1NMUA

Mbp-l30
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
368
structure length
368
Chain Sequence
EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/ribosome
molecule keywords maltose-binding periplasmic protein
publication title Inherent Protein Structural Flexibility at the RNA-binding Interface of L30e
pubmed doi rcsb
source organism Escherichia coli
total genus 122
structure length 368
sequence length 368
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nmuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1nmuA01
2YLNA 3IR1A 1JQFA 1YTVA 1GGGA 4EXKA 3K0VA 5TPAB 2I4BA 5ELVA 4GL0A 3V8XB 5EYFA 1URSA 1I6BA 4OERA 4GFRA 3PUYE 4E0WA 1B3FA 2Z23A 2A5TB 4Q8RA 4TLLB 3RTFB 2I49A 4HW8A 4R6HA 2XHDA 3PPOA 5I56B 4TQUQ 5K2XA 3L6HA 2ZYNA 3UP9A 5DYHA 2PT2A 3W9VA 3FVOA 4LUBA 1AH5A 4G77A 4YKJA 5I57B 2B3BA 2RC9A 1MH3A 3EPEA 4EF2A 3HO7A 1PBQA 1UTHA 1P99A 4BDQA 1LAFE 4KFQA 3L6GA 4FEDA 3T9HB 2XXHA 2XD3A 4IO7A 1A7LA 2LAOA 4E0XA 4NF4A 2RC7A 3CFXA 4G8HA 3MVYA 2O7IA 3DP8A 3PPPA 3TTMA 4FJPA 4IGRA 3FZVA 4OTEA 4F31B 2QS4A 2H25A 2AL5A 4ISUA 4PP0A 3CG3A 4LONB 2P2AA 1TWYA 1URDA 3H3GA 1I69A 3EHTA 1Y3NA 3H6UA 5J1DA 1LBCA 2XX7A 4BDOA 3T22A 2Q2AA 3U92A 4QFPA 1OMPA 4XKNA 3H03A 1CE2A 4Q30B 5DT6A 4F3SA 2QPQA 3M3FA 1USYE 3C32A 3VVFA 2OBGA 2XXXA 3IK6B 4KI0E 3PD9A 5L9SA 4BDLA 4QFLA 3TTLA 2DWIA 2F35A 4RPNA 4WXJA 4ZEFA 2DVCA 1MDQA 1A8EA 3KN7A 1BIYA 4P11A 3U72A 1GTKA 2Z22A 2RC8A 2Y7IA 3TPAA 3SEXA 2HEUA 1LSTA 2XD2A 4JWOA 5TP9B 3CSGA 5JTYB 4I1DA 3KN3A 3VLVA 3R6UA 1B1XA 2XXWA 3RNNA 5AA4B 2PMSA 3W9WA 4KQPA 1NKXA 5F7VA 5A5XA 2DOJA 3ONMA 3S9NC 2DVZA 1F9BA 4ZEIA 2NUVA 1MY0A 1WDNA 3O6IA 4FECA 3Q29A 2F78A 2WKYA 1PEBA 2HZKA 4QFKA 3KOSA 1LGBC 3CFZA 3IO4A 1M5EA 3EQ1A 5CM6A 3T9UA 3OD7A 3KOTA 1BP5A 2D5WA 4GLIA 3OSRA 3MP6A 3CRBA 4RPOA 4EQBA 2XXPA 3PUZE 3VXBA 1SW4A 4THIA 2VOZA 1BLFA 1LFGA 1SD3A 2ZYOA 1M5FA 5AA1A 4OYVA 2OJTA 3MZBA 5H8NB 2ZNUA 1B6HA 1EZ9A 1JW1A 3O66A 1XC1A 4KHZE 4YKIA 4GD5A 1QW0A 3D4GA 4ZZAA 5H8QB 3JYRA 3K6WA 2R9JA 2ZYMA 1B46A 1TFAA 1O63A 1IXIA 4POWA 1TXFA 3S2VA 3LSFB 3K6XA 3IX1A 1Q35A 1LAXA 3MP8A 4F3PA 2F7BA 3TMGA 2D21A 3LSWA 1MRPA 2I6EA 1MXVA 4FE8A 5AE4A 1IEJA 4KYDA 3BFTA 4DLDA 1US5A 4OFLA 3G7WA 2ZMBA 4NF6A 2DXYA 4YAHX 1FTMA 3FXRA 3PUXE 4NWCA 4HTGA 5ISUA 3MJNA 3FXUA 3TFLA 4ND9A 2QS1A 5I2KB 3B6WA 2E0SA 3K6VA 3MPLA 4BDRA 3OO9A 4RK9A 5H8FB 1MQJA 2DP8A 2DS9A 1B1HA 4OESA 4LATA 1B7HA 4OEVA 2GRVA 1Z7ME 1FTJA 1NNFA 2XXVA 3SETA 5ITOA 4NE4A 1GV8A 1EZPA 2ZNSA 4IO4A 2VD3A 4QRZA 4LA9A 2Q8JA 1MQDA 3KN8A 2BJJX 4YICA 2GH9A 4JXIA 4YMAA 2Y7PA 1FTKA 1UIVA 3TTNA 4EQ9A 1AIVA 3K02A 3PUWE 3FGSA 2O1MA 1SDXA 1B4HA 2Z8EA 4FEBA 2HQ0A 4O3BA 2I4CA 3KZGA 3FIRA 3RPWA 3U94A 3KSXA 1B9JA 3T96B 1RYOA 2NVUB 2DE4A 4RNSA 3KGCA 3IJOB 4OXVA 5I2NB 2Q88A 1IIWA 4F19A 2B65A 4X1DA 5B70A 5BUUA 1SW2A 2Y84A 1VFEA 1LCFA 3GBAA 4R2BA 2XX8A 1OVTA 4R73A 1R6ZA 5JEIA 3DP4A 1D4NA 4IO2A 1SW1A 1H45A 1MY1A 4PFWA 3QK6A 4QSDA 3EN3A 4NWDA 4EQ7A 4HCYA 3MVWA 1B7UA 4L17A 1QKAA 3TTRA 2Z8DA 1Y1MA 4OENA 2Q9TA 5CBSA 4IO5A 1UTBB 1S7YA 1FQFA 3TQWA 3V83A 3H4ZA 3WAEA 2RCBA 3KJ7A 1EZOA 2X26A 1MDP1 2UVIA 4PFUA 3KJTA 5CMKA 3T66A 4JWYA 3RQTA 4DXBA 4F3GA 5KDTB 5HM4B 1B52A 1N04A 3KFMA 2O84X 4XKQA 2XXIA 1TT1A 4I8CA 5AA2D 3HHGA 5KCJA 1JNFA 3A3CA 2Y7RA 3MBPA 4BDMA 3QXMA 4ZS9A 3K1PA 1P1WA 1B3EA 4C0RA 3OXNA 4OMBA 4F22A 1DPPA 4F18A 1SW5A 4YKKA 4NF8A 3LC8A 4OEUA 1MPDA 4LQ2A 3TELA 3FJMA 2H4IA 1CB6A 4U22A 4ELOA 4P0GA 1LBBA 1B7ZA 4UACA 4KYSA 5ICTA 1WVJA 4ELPA 3FUZA 2Y7WA 2PYYA 1B4ZA 4XKRA 1T0KA 1B40A 4JB7A 4QFOA 4R6KA 2H9BA 3S9EA 2O1LA 4QHQA 3DM0A 1P1NA 3MAMA 1RKMA 4ZE8A 1N7WA 2ANJA 1N3XA 3PMXA 3FATA 5FHMA 5L8DA 3MWBA 4MF3A 2V3QA 1I6QA 5HBCA 5AA3A 1GR2A 1MQHA 1OQHA 4JSOA 2HXWA 1MXWA 2F6PA 3QUFA 4NF5A 3PMVA 4ZE9A 1URGA 4GWOA 2CMOA 2QJEA 3G3GA 3IOUA 4R9GA 1MM6A 4GXSB 1PB8A 2DXRA 3JV9A 3HN0A 4OQOA 4IGTA 4DXCA 3K01A 4G68C 3IB1A 5AA2A 3IOTA 4KCCA 2THIA 2CZLA 4H8JA 5H8HA 2QRYA 3MZ1A 1US4A 3E3KA 3OSQA 2YJPA 1A54A 5DEXA 1OIBA 3QSLA 1QULA 1IXGA 3TCFA 3CG1A 2AL4A 1B0HA 1XHYA 3U93A 1MY3A 3EF7A 3O29A 3DLNA 2IA4A 4Q5TA 3G3KA 3WAFA 5JK4A 4AB5A 1QUIA 1XVYA 4AB6A 4X9TA 3VDFA 4JBZA 3C33A 3FASA 1JVYA 3RT8A 3MQ9A 3RY3A 2XX9A 3OMBA 3TDJA 5CBRA 3C35A 4RA1A 2KLFA 1OQGA 4UA8A 3EHSA 4DE8A 1P1OA 2GFEA 3PD8A 1B5HA 3IOVA 4N6PA 3C34A 5ITPA 3TYHA 3P7IA 3VVDA 1BKAA 4U23A 3MUQA 1FQDA 3VFJA 4RJZA 3FV2A 2F36A 2H5YA 4GRKA 1POTA 2PVUA 1XT8A 1ZU0A 4PQJA 3G3IA 1H43A 3N6UA 4G68A 4ONYA 3GXAA 5CC2A 1Y1ZA 1PB9A 4DDDA 2ALUA 4ECFA 1M5BA 4I62A 2F5XA 3MPKA 1SYHA 4F1VA 4DCXA 4Z7EA 2H99A 5EHMA 4RYAA 3H06B 2OZZA 4DCYA 3FJGA 4G8NA 4LZ8A 4YB5A 1DSNA 4P0IA 3IOWA 3HV1A 2QMWA 3RN8A 4HS7A 5BWJA 3QAXA 3N6TA 1POY1 3CSBA 3PPNA 1QKBA 1O7TA 1JW5A 1ZKBA 4NEDA 2E1SA 2FYIA 3PPRA 1FCKA 1UTHB 4O3CA 4LVQA 4FIMA 4MLQA 1QJMA 5I58A 4IY5A 1EU8A 1VFDA 3VV5A 3O9PA 4H0WA 1OLCA 1D3KA 1R1NA 3IAZA 4H6DA 4C1UA 3TZAA 4NF4B 3MW0A 4U2RA 2RKMA 4JSDA 3RT6B 4H5FA 1I6AA 1ZTYA 3PMWA 2DE3A 2R6GE 1Y4CA 3MC2A 2I58A 4QSCA 1JEVA 1LB9A 4U4XA 5FTHA 1MY4A 5I59A 4GXAA 1DMBA 2DE2A 1DTZA 1R9LA 3SKPA 1IXHA 5TPAA 4PETA 3C31A 1NH8A 3M3LA 3Q25A 4WEDA 1DOTA 3N5LA 4MLVA 2PBWA 1NNKA 1Y3PA 1USYH 2A5TA 5I84A 1PC3A 2UVHA 3OO8A 4U1ZA 4DIGA 4RXLA 1B0LA 4OVJA 5I56A 2PT1A 1IUDA 1IITA 1MM7A 5FTIA 1L5TA 5TU0A 3VXCA 3SEYA 3LBSA 1JETA 5I57A 1VE4A 5CI5A 4JDFA 3IB0A 4EDPA 2I48A 4F39A 4ZZEA 3E9XA 1MS7A 3FD3A 5CMBA 4F1UA 3K1NA 2B3FA 3LSXA 3MVZA 3OOAA 5A5XB 3LR1A 2XXYA 2XXQA 1NH7A 2VHAA 3I6VA 1ZJLA 3FXQA 4OWDA 1J1NA 4QSEA 4G4PA 5L9MA 5H8SA 4DXUA 3QYTA 3B6TA 1P1QA 5HPQA 2FNCA 3B7DA 1NL5A 3UN6A 3M8UA 1MG1A 2V3TA 1H3DA 1N7XA 3C36A 3PPQA 3H6TA 3U8QA 1H76A 1M5CA 3CI8A 2F6GA 1B32A 2RF1A 1N0TA 3RUMA 1Z7NE 3TCGA 3CR9A 1FTLA 1LFIA 1QVSA 3SEWA 2UVJA 3S9MC 4LZ7A 1YAEA 4MBPA 2FA7A 1II5A 4H5GA 2QS2A 3E13X 3BKIB 3RLFE 2REJA 2I0BA 4FORA 2O51A 4ZEBA 2D3IA 3F11A 2DWAA 4YZZA 3ECRA 4I9DA 1WODA 1IQ7A 1SQYA 1Y9UA 1B05A 1ZLQA 3K00A 3KG2A 5TP9A 4NF6B 2Q2CA 2ONRA 5F1QA 3UA8A 5AA4A 1LFHA 4M1VA 1YPNA 5CMMA 4WEPA 3IORA 2OCUA 3VLWA 1ZMGA 4H67A 1PBPA 1B5IA 2VD2A 3OELA 4OETA 4G8MA 3DELB 2F34A 3W15C 4BDNA 3C4MA 3VLUA 4LQ5A 1FQBA 3IB2A 2O69A 3FVGA 4YU0A 4QFNA 1EH3A 1SVXB 2UVGA 2F97A 4M4GA 3FV1A 3IJXB 4XKPA 2G93A 2HFBA 2F7AA 2DWHA 5H8NA 1MXYA 3Q27A 3LSLA 2IEEA 3QIMA 5H8QA 2DQVA 1ZBMA 3I5OA 3Q28A 3K6UA 3M3KA 1R9QA 1B51A 4RK2A 4XIGQ 1JEUA 5EHSA 2OWSA 4KPTA 3K1MA 1B3HA 3OO7A 3V5AA 5K2YA 1UIUA 4F29A 3EHUA 1MPBA 3A09A 3JZJA 4GF8A 3HHFA 2ZXTA 3VE1B 1FQCA 4R9FA 3TQLA 3ZSFA 3B6QA 4EXLA 2V3UA 3C9HA 1NNPA 4F3BA 4BLAA 4IO3A 4PFYA 3TKDA 2ABHA 5B7DA 4GIZA 5I2KA 4O3AA 4U1OA 1A99A 1GVCA 3RTWB 3T93B 3HPIA 3G3FA 5H8FA 1YCJA 3T9VA 4LZ5A 1QUJA 2DYXA 4NMYA 4R75A 1HSEA 1MY2A 2HZLA 1N76A 3KBRA 3IO6A 4F1YA 2HAVA 1NMUA 4ESXA 1JVXA 3ILUB 4ZDMA 1MXUA 4K3FA 3SESA 2GHBA 5IAIA 3E4RA 4KYEA 5IKBA 1P1UA 1S9TA 4U4SA 1Y4TA 4FATA 5CRYA 5KCJB 1Q1KA 3KEIA 2ESNA 1XVXA 4DZ1A 3LUYA 4R2FA 4OFOA 4YKPA 1DPEA 1B3GA 3V89B 3TCHA 3T9XB 3Q26A 1OVBA 1KWHA 2HAUA 5I2NA 1Y20A 4PFTA 2QL3A 4LP2B 1XOCA 3FJ7A 2F8DA 3OEMA 2I3WA 2X7PA 4NF8B 3OENA 3OO6A 1RYXA 3N94A 3ZKKA 3GZGA 2XXTA 4ESWA 2I3VA 4WKMA 3S9LC 1BTJA 4GOTA 1O64A 3O97A 3TTKA 1SI1A 4TOZA 1B3LA 3PGFA 2M8CA 1FQEA 1XS5A 3GBBA 4RY1A 3GLBA 4AQ4A 2W7YA 3O6GA 1NFTA 2P0SA 1UTBA 1M5DA 5DVJA 5LOMA 4R6YA 5M2VA 4R72A 4ZECA 1MXZA 3PUVE 4TLMB 3R26A 2AIXA 3ILTB 1MH4A 3IL1B 1IXCA 2I0CA 3ZKLA 3S4UA 3VVEA 1HSLA 5L9OA 1ZIUA 1FTOA 5KDTA 3ZS6A 4NF5B 2NWJA 4GL8A 1D9YA 4R74A 2OK2A 4EF1A 4N07A 1JW4A 3N26A 4GVOA 3MP1A 2Q89A 4Z0IA 1MXXA 4ZEKA 4YMBA 4KD5A 2QMXA 4H1XA 3USDA 1LAHE 2RCAA 2ZNTA 1UQWA 1AL3A 2UYFA 4YB6A 5AA2B 3KSJA 2NOOA 1DTGA 1D9VA 2P1SA 1N3WA 2YPNA 3H6VA 5H8HB 3O6HA 3UORA 5FHNA 3CFLA 1IZ1A 1NNTA 3PU5A 5DEXB 3THIA 1PB7A 3SEVA 5DTBA 3TODA 3U1OA 4KR5A 5CMCA 1TFDA 2F7CA 3FVNA 3ODBA 1SBPA 5DVFA 1FW0A 2REGA 1VR5A 2V93A 3SDFA 3QUJA 4IO6A 3D4CA 2AYSA 4POXA 2OWTA 1MQIA 1AOVA 1LAGE 3FVKA 2QSXA 1N84A 4MFIA 4ELRA 4EUOA 2VP1A 5ICQA 4QF9A 2Y7KA 5FHOA 3H7MA 3G3JA 4YB7A 2DSFA 3H6WA 4MH5A 5DVIA 1HSJA 1PDAA 3I3VA 2GHAA 3BFUA 1ELJA 1VSOA 1ATGA 2UYEA 4X48A 1LLSA 1A55A 4ELQA 4GQOA 2X7QA 3TUSA 4IY6A 4G68B 1B58A 4XXUA 4FAJA 2DWJA 1SI0A 3SERA 2PX1A 3CIJA 2O68A 2RINA 2VGQA 2R71A 1B2HA 3TEPA 3MVXA 4OZ9A 4H8IA 1LCTA 2HCAA 3A3UA 4HCWA 3DP6A 3O2AA 3HSTA 3K2DA 1MQGA 2O6AA 3UIFA 1H44A 2XXRA 1A40A 2A5SA 3AXFA 1QUKA 4U21A 2ONKE 2G29A 1AMFA 1Y3QA 2O7UA 2UXAA 4H65A 4F2OA 3TAJA 2ZYKA 3BBRA 3UGWA 3HCQA 4F2QA 2NXOA 3MZ9A 1LB8A 2QS3A 4IB2A 3PV0E 1ANFA 4OHNA 3G3HA 1A8FA 4PE5B 3CVGA 4C1TA 3O28A 2V84A 5I58B 4KCDA 3OEKA 4JWXA 3SEUA 1OLAA 2H98A 1SYIA 5JTYA 4NTLA 2OLBA 1B5JA 1MPCA 2XXUA 3RGYA 4OFJA 3K4UA 1S50A 3UK4A 1FQAA 5KZTA 4Q0CA 3R7XA 2ONSA 2Z8FA 4G2ZA 2V25A 4XTCQ 4X1BA 4N13A 5I59B 4ZEDA
