1NMUA

Mbp-l30
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
368
structure length
368
Chain Sequence
b'EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose-binding periplasmic protein
publication title Inherent Protein Structural Flexibility at the RNA-binding Interface of L30e
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein/ribosome
total genus 122
structure length 368
sequence length 368
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nmuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nmuA01
2O68A 1MY2A 1JETA 2RCBA 1N7XA 3M8UA 3KJTA 1HSEA 3PPOA 3VXCA 1QUKA 3TTNA 3CRBA 4IO5A 1Y9UA 1OVTA 3QAXA 3FATA 4JWXA 3GLBA 4DCYA 1PDAA 1SBPA 4XXUA 1S7YA 1QUIA 2DXYA 4OERA 4RPOA 1TXFA 3K6UA 4ZEIA 2IEEA 1YAEA 3O2AA 4IGTA 3DLNA 3OXNA 3K02A 3H6WA 1B40A 1QVSA 3KSXA 5M2VA 4R2BA 3IORA 2Y84A 2ALUA 1P99A 4Z7EA 3BBRA 1O64A 4U4XA 3B6WA 4F18A 2ZYMA 3TTRA 1SW1A 3O6GA 5ISUA 1FTOA 4BDNA 3MVYA 4AB5A 1EZ9A 2R6GE 3N6TA 3OELA 2XX8A 5CBSA 3HHFA 3OEMA 1O7TA 3V83A 1R9QA 4JB7A 4POWA 4PFYA 3PUYE 2F97A 1MDP1 4DDDA 2A5TA 1D9YA 2F5XA 1MY1A 5AA1A 2DWJA 4GVOA 1B1HA 3GBBA 1MXWA 2DYXA 2XHDA 1JNFA 3PPQA 1TT1A 4ZE9A 2ONSA 3SDFA 3B6QA 2H99A 3SEYA 2OWSA 4IO2A 4LZ7A 2F35A 1A55A 2O51A 1OIBA 2NXOA 5DTBA 4DXBA 2G93A 3V89B 1LAFE 2Z8DA 1I6BA 3K1MA 1LCFA 3TCGA 1UTHA 5J1DA 4QFKA 3OO9A 1SQYA 2HQ0A 5DYHA 4DLDA 4DCXA 3FXRA 1B2HA 1UIVA 3IL1B 3PUVE 1HSJA 1O63A 5ELVA 5I2NA 4YKIA 3VLVA 5B70A 1TFDA 4U1OA 4DZ1A 1Y3NA 2Q88A 5JTYA 3IO4A 3DELB 3PUZE 2ESNA 3ONMA 2HXWA 4LA9A 5CI5A 1H44A 4C0RA 3A09A 2F7BA 4UA8A 4LONB 5ITOA 3F11A 1PB9A 4NF5A 5EYFA 1AIVA 4G2ZA 4N6PA 4QF9A 1EU8A 3IJXB 4F3GA 1SW5A 5FTIA 4KYEA 2QS4A 1L5TA 4P11A 4JXIA 1UQWA 4F2OA 2XXTA 1A8EA 3HSTA 3RT6B 4R2FA 3PPPA 4FJPA 2A5TB 1GR2A 1M5CA 4KHZE 1QUJA 4O3AA 3PUXE 3FIRA 3TQLA 1ATGA 2I0CA 1N0TA 4MBPA 4YB7A 3T22A 4ND9A 5H8NA 4ZEKA 1SW4A 2HEUA 4X9TA 4X1DA 3OENA 3MZBA 2UVHA 3PMWA 5DEXA 3K2DA 4EDPA 1LSTA 1SD3A 3B6TA 5TP9A 1M5FA 1ZBMA 3TFLA 2FA7A 1UTHB 4H6DA 1MQJA 1N3WA 3T9HB 2I0BA 2XXUA 2Y7PA 3K1PA 2R71A 1B05A 3U94A 1VFDA 2OCUA 5I2NB 1WDNA 4G8NA 3UA8A 1PC3A 1DPPA 1XT8A 3UP9A 1MY3A 1OVBA 5JTYB 5EHSA 3KJ7A 4KPTA 4MF3A 3K6VA 3IK6B 1UTBA 2ANJA 5I59A 4EF2A 4EQ9A 3E3KA 1DTZA 3AXFA 4NF5B 4XKRA 3PMXA 3FZVA 3W9VA 4RPNA 2F7AA 4GIZA 4OWDA 3VE1B 1XHYA 4OQOA 2YJPA 4I1DA 3ZS6A 1VE4A 3RTFB 3H06B 3HCQA 4GXSB 4NF6A 3QYTA 3PUWE 5H8NB 3MUQA 2AL5A 3VFJA 2I3WA 2ZNTA 2D21A 3OO7A 3TQWA 1SI0A 4F29A 4IO7A 2OJTA 3FV1A 4G77A 1IXGA 4LQ5A 2Z8EA 5ICTA 3N94A 3HN0A 1LFIA 1RYOA 2XXYA 5HBCA 1B6HA 3I3VA 3ZSFA 5TP9B 1B3HA 2I6EA 4PP0A 2DWIA 1B0HA 1MPBA 1POTA 4JBZA 3Q27A 2E0SA 2I4BA 3MW0A 4LVQA 1H76A 3U92A 2F34A 3RUMA 1VSOA 2QMXA 3W9WA 4TLLB 1NKXA 1ZU0A 1SVXB 3Q25A 2V93A 3DM0A 2O7UA 2QSXA 1UTBB 4ZS9A 5I59B 1VFEA 3MPKA 4YB5A 2DVZA 3C32A 3TTLA 1AMFA 5AE4A 4IO3A 1QULA 4BDRA 4GL8A 3O66A 1LFGA 1ZIUA 1LFHA 2FYIA 4H65A 4KCDA 3K6WA 4OMBA 3A3UA 3IOTA 3HHGA 2HAUA 1MPDA 5TU0A 4QFLA 1S50A 3TTKA 1A54A 1MM7A 2IA4A 1B5JA 1B0LA 2NUVA 4ZE8A 1IEJA 1M5BA 4NF6B 4NE4A 1JW5A 3K00A 1I6QA 4QHQA 3TKDA 3OMBA 2WKYA 3MVWA 1GVCA 4GL0A 4PFTA 1J1NA 4KCCA 3G3FA 4F1UA 4LZ5A 4OEUA 3BFTA 3LBSA 3H6UA 5CC2A 3FASA 3MPLA 1QKAA 3C9HA 1A40A 3K0VA 1MQIA 4H1XA 1MRPA 2O7IA 1D9VA 5L9OA 3OO8A 1IXHA 4I8CA 2DP8A 1FQFA 3H3GA 5DVIA 4QSCA 4UACA 3RY3A 5FHNA 1Y1MA 2I3VA 3EQ1A 2CMOA 3MWBA 3K6XA 1AH5A 4H5GA 3IO6A 3E13X 3C35A 3A3CA 1MXUA 1RYXA 4GD5A 3QUFA 5I2KA 2XXRA 2DWHA 3R26A 1B3LA 3KN8A 3O29A 4JWYA 2XX9A 3D4GA 4ESXA 4F3BA 2HZKA 3IAZA 4MLVA 1FTJA 3S9EA 3UN6A 4N13A 2HCAA 4NMYA 3M3KA 4XKPA 3TMGA 1PBQA 1JW1A 5L8DA 2H9BA 5DT6A 1ZLQA 2FNCA 4E0XA 5KCJA 2W7YA 3IR1A 1YCJA 1EH3A 1B4HA 3L6HA 3SERA 1ZTYA 4C1TA 2V84A 1B1XA 1DMBA 1QW0A 4LZ8A 2NWJA 1B9JA 5K2YA 1T0KA 5I56A 3KG2A 1B5IA 4BLAA 4ECFA 3EHUA 4HTGA 5H8SA 2YLNA 1PEBA 2QPQA 2ZNSA 4PFUA 2UXAA 2XX7A 3TCFA 1TFAA 3O28A 2Y7RA 3S9MC 2B3BA 3TYHA 4JSDA 3EHSA 1NH7A 1LGBC 3T9XB 5ITPA 5I2KB 3ZKKA 2GHAA 2VOZA 2I48A 1P1NA 2ZYNA 4RA1A 1USYE 3IB0A 4LUBA 2Q8JA 4H8JA 3W15C 5EHMA 3TCHA 2Q2AA 3KOTA 5AA2A 3VV5A 2V3UA 2DE2A 1GTKA 5F7VA 2P0SA 5CMKA 4GOTA 1B7UA 3TAJA 3MBPA 2QS1A 2F6GA 2PVUA 3KN3A 3SKPA 3G3KA 5KCJB 3O9PA 3THIA 3K01A 1MXYA 3FVNA 3VDFA 1NNFA 4I9DA 1SI1A 3QXMA 2O69A 3E4RA 1LAXA 4G68A 2I49A 4ZZAA 3ILTB 4QFPA 1FQDA 1BIYA 3FV2A 2GFEA 2Y7IA 3T9VA 1P1QA 5I56B 3EHTA 1BTJA 1ELJA 5IAIA 1MY0A 2H25A 5L9MA 1N7WA 3RN8A 2DE4A 1YTVA 3JYRA 1P1UA 1B46A 2GHBA 1DOTA 2XD2A 1DTGA 4R6HA 3TPAA 3IJOB 3RGYA 1MXVA 5FHOA 1Z7ME 1M5EA 5JK4A 4KYSA 2RCAA 2XXVA 4C1UA 4KR5A 2Z8FA 4OFJA 3TDJA 3H03A 5KDTA 3UK4A 3H4ZA 4L17A 5BWJA 1ZJLA 5F1QA 3LSXA 1PB8A 1P1WA 1MPCA 4XKQA 4Q0CA 4ELOA 1S9TA 3O97A 4XIGQ 3I6VA 3KFMA 1H45A 3TODA 3ZKLA 5AA3A 5AA2B 4ZECA 3D4CA 2XXPA 1MS7A 4G68C 4G8HA 1IUDA 2REJA 2DSFA 1MM6A 3U93A 4GWOA 1BP5A 2X7PA 1PB7A 4XTCQ 4NWCA 3FGSA 3KEIA 3MP6A 4EXKA 4F2QA 1MDQA 4G68B 2HAVA 1XVYA 2OLBA 2OWTA 4AQ4A 3FJGA 3FVOA 5IKBA 1NMUA 3CG1A 3GXAA 1MQHA 4DXUA 3TELA 1GGGA 2O1MA 4GQOA 4YZZA 3CIJA 3N6UA 2OZZA 4F1VA 3OD7A 2CZLA 3QSLA 1FTMA 4OXVA 3PV0E 1A7LA 4FIMA 1XOCA 2I4CA 4X1BA 3OOAA 4OZ9A 2QRYA 3EF7A 5DEXB 4NF4A 1FCKA 1N76A 2F8DA 3K4UA 3LSWA 4GF8A 5KDTB 3VVDA 3S4UA 1QJMA 4KYDA 3BFUA 3C31A 1XVXA 1Q1KA 1BKAA 3CFZA 4ELPA 2UYEA 4EF1A 3CSGA 2Z23A 2UVGA 2ZMBA 2Q89A 2QMWA 4HCYA 3VVFA 1BLFA 2P2AA 1DPEA 2E1SA 4R6YA 2RC9A 2NVUB 2DS9A 5JEIA 4YU0A 3T66A 4X48A 2F6PA 1D4NA 1Y1ZA 2H5YA 3VLUA 4ESWA 1P1OA 1LBCA 4WEPA 2ONRA 1USYH 1B58A 2KLFA 4JWOA 3DP6A 2VGQA 4R6KA 2QS3A 3R6UA 2LAOA 1FTKA 3G3IA 2D5WA 2ONKE 4GFRA 5KZTA 5CBRA 3UORA 1LB9A 3V8XB 3PD8A 3HO7A 3N5LA 1JW4A 4YMBA 1Y20A 2X7QA 4F31B 3MVZA 5B7DA 3DP4A 3T9UA 4AB6A 2V3QA 1LB8A 4YICA 4GRKA 1NL5A 2H4IA 3C36A 1AL3A 5FHMA 2PYYA 4NF4B 1JEUA 1M5DA 2DOJA 1B52A 4Q30B 2DQVA 4BDQA 5H8FA 3G7WA 1QKBA 3GZGA 1Y3QA 4R9FA 1R1NA 2QJEA 2YPNA 4U22A 2B65A 5TPAA 4M1VA 3P7IA 5H8QA 4ZEDA 1FQBA 4F3SA 4ELRA 4ZZEA 4IY5A 4QRZA 4LP2B 3WAEA 2GRVA 3O6HA 3FUZA 3T93B 1MXXA 3IB2A 1ANFA 4QSDA 2VD3A 2DXRA 4R72A 4XKNA 4EQBA 3LR1A 3USDA 4GXAA 3LC8A 1URGA 4YKKA 1R9LA 2PMSA 1B3GA 4OENA 4BDLA 4RYAA 3CVGA 2XXHA 5I84A 1II5A 3OO6A 4H5FA 4OVJA 5I57A 1SYIA 3KGCA 1B7ZA 3PD9A 4KD5A 3U1OA 3GBAA 4H8IA 1WVJA 3MVXA 3SESA 1MG1A 3S9LC 2XXWA 1POY1 2VP1A 1MH3A 4RJZA 4DIGA 1B4ZA 4OEVA 1FQCA 1IIWA 1Y3PA 4QFNA 3Q26A 4GLIA 3FVGA 1XS5A 2F36A 4QSEA 1GV8A 1NNKA 2V25A 5DVFA 5BUUA 2OBGA 3N26A 5HPQA 3Q29A 3RT8A 1A8FA 4ISUA 1LBBA 5DVJA 3PMVA 4FEDA 1B3EA 4F3PA 4IGRA 3G3HA 4G4PA 3H7MA 4RNSA 1ZKBA 3MAMA 1YPNA 3RTWB 3HPIA 4POXA 3MZ1A 1LCTA 5H8FB 1FW0A 4FE8A 1I6AA 3FVKA 1SW2A 1IXCA 3TEPA 4OFOA 2ZNUA 4OTEA 3KN7A 4OETA 2HZLA 5TPAB 2Q2CA 1WODA 5H8QB 3C33A 4KQPA 5CRYA 3VXBA 1LAHE 3M3LA 1US5A 5ICQA 3OSQA 4THIA 1EZOA 3OSRA 3PGFA 5K2XA 4MFIA 4R74A 4OHNA 3M3FA 1D3KA 1B51A 1B3FA 4EQ7A 4O3CA 3CG3A 4HS7A 2PBWA 3FXQA 4OESA 3ECRA 2XXQA 3O6IA 5I57B 1NNTA 4FAJA 1B5HA 2D3IA 1XC1A 4R73A 1MQGA 1PBPA 4Q8RA 3RLFE 2AIXA 4YB6A 4YMAA 1NH8A 2PT2A 1URDA 1URSA 3PU5A 1MXZA 3K1NA 2GH9A 3TZAA 4WEDA 2Y7KA 4Z0IA 4NWDA 1JEVA 3MP1A 1SDXA 3LUYA 3TUSA 4FEBA 4BDMA 4P0IA 2V3TA 3L6GA 2XXXA 2F7CA 5AA4A 1A99A 4WKMA 3VLWA 3KSJA 2ZYOA 5CMCA 3UGWA 4BDOA 4YAHX 1FQAA 5FTHA 1OLAA 4OYVA 3MQ9A 3JV9A 4NEDA 3UIFA 2H98A 5LOMA 2O6AA 3V5AA 3SEVA 5I58A 2VHAA 4RXLA 2R9JA 4H0WA 3MZ9A 4IO6A 5H8HA 1N84A 1DSNA 3C34A 5A5XA 3E9XA 1IITA 4PETA 3VVEA 3TTMA 1Y4TA 2P1SA 3SEUA 1FQEA 3RNNA 4NF8A 1IXIA 3S9NC 1ZMGA 3IX1A 3SETA 2XXIA 4K3FA 3SEWA 3WAFA 4EUOA 2RC8A 3KOSA 2DWAA 4JSOA 3FD3A 4HCWA 2O84X 3S2VA 1JQFA 3OEKA 1B7HA 3KZGA 2RKMA 4DE8A 4ZEBA 4EXLA 4NTLA 3HV1A 2REGA 3CFXA 4ZDMA 2DVCA 2AL4A 4FECA 3SEXA 1Q35A 4TLMB 3I5OA 3B7DA 2RINA 4PFWA 4KFQA 1IQ7A 2M8CA 1MQDA 3RPWA 1H43A 5AA4B 3U72A 2RC7A 3FJMA 4P0GA 1EZPA 1LAGE 3PPRA 2OK2A 2UYFA 1UIUA 3MJNA 4KI0E 4TOZA 2RF1A 3EPEA 4E0WA 1IZ1A 4LATA 4R9GA 3QUJA 3H6VA 4IO4A 4JDFA 4DXCA 1LLSA 3R7XA 3CI8A 3MC2A 2F78A 2PX1A 5I58B 2Y7WA 3C4MA 1OQHA 2ZYKA 5H8HB 3IB1A 2HFBA 5A5XB 4M4GA 3CSBA 1CE2A 3U8QA 4NF8B 4ZEFA 1JVYA 4R75A 2UVJA 3IOUA 3IOVA 3KBRA 2THIA 1H3DA 1MH4A 4MH5A 1F9BA 4U2RA 4U1ZA 1VR5A 2Z22A 4F1YA 4WXJA 4N07A 1MY4A 4YKPA 1OLCA 4RK2A 3CFLA 4ONYA 5CMMA 4ELQA 3PPNA 3IOWA 1JVXA 3ILUB 4F39A 1Y4CA 4IY6A 2A5SA 1TWYA 4OFLA 2I58A 3CR9A 2DE3A 1OMPA 1FTLA 1NFTA 4O3BA 1N3XA 3JZJA 4U4SA 2Q9TA 1OQGA 3LSLA 4I62A 4Q5TA 3BKIB 4PQJA 2XD3A 1HSLA 2BJJX 3ODBA 3EN3A 3LSFB 4TQUQ 4G8MA 4F22A 2G29A 1NNPA 4LQ2A 4U21A 3G3JA 1SYHA 3DP8A 4IB2A 1AOVA 4H67A 1R6ZA 2B3FA 2PT1A 5CMBA 4RK9A 4RY1A 2O1LA 3H6TA 3FXUA 4HW8A 4U23A 3Q28A 4FATA 4F19A 4QFOA 2QL3A 4YKJA 3QIMA 2ZXTA 3FJ7A 4FORA 2UVIA 2QS2A 1KWHA 3G3GA 3QK6A 1Z7NE 1RKMA 5L9SA 3MP8A 2AYSA 1CB6A 1N04A 5AA2D 5CM6A 5HM4B 1B32A 4PE5B 2NOOA 2X26A 4MLQA 2ABHA 1US4A 2VD2A 1I69A 3T96B 3RQTA
