4N6DA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
319
structure length
319
Chain Sequence
ADISLSYANFPPAKTFPCVQMERWKQEVEKRTAGKVQVQTYPGSTLLGAKNTLRGVMQGQADIGCVSLAYHPGVFPLSSVFELPLGFTSSTSASLALWDLYTKYQPKEFKRFKVLTMFASAPSNIMTKVPVRNLDDLKGLEVRASGILSKILESLGATPVSMPMSATPEALQKGVVKGLFSSFEVLKDLNFAEICRYETETNTAVYPFAIIMNMNSWNSLPDDVKKVLNDLGREQAEWTGKYMDEHVKRSLAWAKDKYSIEMIKMSDADMQAIKDKTLPLIEDWKEKAAAKGVDGAAVLSDVEELRIKYEGKAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter-DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio salexigens
molecule tags Transport protein
total genus 116
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4n6dA00
4MMPA 4PGPA 4N6DA 4PDDA 2PFYA 4O8MA 2XWOA 4O7MA 4P56A 4MNIA 3GYYA 4P3LA 2HZKA 4MCOA 4OA4A 4P1LA 4PF6A 4NN3A 2HZLA 4PCDA 4YZZA 4OVTA 4MNCA 4NG7A 4LN5A 4N8YA 4MIJA 4PFBA 4O94A 4PAIA 2ZZXA 2HPGA 4DI4B 4XEQA 4PE3A 2V4CA 4PDHA 4PAKA 5LTCA 4MNPA 4P1EA 5I5PA 4N91A 2WYPA 4P47A 4N4UA 4P9KA 4DI3D 4X04A 4PETA 2VPNA 2XWIA 4N8GA 2ZZVA 4N17A 4XF5A 4PBQA 2WX9A 4OVPA 4PF8A 5CM6A 4N15A 4PBHA 2VPOA 2CEXA 4OVQA 4UABA 2WYKA 4MAGA 4YICA 3FXBA 4NX1A 4PAFA 4MEVA 2XXKA 4N6KA 2ZZWA 3B50A 4OVSA 2CEYA 5IZZA 4NAPA 2XA5A 3U65A 2XWVA 4OVRA 4PGNA 5IGAA 4XFEA 2XWKA 4OANA 4PC9A 4NF0A 4P8BA 4NQ8A 4NHBA 4NGUA 4MHFA 2PFZA 5IM2A 4MX6A 4PFRA 4X8RA 4PFIA 5I7IA
chains in the Genus database with same CATH superfamily
4R9GA 3O2AA 3KEIA 5KCJB 4H0WA 4LQ5A 1M5FA 2GHAA 3RTWB 3LUYA 1SI0A 2I48A 4MNIA 3GYYA 5FTIA 2Q9TA 4H8IA 3M8UA 1UTBA 4NN3A 3VFJA 3HCQA 3H7MA 3QK6A 4H1XA 4X1BA 4GXSB 4GOTA 1AL3A 2F3BA 3S2VA 1UTBB 2ZYOA 3E9XA 2B3BA 4XEQA 5KDTA 3C4MA 4M4GA 2H5YA 4GWYA 4N91A 5KDTB 3CIJA 4YAHX 1DBZA 5I3SA 2AIXA 2VPNA 3IFAA 3PMVA 3IR1A 4O3AA 4KQPA 4QRZA 2HAUA 4N17A 2IA4A 4RYAA 3I5OA 5HM4B 2QSXA 2Q74A 1IMCA 4GFRA 3CHGA 3L6HA 1MPCA 1B4ZA 2A5SA 2CZIA 1B4HA 1Z7ME 4R72A 1FW0A 4ESXA 4PFTA 2HXRA 1NFTA 2V25A 1EH3A 4YMBA 4EF1A 1IQ7A 1B0LA 4NF8A 1B3LA 4DXBA 3RTFB 2I3WA 4EDPA 3Q28A 4X8RA 4HE1A 4NF8B 4MMPA 3RY3A 1G0IA 3E4RA 1IIWA 4YB6A 2AL4A 3ODBA 4KD5A 3KGCA 4O8MA 2F97A 3ZSFA 1O7TA 2XXVA 4P0GA 4AS4A 5F7VA 2I4BA 3O9PA 4BDQA 1POY1 1FQAA 1B2HA 2OBGA 3VVDA 2Z8DA 4C0RA 1ANFA 2X26A 3IB1A 4GIZA 4U2RA 1PC3A 4RXLA 2F7BA 4MBPA 3O66A 2FBPA 1YYZA 1IMBA 4P1EA 3KSJA 2Z8EA 4F29A 4WXJA 1XOCA 4R6KA 5L9MA 2DOJA 4P0IA 3OO6A 1PB8A 1LFHA 2F7CA 3GBAA 3PGFA 4XF5A 4AQ4A 1LAHE 4Q0CA 3OEMA 3VLUA 4PBHA 3HV1A 4OTEA 3V83A 1H45A 3D1RA 3K00A 3O6GA 5BUUA 4F31B 1B3GA 4H5GA 2HXWA 3DLNA 1B32A 3S9EA 4OVRA 3U8QA 1MQJA 4BDNA 2XWKA 1H44A 3ONMA 4U1OA 4GD5A 4RNSA 1FQCA 2O68A 3FVOA 4F39A 5I2NA 2PBWA 4BDLA 1NUYA 2GRVA 3TAJA 3ROJA 2RC8A 5I2NB 1WVJA 4GWWA 1IMDA 3KJTA 3UORA 1ZTYA 3K6VA 1QUKA 4G68A 1ZU0A 1ZIUA 3HSTA 3IFCA 1EU8A 3M3FA 3A29A 4PFBA 3FXRA 3EQ1A 3VXCA 3R26A 4NWCA 2DP8A 1LBVA 2R6GE 1P1UA 3TCHA 4GQOA 2DXYA 3IX1A 3FATA 3MSTA 5AA2D 2VOZA 5KZTA 4H45A 2OZZA 4TLMB 4BDMA 2XXTA 4DI3D 3S9NC 4F1UA 2OCUA 1B7ZA 4PTKA 2XXQA 3D4CA 1B3FA 4C1TA 3PMXA 2ZZVA 1FBEA 3C36A 3C34A 2Q2CA 4I3YA 2VD3A 4DXUA 1DK4A 2Q8JA 4AB5A 1ZJLA 4QF9A 4PAFA 3TZAA 5DVFA 5CC2A 3KC1A 2LAOA 3RT8A 1MM6A 4EQ7A 1I6BA 3TTRA 4X1DA 1Y4TA 3KSXA 1KA1A 3WAFA 4K3FA 1NV3A 1I6AA 1VE4A 1FQDA 3QSLA 4NQ8A 4NHBA 3ZKLA 2HFBA 4R73A 2QS2A 3FXUA 4OFLA 3VXBA 5CMKA 4C1UA 3Q25A 3OELA 4R75A 5ITPA 1POTA 4FIMA 2VT5A 3MUQA 3JZJA 4ZEFA 4ELOA 5K2XA 3IOTA 1UQWA 2E0SA 3CG3A 3TFLA 3GLBA 3KN7A 5EQ7A 4MCOA 1MY0A 3C33A 4OA4A 2ZNUA 3IO6A 1II5A 3MVWA 2IEEA 4MIJA 2F35A 2QMWA 2ZZXA 4QXDA 1FQFA 3Q29A 4HCWA 3TELA 4JWXA 4PE3A 4F3BA 3VVFA 5J16A 1B46A 2YJPA 3OD7A 1QUJA 4U1ZA 5F24A 3FVNA 3IL1B 1Y3NA 1AH5A 4H6DA 1LBZA 2QVRA 5IKBA 4P47A 4OWDA 5CRYA 3MZBA 3T1BA 4P9KA 1YTVA 2V3QA 5ICTA 5AA2A 1AMFA 1PEBA 4GL0A 1RYOA 2E1SA 1N3XA 2RCAA 4LQ2A 3C35A 4E0XA 4JVDA 1VSOA 5I57B 1QUIA 1A99A 4MEVA 4EXKA 1Y1ZA 1FPJA 4OVSA 5H8FA 1HSLA 2ZMBA 1H3DA 4PGNA 3SEXA 2VGQA 3FASA 4HW8A 1FQBA 3TQWA 1N0TA 1FBHA 2XXPA 2ESNA 1MPBA 3O6HA 3B6TA 4Q30B 2O7UA 1HSJA 4QFOA 4I40A 2QS3A 1R6ZA 1FTAA 3G3HA 1DOTA 4N81A 2FA7A 4IB2A 5CMBA 3TUSA 3UK4A 1NV4A 4FJPA 2ZNTA 3LC8A 3H03A 1NH8A 4R2BA 2DYXA 2OLBA 3RUMA 1NV1A 3EHUA 3SEWA 1JQFA 