3SEYA

Zn-mediated polymer of maltose-binding protein a216h/k220h by synthetic symmetrization (form ii)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
371
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
total genus 124
structure length 371
sequence length 371
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3seyA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3seyA01
4JSDA 2O51A 1I6QA 5CI5A 2REGA 1LFGA 3HHGA 3MZ9A 1DTZA 3K2DA 2V84A 1ZKBA 3K0VA 5KCJA 5KCJB 3U93A 4X1DA 1NFTA 1SDXA 1OQGA 1MDQA 2F7BA 4GFRA 3K6WA 1VE4A 5K2XA 4U1OA 2F7AA 1II5A 3E9XA 3IO6A 2THIA 2H98A 3THIA 2RC9A 2NVUB 2YPNA 1OQHA 2D3IA 4G8MA 2E1SA 3RT8A 3FVOA 2O69A 4LONB 3FXQA 4TOZA 1XHYA 2B3BA 5I59A 5I59B 4G8HA 1QVSA 3C4MA 1MG1A 3CSGA 4EQ9A 1F9BA 2QMXA 4OFOA 4THIA 4KYSA 4KI0E 2I49A 3TFLA 4ISUA 1MQIA 4R6KA 3T96B 2CMOA 1Z7ME 4BDOA 1CE2A 3RLFE 1EZ9A 3VVDA 4R6HA 4F31B 3BFTA 4GWOA 4KD5A 4EQ7A 2XHDA 4FATA 2F36A 2I4CA 1HSEA 2XX9A 3USDA 3O2AA 4Z7EA 4KQPA 4I62A 4EF1A 4ZE8A 3C9HA 4FAJA 1B5HA 4YICA 1BKAA 3N5LA 5DVFA 4H5FA 4JDFA 3UORA 4RNSA 1S9TA 2DE2A 3IAZA 1B4HA 1Z7NE 5FHOA 5BUUA 2Q89A 4ZEKA 4JWOA 2FA7A 3M8UA 1FQDA 3TQWA 4GOTA 1LFHA 1ZBMA 2Y7WA 1RKMA 3IB1A 3SDFA 3W9VA 4QFNA 3FGSA 1US4A 4H0WA 2REJA 2PMSA 1WDNA 3C36A 5KZTA 4FEBA 2NOOA 3L6GA 4G2ZA 2XXTA 2ZYMA 3MQ9A 4C0RA 1EZPA 3H06B 4G4PA 4JB7A 3E3KA 5J1DA 5JTYA 5JTYB 3TTLA 3OMBA 2HQ0A 1P1NA 5CMCA 1OIBA 4U22A 3IB0A 1QJMA 1MS7A 3S9NC 3VLWA 3FZVA 2R9JA 4KHZE 1ZJLA 2ONSA 3Q28A 4H65A 2ZXTA 2VD3A 4LQ5A 1AIVA 2OLBA 1LGBC 3QUJA 2PVUA 4X48A 3TUSA 1MPCA 4R72A 4F3BA 4G8NA 2RINA 1D9VA 4U1ZA 2ZNTA 2QS2A 1LAFE 4ELOA 4FECA 2F7CA 4KPTA 4NF4A 4NF4B 4AQ4A 2G93A 4N07A 1P1QA 3K1MA 2XXXA 5HBCA 3KSXA 1MXWA 3H6WA 1MH3A 3SERA 2HXWA 1MM7A 4F19A 1FQBA 1SW2A 1LB9A 3SEUA 2OWSA 1GTKA 2DP8A 3O6IA 1CB6A 4PQJA 4YKPA 5CBRA 3O9PA 3OEMA 4LZ5A 1P99A 1D3KA 5CMMA 1NMUA 1QUIA 3S2VA 1B3HA 1RYOA 2DXRA 4R9GA 3K6XA 3WAFA 2F6GA 3MJNA 2UVHA 1N04A 3KFMA 1IEJA 4GL0A 2Q9TA 4YKIA 1SQYA 3QYTA 3DLNA 3BBRA 4O3AA 1MRPA 4HCWA 4PFTA 3B6TA 2XXYA 2Y7RA 3DELB 4ESXA 3SEWA 2KLFA 1OLCA 1B4ZA 4YB6A 2XX8A 2QSXA 1Q35A 5LOMA 3F11A 4ZS9A 4DE8A 3MW0A 2P1SA 1NNTA 1XS5A 2ABHA 4RK9A 4NWCA 2VD2A 4BDMA 3G7WA 1H3DA 4PFUA 1Y1MA 3WAEA 3B6QA 4Q5TA 3JZJA 3M3FA 4H67A 4PFYA 2RF1A 4RA1A 4YZZA 1FQCA 4R73A 3W9WA 2GFEA 3FATA 1NNKA 4IB2A 1Y9UA 1XT8A 5FTHA 4ZDMA 3TZAA 3LSXA 4WEDA 3FJGA 2O1LA 4GRKA 2FNCA 3IOWA 2ZYNA 1PBQA 4Q0CA 4EQBA 1BLFA 5IAIA 4H8JA 1MXXA 3VDFA 4F1VA 4BDQA 1B52A 1SYHA 4OFLA 4F29A 3PMXA 5AA3A 5DVJA 1H45A 4BDLA 4H5GA 2A5TA 1BIYA 2A5TB 4YKJA 1GVCA 1SVXB 5AA2D 1Y1ZA 2OJTA 4IO2A 1SBPA 3IL1B 4YU0A 2H4IA 3HCQA 2DSFA 1TFDA 1Y3PA 4LVQA 3HO7A 3TCGA 1B58A 3KN3A 3CFXA 1VR5A 3KOTA 4X9TA 2AYSA 1Y3QA 1ELJA 1MY1A 3MVXA 1EU8A 4F2OA 1WVJA 3GBAA 4JWXA 4U21A 2DVCA 4DZ1A 3S9LC 4JBZA 5L9SA 2I3VA 3RNNA 2F8DA 4ELRA 3IX1A 4ZEIA 2OCUA 3OO6A 1POTA 1QULA 4OVJA 4RYAA 3MZ1A 1EH3A 4K3FA 1DPEA 1MXYA 4I1DA 3CIJA 4QHQA 4H6DA 1JW4A 1FTKA 1B51A 1A8EA 3U8QA 4KR5A 3VFJA 2GHAA 3OO7A 3ILTB 1B5JA 5AA1A 1JW5A 2W7YA 4JSOA 2DWIA 1USYE 1LLSA 3G3KA 5TU0A 3C32A 5DYHA 1N3XA 5H8FA 3A3CA 5H8FB 2Q8JA 2O84X 3MP6A 2RC7A 2YLNA 5ISUA 1LBCA 3CFLA 1Y3NA 4O3BA 4FE8A 1LCFA 3FUZA 3QSLA 1MPBA 3TQLA 4IO4A 3MP8A 4ZE9A 2RC8A 4EXLA 2ZNSA 1SI1A 3KBRA 1MQGA 2RCBA 4ELQA 2LAOA 3OSQA 3K1PA 4FEDA 3IOVA 2HAUA 4DIGA 4Q8RA 1IUDA 2P0SA 1QKAA 2F78A 3PGFA 2F5XA 3VE1B 4XXUA 4F39A 3MVWA 3FV2A 4NMYA 3MC2A 4MLQA 5H8SA 1MPDA 4P0GA 3N26A 1P1OA 4OYVA 1TFAA 2XX7A 1J1NA 2V25A 3I5OA 4ZZEA 2HEUA 3SETA 3QK6A 3AXFA 4M1VA 4OMBA 4Z0IA 1B7ZA 1B7UA 2VP1A 3QUFA 3FD3A 3IK6B 2DS9A 1DSNA 3PMWA 2Z23A 4DLDA 2XXUA 1M5CA 3K00A 3OD7A 3G3JA 4U4SA 4YMBA 3EHSA 1MDP1 2NXOA 1KWHA 5DT6A 3T9HB 4RXLA 1M5FA 3ILUB 4YB7A 2ESNA 3FXUA 1MY3A 3FV1A 3IOTA 4M4GA 3CI8A 4GXSB 1ZTYA 1O7TA 1N7WA 3G3IA 3PUZE 4NF6A 4NF6B 3O29A 3TKDA 2G29A 1WODA 1QW0A 4DCYA 1IXIA 2H25A 1HSLA 2FYIA 2Y7IA 1JQFA 3H6VA 4ONYA 4P11A 3T9XB 4N13A 3ONMA 5K2YA 2Z8FA 3C35A 3S9MC 4NEDA 5I57A 3IOUA 5I57B 4RPOA 2H5YA 1B7HA 5A5XA 1UIVA 5A5XB 3S9EA 1LAHE 3PD9A 1UQWA 3LR1A 3LSLA 1I6BA 2Y7PA 4AB5A 1M5DA 4POXA 4LATA 3RQTA 1Q1KA 4OWDA 3IB2A 5L9OA 1B1XA 3CR9A 3VLVA 2O7IA 3T66A 3B6WA 3FVGA 1B0HA 4EUOA 1MXVA 3H7MA 3OSRA 2I4BA 4GLIA 1R9LA 4DDDA 1XVYA 3SESA 1GV8A 1O63A 3SEYA 4TLLB 4MFIA 1P1WA 1VFDA 1SW4A 2OK2A 3OEKA 3H6TA 3ZS6A 1FQFA 5FTIA 4O3CA 2QRYA 4DCXA 4DXUA 1NNFA 3P7IA 2QS1A 1A54A 3HSTA 3OXNA 3PPQA 2A5SA 3FJMA 1A99A 1ZU0A 3KOSA 2ANJA 5CRYA 1MY0A 1BP5A 3BFUA 4I9DA 2V3QA 4GL8A 1URDA 1Y20A 5CM6A 4IY6A 3RTFB 1DPPA 4KYDA 3V5AA 4TQUQ 4R75A 1ANFA 3IO4A 2X7PA 3EQ1A 3IORA 4IO5A 2DVZA 1TXFA 4IGRA 3VLUA 4DXBA 1LAGE 1UIUA 4IO3A 3MPKA 2GHBA 5CBSA 4OESA 4RJZA 3KEIA 4H8IA 4ELPA 4G68C 3SEXA 4N6PA 1R1NA 3KJ7A 2HAVA 3N6TA 3IR1A 5B70A 2CZLA 3A3UA 1PBPA 2XXQA 1Y4TA 5DEXA 2Z8EA 5DEXB 3MPLA 4ND9A 1XC1A 1HSJA 4R74A 5F7VA 5I56A 5I56B 3O66A 5EYFA 2DXYA 3MVYA 1LFIA 3PPRA 4R2BA 2PT1A 3PUYE 4IGTA 4YKKA 5FHMA 5H8HA 5H8HB 2V3TA 3HPIA 3Q27A 4QFPA 1MY4A 4IO7A 5ICQA 3DP4A 2DWJA 5ITOA 4NWDA 3K4UA 2R6GE 4HTGA 4RY1A 3RPWA 4UACA 4C1TA 1Y4CA 3R26A 4QSDA 3K02A 4OXVA 1NNPA 2XXPA 1MXUA 1B3EA 1PDAA 3TELA 3UGWA 3K6VA 2Y84A 3H4ZA 5AE4A 3EN3A 4OEVA 3QXMA 2IEEA 3PPPA 3KZGA 3GXAA 1IITA 4XKRA 2O68A 1ZMGA 5F1QA 1AL3A 3T9VA 4FORA 4E0XA 4OENA 3OELA 3PUVE 2AL4A 2HZLA 3UIFA 1NKXA 1FTJA 3PUXE 1ZIUA 4EXKA 5TP9A 5TP9B 1PB9A 3PU5A 1NH8A 4P0IA 3CSBA 4GQOA 1FQEA 4ZEBA 1MY2A 4NF8A 4NF8B 1FW0A 4F3SA 2I6EA 2X7QA 5KDTA 5KDTB 2PX1A 3UA8A 2X26A 1PB8A 1UTBA 1UTBB 3EPEA 1URGA 4F3PA 1I69A 5L8DA 3V89B 2GRVA 3EHTA 1N76A 5JEIA 3RTWB 1L5TA 3ZKLA 3EHUA 4ZZAA 3KGCA 3JYRA 2QMWA 3E13X 4WXJA 1MH4A 3SKPA 1OVTA 5DTBA 1M5BA 5DVIA 2ALUA 2QS3A 4ZECA 2PYYA 3LBSA 4PFWA 3PPOA 3GBBA 4NF5A 2Q2AA 4NF5B 5TPAA 5TPAB 1O64A 4LP2B 3IJXB 1VFEA 1N7XA 4KYEA 5EHSA 3RUMA 4FJPA 2R71A 2VHAA 1D9YA 2DWHA 3HN0A 3VXBA 3DM0A 4PE5B 2Q88A 2H99A 2UVGA 4QRZA 4ZEDA 4GD5A 3N94A 2DOJA 1NL5A 5L9MA 1PEBA 3FIRA 3TCHA 1N0TA 5CMBA 3W15C 3MBPA 3TPAA 3FJ7A 1JETA 3PD8A 3OENA 3O6GA 2Z8DA 3TTRA 3MZBA 3O6HA 4OZ9A 4POWA 4KCCA 4YMAA 3L6HA 4F1UA 5B7DA 2DYXA 4U2RA 3T22A 4OERA 3VXCA 2YJPA 4XIGQ 3R6UA 1H44A 4XKPA 2UYEA 4MBPA 5CC2A 3RT6B 3R7XA 1B9JA 3H03A 3I3VA 2PBWA 1B6HA 4XTCQ 3PPNA 3TAJA 4LA9A 4F3GA 4HS7A 1YPNA 5JK4A 1XOCA 3HHFA 1B5IA 3U92A 4Q30B 3V8XB 5I84A 1MQDA 4LZ8A 4NTLA 4IY5A 3T9UA 2O6AA 4UA8A 2ZYOA 2DQVA 1MM6A 2D21A 5EHMA 4MLVA 3TEPA 3UK4A 1YTVA 3G3FA 3M3KA 1B0LA 3ODBA 1AH5A 5AA4A 5AA4B 3U94A 4OHNA 1UTHA 1UTHB 3O97A 1R6ZA 5AA2A 5AA2B 1FTMA 2Y7KA 2IA4A 1VSOA 2HZKA 3I6VA 4QFOA 4H1XA 3C31A 2VGQA 2DWAA 3IJOB 3CRBA 2UVJA 2OWTA 1ATGA 1H76A 4U4XA 3D4GA 1AMFA 3LSFB 3O28A 1LAXA 1S50A 1H43A 1R9QA 3H6UA 4ESWA 1A8FA 2E0SA 1SW5A 4RPNA 1FTLA 1LSTA 3MAMA 1LB8A 3U1OA 2PT2A 1US5A 5HM4B 3PV0E 1QKBA 1JNFA 1B1HA 5I2KA 5I2KB 4BDRA 5BWJA 4HCYA 2DE3A 1JVYA 2O7UA 3RGYA 1PB7A 2B3FA 2H9BA 3TTMA 1DMBA 1RYXA 1I6AA 3ZKKA 5IKBA 2UXAA 4XKNA 1QUKA 2HCAA 4OFJA 1N84A 1GGGA 3KSJA 2B65A 1XVXA 5I58A 5I58B 2UYFA 4OETA 3A09A 3G3HA 4E0WA 1IZ1A 2OZZA 4QSEA 2P2AA 2XXHA 2Z22A 4I8CA 2HFBA 4GIZA 1FCKA 4L17A 4QSCA 2I3WA 4F1YA 3JV9A 4EDPA 2ZMBA 3CG3A 3V83A 4WEPA 3KN7A 2V93A 3TDJA 3KJTA 3TMGA 3EF7A 3QIMA 4QFLA 4F2QA 1YAEA 3DP8A 2BJJX 4YB5A 1OLAA 3KN8A 5H8NA 5H8NB 3QAXA 2NWJA 3FXRA 4LZ7A 2I0CA 1IXHA 1IQ7A 3PUWE 4OQOA 4EF2A 2F6PA 3MVZA 3E4RA 1LBBA 1N3WA 3TTKA 4IO6A 4QF9A 4LUBA 2XD3A 3C34A 3FVNA 2XXWA 1IIWA 1TWYA 3MP1A 4R2FA 4KCDA 4ZEFA 1B2HA 4HW8A 2XXIA 2F35A 4PP0A 3VVFA 3OO9A 5ITPA 2QS4A 3OOAA 2RCAA 3C33A 2VOZA 3TTNA 1T0KA 1SW1A 5I2NA 5I2NB 1A7LA 3ECRA 1JEVA 3RN8A 3PMVA 1BTJA 3UP9A 3TODA 3KG2A 3LSWA 1TT1A 3CFZA 4KFQA 1B3GA 3D4CA 4OEUA 1DOTA 1D4NA 1POY1 3S4UA 4R9FA 3GLBA 4BDNA 1DTGA 3H3GA 3HV1A 4DXCA 2RKMA 2GH9A 1PC3A 5FHNA 3K1NA 3CG1A 4JWYA 4ECFA 4AB6A 1P1UA 3GZGA 2QJEA 4R6YA 5HPQA 4OTEA 2F97A 3K01A 1USYH 2NUVA 1JVXA 3MWBA 1FTOA 4YAHX 4F18A 2XXRA 1JW1A 1LCTA 4PETA 3VVEA 4GF8A 4TLMB 1SD3A 3LC8A 1MQHA 4FIMA 1MQJA 2QL3A 2ONKE 1B46A 1SYIA 2M8CA 2ZYKA 2AL5A 1OVBA 3OO8A 1ZLQA 1FQAA 3K6UA 1IXCA 1A55A 3Q26A 1NH7A 1A40A 3U72A 3FASA 2I48A 4GVOA 3UN6A 4GXAA 1EZOA 3BKIB 2ONRA 3RY3A 4G68A 4G68B 3M3LA 3CVGA 2XXVA 2D5WA 2I58A 3MUQA 1MXZA 1JEUA 2XD2A 5ELVA 5ICTA 1URSA 4BLAA 1GR2A 2AIXA 3N6UA 2O1MA 4RK2A 4XKQA 2V3UA 4G77A 3TYHA 1IXGA 3SEVA 1SI0A 3B7DA 4MF3A 2ZNUA 4WKMA 4C1UA 5H8QA 5H8QB 3FVKA 3VV5A 3DP6A 1YCJA 5M2VA 2DE4A 1QUJA 1AOVA 4X1BA 2Q2CA 2OBGA 1M5EA 2WKYA 2F34A 3Q25A 1S7YA 3G3GA 4JXIA 4LQ2A 1B3LA 1B40A 3TCFA 3Q29A 1B32A 4F22A 5CMKA 4MH5A 3T93B 3ZSFA 4QFKA 1B05A 2I0BA 4U23A 2UVIA 2QPQA 3LUYA 1B3FA 1OMPA 4NE4A
