3SEYA

Zn-mediated polymer of maltose-binding protein a216h/k220h by synthetic symmetrization (form ii)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
371
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
total genus 124
structure length 371
sequence length 371
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3seyA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3seyA01
1P1OA 1JW1A 2I4CA 2XXUA 1MY3A 2GHAA 5CMMA 3CI8A 3TPAA 4XTCQ 2DP8A 2DVZA 2NWJA 3HHGA 3ECRA 2RC7A 3LBSA 4DE8A 1ANFA 4EQBA 3MZ9A 3GBBA 4POWA 4EQ7A 3EPEA 5I56B 5L9SA 4R73A 1DSNA 4IO7A 1WDNA 4WEPA 3RY3A 3UN6A 4FE8A 3WAFA 5KDTA 2UYEA 2O51A 3G3HA 2XX9A 4KI0E 4RJZA 1VR5A 4XKRA 3RTFB 1M5BA 4G2ZA 3PPQA 1YAEA 4IGRA 1P1QA 1SVXB 4ECFA 4GL0A 1R9QA 3TELA 4ZE8A 2PBWA 4ELQA 4QFKA 5L8DA 1UIUA 3GLBA 3PUZE 4GLIA 4OZ9A 3FIRA 1BLFA 4NWDA 2QMWA 3VE1B 3VFJA 1EZOA 1MXXA 4NF8B 4YU0A 3IO6A 3MWBA 4YKKA 2XXIA 4HTGA 1N3WA 3MZ1A 4R6HA 2ZNTA 4ZEDA 5JK4A 1I6AA 1B1XA 2QS3A 3FXRA 1TXFA 3GBAA 3LSXA 4PP0A 1S9TA 4O3BA 1Y20A 4DIGA 4GFRA 3TEPA 4F2OA 1II5A 1SI1A 2DS9A 3IB1A 5A5XA 4F31B 4Z0IA 1S50A 1Y3NA 3RT8A 1URDA 2GH9A 3OXNA 4MH5A 5EYFA 5TU0A 3L6HA 3RPWA 4RNSA 4BDNA 1LAFE 4H67A 4U21A 1B7UA 1S7YA 3IK6B 3Q26A 3S9MC 4R6KA 3FGSA 1GV8A 1B9JA 3CG3A 1B58A 1T0KA 3C36A 1SD3A 3IJOB 5ICTA 2WKYA 2H25A 4JDFA 4ELPA 3CFLA 3UK4A 5KCJA 1PDAA 1YCJA 4XKNA 2NUVA 5DEXA 3OO6A 5H8HB 3O9PA 1B1HA 3GZGA 3MP8A 2A5TA 4MBPA 5H8NA 2REGA 1MY4A 1LBBA 4LVQA 3MAMA 2UVGA 1B2HA 3D4GA 3OO8A 4HCWA 4OYVA 3UGWA 3PU5A 3VVFA 4G68C 3K01A 2XXQA 3O97A 3E9XA 4LQ2A 5ITOA 1POTA 4OXVA 2UYFA 4HCYA 4LA9A 1B05A 1D4NA 2Z8FA 3CSGA 1ZBMA 5AA2B 4Q8RA 4F3BA 5I59B 2OK2A 5TPAB 1POY1 1M5FA 1IXIA 2PT2A 3H6UA 4ND9A 4KCDA 1B51A 5H8QA 1MXUA 2Q88A 1FQCA 4ISUA 2RCBA 3G3JA 4H5FA 5DT6A 2F7AA 3KFMA 4I9DA 4DXBA 5AE4A 2O68A 3RN8A 5DYHA 1Y9UA 4LUBA 1N3XA 3BFUA 4PFUA 3MVZA 1UTBA 3QIMA 5CBSA 5B70A 1O63A 1MXYA 2DE2A 2F5XA 3TKDA 1NNPA 2IEEA 2DVCA 2ZYMA 3PUYE 3U72A 5I2KB 1PEBA 3R26A 5DVIA 1N04A 3Q29A 4JWOA 1OVTA 2V25A 4IO3A 1B7HA 5AA4B 4H8IA 1SW2A 5CMBA 3QYTA 5H8FA 4MFIA 4IO5A 5B7DA 3VVEA 3QAXA 1AL3A 4OESA 3Q27A 4NEDA 1ZLQA 4Q5TA 3V5AA 3SDFA 4ZZEA 2F7CA 2RKMA 3JZJA 3F11A 4LQ5A 4RPNA 2DE4A 1XHYA 3U1OA 4EF2A 2PX1A 2QL3A 3FVOA 4OQOA 5I57B 4RY1A 3E13X 4H8JA 3MPKA 2I58A 2OWTA 2PYYA 4IO4A 3TZAA 1NNFA 3H3GA 1QVSA 1AMFA 1PB7A 3VLUA 3VLWA 3VV5A 1Y4TA 1MPDA 4YICA 1R6ZA 1JW4A 1P1NA 2P1SA 4XIGQ 3RTWB 2XHDA 1F9BA 1ZMGA 3C4MA 2ONRA 1A7LA 2F7BA 2CMOA 1VSOA 3DLNA 4POXA 4ZEIA 3WAEA 3T9XB 3TDJA 3IAZA 3PMXA 5H8QB 1ZKBA 4BDMA 4OHNA 2R6GE 1BKAA 3PPNA 2ONSA 1Z7NE 4FEDA 5F7VA 2H99A 2Q9TA 5I58A 3TTRA 2XXYA 1M5EA 5H8FB 2ZYNA 1PC3A 3I3VA 3N94A 5ISUA 1B3EA 5CRYA 1D9YA 3PGFA 3IO4A 3UIFA 1B46A 2AL4A 4EXKA 1LAGE 4YKJA 1IXHA 1NH8A 4JWXA 4WXJA 1JNFA 4X9TA 1XS5A 2QRYA 2Z22A 1OQGA 3FZVA 2A5TB 4JWYA 4UA8A 4YB5A 1B52A 3S2VA 2Y7PA 3G3GA 3MP6A 3KJ7A 3KZGA 3IL1B 3IOUA 2XXTA 3O29A 4FECA 2Z8EA 3KSXA 4H0WA 4F3GA 2QSXA 3ZKLA 5AA2D 5KCJB 3KN8A 1B7ZA 1MH3A 2B65A 2A5SA 3VDFA 3PPPA 3PUXE 1EZPA 1M5CA 2REJA 4GL8A 2PVUA 2BJJX 2VGQA 1PB8A 4YZZA 2Q2CA 1GGGA 3N5LA 1H76A 3MPLA 1B6HA 1BP5A 1FQDA 1N7XA 2X7PA 2D3IA 4KYSA 4R6YA 2GFEA 5BWJA 5I59A 1CB6A 3CRBA 3N6UA 4OENA 3V89B 3QSLA 3RNNA 1LSTA 1QULA 4DCXA 4HW8A 1OMPA 2Y84A 1WODA 2PMSA 1USYE 4F29A 3K00A 3SESA 1Y1ZA 4PFWA 1B5JA 1TWYA 4G68B 1OIBA 3UA8A 1Y3QA 1LFIA 2HZKA 2ZNSA 4JSOA 1MDQA 3C34A 3QUFA 4I1DA 3L6GA 1HSEA 2X7QA 1B0HA 2Q2AA 2E1SA 1NKXA 4OMBA 3I6VA 1IXCA 5TPAA 1B5HA 1EZ9A 1SDXA 2DYXA 1OLCA 2DWAA 5FHOA 4F1UA 1NFTA 4XKQA 1EH3A 2YPNA 1LAHE 5ELVA 1UIVA 4U1OA 4U1ZA 3T93B 4EUOA 1SBPA 4U4XA 1LCTA 3CFZA 3DP8A 3IB0A 1Y3PA 2ABHA 1JVYA 3CVGA 5H8SA 3T9VA 3T22A 1A40A 3K1NA 3OSRA 3TTKA 4BDQA 1MY1A 2Z8DA 2I6EA 3BKIB 3PD9A 1H43A 2DE3A 1IITA 3K2DA 1TFAA 2QJEA 4X1DA 4F39A 1MH4A 1SW1A 2QS1A 1HSJA 3HV1A 1ATGA 1FQEA 1O64A 2I0CA 2PT1A 2O69A 2RF1A 3EQ1A 4DDDA 1A54A 3FJ7A 5CC2A 3MUQA 5I84A 3C33A 1LFGA 2H4IA 1FQFA 3U92A 4GVOA 4KQPA 1P1WA 4BDRA 1ZTYA 1IXGA 5I2KA 1USYH 2XD2A 3SETA 3FATA 1AH5A 2F97A 2ZYKA 4U23A 3IJXB 3EN3A 2OCUA 2OJTA 2YLNA 3A3CA 3IB2A 4FJPA 1XVXA 3K6UA 4U2RA 3C35A 3QXMA 5M2VA 3VXBA 2Q8JA 3TUSA 1TT1A 4BDOA 4IO2A 1DTZA 5IAIA 2F78A 3CSBA 1RYOA 3LC8A 3FVKA 3KOSA 2ANJA 4GOTA 4GXSB 1QKAA 4DCYA 1URGA 5TP9A 4EF1A 1MS7A 2G93A 1UTHA 4F2QA 1MXWA 1MM7A 1NNKA 4QHQA 2NVUB 4JB7A 1J1NA 4F3PA 2P2AA 3TQWA 4NF5A 2HFBA 3JYRA 3S9EA 1FQBA 1ZJLA 4PFTA 3OSQA 3TFLA 3HCQA 1QW0A 1MPCA 1SQYA 5KZTA 4ZS9A 2HCAA 3SEXA 3VXCA 2M8CA 1FTJA 1MM6A 2UVHA 3B6QA 4IGTA 4QSDA 3LR1A 5L9MA 5IKBA 1P99A 3UORA 1ELJA 2P0SA 3EHTA 1P1UA 2F36A 4LZ5A 1SI0A 3MW0A 2DSFA 3QUJA 1OVBA 3ODBA 1FTLA 2IA4A 2NOOA 4LONB 4RXLA 4ZEKA 4R75A 5CMKA 2XD3A 4KFQA 5FTHA 2X26A 4UACA 4TLLB 1H45A 4TQUQ 4IY6A 1YPNA 3USDA 4G68A 3K6XA 1N7WA 4GIZA 4Q0CA 4ZEFA 1VE4A 3H6VA 3O6HA 1DPPA 2VD3A 3RLFE 3OEKA 1MQIA 1IIWA 1MY0A 3MVWA 3O2AA 3RGYA 3B6TA 2XXXA 1HSLA 1LB8A 2ZMBA 4JBZA 4WEDA 5I58B 4KYEA 2F6PA 3KBRA 3PPOA 3V8XB 3LSFB 2HAVA 3PMWA 4ZECA 4YB7A 1I69A 3S9LC 1L5TA 1H3DA 4O3CA 4FAJA 2W7YA 4NTLA 1N0TA 3OO9A 3EHUA 4DLDA 3R7XA 4Q30B 5JTYA 5HBCA 3U8QA 3B7DA 1Y1MA 4ESWA 4YB6A 4QFOA 3O6GA 4WKMA 3SEYA 3T96B 4DXUA 4KHZE 4QSEA 3R6UA 2I4BA 4AQ4A 5I57A 3SKPA 3E3KA 1I6BA 4H6DA 4H65A 4GXAA 1LCFA 3CR9A 2O1MA 3PUVE 4MF3A 4FORA 3C31A 2RCAA 3KN7A 4GF8A 3TCHA 1B3HA 3T9HB 3HSTA 2YJPA 2O1LA 1MXVA 4NMYA 4OVJA 4YKPA 1VFEA 4U4SA 3K4UA 3SEWA 3DP6A 3TMGA 1DTGA 2H9BA 4DXCA 4M1VA 3W9WA 5HPQA 4I62A 3TAJA 4QF9A 4RK9A 1EU8A 1JEVA 2Y7RA 1US5A 4IB2A 4ZEBA 3TTNA 3LSLA 4N6PA 3IX1A 3BFTA 3IOTA 3Q25A 3C32A 4C0RA 3QK6A 2XX7A 3FJMA 4C1TA 3FVNA 1AOVA 2HXWA 3SEUA 3T9UA 2V93A 1QUJA 2O7IA 5EHMA 4E0XA 1FTOA 1UTBB 3FV2A 3IOVA 4H5GA 1WVJA 1DOTA 2THIA 3PMVA 4QRZA 4TOZA 2DWJA 4ELOA 2HAUA 4G8NA 5F1QA 5FHNA 5CBRA 1MQHA 3C9HA 2AIXA 2R71A 4BDLA 2DQVA 3KEIA 3PV0E 3V83A 4YMAA 2I49A 1NL5A 1OLAA 3HN0A 4KYDA 4OFLA 3CFXA 4X1BA 2O84X 3OELA 1D3KA 5DTBA 3OENA 1IEJA 5I2NA 1LFHA 1R1NA 2QS2A 3G3FA 3FUZA 3W15C 1URSA 1IUDA 1IZ1A 1MPBA 1B4HA 2ZNUA 3G3IA 3MP1A 3H6TA 4FIMA 5JTYB 3TTMA 4QFLA 4KPTA 1AIVA 3B6WA 3K0VA 3O66A 1MXZA 2I0BA 3K6VA 3W9VA 4I8CA 3HHFA 2DXYA 1TFDA 2FNCA 2RINA 1FCKA 4NE4A 4QFPA 3LSWA 2HQ0A 4QSCA 3T66A 3TCGA 2ESNA 2O6AA 4HS7A 4R74A 5DEXB 1SYHA 3PD8A 4LATA 5FHMA 4ZZAA 3H6WA 1OQHA 4NF6B 1LLSA 4RPOA 2Q89A 3RQTA 3KJTA 5BUUA 1ZIUA 1JQFA 4OTEA 1RKMA 2FYIA 4L17A 2UVIA 4OFJA 3IORA 4F18A 3K1PA 4KD5A 1MY2A 2RC8A 4AB5A 4Z7EA 3FV1A 2V3UA 1LGBC 5AA2A 1Z7ME 1QUIA 1N84A 2XXVA 3GXAA 4R72A 2I48A 1B32A 1SYIA 3KG2A 3OMBA 4NF4A 4PFYA 3SERA 4F1VA 3ILTB 3ZSFA 3MJNA 4LZ7A 4XXUA 5KDTB 1LAXA 2H98A 3HPIA 3I5OA 3Q28A 3MBPA 2F35A 1LBCA 1KWHA 3TODA 2FA7A 4MLVA 3OO7A 1FQAA 3TTLA 4BLAA 3JV9A 1RYXA 1SW5A 4YAHX 1B3GA 2H5YA 4ELRA 5H8NB 5AA3A 5H8HA 2B3BA 4OEUA 2Y7KA 3DP4A 3ONMA 1B5IA 3ZS6A 4PETA 1MG1A 4G8HA 4NF5B 5I2NB 4F22A 1MRPA 1PBQA 2VHAA 2F8DA 4C1UA 5HM4B 2HEUA 2HZLA 4EQ9A 3LUYA 1N76A 3U94A 2Z23A 1MQJA 2QMXA 4PQJA 4EXLA 1B0LA 4G4PA 4N13A 3H06B 5CM6A 1JETA 2VOZA 3RT6B 3M3KA 5LOMA 4YKIA 4OWDA 3IR1A 2XXHA 2OLBA 1B3FA 2D5WA 2F34A 2UVJA 4P11A 3PPRA 4RYAA 5AA1A 3O6IA 3H4ZA 1GVCA 2AYSA 3D4CA 3FXUA 5J1DA 5ICQA 1UQWA 3EHSA 4P0GA 4R2BA 3MQ9A 2XXRA 1NNTA 3FJGA 4OERA 3S4UA 5I56A 1D9VA 4MLQA 2DWHA 1DPEA 3BBRA 1PB9A 4IO6A 3MVXA 1US4A 2VD2A 3EF7A 1XT8A 4OFOA 1B3LA 1FTKA 4IY5A 3ZKKA 3CG1A 4NF8A 4YMBA 3DM0A 1NMUA 2E0SA 1LB9A 4N07A 2QPQA 2I3WA 3A09A 4ESXA 3M8UA 2XX8A 1Q1KA 1O7TA 1BIYA 2G29A 2Y7IA 3A3UA 2OZZA 3FASA 3ILUB 3OOAA 3RUMA 3FXQA 2XXPA 1QUKA 2CZLA 1IQ7A 2D21A 2GHBA 2GRVA 3MZBA 1JW5A 4M4GA 2OWSA 3G7WA 3E4RA 5AA4A 1A99A 2DWIA 3M3LA 1GR2A 4FATA 3S9NC 2AL5A 2V3TA 1I6QA 4GQOA 3K02A 5CMCA 3DELB 4R9GA 2RC9A 2I3VA 2F6GA 3VLVA 5JEIA 1PBPA 4E0WA 4NWCA 4XKPA 4PE5B 3SEVA 3H03A 4FEBA 5ITPA 1B40A 4DZ1A 5L9OA 5K2XA 5EHSA 4JXIA 4AB6A 3THIA 5K2YA 1MDP1 4KR5A 5DVFA 2B3FA 1GTKA 4GWOA 3MC2A 5FTIA 2LAOA 2XXWA 1XVYA 3N26A 1XOCA 1QJMA 3G3KA 1BTJA 1JVXA 1XC1A 2UXAA 4F3SA 4RK2A 3OD7A 4OEVA 4JSDA 3P7IA 2ZXTA 4G8MA 1B4ZA 1FW0A 2DXRA 4GD5A 4OETA 1YTVA 4LZ8A 2NXOA 1Q35A 4TLMB 5CI5A 3O28A 4THIA 1QKBA 4R9FA 3AXFA 1A8EA 2V3QA 3FVGA 1M5DA 4KCCA 4ONYA 2R9JA 3H7MA 4EDPA 2O7UA 1H44A 2DOJA 1A8FA 2OBGA 2VP1A 4P0IA 1R9LA 1MQDA 3U93A 3N6TA 5DVJA 1ZU0A 4NF4B 1NH7A 1SW4A 1JEUA 4G77A 1CE2A 3FD3A 4RA1A 3TCFA 2KLFA 1A55A 3K6WA 3KN3A 3KOTA 3M3FA 1UTHB 4LP2B 4O3AA 3IOWA 5TP9B 4ZE9A 3TQLA 4GRKA 2V84A 4X48A 4H1XA 1Y4CA 3KGCA 4ZDMA 1VFDA 1FTMA 3K1MA 3UP9A 3CIJA 2ALUA 3OEMA 2QS4A 3PUWE 4NF6A 4QFNA 3TYHA 3VVDA 4F19A 5A5XB 4U22A 4K3FA 4F1YA 1MQGA 3MVYA 3HO7A 2ONKE 3KSJA 4R2FA 2Y7WA 2ZYOA 1DMBA