chains in the Genus database with same CATH superfamily
2O68A 4MAGA 1MY2A 1JETA 4X04A 3E79A 3SZPA 2RCBA 1N7XA 3M8UA 2WEFA 3KJTA 1HSEA 3PPOA 3VXCA 1QUKA 3TTNA 3CRBA 4GX4A 4IO5A 1Y9UA 3MSTA 1OVTA 3QAXA 3FATA 4JWXA 3GLBA 4PAFA 2P3VA 4DCYA 1PDAA 4MNCA 1SBPA 4XXUA 1S7YA 1QUIA 2DXYA 4OERA 4P1LA 4RPOA 1TXFA 3K6UA 4JVDA 4ZEIA 2IEEA 1YAEA 3O2AA 4IGTA 3DLNA 3OXNA 4PDHA 3K02A 3H6WA 1B40A 1QVSA 3KSXA 5M2VA 4R2BA 3IORA 5J16A 2Y84A 2F3DA 3CHGA 2ALUA 4GX3A 1P99A 4Z7EA 3BBRA 1O64A 4U4XA 3B6WA 4F18A 3IFCA 1KZ8A 2ZYMA 3TTRA 1SW1A 3O6GA 5T3JA 5ISUA 1FTOA 4BDNA 3MVYA 4AB5A 1EZ9A 2R6GE 3N6TA 3OELA 2XX8A 5CBSA 3HHFA 3OEMA 1O7TA 3V83A 1R9QA 1YXIA 2CZKA 4JB7A 4POWA 4PFYA 2XA5A 3PUYE 2F97A 1MDP1 4QBAA 4DDDA 2A5TA 1D9YA 2F5XA 1MY1A 5AA1A 2DWJA 4GVOA 1B1HA 3GBBA 1MXWA 1Q9DA 2DYXA 2XHDA 4P9KA 1JNFA 3PPQA 5EQ9A 1TT1A 4ZE9A 2ONSA 3SDFA 3B6QA 2H99A 3SEYA 2OWSA 4IO2A 4LZ7A 2F35A 1A55A 1FBHA 2O51A 1OIBA 2NXOA 5DTBA 4DXBA 2G93A 3V89B 1LAFE 2Z8DA 1I6BA 3K1MA 1LCFA 4KXPA 4NG7A 3TCGA 1UTHA 1K9YA 5J1DA 4QFKA 3OO9A 1SQYA 2HQ0A 5DYHA 4DLDA 4DCXA 3FXRA 4XFEA 1B2HA 1UIVA 3IL1B 3PUVE 1HSJA 1O63A 5ELVA 2KQZA 5I2NA 4YKIA 3VLVA 5B70A 1EYJA 1TFDA 4U1OA 4DZ1A 1Y3NA 2Q88A 4NN3A 5JTYA 3IO4A 1NUWA 3DELB 2XXKA 3PUZE 2ESNA 3ONMA 1G0IA 2HXWA 4LA9A 5CI5A 1DCUA 1H44A 4C0RA 3A09A 2F7BA 4UA8A 4LONB 5ITOA 3F11A 1PB9A 4NF5A 5EYFA 1FSAA 1AIVA 4G2ZA 4N6PA 4QF9A 1EU8A 3IJXB 5FBPA 4F3GA 1SW5A 4I3EA 4MNIA 5FTIA 4KYEA 2QS4A 1L5TA 4P11A 4JXIA 1UQWA 1NV0A 4F2OA 2XXTA 1A8EA 3HSTA 3RT6B 4R2FA 3PPPA 4FJPA 2A5TB 1GR2A 1M5CA 4KHZE 1QUJA 4O3AA 3PUXE 3FIRA 3TQLA 1ATGA 2I0CA 1N0TA 4MBPA 4YB7A 3T22A 4ND9A 5EYGA 4N81A 5H8NA 4ZEKA 1SW4A 2HEUA 4X9TA 4PBHA 4PGPA 1LBZA 1BK4A 4X1DA 3OENA 1FPFA 3MZBA 2UVHA 3PMWA 4OVPA 1NV3A 5DEXA 3K2DA 4EDPA 1LSTA 1SD3A 3B6TA 5TP9A 1M5FA 1ZBMA 3TFLA 2FA7A 1UTHB 4H6DA 1MQJA 4IR8A 1N3WA 3T9HB 2I0BA 2XXUA 2Y7PA 3K1PA 1FRPA 2R71A 1B05A 4GX6A 3U94A 1VFDA 2OCUA 5I2NB 1WDNA 4MIJA 4G8NA 3UA8A 3MYUA 2MKZA 1PC3A 1DPPA 1XT8A 3UP9A 1MY3A 1OVBA 3D1RA 5JTYB 5EHSA 1NV4A 3KJ7A 4KPTA 4MF3A 3K6VA 4DI3D 2P3NA 3IK6B 3RPLA 1UTBA 2ANJA 5I59A 4EF2A 4EQ9A 3E3KA 4GBWA 4P56A 1DTZA 1YZ0A 3AXFA 4NF5B 1LBWA 4XKRA 3PMXA 3FZVA 3W9VA 4RPNA 2F7AA 4GIZA 4OWDA 3VE1B 1XHYA 2Y5KA 2ZZXA 4OQOA 2YJPA 4I1DA 3ZS6A 4DI4B 1IMEA 1VE4A 3T0JA 3RTFB 4GWXA 3H06B 2CZHA 3HCQA 3A29A 4NF6A 2B4LA 4GXSB 3QYTA 3PUWE 5H8NB 3MUQA 1XI6A 2AL5A 3VFJA 2I3WA 2ZNTA 2D21A 3OO7A 3TQWA 1SI0A 4NGUA 4F29A 4IO7A 2OJTA 3FV1A 2FIXA 4G77A 1IXGA 1D9QA 4LQ5A 2Z8EA 5ICTA 3N94A 3HN0A 1LFIA 1RYOA 2XXYA 5HBCA 1B6HA 3I3VA 3ZSFA 5TP9B 1B3HA 2I6EA 2QVVA 4PP0A 2DWIA 1B0HA 1MPBA 1POTA 3ISPA 4JBZA 3Q27A 2E0SA 2I4BA 3MW0A 4LVQA 1FBEA 5IGAA 1H76A 3U92A 4AS5A 4MJOA 2F34A 3RUMA 1VSOA 2QMXA 3W9WA 4TLLB 3GYYA 1NKXA 1ZU0A 1SVXB 3Q25A 2V93A 3DM0A 2O7UA 2QSXA 3RPLB 1UTBB 4QXDA 4ZS9A 5I59B 1VFEA 3MPKA 4YB5A 2DVZA 2HXRA 3C32A 3TTLA 1AMFA 5AE4A 4IO3A 1QULA 4BDRA 4GL8A 5EQAA 3O66A 1LFGA 1ZIUA 1LFHA 2FYIA 4H65A 4KCDA 3K6WA 4OMBA 3A3UA 3IOTA 5LDZA 4MX6A 3HHGA 2HAUA 1MPDA 5TU0A 4QFLA 1S50A 3TTKA 2VT5A 1A54A 3BIGA 2PFZA 1MM7A 2WBDA 2IA4A 1B5JA 4PTKA 1B0LA 2NUVA 4ZE8A 1IEJA 1M5BA 4NF6B 4NE4A 1JW5A 3K00A 1I6QA 4QHQA 3TKDA 3OMBA 5EQ7A 4N91A 2WKYA 3MVWA 1GVCA 4GL0A 4PFTA 1J1NA 4KCCA 3G3FA 4F1UA 4LZ5A 4OEUA 3BFTA 3LBSA 3H6UA 5CC2A 3FASA 3MPLA 1QKAA 3C9HA 1A40A 3K0VA 2F3BA 1MQIA 4H1XA 1MRPA 2O7IA 1D9VA 5L9OA 3OO8A 1IXHA 4I8CA 1YYZA 3U65A 2DP8A 1FQFA 3H3GA 5DVIA 4QSCA 4PAIA 5F24A 4UACA 3RY3A 5FHNA 1Y1MA 1SPIA 2I3VA 3EQ1A 2CMOA 3MWBA 3K6XA 1AH5A 4H5GA 3IO6A 2GQ1A 3E13X 4O94A 3C35A 4PC9A 3A3CA 2PCRA 1MXUA 1RYXA 4GD5A 3QMFA 3QUFA 5I2KA 2XXRA 2DWHA 3R26A 1B3LA 3KN8A 3O29A 4JWYA 2XX9A 3D4GA 4ESXA 4F3BA 2HZKA 3IAZA 4MLVA 1FTJA 3S9EA 3UN6A 1FPKA 4N13A 2HCAA 4NMYA 3M3KA 4XKPA 3TMGA 1PBQA 1JW1A 5L8DA 1NUXA 2H9BA 5DT6A 1ZLQA 2B4MA 2FNCA 4E0XA 5KCJA 2W7YA 3IR1A 1LEVA 1YCJA 1EH3A 1B4HA 3L6HA 3SERA 1ZTYA 4C1TA 4OVTA 2V84A 1B1XA 1DMBA 1QW0A 4LZ8A 2NWJA 4XEQA 1B9JA 5K2YA 1T0KA 5I56A 5LTCA 3KG2A 1B5IA 4BLAA 4GBVA 4ECFA 3EHUA 4HTGA 5H8SA 2YLNA 1PEBA 1FPIA 2QPQA 2ZNSA 4N6KA 4PFUA 2UXAA 2XX7A 3TCFA 1TFAA 3O28A 2Y7RA 1CNQA 3S9MC 2B3BA 3TYHA 4JSDA 2DDKA 1NV1A 3EHSA 2OWZA 1NH7A 1LGBC 3T9XB 5IZ1A 5ITPA 1FBPA 4I40A 5I2KB 3ZKKA 2GHAA 2VOZA 4PFBA 2I48A 1P1NA 2ZYNA 4RA1A 1USYE 3IB0A 2V4CA 4LUBA 2Q8JA 4H8JA 3W15C 5EHMA 3TCHA 1FPLA 2Q2AA 2WBBA 3KOTA 5AA2A 3VV5A 2V3UA 3B8BA 2DE2A 2Y5LA 1GTKA 3KBZA 5F7VA 2P0SA 5CMKA 4GOTA 4HE1A 4GWWA 1B7UA 1FPDA 3TAJA 3MBPA 2QS1A 2F6GA 2PVUA 3KN3A 3SKPA 3G3KA 5KCJB 3O9PA 3THIA 3K01A 1MXYA 3FVNA 2CEYA 3VDFA 2XWIA 1NNFA 4I9DA 1SI1A 3QXMA 2O69A 3E4RA 1LAXA 4G68A 2I49A 4ZZAA 3ILTB 4QFPA 1FQDA 4OVQA 1BIYA 5ET7A 2ZZWA 2PFYA 3FV2A 2GFEA 2Y7IA 4AS4A 3T9VA 1P1QA 5I56B 4X8RA 3EHTA 1BTJA 1ELJA 5IAIA 1MY0A 2H25A 5L9MA 1N7WA 3RN8A 5ET5A 2DE4A 1YTVA 4PDDA 1FPBA 3JYRA 1P1UA 1B46A 2GHBA 1DOTA 2XD2A 4R6HA 1DTGA 3TPAA 2WX9A 3IJOB 3RGYA 1MXVA 4MCOA 5FHOA 4N6DA 1Z7ME 1M5EA 1KA0A 5JK4A 4KYSA 2RCAA 4OVRA 2XXVA 4C1UA 4KR5A 2Z8FA 4OFJA 3TDJA 5A5LA 2ZZVA 3H03A 5KDTA 3UK4A 3H4ZA 4L17A 5BWJA 1ZJLA 5F1QA 3LSXA 2VPOA 1PB8A 1P1WA 1MPCA 4XF5A 4XKQA 4Q0CA 4ELOA 1S9TA 3O97A 1FBDA 4XIGQ 3I6VA 3KFMA 1H45A 3TODA 3ZKLA 3KC1A 2L5VA 5AA3A 5AA2B 4ZECA 3D4CA 1IMAA 1MS7A 1FBCA 2XXPA 4G68C 1IUDA 2REJA 4G8HA 2DSFA 1MM6A 3U93A 4GWOA 1BP5A 2X7PA 1PB7A 4PFRA 4XTCQ 4MEVA 5IM2A 3IFAA 4NWCA 3FGSA 3KEIA 3MP6A 4EXKA 1AWBA 4F2QA 1MDQA 4G68B 2HAVA 1LBYA 1XVYA 2OLBA 2OWTA 2XWOA 2KR0A 4AQ4A 3FJGA 3FVOA 4N8YA 5IKBA 1NMUA 3CG1A 3GXAA 1MQHA 4DXUA 1FPJA 3TELA 1GGGA 2FIEA 2O1MA 4GQOA 4YZZA 3CIJA 3N6UA 4PGNA 4P8BA 4P47A 2OZZA 4F1VA 3OD7A 2CZLA 3QSLA 1FTMA 4OXVA 3PV0E 1A7LA 4FIMA 1XOCA 1VDWA 3LV0A 2I4CA 4N15A 4X1BA 3OOAA 4FBPA 4OZ9A 2QRYA 3EF7A 5DEXB 2QVRA 4NF4A 1FCKA 1FPGA 1N76A 2F8DA 3K4UA 3LSWA 4GF8A 4N4UA 3FXBA 5KDTB 3VVDA 3S4UA 4GWYA 1QJMA 4KYDA 3BFUA 3C31A 1XVXA 1Q1KA 1BKAA 3CFZA 4ELPA 2UYEA 4EF1A 3CSGA 2Z23A 2UVGA 5IZZA 2ZMBA 2Q89A 2QMWA 1IMDA 4HCYA 3VVFA 1BLFA 2P2AA 1DPEA 2E1SA 4R6YA 2RC9A 2NVUB 2DS9A 5JEIA 4YU0A 3T66A 4X48A 2F6PA 1D4NA 1Y1ZA 2H5YA 3VLUA 4ESWA 1P1OA 1K9ZA 1LBCA 4WEPA 2ONRA 1USYH 1B58A 2KLFA 4JWOA 4NAPA 3DP6A 1NI9A 2VGQA 4R6KA 2QS3A 3R6UA 2LAOA 1FTKA 3G3IA 2D5WA 4P3LA 2ONKE 4GFRA 5KZTA 4P1EA 5EYHA 5CBRA 3UORA 1LB9A 3V8XB 4H45A 3PD8A 5ET6A 3HO7A 3N5LA 1JW4A 4YMBA 1Y20A 2X7QA 4F31B 3NOHA 3MVZA 5B7DA 3DP4A 3T9UA 4AB6A 2V3QA 1FBFA 1LB8A 4YICA 4GRKA 1NL5A 3KC0A 2H4IA 1FJ6A 3C36A 1AL3A 5FHMA 2PYYA 4NF4B 4HXVA 4NF0A 1JEUA 1M5DA 2DOJA 2XWKA 1B52A 4Q30B 2DQVA 4BDQA 5H8FA 3G7WA 1QKBA 3GZGA 1Y3QA 4MMPA 4R9FA 1R1NA 4O7MA 2QJEA 1RDXA 2YPNA 4U22A 2B65A 5TPAA 4M1VA 3P7IA 5H8QA 4ZEDA 3RYDA 1FQBA 4F3SA 4ELRA 4ZZEA 4IY5A 4QRZA 4LP2B 3WAEA 2GRVA 3O6HA 3FUZA 3T93B 1MXXA 3EKIA 3IB2A 1ANFA 4QSDA 2VD3A 2DXRA 4R72A 4XKNA 4EQBA 3LR1A 3USDA 4GXAA 3LC8A 1URGA 4YKKA 1R9LA 2PMSA 1B3GA 4OENA 4BDLA 4RYAA 3CVGA 2XXHA 5I84A 1II5A 3OO6A 4H5FA 4OVJA 5I57A 1SYIA 3KGCA 1B7ZA 3PD9A 1EYIA 4KD5A 3LUZA 3U1OA 3GBAA 4H8IA 1WVJA 3MVXA 4NHBA 3SESA 1MG1A 3S9LC 2XXWA 1POY1 2VP1A 1MH3A 4RJZA 4DIGA 1B4ZA 4OEVA 1FQCA 1IIWA 1Y3PA 4PBQA 3Q26A 4GLIA 4QFNA 3FVGA 1XS5A 3E78A 1FPEA 4N17A 2F36A 4QSEA 1GV8A 2Q74A 4PAKA 1NNKA 2V25A 5DVFA 4HE0A 5BUUA 2OBGA 3N26A 5HPQA 1FTAA 3Q29A 5I5PA 3RT8A 1A8FA 4ISUA 1LBBA 5DVJA 3PMVA 4FEDA 1B3EA 4OA4A 4F3PA 4IGRA 3G3HA 4G4PA 3H7MA 4RNSA 2QVUA 1ZKBA 3MAMA 1YPNA 2WYKA 3RTWB 3HPIA 4POXA 2QFLA 3MZ1A 1LCTA 5H8FB 1FW0A 4FE8A 1NV7A 1I6AA 3T1BA 3FVKA 1SW2A 3ROJA 1IXCA 3TEPA 4OFOA 2ZNUA 4OTEA 3KN7A 4OETA 1QGXA 2HZLA 5TPAB 4O7IA 2Q2CA 1WODA 5H8QB 3C33A 4KQPA 5CRYA 3VXBA 1LAHE 3M3LA 1US5A 5ICQA 3OSQA 4THIA 1EZOA 1LBVA 3OSRA 3PGFA 5K2XA 1NUYA 4MFIA 4R74A 4OHNA 3M3FA 1D3KA 1B51A 1B3FA 4EQ7A 4O3CA 3CG3A 4HS7A 1EYKA 2PBWA 3FXQA 4OESA 3ECRA 2XXQA 4NX1A 3O6IA 5I57B 1NV6A 1NNTA 4FAJA 1B5HA 2D3IA 4UABA 1XC1A 4R73A 1MQGA 1PBPA 4Q8RA 3RLFE 2AIXA 4YB6A 4YMAA 1NH8A 2PT2A 1URDA 1URSA 3PU5A 1INPA 1MXZA 3K1NA 2GH9A 3TZAA 4WEDA 2Y7KA 4Z0IA 4NWDA 