chains in the Genus database with same CATH superfamily
1NV0A 2QVVA 4JSDA 2O51A 1I6QA 5ESYA 5CI5A 2REGA 1LFGA 3HHGA 1FBHA 1RDYA 3MZ9A 3BIHA 1DTZA 3K2DA 2V84A 1ZKBA 3K0VA 5KCJA 5KCJB 3U93A 4X1DA 1KA0A 1NFTA 1SDXA 1OQGA 2XXKA 4N4UA 1MDQA 1D9QA 2F7BA 4GFRA 3K6WA 1VE4A 5K2XA 4U1OA 2F7AA 1II5A 3E9XA 3IO6A 2THIA 2H98A 4N91A 2OX3A 3THIA 2RC9A 2NVUB 2YPNA 1OQHA 2D3IA 4G8MA 4QXDA 2E1SA 3RT8A 3FVOA 2O69A 4LONB 3FXQA 4PBHA 4TOZA 1XHYA 2B3BA 4XEQA 5I59A 1KA1A 5I59B 4G8HA 1QVSA 3C4MA 1MG1A 3CSGA 4EQ9A 1F9BA 2QMXA 4OFOA 1FBGA 4THIA 4MNPA 4KYSA 4KI0E 2I49A 3TFLA 4ISUA 2B4MA 1MQIA 4R6KA 3T96B 2CMOA 1Z7ME 4GX3A 4BDOA 1CE2A 3RLFE 1EZ9A 3VVDA 4XF5A 4R6HA 4F31B 3BFTA 4GWOA 4KD5A 4EQ7A 1BK4A 2XHDA 4FATA 2F36A 2I4CA 3MYUA 1HSEA 2XX9A 3USDA 3O2AA 4Z7EA 4KQPA 4I62A 4EF1A 5DW8A 2XWKA 4ZE8A 3C9HA 4FAJA 1B5HA 4YICA 1BKAA 3N5LA 5DVFA 4H5FA 5ET5A 4JDFA 3UORA 4RNSA 1S9TA 2DE2A 3IAZA 1B4HA 4P56A 1Z7NE 5FHOA 5BUUA 2Q89A 1IMCA 4JWOA 4ZEKA 2FA7A 3M8UA 1FQDA 3TQWA 4GOTA 3ISPA 5J16A 1LFHA 1ZBMA 2Y7WA 1IMAA 1RKMA 3IB1A 3SDFA 3W9VA 4QFNA 3FGSA 1US4A 4H0WA 1INPA 2REJA 2PMSA 1WDNA 3C36A 5KZTA 4FEBA 2NOOA 3L6GA 4G2ZA 2XXTA 2ZYMA 3MQ9A 4C0RA 1K9YA 1EZPA 1FPDA 3H06B 4G4PA 4JB7A 3E3KA 5J1DA 5JTYA 4NN3A 5JTYB 2WX9A 3TTLA 3OMBA 2HQ0A 1P1NA 5CMCA 1OIBA 4U22A 3IB0A 5FBPA 1QJMA 1MS7A 3S9NC 3VLWA 3FZVA 2R9JA 4KHZE 1ZJLA 2ONSA 3Q28A 4OANA 4H65A 2ZXTA 2VD3A 4LQ5A 1AIVA 2OLBA 1LGBC 3QUJA 2PVUA 4X48A 3TUSA 1MPCA 4R72A 4F3BA 4G8NA 2RINA 1D9VA 4U1ZA 2ZNTA 2QS2A 1LAFE 4ELOA 4FECA 2F7CA 4KPTA 4NF4A 4NF4B 3IFAA 4AQ4A 2G93A 4N07A 5LDZA 1P1QA 3K1MA 2XXXA 5HBCA 3KSXA 1MXWA 3H6WA 1MH3A 3SERA 2HXWA 1MM7A 4F19A 1FQBA 1SW2A 1LB9A 3SEUA 1NUXA 1GTKA 2OWSA 2DP8A 4H46A 3O6IA 1RDXA 1CB6A 4PQJA 4PAIA 1NV7A 4YKPA 5CBRA 3O9PA 3OEMA 4LZ5A 4HE1A 4P47A 4P1EA 1P99A 2PFYA 1D3KA 5CMMA 1NMUA 1QUIA 3S2VA 5I5PA 4NF0A 1B3HA 1RYOA 2DXRA 4R9GA 3K6XA 3WAFA 2F6GA 3MJNA 2UVHA 1N04A 3KFMA 1IEJA 4GWUA 4GL0A 1G0HA 2Q9TA 2Q8MA 4MX6A 4YKIA 1SQYA 3QYTA 4AS4A 3DLNA 3BBRA 4O3AA 1LBXA 1MRPA 4HCWA 4PFTA 3CHGA 5IGAA 3B6TA 2XXYA 2Y7RA 1IMEA 3DELB 4ESXA 3SEWA 2KLFA 1OLCA 4OVQA 3FBPA 1B4ZA 4YB6A 2XX8A 2QSXA 1NUZA 1Q35A 5LOMA 3F11A 4ZS9A 4DE8A 3MW0A 2P1SA 1NNTA 2Y5KA 1XS5A 2ABHA 4RK9A 4MMPA 4NWCA 2VD2A 4BDMA 3G7WA 1H3DA 4PFUA 1Y1MA 3WAEA 3B6QA 4Q5TA 3JZJA 3M3FA 4H67A 4PFYA 2RF1A 2OWZA 4RA1A 4YZZA 1FQCA 4R73A 3W9WA 2GFEA 3FATA 1NNKA 4IB2A 2DDKA 1Y9UA 1XT8A 5FTHA 4ZDMA 3TZAA 3LSXA 4WEDA 3FJGA 2O1LA 4GRKA 2FNCA 3IOWA 2QVRA 1PBQA 2ZYNA 4Q0CA 4EQBA 1BLFA 3PTYA 5IAIA 4H8JA 1MXXA 4N15A 3VDFA 4BDQA 4F1VA 1B52A 1SYHA 4OFLA 4F29A 3PMXA 5AA3A 5DVJA 3GYYA 1H45A 1DK4A 4BDLA 4DI4B 4H5GA 1NV5A 2A5TA 1BIYA 2A5TB 4YKJA 1GVCA 1SVXB 5AA2D 1Y1ZA 2OJTA 4IO2A 1SBPA 3IL1B 4YU0A 4PGPA 3IFCA 4OVPA 2H4IA 3HCQA 2DSFA 1TFDA 1Y3PA 4LVQA 3HO7A 3TCGA 4PFRA 1B58A 3KN3A 3CFXA 1VR5A 3KOTA 4X9TA 2AYSA 1Y3QA 2CZIA 1ELJA 1MY1A 3MVXA 1EU8A 4HE2A 4F2OA 1WVJA 2KR0A 4GBVA 3GBAA 4JWXA 4U21A 1K9ZA 2DVCA 4DZ1A 3RPLA 3RPLB 3S9LC 4JBZA 1DBZA 5L9SA 2I3VA 4HXVA 3RNNA 2F8DA 1NV6A 4ELRA 3IX1A 4ZEIA 2OCUA 3OO6A 1POTA 1QULA 4OVJA 4RYAA 3MZ1A 1EH3A 4K3FA 1DPEA 4O7IA 1MXYA 4I1DA 3CIJA 4QHQA 2QFLA 4H6DA 1JW4A 1FTKA 1B51A 1A8EA 1EYIA 3U8QA 4KR5A 3VFJA 2GHAA 3OO7A 3ILTB 1B5JA 5AA1A 1JW5A 2W7YA 2MKZA 4JSOA 2DWIA 1USYE 5ET8A 1LLSA 3G3KA 4N81A 2F3DA 5TU0A 3C32A 5DYHA 1N3XA 5H8FA 3A3CA 5H8FB 2Q8JA 3SZPA 2O84X 3MP6A 2RC7A 2YLNA 5ISUA 1LBCA 3CFLA 2XWIA 3B50A 1Y3NA 4O3BA 3LV0A 4FE8A 1LCFA 4H45A 3FUZA 3QSLA 1MPBA 3TQLA 4IO4A 4OVTA 3MP8A 4ZE9A 2RC8A 4EXLA 2ZNSA 4O8MA 1SI1A 4PGNA 3KBRA 1MQGA 2RCBA 4ELQA 3D1RA 2LAOA 3OSQA 3K1PA 2CZKA 1NUWA 4FEDA 4X8RA 3IOVA 2HAUA 4DIGA 4Q8RA 2ZZXA 1IUDA 1FRPA 2P0SA 4JVIA 1QKAA 2F78A 1FBFA 4I40A 4MAGA 3PGFA 2F5XA 3VE1B 4XXUA 4F39A 2ZZWA 1FBCA 3MVWA 1NV1A 3FV2A 4NMYA 3MC2A 2QVUA 4MLQA 5H8SA 1MPDA 4P0GA 3N26A 5IZ3A 5IZ3B 1P1OA 4OYVA 1FPFA 1TFAA 2XX7A 1J1NA 2V25A 4P3LA 3I5OA 4ZZEA 3HFUA 2HEUA 5EQ9A 2FBPA 1Q9DA 3SETA 3QK6A 3AXFA 4M1VA 3T0JA 4OMBA 4Z0IA 1B7ZA 1B7UA 2VP1A 1FPGA 3QUFA 3FD3A 3IK6B 2DS9A 1DSNA 3PMWA 2Z23A 4DLDA 2XXUA 1M5CA 3K00A 3OD7A 3G3JA 4OVSA 4U4SA 4YMBA 2CEXA 3EHSA 1NUYA 1MDP1 2NXOA 3KC0A 4GWSA 1KWHA 5DT6A 3T9HB 4RXLA 1M5FA 3ILUB 4YB7A 2Y5LA 2ESNA 3FXUA 1MY3A 4N8GA 3FV1A 3IOTA 4M4GA 3CI8A 4GXSB 1ZTYA 1O7TA 1N7WA 3G3IA 3PUZE 4NF6A 4NF6B 3O29A 1NI9A 4N17A 3TKDA 2G29A 1WODA 1QW0A 4DCYA 1IXIA 2H25A 1HSLA 2FYIA 2Y7IA 1JQFA 4JVCA 2FIXA 3H6VA 4ONYA 4P11A 3T9XB 4N13A 4OA4A 3ONMA 5K2YA 1DCUA 1FBEA 2Z8FA 3C35A 3S9MC 4NEDA 5I57A 3IOUA 5I57B 4RPOA 2H5YA 1B7HA 4QBAA 5A5XA 1UIVA 5A5XB 3S9EA 1LAHE 2HHMA 3PD9A 4P1LA 1UQWA 3LR1A 3LSLA 1I6BA 2Y7PA 4AB5A 1M5DA 4POXA 4LATA 3EKIA 3RQTA 1Q1KA 4OWDA 3IB2A 5L9OA 2B4LA 1B1XA 3CR9A 3VLVA 2O7IA 3T66A 4KXPA 4I3YA 3B6WA 3FVGA 1B0HA 4EUOA 1VDWA 1MXVA 3H7MA 3OSRA 2I4BA 4GLIA 1R9LA 4DDDA 1XVYA 3SESA 1GV8A 1O63A 4PAFA 5EYGA 3SEYA 4TLLB 4MFIA 1P1WA 1VFDA 5I3SA 1SW4A 2OK2A 4JVDA 3OEKA 3H6TA 3ZS6A 1FQFA 3NOHA 5FTIA 1EYJA 4O3CA 2QRYA 4DCXA 4DXUA 1NNFA 2KQZA 1IMDA 3P7IA 2QS1A 1A54A 4PBQA 3HSTA 3OXNA 3PPQA 2A5SA 3FJMA 1A99A 1ZU0A 3KOSA 2ANJA 5CRYA 1MY0A 2VPNA 1BP5A 3BFUA 4I9DA 3FXBA 2V3QA 4GL8A 1URDA 1Y20A 5CM6A 4IY6A 3RTFB 1DPPA 4KYDA 3V5AA 3RYDA 1LBWA 4TQUQ 4R75A 1ANFA 1LBVA 3IO4A 2X7PA 3EQ1A 3IORA 4IO5A 2DVZA 1TXFA 4IGRA 3VLUA 1LBZA 4DXBA 1LAGE 1UIUA 4IO3A 3MPKA 2GHBA 5CBSA 4OESA 4RJZA 3KEIA 4H8IA 4ELPA 2WBBA 4G68C 3SEXA 4N6PA 1R1NA 3KJ7A 2HAVA 2XWOA 5ET7A 4MNCA 4MEVA 3N6TA 3IR1A 5B70A 2CZLA 5EQ8A 3A3UA 1FPKA 3KC1A 1PBPA 2XXQA 1Y4TA 5DEXA 2Z8EA 5DEXB 3MPLA 4ND9A 1FPEA 1XC1A 1HSJA 4R74A 5F7VA 5I56A 5I56B 3O66A 5EYFA 2DXYA 3MVYA 2P3VA 4N6KA 1RDZA 1LFIA 3PPRA 4R2BA 2PT1A 3PUYE 4IGTA 4YKKA 5FHMA 5H8HA 5H8HB 2V3TA 3MSTA 3U65A 3HPIA 3Q27A 4QFPA 1MY4A 4IO7A 5ICQA 3DP4A 2DWJA 4GWYA 5ITOA 1IMBA 1NV2A 4NWDA 3K4UA 2R6GE 4HTGA 4RY1A 3RPWA 4UACA 4C1TA 1IMFA 1Y4CA 3R26A 4QSDA 3K02A 4OXVA 1NNPA 2XXPA 2P3NA 1MXUA 1B3EA 1PDAA 1NV4A 3TELA 3UGWA 3K6VA 2Y84A 3H4ZA 5AE4A 3EN3A 4OEVA 3QXMA 2IEEA 2WYKA 3PPPA 3KZGA 3GXAA 1IITA 4XKRA 2O68A 1ZMGA 5F1QA 2PCRA 1AL3A 3T9VA 4FORA 4E0XA 4OENA 3OELA 3PUVE 2AL4A 2HZLA 3UIFA 1NKXA 1FTJA 3PUXE 4UABA 1ZIUA 4EXKA 5TP9A 5TP9B 1PB9A 3PU5A 1NH8A 3E78A 4P0IA 3CSBA 4GQOA 1FQEA 4ZEBA 1G0IA 1MY2A 4NF8A 4NF8B 4NAPA 1FW0A 5A5LA 4F3SA 2I6EA 2X7QA 4GWZA 5KDTA 5KDTB 2VT5A 4N8YA 2PX1A 3UA8A 2X26A 1PB8A 1UTBA 1UTBB 3EPEA 1URGA 2XA5A 4F3PA 1I69A 5L8DA 3V89B 2GRVA 3EHTA 