1OQHA 3T96B 4G77A 1US5A 3E3KA 2HPGA 4YKKA 3IO4A 1SI1A 3O97A 5ICQA 3H3GA 5JEIA 3LSXA 5B70A 4KPTA 4DE8A 1L5TA 3KJ7A 3LSWA 1KWHA 3VLWA 4FBPA 2WYPA 1Y9UA 3KOTA 4R6HA 2I3VA 3GZGA 4AS5A 4OVPA 1DPEA 2H9BA 2G29A 1NUZA 4POWA 2CEXA 1NV5A 3KOSA 1Y1MA 1EYIA 1MH3A 5B7DA 1MXZA 2CZLA 1FRPA 1JETA 5T3JA 4N6KA 3B50A 3PPOA 1EYKA 2HQ0A 2KR0A 1SDXA 4JVIA 1SW1A 3PPRA 3RNNA 1R9LA 1R9QA 3FJ7A 4X9TA 4ZS9A 1B51A 3B7DA 2RC7A 5I59B 3IJXB 2Y7PA 4MJOA 1ZKBA 2RKMA 2X7QA 4LONB 3G3GA 1LFGA 3K0VA 4P3LA 5M2VA 1PB9A 1TWYA 4DXCA 3MAMA 3G3FA 2HZLA 5KCJA 4F18A 4ZDMA 1YXIA 3TEPA 1MXWA 4F3SA 1J1NA 4OXVA 3CFLA 3HO7A 3K6XA 4O94A 2QJEA 4OQOA 3TCGA 1IUDA 2GH9A 3E78A 3K2DA 3C32A 3MP6A 3F11A 3H06B 4QFLA 1TT1A 1B1XA 4HXVA 4ONYA 4XKPA 2DSFA 5DW8A 3QUFA 1A7LA 2F3DA 4FAJA 5I84A 2UYEA 5BWJA 3FVKA 1N7XA 1UIUA 5ISUA 1A54A 5H8QB 1LB9A 2RINA 1S7YA 2XXUA 2D5WA 4NEDA 1IXGA 2B3FA 3SETA 4XKQA 1LB8A 1B05A 1D4NA 3VE1B 1EYJA 4NX1A 1F9BA 2XXIA 4R6YA 1NUXA 3MWBA 4PFWA 1B6HA 3EF7A 4NF5A 1FPIA 5CBRA 2I4CA 3TYHA 2F6GA 3RLFE 4DZ1A 1B0HA 2HEUA 4DCXA 4P8BA 5LDZA 4NF5B 3FD3A 2DE3A 4NGUA 4KXPA 1YPNA 3EN3A 4MX6A 2AL5A 2AYSA 4IO4A 1RDXA 3PMWA 2WKYA 2DXRA 5CMCA 3P7IA 1D9QA 4OVTA 1QGXA 4MNCA 3TQLA 5ET5A 3MW0A 2Y7WA 4OZ9A 3MZ9A 3U1OA 4HTGA 1ATGA 1B5HA 1XT8A 3FV2A 1PB7A 2KQZA 3CI8A 3G3JA 3KFMA 3ILUB 2P3VA 3UA8A 2F36A 3U72A 5I2KB 4QFNA 1SQYA 3ECRA 5AA4A 3UIFA 3SESA 3MVXA 2H25A 2NVUB 3E79A 1IXCA 1LAFE 4LVQA 1FTLA 1NUWA 5AA4B 1LAXA 5EYHA 1S50A 1SD3A 3TTKA 1URGA 4UABA 2H4IA 4MAGA 3GBBA 5ITOA 3T66A 4OENA 4MLQA 4UACA 2PT2A 3K6UA 1O64A 5ET8A 3OSRA 2THIA 1BIYA 4H65A 2QRYA 4ZECA 5TU0A 1B5IA 3MP1A 3C31A 4OFOA 3IB2A 1R1NA 4MF3A 1A8EA 3N26A 4OVJA 3FVGA 2RC9A 4L17A 2YLNA 4R9FA 2H98A 4I62A 1MS7A 1BK4A 4RPNA 3OMBA 4YKJA 3ILTB 4TQUQ 4PF6A 1NMUA 1OQGA 2NWJA 4IO7A 4OERA 4GWXA 1M5DA 4LN5A 2OWZA 2H99A 1SW2A 1B5JA 3KN8A 4TOZA 4LATA 2OX3A 1MQHA 4PFYA 2ZYMA 4JDFA 1B40A 4NTLA 4ZE9A 3B6WA 1FPDA 2VHAA 4GL8A 1H43A 3FV1A 4H8JA 2G93A 3PTYA 4LP2B 1Y4CA 3DM0A 4G2ZA 4I9DA 4GF8A 2XX7A 4IO3A 2HCAA 5FHNA 4UA8A 4KCDA 1XC1A 2Y5KA 4ESWA 3H6VA 3MVZA 3N6UA 1SVXB 1SPIA 4BDRA 1I69A 4N13A 4OEVA 3FXBA 2NOOA 4NF6B 3GXAA 1K9ZA 3OEKA 1Q1KA 1MM7A 3E13X 1KA0A 2ZZWA 1Y3PA 3DP4A 1NV0A 2XA5A 4POXA 1JP4A 2RF1A 5ESYA 3B8BA 1G0HA 3PV0E 3U93A 4NF0A 2FYIA 1A40A 4GLIA 2DQVA 3RYDA 2Q88A 1OLCA 4G8MA 3MPKA 2PFYA 1LCTA 4RJZA 3THIA 1LSTA 3LUZA 4GWUA 4R74A 4U4SA 4F1YA 2MKZA 2XXRA 1USYH 3QAXA 1USYE 4G8NA 1VR5A 3OSQA 1GGGA 3BFTA 1IMAA 3B6QA 3FBPA 1YAEA 4GX4A 4IGTA 1JVYA 3K4UA 1FBGA 2I49A 4GVOA 3H6WA 3G3IA 3TMGA 4EXLA 3IOUA 1S9TA 5ET7A 4ZZEA 2I6EA 2V3TA 5AA1A 2ZYKA 2B4LA 2GHBA 3QMFA 1Y20A 4ZEDA 3IAZA 1FBPA 1IITA 4HCYA 3VVEA 5CM6A 2QS4A 1OVTA 2DWAA 3RT6B 1SW5A 4X48A 2WYKA 3K1NA 5DT6A 3KC0A 4WEDA 1D9YA 1MY2A 3H4ZA 3TTLA 1NV7A 4ZEBA 1AWBA 4P11A 4NAPA 1XVXA 4FEBA 1MXVA 1NV6A 2REJA 1ZMGA 3LBSA 4IO5A 2QVUA 1FSAA 3N6TA 5EHSA 5I57A 1NNPA 4MHFA 4O3BA 4EQ9A 4GWOA 2DWHA 1EZOA 5FBPA 4BLAA 2PT1A 1BP5A 4NE4A 3S9MC 1MDQA 2XD2A 3VLVA 5K2YA 4ND9A 4KYEA 4XKRA 3OXNA 4F22A 5FHOA 1QKBA 1I6QA 2NXOA 3NOHA 4XIGQ 3PPPA 3PUVE 3A09A 2DS9A 4G68C 2V4CA 1RDYA 2UVIA 3T22A 4MLVA 5I56A 4MH5A 3MPLA 3BBRA 1QJMA 2ANJA 1OIBA 2BJIA 4ELRA 4NF4B 5I56B 3SZPA 4ISUA 3D4GA 5HPQA 4IY6A 3S4UA 1LEVA 1Y3QA 2QPQA 1SYHA 2ONSA 4N15A 1LBBA 4GX6A 4DDDA 3KBZA 2QVVA 1QVSA 5A5LA 2JJKA 1MY3A 2R9JA 2F6PA 4F2QA 3RPWA 2Y5LA 1M5BA 1LLSA 1RYXA 2UXAA 4AB6A 1CB6A 4PC9A 1ZBMA 3RPLB 1MG1A 4OMBA 1B1HA 1US4A 1VFDA 1HSEA 5L9SA 3FIRA 4QHQA 1Z7NE 3G7WA 1QW0A 4N6DA 5EQAA 2OJTA 4JWOA 3K6WA 1SBPA 4FATA 4YKPA 2GFEA 2Q8MA 5I59A 1XHYA 2ONKE 3SEYA 3LV0A 5TPAA 3IOVA 3PUZE 5DEXB 2O51A 4JVCA 1IXIA 2NUVA 4U21A 2Z22A 2Y7IA 4F1VA 2HAVA 4OESA 5TPAB 3WAEA 1JNFA 3U92A 2A5TB 2FNCA 4Q5TA 2V93A 5DTBA 2V3UA 1MQGA 4N07A 3RGYA 1CNQA 4ELQA 3I6VA 3TKDA 3FJGA 2F5XA 2F8DA 3V5AA 1TFDA 3CRBA 4N8GA 1O63A 4ZE8A 1MDP1 3W9VA 3QXMA 3RN8A 1IEJA 5EQ8A 4EF2A 2UYFA 4OVQA 2XD3A 3MZ1A 4F3GA 2XXKA 5H8QA 1INPA 5AA3A 2F7AA 1MXXA 5DVIA 2OWSA 1LBXA 3BIGA 4XFEA 4EQBA 5AE4A 1DTGA 1B3EA 1FTJA 4YB7A 5IM2A 4PFRA 3SEUA 3PPNA 1BKAA 2ALUA 2Q2AA 2L5VA 2GQ1A 3PUWE 2YPNA 1JVXA 1RDZA 4PDDA 2P3NA 3UP9A 