1NMUA

Mbp-l30
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
368
structure length
368
Chain Sequence
EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose-binding periplasmic protein
publication title Inherent Protein Structural Flexibility at the RNA-binding Interface of L30e
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein/ribosome
total genus 122
structure length 368
sequence length 368
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nmuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nmuA01
3U92A 1LLSA 3H06B 3FGSA 2OZZA 1GR2A 3PU5A 4FIMA 3VE1B 3IO4A 3MC2A 1ZLQA 3ECRA 2YJPA 2V84A 2H5YA 3BKIB 1QW0A 1USYE 4NWCA 3LSWA 3Q29A 1D3KA 3IOWA 4MFIA 1DTGA 3Q27A 3VDFA 2H25A 4H65A 2HQ0A 4YICA 2XXIA 1VFEA 3HSTA 3B7DA 3SEYA 2X26A 1AOVA 4YB5A 1SI0A 1JETA 2RC7A 3MP6A 1XVXA 1B4HA 2F36A 3HO7A 5CMBA 1DOTA 4KCDA 1WODA 4R6KA 2D21A 2DWAA 3FASA 4R9GA 2R71A 4KD5A 1M5FA 3N94A 4BDNA 1FTOA 1POTA 4KCCA 5JTYA 1I6AA 3GBAA 3H6VA 3ILTB 4QFLA 1US4A 4JWXA 5ELVA 1Z7NE 3O66A 1FQEA 3ZKKA 3KJTA 4RNSA 3KGCA 5H8NA 2XD3A 4PFWA 1XT8A 3EF7A 4JBZA 1LAHE 1D4NA 1L5TA 3RGYA 4YKJA 3FXUA 2QS2A 2I58A 3H03A 2OWSA 3PV0E 1Y1ZA 1PEBA 2HAVA 4KFQA 4MF3A 1MM6A 3SETA 1IITA 1PBPA 3T96B 4AB5A 5DEXB 5EHMA 4U23A 2BJJX 2H99A 4RJZA 4RK2A 3Q25A 5FHNA 1US5A 3DM0A 2QMWA 4FEBA 2O51A 4POWA 4G8NA 3P7IA 1JQFA 3LUYA 3HN0A 1UTBA 5A5XB 3DP4A 2O1LA 4QFOA 2NWJA 4AQ4A 4DCYA 1MXUA 4F29A 3TTLA 4GLIA 2QPQA 4NE4A 4EF2A 1DMBA 4NTLA 1LAXA 2V3QA 4HTGA 1UTHB 4XXUA 2Z8EA 3IO6A 3HHGA 1SYIA 1NNPA 2I48A 1LGBC 5H8FA 2DWIA 1IXCA 1LAGE 1P1WA 3SEWA 1B5JA 5H8QB 2UXAA 4ZEBA 5I56B 4RYAA 4IO6A 1UTBB 3G3KA 3WAEA 1P1NA 5TP9A 3PMWA 1FQDA 5KCJA 3HV1A 1A8EA 3TELA 1B5HA 2XX7A 3B6WA 4IO5A 4THIA 2F7CA 2Y7PA 2XXWA 2O84X 4H8JA 3IK6B 4YU0A 1PB7A 1B32A 4ELPA 3W15C 4EDPA 1MY3A 3PUZE 4QRZA 4FATA 1N3XA 4XKPA 2RCBA 1DSNA 2R9JA 4X1BA 3PPPA 5H8FB 2ALUA 4F2QA 1Z7ME 2W7YA 3FJGA 5J1DA 2HEUA 3C31A 4EQ9A 1Y20A 3HHFA 3PPNA 1A8FA 1P99A 1LBBA 5I2KA 2CZLA 1B0LA 2VHAA 4GOTA 3DP6A 3PPQA 4DCXA 3EN3A 3THIA 1Y4CA 4KI0E 2RF1A 4LUBA 3TKDA 4BDQA 2P2AA 4N13A 4NF4A 3CFLA 2O7IA 1XHYA 1HSJA 4F1VA 4R73A 2PT2A 4EQBA 4KYSA 4N07A 2HCAA 3V83A 3LC8A 3M3LA 3FV2A 3FVNA 5I58A 5I59B 1B40A 3LBSA 5CMMA 3K6XA 5IAIA 3MJNA 3PGFA 1MPCA 4DXCA 1SW5A 5HPQA 2NXOA 4JDFA 3I6VA 3VVDA 3U8QA 4O3BA 1B58A 3HCQA 4HCYA 1IXHA 4OHNA 2P0SA 1B1XA 1MRPA 1MPDA 4GVOA 4YB7A 1MQIA 3C4MA 5HBCA 2E1SA 4G8HA 1B3GA 4DDDA 5KDTA 3KFMA 1MM7A 1MG1A 1CE2A 4PETA 5I2NB 3M8UA 3OO9A 4NWDA 3QYTA 3M3KA 2PYYA 2XXUA 3BFTA 3MVXA 2QS4A 5I58B 3CVGA 3K00A 4HS7A 2G93A 1ELJA 2DWJA 2DYXA 3OENA 2B65A 2GH9A 1I69A 4OXVA 1TFAA 3LSLA 3IX1A 2OLBA 3MW0A 1JVXA 1QJMA 3CR9A 2V93A 2VOZA 1QKBA 4ZE9A 3TPAA 2UVIA 4IY6A 1SVXB 2RKMA 1MY2A 5TPAA 2Y7KA 1SW4A 4KHZE 3VLUA 3Q26A 4GWOA 1XOCA 3EQ1A 3FIRA 4TLMB 1VFDA 3KEIA 2QL3A 5AA2D 4OWDA 3K0VA 3RQTA 2NOOA 3TMGA 1NNFA 4RA1A 2HFBA 3O2AA 3FJ7A 2RINA 4F31B 3K6VA 1SDXA 5HM4B 2Q89A 4WEPA 1ZTYA 3ODBA 3JV9A 3QK6A 3N26A 4OFLA 3FXQA 2GRVA 3TAJA 3S9LC 5ICTA 1MQJA 4G68B 4FECA 2D5WA 2F34A 4X1DA 4QSEA 1A99A 4IO2A 4PFYA 3UK4A 4GF8A 1M5DA 1YTVA 3V8XB 5TPAB 4C0RA 5KZTA 2UVJA 2F8DA 4GXSB 3U1OA 4F39A 4QFNA 4NMYA 3RLFE 4RPOA 3V89B 4QHQA 5AA1A 4G4PA 2I49A 3K2DA 3VXCA 4C1TA 1MQDA 4ZE8A 1HSEA 3U94A 2CMOA 3KN8A 1Q1KA 1H45A 3EHTA 5EHSA 3MVWA 1GV8A 2IEEA 3QUJA 2Y84A 3MZ1A 3RT8A 2QRYA 1I6BA 3IJXB 5ITOA 3OD7A 4ELQA 5B7DA 5H8SA 3OSQA 1R1NA 1MDQA 3GZGA 1B3EA 2XXPA 1QUKA 3B6TA 2OBGA 3CFXA 4ZS9A 1ZU0A 1LAFE 4AB6A 3EPEA 3O6IA 1AH5A 2PT1A 3KOSA 3FVOA 5TU0A 1NL5A 3FZVA 4G77A 4WXJA 3MUQA 1PC3A 1R6ZA 1S7YA 2Z22A 1MXYA 3OEMA 4OFOA 1WDNA 4ZEIA 3K1PA 4ZDMA 1H3DA 4RY1A 1LSTA 3CG3A 3E4RA 3OEKA 3JYRA 2QS3A 5JTYB 3HPIA 3L6HA 4JSDA 3VVEA 4JSOA 4LP2B 3VVFA 3O29A 4OEUA 3KN7A 4BDOA 3T9VA 3K1MA 4ESWA 1BIYA 2VD3A 5BUUA 2Q2AA 3OXNA 4WEDA 3OO7A 2O1MA 1Y3QA 3U93A 1QKAA 5H8NB 4UA8A 4Z0IA 4YB6A 1O63A 3ZS6A 1FTKA 4Q5TA 2I4CA 1MS7A 1DPPA 1B46A 4MLQA 4ECFA 5ICQA 1B3LA 3VFJA 2REJA 1NKXA 2UYFA 1SW1A 2LAOA 2WKYA 2IA4A 4U4SA 1P1UA 3ZKLA 4R9FA 3BFUA 3H6UA 3TCHA 1NNKA 2XXQA 1WVJA 1RYXA 5AA4A 1ZMGA 4U1OA 2A5SA 2O68A 1D9VA 3MZBA 4U2RA 3WAFA 4NF6A 4GRKA 3IOUA 4XKNA 1MXXA 3USDA 2ONKE 3MP8A 4OZ9A 4R72A 2F35A 4GD5A 5AE4A 1PB8A 2FYIA 3IOTA 4R75A 4H0WA 4LQ2A 1P1OA 3MPLA 1BP5A 1MH3A 1B52A 2DE3A 1POY1 3MPKA 1M5EA 1OVBA 1KWHA 2HZLA 2XXTA 4IB2A 4NF8A 3C9HA 3RPWA 3OO8A 4GQOA 4R2BA 2I3WA 3CSGA 4GXAA 5DTBA 1MXVA 1Y3PA 3VXBA 5CM6A 3OMBA 4BDLA 4YMAA 1N84A 2VP1A 2A5TA 5I57A 4NF6B 2ZMBA 2I0CA 1AMFA 4LVQA 4ONYA 3S9MC 4Q8RA 1OQGA 1IZ1A 2DE2A 3UP9A 5FHMA 4RPNA 1SYHA 2DE4A 3MVZA 2Q2CA 4R74A 3IOVA 4KR5A 5CMKA 2DWHA 3MAMA 4QFKA 5TP9B 4ZZAA 3L6GA 5KCJB 1VR5A 3RY3A 4F3BA 1S9TA 3C34A 3A3UA 1MDP1 1N76A 2DXRA 4OEVA 4OENA 1B3HA 4KYDA 4NF8B 4F3SA 4O3CA 2ZYMA 4G8MA 1B05A 1SI1A 3IORA 1DPEA 4C1UA 2A5TB 1B7UA 4M4GA 1LBCA 2O6AA 3G7WA 4ZEFA 4PFUA 3TTNA 4F22A 4NEDA 3I3VA 4P0IA 1ZKBA 1MXWA 3UN6A 4H5FA 3FJMA 3R26A 3M3FA 4ZECA 5I2KB 2DSFA 4JB7A 2M8CA 3TQWA 5FHOA 5ISUA 1FTLA 2VD2A 4OMBA 3I5OA 4H8IA 3N5LA 3KN3A 3VV5A 2XXVA 1LFIA 2YLNA 4JWOA 2DXYA 2ZYOA 1XS5A 2B3BA 3QAXA 4NF4B 3KOTA 5JK4A 1ZIUA 4F2OA 2E0SA 4FEDA 3UORA 1MQGA 1HSLA 3FV1A 1LCFA 3G3HA 4OFJA 2Q9TA 1JW5A 3DELB 4OTEA 3RNNA 5LOMA 2XXHA 2F7AA 3ONMA 3TYHA 1J1NA 4FORA 3SEXA 1Y4TA 3K02A 1RKMA 1UQWA 1H44A 1IUDA 3SKPA 1YAEA 2HXWA 3RTWB 4TOZA 5CRYA 2DP8A 1B7HA 4UACA 3MBPA 2B3FA 2X7PA 3SDFA 2I6EA 4P11A 1I6QA 3T9XB 5KDTB 2KLFA 3SERA 3MVYA 1UIUA 3Q28A 4LA9A 2DQVA 3UGWA 2H98A 5ITPA 1NMUA 3C36A 3LSXA 3PUVE 1OMPA 4F18A 1A55A 2V25A 4LZ5A 4U22A 4ND9A 2AIXA 3OO6A 4DXUA 3UA8A 5I84A 3TTRA 4BDMA 1NFTA 1EZPA 2H9BA 2GFEA 2PVUA 4LZ8A 1MQHA 1QVSA 4TLLB 1VE4A 5AA3A 2F97A 1A54A 1S50A 3TDJA 3H4ZA 4KQPA 4H67A 4ZEDA 3O6HA 3CIJA 3RT6B 2XHDA 5L9SA 3KG2A 3EHUA 1Y3NA 2QJEA 2ANJA 1CB6A 4QF9A 2NUVA 1B1HA 3K6WA 3H3GA 4R6YA 5DT6A 3KBRA 4U21A 4FAJA 2G29A 2ZNTA 1FTMA 1F9BA 4FE8A 3T93B 2X7QA 1MY1A 2AL5A 1SW2A 5L8DA 4TQUQ 2FA7A 2QMXA 1AIVA 5M2VA 3ZSFA 5DYHA 1N04A 5K2YA 3TTMA 4O3AA 1FQBA 2Y7RA 3RUMA 3A3CA 4GFRA 4H1XA 1QULA 2GHAA 4HCWA 3E13X 3K4UA 1Q35A 3G3IA 3RTFB 3PPRA 4XIGQ 4DZ1A 2ONRA 1JVYA 4OETA 1JEUA 4QSDA 1NH7A 4EQ7A 3W9VA 1ZJLA 3IJOB 2Y7WA 1GVCA 3H6TA 3LSFB 1MXZA 4EXLA 1NNTA 4YKIA 3VLVA 1FW0A 3OELA 3TFLA 1XVYA 4EXKA 3W9WA 1N7XA 3TQLA 1H76A 1OLAA 3QIMA 4WKMA 2I0BA 1B0HA 5FTIA 4H5GA 5IKBA 1BKAA 1B7ZA 3H7MA 1ANFA 4QSCA 4Z7EA 4JXIA 4P0GA 4RXLA 4F1YA 3ILUB 4IGTA 2Q8JA 3LR1A 1UIVA 1SBPA 1P1QA 2Z8DA 4LZ7A 3KSXA 4FJPA 3F11A 1URDA 3C32A 3PD9A 1PDAA 3GXAA 4G68C 3GBBA 2RCAA 1MH4A 1IXGA 2ZXTA 1TWYA 3PUXE 5DEXA 4M1VA 1LB9A 1LB8A 3TCFA 4JWYA 1URGA 3CRBA 5CMCA 1EU8A 4MH5A 4H6DA 1IXIA 3UIFA 5DVFA 3U72A 4F3GA 5A5XA 3N6TA 2DVCA 1GTKA 1OLCA 3TODA 2VGQA 1IEJA 2ESNA 1IQ7A 4ELOA 3FATA 4R6HA 5CBSA 1N0TA 1GGGA 1II5A 1O7TA 3IB1A 2XXXA 4N6PA 1UTHA 4GL0A 1OVTA 3PMVA 2P1SA 2I4BA 4IO3A 4XKQA 5CBRA 2HZKA 3DLNA 4PE5B 4OESA 3GLBA 1ZBMA 1N7WA 1QUIA 1PB9A 3OOAA 5H8QA 5I56A 3V5AA 2DS9A 3CSBA 4R2FA 1URSA 2F5XA 3TZAA 2OWTA 4BDRA 1OQHA 1YPNA 3D4GA 1YCJA 3PMXA 3IL1B 4HW8A 3MQ9A 1A7LA 4EUOA 2RC9A 4IO4A 3O28A 4U1ZA 4YZZA 5K2XA 3R7XA 3MZ9A 1DTZA 1AL3A 3D4CA 3O6GA 3S2VA 3SESA 4DXBA 1QUJA 2D3IA 1O64A 4I8CA 2UVGA 4PFTA 2UVHA 3S4UA 1BTJA 4KYEA 3T66A 3RN8A 4L17A 5AA2A 3KZGA 2ONSA 4BLAA 5AA4B 3T9UA 3TTKA 4QFPA 3QSLA 1BLFA 5L9OA 3N6UA 4XKRA 5F1QA 2THIA 2XXYA 3G3FA 1B3FA 1A40A 1OIBA 3T9HB 3JZJA 3IAZA 5L9MA 4GL8A 5DVIA 1EZ9A 1JNFA 3A09A 2PMSA 2V3UA 4MLVA 4F19A 1JEVA 5CI5A 3E3KA 5JEIA 1SQYA 3PPOA 5I59A 1TFDA 5B70A 2V3TA 3KSJA 4OYVA 2ZNUA 3K6UA 2O69A 5AA2B 3TUSA 4PP0A 4K3FA 4PQJA 4G2ZA 4F3PA 1FCKA 4YKKA 3IB0A 1B4ZA 1XC1A 5I57B 3FVGA 4LONB 2XX9A 3S9NC 3R6UA 3QXMA 4E0WA 3CG1A 3MWBA 3PUWE 4IO7A 2REGA 2DVZA 4KPTA 4POXA 2F6GA 3C35A 3T22A 2F6PA 3IR1A 1FQAA 1B51A 4E0XA 1USYH 4LATA 5I2NA 1H43A 1TXFA 3QUFA 2PX1A 4YMBA 1M5BA 3PUYE 1LCTA 1Y1MA 3B6QA 4IY5A 3FD3A 2QS1A 4XTCQ 1SD3A 5F7VA 4GIZA 2RC8A 1N3WA 3TCGA 1LFGA 3K1NA 1IIWA 2OK2A 5EYFA 4DE8A 3PD8A 4NF5A 2H4IA 3H6WA 3BBRA 1FTJA 1B6HA 1M5CA 3G3JA 3CFZA 1R9LA 2HAUA 2R6GE 1D9YA 2ZNSA 2Q88A 1EH3A 2GHBA 4OERA 1EZOA 3K01A 1FQCA 2AL4A 4LQ5A 4ESXA 4X48A 4U4XA 4RK9A 1TT1A 1MY4A 3SEUA 2AYSA 3TEPA 1FQFA 3C33A 4YKPA 5DVJA 3FUZA 1ATGA 2YPNA 3AXFA 2FNCA 1NH8A 4DIGA 1MPBA 4ZEKA 2ZYNA 3DP8A 3FVKA 5H8HA 4NF5B 3EHSA 3S9EA 2XD2A 4OVJA 4OQOA 4G68A 1LFHA 2DOJA 2XX8A 3CI8A 4DLDA 4Q0CA 2QSXA 3OSRA 4IGRA 2ABHA 2UYEA 3E9XA 4I9DA 4YAHX 2F78A 4ISUA 2XXRA 3FXRA 2Z23A 1PBQA 3VLWA 1B9JA 4I62A 4ELRA 5BWJA 3O9PA 3G3GA 4ZZEA 4F1UA 3IB2A 2NVUB 3KJ7A 2OJTA 4I1DA 4X9TA 1Y9UA 1T0KA 1MY0A 2Z8FA 2F7BA 4EF1A 4MBPA 3MP1A 2PBWA 1VSOA 3SEVA 1B2HA 1JW1A 5CC2A 2I3VA 2ZYKA 3O97A 5H8HB 5FTHA 1B5IA 1JW4A 2OCUA 1R9QA 2Y7IA 4Q30B 1RYOA 2O7UA