1N76A 5JEIA 3RTWB 1L5TA 3ZKLA 3EHUA 4ZZAA 3KGCA 3JYRA 2QMWA 3E13X 4WXJA 1LBYA 1MH4A 3B8BA 3SKPA 1OVTA 5DTBA 1M5BA 5DVIA 2ALUA 2QS3A 4ZECA 2PYYA 3LBSA 4PFWA 3PPOA 3GBBA 4NF5A 2Q2AA 4NF5B 5TPAA 5TPAB 1O64A 4LP2B 3IJXB 1VFEA 1N7XA 4KYEA 5EHSA 3RUMA 4MHFA 4FJPA 2R71A 2VHAA 1D9YA 2DWHA 3HN0A 3VXBA 3DM0A 4PE5B 5IZZA 2Q88A 2H99A 4GWWA 2UVGA 4QRZA 4ZEDA 4GD5A 3N94A 4NHBA 1YZ0A 2DOJA 1NL5A 5L9MA 1PEBA 3FIRA 3TCHA 5T3JA 1N0TA 4GBWA 5CMBA 3W15C 3MBPA 4PE3A 3TPAA 3FJ7A 1JETA 3PD8A 3OENA 3O6GA 2Z8DA 1SPIA 3TTRA 3MZBA 3O6HA 2R8TA 4OZ9A 4GX6A 4POWA 4KCCA 1AWBA 4YMAA 2PFZA 1FBPA 3L6HA 4F1UA 5B7DA 2DYXA 4U2RA 3T22A 4MIJA 4OERA 3VXCA 2YJPA 4XIGQ 3R6UA 1H44A 4XKPA 2UYEA 2VPOA 4MBPA 5CC2A 3RT6B 3R7XA 1B9JA 3H03A 3I3VA 2JJKA 2PBWA 1B6HA 4XTCQ 3A29A 3PPNA 3TAJA 4LA9A 4F3GA 4HS7A 1YPNA 5JK4A 1XOCA 3HHFA 1B5IA 3U92A 4Q30B 3V8XB 2WEFA 5I84A 1MQDA 4LZ8A 4GWXA 4NTLA 4IY5A 4PFBA 3T9UA 2HPGA 2FIEA 2O6AA 4UA8A 2ZYOA 2DQVA 2HXRA 1MM6A 2D21A 5EHMA 4MLVA 2CEYA 3TEPA 3UK4A 1YTVA 3G3FA 3M3KA 1B0LA 3ODBA 2FHYA 4PTKA 1AH5A 5AA4A 5AA4B 3U94A 4OHNA 1UTHA 1UTHB 3O97A 1FJ9A 1R6ZA 5AA2A 5AA2B 1FTMA 2Y7KA 2IA4A 1VSOA 2HZKA 3I6VA 4QFOA 4H1XA 3C31A 2VGQA 5F24A 2DWAA 3IJOB 3CRBA 2UVJA 2OWTA 4MNIA 1ATGA 1H76A 1JP4A 4U4XA 3D4GA 1AMFA 3LSFB 4PF6A 3O28A 1LAXA 1S50A 1FPBA 3T1BA 1H43A 1R9QA 1YXIA 3H6UA 4PDDA 4ESWA 1A8FA 2E0SA 1SW5A 4NQ8A 4RPNA 1FTLA 1LSTA 3MAMA 4N6DA 1LB8A 3U1OA 2PT2A 1US5A 5HM4B 3PV0E 1QKBA 4NG7A 4NGUA 5IZ1A 1JNFA 1B1HA 5I2KA 5I2KB 4BDRA 5BWJA 4HCYA 2DE3A 1JVYA 2O7UA 3RGYA 1PB7A 2B3FA 2H9BA 3TTMA 1DMBA 4O94A 1RYXA 1I6AA 3ZKKA 5IKBA 2UXAA 4OVRA 4XKNA 1QUKA 2HCAA 2XWVA 4OFJA 1N84A 1GGGA 3KSJA 4P8BA 2B65A 1XVXA 5I58A 3E79A 5I58B 2UYFA 4OETA 3A09A 3G3HA 1FTAA 4E0WA 1IZ1A 2OZZA 4QSEA 2V4CA 2P2AA 2XXHA 2Z22A 4I8CA 2HFBA 4GIZA 3BIGA 1FPJA 1FCKA 4L17A 3ROJA 4QSCA 2I3WA 4F1YA 2ZZVA 1NV3A 3JV9A 4EDPA 2ZMBA 3CG3A 3V83A 2Q74A 4WEPA 1FSAA 3KN7A 2V93A 3TDJA 3KJTA 3TMGA 3EF7A 3QIMA 4QFLA 4F2QA 1YAEA 3DP8A 2WBDA 2BJJX 4YB5A 1OLAA 1XI6A 3KN8A 5H8NA 5H8NB 3QAXA 2NWJA 3FXRA 4LZ7A 2I0CA 2GQ1A 1IXHA 1IQ7A 3PUWE 4PDHA 4OQOA 4EF2A 2F6PA 3MVZA 3E4RA 1LBBA 1N3WA 3TTKA 4IO6A 4QF9A 4LUBA 2XD3A 3C34A 3FVNA 2XXWA 1IIWA 1TWYA 4PAKA 3MP1A 4R2FA 2F3BA 4I3EA 4KCDA 4ZEFA 1B2HA 4HW8A 2XXIA 2F35A 4PP0A 1FPIA 3VVFA 3OO9A 4LN5A 5ITPA 2QS4A 3OOAA 2RCAA 3C33A 1KZ8A 4PFIA 2VOZA 3TTNA 1T0KA 1SW1A 5I2NA 5I2NB 1A7LA 3ECRA 1JEVA 3RN8A 3PMVA 1BTJA 3UP9A 3TODA 4PCDA 3KG2A 3LSWA 1TT1A 3CFZA 4KFQA 1B3GA 3D4CA 4IR8A 4OEUA 4PF8A 4XFEA 1DOTA 1D4NA 1POY1 3S4UA 1LEVA 4R9FA 3GLBA 4BDNA 1DTGA 3H3GA 3HV1A 4DXCA 2RKMA 2GH9A 1YYZA 1PC3A 4DI3D 5FHNA 3K1NA 3CG1A 4JWYA 4ECFA 4AB6A 4FBPA 5LTCA 1P1UA 3GZGA 2QJEA 4R6YA 5HPQA 5EQAA 4GX4A 4OTEA 2F97A 3K01A 1USYH 3QMFA 2NUVA 3KBZA 1JVXA 3MWBA 1FTOA 4YAHX 4AS5A 4F18A 2XXRA 1JW1A 1LCTA 2WYPA 4PETA 1QGXA 3VVEA 4GF8A 4TLMB 1SD3A 3LC8A 1MQHA 4FIMA 1MQJA 2QL3A 4G61A 2ONKE 2L5VA 5IM2A 1B46A 1SYIA 2M8CA 2ZYKA 2AL5A 1OVBA 3OO8A 1ZLQA 1FQAA 5EYHA 3K6UA 1IXCA 1A55A 3Q26A 1NH7A 1A40A 4HE0A 3U72A 3FASA 1FPLA 2I48A 4NX1A 4MCOA 1CNQA 4GVOA 3UN6A 4GXAA 1EZOA 3BKIB 2ONRA 3LUZA 4G68A 3RY3A 4G68B 3M3LA 3CVGA 2XXVA 4X04A 2D5WA 2I58A 3MUQA 1MXZA 1JEUA 5I7IA 2XD2A 5ELVA 5ICTA 5ET6A 5EQ7A 1URSA 4BLAA 4O7MA 1GR2A 2AIXA 3N6UA 2O1MA 4PC9A 1EYKA 4RK2A 4XKQA 1FJ6A 2V3UA 4G77A 3TYHA 1FBDA 1IXGA 3SEVA 1SI0A 3B7DA 2BJIA 4MF3A 2ZNUA 4WKMA 4C1UA 5H8QA 5H8QB 3FVKA 3VV5A 3DP6A 1YCJA 5M2VA 2DE4A 1QUJA 1AOVA 4X1BA 2Q2CA 4MJOA 2OBGA 2FVZA 1M5EA 2WKYA 2F34A 3Q25A 1S7YA 3G3GA 4JXIA 4LQ2A 1B3LA 1B40A 3TCFA 3Q29A 1B32A 4F22A 4P9KA 5CMKA 4MH5A 3T93B 3ZSFA 2CZHA 4QFKA 1B05A 2I0BA 4U23A 2UVIA 2QPQA 3LUYA 1B3FA 1OMPA 4NE4A
chains in the Genus database with same CATH topology
4JSDA 2O51A 1I6QA 5CI5A 2REGA 1LFGA 3HHGA 3MZ9A 1DTZA 3K2DA 2V84A 1ZKBA 3K0VA 5KCJA 5KCJB 3U93A 4X1DA 1NFTA 1SDXA 1OQGA 1MDQA 2F7BA 4GFRA 3K6WA 1VE4A 5K2XA 4U1OA 2F7AA 1II5A 3E9XA 3IO6A 2THIA 2H98A 3THIA 2RC9A 2NVUB 2YPNA 1OQHA 2D3IA 4G8MA 2E1SA 3RT8A 3FVOA 2O69A 4LONB 3FXQA 4TOZA 1XHYA 2B3BA 5I59A 5I59B 4G8HA 1QVSA 3C4MA 1MG1A 3CSGA 4EQ9A 1F9BA 2QMXA 4OFOA 4THIA 4KYSA 4KI0E 2I49A 3TFLA 4ISUA 1MQIA 4R6KA 3T96B 2CMOA 1Z7ME 4BDOA 1CE2A 3RLFE 1EZ9A 3VVDA 4R6HA 4F31B 3BFTA 4GWOA 4KD5A 4EQ7A 2XHDA 4FATA 2F36A 2I4CA 1HSEA 2XX9A 3USDA 3O2AA 4Z7EA 4KQPA 4I62A 4EF1A 4ZE8A 3C9HA 4FAJA 1B5HA 4YICA 1BKAA 3N5LA 5DVFA 4H5FA 4JDFA 3UORA 4RNSA 1S9TA 2DE2A 3IAZA 1B4HA 1Z7NE 5FHOA 5BUUA 2Q89A 4ZEKA 4JWOA 2FA7A 3M8UA 1FQDA 3TQWA 4GOTA 1LFHA 1ZBMA 2Y7WA 1RKMA 3IB1A 3SDFA 3W9VA 4QFNA 3FGSA 1US4A 4H0WA 2REJA 2PMSA 1WDNA 3C36A 5KZTA 4FEBA 2NOOA 3L6GA 4G2ZA 2XXTA 2ZYMA 3MQ9A 4C0RA 1EZPA 3H06B 4G4PA 4JB7A 3E3KA 5J1DA 5JTYA 5JTYB 3TTLA 3OMBA 2HQ0A 1P1NA 5CMCA 1OIBA 4U22A 3IB0A 1QJMA 1MS7A 3S9NC 3VLWA 3FZVA 2R9JA 4KHZE 1ZJLA 2ONSA 3Q28A 4H65A 2ZXTA 2VD3A 4LQ5A 1AIVA 2OLBA 1LGBC 3QUJA 2PVUA 4X48A 3TUSA 1MPCA 4R72A 4F3BA 4G8NA 2RINA 1D9VA 4U1ZA 2ZNTA 2QS2A 1LAFE 4ELOA 4FECA 2F7CA 4KPTA 4NF4A 4NF4B 4AQ4A 2G93A 4N07A 1P1QA 3K1MA 2XXXA 5HBCA 3KSXA 1MXWA 3H6WA 1MH3A 3SERA 2HXWA 1MM7A 4F19A 1FQBA 1SW2A 1LB9A 3SEUA 2OWSA 1GTKA 2DP8A 3O6IA 1CB6A 4PQJA 4YKPA 5CBRA 3O9PA 3OEMA 4LZ5A 1P99A 1D3KA 5CMMA 1NMUA 1QUIA 3S2VA 1B3HA 1RYOA 2DXRA 4R9GA 3K6XA 3WAFA 2F6GA 3MJNA 2UVHA 1N04A 3KFMA 1IEJA 4GL0A 2Q9TA 4YKIA 1SQYA 3QYTA 3DLNA 3BBRA 4O3AA 1MRPA 4HCWA 4PFTA 3B6TA 2XXYA 2Y7RA 3DELB 4ESXA 3SEWA 2KLFA 1OLCA 1B4ZA 4YB6A 2XX8A 2QSXA 1Q35A 5LOMA 3F11A 4ZS9A 4DE8A 3MW0A 2P1SA 1NNTA 1XS5A 2ABHA 4RK9A 4NWCA 2VD2A 4BDMA 3G7WA 1H3DA 4PFUA 1Y1MA 3WAEA 3B6QA 4Q5TA 3JZJA 3M3FA 4H67A 4PFYA 2RF1A 4RA1A 4YZZA 1FQCA 4R73A 3W9WA 2GFEA 3FATA 1NNKA 4IB2A 1Y9UA 1XT8A 5FTHA 4ZDMA 3TZAA 3LSXA 4WEDA 3FJGA 2O1LA 4GRKA 2FNCA 3IOWA 2ZYNA 1PBQA 4Q0CA 4EQBA 1BLFA 5IAIA 4H8JA 1MXXA 3VDFA 4F1VA 4BDQA 1B52A 1SYHA 4OFLA 4F29A 3PMXA 5AA3A 5DVJA 1H45A 4BDLA 4H5GA 2A5TA 1BIYA 2A5TB 4YKJA 1GVCA 1SVXB 5AA2D 1Y1ZA 2OJTA 4IO2A 1SBPA 3IL1B 4YU0A 2H4IA 3HCQA 2DSFA 1TFDA 1Y3PA 4LVQA 3HO7A 3TCGA 1B58A 3KN3A 3CFXA 1VR5A 3KOTA 4X9TA 2AYSA 1Y3QA 1ELJA 1MY1A 3MVXA 1EU8A 4F2OA 1WVJA 3GBAA 4JWXA 4U21A 2DVCA 4DZ1A 3S9LC 4JBZA 5L9SA 2I3VA 3RNNA 2F8DA 4ELRA 3IX1A 4ZEIA 2OCUA 3OO6A 1POTA 1QULA 4OVJA 4RYAA 3MZ1A 1EH3A 4K3FA 1DPEA 1MXYA 4I1DA 3CIJA 4QHQA 4H6DA 1JW4A 1FTKA 1B51A 1A8EA 3U8QA 4KR5A 3VFJA 2GHAA 3OO7A 3ILTB 1B5JA 5AA1A 1JW5A 2W7YA 4JSOA 2DWIA 1USYE 1LLSA 3G3KA 5TU0A 3C32A 5DYHA 1N3XA 5H8FA 3A3CA 5H8FB 2Q8JA 2O84X 3MP6A 2RC7A 2YLNA 5ISUA 1LBCA 3CFLA 1Y3NA 4O3BA 4FE8A 1LCFA 3FUZA 3QSLA 1MPBA 3TQLA 4IO4A 3MP8A 4ZE9A 2RC8A 4EXLA 2ZNSA 1SI1A 3KBRA 1MQGA 2RCBA 4ELQA 2LAOA 3OSQA 3K1PA 4FEDA 3IOVA 2HAUA 4DIGA 4Q8RA 1IUDA 2P0SA 1QKAA 2F78A 3PGFA 2F5XA 3VE1B 4XXUA 4F39A 3MVWA 3FV2A 4NMYA 3MC2A 4MLQA 5H8SA 1MPDA 4P0GA 3N26A 1P1OA 4OYVA 1TFAA 2XX7A 1J1NA 2V25A 3I5OA 4ZZEA 2HEUA 3SETA 3QK6A 3AXFA 4M1VA 4OMBA 4Z0IA 1B7ZA 1B7UA 2VP1A 3QUFA 3FD3A 3IK6B 2DS9A 1DSNA 3PMWA 2Z23A 4DLDA 2XXUA 1M5CA 3K00A 3OD7A 3G3JA 4U4SA 4YMBA 3EHSA 1MDP1 2NXOA 1KWHA 5DT6A 3T9HB 4RXLA 1M5FA 3ILUB 4YB7A 2ESNA 3FXUA 1MY3A 3FV1A 3IOTA 4M4GA 3CI8A 4GXSB 1ZTYA 1O7TA 1N7WA 3G3IA 3PUZE 4NF6A 4NF6B 3O29A 3TKDA 2G29A 1WODA 1QW0A 4DCYA 1IXIA 2H25A 1HSLA 2FYIA 2Y7IA 1JQFA 3H6VA 4ONYA 4P11A 3T9XB 4N13A 3ONMA 5K2YA 2Z8FA 3C35A 3S9MC 4NEDA 5I57A 3IOUA 5I57B 4RPOA 2H5YA 1B7HA 5A5XA 1UIVA 5A5XB 3S9EA 1LAHE 3PD9A 1UQWA 3LR1A 3LSLA 1I6BA 2Y7PA 4AB5A 1M5DA 4POXA 4LATA 3RQTA 1Q1KA 4OWDA 3IB2A 5L9OA 1B1XA 