5DYHA 3O29A 1UTHA 1OVBA 2R8TA 2I0CA 2FIEA 3KZGA 2O69A 3Q26A 3T93B 3SDFA 1FJ6A 4O7MA 4IR8A 1LBCA 1LAGE 3N94A 2B4MA 5IAIA 1UTHB 4P1LA 4QBAA 3AXFA 3FZVA 1MQIA 4RK2A 4ELPA 4EUOA 2VP1A 4NMYA 1JW1A 4WEPA 3PUXE 2DVCA 5J1DA 4DI4B 4Z0IA 2O1MA 4N6PA 1P99A 2O6AA 5ET6A 1P1NA 4JXIA 2DWIA 1DCUA 3PD9A 3S9LC 3PU5A 3PPQA 3CFZA 5LTCA 4MNPA 1JW5A 3EKIA 1IXHA 3QYTA 2BJJX 4U23A 2PVUA 3OOAA 4N4UA 1IMFA 1MY1A 5CI5A 2UVHA 5I2KA 1GV8A 1EZPA 2ZNSA 2XX9A 2P2AA 4JBZA 1NI9A 4FE8A 4H5FA 1N76A 4XKNA 4GRKA 1ELJA 2QL3A 3DP8A 3JV9A 4YU0A 3QIMA 2XX8A 3U65A 4LZ5A 4JSOA 2XWVA 3VDFA 1WDNA 1XI6A 5H8NA 2ZYNA 3K01A 3MBPA 3SERA 3OO8A 4KCCA 5H8HA 4RY1A 1D9VA 5H8NB 2M8CA 4KYDA 5LOMA 1OLAA 1URSA 5JTYA 5H8HB 3SEVA 1YCJA 1OMPA 4KYSA 3HHFA 4QSCA 2PMSA 4HS7A 1JEUA 5JTYB 4LUBA 5EYGA 1FBDA 1B58A 1BTJA 3IORA 1N3WA 3CG1A 2REGA 4JB7A 2DDKA 3MQ9A 1JW4A 1M5CA 4QSEA 1NV2A 3FXQA 4N8YA 3TDJA 2FIXA 4PAIA 2XHDA 4RK9A 1DTZA 3V89B 1LFIA 3ZKKA 1PDAA 3K1MA 1DSNA 4PE5B 1B3HA 1NL5A 5I5PA 3CSGA 3T9XB 2F34A 1Q35A 4PETA 3RQTA 4O3CA 3CSBA 3MYUA 1A55A 3OENA 4DCYA 1NNFA 1XS5A 5EQ9A 4FECA 1P1WA 4G4PA 2DVZA 1SYIA 2ONRA 4GWSA 3IK6B 2B65A 3MVYA 1VFEA 4OFJA 1KZ8A 3CFXA 3OO9A 1DPPA 2Y7RA 3A3CA 3FGSA 3T9VA 1P1QA 3KBRA 1AIVA 4MFIA 3IOWA 5IGAA 4FORA 3T9UA 3M3KA 4NF6A 4G8HA 2X7PA 4R2FA 4O7IA 2PFZA 3USDA 1FJ9A 4FEDA 4GWZA 4G61A 5JK4A 1FPFA 4G68B 3BIHA 4ECFA 4THIA 4PP0A 2Z23A 1MXYA 3MC2A 3K1PA 2CZHA 4P56A 2Z8FA 2HZKA 1EZ9A 4KI0E 2FHYA 1K9YA 4U4XA 2O7IA 4NWDA 3MP8A 4I3EA 4PCDA 3HFUA 4U22A 4TLLB 4NG7A 4I1DA 2R71A 1FQEA 4F19A 2F78A 3IJOB 1FBFA 3KN3A 3R6UA 3C9HA 4QFKA 4IO6A 1SW4A 3A3UA 5EHMA 4PDHA 5EYFA 2WEFA 4PAKA 4XTCQ 5IZ3A 5A5XA 1JEVA 4YMAA 3JYRA 3QUJA 3VV5A 1IMEA 1FPKA 2V84A 3ZS6A 2W7YA 4IY5A 5IZ3B 5A5XB 3BKIB 3UGWA 1UIVA 2WX9A 3T9HB 4PF8A 3L6GA 1QULA 1P1OA 5DVJA 1MPDA 2QS1A 1TXFA 2CMOA 4YICA 3EPEA 4OETA 1B7HA 1A8FA 1FPEA 4GBWA 2Y7KA 1Q9DA 4LZ8A 4PQJA 2FVZA 5IZZA 1MY4A 2PX1A 3G3KA 2PCRA 1FTMA 2QFLA 1LGBC 1MRPA 4ZZAA 5CMMA 1XVYA 1N04A 4ZEKA 3FJMA 1M5EA 2P1SA 1T0KA 4M1VA 1FTKA 3CR9A 4Q8RA 4PFIA 5I7IA 4RA1A 4PGPA 4WKMA 5I58A 1D3KA 3BFUA 3HPIA 5L8DA 2XWOA 2DE4A 1PBPA 3PD8A 1N7WA 4XXUA 1N84A 2D21A 5L9OA 4PFUA 4KHZE 5I58B 3Q27A 4E0WA 1FTOA 4JWYA 3V8XB 2DWJA 2XXYA 2Y84A 3R7XA 3EHTA 3IB0A 3TTNA 3PUYE 1PBQA 4YKIA 1GR2A 1LBYA 3TCFA 1IZ1A 1FCKA 3ISPA 4KFQA 5AA2B 4QSDA 1NH7A 1WODA 2PYYA 3T0JA 2ABHA 5ELVA 1VDWA 2XXHA 3DELB 4X04A 4DIGA 1BLFA 2XWIA 2UVGA 3TPAA 2DE2A 4PBQA 4RPOA 1MXUA 5H8SA 1NNKA 5H8FB 4ZEIA 4NF4A 5F1QA 2I0BA 3I3VA 4IGRA 2KLFA 2P0SA 1AOVA 4KR5A 4GX3A 3OO7A 2CEYA 3SKPA 2UVJA 1CE2A 1MQDA 3UN6A 1B9JA 2OWTA 1NNTA 4Z7EA 3FUZA 1GVCA 3LR1A 3LSFB 4H46A 3W15C 3H6UA 4QFPA 1B7UA 3RPLA 3HHGA 1FPBA 2WBDA 1RKMA 1GTKA 1QKAA 3LSLA 2I58A 1FPGA 2CZKA 3O28A 5HBCA 3H6TA 4YZZA 5CBSA 1LBWA 1B52A 1FPLA 2ZXTA 3KG2A 5DEXA 4OHNA 4HE2A 3W9WA 1YZ0A 4I8CA 4IO2A 4YB5A 1URDA 2D3IA 2A5TA 4GBVA 4BDOA 4F2OA 3U94A 4F3PA 2QMXA 4HE0A 3O6IA 4GXAA 1H76A 1DMBA 2XXXA 4LA9A 2Q89A 4LZ7A 4JSDA 4OEUA 2VPOA 3TODA 2RCBA 1LCFA 2HHMA 3N5LA 5IZ1A 3DP6A 3CVGA 3EHSA 2WBBA 1ZLQA 5TP9A 2O1LA 2OK2A 1FBCA 3HN0A 5FHMA 3TTMA 2VD2A 5TP9B 4OANA 1TFAA 3MJNA 3M3LA 1NKXA 1MH4A 2XXWA 3K02A 4OYVA 2O84X 4DLDA 5FTHA 4H67A
chains in the Genus database with same CATH topology
1FBHA 3RYDA 2PFYA 4I40A 3LUZA 4GWUA 2MKZA 4MNIA 3GYYA 2Q9TA 1FTAA 5EYGA 1FBDA 4N81A 1NV4A 2DDKA 4NN3A 1IMAA 3FBPA 1NV1A 1NV2A 4GX4A 4N8YA 2FIXA 1FBGA 2F3BA 4PAIA 2HPGA 4XEQA 5ET7A 4GWYA 5I5PA 4FBPA 4N91A 2WYPA 1DBZA 5I3SA 2B4LA 4PETA 2VPNA 3IFAA 3QMFA 3MYUA 4AS5A 4N17A 1FBPA 4OVPA 4HCYA 5EQ9A 5CM6A 1NUZA 2Q74A 2CEXA 2DVZA 1IMCA 3CHGA 1NV5A 2WYKA 4GWSA 1EYIA 3KC0A 2CZIA 1KZ8A 1FRPA 2HXRA 5T3JA 4N6KA 1NV7A 3B50A 1EYKA 1AWBA 4NAPA 2KR0A 4JVIA 1NV6A 5IGAA 2QVUA 1FSAA 4X9TA 4MHFA 2PFZA 4O7IA 1FJ9A 4GWZA 4G61A 4X8RA 4MJOA 4HE1A 5JK4A 4MMPA 1FPFA 5FBPA 1G0IA 3BIHA 4O8MA 4AS4A 2CZHA 4P56A 4P3LA 2HZKA 2FHYA 1K9YA 4I3EA 2HZLA 4PCDA 4F18A 3HFUA 4NG7A 1YXIA 4F19A 4O94A 1FBFA 3NOHA 3E78A 2V4CA 1RDYA 4PDHA 2FBPA 1YYZA 1IMBA 2WEFA 4PAKA 4P1EA 5IZ3A 4HXVA 5DW8A 2BJIA 1IMEA 1FPKA 2F3DA 5IZ3B 3SZPA 1LEVA 4XF5A 2WX9A 4PF8A 2QPQA 