4N6DA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
319
structure length
319
Chain Sequence
ADISLSYANFPPAKTFPCVQMERWKQEVEKRTAGKVQVQTYPGSTLLGAKNTLRGVMQGQADIGCVSLAYHPGVFPLSSVFELPLGFTSSTSASLALWDLYTKYQPKEFKRFKVLTMFASAPSNIMTKVPVRNLDDLKGLEVRASGILSKILESLGATPVSMPMSATPEALQKGVVKGLFSSFEVLKDLNFAEICRYETETNTAVYPFAIIMNMNSWNSLPDDVKKVLNDLGREQAEWTGKYMDEHVKRSLAWAKDKYSIEMIKMSDADMQAIKDKTLPLIEDWKEKAAAKGVDGAAVLSDVEELRIKYEGKAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio salexigens
total genus 116
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4n6dA00
2WYKA 4MNCA 5IM2A 4N8GA 2VPOA 4DI3D 4N8YA 3B50A 4UABA 4PDDA 4MAGA 4NX1A 4NGUA 4PAKA 4OANA 4YZZA 4X04A 4NN3A 4PBHA 4LN5A 4OA4A 4N15A 4PF8A 5LTCA 2XWIA 2XA5A 4P1EA 4P9KA 4X8RA 4N91A 2ZZWA 4P3LA 4P8BA 4XEQA 4PAFA 2HPGA 4N6DA 3GYYA 4NF0A 4N17A 4P56A 4OVTA 2WYPA 4PFBA 4PFRA 2XWVA 2ZZVA 4N6KA 3FXBA 4XFEA 4YICA 4MMPA 4P1LA 4PC9A 4NQ8A 2XWKA 2WX9A 4PETA 4PDHA 4P47A 4O94A 4MCOA 4NG7A 2PFZA 4PCDA 4MHFA 4OVPA 4PBQA 2XWOA 2ZZXA 4NAPA 2V4CA 4PGPA 5I7IA 4MEVA 4O8MA 5I5PA 2HZLA 4PE3A 2PFYA 4PAIA 4XF5A 4PF6A 2CEYA 2HZKA 4MNPA 5CM6A 5IGAA 4MX6A 4OVRA 4MIJA 4PFIA 2XXKA 2VPNA 4PGNA 4O7MA 4N4UA 3U65A 4DI4B 4NHBA 4OVQA 2CEXA 4MNIA 4OVSA 5IZZA
chains in the Genus database with same CATH superfamily
3QXMA 1ZLQA 4R73A 3SEXA 1WDNA 2R71A 2QJEA 3RY3A 4GD5A 2ZYKA 3S9EA 1XT8A 3IJOB 4OA4A 2B65A 3TELA 1FTOA 3OOAA 1LCTA 1SW2A 5H8QB 3K6WA 3K00A 4N6DA 3SEVA 3IOWA 4DCXA 5CBSA 3ODBA 5H8HA 2HFBA 2Y7WA 4NF8B 2OWTA 1P1WA 2DWHA 4KFQA 5JTYA 2XX9A 3LSFB 2RCBA 4GVOA 3N6TA 2QRYA 2XD3A 2WX9A 1AH5A 3A29A 4QFLA 4FEDA 1B3EA 1MXUA 2HAUA 4OETA 2DOJA 3ILTB 3MAMA 4HCYA 4LA9A 3RT6B 4MEVA 1D9VA 4MH5A 4PFWA 4LVQA 5IKBA 4G61A 2RC8A 5ISUA 4MX6A 1PBQA 1ZJLA 2DWIA 5I57A 4IO2A 4GWUA 3MZ1A 3BIGA 5J16A 2DVZA 1UTBA 4ND9A 3T9VA 2OWSA 4G68B 4UACA 3H6UA 1FTMA 2OK2A 3JZJA 4I40A 1ZIUA 2QSXA 3G3HA 3TODA 5IZ3A 1UQWA 1NH7A 3HSTA 1EZOA 1LBYA 4DI3D 5ET8A 1ZBMA 5LDZA 2ZYNA 1EH3A 2I58A 5AA2A 3R26A 4KCCA 1BP5A 3BKIB 4EXLA 1WODA 3V5AA 3OO7A 3O66A 1MXZA 3O97A 4U23A 2DWAA 3PMVA 1UTBB 3IOTA 3TEPA 1LB8A 1XS5A 4QXDA 2REJA 2GFEA 4NF0A 3MQ9A 3IR1A 2FIEA 5IZ3B 3KSJA 1R6ZA 5I59A 1NNFA 1Y9UA 2QPQA 2XWVA 4Q30B 1MS7A 3FXBA 5AA2B 5A5XA 4G2ZA 3LSLA 4IB2A 3G7WA 4TQUQ 1BIYA 5EHMA 2GRVA 3IORA 2VD2A 4WKMA 4AQ4A 4F2OA 5J1DA 1FBCA 1SQYA 2ABHA 3QUJA 3VVFA 3K6XA 4FIMA 3O6HA 1NV5A 3SESA 4IO3A 1FTAA 2PBWA 2FIXA 4BDRA 1XC1A 1NV6A 1LBVA 4RA1A 3ROJA 3KGCA 1IEJA 1FJ9A 3MVWA 3K6UA 3VE1B 1IMCA 4O7MA 1MQHA 1FTLA 5I56B 1IMEA 2OWZA 2PT2A 4OVQA 1Y3NA 3DP8A 1M5CA 2R9JA 4MJOA 3R7XA 4ZZEA 4PE5B 3LSWA 5FHOA 1BTJA 1LGBC 2NUVA 1DPEA 3IFCA 4F2QA 4AB6A 4MFIA 1GTKA 3H3GA 2DP8A 4K3FA 3HO7A 1NV2A 1XOCA 2XXWA 3N5LA 1XHYA 3BIHA 1B3HA 1MDP1 3T22A 1IUDA 4PFYA 2XD2A 1IQ7A 5TP9A 3K2DA 5KCJA 2F6GA 4P8BA 1FTJA 4PFUA 3CIJA 4QBAA 4HE1A 1FPLA 3UIFA 3CHGA 2G29A 3PGFA 1CNQA 3C33A 2XXRA 4N6KA 5H8NB 4RY1A 1TXFA 1QKAA 2Y84A 3KJTA 4ZE8A 3TCGA 5DW8A 1PDAA 4OTEA 4IY6A 1ZKBA 3FXRA 1LBWA 4PCDA 3EHSA 2HXWA 3E9XA 3K1MA 5TP9B 5KCJB 1PB7A 1LAXA 4ZEIA 1KWHA 3FJGA 1LFGA 5TPAB 3BBRA 5ICTA 4GBWA 1JP4A 2PMSA 1MQDA 1N76A 3EHUA 1AMFA 4PFIA 4C1UA 1SW1A 1B4HA 4Z0IA 2IA4A 2CMOA 3A09A 1ELJA 2VHAA 1NKXA 3MP1A 3S4UA 4QSCA 3MVYA 4UA8A 4MNIA 2XXTA 1OLCA 2HCAA 3Q25A 2AIXA 2BJIA 3TCFA 4XKQA 3G3GA 4G4PA 2V84A 5HBCA 3TTRA 2A5TA 1H43A 4HTGA 4F3SA 2Z8FA 4X48A 2RCAA 1A7LA 1FBPA 1B0HA 4XEQA 5L9OA 4PAFA 3GYYA 3MVXA 3ZKLA 4GWXA 4C0RA 2H99A 2KLFA 3AXFA 4ZEFA 1FBEA 3OO8A 3SEWA 4HW8A 1MPCA 4RNSA 4H6DA 3OEMA 4BDNA 2WKYA 1MM6A 3HHFA 5CI5A 4M1VA 4R75A 1DPPA 5DYHA 3C4MA 4E0WA 3B8BA 3T66A 1N3XA 3E3KA 3KBRA 2DXYA 1LBCA 2Q74A 2I0CA 4ZECA 4H8JA 4WEPA 3FXUA 1GVCA 3QSLA 5B7DA 2QMXA 2NXOA 5ITPA 3R6UA 5KDTA 4OWDA 1D9YA 4R2BA 4MNCA 2VPOA 3JYRA 4P0GA 1JVXA 2Z22A 4PDDA 1Z7ME 3HV1A 4HS7A 2UVHA 4PP0A 5I84A 3MJNA 4GRKA 3CRBA 4U21A 1EYIA 3ZS6A 3KN7A 3TKDA 2KQZA 4F19A 1NUXA 3PUXE 4QFNA 3TYHA 4G8HA 1ZMGA 1GGGA 3D1RA 2GHAA 2XWIA 4KYSA 3PUZE 1FBHA 5IZ1A 2AL4A 3CVGA 4AS5A 1LBXA 4DCYA 2RF1A 3TTKA 3KN8A 3IB0A 3TZAA 2V3UA 1JEVA 2B4MA 4P1LA 2NVUB 4PC9A 1B5JA 4Q8RA 1FPBA 3S2VA 