chains in the Genus database with same CATH superfamily
3U92A 1LLSA 3H06B 3FGSA 1YXIA 2OZZA 1GR2A 3PU5A 4FIMA 3VE1B 3IO4A 3MC2A 1ZLQA 2HXRA 3ECRA 2YJPA 2V84A 2H5YA 3BKIB 1LEVA 1QW0A 1USYE 4NWCA 3LSWA 3Q29A 1D3KA 1NUYA 3IOWA 4MFIA 4NAPA 1DTGA 3Q27A 3VDFA 4MJOA 2H25A 4H65A 4PAKA 2HQ0A 4YICA 3GYYA 2XXIA 1JP4A 1VFEA 4PDDA 3HSTA 3B7DA 3SEYA 2X26A 4OVSA 1AOVA 2FIXA 4YB5A 2WYKA 1SPIA 1SI0A 2PFZA 1JETA 2RC7A 1NV3A 3MP6A 1XVXA 1FPBA 4GX3A 1B4HA 2F36A 3HO7A 5CMBA 1DOTA 4KCDA 1WODA 4R6KA 2D21A 2DWAA 3FASA 4R9GA 4PC9A 2ZZWA 2R71A 4KD5A 1M5FA 3N94A 4BDNA 1FTOA 1POTA 4KCCA 5JTYA 1I6AA 5FBPA 3GBAA 3H6VA 3ILTB 4QFLA 1US4A 4XEQA 4JWXA 5ELVA 1Z7NE 1FBCA 3O66A 1FQEA 3ZKKA 1G0IA 4PAIA 3KJTA 4RNSA 3KGCA 5H8NA 2XD3A 4PFWA 1XT8A 3EF7A 4JBZA 4P47A 1LAHE 5IGAA 1FBDA 1D4NA 1L5TA 3RGYA 4YKJA 5J16A 4LN5A 4NG7A 3FXUA 2QS2A 1QGXA 2I58A 3H03A 2OWSA 3PV0E 1Y1ZA 1PEBA 2HAVA 4KFQA 4MF3A 1MM6A 4IR8A 4PAFA 3SETA 1IITA 1PBPA 3T96B 4AB5A 5DW8A 5DEXB 5EHMA 4U23A 1FPLA 2BJJX 2H99A 4RJZA 4RK2A 2OWZA 3Q25A 5FHNA 2FIEA 1US5A 3DM0A 5EYHA 2QMWA 4FEBA 5IZZA 2O51A 4POWA 4G8NA 3P7IA 1JQFA 3LUYA 3HN0A 1UTBA 1BK4A 3DP4A 5A5XB 3MSTA 2O1LA 4QFOA 2NWJA 4AQ4A 4DCYA 1MXUA 4F29A 3TTLA 4GLIA 2QPQA 4I3EA 4NE4A 4X8RA 4EF2A 1DMBA 4NTLA 4AS5A 1LAXA 2V3QA 4HTGA 1UTHB 4XXUA 1FPEA 2Z8EA 3BIGA 3IO6A 3HHGA 1SYIA 1NNPA 2I48A 1NV4A 4JVDA 1LGBC 5H8FA 2DWIA 1IXCA 1LBVA 1LAGE 1P1WA 3SEWA 1B5JA 5H8QB 2UXAA 4ZEBA 5I56B 4RYAA 3QMFA 3KBZA 4IO6A 1UTBB 3G3KA 4QXDA 3WAEA 1P1NA 5TP9A 3PMWA 1FQDA 5KCJA 3HV1A 1A8EA 1FJ6A 4P9KA 3RYDA 3TELA 1B5HA 2XX7A 3B6WA 4NHBA 4IO5A 4THIA 4O7IA 2F7CA 2Y7PA 2XXWA 2O84X 4H8JA 3IK6B 4YU0A 1PB7A 1B32A 4ELPA 3W15C 4EDPA 1MY3A 3PUZE 4QRZA 1CNQA 4FATA 1N3XA 4O7MA 2Y5LA 4XKPA 4MIJA 4PF6A 1EYJA 2RCBA 1DSNA 2R9JA 3A29A 4X1BA 3PPPA 4N8YA 5H8FB 2ALUA 4F2QA 1IMCA 1Z7ME 2W7YA 3RPLB 3FJGA 5J1DA 2HEUA 3C31A 4EQ9A 4AS4A 1Y20A 3HHFA 3PPNA 1A8FA 1P99A 1LBBA 5I2KA 2CZLA 1B0LA 1KA0A 2VHAA 4GOTA 3DP6A 1IMAA 3PPQA 4DCXA 3EN3A 3THIA 1Y4CA 4KI0E 2RF1A 4LUBA 3TKDA 4BDQA 2P2AA 4N13A 4NF4A 3CFLA 2O7IA 1XHYA 1HSJA 4F1VA 4R73A 2PT2A 4EQBA 3LUZA 1YZ0A 4KYSA 4N07A 2HCAA 2GQ1A 3CHGA 4FBPA 3V83A 3LC8A 5F24A 3M3LA 3FV2A 3FVNA 5I58A 5I59B 1B40A 3LBSA 5CMMA 3K6XA 5IAIA 1FBEA 3MJNA 3PGFA 1IMFA 1MPCA 4DXCA 1SW5A 5HPQA 2NXOA 4JDFA 3I6VA 3VVDA 3U8QA 4GWYA 4O3BA 1B58A 3HCQA 4HCYA 1IXHA 4OHNA 2P0SA 1B1XA 1MRPA 1MPDA 4GVOA 2XWOA 4YB7A 4NQ8A 1MQIA 3C4MA 4OVTA 5HBCA 2E1SA 4G8HA 1B3GA 4DDDA 4OVQA 5KDTA 3KFMA 1MM7A 1MG1A 1CE2A 4PETA 5I2NB 3M8UA 3OO9A 4NWDA 3QYTA 3M3KA 2PYYA 1NV5A 2XXUA 3BFTA 3MVXA 2QS4A 5I58B 3CVGA 3K00A 4HS7A 5ET5A 2G93A 1ELJA 2DWJA 2DYXA 3OENA 2B65A 4OANA 2GH9A 4H46A 1I69A 4OXVA 1TFAA 3LSLA 3IX1A 2OLBA 3MW0A 4MNIA 1JVXA 3D1RA 2V4CA 1QJMA 3CR9A 2V93A 3FBPA 2VOZA 2Q8MA 1QKBA 4ZE9A 3TPAA 2UVIA 4IY6A 1SVXB 5EYGA 4MHFA 2RKMA 1MY2A 5TPAA 2Y7KA 1SW4A 4KHZE 3E79A 3VLUA 3Q26A 4GWOA 1XOCA 3EQ1A 2L5VA 2XWVA 3FIRA 4TLMB 1LBWA 1VFDA 3KEIA 4PFRA 5EQ9A 2QL3A 4GBVA 2XWKA 5AA2D 4OWDA 4PF8A 2FHYA 1DK4A 3K0VA 3RQTA 2NOOA 1NV2A 3T0JA 3TMGA 1NNFA 4RA1A 5I7IA 2HFBA 3O2AA 3FJ7A 2RINA 4F31B 3K6VA 1SDXA 5HM4B 2Q89A 4WEPA 1ZTYA 3ODBA 4P1LA 3JV9A 3QK6A 3N26A 4OFLA 3FXQA 2GRVA 3TAJA 3S9LC 5ICTA 1MQJA 4G68B 4FECA 2D5WA 3MYUA 2HHMA 2F34A 4X1DA 1EYIA 4QSEA 1A99A 4IO2A 4PFYA 3UK4A 4GF8A 1M5DA 1FPKA 1YTVA 3V8XB 4DI4B 5TPAB 4C0RA 5KZTA 2UVJA 2F8DA 4GXSB 3U1OA 4F39A 4QFNA 4NMYA 3RLFE 4RPOA 4XFEA 3V89B 2B4MA 4QHQA 5AA1A 4G4PA 1FRPA 2I49A 3K2DA 3VXCA 4C1TA 2HPGA 1MQDA 4MNCA 4ZE8A 1HSEA 4N91A 2F3BA 2CEXA 3U94A 2CMOA 3KN8A 1Q1KA 1H45A 3EHTA 5EHSA 3MVWA 4I40A 1GV8A 1D9QA 2IEEA 3QUJA 2Y84A 3MZ1A 3RT8A 2QRYA 1I6BA 3IJXB 5ITOA 2FBPA 3OD7A 4ELQA 5B7DA 5H8SA 3OSQA 1FBGA 4GX6A 1R1NA 1MDQA 2PFYA 3GZGA 1B3EA 2XXPA 1QUKA 3B6TA 2OBGA 3CFXA 4ZS9A 1ZU0A 5LTCA 1LAFE 4AB6A 1NV0A 3EPEA 3O6IA 4O94A 1AH5A 2PT1A 4UABA 3KOSA 3FVOA 2BJIA 5TU0A 1NL5A 3FZVA 4G77A 4WXJA 3MUQA 1PC3A 4I3YA 1R6ZA 1S7YA 2Z22A 1MXYA 3OEMA 4OFOA 1WDNA 4ZEIA 3K1PA 4ZDMA 1FTAA 1H3DA 4RY1A 1LSTA 3CG3A 3E4RA 3OEKA 3JYRA 2QS3A 5JTYB 3HPIA 3L6HA 4JSDA 3VVEA 4JSOA 4LP2B 3VVFA 3O29A 4OEUA 3KN7A 4HE2A 4BDOA 3T9VA 3K1MA 4ESWA 1BIYA 2VD3A 5BUUA 2Q2AA 3OXNA 1AWBA 4WEDA 3OO7A 2O1MA 1Y3QA 3U93A 1QKAA 5H8NB 4PFBA 4UA8A 4Z0IA 4YB6A 1O63A 3ZS6A 1FTKA 4Q5TA 2I4CA 1MS7A 1DPPA 1B46A 4MLQA 4ECFA 2P3NA 2KR0A 5ICQA 1B3LA 3VFJA 2REJA 1NKXA 4N6KA 2UYFA 4N17A 1SW1A 2LAOA 2WKYA 2IA4A 4U4SA 1P1UA 4P1EA 3ZKLA 4R9FA 3BFUA 3H6UA 3TCHA 1NNKA 2XXQA 1WVJA 1RYXA 5AA4A 1ZMGA 3FXBA 4U1OA 2A5SA 2O68A 1D9VA 1LBXA 3B50A 3MZBA 4U2RA 3WAFA 4NF6A 4GRKA 4P3LA 3IOUA 4XKNA 5I5PA 1MXXA 4X04A 3USDA 2ONKE 3MP8A 4OZ9A 1NUXA 4R72A 2F35A 4PTKA 4GD5A 5AE4A 1PB8A 2FYIA 3IOTA 4R75A 4H0WA 4LQ2A 2CZKA 1P1OA 3MPLA 1BP5A 1MH3A 1B52A 2DE3A 1POY1 3MPKA 1M5EA 1OVBA 1KWHA 2HZLA 2XXTA 4IB2A 4NF8A 1IMBA 3C9HA 3RPWA 3OO8A 4GQOA 4R2BA 2I3WA 3CSGA 4GXAA 5DTBA 1MXVA 1Y3PA 3VXBA 5CM6A 3OMBA 4BDLA 4YMAA 3E78A 1N84A 2VP1A 2A5TA 5I57A 4NF6B 2ZMBA 2I0CA 1AMFA 4LVQA 4ONYA 2FVZA 4GWSA 4OVRA 3S9MC 3NOHA 4Q8RA 1OQGA 1IZ1A 1FPGA 2DE2A 3UP9A 5FHMA 4RPNA 1LBZA 1SYHA 2DE4A 3MVZA 2Q2CA 4R74A 3IOVA 2CEYA 4KR5A 5CMKA 2DWHA 4N81A 3MAMA 4QFKA 5TP9B 1KA1A 4ZZAA 3L6GA 5KCJB 1VR5A 3RY3A 4F3BA 1S9TA 3C34A 3A3UA 1MDP1 1N76A 2DXRA 4OEVA 4OENA 1B3HA 2F3DA 4KYDA 4NF8B 4F3SA 4O3CA 2ZYMA 4G8MA 1B05A 2ZZXA 1SI1A 4N6DA 3IORA 1DPEA 4C1UA 2A5TB 1B7UA 4M4GA 2XA5A 1LBCA 2O6AA 4PFIA 3G7WA 4ZEFA 4PFUA 3TTNA 4F22A 4NEDA 3I3VA 4P0IA 1ZKBA 1MXWA 1G0HA 3UN6A 4H5FA 3FJMA 4KXPA 2CZHA 3R26A 3M3FA 4ZECA 5I2KB 5ET7A 2DSFA 4JB7A 2M8CA 3TQWA 5FHOA 5ISUA 1FTLA 2VD2A 4OMBA 3I5OA 4H8IA 3N5LA 3KN3A 2XXVA 3VV5A 1LFIA 2YLNA 4JWOA 2DXYA 2ZYOA 1XS5A 1DBZA 2WEFA 1RDXA 2B3BA 3QAXA 4NF4B 3KOTA 5JK4A 1ZIUA 4F2OA 2E0SA 4FEDA 3UORA 1MQGA 1HSLA 3FV1A 4JVCA 1LCFA 3G3HA 2WX9A 4OFJA 2Q9TA 1JW5A 1NV7A 3DELB 4OTEA 3RNNA 2QFLA 5LOMA 4GX4A 1XI6A 2XXHA 3T1BA 2F7AA 3ONMA 4PBQA 5T3JA 3TYHA 1J1NA 4FORA 3SEXA 1Y4TA 3K02A 1RKMA 1UQWA 1H44A 1IUDA 3SKPA 2WBDA 1YAEA 2HXWA 1FBHA 3RTWB 3ROJA 1LBYA 4TOZA 5CRYA 2DP8A 1B7HA 4UACA 3MBPA 2B3FA 2X7PA 3SDFA 2I6EA 4P11A 1I6QA 3T9XB 5KDTB 4PCDA 4GWUA 2KLFA 3SERA 3MVYA 4XF5A 1UIUA 3Q28A 4LA9A 4PBHA 2DQVA 4HE1A 4MCOA 3UGWA 2H98A 5ITPA 1NMUA 3C36A 3LSXA 3PUVE 2MKZA 1OMPA 4F18A 1A55A 2V25A 4LZ5A 4U22A 4ND9A 2AIXA 3OO6A 4N8GA 3UA8A 4DXUA 5I84A 3TTRA 4BDMA 2WBBA 1NFTA 1EZPA 2H9BA 2GFEA 2PVUA 4LZ8A 1MQHA 1QVSA 4PGNA 4TLLB 1VE4A 5AA3A 2F97A 1A54A 1S50A 3TDJA 1Q9DA 3H4ZA 4KQPA 4H67A 4ZEDA 3O6HA 4NN3A 3CIJA 3RT6B 2XHDA 5L9SA 2WYPA 3KG2A 3EHUA 1Y3NA 2QJEA 2ANJA 1IMEA 1CB6A 4QF9A 2NUVA 1B1HA 3K6WA 3H3GA 4R6YA 5IZ3A 4GBWA 5DT6A 3KBRA 4U21A 4FAJA 2G29A 2ZNTA 1FTMA 1F9BA 4FE8A 3T93B 2VPOA 2X7QA 4PE3A 1MY1A 2AL5A 1SW2A 5L8DA 4TQUQ 2FA7A 2QMXA 1AIVA 1FPIA 5M2VA 3ZSFA 5DYHA 1N04A 5K2YA 3TTMA 4O3AA 1FQBA 2Y7RA 3RUMA 3A3CA 4GFRA 4H1XA 1QULA 2GHAA 4HCWA 3LV0A 3E13X 3K4UA 1Q35A 3G3IA 3PPRA 3RTFB 4XIGQ 4DZ1A 2ONRA 1JVYA 4OETA 1JEUA 4QSDA 1NH7A 4EQ7A 3W9VA 1ZJLA 3IJOB 2Y7WA 1GVCA 3H6TA 5IZ3B 3LSFB 1MXZA 4EXLA 1NNTA 4YKIA 3VLVA 1FW0A 3OELA 3TFLA 1XVYA 4EXKA 3W9WA 1N7XA 3TQLA 1H76A 1OLAA 2JJKA 3QIMA 4WKMA 2I0BA 3ISPA 1B0HA 4G61A 5FTIA 4H5GA 5IKBA 1BKAA 1B7ZA 3H7MA 1ANFA 4QSCA 4Z7EA 4JXIA 4P0GA 4RXLA 4F1YA 3ILUB 5EQAA 4IGTA 2Q8JA 3LR1A 4N4UA 2PCRA 1UIVA 5ET6A 1SBPA 1P1QA 5LDZA 1FJ9A 2Z8DA 4LZ7A 3KSXA 4PDHA 4FJPA 1RDYA 3F11A 1URDA 2QVVA 2XWIA 3C32A 3PD9A 1PDAA 3GXAA 4G68C 2QVUA 3GBBA 2RCAA 1MH4A 1IXGA 2ZXTA 1TWYA 3PUXE 4P8BA 5DEXA 4M1VA 1LB9A 1LB8A 1URGA 4JWYA 3TCFA 3CRBA 2Y5KA 5CMCA 1EU8A 1FPJA 4MH5A 4H6DA 1IXIA 3UIFA 5DVFA 3U72A 4HXVA 2QVRA 4F3GA 5A5XA 3N6TA 2DVCA 1GTKA 1OLCA 3TODA 2VGQA 4MEVA 1IEJA 2ESNA 1IQ7A 4ELOA 1RDZA 3FATA 4R6HA 5CBSA 1N0TA 5IM2A 1GGGA 1VDWA 1II5A 3B8BA 1O7TA 3IB1A 2XXXA 4N6PA 1UTHA 4GL0A 1OVTA 3PMVA 2P1SA 2I4BA 4IO3A 4NGUA 5EQ8A 4XKQA 5CBRA 2HZKA 3DLNA 3IFCA 4OESA 4PE5B 3GLBA 1ZBMA 1N7WA 1QUIA 4JVIA 1PB9A 3OOAA 5H8QA 5I56A 2CZIA 3V5AA 2DS9A 3CSBA 4R2FA 1NUZA 1URSA 2F5XA 