4N15A 4PBHA 4GX6A 3KBZA 4YICA 2QVVA 1EYJA 3D1RA 4NX1A 1FPEA 4GBWA 5A5LA 2JJKA 1Q9DA 1NUXA 2FVZA 2Y5LA 5IZZA 1FPIA 4OVRA 2XWKA 2PCRA 2QFLA 4PC9A 3RPLB 4P8BA 5LDZA 2DE3A 4NGUA 4KXPA 4M1VA 4MX6A 4PFIA 5I7IA 4PGPA 4N6DA 5EQAA 1NUYA 1RDXA 2XWOA 2DE4A 3ROJA 2Q8MA 4GWWA 1IMDA 3LV0A 1D9QA 4JVCA 4OVTA 1QGXA 4MNCA 5ET5A 3IFCA 3A29A 4F1VA 4PFBA 2KQZA 1LBYA 1LBVA 2P3VA 3ISPA 3MSTA 1CNQA 4H45A 3T0JA 1VDWA 2F5XA 4DI3D 4X04A 4F1UA 4PTKA 2XWIA 4N8GA 2ZZVA 1FBEA 2DE2A 4PBQA 3E79A 3W9VA 1NUWA 5EYHA 4I3YA 5EQ8A 4OVQA 4UABA 4MAGA 1DK4A 4PAFA 2XXKA 3KC1A 4GX3A 1INPA 2CEYA 5ET8A 1KA1A 1LBXA 3BIGA 4XFEA 1NV3A 4NQ8A 4NHBA 5IM2A 4PFRA 4H46A 2L5VA 2GQ1A 2VT5A 1RDZA 4PDDA 3RPLA 2P3NA 2R8TA 2FIEA 1FPBA 1FJ6A 4O7MA 4IR8A 2WBDA 5EQ7A 1BK4A 4MCOA 2B4MA 1FPGA 2CZKA 4OA4A 4P1LA 4PF6A 4QBAA 4YZZA 1LBWA 4GWXA 4LN5A 2OWZA 4MIJA 2ZZXA 4QXDA 1FPLA 4DI4B 5J1DA 4HCWA 2OX3A 5ET6A 4HE2A 4PE3A 5J16A 1DCUA 3W9WA 1YZ0A 5F24A 5LTCA 1FPDA 4MNPA 3EKIA 1LBZA 2QVRA 4P47A 4N4UA 3T1BA 1IMFA 3PTYA 4P9KA 4GBVA 2V3QA 4HE0A 2Y5KA 2VPOA 1SPIA 1NI9A 4JVDA 2HHMA 3FXBA 5IZ1A 1K9ZA 2WBBA 4MEVA 1KA0A 1FPJA 2ZZWA 4OVSA 1NV0A 1FBCA 2XA5A 3U65A 1JP4A 2XWVA 5ESYA 4PGNA 1XI6A 3B8BA 1G0HA 4OANA 4NF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMP A;  4PGP A;  4N6D A;  4PDD A;  2PFY A;  4O8M A;  2XWO A;  4O7M A;  4P56 A;  4MNI A;  3GYY A;  4P3L A;  2HZK A;  4MCO A;  4OA4 A;  4P1L A;  4PF6 A;  4NN3 A;  2HZL A;  4PCD A;  4YZZ A;  4OVT A;  4MNC A;  4NG7 A;  4LN5 A;  4N8Y A;  4MIJ A;  4PFB A;  4O94 A;  4PAI A;  2ZZX A;  2HPG A;  4DI4 B;  4XEQ A;  4PE3 A;  2V4C A;  4PDH A;  4PAK A;  5LTC A;  4MNP A;  4P1E A;  5I5P A;  4N91 A;  2WYP A;  4P47 A;  4N4U A;  4P9K A;  4DI3 D;  4X04 A;  4PET A;  2VPN A;  2XWI A;  4N8G A;  2ZZV A;  4N17 A;  4XF5 A;  4PBQ A;  2WX9 A;  4OVP A;  4PF8 A;  5CM6 A;  4N15 A;  4PBH A;  2VPO A;  2CEX A;  4OVQ A;  4UAB A;  2WYK A;  4MAG A;  4YIC A;  3FXB A;  4NX1 A;  4PAF A;  4MEV A;  2XXK A;  4N6K A;  2ZZW A;  3B50 A;  4OVS A;  2CEY A;  5IZZ A;  4NAP A;  2XA5 A;  3U65 A;  2XWV A;  4OVR A;  4PGN A;  5IGA A;  4XFE A;  2XWK A;  4OAN A;  4PC9 A;  4NF0 A;  4P8B A;  4NQ8 A;  4NHB A;  4NGU A;  4MHF A;  2PFZ A;  5IM2 A;  4MX6 A;  4PFR A;  4X8R A;  4PFI A;  5I7I A; 
#chains in the Genus database with same CATH topology
 4R9G A;  3O2A A;  3KEI A;  5KCJ B;  4H0W A;  4LQ5 A;  1M5F A;  2GHA A;  3RTW B;  3LUY A;  1SI0 A;  2I48 A;  4MNI A;  3GYY A;  5FTI A;  2Q9T A;  4H8I A;  3M8U A;  1UTB A;  4NN3 A;  3VFJ A;  3HCQ A;  3H7M A;  3QK6 A;  4H1X A;  4X1B A;  4GXS B;  4GOT A;  1AL3 A;  2F3B A;  3S2V A;  1UTB B;  2ZYO A;  3E9X A;  2B3B A;  4XEQ A;  5KDT A;  3C4M A;  4M4G A;  2H5Y A;  4GWY A;  4N91 A;  5KDT B;  3CIJ A;  4YAH X;  1DBZ A;  5I3S A;  2AIX A;  2VPN A;  3IFA A;  3PMV A;  3IR1 A;  4O3A A;  4KQP A;  4QRZ A;  2HAU A;  4N17 A;  2IA4 A;  4RYA A;  3I5O A;  5HM4 B;  2QSX A;  2Q74 A;  1IMC A;  4GFR A;  3CHG A;  3L6H A;  1MPC A;  1B4Z A;  2A5S A;  2CZI A;  1B4H A;  1Z7M E;  4R72 A;  1FW0 A;  4ESX A;  4PFT A;  2HXR A;  1NFT A;  2V25 A;  1EH3 A;  4YMB A;  4EF1 A;  1IQ7 A;  1B0L A;  4NF8 A;  1B3L A;  4DXB A;  3RTF B;  2I3W A;  4EDP A;  3Q28 A;  4X8R A;  4HE1 A;  4NF8 B;  4MMP A;  3RY3 A;  1G0I A;  3E4R A;  1IIW A;  4YB6 A;  2AL4 A;  3ODB A;  4KD5 A;  3KGC A;  4O8M A;  2F97 A;  3ZSF A;  1O7T A;  2XXV A;  4P0G A;  4AS4 A;  5F7V A;  2I4B A;  3O9P A;  4BDQ A;  1POY 1;  1FQA A;  1B2H A;  2OBG A;  3VVD A;  2Z8D A;  4C0R A;  1ANF A;  2X26 A;  3IB1 A;  4GIZ A;  4U2R A;  1PC3 A;  4RXL A;  2F7B A;  4MBP A;  3O66 A;  2FBP A;  1YYZ A;  1IMB A;  4P1E A;  3KSJ A;  2Z8E A;  4F29 A;  4WXJ A;  1XOC A;  4R6K A;  5L9M A;  2DOJ A;  4P0I A;  3OO6 A;  1PB8 A;  1LFH A;  2F7C A;  3GBA A;  3PGF A;  4XF5 A;  4AQ4 A;  1LAH E;  4Q0C A;  3OEM A;  3VLU A;  4PBH A;  3HV1 A;  4OTE A;  3V83 A;  1H45 A;  3D1R A;  3K00 A;  3O6G A;  5BUU A;  4F31 B;  1B3G A;  4H5G A;  2HXW A;  3DLN A;  1B32 A;  3S9E A;  4OVR A;  3U8Q A;  1MQJ A;  4BDN A;  2XWK A;  1H44 A;  3ONM A;  4U1O A;  4GD5 A;  4RNS A;  1FQC A;  2O68 A;  3FVO A;  4F39 A;  5I2N A;  2PBW