3CR9A 3VLVA 2O7IA 3T66A 3B6WA 3FVGA 1B0HA 4EUOA 1MXVA 3H7MA 3OSRA 2I4BA 4GLIA 1R9LA 4DDDA 1XVYA 3SESA 1GV8A 1O63A 3SEYA 4TLLB 4MFIA 1P1WA 1VFDA 1SW4A 2OK2A 3OEKA 3H6TA 3ZS6A 1FQFA 5FTIA 4O3CA 2QRYA 4DCXA 4DXUA 1NNFA 3P7IA 2QS1A 1A54A 3HSTA 3OXNA 3PPQA 2A5SA 3FJMA 1A99A 1ZU0A 3KOSA 2ANJA 5CRYA 1MY0A 1BP5A 3BFUA 4I9DA 2V3QA 4GL8A 1URDA 1Y20A 5CM6A 4IY6A 3RTFB 1DPPA 4KYDA 3V5AA 4TQUQ 4R75A 1ANFA 3IO4A 2X7PA 3EQ1A 3IORA 4IO5A 2DVZA 1TXFA 4IGRA 3VLUA 4DXBA 1LAGE 1UIUA 4IO3A 3MPKA 2GHBA 5CBSA 4OESA 4RJZA 3KEIA 4H8IA 4ELPA 4G68C 3SEXA 4N6PA 1R1NA 3KJ7A 2HAVA 3N6TA 3IR1A 5B70A 2CZLA 3A3UA 1PBPA 2XXQA 1Y4TA 5DEXA 2Z8EA 5DEXB 3MPLA 4ND9A 1XC1A 1HSJA 4R74A 5F7VA 5I56A 5I56B 3O66A 5EYFA 2DXYA 3MVYA 1LFIA 3PPRA 4R2BA 2PT1A 3PUYE 4IGTA 4YKKA 5FHMA 5H8HA 5H8HB 2V3TA 3HPIA 3Q27A 4QFPA 1MY4A 4IO7A 5ICQA 3DP4A 2DWJA 5ITOA 4NWDA 3K4UA 2R6GE 4HTGA 4RY1A 3RPWA 4UACA 4C1TA 1Y4CA 3R26A 4QSDA 3K02A 4OXVA 1NNPA 2XXPA 1MXUA 1B3EA 1PDAA 3TELA 3UGWA 3K6VA 2Y84A 3H4ZA 5AE4A 3EN3A 4OEVA 3QXMA 2IEEA 3PPPA 3KZGA 3GXAA 1IITA 4XKRA 2O68A 1ZMGA 5F1QA 1AL3A 3T9VA 4FORA 4E0XA 4OENA 3OELA 3PUVE 2AL4A 2HZLA 3UIFA 1NKXA 1FTJA 3PUXE 1ZIUA 4EXKA 5TP9A 5TP9B 1PB9A 3PU5A 1NH8A 4P0IA 3CSBA 4GQOA 1FQEA 4ZEBA 1MY2A 4NF8A 4NF8B 1FW0A 4F3SA 2I6EA 2X7QA 5KDTA 5KDTB 2PX1A 3UA8A 2X26A 1PB8A 1UTBA 1UTBB 3EPEA 1URGA 4F3PA 1I69A 5L8DA 3V89B 2GRVA 3EHTA 1N76A 5JEIA 3RTWB 1L5TA 3ZKLA 3EHUA 4ZZAA 3KGCA 3JYRA 2QMWA 3E13X 4WXJA 1MH4A 3SKPA 1OVTA 5DTBA 1M5BA 5DVIA 2ALUA 2QS3A 4ZECA 2PYYA 3LBSA 4PFWA 3PPOA 3GBBA 4NF5A 2Q2AA 4NF5B 5TPAA 5TPAB 1O64A 4LP2B 3IJXB 1VFEA 1N7XA 4KYEA 5EHSA 3RUMA 4FJPA 2R71A 2VHAA 1D9YA 2DWHA 3HN0A 3VXBA 3DM0A 4PE5B 2Q88A 2H99A 2UVGA 4QRZA 4ZEDA 4GD5A 3N94A 2DOJA 1NL5A 5L9MA 1PEBA 3FIRA 3TCHA 1N0TA 5CMBA 3W15C 3MBPA 3TPAA 3FJ7A 1JETA 3PD8A 3OENA 3O6GA 2Z8DA 3TTRA 3MZBA 3O6HA 4OZ9A 4POWA 4KCCA 4YMAA 3L6HA 4F1UA 5B7DA 2DYXA 4U2RA 3T22A 4OERA 3VXCA 2YJPA 4XIGQ 3R6UA 1H44A 4XKPA 2UYEA 4MBPA 5CC2A 3RT6B 3R7XA 1B9JA 3H03A 3I3VA 2PBWA 1B6HA 4XTCQ 3PPNA 3TAJA 4LA9A 4F3GA 4HS7A 1YPNA 5JK4A 1XOCA 3HHFA 1B5IA 3U92A 4Q30B 3V8XB 5I84A 1MQDA 4LZ8A 4NTLA 4IY5A 3T9UA 2O6AA 4UA8A 2ZYOA 2DQVA 1MM6A 2D21A 5EHMA 4MLVA 3TEPA 3UK4A 1YTVA 3G3FA 3M3KA 1B0LA 3ODBA 1AH5A 5AA4A 5AA4B 3U94A 4OHNA 1UTHA 1UTHB 3O97A 1R6ZA 5AA2A 5AA2B 1FTMA 2Y7KA 2IA4A 1VSOA 2HZKA 3I6VA 4QFOA 4H1XA 3C31A 2VGQA 2DWAA 3IJOB 3CRBA 2UVJA 2OWTA 1ATGA 1H76A 4U4XA 3D4GA 1AMFA 3LSFB 3O28A 1LAXA 1S50A 1H43A 1R9QA 3H6UA 4ESWA 1A8FA 2E0SA 1SW5A 4RPNA 1FTLA 1LSTA 3MAMA 1LB8A 3U1OA 2PT2A 1US5A 5HM4B 3PV0E 1QKBA 1JNFA 1B1HA 5I2KA 5I2KB 4BDRA 5BWJA 4HCYA 2DE3A 1JVYA 2O7UA 3RGYA 1PB7A 2B3FA 2H9BA 3TTMA 1DMBA 1RYXA 1I6AA 3ZKKA 5IKBA 2UXAA 4XKNA 1QUKA 2HCAA 4OFJA 1N84A 1GGGA 3KSJA 2B65A 1XVXA 5I58A 5I58B 2UYFA 4OETA 3A09A 3G3HA 4E0WA 1IZ1A 2OZZA 4QSEA 2P2AA 2XXHA 2Z22A 4I8CA 2HFBA 4GIZA 1FCKA 4L17A 4QSCA 2I3WA 4F1YA 3JV9A 4EDPA 2ZMBA 3CG3A 3V83A 4WEPA 3KN7A 2V93A 3TDJA 3KJTA 3TMGA 3EF7A 3QIMA 4QFLA 4F2QA 1YAEA 3DP8A 2BJJX 4YB5A 1OLAA 3KN8A 5H8NA 5H8NB 3QAXA 2NWJA 3FXRA 4LZ7A 2I0CA 1IXHA 1IQ7A 3PUWE 4OQOA 4EF2A 2F6PA 3MVZA 3E4RA 1LBBA 1N3WA 3TTKA 4IO6A 4QF9A 4LUBA 2XD3A 3C34A 3FVNA 2XXWA 1IIWA 1TWYA 3MP1A 4R2FA 4KCDA 4ZEFA 1B2HA 4HW8A 2XXIA 2F35A 4PP0A 3VVFA 3OO9A 5ITPA 2QS4A 3OOAA 2RCAA 3C33A 2VOZA 3TTNA 1T0KA 1SW1A 5I2NA 5I2NB 1A7LA 3ECRA 1JEVA 3RN8A 3PMVA 1BTJA 3UP9A 3TODA 3KG2A 3LSWA 1TT1A 3CFZA 4KFQA 1B3GA 3D4CA 4OEUA 1DOTA 1D4NA 1POY1 3S4UA 4R9FA 3GLBA 4BDNA 1DTGA 3H3GA 3HV1A 4DXCA 2RKMA 2GH9A 1PC3A 5FHNA 3K1NA 3CG1A 4JWYA 4ECFA 4AB6A 1P1UA 3GZGA 2QJEA 4R6YA 5HPQA 4OTEA 2F97A 3K01A 1USYH 2NUVA 1JVXA 3MWBA 1FTOA 4YAHX 4F18A 2XXRA 1JW1A 1LCTA 4PETA 3VVEA 4GF8A 4TLMB 1SD3A 3LC8A 1MQHA 4FIMA 1MQJA 2QL3A 2ONKE 1B46A 1SYIA 2M8CA 2ZYKA 2AL5A 1OVBA 3OO8A 1ZLQA 1FQAA 3K6UA 1IXCA 1A55A 3Q26A 1NH7A 1A40A 3U72A 3FASA 2I48A 4GVOA 3UN6A 4GXAA 1EZOA 3BKIB 2ONRA 3RY3A 4G68A 4G68B 3M3LA 3CVGA 2XXVA 2D5WA 2I58A 3MUQA 1MXZA 1JEUA 2XD2A 5ELVA 5ICTA 1URSA 4BLAA 1GR2A 2AIXA 3N6UA 2O1MA 4RK2A 4XKQA 2V3UA 4G77A 3TYHA 1IXGA 3SEVA 1SI0A 3B7DA 4MF3A 2ZNUA 4WKMA 4C1UA 5H8QA 5H8QB 3FVKA 3VV5A 3DP6A 1YCJA 5M2VA 2DE4A 1QUJA 1AOVA 4X1BA 2Q2CA 2OBGA 1M5EA 2WKYA 2F34A 3Q25A 1S7YA 3G3GA 4JXIA 4LQ2A 1B3LA 1B40A 3TCFA 3Q29A 1B32A 4F22A 5CMKA 4MH5A 3T93B 3ZSFA 4QFKA 1B05A 2I0BA 4U23A 2UVIA 2QPQA 3LUYA 1B3FA 1OMPA 4NE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSD A;  2O51 A;  1I6Q A;  5CI5 A;  2REG A;  1LFG A;  3HHG A;  3MZ9 A;  1DTZ A;  3K2D A;  2V84 A;  1ZKB A;  3K0V A;  5KCJ A;  5KCJ B;  3U93 A;  4X1D A;  1NFT A;  1SDX A;  1OQG A;  1MDQ A;  2F7B A;  4GFR A;  3K6W A;  1VE4 A;  5K2X A;  4U1O A;  2F7A A;  1II5 A;  3E9X A;  3IO6 A;  2THI A;  2H98 A;  3THI A;  2RC9 A;  2NVU B;  2YPN A;  1OQH A;  2D3I A;  4G8M A;  2E1S A;  3RT8 A;  3FVO A;  2O69 A;  4LON B;  3FXQ A;  4TOZ A;  1XHY A;  2B3B A;  5I59 A;  5I59 B;  4G8H A;  1QVS A;  3C4M A;  1MG1 A;  3CSG A;  4EQ9 A;  1F9B A;  2QMX A;  4OFO A;  4THI A;  4KYS A;  4KI0 E;  2I49 A;  3TFL A;  4ISU A;  1MQI A;  4R6K A;  3T96 B;  2CMO A;  1Z7M E;  4BDO A;  1CE2 A;  3RLF E;  1EZ9 A;  3VVD A;  4R6H A;  4F31 B;  3BFT A;  4GWO A;  4KD5 A;  4EQ7 A;  2XHD A;  4FAT A;  2F36 A;  2I4C A;  1HSE A;  2XX9 A;  3USD A;  3O2A A;  4Z7E A;  4KQP A;  4I62 A;  4EF1 A;  4ZE8 A;  3C9H A;  4FAJ A;  1B5H A;  4YIC A;  1BKA A;  3N5L A;  5DVF A;  4H5F A;  4JDF A;  3UOR A;  4RNS A;  1S9T A;  2DE2 A;  3IAZ A;  1B4H A;  1Z7N E;  5FHO A;  5BUU A;  2Q89 A;  4ZEK A;  4JWO A;  2FA7 A;  3M8U A;  1FQD A;  3TQW A;  4GOT A;  1LFH A;  1ZBM A;  2Y7W A;  1RKM A;  3IB1 A;  3SDF A;  3W9V A;  4QFN A;  3FGS A;  1US4 A;  4H0W A;  2REJ A;  2PMS A;  1WDN A;  3C36 A;  5KZT A;  4FEB A;  2NOO A;  3L6G A;  4G2Z A;  2XXT A;  2ZYM A;  3MQ9 A;  4C0R A;  1EZP A;  3H06 B;  4G4P A;  4JB7 A;  3E3K A;  5J1D A;  5JTY A;  5JTY B;  3TTL A;  3OMB A;  2HQ0 A;  1P1N A;  5CMC A;  1OIB A;  4U22 A;  3IB0 A;  1QJM A;  1MS7 A;  3S9N C;  3VLW A;  3FZV A;  2R9J A;  4KHZ E;  1ZJL A;  2ONS A;  3Q28 A;  4H65 A;  2ZXT A;  2VD3 A;  4LQ5 A;  1AIV A;  2OLB A;  1LGB C;  3QUJ A;  2PVU A;  4X48 A;  3TUS A;  1MPC A;  4R72 A;  4F3B A;  4G8N A;  2RIN A;  1D9V A;  4U1Z A;  2ZNT A;  2QS2 A;  1LAF E;  4ELO A;  4FEC A;  2F7C A;  4KPT A;  4NF4 A;  4NF4 B;  4AQ4 A;  2G93 A;  4N07 A;  1P1Q A;  3K1M A;  2XXX A;  5HBC A;  3KSX A;  1MXW A;  3H6W A;  1MH3 A;  3SER A;  2HXW A;  1MM7 A;  4F19 A;  1FQB A;  1SW2 A;  1LB9 A;  3SEU A;  2OWS A;  1GTK A;  2DP8 A;  3O6I A;  1CB6 A;  4PQJ A;  4YKP A;  5CBR A;  3O9P A;  3OEM A;  4LZ5 A;  1P99 A;  1D3K A;  5CMM A;  1NMU A;  1QUI A;  3S2V A;  1B3H A;  1RYO A;  2DXR A;  4R9G A;  3K6X A;  3WAF A;  2F6G A;  3MJN A;  2UVH A;  1N04 A;  3KFM A;  1IEJ A;  4GL0 A;  2Q9T A;  4YKI A;  1SQY A;  3QYT A;  3DLN A;  3BBR A;  4O3A A;  1MRP A;  4HCW A;  4PFT A;  3B6T A;  2XXY A;  2Y7R A;  3DEL B;  4ESX A;  3SEW A;  2KLF A;  1OLC A;  1B4Z A;  4YB6 A;  2XX8 A;  2QSX A;  1Q35 A;  5LOM A;  3F11 A;  4ZS9 A;  4DE8 A;  3MW0 A;  2P1S A;  1NNT A;  1XS5 A;  2ABH A;  4RK9 A;  4NWC A;  2VD2 A;  4BDM A;  3G7W A;  1H3D A;  4PFU A;  1Y1M A;  3WAE A;  3B6Q A;  4Q5T A;  3JZJ A;  3M3F A;  4H67 A;  4PFY A;  2RF1 A;  4RA1 A;  4YZZ A;  1FQC A;  4R73 A;  3W9W A;  2GFE A;  3FAT A;  1NNK A;  4IB2 A;  1Y9U A;  1XT8 A;  5FTH A;  4ZDM A;  3TZA A;  3LSX A;  4WED A;  3FJG A;  2O1L A;  4GRK A;  2FNC A;  3IOW A;  2ZYN A;  1PBQ A;  4Q0C