3TZAA 2OWTA 4BDRA 5ET8A 1OQHA 1DCUA 1YPNA 3D4GA 1YCJA 3PMXA 4OVPA 3IL1B 4HW8A 3MQ9A 4N15A 5ESYA 1A7LA 4EUOA 2RC9A 4IO4A 3O28A 4U1ZA 4YZZA 5K2XA 3R7XA 3MZ9A 1DTZA 1AL3A 3D4CA 3O6GA 3S2VA 3SESA 4DXBA 1QUJA 2D3IA 1FBPA 1O64A 3BIHA 2P3VA 4I8CA 2UVGA 4PFTA 3RPLA 2UVHA 3S4UA 1BTJA 4KYEA 3T66A 4NX1A 3RN8A 4L17A 5AA2A 1NI9A 3KZGA 2ONSA 4BLAA 5AA4B 3T9UA 1KZ8A 4PGPA 3TTKA 4QFPA 3QSLA 5IZ1A 1BLFA 2KQZA 5L9OA 3N6UA 4XKRA 5F1QA 2THIA 2XXYA 3G3FA 1B3FA 1A40A 3PTYA 1OIBA 3T9HB 3JZJA 3IAZA 5L9MA 4GL8A 4GWWA 5DVIA 1EZ9A 4GWZA 1JNFA 3A09A 2PMSA 2V3UA 4MLVA 4F19A 1JEVA 5CI5A 3E3KA 5JEIA 1SQYA 3KC0A 2R8TA 3PPOA 5I59A 1TFDA 5B70A 2V3TA 3KSJA 4OYVA 2ZNUA 3K6UA 2O69A 5AA2B 3TUSA 3EKIA 4PP0A 4K3FA 4OA4A 4PQJA 4G2ZA 4F3PA 1FCKA 4YKKA 3IB0A 1B4ZA 1XC1A 5I57B 3FVGA 4LONB 2XX9A 3S9NC 3R6UA 3QXMA 4E0WA 4MNPA 3CG1A 3MWBA 5I3SA 3PUWE 4IO7A 2REGA 2DVZA 4MAGA 4KPTA 4POXA 2F6GA 1NUWA 3C35A 1EYKA 3T22A 2F6PA 3IR1A 1FQAA 1B51A 4E0XA 1USYH 4LATA 5I2NA 1H43A 5EQ7A 1K9ZA 1TXFA 2VPNA 3QUFA 2PX1A 4YMBA 1M5BA 3PUYE 1LCTA 1Y1MA 3B6QA 4IY5A 3FD3A 2QS1A 4P56A 4XTCQ 1SD3A 5F7VA 4GIZA 2RC8A 1INPA 4O8MA 1N3WA 5A5LA 4HE0A 2B4LA 1LFGA 3TCGA 3K1NA 2ZZVA 3U65A 2DDKA 1IIWA 2OK2A 5EYFA 4DE8A 3PD8A 4NF5A 2H4IA 3H6WA 3BBRA 1FTJA 1B6HA 1M5CA 3G3JA 3CFZA 1R9LA 2XXKA 4QBAA 2HAUA 2R6GE 1D9YA 2ZNSA 2Q88A 1EH3A 2GHBA 4OERA 1IMDA 1EZOA 3K01A 1FQCA 2AL4A 4LQ5A 4ESXA 4X48A 4U4XA 4RK9A 1TT1A 1MY4A 3SEUA 1NV6A 2AYSA 3TEPA 1FQFA 3C33A 4YKPA 5DVJA 3FUZA 1ATGA 2YPNA 3IFAA 3AXFA 2OX3A 2FNCA 1NH8A 4DI3D 4DIGA 1MPBA 4ZEKA 2ZYNA 3DP8A 3FVKA 5H8HA 4NF5B 1FPFA 3EHSA 3S9EA 2XD2A 4OVJA 4OQOA 4G68A 1LFHA 2DOJA 2XX8A 1FPDA 3CI8A 4DLDA 4Q0CA 2QSXA 3OSRA 4IGRA 1FSAA 2ABHA 2UYEA 3E9XA 4I9DA 4YAHX 2F78A 4ISUA 2XXRA 3FXRA 2Z23A 1PBQA 3VLWA 1B9JA 4I62A 4ELRA 5BWJA 3O9PA 3G3GA 4ZZEA 4F1UA 3IB2A 2NVUB 3KJ7A 2OJTA 3KC1A 3SZPA 4I1DA 4X9TA 1Y9UA 4H45A 4NF0A 1T0KA 4MX6A 4GWXA 1MY0A 2Z8FA 2F7BA 1YYZA 4EF1A 4MBPA 3MP1A 2PBWA 1VSOA 3SEVA 1B2HA 1JW1A 5CC2A 1K9YA 2I3VA 2ZYKA 3O97A 4MMPA 2Q74A 1NV1A 5H8HB 2VT5A 5FTHA 1B5IA 3HFUA 1JW4A 2OCUA 1R9QA 1FBFA 2Y7IA 4Q30B 1RYOA 2O7UA
chains in the Genus database with same CATH topology
3U92A 1LLSA 3H06B 3FGSA 2OZZA 1GR2A 3PU5A 4FIMA 3VE1B 3IO4A 3MC2A 1ZLQA 3ECRA 2YJPA 2V84A 2H5YA 3BKIB 1QW0A 1USYE 4NWCA 3LSWA 3Q29A 1D3KA 3IOWA 4MFIA 1DTGA 3Q27A 3VDFA 2H25A 4H65A 2HQ0A 4YICA 2XXIA 1VFEA 3HSTA 3B7DA 3SEYA 2X26A 1AOVA 4YB5A 1SI0A 1JETA 2RC7A 3MP6A 1XVXA 1B4HA 2F36A 3HO7A 5CMBA 1DOTA 4KCDA 1WODA 4R6KA 2D21A 2DWAA 3FASA 4R9GA 2R71A 4KD5A 1M5FA 3N94A 4BDNA 1FTOA 1POTA 4KCCA 5JTYA 1I6AA 3GBAA 3H6VA 3ILTB 4QFLA 1US4A 4JWXA 5ELVA 1Z7NE 3O66A 1FQEA 3ZKKA 3KJTA 4RNSA 3KGCA 5H8NA 2XD3A 4PFWA 1XT8A 3EF7A 4JBZA 1LAHE 1D4NA 1L5TA 3RGYA 4YKJA 3FXUA 2QS2A 2I58A 3H03A 2OWSA 3PV0E 1Y1ZA 1PEBA 2HAVA 4KFQA 4MF3A 1MM6A 3SETA 1IITA 1PBPA 3T96B 4AB5A 5DEXB 5EHMA 4U23A 2BJJX 2H99A 4RJZA 4RK2A 3Q25A 5FHNA 1US5A 3DM0A 2QMWA 4FEBA 2O51A 4POWA 4G8NA 3P7IA 1JQFA 3LUYA 3HN0A 1UTBA 5A5XB 3DP4A 2O1LA 4QFOA 2NWJA 4AQ4A 4DCYA 1MXUA 4F29A 3TTLA 4GLIA 2QPQA 4NE4A 4EF2A 1DMBA 4NTLA 1LAXA 2V3QA 4HTGA 1UTHB 4XXUA 2Z8EA 3IO6A 3HHGA 1SYIA 1NNPA 2I48A 1LGBC 5H8FA 2DWIA 1IXCA 1LAGE 1P1WA 3SEWA 1B5JA 5H8QB 2UXAA 4ZEBA 5I56B 4RYAA 4IO6A 1UTBB 3G3KA 3WAEA 1P1NA 5TP9A 3PMWA 1FQDA 5KCJA 3HV1A 1A8EA 3TELA 1B5HA 2XX7A 3B6WA 4IO5A 4THIA 2F7CA 2Y7PA 2XXWA 2O84X 4H8JA 3IK6B 4YU0A 1PB7A 1B32A 4ELPA 3W15C 4EDPA 1MY3A 3PUZE 4QRZA 4FATA 1N3XA 4XKPA 2RCBA 1DSNA 2R9JA 4X1BA 3PPPA 5H8FB 2ALUA 4F2QA 1Z7ME 2W7YA 3FJGA 5J1DA 2HEUA 3C31A 4EQ9A 1Y20A 3HHFA 3PPNA 1A8FA 1P99A 1LBBA 5I2KA 2CZLA 1B0LA 2VHAA 4GOTA 3DP6A 3PPQA 4DCXA 3EN3A 3THIA 1Y4CA 4KI0E 2RF1A 4LUBA 3TKDA 4BDQA 2P2AA 4N13A 4NF4A 3CFLA 2O7IA 1XHYA 1HSJA 4F1VA 4R73A 2PT2A 4EQBA 4KYSA 4N07A 2HCAA 3V83A 3LC8A 3M3LA 3FV2A 3FVNA 5I58A 5I59B 1B40A 3LBSA 5CMMA 3K6XA 5IAIA 3MJNA 3PGFA 1MPCA 4DXCA 1SW5A 5HPQA 2NXOA 4JDFA 3I6VA 3VVDA 3U8QA 4O3BA 1B58A 3HCQA 4HCYA 1IXHA 4OHNA 2P0SA 1B1XA 1MRPA 1MPDA 4GVOA 4YB7A 1MQIA 3C4MA 5HBCA 2E1SA 4G8HA 1B3GA 4DDDA 5KDTA 3KFMA 1MM7A 1MG1A 1CE2A 4PETA 5I2NB 3M8UA 3OO9A 4NWDA 3QYTA 3M3KA 2PYYA 2XXUA 3BFTA 3MVXA 2QS4A 5I58B 3CVGA 3K00A 4HS7A 2G93A 1ELJA 2DWJA 2DYXA 3OENA 2B65A 2GH9A 1I69A 4OXVA 1TFAA 3LSLA 3IX1A 2OLBA 3MW0A 1JVXA 1QJMA 3CR9A 2V93A 2VOZA 1QKBA 4ZE9A 3TPAA 2UVIA 4IY6A 1SVXB 2RKMA 1MY2A 5TPAA 2Y7KA 1SW4A 4KHZE 3VLUA 3Q26A 4GWOA 1XOCA 3EQ1A 3FIRA 4TLMB 1VFDA 3KEIA 2QL3A 5AA2D 4OWDA 3K0VA 3RQTA 2NOOA 3TMGA 1NNFA 4RA1A 2HFBA 3O2AA 3FJ7A 2RINA 4F31B 3K6VA 1SDXA 5HM4B 2Q89A 4WEPA 1ZTYA 3ODBA 3JV9A 3QK6A 3N26A 4OFLA 3FXQA 2GRVA 3TAJA 3S9LC 5ICTA 1MQJA 4G68B 4FECA 2D5WA 2F34A 4X1DA 4QSEA 1A99A 4IO2A 4PFYA 3UK4A 4GF8A 1M5DA 1YTVA 3V8XB 5TPAB 4C0RA 5KZTA 2UVJA 2F8DA 4GXSB 3U1OA 4F39A 4QFNA 4NMYA 3RLFE 4RPOA 3V89B 4QHQA 5AA1A 4G4PA 2I49A 3K2DA 3VXCA 4C1TA 1MQDA 4ZE8A 1HSEA 3U94A 2CMOA 3KN8A 1Q1KA 1H45A 3EHTA 5EHSA 3MVWA 1GV8A 2IEEA 3QUJA 2Y84A 3MZ1A 3RT8A 2QRYA 1I6BA 3IJXB 5ITOA 3OD7A 4ELQA 5B7DA 5H8SA 3OSQA 1R1NA 1MDQA 3GZGA 1B3EA 2XXPA 1QUKA 3B6TA 2OBGA 3CFXA 4ZS9A 1ZU0A 1LAFE 4AB6A 3EPEA 3O6IA 1AH5A 2PT1A 3KOSA 3FVOA 5TU0A 1NL5A 3FZVA 4G77A 4WXJA 3MUQA 1PC3A 1R6ZA 1S7YA 2Z22A 1MXYA 3OEMA 4OFOA 1WDNA 4ZEIA 3K1PA 4ZDMA 1H3DA 4RY1A 1LSTA 3CG3A 3E4RA 3OEKA 3JYRA 2QS3A 5JTYB 3HPIA 3L6HA 4JSDA 3VVEA 4JSOA 4LP2B 3VVFA 3O29A 4OEUA 3KN7A 4BDOA 3T9VA 3K1MA 4ESWA 1BIYA 2VD3A 5BUUA 2Q2AA 3OXNA 4WEDA 3OO7A 2O1MA 1Y3QA 3U93A 1QKAA 5H8NB 4UA8A 4Z0IA 4YB6A 1O63A 3ZS6A 1FTKA 4Q5TA 2I4CA 1MS7A 1DPPA 1B46A 4MLQA 4ECFA 5ICQA 1B3LA 3VFJA 2REJA 1NKXA 2UYFA 1SW1A 2LAOA 2WKYA 2IA4A 4U4SA 1P1UA 3ZKLA 4R9FA 3BFUA 3H6UA 3TCHA 1NNKA 2XXQA 1WVJA 1RYXA 5AA4A 1ZMGA 4U1OA 2A5SA 2O68A 1D9VA 3MZBA 4U2RA 3WAFA 4NF6A 4GRKA 3IOUA 4XKNA 1MXXA 3USDA 2ONKE 3MP8A 4OZ9A 4R72A 2F35A 4GD5A 5AE4A 1PB8A 2FYIA 3IOTA 4R75A 4H0WA 4LQ2A 1P1OA 3MPLA 1BP5A 1MH3A 1B52A 2DE3A 1POY1 3MPKA 1M5EA 1OVBA 1KWHA 2HZLA 2XXTA 4IB2A 4NF8A 3C9HA 3RPWA 3OO8A 4GQOA 4R2BA 2I3WA 3CSGA 4GXAA 5DTBA 1MXVA 1Y3PA 3VXBA 5CM6A 3OMBA 4BDLA 4YMAA 1N84A 2VP1A 2A5TA 5I57A 4NF6B 2ZMBA 2I0CA 1AMFA 4LVQA 4ONYA 3S9MC 4Q8RA 1OQGA 1IZ1A 2DE2A 3UP9A 5FHMA 4RPNA 1SYHA 2DE4A 3MVZA 2Q2CA 4R74A 3IOVA 4KR5A 5CMKA 2DWHA 3MAMA 4QFKA 5TP9B 4ZZAA 3L6GA 5KCJB 1VR5A 3RY3A 4F3BA 1S9TA 3C34A 3A3UA 1MDP1 1N76A 2DXRA 4OEVA 4OENA 1B3HA 4KYDA 4NF8B 4F3SA 4O3CA 2ZYMA 4G8MA 1B05A 1SI1A 3IORA 1DPEA 4C1UA 2A5TB 1B7UA 4M4GA 1LBCA 2O6AA 3G7WA 4ZEFA 4PFUA 3TTNA 4F22A 4NEDA 3I3VA 4P0IA 1ZKBA 1MXWA 3UN6A 4H5FA 3FJMA 3R26A 3M3FA 4ZECA 5I2KB 2DSFA 4JB7A 2M8CA 3TQWA 5FHOA 5ISUA 1FTLA 2VD2A 4OMBA 3I5OA 4H8IA 3N5LA 3KN3A 3VV5A 2XXVA 1LFIA 2YLNA 4JWOA 2DXYA 2ZYOA 1XS5A 2B3BA 3QAXA 4NF4B 3KOTA 5JK4A 1ZIUA 4F2OA 2E0SA 4FEDA 3UORA 1MQGA 1HSLA 3FV1A 1LCFA 3G3HA 4OFJA 2Q9TA 1JW5A 3DELB 4OTEA 3RNNA 5LOMA 2XXHA 2F7AA 3ONMA 3TYHA 1J1NA 4FORA 3SEXA 1Y4TA 3K02A 1RKMA 1UQWA 1H44A 1IUDA 3SKPA 1YAEA 2HXWA 3RTWB 4TOZA 5CRYA 2DP8A 1B7HA 4UACA 3MBPA 2B3FA 2X7PA 3SDFA 2I6EA 4P11A 1I6QA 3T9XB 5KDTB 2KLFA 3SERA 3MVYA 1UIUA 3Q28A 4LA9A 2DQVA 3UGWA 2H98A 5ITPA 1NMUA 3C36A 3LSXA 3PUVE 1OMPA 4F18A 1A55A 2V25A 4LZ5A 4U22A 4ND9A 2AIXA 3OO6A 4DXUA 3UA8A 5I84A 3TTRA 4BDMA 1NFTA 1EZPA 2H9BA 2GFEA 2PVUA 4LZ8A 1MQHA 1QVSA 4TLLB 1VE4A 5AA3A 2F97A 1A54A 1S50A 3TDJA 3H4ZA 4KQPA 4H67A 4ZEDA 3O6HA 3CIJA 3RT6B 2XHDA 5L9SA 3KG2A 3EHUA 1Y3NA 2QJEA 2ANJA 1CB6A 4QF9A 2NUVA 1B1HA 3K6WA 3H3GA 4R6YA 5DT6A 3KBRA 4U21A 4FAJA 2G29A 2ZNTA 1FTMA 1F9BA 4FE8A 3T93B 2X7QA 1MY1A 2AL5A 1SW2A 5L8DA 4TQUQ 2FA7A 2QMXA 1AIVA 5M2VA 3ZSFA 5DYHA 1N04A 5K2YA 3TTMA 4O3AA 1FQBA 2Y7RA 3RUMA 3A3CA 4GFRA 4H1XA 1QULA 2GHAA 4HCWA 3E13X 3K4UA 1Q35A 3G3IA 3RTFB 3PPRA 4XIGQ 4DZ1A 2ONRA 1JVYA 4OETA 1JEUA 4QSDA 1NH7A 4EQ7A 3W9VA 1ZJLA 3IJOB 2Y7WA 1GVCA 3H6TA 3LSFB 1MXZA 4EXLA 1NNTA 4YKIA 3VLVA 1FW0A 3OELA 3TFLA 1XVYA 4EXKA 3W9WA 1N7XA 3TQLA 1H76A 1OLAA 3QIMA 4WKMA 2I0BA 1B0HA 5FTIA 4H5GA 5IKBA 1BKAA 1B7ZA 3H7MA 1ANFA 4QSCA 4Z7EA 4JXIA 4P0GA 4RXLA 4F1YA 3ILUB 4IGTA 2Q8JA 3LR1A 1UIVA 1SBPA 1P1QA 2Z8DA 4LZ7A 3KSXA 4FJPA 3F11A 1URDA 3C32A 3PD9A 1PDAA 3GXAA 4G68C 3GBBA 2RCAA 1MH4A 1IXGA 2ZXTA 1TWYA 3PUXE 5DEXA 4M1VA 1LB9A 1LB8A 3TCFA 4JWYA 1URGA 3CRBA 5CMCA 1EU8A 4MH5A 4H6DA 1IXIA 3UIFA 5DVFA 3U72A 4F3GA 5A5XA 3N6TA 2DVCA 1GTKA 1OLCA 3TODA 2VGQA 1IEJA 