A;  4BDL A;  1NUY A;  2GRV A;  3TAJ A;  3ROJ A;  2RC8 A;  5I2N B;  1WVJ A;  4GWW A;  1IMD A;  3KJT A;  3UOR A;  1ZTY A;  3K6V A;  1QUK A;  4G68 A;  1ZU0 A;  1ZIU A;  3HST A;  3IFC A;  1EU8 A;  3M3F A;  3A29 A;  4PFB A;  3FXR A;  3EQ1 A;  3VXC A;  3R26 A;  4NWC A;  2DP8 A;  1LBV A;  2R6G E;  1P1U A;  3TCH A;  4GQO A;  2DXY A;  3IX1 A;  3FAT A;  3MST A;  5AA2 D;  2VOZ A;  5KZT A;  4H45 A;  2OZZ A;  4TLM B;  4BDM A;  2XXT A;  4DI3 D;  3S9N C;  4F1U A;  2OCU A;  1B7Z A;  4PTK A;  2XXQ A;  3D4C A;  1B3F A;  4C1T A;  3PMX A;  2ZZV A;  1FBE A;  3C36 A;  3C34 A;  2Q2C A;  4I3Y A;  2VD3 A;  4DXU A;  1DK4 A;  2Q8J A;  4AB5 A;  1ZJL A;  4QF9 A;  4PAF A;  3TZA A;  5DVF A;  5CC2 A;  3KC1 A;  2LAO A;  3RT8 A;  1MM6 A;  4EQ7 A;  1I6B A;  3TTR A;  4X1D A;  1Y4T A;  3KSX A;  1KA1 A;  3WAF A;  4K3F A;  1NV3 A;  1I6A A;  1VE4 A;  1FQD A;  3QSL A;  4NQ8 A;  4NHB A;  3ZKL A;  2HFB A;  4R73 A;  2QS2 A;  3FXU A;  4OFL A;  3VXB A;  5CMK A;  4C1U A;  3Q25 A;  3OEL A;  4R75 A;  5ITP A;  1POT A;  4FIM A;  2VT5 A;  3MUQ A;  3JZJ A;  4ZEF A;  4ELO A;  5K2X A;  3IOT A;  1UQW A;  2E0S A;  3CG3 A;  3TFL A;  3GLB A;  3KN7 A;  5EQ7 A;  4MCO A;  1MY0 A;  3C33 A;  4OA4 A;  2ZNU A;  3IO6 A;  1II5 A;  3MVW A;  2IEE A;  4MIJ A;  2F35 A;  2QMW A;  2ZZX A;  4QXD A;  1FQF A;  3Q29 A;  4HCW A;  3TEL A;  4JWX A;  4PE3 A;  4F3B A;  3VVF A;  5J16 A;  1B46 A;  2YJP A;  3OD7 A;  1QUJ A;  4U1Z A;  5F24 A;  3FVN A;  3IL1 B;  1Y3N A;  1AH5 A;  4H6D A;  1LBZ A;  2QVR A;  5IKB A;  4P47 A;  4OWD A;  5CRY A;  3MZB A;  3T1B A;  4P9K A;  1YTV A;  2V3Q A;  5ICT A;  5AA2 A;  1AMF A;  1PEB A;  4GL0 A;  1RYO A;  2E1S A;  1N3X A;  2RCA A;  4LQ2 A;  3C35 A;  4E0X A;  4JVD A;  1VSO A;  5I57 B;  1QUI A;  1A99 A;  4MEV A;  4EXK A;  1Y1Z A;  1FPJ A;  4OVS A;  5H8F A;  1HSL A;  2ZMB A;  1H3D A;  4PGN A;  3SEX A;  2VGQ A;  3FAS A;  4HW8 A;  1FQB A;  3TQW A;  1N0T A;  1FBH A;  2XXP A;  2ESN A;  1MPB A;  3O6H A;  3B6T A;  4Q30 B;  2O7U A;  1HSJ A;  4QFO A;  4I40 A;  2QS3 A;  1R6Z A;  1FTA A;  3G3H A;  1DOT A;  4N81 A;  2FA7 A;  4IB2 A;  5CMB A;  3TUS A;  3UK4 A;  1NV4 A;  4FJP A;  2ZNT A;  3LC8 A;  3H03 A;  1NH8 A;  4R2B A;  2DYX A;  2OLB A;  3RUM A;  1NV1 A;  3EHU A;  3SEW A;  1JQF A;  1OQH A;  3T96 B;  4G77 A;  1US5 A;  3E3K A;  2HPG A;  4YKK A;  3IO4 A;  1SI1 A;  3O97 A;  5ICQ A;  3H3G A;  5JEI A;  3LSX A;  5B70 A;  4KPT A;  4DE8 A;  1L5T A;  3KJ7 A;  3LSW A;  1KWH A;  3VLW A;  4FBP A;  2WYP A;  1Y9U A;  3KOT A;  4R6H A;  2I3V A;  3GZG A;  4AS5 A;  4OVP A;  1DPE A;  2H9B A;  2G29 A;  1NUZ A;  4POW A;  2CEX A;  1NV5 A;  3KOS A;  1Y1M A;  1EYI A;  1MH3 A;  5B7D A;  1MXZ A;  2CZL A;  1FRP A;  1JET A;  5T3J A;  4N6K A;  3B50 A;  3PPO A;  1EYK A;  2HQ0 A;  2KR0 A;  1SDX A;  4JVI A;  1SW1 A;  3PPR A;  3RNN A;  1R9L A;  1R9Q A;  3FJ7 A;  4X9T A;  4ZS9 A;  1B51 A;  3B7D A;  2RC7 A;  5I59 B;  3IJX B;  2Y7P A;  4MJO A;  1ZKB A;  2RKM A;  2X7Q A;  4LON B;  3G3G A;  1LFG A;  3K0V A;  4P3L A;  5M2V A;  1PB9 A;  1TWY A;  4DXC A;  3MAM A;  3G3F A;  2HZL A;  5KCJ A;  4F18 A;  4ZDM A;  1YXI A;  3TEP A;  1MXW A;  4F3S A;  1J1N A;  4OXV A;  3CFL A;  3HO7 A;  3K6X A;  4O94 A;  2QJE A;  4OQO A;  3TCG A;  1IUD A;  2GH9 A;  3E78 A;  3K2D A;  3C32 A;  3MP6 A;  3F11 A;  3H06 B;  4QFL A;  1TT1 A;  1B1X A;  4HXV A;  4ONY A;  4XKP A;  2DSF A;  5DW8 A;  3QUF A;  1A7L A;  2F3D A;  4FAJ A;  5I84 A;  2UYE A;  5BWJ A;  3FVK A;  1N7X A;  1UIU A;  5ISU A;  1A54 A;  5H8Q B;  1LB9 A;  2RIN A;  1S7Y A;  2XXU A;  2D5W A;  4NED A;  1IXG A;  2B3F A;  3SET A;  4XKQ A;  1LB8 A;  1B05 A;  1D4N A;  3VE1 B;  1EYJ A;  4NX1 A;  1F9B A;  2XXI A;  4R6Y A;  1NUX A;  3MWB A;  4PFW A;  1B6H A;  3EF7 A;  4NF5 A;  1FPI A;  5CBR A;  2I4C A;  3TYH A;  2F6G A;  3RLF E;  4DZ1 A;  1B0H A;  2HEU A;  4DCX A;  4P8B A;  5LDZ A;  4NF5 B;  3FD3 A;  2DE3 A;  4NGU A;  4KXP A;  1YPN A;  3EN3 A;  4MX6 A;  2AL5 A;  2AYS A;  4IO4 A;  1RDX A;  3PMW A;  2WKY A;  2DXR A;  5CMC A;  3P7I A;  1D9Q A;  4OVT A;  1QGX A;  4MNC A;  3TQL A;  5ET5 A;  3MW0 A;  2Y7W A;  4OZ9 A;  3MZ9 