1BKAA 5L8DA 2QL3A 1II5A 1FQEA 4QHQA 3OENA 3LC8A 4QF9A 3B7DA 5CMMA 3PPPA 2V4CA 5I5PA 3KG2A 5I2NB 2PFYA 1AIVA 3PD8A 4FEBA 3TTMA 4GWSA 1NFTA 3RNNA 1PC3A 1XVXA 1LBZA 1ANFA 2AL5A 3PPNA 3B6WA 3IOVA 4R9GA 1BK4A 3FVGA 2V25A 3PPOA 3U65A 3FGSA 3T93B 1JETA 1B7ZA 1NV3A 4GF8A 2JJKA 4GL0A 1A54A 3MWBA 2XXPA 2F35A 4H5GA 2PVUA 3IK6B 5FTIA 3OSQA 1MY1A 2XXIA 1JQFA 3VXBA 4ZEDA 2KR0A 4FJPA 4MLVA 2O1LA 3IL1B 5H8QA 2P3VA 3DELB 4LZ8A 4KI0E 3E4RA 4YKIA 3N94A 4ZS9A 4X8RA 3USDA 1FSAA 4G8NA 5EQAA 3IX1A 2FVZA 3GBBA 3IO4A 3RTWB 3V83A 5DVIA 4NF8A 3FXQA 4N17A 1N3WA 4P56A 1K9YA 4Z7EA 1OLAA 5ET5A 3N26A 4TLLB 2Z8DA 2CZKA 3FZVA 4WEDA 4XFEA 4QFOA 1FQAA 2D5WA 2FA7A 3VFJA 1NUZA 2ALUA 1YZ0A 2Y5KA 1RDYA 1B52A 3QYTA 4ZE9A 1B6HA 4DLDA 1NV4A 4ONYA 3C36A 3H4ZA 3HHGA 3LBSA 4P11A 3V89B 5FHMA 4MF3A 3BFUA 2VGQA 3G3FA 2LAOA 5F24A 1SVXB 4BDMA 1B3FA 1IXHA 1DBZA 1TFDA 3U94A 4MLQA 3VXCA 4G68A 1N7WA 1MQIA 5IGAA 1M5FA 2P0SA 4JBZA 5IAIA 5TU0A 3H6TA 3THIA 2A5SA 3OXNA 3TPAA 5BWJA 3HCQA 1H76A 1SYIA 3VLVA 1PB8A 1LBBA 4LQ2A 1B4ZA 4N8GA 3MUQA 4HE0A 3O2AA 5DEXB 5FBPA 3TDJA 1MM7A 3DP6A 3GXAA 4MBPA 3TQWA 2RKMA 1S9TA 3OO9A 2MKZA 2UVJA 5EHSA 4OFOA 4NN3A 4N15A 4PF8A 4OESA 2XA5A 4R6KA 3PUWE 2X7QA 4JWXA 5FTHA 3T0JA 3SERA 1FRPA 1MY4A 3TUSA 4F18A 4EQBA 2GHBA 4YKJA 2QVRA 5EYFA 1D9QA 4PETA 2V3QA 2F3BA 2QS2A 1FBDA 5CBRA 5M2VA 3EQ1A 3IJXB 4NMYA 4BLAA 4O94A 4RPOA 3MP8A 1Q1KA 1CB6A 3U8QA 4OVPA 3UORA 4ZEKA 5I2KA 1RDXA 2DE3A 1MXXA 4LQ5A 4NWCA 1O64A 4GQOA 1LFHA 5HPQA 2OLBA 1UTHB 4N07A 1F9BA 1GV8A 2DWJA 2QS1A 2Q8MA 1FPDA 5I56A 2I6EA 1FPJA 3SZPA 3KFMA 3GZGA 2XXKA 1LAFE 2DS9A 1NV1A 4HE2A 1QUIA 2QFLA 3PUYE 1IMBA 2UYEA 1Z7NE 3SEUA 4YB7A 3P7IA 2HQ0A 3M8UA 5IZZA 4GBVA 1EYKA 3K1PA 5I2KB 4POXA 2F3DA 4NX1A 5F7VA 1Y20A 3C31A 4OEUA 1DOTA 4XXUA 1JNFA 3FVKA 2THIA 4XTCQ 5CMKA 2F6PA 2Z8EA 3TTLA 5ICQA 1EU8A 1MQJA 4N91A 1VR5A 1I6BA 3UGWA 4U4XA 1FQFA 5H8NA 1NNKA 1HSJA 4PFRA 3WAFA 2I48A 3O28A 4MMPA 4EF2A 4G68C 4LZ5A 3C9HA 2XWKA 4H0WA 3UP9A 2P2AA 3HPIA 3PU5A 1J1NA 3ZSFA 4I3YA 4WXJA 5AA4B 3RLFE 4R9FA 1ZTYA 3FJMA 5TPAA 3FJ7A 4GL8A 1YXIA 3W9VA 3LUZA 1FPGA 4GWOA 3DLNA 3KOTA 4ESXA 2OX3A 2GQ1A 3EKIA 3M3FA 1B05A 2YJPA 1RYXA 4H8IA 3I5OA 4JDFA 4ZZAA 3RQTA 3CI8A 3K02A 3FUZA 1FPIA 3U72A 3H6WA 2H5YA 1NL5A 1POTA 4H46A 3U93A 3RT8A 3KZGA 1LLSA 4PAKA 1YYZA 2AYSA 3S9MC 3IFAA 2V3TA 3GBAA 1I69A 2DXRA 1B0LA 4P1EA 3IO6A 5CRYA 4GWYA 2B3BA 4X9TA 3CSBA 2FNCA 4YB5A 4GOTA 3G3JA 4OEVA 1LAHE 3EHTA 1UIVA 2NWJA 1KA0A 4NE4A 1MPDA 1DTGA 2DSFA 2W7YA 2PT1A 1QW0A 3I3VA 1IIWA 1Y1MA 1DK4A 3RYDA 1XI6A 2F78A 4NG7A 3DP4A 4I1DA 1B7HA 4EDPA 2M8CA 4M4GA 2ONRA 1A55A 4PFTA 3EF7A 1MH4A 4I8CA 1ATGA 4OHNA 3E78A 3MBPA 1AWBA 4XKPA 4ISUA 4R72A 3T9HB 3FATA 4G8MA 2DYXA 4EXKA 2RC9A 3G3IA 3VV5A 3UN6A 1US5A 2Y7KA 4LZ7A 1T0KA 4F1YA 2CEXA 2H98A 3FVNA 5IM2A 1IXGA 1S7YA 3OMBA 4ZEBA 2DVCA 3M3LA 1R9QA 2XXVA 3H7MA 2L5VA 4X04A 2F36A 4EQ9A 4OENA 1LB9A 3VVEA 4RXLA 4DXUA 2X26A 4KD5A 3LUYA 4PQJA 4IR8A 1IMAA 3RPLA 3OELA 1N04A 3K1NA 3MP6A 2I4CA 3RGYA 3EN3A 1LEVA 2O7IA 2F34A 3FBPA 3MVZA 4GXAA 3N6UA 3ECRA 3FV2A 3HN0A 4GLIA 3MZ9A 2F8DA 1MXWA 1NUYA 1OQHA 3KC0A 2I3WA 1A40A 4R6HA 1G0IA 1KA1A 4P47A 2ONKE 1JW1A 4MCOA 5L9MA 5AA1A 3RPLB 4OVJA 5I2NA 3VLWA 4PBQA 3OO6A 1MXVA 2E0SA 2HHMA 3HFUA 2XX7A 2F7CA 1OVTA 2XXUA 2HZLA 1B1HA 3KOSA 4N6PA 2ZNSA 4XF5A 4PF6A 3W15C 5EQ7A 3PV0E 4KHZE 4IO6A 3Q26A 4OVRA 1XVYA 1VFDA 3PD9A 2H4IA 2UVGA 3OEKA 4JWYA 3T9UA 1A8FA 3RUMA 4N4UA 1IXIA 4DZ1A 4QFPA 3MPLA 5AA2D 2OCUA 3MSTA 2P3NA 1FCKA 3PPRA 4R74A 3OSRA 4NWDA 5JEIA 4QSEA 2I4BA 4XKNA 4I9DA 4F39A 3DM0A 4Q5TA 4KR5A 4JXIA 3NOHA 3H6VA 4KYEA 3RN8A 3PPQA 4FE8A 3ONMA 2VD3A 5CMCA 2RINA 4U4SA 2QVUA 1S50A 5K2YA 3TMGA 3TCHA 1LFIA 5DVFA 1Q9DA 3FIRA 2B3FA 1PEBA 3KBZA 2I3VA 3IB1A 4OVTA 2WYPA 2Z23A 3K4UA 2CZIA 2O84X 4ELOA 2ZNTA 4F3GA 1TT1A 1Y1ZA 3MYUA 4IO7A 4E0XA 2YLNA 1HSLA 2VT5A 2HXRA 4GX3A 3M3KA 1B2HA 5I7IA 3UA8A 4YB6A 1FBGA 3CFZA 4IO5A 1B32A 2Y5LA 1N7XA 4FORA 4F3BA 3LV0A 4LUBA 1R1NA 3L6GA 1URGA 4GIZA 4DXBA 4DE8A 1SI0A 5L9SA 4NF5B 4RPNA 4C1TA 1JVYA 1US4A 5H8FB 2HEUA 5H8SA 4OMBA 1B5HA 3CG3A 4EUOA 2PX1A 4DI4B 2O6AA 5DEXA 3CG1A 1LAGE 1RYOA 