chains in the Genus database with same CATH superfamily
2YLNA 3IR1A 1JQFA 1YTVA 1JP4A 1GGGA 4EXKA 3K0VA 4OVPA 2OWZA 5TPAB 4QBAA 2I4BA 5ELVA 3LV0A 5EYGA 4GL0A 5FBPA 3V8XB 5EYFA 1URSA 1FPIA 1I6BA 4OERA 4GFRA 2DDKA 3PUYE 4N8GA 4E0WA 1B3FA 2Z23A 1LBWA 2A5TB 4Q8RA 4TLLB 3RTFB 2I49A 4HW8A 4R6HA 2XHDA 2WYKA 3PPOA 5I56B 3BIGA 4TQUQ 5K2XA 3L6HA 2ZYNA 3UP9A 5DYHA 2PT2A 3W9VA 3FVOA 4LUBA 4X8RA 1AH5A 4G77A 4YKJA 5I57B 4XF5A 4GBWA 2B3BA 2RC9A 1MH3A 5J16A 3EPEA 4NHBA 4EF2A 4MIJA 4QXDA 3HO7A 4PBHA 1PBQA 1UTHA 1P99A 1FBCA 4BDQA 1LAFE 4KFQA 3L6GA 4FEDA 3T9HB 2XXHA 2XD3A 1NV4A 4IO7A 1A7LA 2LAOA 4H46A 5IM2A 3U65A 4E0XA 2WEFA 4NF4A 2RC7A 3CFXA 4G8HA 3MVYA 2O7IA 3DP8A 3PPPA 3TTMA 4GWXA 4FJPA 5IZ1A 4P1EA 4IGRA 3FZVA 4OTEA 5EQ8A 4F31B 2QS4A 2H25A 2AL5A 4ISUA 4PP0A 1FJ9A 3CG3A 4LONB 2P2AA 1TWYA 1URDA 3H3GA 4DI3D 2F3DA 1I69A 1XI6A 3EHTA 1Y3NA 3H6UA 2XWVA 5J1DA 5EQ9A 1LBCA 2ZZWA 2XX7A 4BDOA 3T22A 2Q2AA 3U92A 4QFPA 1OMPA 4XKNA 3H03A 1CE2A 4Q30B 5DT6A 4F3SA 2QPQA 3M3FA 1USYE 4PGPA 3C32A 3VVFA 2OBGA 2XXXA 3IK6B 4KI0E 3PD9A 5L9SA 3RPLB 4BDLA 4QFLA 3TTLA 2DWIA 1FPKA 2F35A 4RPNA 4WXJA 4ZEFA 2DVCA 2QVVA 1MDQA 1A8EA 3KN7A 1BIYA 2WBDA 4P11A 3U72A 1GTKA 2Z22A 2RC8A 2Y7IA 3TPAA 1NV1A 3SEXA 2HEUA 1LSTA 2XD2A 4JWOA 5TP9B 3CSGA 5JTYB 4I1DA 4O8MA 4GX3A 3KN3A 3VLVA 3R6UA 1B1XA 1FBEA 4HXVA 2XXWA 1FRPA 3RNNA 5AA4B 2PMSA 3KC0A 3W9WA 4KQPA 1NKXA 5F7VA 5A5XA 2DOJA 3ONMA 2WX9A 3S9NC 2DVZA 1F9BA 4ZEIA 2NUVA 1MY0A 1WDNA 1NI9A 3O6IA 4FECA 3Q29A 5DW8A 2F78A 2WKYA 1PEBA 2HZKA 4QFKA 3KOSA 1LGBC 3CFZA 3IO4A 1EYIA 1M5EA 3EQ1A 5CM6A 3T9UA 4GLIA 3KOTA 1BP5A 2CEYA 2D5WA 3OD7A 3OSRA 3MP6A 2ZZVA 3CRBA 4RPOA 4EQBA 2XXPA 3PUZE 3VXBA 1SW4A 4OA4A 4THIA 2VOZA 1BLFA 1LFGA 1SD3A 2ZYOA 1M5FA 5AA1A 4OYVA 2OJTA 3MZBA 5H8NB 1FTAA 2ZNUA 1B6HA 1EZ9A 1JW1A 3O66A 1XC1A 4KHZE 4YKIA 4DI4B 4GD5A 1QW0A 3D4GA 4ZZAA 5H8QB 3JYRA 3K6WA 4MEVA 2R9JA 2L5VA 2ZYMA 4HE2A 1B46A 1TFAA 1O63A 4OVTA 4MNCA 1IXIA 4POWA 1TXFA 3S2VA 3LSFB 3K6XA 3IX1A 1Q35A 1LAXA 3MP8A 4F3PA 2F7BA 2QVUA 2D21A 3TMGA 3LSWA 1MRPA 2I6EA 1MXVA 4FE8A 5AE4A 1IEJA 3D1RA 4KYDA 3BFTA 4DLDA 1US5A 4OFLA 2VT5A 3G7WA 1NV6A 2ZMBA 4NF6A 2DXYA 4YAHX 1FTMA 1G0IA 3FXRA 3PUXE 2XWOA 1IMCA 4NWCA 4HTGA 1KA1A 5ISUA 3MJNA 4N91A 3FXUA 4OVSA 3TFLA 4ND9A 2QS1A 5I2KB 3B6WA 2E0SA 3K6VA 3MPLA 4BDRA 2B4MA 3OO9A 2P3VA 4RK9A 5H8FB 1MQJA 2DP8A 2DS9A 1B1HA 4OESA 4LATA 5ET6A 1B7HA 4OEVA 2GRVA 4HE0A 1Z7ME 1FTJA 3HFUA 1NNFA 2XXVA 3SETA 4P3LA 5ITOA 4NE4A 1GV8A 1EZPA 2ZNSA 1EYKA 4PTKA 4IO4A 2VD3A 4QRZA 4LA9A 2Q8JA 1MQDA 3KN8A 2BJJX 4YICA 2GH9A 4JXIA 4YMAA 2Y7PA 1FTKA 1UIVA 3TTNA 4EQ9A 1AIVA 3K02A 3PUWE 3FGSA 2O1MA 1SDXA 1B4HA 2Z8EA 4FEBA 2HQ0A 4O3BA 2I4CA 3KZGA 3FIRA 3RPWA 3U94A 3KSXA 1B9JA 3T96B 4NQ8A 1RYOA 2NVUB 2DE4A 4RNSA 3KGCA 3IJOB 4OXVA 5I2NB 2Q88A 1IIWA 1NUXA 4F19A 2B65A 4X1DA 5B70A 1LBYA 1SPIA 5BUUA 4JVIA 2GQ1A 1SW2A 2Y84A 1VFEA 3MYUA 1FPDA 4I40A 1LCFA 3GBAA 4R2BA 2XX8A 1OVTA 4R73A 2ZZXA 2B4LA 1R6ZA 3BIHA 5JEIA 3DP4A 4MMPA 1D4NA 4IO2A 1SW1A 1H45A 1MY1A 1AWBA 4PFWA 3QK6A 4QSDA 2CZKA 3EN3A 4NWDA 4EQ7A 4HCYA 3MVWA 1B7UA 4L17A 5EYHA 1QKAA 3TTRA 2Z8DA 1Y1MA 4OENA 2Q9TA 5T3JA 4PAKA 5CBSA 4IO5A 1UTBB 5ESYA 1S7YA 3A29A 1FQFA 3TQWA 3V83A 3H4ZA 1D9QA 3WAEA 2RCBA 3KJ7A 1EZOA 2X26A 1MDP1 2UVIA 4PFUA 4NAPA 1G0HA 4JVDA 3ISPA 5I7IA 4PF8A 3KJTA 5CMKA 3T66A 2PFZA 4JWYA 3RQTA 4DXBA 4F3GA 5KDTB 5HM4B 1B52A 1N04A 3KFMA 2O84X 4XKQA 2XXIA 1TT1A 4I8CA 5AA2D 3HHGA 5KCJA 1JNFA 3A3CA 2Y7RA 3MBPA 4P56A 4BDMA 3QXMA 4ZS9A 3T0JA 3K1PA 1P1WA 1B3EA 4C0RA 3OXNA 4OMBA 4F22A 5IZ3B 1DPPA 1SW5A 4F18A 4YKKA 4NF8A 3LC8A 3LUZA 4OEUA 1MPDA 4LQ2A 3TELA 3FJMA 2H4IA 1CB6A 4MNIA 4U22A 4ELOA 4P0GA 1LBBA 1B7ZA 4UACA 4KYSA 4OVRA 4GWYA 5ICTA 1WVJA 4ELPA 3FUZA 2Y7WA 1DCUA 1NV5A 2PYYA 1B4ZA 4XKRA 4UABA 1T0KA 1B40A 4JB7A 4QFOA 4R6KA 2H9BA 3S9EA 2O1LA 4QHQA 3DM0A 1P1NA 3MAMA 3FXBA 1RKMA 4ZE8A 1N7WA 2ANJA 1N3XA 3PMXA 3FATA 5FHMA 5L8DA 4XEQA 4N6KA 3MWBA 4MF3A 2V3QA 1I6QA 5HBCA 5AA3A 1GR2A 5ET5A 1FPLA 1MQHA 1OQHA 4JSOA 2QVRA 2HXWA 1MXWA 2F6PA 3QUFA 4NF5A 3PMVA 4ZE9A 1URGA 4GWOA 4PDDA 4N4UA 2CMOA 2MKZA 2QJEA 3G3GA 1FPEA 3IOUA 4R9GA 1MM6A 4GXSB 1PB8A 3QMFA 2DXRA 3JV9A 3HN0A 4OQOA 4IGTA 4DXCA 3K01A 4G68C 3IB1A 5AA2A 3IOTA 4KCCA 2THIA 2CZLA 4H8JA 5H8HA 2QRYA 4I3EA 3MZ1A 1US4A 3E3KA 3OSQA 2YJPA 1NV3A 1A54A 5DEXA 1OIBA 4AS5A 3QSLA 1QULA 1IXGA 4HE1A 4GX6A 3TCFA 3CG1A 2AL4A 1B0HA 1IMAA 2FIEA 1XHYA 3U93A 1MY3A 3EF7A 2OX3A 3O29A 3DLNA 2IA4A 4Q5TA 3G3KA 3WAFA 5JK4A 3NOHA 4AB5A 4N6DA 1QUIA 2P3NA 1YYZA 1XVYA 4AB6A 4X9TA 3VDFA 2PCRA 4JBZA 3C33A 3FASA 1JVYA 3RT8A 3MQ9A 1LBZA 2XX9A 3OMBA 3RY3A 3TDJA 5CBRA 3C35A 4RA1A 2KLFA 1OQGA 4UA8A 3EHSA 4DE8A 1P1OA 2GFEA 3PD8A 1B5HA 3IOVA 4N6PA 3C34A 5ITPA 3TYHA 3P7IA 4O7IA 3VVDA 4MHFA 1BKAA 4U23A 3MUQA 4GWWA 1FQDA 3VFJA 4RJZA 3FV2A 1NV7A 2F36A 2FBPA 2H5YA 4GRKA 2Q8MA 1POTA 2PVUA 1XT8A 1ZU0A 4PFBA 4PQJA 3G3IA 1H43A 2CEXA 4OANA 2XA5A 3N6UA 4G68A 4ONYA 3GXAA 3E78A 5CC2A 1Y1ZA 1PB9A 4DDDA 2ALUA 4ECFA 1M5BA 4I62A 2F5XA 1CNQA 4PBQA 3MPKA 4P8BA 1SYHA 4F1VA 2Y5LA 4DCXA 2XWKA 4Z7EA 2FHYA 2H99A 5EHMA 5I5PA 4RYAA 2WYPA 3H06B 1K9YA 2OZZA 4DCYA 3FJGA 4N15A 1VDWA 4G8NA 4LZ8A 4YB5A 1DSNA 4P0IA 3IOWA 4NX1A 3HV1A 2QMWA 5EQ7A 3RN8A 4HS7A 5BWJA 3QAXA 3N6TA 1POY1 3CSBA 5IGAA 3PPNA 1QKBA 1O7TA 1JW5A 1ZKBA 4NEDA 2E1SA 2FYIA 3PPRA 1FCKA 1UTHB 4O3CA 3E79A 4LVQA 5F24A 4FIMA 4MLQA 1QJMA 5I58A 4IY5A 1EU8A 1VFDA 5EQAA 3VV5A 1YXIA 3O9PA 4H0WA 1OLCA 1D3KA 1R1NA 3IAZA 4H6DA 1FBDA 4PC9A 1KZ8A 4C1UA 3TZAA 1LBVA 4NF4B 3MW0A 4IR8A 4N8YA 4U2RA 2RKMA 4JSDA 3RT6B 4H5FA 1I6AA 1ZTYA 3B8BA 3EKIA 3PMWA 2DE3A 2R6GE 1Y4CA 3MC2A 2I58A 4QSCA 1JEVA 1LB9A 4U4XA 5FTHA 5ET8A 1K9ZA 3IFAA 1MY4A 5I59A 4GXAA 1DMBA 2DE2A 1DTZA 1R9LA 4PDHA 3SKPA 1IXHA 2JJKA 4GBVA 5TPAA 1FBFA 4PETA 3C31A 1NH8A 3FBPA 3M3LA 3Q25A 4WEDA 1DOTA 3N5LA 4MLVA 2PBWA 1NNKA 1Y3PA 5LDZA 1USYH 4OVQA 2A5TA 5I84A 1PC3A 1INPA 2UVHA 3OO8A 3T1BA 4U1ZA 4DIGA 4RXLA 1B0LA 4OVJA 5I56A 1NV2A 2PT1A 1IUDA 1RDZA 1IITA 4NN3A 1MM7A 5FTIA 4XFEA 1L5TA 5TU0A 3VXCA 3SEYA 3LBSA 1JETA 2HXRA 4NF0A 1FPBA 5I57A 1VE4A 5CI5A 4JDFA 3IB0A 4EDPA 2I48A 4GWUA 4F39A 4ZZEA 3E9XA 1FSAA 1MS7A 3FD3A 5CMBA 4F1UA 3K1NA 2B3FA 3LSXA 3MVZA 3OOAA 5A5XB 5IZZA 3LR1A 4MAGA 2XXYA 2XXQA 1NH7A 2VHAA 3I6VA 1ZJLA 3FXQA 4OWDA 1J1NA 4QSEA 4G4PA 5L9MA 5H8SA 4DXUA 3QYTA 2CZIA 3B6TA 1P1QA 2Q74A 5HPQA 2VPOA 2FNCA 3B7DA 1NL5A 3UN6A 3M8UA 1MG1A 1NUYA 2V3TA 1H3DA 1N7XA 3C36A 3PPQA 3H6TA 3U8QA 1H76A 1NV0A 1M5CA 3CI8A 2F6GA 1B32A 3IFCA 2RF1A 1N0TA 3RUMA 1Z7NE 3TCGA 1FJ6A 3CR9A 1FTLA 1LFIA 4PAFA 1QVSA 3SEWA 2UVJA 3SZPA 3RPLA 3S9MC 4LZ7A 1YAEA 4MBPA 3RYDA 2FA7A 5A5LA 1II5A 4H5GA 2QS2A 3E13X 3BKIB 3RLFE 2REJA 2I0BA 4FORA 2O51A 4ZEBA 2D3IA 3F11A 2DWAA 4YZZA 3ECRA 4I9DA 1WODA 1IQ7A 1SQYA 1Y9UA 1B05A 1ZLQA 3K00A 3KG2A 5TP9A 4NF6B 2Q2CA 2ONRA 5F1QA 3UA8A 5AA4A 1LFHA 4M1VA 1YPNA 4AS4A 5CMMA 4WEPA 2KQZA 3IORA 2OCUA 3VLWA 1ZMGA 4H67A 4MNPA 1PBPA 1B5IA 2VD2A 1IMEA 3OELA 4OETA 4G8MA 2FIXA 3DELB 4NG7A 2F34A 3W15C 4BDNA 3C4MA 3VLUA 4LQ5A 1FQBA 3IB2A 2XXKA 4KXPA 2O69A 3FVGA 4YU0A 4QFNA 4I3YA 1EH3A 1SVXB 3ROJA 2UVGA 2F97A 4M4GA 3FV1A 3IJXB 4XKPA 2G93A 2HPGA 2HFBA 2F7AA 2DWHA 5H8NA 1MXYA 1DBZA 3Q27A 1IMFA 3LSLA 2IEEA 3QIMA 5H8QA 2DQVA 1ZBMA 3I5OA 3Q28A 4PF6A 4PCDA 3K6UA 3M3KA 1R9QA 1B51A 4RK2A 4XIGQ 1JEUA 5EHSA 2OWSA 4KPTA 1YZ0A 4MCOA 5LTCA 3K1MA 1B3HA 3OO7A 3V5AA 5K2YA 1UIUA 4F29A 3EHUA 1MPBA 3A09A 3JZJA 4GF8A 3HHFA 2ZXTA 3VE1B 1FQCA 4R9FA 3TQLA 3ZSFA 2HHMA 4N81A 3B6QA 4EXLA 2V3UA 3C9HA 1NNPA 4F3BA 1RDXA 4BLAA 4IO3A 4PFYA 3TKDA 2ABHA 5B7DA 4PAIA 4GIZA 5I2KA 1DK4A 4O3AA 4U1OA 1A99A 1GVCA 3RTWB 3T93B 3HPIA 3G3FA 4P47A 5H8FA 1YCJA 3T9VA 4LZ5A 1QUJA 2DYXA 4NMYA 4R75A 4O7MA 1HSEA 1QGXA 1MY2A 2HZLA 1N76A 3KBRA 3IO6A 4F1YA 2HAVA 1NMUA 4ESXA 1JVXA 3ILUB 4ZDMA 1MXUA 4K3FA 3SESA 2GHBA 5IAIA 3E4RA 4O94A 4KYEA 5IKBA 1P1UA 1S9TA 4U4SA 1Y4TA 4FATA 5CRYA 1NUWA 5KCJB 1Q1KA 3KEIA 2ESNA 1XVXA 4DZ1A 3B50A 3LUYA 4JVCA 4R2FA 4OFOA 4YKPA 1DPEA 1B3GA 3V89B 