chains in the Genus database with same CATH superfamily
2V4CA 2XXUA 1MY3A 3CI8A 2DP8A 4PBHA 2DVZA 2NWJA 5I56B 3MZ9A 4POWA 4NHBA 4O7MA 3UN6A 1WDNA 4FE8A 3G3HA 1YAEA 4IGRA 1P1QA 1SVXB 4ZE8A 4MCOA 4GLIA 1FBFA 4OZ9A 4YU0A 4HTGA 2ZNTA 2QS3A 3LSXA 4O3BA 4GFRA 1II5A 1SI1A 2DS9A 2GH9A 5EYFA 4PBQA 3RPWA 4RNSA 1B9JA 4JDFA 5H8HB 5H8NA 2REGA 1MY4A 4LVQA 4HCWA 3VVFA 3PU5A 5IZ3A 1RDXA 2Z8FA 5EQ7A 4ND9A 4KCDA 1B51A 2Q88A 1FQCA 4ISUA 4EQBA 4H5FA 3KFMA 4I9DA 4DXBA 3RN8A 5DYHA 3MVZA 1UTBA 1MXYA 3TKDA 2ZYMA 5DVIA 1FPKA 4MFIA 1AL3A 4OESA 3V5AA 3B8BA 3SDFA 3F11A 3U1OA 4EF2A 2PX1A 2QL3A 2OWTA 3S9NC 3H3GA 1QVSA 1PB7A 4QBAA 2XHDA 2ONRA 4GWUA 4ZEIA 1ZKBA 4GWSA 4FEDA 2ONSA 5I58A 2H99A 1FTAA 2XXYA 3I3VA 3UIFA 1B46A 4JWXA 1XS5A 4GWXA 2A5TB 3MP6A 3KJ7A 3IL1B 3O29A 2Z8EA 3VDFA 3PPPA 2VGQA 4YZZA 2Q2CA 1GGGA 1H76A 3MPLA 1B6HA 2D3IA 2KQZA 2GFEA 4HE1A 1CB6A 3RPLB 1QULA 4DCXA 4PAFA 2Y84A 2QVUA 5IZ3B 3SESA 1TWYA 4G68B 1OIBA 4JSOA 1XI6A 1MDQA 3C34A 4XF5A 3QUFA 1HSEA 2X7QA 4G61A 3I6VA 1B5HA 1SDXA 2DYXA 1OLCA 5FHOA 4XKQA 1LAHE 1UIVA 4U1OA 4U4XA 5H8SA 2ABHA 1NV3A 1MY1A 2Z8DA 4GWZA 4NAPA 1NV1A 2CEYA 1FPEA 3MUQA 2H4IA 3U92A 1P1WA 1IXGA 2XD2A 1AH5A 3IJXB 3EN3A 2OCUA 2OJTA 2YLNA 4IO2A 1DTZA 5IAIA 3LC8A 4GXSB 1QKAA 1FPBA 2NVUB 4NF5A 1ZJLA 2XXKA 3HCQA 2FIEA 1NUYA 5KZTA 3VXCA 2UVHA 4IGTA 3NOHA 5IKBA 1ELJA 3EHTA 4NG7A 1FPJA 3TEPA 1NV6A 4ZEKA 4KFQA 5FTHA 1H45A 4IY6A 1YPNA 3H6VA 4IR8A 3RGYA 3B6TA 2XXXA 4JBZA 4WEDA 4QXDA 3CHGA 5I58B 2F6PA 3KBRA 1K9YA 3LSFB 3PMWA 1I69A 3S9LC 1L5TA 1H3DA 4FAJA 2W7YA 1N0TA 3EHUA 1YXIA 2ZZWA 4N15A 4QSEA 4UABA 1I6BA 3CR9A 2O1MA 3KN7A 4GF8A 4OVJA 4YKPA 2O1LA 4ZEDA 3SEWA 4U4SA 4DXCA 5I3SA 4P56A 4RK9A 1NUZA 2WBDA 4C0RA 3SEUA 3T9UA 4E0XA 1QUJA 2O7IA 1UTBB 4H5GA 3PMVA 2DWJA 4OA4A 3V83A 4YMAA 4OFLA 4KYDA 1D3KA 3OENA 5I2NA 3G3FA 3W15C 4GBWA 2ZNUA 3TTMA 4QFLA 3T66A 2HQ0A 3TCGA 2KR0A 3BIHA 4HS7A 4R74A 3H6WA 3RQTA 5IM2A 2FYIA 4OFJA 3IORA 1MY2A 3FV1A 2V3UA 4OVTA 1N84A 4R72A 1B32A 4PFYA 4PFRA 2R8TA 3S9EA 3Q28A 3MBPA 3OO7A 3TTLA 3JV9A 2PCRA 4DI4B 2CZHA 4NF5B 4G8HA 4MJOA 2VHAA 2F8DA 1FJ6A 4NF0A 4PQJA 2F34A 3H4ZA 4P0GA 4NGUA 2XXRA 1D9VA 4MLQA 2DWHA 1DPEA 3BBRA 1QGXA 3EF7A 1XT8A 1FTKA 4NF8A 1NMUA 2I3WA 2Y7IA 3OOAA 2OZZA 2D21A 2CZLA 1IQ7A 2GRVA 5AA4A 1FPIA 4FATA 2PFZA 3DELB 5CMCA 2F6GA 1PBPA 3H03A 1FBHA 5L9OA 1INPA 1MDP1 1DK4A 4N17A 3FXBA 3P7IA 4G8MA 1FW0A 4OETA 1Q35A 4GX3A 3QMFA 4R9FA 1K9ZA 4EDPA 2O7UA 2OBGA 4P0IA 1MQDA 4NF4B 1NH7A 1JEUA 1A55A 1UTHB 2ZZXA 4LP2B 3TQLA 4N4UA 3K1MA 4MNCA 4YMBA 2ALUA 3OEMA 3TYHA 5A5XB 5CMMA 1JW1A 3HHGA 2RC7A 1ANFA 4PAKA 5L9SA 3U65A 4R73A 3RY3A 4RJZA 1VR5A 3RTFB 1BK4A 4ECFA 4GL0A 3TELA 4QFKA 5L8DA 3PUZE 3FIRA 4N81A 1MXXA 1FPDA 3MZ1A 4R6HA 5JK4A 1I6AA 3GBAA 1Y20A 4F2OA 4I40A 1IMFA 2XWKA 3RPLA 5TU0A 2XWOA 5IZZA 1S7YA 3Q26A 3FGSA 1GV8A 1SD3A 2WKYA 5KCJA 1PDAA 1LBXA 4PFBA 4XKNA 2QFLA 3O9PA 3RYDA 3GZGA 1FJ9A 3MAMA 4OYVA 4G68C 3O97A 4LQ2A 1D4NA 3CSGA 5I59B 4Q8RA 2OK2A 2PT2A 3H6UA 2P3NA 2WEFA 1MXUA 5AE4A 4N8GA 3QIMA 5B70A 2DE2A 2IEEA 2DVCA 3PUYE 3R26A 3Q29A 4IO3A 2CZKA 1EYJA 5LTCA 4IO5A 3VVEA 3Q27A 4NEDA 4Q5TA 2F7CA 5I57B 3E13X 4H8JA 3MPKA 2I58A 4IO4A 1Y4TA 1MPDA 2P1SA 1JW4A 4Z7EA 3WAEA 2VT5A 2R6GE 1BKAA 5F7VA 1Z7NE 5ET8A 3TTRA 2F3BA 5EYGA 1D9YA 4EXKA 2VPNA 4YKJA 1JNFA 4JWYA 4YB5A 3S2VA 4F3GA 3IOUA 2XXTA 2QSXA 3ZKLA 3KN8A 2B65A 2A5SA 1EZPA 1M5CA 2PVUA 2BJJX 3N5LA 1FQDA 4R6YA 5BWJA 4KYSA 5I59A 3N6UA 5EQ9A 4N6DA 1OMPA 1USYE 1B5JA 3L6GA 1B0HA 4OMBA 1IXCA 5TPAA 1KZ8A 1EZ9A 2DWAA 4F1UA 2ZZVA 5ELVA 4EUOA 1YZ0A 1LCTA 3CFZA 3IB0A 3T9VA 3K1NA 3BKIB 2I6EA 3PD9A 3V89B 2DE3A 5H8FA 3K2DA 1MH4A 1SW1A 1HSJA 1FQEA 2PT1A 2I0CA 4DDDA 5CC2A 3FJ7A 5I84A 4OVQA 1LFGA 4KQPA 3FATA 2F97A 4U23A 2WBBA 5TPAB 3A3CA 4FJPA 4U2RA 3QXMA 4GX4A 2Q8JA 4GOTA 5TP9A 2FIXA 2VPOA 1MM7A 1NNKA 1J1NA 4F3PA 3TQWA 1FQBA 3TFLA 1SQYA 3SEXA 1NV2A 2M8CA 3LR1A 2P0SA 2F36A 4LZ5A 3MW0A 2DSFA 4RXLA 3ODBA 5CMKA 2NOOA 4O94A 2XD3A 2X26A 4UACA 4TLLB 4PFIA 4G68A 4ZEFA 1VE4A 3RLFE 1DPPA 4PDDA 3OEKA 1MQIA 1IIWA 1HSLA 4KYEA 3PPOA 3V8XB 2HAVA 4MHFA 4NTLA 4X04A 2B4LA 4DLDA 5JTYA 4MNIA 4ESWA 4DXUA 2WYPA 3O6GA 4WKMA 3R6UA 2I4BA 1LBZA 5I57A 5J16A 4H65A 4GXAA 4MIJA 3T9HB 3HSTA 2YJPA 1VFEA 3DP6A 3TMGA 4M1VA 4I62A 4P3LA 2Y7RA 4ZEBA 4P47A 3ROJA 4N6PA 3IX1A 3Q25A 3C32A 3QK6A 3FJMA 4C1TA 2HXWA 5EHMA 2FHYA 3C9HA 2DQVA 2I49A 3CFXA 2O84X 2L5VA 1LFHA 2QS2A 3MP1A 3H6TA 4FIMA 1AIVA 4KPTA 3W9VA 3HHFA 2RINA 4QSCA 4N8YA 4LATA 5FHMA 1OQHA 1LLSA 2Q89A 5BUUA 1ZIUA 1NUXA 1JQFA 2QVRA 1Z7ME 2XXVA 3OMBA 4NF4A 3SERA 4F1VA 3ILTB 3ZSFA 4XXUA 5KDTB 3TODA 1FQAA 1SW5A 2H5YA 4ELRA 5H8NB 5AA3A 5H8HA 4OEUA 3DP4A 4P8BA 5ET5A 2MKZA 4OVPA 2HEUA 1N76A 3U94A 2Z23A 2F3DA 2QMXA 4G4PA 3MYUA 4N13A 1JETA 3M3KA 5ESYA 3IR1A 2UVJA 1B3FA 4RYAA 1UQWA 3MQ9A 4OERA 4JVCA 3E78A 1KA1A 2WX9A 1US4A 2VD2A 4PF8A 1B3LA 4IY5A 3DM0A 1LB9A 2QPQA 4ESXA 3A09A 3MWBA 3O66A 4I8CA 3M8UA 1Q1KA 1O7TA 3A3UA 3FASA 3ILUB 5A5LA 2GHBA 5EQAA 3G7WA 5EYHA 2DWIA 1GR2A 2AL5A 1I6QA 4GQOA 2HPGA 5JEIA 4E0WA 4NWCA 4XKPA 4PE5B 4FEBA 4DZ1A 5K2XA 4MEVA 1IMCA 5EHSA 1IMEA 5K2YA 4KR5A 5DVFA 3MC2A 3N26A 1XOCA 1QJMA 4GWWA 3OD7A 4OEVA 4GD5A 4TLMB 5CI5A 1YTVA 3O28A 4THIA 3AXFA 3FVGA 1M5DA 2VP1A 1R9LA 2P3VA 1LBVA 5DVJA 1SW4A 4G77A 4RA1A 3K6WA 3M3FA 1FBPA 5IGAA 4O3AA 3IOWA 5TP9B 3KBZA 4X48A 1VFDA 1IMAA 4K3FA 3KSJA 2ONKE 4R2FA 2ZYOA 2GHAA 3TPAA 3LBSA 3ECRA 4EQ7A 3GBBA 1DSNA 4IO7A 3WAFA 2O51A 2XX9A 4KI0E 4XKRA 4G2ZA 1R9QA 2PBWA 3GLBA 2QMWA 3VE1B 1EZOA 3IO6A 2XXIA 1N3WA 3FXRA 1TXFA 3IB1A 4Z0IA 1Y3NA 1URDA 4MH5A 3OXNA 3L6HA 4BDNA 4U21A 4O8MA 1B7UA 3IK6B 3S9MC 3CG3A 1B58A 1T0KA 3C36A 3IJOB 3OO6A 1B1HA 3MP8A 4MBPA 2UVGA 3UGWA 4H45A 3E9XA 5ITOA 2UYFA 4HCYA 4LA9A 5AA2B 1ZBMA 2OWZA 1POY1 1M5FA 1IXIA 2WYKA 1NV7A 2Y5LA 4PGNA 5H8QA 5DT6A 2RCBA 1NV4A 2O68A 4PFUA 1N3XA 2DDKA 5CBSA 1O63A 2F5XA 3FBPA 4P1EA 5I2KB 1B7HA 5CMBA 4NN3A 2CZIA 3QAXA 1ZLQA 3JZJA 4LQ5A 4RY1A 1SPIA 2PYYA 1NNFA 3VLWA 3RTWB 4YICA 2FVZA 1P1NA 4XIGQ 1F9BA 1ZMGA 1A7LA 2F7BA 2CMOA 1VSOA 3DLNA 4HXVA 4POXA 3T9XB 3TDJA 3IAZA 3PMXA 4BDMA 4OHNA 2PFYA 2ZYNA 1PC3A 5ISUA 3PGFA 4PC9A 2AL4A 1LAGE 1RDYA 2QRYA 1OQGA 3FZVA 4XEQA 4FECA 3KZGA 4H0WA 5KCJB 5AA2D 1PB8A 1BP5A 5KDTA 1N7XA 3CRBA 3QSLA 3RNNA 1WODA 5T3JA 2ZNSA 1LFIA 1FSAA 4P1LA 2Q2AA 2E1SA 1NKXA 1EH3A 2YPNA 4U1ZA 1Y3PA 4HE0A 1JVYA 3OSRA 3TTKA 4BDQA 4X1DA 1TFAA 2QJEA 3T1BA 2QS1A 5CM6A 1KA0A 1O64A 3EQ1A 2O69A 3GYYA 4LN5A 2B4MA 4MAGA 4BDRA 5I2KA 2ZYKA 1Q9DA 5M2VA 3IFAA 4BDOA 2F78A 3HFUA 3CSBA 4N6KA 1RYOA 4ELQA 3KOSA 4DCYA 4EF1A 2G93A 1UTHA 1IMBA 3JYRA 1QW0A 1MPCA 4ZS9A 2HCAA 1MM6A 5L9MA 3SZPA 1P99A 1P1UA 3QUJA 1FTLA 4NX1A 3K6XA 1N7WA 4GIZA 2VD3A 3MVWA 3O2AA 3KC0A 2ZMBA 3D1RA 4YB7A 4MNPA 4O3CA 4PDHA 3OO9A 5ET7A 3R7XA 4Q30B 5HBCA 3U8QA 1FBDA 1Y1MA 3B7DA 3SEYA 4KHZE 4AQ4A 3T0JA 3SKPA 3E3KA 1LCFA 3PUVE 4FORA 2RCAA 3TCHA 3UK4A 1MXVA 1DTGA 3W9WA 3TAJA 4QF9A 1EU8A 4IB2A 3TTNA 3LSLA 3BFTA 1DBZA 2XX7A 1FBEA 5ET6A 2V93A 1FTOA 3IOVA 1WVJA 1DOTA 4QRZA 3LUZA 2HAUA 4G8NA 5F1QA 5CBRA 1MQHA 4JVDA 3KEIA 3PV0E 1NL5A 1OLAA 3HN0A 4X1BA 3OELA 1FPGA 4OVRA 1URSA 1B4HA 3G3IA 1LBWA 3K0VA 3K6VA 2XA5A 1LEVA 4QFPA 3LSWA 2ESNA 1SYHA 3PD8A 4NQ8A 4NF6B 4RPOA 3KJTA 4OTEA 1RKMA 4L17A 2UVIA 2RC8A 4AB5A 1YYZA 1QUIA 3GXAA 3KG2A 3MJNA 2H98A 3I5OA 1RYXA 1B3GA 4N91A 2B3BA 3ONMA 1B5IA 1MG1A 5I2NB 1PBQA 4C1UA 5HM4B 1MQJA 4EXLA 1FPFA 2VOZA 3RT6B 4YKIA 4OWDA 2XXHA 2OLBA 4P11A 3EKIA 2AYSA 3FXUA 4R2BA 3S4UA 1NNTA 3FJGA 5I56A 1PB9A 3MVXA 3ZKKA 1DCUA 1EYKA 2E0SA 4N07A 3ISPA 2XX8A 4ZE9A 1BIYA 3FXQA 4P9KA 3M3LA 2V3TA 3K02A 2I3VA 4PF6A 2BJIA 3VLVA 5ITPA 4JXIA 3THIA 2B3FA 3G3KA 1XC1A 2UXAA 4F3SA 4AS4A 4RK2A 4JSDA 1B4ZA 2DXRA 4LZ8A 1NV5A 5DW8A 2V3QA 4ONYA 4KCCA 4OVSA 2R9JA 3H7MA 1H44A 2DOJA 1D9QA 1ZU0A 3FD3A 4PGPA 4H46A 2KLFA 4GRKA 2V84A 1Y4CA 3KGCA 3UP9A 1FTMA 3CIJA 3VVDA 2QS4A 4QFNA 4U22A 4F1YA 1MQGA 1DMBA 1P1OA 2I4CA 4XTCQ 4DE8A 4PE3A 3EPEA 4WEPA 2UYEA 1AWBA 1M5BA 3PPQA 4KXPA 1VDWA 1UIUA 1BLFA 4NWDA 3VFJA 4NF8B 4YKKA 1B1XA 4PP0A 1FBGA 4PAIA 1S9TA 4DIGA 5A5XA 4F31B 2HXRA 1S50A 3RT8A 1LAFE 4H67A 4I3YA 4GBVA 5F24A 4R6KA 5ICTA 2H25A 4ELPA 