1N0TA 3QIMA 1USYH 3PMWA 3O6IA 2XX8A 1VFEA 2Q9TA 1VE4A 4NF4B 2Y7PA 4QFKA 1PB9A 4OANA 1LCFA 4XKRA 5ET7A 4TOZA 2ZNUA 1SPIA 2ZMBA 1OVBA 1Y4CA 5BUUA 3C35A 3RTFB 4F29A 3CSGA 5CMBA 1O63A 1H3DA 3TQLA 3QAXA 3IAZA 1YAEA 4NTLA 4RK2A 4GX4A 2P1SA 3C32A 1FTKA 3LR1A 4P0IA 2Y7RA 3TAJA 1SW4A 4U2RA 5H8HB 1AL3A 1O7TA 1MH3A 2O1MA 4PDHA 4GFRA 1TWYA 1FPEA 2F97A 5JTYB 3O9PA 1M5BA 2CZHA 1MY3A 1UTHA 5ITOA 3KEIA 4O3AA 1SD3A 3WAEA 4OFJA 4U22A 5ELVA 2QMWA 1NNTA 4F1VA 2DQVA 2V93A 1I6QA 3SEYA 3V8XB 2HZKA 2OBGA 1N84A 1B5IA 1GR2A 1MRPA 1Y3PA 4GX6A 1YTVA 2QS3A 4ELPA 1H44A 1FPFA 1NI9A 5I57B 1NNPA 2R6GE 1MY0A 1QGXA 3TTNA 1A99A 4HXVA 5ESYA 2REGA 2Q2AA 2D21A 1A8EA 3B50A 4UABA 3F11A 5EQ8A 3MZBA 2GH9A 3JV9A 2VP1A 4FAJA 3OD7A 4JVIA 5EQ9A 3PUVE 1FW0A 4OQOA 4FECA 3CFLA 1QUKA 4JB7A 1VSOA 4PBHA 4RJZA 4LN5A 4QRZA 3K01A 4O3BA 4OYVA 2ANJA 4JSDA 3ISPA 3O6GA 1B3GA 5ET6A 3PMXA 1MQGA 3TFLA 2ESNA 4IO4A 1SDXA 4N13A 1URDA 1TFAA 4X1DA 3KSXA 1JW4A 5K2XA 4I62A 3VVDA 4KCDA 1M5EA 1FQBA 4L17A 3IB2A 3KN3A 5AA4A 5I59B 1I6AA 3FVOA 4U1OA 1KZ8A 5A5LA 5A5XB 3SKPA 2XHDA 2PFZA 3SDFA 3E79A 4NAPA 2I49A 3UK4A 1QKBA 1URSA 5JK4A 3FD3A 3T96B 4PAIA 4N81A 2PCRA 1L5TA 1B1XA 4GWZA 5CM6A 1EZPA 4FBPA 4U1ZA 4EQ7A 1DCUA 1INPA 1QJMA 1SI1A 2CZLA 1PBPA 2F7BA 4F22A 3LSXA 2XXHA 3U1OA 3D4GA 1IXCA 1YCJA 4ELRA 2Q88A 2O69A 1NV0A 1EYJA 2RC7A 2WYKA 4BDQA 4IY5A 2G93A 4GWWA 4RYAA 4NGUA 1P1QA 1JEUA 1EZ9A 4R6YA 4YZZA 2PYYA 3CR9A 5B70A 2ZYMA 2O68A 4TLMB 3S9NC 1H45A 3QMFA 3G3KA 1SW5A 1FQDA 2OZZA 5LTCA 4ECFA 1Q35A 3Q29A 4ESWA 3MC2A 2DE4A 4P3LA 5CC2A 2HPGA 1IITA 3ILUB 4GXSB 2X7PA 1B58A 1OIBA 4H1XA 4PFBA 1P1OA 5T3JA 2F5XA 3A3UA 2O51A 3E13X 4O3CA 3B6QA 1ZU0A 3U92A 2BJJX 1D4NA 4KQPA 1Y3QA 4QSDA 1FJ6A 4FATA 2I0BA 3FASA 1POY1 3ZKKA 3Q27A 1CE2A 4MHFA 4OERA 2B4LA 1P99A 1QUJA 4YKKA 4EF1A 1B40A 2QS4A 4PE3A 4JSOA 2HAVA 3T1BA 5DT6A 4LATA 1IMDA 4G77A 4AS4A 1DSNA 1QVSA 2VPNA 4IGRA 2DDKA 4HCWA 1FBFA 2Y7IA 5AA3A 2Q8JA 1B3LA 3FV1A 3IOUA 4OVSA 1P1NA 1MPBA 3K0VA 4DDDA 4KXPA 1JW5A 4N8YA 4I3EA 4R2FA 2ONSA 2YPNA 3K6VA 1VDWA 3QK6A 5EYGA 2WBDA 1MG1A 2FYIA 3T9XB 3GLBA 3I6VA 1OQGA 4X1BA 1RDZA 2A5TB 1FQCA 2ZXTA 1NV7A 2WEFA 1IZ1A 2FBPA 1K9ZA 1USYE 1SYHA 3H06B 4XIGQ 1M5DA 1B51A 2ZZVA 2UYFA 4H45A 1DTZA 1OMPA 1MY2A 4YICA 2NOOA 1B9JA 4LONB 4NQ8A 2ZYOA 1RKMA 2XXXA 4YMAA 3PTYA 5I58A 4YKPA 3A3CA 3BFTA 5DTBA 3KJ7A 4PTKA 2XWOA 2ZZXA 4PGPA 1P1UA 5AE4A 1NUWA 1WVJA 3L6HA 4THIA 4F3PA 4O8MA 4POWA 3W9WA 2XXYA 2E1SA 2CEYA 1G0HA 2D3IA 2H9BA 4YAHX 4DXCA 4MIJA 5LOMA 1HSEA 4NF6A 2OJTA 4H65A 1B7UA 2IEEA 3MPKA 5I58B 2UVIA 4NHBA 3MW0A 1LSTA 1SBPA 2DE2A 4H5FA 4IGTA 3VLUA 5F1QA 4F1UA 3C34A 4MAGA 4KYDA 2XXQA 4JVCA 3RPWA 1BLFA 5KDTB 2UXAA 2FHYA 4F31B 4OZ9A 2F7AA 4RK9A 4OFLA 3H03A 4Q0CA 4ZDMA 1MXYA 1QULA 2R8TA 1YPNA 2O7UA 4NF6B 1MDQA 3D4CA 4AB5A 4O7IA 4P9KA 2Q2CA 2VOZA 2ZZWA 5I3SA 3S9LC 4BDOA 5FHNA 3EPEA 1B46A 1UIUA 3O29A 2Q89A 1FPKA 3CFXA 1DMBA 4JWOA 3KC1A 5DVJA 1AOVA 5HM4B 3Q28A 4ELQA 4OXVA 1NH8A 5EYHA 4NF5A 3QUFA 1IMFA 1Y4TA 4MNPA 5H8FA 2WBBA 4DIGA 1R9LA 2H25A 3B6TA 4BDLA 4PGNA 3VDFA 4JVDA 3SETA 1D3KA 4KPTA 4YMBA 4H67A 4NF4A 5KZTA 4YU0A 4LP2B 2QVVA 4NEDA 1NMUA
chains in the Genus database with same CATH topology
4MNCA 2VPOA 3B50A 4UABA 5EQ8A 4PDDA 4PAKA 1EYIA 4JVIA 2KQZA 5EQ9A 1YYZA 4F19A 1NUXA 3IFAA 4PBHA 4LN5A 4OA4A 3D1RA 2XWIA 3ISPA 4P1EA 4GWYA 5ET6A 1FBHA 5IZ1A 4N6DA 4X9TA 4AS5A 1LBXA 1KA0A 2B4MA 4P1LA 4PC9A 1FPBA 2WX9A 1DK4A 3A29A 3RYDA 1KZ8A 1XI6A 5A5LA 4NG7A 2PFZA 3E79A 4NAPA 2V4CA 4HCYA 4MEVA 5JK4A 5I5PA 2PFYA 4PAIA 4N81A 3E78A 2PCRA 1AWBA 4G61A 4GWZA 4GWSA 5CM6A 4FBPA 4MX6A 1LBZA 1DCUA 1INPA 4GWUA 3BIGA 5J16A 2DVZA 1BK4A 3U65A 4I40A 2CEXA 1NV0A 1NV3A 2JJKA 1EYJA 5IZ3A 2WYKA 5IM2A 1LBYA 4DI3D 5ET8A 5LDZA 4GWWA 4NGUA 4YZZA 2L5VA 4X04A 2KR0A 2P3VA 3QMFA 4IR8A 1IMAA 3RPLA 5LTCA 4X8RA 1FSAA 5EQAA 2DE4A 4P3LA 4QXDA 2HPGA 2FVZA 1LEVA 4NF0A 3FBPA 4N17A 4P56A 1K9YA 2FIEA 5IZ3B 4PFBA 5ET5A 2QPQA 2XWVA 5T3JA 2F5XA 2CZKA 3FXBA 4XFEA 1NUYA 1NUZA 1YZ0A 1FJ6A 3KC0A 1G0IA 2Y5KA 1RDYA 1KA1A 4P47A 4MCOA 1NV4A 3RPLB 4MHFA 4PBQA 5J1DA 1FBCA 2B4LA 2HHMA 3HFUA 5F24A 2HZLA 4PE3A 1NV5A 4XF5A 