3TCHA 3T9XB 3Q26A 1OVBA 1KWHA 2HAUA 1FBGA 5I2NA 1Y20A 4MX6A 4PFTA 2VPNA 2QL3A 4G61A 2WBBA 4LP2B 1XOCA 3FJ7A 2F8DA 3OEMA 2I3WA 2X7PA 4NF8B 3OENA 5I3SA 3OO6A 1RYXA 3N94A 3ZKKA 3GZGA 2XXTA 4ESWA 2KR0A 2I3VA 4WKMA 3S9LC 1BTJA 4GOTA 1O64A 3O97A 3TTKA 1SI1A 4TOZA 1B3LA 3PGFA 2M8CA 4P9KA 1FQEA 1XS5A 3GBBA 4RY1A 3GLBA 4AQ4A 2W7YA 4FBPA 3O6GA 1NFTA 2P0SA 1IMDA 4H45A 1UTBA 1M5DA 5DVJA 5LOMA 4R6YA 5M2VA 4R72A 4ZECA 1MXZA 3PUVE 4TLMB 3R26A 2AIXA 4LN5A 1KA0A 3ILTB 1MH4A 3IL1B 1IXCA 2I0CA 3ZKLA 3S4UA 3VVEA 1HSLA 5L9OA 1ZIUA 1FTOA 5KDTA 3ZS6A 4NF5B 2NWJA 4GL8A 1D9YA 4R74A 2OK2A 3KBZA 4EF1A 4N07A 1JW4A 3N26A 4GVOA 1FPGA 2Q89A 3MP1A 4Z0IA 1MXXA 4ZEKA 4YMBA 4KD5A 2QMXA 4H1XA 3USDA 1LAHE 2RCAA 2ZNTA 1UQWA 3KC1A 1AL3A 2PFYA 2UYFA 4YB6A 5AA2B 3KSJA 2NOOA 1DTGA 1D9VA 2P1SA 1N3WA 2YPNA 3H6VA 5IZ3A 5ET7A 3O6HA 5H8HB 3UORA 4NGUA 5FHNA 3CFLA 1IZ1A 1NNTA 2BJIA 3PU5A 5DEXB 3THIA 1PB7A 3SEVA 3GYYA 5DTBA 3TODA 3U1OA 2CZHA 4KR5A 5CMCA 4X04A 1TFDA 2F7CA 3FVNA 3ODBA 1SBPA 5DVFA 1FW0A 2REGA 1VR5A 2V93A 3SDFA 3QUJA 4IO6A 3PTYA 4N17A 3D4CA 1FBHA 3CHGA 1RDYA 2AYSA 4POXA 2OWTA 1MQIA 1FPJA 1AOVA 1LAGE 1EYJA 3FVKA 2QFLA 2QSXA 1N84A 4MFIA 4ELRA 1LBXA 4EUOA 2VP1A 5ICQA 3MSTA 4QF9A 2Y7KA 5FHOA 3H7MA 3G3JA 4YB7A 2DSFA 3H6WA 4MH5A 5DVIA 1HSJA 4PGNA 1PDAA 3I3VA 2GHAA 1FBPA 3BFUA 1ELJA 1VSOA 1ATGA 2UYEA 4MJOA 4X48A 1LLSA 1A55A 4ELQA 4GQOA 2F3BA 2X7QA 3TUSA 4IY6A 4G68B 1B58A 2R8TA 4XXUA 4FAJA 2DWJA 1SI0A 3SERA 1BK4A 1Q9DA 2PX1A 3CIJA 2O68A 2RINA 2VGQA 2R71A 1B2HA 3TEPA 1IMBA 3MVXA 4OZ9A 4H8IA 1LCTA 2HCAA 3A3UA 4HCWA 3DP6A 3O2AA 3HSTA 3K2DA 1MQGA 2O6AA 4GWSA 3UIFA 1H44A 2XXRA 1A40A 2A5SA 3AXFA 1QUKA 4U21A 2ONKE 2G29A 1AMFA 1Y3QA 2O7UA 2UXAA 4H65A 4F2OA 3TAJA 2ZYKA 3BBRA 3UGWA 3HCQA 4F2QA 2NXOA 3MZ9A 1LB8A 2QS3A 4IB2A 3PV0E 1ANFA 4OHNA 1NUZA 3G3HA 1A8FA 2Y5KA 4GX4A 4PE5B 3CVGA 4C1TA 3O28A 2V84A 5I58B 4KCDA 3OEKA 4JWXA 3SEUA 1OLAA 2H98A 1SYIA 5JTYA 4NTLA 2OLBA 1B5JA 2FVZA 2XWIA 1FPFA 4PFRA 1MPCA 2XXUA 3RGYA 4OFJA 3K4UA 1S50A 3UK4A 1FQAA 5KZTA 4Q0CA 3R7XA 4P1LA 2ONSA 2Z8FA 4G2ZA 2V4CA 1LEVA 2V25A 4PE3A 4XTCQ 4PFIA 4X1BA 4N13A 4GWZA 5I59B 4ZEDA
chains in the Genus database with same CATH topology
2YLNA 3IR1A 1JQFA 1YTVA 1GGGA 4EXKA 3K0VA 5TPAB 2I4BA 5ELVA 4GL0A 3V8XB 5EYFA 1URSA 1I6BA 4OERA 4GFRA 3PUYE 4E0WA 1B3FA 2Z23A 2A5TB 4Q8RA 4TLLB 3RTFB 2I49A 4HW8A 4R6HA 2XHDA 3PPOA 5I56B 4TQUQ 5K2XA 3L6HA 2ZYNA 3UP9A 5DYHA 2PT2A 3W9VA 3FVOA 4LUBA 1AH5A 4G77A 4YKJA 5I57B 2B3BA 2RC9A 1MH3A 3EPEA 4EF2A 3HO7A 1PBQA 1UTHA 1P99A 4BDQA 1LAFE 4KFQA 3L6GA 4FEDA 3T9HB 2XXHA 2XD3A 4IO7A 1A7LA 2LAOA 4E0XA 4NF4A 2RC7A 3CFXA 4G8HA 3MVYA 2O7IA 3DP8A 3PPPA 3TTMA 4FJPA 4IGRA 3FZVA 4OTEA 4F31B 2QS4A 2H25A 2AL5A 4ISUA 4PP0A 3CG3A 4LONB 2P2AA 1TWYA 1URDA 3H3GA 1I69A 3EHTA 1Y3NA 3H6UA 5J1DA 1LBCA 2XX7A 4BDOA 3T22A 2Q2AA 3U92A 4QFPA 1OMPA 4XKNA 3H03A 1CE2A 4Q30B 5DT6A 4F3SA 2QPQA 3M3FA 1USYE 3C32A 3VVFA 2OBGA 2XXXA 3IK6B 4KI0E 3PD9A 5L9SA 4BDLA 4QFLA 3TTLA 2DWIA 2F35A 4RPNA 4WXJA 4ZEFA 2DVCA 1MDQA 1A8EA 3KN7A 1BIYA 4P11A 3U72A 1GTKA 2Z22A 2RC8A 2Y7IA 3TPAA 3SEXA 2HEUA 1LSTA 2XD2A 4JWOA 5TP9B 3CSGA 5JTYB 4I1DA 3KN3A 3VLVA 3R6UA 1B1XA 2XXWA 3RNNA 5AA4B 2PMSA 3W9WA 4KQPA 1NKXA 5F7VA 5A5XA 2DOJA 3ONMA 3S9NC 2DVZA 1F9BA 4ZEIA 2NUVA 1MY0A 1WDNA 3O6IA 4FECA 3Q29A 2F78A 2WKYA 1PEBA 2HZKA 4QFKA 3KOSA 1LGBC 3CFZA 3IO4A 1M5EA 3EQ1A 5CM6A 3T9UA 3OD7A 3KOTA 1BP5A 2D5WA 4GLIA 3OSRA 3MP6A 3CRBA 4RPOA 4EQBA 2XXPA 3PUZE 3VXBA 1SW4A 4THIA 2VOZA 1BLFA 1LFGA 1SD3A 2ZYOA 1M5FA 5AA1A 4OYVA 2OJTA 3MZBA 5H8NB 2ZNUA 1B6HA 1EZ9A 1JW1A 3O66A 1XC1A 4KHZE 4YKIA 4GD5A 1QW0A 3D4GA 4ZZAA 5H8QB 3JYRA 3K6WA 2R9JA 2ZYMA 1B46A 1TFAA 1O63A 1IXIA 4POWA 1TXFA 3S2VA 3LSFB 3K6XA 3IX1A 1Q35A 1LAXA 3MP8A 4F3PA 2F7BA 3TMGA 2D21A 3LSWA 1MRPA 2I6EA 1MXVA 4FE8A 5AE4A 1IEJA 4KYDA 3BFTA 4DLDA 1US5A 4OFLA 3G7WA 2ZMBA 4NF6A 2DXYA 4YAHX 1FTMA 3FXRA 3PUXE 4NWCA 4HTGA 5ISUA 3MJNA 3FXUA 3TFLA 4ND9A 2QS1A 5I2KB 3B6WA 2E0SA 3K6VA 3MPLA 4BDRA 3OO9A 4RK9A 5H8FB 1MQJA 2DP8A 2DS9A 1B1HA 4OESA 4LATA 1B7HA 4OEVA 2GRVA 1Z7ME 1FTJA 1NNFA 2XXVA 3SETA 5ITOA 4NE4A 1GV8A 1EZPA 2ZNSA 4IO4A 2VD3A 4QRZA 4LA9A 2Q8JA 1MQDA 3KN8A 2BJJX 4YICA 2GH9A 4JXIA 4YMAA 2Y7PA 1FTKA 1UIVA 3TTNA 4EQ9A 1AIVA 3K02A 3PUWE 3FGSA 2O1MA 1SDXA 1B4HA 2Z8EA 4FEBA 2HQ0A 4O3BA 2I4CA 3KZGA 3FIRA 3RPWA 3U94A 3KSXA 1B9JA 3T96B 1RYOA 2NVUB 2DE4A 4RNSA 3KGCA 3IJOB 4OXVA 5I2NB 2Q88A 1IIWA 4F19A 2B65A 4X1DA 5B70A 5BUUA 1SW2A 2Y84A 1VFEA 1LCFA 3GBAA 4R2BA 2XX8A 1OVTA 4R73A 1R6ZA 5JEIA 3DP4A 1D4NA 4IO2A 1SW1A 1H45A 1MY1A 4PFWA 3QK6A 4QSDA 3EN3A 4NWDA 4EQ7A 4HCYA 3MVWA 1B7UA 4L17A 1QKAA 3TTRA 2Z8DA 1Y1MA 4OENA 2Q9TA 5CBSA 4IO5A 1UTBB 1S7YA 1FQFA 3TQWA 3V83A 3H4ZA 3WAEA 2RCBA 3KJ7A 1EZOA 2X26A 1MDP1 2UVIA 4PFUA 3KJTA 5CMKA 3T66A 4JWYA 3RQTA 4DXBA 4F3GA 5KDTB 5HM4B 1B52A 1N04A 3KFMA 2O84X 4XKQA 2XXIA 1TT1A 4I8CA 5AA2D 3HHGA 5KCJA 1JNFA 3A3CA 2Y7RA 3MBPA 4BDMA 3QXMA 4ZS9A 3K1PA 1P1WA 1B3EA 4C0RA 3OXNA 4OMBA 4F22A 1DPPA 4F18A 1SW5A 4YKKA 4NF8A 3LC8A 4OEUA 1MPDA 4LQ2A 3TELA 3FJMA 2H4IA 1CB6A 4U22A 4ELOA 4P0GA 1LBBA 1B7ZA 4UACA 4KYSA 5ICTA 1WVJA 4ELPA 3FUZA 2Y7WA 2PYYA 1B4ZA 4XKRA 1T0KA 1B40A 4JB7A 4QFOA 4R6KA 2H9BA 3S9EA 2O1LA 4QHQA 3DM0A 1P1NA 3MAMA 1RKMA 4ZE8A 1N7WA 2ANJA 1N3XA 3PMXA 3FATA 5FHMA 5L8DA 3MWBA 4MF3A 2V3QA 1I6QA 5HBCA 5AA3A 1GR2A 1MQHA 1OQHA 4JSOA 2HXWA 1MXWA 2F6PA 3QUFA 4NF5A 3PMVA 4ZE9A 1URGA 4GWOA 2CMOA 2QJEA 3G3GA 3IOUA 4R9GA 1MM6A 4GXSB 1PB8A 2DXRA 3JV9A 3HN0A 4OQOA 4IGTA 4DXCA 3K01A 4G68C 3IB1A 5AA2A 3IOTA 4KCCA 2THIA 2CZLA 4H8JA 5H8HA 2QRYA 3MZ1A 1US4A 3E3KA 3OSQA 2YJPA 1A54A 5DEXA 1OIBA 3QSLA 1QULA 1IXGA 3TCFA 3CG1A 2AL4A 1B0HA 1XHYA 3U93A 1MY3A 3EF7A 3O29A 3DLNA 2IA4A 4Q5TA 3G3KA 3WAFA 5JK4A 4AB5A 1QUIA 1XVYA 4AB6A 4X9TA 3VDFA 4JBZA 3C33A 3FASA 1JVYA 3RT8A 3MQ9A 3RY3A 2XX9A 3OMBA 3TDJA 5CBRA 3C35A 4RA1A 2KLFA 1OQGA 4UA8A 3EHSA 4DE8A 1P1OA 2GFEA 3PD8A 1B5HA 3IOVA 4N6PA 3C34A 5ITPA 3TYHA 3P7IA 3VVDA 1BKAA 4U23A 3MUQA 1FQDA 3VFJA 4RJZA 3FV2A 2F36A 2H5YA 4GRKA 1POTA 2PVUA 1XT8A 1ZU0A 4PQJA 3G3IA 1H43A 3N6UA 4G68A 4ONYA 3GXAA 5CC2A 1Y1ZA 1PB9A 4DDDA 2ALUA 4ECFA 1M5BA 4I62A 2F5XA 3MPKA 1SYHA 4F1VA 4DCXA 4Z7EA 2H99A 5EHMA 4RYAA 3H06B 2OZZA 4DCYA 3FJGA 4G8NA 4LZ8A 4YB5A 1DSNA 4P0IA 3IOWA 3HV1A 2QMWA 3RN8A 4HS7A 5BWJA 3QAXA 3N6TA 1POY1 3CSBA 3PPNA 1QKBA 1O7TA 1JW5A 1ZKBA 4NEDA 2E1SA 2FYIA 3PPRA 1FCKA 1UTHB 4O3CA 4LVQA 4FIMA 4MLQA 1QJMA 5I58A 4IY5A 1EU8A 1VFDA 3VV5A 3O9PA 4H0WA 1OLCA 1D3KA 1R1NA 3IAZA 4H6DA 4C1UA 3TZAA 4NF4B 3MW0A 4U2RA 2RKMA 4JSDA 3RT6B 4H5FA 1I6AA 1ZTYA 3PMWA 2DE3A 2R6GE 1Y4CA 3MC2A 2I58A 4QSCA 1JEVA 1LB9A 4U4XA 5FTHA 1MY4A 5I59A 4GXAA 1DMBA 2DE2A 1DTZA 1R9LA 3SKPA 1IXHA 5TPAA 4PETA 3C31A 1NH8A 3M3LA 3Q25A 4WEDA 1DOTA 3N5LA 4MLVA 2PBWA 1NNKA 1Y3PA 1USYH 2A5TA 5I84A 1PC3A 2UVHA 3OO8A 4U1ZA 4DIGA 4RXLA 1B0LA 4OVJA 5I56A 2PT1A 1IUDA 1IITA 1MM7A 5FTIA 1L5TA 5TU0A 3VXCA 3SEYA 3LBSA 1JETA 5I57A 1VE4A 5CI5A 4JDFA 3IB0A 4EDPA 2I48A 4F39A 4ZZEA 3E9XA 1MS7A 3FD3A 5CMBA 4F1UA 3K1NA 2B3FA 3LSXA 3MVZA 3OOAA 5A5XB 3LR1A 2XXYA 2XXQA 1NH7A 2VHAA 3I6VA 1ZJLA 3FXQA 4OWDA 1J1NA 4QSEA 4G4PA 5L9MA 5H8SA 4DXUA 3QYTA 3B6TA 1P1QA 5HPQA 2FNCA 3B7DA 1NL5A 3UN6A 3M8UA 1MG1A 2V3TA 1H3DA 1N7XA 3C36A 3PPQA 3H6TA 3U8QA 1H76A 1M5CA 3CI8A 2F6GA 1B32A 2RF1A 1N0TA 3RUMA 1Z7NE 3TCGA 3CR9A 1FTLA 1LFIA 1QVSA 3SEWA 2UVJA 3S9MC 4LZ7A 1YAEA 4MBPA 2FA7A 1II5A 4H5GA 2QS2A 3E13X 3BKIB 3RLFE 2REJA 2I0BA 4FORA 2O51A 4ZEBA 2D3IA 3F11A 2DWAA 4YZZA 3ECRA 4I9DA 1WODA 1IQ7A 1SQYA 1Y9UA 1B05A 1ZLQA 3K00A 3KG2A 5TP9A 4NF6B 2Q2CA 2ONRA 5F1QA 3UA8A 5AA4A 1LFHA 4M1VA 1YPNA 5CMMA 4WEPA 3IORA 2OCUA 3VLWA 1ZMGA 4H67A 1PBPA 1B5IA 2VD2A 3OELA 4OETA 4G8MA 3DELB 2F34A 3W15C 4BDNA 3C4MA 3VLUA 4LQ5A 1FQBA 3IB2A 2O69A 3FVGA 4YU0A 4QFNA 1EH3A 1SVXB 2UVGA 2F97A 4M4GA 3FV1A 3IJXB 4XKPA 2G93A 2HFBA 2F7AA 2DWHA 5H8NA 1MXYA 3Q27A 3LSLA 2IEEA 3QIMA 5H8QA 2DQVA 1ZBMA 3I5OA 3Q28A 3K6UA 3M3KA 1R9QA 1B51A 4RK2A 4XIGQ 1JEUA 5EHSA 2OWSA 4KPTA 3K1MA 1B3HA 3OO7A 3V5AA 5K2YA 1UIUA 4F29A 3EHUA 1MPBA 3A09A 3JZJA 4GF8A 3HHFA 2ZXTA 3VE1B 1FQCA 4R9FA 3TQLA 3ZSFA 3B6QA 4EXLA 2V3UA 3C9HA 1NNPA 4F3BA 4BLAA 4IO3A 4PFYA 3TKDA 2ABHA 5B7DA 4GIZA 5I2KA 4O3AA 4U1OA 1A99A 1GVCA 3RTWB 3T93B 3HPIA 3G3FA 5H8FA 1YCJA 3T9VA 4LZ5A 1QUJA 2DYXA 4NMYA 4R75A 1HSEA 1MY2A 2HZLA 1N76A 3KBRA 3IO6A 4F1YA 2HAVA 