A;  4EQB A;  1BLF A;  5IAI A;  4H8J A;  1MXX A;  3VDF A;  4F1V A;  4BDQ A;  1B52 A;  1SYH A;  4OFL A;  4F29 A;  3PMX A;  5AA3 A;  5DVJ A;  1H45 A;  4BDL A;  4H5G A;  2A5T A;  1BIY A;  2A5T B;  4YKJ A;  1GVC A;  1SVX B;  5AA2 D;  1Y1Z A;  2OJT A;  4IO2 A;  1SBP A;  3IL1 B;  4YU0 A;  2H4I A;  3HCQ A;  2DSF A;  1TFD A;  1Y3P A;  4LVQ A;  3HO7 A;  3TCG A;  1B58 A;  3KN3 A;  3CFX A;  1VR5 A;  3KOT A;  4X9T A;  2AYS A;  1Y3Q A;  1ELJ A;  1MY1 A;  3MVX A;  1EU8 A;  4F2O A;  1WVJ A;  3GBA A;  4JWX A;  4U21 A;  2DVC A;  4DZ1 A;  3S9L C;  4JBZ A;  5L9S A;  2I3V A;  3RNN A;  2F8D A;  4ELR A;  3IX1 A;  4ZEI A;  2OCU A;  3OO6 A;  1POT A;  1QUL A;  4OVJ A;  4RYA A;  3MZ1 A;  1EH3 A;  4K3F A;  1DPE A;  1MXY A;  4I1D A;  3CIJ A;  4QHQ A;  4H6D A;  1JW4 A;  1FTK A;  1B51 A;  1A8E A;  3U8Q A;  4KR5 A;  3VFJ A;  2GHA A;  3OO7 A;  3ILT B;  1B5J A;  5AA1 A;  1JW5 A;  2W7Y A;  4JSO A;  2DWI A;  1USY E;  1LLS A;  3G3K A;  5TU0 A;  3C32 A;  5DYH A;  1N3X A;  5H8F A;  3A3C A;  5H8F B;  2Q8J A;  2O84 X;  3MP6 A;  2RC7 A;  2YLN A;  5ISU A;  1LBC A;  3CFL A;  1Y3N A;  4O3B A;  4FE8 A;  1LCF A;  3FUZ A;  3QSL A;  1MPB A;  3TQL A;  4IO4 A;  3MP8 A;  4ZE9 A;  2RC8 A;  4EXL A;  2ZNS A;  1SI1 A;  3KBR A;  1MQG A;  2RCB A;  4ELQ A;  2LAO A;  3OSQ A;  3K1P A;  4FED A;  3IOV A;  2HAU A;  4DIG A;  4Q8R A;  1IUD A;  2P0S A;  1QKA A;  2F78 A;  3PGF A;  2F5X A;  3VE1 B;  4XXU A;  4F39 A;  3MVW A;  3FV2 A;  4NMY A;  3MC2 A;  4MLQ A;  5H8S A;  1MPD A;  4P0G A;  3N26 A;  1P1O A;  4OYV A;  1TFA A;  2XX7 A;  1J1N A;  2V25 A;  3I5O A;  4ZZE A;  2HEU A;  3SET A;  3QK6 A;  3AXF A;  4M1V A;  4OMB A;  4Z0I A;  1B7Z A;  1B7U A;  2VP1 A;  3QUF A;  3FD3 A;  3IK6 B;  2DS9 A;  1DSN A;  3PMW A;  2Z23 A;  4DLD A;  2XXU A;  1M5C A;  3K00 A;  3OD7 A;  3G3J A;  4U4S A;  4YMB A;  3EHS A;  1MDP 1;  2NXO A;  1KWH A;  5DT6 A;  3T9H B;  4RXL A;  1M5F A;  3ILU B;  4YB7 A;  2ESN A;  3FXU A;  1MY3 A;  3FV1 A;  3IOT A;  4M4G A;  3CI8 A;  4GXS B;  1ZTY A;  1O7T A;  1N7W A;  3G3I A;  3PUZ E;  4NF6 A;  4NF6 B;  3O29 A;  3TKD A;  2G29 A;  1WOD A;  1QW0 A;  4DCY A;  1IXI A;  2H25 A;  1HSL A;  2FYI A;  2Y7I A;  1JQF A;  3H6V A;  4ONY A;  4P11 A;  3T9X B;  4N13 A;  3ONM A;  5K2Y A;  2Z8F A;  3C35 A;  3S9M C;  4NED A;  5I57 A;  3IOU A;  5I57 B;  4RPO A;  2H5Y A;  1B7H A;  5A5X A;  1UIV A;  5A5X B;  3S9E A;  1LAH E;  3PD9 A;  1UQW A;  3LR1 A;  3LSL A;  1I6B A;  2Y7P A;  4AB5 A;  1M5D A;  4POX A;  4LAT A;  3RQT A;  1Q1K A;  4OWD A;  3IB2 A;  5L9O A;  1B1X A;  3CR9 A;  3VLV A;  2O7I A;  3T66 A;  3B6W A;  3FVG A;  1B0H A;  4EUO A;  1MXV A;  3H7M A;  3OSR A;  2I4B A;  4GLI A;  1R9L A;  4DDD A;  1XVY A;  3SES A;  1GV8 A;  1O63 A;  3SEY A;  4TLL B;  4MFI A;  1P1W A;  1VFD A;  1SW4 A;  2OK2 A;  3OEK A;  3H6T A;  3ZS6 A;  1FQF A;  5FTI A;  4O3C A;  2QRY A;  4DCX A;  4DXU A;  1NNF A;  3P7I A;  2QS1 A;  1A54 A;  3HST A;  3OXN A;  3PPQ A;  2A5S A;  3FJM A;  1A99 A;  1ZU0 A;  3KOS A;  2ANJ A;  5CRY A;  1MY0 A;  1BP5 A;  3BFU A;  4I9D A;  2V3Q A;  4GL8 A;  1URD A;  1Y20 A;  5CM6 A;  4IY6 A;  3RTF B;  1DPP A;  4KYD A;  3V5A A;  4TQU Q;  4R75 A;  1ANF A;  3IO4 A;  2X7P A;  3EQ1 A;  3IOR A;  4IO5 A;  2DVZ A;  1TXF A;  4IGR A;  3VLU A;  4DXB A;  1LAG E;  1UIU A;  4IO3 A;  3MPK A;  2GHB A;  5CBS A;  4OES A;  4RJZ A;  3KEI A;  4H8I A;  4ELP A;  4G68 C;  3SEX A;  4N6P A;  1R1N A;  3KJ7 A;  2HAV A;  3N6T A;  3IR1 A;  5B70 A;  2CZL A;  3A3U A;  1PBP A;  2XXQ A;  1Y4T A;  5DEX A;  2Z8E A;  5DEX B;  3MPL A;  4ND9 A;  1XC1 A;  1HSJ A;  4R74 A;  5F7V A;  5I56 A;  5I56 B;  3O66 A;  5EYF A;  2DXY A;  3MVY A;  1LFI A;  3PPR A;  4R2B A;  2PT1 A;  3PUY E;  4IGT A;  4YKK A;  5FHM A;  5H8H A;  5H8H B;  2V3T A;  3HPI A;  3Q27 A;  4QFP A;  1MY4 A;  4IO7 A;  5ICQ A;  3DP4 A;  2DWJ A;  5ITO A;  4NWD A;  3K4U A;  2R6G E;  4HTG A;  4RY1 A;  3RPW A;  4UAC A;  4C1T A;  1Y4C A;  3R26 A;  4QSD A;  3K02 A;  4OXV A;  1NNP A;  2XXP A;  1MXU A;  1B3E A;  1PDA A;  3TEL A;  3UGW A;  3K6V A;  2Y84 A;  3H4Z A;  5AE4 A;  3EN3 A;  4OEV A;  3QXM A;  2IEE A;  3PPP A;  3KZG A;  3GXA A;  1IIT A;  4XKR A;  2O68 A;  1ZMG A;  5F1Q A;  1AL3 A;  3T9V A;  4FOR A;  4E0X A;  4OEN A;  3OEL A;  3PUV E;  2AL4 A;  2HZL A;  3UIF A;  1NKX A;  1FTJ A;  3PUX E;  1ZIU A;  4EXK A;  5TP9 A;  5TP9 B;  1PB9 A;  3PU5 A;  1NH8 A;  4P0I A;  3CSB A;  4GQO A;  1FQE A;  4ZEB A;  1MY2 A;  4NF8 A;  4NF8 B;  1FW0 A;  4F3S A;  2I6E A;  2X7Q A;  5KDT A;  5KDT B;  2PX1 A;  3UA8 A;  2X26 A;  1PB8 A;  1UTB A;  1UTB B;  3EPE A;  1URG A;  4F3P A;  1I69 A;  5L8D A;  3V89 B;  2GRV A;  3EHT A;  1N76 A;  5JEI A;  3RTW B;  1L5T A;  3ZKL A;  3EHU A;  4ZZA A;  3KGC A;  3JYR A;  2QMW A;  3E13 X;  4WXJ A;  1MH4 A;  3SKP A;  1OVT A;  5DTB A;  1M5B A;  5DVI A;  2ALU A;  2QS3 A;  4ZEC A;  2PYY A;  3LBS A;  4PFW A;  3PPO A;  3GBB A;  4NF5 A;  2Q2A A;  4NF5 B;  5TPA A;  5TPA B;  1O64 A;  4LP2 B;  3IJX B;  1VFE A;  1N7X A;  4KYE A;  5EHS A;  3RUM A;  4FJP A;  2R71 A;  2VHA A;  1D9Y A;  2DWH A;  3HN0 A;  3VXB A;  3DM0 A;  4PE5 B;  2Q88 A;  2H99 A;  2UVG A;  4QRZ A;  4ZED A;  4GD5 A;  3N94 A;  2DOJ A;  1NL5 A;  5L9M A;  1PEB A;  3FIR A;  3TCH A;  1N0T A;  5CMB A;  3W15 C;  3MBP A;  3TPA A;  3FJ7 A;  1JET A;  3PD8 A;  3OEN A;  3O6G A;  2Z8D A;  3TTR A;  3MZB A;  3O6H A;  4OZ9 A;  4POW A;  4KCC A;  4YMA A;  3L6H A;  4F1U A;  5B7D A;  2DYX A;  4U2R A;  3T22 A;  4OER A;  3VXC A;  2YJP A;  4XIG Q;  3R6U A;  1H44 A;  4XKP A;  2UYE A;  4MBP A;  5CC2 A;  3RT6 B;  3R7X A;  1B9J A;  3H03 A;  3I3V A;  2PBW A;  1B6H A;  4XTC Q;  3PPN A;  3TAJ A;  4LA9 A;  4F3G A;  4HS7 A;  1YPN A;  5JK4 A;  1XOC A;  3HHF A;  1B5I A;  3U92 A;  4Q30 B;  3V8X B;  5I84 A;  1MQD A;  4LZ8 A;  4NTL A;  4IY5 A;  3T9U A;  2O6A A;  4UA8 A;  2ZYO A;  2DQV A;  1MM6 A;  2D21 A;  5EHM A;  4MLV A;  3TEP A;  3UK4 A;  1YTV A;  3G3F A;  3M3K A;  1B0L A;  3ODB A;  1AH5 A;  5AA4 A;  5AA4 B;  3U94 A;  4OHN A;  1UTH A;  1UTH B;  3O97 A;  1R6Z A;  5AA2 A;  5AA2 B;  1FTM A;  2Y7K A;  2IA4 A;  1VSO A;  2HZK A;  3I6V A;  4QFO A;  4H1X A;  3C31 A;  2VGQ A;  2DWA A;  3IJO B;  3CRB A;  2UVJ A;  2OWT A;  1ATG A;  1H76 A;  4U4X A;  3D4G A;  1AMF A;  3LSF B;  3O28 A;  1LAX A;  1S50 A;  1H43 A;  1R9Q A;  3H6U A;  4ESW A;  1A8F A;  2E0S A;  1SW5 A;  4RPN A;  1FTL A;  1LST A;  3MAM A;  1LB8 A;  3U1O A;  2PT2 A;  1US5 A;  5HM4 B;  3PV0 E;  1QKB A;  1JNF A;  1B1H A;  5I2K A;  5I2K B;  4BDR A;  5BWJ A;  4HCY A;  2DE3 A;  1JVY A;  2O7U A;  3RGY A;  1PB7 A;  2B3F A;  2H9B A;  3TTM A;  1DMB A;  1RYX A;  1I6A A;  3ZKK A;  5IKB A;  2UXA A;  4XKN A;  1QUK A;  2HCA A;  4OFJ A;  1N84 A;  1GGG A;  3KSJ A;  2B65 A;  1XVX A;  5I58 A;  5I58 B;  2UYF A;  4OET A;  3A09 A;  3G3H A;  4E0W A;  1IZ1 A;  2OZZ A;  4QSE A;  2P2A A;  2XXH A;  2Z22 A;  4I8C A;  2HFB A;  4GIZ A;  1FCK A;  4L17 A;  4QSC A;  2I3W A;  4F1Y A;  3JV9 A;  4EDP A;  2ZMB A;  3CG3 A;  3V83 A;  4WEP A;  3KN7 A;  2V93 A;  3TDJ A;  3KJT A;  3TMG A;  3EF7 A;  3QIM A;  4QFL A;  4F2Q A;  1YAE A;  3DP8 A;  2BJJ X;  4YB5 A;  1OLA A;  3KN8 A;  5H8N A;  5H8N B;  3QAX A;  2NWJ A;  3FXR A;  4LZ7 A;  2I0C A;  1IXH A;  1IQ7 A;  3PUW E;  4OQO A;  4EF2 A;  2F6P A;  3MVZ A;  3E4R A;  1LBB A;  1N3W A;  3TTK A;  4IO6 A;  4QF9 A;  4LUB A;  2XD3 A;  3C34 A;  3FVN A;  2XXW A;  1IIW A;  1TWY A;  3MP1 A;  4R2F A;  4KCD A;  4ZEF A;  1B2H A;  4HW8 A;  2XXI A;  2F35 A;  