1FTAA 4PF6A 2FIXA 1DBZA 3T1BA 5EQ7A 1LBVA 1NV6A 5IGAA 4OVRA 3ROJA 1IMDA 4AS4A 1FJ9A 2VPNA 1IMCA 4O7MA 2DDKA 1IMEA 4N4UA 4HCWA 2OWZA 1FBFA 4OVQA 4MJOA 3MSTA 4OVSA 2P3NA 4N8GA 4KXPA 4N8YA 4HE0A 5FBPA 4I3EA 3IFCA 1VDWA 1NV2A 5EYGA 2MKZA 3NOHA 2WBDA 3BIHA 4NN3A 4N15A 4PF8A 2XA5A 2QVUA 1RDZA 4P8BA 1NV7A 1Q9DA 2WEFA 4QBAA 2FBPA 3T0JA 3KBZA 4HE1A 1FPLA 1K9ZA 1FRPA 4OVTA 2WYPA 3CHGA 4F18A 1CNQA 2ZZVA 2QVRA 4H45A 4N6KA 2CZIA 4YICA 4NQ8A 1D9QA 4PETA 2V3QA 2F3BA 3MYUA 3PTYA 5DW8A 1FBDA 2VT5A 4O94A 2HXRA 1LBWA 4PCDA 4PTKA 4OVPA 2XWOA 4GX3A 2ZZXA 1RDXA 2DE3A 4PGPA 5I7IA 1NUWA 1FBGA 4O8MA 2Y5LA 3W9WA 3LV0A 2CEYA 1G0HA 4GBWA 2Q8MA 1FPDA 1JP4A 3SZPA 1FPJA 4MIJA 4PFIA 2XXKA 1NV1A 4HE2A 2QFLA 4DI4B 1IMBA 4NHBA 2DE2A 4MNIA 5IZZA 4GBVA 1EYKA 2Q9TA 4F1UA 2F3DA 4MAGA 4NX1A 4JVCA 2BJIA 4OANA 2FHYA 5ET7A 2R8TA 1SPIA 1FBPA 4O7IA 4P9KA 4N91A 4XEQA 2ZZWA 5I3SA 4PAFA 3GYYA 4GWXA 4GX4A 4PFRA 1FBEA 4MMPA 1FPKA 2XWKA 4PDHA 3KC1A 1FPEA 4I3YA 2CZHA 4M1VA 1YXIA 3W9VA 3LUZA 1FPGA 3B8BA 5EYHA 4F1VA 2OX3A 2GQ1A 3EKIA 1IMFA 2HZKA 4MNPA 2WBBA 2Q74A 4GX6A 4PGNA 4JVDA 1FPFA 1FPIA 1NI9A 1QGXA 4H46A 5ESYA 4HXVA 2QVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WYK A;  4MNC A;  5IM2 A;  4N8G A;  2VPO A;  4DI3 D;  4N8Y A;  3B50 A;  4UAB A;  4PDD A;  4MAG A;  4NX1 A;  4NGU A;  4PAK A;  4OAN A;  4YZZ A;  4X04 A;  4NN3 A;  4PBH A;  4LN5 A;  4OA4 A;  4N15 A;  4PF8 A;  5LTC A;  2XWI A;  2XA5 A;  4P1E A;  4P9K A;  4X8R A;  4N91 A;  2ZZW A;  4P3L A;  4P8B A;  4XEQ A;  4PAF A;  2HPG A;  4N6D A;  3GYY A;  4NF0 A;  4N17 A;  4P56 A;  4OVT A;  2WYP A;  4PFB A;  4PFR A;  2XWV A;  2ZZV A;  4N6K A;  3FXB A;  4XFE A;  4YIC A;  4MMP A;  4P1L A;  4PC9 A;  4NQ8 A;  2XWK A;  2WX9 A;  4PET A;  4PDH A;  4P47 A;  4O94 A;  4MCO A;  4NG7 A;  2PFZ A;  4PCD A;  4MHF A;  4OVP A;  4PBQ A;  2XWO A;  2ZZX A;  4NAP A;  2V4C A;  4PGP A;  5I7I A;  4MEV A;  4O8M A;  5I5P A;  2HZL A;  4PE3 A;  2PFY A;  4PAI A;  4XF5 A;  4PF6 A;  2CEY A;  2HZK A;  4MNP A;  5CM6 A;  5IGA A;  4MX6 A;  4OVR A;  4MIJ A;  4PFI A;  2XXK A;  2VPN A;  4PGN A;  4O7M A;  4N4U A;  3U65 A;  4DI4 B;  4NHB A;  4OVQ A;  2CEX A;  4MNI A;  4OVS A;  5IZZ A; 
#chains in the Genus database with same CATH topology
 3QXM A;  1ZLQ A;  4R73 A;  3SEX A;  1WDN A;  2R71 A;  2QJE A;  3RY3 A;  4GD5 A;  2ZYK A;  3S9E A;  1XT8 A;  3IJO B;  4OA4 A;  2B65 A;  3TEL A;  1FTO A;  3OOA A;  1LCT A;  1SW2 A;  5H8Q B;  3K6W A;  3K00 A;  4N6D A;  3SEV A;  3IOW A;  4DCX A;  5CBS A;  3ODB A;  5H8H A;  2HFB A;  2Y7W A;  4NF8 B;  2OWT A;  1P1W A;  2DWH A;  4KFQ A;  5JTY A;  2XX9 A;  3LSF B;  2RCB A;  4GVO A;  3N6T A;  2QRY A;  2XD3 A;  2WX9 A;  1AH5 A;  3A29 A;  4QFL A;  4FED A;  1B3E A;  1MXU A;  2HAU A;  4OET A;  2DOJ A;  3ILT B;  3MAM A;  4HCY A;  4LA9 A;  3RT6 B;  4MEV A;  1D9V A;  4MH5 A;  4PFW A;  4LVQ A;  5IKB A;  4G61 A;  2RC8 A;  5ISU A;  4MX6 A;  1PBQ A;  1ZJL A;  2DWI A;  5I57 A;  4IO2 A;  4GWU A;  3MZ1 A;  3BIG A;  5J16 A;  2DVZ A;  1UTB A;  4ND9 A;  3T9V A;  2OWS A;  4G68 B;  4UAC A;  3H6U A;  1FTM A;  2OK2 A;  3JZJ A;  4I40 A;  1ZIU A;  2QSX A;  3G3H A;  3TOD A;  5IZ3 A;  1UQW A;  1NH7 A;  3HST A;  1EZO A;  1LBY A;  4DI3 D;  5ET8 A;  1ZBM A;  5LDZ A;  2ZYN A;  1EH3 A;  2I58 A;  5AA2 A;  3R26 A;  4KCC A;  1BP5 A;  3BKI B;  4EXL A;  1WOD A;  3V5A A;  3OO7 A;  3O66 A;  1MXZ A;  3O97 A;  4U23 A;  2DWA A;  3PMV A;  1UTB B;  3IOT A;  3TEP A;  1LB8 A;  1XS5 A;  4QXD A;  2REJ A;  2GFE A;  4NF0 A;  3MQ9 A;  3IR1 A;  2FIE A;  5IZ3 B;  3KSJ A;  1R6Z A;  5I59 A;  1NNF A;  1Y9U A;  2QPQ A;  2XWV A;  4Q30 B;  1MS7 A;  3FXB A;  5AA2 B;  5A5X A;  4G2Z A;  3LSL A;  4IB2 A;  3G7W A;  4TQU Q;  1BIY A;  5EHM A;  2GRV A;  3IOR A;  2VD2 A;  4WKM A;  4AQ4 A;  4F2O A;  5J1D A;  1FBC A;  1SQY A;  2ABH A;  3QUJ A;  3VVF A;  3K6X A;  4FIM A;  3O6H A;  1NV5 A;  3SES A;  4IO3 A;  1FTA A;  2PBW A;  2FIX A;  4BDR A;  1XC1 A;  1NV6 A;  1LBV A;  4RA1 A;  3ROJ A;  3KGC A;  1IEJ A;  1FJ9 A;  3MVW A;  3K6U A;  3VE1 B;  1IMC A;  4O7M A;  1MQH A;  1FTL A;  5I56 B;  1IME A;  2OWZ A;  2PT2 A;  4OVQ A;  1Y3N A;  3DP8 A;  1M5C A;  2R9J A;  4MJO A;  3R7X A;  4ZZE A;  4PE5 B;  3LSW A;  5FHO A;  1BTJ A;  1LGB C;  2NUV A;  1DPE A;  3IFC A;  4F2Q A;  4AB6 A;  4MFI A;  1GTK A;  3H3G A;  2DP8 A;  4K3F A;  3HO7 A;  1NV2 A;  1XOC A;  2XXW A;  3N5L A;  1XHY A;  3BIH A;  1B3H A;  1MDP 1;  3T22 A;  1IUD A;  4PFY A;  2XD2 A;  1IQ7 A;  5TP9 A;  3K2D A;  5KCJ A;  2F6G A;  4P8B A;  1FTJ A;  4PFU A;  3CIJ A;  4QBA A;  4HE1 A;  1FPL A;  3UIF A;  3CHG A;  2G29 A;  3PGF A;  1CNQ A;  3C33 A;  2XXR A;  4N6K A;  5H8N B;  4RY1 A;  1TXF A;  1QKA A;  2Y84 A;  3KJT A;  4ZE8 A;  3TCG A;  5DW8 A;  1PDA A;  4OTE A;  4IY6 A;  1ZKB A;  3FXR A;  1LBW A;  4PCD A;  3EHS A;  2HXW A;  3E9X A;  3K1M A;  5TP9 B;  5KCJ B;  1PB7 A;  1LAX A;  4ZEI A;  1KWH A;  3FJG A;  1LFG A;  5TPA B;  3BBR A;  5ICT A;  4GBW A;  1JP4 A;  2PMS A;  1MQD A;  1N76 A;  3EHU A;  1AMF A;  4PFI A;  4C1U A;  1SW1 A;  1B4H A;  4Z0I A;  2IA4 A;  2CMO A;  3A09 A;  1ELJ A;  2VHA A;  1NKX A;  3MP1 A;  3S4U A;  4QSC A;  3MVY A;  4UA8 A;  4MNI A;  2XXT A;  1OLC A;  2HCA A;  3Q25 A;  2AIX A;  2BJI A;  3TCF A;  4XKQ A;  3G3G A;  4G4P A;  2V84 A;  5HBC A;  3TTR A;  2A5T A;  1H43 A;  4HTG A;  4F3S A;  2Z8F A;  4X48 A;  2RCA A;  1A7L A;  1FBP A;  1B0H A;  4XEQ A;  5L9O A;  4PAF A;  3GYY A;  3MVX A;  3ZKL A;  4GWX A;  4C0R A;  2H99 A;  2KLF A;  3AXF A;  4ZEF A;  1FBE A;  3OO8 A;  3SEW A;  4HW8 A;  1MPC A;  4RNS A;  4H6D A;  3OEM A;  4BDN A;  2WKY A;  1MM6 A;  3HHF A;  5CI5 A;  4M1V A;  4R75 A;  1DPP A;  5DYH A;  3C4M A;  4E0W A;  3B8B A;  3T66 A;  1N3X A;  3E3K A;  3KBR A;  2DXY A;  1LBC A;  2Q74 A;  2I0C A;  4ZEC A;  4H8J A;  4WEP A;  3FXU A;  1GVC A;  3QSL A;  5B7D A;  2QMX A;  2NXO A;  5ITP A;  3R6U A;  5KDT A;  4OWD A;  1D9Y A;  4R2B A;  4MNC A;  2VPO A;  3JYR A;  4P0G A;  1JVX A;  2Z22 A;  4PDD A;  1Z7M E;  3HV1 A;  4HS7 A;  2UVH A;  4PP0 A;  5I84 A;  3MJN A;  4GRK A;  3CRB A;  4U21 A;  1EYI A;  3ZS6 A;  3KN7 A;  3TKD A;  2KQZ A;  4F19 A;  1NUX A;  3PUX E;  4QFN A;  3TYH A;  4G8H A;  1ZMG A;  1GGG A;  3D1R A;  2GHA A;  2XWI A;  4KYS A;  3PUZ E;  1FBH A;  5IZ1 A;  2AL4 A;  3CVG A;  4AS5 A;  1LBX A;  4DCY A;  2RF1 A;  3TTK A;  3KN8 A;  3IB0 A;  3TZA A;  2V3U A;  1JEV A;  2B4M A;  4P1L A;  2NVU B;  4PC9 A;  1B5J A;  4Q8R A;  1FPB A;  3S2V A;  1BKA A;  5L8D A;  2QL3 A;  1II5 A;  1FQE A;  4QHQ A;  3OEN A;  3LC8 A;  4QF9 A;  3B7D A;  5CMM A;  3PPP A;  2V4C A;  5I5P A;  3KG2 A;  5I2N B;  2PFY A;  1AIV A;  3PD8 A;  4FEB A;  3TTM A;  4GWS A;  1NFT A;  3RNN A;  1PC3 A;  1XVX A;  1LBZ A;  1ANF A;  2AL5 A;  3PPN A;  3B6W A;  3IOV A;  4R9G A;  1BK4 A;  3FVG A;  2V25 A;  3PPO A;  3U65 A;  3FGS A;  3T93 B;  1JET A;  1B7Z A;  1NV3 A;  4GF8 A;  2JJK A;  4GL0 A;  1A54 A;  3MWB A;  2XXP A;  2F35 A;  4H5G A;  2PVU A;  3IK6 B;  5FTI A;  3OSQ A;  1MY1 A;  2XXI A;  1JQF A;  3VXB A;  4ZED A;  2KR0 A;  4FJP A;  4MLV A;  2O1L A;  3IL1 B;  5H8Q A;  2P3V A;  3DEL B;  4LZ8 A;  4KI0 E;  3E4R A;  4YKI A;  3N94 A;  4ZS9 A;  4X8R A;  3USD A;  1FSA A;  4G8N A;  5EQA A;  3IX1 A;  2FVZ A;  3GBB A;  3IO4 A;  3RTW B;  3V83 A;  5DVI A;  4NF8 A;  3FXQ A;  4N17 A;  1N3W A;  4P56 A;  1K9Y A;  4Z7E A;  1OLA A;  5ET5 A;  3N26 A;  4TLL B;  2Z8D A;  2CZK A;  3FZV A;  4WED A;  4XFE A;  4QFO A;  1FQA A;  2D5W A;  2FA7 A;  3VFJ A;  1NUZ A;  2ALU A;  1YZ0 A;  2Y5K A;  1RDY A;  1B52 A;  3QYT A;  4ZE9 A;  1B6H A;  4DLD A;  1NV4 A;  4ONY A;  3C36 A;  3H4Z A;  3HHG A;  3LBS A;  4P11 A;  3V89 B;  5FHM A;  4MF3 A;  3BFU A;  2VGQ A;  3G3F A;  2LAO A;  5F24 A;  1SVX B;  4BDM A;  1B3F A;  1IXH A;  1DBZ A;  1TFD A;  3U94 A;  4MLQ A;  3VXC A;  4G68 A;  1N7W A;  1MQI A;  5IGA A;  1M5F A;  2P0S A;  4JBZ A;  5IAI A;  5TU0 A;  3H6T A;  3THI A;  2A5S A;  3OXN A;  3TPA A;  5BWJ A;  3HCQ A;  1H76 A;  1SYI A;  3VLV A;  1PB8 A;  1LBB A;  4LQ2 A;  1B4Z A;  4N8G A;  3MUQ A;  4HE0 A;  3O2A A;  5DEX B;  5FBP A;  3TDJ A;  1MM7 A;  3DP6 A;  3GXA A;  4MBP A;  3TQW A;  2RKM A;  1S9T A;  3OO9 A;  2MKZ A;  2UVJ A;  5EHS A;  4OFO A;  4NN3 A;  4N15 A;  4PF8 