1NMUA 4ESXA 1JVXA 3ILUB 4ZDMA 1MXUA 4K3FA 3SESA 2GHBA 5IAIA 3E4RA 4KYEA 5IKBA 1P1UA 1S9TA 4U4SA 1Y4TA 4FATA 5CRYA 5KCJB 1Q1KA 3KEIA 2ESNA 1XVXA 4DZ1A 3LUYA 4R2FA 4OFOA 4YKPA 1DPEA 1B3GA 3V89B 3TCHA 3T9XB 3Q26A 1OVBA 1KWHA 2HAUA 5I2NA 1Y20A 4PFTA 2QL3A 4LP2B 1XOCA 3FJ7A 2F8DA 3OEMA 2I3WA 2X7PA 4NF8B 3OENA 3OO6A 1RYXA 3N94A 3ZKKA 3GZGA 2XXTA 4ESWA 2I3VA 4WKMA 3S9LC 1BTJA 4GOTA 1O64A 3O97A 3TTKA 1SI1A 4TOZA 1B3LA 3PGFA 2M8CA 1FQEA 1XS5A 3GBBA 4RY1A 3GLBA 4AQ4A 2W7YA 3O6GA 1NFTA 2P0SA 1UTBA 1M5DA 5DVJA 5LOMA 4R6YA 5M2VA 4R72A 4ZECA 1MXZA 3PUVE 4TLMB 3R26A 2AIXA 3ILTB 1MH4A 3IL1B 1IXCA 2I0CA 3ZKLA 3S4UA 3VVEA 1HSLA 5L9OA 1ZIUA 1FTOA 5KDTA 3ZS6A 4NF5B 2NWJA 4GL8A 1D9YA 4R74A 2OK2A 4EF1A 4N07A 1JW4A 3N26A 4GVOA 3MP1A 2Q89A 4Z0IA 1MXXA 4ZEKA 4YMBA 4KD5A 2QMXA 4H1XA 3USDA 1LAHE 2RCAA 2ZNTA 1UQWA 1AL3A 2UYFA 4YB6A 5AA2B 3KSJA 2NOOA 1DTGA 1D9VA 2P1SA 1N3WA 2YPNA 3H6VA 5H8HB 3O6HA 3UORA 5FHNA 3CFLA 1IZ1A 1NNTA 3PU5A 5DEXB 3THIA 1PB7A 3SEVA 5DTBA 3TODA 3U1OA 4KR5A 5CMCA 1TFDA 2F7CA 3FVNA 3ODBA 1SBPA 5DVFA 1FW0A 2REGA 1VR5A 2V93A 3SDFA 3QUJA 4IO6A 3D4CA 2AYSA 4POXA 2OWTA 1MQIA 1AOVA 1LAGE 3FVKA 2QSXA 1N84A 4MFIA 4ELRA 4EUOA 2VP1A 5ICQA 4QF9A 2Y7KA 5FHOA 3H7MA 3G3JA 4YB7A 2DSFA 3H6WA 4MH5A 5DVIA 1HSJA 1PDAA 3I3VA 2GHAA 3BFUA 1ELJA 1VSOA 1ATGA 2UYEA 4X48A 1LLSA 1A55A 4ELQA 4GQOA 2X7QA 3TUSA 4IY6A 4G68B 1B58A 4XXUA 4FAJA 2DWJA 1SI0A 3SERA 2PX1A 3CIJA 2O68A 2RINA 2VGQA 2R71A 1B2HA 3TEPA 3MVXA 4OZ9A 4H8IA 1LCTA 2HCAA 3A3UA 4HCWA 3DP6A 3O2AA 3HSTA 3K2DA 1MQGA 2O6AA 3UIFA 1H44A 2XXRA 1A40A 2A5SA 3AXFA 1QUKA 4U21A 2ONKE 2G29A 1AMFA 1Y3QA 2O7UA 2UXAA 4H65A 4F2OA 3TAJA 2ZYKA 3BBRA 3UGWA 3HCQA 4F2QA 2NXOA 3MZ9A 1LB8A 2QS3A 4IB2A 3PV0E 1ANFA 4OHNA 3G3HA 1A8FA 4PE5B 3CVGA 4C1TA 3O28A 2V84A 5I58B 4KCDA 3OEKA 4JWXA 3SEUA 1OLAA 2H98A 1SYIA 5JTYA 4NTLA 2OLBA 1B5JA 1MPCA 2XXUA 3RGYA 4OFJA 3K4UA 1S50A 3UK4A 1FQAA 5KZTA 4Q0CA 3R7XA 2ONSA 2Z8FA 4G2ZA 2V25A 4XTCQ 4X1BA 4N13A 5I59B 4ZEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLN A;  3IR1 A;  1JQF A;  1YTV A;  1GGG A;  4EXK A;  3K0V A;  5TPA B;  2I4B A;  5ELV A;  4GL0 A;  3V8X B;  5EYF A;  1URS A;  1I6B A;  4OER A;  4GFR A;  3PUY E;  4E0W A;  1B3F A;  2Z23 A;  2A5T B;  4Q8R A;  4TLL B;  3RTF B;  2I49 A;  4HW8 A;  4R6H A;  2XHD A;  3PPO A;  5I56 B;  4TQU Q;  5K2X A;  3L6H A;  2ZYN A;  3UP9 A;  5DYH A;  2PT2 A;  3W9V A;  3FVO A;  4LUB A;  1AH5 A;  4G77 A;  4YKJ A;  5I57 B;  2B3B A;  2RC9 A;  1MH3 A;  3EPE A;  4EF2 A;  3HO7 A;  1PBQ A;  1UTH A;  1P99 A;  4BDQ A;  1LAF E;  4KFQ A;  3L6G A;  4FED A;  3T9H B;  2XXH A;  2XD3 A;  4IO7 A;  1A7L A;  2LAO A;  4E0X A;  4NF4 A;  2RC7 A;  3CFX A;  4G8H A;  3MVY A;  2O7I A;  3DP8 A;  3PPP A;  3TTM A;  4FJP A;  4IGR A;  3FZV A;  4OTE A;  4F31 B;  2QS4 A;  2H25 A;  2AL5 A;  4ISU A;  4PP0 A;  3CG3 A;  4LON B;  2P2A A;  1TWY A;  1URD A;  3H3G A;  1I69 A;  3EHT A;  1Y3N A;  3H6U A;  5J1D A;  1LBC A;  2XX7 A;  4BDO A;  3T22 A;  2Q2A A;  3U92 A;  4QFP A;  1OMP A;  4XKN A;  3H03 A;  1CE2 A;  4Q30 B;  5DT6 A;  4F3S A;  2QPQ A;  3M3F A;  1USY E;  3C32 A;  3VVF A;  2OBG A;  2XXX A;  3IK6 B;  4KI0 E;  3PD9 A;  5L9S A;  4BDL A;  4QFL A;  3TTL A;  2DWI A;  2F35 A;  4RPN A;  4WXJ A;  4ZEF A;  2DVC A;  1MDQ A;  1A8E A;  3KN7 A;  1BIY A;  4P11 A;  3U72 A;  1GTK A;  2Z22 A;  2RC8 A;  2Y7I A;  3TPA A;  3SEX A;  2HEU A;  1LST A;  2XD2 A;  4JWO A;  5TP9 B;  3CSG A;  5JTY B;  4I1D A;  3KN3 A;  3VLV A;  3R6U A;  1B1X A;  2XXW A;  3RNN A;  5AA4 B;  2PMS A;  3W9W A;  4KQP A;  1NKX A;  5F7V A;  5A5X A;  2DOJ A;  3ONM A;  3S9N C;  2DVZ A;  1F9B A;  4ZEI A;  2NUV A;  1MY0 A;  1WDN A;  3O6I A;  4FEC A;  3Q29 A;  2F78 A;  2WKY A;  1PEB A;  2HZK A;  4QFK A;  3KOS A;  1LGB C;  3CFZ A;  3IO4 A;  1M5E A;  3EQ1 A;  5CM6 A;  3T9U A;  3OD7 A;  3KOT A;  1BP5 A;  2D5W A;  4GLI A;  3OSR A;  3MP6 A;  3CRB A;  4RPO A;  4EQB A;  2XXP A;  3PUZ E;  3VXB A;  1SW4 A;  4THI A;  2VOZ A;  1BLF A;  1LFG A;  1SD3 A;  2ZYO A;  1M5F A;  5AA1 A;  4OYV A;  2OJT A;  3MZB A;  5H8N B;  2ZNU A;  1B6H A;  1EZ9 A;  1JW1 A;  3O66 A;  1XC1 A;  4KHZ E;  4YKI A;  4GD5 A;  1QW0 A;  3D4G A;  4ZZA A;  5H8Q B;  3JYR A;  3K6W A;  2R9J A;  2ZYM A;  1B46 A;  1TFA A;  1O63 A;  1IXI A;  4POW A;  1TXF A;  3S2V A;  3LSF B;  3K6X A;  3IX1 A;  1Q35 A;  1LAX A;  3MP8 A;  4F3P A;  2F7B A;  3TMG A;  2D21 A;  3LSW A;  1MRP A;  2I6E A;  1MXV A;  4FE8 A;  5AE4 A;  1IEJ A;  4KYD A;  3BFT A;  4DLD A;  1US5 A;  4OFL A;  3G7W A;  2ZMB A;  4NF6 A;  2DXY A;  4YAH X;  1FTM A;  3FXR A;  3PUX E;  4NWC A;  4HTG A;  5ISU A;  3MJN A;  3FXU A;  3TFL A;  4ND9 A;  2QS1 A;  5I2K B;  3B6W A;  2E0S A;  3K6V A;  3MPL A;  4BDR A;  3OO9 A;  4RK9 A;  5H8F B;  1MQJ A;  2DP8 A;  2DS9 A;  1B1H A;  4OES A;  4LAT A;  1B7H A;  4OEV A;  2GRV A;  1Z7M E;  1FTJ A;  1NNF A;  2XXV A;  3SET A;  5ITO A;  4NE4 A;  1GV8 A;  1EZP A;  2ZNS A;  4IO4 A;  2VD3 A;  4QRZ A;  4LA9 A;  2Q8J A;  1MQD A;  3KN8 A;  2BJJ X;  4YIC A;  2GH9 A;  4JXI A;  4YMA A;  2Y7P A;  1FTK A;  1UIV A;  3TTN A;  4EQ9 A;  1AIV A;  3K02 A;  3PUW E;  3FGS A;  2O1M A;  1SDX A;  1B4H A;  2Z8E A;  4FEB A;  2HQ0 A;  4O3B A;  2I4C A;  3KZG A;  3FIR A;  3RPW A;  3U94 A;  3KSX A;  1B9J A;  3T96 B;  1RYO A;  2NVU B;  2DE4 A;  4RNS A;  3KGC A;  3IJO B;  4OXV A;  5I2N B;  2Q88 A;  1IIW A;  4F19 A;  2B65 A;  4X1D A;  5B70 A;  5BUU A;  1SW2 A;  2Y84 A;  1VFE A;  1LCF A;  3GBA A;  4R2B A;  2XX8 A;  1OVT A;  4R73 A;  1R6Z A;  5JEI A;  3DP4 A;  1D4N A;  4IO2 A;  1SW1 A;  1H45 A;  1MY1 A;  4PFW A;  3QK6 A;  4QSD A;  3EN3 A;  4NWD A;  4EQ7 A;  4HCY A;  3MVW A;  1B7U A;  4L17 A;  1QKA A;  3TTR A;  2Z8D A;  1Y1M A;  4OEN A;  2Q9T A;  5CBS A;  4IO5 A;  1UTB B;  1S7Y A;  1FQF A;  3TQW A;  3V83 A;  3H4Z A;  3WAE A;  2RCB A;  3KJ7 A;  1EZO A;  2X26 A;  1MDP 1;  2UVI A;  4PFU A;  3KJT A;  5CMK A;  3T66 A;  4JWY A;  3RQT A;  4DXB A;  4F3G A;  5KDT B;  5HM4 B;  1B52 A;  1N04 A;  3KFM A;  2O84 X;  4XKQ A;  2XXI A;  1TT1 A;  4I8C A;  5AA2 D;  3HHG A;  5KCJ A;  1JNF A;  3A3C A;  2Y7R A;  3MBP A;  4BDM A;  3QXM A;  4ZS9 A;  3K1P A;  1P1W A;  1B3E A;  4C0R A;  3OXN A;  4OMB A;  4F22 A;  1DPP A;  4F18 A;  1SW5 A;  4YKK A;  4NF8 A;  3LC8 A;  4OEU A;  1MPD A;  4LQ2 A;  3TEL A;  3FJM A;  2H4I A;  1CB6 A;  4U22 A;  4ELO A;  4P0G A;  1LBB A;  1B7Z A;  4UAC A;  4KYS A;  5ICT A;  1WVJ A;  4ELP A;  3FUZ A;  2Y7W A;  2PYY A;  1B4Z A;  4XKR A;  1T0K A;  1B40 A;  4JB7 A;  4QFO A;  4R6K A;  2H9B A;  3S9E A;  2O1L A;  4QHQ A;  3DM0 A;  1P1N A;  3MAM A;  1RKM A;  4ZE8 A;  1N7W A;  2ANJ A;  1N3X A;  3PMX A;  3FAT A;  5FHM A;  5L8D A;  3MWB A;  4MF3 A;  2V3Q A;  1I6Q A;  5HBC A;  5AA3 A;  1GR2 A;  1MQH A;  1OQH A;  4JSO A;  2HXW A;  1MXW A;  2F6P A;  3QUF A;  4NF5 A;  3PMV A;  4ZE9 A;  1URG A;  4GWO A;  2CMO A;  2QJE A;  3G3G A;  3IOU A;  4R9G A;  1MM6 A;  4GXS B;  1PB8 A;  2DXR A;  3JV9 A;  3HN0 A;  4OQO A;  4IGT A;  4DXC A;  3K01 A;  4G68 C;  3IB1 A;  5AA2 A;  3IOT A;  4KCC A;  2THI A;  2CZL A;  4H8J A;  5H8H A;  2QRY A;  3MZ1 A;  1US4 A;  3E3K A;  3OSQ A;  2YJP A;  1A54 A;  5DEX A;  1OIB A;  3QSL A;  1QUL A;  1IXG A;  3TCF A;  3CG1 A;  2AL4 A;  1B0H A;  1XHY A;  3U93 A;  1MY3 A;  3EF7 A;  3O29 A;  3DLN A;  2IA4 A;  4Q5T A;  3G3K A;  3WAF A;  5JK4 A;  4AB5 A;  1QUI A;  1XVY A;  4AB6 A;  4X9T A;  3VDF A;  4JBZ A;  3C33 A;  3FAS A;  1JVY A;  3RT8 A;  3MQ9 A;  3RY3 A;  2XX9 A;  3OMB A;  3TDJ A;  5CBR A;  3C35 A;  4RA1 A;  2KLF A;  1OQG A;  4UA8 A;  3EHS A;  4DE8 A;  1P1O A;  2GFE A;  3PD8 A;  1B5H A;  3IOV A;  4N6P A;  3C34 A;  5ITP A;  3TYH A;  3P7I A;  3VVD A;  1BKA A;  4U23 A;  3MUQ A;  1FQD A;  3VFJ A;  4RJZ A;  3FV2 A;  2F36 A;  2H5Y A;  4GRK A;  1POT A;  2PVU A;  1XT8 A;  1ZU0 A;  4PQJ A;  3G3I A;  1H43 A;  3N6U A;  4G68 A;  4ONY A;  3GXA A;  5CC2 A;  1Y1Z A;  1PB9 A;  4DDD A;  2ALU A;  4ECF A;  1M5B A;  4I62 A;  2F5X A;  3MPK A;  1SYH A;  4F1V A;  4DCX A;  4Z7E A;  2H99 A;  5EHM A;  4RYA A;  3H06 B;  2OZZ A;  4DCY A;  3FJG A;  4G8N A;  4LZ8 A;  4YB5 A;  1DSN A;  4P0I A;  3IOW A;  3HV1 A;  2QMW A;  3RN8 A;  4HS7 A;  5BWJ A;  3QAX A;  3N6T A;  1POY 1;  3CSB A;  3PPN A;  1QKB A;  1O7T A;  1JW5 A;  1ZKB A;  4NED A;  2E1S A;  2FYI A;  3PPR A;  1FCK A;  1UTH B;  4O3C A;  4LVQ A;  4FIM A;  4MLQ A;  1QJM A;  5I58 A;  4IY5 A;  1EU8 A;  1VFD A;  3VV5 A;  3O9P A;  4H0W A;  1OLC A;  1D3K A;  1R1N A;  3IAZ A;  4H6D A;  4C1U A;  3TZA A;  4NF4 B;  3MW0 A;  4U2R A;  2RKM A;  4JSD A;  3RT6 B;  4H5F A;  1I6A A;  1ZTY A;  3PMW A;  2DE3 A;  2R6G E;  1Y4C A;  3MC2 A;  2I58 A;  4QSC A;  1JEV A;  1LB9 A;  4U4X A;  5FTH A;  1MY4 A;  5I59 A;  4GXA A;  1DMB A;  2DE2 A;  1DTZ A;  1R9L A;  3SKP A;  1IXH A;  5TPA A;  4PET A;  3C31 A;  1NH8 A;  3M3L A;  3Q25 A;  4WED A;  1DOT A;  3N5L A;  4MLV A;  2PBW A;  1NNK A;  1Y3P A;  1USY H;  2A5T A;  5I84 A;  1PC3 A;  2UVH A;  3OO8 A;  4U1Z A;  4DIG A;  4RXL A;  1B0L A;  4OVJ A;  5I56 A;  2PT1 A;  1IUD A;  1IIT A;  1MM7 A;  5FTI A;  1L5T A;  5TU0 A;  3VXC A;  3SEY A;  3LBS A;  1JET A;  5I57 A;  1VE4 A;  5CI5 A;  4JDF A;  3IB0 A;  4EDP A;  2I48 A;  4F39 A;  4ZZE A;  3E9X A;  1MS7 A;  3FD3 A;  5CMB A;  4F1U A;  3K1N A;  2B3F A;  3LSX A;  3MVZ A;  3OOA A;  5A5X B;  3LR1 A;  2XXY A;  2XXQ A;  1NH7 A;  2VHA A;  3I6V A;  1ZJL A;  3FXQ A;  4OWD A;  1J1N A;  4QSE A;  4G4P A;  5L9M A;  5H8S A;  4DXU A;  3QYT A;  3B6T A;  1P1Q A;  5HPQ A;  2FNC A;  3B7D A;  1NL5 A;  3UN6 A;  3M8U A;  1MG1 A;  2V3T A;  1H3D A;  1N7X A;  3C36 A;  3PPQ A;  3H6T A;  3U8Q A;  1H76 A;  1M5C A;  3CI8 A;  2F6G A;  1B32 A;  2RF1 A;  1N0T A;  3RUM A;  1Z7N E;  3TCG A;  3CR9 A;  1FTL A;  1LFI A;  1QVS A;  3SEW A;  2UVJ A;  3S9M C;  4LZ7 A;  1YAE A;  4MBP A;  2FA7 A;  1II5 A;  4H5G A;  2QS2 A;  3E13 X;  3BKI B;  3RLF E;  2REJ A;  2I0B A;  4FOR A;  2O51 A;  4ZEB A;  2D3I A;  3F11 A;  2DWA A;  4YZZ A;  3ECR A;  4I9D A;  1WOD A;  1IQ7 A;  1SQY A;  1Y9U A;  1B05 A;  1ZLQ A;  3K00 A;  3KG2 A;  5TP9 A;  4NF6 B;  2Q2C A;  2ONR A;  5F1Q A;  3UA8 A;  5AA4 A;  1LFH A;  4M1V A;  1YPN A;  5CMM A;  4WEP A;  3IOR A;  2OCU A;  3VLW A;  1ZMG A;  4H67 A;  1PBP A;  1B5I A;  2VD2 A;  3OEL A;  4OET A;  4G8M A;  3DEL B;  2F34 A;  3W15 C;  4BDN A;  3C4M A;  3VLU A;  4LQ5 A;  1FQB A;  3IB2 A;  2O69 A;  3FVG A;  4YU0 A;  4QFN A;  1EH3 A;  1SVX B;  2UVG A;  2F97 A;  4M4G A;  3FV1 A;  3IJX B;  4XKP A;  2G93 A;  2HFB A;  2F7A A;  2DWH A;  5H8N A;  1MXY A;  3Q27 A;  3LSL A;  2IEE A;  3QIM A;  5H8Q A;  2DQV A;  1ZBM A;  3I5O A;  3Q28 A;  3K6U A;  3M3K A;  1R9Q A;  1B51 A;  4RK2 A;  4XIG Q;  1JEU A;  5EHS A;  2OWS A;  4KPT A;  3K1M A;  1B3H A;  3OO7 A;  3V5A A;  5K2Y A;  1UIU A;  4F29 A;  3EHU A;  1MPB A;  3A09 A;  3JZJ A;  4GF8 A;  3HHF A;  2ZXT A;  3VE1 B;  1FQC A;  4R9F A;  3TQL A;  3ZSF A;  3B6Q A;  4EXL A;  2V3U A;  3C9H A;  1NNP A;  4F3B A;  4BLA A;  4IO3 A;  4PFY A;  3TKD A;  2ABH A;  5B7D A;  4GIZ A;  5I2K A;  4O3A A;  4U1O A;  1A99 A;  1GVC A;  3RTW B;  3T93 B;  3HPI A;  3G3F A;  5H8F A;  1YCJ A;  3T9V A;  4LZ5 A;  1QUJ A;  2DYX A;  4NMY A;  4R75 A;  1HSE A;  1MY2 A;  2HZL A;  1N76 A;  3KBR A;  3IO6 A;  4F1Y A;  2HAV A;  1NMU A;  4ESX A;  1JVX A;  3ILU B;  4ZDM A;  1MXU A;  4K3F A;  3SES A;  2GHB A;  5IAI A;  3E4R A;  4KYE A;  5IKB A;  1P1U A;  1S9T A;  4U4S A;  1Y4T A;  4FAT A;  5CRY A;  5KCJ B;  1Q1K A;  3KEI A;  2ESN A;  1XVX A;  4DZ1 A;  3LUY A;  4R2F A;  4OFO A;  4YKP A;  1DPE A;  1B3G A;  3V89 B;  3TCH A;  3T9X B;  3Q26 A;  1OVB A;  1KWH A;  2HAU A;  5I2N A;  1Y20 A;  4PFT A;  2QL3 A;  4LP2 B;  1XOC A;  3FJ7 A;  2F8D A;  3OEM A;  2I3W A;  2X7P A;  4NF8 B;  3OEN A;  3OO6 A;  1RYX A;  3N94 A;  3ZKK A;  3GZG A;  2XXT A;  4ESW A;  2I3V A;  4WKM A;  3S9L C;  1BTJ A;  4GOT A;  1O64 A;  3O97 A;  3TTK A;  1SI1 A;  4TOZ A;  1B3L A;  3PGF A;  2M8C A;  1FQE A;  1XS5 A;  3GBB A;  4RY1 A;  3GLB A;  4AQ4 A;  2W7Y A;  3O6G A;  1NFT A;  2P0S A;  1UTB A;  1M5D A;  5DVJ A;  5LOM A;  4R6Y A;  5M2V A;  4R72 A;  4ZEC A;  1MXZ A;  3PUV E;  4TLM B;  3R26 A;  2AIX A;  3ILT B;  1MH4 A;  3IL1 B;  1IXC A;  2I0C A;  3ZKL A;  3S4U A;  3VVE A;  1HSL A;  5L9O A;  1ZIU A;  1FTO A;  5KDT A;  3ZS6 A;  4NF5 B;  2NWJ A;  4GL8 A;  1D9Y A;  4R74 A;  2OK2 A;  4EF1 A;  4N07 A;  1JW4 A;  3N26 A;  4GVO A;  3MP1 A;  2Q89 A;  4Z0I A;  1MXX A;  4ZEK A;  4YMB A;  4KD5 A;  2QMX A;  4H1X A;  3USD A;  1LAH E;  2RCA A;  2ZNT A;  1UQW A;  1AL3 A;  2UYF A;  4YB6 A;  5AA2 B;  3KSJ A;  2NOO A;  1DTG A;  1D9V A;  2P1S A;  1N3W A;  2YPN A;  3H6V A;  5H8H B;  3O6H A;  3UOR A;  5FHN A;  3CFL A;  1IZ1 A;  1NNT A;  3PU5 A;  5DEX B;  3THI A;  1PB7 A;  3SEV A;  5DTB A;  3TOD A;  3U1O A;  4KR5 A;  5CMC A;  1TFD A;  2F7C A;  3FVN A;  3ODB A;  1SBP A;  5DVF A;  1FW0 A;  2REG A;  1VR5 A;  2V93 A;  3SDF A;  3QUJ A;  4IO6 A;  3D4C A;  2AYS A;  4POX A;  2OWT A;  1MQI A;  1AOV A;  1LAG E;  3FVK A;  2QSX A;  1N84 A;  4MFI A;  4ELR A;  4EUO A;  2VP1 A;  5ICQ A;  4QF9 A;  2Y7K A;  5FHO A;  3H7M A;  3G3J A;  4YB7 A;  2DSF A;  3H6W A;  4MH5 A;  5DVI A;  1HSJ A;  1PDA A;  3I3V A;  2GHA A;  3BFU A;  1ELJ A;  1VSO A;  1ATG A;  2UYE A;  4X48 A;  1LLS A;  1A55 A;  4ELQ A;  4GQO A;  2X7Q A;  3TUS A;  4IY6 A;  4G68 B;  1B58 A;  4XXU A;  4FAJ A;  2DWJ A;  1SI0 A;  3SER A;  2PX1 A;  3CIJ A;  2O68 A;  2RIN A;  2VGQ A;  2R71 A;  1B2H A;  3TEP A;  3MVX A;  4OZ9 A;  4H8I A;  1LCT A;  2HCA A;  3A3U A;  4HCW A;  3DP6 A;  3O2A A;  3HST A;  3K2D A;  1MQG A;  2O6A A;  3UIF A;  1H44 A;  2XXR A;  1A40 A;  2A5S A;  3AXF A;  1QUK A;  4U21 A;  2ONK E;  2G29 A;  1AMF A;  1Y3Q A;  2O7U A;  2UXA A;  4H65 A;  4F2O A;  3TAJ A;  2ZYK A;  3BBR A;  3UGW A;  3HCQ A;  4F2Q A;  2NXO A;  3MZ9 A;  1LB8 A;  2QS3 A;  4IB2 A;  3PV0 E;  1ANF A;  4OHN A;  3G3H A;  1A8F A;  4PE5 B;  3CVG A;  4C1T A;  3O28 A;  2V84 A;  5I58 B;  4KCD A;  3OEK A;  4JWX A;  3SEU A;  1OLA A;  2H98 A;  1SYI A;  5JTY A;  4NTL A;  2OLB A;  1B5J A;  1MPC A;  2XXU A;  3RGY A;  4OFJ A;  3K4U A;  1S50 A;  3UK4 A;  1FQA A;  5KZT A;  4Q0C A;  3R7X A;  2ONS A;  2Z8F A;  4G2Z A;  2V25 A;  4XTC Q;  4X1B A;  4N13 A;  5I59 B;  4ZED A; 
#chains in the Genus database with same CATH topology
 2YLN A;  3IR1 A;  1JQF A;  1YTV A;  1JP4 A;  1GGG A;  4EXK A;  3K0V A;  4OVP A;  2OWZ A;  5TPA B;  4QBA A;  2I4B A;  5ELV A;  3LV0 A;  5EYG A;  4GL0 A;  5FBP A;  3V8X B;  5EYF A;  1URS A;  1FPI A;  1I6B A;  4OER A;  4GFR A;  2DDK A;  3PUY E;  4N8G A;  4E0W A;  1B3F A;  2Z23 A;  1LBW A;  2A5T B;  4Q8R A;  4TLL B;  3RTF B;  2I49 A;  4HW8 A;  4R6H A;  2XHD A;  2WYK A;  3PPO A;  5I56 B;  3BIG A;  4TQU Q;  5K2X A;  3L6H A;  2ZYN A;  3UP9 A;  5DYH A;  2PT2 A;  3W9V A;  3FVO A;  4LUB A;  4X8R A;  1AH5 A;  4G77 A;  4YKJ A;  5I57 B;  4XF5 A;  4GBW A;  2B3B A;  2RC9 A;  1MH3 A;  5J16 A;  3EPE A;  4NHB A;  4EF2 A;  4MIJ A;  4QXD A;  3HO7 A;  4PBH A;  1PBQ A;  1UTH A;  1P99 A;  1FBC A;  4BDQ A;  1LAF E;  4KFQ A;  3L6G A;  4FED A;  3T9H B;  2XXH A;  2XD3 A;  1NV4 A;  4IO7 A;  1A7L A;  2LAO A;  4H46 A;  5IM2 A;  3U65 A;  4E0X A;  2WEF A;  4NF4 A;  2RC7 A;  3CFX A;  4G8H A;  3MVY A;  2O7I A;  3DP8 A;  3PPP A;  3TTM A;  4GWX A;  4FJP A;  5IZ1 A;  4P1E A;  4IGR A;  3FZV A;  4OTE A;  5EQ8 A;  4F31 B;  2QS4 A;  2H25 A;  2AL5 A;  4ISU A;  4PP0 A;  1FJ9 A;  3CG3 A;  4LON B;  2P2A A;  1TWY A;  1URD A;  3H3G A;  4DI3 D;  2F3D A;  1I69 A;  1XI6 A;  3EHT A;  1Y3N A;  3H6U A;  2XWV A;  5J1D A;  5EQ9 A;  1LBC A;  2ZZW A;  2XX7 A;  4BDO A;  3T22 A;  2Q2A A;  3U92 A;  4QFP A;  1OMP A;  4XKN A;  3H03 A;  1CE2 A;  4Q30 B;  5DT6 A;  4F3S A;  2QPQ A;  3M3F A;  1USY E;  4PGP A;  3C32 A;  3VVF A;  2OBG A;  2XXX A;  3IK6 B;  4KI0 E;  3PD9 A;  5L9S A;  3RPL B;  4BDL A;  4QFL A;  3TTL A;  2DWI A;  1FPK A;  2F35 A;  4RPN A;  4WXJ A;  4ZEF A;  2DVC A;  2QVV A;  1MDQ A;  1A8E A;  3KN7 A;  1BIY A;  2WBD A;  4P11 A;  3U72 A;  1GTK A;  2Z22 A;  2RC8 A;  2Y7I A;  3TPA A;  1NV1 A;  3SEX A;  2HEU A;  1LST A;  2XD2 A;  4JWO A;  5TP9 B;  3CSG A;  5JTY B;  4I1D A;  4O8M A;  4GX3 A;  3KN3 A;  3VLV A;  3R6U A;  1B1X A;  1FBE A;  4HXV A;  2XXW A;  1FRP A;  3RNN A;  5AA4 B;  2PMS A;  3KC0 A;  3W9W A;  4KQP A;  1NKX A;  5F7V A;  5A5X A;  2DOJ A;  3ONM A;  2WX9 A;  3S9N C;  2DVZ A;  1F9B A;  4ZEI A;  2NUV A;  1MY0 A;  1WDN A;  1NI9 A;  3O6I A;  4FEC A;  3Q29 A;  5DW8 A;  2F78 A;  2WKY A;  1PEB A;  2HZK A;  4QFK A;  3KOS A;  1LGB C;  3CFZ A;  3IO4 A;  1EYI A;  1M5E A;  3EQ1 A;  5CM6 A;  3T9U A;  4GLI A;  3KOT A;  1BP5 A;  2CEY A;  2D5W A;  3OD7 A;  3OSR A;  3MP6 