3CFLA 1YCJA 5DEXA 2NUVA 3E79A 2A5TA 4GWYA 1LBBA 1B2HA 3D4GA 3OO8A 4I3EA 1LBYA 2XXQA 3K01A 1POTA 4OXVA 2Y5KA 1B05A 4F3BA 5LDZA 5FBPA 3G3JA 4JVIA 2F7AA 1Y9UA 4LUBA 3BFUA 1NNPA 3U72A 1PEBA 1N04A 4X8RA 4JWOA 1OVTA 2V25A 5AA4B 4H8IA 1SW2A 3QYTA 5B7DA 3LV0A 4ZZEA 2Q74A 2RKMA 4RPNA 2DE4A 1XHYA 4OQOA 3FVOA 5IZ1A 3VLUA 3TZAA 1AMFA 3VV5A 1R6ZA 4MX6A 3C4MA 1NUWA 4AS5A 5H8QB 4FBPA 3KC1A 3PPNA 2Q9TA 1M5EA 5H8FB 3N94A 1B3EA 5CRYA 3IO4A 4MMPA 1IXHA 1NH8A 4WXJA 4X9TA 2Z22A 1NV0A 4UA8A 1B52A 1FRPA 2Y7PA 3G3GA 1FBCA 5AA1A 3KSXA 5EQ8A 1B7ZA 1MH3A 3PUXE 2REJA 4GL8A 2CEXA 1EYIA 2X7PA 4O7IA 4OENA 1LSTA 4HW8A 2PMSA 4F29A 3K00A 1Y1ZA 4PFWA 3UA8A 1Y3QA 2Q8MA 2HZKA 4I1DA 1NFTA 2JJKA 3T93B 1SBPA 3DP8A 3CVGA 3T22A 1A40A 4ELOA 1H43A 4F39A 1IITA 3HV1A 1ATGA 2RF1A 1A54A 3C33A 1FQFA 4GVOA 1ZTYA 1USYH 3SETA 3IB2A 1XVXA 3K6UA 3C35A 3VXBA 3TUSA 1TT1A 3FVKA 3MSTA 2ANJA 1URGA 1MS7A 4F2QA 1MXWA 4QHQA 4JB7A 2P2AA 4PTKA 2HFBA 4PFTA 3OSQA 1FTJA 4QSDA 3B6QA 3UORA 1SI0A 4LONB 1OVBA 2IA4A 4R75A 4TQUQ 3USDA 4Q0CA 3O6HA 2GQ1A 1MY0A 4PCDA 1LB8A 4ZECA 1G0IA 2QVVA 4YB6A 2FBPA 4QFOA 3T96B 4H6DA 4MF3A 3C31A 1B3HA 4NMYA 3K4UA 1JP4A 5HPQA 2H9BA 1JEVA 1US5A 3IOTA 3FVNA 1AOVA 3FV2A 4TOZA 2THIA 5FHNA 2AIXA 2R71A 4BDLA 5DTBA 4HE2A 1IEJA 1R1NA 3FUZA 1IUDA 5JTYB 1IZ1A 1MPBA 3B6WA 1MXZA 2I0BA 2DXYA 1TFDA 2FNCA 4NE4A 1FCKA 3U93A 3PTYA 2O6AA 5DEXB 4ZZAA 2HHMA 4F18A 3K1PA 4KD5A 1LGBC 5AA2A 1IMDA 2I48A 1SYIA 4LZ7A 1LAXA 3HPIA 2F35A 1LBCA 1KWHA 2FA7A 4MLVA 4BLAA 4YAHX 3ZS6A 2Y7KA 4PETA 4F22A 1MRPA 2HZLA 4EQ9A 3LUYA 3A29A 1B0LA 3H06B 5LOMA 4DI3D 2D5WA 3PPRA 3O6IA 1GVCA 3D4CA 5J1DA 5ICQA 2OX3A 3EHSA 4IO6A 4OFOA 3CG1A 1CNQA 4GX6A 2G29A 3RUMA 3B50A 2XXPA 1QUKA 3BIGA 3MZBA 1JW5A 4M4GA 2OWSA 3E4RA 1A99A 4R9GA 2RC9A 3SEVA 1B40A 4AB6A 1GTKA 4GWOA 5FTIA 5I5PA 2LAOA 2XXWA 1NI9A 1XVYA 2XWVA 1BTJA 1JVXA 2ZXTA 1G0HA 2XWIA 2NXOA 1QKBA 1A8EA 5I7IA 1A8FA 4XFEA 3N6TA 1RDZA 1CE2A 1FPLA 3TCFA 3KN3A 3KOTA 3IFCA 4H1XA 4OANA 4ZDMA 4NF6A 3PUWE 4F19A 3MVYA 3HO7A 2Y7WA
chains in the Genus database with same CATH topology
1P1OA 1JW1A 2I4CA 2XXUA 1MY3A 2GHAA 5CMMA 3CI8A 3TPAA 4XTCQ 2DP8A 2DVZA 2NWJA 3HHGA 3ECRA 2RC7A 3LBSA 4DE8A 1ANFA 4EQBA 3MZ9A 3GBBA 4POWA 4EQ7A 3EPEA 5I56B 5L9SA 4R73A 1DSNA 4IO7A 1WDNA 4WEPA 3RY3A 3UN6A 4FE8A 3WAFA 5KDTA 2UYEA 2O51A 3G3HA 2XX9A 4KI0E 4RJZA 1VR5A 4XKRA 3RTFB 1M5BA 4G2ZA 3PPQA 1YAEA 4IGRA 1P1QA 1SVXB 4ECFA 4GL0A 1R9QA 3TELA 4ZE8A 2PBWA 4ELQA 4QFKA 5L8DA 1UIUA 3GLBA 3PUZE 4GLIA 4OZ9A 3FIRA 1BLFA 4NWDA 2QMWA 3VE1B 3VFJA 1EZOA 1MXXA 4NF8B 4YU0A 3IO6A 3MWBA 4YKKA 2XXIA 4HTGA 1N3WA 3MZ1A 4R6HA 2ZNTA 4ZEDA 5JK4A 1I6AA 1B1XA 2QS3A 3FXRA 1TXFA 3GBAA 3LSXA 4PP0A 1S9TA 4O3BA 1Y20A 4DIGA 4GFRA 3TEPA 4F2OA 1II5A 1SI1A 2DS9A 3IB1A 5A5XA 4F31B 4Z0IA 1S50A 1Y3NA 3RT8A 1URDA 2GH9A 3OXNA 4MH5A 5EYFA 5TU0A 3L6HA 3RPWA 4RNSA 4BDNA 1LAFE 4H67A 4U21A 1B7UA 1S7YA 3IK6B 3Q26A 3S9MC 4R6KA 3FGSA 1GV8A 1B9JA 3CG3A 1B58A 1T0KA 3C36A 1SD3A 3IJOB 5ICTA 2WKYA 2H25A 4JDFA 4ELPA 3CFLA 3UK4A 5KCJA 1PDAA 1YCJA 4XKNA 2NUVA 5DEXA 3OO6A 5H8HB 3O9PA 1B1HA 3GZGA 3MP8A 2A5TA 4MBPA 5H8NA 2REGA 1MY4A 1LBBA 4LVQA 3MAMA 2UVGA 1B2HA 3D4GA 3OO8A 4HCWA 4OYVA 3UGWA 3PU5A 3VVFA 4G68C 3K01A 2XXQA 3O97A 3E9XA 4LQ2A 5ITOA 1POTA 4OXVA 2UYFA 4HCYA 4LA9A 1B05A 1D4NA 2Z8FA 3CSGA 1ZBMA 5AA2B 4Q8RA 4F3BA 5I59B 2OK2A 5TPAB 1POY1 1M5FA 1IXIA 2PT2A 3H6UA 4ND9A 4KCDA 1B51A 5H8QA 1MXUA 2Q88A 1FQCA 4ISUA 2RCBA 3G3JA 4H5FA 5DT6A 2F7AA 3KFMA 4I9DA 4DXBA 5AE4A 2O68A 3RN8A 5DYHA 1Y9UA 4LUBA 1N3XA 3BFUA 4PFUA 3MVZA 1UTBA 3QIMA 5CBSA 5B70A 1O63A 1MXYA 2DE2A 2F5XA 3TKDA 1NNPA 2IEEA 2DVCA 2ZYMA 3PUYE 3U72A 5I2KB 1PEBA 3R26A 5DVIA 1N04A 3Q29A 4JWOA 1OVTA 2V25A 4IO3A 1B7HA 5AA4B 4H8IA 1SW2A 5CMBA 3QYTA 5H8FA 4MFIA 4IO5A 5B7DA 3VVEA 3QAXA 1AL3A 4OESA 3Q27A 4NEDA 1ZLQA 4Q5TA 3V5AA 3SDFA 4ZZEA 2F7CA 2RKMA 3JZJA 3F11A 4LQ5A 4RPNA 2DE4A 1XHYA 3U1OA 4EF2A 2PX1A 2QL3A 3FVOA 4OQOA 5I57B 4RY1A 3E13X 4H8JA 3MPKA 2I58A 2OWTA 2PYYA 4IO4A 3TZAA 1NNFA 3H3GA 1QVSA 1AMFA 1PB7A 3VLUA 3VLWA 3VV5A 1Y4TA 1MPDA 4YICA 1R6ZA 1JW4A 1P1NA 2P1SA 4XIGQ 3RTWB 2XHDA 1F9BA 1ZMGA 3C4MA 2ONRA 1A7LA 2F7BA 2CMOA 1VSOA 3DLNA 4POXA 4ZEIA 3WAEA 3T9XB 3TDJA 3IAZA 3PMXA 5H8QB 1ZKBA 4BDMA 4OHNA 2R6GE 1BKAA 3PPNA 2ONSA 1Z7NE 4FEDA 5F7VA 2H99A 2Q9TA 5I58A 3TTRA 2XXYA 1M5EA 5H8FB 2ZYNA 1PC3A 3I3VA 3N94A 5ISUA 1B3EA 5CRYA 1D9YA 3PGFA 3IO4A 3UIFA 1B46A 2AL4A 4EXKA 1LAGE 4YKJA 1IXHA 1NH8A 4JWXA 4WXJA 1JNFA 4X9TA 1XS5A 2QRYA 2Z22A 1OQGA 3FZVA 2A5TB 4JWYA 4UA8A 4YB5A 1B52A 3S2VA 2Y7PA 3G3GA 3MP6A 3KJ7A 3KZGA 3IL1B 3IOUA 2XXTA 3O29A 4FECA 2Z8EA 3KSXA 4H0WA 4F3GA 2QSXA 3ZKLA 5AA2D 5KCJB 3KN8A 1B7ZA 1MH3A 2B65A 2A5SA 3VDFA 3PPPA 3PUXE 1EZPA 1M5CA 2REJA 4GL8A 2PVUA 2BJJX 2VGQA 1PB8A 4YZZA 2Q2CA 1GGGA 3N5LA 1H76A 3MPLA 1B6HA 1BP5A 1FQDA 1N7XA 2X7PA 2D3IA 4KYSA 4R6YA 2GFEA 5BWJA 5I59A 1CB6A 3CRBA 3N6UA 4OENA 3V89B 3QSLA 3RNNA 1LSTA 1QULA 4DCXA 4HW8A 1OMPA 2Y84A 1WODA 2PMSA 1USYE 4F29A 3K00A 3SESA 1Y1ZA 4PFWA 1B5JA 1TWYA 4G68B 1OIBA 3UA8A 1Y3QA 1LFIA 2HZKA 2ZNSA 4JSOA 1MDQA 3C34A 3QUFA 4I1DA 3L6GA 1HSEA 2X7QA 1B0HA 2Q2AA 2E1SA 1NKXA 4OMBA 3I6VA 1IXCA 5TPAA 1B5HA 1EZ9A 1SDXA 2DYXA 1OLCA 2DWAA 5FHOA 4F1UA 1NFTA 4XKQA 1EH3A 2YPNA 1LAHE 5ELVA 1UIVA 4U1OA 4U1ZA 3T93B 4EUOA 1SBPA 4U4XA 1LCTA 3CFZA 3DP8A 3IB0A 1Y3PA 2ABHA 1JVYA 3CVGA 5H8SA 3T9VA 3T22A 1A40A 3K1NA 3OSRA 3TTKA 4BDQA 1MY1A 2Z8DA 2I6EA 3BKIB 3PD9A 1H43A 2DE3A 1IITA 3K2DA 1TFAA 2QJEA 4X1DA 4F39A 1MH4A 1SW1A 2QS1A 1HSJA 3HV1A 1ATGA 1FQEA 1O64A 2I0CA 2PT1A 2O69A 2RF1A 3EQ1A 4DDDA 1A54A 3FJ7A 5CC2A 3MUQA 5I84A 3C33A 1LFGA 2H4IA 1FQFA 3U92A 4GVOA 4KQPA 1P1WA 4BDRA 1ZTYA 1IXGA 5I2KA 1USYH 2XD2A 3SETA 3FATA 1AH5A 2F97A 2ZYKA 4U23A 3IJXB 3EN3A 2OCUA 2OJTA 2YLNA 3A3CA 3IB2A 4FJPA 1XVXA 3K6UA 4U2RA 3C35A 3QXMA 5M2VA 3VXBA 2Q8JA 3TUSA 1TT1A 4BDOA 4IO2A 1DTZA 5IAIA 2F78A 3CSBA 1RYOA 3LC8A 3FVKA 3KOSA 2ANJA 4GOTA 4GXSB 1QKAA 4DCYA 1URGA 5TP9A 4EF1A 1MS7A 2G93A 1UTHA 4F2QA 1MXWA 1MM7A 1NNKA 4QHQA 2NVUB 4JB7A 1J1NA 4F3PA 2P2AA 3TQWA 4NF5A 2HFBA 3JYRA 3S9EA 1FQBA 1ZJLA 4PFTA 3OSQA 3TFLA 3HCQA 1QW0A 1MPCA 1SQYA 5KZTA 4ZS9A 2HCAA 3SEXA 3VXCA 2M8CA 1FTJA 1MM6A 2UVHA 3B6QA 4IGTA 4QSDA 3LR1A 5L9MA 5IKBA 1P99A 3UORA 1ELJA 2P0SA 3EHTA 1P1UA 2F36A 4LZ5A 1SI0A 3MW0A 2DSFA 3QUJA 1OVBA 3ODBA 1FTLA 2IA4A 2NOOA 4LONB 4RXLA 4ZEKA 4R75A 5CMKA 2XD3A 4KFQA 5FTHA 2X26A 4UACA 4TLLB 1H45A 4TQUQ 4IY6A 1YPNA 3USDA 4G68A 3K6XA 1N7WA 4GIZA 4Q0CA 4ZEFA 1VE4A 3H6VA 3O6HA 1DPPA 2VD3A 3RLFE 3OEKA 1MQIA 1IIWA 1MY0A 3MVWA 3O2AA 3RGYA 3B6TA 2XXXA 1HSLA 1LB8A 2ZMBA 4JBZA 4WEDA 5I58B 4KYEA 2F6PA 3KBRA 3PPOA 3V8XB 3LSFB 2HAVA 3PMWA 4ZECA 4YB7A 1I69A 3S9LC 1L5TA 1H3DA 4O3CA 4FAJA 2W7YA 4NTLA 1N0TA 3OO9A 3EHUA 4DLDA 3R7XA 4Q30B 5JTYA 5HBCA 3U8QA 3B7DA 1Y1MA 4ESWA 4YB6A 4QFOA 3O6GA 4WKMA 3SEYA 3T96B 4DXUA 4KHZE 4QSEA 3R6UA 2I4BA 4AQ4A 5I57A 3SKPA 3E3KA 1I6BA 4H6DA 4H65A 4GXAA 1LCFA 3CR9A 2O1MA 3PUVE 4MF3A 4FORA 3C31A 2RCAA 3KN7A 4GF8A 3TCHA 1B3HA 3T9HB 3HSTA 2YJPA 2O1LA 1MXVA 4NMYA 4OVJA 4YKPA 1VFEA 4U4SA 3K4UA 3SEWA 3DP6A 3TMGA 1DTGA 2H9BA 4DXCA 4M1VA 3W9WA 5HPQA 4I62A 3TAJA 4QF9A 4RK9A 1EU8A 1JEVA 2Y7RA 1US5A 4IB2A 4ZEBA 3TTNA 3LSLA 4N6PA 3IX1A 3BFTA 3IOTA 3Q25A 3C32A 4C0RA 3QK6A 2XX7A 3FJMA 4C1TA 3FVNA 1AOVA 2HXWA 3SEUA 3T9UA 2V93A 1QUJA 2O7IA 5EHMA 4E0XA 1FTOA 1UTBB 3FV2A 3IOVA 4H5GA 1WVJA 1DOTA 2THIA 3PMVA 4QRZA 4TOZA 2DWJA 4ELOA 2HAUA 4G8NA 5F1QA 5FHNA 5CBRA 1MQHA 3C9HA 2AIXA 2R71A 4BDLA 2DQVA 3KEIA 3PV0E 3V83A 4YMAA 2I49A 1NL5A 1OLAA 3HN0A 4KYDA 4OFLA 3CFXA 4X1BA 2O84X 3OELA 1D3KA 5DTBA 3OENA 1IEJA 5I2NA 1LFHA 1R1NA 2QS2A 3G3FA 3FUZA 3W15C 1URSA 1IUDA 1IZ1A 1MPBA 1B4HA 2ZNUA 3G3IA 3MP1A 3H6TA 4FIMA 5JTYB 3TTMA 4QFLA 4KPTA 1AIVA 3B6WA 3K0VA 3O66A 1MXZA 2I0BA 3K6VA 3W9VA 4I8CA 3HHFA 2DXYA 1TFDA 2FNCA 2RINA 1FCKA 4NE4A 4QFPA 3LSWA 2HQ0A 4QSCA 3T66A 3TCGA 2ESNA 2O6AA 4HS7A 4R74A 5DEXB 1SYHA 3PD8A 4LATA 5FHMA 4ZZAA 3H6WA 1OQHA 4NF6B 1LLSA 4RPOA 2Q89A 3RQTA 3KJTA 5BUUA 1ZIUA 1JQFA 4OTEA 1RKMA 2FYIA 4L17A 2UVIA 4OFJA 3IORA 4F18A 3K1PA 4KD5A 1MY2A 2RC8A 4AB5A 4Z7EA 3FV1A 2V3UA 1LGBC 5AA2A 1Z7ME 1QUIA 1N84A 2XXVA 3GXAA 4R72A 2I48A 1B32A 1SYIA 3KG2A 3OMBA 4NF4A 4PFYA 3SERA 4F1VA 3ILTB 3ZSFA 3MJNA 4LZ7A 4XXUA 5KDTB 1LAXA 2H98A 3HPIA 3I5OA 3Q28A 3MBPA 2F35A 1LBCA 1KWHA 3TODA 2FA7A 4MLVA 3OO7A 1FQAA 3TTLA 4BLAA 3JV9A 1RYXA 1SW5A 4YAHX 1B3GA 2H5YA 4ELRA 5H8NB 5AA3A 5H8HA 2B3BA 4OEUA 2Y7KA 3DP4A 3ONMA 1B5IA 3ZS6A 4PETA 1MG1A 4G8HA 4NF5B 5I2NB 4F22A 1MRPA 1PBQA 2VHAA 2F8DA 4C1UA 5HM4B 2HEUA 2HZLA 4EQ9A 3LUYA 1N76A 3U94A 2Z23A 1MQJA 2QMXA 4PQJA 4EXLA 1B0LA 4G4PA 4N13A 3H06B 5CM6A 1JETA 2VOZA 3RT6B 3M3KA 5LOMA 4YKIA 4OWDA 3IR1A 2XXHA 2OLBA 1B3FA 2D5WA 2F34A 2UVJA 4P11A 3PPRA 4RYAA 5AA1A 3O6IA 3H4ZA 1GVCA 2AYSA 3D4CA 3FXUA 5J1DA 5ICQA 1UQWA 3EHSA 4P0GA 4R2BA 3MQ9A 2XXRA 1NNTA 3FJGA 4OERA 3S4UA 5I56A 1D9VA 4MLQA 2DWHA 1DPEA 3BBRA 1PB9A 4IO6A 3MVXA 1US4A 2VD2A 3EF7A 1XT8A 4OFOA 1B3LA 1FTKA 4IY5A 3ZKKA 3CG1A 4NF8A 4YMBA 3DM0A 1NMUA 2E0SA 1LB9A 4N07A 2QPQA 2I3WA 3A09A 4ESXA 3M8UA 2XX8A 1Q1KA 1O7TA 1BIYA 2G29A 2Y7IA 3A3UA 2OZZA 3FASA 3ILUB 3OOAA 3RUMA 3FXQA 2XXPA 1QUKA 2CZLA 1IQ7A 2D21A 2GHBA 2GRVA 3MZBA 1JW5A 4M4GA 2OWSA 3G7WA 3E4RA 5AA4A 1A99A 2DWIA 3M3LA 1GR2A 4FATA 3S9NC 2AL5A 2V3TA 1I6QA 4GQOA 3K02A 5CMCA 3DELB 4R9GA 2RC9A 2I3VA 2F6GA 3VLVA 5JEIA 1PBPA 4E0WA 4NWCA 4XKPA 4PE5B 3SEVA 3H03A 4FEBA 5ITPA 1B40A 4DZ1A 5L9OA 5K2XA 5EHSA 4JXIA 4AB6A 3THIA 5K2YA 1MDP1 4KR5A 5DVFA 2B3FA 1GTKA 4GWOA 3MC2A 5FTIA 2LAOA 2XXWA 1XVYA 3N26A 1XOCA 1QJMA 3G3KA 1BTJA 1JVXA 1XC1A 2UXAA 4F3SA 4RK2A 3OD7A 4OEVA 4JSDA 3P7IA 2ZXTA 4G8MA 1B4ZA 1FW0A 2DXRA 4GD5A 4OETA 1YTVA 4LZ8A 2NXOA 1Q35A 4TLMB 5CI5A 3O28A 4THIA 1QKBA 4R9FA 3AXFA 1A8EA 2V3QA 3FVGA 1M5DA 4KCCA 4ONYA 2R9JA 3H7MA 4EDPA 2O7UA 1H44A 2DOJA 1A8FA 2OBGA 2VP1A 4P0IA 1R9LA 1MQDA 3U93A 3N6TA 5DVJA 1ZU0A 4NF4B 1NH7A 1SW4A 1JEUA 4G77A 1CE2A 3FD3A 4RA1A 3TCFA 2KLFA 1A55A 3K6WA 3KN3A 3KOTA 3M3FA 1UTHB 4LP2B 4O3AA 3IOWA 5TP9B 4ZE9A 3TQLA 4GRKA 2V84A 4X48A 4H1XA 1Y4CA 3KGCA 4ZDMA 1VFDA 1FTMA 3K1MA 3UP9A 3CIJA 2ALUA 3OEMA 2QS4A 3PUWE 4NF6A 4QFNA 3TYHA 3VVDA 4F19A 5A5XB 4U22A 4K3FA 4F1YA 1MQGA 3MVYA 3HO7A 2ONKE 3KSJA 4R2FA 2Y7WA 2ZYOA 1DMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1O A;  1JW1 A;  2I4C A;  2XXU A;  1MY3 A;  2GHA A;  5CMM A;  3CI8 A;  3TPA A;  4XTC Q;  2DP8 A;  2DVZ A;  2NWJ A;  3HHG A;  3ECR A;  2RC7 A;  3LBS A;  4DE8 A;  1ANF A;  4EQB A;  3MZ9 A;  3GBB A;  4POW A;  4EQ7 A;  3EPE A;  5I56 B;  5L9S A;  4R73 A;  1DSN A;  4IO7 A;  1WDN A;  4WEP A;  3RY3 A;  3UN6 A;  4FE8 A;  3WAF A;  5KDT A;  2UYE A;  2O51 A;  3G3H A;  2XX9 A;  4KI0 E;  4RJZ A;  1VR5 A;  4XKR A;  3RTF B;  1M5B A;  4G2Z A;  3PPQ A;  1YAE A;  4IGR A;  1P1Q A;  1SVX B;  4ECF A;  4GL0 A;  1R9Q A;  3TEL A;  4ZE8 A;  2PBW A;  4ELQ A;  4QFK A;  5L8D A;  1UIU A;  3GLB A;  3PUZ E;  4GLI A;  4OZ9 A;  3FIR A;  1BLF A;  4NWD A;  2QMW A;  3VE1 B;  3VFJ A;  1EZO A;  1MXX A;  4NF8 B;  4YU0 A;  3IO6 A;  3MWB A;  4YKK A;  2XXI A;  4HTG A;  1N3W A;  3MZ1 A;  4R6H A;  2ZNT A;  4ZED A;  5JK4 A;  1I6A A;  1B1X A;  2QS3 A;  3FXR A;  1TXF A;  3GBA A;  3LSX A;  4PP0 A;  1S9T A;  4O3B A;  1Y20 A;  4DIG A;  4GFR A;  3TEP A;  4F2O A;  1II5 A;  1SI1 A;  2DS9 A;  3IB1 A;  5A5X A;  4F31 B;  4Z0I A;  1S50 A;  1Y3N A;  3RT8 A;  1URD A;  2GH9 A;  3OXN A;  4MH5 A;  5EYF A;  5TU0 A;  3L6H A;  3RPW A;  4RNS A;  4BDN A;  1LAF E;  4H67 A;  4U21 A;  1B7U A;  1S7Y A;  3IK6 B;  3Q26 A;  3S9M C;  4R6K A;  3FGS A;  1GV8 A;  1B9J A;  3CG3 A;  1B58 A;  1T0K A;  3C36 A;  1SD3 A;  3IJO B;  5ICT A;  2WKY A;  2H25 A;  4JDF A;  4ELP A;  3CFL A;  3UK4 A;  5KCJ A;  1PDA A;  1YCJ A;  4XKN A;  2NUV A;  5DEX A;  3OO6 A;  5H8H B;  3O9P A;  1B1H A;  3GZG A;  3MP8 A;  2A5T A;  4MBP A;  5H8N A;  2REG A;  1MY4 A;  1LBB A;  4LVQ A;  3MAM A;  2UVG A;  1B2H A;  3D4G A;  3OO8 A;  4HCW A;  4OYV A;  3UGW A;  3PU5 A;  3VVF A;  4G68 C;  3K01 A;  2XXQ A;  3O97 A;  3E9X A;  4LQ2 A;  5ITO A;  1POT A;  4OXV A;  2UYF A;  4HCY A;  4LA9 A;  1B05 A;  1D4N A;  2Z8F A;  3CSG A;  1ZBM A;  5AA2 B;  4Q8R A;  4F3B A;  5I59 B;  2OK2 A;  5TPA B;  1POY 1;  1M5F A;  1IXI A;  2PT2 A;  3H6U A;  4ND9 A;  4KCD A;  1B51 A;  5H8Q A;  1MXU A;  2Q88 A;  1FQC A;  4ISU A;  2RCB A;  3G3J A;  4H5F A;  5DT6 A;  2F7A A;  3KFM A;  4I9D A;  4DXB A;  5AE4 A;  2O68 A;  3RN8 A;  5DYH A;  1Y9U A;  4LUB A;  1N3X A;  3BFU A;  4PFU A;  3MVZ A;  1UTB A;  3QIM A;  5CBS A;  5B70 A;  1O63 A;  1MXY A;  2DE2 A;  2F5X A;  3TKD A;  1NNP A;  2IEE A;  2DVC A;  2ZYM A;  3PUY E;  3U72 A;  5I2K B;  1PEB A;  3R26 A;  5DVI A;  1N04 A;  3Q29 A;  4JWO A;  1OVT A;  2V25 A;  4IO3 A;  1B7H A;  5AA4 B;  4H8I A;  1SW2 A;  5CMB A;  3QYT A;  5H8F A;  4MFI A;  4IO5 A;  5B7D A;  3VVE A;  3QAX A;  1AL3 A;  4OES A;  3Q27 A;  4NED A;  1ZLQ A;  4Q5T A;  3V5A A;  3SDF A;  4ZZE A;  2F7C A;  2RKM A;  3JZJ A;  3F11 A;  4LQ5 A;  4RPN A;  2DE4 A;  1XHY A;  3U1O A;  4EF2 A;  2PX1 A;  2QL3 A;  3FVO A;  4OQO A;  5I57 B;  4RY1 A;  3E13 X;  4H8J A;  3MPK A;  2I58 A;  2OWT A;  2PYY A;  4IO4 A;  3TZA A;  1NNF A;  3H3G A;  1QVS A;  1AMF A;  1PB7 A;  3VLU A;  3VLW A;  3VV5 A;  1Y4T A;  1MPD A;  4YIC A;  1R6Z A;  1JW4 A;  1P1N A;  2P1S A;  4XIG Q;  3RTW B;  2XHD A;  1F9B A;  1ZMG A;  3C4M A;  2ONR A;  1A7L A;  2F7B A;  2CMO A;  1VSO A;  3DLN A;  4POX A;  4ZEI A;  3WAE A;  3T9X B;  3TDJ A;  3IAZ A;  3PMX A;  5H8Q B;  1ZKB A;  4BDM A;  4OHN A;  2R6G E;  1BKA A;  3PPN A;  2ONS A;  1Z7N E;  4FED A;  5F7V A;  2H99 A;  2Q9T A;  5I58 A;  3TTR A;  2XXY A;  1M5E A;  5H8F B;  2ZYN A;  1PC3 A;  3I3V A;  3N94 A;  5ISU A;  1B3E A;  5CRY A;  1D9Y A;  3PGF A;  3IO4 A;  3UIF A;  1B46 A;  2AL4 A;  4EXK A;  1LAG E;  4YKJ A;  1IXH A;  1NH8 A;  4JWX A;  4WXJ A;  1JNF A;  4X9T A;  1XS5 A;  2QRY A;  2Z22 A;  1OQG A;  3FZV A;  2A5T B;  4JWY A;  4UA8 A;  4YB5 A;  1B52 A;  3S2V A;  2Y7P A;  3G3G A;  3MP6 A;  3KJ7 A;  3KZG A;  3IL1 B;  3IOU A;  2XXT A;  3O29 A;  4FEC A;  2Z8E A;  3KSX A;  4H0W A;  4F3G A;  2QSX A;  3ZKL A;  5AA2 D;  5KCJ B;  3KN8 A;  1B7Z A;  1MH3 A;  2B65 A;  2A5S A;  3VDF A;  3PPP A;  3PUX E;  1EZP A;  1M5C A;  2REJ A;  4GL8 A;  2PVU A;  2BJJ X;  2VGQ A;  1PB8 A;  4YZZ A;  2Q2C A;  1GGG A;  3N5L A;  1H76 A;  3MPL A;  1B6H A;  1BP5 A;  1FQD A;  1N7X A;  2X7P A;  2D3I A;  4KYS A;  4R6Y A;  2GFE A;  5BWJ A;  5I59 A;  1CB6 A;  3CRB A;  3N6U A;  4OEN A;  3V89 B;  3QSL A;  3RNN A;  1LST A;  1QUL A;  4DCX A;  4HW8 A;  1OMP A;  2Y84 A;  1WOD A;  2PMS A;  1USY E;  4F29 A;  3K00 A;  3SES A;  1Y1Z A;  4PFW A;  1B5J A;  1TWY A;  4G68 B;  1OIB A;  3UA8 A;  1Y3Q A;  1LFI A;  2HZK A;  2ZNS A;  4JSO A;  1MDQ A;  3C34 A;  3QUF A;  4I1D A;  3L6G A;  1HSE A;  2X7Q A;  1B0H A;  2Q2A A;  2E1S A;  1NKX A;  4OMB A;  3I6V A;  1IXC A;  5TPA A;  1B5H A;  1EZ9 A;  1SDX A;  2DYX A;  1OLC A;  2DWA A;  5FHO A;  4F1U A;  1NFT A;  4XKQ A;  1EH3 A;  2YPN A;  1LAH E;  5ELV A;  1UIV A;  4U1O A;  4U1Z A;  3T93 B;  4EUO A;  1SBP A;  4U4X A;  1LCT A;  3CFZ A;  3DP8 A;  3IB0 A;  1Y3P A;  2ABH A;  1JVY A;  3CVG A;  5H8S A;  3T9V A;  3T22 A;  1A40 A;  3K1N A;  3OSR A;  3TTK A;  4BDQ A;  1MY1 A;  2Z8D A;  2I6E A;  3BKI B;  3PD9 A;  1H43 A;  2DE3 A;  1IIT A;  3K2D A;  1TFA A;  2QJE A;  4X1D A;  4F39 A;  1MH4 A;  1SW1 A;  2QS1 A;  1HSJ A;  3HV1 A;  1ATG A;  1FQE A;  1O64 A;  2I0C A;  2PT1 A;  2O69 A;  2RF1 A;  3EQ1 A;  4DDD A;  1A54 A;  3FJ7 A;  5CC2 A;  3MUQ A;  5I84 A;  3C33 A;  1LFG A;  2H4I A;  1FQF A;  3U92 A;  4GVO A;  4KQP A;  1P1W A;  4BDR A;  1ZTY A;  1IXG A;  5I2K A;  1USY H;  2XD2 A;  3SET A;  3FAT A;  1AH5 A;  2F97 A;  2ZYK A;  4U23 A;  3IJX B;  3EN3 A;  2OCU A;  2OJT A;  2YLN A;  3A3C A;  3IB2 A;  4FJP A;  1XVX A;  3K6U A;  4U2R A;  3C35 A;  3QXM A;  5M2V A;  3VXB A;  2Q8J A;  3TUS A;  1TT1 A;  4BDO A;  4IO2 A;  1DTZ A;  5IAI A;  2F78 A;  3CSB A;  1RYO A;  3LC8 A;  3FVK A;  3KOS A;  2ANJ A;  4GOT A;  4GXS B;  1QKA A;  4DCY A;  1URG A;  5TP9 A;  4EF1 A;  1MS7 A;  2G93 A;  1UTH A;  4F2Q A;  1MXW A;  1MM7 A;  1NNK A;  4QHQ A;  2NVU B;  4JB7 A;  1J1N A;  4F3P A;  2P2A A;  3TQW A;  4NF5 A;  2HFB A;  3JYR A;  3S9E A;  1FQB A;  1ZJL A;  4PFT A;  3OSQ A;  3TFL A;  3HCQ A;  1QW0 A;  1MPC A;  1SQY A;  5KZT A;  4ZS9 A;  2HCA A;  3SEX A;  3VXC A;  2M8C A;  1FTJ A;  1MM6 A;  2UVH A;  3B6Q A;  4IGT A;  4QSD A;  3LR1 A;  5L9M A;  5IKB A;  1P99 A;  3UOR A;  1ELJ A;  2P0S A;  3EHT A;  1P1U A;  2F36 A;  4LZ5 A;  1SI0 A;  3MW0 A;  2DSF A;  3QUJ A;  1OVB A;  3ODB A;  1FTL A;  2IA4 A;  2NOO A;  4LON B;  4RXL A;  4ZEK A;  