A;  4OES A;  2XA5 A;  4R6K A;  3PUW E;  2X7Q A;  4JWX A;  5FTH A;  3T0J A;  3SER A;  1FRP A;  1MY4 A;  3TUS A;  4F18 A;  4EQB A;  2GHB A;  4YKJ A;  2QVR A;  5EYF A;  1D9Q A;  4PET A;  2V3Q A;  2F3B A;  2QS2 A;  1FBD A;  5CBR A;  5M2V A;  3EQ1 A;  3IJX B;  4NMY A;  4BLA A;  4O94 A;  4RPO A;  3MP8 A;  1Q1K A;  1CB6 A;  3U8Q A;  4OVP A;  3UOR A;  4ZEK A;  5I2K A;  1RDX A;  2DE3 A;  1MXX A;  4LQ5 A;  4NWC A;  1O64 A;  4GQO A;  1LFH A;  5HPQ A;  2OLB A;  1UTH B;  4N07 A;  1F9B A;  1GV8 A;  2DWJ A;  2QS1 A;  2Q8M A;  1FPD A;  5I56 A;  2I6E A;  1FPJ A;  3SZP A;  3KFM A;  3GZG A;  2XXK A;  1LAF E;  2DS9 A;  1NV1 A;  4HE2 A;  1QUI A;  2QFL A;  3PUY E;  1IMB A;  2UYE A;  1Z7N E;  3SEU A;  4YB7 A;  3P7I A;  2HQ0 A;  3M8U A;  5IZZ A;  4GBV A;  1EYK A;  3K1P A;  5I2K B;  4POX A;  2F3D A;  4NX1 A;  5F7V A;  1Y20 A;  3C31 A;  4OEU A;  1DOT A;  4XXU A;  1JNF A;  3FVK A;  2THI A;  4XTC Q;  5CMK A;  2F6P A;  2Z8E A;  3TTL A;  5ICQ A;  1EU8 A;  1MQJ A;  4N91 A;  1VR5 A;  1I6B A;  3UGW A;  4U4X A;  1FQF A;  5H8N A;  1NNK A;  1HSJ A;  4PFR A;  3WAF A;  2I48 A;  3O28 A;  4MMP A;  4EF2 A;  4G68 C;  4LZ5 A;  3C9H A;  2XWK A;  4H0W A;  3UP9 A;  2P2A A;  3HPI A;  3PU5 A;  1J1N A;  3ZSF A;  4I3Y A;  4WXJ A;  5AA4 B;  3RLF E;  4R9F A;  1ZTY A;  3FJM A;  5TPA A;  3FJ7 A;  4GL8 A;  1YXI A;  3W9V A;  3LUZ A;  1FPG A;  4GWO A;  3DLN A;  3KOT A;  4ESX A;  2OX3 A;  2GQ1 A;  3EKI A;  3M3F A;  1B05 A;  2YJP A;  1RYX A;  4H8I A;  3I5O A;  4JDF A;  4ZZA A;  3RQT A;  3CI8 A;  3K02 A;  3FUZ A;  1FPI A;  3U72 A;  3H6W A;  2H5Y A;  1NL5 A;  1POT A;  4H46 A;  3U93 A;  3RT8 A;  3KZG A;  1LLS A;  4PAK A;  1YYZ A;  2AYS A;  3S9M C;  3IFA A;  2V3T A;  3GBA A;  1I69 A;  2DXR A;  1B0L A;  4P1E A;  3IO6 A;  5CRY A;  4GWY A;  2B3B A;  4X9T A;  3CSB A;  2FNC A;  4YB5 A;  4GOT A;  3G3J A;  4OEV A;  1LAH E;  3EHT A;  1UIV A;  2NWJ A;  1KA0 A;  4NE4 A;  1MPD A;  1DTG A;  2DSF A;  2W7Y A;  2PT1 A;  1QW0 A;  3I3V A;  1IIW A;  1Y1M A;  1DK4 A;  3RYD A;  1XI6 A;  2F78 A;  4NG7 A;  3DP4 A;  4I1D A;  1B7H A;  4EDP A;  2M8C A;  4M4G A;  2ONR A;  1A55 A;  4PFT A;  3EF7 A;  1MH4 A;  4I8C A;  1ATG A;  4OHN A;  3E78 A;  3MBP A;  1AWB A;  4XKP A;  4ISU A;  4R72 A;  3T9H B;  3FAT A;  4G8M A;  2DYX A;  4EXK A;  2RC9 A;  3G3I A;  3VV5 A;  3UN6 A;  1US5 A;  2Y7K A;  4LZ7 A;  1T0K A;  4F1Y A;  2CEX A;  2H98 A;  3FVN A;  5IM2 A;  1IXG A;  1S7Y A;  3OMB A;  4ZEB A;  2DVC A;  3M3L A;  1R9Q A;  2XXV A;  3H7M A;  2L5V A;  4X04 A;  2F36 A;  4EQ9 A;  4OEN A;  1LB9 A;  3VVE A;  4RXL A;  4DXU A;  2X26 A;  4KD5 A;  3LUY A;  4PQJ A;  4IR8 A;  1IMA A;  3RPL A;  3OEL A;  1N04 A;  3K1N A;  3MP6 A;  2I4C A;  3RGY A;  3EN3 A;  1LEV A;  2O7I A;  2F34 A;  3FBP A;  3MVZ A;  4GXA A;  3N6U A;  3ECR A;  3FV2 A;  3HN0 A;  4GLI A;  3MZ9 A;  2F8D A;  1MXW A;  1NUY A;  1OQH A;  3KC0 A;  2I3W A;  1A40 A;  4R6H A;  1G0I A;  1KA1 A;  4P47 A;  2ONK E;  1JW1 A;  4MCO A;  5L9M A;  5AA1 A;  3RPL B;  4OVJ A;  5I2N A;  3VLW A;  4PBQ A;  3OO6 A;  1MXV A;  2E0S A;  2HHM A;  3HFU A;  2XX7 A;  2F7C A;  1OVT A;  2XXU A;  2HZL A;  1B1H A;  3KOS A;  4N6P A;  2ZNS A;  4XF5 A;  4PF6 A;  3W15 C;  5EQ7 A;  3PV0 E;  4KHZ E;  4IO6 A;  3Q26 A;  4OVR A;  1XVY A;  1VFD A;  3PD9 A;  2H4I A;  2UVG A;  3OEK A;  4JWY A;  3T9U A;  1A8F A;  3RUM A;  4N4U A;  1IXI A;  4DZ1 A;  4QFP A;  3MPL A;  5AA2 D;  2OCU A;  3MST A;  2P3N A;  1FCK A;  3PPR A;  4R74 A;  3OSR A;  4NWD A;  5JEI A;  4QSE A;  2I4B A;  4XKN A;  4I9D A;  4F39 A;  3DM0 A;  4Q5T A;  4KR5 A;  4JXI A;  3NOH A;  3H6V A;  4KYE A;  3RN8 A;  3PPQ A;  4FE8 A;  3ONM A;  2VD3 A;  5CMC A;  2RIN A;  4U4S A;  2QVU A;  1S50 A;  5K2Y A;  3TMG A;  3TCH A;  1LFI A;  5DVF A;  1Q9D A;  3FIR A;  2B3F A;  1PEB A;  3KBZ A;  2I3V A;  3IB1 A;  4OVT A;  2WYP A;  2Z23 A;  3K4U A;  2CZI A;  2O84 X;  4ELO A;  2ZNT A;  4F3G A;  1TT1 A;  1Y1Z A;  3MYU A;  4IO7 A;  4E0X A;  2YLN A;  1HSL A;  2VT5 A;  2HXR A;  4GX3 A;  3M3K A;  1B2H A;  5I7I A;  3UA8 A;  4YB6 A;  1FBG A;  3CFZ A;  4IO5 A;  1B32 A;  2Y5L A;  1N7X A;  