A;  2ZZV A;  3CRB A;  4RPO A;  4EQB A;  2XXP A;  3PUZ E;  3VXB A;  1SW4 A;  4OA4 A;  4THI A;  2VOZ A;  1BLF A;  1LFG A;  1SD3 A;  2ZYO A;  1M5F A;  5AA1 A;  4OYV A;  2OJT A;  3MZB A;  5H8N B;  1FTA A;  2ZNU A;  1B6H A;  1EZ9 A;  1JW1 A;  3O66 A;  1XC1 A;  4KHZ E;  4YKI A;  4DI4 B;  4GD5 A;  1QW0 A;  3D4G A;  4ZZA A;  5H8Q B;  3JYR A;  3K6W A;  4MEV A;  2R9J A;  2L5V A;  2ZYM A;  4HE2 A;  1B46 A;  1TFA A;  1O63 A;  4OVT A;  4MNC A;  1IXI A;  4POW A;  1TXF A;  3S2V A;  3LSF B;  3K6X A;  3IX1 A;  1Q35 A;  1LAX A;  3MP8 A;  4F3P A;  2F7B A;  2QVU A;  2D21 A;  3TMG A;  3LSW A;  1MRP A;  2I6E A;  1MXV A;  4FE8 A;  5AE4 A;  1IEJ A;  3D1R A;  4KYD A;  3BFT A;  4DLD A;  1US5 A;  4OFL A;  2VT5 A;  3G7W A;  1NV6 A;  2ZMB A;  4NF6 A;  2DXY A;  4YAH X;  1FTM A;  1G0I A;  3FXR A;  3PUX E;  2XWO A;  1IMC A;  4NWC A;  4HTG A;  1KA1 A;  5ISU A;  3MJN A;  4N91 A;  3FXU A;  4OVS A;  3TFL A;  4ND9 A;  2QS1 A;  5I2K B;  3B6W A;  2E0S A;  3K6V A;  3MPL A;  4BDR A;  2B4M A;  3OO9 A;  2P3V A;  4RK9 A;  5H8F B;  1MQJ A;  2DP8 A;  2DS9 A;  1B1H A;  4OES A;  4LAT A;  5ET6 A;  1B7H A;  4OEV A;  2GRV A;  4HE0 A;  1Z7M E;  1FTJ A;  3HFU A;  1NNF A;  2XXV A;  3SET A;  4P3L A;  5ITO A;  4NE4 A;  1GV8 A;  1EZP A;  2ZNS A;  1EYK A;  4PTK A;  4IO4 A;  2VD3 A;  4QRZ A;  4LA9 A;  2Q8J A;  1MQD A;  3KN8 A;  2BJJ X;  4YIC A;  2GH9 A;  4JXI A;  4YMA A;  2Y7P A;  1FTK A;  1UIV A;  3TTN A;  4EQ9 A;  1AIV A;  3K02 A;  3PUW E;  3FGS A;  2O1M A;  1SDX A;  1B4H A;  2Z8E A;  4FEB A;  2HQ0 A;  4O3B A;  2I4C A;  3KZG A;  3FIR A;  3RPW A;  3U94 A;  3KSX A;  1B9J A;  3T96 B;  4NQ8 A;  1RYO A;  2NVU B;  2DE4 A;  4RNS A;  3KGC A;  3IJO B;  4OXV A;  5I2N B;  2Q88 A;  1IIW A;  1NUX A;  4F19 A;  2B65 A;  4X1D A;  5B70 A;  1LBY A;  1SPI A;  5BUU A;  4JVI A;  2GQ1 A;  1SW2 A;  2Y84 A;  1VFE A;  3MYU A;  1FPD A;  4I40 A;  1LCF A;  3GBA A;  4R2B A;  2XX8 A;  1OVT A;  4R73 A;  2ZZX A;  2B4L A;  1R6Z A;  3BIH A;  5JEI A;  3DP4 A;  4MMP A;  1D4N A;  4IO2 A;  1SW1 A;  1H45 A;  1MY1 A;  1AWB A;  4PFW A;  3QK6 A;  4QSD A;  2CZK A;  3EN3 A;  4NWD A;  4EQ7 A;  4HCY A;  3MVW A;  1B7U A;  4L17 A;  5EYH A;  1QKA A;  3TTR A;  2Z8D A;  1Y1M A;  4OEN A;  2Q9T A;  5T3J A;  4PAK A;  5CBS A;  4IO5 A;  1UTB B;  5ESY A;  1S7Y A;  3A29 A;  1FQF A;  3TQW A;  3V83 A;  3H4Z A;  1D9Q A;  3WAE A;  2RCB A;  3KJ7 A;  1EZO A;  2X26 A;  1MDP 1;  2UVI A;  4PFU A;  4NAP A;  1G0H A;  4JVD A;  3ISP A;  5I7I A;  4PF8 A;  3KJT A;  5CMK A;  3T66 A;  2PFZ A;  4JWY A;  3RQT A;  4DXB A;  4F3G A;  5KDT B;  5HM4 B;  1B52 A;  1N04 A;  3KFM A;  2O84 X;  4XKQ A;  2XXI A;  1TT1 A;  4I8C A;  5AA2 D;  3HHG A;  5KCJ A;  1JNF A;  3A3C A;  2Y7R A;  3MBP A;  4P56 A;  4BDM A;  3QXM A;  4ZS9 A;  3T0J A;  3K1P A;  1P1W A;  1B3E A;  4C0R A;  3OXN A;  4OMB A;  4F22 A;  5IZ3 B;  1DPP A;  1SW5 A;  4F18 A;  4YKK A;  4NF8 A;  3LC8 A;  3LUZ A;  4OEU A;  1MPD A;  4LQ2 A;  3TEL A;  3FJM A;  2H4I A;  1CB6 A;  4MNI A;  4U22 A;  4ELO A;  4P0G A;  1LBB A;  1B7Z A;  4UAC A;  4KYS A;  4OVR A;  4GWY A;  5ICT A;  1WVJ A;  4ELP A;  3FUZ A;  2Y7W A;  1DCU A;  1NV5 A;  2PYY A;  1B4Z A;  4XKR A;  4UAB A;  1T0K A;  1B40 A;  4JB7 A;  4QFO A;  4R6K A;  2H9B A;  3S9E A;  2O1L A;  4QHQ A;  3DM0 A;  1P1N A;  3MAM A;  3FXB A;  1RKM A;  4ZE8 A;  1N7W A;  2ANJ A;  1N3X A;  3PMX A;  3FAT A;  5FHM A;  5L8D A;  4XEQ A;  4N6K A;  3MWB A;  4MF3 A;  2V3Q A;  1I6Q A;  5HBC A;  5AA3 A;  1GR2 A;  5ET5 A;  1FPL A;  1MQH A;  1OQH A;  4JSO A;  2QVR A;  2HXW A;  1MXW A;  2F6P A;  3QUF A;  4NF5 A;  3PMV A;  4ZE9 A;  1URG A;  4GWO A;  4PDD A;  4N4U A;  2CMO A;  2MKZ A;  2QJE A;  3G3G A;  1FPE A;  3IOU A;  4R9G A;  1MM6 A;  4GXS B;  1PB8 A;  3QMF A;  2DXR A;  3JV9 A;  3HN0 A;  4OQO A;  4IGT A;  4DXC A;  3K01 A;  4G68 C;  3IB1 A;  5AA2 A;  3IOT A;  4KCC A;  2THI A;  2CZL A;  4H8J A;  5H8H A;  2QRY A;  4I3E A;  3MZ1 A;  1US4 A;  3E3K A;  3OSQ A;  2YJP A;  1NV3 A;  1A54 A;  5DEX A;  1OIB A;  4AS5 A;  3QSL A;  1QUL A;  1IXG A;  4HE1 A;  4GX6 A;  3TCF A;  3CG1 A;  2AL4 A;  1B0H A;  1IMA A;  2FIE A;  1XHY A;  3U93 A;  1MY3 A;  3EF7 A;  2OX3 A;  3O29 A;  3DLN A;  2IA4 A;  4Q5T A;  3G3K A;  3WAF A;  5JK4 A;  3NOH A;  4AB5 A;  4N6D A;  1QUI A;  2P3N A;  1YYZ A;  1XVY A;  4AB6 A;  4X9T A;  3VDF A;  2PCR A;  4JBZ A;  3C33 A;  3FAS A;  1JVY A;  3RT8 A;  3MQ9 A;  1LBZ A;  2XX9 A;  3OMB A;  3RY3 A;  3TDJ A;  5CBR A;  3C35 A;  4RA1 A;  2KLF A;  1OQG A;  4UA8 A;  3EHS A;  4DE8 A;  1P1O A;  2GFE A;  3PD8 A;  1B5H A;  3IOV A;  4N6P A;  3C34 A;  5ITP A;  3TYH A;  3P7I A;  4O7I A;  3VVD A;  4MHF A;  1BKA A;  4U23 A;  3MUQ A;  4GWW A;  1FQD A;  3VFJ A;  4RJZ A;  3FV2 A;  1NV7 A;  2F36 A;  2FBP A;  2H5Y A;  4GRK A;  2Q8M A;  1POT A;  2PVU A;  1XT8 A;  1ZU0 A;  4PFB A;  4PQJ A;  3G3I A;  1H43 A;  2CEX A;  4OAN A;  2XA5 A;  3N6U A;  4G68 A;  4ONY A;  3GXA A;  3E78 A;  5CC2 A;  1Y1Z A;  1PB9 A;  4DDD A;  2ALU A;  4ECF A;  1M5B A;  4I62 A;  2F5X A;  1CNQ A;  4PBQ A;  3MPK A;  4P8B A;  1SYH A;  4F1V A;  2Y5L A;  4DCX A;  2XWK A;  4Z7E A;  2FHY A;  2H99 A;  5EHM A;  5I5P A;  4RYA A;  2WYP A;  3H06 B;  1K9Y A;  2OZZ A;  4DCY A;  3FJG A;  4N15 A;  1VDW A;  4G8N A;  4LZ8 A;  4YB5 A;  1DSN A;  4P0I A;  3IOW A;  4NX1 A;  3HV1 A;  2QMW A;  5EQ7 A;  3RN8 A;  4HS7 A;  5BWJ A;  3QAX A;  3N6T A;  1POY 1;  3CSB A;  5IGA A;  3PPN A;  1QKB A;  1O7T A;  1JW5 A;  1ZKB A;  4NED A;  2E1S A;  2FYI A;  3PPR A;  1FCK A;  1UTH B;  4O3C A;  3E79 A;  4LVQ A;  5F24 A;  4FIM A;  4MLQ A;  1QJM A;  5I58 A;  4IY5 A;  1EU8 A;  1VFD A;  5EQA A;  3VV5 A;  1YXI A;  3O9P A;  4H0W A;  1OLC A;  1D3K A;  1R1N A;  3IAZ A;  4H6D A;  1FBD A;  4PC9 A;  1KZ8 A;  4C1U A;  3TZA A;  1LBV A;  4NF4 B;  3MW0 A;  4IR8 A;  4N8Y A;  4U2R A;  2RKM A;  4JSD A;  3RT6 B;  4H5F A;  1I6A A;  1ZTY A;  3B8B A;  3EKI A;  3PMW A;  2DE3 A;  2R6G E;  1Y4C A;  3MC2 A;  2I58 A;  4QSC A;  1JEV A;  1LB9 A;  4U4X A;  5FTH A;  5ET8 A;  1K9Z A;  3IFA A;  1MY4 A;  5I59 A;  4GXA A;  1DMB A;  2DE2 A;  1DTZ A;  1R9L A;  4PDH A;  3SKP A;  1IXH A;  2JJK A;  4GBV A;  5TPA A;  1FBF A;  4PET A;  3C31 A;  1NH8 A;  3FBP A;  3M3L A;  3Q25 A;  4WED A;  1DOT A;  3N5L A;  4MLV A;  2PBW A;  1NNK A;  1Y3P A;  5LDZ A;  1USY H;  4OVQ A;  2A5T A;  5I84 A;  1PC3 A;  1INP A;  2UVH A;  3OO8 A;  3T1B A;  4U1Z A;  4DIG A;  4RXL A;  1B0L A;  4OVJ A;  5I56 A;  1NV2 A;  2PT1 A;  1IUD A;  1RDZ A;  1IIT A;  4NN3 A;  1MM7 A;  5FTI A;  4XFE A;  1L5T A;  5TU0 A;  3VXC A;  3SEY A;  3LBS A;  1JET A;  2HXR A;  4NF0 A;  1FPB A;  5I57 A;  1VE4 A;  5CI5 A;  4JDF A;  3IB0 A;  4EDP A;  2I48 A;  4GWU A;  4F39 A;  4ZZE A;  3E9X A;  1FSA A;  1MS7 A;  3FD3 A;  5CMB A;  4F1U A;  3K1N A;  2B3F A;  3LSX A;  3MVZ A;  3OOA A;  5A5X B;  5IZZ A;  3LR1 A;  4MAG A;  2XXY A;  2XXQ A;  1NH7 A;  2VHA A;  3I6V A;  1ZJL A;  3FXQ A;  4OWD A;  1J1N A;  4QSE A;  4G4P A;  5L9M A;  5H8S A;  4DXU A;  3QYT A;  2CZI A;  3B6T A;  1P1Q A;  2Q74 A;  5HPQ A;  2VPO A;  2FNC A;  3B7D A;  1NL5 A;  3UN6 A;  3M8U A;  1MG1 A;  1NUY A;  2V3T A;  1H3D A;  1N7X A;  3C36 A;  3PPQ A;  3H6T A;  3U8Q A;  1H76 A;  1NV0 A;  1M5C A;  3CI8 A;  2F6G A;  1B32 A;  3IFC A;  2RF1 A;  1N0T A;  3RUM A;  1Z7N E;  3TCG A;  1FJ6 A;  3CR9 A;  1FTL A;  1LFI A;  4PAF A;  1QVS A;  3SEW A;  2UVJ A;  3SZP A;  3RPL A;  3S9M C;  4LZ7 A;  1YAE A;  4MBP A;  3RYD A;  2FA7 A;  5A5L A;  1II5 A;  4H5G A;  2QS2 A;  3E13 X;  3BKI B;  3RLF E;  2REJ A;  2I0B A;  4FOR A;  2O51 A;  4ZEB A;  2D3I A;  3F11 A;  2DWA A;  4YZZ A;  3ECR A;  4I9D A;  1WOD A;  1IQ7 A;  1SQY A;  1Y9U A;  1B05 A;  1ZLQ A;  3K00 A;  3KG2 A;  5TP9 A;  4NF6 B;  2Q2C A;  2ONR A;  5F1Q A;  3UA8 A;  5AA4 A;  1LFH A;  4M1V A;  1YPN A;  4AS4 A;  5CMM A;  4WEP A;  2KQZ A;  3IOR A;  2OCU A;  3VLW A;  1ZMG A;  4H67 A;  4MNP A;  1PBP A;  1B5I A;  2VD2 A;  1IME A;  3OEL A;  4OET A;  4G8M A;  2FIX A;  3DEL B;  4NG7 A;  2F34 A;  3W15 C;  4BDN A;  3C4M A;  3VLU A;  4LQ5 A;  1FQB A;  3IB2 A;  2XXK A;  4KXP A;  2O69 A;  3FVG A;  4YU0 A;  4QFN A;  4I3Y A;  1EH3 A;  1SVX B;  3ROJ A;  2UVG A;  2F97 A;  4M4G A;  3FV1 A;  3IJX B;  4XKP A;  2G93 A;  2HPG A;  2HFB A;  2F7A A;  2DWH A;  5H8N A;  1MXY A;  1DBZ A;  3Q27 A;  1IMF A;  3LSL A;  2IEE A;  3QIM A;  