2ESNA 1IQ7A 4ELOA 3FATA 4R6HA 5CBSA 1N0TA 1GGGA 1II5A 1O7TA 3IB1A 2XXXA 4N6PA 1UTHA 4GL0A 1OVTA 3PMVA 2P1SA 2I4BA 4IO3A 4XKQA 5CBRA 2HZKA 3DLNA 4PE5B 4OESA 3GLBA 1ZBMA 1N7WA 1QUIA 1PB9A 3OOAA 5H8QA 5I56A 3V5AA 2DS9A 3CSBA 4R2FA 1URSA 2F5XA 3TZAA 2OWTA 4BDRA 1OQHA 1YPNA 3D4GA 1YCJA 3PMXA 3IL1B 4HW8A 3MQ9A 1A7LA 4EUOA 2RC9A 4IO4A 3O28A 4U1ZA 4YZZA 5K2XA 3R7XA 3MZ9A 1DTZA 1AL3A 3D4CA 3O6GA 3S2VA 3SESA 4DXBA 1QUJA 2D3IA 1O64A 4I8CA 2UVGA 4PFTA 2UVHA 3S4UA 1BTJA 4KYEA 3T66A 3RN8A 4L17A 5AA2A 3KZGA 2ONSA 4BLAA 5AA4B 3T9UA 3TTKA 4QFPA 3QSLA 1BLFA 5L9OA 3N6UA 4XKRA 5F1QA 2THIA 2XXYA 3G3FA 1B3FA 1A40A 1OIBA 3T9HB 3JZJA 3IAZA 5L9MA 4GL8A 5DVIA 1EZ9A 1JNFA 3A09A 2PMSA 2V3UA 4MLVA 4F19A 1JEVA 5CI5A 3E3KA 5JEIA 1SQYA 3PPOA 5I59A 1TFDA 5B70A 2V3TA 3KSJA 4OYVA 2ZNUA 3K6UA 2O69A 5AA2B 3TUSA 4PP0A 4K3FA 4PQJA 4G2ZA 4F3PA 1FCKA 4YKKA 3IB0A 1B4ZA 1XC1A 5I57B 3FVGA 4LONB 2XX9A 3S9NC 3R6UA 3QXMA 4E0WA 3CG1A 3MWBA 3PUWE 4IO7A 2REGA 2DVZA 4KPTA 4POXA 2F6GA 3C35A 3T22A 2F6PA 3IR1A 1FQAA 1B51A 4E0XA 1USYH 4LATA 5I2NA 1H43A 1TXFA 3QUFA 2PX1A 4YMBA 1M5BA 3PUYE 1LCTA 1Y1MA 3B6QA 4IY5A 3FD3A 2QS1A 4XTCQ 1SD3A 5F7VA 4GIZA 2RC8A 1N3WA 3TCGA 1LFGA 3K1NA 1IIWA 2OK2A 5EYFA 4DE8A 3PD8A 4NF5A 2H4IA 3H6WA 3BBRA 1FTJA 1B6HA 1M5CA 3G3JA 3CFZA 1R9LA 2HAUA 2R6GE 1D9YA 2ZNSA 2Q88A 1EH3A 2GHBA 4OERA 1EZOA 3K01A 1FQCA 2AL4A 4LQ5A 4ESXA 4X48A 4U4XA 4RK9A 1TT1A 1MY4A 3SEUA 2AYSA 3TEPA 1FQFA 3C33A 4YKPA 5DVJA 3FUZA 1ATGA 2YPNA 3AXFA 2FNCA 1NH8A 4DIGA 1MPBA 4ZEKA 2ZYNA 3DP8A 3FVKA 5H8HA 4NF5B 3EHSA 3S9EA 2XD2A 4OVJA 4OQOA 4G68A 1LFHA 2DOJA 2XX8A 3CI8A 4DLDA 4Q0CA 2QSXA 3OSRA 4IGRA 2ABHA 2UYEA 3E9XA 4I9DA 4YAHX 2F78A 4ISUA 2XXRA 3FXRA 2Z23A 1PBQA 3VLWA 1B9JA 4I62A 4ELRA 5BWJA 3O9PA 3G3GA 4ZZEA 4F1UA 3IB2A 2NVUB 3KJ7A 2OJTA 4I1DA 4X9TA 1Y9UA 1T0KA 1MY0A 2Z8FA 2F7BA 4EF1A 4MBPA 3MP1A 2PBWA 1VSOA 3SEVA 1B2HA 1JW1A 5CC2A 2I3VA 2ZYKA 3O97A 5H8HB 5FTHA 1B5IA 1JW4A 2OCUA 1R9QA 2Y7IA 4Q30B 1RYOA 2O7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U92 A;  1LLS A;  3H06 B;  3FGS A;  2OZZ A;  1GR2 A;  3PU5 A;  4FIM A;  3VE1 B;  3IO4 A;  3MC2 A;  1ZLQ A;  3ECR A;  2YJP A;  2V84 A;  2H5Y A;  3BKI B;  1QW0 A;  1USY E;  4NWC A;  3LSW A;  3Q29 A;  1D3K A;  3IOW A;  4MFI A;  1DTG A;  3Q27 A;  3VDF A;  2H25 A;  4H65 A;  2HQ0 A;  4YIC A;  2XXI A;  1VFE A;  3HST A;  3B7D A;  3SEY A;  2X26 A;  1AOV A;  4YB5 A;  1SI0 A;  1JET A;  2RC7 A;  3MP6 A;  1XVX A;  1B4H A;  2F36 A;  3HO7 A;  5CMB A;  1DOT A;  4KCD A;  1WOD A;  4R6K A;  2D21 A;  2DWA A;  3FAS A;  4R9G A;  2R71 A;  4KD5 A;  1M5F A;  3N94 A;  4BDN A;  1FTO A;  1POT A;  4KCC A;  5JTY A;  1I6A A;  3GBA A;  3H6V A;  3ILT B;  4QFL A;  1US4 A;  4JWX A;  5ELV A;  1Z7N E;  3O66 A;  1FQE A;  3ZKK A;  3KJT A;  4RNS A;  3KGC A;  5H8N A;  2XD3 A;  4PFW A;  1XT8 A;  3EF7 A;  4JBZ A;  1LAH E;  1D4N A;  1L5T A;  3RGY A;  4YKJ A;  3FXU A;  2QS2 A;  2I58 A;  3H03 A;  2OWS A;  3PV0 E;  1Y1Z A;  1PEB A;  2HAV A;  4KFQ A;  4MF3 A;  1MM6 A;  3SET A;  1IIT A;  1PBP A;  3T96 B;  4AB5 A;  5DEX B;  5EHM A;  4U23 A;  2BJJ X;  2H99 A;  4RJZ A;  4RK2 A;  3Q25 A;  5FHN A;  1US5 A;  3DM0 A;  2QMW A;  4FEB A;  2O51 A;  4POW A;  4G8N A;  3P7I A;  1JQF A;  3LUY A;  3HN0 A;  1UTB A;  5A5X B;  3DP4 A;  2O1L A;  4QFO A;  2NWJ A;  4AQ4 A;  4DCY A;  1MXU A;  4F29 A;  3TTL A;  4GLI A;  2QPQ A;  4NE4 A;  4EF2 A;  1DMB A;  4NTL A;  1LAX A;  2V3Q A;  4HTG A;  1UTH B;  4XXU A;  2Z8E A;  3IO6 A;  3HHG A;  1SYI A;  1NNP A;  2I48 A;  1LGB C;  5H8F A;  2DWI A;  1IXC A;  1LAG E;  1P1W A;  3SEW A;  1B5J A;  5H8Q B;  2UXA A;  4ZEB A;  5I56 B;  4RYA A;  4IO6 A;  1UTB B;  3G3K A;  3WAE A;  1P1N A;  5TP9 A;  3PMW A;  1FQD A;  5KCJ A;  3HV1 A;  1A8E A;  3TEL A;  1B5H A;  2XX7 A;  3B6W A;  4IO5 A;  4THI A;  2F7C A;  2Y7P A;  2XXW A;  2O84 X;  4H8J A;  3IK6 B;  4YU0 A;  1PB7 A;  1B32 A;  4ELP A;  3W15 C;  4EDP A;  1MY3 A;  3PUZ E;  4QRZ A;  4FAT A;  1N3X A;  4XKP A;  2RCB A;  1DSN A;  2R9J A;  4X1B A;  3PPP A;  5H8F B;  2ALU A;  4F2Q A;  1Z7M E;  2W7Y A;  3FJG A;  5J1D A;  2HEU A;  3C31 A;  4EQ9 A;  1Y20 A;  3HHF A;  3PPN A;  1A8F A;  1P99 A;  1LBB A;  5I2K A;  2CZL A;  1B0L A;  2VHA A;  4GOT A;  3DP6 A;  3PPQ A;  4DCX A;  3EN3 A;  3THI A;  1Y4C A;  4KI0 E;  2RF1 A;  4LUB A;  3TKD A;  4BDQ A;  2P2A A;  4N13 A;  4NF4 A;  3CFL A;  2O7I A;  1XHY A;  1HSJ A;  4F1V A;  4R73 A;  2PT2 A;  4EQB A;  4KYS A;  4N07 A;  2HCA A;  3V83 A;  3LC8 A;  3M3L A;  3FV2 A;  3FVN A;  5I58 A;  5I59 B;  1B40 A;  3LBS A;  5CMM A;  3K6X A;  5IAI A;  3MJN A;  3PGF A;  1MPC A;  4DXC A;  1SW5 A;  5HPQ A;  2NXO A;  4JDF A;  3I6V A;  3VVD A;  3U8Q A;  4O3B A;  1B58 A;  3HCQ A;  4HCY A;  1IXH A;  4OHN A;  2P0S A;  1B1X A;  1MRP A;  1MPD A;  4GVO A;  4YB7 A;  1MQI A;  3C4M A;  5HBC A;  2E1S A;  4G8H A;  1B3G A;  4DDD A;  5KDT A;  3KFM A;  1MM7 A;  1MG1 A;  1CE2 A;  4PET A;  5I2N B;  3M8U A;  3OO9 A;  4NWD A;  3QYT A;  3M3K A;  2PYY A;  2XXU A;  3BFT A;  3MVX A;  2QS4 A;  5I58 B;  3CVG A;  3K00 A;  4HS7 A;  2G93 A;  1ELJ A;  2DWJ A;  2DYX A;  3OEN A;  2B65 A;  2GH9 A;  1I69 A;  4OXV A;  1TFA A;  3LSL A;  3IX1 A;  2OLB A;  3MW0 A;  1JVX A;  1QJM A;  3CR9 A;  2V93 A;  2VOZ A;  1QKB A;  4ZE9 A;  3TPA A;  2UVI A;  4IY6 A;  1SVX B;  2RKM A;  1MY2 A;  5TPA A;  2Y7K A;  1SW4 A;  4KHZ E;  3VLU A;  3Q26 A;  4GWO A;  1XOC A;  3EQ1 A;  3FIR A;  4TLM B;  1VFD A;  3KEI A;  2QL3 A;  5AA2 D;  4OWD A;  3K0V A;  3RQT A;  2NOO A;  3TMG A;  1NNF A;  4RA1 A;  2HFB A;  3O2A A;  3FJ7 A;  2RIN A;  4F31 B;  3K6V A;  1SDX A;  5HM4 B;  2Q89 A;  4WEP A;  1ZTY A;  3ODB A;  3JV9 A;  3QK6 A;  3N26 A;  4OFL A;  3FXQ A;  2GRV A;  3TAJ A;  3S9L C;  5ICT A;  1MQJ A;  4G68 B;  4FEC A;  2D5W A;  2F34 A;  4X1D A;  4QSE A;  1A99 A;  4IO2 A;  4PFY A;  3UK4 A;  4GF8 A;  1M5D A;  1YTV A;  3V8X B;  5TPA B;  4C0R A;  5KZT A;  2UVJ A;  2F8D A;  4GXS B;  3U1O A;  4F39 A;  4QFN A;  4NMY A;  3RLF E;  4RPO A;  3V89 B;  4QHQ A;  5AA1 A;  4G4P A;  2I49 A;  3K2D A;  3VXC A;  4C1T A;  1MQD A;  4ZE8 A;  1HSE A;  3U94 A;  2CMO A;  3KN8 A;  1Q1K A;  1H45 A;  3EHT A;  5EHS A;  3MVW A;  1GV8 A;  2IEE A;  3QUJ A;  2Y84 A;  3MZ1 A;  3RT8 A;  2QRY A;  1I6B A;  3IJX B;  5ITO A;  3OD7 A;  4ELQ A;  5B7D A;  5H8S A;  3OSQ A;  1R1N A;  1MDQ A;  3GZG A;  1B3E A;  2XXP A;  1QUK A;  3B6T A;  2OBG A;  3CFX A;  4ZS9 A;  1ZU0 A;  1LAF E;  4AB6 A;  3EPE A;  3O6I A;  1AH5 A;  2PT1 A;  3KOS A;  3FVO A;  5TU0 A;  1NL5 A;  3FZV A;  4G77 A;  4WXJ A;  3MUQ A;  1PC3 A;  1R6Z A;  1S7Y A;  2Z22 A;  1MXY A;  3OEM A;  4OFO A;  1WDN A;  4ZEI A;  3K1P A;  4ZDM A;  1H3D A;  4RY1 A;  1LST A;  3CG3 A;  3E4R A;  3OEK A;  3JYR A;  2QS3 A;  5JTY B;  3HPI A;  3L6H A;  4JSD A;  3VVE A;  4JSO A;  4LP2 B;  3VVF A;  3O29 A;  4OEU A;  3KN7 A;  4BDO A;  3T9V A;  3K1M A;  4ESW A;  1BIY A;  2VD3 A;  5BUU A;  2Q2A A;  3OXN A;  4WED A;  3OO7 A;  2O1M A;  1Y3Q A;  3U93 A;  1QKA A;  5H8N B;  4UA8 A;  4Z0I A;  4YB6 A;  1O63 A;  3ZS6 A;  1FTK A;  4Q5T A;  2I4C A;  1MS7 A;  1DPP A;  1B46 A;  4MLQ A;  4ECF A;  5ICQ A;  1B3L A;  3VFJ A;  2REJ A;  1NKX A;  2UYF A;  1SW1 A;  2LAO A;  2WKY A;  2IA4 A;  4U4S A;  1P1U A;  3ZKL A;  4R9F A;  3BFU A;  3H6U A;  3TCH A;  1NNK A;  2XXQ A;  1WVJ A;  1RYX A;  5AA4 A;  1ZMG A;  4U1O A;  2A5S A;  2O68 A;  1D9V A;  3MZB A;  4U2R A;  3WAF A;  4NF6 A;  4GRK A;  3IOU A;  4XKN A;  1MXX A;  3USD A;  2ONK E;  3MP8 A;  4OZ9 A;  4R72 A;  2F35 A;  4GD5 A;  5AE4 A;  1PB8 A;  2FYI A;  3IOT A;  4R75 A;  4H0W A;  4LQ2 A;  1P1O A;  3MPL A;  1BP5 A;  1MH3 A;  1B52 A;  2DE3 A;  1POY 1;  3MPK A;  1M5E A;  1OVB A;  1KWH A;  2HZL A;  2XXT A;  4IB2 A;  4NF8 A;  3C9H A;  3RPW A;  3OO8 A;  4GQO A;  4R2B A;  2I3W A;  3CSG A;  4GXA A;  5DTB A;  1MXV A;  1Y3P A;  3VXB A;  5CM6 A;  3OMB A;  4BDL A;  4YMA A;  1N84 A;  2VP1 A;  2A5T A;  5I57 A;  4NF6 B;  2ZMB A;  2I0C A;  1AMF A;  4LVQ A;  4ONY A;  3S9M C;  4Q8R A;  1OQG A;  1IZ1 A;  2DE2 A;  3UP9 A;  5FHM A;  4RPN A;  1SYH A;  2DE4 A;  3MVZ A;  2Q2C A;  4R74 A;  3IOV A;  4KR5 A;  5CMK A;  2DWH A;  3MAM A;  4QFK A;  5TP9 B;  4ZZA A;  3L6G A;  5KCJ B;  1VR5 A;  3RY3 A;  4F3B A;  1S9T A;  3C34 A;  3A3U A;  1MDP 1;  1N76 A;  2DXR A;  4OEV A;  4OEN A;  1B3H A;  4KYD A;  4NF8 B;  4F3S A;  