1JEVA 3MP1A 1SDXA 5I7IA 3LUYA 3TUSA 4FEBA 2FVZA 4BDMA 4P0IA 2V3TA 4LN5A 3L6GA 2XXXA 4PCDA 2F7CA 5AA4A 1NV2A 1A99A 4WKMA 3VLWA 3KSJA 4GWUA 2ZYOA 5CMCA 4OVSA 2HPGA 3UGWA 4BDOA 4YAHX 1FQAA 4N8GA 5FTHA 1OLAA 4H46A 4OYVA 3MQ9A 3JV9A 4NEDA 2FBPA 3UIFA 2H98A 5LOMA 2O6AA 4GWZA 3V5AA 4O8MA 1LBXA 3SEVA 5I3SA 3FBPA 5I58A 2VHAA 4RXLA 2R9JA 2JJKA 4H0WA 3MZ9A 4IO6A 3HFUA 5H8HA 1N84A 1DSNA 3C34A 1NUZA 5A5XA 3E9XA 1IITA 5ET8A 4PETA 1DBZA 3VVEA 3TTMA 1Y4TA 2CZIA 2P1SA 1FQEA 3SEUA 4PE3A 3RNNA 4NF8A 1IXIA 3S9NC 1ZMGA 3BIHA 3IX1A 3SETA 2XXIA 4K3FA 3SEWA 3WAFA 4EUOA 2R8TA 2RC8A 3KOSA 1IMFA 2DWAA 4JSOA 3FD3A 4HCWA 2O84X 3S2VA 1JQFA 3OEKA 1B7HA 4OANA 3KZGA 2RKMA 4DE8A 4ZEBA 4EXLA 4NQ8A 4NTLA 3HV1A 2REGA 3CFXA 4ZDMA 2DVCA 2AL4A 3B50A 4FECA 3SEXA 1Q35A 4TLMB 3I5OA 3B7DA 2RINA 4PFWA 1FJ9A 4KFQA 1IQ7A 2M8CA 4MHFA 1MQDA 3RPWA 1H43A 5AA4B 5IZ3A 1DK4A 4GWSA 3U72A 2RC7A 3FJMA 4G61A 4P0GA 1EZPA 1LAGE 3PPRA 2OK2A 2UYFA 1UIUA 4PFIA 3MJNA 4KI0E 4TOZA 2RF1A 3EPEA 4E0WA 1IZ1A 5DW8A 4LATA 4R9GA 3QUJA 1FBGA 3H6VA 4IO4A 4JDFA 5ESYA 1IMCA 4DXCA 5EQ8A 1LLSA 3R7XA 3CI8A 3MC2A 2F78A 2PX1A 5I58B 2Y7WA 3C4MA 1OQHA 2FHYA 2ZYKA 5H8HB 3IB1A 2HFBA 5A5XB 4M4GA 3CSBA 1CE2A 3PTYA 3U8QA 2OX3A 4NF8B 4ZEFA 1JVYA 2WYPA 4R75A 2UVJA 3IOUA 2HHMA 3IOVA 1KA1A 3KBRA 2THIA 1H3DA 1MH4A 4MH5A 1F9BA 4U2RA 4U1ZA 1VR5A 2Z22A 1RDZA 4F1YA 4HE2A 4WXJA 4N07A 1MY4A 4YKPA 1OLCA 4RK2A 3CFLA 4JVCA 4ONYA 4PF6A 5CMMA 4ELQA 3PPNA 3IOWA 1JVXA 3ILUB 4F39A 1Y4CA 4IY6A 2A5SA 1TWYA 4OFLA 2I58A 3CR9A 2DE3A 1OMPA 1FTLA 1NFTA 1RDYA 4O3BA 1N3XA 2XWVA 3JZJA 4U4SA 5IZ3B 2Q9TA 2Q8MA 1OQGA 3LSLA 4I62A 4Q5TA 3BKIB 4PQJA 2XD3A 1HSLA 2BJJX 3ODBA 3EN3A 3LSFB 4TQUQ 4G8MA 2CEXA 4F22A 2G29A 1NNPA 4LQ2A 4U21A 3G3JA 1SYHA 3DP8A 4IB2A 1AOVA 4H67A 1R6ZA 2B3FA 2PT1A 5CMBA 4RK9A 4RY1A 2O1LA 3H6TA 3FXUA 4HW8A 4U23A 2BJIA 3Q28A 4FATA 4I3YA 4F19A 4QFOA 2QL3A 4YKJA 3QIMA 2ZXTA 1NV5A 3FJ7A 4FORA 1JP4A 2UVIA 2QS2A 1KWHA 3G3GA 3QK6A 1Z7NE 1RKMA 5L9SA 3MP8A 4JVIA 2AYSA 1CB6A 1N04A 5AA2D 5CM6A 4PF8A 5HM4B 1B32A 4PE5B 2VPNA 2NOOA 2X26A 4MLQA 4MNPA 1G0HA 1IMBA 2ABHA 1US4A 2VD2A 1I69A 3T96B 3RQTA
chains in the Genus database with same CATH topology
2O68A 1MY2A 1JETA 2RCBA 1N7XA 3M8UA 3KJTA 1HSEA 3PPOA 3VXCA 1QUKA 3TTNA 3CRBA 4IO5A 1Y9UA 1OVTA 3QAXA 3FATA 4JWXA 3GLBA 4DCYA 1PDAA 1SBPA 4XXUA 1S7YA 1QUIA 2DXYA 4OERA 4RPOA 1TXFA 3K6UA 4ZEIA 2IEEA 1YAEA 3O2AA 4IGTA 3DLNA 3OXNA 3K02A 3H6WA 1B40A 1QVSA 3KSXA 5M2VA 4R2BA 3IORA 2Y84A 2ALUA 1P99A 4Z7EA 3BBRA 1O64A 4U4XA 3B6WA 4F18A 2ZYMA 3TTRA 1SW1A 3O6GA 5ISUA 1FTOA 4BDNA 3MVYA 4AB5A 1EZ9A 2R6GE 3N6TA 3OELA 2XX8A 5CBSA 3HHFA 3OEMA 1O7TA 3V83A 1R9QA 4JB7A 4POWA 4PFYA 3PUYE 2F97A 1MDP1 4DDDA 2A5TA 1D9YA 2F5XA 1MY1A 5AA1A 2DWJA 4GVOA 1B1HA 3GBBA 1MXWA 2DYXA 2XHDA 1JNFA 3PPQA 1TT1A 4ZE9A 2ONSA 3SDFA 3B6QA 2H99A 3SEYA 2OWSA 4IO2A 4LZ7A 2F35A 1A55A 2O51A 1OIBA 2NXOA 5DTBA 4DXBA 2G93A 3V89B 1LAFE 2Z8DA 1I6BA 3K1MA 1LCFA 3TCGA 1UTHA 5J1DA 4QFKA 3OO9A 1SQYA 2HQ0A 5DYHA 4DLDA 4DCXA 3FXRA 1B2HA 1UIVA 3IL1B 3PUVE 1HSJA 1O63A 5ELVA 5I2NA 4YKIA 3VLVA 5B70A 1TFDA 4U1OA 4DZ1A 1Y3NA 2Q88A 5JTYA 3IO4A 3DELB 3PUZE 2ESNA 3ONMA 2HXWA 4LA9A 5CI5A 1H44A 4C0RA 3A09A 2F7BA 4UA8A 4LONB 5ITOA 3F11A 1PB9A 4NF5A 5EYFA 1AIVA 4G2ZA 4N6PA 4QF9A 1EU8A 3IJXB 4F3GA 1SW5A 5FTIA 4KYEA 2QS4A 1L5TA 4P11A 4JXIA 1UQWA 4F2OA 2XXTA 1A8EA 3HSTA 3RT6B 4R2FA 3PPPA 4FJPA 2A5TB 1GR2A 1M5CA 4KHZE 1QUJA 4O3AA 3PUXE 3FIRA 3TQLA 1ATGA 2I0CA 1N0TA 4MBPA 4YB7A 3T22A 4ND9A 5H8NA 4ZEKA 1SW4A 2HEUA 4X9TA 4X1DA 3OENA 3MZBA 2UVHA 3PMWA 5DEXA 3K2DA 4EDPA 1LSTA 1SD3A 3B6TA 5TP9A 1M5FA 1ZBMA 3TFLA 2FA7A 1UTHB 4H6DA 1MQJA 1N3WA 3T9HB 2I0BA 2XXUA 2Y7PA 3K1PA 2R71A 1B05A 3U94A 1VFDA 2OCUA 5I2NB 1WDNA 4G8NA 3UA8A 1PC3A 1DPPA 1XT8A 3UP9A 1MY3A 1OVBA 5JTYB 5EHSA 3KJ7A 4KPTA 4MF3A 3K6VA 3IK6B 1UTBA 2ANJA 5I59A 4EF2A 4EQ9A 3E3KA 1DTZA 3AXFA 4NF5B 4XKRA 3PMXA 3FZVA 3W9VA 4RPNA 2F7AA 4GIZA 4OWDA 3VE1B 1XHYA 4OQOA 2YJPA 4I1DA 3ZS6A 1VE4A 3RTFB 3H06B 3HCQA 4GXSB 4NF6A 3QYTA 3PUWE 5H8NB 3MUQA 2AL5A 3VFJA 2I3WA 2ZNTA 2D21A 3OO7A 3TQWA 1SI0A 4F29A 4IO7A 2OJTA 3FV1A 4G77A 1IXGA 4LQ5A 2Z8EA 5ICTA 3N94A 3HN0A 1LFIA 1RYOA 2XXYA 5HBCA 1B6HA 3I3VA 3ZSFA 5TP9B 1B3HA 2I6EA 4PP0A 2DWIA 1B0HA 1MPBA 1POTA 4JBZA 3Q27A 2E0SA 2I4BA 3MW0A 4LVQA 1H76A 3U92A 2F34A 3RUMA 1VSOA 2QMXA 3W9WA 4TLLB 1NKXA 1ZU0A 1SVXB 3Q25A 2V93A 3DM0A 2O7UA 2QSXA 1UTBB 4ZS9A 5I59B 1VFEA 3MPKA 4YB5A 2DVZA 3C32A 3TTLA 1AMFA 5AE4A 4IO3A 1QULA 4BDRA 4GL8A 3O66A 1LFGA 1ZIUA 1LFHA 2FYIA 4H65A 4KCDA 3K6WA 4OMBA 3A3UA 3IOTA 3HHGA 2HAUA 1MPDA 5TU0A 4QFLA 1S50A 3TTKA 1A54A 1MM7A 2IA4A 1B5JA 1B0LA 2NUVA 4ZE8A 1IEJA 1M5BA 4NF6B 4NE4A 1JW5A 3K00A 1I6QA 4QHQA 3TKDA 3OMBA 2WKYA 3MVWA 1GVCA 4GL0A 4PFTA 1J1NA 4KCCA 3G3FA 4F1UA 4LZ5A 4OEUA 3BFTA 3LBSA 3H6UA 5CC2A 3FASA 3MPLA 1QKAA 3C9HA 1A40A 3K0VA 1MQIA 4H1XA 1MRPA 2O7IA 1D9VA 5L9OA 3OO8A 1IXHA 4I8CA 2DP8A 1FQFA 3H3GA 5DVIA 4QSCA 4UACA 3RY3A 5FHNA 1Y1MA 2I3VA 3EQ1A 2CMOA 3MWBA 3K6XA 1AH5A 4H5GA 3IO6A 3E13X 3C35A 3A3CA 1MXUA 1RYXA 4GD5A 3QUFA 5I2KA 2XXRA 2DWHA 3R26A 1B3LA 3KN8A 3O29A 4JWYA 2XX9A 3D4GA 4ESXA 4F3BA 2HZKA 3IAZA 4MLVA 1FTJA 3S9EA 3UN6A 4N13A 2HCAA 4NMYA 3M3KA 4XKPA 3TMGA 1PBQA 1JW1A 5L8DA 2H9BA 5DT6A 1ZLQA 2FNCA 4E0XA 5KCJA 2W7YA 3IR1A 1YCJA 1EH3A 1B4HA 3L6HA 3SERA 1ZTYA 4C1TA 2V84A 1B1XA 1DMBA 1QW0A 4LZ8A 2NWJA 1B9JA 5K2YA 1T0KA 5I56A 3KG2A 1B5IA 4BLAA 4ECFA 3EHUA 4HTGA 5H8SA 2YLNA 1PEBA 2QPQA 2ZNSA 4PFUA 2UXAA 2XX7A 3TCFA 1TFAA 3O28A 2Y7RA 3S9MC 2B3BA 3TYHA 4JSDA 3EHSA 1NH7A 1LGBC 3T9XB 5ITPA 5I2KB 3ZKKA 2GHAA 2VOZA 2I48A 1P1NA 2ZYNA 4RA1A 1USYE 3IB0A 4LUBA 2Q8JA 4H8JA 3W15C 5EHMA 3TCHA 2Q2AA 3KOTA 5AA2A 3VV5A 2V3UA 2DE2A 1GTKA 5F7VA 2P0SA 5CMKA 4GOTA 1B7UA 3TAJA 3MBPA 2QS1A 2F6GA 2PVUA 3KN3A 3SKPA 3G3KA 5KCJB 3O9PA 3THIA 3K01A 1MXYA 3FVNA 3VDFA 1NNFA 4I9DA 1SI1A 3QXMA 2O69A 3E4RA 1LAXA 4G68A 2I49A 4ZZAA 3ILTB 4QFPA 1FQDA 1BIYA 3FV2A 2GFEA 2Y7IA 3T9VA 1P1QA 5I56B 3EHTA 1BTJA 1ELJA 5IAIA 1MY0A 2H25A 5L9MA 1N7WA 3RN8A 2DE4A 1YTVA 3JYRA 1P1UA 1B46A 2GHBA 1DOTA 2XD2A 1DTGA 4R6HA 3TPAA 3IJOB 3RGYA 1MXVA 5FHOA 1Z7ME 1M5EA 5JK4A 4KYSA 2RCAA 2XXVA 4C1UA 4KR5A 2Z8FA 4OFJA 3TDJA 3H03A 5KDTA 3UK4A 3H4ZA 4L17A 5BWJA 1ZJLA 5F1QA 3LSXA 1PB8A 1P1WA 1MPCA 4XKQA 4Q0CA 4ELOA 1S9TA 3O97A 4XIGQ 3I6VA 3KFMA 1H45A 3TODA 3ZKLA 5AA3A 5AA2B 4ZECA 3D4CA 2XXPA 1MS7A 4G68C 4G8HA 1IUDA 2REJA 2DSFA 1MM6A 3U93A 4GWOA 1BP5A 2X7PA 1PB7A 4XTCQ 4NWCA 3FGSA 3KEIA 3MP6A 4EXKA 4F2QA 1MDQA 4G68B 2HAVA 1XVYA 2OLBA 2OWTA 4AQ4A 3FJGA 3FVOA 5IKBA 1NMUA 3CG1A 3GXAA 1MQHA 4DXUA 3TELA 1GGGA 2O1MA 4GQOA 4YZZA 3CIJA 3N6UA 2OZZA 4F1VA 3OD7A 2CZLA 3QSLA 1FTMA 4OXVA 3PV0E 1A7LA 4FIMA 1XOCA 2I4CA 4X1BA 3OOAA 4OZ9A 2QRYA 3EF7A 5DEXB 4NF4A 1FCKA 1N76A 2F8DA 3K4UA 3LSWA 4GF8A 5KDTB 3VVDA 3S4UA 1QJMA 4KYDA 3BFUA 3C31A 1XVXA 1Q1KA 1BKAA 3CFZA 4ELPA 2UYEA 4EF1A 3CSGA 2Z23A 2UVGA 2ZMBA 2Q89A 2QMWA 4HCYA 3VVFA 1BLFA 2P2AA 1DPEA 2E1SA 4R6YA 2RC9A 2NVUB 2DS9A 5JEIA 4YU0A 3T66A 4X48A 2F6PA 1D4NA 1Y1ZA 2H5YA 3VLUA 4ESWA 1P1OA 1LBCA 4WEPA 2ONRA 1USYH 1B58A 2KLFA 4JWOA 3DP6A 2VGQA 4R6KA 2QS3A 3R6UA 2LAOA 1FTKA 3G3IA 2D5WA 2ONKE 4GFRA 5KZTA 5CBRA 3UORA 1LB9A 3V8XB 3PD8A 3HO7A 3N5LA 1JW4A 4YMBA 1Y20A 2X7QA 4F31B 3MVZA 5B7DA 3DP4A 3T9UA 4AB6A 2V3QA 1LB8A 4YICA 4GRKA 1NL5A 2H4IA 3C36A 1AL3A 5FHMA 2PYYA 4NF4B 1JEUA 1M5DA 2DOJA 1B52A 4Q30B 2DQVA 4BDQA 5H8FA 3G7WA 1QKBA 3GZGA 1Y3QA 4R9FA 1R1NA 2QJEA 2YPNA 4U22A 2B65A 5TPAA 4M1VA 3P7IA 5H8QA 4ZEDA 1FQBA 4F3SA 4ELRA 4ZZEA 4IY5A 4QRZA 4LP2B 3WAEA 2GRVA 3O6HA 3FUZA 3T93B 1MXXA 3IB2A 1ANFA 4QSDA 2VD3A 2DXRA 4R72A 4XKNA 4EQBA 3LR1A 3USDA 4GXAA 3LC8A 1URGA 4YKKA 1R9LA 2PMSA 1B3GA 4OENA 4BDLA 4RYAA 3CVGA 2XXHA 5I84A 1II5A 3OO6A 4H5FA 4OVJA 5I57A 1SYIA 3KGCA 1B7ZA 3PD9A 4KD5A 3U1OA 3GBAA 4H8IA 1WVJA 3MVXA 3SESA 1MG1A 3S9LC 2XXWA 1POY1 2VP1A 1MH3A 4RJZA 4DIGA 1B4ZA 4OEVA 1FQCA 1IIWA 1Y3PA 4QFNA 3Q26A 4GLIA 3FVGA 1XS5A 2F36A 4QSEA 1GV8A 1NNKA 2V25A 5DVFA 5BUUA 2OBGA 3N26A 5HPQA 3Q29A 3RT8A 1A8FA 4ISUA 1LBBA 5DVJA 3PMVA 4FEDA 1B3EA 4F3PA 4IGRA 3G3HA 4G4PA 3H7MA 4RNSA 1ZKBA 3MAMA 1YPNA 3RTWB 3HPIA 4POXA 3MZ1A 1LCTA 5H8FB 1FW0A 4FE8A 1I6AA 3FVKA 1SW2A 1IXCA 3TEPA 4OFOA 2ZNUA 4OTEA 3KN7A 4OETA 2HZLA 5TPAB 2Q2CA 1WODA 5H8QB 3C33A 4KQPA 5CRYA 3VXBA 1LAHE 3M3LA 1US5A 5ICQA 3OSQA 4THIA 1EZOA 3OSRA 3PGFA 5K2XA 4MFIA 