5H8Q A;  2DQV A;  1ZBM A;  3I5O A;  3Q28 A;  4PF6 A;  4PCD A;  3K6U A;  3M3K A;  1R9Q A;  1B51 A;  4RK2 A;  4XIG Q;  1JEU A;  5EHS A;  2OWS A;  4KPT A;  1YZ0 A;  4MCO A;  5LTC A;  3K1M A;  1B3H A;  3OO7 A;  3V5A A;  5K2Y A;  1UIU A;  4F29 A;  3EHU A;  1MPB A;  3A09 A;  3JZJ A;  4GF8 A;  3HHF A;  2ZXT A;  3VE1 B;  1FQC A;  4R9F A;  3TQL A;  3ZSF A;  2HHM A;  4N81 A;  3B6Q A;  4EXL A;  2V3U A;  3C9H A;  1NNP A;  4F3B A;  1RDX A;  4BLA A;  4IO3 A;  4PFY A;  3TKD A;  2ABH A;  5B7D A;  4PAI A;  4GIZ A;  5I2K A;  1DK4 A;  4O3A A;  4U1O A;  1A99 A;  1GVC A;  3RTW B;  3T93 B;  3HPI A;  3G3F A;  4P47 A;  5H8F A;  1YCJ A;  3T9V A;  4LZ5 A;  1QUJ A;  2DYX A;  4NMY A;  4R75 A;  4O7M A;  1HSE A;  1QGX A;  1MY2 A;  2HZL A;  1N76 A;  3KBR A;  3IO6 A;  4F1Y A;  2HAV A;  1NMU A;  4ESX A;  1JVX A;  3ILU B;  4ZDM A;  1MXU A;  4K3F A;  3SES A;  2GHB A;  5IAI A;  3E4R A;  4O94 A;  4KYE A;  5IKB A;  1P1U A;  1S9T A;  4U4S A;  1Y4T A;  4FAT A;  5CRY A;  1NUW A;  5KCJ B;  1Q1K A;  3KEI A;  2ESN A;  1XVX A;  4DZ1 A;  3B50 A;  3LUY A;  4JVC A;  4R2F A;  4OFO A;  4YKP A;  1DPE A;  1B3G A;  3V89 B;  3TCH A;  3T9X B;  3Q26 A;  1OVB A;  1KWH A;  2HAU A;  1FBG A;  5I2N A;  1Y20 A;  4MX6 A;  4PFT A;  2VPN A;  2QL3 A;  4G61 A;  2WBB A;  4LP2 B;  1XOC A;  3FJ7 A;  2F8D A;  3OEM A;  2I3W A;  2X7P A;  4NF8 B;  3OEN A;  5I3S A;  3OO6 A;  1RYX A;  3N94 A;  3ZKK A;  3GZG A;  2XXT A;  4ESW A;  2KR0 A;  2I3V A;  4WKM A;  3S9L C;  1BTJ A;  4GOT A;  1O64 A;  3O97 A;  3TTK A;  1SI1 A;  4TOZ A;  1B3L A;  3PGF A;  2M8C A;  4P9K A;  1FQE A;  1XS5 A;  3GBB A;  4RY1 A;  3GLB A;  4AQ4 A;  2W7Y A;  4FBP A;  3O6G A;  1NFT A;  2P0S A;  1IMD A;  4H45 A;  1UTB A;  1M5D A;  5DVJ A;  5LOM A;  4R6Y A;  5M2V A;  4R72 A;  4ZEC A;  1MXZ A;  3PUV E;  4TLM B;  3R26 A;  2AIX A;  4LN5 A;  1KA0 A;  3ILT B;  1MH4 A;  3IL1 B;  1IXC A;  2I0C A;  3ZKL A;  3S4U A;  3VVE A;  1HSL A;  5L9O A;  1ZIU A;  1FTO A;  5KDT A;  3ZS6 A;  4NF5 B;  2NWJ A;  4GL8 A;  1D9Y A;  4R74 A;  2OK2 A;  3KBZ A;  4EF1 A;  4N07 A;  1JW4 A;  3N26 A;  4GVO A;  1FPG A;  2Q89 A;  3MP1 A;  4Z0I A;  1MXX A;  4ZEK A;  4YMB A;  4KD5 A;  2QMX A;  4H1X A;  3USD A;  1LAH E;  2RCA A;  2ZNT A;  1UQW A;  3KC1 A;  1AL3 A;  2PFY A;  2UYF A;  4YB6 A;  5AA2 B;  3KSJ A;  2NOO A;  1DTG A;  1D9V A;  2P1S A;  1N3W A;  2YPN A;  3H6V A;  5IZ3 A;  5ET7 A;  3O6H A;  5H8H B;  3UOR A;  4NGU A;  5FHN A;  3CFL A;  1IZ1 A;  1NNT A;  2BJI A;  3PU5 A;  5DEX B;  3THI A;  1PB7 A;  3SEV A;  3GYY A;  5DTB A;  3TOD A;  3U1O A;  2CZH A;  4KR5 A;  5CMC A;  4X04 A;  1TFD A;  2F7C A;  3FVN A;  3ODB A;  1SBP A;  5DVF A;  1FW0 A;  2REG A;  1VR5 A;  2V93 A;  3SDF A;  3QUJ A;  4IO6 A;  3PTY A;  4N17 A;  3D4C A;  1FBH A;  3CHG A;  1RDY A;  2AYS A;  4POX A;  2OWT A;  1MQI A;  1FPJ A;  1AOV A;  1LAG E;  1EYJ A;  3FVK A;  2QFL A;  2QSX A;  1N84 A;  4MFI A;  4ELR A;  1LBX A;  4EUO A;  2VP1 A;  5ICQ A;  3MST A;  4QF9 A;  2Y7K A;  5FHO A;  3H7M A;  3G3J A;  4YB7 A;  2DSF A;  3H6W A;  4MH5 A;  5DVI A;  1HSJ A;  4PGN A;  1PDA A;  3I3V A;  2GHA A;  1FBP A;  3BFU A;  1ELJ A;  1VSO A;  1ATG A;  2UYE A;  4MJO A;  4X48 A;  1LLS A;  1A55 A;  4ELQ A;  4GQO A;  2F3B A;  2X7Q A;  3TUS A;  4IY6 A;  4G68 B;  1B58 A;  2R8T A;  4XXU A;  4FAJ A;  2DWJ A;  1SI0 A;  3SER A;  1BK4 A;  1Q9D A;  2PX1 A;  3CIJ A;  2O68 A;  2RIN A;  2VGQ A;  2R71 A;  1B2H A;  3TEP A;  1IMB A;  3MVX A;  4OZ9 A;  4H8I A;  1LCT A;  2HCA A;  3A3U A;  4HCW A;  3DP6 A;  3O2A A;  3HST A;  3K2D A;  1MQG A;  2O6A A;  4GWS A;  3UIF A;  1H44 A;  2XXR A;  1A40 A;  2A5S A;  3AXF A;  1QUK A;  4U21 A;  2ONK E;  2G29 A;  1AMF A;  1Y3Q A;  2O7U A;  2UXA A;  4H65 A;  4F2O A;  3TAJ A;  2ZYK A;  3BBR A;  3UGW A;  3HCQ A;  4F2Q A;  2NXO A;  3MZ9 A;  1LB8 A;  2QS3 A;  4IB2 A;  3PV0 E;  1ANF A;  4OHN A;  1NUZ A;  3G3H A;  1A8F A;  2Y5K A;  4GX4 A;  4PE5 B;  3CVG A;  4C1T A;  3O28 A;  2V84 A;  5I58 B;  4KCD A;  3OEK A;  4JWX A;  3SEU A;  1OLA A;  2H98 A;  1SYI A;  5JTY A;  4NTL A;  2OLB A;  1B5J A;  2FVZ A;  2XWI A;  1FPF A;  4PFR A;  1MPC A;  2XXU A;  3RGY A;  4OFJ A;  3K4U A;  1S50 A;  3UK4 A;  1FQA A;  5KZT A;  4Q0C A;  3R7X A;  4P1L A;  2ONS A;  2Z8F A;  4G2Z A;  2V4C A;  1LEV A;  2V25 A;  4PE3 A;  4XTC Q;  4PFI A;  4X1B A;  4N13 A;  4GWZ A;  5I59 B;  4ZED A; 
#chains in the Genus database with same CATH homology
 2YLN A;  3IR1 A;  1JQF A;  1YTV A;  1GGG A;  4EXK A;  3K0V A;  5TPA B;  2I4B A;  5ELV A;  4GL0 A;  3V8X B;  5EYF A;  1URS A;  1I6B A;  4OER A;  4GFR A;  3PUY E;  4E0W A;  1B3F A;  2Z23 A;  2A5T B;  4Q8R A;  4TLL B;  3RTF B;  2I49 A;  4HW8 A;  4R6H A;  2XHD A;  3PPO A;  5I56 B;  4TQU Q;  5K2X A;  3L6H A;  2ZYN A;  3UP9 A;  5DYH A;  2PT2 A;  3W9V A;  3FVO A;  4LUB A;  1AH5 A;  4G77 A;  4YKJ A;  5I57 B;  2B3B A;  2RC9 A;  1MH3 A;  3EPE A;  4EF2 A;  3HO7 A;  1PBQ A;  1UTH A;  1P99 A;  4BDQ A;  1LAF E;  4KFQ A;  3L6G A;  4FED A;  3T9H B;  2XXH A;  2XD3 A;  4IO7 A;  1A7L A;  2LAO A;  4E0X A;  4NF4 A;  2RC7 A;  3CFX A;  4G8H A;  3MVY A;  2O7I A;  3DP8 A;  3PPP A;  3TTM A;  4FJP A;  4IGR A;  3FZV A;  4OTE A;  4F31 B;  2QS4 A;  2H25 A;  2AL5 A;  4ISU A;  4PP0 A;  3CG3 A;  4LON B;  2P2A A;  1TWY A;  1URD A;  3H3G A;  1I69 A;  3EHT A;  1Y3N A;  3H6U A;  5J1D A;  1LBC A;  2XX7 A;  4BDO A;  3T22 A;  2Q2A A;  3U92 A;  4QFP A;  1OMP A;  4XKN A;  3H03 A;  1CE2 A;  4Q30 B;  5DT6 A;  4F3S A;  2QPQ A;  3M3F A;  1USY E;  3C32 A;  3VVF A;  2OBG A;  2XXX A;  3IK6 B;  4KI0 E;  3PD9 A;  5L9S A;  4BDL A;  4QFL A;  3TTL A;  2DWI A;  2F35 A;  4RPN A;  4WXJ A;  4ZEF A;  2DVC A;  1MDQ A;  1A8E A;  3KN7 A;  1BIY A;  4P11 A;  3U72 A;  1GTK A;  2Z22 A;  2RC8 A;  2Y7I A;  3TPA A;  3SEX A;  2HEU A;  1LST A;  2XD2 A;  4JWO A;  5TP9 B;  3CSG A;  5JTY B;  4I1D A;  3KN3 A;  3VLV A;  3R6U A;  1B1X A;  2XXW A;  3RNN A;  5AA4 B;  2PMS A;  3W9W A;  4KQP A;  1NKX A;  5F7V A;  5A5X A;  2DOJ A;  3ONM A;  3S9N C;  2DVZ A;  1F9B A;  4ZEI A;  2NUV A;  1MY0 A;  1WDN A;  3O6I A;  4FEC A;  3Q29 A;  2F78 A;  2WKY A;  1PEB A;  2HZK A;  4QFK A;  3KOS A;  1LGB C;  3CFZ A;  3IO4 A;  1M5E A;  3EQ1 A;  5CM6 A;  3T9U A;  3OD7 A;  3KOT A;  1BP5 A;  2D5W A;  4GLI A;  3OSR A;  3MP6 A;  3CRB A;  4RPO A;  4EQB A;  2XXP A;  3PUZ E;  3VXB A;  1SW4 A;  4THI A;  2VOZ A;  1BLF A;  1LFG A;  1SD3 A;  2ZYO A;  1M5F A;  5AA1 A;  4OYV A;  2OJT A;  3MZB A;  5H8N B;  2ZNU A;  1B6H A;  1EZ9 A;  1JW1 A;  3O66 A;  1XC1 A;  4KHZ E;  4YKI A;  4GD5 A;  1QW0 A;  3D4G A;  4ZZA A;  5H8Q B;  3JYR A;  3K6W A;  2R9J A;  2ZYM A;  1B46 A;  1TFA A;  1O63 A;  1IXI A;  4POW A;  1TXF A;  3S2V A;  3LSF B;  3K6X A;  3IX1 A;  1Q35 A;  1LAX A;  3MP8 A;  4F3P A;  2F7B A;  3TMG A;  2D21 A;  3LSW A;  1MRP A;  2I6E A;  1MXV A;  4FE8 A;  5AE4 A;  1IEJ A;  4KYD A;  3BFT A;  4DLD A;  1US5 A;  4OFL A;  3G7W A;  2ZMB A;  4NF6 A;  2DXY A;  4YAH X;  1FTM A;  3FXR A;  3PUX E;  4NWC A;  4HTG A;  5ISU A;  3MJN A;  3FXU A;  3TFL A;  4ND9 A;  2QS1 A;  5I2K B;  3B6W A;  2E0S A;  3K6V A;  3MPL A;  4BDR A;  3OO9 A;  4RK9 A;  5H8F B;  1MQJ A;  2DP8 A;  2DS9 A;  1B1H A;  4OES A;  4LAT A;  1B7H A;  4OEV A;  2GRV A;  1Z7M E;  1FTJ A;  1NNF A;  2XXV A;  3SET A;  5ITO A;  4NE4 A;  1GV8 A;  1EZP A;  2ZNS A;  4IO4 A;  2VD3 A;  4QRZ A;  4LA9 A;  2Q8J A;  1MQD A;  3KN8 A;  2BJJ X;  4YIC A;  2GH9 A;  4JXI A;  4YMA A;  2Y7P A;  1FTK A;  1UIV A;  3TTN A;  4EQ9 A;  1AIV A;  3K02 A;  3PUW E;  3FGS A;  2O1M A;  1SDX A;  1B4H A;  2Z8E A;  4FEB A;  2HQ0 A;  4O3B A;  2I4C A;  3KZG A;  3FIR A;  3RPW A;  3U94 A;  3KSX A;  1B9J A;  3T96 B;  1RYO A;  2NVU B;  2DE4 A;  4RNS A;  3KGC A;  3IJO B;  4OXV A;  5I2N B;  2Q88 A;  1IIW A;  4F19 A;  2B65 A;  4X1D A;  5B70 A;  5BUU A;  1SW2 A;  2Y84 A;  1VFE A;  1LCF A;  3GBA A;  4R2B A;  2XX8 A;  1OVT A;  4R73 A;  1R6Z A;  5JEI A;  3DP4 A;  1D4N A;  4IO2 A;  1SW1 A;  1H45 A;  1MY1 A;  4PFW A;  3QK6 A;  4QSD A;  3EN3 A;  4NWD A;  4EQ7 A;  4HCY A;  3MVW A;  1B7U A;  4L17 A;  1QKA A;  3TTR A;  2Z8D A;  1Y1M A;  4OEN A;  2Q9T A;  5CBS A;  4IO5 A;  1UTB B;  1S7Y A;  1FQF A;  3TQW A;  3V83 A;  3H4Z A;  3WAE A;  2RCB A;  3KJ7 A;  1EZO A;  2X26 A;  1MDP 1;  2UVI A;  4PFU A;  3KJT A;  5CMK A;  3T66 A;  4JWY A;  3RQT A;  4DXB A;  4F3G A;  5KDT