4O3C A;  2ZYM A;  4G8M A;  1B05 A;  1SI1 A;  3IOR A;  1DPE A;  4C1U A;  2A5T B;  1B7U A;  4M4G A;  1LBC A;  2O6A A;  3G7W A;  4ZEF A;  4PFU A;  3TTN A;  4F22 A;  4NED A;  3I3V A;  4P0I A;  1ZKB A;  1MXW A;  3UN6 A;  4H5F A;  3FJM A;  3R26 A;  3M3F A;  4ZEC A;  5I2K B;  2DSF A;  4JB7 A;  2M8C A;  3TQW A;  5FHO A;  5ISU A;  1FTL A;  2VD2 A;  4OMB A;  3I5O A;  4H8I A;  3N5L A;  3KN3 A;  3VV5 A;  2XXV A;  1LFI A;  2YLN A;  4JWO A;  2DXY A;  2ZYO A;  1XS5 A;  2B3B A;  3QAX A;  4NF4 B;  3KOT A;  5JK4 A;  1ZIU A;  4F2O A;  2E0S A;  4FED A;  3UOR A;  1MQG A;  1HSL A;  3FV1 A;  1LCF A;  3G3H A;  4OFJ A;  2Q9T A;  1JW5 A;  3DEL B;  4OTE A;  3RNN A;  5LOM A;  2XXH A;  2F7A A;  3ONM A;  3TYH A;  1J1N A;  4FOR A;  3SEX A;  1Y4T A;  3K02 A;  1RKM A;  1UQW A;  1H44 A;  1IUD A;  3SKP A;  1YAE A;  2HXW A;  3RTW B;  4TOZ A;  5CRY A;  2DP8 A;  1B7H A;  4UAC A;  3MBP A;  2B3F A;  2X7P A;  3SDF A;  2I6E A;  4P11 A;  1I6Q A;  3T9X B;  5KDT B;  2KLF A;  3SER A;  3MVY A;  1UIU A;  3Q28 A;  4LA9 A;  2DQV A;  3UGW A;  2H98 A;  5ITP A;  1NMU A;  3C36 A;  3LSX A;  3PUV E;  1OMP A;  4F18 A;  1A55 A;  2V25 A;  4LZ5 A;  4U22 A;  4ND9 A;  2AIX A;  3OO6 A;  4DXU A;  3UA8 A;  5I84 A;  3TTR A;  4BDM A;  1NFT A;  1EZP A;  2H9B A;  2GFE A;  2PVU A;  4LZ8 A;  1MQH A;  1QVS A;  4TLL B;  1VE4 A;  5AA3 A;  2F97 A;  1A54 A;  1S50 A;  3TDJ A;  3H4Z A;  4KQP A;  4H67 A;  4ZED A;  3O6H A;  3CIJ A;  3RT6 B;  2XHD A;  5L9S A;  3KG2 A;  3EHU A;  1Y3N A;  2QJE A;  2ANJ A;  1CB6 A;  4QF9 A;  2NUV A;  1B1H A;  3K6W A;  3H3G A;  4R6Y A;  5DT6 A;  3KBR A;  4U21 A;  4FAJ A;  2G29 A;  2ZNT A;  1FTM A;  1F9B A;  4FE8 A;  3T93 B;  2X7Q A;  1MY1 A;  2AL5 A;  1SW2 A;  5L8D A;  4TQU Q;  2FA7 A;  2QMX A;  1AIV A;  5M2V A;  3ZSF A;  5DYH A;  1N04 A;  5K2Y A;  3TTM A;  4O3A A;  1FQB A;  2Y7R A;  3RUM A;  3A3C A;  4GFR A;  4H1X A;  1QUL A;  2GHA A;  4HCW A;  3E13 X;  3K4U A;  1Q35 A;  3G3I A;  3RTF B;  3PPR A;  4XIG Q;  4DZ1 A;  2ONR A;  1JVY A;  4OET A;  1JEU A;  4QSD A;  1NH7 A;  4EQ7 A;  3W9V A;  1ZJL A;  3IJO B;  2Y7W A;  1GVC A;  3H6T A;  3LSF B;  1MXZ A;  4EXL A;  1NNT A;  4YKI A;  3VLV A;  1FW0 A;  3OEL A;  3TFL A;  1XVY A;  4EXK A;  3W9W A;  1N7X A;  3TQL A;  1H76 A;  1OLA A;  3QIM A;  4WKM A;  2I0B A;  1B0H A;  5FTI A;  4H5G A;  5IKB A;  1BKA A;  1B7Z A;  3H7M A;  1ANF A;  4QSC A;  4Z7E A;  4JXI A;  4P0G A;  4RXL A;  4F1Y A;  3ILU B;  4IGT A;  2Q8J A;  3LR1 A;  1UIV A;  1SBP A;  1P1Q A;  2Z8D A;  4LZ7 A;  3KSX A;  4FJP A;  3F11 A;  1URD A;  3C32 A;  3PD9 A;  1PDA A;  3GXA A;  4G68 C;  3GBB A;  2RCA A;  1MH4 A;  1IXG A;  2ZXT A;  1TWY A;  3PUX E;  5DEX A;  4M1V A;  1LB9 A;  1LB8 A;  3TCF A;  4JWY A;  1URG A;  3CRB A;  5CMC A;  1EU8 A;  4MH5 A;  4H6D A;  1IXI A;  3UIF A;  5DVF A;  3U72 A;  4F3G A;  5A5X A;  3N6T A;  2DVC A;  1GTK A;  1OLC A;  3TOD A;  2VGQ A;  1IEJ A;  2ESN A;  1IQ7 A;  4ELO A;  3FAT A;  4R6H A;  5CBS A;  1N0T A;  1GGG A;  1II5 A;  1O7T A;  3IB1 A;  2XXX A;  4N6P A;  1UTH A;  4GL0 A;  1OVT A;  3PMV A;  2P1S A;  2I4B A;  4IO3 A;  4XKQ A;  5CBR A;  2HZK A;  3DLN A;  4PE5 B;  4OES A;  3GLB A;  1ZBM A;  1N7W A;  1QUI A;  1PB9 A;  3OOA A;  5H8Q A;  5I56 A;  3V5A A;  2DS9 A;  3CSB A;  4R2F A;  1URS A;  2F5X A;  3TZA A;  2OWT A;  4BDR A;  1OQH A;  1YPN A;  3D4G A;  1YCJ A;  3PMX A;  3IL1 B;  4HW8 A;  3MQ9 A;  1A7L A;  4EUO A;  2RC9 A;  4IO4 A;  3O28 A;  4U1Z A;  4YZZ A;  5K2X A;  3R7X A;  3MZ9 A;  1DTZ A;  1AL3 A;  3D4C A;  3O6G A;  3S2V A;  3SES A;  4DXB A;  1QUJ A;  2D3I A;  1O64 A;  4I8C A;  2UVG A;  4PFT A;  2UVH A;  3S4U A;  1BTJ A;  4KYE A;  3T66 A;  3RN8 A;  4L17 A;  5AA2 A;  3KZG A;  2ONS A;  4BLA A;  5AA4 B;  3T9U A;  3TTK A;  4QFP A;  3QSL A;  1BLF A;  5L9O A;  3N6U A;  4XKR A;  5F1Q A;  2THI A;  2XXY A;  3G3F A;  1B3F A;  1A40 A;  1OIB A;  3T9H B;  3JZJ A;  3IAZ A;  5L9M A;  4GL8 A;  5DVI A;  1EZ9 A;  1JNF A;  3A09 A;  2PMS A;  2V3U A;  4MLV A;  4F19 A;  1JEV A;  5CI5 A;  3E3K A;  5JEI A;  1SQY A;  3PPO A;  5I59 A;  1TFD A;  5B70 A;  2V3T A;  3KSJ A;  4OYV A;  2ZNU A;  3K6U A;  2O69 A;  5AA2 B;  3TUS A;  4PP0 A;  4K3F A;  4PQJ A;  4G2Z A;  4F3P A;  1FCK A;  4YKK A;  3IB0 A;  1B4Z A;  1XC1 A;  5I57 B;  3FVG A;  4LON B;  2XX9 A;  3S9N C;  3R6U A;  3QXM A;  4E0W A;  3CG1 A;  3MWB A;  3PUW E;  4IO7 A;  2REG A;  2DVZ A;  4KPT A;  4POX A;  2F6G A;  3C35 A;  3T22 A;  2F6P A;  3IR1 A;  1FQA A;  1B51 A;  4E0X A;  1USY H;  4LAT A;  5I2N A;  1H43 A;  1TXF A;  3QUF A;  2PX1 A;  4YMB A;  1M5B A;  3PUY E;  1LCT A;  1Y1M A;  3B6Q A;  4IY5 A;  3FD3 A;  2QS1 A;  4XTC Q;  1SD3 A;  5F7V A;  4GIZ A;  2RC8 A;  1N3W A;  3TCG A;  1LFG A;  3K1N A;  1IIW A;  2OK2 A;  5EYF A;  4DE8 A;  3PD8 A;  4NF5 A;  2H4I A;  3H6W A;  3BBR A;  1FTJ A;  1B6H A;  1M5C A;  3G3J A;  3CFZ A;  1R9L A;  2HAU A;  2R6G E;  1D9Y A;  2ZNS A;  2Q88 A;  1EH3 A;  2GHB A;  4OER A;  1EZO A;  3K01 A;  1FQC A;  2AL4 A;  4LQ5 A;  4ESX A;  4X48 A;  4U4X A;  4RK9 A;  1TT1 A;  1MY4 A;  3SEU A;  2AYS A;  3TEP A;  1FQF A;  3C33 A;  4YKP A;  5DVJ A;  3FUZ A;  1ATG A;  2YPN A;  3AXF A;  2FNC A;  1NH8 A;  4DIG A;  1MPB A;  4ZEK A;  2ZYN A;  3DP8 A;  3FVK A;  5H8H A;  4NF5 B;  3EHS A;  3S9E A;  2XD2 A;  4OVJ A;  4OQO A;  4G68 A;  1LFH A;  2DOJ A;  2XX8 A;  3CI8 A;  4DLD A;  4Q0C A;  2QSX A;  3OSR A;  4IGR A;  2ABH A;  2UYE A;  3E9X A;  4I9D A;  4YAH X;  2F78 A;  4ISU A;  2XXR A;  3FXR A;  2Z23 A;  1PBQ A;  3VLW A;  1B9J A;  4I62 A;  4ELR A;  5BWJ A;  3O9P A;  3G3G A;  4ZZE A;  4F1U A;  3IB2 A;  2NVU B;  3KJ7 A;  2OJT A;  4I1D A;  4X9T A;  1Y9U A;  1T0K A;  1MY0 A;  2Z8F A;  2F7B A;  4EF1 A;  4MBP A;  3MP1 A;  2PBW A;  1VSO A;  3SEV A;  1B2H A;  1JW1 A;  5CC2 A;  2I3V A;  2ZYK A;  3O97 A;  5H8H B;  5FTH A;  1B5I A;  1JW4 A;  2OCU A;  1R9Q A;  2Y7I A;  4Q30 B;  1RYO A;  2O7U A; 
#chains in the Genus database with same CATH topology
 3U92 A;  1LLS A;  3H06 B;  3FGS A;  1YXI A;  2OZZ A;  1GR2 A;  3PU5 A;  4FIM A;  3VE1 B;  3IO4 A;  3MC2 A;  1ZLQ A;  2HXR A;  3ECR A;  2YJP A;  2V84 A;  2H5Y A;  3BKI B;  1LEV A;  1QW0 A;  1USY E;  4NWC A;  3LSW A;  3Q29 A;  1D3K A;  1NUY A;  3IOW A;  4MFI A;  4NAP A;  1DTG A;  3Q27 A;  3VDF A;  4MJO A;  2H25 A;  4H65 A;  4PAK A;  2HQ0 A;  4YIC A;  3GYY A;  2XXI A;  1JP4 A;  1VFE A;  4PDD A;  3HST A;  3B7D A;  3SEY A;  2X26 A;  4OVS A;  1AOV A;  2FIX A;  4YB5 A;  2WYK A;  1SPI A;  1SI0 A;  2PFZ A;  1JET A;  2RC7 A;  1NV3 A;  3MP6 A;  1XVX A;  1FPB A;  4GX3 A;  1B4H A;  2F36 A;  3HO7 A;  5CMB A;  1DOT A;  4KCD A;  1WOD A;  4R6K A;  2D21 A;  2DWA A;  3FAS A;  4R9G A;  4PC9 A;  2ZZW A;  2R71 A;  4KD5 A;  1M5F A;  3N94 A;  4BDN A;  1FTO A;  1POT A;  4KCC A;  5JTY A;  1I6A A;  5FBP A;  3GBA A;  3H6V A;  3ILT B;  4QFL A;  1US4 A;  4XEQ A;  4JWX A;  5ELV A;  1Z7N E;  1FBC A;  3O66 A;  1FQE A;  3ZKK A;  1G0I A;  4PAI A;  3KJT A;  4RNS A;  3KGC A;  5H8N A;  2XD3 A;  4PFW A;  1XT8 A;  3EF7 A;  4JBZ A;  4P47 A;  1LAH E;  5IGA A;  1FBD A;  1D4N A;  1L5T A;  3RGY A;  4YKJ A;  5J16 A;  4LN5 A;  4NG7 A;  3FXU A;  2QS2 A;  1QGX A;  2I58 A;  3H03 A;  2OWS A;  3PV0 E;  1Y1Z A;  1PEB A;  2HAV A;  4KFQ A;  4MF3 A;  1MM6 A;  4IR8 A;  4PAF A;  3SET A;  1IIT A;  1PBP A;  3T96 B;  4AB5 A;  5DW8 A;  5DEX B;  5EHM A;  4U23 A;  1FPL A;  2BJJ X;  2H99 A;  4RJZ A;  4RK2 A;  2OWZ A;  3Q25 A;  5FHN A;  2FIE A;  1US5 A;  3DM0 A;  5EYH A;  2QMW A;  4FEB A;  5IZZ A;  2O51 A;  4POW A;  4G8N A;  3P7I A;  1JQF A;  3LUY A;  3HN0 A;  1UTB A;  1BK4 A;  3DP4 A;  5A5X B;  3MST A;  2O1L A;  4QFO A;  2NWJ A;  4AQ4 A;  4DCY A;  1MXU A;  4F29 A;  3TTL A;  4GLI A;  2QPQ A;  4I3E A;  4NE4 A;  4X8R A;  4EF2 A;  1DMB A;  4NTL A;  4AS5 A;  1LAX A;  2V3Q A;  4HTG A;  1UTH B;  4XXU A;  1FPE A;  2Z8E A;  3BIG A;  3IO6 A;  3HHG A;  1SYI A;  1NNP A;  2I48 A;  1NV4 A;  4JVD A;  1LGB C;  5H8F A;  2DWI A;  1IXC A;  1LBV A;  1LAG E;  1P1W A;  3SEW A;  1B5J A;  5H8Q B;  2UXA A;  4ZEB A;  5I56 B;  4RYA A;  3QMF A;  3KBZ A;  4IO6 A;  1UTB B;  3G3K A;  4QXD A;  3WAE A;  1P1N A;  5TP9 A;  3PMW A;  1FQD A;  5KCJ A;  3HV1 A;  1A8E A;  1FJ6 A;  4P9K A;  3RYD A;  3TEL A;  1B5H A;  2XX7 A;  3B6W A;  4NHB A;  4IO5 A;  4THI A;  4O7I A;  2F7C A;  2Y7P A;  2XXW A;  2O84 X;  4H8J A;  