4R75 A;  5CMK A;  2XD3 A;  4KFQ A;  5FTH A;  2X26 A;  4UAC A;  4TLL B;  1H45 A;  4TQU Q;  4IY6 A;  1YPN A;  3USD A;  4G68 A;  3K6X A;  1N7W A;  4GIZ A;  4Q0C A;  4ZEF A;  1VE4 A;  3H6V A;  3O6H A;  1DPP A;  2VD3 A;  3RLF E;  3OEK A;  1MQI A;  1IIW A;  1MY0 A;  3MVW A;  3O2A A;  3RGY A;  3B6T A;  2XXX A;  1HSL A;  1LB8 A;  2ZMB A;  4JBZ A;  4WED A;  5I58 B;  4KYE A;  2F6P A;  3KBR A;  3PPO A;  3V8X B;  3LSF B;  2HAV A;  3PMW A;  4ZEC A;  4YB7 A;  1I69 A;  3S9L C;  1L5T A;  1H3D A;  4O3C A;  4FAJ A;  2W7Y A;  4NTL A;  1N0T A;  3OO9 A;  3EHU A;  4DLD A;  3R7X A;  4Q30 B;  5JTY A;  5HBC A;  3U8Q A;  3B7D A;  1Y1M A;  4ESW A;  4YB6 A;  4QFO A;  3O6G A;  4WKM A;  3SEY A;  3T96 B;  4DXU A;  4KHZ E;  4QSE A;  3R6U A;  2I4B A;  4AQ4 A;  5I57 A;  3SKP A;  3E3K A;  1I6B A;  4H6D A;  4H65 A;  4GXA A;  1LCF A;  3CR9 A;  2O1M A;  3PUV E;  4MF3 A;  4FOR A;  3C31 A;  2RCA A;  3KN7 A;  4GF8 A;  3TCH A;  1B3H A;  3T9H B;  3HST A;  2YJP A;  2O1L A;  1MXV A;  4NMY A;  4OVJ A;  4YKP A;  1VFE A;  4U4S A;  3K4U A;  3SEW A;  3DP6 A;  3TMG A;  1DTG A;  2H9B A;  4DXC A;  4M1V A;  3W9W A;  5HPQ A;  4I62 A;  3TAJ A;  4QF9 A;  4RK9 A;  1EU8 A;  1JEV A;  2Y7R A;  1US5 A;  4IB2 A;  4ZEB A;  3TTN A;  3LSL A;  4N6P A;  3IX1 A;  3BFT A;  3IOT A;  3Q25 A;  3C32 A;  4C0R A;  3QK6 A;  2XX7 A;  3FJM A;  4C1T A;  3FVN A;  1AOV A;  2HXW A;  3SEU A;  3T9U A;  2V93 A;  1QUJ A;  2O7I A;  5EHM A;  4E0X A;  1FTO A;  1UTB B;  3FV2 A;  3IOV A;  4H5G A;  1WVJ A;  1DOT A;  2THI A;  3PMV A;  4QRZ A;  4TOZ A;  2DWJ A;  4ELO A;  2HAU A;  4G8N A;  5F1Q A;  5FHN A;  5CBR A;  1MQH A;  3C9H A;  2AIX A;  2R71 A;  4BDL A;  2DQV A;  3KEI A;  3PV0 E;  3V83 A;  4YMA A;  2I49 A;  1NL5 A;  1OLA A;  3HN0 A;  4KYD A;  4OFL A;  3CFX A;  4X1B A;  2O84 X;  3OEL A;  1D3K A;  5DTB A;  3OEN A;  1IEJ A;  5I2N A;  1LFH A;  1R1N A;  2QS2 A;  3G3F A;  3FUZ A;  3W15 C;  1URS A;  1IUD A;  1IZ1 A;  1MPB A;  1B4H A;  2ZNU A;  3G3I A;  3MP1 A;  3H6T A;  4FIM A;  5JTY B;  3TTM A;  4QFL A;  4KPT A;  1AIV A;  3B6W A;  3K0V A;  3O66 A;  1MXZ A;  2I0B A;  3K6V A;  3W9V A;  4I8C A;  3HHF A;  2DXY A;  1TFD A;  2FNC A;  2RIN A;  1FCK A;  4NE4 A;  4QFP A;  3LSW A;  2HQ0 A;  4QSC A;  3T66 A;  3TCG A;  2ESN A;  2O6A A;  4HS7 A;  4R74 A;  5DEX B;  1SYH A;  3PD8 A;  4LAT A;  5FHM A;  4ZZA A;  3H6W A;  1OQH A;  4NF6 B;  1LLS A;  4RPO A;  2Q89 A;  3RQT A;  3KJT A;  5BUU A;  1ZIU A;  1JQF A;  4OTE A;  1RKM A;  2FYI A;  4L17 A;  2UVI A;  4OFJ A;  3IOR A;  4F18 A;  3K1P A;  4KD5 A;  1MY2 A;  2RC8 A;  4AB5 A;  4Z7E A;  3FV1 A;  2V3U A;  1LGB C;  5AA2 A;  1Z7M E;  1QUI A;  1N84 A;  2XXV A;  3GXA A;  4R72 A;  2I48 A;  1B32 A;  1SYI A;  3KG2 A;  3OMB A;  4NF4 A;  4PFY A;  3SER A;  4F1V A;  3ILT B;  3ZSF A;  3MJN A;  4LZ7 A;  4XXU A;  5KDT B;  1LAX A;  2H98 A;  3HPI A;  3I5O A;  3Q28 A;  3MBP A;  2F35 A;  1LBC A;  1KWH A;  3TOD A;  2FA7 A;  4MLV A;  3OO7 A;  1FQA A;  3TTL A;  4BLA A;  3JV9 A;  1RYX A;  1SW5 A;  4YAH X;  1B3G A;  2H5Y A;  4ELR A;  5H8N B;  5AA3 A;  5H8H A;  2B3B A;  4OEU A;  2Y7K A;  3DP4 A;  3ONM A;  1B5I A;  3ZS6 A;  4PET A;  1MG1 A;  4G8H A;  4NF5 B;  5I2N B;  4F22 A;  1MRP A;  1PBQ A;  2VHA A;  2F8D A;  4C1U A;  5HM4 B;  2HEU A;  2HZL A;  4EQ9 A;  3LUY A;  1N76 A;  3U94 A;  2Z23 A;  1MQJ A;  2QMX A;  4PQJ A;  4EXL A;  1B0L A;  4G4P A;  4N13 A;  3H06 B;  5CM6 A;  1JET A;  2VOZ A;  3RT6 B;  3M3K A;  5LOM A;  4YKI A;  4OWD A;  3IR1 A;  2XXH A;  2OLB A;  1B3F A;  2D5W A;  2F34 A;  2UVJ A;  4P11 A;  3PPR A;  4RYA A;  5AA1 A;  3O6I A;  3H4Z A;  1GVC A;  2AYS A;  3D4C A;  3FXU A;  5J1D A;  5ICQ A;  1UQW A;  3EHS A;  4P0G A;  4R2B A;  3MQ9 A;  2XXR A;  1NNT A;  3FJG A;  4OER A;  3S4U A;  5I56 A;  1D9V A;  4MLQ A;  2DWH A;  1DPE A;  3BBR A;  1PB9 A;  4IO6 A;  3MVX A;  1US4 A;  2VD2 A;  3EF7 A;  1XT8 A;  4OFO A;  1B3L A;  1FTK A;  4IY5 A;  3ZKK A;  3CG1 A;  4NF8 A;  4YMB A;  3DM0 A;  1NMU A;  2E0S A;  1LB9 A;  4N07 A;  2QPQ A;  2I3W A;  3A09 A;  4ESX A;  3M8U A;  2XX8 A;  1Q1K A;  1O7T A;  1BIY A;  2G29 A;  2Y7I A;  3A3U A;  2OZZ A;  3FAS A;  3ILU B;  3OOA A;  3RUM A;  3FXQ A;  2XXP A;  1QUK A;  2CZL A;  1IQ7 A;  2D21 A;  2GHB A;  2GRV A;  3MZB A;  1JW5 A;  4M4G A;  2OWS A;  3G7W A;  3E4R A;  5AA4 A;  1A99 A;  2DWI A;  3M3L A;  1GR2 A;  4FAT A;  3S9N C;  2AL5 A;  2V3T A;  1I6Q A;  4GQO A;  3K02 A;  5CMC A;  3DEL B;  4R9G A;  2RC9 A;  2I3V A;  2F6G A;  3VLV A;  5JEI A;  1PBP A;  4E0W A;  4NWC A;  4XKP A;  4PE5 B;  3SEV A;  3H03 A;  4FEB A;  5ITP A;  1B40 A;  4DZ1 A;  5L9O A;  5K2X A;  5EHS A;  4JXI A;  4AB6 A;  3THI A;  5K2Y A;  1MDP 1;  4KR5 A;  5DVF A;  2B3F A;  1GTK A;  4GWO A;  3MC2 A;  5FTI A;  2LAO A;  2XXW A;  1XVY A;  3N26 A;  1XOC A;  1QJM A;  3G3K A;  1BTJ A;  1JVX A;  1XC1 A;  2UXA A;  4F3S A;  4RK2 A;  3OD7 A;  4OEV A;  4JSD A;  3P7I A;  2ZXT A;  4G8M A;  1B4Z A;  1FW0 A;  2DXR A;  4GD5 A;  4OET A;  1YTV A;  4LZ8 A;  2NXO A;  1Q35 A;  4TLM B;  5CI5 A;  3O28 A;  4THI A;  1QKB A;  4R9F A;  3AXF A;  1A8E A;  2V3Q A;  3FVG A;  1M5D A;  4KCC A;  4ONY A;  2R9J A;  3H7M A;  4EDP A;  2O7U A;  1H44 A;  2DOJ A;  1A8F A;  2OBG A;  2VP1 A;  4P0I A;  1R9L A;  1MQD A;  3U93 A;  3N6T A;  5DVJ A;  1ZU0 A;  4NF4 B;  1NH7 A;  1SW4 A;  1JEU A;  4G77 A;  1CE2 A;  3FD3 A;  4RA1 A;  3TCF A;  2KLF A;  1A55 A;  3K6W A;  3KN3 A;  3KOT A;  3M3F A;  1UTH B;  4LP2 B;  4O3A A;  3IOW A;  5TP9 B;  4ZE9 A;  3TQL A;  4GRK A;  2V84 A;  4X48 A;  4H1X A;  1Y4C A;  3KGC A;  4ZDM A;  1VFD A;  1FTM A;  3K1M A;  3UP9 A;  3CIJ A;  2ALU A;  3OEM A;  2QS4 A;  3PUW E;  4NF6 A;  4QFN A;  3TYH A;  3VVD A;  4F19 A;  5A5X B;  4U22 A;  4K3F A;  4F1Y A;  1MQG A;  3MVY A;  3HO7 A;  2ONK E;  3KSJ A;  4R2F A;  2Y7W A;  2ZYO A;  1DMB A; 
#chains in the Genus database with same CATH topology
 2V4C A;  2XXU A;  1MY3 A;  3CI8 A;  2DP8 A;  4PBH A;  2DVZ A;  2NWJ A;  5I56 B;  3MZ9 A;  4POW A;  4NHB A;  4O7M A;  3UN6 A;  1WDN A;  4FE8 A;  3G3H A;  1YAE A;  4IGR A;  1P1Q A;  1SVX B;  4ZE8 A;  4MCO A;  4GLI A;  1FBF A;  4OZ9 A;  4YU0 A;  4HTG A;  2ZNT A;  2QS3 A;  3LSX A;  4O3B A;  4GFR A;  1II5 A;  1SI1 A;  2DS9 A;  2GH9 A;  5EYF A;  4PBQ A;  3RPW A;  4RNS A;  1B9J A;  4JDF A;  5H8H B;  5H8N A;  2REG A;  1MY4 A;  4LVQ A;  4HCW A;  3VVF A;  3PU5 A;  5IZ3 A;  1RDX A;  2Z8F A;  5EQ7 A;  4ND9 A;  4KCD A;  1B51 A;  2Q88 A;  1FQC A;  4ISU A;  4EQB A;  4H5F A;  3KFM A;  4I9D A;  4DXB A;  3RN8 A;  5DYH A;  3MVZ A;  1UTB A;  1MXY A;  3TKD A;  2ZYM A;  5DVI A;  1FPK A;  4MFI A;  1AL3 A;  4OES A;  3V5A A;  3B8B A;  3SDF A;  3F11 A;  3U1O A;  4EF2 A;  2PX1 A;  2QL3 A;  2OWT A;  3S9N C;  3H3G A;  1QVS A;  1PB7 A;  4QBA A;  2XHD A;  2ONR A;  4GWU A;  4ZEI A;  1ZKB A;  4GWS A;  4FED A;  2ONS A;  5I58 A;  2H99 A;  1FTA A;  2XXY A;  3I3V A;  3UIF A;  1B46 A;  4JWX A;  1XS5 A;  4GWX A;  2A5T B;  3MP6 A;  3KJ7 A;  3IL1 B;  3O29 A;  2Z8E A;  3VDF A;  3PPP A;  2VGQ A;  4YZZ A;  2Q2C A;  1GGG A;  1H76 A;  3MPL A;  1B6H A;  2D3I A;  2KQZ A;  2GFE A;  4HE1 A;  1CB6 A;  3RPL B;  1QUL A;  4DCX A;  4PAF A;  2Y84 A;  2QVU A;  5IZ3 B;  3SES A;  1TWY A;  4G68 B;  1OIB A;  4JSO A;  1XI6 A;  1MDQ A;  3C34 A;  4XF5 A;  3QUF A;  1HSE A;  2X7Q A;  4G61 A;  3I6V A;  1B5H A;  1SDX A;  2DYX A;  1OLC A;  5FHO A;  4XKQ A;  1LAH E;  1UIV A;  4U1O A;  4U4X A;  5H8S A;  2ABH A;  1NV3 A;  1MY1 A;  2Z8D A;  4GWZ A;  4NAP A;  1NV1 A;  2CEY A;  1FPE A;  3MUQ A;  2H4I A;  3U92 A;  1P1W A;  1IXG A;  2XD2 A;  1AH5 A;  3IJX B;  3EN3 A;  2OCU A;  2OJT A;  2YLN A;  4IO2 A;  1DTZ A;  5IAI A;  3LC8 A;  4GXS B;  1QKA A;  1FPB A;  2NVU B;  4NF5 A;  1ZJL A;  2XXK A;  3HCQ A;  2FIE A;  1NUY A;  5KZT A;  3VXC A;  2UVH A;  4IGT A;  3NOH A;  5IKB A;  1ELJ A;  3EHT A;  4NG7 A;  1FPJ A;  3TEP A;  1NV6 A;  4ZEK A;  4KFQ A;  5FTH A;  1H45 A;  4IY6 A;  1YPN A;  3H6V A;  4IR8 A;  3RGY A;  3B6T A;  2XXX A;  4JBZ A;  4WED A;  4QXD A;  3CHG A;  5I58 B;  2F6P A;  3KBR A;  1K9Y A;  3LSF B;  3PMW A;  1I69 A;  3S9L C;  1L5T A;  1H3D A;  4FAJ A;  2W7Y A;  1N0T A;  3EHU A;  1YXI A;  2ZZW A;  4N15 A;  4QSE A;  4UAB A;  1I6B A;  3CR9 A;  2O1M A;  3KN7 A;  4GF8 A;  4OVJ A;  4YKP A;  2O1L A;  4ZED A;  3SEW A;  4U4S A;  4DXC A;  5I3S A;  