4PP0 A;  3VVF A;  3OO9 A;  5ITP A;  2QS4 A;  3OOA A;  2RCA A;  3C33 A;  2VOZ A;  3TTN A;  1T0K A;  1SW1 A;  5I2N A;  5I2N B;  1A7L A;  3ECR A;  1JEV A;  3RN8 A;  3PMV A;  1BTJ A;  3UP9 A;  3TOD A;  3KG2 A;  3LSW A;  1TT1 A;  3CFZ A;  4KFQ A;  1B3G A;  3D4C A;  4OEU A;  1DOT A;  1D4N A;  1POY 1;  3S4U A;  4R9F A;  3GLB A;  4BDN A;  1DTG A;  3H3G A;  3HV1 A;  4DXC A;  2RKM A;  2GH9 A;  1PC3 A;  5FHN A;  3K1N A;  3CG1 A;  4JWY A;  4ECF A;  4AB6 A;  1P1U A;  3GZG A;  2QJE A;  4R6Y A;  5HPQ A;  4OTE A;  2F97 A;  3K01 A;  1USY H;  2NUV A;  1JVX A;  3MWB A;  1FTO A;  4YAH X;  4F18 A;  2XXR A;  1JW1 A;  1LCT A;  4PET A;  3VVE A;  4GF8 A;  4TLM B;  1SD3 A;  3LC8 A;  1MQH A;  4FIM A;  1MQJ A;  2QL3 A;  2ONK E;  1B46 A;  1SYI A;  2M8C A;  2ZYK A;  2AL5 A;  1OVB A;  3OO8 A;  1ZLQ A;  1FQA A;  3K6U A;  1IXC A;  1A55 A;  3Q26 A;  1NH7 A;  1A40 A;  3U72 A;  3FAS A;  2I48 A;  4GVO A;  3UN6 A;  4GXA A;  1EZO A;  3BKI B;  2ONR A;  3RY3 A;  4G68 A;  4G68 B;  3M3L A;  3CVG A;  2XXV A;  2D5W A;  2I58 A;  3MUQ A;  1MXZ A;  1JEU A;  2XD2 A;  5ELV A;  5ICT A;  1URS A;  4BLA A;  1GR2 A;  2AIX A;  3N6U A;  2O1M A;  4RK2 A;  4XKQ A;  2V3U A;  4G77 A;  3TYH A;  1IXG A;  3SEV A;  1SI0 A;  3B7D A;  4MF3 A;  2ZNU A;  4WKM A;  4C1U A;  5H8Q A;  5H8Q B;  3FVK A;  3VV5 A;  3DP6 A;  1YCJ A;  5M2V A;  2DE4 A;  1QUJ A;  1AOV A;  4X1B A;  2Q2C A;  2OBG A;  1M5E A;  2WKY A;  2F34 A;  3Q25 A;  1S7Y A;  3G3G A;  4JXI A;  4LQ2 A;  1B3L A;  1B40 A;  3TCF A;  3Q29 A;  1B32 A;  4F22 A;  5CMK A;  4MH5 A;  3T93 B;  3ZSF A;  4QFK A;  1B05 A;  2I0B A;  4U23 A;  2UVI A;  2QPQ A;  3LUY A;  1B3F A;  1OMP A;  4NE4 A; 
#chains in the Genus database with same CATH topology
 1NV0 A;  2QVV A;  4JSD A;  2O51 A;  1I6Q A;  5ESY A;  5CI5 A;  2REG A;  1LFG A;  3HHG A;  1FBH A;  1RDY A;  3MZ9 A;  3BIH A;  1DTZ A;  3K2D A;  2V84 A;  1ZKB A;  3K0V A;  5KCJ A;  5KCJ B;  3U93 A;  4X1D A;  1KA0 A;  1NFT A;  1SDX A;  1OQG A;  2XXK A;  4N4U A;  1MDQ A;  1D9Q A;  2F7B A;  4GFR A;  3K6W A;  1VE4 A;  5K2X A;  4U1O A;  2F7A A;  1II5 A;  3E9X A;  3IO6 A;  2THI A;  2H98 A;  4N91 A;  2OX3 A;  3THI A;  2RC9 A;  2NVU B;  2YPN A;  1OQH A;  2D3I A;  4G8M A;  4QXD A;  2E1S A;  3RT8 A;  3FVO A;  2O69 A;  4LON B;  3FXQ A;  4PBH A;  4TOZ A;  1XHY A;  2B3B A;  4XEQ A;  5I59 A;  1KA1 A;  5I59 B;  4G8H A;  1QVS A;  3C4M A;  1MG1 A;  3CSG A;  4EQ9 A;  1F9B A;  2QMX A;  4OFO A;  1FBG A;  4THI A;  4MNP A;  4KYS A;  4KI0 E;  2I49 A;  3TFL A;  4ISU A;  2B4M A;  1MQI A;  4R6K A;  3T96 B;  2CMO A;  1Z7M E;  4GX3 A;  4BDO A;  1CE2 A;  3RLF E;  1EZ9 A;  3VVD A;  4XF5 A;  4R6H A;  4F31 B;  3BFT A;  4GWO A;  4KD5 A;  4EQ7 A;  1BK4 A;  2XHD A;  4FAT A;  2F36 A;  2I4C A;  3MYU A;  1HSE A;  2XX9 A;  3USD A;  3O2A A;  4Z7E A;  4KQP A;  4I62 A;  4EF1 A;  5DW8 A;  2XWK A;  4ZE8 A;  3C9H A;  4FAJ A;  1B5H A;  4YIC A;  1BKA A;  3N5L A;  5DVF A;  4H5F A;  5ET5 A;  4JDF A;  3UOR A;  4RNS A;  1S9T A;  2DE2 A;  3IAZ A;  1B4H A;  4P56 A;  1Z7N E;  5FHO A;  5BUU A;  2Q89 A;  1IMC A;  4JWO A;  4ZEK A;  2FA7 A;  3M8U A;  1FQD A;  3TQW A;  4GOT A;  3ISP A;  5J16 A;  1LFH A;  1ZBM A;  2Y7W A;  1IMA A;  1RKM A;  3IB1 A;  3SDF A;  3W9V A;  4QFN A;  3FGS A;  1US4 A;  4H0W A;  1INP A;  2REJ A;  2PMS A;  1WDN A;  3C36 A;  5KZT A;  4FEB A;  2NOO A;  3L6G A;  4G2Z A;  2XXT A;  2ZYM A;  3MQ9 A;  4C0R A;  1K9Y A;  1EZP A;  1FPD A;  3H06 B;  4G4P A;  4JB7 A;  3E3K A;  5J1D A;  5JTY A;  4NN3 A;  5JTY B;  2WX9 A;  3TTL A;  3OMB A;  2HQ0 A;  1P1N A;  5CMC A;  1OIB A;  4U22 A;  3IB0 A;  5FBP A;  1QJM A;  1MS7 A;  3S9N C;  3VLW A;  3FZV A;  2R9J A;  4KHZ E;  1ZJL A;  2ONS A;  3Q28 A;  4OAN A;  4H65 A;  2ZXT A;  2VD3 A;  4LQ5 A;  1AIV A;  2OLB A;  1LGB C;  3QUJ A;  2PVU A;  4X48 A;  3TUS A;  1MPC A;  4R72 A;  4F3B A;  4G8N A;  2RIN A;  1D9V A;  4U1Z A;  2ZNT A;  2QS2 A;  1LAF E;  4ELO A;  4FEC A;  2F7C A;  4KPT A;  4NF4 A;  4NF4 B;  3IFA A;  4AQ4 A;  2G93 A;  4N07 A;  5LDZ A;  1P1Q A;  3K1M A;  2XXX A;  5HBC A;  3KSX A;  1MXW A;  3H6W A;  1MH3 A;  3SER A;  2HXW A;  1MM7 A;  4F19 A;  1FQB A;  1SW2 A;  1LB9 A;  3SEU A;  1NUX A;  1GTK A;  2OWS A;  2DP8 A;  4H46 A;  3O6I A;  1RDX A;  1CB6 A;  4PQJ A;  4PAI A;  1NV7 A;  4YKP A;  5CBR A;  3O9P A;  3OEM A;  4LZ5 A;  4HE1 A;  4P47 A;  4P1E A;  1P99 A;  2PFY A;  1D3K A;  5CMM A;  1NMU A;  1QUI A;  3S2V A;  5I5P A;  4NF0 A;  1B3H A;  1RYO A;  2DXR A;  4R9G A;  3K6X A;  3WAF A;  2F6G A;  3MJN A;  2UVH A;  1N04 A;  3KFM A;  1IEJ A;  4GWU A;  4GL0 A;  1G0H A;  2Q9T A;  2Q8M A;  4MX6 A;  4YKI A;  1SQY A;  3QYT A;  4AS4 A;  3DLN A;  3BBR A;  4O3A A;  1LBX A;  1MRP A;  4HCW A;  4PFT A;  3CHG A;  5IGA A;  3B6T A;  2XXY A;  2Y7R A;  1IME A;  3DEL B;  4ESX A;  3SEW A;  2KLF A;  1OLC A;  4OVQ A;  3FBP A;  1B4Z A;  4YB6 A;  2XX8 A;  2QSX A;  1NUZ A;  1Q35 A;  5LOM A;  3F11 A;  4ZS9 A;  4DE8 A;  3MW0 A;  2P1S A;  1NNT A;  2Y5K A;  1XS5 A;  2ABH A;  4RK9 A;  4MMP A;  4NWC A;  2VD2 A;  4BDM A;  3G7W A;  1H3D A;  4PFU A;  1Y1M A;  3WAE A;  3B6Q A;  4Q5T A;  3JZJ A;  3M3F A;  4H67 A;  4PFY A;  2RF1 A;  2OWZ A;  4RA1 A;  4YZZ A;  1FQC A;  4R73 A;  3W9W A;  2GFE A;  3FAT A;  1NNK A;  4IB2 A;  2DDK A;  1Y9U A;  1XT8 A;  5FTH A;  4ZDM A;  3TZA A;  3LSX A;  4WED A;  3FJG A;  2O1L A;  4GRK A;  2FNC A;  3IOW A;  2QVR A;  1PBQ A;  2ZYN A;  4Q0C A;  4EQB A;  1BLF A;  3PTY A;  5IAI A;  4H8J A;  1MXX A;  4N15 A;  3VDF A;  4BDQ A;  4F1V A;  1B52 A;  1SYH A;  4OFL A;  4F29 A;  3PMX A;  5AA3 A;  5DVJ A;  3GYY A;  1H45 A;  1DK4 A;  4BDL A;  4DI4 B;  4H5G A;  1NV5 A;  2A5T A;  1BIY A;  2A5T B;  4YKJ A;  1GVC A;  1SVX B;  5AA2 D;  1Y1Z A;  2OJT A;  4IO2 A;  1SBP A;  3IL1 B;  4YU0 A;  4PGP A;  3IFC A;  4OVP A;  2H4I A;  3HCQ A;  2DSF A;  1TFD A;  1Y3P A;  4LVQ A;  3HO7 A;  3TCG A;  4PFR A;  1B58 A;  3KN3 A;  3CFX A;  1VR5 A;  3KOT A;  4X9T A;  2AYS A;  1Y3Q A;  2CZI A;  1ELJ A;  1MY1 A;  3MVX A;  1EU8 A;  4HE2 A;  4F2O A;  1WVJ A;  2KR0 A;  4GBV A;  3GBA A;  4JWX A;  4U21 A;  1K9Z A;  2DVC A;  4DZ1 A;  3RPL A;  3RPL B;  3S9L C;  4JBZ A;  1DBZ A;  5L9S A;  2I3V A;  4HXV A;  3RNN A;  2F8D A;  1NV6 A;  4ELR A;  3IX1 A;  4ZEI A;  2OCU A;  3OO6 A;  1POT A;  1QUL A;  4OVJ A;  4RYA A;  3MZ1 A;  1EH3 A;  4K3F A;  1DPE A;  4O7I A;  1MXY A;  4I1D A;  3CIJ A;  4QHQ A;  2QFL A;  4H6D A;  1JW4 A;  1FTK A;  1B51 A;  1A8E A;  1EYI A;  3U8Q A;  4KR5 A;  3VFJ A;  2GHA A;  3OO7 A;  3ILT B;  1B5J A;  5AA1 A;  1JW5 A;  2W7Y A;  2MKZ A;  4JSO A;  2DWI A;  1USY E;  5ET8 A;  1LLS A;  3G3K A;  4N81 A;  2F3D A;  5TU0 A;  3C32 A;  5DYH A;  1N3X A;  5H8F A;  3A3C A;  5H8F B;  2Q8J A;  3SZP A;  2O84 X;  3MP6 A;  2RC7 A;  2YLN A;  5ISU A;  1LBC A;  3CFL A;  2XWI A;  3B50 A;  1Y3N A;  4O3B A;  3LV0 A;  4FE8 A;  1LCF A;  4H45 A;  3FUZ A;  3QSL A;  1MPB A;  3TQL A;  4IO4 A;  4OVT A;  3MP8 A;  4ZE9 A;  2RC8 A;  4EXL A;  2ZNS A;  4O8M A;  1SI1 A;  4PGN A;  3KBR A;  1MQG A;  2RCB A;  4ELQ A;  3D1R A;  2LAO A;  3OSQ A;  3K1P A;  2CZK A;  1NUW A;  4FED A;  4X8R A;  3IOV A;  2HAU A;  4DIG A;  4Q8R A;  2ZZX A;  1IUD A;  1FRP A;  2P0S A;  4JVI A;  1QKA A;  2F78 A;  1FBF A;  4I40 A;  4MAG A;  3PGF A;  2F5X A;  3VE1 B;  4XXU A;  4F39 A;  2ZZW A;  1FBC A;  3MVW A;  1NV1 A;  3FV2 A;  4NMY A;  3MC2 A;  2QVU A;  4MLQ A;  5H8S A;  1MPD A;  4P0G A;  3N26 A;  5IZ3 A;  5IZ3 B;  1P1O A;  4OYV A;  1FPF A;  1TFA A;  