A;  3U1O A;  4HTG A;  1ATG A;  1B5H A;  1XT8 A;  3FV2 A;  1PB7 A;  2KQZ A;  3CI8 A;  3G3J A;  3KFM A;  3ILU B;  2P3V A;  3UA8 A;  2F36 A;  3U72 A;  5I2K B;  4QFN A;  1SQY A;  3ECR A;  5AA4 A;  3UIF A;  3SES A;  3MVX A;  2H25 A;  2NVU B;  3E79 A;  1IXC A;  1LAF E;  4LVQ A;  1FTL A;  1NUW A;  5AA4 B;  1LAX A;  5EYH A;  1S50 A;  1SD3 A;  3TTK A;  1URG A;  4UAB A;  2H4I A;  4MAG A;  3GBB A;  5ITO A;  3T66 A;  4OEN A;  4MLQ A;  4UAC A;  2PT2 A;  3K6U A;  1O64 A;  5ET8 A;  3OSR A;  2THI A;  1BIY A;  4H65 A;  2QRY A;  4ZEC A;  5TU0 A;  1B5I A;  3MP1 A;  3C31 A;  4OFO A;  3IB2 A;  1R1N A;  4MF3 A;  1A8E A;  3N26 A;  4OVJ A;  3FVG A;  2RC9 A;  4L17 A;  2YLN A;  4R9F A;  2H98 A;  4I62 A;  1MS7 A;  1BK4 A;  4RPN A;  3OMB A;  4YKJ A;  3ILT B;  4TQU Q;  4PF6 A;  1NMU A;  1OQG A;  2NWJ A;  4IO7 A;  4OER A;  4GWX A;  1M5D A;  4LN5 A;  2OWZ A;  2H99 A;  1SW2 A;  1B5J A;  3KN8 A;  4TOZ A;  4LAT A;  2OX3 A;  1MQH A;  4PFY A;  2ZYM A;  4JDF A;  1B40 A;  4NTL A;  4ZE9 A;  3B6W A;  1FPD A;  2VHA A;  4GL8 A;  1H43 A;  3FV1 A;  4H8J A;  2G93 A;  3PTY A;  4LP2 B;  1Y4C A;  3DM0 A;  4G2Z A;  4I9D A;  4GF8 A;  2XX7 A;  4IO3 A;  2HCA A;  5FHN A;  4UA8 A;  4KCD A;  1XC1 A;  2Y5K A;  4ESW A;  3H6V A;  3MVZ A;  3N6U A;  1SVX B;  1SPI A;  4BDR A;  1I69 A;  4N13 A;  4OEV A;  3FXB A;  2NOO A;  4NF6 B;  3GXA A;  1K9Z A;  3OEK A;  1Q1K A;  1MM7 A;  3E13 X;  1KA0 A;  2ZZW A;  1Y3P A;  3DP4 A;  1NV0 A;  2XA5 A;  4POX A;  1JP4 A;  2RF1 A;  5ESY A;  3B8B A;  1G0H A;  3PV0 E;  3U93 A;  4NF0 A;  2FYI A;  1A40 A;  4GLI A;  2DQV A;  3RYD A;  2Q88 A;  1OLC A;  4G8M A;  3MPK A;  2PFY A;  1LCT A;  4RJZ A;  3THI A;  1LST A;  3LUZ A;  4GWU A;  4R74 A;  4U4S A;  4F1Y A;  2MKZ A;  2XXR A;  1USY H;  3QAX A;  1USY E;  4G8N A;  1VR5 A;  3OSQ A;  1GGG A;  3BFT A;  1IMA A;  3B6Q A;  3FBP A;  1YAE A;  4GX4 A;  4IGT A;  1JVY A;  3K4U A;  1FBG A;  2I49 A;  4GVO A;  3H6W A;  3G3I A;  3TMG A;  4EXL A;  3IOU A;  1S9T A;  5ET7 A;  4ZZE A;  2I6E A;  2V3T A;  5AA1 A;  2ZYK A;  2B4L A;  2GHB A;  3QMF A;  1Y20 A;  4ZED A;  3IAZ A;  1FBP A;  1IIT A;  4HCY A;  3VVE A;  5CM6 A;  2QS4 A;  1OVT A;  2DWA A;  3RT6 B;  1SW5 A;  4X48 A;  2WYK A;  3K1N A;  5DT6 A;  3KC0 A;  4WED A;  1D9Y A;  1MY2 A;  3H4Z A;  3TTL A;  1NV7 A;  4ZEB A;  1AWB A;  4P11 A;  4NAP A;  1XVX A;  4FEB A;  1MXV A;  1NV6 A;  2REJ A;  1ZMG A;  3LBS A;  4IO5 A;  2QVU A;  1FSA A;  3N6T A;  5EHS A;  5I57 A;  1NNP A;  4MHF A;  4O3B A;  4EQ9 A;  4GWO A;  2DWH A;  1EZO A;  5FBP A;  4BLA A;  2PT1 A;  1BP5 A;  4NE4 A;  3S9M C;  1MDQ A;  2XD2 A;  3VLV A;  5K2Y A;  4ND9 A;  4KYE A;  4XKR A;  3OXN A;  4F22 A;  5FHO A;  1QKB A;  1I6Q A;  2NXO A;  3NOH A;  4XIG Q;  3PPP A;  3PUV E;  3A09 A;  2DS9 A;  4G68 C;  2V4C A;  1RDY A;  2UVI A;  3T22 A;  4MLV A;  5I56 A;  4MH5 A;  3MPL A;  3BBR A;  1QJM A;  2ANJ A;  1OIB A;  2BJI A;  4ELR A;  4NF4 B;  5I56 B;  3SZP A;  4ISU A;  3D4G A;  5HPQ A;  4IY6 A;  3S4U A;  1LEV A;  1Y3Q A;  2QPQ A;  1SYH A;  2ONS A;  4N15 A;  1LBB A;  4GX6 A;  4DDD A;  3KBZ A;  2QVV A;  1QVS A;  5A5L A;  2JJK A;  1MY3 A;  2R9J A;  2F6P A;  4F2Q A;  3RPW A;  2Y5L A;  1M5B A;  1LLS A;  1RYX A;  2UXA A;  4AB6 A;  1CB6 A;  4PC9 A;  1ZBM A;  3RPL B;  1MG1 A;  4OMB A;  1B1H A;  1US4 A;  1VFD A;  1HSE A;  5L9S A;  3FIR A;  4QHQ A;  1Z7N E;  3G7W A;  1QW0 A;  4N6D A;  5EQA A;  2OJT A;  4JWO A;  3K6W A;  1SBP A;  4FAT A;  4YKP A;  2GFE A;  2Q8M A;  5I59 A;  1XHY A;  2ONK E;  3SEY A;  3LV0 A;  5TPA A;  3IOV A;  3PUZ E;  5DEX B;  2O51 A;  4JVC A;  1IXI A;  2NUV A;  4U21 A;  2Z22 A;  2Y7I A;  4F1V A;  2HAV A;  4OES A;  5TPA B;  3WAE A;  1JNF A;  3U92 A;  2A5T B;  2FNC A;  4Q5T A;  2V93 A;  5DTB A;  2V3U A;  1MQG A;  4N07 A;  3RGY A;  1CNQ A;  4ELQ A;  3I6V A;  3TKD A;  3FJG A;  2F5X A;  2F8D A;  3V5A A;  1TFD A;  3CRB A;  4N8G A;  1O63 A;  4ZE8 A;  1MDP 1;  3W9V A;  3QXM A;  3RN8 A;  1IEJ A;  5EQ8 A;  4EF2 A;  2UYF A;  4OVQ A;  2XD3 A;  3MZ1 A;  4F3G A;  2XXK A;  5H8Q A;  1INP A;  5AA3 A;  2F7A A;  1MXX A;  5DVI A;  2OWS A;  1LBX A;  3BIG A;  4XFE