4P56 A;  4RK9 A;  1NUZ A;  2WBD A;  4C0R A;  3SEU A;  3T9U A;  4E0X A;  1QUJ A;  2O7I A;  1UTB B;  4H5G A;  3PMV A;  2DWJ A;  4OA4 A;  3V83 A;  4YMA A;  4OFL A;  4KYD A;  1D3K A;  3OEN A;  5I2N A;  3G3F A;  3W15 C;  4GBW A;  2ZNU A;  3TTM A;  4QFL A;  3T66 A;  2HQ0 A;  3TCG A;  2KR0 A;  3BIH A;  4HS7 A;  4R74 A;  3H6W A;  3RQT A;  5IM2 A;  2FYI A;  4OFJ A;  3IOR A;  1MY2 A;  3FV1 A;  2V3U A;  4OVT A;  1N84 A;  4R72 A;  1B32 A;  4PFY A;  4PFR A;  2R8T A;  3S9E A;  3Q28 A;  3MBP A;  3OO7 A;  3TTL A;  3JV9 A;  2PCR A;  4DI4 B;  2CZH A;  4NF5 B;  4G8H A;  4MJO A;  2VHA A;  2F8D A;  1FJ6 A;  4NF0 A;  4PQJ A;  2F34 A;  3H4Z A;  4P0G A;  4NGU A;  2XXR A;  1D9V A;  4MLQ A;  2DWH A;  1DPE A;  3BBR A;  1QGX A;  3EF7 A;  1XT8 A;  1FTK A;  4NF8 A;  1NMU A;  2I3W A;  2Y7I A;  3OOA A;  2OZZ A;  2D21 A;  2CZL A;  1IQ7 A;  2GRV A;  5AA4 A;  1FPI A;  4FAT A;  2PFZ A;  3DEL B;  5CMC A;  2F6G A;  1PBP A;  3H03 A;  1FBH A;  5L9O A;  1INP A;  1MDP 1;  1DK4 A;  4N17 A;  3FXB A;  3P7I A;  4G8M A;  1FW0 A;  4OET A;  1Q35 A;  4GX3 A;  3QMF A;  4R9F A;  1K9Z A;  4EDP A;  2O7U A;  2OBG A;  4P0I A;  1MQD A;  4NF4 B;  1NH7 A;  1JEU A;  1A55 A;  1UTH B;  2ZZX A;  4LP2 B;  3TQL A;  4N4U A;  3K1M A;  4MNC A;  4YMB A;  2ALU A;  3OEM A;  3TYH A;  5A5X B;  5CMM A;  1JW1 A;  3HHG A;  2RC7 A;  1ANF A;  4PAK A;  5L9S A;  3U65 A;  4R73 A;  3RY3 A;  4RJZ A;  1VR5 A;  3RTF B;  1BK4 A;  4ECF A;  4GL0 A;  3TEL A;  4QFK A;  5L8D A;  3PUZ E;  3FIR A;  4N81 A;  1MXX A;  1FPD A;  3MZ1 A;  4R6H A;  5JK4 A;  1I6A A;  3GBA A;  1Y20 A;  4F2O A;  4I40 A;  1IMF A;  2XWK A;  3RPL A;  5TU0 A;  2XWO A;  5IZZ A;  1S7Y A;  3Q26 A;  3FGS A;  1GV8 A;  1SD3 A;  2WKY A;  5KCJ A;  1PDA A;  1LBX A;  4PFB A;  4XKN A;  2QFL A;  3O9P A;  3RYD A;  3GZG A;  1FJ9 A;  3MAM A;  4OYV A;  4G68 C;  3O97 A;  4LQ2 A;  1D4N A;  3CSG A;  5I59 B;  4Q8R A;  2OK2 A;  2PT2 A;  3H6U A;  2P3N A;  2WEF A;  1MXU A;  5AE4 A;  4N8G A;  3QIM A;  5B70 A;  2DE2 A;  2IEE A;  2DVC A;  3PUY E;  3R26 A;  3Q29 A;  4IO3 A;  2CZK A;  1EYJ A;  5LTC A;  4IO5 A;  3VVE A;  3Q27 A;  4NED A;  4Q5T A;  2F7C A;  5I57 B;  3E13 X;  4H8J A;  3MPK A;  2I58 A;  4IO4 A;  1Y4T A;  1MPD A;  2P1S A;  1JW4 A;  4Z7E A;  3WAE A;  2VT5 A;  2R6G E;  1BKA A;  5F7V A;  1Z7N E;  5ET8 A;  3TTR A;  2F3B A;  5EYG A;  1D9Y A;  4EXK A;  2VPN A;  4YKJ A;  1JNF A;  4JWY A;  4YB5 A;  3S2V A;  4F3G A;  3IOU A;  2XXT A;  2QSX A;  3ZKL A;  3KN8 A;  2B65 A;  2A5S A;  1EZP A;  1M5C A;  2PVU A;  2BJJ X;  3N5L A;  1FQD A;  4R6Y A;  5BWJ A;  4KYS A;  5I59 A;  3N6U A;  5EQ9 A;  4N6D A;  1OMP A;  1USY E;  1B5J A;  3L6G A;  1B0H A;  4OMB A;  1IXC A;  5TPA A;  1KZ8 A;  1EZ9 A;  2DWA A;  4F1U A;  2ZZV A;  5ELV A;  4EUO A;  1YZ0 A;  1LCT A;  3CFZ A;  3IB0 A;  3T9V A;  3K1N A;  3BKI B;  2I6E A;  3PD9 A;  3V89 B;  2DE3 A;  5H8F A;  3K2D A;  1MH4 A;  1SW1 A;  1HSJ A;  1FQE A;  2PT1 A;  2I0C A;  4DDD A;  5CC2 A;  3FJ7 A;  5I84 A;  4OVQ A;  1LFG A;  4KQP A;  3FAT A;  2F97 A;  4U23 A;  2WBB A;  5TPA B;  3A3C A;  4FJP A;  4U2R A;  3QXM A;  4GX4 A;  2Q8J A;  4GOT A;  5TP9 A;  2FIX A;  2VPO A;  1MM7 A;  1NNK A;  1J1N A;  4F3P A;  3TQW A;  1FQB A;  3TFL A;  1SQY A;  3SEX A;  1NV2 A;  2M8C A;  3LR1 A;  2P0S A;  2F36 A;  4LZ5 A;  3MW0 A;  2DSF A;  4RXL A;  3ODB A;  5CMK A;  2NOO A;  4O94 A;  2XD3 A;  2X26 A;  4UAC A;  4TLL B;  4PFI A;  4G68 A;  4ZEF A;  1VE4 A;  3RLF E;  1DPP A;  4PDD A;  3OEK A;  1MQI A;  1IIW A;  1HSL A;  4KYE A;  3PPO A;  3V8X B;  2HAV A;  4MHF A;  4NTL A;  4X04 A;  2B4L A;  4DLD A;  5JTY A;  4MNI A;  4ESW A;  4DXU A;  2WYP A;  3O6G A;  4WKM A;  3R6U A;  2I4B A;  1LBZ A;  5I57 A;  5J16 A;  4H65 A;  4GXA A;  4MIJ A;  3T9H B;  3HST A;  2YJP A;  1VFE A;  3DP6 A;  3TMG A;  4M1V A;  4I62 A;  4P3L A;  2Y7R A;  4ZEB A;  4P47 A;  3ROJ A;  4N6P A;  3IX1 A;  3Q25 A;  3C32 A;  3QK6 A;  3FJM A;  4C1T A;  2HXW A;  5EHM A;  2FHY A;  3C9H A;  2DQV A;  2I49 A;  3CFX A;  2O84 X;  2L5V A;  1LFH A;  2QS2 A;  3MP1 A;  3H6T A;  4FIM A;  1AIV A;  4KPT A;  3W9V A;  3HHF A;  2RIN A;  4QSC A;  4N8Y A;  4LAT A;  5FHM A;  1OQH A;  1LLS A;  2Q89 A;  5BUU A;  1ZIU A;  1NUX A;  1JQF A;  2QVR A;  1Z7M E;  2XXV A;  3OMB A;  4NF4 A;  3SER A;  4F1V A;  3ILT B;  3ZSF A;  4XXU A;  5KDT B;  3TOD A;  1FQA A;  1SW5 A;  2H5Y A;  4ELR A;  5H8N B;  5AA3 A;  5H8H A;  4OEU A;  3DP4 A;  4P8B A;  5ET5 A;  2MKZ A;  4OVP A;  2HEU A;  1N76 A;  3U94 A;  2Z23 A;  2F3D A;  2QMX A;  4G4P A;  3MYU A;  4N13 A;  1JET A;  3M3K A;  5ESY A;  3IR1 A;  2UVJ A;  1B3F A;  4RYA A;  1UQW A;  3MQ9 A;  4OER A;  4JVC A;  3E78 A;  1KA1 A;  2WX9 A;  1US4 A;  2VD2 A;  4PF8 A;  1B3L A;  4IY5 A;  3DM0 A;  1LB9 A;  2QPQ A;  4ESX A;  3A09 A;  3MWB A;  3O66 A;  4I8C A;  3M8U A;  1Q1K A;  1O7T A;  3A3U A;  3FAS A;  3ILU B;  5A5L A;  2GHB A;  5EQA A;  3G7W A;  5EYH A;  2DWI A;  1GR2 A;  2AL5 A;  1I6Q A;  4GQO A;  2HPG A;  5JEI A;  4E0W A;  4NWC A;  4XKP A;  4PE5 B;  4FEB A;  4DZ1 A;  5K2X A;  4MEV A;  1IMC A;  5EHS A;  1IME A;  5K2Y A;  4KR5 A;  5DVF A;  3MC2 A;  3N26 A;  1XOC A;  1QJM A;  4GWW A;  3OD7 A;  4OEV A;  4GD5 A;  4TLM B;  5CI5 A;  1YTV A;  3O28 A;  4THI A;  3AXF A;  3FVG A;  1M5D A;  2VP1 A;  1R9L A;  2P3V A;  1LBV A;  5DVJ A;  1SW4 A;  4G77 A;  4RA1 A;  3K6W A;  3M3F A;  1FBP A;  5IGA A;  4O3A A;  3IOW A;  5TP9 B;  3KBZ A;  4X48 A;  1VFD A;  1IMA A;  4K3F A;  3KSJ A;  2ONK E;  4R2F A;  2ZYO A;  2GHA A;  3TPA A;  3LBS A;  3ECR A;  4EQ7 A;  3GBB A;  1DSN A;  4IO7 A;  3WAF A;  2O51 A;  2XX9 A;  4KI0 E;  4XKR A;  4G2Z A;  1R9Q A;  2PBW A;  3GLB A;  2QMW A;  3VE1 B;  1EZO A;  3IO6 A;  2XXI A;  1N3W A;  3FXR A;  1TXF A;  3IB1 A;  4Z0I A;  1Y3N A;  1URD A;  4MH5 A;  3OXN A;  3L6H A;  4BDN A;  4U21 A;  4O8M A;  1B7U A;  3IK6 B;  3S9M C;  3CG3 A;  1B58 A;  1T0K A;  3C36 A;  3IJO B;  3OO6 A;  1B1H A;  3MP8 A;  4MBP A;  2UVG A;  3UGW A;  4H45 A;  3E9X A;  5ITO A;  2UYF A;  4HCY A;  4LA9 A;  5AA2 B;  1ZBM A;  2OWZ A;  1POY 1;  1M5F A;  1IXI A;  2WYK A;  1NV7 A;  2Y5L A;  4PGN A;  5H8Q A;  5DT6 A;  2RCB A;  1NV4 A;  2O68 A;  4PFU A;  1N3X A;  2DDK A;  5CBS A;  1O63 A;  2F5X A;  3FBP A;  4P1E A;  5I2K B;  1B7H A;  5CMB A;  4NN3 A;  2CZI A;  3QAX A;  1ZLQ A;  3JZJ A;  4LQ5 A;  4RY1 A;  1SPI A;  2PYY A;  1NNF A;  3VLW A;  3RTW B;  4YIC A;  2FVZ A;  1P1N A;  4XIG Q;  1F9B A;  1ZMG A;  1A7L A;  2F7B A;  2CMO A;  1VSO A;  3DLN A;  4HXV A;  4POX A;  3T9X B;  3TDJ A;  3IAZ A;  3PMX A;  4BDM A;  4OHN A;  2PFY A;  2ZYN A;  1PC3 A;  5ISU A;  3PGF A;  4PC9 A;  2AL4 A;  1LAG E;  1RDY A;  2QRY A;  1OQG A;  3FZV A;  4XEQ A;  4FEC A;  3KZG A;  4H0W A;  5KCJ B;  5AA2 D;  1PB8 A;  1BP5 A;  5KDT A;  1N7X A;  3CRB A;  3QSL A;  3RNN A;  1WOD A;  5T3J A;  2ZNS A;  1LFI A;  1FSA A;  4P1L A;  2Q2A A;  2E1S A;  1NKX A;  1EH3 A;  2YPN A;  4U1Z A;  1Y3P A;  4HE0 A;  1JVY A;  3OSR A;  3TTK A;  4BDQ A;  4X1D A;  1TFA A;  2QJE A;  3T1B A;  2QS1 A;  5CM6 A;  1KA0 A;  1O64 A;  3EQ1 A;  2O69 A;  3GYY A;  4LN5 A;  2B4M A;  4MAG A;  4BDR A;  5I2K A;  2ZYK A;  1Q9D A;  5M2V A;  3IFA A;  4BDO A;  2F78 A;  3HFU A;  3CSB A;  4N6K A;  1RYO A;  4ELQ A;  3KOS A;  4DCY A;  4EF1 A;  2G93 A;  1UTH A;  1IMB A;  3JYR A;  1QW0 A;  1MPC A;  4ZS9 A;  2HCA A;  1MM6 A;  5L9M A;  3SZP A;  1P99 A;  1P1U A;  3QUJ A;  1FTL A;  4NX1 A;  3K6X A;  1N7W A;  4GIZ A;  2VD3 A;  3MVW A;  3O2A A;  3KC0 A;  2ZMB A;  3D1R A;  4YB7 A;  4MNP A;  4O3C A;  4PDH A;  3OO9 A;  5ET7 A;  3R7X A;  4Q30 B;  5HBC A;  3U8Q A;  1FBD A;  1Y1M A;  3B7D A;  3SEY A;  4KHZ E;  4AQ4 A;  3T0J A;  3SKP A;  3E3K A;  1LCF A;  3PUV E;  4FOR A;  2RCA A;  3TCH A;  3UK4 A;  1MXV A;  1DTG A;  3W9W A;  3TAJ A;  4QF9 A;  1EU8 A;  4IB2 A;  3TTN A;  3LSL A;  3BFT A;  1DBZ A;  2XX7 A;  1FBE A;  5ET6 A;  2V93 A;  1FTO A;  3IOV A;  1WVJ A;  1DOT A;  4QRZ A;  3LUZ A;  2HAU A;  4G8N A;  5F1Q A;  5CBR A;  1MQH A;  4JVD A;  3KEI A;  3PV0 E;  1NL5 A;  1OLA A;  3HN0 A;  4X1B A;  3OEL A;  1FPG A;  4OVR A;  1URS A;  1B4H A;  3G3I A;  1LBW A;  3K0V A;  3K6V A;  2XA5 A;  1LEV A;  4QFP A;  3LSW A;  2ESN A;  1SYH A;  3PD8 A;  4NQ8 A;  4NF6 B;  4RPO A;  3KJT A;  4OTE A;  1RKM A;  4L17 A;  2UVI A;  2RC8 A;  4AB5 A;  1YYZ A;  1QUI A;  3GXA A;  3KG2 A;  3MJN A;  2H98 A;  3I5O A;  1RYX A;  1B3G A;  4N91 A;  2B3B A;  3ONM A;  1B5I A;  1MG1 A;  5I2N B;  1PBQ A;  4C1U A;  5HM4 B;  1MQJ A;  4EXL A;  1FPF A;  2VOZ A;  3RT6 B;  4YKI A;  4OWD A;  2XXH A;  2OLB A;  4P11 A;  3EKI A;  2AYS A;  3FXU A;  4R2B A;  3S4U A;  1NNT A;  3FJG A;  5I56 A;  1PB9 A;  3MVX A;  3ZKK A;  1DCU A;  1EYK A;  2E0S A;  4N07 A;  3ISP A;  2XX8 A;  4ZE9 A;  1BIY A;  3FXQ A;  4P9K A;  3M3L A;  2V3T A;  3K02 A;  2I3V A;  4PF6 A;  2BJI A;  3VLV A;  5ITP A;  4JXI A;  3THI A;  2B3F A;  3G3K A;  1XC1 A;  2UXA A;  4F3S A;  4AS4 A;  4RK2 A;  4JSD A;  1B4Z A;  2DXR A;  4LZ8 A;  1NV5 A;  5DW8 A;  2V3Q A;  4ONY A;  4KCC A;  4OVS A;  2R9J A;  3H7M A;  1H44 A;  2DOJ A;  1D9Q A;  1ZU0 A;  3FD3 A;  4PGP A;  4H46 A;  2KLF A;  4GRK A;  2V84 A;  1Y4C A;  3KGC A;  3UP9 A;  1FTM A;  3CIJ A;  3VVD A;  2QS4 A;  4QFN A;  4U22 A;  4F1Y A;  1MQG A;  1DMB A;  1P1O A;  2I4C A;  4XTC Q;  4DE8 A;  4PE3 A;  3EPE A;  4WEP A;  2UYE A;  1AWB A;  1M5B A;  3PPQ A;  4KXP A;  1VDW A;  1UIU A;  1BLF A;  4NWD A;  3VFJ A;  4NF8 B;  4YKK A;  1B1X A;  4PP0 A;  1FBG A;  4PAI A;  1S9T A;  4DIG A;  5A5X A;  4F31 B;  2HXR A;  1S50 A;  3RT8 A;  1LAF E;  4H67 A;  4I3Y A;  4GBV A;  5F24 A;  4R6K A;  5ICT A;  2H25 A;  4ELP A;  3CFL A;  1YCJ A;  5DEX A;  2NUV A;  3E79 A;  2A5T A;  4GWY A;  1LBB A;  1B2H A;  3D4G A;  3OO8 A;  4I3E A;  1LBY A;  2XXQ A;  3K01 A;  1POT A;  4OXV A;  2Y5K A;  1B05 A;  4F3B A;  5LDZ A;  5FBP A;  3G3J A;  4JVI A;  2F7A A;  1Y9U A;  4LUB A;  3BFU A;  1NNP A;  3U72 A;  1PEB A;  1N04 A;  4X8R A;  4JWO A;  1OVT A;  2V25 A;  5AA4 B;  4H8I A;  1SW2 A;  3QYT A;  5B7D A;  3LV0 A;  4ZZE A;  2Q74 A;  2RKM A;  4RPN A;  2DE4 A;  1XHY A;  4OQO A;  3FVO A;  5IZ1 A;  3VLU A;  3TZA A;  1AMF A;  3VV5 A;  1R6Z A;  4MX6 A;  3C4M A;  1NUW A;  4AS5 A;  5H8Q B;  4FBP A;  3KC1 A;  3PPN A;  2Q9T A;  1M5E A;  5H8F B;  3N94 A;  1B3E A;  5CRY A;  3IO4 A;  4MMP A;  1IXH A;  1NH8 A;  4WXJ A;  4X9T A;  2Z22 A;  1NV0 A;  4UA8 A;  1B52 A;  1FRP A;  2Y7P A;  3G3G A;  1FBC A;  5AA1 A;  3KSX A;  5EQ8 A;  1B7Z A;  1MH3 A;  3PUX E;  2REJ A;  4GL8 A;  2CEX A;  1EYI A;  2X7P A;  4O7I A;  4OEN A;  1LST A;  4HW8 A;  2PMS A;  4F29 A;  3K00 A;  1Y1Z A;  4PFW A;  3UA8 A;  1Y3Q A;  2Q8M A;  2HZK A;  4I1D A;  1NFT A;  2JJK A;  3T93 B;  1SBP A;  3DP8 A;  3CVG A;  3T22 A;  1A40 A;  4ELO A;  1H43 A;  4F39 A;  1IIT A;  3HV1 A;  1ATG A;  2RF1 A;  1A54 A;  3C33 A;  1FQF A;  4GVO A;  1ZTY A;  1USY H;  3SET A;  3IB2 A;  1XVX A;  3K6U A;  3C35 A;  3VXB A;  3TUS A;  1TT1 A;  3FVK A;  3MST A;  2ANJ A;  1URG A;  1MS7 A;  4F2Q A;  1MXW A;  4QHQ A;  4JB7 A;  2P2A A;  4PTK A;  2HFB A;  4PFT A;  3OSQ A;  1FTJ A;  4QSD A;  3B6Q A;  3UOR A;  1SI0 A;  4LON B;  1OVB A;  2IA4 A;  4R75 A;  4TQU Q;  3USD A;  4Q0C A;  3O6H A;  2GQ1 A;  1MY0 A;  4PCD A;  1LB8 A;  4ZEC A;  1G0I A;  2QVV A;  4YB6 A;  2FBP A;  4QFO A;  3T96 B;  4H6D A;  4MF3 A;  3C31 A;  1B3H A;  4NMY A;  3K4U A;  1JP4 A;  5HPQ A;  2H9B A;  1JEV A;  1US5 A;  3IOT A;  3FVN A;  1AOV A;  3FV2 A;  4TOZ A;  2THI A;  5FHN A;  2AIX A;  2R71 A;  4BDL A;  5DTB A;  4HE2 A;  1IEJ A;  1R1N A;  3FUZ A;  1IUD A;  5JTY B;  1IZ1 A;  1MPB A;  3B6W A;  1MXZ A;  2I0B A;  2DXY A;  1TFD A;  2FNC A;  4NE4 A;  1FCK A;  3U93 A;  3PTY A;  2O6A A;  5DEX B;  4ZZA A;  2HHM A;  4F18 A;  3K1P A;  4KD5 A;  1LGB C;  5AA2 A;  1IMD A;  2I48 A;  1SYI A;  4LZ7 A;  1LAX A;  3HPI A;  2F35 A;  1LBC A;  1KWH A;  2FA7 A;  4MLV A;  4BLA A;  4YAH X;  3ZS6 A;  2Y7K A;  4PET A;  4F22 A;  1MRP A;  2HZL A;  4EQ9 A;  3LUY A;  3A29 A;  1B0L A;  3H06 B;  5LOM A;  4DI3 D;  2D5W A;  3PPR A;  3O6I A;  1GVC A;  3D4C A;  5J1D A;  5ICQ A;  2OX3 A;  3EHS A;  4IO6 A;  4OFO A;  3CG1 A;  1CNQ A;  4GX6 A;  2G29 A;  3RUM A;  3B50 A;  2XXP A;  1QUK A;  3BIG A;  3MZB A;  1JW5 A;  4M4G A;  2OWS A;  3E4R A;  1A99 A;  4R9G A;  2RC9 A;  3SEV A;  1B40 A;  4AB6 A;  1GTK A;  4GWO A;  5FTI A;  5I5P A;  2LAO A;  2XXW A;  1NI9 A;  1XVY A;  2XWV A;  1BTJ A;  1JVX A;  2ZXT A;  1G0H A;  2XWI A;  2NXO A;  1QKB A;  1A8E A;  5I7I A;  1A8F A;  4XFE A;  3N6T A;  1RDZ A;  1CE2 A;  1FPL A;  3TCF A;  3KN3 A;  3KOT A;  3IFC A;  4H1X A;  4OAN A;  4ZDM A;  4NF6 A;  3PUW E;  4F19 A;  3MVY A;  3HO7 A;  2Y7W A; 
#chains in the Genus database with same CATH homology
 1P1O A;  1JW1 A;  2I4C A;  2XXU A;  1MY3 A;  2GHA A;  5CMM A;  3CI8 A;  3TPA A;  4XTC Q;  2DP8 A;  2DVZ A;  2NWJ A;  3HHG A;  3ECR A;  2RC7 A;  3LBS A;  4DE8 A;  1ANF A;  4EQB A;  3MZ9 A;  3GBB A;  4POW A;  4EQ7 A;  3EPE A;  5I56 B;  5L9S A;  4R73 A;  1DSN A;  4IO7 A;  1WDN A;  4WEP A;  3RY3 A;  3UN6 A;  4FE8 A;  3WAF A;  5KDT A;  2UYE A;  2O51 A;  3G3H A;  2XX9 A;  4KI0 E;  4RJZ A;  1VR5 A;  4XKR A;  3RTF B;  1M5B A;  4G2Z A;  3PPQ A;  1YAE A;  4IGR A;  1P1Q A;  1SVX B;  4ECF A;  4GL0 A;  1R9Q A;  3TEL A;  4ZE8 A;  2PBW A;  4ELQ A;  4QFK A;  5L8D A;  1UIU A;  3GLB A;  3PUZ E;  4GLI A;  4OZ9 A;  3FIR A;  1BLF A;  4NWD A;  2QMW A;  3VE1 B;  3VFJ A;  1EZO A;  1MXX A;  4NF8 B;  4YU0 A;  3IO6 A;  3MWB A;  4YKK A;  2XXI A;  4HTG A;  1N3W A;  3MZ1 A;  4R6H A;  2ZNT A;  4ZED A;  5JK4 A;  1I6A A;  1B1X A;  2QS3 A;  3FXR A;  1TXF A;  3GBA A;  3LSX A;  4PP0 A;  1S9T A;  4O3B A;  1Y20 A;  4DIG A;  4GFR A;  3TEP A;  4F2O A;  1II5 A;  1SI1 A;  2DS9 A;  3IB1 A;  5A5X A;  4F31 B;  4Z0I A;  1S50 A;  1Y3N A;  3RT8 A;  1URD A;  2GH9 A;  3OXN A;  4MH5 A;  5EYF A;  5TU0 A;  3L6H A;  3RPW A;  4RNS A;  4BDN A;  1LAF E;  4H67 A;  4U21 A;  1B7U A;  1S7Y A;  3IK6 B;  3Q26 A;  3S9M C;  4R6K A;  3FGS A;  1GV8 A;  1B9J A;  3CG3 A;  1B58 A;  1T0K A;  3C36 A;  1SD3 A;  3IJO B;  5ICT A;  2WKY A;  2H25 A;  4JDF A;  4ELP A;  3CFL A;  3UK4 A;  5KCJ A;  1PDA A;  1YCJ A;  4XKN A;  2NUV A;  5DEX A;  3OO6 A;  5H8H B;  3O9P A;  1B1H A;  3GZG A;  3MP8 A;  2A5T A;  4MBP A;  5H8N A;  2REG A;  1MY4 A;  1LBB A;  4LVQ A;  3MAM A;  2UVG A;  1B2H A;  3D4G A;  3OO8 A;  4HCW A;  4OYV A;  3UGW A;  3PU5 A;  3VVF A;  4G68 C;  3K01 A;  2XXQ A;  3O97 A;  3E9X A;  4LQ2 A;  5ITO A;  1POT A;  4OXV A;  2UYF A;  4HCY A;  4LA9 A;  1B05 A;  1D4N A;  2Z8F A;  3CSG A;  1ZBM A;  5AA2 B;  4Q8R A;  4F3B A;  5I59 B;  2OK2 A;  5TPA B;  1POY 1;  1M5F A;  1IXI A;  2PT2 A;  3H6U A;  4ND9 A;  4KCD A;  1B51 A;  5H8Q A;  1MXU A;  2Q88 A;  1FQC A;  4ISU A;  2RCB A;  3G3J A;  4H5F A;  5DT6 A;  2F7A A;  3KFM A;  4I9D A;  4DXB A;  5AE4 A;  2O68 A;  3RN8 A;  5DYH A;  1Y9U A;  4LUB A;  1N3X A;  3BFU A;  4PFU A;  3MVZ A;  1UTB A;  3QIM A;  5CBS A;  5B70 A;  1O63 A;  1MXY A;  2DE2 A;  2F5X A;  3TKD A;  1NNP A;  2IEE A;  2DVC A;  2ZYM A;  3PUY E;  3U72 A;  5I2K B;  1PEB A;  3R26 A;  5DVI A;  1N04 A;  3Q29 A;  4JWO A;  1OVT A;  2V25 A;  4IO3 A;  1B7H A;  5AA4 B;  4H8I A;  1SW2 A;  5CMB A;  3QYT A;  5H8F A;  4MFI A;  4IO5 A;  5B7D A;  3VVE A;  3QAX A;  1AL3 A;  4OES A;  3Q27 A;  4NED A;  1ZLQ A;  4Q5T A;  3V5A A;  3SDF A;  4ZZE A;  2F7C A;  2RKM A;  3JZJ A;  3F11 A;  4LQ5 A;  4RPN A;  2DE4 A;  1XHY A;  3U1O A;  4EF2 A;  2PX1 A;  2QL3 A;  3FVO A;  4OQO A;  5I57 B;  4RY1 A;  3E13 X;  4H8J A;  3MPK A;  2I58 A;  2OWT A;  2PYY A;  4IO4 A;  3TZA A;  1NNF A;  3H3G A;  1QVS A;  1AMF A;  1PB7 A;  3VLU A;  3VLW A;  3VV5 A;  1Y4T A;  1MPD A;  4YIC A;  1R6Z A;  1JW4 A;  1P1N A;  2P1S A;  4XIG Q;  3RTW B;  2XHD A;  1F9B A;  1ZMG A;  3C4M A;  2ONR A;  1A7L A;  2F7B A;  2CMO A;  1VSO A;  3DLN A;  4POX A;  4ZEI A;  3WAE A;  3T9X B;  3TDJ A;  3IAZ A;  3PMX A;  5H8Q B;  1ZKB A;  4BDM A;  4OHN A;  2R6G E;  1BKA A;  3PPN A;  2ONS A;  1Z7N E;  4FED A;  5F7V A;  2H99 A;  2Q9T A;  5I58 A;  3TTR A;  2XXY A;  1M5E A;  5H8F B;  2ZYN A;  1PC3 A;  3I3V A;  3N94 A;  5ISU A;  1B3E A;  5CRY A;  1D9Y A;  3PGF A;  3IO4 A;  3UIF A;  1B46 A;  2AL4 A;  4EXK A;  1LAG E;  4YKJ A;  1IXH A;  1NH8 A;  4JWX A;  4WXJ A;  1JNF A;  4X9T A;  1XS5 A;  2QRY A;  2Z22 A;  1OQG A;  3FZV A;  2A5T B;  4JWY A;  4UA8 A;  4YB5 A;  1B52 A;  3S2V A;  2Y7P A;  3G3G A;  3MP6 A;  3KJ7 A;  3KZG A;  3IL1 B;  3IOU A;  2XXT A;  3O29 A;  4FEC A;  2Z8E A;  3KSX A;  4H0W A;  4F3G A;  2QSX A;  3ZKL A;  5AA2 D;  5KCJ B;  3KN8 A;  1B7Z A;  1MH3 A;  2B65 A;  2A5S A;  3VDF A;  3PPP A;  3PUX E;  1EZP A;  1M5C