2XX7 A;  1J1N A;  2V25 A;  4P3L A;  3I5O A;  4ZZE A;  3HFU A;  2HEU A;  5EQ9 A;  2FBP A;  1Q9D A;  3SET A;  3QK6 A;  3AXF A;  4M1V A;  3T0J A;  4OMB A;  4Z0I A;  1B7Z A;  1B7U A;  2VP1 A;  1FPG A;  3QUF A;  3FD3 A;  3IK6 B;  2DS9 A;  1DSN A;  3PMW A;  2Z23 A;  4DLD A;  2XXU A;  1M5C A;  3K00 A;  3OD7 A;  3G3J A;  4OVS A;  4U4S A;  4YMB A;  2CEX A;  3EHS A;  1NUY A;  1MDP 1;  2NXO A;  3KC0 A;  4GWS A;  1KWH A;  5DT6 A;  3T9H B;  4RXL A;  1M5F A;  3ILU B;  4YB7 A;  2Y5L A;  2ESN A;  3FXU A;  1MY3 A;  4N8G A;  3FV1 A;  3IOT A;  4M4G A;  3CI8 A;  4GXS B;  1ZTY A;  1O7T A;  1N7W A;  3G3I A;  3PUZ E;  4NF6 A;  4NF6 B;  3O29 A;  1NI9 A;  4N17 A;  3TKD A;  2G29 A;  1WOD A;  1QW0 A;  4DCY A;  1IXI A;  2H25 A;  1HSL A;  2FYI A;  2Y7I A;  1JQF A;  4JVC A;  2FIX A;  3H6V A;  4ONY A;  4P11 A;  3T9X B;  4N13 A;  4OA4 A;  3ONM A;  5K2Y A;  1DCU A;  1FBE A;  2Z8F A;  3C35 A;  3S9M C;  4NED A;  5I57 A;  3IOU A;  5I57 B;  4RPO A;  2H5Y A;  1B7H A;  4QBA A;  5A5X A;  1UIV A;  5A5X B;  3S9E A;  1LAH E;  2HHM A;  3PD9 A;  4P1L A;  1UQW A;  3LR1 A;  3LSL A;  1I6B A;  2Y7P A;  4AB5 A;  1M5D A;  4POX A;  4LAT A;  3EKI A;  3RQT A;  1Q1K A;  4OWD A;  3IB2 A;  5L9O A;  2B4L A;  1B1X A;  3CR9 A;  3VLV A;  2O7I A;  3T66 A;  4KXP A;  4I3Y A;  3B6W A;  3FVG A;  1B0H A;  4EUO A;  1VDW A;  1MXV A;  3H7M A;  3OSR A;  2I4B A;  4GLI A;  1R9L A;  4DDD A;  1XVY A;  3SES A;  1GV8 A;  1O63 A;  4PAF A;  5EYG A;  3SEY A;  4TLL B;  4MFI A;  1P1W A;  1VFD A;  5I3S A;  1SW4 A;  2OK2 A;  4JVD A;  3OEK A;  3H6T A;  3ZS6 A;  1FQF A;  3NOH A;  5FTI A;  1EYJ A;  4O3C A;  2QRY A;  4DCX A;  4DXU A;  1NNF A;  2KQZ A;  1IMD A;  3P7I A;  2QS1 A;  1A54 A;  4PBQ A;  3HST A;  3OXN A;  3PPQ A;  2A5S A;  3FJM A;  1A99 A;  1ZU0 A;  3KOS A;  2ANJ A;  5CRY A;  1MY0 A;  2VPN A;  1BP5 A;  3BFU A;  4I9D A;  3FXB A;  2V3Q A;  4GL8 A;  1URD A;  1Y20 A;  5CM6 A;  4IY6 A;  3RTF B;  1DPP A;  4KYD A;  3V5A A;  3RYD A;  1LBW A;  4TQU Q;  4R75 A;  1ANF A;  1LBV A;  3IO4 A;  2X7P A;  3EQ1 A;  3IOR A;  4IO5 A;  2DVZ A;  1TXF A;  4IGR A;  3VLU A;  1LBZ A;  4DXB A;  1LAG E;  1UIU A;  4IO3 A;  3MPK A;  2GHB A;  5CBS A;  4OES A;  4RJZ A;  3KEI A;  4H8I A;  4ELP A;  2WBB A;  4G68 C;  3SEX A;  4N6P A;  1R1N A;  3KJ7 A;  2HAV A;  2XWO A;  5ET7 A;  4MNC A;  4MEV A;  3N6T A;  3IR1 A;  5B70 A;  2CZL A;  5EQ8 A;  3A3U A;  1FPK A;  3KC1 A;  1PBP A;  2XXQ A;  1Y4T A;  5DEX A;  2Z8E A;  5DEX B;  3MPL A;  4ND9 A;  1FPE A;  1XC1 A;  1HSJ A;  4R74 A;  5F7V A;  5I56 A;  5I56 B;  3O66 A;  5EYF A;  2DXY A;  3MVY A;  2P3V A;  4N6K A;  1RDZ A;  1LFI A;  3PPR A;  4R2B A;  2PT1 A;  3PUY E;  4IGT A;  4YKK A;  5FHM A;  5H8H A;  5H8H B;  2V3T A;  3MST A;  3U65 A;  3HPI A;  3Q27 A;  4QFP A;  1MY4 A;  4IO7 A;  5ICQ A;  3DP4 A;  2DWJ A;  4GWY A;  5ITO A;  1IMB A;  1NV2 A;  4NWD A;  3K4U A;  2R6G E;  4HTG A;  4RY1 A;  3RPW A;  4UAC A;  4C1T A;  1IMF A;  1Y4C A;  3R26 A;  4QSD A;  3K02 A;  4OXV A;  1NNP A;  2XXP A;  2P3N A;  1MXU A;  1B3E A;  1PDA A;  1NV4 A;  3TEL A;  3UGW A;  3K6V A;  2Y84 A;  3H4Z A;  5AE4 A;  3EN3 A;  4OEV A;  3QXM A;  2IEE A;  2WYK A;  3PPP A;  3KZG A;  3GXA A;  1IIT A;  4XKR A;  2O68 A;  1ZMG A;  5F1Q A;  2PCR A;  1AL3 A;  3T9V A;  4FOR A;  4E0X A;  4OEN A;  3OEL A;  3PUV E;  2AL4 A;  2HZL A;  3UIF A;  1NKX A;  1FTJ A;  3PUX E;  4UAB A;  1ZIU A;  4EXK A;  5TP9 A;  5TP9 B;  1PB9 A;  3PU5 A;  1NH8 A;  3E78 A;  4P0I A;  3CSB A;  4GQO A;  1FQE A;  4ZEB A;  1G0I A;  1MY2 A;  4NF8 A;  4NF8 B;  4NAP A;  1FW0 A;  5A5L A;  4F3S A;  2I6E A;  2X7Q A;  4GWZ A;  5KDT A;  5KDT B;  2VT5 A;  4N8Y A;  2PX1 A;  3UA8 A;  2X26 A;  1PB8 A;  1UTB A;  1UTB B;  3EPE A;  1URG A;  2XA5 A;  4F3P A;  1I69 A;  5L8D A;  3V89 B;  2GRV A;  3EHT A;  1N76 A;  5JEI A;  3RTW B;  1L5T A;  3ZKL A;  3EHU A;  4ZZA A;  3KGC A;  3JYR A;  2QMW A;  3E13 X;  4WXJ A;  1LBY A;  1MH4 A;  3B8B A;  3SKP A;  1OVT A;  5DTB A;  1M5B A;  5DVI A;  2ALU A;  2QS3 A;  4ZEC A;  2PYY A;  3LBS A;  4PFW A;  3PPO A;  3GBB A;  4NF5 A;  2Q2A A;  4NF5 B;  5TPA A;  5TPA B;  1O64 A;  4LP2 B;  3IJX B;  1VFE A;  1N7X A;  4KYE A;  5EHS A;  3RUM A;  4MHF A;  4FJP A;  2R71 A;  2VHA A;  1D9Y A;  2DWH A;  3HN0 A;  3VXB A;  3DM0 A;  4PE5 B;  5IZZ A;  2Q88 A;  2H99 A;  4GWW A;  2UVG A;  4QRZ A;  4ZED A;  4GD5 A;  3N94 A;  4NHB A;  1YZ0 A;  2DOJ A;  1NL5 A;  5L9M A;  1PEB A;  3FIR A;  3TCH A;  5T3J A;  1N0T A;  4GBW A;  5CMB A;  3W15 C;  3MBP A;  4PE3 A;  3TPA A;  3FJ7 A;  1JET A;  3PD8 A;  3OEN A;  3O6G A;  2Z8D A;  1SPI A;  3TTR A;  3MZB A;  3O6H A;  2R8T A;  4OZ9 A;  4GX6 A;  4POW A;  4KCC A;  1AWB A;  4YMA A;  2PFZ A;  1FBP A;  3L6H A;  4F1U A;  5B7D A;  2DYX A;  4U2R A;  3T22 A;  4MIJ A;  4OER A;  3VXC A;  2YJP A;  4XIG Q;  3R6U A;  1H44 A;  4XKP A;  2UYE A;  2VPO A;  4MBP A;  5CC2 A;  3RT6 B;  3R7X A;  1B9J A;  3H03 A;  3I3V A;  2JJK A;  2PBW A;  1B6H A;  4XTC Q;  3A29 A;  3PPN A;  3TAJ A;  4LA9 A;  4F3G A;  4HS7 A;  1YPN A;  5JK4 A;  1XOC A;  3HHF A;  1B5I A;  3U92 A;  4Q30 B;  3V8X B;  2WEF A;  5I84 A;  1MQD A;  4LZ8 A;  4GWX A;  4NTL A;  4IY5 A;  4PFB A;  3T9U A;  2HPG A;  2FIE A;  2O6A A;  4UA8 A;  2ZYO A;  2DQV A;  2HXR A;  1MM6 A;  2D21 A;  5EHM A;  4MLV A;  2CEY A;  3TEP A;  3UK4 A;  1YTV A;  3G3F A;  3M3K A;  1B0L A;  3ODB A;  2FHY A;  4PTK A;  1AH5 A;  5AA4 A;  5AA4 B;  3U94 A;  4OHN A;  1UTH A;  1UTH B;  3O97 A;  1FJ9 A;  1R6Z A;  5AA2 A;  5AA2 B;  1FTM A;  2Y7K A;  2IA4 A;  1VSO A;  2HZK A;  3I6V A;  4QFO A;  4H1X A;  3C31 A;  2VGQ A;  5F24 A;  2DWA A;  3IJO B;  3CRB A;  2UVJ A;  2OWT A;  4MNI A;  1ATG A;  1H76 A;  1JP4 A;  4U4X A;  3D4G A;  1AMF A;  3LSF B;  4PF6 A;  3O28 A;  1LAX A;  1S50 A;  1FPB A;  3T1B A;  1H43 A;  1R9Q A;  1YXI A;  3H6U A;  4PDD A;  4ESW A;  1A8F A;  2E0S A;  1SW5 A;  4NQ8 A;  4RPN A;  1FTL A;  1LST A;  3MAM A;  4N6D A;  1LB8 A;  3U1O A;  2PT2 A;  1US5 A;  5HM4 B;  3PV0 E;  1QKB A;  4NG7 A;  4NGU A;  5IZ1 A;  1JNF A;  1B1H A;  5I2K A;  5I2K B;  4BDR A;  5BWJ A;  4HCY A;  2DE3 A;  1JVY A;  2O7U A;  3RGY A;  1PB7 A;  2B3F A;  2H9B A;  3TTM A;  1DMB A;  4O94 A;  1RYX A;  1I6A A;  3ZKK A;  5IKB A;  2UXA A;  4OVR A;  4XKN A;  1QUK A;  2HCA A;  2XWV A;  4OFJ A;  1N84 A;  1GGG A;  3KSJ A;  4P8B A;  2B65 A;  1XVX A;  5I58 A;  3E79 A;  5I58 B;  2UYF A;  4OET A;  3A09 A;  3G3H A;  1FTA A;  4E0W A;  1IZ1 A;  2OZZ A;  4QSE A;  2V4C A;  2P2A A;  2XXH A;  2Z22 A;  4I8C A;  2HFB A;  4GIZ A;  3BIG A;  1FPJ A;  1FCK A;  4L17 A;  3ROJ A;  4QSC A;  2I3W A;  4F1Y A;  2ZZV A;  1NV3 A;  3JV9 A;  4EDP A;  2ZMB A;  3CG3 A;  3V83 A;  2Q74 A;  4WEP A;  1FSA A;  3KN7 A;  2V93 A;  3TDJ A;  3KJT A;  3TMG A;  3EF7 A;  3QIM A;  4QFL A;  4F2Q A;  1YAE A;  3DP8 A;  2WBD A;  2BJJ X;  4YB5 A;  1OLA A;  1XI6 A;  3KN8 A;  5H8N A;  5H8N B;  3QAX A;  2NWJ A;  3FXR A;  4LZ7 A;  2I0C A;  2GQ1 A;  1IXH A;  1IQ7 A;  3PUW E;  4PDH A;  4OQO A;  4EF2 A;  2F6P A;  3MVZ A;  3E4R A;  1LBB A;  1N3W A;  3TTK A;  4IO6 A;  4QF9 A;  4LUB A;  2XD3 A;  3C34 A;  3FVN A;  2XXW A;  1IIW A;  1TWY A;  4PAK A;  3MP1 A;  4R2F A;  2F3B A;  4I3E A;  4KCD A;  4ZEF A;  1B2H A;  4HW8 A;  2XXI A;  2F35 A;  4PP0 A;  1FPI A;  3VVF A;  3OO9 A;  4LN5 A;  5ITP A;  2QS4 A;  3OOA A;  2RCA A;  3C33 A;  1KZ8 A;  4PFI A;  2VOZ A;  3TTN A;  1T0K A;  1SW1 A;  5I2N A;  5I2N B;  1A7L A;  3ECR A;  1JEV A;  3RN8 A;  3PMV A;  1BTJ A;  3UP9 A;  3TOD