3IK6 B;  4YU0 A;  1PB7 A;  1B32 A;  4ELP A;  3W15 C;  4EDP A;  1MY3 A;  3PUZ E;  4QRZ A;  1CNQ A;  4FAT A;  1N3X A;  4O7M A;  2Y5L A;  4XKP A;  4MIJ A;  4PF6 A;  1EYJ A;  2RCB A;  1DSN A;  2R9J A;  3A29 A;  4X1B A;  3PPP A;  4N8Y A;  5H8F B;  2ALU A;  4F2Q A;  1IMC A;  1Z7M E;  2W7Y A;  3RPL B;  3FJG A;  5J1D A;  2HEU A;  3C31 A;  4EQ9 A;  4AS4 A;  1Y20 A;  3HHF A;  3PPN A;  1A8F A;  1P99 A;  1LBB A;  5I2K A;  2CZL A;  1B0L A;  1KA0 A;  2VHA A;  4GOT A;  3DP6 A;  1IMA A;  3PPQ A;  4DCX A;  3EN3 A;  3THI A;  1Y4C A;  4KI0 E;  2RF1 A;  4LUB A;  3TKD A;  4BDQ A;  2P2A A;  4N13 A;  4NF4 A;  3CFL A;  2O7I A;  1XHY A;  1HSJ A;  4F1V A;  4R73 A;  2PT2 A;  4EQB A;  3LUZ A;  1YZ0 A;  4KYS A;  4N07 A;  2HCA A;  2GQ1 A;  3CHG A;  4FBP A;  3V83 A;  3LC8 A;  5F24 A;  3M3L A;  3FV2 A;  3FVN A;  5I58 A;  5I59 B;  1B40 A;  3LBS A;  5CMM A;  3K6X A;  5IAI A;  1FBE A;  3MJN A;  3PGF A;  1IMF A;  1MPC A;  4DXC A;  1SW5 A;  5HPQ A;  2NXO A;  4JDF A;  3I6V A;  3VVD A;  3U8Q A;  4GWY A;  4O3B A;  1B58 A;  3HCQ A;  4HCY A;  1IXH A;  4OHN A;  2P0S A;  1B1X A;  1MRP A;  1MPD A;  4GVO A;  2XWO A;  4YB7 A;  4NQ8 A;  1MQI A;  3C4M A;  4OVT A;  5HBC A;  2E1S A;  4G8H A;  1B3G A;  4DDD A;  4OVQ A;  5KDT A;  3KFM A;  1MM7 A;  1MG1 A;  1CE2 A;  4PET A;  5I2N B;  3M8U A;  3OO9 A;  4NWD A;  3QYT A;  3M3K A;  2PYY A;  1NV5 A;  2XXU A;  3BFT A;  3MVX A;  2QS4 A;  5I58 B;  3CVG A;  3K00 A;  4HS7 A;  5ET5 A;  2G93 A;  1ELJ A;  2DWJ A;  2DYX A;  3OEN A;  2B65 A;  4OAN A;  2GH9 A;  4H46 A;  1I69 A;  4OXV A;  1TFA A;  3LSL A;  3IX1 A;  2OLB A;  3MW0 A;  4MNI A;  1JVX A;  3D1R A;  2V4C A;  1QJM A;  3CR9 A;  2V93 A;  3FBP A;  2VOZ A;  2Q8M A;  1QKB A;  4ZE9 A;  3TPA A;  2UVI A;  4IY6 A;  1SVX B;  5EYG A;  4MHF A;  2RKM A;  1MY2 A;  5TPA A;  2Y7K A;  1SW4 A;  4KHZ E;  3E79 A;  3VLU A;  3Q26 A;  4GWO A;  1XOC A;  3EQ1 A;  2L5V A;  2XWV A;  3FIR A;  4TLM B;  1LBW A;  1VFD A;  3KEI A;  4PFR A;  5EQ9 A;  2QL3 A;  4GBV A;  2XWK A;  5AA2 D;  4OWD A;  4PF8 A;  2FHY A;  1DK4 A;  3K0V A;  3RQT A;  2NOO A;  1NV2 A;  3T0J A;  3TMG A;  1NNF A;  4RA1 A;  5I7I A;  2HFB A;  3O2A A;  3FJ7 A;  2RIN A;  4F31 B;  3K6V A;  1SDX A;  5HM4 B;  2Q89 A;  4WEP A;  1ZTY A;  3ODB A;  4P1L A;  3JV9 A;  3QK6 A;  3N26 A;  4OFL A;  3FXQ A;  2GRV A;  3TAJ A;  3S9L C;  5ICT A;  1MQJ A;  4G68 B;  4FEC A;  2D5W A;  3MYU A;  2HHM A;  2F34 A;  4X1D A;  1EYI A;  4QSE A;  1A99 A;  4IO2 A;  4PFY A;  3UK4 A;  4GF8 A;  1M5D A;  1FPK A;  1YTV A;  3V8X B;  4DI4 B;  5TPA B;  4C0R A;  5KZT A;  2UVJ A;  2F8D A;  4GXS B;  3U1O A;  4F39 A;  4QFN A;  4NMY A;  3RLF E;  4RPO A;  4XFE A;  3V89 B;  2B4M A;  4QHQ A;  5AA1 A;  4G4P A;  1FRP A;  2I49 A;  3K2D A;  3VXC A;  4C1T A;  2HPG A;  1MQD A;  4MNC A;  4ZE8 A;  1HSE A;  4N91 A;  2F3B A;  2CEX A;  3U94 A;  2CMO A;  3KN8 A;  1Q1K A;  1H45 A;  3EHT A;  5EHS A;  3MVW A;  4I40 A;  1GV8 A;  1D9Q A;  2IEE A;  3QUJ A;  2Y84 A;  3MZ1 A;  3RT8 A;  2QRY A;  1I6B A;  3IJX B;  5ITO A;  2FBP A;  3OD7 A;  4ELQ A;  5B7D A;  5H8S A;  3OSQ A;  1FBG A;  4GX6 A;  1R1N A;  1MDQ A;  2PFY A;  3GZG A;  1B3E A;  2XXP A;  1QUK A;  3B6T A;  2OBG A;  3CFX A;  4ZS9 A;  1ZU0 A;  5LTC A;  1LAF E;  4AB6 A;  1NV0 A;  3EPE A;  3O6I A;  4O94 A;  1AH5 A;  2PT1 A;  4UAB A;  3KOS A;  3FVO A;  2BJI A;  5TU0 A;  1NL5 A;  3FZV A;  4G77 A;  4WXJ A;  3MUQ A;  1PC3 A;  4I3Y A;  1R6Z A;  1S7Y A;  2Z22 A;  1MXY A;  3OEM A;  4OFO A;  1WDN A;  4ZEI A;  3K1P A;  4ZDM A;  1FTA A;  1H3D A;  4RY1 A;  1LST A;  3CG3 A;  3E4R A;  3OEK A;  3JYR A;  2QS3 A;  5JTY B;  3HPI A;  3L6H A;  4JSD A;  3VVE A;  4JSO A;  4LP2 B;  3VVF A;  3O29 A;  4OEU A;  3KN7 A;  4HE2 A;  4BDO A;  3T9V A;  3K1M A;  4ESW A;  1BIY A;  2VD3 A;  5BUU A;  2Q2A A;  3OXN A;  1AWB A;  4WED A;  3OO7 A;  2O1M A;  1Y3Q A;  3U93 A;  1QKA A;  5H8N B;  4PFB A;  4UA8 A;  4Z0I A;  4YB6 A;  1O63 A;  3ZS6 A;  1FTK A;  4Q5T A;  2I4C A;  1MS7 A;  1DPP A;  1B46 A;  4MLQ A;  4ECF A;  2P3N A;  2KR0 A;  5ICQ A;  1B3L A;  3VFJ A;  2REJ A;  1NKX A;  4N6K A;  2UYF A;  4N17 A;  1SW1 A;  2LAO A;  2WKY A;  2IA4 A;  4U4S A;  1P1U A;  4P1E A;  3ZKL A;  4R9F A;  3BFU A;  3H6U A;  3TCH A;  1NNK A;  2XXQ A;  1WVJ A;  1RYX A;  5AA4 A;  1ZMG A;  3FXB A;  4U1O A;  2A5S A;  2O68 A;  1D9V A;  1LBX A;  3B50 A;  3MZB A;  4U2R A;  3WAF A;  4NF6 A;  4GRK A;  4P3L A;  3IOU A;  4XKN A;  5I5P A;  1MXX A;  4X04 A;  3USD A;  2ONK E;  3MP8 A;  4OZ9 A;  1NUX A;  4R72 A;  2F35 A;  4PTK A;  4GD5 A;  5AE4 A;  1PB8 A;  2FYI A;  3IOT A;  4R75 A;  4H0W A;  4LQ2 A;  2CZK A;  1P1O A;  3MPL A;  1BP5 A;  1MH3 A;  1B52 A;  2DE3 A;  1POY 1;  3MPK A;  1M5E A;  1OVB A;  1KWH A;  2HZL A;  2XXT A;  4IB2 A;  4NF8 A;  1IMB A;  3C9H A;  3RPW A;  3OO8 A;  4GQO A;  4R2B A;  2I3W A;  3CSG A;  4GXA A;  5DTB A;  1MXV A;  1Y3P A;  3VXB A;  5CM6 A;  3OMB A;  4BDL A;  4YMA A;  3E78 A;  1N84 A;  2VP1 A;  2A5T A;  5I57 A;  4NF6 B;  2ZMB A;  2I0C A;  1AMF A;  4LVQ A;  4ONY A;  2FVZ A;  4GWS A;  4OVR A;  3S9M C;  3NOH A;  4Q8R A;  1OQG A;  1IZ1 A;  1FPG A;  2DE2 A;  3UP9 A;  5FHM A;  4RPN A;  1LBZ A;  1SYH A;  2DE4 A;  3MVZ A;  2Q2C A;  4R74 A;  3IOV A;  2CEY A;  4KR5 A;  5CMK A;  2DWH A;  4N81 A;  3MAM A;  4QFK A;  5TP9 B;  1KA1 A;  4ZZA A;  3L6G A;  5KCJ B;  1VR5 A;  3RY3 A;  4F3B A;  1S9T A;  3C34 A;  3A3U A;  1MDP 1;  1N76 A;  2DXR A;  4OEV A;  4OEN A;  1B3H A;  2F3D A;  4KYD A;  4NF8 B;  4F3S A;  4O3C A;  2ZYM A;  4G8M A;  1B05 A;  2ZZX A;  1SI1 A;  4N6D A;  3IOR A;  1DPE A;  4C1U A;  2A5T B;  1B7U A;  4M4G A;  2XA5 A;  1LBC A;  2O6A A;  4PFI A;  3G7W A;  4ZEF A;  4PFU A;  3TTN A;  4F22 A;  4NED A;  3I3V A;  4P0I A;  1ZKB A;  1MXW A;  1G0H A;  3UN6 A;  4H5F A;  3FJM A;  4KXP A;  2CZH A;  3R26 A;  3M3F A;  4ZEC A;  5I2K B;  5ET7 A;  2DSF A;  4JB7 A;  2M8C A;  3TQW A;  5FHO A;  5ISU A;  1FTL A;  2VD2 A;  4OMB A;  3I5O A;  4H8I A;  3N5L A;  3KN3 A;  2XXV A;  3VV5 A;  1LFI A;  2YLN A;  4JWO A;  2DXY A;  2ZYO A;  1XS5 A;  1DBZ A;  2WEF A;  1RDX A;  2B3B A;  3QAX A;  4NF4 B;  3KOT A;  5JK4 A;  1ZIU A;  4F2O A;  2E0S A;  4FED A;  3UOR A;  1MQG A;  1HSL A;  3FV1 A;  4JVC A;  1LCF A;  3G3H A;  2WX9 A;  4OFJ A;  2Q9T A;  1JW5 A;  1NV7 A;  3DEL B;  4OTE A;  3RNN A;  2QFL A;  5LOM A;  4GX4 A;  1XI6 A;  2XXH A;  3T1B A;  2F7A A;  3ONM A;  4PBQ A;  5T3J A;  3TYH A;  1J1N A;  4FOR A;  3SEX A;  1Y4T A;  3K02 A;  1RKM A;  1UQW A;  1H44 A;  1IUD A;  3SKP A;  2WBD A;  1YAE A;  2HXW A;  1FBH A;  3RTW B;  3ROJ A;  1LBY A;  4TOZ A;  5CRY A;  2DP8 A;  1B7H A;  4UAC A;  3MBP A;  2B3F A;  2X7P A;  3SDF A;  2I6E A;  4P11 A;  1I6Q A;  3T9X B;  5KDT B;  4PCD A;  4GWU A;  2KLF A;  3SER A;  3MVY A;  4XF5 A;  1UIU A;  3Q28 A;  4LA9 A;  4PBH A;  2DQV A;  4HE1 A;  4MCO A;  3UGW A;  2H98 A;  5ITP A;  1NMU A;  3C36 A;  3LSX A;  3PUV E;  2MKZ A;  1OMP A;  4F18 A;  1A55 A;  2V25 A;  4LZ5 A;  4U22 A;  4ND9 A;  2AIX A;  3OO6 A;  4N8G A;  3UA8 A;  4DXU A;  5I84 A;  3TTR A;  4BDM A;  2WBB A;  1NFT A;  1EZP A;  2H9B A;  2GFE A;  2PVU A;  4LZ8 A;  1MQH A;  1QVS A;  4PGN A;  4TLL B;  1VE4 A;  5AA3 A;  2F97 A;  1A54 A;  1S50 A;  3TDJ A;  1Q9D A;  3H4Z A;  4KQP A;  4H67 A;  4ZED A;  3O6H A;  4NN3 A;  3CIJ A;  3RT6 B;  2XHD A;  5L9S A;  2WYP A;  3KG2 A;  3EHU A;  1Y3N A;  2QJE A;  2ANJ A;  1IME A;  1CB6 A;  4QF9 A;  2NUV A;  1B1H A;  3K6W A;  3H3G A;  4R6Y A;  5IZ3 A;  4GBW A;  5DT6 A;  3KBR A;  4U21 A;  4FAJ A;  2G29 A;  2ZNT A;  1FTM A;  1F9B A;  4FE8 A;  3T93 B;  2VPO A;  2X7Q A;  4PE3 A;  1MY1 A;  2AL5 A;  1SW2 A;  5L8D A;  4TQU Q;  2FA7 A;  2QMX A;  1AIV A;  1FPI A;  5M2V A;  3ZSF A;  5DYH A;  1N04 A;  5K2Y A;  3TTM A;  4O3A A;  1FQB A;  2Y7R A;  3RUM A;  3A3C A;  4GFR A;  4H1X A;  1QUL A;  2GHA A;  4HCW A;  3LV0 A;  3E13 X;  3K4U A;  1Q35 A;  3G3I A;  3PPR A;  3RTF B;  4XIG Q;  4DZ1 A;  2ONR A;  1JVY A;  4OET A;  1JEU A;  4QSD A;  1NH7 A;  4EQ7 A;  3W9V A;  1ZJL A;  3IJO B;  2Y7W A;  1GVC A;  3H6T A;  5IZ3 B;  3LSF B;  1MXZ A;  4EXL A;  1NNT A;  4YKI A;  3VLV A;  1FW0 A;  3OEL A;  3TFL A;  1XVY A;  4EXK A;  3W9W A;  1N7X A;  3TQL A;  1H76 A;  1OLA A;  2JJK A;  3QIM A;  4WKM A;  2I0B A;  3ISP A;  1B0H A;  4G61 A;  5FTI A;  4H5G A;  5IKB A;  1BKA A;  1B7Z A;  3H7M A;  1ANF A;  4QSC