4R74A 4OHNA 3M3FA 1D3KA 1B51A 1B3FA 4EQ7A 4O3CA 3CG3A 4HS7A 2PBWA 3FXQA 4OESA 3ECRA 2XXQA 3O6IA 5I57B 1NNTA 4FAJA 1B5HA 2D3IA 1XC1A 4R73A 1MQGA 1PBPA 4Q8RA 3RLFE 2AIXA 4YB6A 4YMAA 1NH8A 2PT2A 1URDA 1URSA 3PU5A 1MXZA 3K1NA 2GH9A 3TZAA 4WEDA 2Y7KA 4Z0IA 4NWDA 1JEVA 3MP1A 1SDXA 3LUYA 3TUSA 4FEBA 4BDMA 4P0IA 2V3TA 3L6GA 2XXXA 2F7CA 5AA4A 1A99A 4WKMA 3VLWA 3KSJA 2ZYOA 5CMCA 3UGWA 4BDOA 4YAHX 1FQAA 5FTHA 1OLAA 4OYVA 3MQ9A 3JV9A 4NEDA 3UIFA 2H98A 5LOMA 2O6AA 3V5AA 3SEVA 5I58A 2VHAA 4RXLA 2R9JA 4H0WA 3MZ9A 4IO6A 5H8HA 1N84A 1DSNA 3C34A 5A5XA 3E9XA 1IITA 4PETA 3VVEA 3TTMA 1Y4TA 2P1SA 3SEUA 1FQEA 3RNNA 4NF8A 1IXIA 3S9NC 1ZMGA 3IX1A 3SETA 2XXIA 4K3FA 3SEWA 3WAFA 4EUOA 2RC8A 3KOSA 2DWAA 4JSOA 3FD3A 4HCWA 2O84X 3S2VA 1JQFA 3OEKA 1B7HA 3KZGA 2RKMA 4DE8A 4ZEBA 4EXLA 4NTLA 3HV1A 2REGA 3CFXA 4ZDMA 2DVCA 2AL4A 4FECA 3SEXA 1Q35A 4TLMB 3I5OA 3B7DA 2RINA 4PFWA 4KFQA 1IQ7A 2M8CA 1MQDA 3RPWA 1H43A 5AA4B 3U72A 2RC7A 3FJMA 4P0GA 1EZPA 1LAGE 3PPRA 2OK2A 2UYFA 1UIUA 3MJNA 4KI0E 4TOZA 2RF1A 3EPEA 4E0WA 1IZ1A 4LATA 4R9GA 3QUJA 3H6VA 4IO4A 4JDFA 4DXCA 1LLSA 3R7XA 3CI8A 3MC2A 2F78A 2PX1A 5I58B 2Y7WA 3C4MA 1OQHA 2ZYKA 5H8HB 3IB1A 2HFBA 5A5XB 4M4GA 3CSBA 1CE2A 3U8QA 4NF8B 4ZEFA 1JVYA 4R75A 2UVJA 3IOUA 3IOVA 3KBRA 2THIA 1H3DA 1MH4A 4MH5A 1F9BA 4U2RA 4U1ZA 1VR5A 2Z22A 4F1YA 4WXJA 4N07A 1MY4A 4YKPA 1OLCA 4RK2A 3CFLA 4ONYA 5CMMA 4ELQA 3PPNA 3IOWA 1JVXA 3ILUB 4F39A 1Y4CA 4IY6A 2A5SA 1TWYA 4OFLA 2I58A 3CR9A 2DE3A 1OMPA 1FTLA 1NFTA 4O3BA 1N3XA 3JZJA 4U4SA 2Q9TA 1OQGA 3LSLA 4I62A 4Q5TA 3BKIB 4PQJA 2XD3A 1HSLA 2BJJX 3ODBA 3EN3A 3LSFB 4TQUQ 4G8MA 4F22A 2G29A 1NNPA 4LQ2A 4U21A 3G3JA 1SYHA 3DP8A 4IB2A 1AOVA 4H67A 1R6ZA 2B3FA 2PT1A 5CMBA 4RK9A 4RY1A 2O1LA 3H6TA 3FXUA 4HW8A 4U23A 3Q28A 4FATA 4F19A 4QFOA 2QL3A 4YKJA 3QIMA 2ZXTA 3FJ7A 4FORA 2UVIA 2QS2A 1KWHA 3G3GA 3QK6A 1Z7NE 1RKMA 5L9SA 3MP8A 2AYSA 1CB6A 1N04A 5AA2D 5CM6A 5HM4B 1B32A 4PE5B 2NOOA 2X26A 4MLQA 2ABHA 1US4A 2VD2A 1I69A 3T96B 3RQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O68 A;  1MY2 A;  1JET A;  2RCB A;  1N7X A;  3M8U A;  3KJT A;  1HSE A;  3PPO A;  3VXC A;  1QUK A;  3TTN A;  3CRB A;  4IO5 A;  1Y9U A;  1OVT A;  3QAX A;  3FAT A;  4JWX A;  3GLB A;  4DCY A;  1PDA A;  1SBP A;  4XXU A;  1S7Y A;  1QUI A;  2DXY A;  4OER A;  4RPO A;  1TXF A;  3K6U A;  4ZEI A;  2IEE A;  1YAE A;  3O2A A;  4IGT A;  3DLN A;  3OXN A;  3K02 A;  3H6W A;  1B40 A;  1QVS A;  3KSX A;  5M2V A;  4R2B A;  3IOR A;  2Y84 A;  2ALU A;  1P99 A;  4Z7E A;  3BBR A;  1O64 A;  4U4X A;  3B6W A;  4F18 A;  2ZYM A;  3TTR A;  1SW1 A;  3O6G A;  5ISU A;  1FTO A;  4BDN A;  3MVY A;  4AB5 A;  1EZ9 A;  2R6G E;  3N6T A;  3OEL A;  2XX8 A;  5CBS A;  3HHF A;  3OEM A;  1O7T A;  3V83 A;  1R9Q A;  4JB7 A;  4POW A;  4PFY A;  3PUY E;  2F97 A;  1MDP 1;  4DDD A;  2A5T A;  1D9Y A;  2F5X A;  1MY1 A;  5AA1 A;  2DWJ A;  4GVO A;  1B1H A;  3GBB A;  1MXW A;  2DYX A;  2XHD A;  1JNF A;  3PPQ A;  1TT1 A;  4ZE9 A;  2ONS A;  3SDF A;  3B6Q A;  2H99 A;  3SEY A;  2OWS A;  4IO2 A;  4LZ7 A;  2F35 A;  1A55 A;  2O51 A;  1OIB A;  2NXO A;  5DTB A;  4DXB A;  2G93 A;  3V89 B;  1LAF E;  2Z8D A;  1I6B A;  3K1M A;  1LCF A;  3TCG A;  1UTH A;  5J1D A;  4QFK A;  3OO9 A;  1SQY A;  2HQ0 A;  5DYH A;  4DLD A;  4DCX A;  3FXR A;  1B2H A;  1UIV A;  3IL1 B;  3PUV E;  1HSJ A;  1O63 A;  5ELV A;  5I2N A;  4YKI A;  3VLV A;  5B70 A;  1TFD A;  4U1O A;  4DZ1 A;  1Y3N A;  2Q88 A;  5JTY A;  3IO4 A;  3DEL B;  3PUZ E;  2ESN A;  3ONM A;  2HXW A;  4LA9 A;  5CI5 A;  1H44 A;  4C0R A;  3A09 A;  2F7B A;  4UA8 A;  4LON B;  5ITO A;  3F11 A;  1PB9 A;  4NF5 A;  5EYF A;  1AIV A;  4G2Z A;  4N6P A;  4QF9 A;  1EU8 A;  3IJX B;  4F3G A;  1SW5 A;  5FTI A;  4KYE A;  2QS4 A;  1L5T A;  4P11 A;  4JXI A;  1UQW A;  4F2O A;  2XXT A;  1A8E A;  3HST A;  3RT6 B;  4R2F A;  3PPP A;  4FJP A;  2A5T B;  1GR2 A;  1M5C A;  4KHZ E;  1QUJ A;  4O3A A;  3PUX E;  3FIR A;  3TQL A;  1ATG A;  2I0C A;  1N0T A;  4MBP A;  4YB7 A;  3T22 A;  4ND9 A;  5H8N A;  4ZEK A;  1SW4 A;  2HEU A;  4X9T A;  4X1D A;  3OEN A;  3MZB A;  2UVH A;  3PMW A;  5DEX A;  3K2D A;  4EDP A;  1LST A;  1SD3 A;  3B6T A;  5TP9 A;  1M5F A;  1ZBM A;  3TFL A;  2FA7 A;  1UTH B;  4H6D A;  1MQJ A;  1N3W A;  3T9H B;  2I0B A;  2XXU A;  2Y7P A;  3K1P A;  2R71 A;  1B05 A;  3U94 A;  1VFD A;  2OCU A;  5I2N B;  1WDN A;  4G8N A;  3UA8 A;  1PC3 A;  1DPP A;  1XT8 A;  3UP9 A;  1MY3 A;  1OVB A;  5JTY B;  5EHS A;  3KJ7 A;  4KPT A;  4MF3 A;  3K6V A;  3IK6 B;  1UTB A;  2ANJ A;  5I59 A;  4EF2 A;  4EQ9 A;  3E3K A;  1DTZ A;  3AXF A;  4NF5 B;  4XKR A;  3PMX A;  3FZV A;  3W9V A;  4RPN A;  2F7A A;  4GIZ A;  4OWD A;  3VE1 B;  1XHY A;  4OQO A;  2YJP A;  4I1D A;  3ZS6 A;  1VE4 A;  3RTF B;  3H06 B;  3HCQ A;  4GXS B;  4NF6 A;  3QYT A;  3PUW E;  5H8N B;  3MUQ A;  2AL5 A;  3VFJ A;  2I3W A;  2ZNT A;  2D21 A;  3OO7 A;  3TQW A;  1SI0 A;  4F29 A;  4IO7 A;  2OJT A;  3FV1 A;  4G77 A;  1IXG A;  4LQ5 A;  2Z8E A;  5ICT A;  3N94 A;  3HN0 A;  1LFI A;  1RYO A;  2XXY A;  5HBC A;  1B6H A;  3I3V A;  3ZSF A;  5TP9 B;  1B3H A;  2I6E A;  4PP0 A;  2DWI A;  1B0H A;  1MPB A;  1POT A;  4JBZ A;  3Q27 A;  2E0S A;  2I4B A;  3MW0 A;  4LVQ A;  1H76 A;  3U92 A;  2F34 A;  3RUM A;  1VSO A;  2QMX A;  3W9W A;  4TLL B;  1NKX A;  1ZU0 A;  1SVX B;  3Q25 A;  2V93 A;  3DM0 A;  2O7U A;  2QSX A;  1UTB B;  4ZS9 A;  5I59 B;  1VFE A;  3MPK A;  4YB5 A;  2DVZ A;  3C32 A;  3TTL A;  1AMF A;  5AE4 A;  4IO3 A;  1QUL A;  4BDR A;  4GL8 A;  3O66 A;  1LFG A;  1ZIU A;  1LFH A;  2FYI A;  4H65 A;  4KCD A;  3K6W A;  4OMB A;  3A3U A;  3IOT A;  3HHG A;  2HAU A;  1MPD A;  5TU0 A;  4QFL A;  1S50 A;  3TTK A;  1A54 A;  1MM7 A;  2IA4 A;  1B5J A;  1B0L A;  2NUV A;  4ZE8 A;  1IEJ A;  1M5B A;  4NF6 B;  4NE4 A;  1JW5 A;  3K00 A;  1I6Q A;  4QHQ A;  3TKD A;  3OMB A;  2WKY A;  3MVW A;  1GVC A;  4GL0 A;  4PFT A;  1J1N A;  4KCC A;  3G3F A;  4F1U A;  4LZ5 A;  4OEU A;  3BFT A;  3LBS A;  3H6U A;  5CC2 A;  3FAS A;  3MPL A;  1QKA A;  3C9H A;  1A40 A;  3K0V A;  1MQI A;  4H1X A;  1MRP A;  2O7I A;  1D9V A;  5L9O A;  3OO8 A;  1IXH A;  4I8C A;  2DP8 A;  1FQF A;  3H3G A;  5DVI A;  4QSC A;  4UAC A;  3RY3 A;  5FHN A;  1Y1M A;  2I3V A;  3EQ1 A;  2CMO A;  3MWB A;  3K6X A;  1AH5 A;  4H5G A;  3IO6 A;  3E13 X;  3C35 A;  3A3C A;  1MXU A;  1RYX A;  4GD5 A;  3QUF A;  5I2K A;  2XXR A;  2DWH A;  3R26 A;  1B3L A;  3KN8 A;  3O29 A;  4JWY A;  2XX9 A;  3D4G A;  4ESX A;  4F3B A;  2HZK A;  3IAZ A;  4MLV A;  1FTJ A;  3S9E A;  3UN6 A;  4N13 A;  2HCA A;  4NMY A;  3M3K A;  4XKP A;  3TMG A;  1PBQ A;  1JW1 A;  5L8D A;  2H9B A;  5DT6 A;  1ZLQ A;  2FNC A;  4E0X A;  5KCJ A;  2W7Y A;  3IR1 A;  1YCJ A;  1EH3 A;  1B4H A;  3L6H A;  3SER A;  1ZTY A;  4C1T A;  2V84 A;  1B1X A;  1DMB A;  1QW0 A;  4LZ8 A;  2NWJ A;  1B9J A;  5K2Y A;  1T0K A;  5I56 A;  3KG2 A;  1B5I A;  4BLA A;  4ECF A;  3EHU A;  4HTG A;  5H8S A;  2YLN A;  1PEB A;  2QPQ A;  2ZNS A;  4PFU A;  2UXA A;  2XX7 A;  3TCF A;  1TFA A;  3O28 A;  2Y7R A;  3S9M C;  2B3B A;  3TYH A;  4JSD A;  3EHS A;  1NH7 A;  1LGB C;  3T9X B;  5ITP A;  5I2K B;  3ZKK A;  2GHA A;  2VOZ A;  2I48 A;  1P1N A;  2ZYN A;  4RA1 A;  1USY E;  3IB0 A;  4LUB A;  2Q8J A;  4H8J A;  3W15 C;  5EHM A;  3TCH A;  2Q2A A;  3KOT A;  5AA2 A;  3VV5 A;  2V3U A;  2DE2 A;  1GTK A;  5F7V A;  2P0S A;  5CMK A;  4GOT A;  1B7U A;  3TAJ A;  3MBP A;  2QS1 A;  2F6G A;  2PVU A;  3KN3 A;  3SKP A;  3G3K A;  5KCJ B;  3O9P A;  3THI A;  3K01 A;  1MXY A;  3FVN A;  3VDF A;  1NNF A;  4I9D A;  1SI1 A;  3QXM A;  2O69 A;  3E4R A;  1LAX A;  4G68 A;  2I49 A;  4ZZA A;  3ILT B;  4QFP A;  1FQD A;  1BIY A;  3FV2 A;  2GFE A;  2Y7I A;  3T9V A;  1P1Q A;  5I56 B;  3EHT A;  1BTJ A;  1ELJ A;  5IAI A;  1MY0 A;  2H25 A;  5L9M A;  1N7W A;  3RN8 A;  2DE4 A;  1YTV A;  3JYR A;  1P1U A;  1B46 A;  2GHB A;  1DOT A;  2XD2 A;  1DTG A;  4R6H A;  3TPA A;  3IJO B;  3RGY A;  1MXV A;  5FHO A;  1Z7M E;  1M5E A;  5JK4 A;  4KYS A;  2RCA A;  2XXV A;  4C1U A;  4KR5 A;  2Z8F A;  4OFJ A;  3TDJ A;  3H03 A;  5KDT A;  3UK4 A;  3H4Z A;  4L17 A;  5BWJ A;  1ZJL A;  5F1Q A;  3LSX A;  1PB8 A;  1P1W A;  1MPC A;  4XKQ A;  4Q0C A;  4ELO A;  1S9T A;  3O97 A;  4XIG Q;  3I6V A;  3KFM A;  1H45 A;  3TOD A;  3ZKL A;  5AA3 A;  5AA2 B;  4ZEC A;  3D4C A;  2XXP A;  1MS7 A;  4G68 C;  4G8H A;  1IUD A;  2REJ A;  2DSF A;  