B;  5HM4 B;  1B52 A;  1N04 A;  3KFM A;  2O84 X;  4XKQ A;  2XXI A;  1TT1 A;  4I8C A;  5AA2 D;  3HHG A;  5KCJ A;  1JNF A;  3A3C A;  2Y7R A;  3MBP A;  4BDM A;  3QXM A;  4ZS9 A;  3K1P A;  1P1W A;  1B3E A;  4C0R A;  3OXN A;  4OMB A;  4F22 A;  1DPP A;  4F18 A;  1SW5 A;  4YKK A;  4NF8 A;  3LC8 A;  4OEU A;  1MPD A;  4LQ2 A;  3TEL A;  3FJM A;  2H4I A;  1CB6 A;  4U22 A;  4ELO A;  4P0G A;  1LBB A;  1B7Z A;  4UAC A;  4KYS A;  5ICT A;  1WVJ A;  4ELP A;  3FUZ A;  2Y7W A;  2PYY A;  1B4Z A;  4XKR A;  1T0K A;  1B40 A;  4JB7 A;  4QFO A;  4R6K A;  2H9B A;  3S9E A;  2O1L A;  4QHQ A;  3DM0 A;  1P1N A;  3MAM A;  1RKM A;  4ZE8 A;  1N7W A;  2ANJ A;  1N3X A;  3PMX A;  3FAT A;  5FHM A;  5L8D A;  3MWB A;  4MF3 A;  2V3Q A;  1I6Q A;  5HBC A;  5AA3 A;  1GR2 A;  1MQH A;  1OQH A;  4JSO A;  2HXW A;  1MXW A;  2F6P A;  3QUF A;  4NF5 A;  3PMV A;  4ZE9 A;  1URG A;  4GWO A;  2CMO A;  2QJE A;  3G3G A;  3IOU A;  4R9G A;  1MM6 A;  4GXS B;  1PB8 A;  2DXR A;  3JV9 A;  3HN0 A;  4OQO A;  4IGT A;  4DXC A;  3K01 A;  4G68 C;  3IB1 A;  5AA2 A;  3IOT A;  4KCC A;  2THI A;  2CZL A;  4H8J A;  5H8H A;  2QRY A;  3MZ1 A;  1US4 A;  3E3K A;  3OSQ A;  2YJP A;  1A54 A;  5DEX A;  1OIB A;  3QSL A;  1QUL A;  1IXG A;  3TCF A;  3CG1 A;  2AL4 A;  1B0H A;  1XHY A;  3U93 A;  1MY3 A;  3EF7 A;  3O29 A;  3DLN A;  2IA4 A;  4Q5T A;  3G3K A;  3WAF A;  5JK4 A;  4AB5 A;  1QUI A;  1XVY A;  4AB6 A;  4X9T A;  3VDF A;  4JBZ A;  3C33 A;  3FAS A;  1JVY A;  3RT8 A;  3MQ9 A;  3RY3 A;  2XX9 A;  3OMB A;  3TDJ A;  5CBR A;  3C35 A;  4RA1 A;  2KLF A;  1OQG A;  4UA8 A;  3EHS A;  4DE8 A;  1P1O A;  2GFE A;  3PD8 A;  1B5H A;  3IOV A;  4N6P A;  3C34 A;  5ITP A;  3TYH A;  3P7I A;  3VVD A;  1BKA A;  4U23 A;  3MUQ A;  1FQD A;  3VFJ A;  4RJZ A;  3FV2 A;  2F36 A;  2H5Y A;  4GRK A;  1POT A;  2PVU A;  1XT8 A;  1ZU0 A;  4PQJ A;  3G3I A;  1H43 A;  3N6U A;  4G68 A;  4ONY A;  3GXA A;  5CC2 A;  1Y1Z A;  1PB9 A;  4DDD A;  2ALU A;  4ECF A;  1M5B A;  4I62 A;  2F5X A;  3MPK A;  1SYH A;  4F1V A;  4DCX A;  4Z7E A;  2H99 A;  5EHM A;  4RYA A;  3H06 B;  2OZZ A;  4DCY A;  3FJG A;  4G8N A;  4LZ8 A;  4YB5 A;  1DSN A;  4P0I A;  3IOW A;  3HV1 A;  2QMW A;  3RN8 A;  4HS7 A;  5BWJ A;  3QAX A;  3N6T A;  1POY 1;  3CSB A;  3PPN A;  1QKB A;  1O7T A;  1JW5 A;  1ZKB A;  4NED A;  2E1S A;  2FYI A;  3PPR A;  1FCK A;  1UTH B;  4O3C A;  4LVQ A;  4FIM A;  4MLQ A;  1QJM A;  5I58 A;  4IY5 A;  1EU8 A;  1VFD A;  3VV5 A;  3O9P A;  4H0W A;  1OLC A;  1D3K A;  1R1N A;  3IAZ A;  4H6D A;  4C1U A;  3TZA A;  4NF4 B;  3MW0 A;  4U2R A;  2RKM A;  4JSD A;  3RT6 B;  4H5F A;  1I6A A;  1ZTY A;  3PMW A;  2DE3 A;  2R6G E;  1Y4C A;  3MC2 A;  2I58 A;  4QSC A;  1JEV A;  1LB9 A;  4U4X A;  5FTH A;  1MY4 A;  5I59 A;  4GXA A;  1DMB A;  2DE2 A;  1DTZ A;  1R9L A;  3SKP A;  1IXH A;  5TPA A;  4PET A;  3C31 A;  1NH8 A;  3M3L A;  3Q25 A;  4WED A;  1DOT A;  3N5L A;  4MLV A;  2PBW A;  1NNK A;  1Y3P A;  1USY H;  2A5T A;  5I84 A;  1PC3 A;  2UVH A;  3OO8 A;  4U1Z A;  4DIG A;  4RXL A;  1B0L A;  4OVJ A;  5I56 A;  2PT1 A;  1IUD A;  1IIT A;  1MM7 A;  5FTI A;  1L5T A;  5TU0 A;  3VXC A;  3SEY A;  3LBS A;  1JET A;  5I57 A;  1VE4 A;  5CI5 A;  4JDF A;  3IB0 A;  4EDP A;  2I48 A;  4F39 A;  4ZZE A;  3E9X A;  1MS7 A;  3FD3 A;  5CMB A;  4F1U A;  3K1N A;  2B3F A;  3LSX A;  3MVZ A;  3OOA A;  5A5X B;  3LR1 A;  2XXY A;  2XXQ A;  1NH7 A;  2VHA A;  3I6V A;  1ZJL A;  3FXQ A;  4OWD A;  1J1N A;  4QSE A;  4G4P A;  5L9M A;  5H8S A;  4DXU A;  3QYT A;  3B6T A;  1P1Q A;  5HPQ A;  2FNC A;  3B7D A;  1NL5 A;  3UN6 A;  3M8U A;  1MG1 A;  2V3T A;  1H3D A;  1N7X A;  3C36 A;  3PPQ A;  3H6T A;  3U8Q A;  1H76 A;  1M5C A;  3CI8 A;  2F6G A;  1B32 A;  2RF1 A;  1N0T A;  3RUM A;  1Z7N E;  3TCG A;  3CR9 A;  1FTL A;  1LFI A;  1QVS A;  3SEW A;  2UVJ A;  3S9M C;  4LZ7 A;  1YAE A;  4MBP A;  2FA7 A;  1II5 A;  4H5G A;  2QS2 A;  3E13 X;  3BKI B;  3RLF E;  2REJ A;  2I0B A;  4FOR A;  2O51 A;  4ZEB A;  2D3I A;  3F11 A;  2DWA A;  4YZZ A;  3ECR A;  4I9D A;  1WOD A;  1IQ7 A;  1SQY A;  1Y9U A;  1B05 A;  1ZLQ A;  3K00 A;  3KG2 A;  5TP9 A;  4NF6 B;  2Q2C A;  2ONR A;  5F1Q A;  3UA8 A;  5AA4 A;  1LFH A;  4M1V A;  1YPN A;  5CMM A;  4WEP A;  3IOR A;  2OCU A;  3VLW A;  1ZMG A;  4H67 A;  1PBP A;  1B5I A;  2VD2 A;  3OEL A;  4OET A;  4G8M A;  3DEL B;  2F34 A;  3W15 C;  4BDN A;  3C4M A;  3VLU A;  4LQ5 A;  1FQB A;  3IB2 A;  2O69 A;  3FVG A;  4YU0 A;  4QFN A;  1EH3 A;  1SVX B;  2UVG A;  2F97 A;  4M4G A;  3FV1 A;  3IJX B;  4XKP A;  2G93 A;  2HFB A;  2F7A A;  2DWH A;  5H8N A;  1MXY A;  3Q27 A;  3LSL A;  2IEE A;  3QIM A;  5H8Q A;  2DQV A;  1ZBM A;  3I5O A;  3Q28 A;  3K6U A;  3M3K A;  1R9Q A;  1B51 A;  4RK2 A;  4XIG Q;  1JEU A;  5EHS A;  2OWS A;  4KPT A;  3K1M A;  1B3H A;  3OO7 A;  3V5A A;  5K2Y A;  1UIU A;  4F29 A;  3EHU A;  1MPB A;  3A09 A;  3JZJ A;  4GF8 A;  3HHF A;  2ZXT A;  3VE1 B;  1FQC A;  4R9F A;  3TQL A;  3ZSF A;  3B6Q A;  4EXL A;  2V3U A;  3C9H A;  1NNP A;  4F3B A;  4BLA A;  4IO3 A;  4PFY A;  3TKD A;  2ABH A;  5B7D A;  4GIZ A;  5I2K A;  4O3A A;  4U1O A;  1A99 A;  1GVC A;  3RTW B;  3T93 B;  3HPI A;  3G3F A;  5H8F A;  1YCJ A;  3T9V A;  4LZ5 A;  1QUJ A;  2DYX A;  4NMY A;  4R75 A;  1HSE A;  1MY2 A;  2HZL A;  1N76 A;  3KBR A;  3IO6 A;  4F1Y A;  2HAV A;  1NMU A;  4ESX A;  1JVX A;  3ILU B;  4ZDM A;  1MXU A;  4K3F A;  3SES A;  2GHB A;  5IAI A;  3E4R A;  4KYE A;  5IKB A;  1P1U A;  1S9T A;  4U4S A;  1Y4T A;  4FAT A;  5CRY A;  5KCJ B;  1Q1K A;  3KEI A;  2ESN A;  1XVX A;  4DZ1 A;  3LUY A;  4R2F A;  4OFO A;  4YKP A;  1DPE A;  1B3G A;  3V89 B;  3TCH A;  3T9X B;  3Q26 A;  1OVB A;  1KWH A;  2HAU A;  5I2N A;  1Y20 A;  4PFT A;  2QL3 A;  4LP2 B;  1XOC A;  3FJ7 A;  2F8D A;  3OEM A;  2I3W A;  2X7P A;  4NF8 B;  3OEN A;  3OO6 A;  1RYX A;  3N94 A;  3ZKK A;  3GZG A;  2XXT A;  4ESW A;  2I3V A;  4WKM A;  3S9L C;  1BTJ A;  4GOT A;  1O64 A;  3O97 A;  3TTK A;  1SI1 A;  4TOZ A;  1B3L A;  3PGF A;  2M8C A;  1FQE A;  1XS5 A;  3GBB A;  4RY1 A;  3GLB A;  4AQ4 A;  2W7Y A;  3O6G A;  1NFT A;  2P0S A;  1UTB A;  1M5D A;  5DVJ A;  5LOM A;  4R6Y A;  5M2V A;  4R72 A;  4ZEC A;  1MXZ A;  3PUV E;  4TLM B;  3R26 A;  2AIX A;  3ILT B;  1MH4 A;  3IL1 B;  1IXC A;  2I0C A;  3ZKL A;  3S4U A;  3VVE A;  1HSL A;  5L9O A;  1ZIU A;  1FTO A;  5KDT A;  3ZS6 A;  4NF5 B;  2NWJ A;  4GL8 A;  1D9Y A;  4R74 A;  2OK2 A;  4EF1 A;  4N07 A;  1JW4 A;  3N26 A;  4GVO A;  3MP1 A;  2Q89 A;  4Z0I A;  1MXX A;  4ZEK A;  4YMB A;  4KD5 A;  2QMX A;  4H1X A;  3USD A;  1LAH E;  2RCA A;  2ZNT A;  1UQW A;  1AL3 A;  2UYF A;  4YB6 A;  5AA2 B;  3KSJ A;  2NOO A;  1DTG A;  1D9V A;  2P1S A;  1N3W A;  2YPN A;  3H6V A;  5H8H B;  3O6H A;  3UOR A;  5FHN A;  3CFL A;  1IZ1 A;  1NNT A;  3PU5 A;  5DEX B;  3THI A;  1PB7 A;  3SEV A;  5DTB A;  3TOD A;  3U1O A;  4KR5 A;  5CMC A;  1TFD A;  2F7C A;  3FVN A;  3ODB A;  1SBP A;  5DVF A;  1FW0 A;  2REG A;  1VR5 A;  2V93 A;  3SDF A;  3QUJ A;  4IO6 A;  3D4C A;  2AYS A;  4POX A;  2OWT A;  1MQI A;  1AOV A;  1LAG E;  3FVK A;  2QSX A;  1N84 A;  4MFI A;  4ELR A;  4EUO A;  2VP1 A;  5ICQ A;  4QF9 A;  2Y7K A;  5FHO A;  3H7M A;  3G3J A;  4YB7 A;  2DSF A;  3H6W A;  4MH5 A;  5DVI A;  1HSJ A;  1PDA A;  3I3V A;  2GHA A;  3BFU A;  1ELJ A;  1VSO A;  1ATG A;  2UYE A;  4X48 A;  1LLS A;  1A55 A;  4ELQ A;  4GQO A;  2X7Q A;  3TUS A;  4IY6 A;  4G68 B;  1B58 A;  4XXU A;  4FAJ A;  2DWJ A;  1SI0 A;  3SER A;  2PX1 A;  3CIJ A;  2O68 A;  2RIN A;  2VGQ A;  2R71 A;  1B2H A;  3TEP A;  3MVX A;  4OZ9 A;  4H8I A;  1LCT A;  2HCA A;  3A3U A;  4HCW A;  3DP6 A;  3O2A A;  3HST A;  3K2D A;  1MQG A;  2O6A A;  3UIF A;  1H44 A;  2XXR A;  1A40 A;  2A5S A;  3AXF A;  1QUK A;  4U21 A;  2ONK E;  2G29 A;  1AMF A;  1Y3Q A;  2O7U A;  2UXA A;  4H65 A;  4F2O A;  3TAJ A;  2ZYK A;  3BBR A;  3UGW A;  3HCQ A;  4F2Q A;  2NXO A;  3MZ9 A;  1LB8 A;  2QS3 A;  4IB2 A;  3PV0 E;  1ANF A;  4OHN A;  3G3H A;  1A8F A;  4PE5 B;  3CVG A;  4C1T A;  3O28 A;  2V84 A;  5I58 B;  4KCD A;  3OEK A;  4JWX A;  3SEU A;  1OLA A;  2H98 A;  1SYI A;  5JTY A;  4NTL A;  2OLB A;  1B5J A;  1MPC A;  2XXU A;  3RGY A;  4OFJ A;  3K4U A;  1S50 A;  3UK4 A;  1FQA A;  5KZT A;  4Q0C A;  3R7X A;  2ONS A;  2Z8F A;  4G2Z A;  2V25 A;  4XTC Q;  4X1B A;  4N13 A;  5I59 B;  4ZED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...