A;  4EQB A;  5AE4 A;  1DTG A;  1B3E A;  1FTJ A;  4YB7 A;  5IM2 A;  4PFR A;  3SEU A;  3PPN A;  1BKA A;  2ALU A;  2Q2A A;  2L5V A;  2GQ1 A;  3PUW E;  2YPN A;  1JVX A;  1RDZ A;  4PDD A;  2P3N A;  3UP9 A;  5DYH A;  3O29 A;  1UTH A;  1OVB A;  2R8T A;  2I0C A;  2FIE A;  3KZG A;  2O69 A;  3Q26 A;  3T93 B;  3SDF A;  1FJ6 A;  4O7M A;  4IR8 A;  1LBC A;  1LAG E;  3N94 A;  2B4M A;  5IAI A;  1UTH B;  4P1L A;  4QBA A;  3AXF A;  3FZV A;  1MQI A;  4RK2 A;  4ELP A;  4EUO A;  2VP1 A;  4NMY A;  1JW1 A;  4WEP A;  3PUX E;  2DVC A;  5J1D A;  4DI4 B;  4Z0I A;  2O1M A;  4N6P A;  1P99 A;  2O6A A;  5ET6 A;  1P1N A;  4JXI A;  2DWI A;  1DCU A;  3PD9 A;  3S9L C;  3PU5 A;  3PPQ A;  3CFZ A;  5LTC A;  4MNP A;  1JW5 A;  3EKI A;  1IXH A;  3QYT A;  2BJJ X;  4U23 A;  2PVU A;  3OOA A;  4N4U A;  1IMF A;  1MY1 A;  5CI5 A;  2UVH A;  5I2K A;  1GV8 A;  1EZP A;  2ZNS A;  2XX9 A;  2P2A A;  4JBZ A;  1NI9 A;  4FE8 A;  4H5F A;  1N76 A;  4XKN A;  4GRK A;  1ELJ A;  2QL3 A;  3DP8 A;  3JV9 A;  4YU0 A;  3QIM A;  2XX8 A;  3U65 A;  4LZ5 A;  4JSO A;  2XWV A;  3VDF A;  1WDN A;  1XI6 A;  5H8N A;  2ZYN A;  3K01 A;  3MBP A;  3SER A;  3OO8 A;  4KCC A;  5H8H A;  4RY1 A;  1D9V A;  5H8N B;  2M8C A;  4KYD A;  5LOM A;  1OLA A;  1URS A;  5JTY A;  5H8H B;  3SEV A;  1YCJ A;  1OMP A;  4KYS A;  3HHF A;  4QSC A;  2PMS A;  4HS7 A;  1JEU A;  5JTY B;  4LUB A;  5EYG A;  1FBD A;  1B58 A;  1BTJ A;  3IOR A;  1N3W A;  3CG1 A;  2REG A;  4JB7 A;  2DDK A;  3MQ9 A;  1JW4 A;  1M5C A;  4QSE A;  1NV2 A;  3FXQ A;  4N8Y A;  3TDJ A;  2FIX A;  4PAI A;  2XHD A;  4RK9 A;  1DTZ A;  3V89 B;  1LFI A;  3ZKK A;  1PDA A;  3K1M A;  1DSN A;  4PE5 B;  1B3H A;  1NL5 A;  5I5P A;  3CSG A;  3T9X B;  2F34 A;  1Q35 A;  4PET A;  3RQT A;  4O3C A;  3CSB A;  3MYU A;  1A55 A;  3OEN A;  4DCY A;  1NNF A;  1XS5 A;  5EQ9 A;  4FEC A;  1P1W A;  4G4P A;  2DVZ A;  1SYI A;  2ONR A;  4GWS A;  3IK6 B;  2B65 A;  3MVY A;  1VFE A;  4OFJ A;  1KZ8 A;  3CFX A;  3OO9 A;  1DPP A;  2Y7R A;  3A3C A;  3FGS A;  3T9V A;  1P1Q A;  3KBR A;  1AIV A;  4MFI A;  3IOW A;  5IGA A;  4FOR A;  3T9U A;  3M3K A;  4NF6 A;  4G8H A;  2X7P A;  4R2F A;  4O7I A;  2PFZ A;  3USD A;  1FJ9 A;  4FED A;  4GWZ A;  4G61 A;  5JK4 A;  1FPF A;  4G68 B;  3BIH A;  4ECF A;  4THI A;  4PP0 A;  2Z23 A;  1MXY A;  3MC2 A;  3K1P A;  2CZH A;  4P56 A;  2Z8F A;  2HZK A;  1EZ9 A;  4KI0 E;  2FHY A;  1K9Y A;  4U4X A;  2O7I A;  4NWD A;  3MP8 A;  4I3E A;  4PCD A;  3HFU A;  4U22 A;  4TLL B;  4NG7 A;  4I1D A;  2R71 A;  1FQE A;  4F19 A;  2F78 A;  3IJO B;  1FBF A;  3KN3 A;  3R6U A;  3C9H A;  4QFK A;  4IO6 A;  1SW4 A;  3A3U A;  5EHM A;  4PDH A;  5EYF A;  2WEF A;  4PAK A;  4XTC Q;  5IZ3 A;  5A5X A;  1JEV A;  4YMA A;  3JYR A;  3QUJ A;  3VV5 A;  1IME A;  1FPK A;  2V84 A;  3ZS6 A;  2W7Y A;  4IY5 A;  5IZ3 B;  5A5X B;  3BKI B;  3UGW A;  1UIV A;  2WX9 A;  3T9H B;  4PF8 A;  3L6G A;  1QUL A;  1P1O A;  5DVJ A;  1MPD A;  2QS1 A;  1TXF A;  2CMO A;  4YIC A;  3EPE A;  4OET A;  1B7H A;  1A8F A;  1FPE A;  4GBW A;  2Y7K A;  1Q9D A;  4LZ8 A;  4PQJ A;  2FVZ A;  5IZZ A;  1MY4 A;  2PX1 A;  3G3K A;  2PCR A;  1FTM A;  2QFL A;  1LGB C;  1MRP A;  4ZZA A;  5CMM A;  1XVY A;  1N04 A;  4ZEK A;  3FJM A;  1M5E A;  2P1S A;  1T0K A;  4M1V A;  1FTK A;  3CR9 A;  4Q8R A;  4PFI A;  5I7I A;  4RA1 A;  4PGP A;  4WKM A;  5I58 A;  1D3K A;  3BFU A;  3HPI A;  5L8D A;  2XWO A;  2DE4 A;  1PBP A;  3PD8 A;  1N7W A;  4XXU A;  1N84 A;  2D21 A;  5L9O A;  4PFU A;  4KHZ E;  5I58 B;  3Q27 A;  4E0W A;  1FTO A;  4JWY A;  3V8X B;  2DWJ A;  2XXY A;  2Y84 A;  3R7X A;  3EHT A;  3IB0 A;  3TTN A;  3PUY E;  1PBQ A;  4YKI A;  1GR2 A;  1LBY A;  3TCF A;  1IZ1 A;  1FCK A;  3ISP A;  4KFQ A;  5AA2 B;  4QSD A;  1NH7 A;  1WOD A;  2PYY A;  3T0J A;  2ABH A;  5ELV A;  1VDW A;  2XXH A;  3DEL B;  4X04 A;  4DIG A;  1BLF A;  2XWI A;  2UVG A;  3TPA A;  2DE2 A;  4PBQ A;  4RPO A;  1MXU A;  5H8S A;  1NNK A;  5H8F B;  4ZEI A;  4NF4 A;  5F1Q A;  2I0B A;  3I3V A;  4IGR A;  2KLF A;  2P0S A;  1AOV A;  4KR5 A;  4GX3 A;  3OO7 A;  2CEY A;  3SKP A;  2UVJ A;  1CE2 A;  1MQD A;  3UN6 A;  1B9J A;  2OWT A;  1NNT