1MM6 A;  3U93 A;  4GWO A;  1BP5 A;  2X7P A;  1PB7 A;  4XTC Q;  4NWC A;  3FGS A;  3KEI A;  3MP6 A;  4EXK A;  4F2Q A;  1MDQ A;  4G68 B;  2HAV A;  1XVY A;  2OLB A;  2OWT A;  4AQ4 A;  3FJG A;  3FVO A;  5IKB A;  1NMU A;  3CG1 A;  3GXA A;  1MQH A;  4DXU A;  3TEL A;  1GGG A;  2O1M A;  4GQO A;  4YZZ A;  3CIJ A;  3N6U A;  2OZZ A;  4F1V A;  3OD7 A;  2CZL A;  3QSL A;  1FTM A;  4OXV A;  3PV0 E;  1A7L A;  4FIM A;  1XOC A;  2I4C A;  4X1B A;  3OOA A;  4OZ9 A;  2QRY A;  3EF7 A;  5DEX B;  4NF4 A;  1FCK A;  1N76 A;  2F8D A;  3K4U A;  3LSW A;  4GF8 A;  5KDT B;  3VVD A;  3S4U A;  1QJM A;  4KYD A;  3BFU A;  3C31 A;  1XVX A;  1Q1K A;  1BKA A;  3CFZ A;  4ELP A;  2UYE A;  4EF1 A;  3CSG A;  2Z23 A;  2UVG A;  2ZMB A;  2Q89 A;  2QMW A;  4HCY A;  3VVF A;  1BLF A;  2P2A A;  1DPE A;  2E1S A;  4R6Y A;  2RC9 A;  2NVU B;  2DS9 A;  5JEI A;  4YU0 A;  3T66 A;  4X48 A;  2F6P A;  1D4N A;  1Y1Z A;  2H5Y A;  3VLU A;  4ESW A;  1P1O A;  1LBC A;  4WEP A;  2ONR A;  1USY H;  1B58 A;  2KLF A;  4JWO A;  3DP6 A;  2VGQ A;  4R6K A;  2QS3 A;  3R6U A;  2LAO A;  1FTK A;  3G3I A;  2D5W A;  2ONK E;  4GFR A;  5KZT A;  5CBR A;  3UOR A;  1LB9 A;  3V8X B;  3PD8 A;  3HO7 A;  3N5L A;  1JW4 A;  4YMB A;  1Y20 A;  2X7Q A;  4F31 B;  3MVZ A;  5B7D A;  3DP4 A;  3T9U A;  4AB6 A;  2V3Q A;  1LB8 A;  4YIC A;  4GRK A;  1NL5 A;  2H4I A;  3C36 A;  1AL3 A;  5FHM A;  2PYY A;  4NF4 B;  1JEU A;  1M5D A;  2DOJ A;  1B52 A;  4Q30 B;  2DQV A;  4BDQ A;  5H8F A;  3G7W A;  1QKB A;  3GZG A;  1Y3Q A;  4R9F A;  1R1N A;  2QJE A;  2YPN A;  4U22 A;  2B65 A;  5TPA A;  4M1V A;  3P7I A;  5H8Q A;  4ZED A;  1FQB A;  4F3S A;  4ELR A;  4ZZE A;  4IY5 A;  4QRZ A;  4LP2 B;  3WAE A;  2GRV A;  3O6H A;  3FUZ A;  3T93 B;  1MXX A;  3IB2 A;  1ANF A;  4QSD A;  2VD3 A;  2DXR A;  4R72 A;  4XKN A;  4EQB A;  3LR1 A;  3USD A;  4GXA A;  3LC8 A;  1URG A;  4YKK A;  1R9L A;  2PMS A;  1B3G A;  4OEN A;  4BDL A;  4RYA A;  3CVG A;  2XXH A;  5I84 A;  1II5 A;  3OO6 A;  4H5F A;  4OVJ A;  5I57 A;  1SYI A;  3KGC A;  1B7Z A;  3PD9 A;  4KD5 A;  3U1O A;  3GBA A;  4H8I A;  1WVJ A;  3MVX A;  3SES A;  1MG1 A;  3S9L C;  2XXW A;  1POY 1;  2VP1 A;  1MH3 A;  4RJZ A;  4DIG A;  1B4Z A;  4OEV A;  1FQC A;  1IIW A;  1Y3P A;  4QFN A;  3Q26 A;  4GLI A;  3FVG A;  1XS5 A;  2F36 A;  4QSE A;  1GV8 A;  1NNK A;  2V25 A;  5DVF A;  5BUU A;  2OBG A;  3N26 A;  5HPQ A;  3Q29 A;  3RT8 A;  1A8F A;  4ISU A;  1LBB A;  5DVJ A;  3PMV A;  4FED A;  1B3E A;  4F3P A;  4IGR A;  3G3H A;  4G4P A;  3H7M A;  4RNS A;  1ZKB A;  3MAM A;  1YPN A;  3RTW B;  3HPI A;  4POX A;  3MZ1 A;  1LCT A;  5H8F B;  1FW0 A;  4FE8 A;  1I6A A;  3FVK A;  1SW2 A;  1IXC A;  3TEP A;  4OFO A;  2ZNU A;  4OTE A;  3KN7 A;  4OET A;  2HZL A;  5TPA B;  2Q2C A;  1WOD A;  5H8Q B;  3C33 A;  4KQP A;  5CRY A;  3VXB A;  1LAH E;  3M3L A;  1US5 A;  5ICQ A;  3OSQ A;  4THI A;  1EZO A;  3OSR A;  3PGF A;  5K2X A;  4MFI A;  4R74 A;  4OHN A;  3M3F A;  1D3K A;  1B51 A;  1B3F A;  4EQ7 A;  4O3C A;  3CG3 A;  4HS7 A;  2PBW A;  3FXQ A;  4OES A;  3ECR A;  2XXQ A;  3O6I A;  5I57 B;  1NNT A;  4FAJ A;  1B5H A;  2D3I A;  1XC1 A;  4R73 A;  1MQG A;  1PBP A;  4Q8R A;  3RLF E;  2AIX A;  4YB6 A;  4YMA A;  1NH8 A;  2PT2 A;  1URD A;  1URS A;  3PU5 A;  1MXZ A;  3K1N A;  2GH9 A;  3TZA A;  4WED A;  2Y7K A;  4Z0I A;  4NWD A;  1JEV A;  3MP1 A;  1SDX A;  3LUY A;  3TUS A;  4FEB A;  4BDM A;  4P0I A;  2V3T A;  3L6G A;  2XXX A;  2F7C A;  5AA4 A;  1A99 A;  4WKM A;  3VLW A;  3KSJ A;  2ZYO A;  5CMC A;  3UGW A;  4BDO A;  4YAH X;  1FQA A;  5FTH A;  1OLA A;  4OYV A;  3MQ9 A;  3JV9 A;  4NED A;  3UIF A;  2H98 A;  5LOM A;  2O6A A;  3V5A A;  3SEV A;  5I58 A;  2VHA A;  4RXL A;  2R9J A;  4H0W A;  3MZ9 A;  4IO6 A;  5H8H A;  1N84 A;  1DSN A;  3C34 A;  5A5X A;  3E9X A;  1IIT A;  4PET A;  3VVE A;  3TTM A;  1Y4T A;  2P1S A;  3SEU A;  1FQE A;  3RNN A;  4NF8 A;  1IXI A;  3S9N C;  1ZMG A;  3IX1 A;  3SET A;  2XXI A;  4K3F A;  3SEW A;  3WAF A;  4EUO A;  2RC8 A;  3KOS A;  2DWA A;  4JSO A;  3FD3 A;  4HCW A;  2O84 X;  3S2V A;  1JQF A;  3OEK A;  1B7H A;  3KZG A;  2RKM A;  4DE8 A;  4ZEB A;  4EXL A;  4NTL A;  3HV1 A;  2REG A;  3CFX A;  4ZDM A;  2DVC A;  2AL4 A;  4FEC A;  3SEX A;  1Q35 A;  4TLM B;  3I5O A;  3B7D A;  2RIN A;  4PFW A;  4KFQ A;  1IQ7 A;  2M8C A;  1MQD A;  3RPW A;  1H43 A;  5AA4 B;  3U72 A;  2RC7 A;  3FJM A;  4P0G A;  1EZP A;  1LAG E;  3PPR A;  2OK2 A;  2UYF A;  1UIU A;  3MJN A;  4KI0 E;  4TOZ A;  2RF1 A;  3EPE A;  4E0W A;  1IZ1 A;  4LAT A;  4R9G A;  3QUJ A;  3H6V A;  4IO4 A;  4JDF A;  4DXC A;  1LLS A;  3R7X A;  3CI8 A;  3MC2 A;  2F78 A;  2PX1 A;  5I58 B;  2Y7W A;  3C4M A;  1OQH A;  2ZYK A;  5H8H B;  3IB1 A;  2HFB A;  5A5X B;  4M4G A;  3CSB A;  1CE2 A;  3U8Q A;  4NF8 B;  4ZEF A;  1JVY A;  4R75 A;  2UVJ A;  3IOU A;  3IOV A;  3KBR A;  2THI A;  1H3D A;  1MH4 A;  4MH5 A;  1F9B A;  4U2R A;  4U1Z A;  1VR5 A;  2Z22 A;  4F1Y A;  4WXJ A;  4N07 A;  1MY4 A;  4YKP A;  1OLC A;  4RK2 A;  3CFL A;  4ONY A;  5CMM A;  4ELQ A;  3PPN A;  3IOW A;  1JVX A;  3ILU B;  4F39 A;  1Y4C A;  4IY6 A;  2A5S A;  1TWY A;  4OFL A;  2I58 A;  3CR9 A;  2DE3 A;  1OMP A;  1FTL A;  1NFT A;  4O3B A;  1N3X A;  3JZJ A;  4U4S A;  2Q9T A;  1OQG A;  3LSL A;  4I62 A;  4Q5T A;  3BKI B;  4PQJ A;  2XD3 A;  1HSL A;  2BJJ X;  3ODB A;  3EN3 A;  3LSF B;  4TQU Q;  4G8M A;  4F22 A;  2G29 A;  1NNP A;  4LQ2 A;  4U21 A;  3G3J A;  1SYH A;  3DP8 A;  4IB2 A;  1AOV A;  4H67 A;  1R6Z A;  2B3F A;  2PT1 A;  5CMB A;  4RK9 A;  4RY1 A;  2O1L A;  3H6T A;  3FXU A;  4HW8 A;  4U23 A;  3Q28 A;  4FAT A;  4F19 A;  4QFO A;  2QL3 A;  4YKJ A;  3QIM A;  2ZXT A;  3FJ7 A;  4FOR A;  2UVI A;  2QS2 A;  1KWH A;  3G3G A;  3QK6 A;  1Z7N E;  1RKM A;  5L9S A;  3MP8 A;  2AYS A;  1CB6 A;  1N04 A;  5AA2 D;  5CM6 A;  5HM4 B;  1B32 A;  4PE5 B;  2NOO A;  2X26 A;  4MLQ A;  2ABH A;  1US4 A;  2VD2 A;  1I69 A;  3T96 B;  3RQT A; 
#chains in the Genus database with same CATH topology
 2O68 A;  4MAG A;  1MY2 A;  1JET A;  4X04 A;  3E79 A;  3SZP A;  2RCB A;  1N7X A;  3M8U A;  2WEF A;  3KJT A;  1HSE A;  3PPO A;  3VXC A;  1QUK A;  3TTN A;  3CRB A;  4GX4 A;  4IO5 A;  1Y9U A;  3MST A;  1OVT A;  3QAX A;  3FAT A;  4JWX A;  3GLB A;  4PAF A;  2P3V A;  4DCY A;  1PDA A;  4MNC A;  1SBP A;  4XXU A;  1S7Y A;  1QUI A;  2DXY A;  4OER A;  4P1L A;  4RPO A;  1TXF A;  3K6U A;  4JVD A;  4ZEI A;  2IEE A;  1YAE A;  3O2A A;  4IGT A;  3DLN A;  3OXN A;  4PDH A;  3K02 A;  3H6W A;  1B40 A;  1QVS A;  3KSX A;  5M2V A;  4R2B A;  3IOR A;  5J16 A;  2Y84 A;  2F3D A;  3CHG A;  2ALU A;  4GX3 A;  1P99 A;  4Z7E A;  3BBR A;  1O64 A;  4U4X A;  3B6W A;  4F18 A;  3IFC A;  1KZ8 A;  2ZYM A;  3TTR A;  1SW1 A;  3O6G A;  5T3J A;  5ISU A;  1FTO A;  4BDN A;  3MVY A;  4AB5 A;  1EZ9 A;  2R6G E;  3N6T A;  3OEL A;  2XX8 A;  5CBS A;  3HHF A;  3OEM A;  1O7T A;  3V83 A;  1R9Q A;  1YXI A;  2CZK A;  4JB7 A;  4POW A;  4PFY A;  2XA5 A;  3PUY E;  2F97 A;  1MDP 1;  4QBA A;  4DDD A;  2A5T A;  1D9Y A;  2F5X A;  1MY1 A;  5AA1 A;  2DWJ A;  4GVO A;  1B1H A;  3GBB A;  1MXW A;  1Q9D A;  2DYX A;  2XHD A;  4P9K A;  1JNF A;  3PPQ A;  5EQ9 A;  1TT1 A;  4ZE9 A;  2ONS A;  3SDF A;  3B6Q A;  2H99 A;  3SEY A;  2OWS A;  4IO2 A;  4LZ7 A;  2F35 A;  1A55 A;  1FBH A;  2O51 A;  1OIB A;  2NXO A;  5DTB A;  4DXB A;  2G93 A;  3V89 B;  1LAF E;  2Z8D A;  1I6B A;  3K1M A;  1LCF A;  4KXP A;  4NG7 A;  3TCG A;  1UTH A;  1K9Y A;  5J1D A;  4QFK A;  3OO9 A;  1SQY A;  2HQ0 A;  5DYH A;  4DLD A;  4DCX A;  3FXR A;  4XFE A;  1B2H A;  1UIV A;  3IL1 B;  3PUV E;  1HSJ A;  1O63 A;  5ELV A;  2KQZ A;  5I2N A;  4YKI A;  3VLV A;  5B70 A;  1EYJ A;  1TFD A;  4U1O A;  4DZ1 A;  1Y3N A;  2Q88 A;  4NN3 A;  5JTY A;  3IO4 A;  1NUW A;  3DEL B;  2XXK A;  3PUZ E;  2ESN A;  3ONM A;  1G0I A;  2HXW A;  4LA9 A;  5CI5 A;  1DCU A;  1H44 A;  4C0R A;  3A09 A;  2F7B A;  4UA8 A;  4LON B;  5ITO A;  3F11 A;  1PB9 A;  4NF5 A;  5EYF A;  1FSA A;  1AIV A;  4G2Z A;  4N6P A;  4QF9 A;  1EU8 A;  3IJX B;  5FBP A;  4F3G A;  1SW5 A;  4I3E A;  4MNI A;  5FTI A;  4KYE A;  2QS4 A;  1L5T A;  4P11 A;  4JXI A;  1UQW A;  1NV0 A;  4F2O A;  2XXT A;  1A8E A;  3HST A;  3RT6 B;  4R2F A;  3PPP A;  4FJP A;  2A5T B;  1GR2 A;  1M5C A;  4KHZ E;  1QUJ A;  4O3A A;  3PUX E;  3FIR A;  3TQL A;  1ATG A;  2I0C A;  1N0T A;  4MBP A;  4YB7 A;  3T22 A;  4ND9 A;  