A;  4Z7E A;  4JXI A;  4P0G A;  4RXL A;  4F1Y A;  3ILU B;  5EQA A;  4IGT A;  2Q8J A;  3LR1 A;  4N4U A;  2PCR A;  1UIV A;  5ET6 A;  1SBP A;  1P1Q A;  5LDZ A;  1FJ9 A;  2Z8D A;  4LZ7 A;  3KSX A;  4PDH A;  4FJP A;  1RDY A;  3F11 A;  1URD A;  2QVV A;  2XWI A;  3C32 A;  3PD9 A;  1PDA A;  3GXA A;  4G68 C;  2QVU A;  3GBB A;  2RCA A;  1MH4 A;  1IXG A;  2ZXT A;  1TWY A;  3PUX E;  4P8B A;  5DEX A;  4M1V A;  1LB9 A;  1LB8 A;  1URG A;  4JWY A;  3TCF A;  3CRB A;  2Y5K A;  5CMC A;  1EU8 A;  1FPJ A;  4MH5 A;  4H6D A;  1IXI A;  3UIF A;  5DVF A;  3U72 A;  4HXV A;  2QVR A;  4F3G A;  5A5X A;  3N6T A;  2DVC A;  1GTK A;  1OLC A;  3TOD A;  2VGQ A;  4MEV A;  1IEJ A;  2ESN A;  1IQ7 A;  4ELO A;  1RDZ A;  3FAT A;  4R6H A;  5CBS A;  1N0T A;  5IM2 A;  1GGG A;  1VDW A;  1II5 A;  3B8B A;  1O7T A;  3IB1 A;  2XXX A;  4N6P A;  1UTH A;  4GL0 A;  1OVT A;  3PMV A;  2P1S A;  2I4B A;  4IO3 A;  4NGU A;  5EQ8 A;  4XKQ A;  5CBR A;  2HZK A;  3DLN A;  3IFC A;  4OES A;  4PE5 B;  3GLB A;  1ZBM A;  1N7W A;  1QUI A;  4JVI A;  1PB9 A;  3OOA A;  5H8Q A;  5I56 A;  2CZI A;  3V5A A;  2DS9 A;  3CSB A;  4R2F A;  1NUZ A;  1URS A;  2F5X A;  3TZA A;  2OWT A;  4BDR A;  5ET8 A;  1OQH A;  1DCU A;  1YPN A;  3D4G A;  1YCJ A;  3PMX A;  4OVP A;  3IL1 B;  4HW8 A;  3MQ9 A;  4N15 A;  5ESY A;  1A7L A;  4EUO A;  2RC9 A;  4IO4 A;  3O28 A;  4U1Z A;  4YZZ A;  5K2X A;  3R7X A;  3MZ9 A;  1DTZ A;  1AL3 A;  3D4C A;  3O6G A;  3S2V A;  3SES A;  4DXB A;  1QUJ A;  2D3I A;  1FBP A;  1O64 A;  3BIH A;  2P3V A;  4I8C A;  2UVG A;  4PFT A;  3RPL A;  2UVH A;  3S4U A;  1BTJ A;  4KYE A;  3T66 A;  4NX1 A;  3RN8 A;  4L17 A;  5AA2 A;  1NI9 A;  3KZG A;  2ONS A;  4BLA A;  5AA4 B;  3T9U A;  1KZ8 A;  4PGP A;  3TTK A;  4QFP A;  3QSL A;  5IZ1 A;  1BLF A;  2KQZ A;  5L9O A;  3N6U A;  4XKR A;  5F1Q A;  2THI A;  2XXY A;  3G3F A;  1B3F A;  1A40 A;  3PTY A;  1OIB A;  3T9H B;  3JZJ A;  3IAZ A;  5L9M A;  4GL8 A;  4GWW A;  5DVI A;  1EZ9 A;  4GWZ A;  1JNF A;  3A09 A;  2PMS A;  2V3U A;  4MLV A;  4F19 A;  1JEV A;  5CI5 A;  3E3K A;  5JEI A;  1SQY A;  3KC0 A;  2R8T A;  3PPO A;  5I59 A;  1TFD A;  5B70 A;  2V3T A;  3KSJ A;  4OYV A;  2ZNU A;  3K6U A;  2O69 A;  5AA2 B;  3TUS A;  3EKI A;  4PP0 A;  4K3F A;  4OA4 A;  4PQJ A;  4G2Z A;  4F3P A;  1FCK A;  4YKK A;  3IB0 A;  1B4Z A;  1XC1 A;  5I57 B;  3FVG A;  4LON B;  2XX9 A;  3S9N C;  3R6U A;  3QXM A;  4E0W A;  4MNP A;  3CG1 A;  3MWB A;  5I3S A;  3PUW E;  4IO7 A;  2REG A;  2DVZ A;  4MAG A;  4KPT A;  4POX A;  2F6G A;  1NUW A;  3C35 A;  1EYK A;  3T22 A;  2F6P A;  3IR1 A;  1FQA A;  1B51 A;  4E0X A;  1USY H;  4LAT A;  5I2N A;  1H43 A;  5EQ7 A;  1K9Z A;  1TXF A;  2VPN A;  3QUF A;  2PX1 A;  4YMB A;  1M5B A;  3PUY E;  1LCT A;  1Y1M A;  3B6Q A;  4IY5 A;  3FD3 A;  2QS1 A;  4P56 A;  4XTC Q;  1SD3 A;  5F7V A;  4GIZ A;  2RC8 A;  1INP A;  4O8M A;  1N3W A;  5A5L A;  4HE0 A;  2B4L A;  1LFG A;  3TCG A;  3K1N A;  2ZZV A;  3U65 A;  2DDK A;  1IIW A;  2OK2 A;  5EYF A;  4DE8 A;  3PD8 A;  4NF5 A;  2H4I A;  3H6W A;  3BBR A;  1FTJ A;  1B6H A;  1M5C A;  3G3J A;  3CFZ A;  1R9L A;  2XXK A;  4QBA A;  2HAU A;  2R6G E;  1D9Y A;  2ZNS A;  2Q88 A;  1EH3 A;  2GHB A;  4OER A;  1IMD A;  1EZO A;  3K01 A;  1FQC A;  2AL4 A;  4LQ5 A;  4ESX A;  4X48 A;  4U4X A;  4RK9 A;  1TT1 A;  1MY4 A;  3SEU A;  1NV6 A;  2AYS A;  3TEP A;  1FQF A;  3C33 A;  4YKP A;  5DVJ A;  3FUZ A;  1ATG A;  2YPN A;  3IFA A;  3AXF A;  2OX3 A;  2FNC A;  1NH8 A;  4DI3 D;  4DIG A;  1MPB A;  4ZEK A;  2ZYN A;  3DP8 A;  3FVK A;  5H8H A;  4NF5 B;  1FPF A;  3EHS A;  3S9E A;  2XD2 A;  4OVJ A;  4OQO A;  4G68 A;  1LFH A;  2DOJ A;  2XX8 A;  1FPD A;  3CI8 A;  4DLD A;  4Q0C A;  2QSX A;  3OSR A;  4IGR A;  1FSA A;  2ABH A;  2UYE A;  3E9X A;  4I9D A;  4YAH X;  2F78 A;  4ISU A;  2XXR A;  3FXR A;  2Z23 A;  1PBQ A;  3VLW A;  1B9J A;  4I62 A;  4ELR A;  5BWJ A;  3O9P A;  3G3G A;  4ZZE A;  4F1U A;  3IB2 A;  2NVU B;  3KJ7 A;  2OJT A;  3KC1 A;  3SZP A;  4I1D A;  4X9T A;  1Y9U A;  4H45 A;  4NF0 A;  1T0K A;  4MX6 A;  4GWX A;  1MY0 A;  2Z8F A;  2F7B A;  1YYZ A;  4EF1 A;  4MBP A;  3MP1 A;  2PBW A;  1VSO A;  3SEV A;  1B2H A;  1JW1 A;  5CC2 A;  1K9Y A;  2I3V A;  2ZYK A;  3O97 A;  4MMP A;  2Q74 A;  1NV1 A;  5H8H B;  2VT5 A;  5FTH A;  1B5I A;  3HFU A;  1JW4 A;  2OCU A;  1R9Q A;  1FBF A;  2Y7I A;  4Q30 B;  1RYO A;  2O7U A; 
#chains in the Genus database with same CATH homology
 3U92 A;  1LLS A;  3H06 B;  3FGS A;  2OZZ A;  1GR2 A;  3PU5 A;  4FIM A;  3VE1 B;  3IO4 A;  3MC2 A;  1ZLQ A;  3ECR A;  2YJP A;  2V84 A;  2H5Y A;  3BKI B;  1QW0 A;  1USY E;  4NWC A;  3LSW A;  3Q29 A;  1D3K A;  3IOW A;  4MFI A;  1DTG A;  3Q27 A;  3VDF A;  2H25 A;  4H65 A;  2HQ0 A;  4YIC A;  2XXI A;  1VFE A;  3HST A;  3B7D A;  3SEY A;  2X26 A;  1AOV A;  4YB5 A;  1SI0 A;  1JET A;  2RC7 A;  3MP6 A;  1XVX A;  1B4H A;  2F36 A;  3HO7 A;  5CMB A;  1DOT A;  4KCD A;  1WOD A;  4R6K A;  2D21 A;  2DWA A;  3FAS A;  4R9G A;  2R71 A;  4KD5 A;  1M5F A;  3N94 A;  4BDN A;  1FTO A;  1POT A;  4KCC A;  5JTY A;  1I6A A;  3GBA A;  3H6V A;  3ILT B;  4QFL A;  1US4 A;  4JWX A;  5ELV A;  1Z7N E;  3O66 A;  1FQE A;  3ZKK A;  3KJT A;  4RNS A;  3KGC A;  5H8N A;  2XD3 A;  4PFW A;  1XT8 A;  3EF7 A;  4JBZ A;  1LAH E;  1D4N A;  1L5T A;  3RGY A;  4YKJ A;  3FXU A;  2QS2 A;  2I58 A;  3H03 A;  2OWS A;  3PV0 E;  1Y1Z A;  1PEB A;  2HAV A;  4KFQ A;  4MF3 A;  1MM6 A;  3SET A;  1IIT A;  1PBP A;  3T96 B;  4AB5 A;  5DEX B;  5EHM A;  4U23 A;  2BJJ X;  2H99 A;  4RJZ A;  4RK2 A;  3Q25 A;  5FHN A;  1US5 A;  3DM0 A;  2QMW A;  4FEB A;  2O51 A;  4POW A;  4G8N A;  3P7I A;  1JQF A;  3LUY A;  3HN0 A;  1UTB A;  5A5X B;  3DP4 A;  2O1L A;  4QFO A;  2NWJ A;  4AQ4 A;  4DCY A;  1MXU A;  4F29 A;  3TTL A;  4GLI A;  2QPQ A;  4NE4 A;  4EF2 A;  1DMB A;  4NTL A;  1LAX A;  2V3Q A;  4HTG A;  1UTH B;  4XXU A;  2Z8E A;  3IO6 A;  3HHG A;  1SYI A;  1NNP A;  2I48 A;  1LGB C;  5H8F A;  2DWI A;  1IXC A;  1LAG E;  1P1W A;  3SEW A;  1B5J A;  5H8Q B;  2UXA A;  4ZEB A;  5I56 B;  4RYA A;  4IO6 A;  1UTB B;  3G3K A;  3WAE A;  1P1N A;  5TP9 A;  3PMW A;  1FQD A;  5KCJ A;  3HV1 A;  1A8E A;  3TEL A;  1B5H A;  2XX7 A;  3B6W A;  4IO5 A;  4THI A;  2F7C A;  2Y7P A;  2XXW A;  2O84 X;  4H8J A;  3IK6 B;  4YU0 A;  1PB7 A;  1B32 A;  4ELP A;  3W15 C;  4EDP A;  1MY3 A;  3PUZ E;  4QRZ A;  4FAT A;  1N3X A;  4XKP A;  2RCB A;  1DSN A;  2R9J A;  4X1B A;  3PPP A;  5H8F B;  2ALU A;  4F2Q A;  1Z7M E;  2W7Y A;  3FJG A;  5J1D A;  2HEU A;  3C31 A;  4EQ9 A;  1Y20 A;  3HHF A;  3PPN A;  1A8F A;  1P99 A;  1LBB A;  5I2K A;  2CZL A;  1B0L A;  2VHA A;  4GOT A;  3DP6 A;  3PPQ A;  4DCX A;  3EN3 A;  3THI A;  1Y4C A;  4KI0 E;  2RF1 A;  4LUB A;  3TKD A;  4BDQ A;  2P2A A;  4N13 A;  4NF4 A;  3CFL A;  2O7I A;  1XHY A;  1HSJ A;  4F1V A;  4R73 A;  2PT2 A;  4EQB A;  4KYS A;  4N07 A;  2HCA A;  3V83 A;  3LC8 A;  3M3L A;  3FV2 A;  3FVN A;  5I58 A;  5I59 B;  1B40 A;  3LBS A;  5CMM A;  3K6X A;  5IAI A;  3MJN A;  3PGF A;  1MPC A;  4DXC A;  1SW5 A;  5HPQ A;  2NXO A;  4JDF A;  3I6V A;  3VVD A;  3U8Q A;  4O3B A;  1B58 A;  3HCQ A;  4HCY A;  1IXH A;  4OHN A;  2P0S A;  1B1X A;  1MRP A;  1MPD A;  4GVO A;  4YB7 A;  1MQI A;  3C4M A;  5HBC A;  2E1S A;  4G8H A;  1B3G A;  4DDD A;  5KDT A;  3KFM A;  1MM7 A;  1MG1 A;  1CE2 A;  4PET A;  5I2N B;  3M8U A;  3OO9 A;  4NWD A;  3QYT A;  3M3K A;  2PYY A;  2XXU A;  3BFT A;  3MVX A;  2QS4 A;  5I58 B;  3CVG A;  3K00 A;  4HS7 A;  2G93 A;  1ELJ A;  2DWJ A;  2DYX A;  3OEN A;  2B65 A;  2GH9 A;  1I69 A;  4OXV A;  1TFA A;  3LSL A;  3IX1 A;  2OLB A;  3MW0 A;  1JVX A;  1QJM A;  3CR9 A;  2V93 A;  2VOZ A;  1QKB A;  4ZE9 A;  3TPA A;  2UVI A;  4IY6 A;  1SVX B;  2RKM A;  1MY2 A;  5TPA A;  2Y7K A;  1SW4 A;  4KHZ E;  3VLU A;  3Q26 A;  4GWO A;  1XOC A;  3EQ1 A;  3FIR A;  4TLM B;  1VFD A;  3KEI A;  2QL3 A;  5AA2 D;  4OWD A;  3K0V A;  3RQT A;  2NOO A;  3TMG A;  1NNF A;  4RA1 A;  2HFB A;  3O2A A;  3FJ7 A;  2RIN A;  4F31 B;  3K6V A;  1SDX A;  5HM4 B;  2Q89 A;  4WEP A;  1ZTY A;  3ODB A;  3JV9 A;  3QK6 A;  3N26 A;  4OFL A;  3FXQ A;  2GRV A;  3TAJ A;  3S9L C;  5ICT A;  1MQJ A;  4G68 B;  4FEC A;  2D5W A;  2F34 A;  4X1D A;  4QSE A;  1A99 A;  4IO2 A;  4PFY A;  3UK4 A;  4GF8 A;  1M5D A;  1YTV A;  3V8X B;  5TPA B;  4C0R A;  5KZT A;  2UVJ A;  2F8D A;  4GXS B;  3U1O A;  4F39 