A;  4Z7E A;  3FUZ A;  1GVC A;  3LR1 A;  3LSF B;  4H46 A;  3W15 C;  3H6U A;  4QFP A;  1B7U A;  3RPL A;  3HHG A;  1FPB A;  2WBD A;  1RKM A;  1GTK A;  1QKA A;  3LSL A;  2I58 A;  1FPG A;  2CZK A;  3O28 A;  5HBC A;  3H6T A;  4YZZ A;  5CBS A;  1LBW A;  1B52 A;  1FPL A;  2ZXT A;  3KG2 A;  5DEX A;  4OHN A;  4HE2 A;  3W9W A;  1YZ0 A;  4I8C A;  4IO2 A;  4YB5 A;  1URD A;  2D3I A;  2A5T A;  4GBV A;  4BDO A;  4F2O A;  3U94 A;  4F3P A;  2QMX A;  4HE0 A;  3O6I A;  4GXA A;  1H76 A;  1DMB A;  2XXX A;  4LA9 A;  2Q89 A;  4LZ7 A;  4JSD A;  4OEU A;  2VPO A;  3TOD A;  2RCB A;  1LCF A;  2HHM A;  3N5L A;  5IZ1 A;  3DP6 A;  3CVG A;  3EHS A;  2WBB A;  1ZLQ A;  5TP9 A;  2O1L A;  2OK2 A;  1FBC A;  3HN0 A;  5FHM A;  3TTM A;  2VD2 A;  5TP9 B;  4OAN A;  1TFA A;  3MJN A;  3M3L A;  1NKX A;  1MH4 A;  2XXW A;  3K02 A;  4OYV A;  2O84 X;  4DLD A;  5FTH A;  4H67 A; 
#chains in the Genus database with same CATH homology
 1FBH A;  3RYD A;  2PFY A;  4I40 A;  3LUZ A;  4GWU A;  2MKZ A;  4MNI A;  3GYY A;  2Q9T A;  1FTA A;  5EYG A;  1FBD A;  4N81 A;  1NV4 A;  2DDK A;  4NN3 A;  1IMA A;  3FBP A;  1NV1 A;  1NV2 A;  4GX4 A;  4N8Y A;  2FIX A;  1FBG A;  2F3B A;  4PAI A;  2HPG A;  4XEQ A;  5ET7 A;  4GWY A;  5I5P A;  4FBP A;  4N91 A;  2WYP A;  1DBZ A;  5I3S A;  2B4L A;  4PET A;  2VPN A;  3IFA A;  3QMF A;  3MYU A;  4AS5 A;  4N17 A;  1FBP A;  4OVP A;  4HCY A;  5EQ9 A;  5CM6 A;  1NUZ A;  2Q74 A;  2CEX A;  2DVZ A;  1IMC A;  3CHG A;  1NV5 A;  2WYK A;  4GWS A;  1EYI A;  3KC0 A;  2CZI A;  1KZ8 A;  1FRP A;  2HXR A;  5T3J A;  4N6K A;  1NV7 A;  3B50 A;  1EYK A;  1AWB A;  4NAP A;  2KR0 A;  4JVI A;  1NV6 A;  5IGA A;  2QVU A;  1FSA A;  4X9T A;  4MHF A;  2PFZ A;  4O7I A;  1FJ9 A;  4GWZ A;  4G61 A;  4X8R A;  4MJO A;  4HE1 A;  5JK4 A;  4MMP A;  1FPF A;  5FBP A;  1G0I A;  3BIH A;  4O8M A;  4AS4 A;  2CZH A;  4P56 A;  4P3L A;  2HZK A;  2FHY A;  1K9Y A;  4I3E A;  2HZL A;  4PCD A;  4F18 A;  3HFU A;  4NG7 A;  1YXI A;  4F19 A;  4O94 A;  1FBF A;  3NOH A;  3E78 A;  2V4C A;  1RDY A;  4PDH A;  2FBP A;  1YYZ A;  1IMB A;  2WEF A;  4PAK A;  4P1E A;  5IZ3 A;  4HXV A;  5DW8 A;  2BJI A;  1IME A;  1FPK A;  2F3D A;  5IZ3 B;  3SZP A;  1LEV A;  4XF5 A;  2WX9 A;  4PF8 A;  2QPQ A;  4N15 A;  4PBH A;  4GX6 A;  3KBZ A;  4YIC A;  2QVV A;  1EYJ A;  3D1R A;  4NX1 A;  1FPE A;  4GBW A;  5A5L A;  2JJK A;  1Q9D A;  1NUX A;  2FVZ A;  2Y5L A;  5IZZ A;  1FPI A;  4OVR A;  2XWK A;  2PCR A;  2QFL A;  4PC9 A;  3RPL B;  4P8B A;  5LDZ A;  2DE3 A;  4NGU A;  4KXP A;  4M1V A;  4MX6 A;  4PFI A;  5I7I A;  4PGP A;  4N6D A;  5EQA A;  1NUY A;  1RDX A;  2XWO A;  2DE4 A;  3ROJ A;  2Q8M A;  4GWW A;  1IMD A;  3LV0 A;  1D9Q A;  4JVC A;  4OVT A;  1QGX A;  4MNC A;  5ET5 A;  3IFC A;  3A29 A;  4F1V A;  4PFB A;  2KQZ A;  1LBY A;  1LBV A;  2P3V A;  3ISP A;  3MST A;  1CNQ A;  4H45 A;  3T0J A;  1VDW A;  2F5X A;  4DI3 D;  4X04 A;  4F1U A;  4PTK A;  2XWI A;  4N8G A;  2ZZV A;  1FBE A;  2DE2 A;  4PBQ A;  3E79 A;  3W9V A;  1NUW A;  5EYH A;  4I3Y A;  5EQ8 A;  4OVQ A;  4UAB A;  4MAG A;  1DK4 A;  4PAF A;  2XXK A;  3KC1 A;  4GX3 A;  1INP A;  2CEY A;  5ET8 A;  1KA1 A;  1LBX A;  3BIG A;  4XFE A;  1NV3 A;  4NQ8 A;  4NHB A;  5IM2 A;  4PFR A;  4H46 A;  2L5V A;  2GQ1 A;  2VT5 A;  1RDZ A;  4PDD A;  3RPL A;  2P3N A;  2R8T A;  2FIE A;  1FPB A;  1FJ6 A;  4O7M A;  4IR8 A;  2WBD A;  5EQ7 A;  1BK4 A;  4MCO A;  2B4M A;  1FPG A;  2CZK A;  4OA4 A;  4P1L A;  4PF6 A;  4QBA A;  4YZZ A;  1LBW A;  4GWX A;  4LN5 A;  2OWZ A;  4MIJ A;  2ZZX A;  4QXD A;  1FPL A;  4DI4 B;  5J1D A;  4HCW A;  2OX3 A;  5ET6 A;  4HE2 A;  4PE3 A;  5J16 A;  1DCU A;  3W9W A;  1YZ0 A;  5F24 A;  5LTC A;  1FPD A;  4MNP A;  3EKI A;  1LBZ A;  2QVR A;  4P47 A;  4N4U A;  3T1B A;  1IMF A;  3PTY A;  4P9K A;  4GBV A;  2V3Q A;  4HE0 A;  2Y5K A;  2VPO A;  1SPI A;  1NI9 A;  4JVD A;  2HHM A;  3FXB A;  5IZ1 A;  1K9Z A;  2WBB A;  4MEV A;  1KA0 A;  1FPJ A;  2ZZW A;  4OVS A;  1NV0 A;  1FBC A;  2XA5 A;  3U65 A;  1JP4 A;  2XWV A;  5ESY A;  4PGN A;  1XI6 A;  3B8B A;  1G0H A;  4OAN A;  4NF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...