5EYG A;  4N81 A;  5H8N A;  4ZEK A;  1SW4 A;  2HEU A;  4X9T A;  4PBH A;  4PGP A;  1LBZ A;  1BK4 A;  4X1D A;  3OEN A;  1FPF A;  3MZB A;  2UVH A;  3PMW A;  4OVP A;  1NV3 A;  5DEX A;  3K2D A;  4EDP A;  1LST A;  1SD3 A;  3B6T A;  5TP9 A;  1M5F A;  1ZBM A;  3TFL A;  2FA7 A;  1UTH B;  4H6D A;  1MQJ A;  4IR8 A;  1N3W A;  3T9H B;  2I0B A;  2XXU A;  2Y7P A;  3K1P A;  1FRP A;  2R71 A;  1B05 A;  4GX6 A;  3U94 A;  1VFD A;  2OCU A;  5I2N B;  1WDN A;  4MIJ A;  4G8N A;  3UA8 A;  3MYU A;  2MKZ A;  1PC3 A;  1DPP A;  1XT8 A;  3UP9 A;  1MY3 A;  1OVB A;  3D1R A;  5JTY B;  5EHS A;  1NV4 A;  3KJ7 A;  4KPT A;  4MF3 A;  3K6V A;  4DI3 D;  2P3N A;  3IK6 B;  3RPL A;  1UTB A;  2ANJ A;  5I59 A;  4EF2 A;  4EQ9 A;  3E3K A;  4GBW A;  4P56 A;  1DTZ A;  1YZ0 A;  3AXF A;  4NF5 B;  1LBW A;  4XKR A;  3PMX A;  3FZV A;  3W9V A;  4RPN A;  2F7A A;  4GIZ A;  4OWD A;  3VE1 B;  1XHY A;  2Y5K A;  2ZZX A;  4OQO A;  2YJP A;  4I1D A;  3ZS6 A;  4DI4 B;  1IME A;  1VE4 A;  3T0J A;  3RTF B;  4GWX A;  3H06 B;  2CZH A;  3HCQ A;  3A29 A;  4NF6 A;  2B4L A;  4GXS B;  3QYT A;  3PUW E;  5H8N B;  3MUQ A;  1XI6 A;  2AL5 A;  3VFJ A;  2I3W A;  2ZNT A;  2D21 A;  3OO7 A;  3TQW A;  1SI0 A;  4NGU A;  4F29 A;  4IO7 A;  2OJT A;  3FV1 A;  2FIX A;  4G77 A;  1IXG A;  1D9Q A;  4LQ5 A;  2Z8E A;  5ICT A;  3N94 A;  3HN0 A;  1LFI A;  1RYO A;  2XXY A;  5HBC A;  1B6H A;  3I3V A;  3ZSF A;  5TP9 B;  1B3H A;  2I6E A;  2QVV A;  4PP0 A;  2DWI A;  1B0H A;  1MPB A;  1POT A;  3ISP A;  4JBZ A;  3Q27 A;  2E0S A;  2I4B A;  3MW0 A;  4LVQ A;  1FBE A;  5IGA A;  1H76 A;  3U92 A;  4AS5 A;  4MJO A;  2F34 A;  3RUM A;  1VSO A;  2QMX A;  3W9W A;  4TLL B;  3GYY A;  1NKX A;  1ZU0 A;  1SVX B;  3Q25 A;  2V93 A;  3DM0 A;  2O7U A;  2QSX A;  3RPL B;  1UTB B;  4QXD A;  4ZS9 A;  5I59 B;  1VFE A;  3MPK A;  4YB5 A;  2DVZ A;  2HXR A;  3C32 A;  3TTL A;  1AMF A;  5AE4 A;  4IO3 A;  1QUL A;  4BDR A;  4GL8 A;  5EQA A;  3O66 A;  1LFG A;  1ZIU A;  1LFH A;  2FYI A;  4H65 A;  4KCD A;  3K6W A;  4OMB A;  3A3U A;  3IOT A;  5LDZ A;  4MX6 A;  3HHG A;  2HAU A;  1MPD A;  5TU0 A;  4QFL A;  1S50 A;  3TTK A;  2VT5 A;  1A54 A;  3BIG A;  2PFZ A;  1MM7 A;  2WBD A;  2IA4 A;  1B5J A;  4PTK A;  1B0L A;  2NUV A;  4ZE8 A;  1IEJ A;  1M5B A;  4NF6 B;  4NE4 A;  1JW5 A;  3K00 A;  1I6Q A;  4QHQ A;  3TKD A;  3OMB A;  5EQ7 A;  4N91 A;  2WKY A;  3MVW A;  1GVC A;  4GL0 A;  4PFT A;  1J1N A;  4KCC A;  3G3F A;  4F1U A;  4LZ5 A;  4OEU A;  3BFT A;  3LBS A;  3H6U A;  5CC2 A;  3FAS A;  3MPL A;  1QKA A;  3C9H A;  1A40 A;  3K0V A;  2F3B A;  1MQI A;  4H1X A;  1MRP A;  2O7I A;  1D9V A;  5L9O A;  3OO8 A;  1IXH A;  4I8C A;  1YYZ A;  3U65 A;  2DP8 A;  1FQF A;  3H3G A;  5DVI A;  4QSC A;  4PAI A;  5F24 A;  4UAC A;  3RY3 A;  5FHN A;  1Y1M A;  1SPI A;  2I3V A;  3EQ1 A;  2CMO A;  3MWB A;  3K6X A;  1AH5 A;  4H5G A;  3IO6 A;  2GQ1 A;  3E13 X;  4O94 A;  3C35 A;  4PC9 A;  3A3C A;  2PCR A;  1MXU A;  1RYX A;  4GD5 A;  3QMF A;  3QUF A;  5I2K A;  2XXR A;  2DWH A;  3R26 A;  1B3L A;  3KN8 A;  3O29 A;  4JWY A;  2XX9 A;  3D4G A;  4ESX A;  4F3B A;  2HZK A;  3IAZ A;  4MLV A;  1FTJ A;  3S9E A;  3UN6 A;  1FPK A;  4N13 A;  2HCA A;  4NMY A;  3M3K A;  4XKP A;  3TMG A;  1PBQ A;  1JW1 A;  5L8D A;  1NUX A;  2H9B A;  5DT6 A;  1ZLQ A;  2B4M A;  2FNC A;  4E0X A;  5KCJ A;  2W7Y A;  3IR1 A;  1LEV A;  1YCJ A;  1EH3 A;  1B4H A;  3L6H A;  3SER A;  1ZTY A;  4C1T A;  4OVT A;  2V84 A;  1B1X A;  1DMB A;  1QW0 A;  4LZ8 A;  2NWJ A;  4XEQ A;  1B9J A;  5K2Y A;  1T0K A;  5I56 A;  5LTC A;  3KG2 A;  1B5I A;  4BLA A;  4GBV A;  4ECF A;  3EHU A;  4HTG A;  5H8S A;  2YLN A;  1PEB A;  1FPI A;  2QPQ A;  2ZNS A;  4N6K A;  4PFU A;  2UXA A;  2XX7 A;  3TCF A;  1TFA A;  3O28 A;  2Y7R A;  1CNQ A;  3S9M C;  2B3B A;  3TYH A;  4JSD A;  2DDK A;  1NV1 A;  3EHS A;  2OWZ A;  1NH7 A;  1LGB C;  3T9X B;  5IZ1 A;  5ITP A;  1FBP A;  4I40 A;  5I2K B;  3ZKK A;  2GHA A;  2VOZ A;  4PFB A;  2I48 A;  1P1N A;  2ZYN A;  4RA1 A;  1USY E;  3IB0 A;  2V4C A;  4LUB A;  2Q8J A;  4H8J A;  3W15 C;  5EHM A;  3TCH A;  1FPL A;  2Q2A A;  2WBB A;  3KOT A;  5AA2 A;  3VV5 A;  2V3U A;  3B8B A;  2DE2 A;  2Y5L A;  1GTK A;  3KBZ A;  5F7V A;  2P0S A;  5CMK A;  4GOT A;  4HE1 A;  4GWW A;  1B7U A;  1FPD A;  3TAJ A;  3MBP A;  2QS1 A;  2F6G A;  2PVU A;  3KN3 A;  3SKP A;  3G3K A;  5KCJ B;  3O9P A;  3THI A;  3K01 A;  1MXY A;  3FVN A;  2CEY A;  3VDF A;  2XWI A;  1NNF A;  4I9D A;  1SI1 A;  3QXM A;  2O69 A;  3E4R A;  1LAX A;  4G68 A;  2I49 A;  4ZZA A;  3ILT B;  4QFP A;  1FQD A;  4OVQ A;  1BIY A;  5ET7 A;  2ZZW A;  2PFY A;  3FV2 A;  2GFE A;  2Y7I A;  4AS4 A;  3T9V A;  1P1Q A;  5I56 B;  4X8R A;  3EHT A;  1BTJ A;  1ELJ A;  5IAI A;  1MY0 A;  2H25 A;  5L9M A;  1N7W A;  3RN8 A;  5ET5 A;  2DE4 A;  1YTV A;  4PDD A;  1FPB A;  3JYR A;  1P1U A;  1B46 A;  2GHB A;  1DOT A;  2XD2 A;  4R6H A;  1DTG A;  3TPA A;  2WX9 A;  3IJO B;  3RGY A;  1MXV A;  4MCO A;  5FHO A;  4N6D A;  1Z7M E;  1M5E A;  1KA0 A;  5JK4 A;  4KYS A;  2RCA A;  4OVR A;  2XXV A;  4C1U A;  4KR5 A;  2Z8F A;  4OFJ A;  3TDJ A;  5A5L A;  2ZZV A;  3H03 A;  5KDT A;  3UK4 A;  3H4Z A;  4L17 A;  5BWJ A;  1ZJL A;  5F1Q A;  3LSX A;  2VPO A;  1PB8 A;  1P1W A;  1MPC A;  4XF5 A;  4XKQ A;  4Q0C A;  4ELO A;  1S9T A;  3O97 A;  1FBD A;  4XIG Q;  3I6V A;  3KFM A;  1H45 A;  3TOD A;  3ZKL A;  3KC1 A;  2L5V A;  5AA3 A;  5AA2 B;  4ZEC A;  3D4C A;  1IMA A;  1MS7 A;  1FBC A;  2XXP A;  4G68 C;  1IUD A;  2REJ A;  4G8H A;  2DSF A;  1MM6 A;  3U93 A;  4GWO A;  1BP5 A;  2X7P A;  1PB7 A;  4PFR A;  4XTC Q;  4MEV A;  5IM2 A;  3IFA A;  4NWC A;  3FGS A;  3KEI A;  3MP6 A;  4EXK A;  1AWB A;  4F2Q A;  1MDQ A;  4G68 B;  2HAV A;  1LBY A;  1XVY A;  2OLB A;  2OWT A;  2XWO A;  2KR0 A;  4AQ4 A;  3FJG A;  3FVO A;  4N8Y A;  5IKB A;  1NMU A;  3CG1 A;  3GXA A;  1MQH A;  4DXU A;  1FPJ A;  3TEL A;  1GGG A;  2FIE A;  2O1M A;  4GQO A;  4YZZ A;  3CIJ A;  3N6U A;  4PGN A;  4P8B A;  4P47 A;  2OZZ A;  4F1V A;  3OD7 A;  2CZL A;  3QSL A;  1FTM A;  4OXV A;  3PV0 E;  1A7L A;  4FIM A;  1XOC A;  1VDW A;  3LV0 A;  2I4C A;  4N15 A;  4X1B A;  3OOA A;  4FBP A;  4OZ9 A;  2QRY A;  3EF7 A;  5DEX B;  2QVR A;  4NF4 A;  1FCK A;  1FPG A;  1N76 A;  2F8D A;  3K4U A;  3LSW A;  4GF8 A;  4N4U A;  3FXB A;  5KDT B;  3VVD A;  3S4U A;  4GWY A;  1QJM A;  4KYD A;  3BFU A;  3C31 A;  1XVX A;  1Q1K A;  1BKA A;  3CFZ A;  4ELP A;  2UYE A;  4EF1 A;  3CSG A;  2Z23 A;  2UVG A;  5IZZ A;  2ZMB A;  2Q89 A;  2QMW A;  1IMD A;  4HCY A;  3VVF A;  1BLF A;  2P2A A;  1DPE A;  2E1S A;  4R6Y A;  2RC9 A;  2NVU B;  2DS9 A;  5JEI A;  4YU0 A;  3T66 A;  4X48 A;  2F6P A;  1D4N A;  1Y1Z A;  2H5Y A;  3VLU A;  4ESW A;  1P1O A;  1K9Z A;  1LBC A;  4WEP A;  2ONR A;  1USY H;  1B58 A;  2KLF A;  4JWO A;  4NAP A;  3DP6 A;  1NI9 A;  2VGQ A;  4R6K A;  2QS3 A;  3R6U A;  2LAO A;  1FTK A;  3G3I A;  2D5W A;  4P3L A;  2ONK E;  4GFR A;  5KZT A;  4P1E A;  5EYH A;  5CBR A;  3UOR A;  1LB9 A;  3V8X B;  4H45 A;  3PD8 A;  5ET6 A;  3HO7 A;  3N5L A;  1JW4 A;  4YMB A;  1Y20 A;  2X7Q A;  4F31 B;  3NOH A;  3MVZ A;  5B7D A;  3DP4 A;  3T9U A;  4AB6 A;  2V3Q A;  1FBF A;  1LB8 A;  4YIC A;  4GRK A;  1NL5 A;  3KC0 A;  2H4I A;  1FJ6 A;  3C36 A;  1AL3 A;  5FHM A;  2PYY A;  4NF4 B;  4HXV A;  4NF0 A;  1JEU A;  1M5D A;  2DOJ A;  2XWK A;  1B52 A;  4Q30 B;  2DQV A;  4BDQ A;  5H8F A;  3G7W A;  1QKB A;  3GZG A;  1Y3Q A;  4MMP A;  4R9F A;  1R1N A;  4O7M A;  2QJE A;  1RDX A;  2YPN A;  4U22 A;  2B65 A;  5TPA A;  4M1V A;  3P7I A;  5H8Q A;  4ZED A;  3RYD A;  1FQB A;  4F3S A;  4ELR A;  4ZZE A;  4IY5 A;  4QRZ A;  4LP2 B;  3WAE A;  2GRV A;  3O6H A;  3FUZ A;  3T93 B;  1MXX A;  3EKI A;  3IB2 A;  1ANF A;  4QSD A;  2VD3 A;  2DXR A;  4R72 A;  4XKN A;  4EQB A;  3LR1 A;  3USD A;  4GXA A;  3LC8 A;  1URG A;  4YKK A;  1R9L A;  2PMS A;  1B3G A;  4OEN A;  4BDL A;  4RYA A;  3CVG A;  2XXH A;  5I84 A;  1II5 A;  3OO6 A;  4H5F A;  4OVJ A;  5I57 A;  1SYI A;  3KGC A;  1B7Z A;  3PD9 A;  1EYI A;  4KD5 A;  3LUZ A;  3U1O A;  3GBA A;  4H8I A;  1WVJ A;  3MVX A;  4NHB A;  3SES A;  1MG1 A;  3S9L C;  2XXW A;  1POY 1;  2VP1 A;  1MH3 A;  4RJZ A;  4DIG A;  1B4Z A;  4OEV A;  1FQC A;  1IIW A;  1Y3P A;  4PBQ A;  3Q26 A;  4GLI A;  4QFN A;  3FVG A;  1XS5 A;  3E78 A;  1FPE A;  4N17 A;  2F36 A;  4QSE A;  1GV8 A;  2Q74 A;  4PAK A;  1NNK A;  2V25 A;  5DVF