4FOR A;  4F3B A;  3LV0 A;  4LUB A;  1R1N A;  3L6G A;  1URG A;  4GIZ A;  4DXB A;  4DE8 A;  1SI0 A;  5L9S A;  4NF5 B;  4RPN A;  4C1T A;  1JVY A;  1US4 A;  5H8F B;  2HEU A;  5H8S A;  4OMB A;  1B5H A;  3CG3 A;  4EUO A;  2PX1 A;  4DI4 B;  2O6A A;  5DEX A;  3CG1 A;  1LAG E;  1RYO A;  1N0T A;  3QIM A;  1USY H;  3PMW A;  3O6I A;  2XX8 A;  1VFE A;  2Q9T A;  1VE4 A;  4NF4 B;  2Y7P A;  4QFK A;  1PB9 A;  4OAN A;  1LCF A;  4XKR A;  5ET7 A;  4TOZ A;  2ZNU A;  1SPI A;  2ZMB A;  1OVB A;  1Y4C A;  5BUU A;  3C35 A;  3RTF B;  4F29 A;  3CSG A;  5CMB A;  1O63 A;  1H3D A;  3TQL A;  3QAX A;  3IAZ A;  1YAE A;  4NTL A;  4RK2 A;  4GX4 A;  2P1S A;  3C32 A;  1FTK A;  3LR1 A;  4P0I A;  2Y7R A;  3TAJ A;  1SW4 A;  4U2R A;  5H8H B;  1AL3 A;  1O7T A;  1MH3 A;  2O1M A;  4PDH A;  4GFR A;  1TWY A;  1FPE A;  2F97 A;  5JTY B;  3O9P A;  1M5B A;  2CZH A;  1MY3 A;  1UTH A;  5ITO A;  3KEI A;  4O3A A;  1SD3 A;  3WAE A;  4OFJ A;  4U22 A;  5ELV A;  2QMW A;  1NNT A;  4F1V A;  2DQV A;  2V93 A;  1I6Q A;  3SEY A;  3V8X B;  2HZK A;  2OBG A;  1N84 A;  1B5I A;  1GR2 A;  1MRP A;  1Y3P A;  4GX6 A;  1YTV A;  2QS3 A;  4ELP A;  1H44 A;  1FPF A;  1NI9 A;  5I57 B;  1NNP A;  2R6G E;  1MY0 A;  1QGX A;  3TTN A;  1A99 A;  4HXV A;  5ESY A;  2REG A;  2Q2A A;  2D21 A;  1A8E A;  3B50 A;  4UAB A;  3F11 A;  5EQ8 A;  3MZB A;  2GH9 A;  3JV9 A;  2VP1 A;  4FAJ A;  3OD7 A;  4JVI A;  5EQ9 A;  3PUV E;  1FW0 A;  4OQO A;  4FEC A;  3CFL A;  1QUK A;  4JB7 A;  1VSO A;  4PBH A;  4RJZ A;  4LN5 A;  4QRZ A;  3K01 A;  4O3B A;  4OYV A;  2ANJ A;  4JSD A;  3ISP A;  3O6G A;  1B3G A;  5ET6 A;  3PMX A;  1MQG A;  3TFL A;  2ESN A;  4IO4 A;  1SDX A;  4N13 A;  1URD A;  1TFA A;  4X1D A;  3KSX A;  1JW4 A;  5K2X A;  4I62 A;  3VVD A;  4KCD A;  1M5E A;  1FQB A;  4L17 A;  3IB2 A;  3KN3 A;  5AA4 A;  5I59 B;  1I6A A;  3FVO A;  4U1O A;  1KZ8 A;  5A5L A;  5A5X B;  3SKP A;  2XHD A;  2PFZ A;  3SDF A;  3E79 A;  4NAP A;  2I49 A;  3UK4 A;  1QKB A;  1URS A;  5JK4 A;  3FD3 A;  3T96 B;  4PAI A;  4N81 A;  2PCR A;  1L5T A;  1B1X A;  4GWZ A;  5CM6 A;  1EZP A;  4FBP A;  4U1Z A;  4EQ7 A;  1DCU A;  1INP A;  1QJM A;  1SI1 A;  2CZL A;  1PBP A;  2F7B A;  4F22 A;  3LSX A;  2XXH A;  3U1O A;  3D4G A;  1IXC A;  1YCJ A;  4ELR A;  2Q88 A;  2O69 A;  1NV0 A;  1EYJ A;  2RC7 A;  2WYK A;  4BDQ A;  4IY5 A;  2G93 A;  4GWW A;  4RYA A;  4NGU A;  1P1Q A;  1JEU A;  1EZ9 A;  4R6Y A;  4YZZ A;  2PYY A;  3CR9 A;  5B70 A;  2ZYM A;  2O68 A;  4TLM B;  3S9N C;  1H45 A;  3QMF A;  3G3K A;  1SW5 A;  1FQD A;  2OZZ A;  5LTC A;  4ECF A;  1Q35 A;  3Q29 A;  4ESW A;  3MC2 A;  2DE4 A;  4P3L A;  5CC2 A;  2HPG A;  1IIT A;  3ILU B;  4GXS B;  2X7P A;  1B58 A;  1OIB A;  4H1X A;  4PFB A;  1P1O A;  5T3J A;  2F5X A;  3A3U A;  2O51 A;  3E13 X;  4O3C A;  3B6Q A;  1ZU0 A;  3U92 A;  2BJJ X;  1D4N A;  4KQP A;  1Y3Q A;  4QSD A;  1FJ6 A;  4FAT A;  2I0B A;  3FAS A;  1POY 1;  3ZKK A;  3Q27 A;  1CE2 A;  4MHF A;  4OER A;  2B4L A;  1P99 A;  1QUJ A;  4YKK A;  4EF1 A;  1B40 A;  2QS4 A;  4PE3 A;  4JSO A;  2HAV A;  3T1B A;  5DT6 A;  4LAT A;  1IMD A;  4G77 A;  4AS4 A;  1DSN A;  1QVS A;  2VPN A;  4IGR A;  2DDK A;  4HCW A;  1FBF A;  2Y7I A;  5AA3 A;  2Q8J A;  1B3L A;  3FV1 A;  3IOU A;  4OVS A;  1P1N A;  1MPB A;  3K0V A;  4DDD A;  4KXP A;  1JW5 A;  4N8Y A;  4I3E A;  4R2F A;  2ONS A;  2YPN A;  3K6V A;  1VDW A;  3QK6 A;  5EYG A;  2WBD A;  1MG1 A;  2FYI A;  3T9X B;  3GLB A;  3I6V A;  1OQG A;  4X1B A;  1RDZ A;  2A5T B;  1FQC A;  2ZXT A;  1NV7 A;  2WEF A;  1IZ1 A;  2FBP A;  1K9Z A;  1USY E;  1SYH A;  3H06 B;  4XIG Q;  1M5D A;  1B51 A;  2ZZV A;  2UYF A;  4H45 A;  1DTZ A;  1OMP A;  1MY2 A;  4YIC A;  2NOO A;  1B9J A;  4LON B;  4NQ8 A;  2ZYO A;  1RKM A;  2XXX A;  4YMA A;  3PTY A;  5I58 A;  4YKP A;  3A3C A;  3BFT A;  5DTB A;  3KJ7 A;  4PTK A;  2XWO A;  2ZZX A;  4PGP A;  1P1U A;  5AE4 A;  1NUW A;  1WVJ A;  3L6H A;  4THI A;  4F3P A;  4O8M A;  4POW A;  3W9W A;  2XXY A;  2E1S A;  2CEY A;  1G0H A;  2D3I A;  2H9B A;  4YAH X;  4DXC A;  4MIJ A;  5LOM A;  1HSE A;  4NF6 A;  2OJT A;  4H65 A;  1B7U A;  2IEE A;  3MPK A;  5I58 B;  