A;  2REJ A;  4GL8 A;  2PVU A;  2BJJ X;  2VGQ A;  1PB8 A;  4YZZ A;  2Q2C A;  1GGG A;  3N5L A;  1H76 A;  3MPL A;  1B6H A;  1BP5 A;  1FQD A;  1N7X A;  2X7P A;  2D3I A;  4KYS A;  4R6Y A;  2GFE A;  5BWJ A;  5I59 A;  1CB6 A;  3CRB A;  3N6U A;  4OEN A;  3V89 B;  3QSL A;  3RNN A;  1LST A;  1QUL A;  4DCX A;  4HW8 A;  1OMP A;  2Y84 A;  1WOD A;  2PMS A;  1USY E;  4F29 A;  3K00 A;  3SES A;  1Y1Z A;  4PFW A;  1B5J A;  1TWY A;  4G68 B;  1OIB A;  3UA8 A;  1Y3Q A;  1LFI A;  2HZK A;  2ZNS A;  4JSO A;  1MDQ A;  3C34 A;  3QUF A;  4I1D A;  3L6G A;  1HSE A;  2X7Q A;  1B0H A;  2Q2A A;  2E1S A;  1NKX A;  4OMB A;  3I6V A;  1IXC A;  5TPA A;  1B5H A;  1EZ9 A;  1SDX A;  2DYX A;  1OLC A;  2DWA A;  5FHO A;  4F1U A;  1NFT A;  4XKQ A;  1EH3 A;  2YPN A;  1LAH E;  5ELV A;  1UIV A;  4U1O A;  4U1Z A;  3T93 B;  4EUO A;  1SBP A;  4U4X A;  1LCT A;  3CFZ A;  3DP8 A;  3IB0 A;  1Y3P A;  2ABH A;  1JVY A;  3CVG A;  5H8S A;  3T9V A;  3T22 A;  1A40 A;  3K1N A;  3OSR A;  3TTK A;  4BDQ A;  1MY1 A;  2Z8D A;  2I6E A;  3BKI B;  3PD9 A;  1H43 A;  2DE3 A;  1IIT A;  3K2D A;  1TFA A;  2QJE A;  4X1D A;  4F39 A;  1MH4 A;  1SW1 A;  2QS1 A;  1HSJ A;  3HV1 A;  1ATG A;  1FQE A;  1O64 A;  2I0C A;  2PT1 A;  2O69 A;  2RF1 A;  3EQ1 A;  4DDD A;  1A54 A;  3FJ7 A;  5CC2 A;  3MUQ A;  5I84 A;  3C33 A;  1LFG A;  2H4I A;  1FQF A;  3U92 A;  4GVO A;  4KQP A;  1P1W A;  4BDR A;  1ZTY A;  1IXG A;  5I2K A;  1USY H;  2XD2 A;  3SET A;  3FAT A;  1AH5 A;  2F97 A;  2ZYK A;  4U23 A;  3IJX B;  3EN3 A;  2OCU A;  2OJT A;  2YLN A;  3A3C A;  3IB2 A;  4FJP A;  1XVX A;  3K6U A;  4U2R A;  3C35 A;  3QXM A;  5M2V A;  3VXB A;  2Q8J A;  3TUS A;  1TT1 A;  4BDO A;  4IO2 A;  1DTZ A;  5IAI A;  2F78 A;  3CSB A;  1RYO A;  3LC8 A;  3FVK A;  3KOS A;  2ANJ A;  4GOT A;  4GXS B;  1QKA A;  4DCY A;  1URG A;  5TP9 A;  4EF1 A;  1MS7 A;  2G93 A;  1UTH A;  4F2Q A;  1MXW A;  1MM7 A;  1NNK A;  4QHQ A;  2NVU B;  4JB7 A;  1J1N A;  4F3P A;  2P2A A;  3TQW A;  4NF5 A;  2HFB A;  3JYR A;  3S9E A;  1FQB A;  1ZJL A;  4PFT A;  3OSQ A;  3TFL A;  3HCQ A;  1QW0 A;  1MPC A;  1SQY A;  5KZT A;  4ZS9 A;  2HCA A;  3SEX A;  3VXC A;  2M8C A;  1FTJ A;  1MM6 A;  2UVH A;  3B6Q A;  4IGT A;  4QSD A;  3LR1 A;  5L9M A;  5IKB A;  1P99 A;  3UOR A;  1ELJ A;  2P0S A;  3EHT A;  1P1U A;  2F36 A;  4LZ5 A;  1SI0 A;  3MW0 A;  2DSF A;  3QUJ A;  1OVB A;  3ODB A;  1FTL A;  2IA4 A;  2NOO A;  4LON B;  4RXL A;  4ZEK A;  4R75 A;  5CMK A;  2XD3 A;  4KFQ A;  5FTH A;  2X26 A;  4UAC A;  4TLL B;  1H45 A;  4TQU Q;  4IY6 A;  1YPN A;  3USD A;  4G68 A;  3K6X A;  1N7W A;  4GIZ A;  4Q0C A;  4ZEF A;  1VE4 A;  3H6V A;  3O6H A;  1DPP A;  2VD3 A;  3RLF E;  3OEK A;  1MQI A;  1IIW A;  1MY0 A;  3MVW A;  3O2A A;  3RGY A;  3B6T A;  2XXX A;  1HSL A;  1LB8 A;  2ZMB A;  4JBZ A;  4WED A;  5I58 B;  4KYE A;  2F6P A;  3KBR A;  3PPO A;  3V8X B;  3LSF B;  2HAV A;  3PMW A;  4ZEC A;  4YB7 A;  1I69 A;  3S9L C;  1L5T A;  1H3D A;  4O3C A;  4FAJ A;  2W7Y A;  4NTL A;  1N0T A;  3OO9 A;  3EHU A;  4DLD A;  3R7X A;  4Q30 B;  5JTY A;  5HBC A;  3U8Q A;  3B7D A;  1Y1M A;  4ESW A;  4YB6 A;  4QFO A;  3O6G A;  4WKM A;  3SEY A;  3T96 B;  4DXU A;  4KHZ E;  4QSE A;  3R6U A;  2I4B A;  4AQ4 A;  5I57 A;  3SKP A;  3E3K A;  1I6B A;  4H6D A;  4H65 A;  4GXA A;  1LCF A;  3CR9 A;  2O1M A;  3PUV E;  4MF3 A;  4FOR A;  3C31 A;  2RCA A;  3KN7 A;  4GF8 A;  3TCH A;  1B3H A;  3T9H B;  3HST A;  2YJP A;  2O1L A;  1MXV A;  4NMY A;  4OVJ A;  4YKP A;  1VFE A;  4U4S A;  3K4U A;  3SEW A;  3DP6 A;  3TMG A;  1DTG A;  2H9B A;  4DXC A;  4M1V A;  3W9W A;  5HPQ A;  4I62 A;  3TAJ A;  4QF9 A;  4RK9 A;  1EU8 A;  1JEV A;  2Y7R A;  1US5 A;  4IB2 A;  4ZEB A;  3TTN A;  3LSL A;  4N6P A;  3IX1 A;  3BFT A;  3IOT A;  3Q25 A;  3C32 A;  4C0R A;  3QK6 A;  2XX7 A;  3FJM A;  4C1T A;  3FVN A;  1AOV A;  2HXW A;  3SEU A;  3T9U A;  2V93 A;  1QUJ A;  2O7I A;  5EHM A;  4E0X A;  1FTO A;  1UTB B;  3FV2 A;  3IOV A;  4H5G A;  1WVJ A;  1DOT A;  2THI A;  3PMV A;  4QRZ A;  4TOZ A;  2DWJ A;  4ELO A;  2HAU A;  4G8N A;  5F1Q A;  5FHN A;  5CBR A;  1MQH A;  3C9H A;  2AIX A;  2R71 A;  4BDL A;  2DQV A;  3KEI A;  3PV0 E;  3V83 A;  4YMA A;  2I49 A;  1NL5 A;  1OLA A;  3HN0 A;  4KYD A;  4OFL A;  3CFX A;  4X1B A;  2O84 X;  3OEL A;  1D3K A;  5DTB A;  3OEN A;  1IEJ A;  5I2N A;  1LFH A;  1R1N A;  2QS2 A;  3G3F A;  3FUZ A;  3W15 C;  1URS A;  1IUD A;  1IZ1 A;  1MPB A;  1B4H A;  2ZNU A;  3G3I A;  3MP1 A;  3H6T A;  4FIM A;  5JTY B;  3TTM A;  4QFL A;  4KPT A;  1AIV A;  3B6W A;  3K0V A;  3O66 A;  1MXZ A;  2I0B A;  3K6V A;  3W9V A;  4I8C A;  3HHF A;  2DXY A;  1TFD A;  2FNC A;  2RIN A;  1FCK A;  4NE4 A;  4QFP A;  3LSW A;  2HQ0 A;  4QSC A;  3T66 A;  3TCG A;  2ESN A;  2O6A A;  4HS7 A;  4R74 A;  5DEX B;  1SYH A;  3PD8 A;  4LAT A;  5FHM A;  4ZZA A;  3H6W A;  1OQH A;  4NF6 B;  1LLS A;  4RPO A;  2Q89 A;  3RQT A;  3KJT A;  5BUU A;  1ZIU A;  1JQF A;  4OTE A;  1RKM A;  2FYI A;  4L17 A;  2UVI A;  4OFJ A;  3IOR A;  4F18 A;  3K1P A;  4KD5 A;  1MY2 A;  2RC8 A;  4AB5 A;  4Z7E A;  3FV1 A;  2V3U A;  1LGB C;  5AA2 A;  1Z7M E;  1QUI A;  1N84 A;  2XXV A;  3GXA A;  4R72 A;  2I48 A;  1B32 A;  1SYI A;  3KG2 A;  3OMB A;  4NF4 A;  4PFY A;  3SER A;  4F1V A;  3ILT B;  3ZSF A;  3MJN A;  4LZ7 A;  4XXU A;  5KDT B;  1LAX A;  2H98 A;  3HPI A;  3I5O A;  3Q28 A;  3MBP A;  2F35 A;  1LBC A;  1KWH A;  3TOD A;  2FA7 A;  4MLV A;  3OO7 A;  1FQA A;  3TTL A;  4BLA A;  3JV9 A;  1RYX A;  1SW5 A;  4YAH X;  1B3G A;  2H5Y A;  4ELR A;  5H8N B;  5AA3 A;  5H8H A;  2B3B A;  4OEU A;  2Y7K A;  3DP4 A;  3ONM A;  1B5I A;  3ZS6 A;  4PET A;  1MG1 A;  4G8H A;  4NF5 B;  5I2N B;  4F22 A;  1MRP A;  1PBQ A;  2VHA A;  2F8D A;  4C1U A;  5HM4 B;  2HEU A;  2HZL A;  4EQ9 A;  3LUY A;  1N76 A;  3U94 A;  2Z23 A;  1MQJ A;  2QMX A;  4PQJ A;  4EXL A;  1B0L A;  4G4P A;  4N13 A;  3H06 B;  5CM6 A;  1JET A;  2VOZ A;  3RT6 B;  3M3K A;  5LOM A;  4YKI A;  4OWD A;  3IR1 A;  2XXH A;  2OLB A;  1B3F A;  2D5W A;  2F34 A;  2UVJ A;  4P11 A;  3PPR A;  4RYA A;  5AA1 A;  3O6I A;  3H4Z A;  1GVC A;  2AYS A;  3D4C A;  3FXU A;  5J1D A;  5ICQ A;  1UQW A;  3EHS A;  4P0G A;  4R2B A;  3MQ9 A;  2XXR A;  1NNT A;  3FJG A;  4OER A;  3S4U A;  5I56 A;  1D9V A;  4MLQ A;  2DWH A;  1DPE A;  3BBR A;  1PB9 A;  4IO6 A;  3MVX A;  1US4 A;  2VD2 A;  3EF7 A;  1XT8 A;  4OFO A;  1B3L A;  1FTK A;  4IY5 A;  3ZKK A;  3CG1 A;  4NF8 A;  4YMB A;  3DM0 A;  1NMU A;  2E0S A;  1LB9 A;  4N07 A;  2QPQ A;  2I3W A;  3A09 A;  4ESX A;  3M8U A;  2XX8 A;  1Q1K A;  1O7T A;  1BIY A;  2G29 A;  2Y7I A;  3A3U A;  2OZZ A;  3FAS A;  3ILU B;  3OOA A;  3RUM A;  3FXQ A;  2XXP A;  1QUK A;  2CZL A;  1IQ7 A;  2D21 A;  2GHB A;  2GRV A;  3MZB A;  1JW5 A;  4M4G A;  2OWS A;  3G7W A;  3E4R A;  5AA4 A;  1A99 A;  2DWI A;  3M3L A;  1GR2 A;  4FAT A;  3S9N C;  2AL5 A;  2V3T A;  1I6Q A;  4GQO A;  3K02 A;  5CMC A;  3DEL B;  4R9G A;  2RC9 A;  2I3V A;  2F6G A;  3VLV A;  5JEI A;  1PBP A;  4E0W A;  4NWC A;  4XKP A;  4PE5 B;  3SEV A;  3H03 A;  4FEB A;  5ITP A;  1B40 A;  4DZ1 A;  5L9O A;  5K2X A;  5EHS A;  4JXI A;  4AB6 A;  3THI A;  5K2Y A;  1MDP 1;  4KR5 A;  5DVF A;  2B3F A;  1GTK A;  4GWO A;  3MC2 A;  5FTI A;  2LAO A;  2XXW A;  1XVY A;  3N26 A;  1XOC A;  1QJM A;  3G3K A;  1BTJ A;  1JVX A;  1XC1 A;  2UXA A;  4F3S A;  4RK2 A;  3OD7 A;  4OEV A;  4JSD A;  3P7I A;  2ZXT A;  4G8M A;  1B4Z A;  1FW0 A;  2DXR A;  4GD5 A;  4OET A;  1YTV A;  4LZ8 A;  2NXO A;  1Q35 A;  4TLM B;  5CI5 A;  3O28 A;  4THI A;  1QKB A;  4R9F A;  3AXF A;  1A8E A;  2V3Q A;  3FVG A;  1M5D A;  4KCC A;  4ONY A;  2R9J A;  3H7M A;  4EDP A;  2O7U A;  1H44 A;  2DOJ A;  1A8F A;  2OBG A;  2VP1 A;  4P0I A;  1R9L A;  1MQD A;  3U93 A;  3N6T A;  5DVJ A;  1ZU0 A;  4NF4 B;  1NH7 A;  1SW4 A;  1JEU A;  4G77 A;  1CE2 A;  3FD3 A;  4RA1 A;  3TCF A;  2KLF A;  1A55 A;  3K6W A;  3KN3 A;  3KOT A;  3M3F A;  1UTH B;  4LP2 B;  4O3A A;  3IOW A;  5TP9 B;  4ZE9 A;  3TQL A;  4GRK A;  2V84 A;  4X48 A;  4H1X A;  1Y4C A;  3KGC A;  4ZDM A;  1VFD A;  1FTM A;  3K1M A;  3UP9 A;  3CIJ A;  2ALU A;  3OEM A;  2QS4 A;  3PUW E;  4NF6 A;  4QFN A;  3TYH A;  3VVD A;  4F19 A;  5A5X B;  4U22 A;  4K3F A;  4F1Y A;  1MQG A;  3MVY A;  3HO7 A;  2ONK E;  3KSJ A;  4R2F A;  2Y7W A;  2ZYO A;  1DMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...