A;  4HE0 A;  5BUU A;  2OBG A;  3N26 A;  5HPQ A;  1FTA A;  3Q29 A;  5I5P A;  3RT8 A;  1A8F A;  4ISU A;  1LBB A;  5DVJ A;  3PMV A;  4FED A;  1B3E A;  4OA4 A;  4F3P A;  4IGR A;  3G3H A;  4G4P A;  3H7M A;  4RNS A;  2QVU A;  1ZKB A;  3MAM A;  1YPN A;  2WYK A;  3RTW B;  3HPI A;  4POX A;  2QFL A;  3MZ1 A;  1LCT A;  5H8F B;  1FW0 A;  4FE8 A;  1NV7 A;  1I6A A;  3T1B A;  3FVK A;  1SW2 A;  3ROJ A;  1IXC A;  3TEP A;  4OFO A;  2ZNU A;  4OTE A;  3KN7 A;  4OET A;  1QGX A;  2HZL A;  5TPA B;  4O7I A;  2Q2C A;  1WOD A;  5H8Q B;  3C33 A;  4KQP A;  5CRY A;  3VXB A;  1LAH E;  3M3L A;  1US5 A;  5ICQ A;  3OSQ A;  4THI A;  1EZO A;  1LBV A;  3OSR A;  3PGF A;  5K2X A;  1NUY A;  4MFI A;  4R74 A;  4OHN A;  3M3F A;  1D3K A;  1B51 A;  1B3F A;  4EQ7 A;  4O3C A;  3CG3 A;  4HS7 A;  1EYK A;  2PBW A;  3FXQ A;  4OES A;  3ECR A;  2XXQ A;  4NX1 A;  3O6I A;  5I57 B;  1NV6 A;  1NNT A;  4FAJ A;  1B5H A;  2D3I A;  4UAB A;  1XC1 A;  4R73 A;  1MQG A;  1PBP A;  4Q8R A;  3RLF E;  2AIX A;  4YB6 A;  4YMA A;  1NH8 A;  2PT2 A;  1URD A;  1URS A;  3PU5 A;  1INP A;  1MXZ A;  3K1N A;  2GH9 A;  3TZA A;  4WED A;  2Y7K A;  4Z0I A;  4NWD A;  1JEV A;  3MP1 A;  1SDX A;  5I7I A;  3LUY A;  3TUS A;  4FEB A;  2FVZ A;  4BDM A;  4P0I A;  2V3T A;  4LN5 A;  3L6G A;  2XXX A;  4PCD A;  2F7C A;  5AA4 A;  1NV2 A;  1A99 A;  4WKM A;  3VLW A;  3KSJ A;  4GWU A;  2ZYO A;  5CMC A;  4OVS A;  2HPG A;  3UGW A;  4BDO A;  4YAH X;  1FQA A;  4N8G A;  5FTH A;  1OLA A;  4H46 A;  4OYV A;  3MQ9 A;  3JV9 A;  4NED A;  2FBP A;  3UIF A;  2H98 A;  5LOM A;  2O6A A;  4GWZ A;  3V5A A;  4O8M A;  1LBX A;  3SEV A;  5I3S A;  3FBP A;  5I58 A;  2VHA A;  4RXL A;  2R9J A;  2JJK A;  4H0W A;  3MZ9 A;  4IO6 A;  3HFU A;  5H8H A;  1N84 A;  1DSN A;  3C34 A;  1NUZ A;  5A5X A;  3E9X A;  1IIT A;  5ET8 A;  4PET A;  1DBZ A;  3VVE A;  3TTM A;  1Y4T A;  2CZI A;  2P1S A;  1FQE A;  3SEU A;  4PE3 A;  3RNN A;  4NF8 A;  1IXI A;  3S9N C;  1ZMG A;  3BIH A;  3IX1 A;  3SET A;  2XXI A;  4K3F A;  3SEW A;  3WAF A;  4EUO A;  2R8T A;  2RC8 A;  3KOS A;  1IMF A;  2DWA A;  4JSO A;  3FD3 A;  4HCW A;  2O84 X;  3S2V A;  1JQF A;  3OEK A;  1B7H A;  4OAN A;  3KZG A;  2RKM A;  4DE8 A;  4ZEB A;  4EXL A;  4NQ8 A;  4NTL A;  3HV1 A;  2REG A;  3CFX A;  4ZDM A;  2DVC A;  2AL4 A;  3B50 A;  4FEC A;  3SEX A;  1Q35 A;  4TLM B;  3I5O A;  3B7D A;  2RIN A;  4PFW A;  1FJ9 A;  4KFQ A;  1IQ7 A;  2M8C A;  4MHF A;  1MQD A;  3RPW A;  1H43 A;  5AA4 B;  5IZ3 A;  1DK4 A;  4GWS A;  3U72 A;  2RC7 A;  3FJM A;  4G61 A;  4P0G A;  1EZP A;  1LAG E;  3PPR A;  2OK2 A;  2UYF A;  1UIU A;  4PFI A;  3MJN A;  4KI0 E;  4TOZ A;  2RF1 A;  3EPE A;  4E0W A;  1IZ1 A;  5DW8 A;  4LAT A;  4R9G A;  3QUJ A;  1FBG A;  3H6V A;  4IO4 A;  4JDF A;  5ESY A;  1IMC A;  4DXC A;  5EQ8 A;  1LLS A;  3R7X A;  3CI8 A;  3MC2 A;  2F78 A;  2PX1 A;  5I58 B;  2Y7W A;  3C4M A;  1OQH A;  2FHY A;  2ZYK A;  5H8H B;  3IB1 A;  2HFB A;  5A5X B;  4M4G A;  3CSB A;  1CE2 A;  3PTY A;  3U8Q A;  2OX3 A;  4NF8 B;  4ZEF A;  1JVY A;  2WYP A;  4R75 A;  2UVJ A;  3IOU A;  2HHM A;  3IOV A;  1KA1 A;  3KBR A;  2THI A;  1H3D A;  1MH4 A;  4MH5 A;  1F9B A;  4U2R A;  4U1Z A;  1VR5 A;  2Z22 A;  1RDZ A;  4F1Y A;  4HE2 A;  4WXJ A;  4N07 A;  1MY4 A;  4YKP A;  1OLC A;  4RK2 A;  3CFL A;  4JVC A;  4ONY A;  4PF6 A;  5CMM A;  4ELQ A;  3PPN A;  3IOW A;  1JVX A;  3ILU B;  4F39 A;  1Y4C A;  4IY6 A;  2A5S A;  1TWY A;  4OFL A;  2I58 A;  3CR9 A;  2DE3 A;  1OMP A;  1FTL A;  1NFT A;  1RDY A;  4O3B A;  1N3X A;  2XWV A;  3JZJ A;  4U4S A;  5IZ3 B;  2Q9T A;  2Q8M A;  1OQG A;  3LSL A;  4I62 A;  4Q5T A;  3BKI B;  4PQJ A;  2XD3 A;  1HSL A;  2BJJ X;  3ODB A;  3EN3 A;  3LSF B;  4TQU Q;  4G8M A;  2CEX A;  4F22 A;  2G29 A;  1NNP A;  4LQ2 A;  4U21 A;  3G3J A;  1SYH A;  3DP8 A;  4IB2 A;  1AOV A;  4H67 A;  1R6Z A;  2B3F A;  2PT1 A;  5CMB A;  4RK9 A;  4RY1 A;  2O1L A;  3H6T A;  3FXU A;  4HW8 A;  4U23 A;  2BJI A;  3Q28 A;  4FAT A;  4I3Y A;  4F19 A;  4QFO A;  2QL3 A;  4YKJ A;  3QIM A;  2ZXT A;  1NV5 A;  3FJ7 A;  4FOR A;  1JP4 A;  2UVI A;  2QS2 A;  1KWH A;  3G3G A;  3QK6 A;  1Z7N E;  1RKM A;  5L9S A;  3MP8 A;  4JVI A;  2AYS A;  1CB6 A;  1N04 A;  5AA2 D;  5CM6 A;  4PF8 A;  5HM4 B;  1B32 A;  4PE5 B;  2VPN A;  2NOO A;  2X26 A;  4MLQ A;  4MNP A;  1G0H A;  1IMB A;  2ABH A;  1US4 A;  2VD2 A;  1I69 A;  3T96 B;  3RQT A; 
#chains in the Genus database with same CATH homology
 2O68 A;  1MY2 A;  1JET A;  2RCB A;  1N7X A;  3M8U A;  3KJT A;  1HSE A;  3PPO A;  3VXC A;  1QUK A;  3TTN A;  3CRB A;  4IO5 A;  1Y9U A;  1OVT A;  3QAX A;  3FAT A;  4JWX A;  3GLB A;  4DCY A;  1PDA A;  1SBP A;  4XXU A;  1S7Y A;  1QUI A;  2DXY A;  4OER A;  4RPO A;  1TXF A;  3K6U A;  4ZEI A;  2IEE A;  1YAE A;  3O2A A;  4IGT A;  3DLN A;  3OXN A;  3K02 A;  3H6W A;  1B40 A;  1QVS A;  3KSX A;  5M2V A;  4R2B A;  3IOR A;  2Y84 A;  2ALU A;  1P99 A;  4Z7E A;  3BBR A;  1O64 A;  4U4X A;  3B6W A;  4F18 A;  2ZYM A;  3TTR A;  1SW1 A;  3O6G A;  5ISU A;  1FTO A;  4BDN A;  3MVY A;  4AB5 A;  1EZ9 A;  2R6G E;  3N6T A;  3OEL A;  2XX8 A;  5CBS A;  3HHF A;  3OEM A;  1O7T A;  3V83 A;  1R9Q A;  4JB7 A;  4POW A;  4PFY A;  3PUY E;  2F97 A;  1MDP 1;  4DDD A;  2A5T A;  1D9Y A;  2F5X A;  1MY1 A;  5AA1 A;  2DWJ A;  4GVO A;  1B1H A;  3GBB A;  1MXW A;  2DYX A;  2XHD A;  1JNF A;  3PPQ A;  1TT1 A;  4ZE9 A;  2ONS A;  3SDF A;  3B6Q A;  2H99 A;  3SEY A;  2OWS A;  4IO2 A;  4LZ7 A;  2F35 A;  1A55 A;  2O51 A;  1OIB A;  2NXO A;  5DTB A;  4DXB A;  2G93 A;  3V89 B;  1LAF E;  2Z8D A;  1I6B A;  3K1M A;  1LCF A;  3TCG A;  1UTH A;  5J1D A;  4QFK A;  3OO9 A;  1SQY A;  2HQ0 A;  5DYH A;  4DLD A;  4DCX A;  3FXR A;  1B2H A;  1UIV A;  3IL1 B;  3PUV E;  1HSJ A;  1O63 A;  5ELV A;  5I2N A;  4YKI A;  3VLV A;  5B70 A;  1TFD A;  4U1O A;  4DZ1 A;  1Y3N A;  2Q88 A;  5JTY A;  3IO4 A;  3DEL B;  3PUZ E;  2ESN A;  3ONM A;  2HXW A;  4LA9 A;  5CI5 A;  1H44 A;  4C0R A;  3A09 A;  2F7B A;  4UA8 A;  4LON B;  5ITO A;  3F11 A;  1PB9 A;  4NF5 A;  5EYF A;  1AIV A;  4G2Z A;  4N6P A;  4QF9 A;  1EU8 A;  3IJX B;  4F3G A;  1SW5 A;  5FTI A;  4KYE A;  2QS4 A;  1L5T A;  4P11 A;  4JXI A;  1UQW A;  4F2O A;  2XXT A;  1A8E A;  3HST A;  3RT6 B;  4R2F A;  3PPP A;  4FJP A;  2A5T B;  1GR2 A;  1M5C A;  4KHZ E;  1QUJ A;  4O3A A;  3PUX E;  3FIR A;  3TQL A;  1ATG A;  2I0C A;  1N0T A;  4MBP A;  4YB7 A;  3T22 A;  4ND9 A;  5H8N A;  4ZEK A;  1SW4 A;  2HEU A;  4X9T A;  4X1D A;  3OEN A;  3MZB A;  2UVH A;  3PMW A;  5DEX A;  3K2D A;  4EDP A;  1LST A;  1SD3 A;  3B6T A;  5TP9 A;  1M5F A;  1ZBM A;  3TFL A;  2FA7 A;  1UTH B;  4H6D A;  1MQJ A;  1N3W A;  3T9H B;  2I0B A;  2XXU A;  2Y7P A;  3K1P A;  2R71 A;  1B05 A;  3U94 A;  1VFD A;  2OCU A;  5I2N B;  1WDN A;  4G8N A;  3UA8 A;  1PC3 A;  1DPP A;  1XT8 A;  3UP9 A;  1MY3 A;  1OVB A;  5JTY B;  5EHS A;  3KJ7 A;  4KPT A;  4MF3 A;  3K6V A;  3IK6 B;  1UTB A;  2ANJ A;  5I59 A;  4EF2 A;  4EQ9 A;  3E3K A;  1DTZ A;  3AXF A;  4NF5 B;  4XKR A;  3PMX A;  3FZV A;  3W9V A;  4RPN A;  2F7A A;  4GIZ A;  4OWD A;  3VE1 B;  1XHY A;  4OQO A;  2YJP A;  4I1D A;  3ZS6 A;  1VE4 A;  3RTF B;  3H06 B;  3HCQ A;  4GXS B;  4NF6 A;  3QYT A;  3PUW E;  5H8N B;  3MUQ A;  2AL5 A;  3VFJ A;  2I3W A;  2ZNT A;  2D21 A;  3OO7 A;  3TQW A;  1SI0 A;  4F29 A;  4IO7 A;  2OJT A;  3FV1 A;  4G77 A;  1IXG A;  4LQ5 A;  2Z8E A;  5ICT A;  3N94 A;  3HN0 A;  1LFI A;  1RYO A;  2XXY A;  5HBC A;  1B6H A;  3I3V A;  3ZSF A;  5TP9 B;  1B3H A;  2I6E A;  4PP0 A;  2DWI A;  1B0H A;  1MPB A;  1POT A;  4JBZ A;  3Q27 A;  2E0S A;  2I4B A;  3MW0 A;  4LVQ A;  1H76 A;  3U92 A;  2F34 A;  3RUM A;  1VSO A;  2QMX A;  3W9W A;  4TLL B;  1NKX A;  1ZU0 A;  1SVX B;  3Q25 A;  2V93 A;  3DM0 A;  2O7U A;  2QSX A;  1UTB B;  4ZS9 A;  5I59 B;  1VFE A;  3MPK A;  4YB5 A;  2DVZ A;  3C32 A;  3TTL A;  1AMF A;  5AE4 A;  4IO3 A;  1QUL A;  4BDR A;  4GL8 A;  3O66 A;  1LFG A;  1ZIU A;  1LFH A;  2FYI A;  4H65 A;  4KCD A;  3K6W A;  4OMB A;  3A3U A;  3IOT A;  3HHG A;  2HAU A;  1MPD A;  5TU0 A;  4QFL A;  1S50 A;  3TTK A;  1A54 A;  1MM7 A;  2IA4 A;  1B5J A;  1B0L A;  2NUV A;  4ZE8 A;  1IEJ A;  1M5B A;  4NF6 B;  4NE4 A;  1JW5 A;  3K00 A;  1I6Q A;  4QHQ A;  3TKD A;  3OMB A;  2WKY A;  3MVW A;  1GVC A;  4GL0 A;  4PFT A;  1J1N A;  4KCC A;  3G3F A;  4F1U A;  4LZ5 A;  4OEU A;  3BFT A;  3LBS A;  3H6U A;  5CC2 