2UVI A;  4NHB A;  3MW0 A;  1LST A;  1SBP A;  2DE2 A;  4H5F A;  4IGT A;  3VLU A;  5F1Q A;  4F1U A;  3C34 A;  4MAG A;  4KYD A;  2XXQ A;  4JVC A;  3RPW A;  1BLF A;  5KDT B;  2UXA A;  2FHY A;  4F31 B;  4OZ9 A;  2F7A A;  4RK9 A;  4OFL A;  3H03 A;  4Q0C A;  4ZDM A;  1MXY A;  1QUL A;  2R8T A;  1YPN A;  2O7U A;  4NF6 B;  1MDQ A;  3D4C A;  4AB5 A;  4O7I A;  4P9K A;  2Q2C A;  2VOZ A;  2ZZW A;  5I3S A;  3S9L C;  4BDO A;  5FHN A;  3EPE A;  1B46 A;  1UIU A;  3O29 A;  2Q89 A;  1FPK A;  3CFX A;  1DMB A;  4JWO A;  3KC1 A;  5DVJ A;  1AOV A;  5HM4 B;  3Q28 A;  4ELQ A;  4OXV A;  1NH8 A;  5EYH A;  4NF5 A;  3QUF A;  1IMF A;  1Y4T A;  4MNP A;  5H8F A;  2WBB A;  4DIG A;  1R9L A;  2H25 A;  3B6T A;  4BDL A;  4PGN A;  3VDF A;  4JVD A;  3SET A;  1D3K A;  4KPT A;  4YMB A;  4H67 A;  4NF4 A;  5KZT A;  4YU0 A;  4LP2 B;  2QVV A;  4NED A;  1NMU A; 
#chains in the Genus database with same CATH homology
 4MNC A;  2VPO A;  3B50 A;  4UAB A;  5EQ8 A;  4PDD A;  4PAK A;  1EYI A;  4JVI A;  2KQZ A;  5EQ9 A;  1YYZ A;  4F19 A;  1NUX A;  3IFA A;  4PBH A;  4LN5 A;  4OA4 A;  3D1R A;  2XWI A;  3ISP A;  4P1E A;  4GWY A;  5ET6 A;  1FBH A;  5IZ1 A;  4N6D A;  4X9T A;  4AS5 A;  1LBX A;  1KA0 A;  2B4M A;  4P1L A;  4PC9 A;  1FPB A;  2WX9 A;  1DK4 A;  3A29 A;  3RYD A;  1KZ8 A;  1XI6 A;  5A5L A;  4NG7 A;  2PFZ A;  3E79 A;  4NAP A;  2V4C A;  4HCY A;  4MEV A;  5JK4 A;  5I5P A;  2PFY A;  4PAI A;  4N81 A;  3E78 A;  2PCR A;  1AWB A;  4G61 A;  4GWZ A;  4GWS A;  5CM6 A;  4FBP A;  4MX6 A;  1LBZ A;  1DCU A;  1INP A;  4GWU A;  3BIG A;  5J16 A;  2DVZ A;  1BK4 A;  3U65 A;  4I40 A;  2CEX A;  1NV0 A;  1NV3 A;  2JJK A;  1EYJ A;  5IZ3 A;  2WYK A;  5IM2 A;  1LBY A;  4DI3 D;  5ET8 A;  5LDZ A;  4GWW A;  4NGU A;  4YZZ A;  2L5V A;  4X04 A;  2KR0 A;  2P3V A;  3QMF A;  4IR8 A;  1IMA A;  3RPL A;  5LTC A;  4X8R A;  1FSA A;  5EQA A;  2DE4 A;  4P3L A;  4QXD A;  2HPG A;  2FVZ A;  1LEV A;  4NF0 A;  3FBP A;  4N17 A;  4P56 A;  1K9Y A;  2FIE A;  5IZ3 B;  4PFB A;  5ET5 A;  2QPQ A;  2XWV A;  5T3J A;  2F5X A;  2CZK A;  3FXB A;  4XFE A;  1NUY A;  1NUZ A;  1YZ0 A;  1FJ6 A;  3KC0 A;  1G0I A;  2Y5K A;  1RDY A;  1KA1 A;  4P47 A;  4MCO A;  1NV4 A;  3RPL B;  4MHF A;  4PBQ A;  5J1D A;  1FBC A;  2B4L A;  2HHM A;  3HFU A;  5F24 A;  2HZL A;  4PE3 A;  1NV5 A;  4XF5 A;  1FTA A;  4PF6 A;  2FIX A;  1DBZ A;  3T1B A;  5EQ7 A;  1LBV A;  1NV6 A;  5IGA A;  4OVR A;  3ROJ A;  1IMD A;  4AS4 A;  1FJ9 A;  2VPN A;  1IMC A;  4O7M A;  2DDK A;  1IME A;  4N4U A;  4HCW A;  2OWZ A;  1FBF A;  4OVQ A;  4MJO A;  3MST A;  4OVS A;  2P3N A;  4N8G A;  4KXP A;  4N8Y A;  4HE0 A;  5FBP A;  4I3E A;  3IFC A;  1VDW A;  1NV2 A;  5EYG A;  2MKZ A;  3NOH A;  2WBD A;  3BIH A;  4NN3 A;  4N15 A;  4PF8 A;  2XA5 A;  2QVU A;  1RDZ A;  4P8B A;  1NV7 A;  1Q9D A;  2WEF A;  4QBA A;  2FBP A;  3T0J A;  3KBZ A;  4HE1 A;  1FPL A;  1K9Z A;  1FRP A;  4OVT A;  2WYP A;  3CHG A;  4F18 A;  1CNQ A;  2ZZV A;  2QVR A;  4H45 A;  4N6K A;  2CZI A;  4YIC A;  4NQ8 A;  1D9Q A;  4PET A;  2V3Q A;  2F3B A;  3MYU A;  3PTY A;  5DW8 A;  1FBD A;  2VT5 A;  4O94 A;  2HXR A;  1LBW A;  4PCD A;  4PTK A;  4OVP A;  2XWO A;  4GX3 A;  2ZZX A;  1RDX A;  2DE3 A;  4PGP A;  5I7I A;  1NUW A;  1FBG A;  4O8M A;  2Y5L A;  3W9W A;  3LV0 A;  2CEY A;  1G0H A;  4GBW A;  2Q8M A;  1FPD A;  1JP4 A;  3SZP A;  1FPJ A;  4MIJ A;  4PFI A;  2XXK A;  1NV1 A;  4HE2 A;  2QFL A;  4DI4 B;  1IMB A;  4NHB A;  2DE2 A;  4MNI A;  5IZZ A;  4GBV A;  1EYK A;  2Q9T A;  4F1U A;  2F3D A;  4MAG A;  4NX1 A;  4JVC A;  2BJI A;  4OAN A;  2FHY A;  5ET7 A;  2R8T A;  1SPI A;  1FBP A;  4O7I A;  4P9K A;  4N91 A;  4XEQ A;  2ZZW A;  5I3S A;  4PAF A;  3GYY A;  4GWX A;  4GX4 A;  4PFR A;  1FBE A;  4MMP A;  1FPK A;  2XWK A;  4PDH A;  3KC1 A;  1FPE A;  4I3Y A;  2CZH A;  4M1V A;  1YXI A;  3W9V A;  3LUZ A;  1FPG A;  3B8B A;  5EYH A;  4F1V A;  2OX3 A;  2GQ1 A;  3EKI A;  1IMF A;  2HZK A;  4MNP A;  2WBB A;  2Q74 A;  4GX6 A;  4PGN A;  4JVD A;  1FPF A;  1FPI A;  1NI9 A;  1QGX A;  4H46 A;  5ESY A;  4HXV A;  2QVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...