A;  4QFN A;  4NMY A;  3RLF E;  4RPO A;  3V89 B;  4QHQ A;  5AA1 A;  4G4P A;  2I49 A;  3K2D A;  3VXC A;  4C1T A;  1MQD A;  4ZE8 A;  1HSE A;  3U94 A;  2CMO A;  3KN8 A;  1Q1K A;  1H45 A;  3EHT A;  5EHS A;  3MVW A;  1GV8 A;  2IEE A;  3QUJ A;  2Y84 A;  3MZ1 A;  3RT8 A;  2QRY A;  1I6B A;  3IJX B;  5ITO A;  3OD7 A;  4ELQ A;  5B7D A;  5H8S A;  3OSQ A;  1R1N A;  1MDQ A;  3GZG A;  1B3E A;  2XXP A;  1QUK A;  3B6T A;  2OBG A;  3CFX A;  4ZS9 A;  1ZU0 A;  1LAF E;  4AB6 A;  3EPE A;  3O6I A;  1AH5 A;  2PT1 A;  3KOS A;  3FVO A;  5TU0 A;  1NL5 A;  3FZV A;  4G77 A;  4WXJ A;  3MUQ A;  1PC3 A;  1R6Z A;  1S7Y A;  2Z22 A;  1MXY A;  3OEM A;  4OFO A;  1WDN A;  4ZEI A;  3K1P A;  4ZDM A;  1H3D A;  4RY1 A;  1LST A;  3CG3 A;  3E4R A;  3OEK A;  3JYR A;  2QS3 A;  5JTY B;  3HPI A;  3L6H A;  4JSD A;  3VVE A;  4JSO A;  4LP2 B;  3VVF A;  3O29 A;  4OEU A;  3KN7 A;  4BDO A;  3T9V A;  3K1M A;  4ESW A;  1BIY A;  2VD3 A;  5BUU A;  2Q2A A;  3OXN A;  4WED A;  3OO7 A;  2O1M A;  1Y3Q A;  3U93 A;  1QKA A;  5H8N B;  4UA8 A;  4Z0I A;  4YB6 A;  1O63 A;  3ZS6 A;  1FTK A;  4Q5T A;  2I4C A;  1MS7 A;  1DPP A;  1B46 A;  4MLQ A;  4ECF A;  5ICQ A;  1B3L A;  3VFJ A;  2REJ A;  1NKX A;  2UYF A;  1SW1 A;  2LAO A;  2WKY A;  2IA4 A;  4U4S A;  1P1U A;  3ZKL A;  4R9F A;  3BFU A;  3H6U A;  3TCH A;  1NNK A;  2XXQ A;  1WVJ A;  1RYX A;  5AA4 A;  1ZMG A;  4U1O A;  2A5S A;  2O68 A;  1D9V A;  3MZB A;  4U2R A;  3WAF A;  4NF6 A;  4GRK A;  3IOU A;  4XKN A;  1MXX A;  3USD A;  2ONK E;  3MP8 A;  4OZ9 A;  4R72 A;  2F35 A;  4GD5 A;  5AE4 A;  1PB8 A;  2FYI A;  3IOT A;  4R75 A;  4H0W A;  4LQ2 A;  1P1O A;  3MPL A;  1BP5 A;  1MH3 A;  1B52 A;  2DE3 A;  1POY 1;  3MPK A;  1M5E A;  1OVB A;  1KWH A;  2HZL A;  2XXT A;  4IB2 A;  4NF8 A;  3C9H A;  3RPW A;  3OO8 A;  4GQO A;  4R2B A;  2I3W A;  3CSG A;  4GXA A;  5DTB A;  1MXV A;  1Y3P A;  3VXB A;  5CM6 A;  3OMB A;  4BDL A;  4YMA A;  1N84 A;  2VP1 A;  2A5T A;  5I57 A;  4NF6 B;  2ZMB A;  2I0C A;  1AMF A;  4LVQ A;  4ONY A;  3S9M C;  4Q8R A;  1OQG A;  1IZ1 A;  2DE2 A;  3UP9 A;  5FHM A;  4RPN A;  1SYH A;  2DE4 A;  3MVZ A;  2Q2C A;  4R74 A;  3IOV A;  4KR5 A;  5CMK A;  2DWH A;  3MAM A;  4QFK A;  5TP9 B;  4ZZA A;  3L6G A;  5KCJ B;  1VR5 A;  3RY3 A;  4F3B A;  1S9T A;  3C34 A;  3A3U A;  1MDP 1;  1N76 A;  2DXR A;  4OEV A;  4OEN A;  1B3H A;  4KYD A;  4NF8 B;  4F3S A;  4O3C A;  2ZYM A;  4G8M A;  1B05 A;  1SI1 A;  3IOR A;  1DPE A;  4C1U A;  2A5T B;  1B7U A;  4M4G A;  1LBC A;  2O6A A;  3G7W A;  4ZEF A;  4PFU A;  3TTN A;  4F22 A;  4NED A;  3I3V A;  4P0I A;  1ZKB A;  1MXW A;  3UN6 A;  4H5F A;  3FJM A;  3R26 A;  3M3F A;  4ZEC A;  5I2K B;  2DSF A;  4JB7 A;  2M8C A;  3TQW A;  5FHO A;  5ISU A;  1FTL A;  2VD2 A;  4OMB A;  3I5O A;  4H8I A;  3N5L A;  3KN3 A;  3VV5 A;  2XXV A;  1LFI A;  2YLN A;  4JWO A;  2DXY A;  2ZYO A;  1XS5 A;  2B3B A;  3QAX A;  4NF4 B;  3KOT A;  5JK4 A;  1ZIU A;  4F2O A;  2E0S A;  4FED A;  3UOR A;  1MQG A;  1HSL A;  3FV1 A;  1LCF A;  3G3H A;  4OFJ A;  2Q9T A;  1JW5 A;  3DEL B;  4OTE A;  3RNN A;  5LOM A;  2XXH A;  2F7A A;  3ONM A;  3TYH A;  1J1N A;  4FOR A;  3SEX A;  1Y4T A;  3K02 A;  1RKM A;  1UQW A;  1H44 A;  1IUD A;  3SKP A;  1YAE A;  2HXW A;  3RTW B;  4TOZ A;  5CRY A;  2DP8 A;  1B7H A;  4UAC A;  3MBP A;  2B3F A;  2X7P A;  3SDF A;  2I6E A;  4P11 A;  1I6Q A;  3T9X B;  5KDT B;  2KLF A;  3SER A;  3MVY A;  1UIU A;  3Q28 A;  4LA9 A;  2DQV A;  3UGW A;  2H98 A;  5ITP A;  1NMU A;  3C36 A;  3LSX A;  3PUV E;  1OMP A;  4F18 A;  1A55 A;  2V25 A;  4LZ5 A;  4U22 A;  4ND9 A;  2AIX A;  3OO6 A;  4DXU A;  3UA8 A;  5I84 A;  3TTR A;  4BDM A;  1NFT A;  1EZP A;  2H9B A;  2GFE A;  2PVU A;  4LZ8 A;  1MQH A;  1QVS A;  4TLL B;  1VE4 A;  5AA3 A;  2F97 A;  1A54 A;  1S50 A;  3TDJ A;  3H4Z A;  4KQP A;  4H67 A;  4ZED A;  3O6H A;  3CIJ A;  3RT6 B;  2XHD A;  5L9S A;  3KG2 A;  3EHU A;  1Y3N A;  2QJE A;  2ANJ A;  1CB6 A;  4QF9 A;  2NUV A;  1B1H A;  3K6W A;  3H3G A;  4R6Y A;  5DT6 A;  3KBR A;  4U21 A;  4FAJ A;  2G29 A;  2ZNT A;  1FTM A;  1F9B A;  4FE8 A;  3T93 B;  2X7Q A;  1MY1 A;  2AL5 A;  1SW2 A;  5L8D A;  4TQU Q;  2FA7 A;  2QMX A;  1AIV A;  5M2V A;  3ZSF A;  5DYH A;  1N04 A;  5K2Y A;  3TTM A;  4O3A A;  1FQB A;  2Y7R A;  3RUM A;  3A3C A;  4GFR A;  4H1X A;  1QUL A;  2GHA A;  4HCW A;  3E13 X;  3K4U A;  1Q35 A;  3G3I A;  3RTF B;  3PPR A;  4XIG Q;  4DZ1 A;  2ONR A;  1JVY A;  4OET A;  1JEU A;  4QSD A;  1NH7 A;  4EQ7 A;  3W9V A;  1ZJL A;  3IJO B;  2Y7W A;  1GVC A;  3H6T A;  3LSF B;  1MXZ A;  4EXL A;  1NNT A;  4YKI A;  3VLV A;  1FW0 A;  3OEL A;  3TFL A;  1XVY A;  4EXK A;  3W9W A;  1N7X A;  3TQL A;  1H76 A;  1OLA A;  3QIM A;  4WKM A;  2I0B A;  1B0H A;  5FTI A;  4H5G A;  5IKB A;  1BKA A;  1B7Z A;  3H7M A;  1ANF A;  4QSC A;  4Z7E A;  4JXI A;  4P0G A;  4RXL A;  4F1Y A;  3ILU B;  4IGT A;  2Q8J A;  3LR1 A;  1UIV A;  1SBP A;  1P1Q A;  2Z8D A;  4LZ7 A;  3KSX A;  4FJP A;  3F11 A;  1URD A;  3C32 A;  3PD9 A;  1PDA A;  3GXA A;  4G68 C;  3GBB A;  2RCA A;  1MH4 A;  1IXG A;  2ZXT A;  1TWY A;  3PUX E;  5DEX A;  4M1V A;  1LB9 A;  1LB8 A;  3TCF A;  4JWY A;  1URG A;  3CRB A;  5CMC A;  1EU8 A;  4MH5 A;  4H6D A;  1IXI A;  3UIF A;  5DVF A;  3U72 A;  4F3G A;  5A5X A;  3N6T A;  2DVC A;  1GTK A;  1OLC A;  3TOD A;  2VGQ A;  1IEJ A;  2ESN A;  1IQ7 A;  4ELO A;  3FAT A;  4R6H A;  5CBS A;  1N0T A;  1GGG A;  1II5 A;  1O7T A;  3IB1 A;  2XXX A;  4N6P A;  1UTH A;  4GL0 A;  1OVT A;  3PMV A;  2P1S A;  2I4B A;  4IO3 A;  4XKQ A;  5CBR A;  2HZK A;  3DLN A;  4PE5 B;  4OES A;  3GLB A;  1ZBM A;  1N7W A;  1QUI A;  1PB9 A;  3OOA A;  5H8Q A;  5I56 A;  3V5A A;  2DS9 A;  3CSB A;  4R2F A;  1URS A;  2F5X A;  3TZA A;  2OWT A;  4BDR A;  1OQH A;  1YPN A;  3D4G A;  1YCJ A;  3PMX A;  3IL1 B;  4HW8 A;  3MQ9 A;  1A7L A;  4EUO A;  2RC9 A;  4IO4 A;  3O28 A;  4U1Z A;  4YZZ A;  5K2X A;  3R7X A;  3MZ9 A;  1DTZ A;  1AL3 A;  3D4C A;  3O6G A;  3S2V A;  3SES A;  4DXB A;  1QUJ A;  2D3I A;  1O64 A;  4I8C A;  2UVG A;  4PFT A;  2UVH A;  3S4U A;  1BTJ A;  4KYE A;  3T66 A;  3RN8 A;  4L17 A;  5AA2 A;  3KZG A;  2ONS A;  4BLA A;  5AA4 B;  3T9U A;  3TTK A;  4QFP A;  3QSL A;  1BLF A;  5L9O A;  3N6U A;  4XKR A;  5F1Q A;  2THI A;  2XXY A;  3G3F A;  1B3F A;  1A40 A;  1OIB A;  3T9H B;  3JZJ A;  3IAZ A;  5L9M A;  4GL8 A;  5DVI A;  1EZ9 A;  1JNF A;  3A09 A;  2PMS A;  2V3U A;  4MLV A;  4F19 A;  1JEV A;  5CI5 A;  3E3K A;  5JEI A;  1SQY A;  3PPO A;  5I59 A;  1TFD A;  5B70 A;  2V3T A;  3KSJ A;  4OYV A;  2ZNU A;  3K6U A;  2O69 A;  5AA2 B;  3TUS A;  4PP0 A;  4K3F A;  4PQJ A;  4G2Z A;  4F3P A;  1FCK A;  4YKK A;  3IB0 A;  1B4Z A;  1XC1 A;  5I57 B;  3FVG A;  4LON B;  2XX9 A;  3S9N C;  3R6U A;  3QXM A;  4E0W A;  3CG1 A;  3MWB A;  3PUW E;  4IO7 A;  2REG A;  2DVZ A;  4KPT A;  4POX A;  2F6G A;  3C35 A;  3T22 A;  2F6P A;  3IR1 A;  1FQA A;  1B51 A;  4E0X A;  1USY H;  4LAT A;  5I2N A;  1H43 A;  1TXF A;  3QUF A;  2PX1 A;  4YMB A;  1M5B A;  3PUY E;  1LCT A;  1Y1M A;  3B6Q A;  4IY5 A;  3FD3 A;  2QS1 A;  4XTC Q;  1SD3 A;  5F7V A;  4GIZ A;  2RC8 A;  1N3W A;  3TCG A;  1LFG A;  3K1N A;  1IIW A;  2OK2 A;  5EYF A;  4DE8 A;  3PD8 A;  4NF5 A;  2H4I A;  3H6W A;  3BBR A;  1FTJ A;  1B6H A;  1M5C A;  3G3J A;  3CFZ A;  1R9L A;  2HAU A;  2R6G E;  1D9Y A;  2ZNS A;  2Q88 A;  1EH3 A;  2GHB A;  4OER A;  1EZO A;  3K01 A;  1FQC A;  2AL4 A;  4LQ5 A;  4ESX A;  4X48 A;  4U4X A;  4RK9 A;  1TT1 A;  1MY4 A;  3SEU A;  2AYS A;  3TEP A;  1FQF A;  3C33 A;  4YKP A;  5DVJ A;  3FUZ A;  1ATG A;  2YPN A;  3AXF A;  2FNC A;  1NH8 A;  4DIG A;  1MPB A;  4ZEK A;  2ZYN A;  3DP8 A;  3FVK A;  5H8H A;  4NF5 B;  3EHS A;  3S9E A;  2XD2 A;  4OVJ A;  4OQO A;  4G68 A;  1LFH A;  2DOJ A;  2XX8 A;  3CI8 A;  4DLD A;  4Q0C A;  2QSX A;  3OSR A;  4IGR A;  2ABH A;  2UYE A;  3E9X A;  4I9D A;  4YAH X;  2F78 A;  4ISU A;  2XXR A;  3FXR A;  2Z23 A;  1PBQ A;  3VLW A;  1B9J A;  4I62 A;  4ELR A;  5BWJ A;  3O9P A;  3G3G A;  4ZZE A;  4F1U A;  3IB2 A;  2NVU B;  3KJ7 A;  2OJT A;  4I1D A;  4X9T A;  1Y9U A;  1T0K A;  1MY0 A;  2Z8F A;  2F7B A;  4EF1 A;  4MBP A;  3MP1 A;  2PBW A;  1VSO A;  3SEV A;  1B2H A;  1JW1 A;  5CC2 A;  2I3V A;  2ZYK A;  3O97 A;  5H8H B;  5FTH A;  1B5I A;  1JW4 A;  2OCU A;  1R9Q A;  2Y7I A;  4Q30 B;  1RYO A;  2O7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...