A;  3FAS A;  3MPL A;  1QKA A;  3C9H A;  1A40 A;  3K0V A;  1MQI A;  4H1X A;  1MRP A;  2O7I A;  1D9V A;  5L9O A;  3OO8 A;  1IXH A;  4I8C A;  2DP8 A;  1FQF A;  3H3G A;  5DVI A;  4QSC A;  4UAC A;  3RY3 A;  5FHN A;  1Y1M A;  2I3V A;  3EQ1 A;  2CMO A;  3MWB A;  3K6X A;  1AH5 A;  4H5G A;  3IO6 A;  3E13 X;  3C35 A;  3A3C A;  1MXU A;  1RYX A;  4GD5 A;  3QUF A;  5I2K A;  2XXR A;  2DWH A;  3R26 A;  1B3L A;  3KN8 A;  3O29 A;  4JWY A;  2XX9 A;  3D4G A;  4ESX A;  4F3B A;  2HZK A;  3IAZ A;  4MLV A;  1FTJ A;  3S9E A;  3UN6 A;  4N13 A;  2HCA A;  4NMY A;  3M3K A;  4XKP A;  3TMG A;  1PBQ A;  1JW1 A;  5L8D A;  2H9B A;  5DT6 A;  1ZLQ A;  2FNC A;  4E0X A;  5KCJ A;  2W7Y A;  3IR1 A;  1YCJ A;  1EH3 A;  1B4H A;  3L6H A;  3SER A;  1ZTY A;  4C1T A;  2V84 A;  1B1X A;  1DMB A;  1QW0 A;  4LZ8 A;  2NWJ A;  1B9J A;  5K2Y A;  1T0K A;  5I56 A;  3KG2 A;  1B5I A;  4BLA A;  4ECF A;  3EHU A;  4HTG A;  5H8S A;  2YLN A;  1PEB A;  2QPQ A;  2ZNS A;  4PFU A;  2UXA A;  2XX7 A;  3TCF A;  1TFA A;  3O28 A;  2Y7R A;  3S9M C;  2B3B A;  3TYH A;  4JSD A;  3EHS A;  1NH7 A;  1LGB C;  3T9X B;  5ITP A;  5I2K B;  3ZKK A;  2GHA A;  2VOZ A;  2I48 A;  1P1N A;  2ZYN A;  4RA1 A;  1USY E;  3IB0 A;  4LUB A;  2Q8J A;  4H8J A;  3W15 C;  5EHM A;  3TCH A;  2Q2A A;  3KOT A;  5AA2 A;  3VV5 A;  2V3U A;  2DE2 A;  1GTK A;  5F7V A;  2P0S A;  5CMK A;  4GOT A;  1B7U A;  3TAJ A;  3MBP A;  2QS1 A;  2F6G A;  2PVU A;  3KN3 A;  3SKP A;  3G3K A;  5KCJ B;  3O9P A;  3THI A;  3K01 A;  1MXY A;  3FVN A;  3VDF A;  1NNF A;  4I9D A;  1SI1 A;  3QXM A;  2O69 A;  3E4R A;  1LAX A;  4G68 A;  2I49 A;  4ZZA A;  3ILT B;  4QFP A;  1FQD A;  1BIY A;  3FV2 A;  2GFE A;  2Y7I A;  3T9V A;  1P1Q A;  5I56 B;  3EHT A;  1BTJ A;  1ELJ A;  5IAI A;  1MY0 A;  2H25 A;  5L9M A;  1N7W A;  3RN8 A;  2DE4 A;  1YTV A;  3JYR A;  1P1U A;  1B46 A;  2GHB A;  1DOT A;  2XD2 A;  1DTG A;  4R6H A;  3TPA A;  3IJO B;  3RGY A;  1MXV A;  5FHO A;  1Z7M E;  1M5E A;  5JK4 A;  4KYS A;  2RCA A;  2XXV A;  4C1U A;  4KR5 A;  2Z8F A;  4OFJ A;  3TDJ A;  3H03 A;  5KDT A;  3UK4 A;  3H4Z A;  4L17 A;  5BWJ A;  1ZJL A;  5F1Q A;  3LSX A;  1PB8 A;  1P1W A;  1MPC A;  4XKQ A;  4Q0C A;  4ELO A;  1S9T A;  3O97 A;  4XIG Q;  3I6V A;  3KFM A;  1H45 A;  3TOD A;  3ZKL A;  5AA3 A;  5AA2 B;  4ZEC A;  3D4C A;  2XXP A;  1MS7 A;  4G68 C;  4G8H A;  1IUD A;  2REJ A;  2DSF A;  1MM6 A;  3U93 A;  4GWO A;  1BP5 A;  2X7P A;  1PB7 A;  4XTC Q;  4NWC A;  3FGS A;  3KEI A;  3MP6 A;  4EXK A;  4F2Q A;  1MDQ A;  4G68 B;  2HAV A;  1XVY A;  2OLB A;  2OWT A;  4AQ4 A;  3FJG A;  3FVO A;  5IKB A;  1NMU A;  3CG1 A;  3GXA A;  1MQH A;  4DXU A;  3TEL A;  1GGG A;  2O1M A;  4GQO A;  4YZZ A;  3CIJ A;  3N6U A;  2OZZ A;  4F1V A;  3OD7 A;  2CZL A;  3QSL A;  1FTM A;  4OXV A;  3PV0 E;  1A7L A;  4FIM A;  1XOC A;  2I4C A;  4X1B A;  3OOA A;  4OZ9 A;  2QRY A;  3EF7 A;  5DEX B;  4NF4 A;  1FCK A;  1N76 A;  2F8D A;  3K4U A;  3LSW A;  4GF8 A;  5KDT B;  3VVD A;  3S4U A;  1QJM A;  4KYD A;  3BFU A;  3C31 A;  1XVX A;  1Q1K A;  1BKA A;  3CFZ A;  4ELP A;  2UYE A;  4EF1 A;  3CSG A;  2Z23 A;  2UVG A;  2ZMB A;  2Q89 A;  2QMW A;  4HCY A;  3VVF A;  1BLF A;  2P2A A;  1DPE A;  2E1S A;  4R6Y A;  2RC9 A;  2NVU B;  2DS9 A;  5JEI A;  4YU0 A;  3T66 A;  4X48 A;  2F6P A;  1D4N A;  1Y1Z A;  2H5Y A;  3VLU A;  4ESW A;  1P1O A;  1LBC A;  4WEP A;  2ONR A;  1USY H;  1B58 A;  2KLF A;  4JWO A;  3DP6 A;  2VGQ A;  4R6K A;  2QS3 A;  3R6U A;  2LAO A;  1FTK A;  3G3I A;  2D5W A;  2ONK E;  4GFR A;  5KZT A;  5CBR A;  3UOR A;  1LB9 A;  3V8X B;  3PD8 A;  3HO7 A;  3N5L A;  1JW4 A;  4YMB A;  1Y20 A;  2X7Q A;  4F31 B;  3MVZ A;  5B7D A;  3DP4 A;  3T9U A;  4AB6 A;  2V3Q A;  1LB8 A;  4YIC A;  4GRK A;  1NL5 A;  2H4I A;  3C36 A;  1AL3 A;  5FHM A;  2PYY A;  4NF4 B;  1JEU A;  1M5D A;  2DOJ A;  1B52 A;  4Q30 B;  2DQV A;  4BDQ A;  5H8F A;  3G7W A;  1QKB A;  3GZG A;  1Y3Q A;  4R9F A;  1R1N A;  2QJE A;  2YPN A;  4U22 A;  2B65 A;  5TPA A;  4M1V A;  3P7I A;  5H8Q A;  4ZED A;  1FQB A;  4F3S A;  4ELR A;  4ZZE A;  4IY5 A;  4QRZ A;  4LP2 B;  3WAE A;  2GRV A;  3O6H A;  3FUZ A;  3T93 B;  1MXX A;  3IB2 A;  1ANF A;  4QSD A;  2VD3 A;  2DXR A;  4R72 A;  4XKN A;  4EQB A;  3LR1 A;  3USD A;  4GXA A;  3LC8 A;  1URG A;  4YKK A;  1R9L A;  2PMS A;  1B3G A;  4OEN A;  4BDL A;  4RYA A;  3CVG A;  2XXH A;  5I84 A;  1II5 A;  3OO6 A;  4H5F A;  4OVJ A;  5I57 A;  1SYI A;  3KGC A;  1B7Z A;  3PD9 A;  4KD5 A;  3U1O A;  3GBA A;  4H8I A;  1WVJ A;  3MVX A;  3SES A;  1MG1 A;  3S9L C;  2XXW A;  1POY 1;  2VP1 A;  1MH3 A;  4RJZ A;  4DIG A;  1B4Z A;  4OEV A;  1FQC A;  1IIW A;  1Y3P A;  4QFN A;  3Q26 A;  4GLI A;  3FVG A;  1XS5 A;  2F36 A;  4QSE A;  1GV8 A;  1NNK A;  2V25 A;  5DVF A;  5BUU A;  2OBG A;  3N26 A;  5HPQ A;  3Q29 A;  3RT8 A;  1A8F A;  4ISU A;  1LBB A;  5DVJ A;  3PMV A;  4FED A;  1B3E A;  4F3P A;  4IGR A;  3G3H A;  4G4P A;  3H7M A;  4RNS A;  1ZKB A;  3MAM A;  1YPN A;  3RTW B;  3HPI A;  4POX A;  3MZ1 A;  1LCT A;  5H8F B;  1FW0 A;  4FE8 A;  1I6A A;  3FVK A;  1SW2 A;  1IXC A;  3TEP A;  4OFO A;  2ZNU A;  4OTE A;  3KN7 A;  4OET A;  2HZL A;  5TPA B;  2Q2C A;  1WOD A;  5H8Q B;  3C33 A;  4KQP A;  5CRY A;  3VXB A;  1LAH E;  3M3L A;  1US5 A;  5ICQ A;  3OSQ A;  4THI A;  1EZO A;  3OSR A;  3PGF A;  5K2X A;  4MFI A;  4R74 A;  4OHN A;  3M3F A;  1D3K A;  1B51 A;  1B3F A;  4EQ7 A;  4O3C A;  3CG3 A;  4HS7 A;  2PBW A;  3FXQ A;  4OES A;  3ECR A;  2XXQ A;  3O6I A;  5I57 B;  1NNT A;  4FAJ A;  1B5H A;  2D3I A;  1XC1 A;  4R73 A;  1MQG A;  1PBP A;  4Q8R A;  3RLF E;  2AIX A;  4YB6 A;  4YMA A;  1NH8 A;  2PT2 A;  1URD A;  1URS A;  3PU5 A;  1MXZ A;  3K1N A;  2GH9 A;  3TZA A;  4WED A;  2Y7K A;  4Z0I A;  4NWD A;  1JEV A;  3MP1 A;  1SDX A;  3LUY A;  3TUS A;  4FEB A;  4BDM A;  4P0I A;  2V3T A;  3L6G A;  2XXX A;  2F7C A;  5AA4 A;  1A99 A;  4WKM A;  3VLW A;  3KSJ A;  2ZYO A;  5CMC A;  3UGW A;  4BDO A;  4YAH X;  1FQA A;  5FTH A;  1OLA A;  4OYV A;  3MQ9 A;  3JV9 A;  4NED A;  3UIF A;  2H98 A;  5LOM A;  2O6A A;  3V5A A;  3SEV A;  5I58 A;  2VHA A;  4RXL A;  2R9J A;  4H0W A;  3MZ9 A;  4IO6 A;  5H8H A;  1N84 A;  1DSN A;  3C34 A;  5A5X A;  3E9X A;  1IIT A;  4PET A;  3VVE A;  3TTM A;  1Y4T A;  2P1S A;  3SEU A;  1FQE A;  3RNN A;  4NF8 A;  1IXI A;  3S9N C;  1ZMG A;  3IX1 A;  3SET A;  2XXI A;  4K3F A;  3SEW A;  3WAF A;  4EUO A;  2RC8 A;  3KOS A;  2DWA A;  4JSO A;  3FD3 A;  4HCW A;  2O84 X;  3S2V A;  1JQF A;  3OEK A;  1B7H A;  3KZG A;  2RKM A;  4DE8 A;  4ZEB A;  4EXL A;  4NTL A;  3HV1 A;  2REG A;  3CFX A;  4ZDM A;  2DVC A;  2AL4 A;  4FEC A;  3SEX A;  1Q35 A;  4TLM B;  3I5O A;  3B7D A;  2RIN A;  4PFW A;  4KFQ A;  1IQ7 A;  2M8C A;  1MQD A;  3RPW A;  1H43 A;  5AA4 B;  3U72 A;  2RC7 A;  3FJM A;  4P0G A;  1EZP A;  1LAG E;  3PPR A;  2OK2 A;  2UYF A;  1UIU A;  3MJN A;  4KI0 E;  4TOZ A;  2RF1 A;  3EPE A;  4E0W A;  1IZ1 A;  4LAT A;  4R9G A;  3QUJ A;  3H6V A;  4IO4 A;  4JDF A;  4DXC A;  1LLS A;  3R7X A;  3CI8 A;  3MC2 A;  2F78 A;  2PX1 A;  5I58 B;  2Y7W A;  3C4M A;  1OQH A;  2ZYK A;  5H8H B;  3IB1 A;  2HFB A;  5A5X B;  4M4G A;  3CSB A;  1CE2 A;  3U8Q A;  4NF8 B;  4ZEF A;  1JVY A;  4R75 A;  2UVJ A;  3IOU A;  3IOV A;  3KBR A;  2THI A;  1H3D A;  1MH4 A;  4MH5 A;  1F9B A;  4U2R A;  4U1Z A;  1VR5 A;  2Z22 A;  4F1Y A;  4WXJ A;  4N07 A;  1MY4 A;  4YKP A;  1OLC A;  4RK2 A;  3CFL A;  4ONY A;  5CMM A;  4ELQ A;  3PPN A;  3IOW A;  1JVX A;  3ILU B;  4F39 A;  1Y4C A;  4IY6 A;  2A5S A;  1TWY A;  4OFL A;  2I58 A;  3CR9 A;  2DE3 A;  1OMP A;  1FTL A;  1NFT A;  4O3B A;  1N3X A;  3JZJ A;  4U4S A;  2Q9T A;  1OQG A;  3LSL A;  4I62 A;  4Q5T A;  3BKI B;  4PQJ A;  2XD3 A;  1HSL A;  2BJJ X;  3ODB A;  3EN3 A;  3LSF B;  4TQU Q;  4G8M A;  4F22 A;  2G29 A;  1NNP A;  4LQ2 A;  4U21 A;  3G3J A;  1SYH A;  3DP8 A;  4IB2 A;  1AOV A;  4H67 A;  1R6Z A;  2B3F A;  2PT1 A;  5CMB A;  4RK9 A;  4RY1 A;  2O1L A;  3H6T A;  3FXU A;  4HW8 A;  4U23 A;  3Q28 A;  4FAT A;  4F19 A;  4QFO A;  2QL3 A;  4YKJ A;  3QIM A;  2ZXT A;  3FJ7 A;  4FOR A;  2UVI A;  2QS2 A;  1KWH A;  3G3G A;  3QK6 A;  1Z7N E;  1RKM A;  5L9S A;  3MP8 A;  2AYS A;  1CB6 A;  1N04 A;  5AA2 D;  5CM6 A;  5HM4 B;  1B32 A;  4PE5 B;  2NOO A;  2X26 A;  4MLQ A;  2ABH A;  1US4 A;  2VD2 A;  1I69 A;  3T96 B;  3RQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...