A;  4PCD A;  3KG2 A;  3LSW A;  1TT1 A;  3CFZ A;  4KFQ A;  1B3G A;  3D4C A;  4IR8 A;  4OEU A;  4PF8 A;  4XFE A;  1DOT A;  1D4N A;  1POY 1;  3S4U A;  1LEV A;  4R9F A;  3GLB A;  4BDN A;  1DTG A;  3H3G A;  3HV1 A;  4DXC A;  2RKM A;  2GH9 A;  1YYZ A;  1PC3 A;  4DI3 D;  5FHN A;  3K1N A;  3CG1 A;  4JWY A;  4ECF A;  4AB6 A;  4FBP A;  5LTC A;  1P1U A;  3GZG A;  2QJE A;  4R6Y A;  5HPQ A;  5EQA A;  4GX4 A;  4OTE A;  2F97 A;  3K01 A;  1USY H;  3QMF A;  2NUV A;  3KBZ A;  1JVX A;  3MWB A;  1FTO A;  4YAH X;  4AS5 A;  4F18 A;  2XXR A;  1JW1 A;  1LCT A;  2WYP A;  4PET A;  1QGX A;  3VVE A;  4GF8 A;  4TLM B;  1SD3 A;  3LC8 A;  1MQH A;  4FIM A;  1MQJ A;  2QL3 A;  4G61 A;  2ONK E;  2L5V A;  5IM2 A;  1B46 A;  1SYI A;  2M8C A;  2ZYK A;  2AL5 A;  1OVB A;  3OO8 A;  1ZLQ A;  1FQA A;  5EYH A;  3K6U A;  1IXC A;  1A55 A;  3Q26 A;  1NH7 A;  1A40 A;  4HE0 A;  3U72 A;  3FAS A;  1FPL A;  2I48 A;  4NX1 A;  4MCO A;  1CNQ A;  4GVO A;  3UN6 A;  4GXA A;  1EZO A;  3BKI B;  2ONR A;  3LUZ A;  4G68 A;  3RY3 A;  4G68 B;  3M3L A;  3CVG A;  2XXV A;  4X04 A;  2D5W A;  2I58 A;  3MUQ A;  1MXZ A;  1JEU A;  5I7I A;  2XD2 A;  5ELV A;  5ICT A;  5ET6 A;  5EQ7 A;  1URS A;  4BLA A;  4O7M A;  1GR2 A;  2AIX A;  3N6U A;  2O1M A;  4PC9 A;  1EYK A;  4RK2 A;  4XKQ A;  1FJ6 A;  2V3U A;  4G77 A;  3TYH A;  1FBD A;  1IXG A;  3SEV A;  1SI0 A;  3B7D A;  2BJI A;  4MF3 A;  2ZNU A;  4WKM A;  4C1U A;  5H8Q A;  5H8Q B;  3FVK A;  3VV5 A;  3DP6 A;  1YCJ A;  5M2V A;  2DE4 A;  1QUJ A;  1AOV A;  4X1B A;  2Q2C A;  4MJO A;  2OBG A;  2FVZ A;  1M5E A;  2WKY A;  2F34 A;  3Q25 A;  1S7Y A;  3G3G A;  4JXI A;  4LQ2 A;  1B3L A;  1B40 A;  3TCF A;  3Q29 A;  1B32 A;  4F22 A;  4P9K A;  5CMK A;  4MH5 A;  3T93 B;  3ZSF A;  2CZH A;  4QFK A;  1B05 A;  2I0B A;  4U23 A;  2UVI A;  2QPQ A;  3LUY A;  1B3F A;  1OMP A;  4NE4 A; 
#chains in the Genus database with same CATH homology
 4JSD A;  2O51 A;  1I6Q A;  5CI5 A;  2REG A;  1LFG A;  3HHG A;  3MZ9 A;  1DTZ A;  3K2D A;  2V84 A;  1ZKB A;  3K0V A;  5KCJ A;  5KCJ B;  3U93 A;  4X1D A;  1NFT A;  1SDX A;  1OQG A;  1MDQ A;  2F7B A;  4GFR A;  3K6W A;  1VE4 A;  5K2X A;  4U1O A;  2F7A A;  1II5 A;  3E9X A;  3IO6 A;  2THI A;  2H98 A;  3THI A;  2RC9 A;  2NVU B;  2YPN A;  1OQH A;  2D3I A;  4G8M A;  2E1S A;  3RT8 A;  3FVO A;  2O69 A;  4LON B;  3FXQ A;  4TOZ A;  1XHY A;  2B3B A;  5I59 A;  5I59 B;  4G8H A;  1QVS A;  3C4M A;  1MG1 A;  3CSG A;  4EQ9 A;  1F9B A;  2QMX A;  4OFO A;  4THI A;  4KYS A;  4KI0 E;  2I49 A;  3TFL A;  4ISU A;  1MQI A;  4R6K A;  3T96 B;  2CMO A;  1Z7M E;  4BDO A;  1CE2 A;  3RLF E;  1EZ9 A;  3VVD A;  4R6H A;  4F31 B;  3BFT A;  4GWO A;  4KD5 A;  4EQ7 A;  2XHD A;  4FAT A;  2F36 A;  2I4C A;  1HSE A;  2XX9 A;  3USD A;  3O2A A;  4Z7E A;  4KQP A;  4I62 A;  4EF1 A;  4ZE8 A;  3C9H A;  4FAJ A;  1B5H A;  4YIC A;  1BKA A;  3N5L A;  5DVF A;  4H5F A;  4JDF A;  3UOR A;  4RNS A;  1S9T A;  2DE2 A;  3IAZ A;  1B4H A;  1Z7N E;  5FHO A;  5BUU A;  2Q89 A;  4ZEK A;  4JWO A;  2FA7 A;  3M8U A;  1FQD A;  3TQW A;  4GOT A;  1LFH A;  1ZBM A;  2Y7W A;  1RKM A;  3IB1 A;  3SDF A;  3W9V A;  4QFN A;  3FGS A;  1US4 A;  4H0W A;  2REJ A;  2PMS A;  1WDN A;  3C36 A;  5KZT A;  4FEB A;  2NOO A;  3L6G A;  4G2Z A;  2XXT A;  2ZYM A;  3MQ9 A;  4C0R A;  1EZP A;  3H06 B;  4G4P A;  4JB7 A;  3E3K A;  5J1D A;  5JTY A;  5JTY B;  3TTL A;  3OMB A;  2HQ0 A;  1P1N A;  5CMC A;  1OIB A;  4U22 A;  3IB0 A;  1QJM A;  1MS7 A;  3S9N C;  3VLW A;  3FZV A;  2R9J A;  4KHZ E;  1ZJL A;  2ONS A;  3Q28 A;  4H65 A;  2ZXT A;  2VD3 A;  4LQ5 A;  1AIV A;  2OLB A;  1LGB C;  3QUJ A;  2PVU A;  4X48 A;  3TUS A;  1MPC A;  4R72 A;  4F3B A;  4G8N A;  2RIN A;  1D9V A;  4U1Z A;  2ZNT A;  2QS2 A;  1LAF E;  4ELO A;  4FEC A;  2F7C A;  4KPT A;  4NF4 A;  4NF4 B;  4AQ4 A;  2G93 A;  4N07 A;  1P1Q A;  3K1M A;  2XXX A;  5HBC A;  3KSX A;  1MXW A;  3H6W A;  1MH3 A;  3SER A;  2HXW A;  1MM7 A;  4F19 A;  1FQB A;  1SW2 A;  1LB9 A;  3SEU A;  2OWS A;  1GTK A;  2DP8 A;  3O6I A;  1CB6 A;  4PQJ A;  4YKP A;  5CBR A;  3O9P A;  3OEM A;  4LZ5 A;  1P99 A;  1D3K A;  5CMM A;  1NMU A;  1QUI A;  3S2V A;  1B3H A;  1RYO A;  2DXR A;  4R9G A;  3K6X A;  3WAF A;  2F6G A;  3MJN A;  2UVH A;  1N04 A;  3KFM A;  1IEJ A;  4GL0 A;  2Q9T A;  4YKI A;  1SQY A;  3QYT A;  3DLN A;  3BBR A;  4O3A A;  1MRP A;  4HCW A;  4PFT A;  3B6T A;  2XXY A;  2Y7R A;  3DEL B;  4ESX A;  3SEW A;  2KLF A;  1OLC A;  1B4Z A;  4YB6 A;  2XX8 A;  2QSX A;  1Q35 A;  5LOM A;  3F11 A;  4ZS9 A;  4DE8 A;  3MW0 A;  2P1S A;  1NNT A;  1XS5 A;  2ABH A;  4RK9 A;  4NWC A;  2VD2 A;  4BDM A;  3G7W A;  1H3D A;  4PFU A;  1Y1M A;  3WAE A;  3B6Q A;  4Q5T A;  3JZJ A;  3M3F A;  4H67 A;  4PFY A;  2RF1 A;  4RA1 A;  4YZZ A;  1FQC A;  4R73 A;  3W9W A;  2GFE A;  3FAT A;  1NNK A;  4IB2 A;  1Y9U A;  1XT8 A;  5FTH A;  4ZDM A;  3TZA A;  3LSX A;  4WED A;  3FJG A;  2O1L A;  4GRK A;  2FNC A;  3IOW A;  2ZYN A;  1PBQ A;  4Q0C A;  4EQB A;  1BLF A;  5IAI A;  4H8J A;  1MXX A;  3VDF A;  4F1V A;  4BDQ A;  1B52 A;  1SYH A;  4OFL A;  4F29 A;  3PMX A;  5AA3 A;  5DVJ A;  1H45 A;  4BDL A;  4H5G A;  2A5T A;  1BIY A;  2A5T B;  4YKJ A;  1GVC A;  1SVX B;  5AA2 D;  1Y1Z A;  2OJT A;  4IO2 A;  1SBP A;  3IL1 B;  4YU0 A;  2H4I A;  3HCQ A;  2DSF A;  1TFD A;  1Y3P A;  4LVQ A;  3HO7 A;  3TCG A;  1B58 A;  3KN3 A;  3CFX A;  1VR5 A;  3KOT A;  4X9T A;  2AYS A;  1Y3Q A;  1ELJ A;  1MY1 A;  3MVX A;  1EU8 A;  4F2O A;  1WVJ A;  3GBA A;  4JWX A;  4U21 A;  2DVC A;  4DZ1 A;  3S9L C;  4JBZ A;  5L9S A;  2I3V A;  3RNN A;  2F8D A;  4ELR A;  3IX1 A;  4ZEI A;  2OCU A;  3OO6 A;  1POT A;  1QUL A;  4OVJ A;  4RYA A;  3MZ1 A;  1EH3 A;  4K3F A;  1DPE A;  1MXY A;  4I1D A;  3CIJ A;  4QHQ A;  4H6D A;  1JW4 A;  1FTK A;  1B51 A;  1A8E A;  3U8Q A;  4KR5 A;  3VFJ A;  2GHA A;  3OO7 A;  3ILT B;  1B5J A;  5AA1 A;  1JW5 A;  2W7Y A;  4JSO A;  2DWI A;  1USY E;  1LLS A;  3G3K A;  5TU0 A;  3C32 A;  5DYH A;  1N3X A;  5H8F A;  3A3C A;  5H8F B;  2Q8J A;  2O84 X;  3MP6 A;  2RC7 A;  2YLN A;  5ISU A;  1LBC A;  3CFL A;  1Y3N A;  4O3B A;  4FE8 A;  1LCF A;  3FUZ A;  3QSL A;  1MPB A;  3TQL A;  4IO4 A;  3MP8 A;  4ZE9 A;  2RC8 A;  4EXL A;  2ZNS A;  1SI1 A;  3KBR A;  1MQG A;  2RCB A;  4ELQ A;  2LAO A;  3OSQ A;  3K1P A;  4FED A;  3IOV A;  2HAU A;  4DIG A;  4Q8R A;  1IUD A;  2P0S A;  1QKA A;  2F78 A;  3PGF A;  2F5X A;  3VE1 B;  4XXU A;  4F39 A;  3MVW A;  3FV2 A;  4NMY A;  3MC2 A;  4MLQ A;  5H8S A;  1MPD A;  4P0G A;  3N26 A;  1P1O A;  4OYV A;  1TFA A;  2XX7 A;  1J1N A;  2V25 A;  3I5O A;  4ZZE A;  2HEU A;  3SET A;  3QK6 A;  3AXF A;  4M1V A;  4OMB A;  4Z0I A;  1B7Z A;  1B7U A;  2VP1 A;  3QUF A;  3FD3 A;  3IK6 B;  2DS9 A;  1DSN A;  3PMW A;  2Z23 A;  4DLD A;  2XXU A;  1M5C A;  3K00 A;  3OD7 A;  3G3J A;  4U4S A;  4YMB A;  3EHS A;  1MDP 1;  2NXO A;  1KWH A;  5DT6 A;  3T9H B;  4RXL A;  1M5F A;  3ILU B;  4YB7 A;  2ESN A;  3FXU A;  1MY3 A;  3FV1 A;  3IOT A;  4M4G A;  3CI8 A;  4GXS B;  1ZTY A;  1O7T A;  1N7W A;  3G3I A;  3PUZ E;  4NF6 A;  4NF6 B;  3O29 A;  3TKD A;  2G29 A;  1WOD A;  1QW0 A;  4DCY A;  1IXI A;  2H25 A;  1HSL A;  2FYI A;  2Y7I A;  1JQF A;  3H6V A;  4ONY A;  4P11 A;  3T9X B;  4N13 A;  3ONM A;  5K2Y A;  2Z8F A;  3C35 A;  3S9M C;  4NED A;  5I57 A;  3IOU A;  5I57 B;  4RPO A;  2H5Y A;  1B7H A;  5A5X A;  1UIV A;  5A5X B;  3S9E A;  1LAH E;  3PD9 A;  1UQW A;  3LR1 A;  3LSL A;  1I6B A;  2Y7P A;  4AB5 A;  1M5D A;  4POX A;  4LAT A;  3RQT A;  1Q1K A;  4OWD A;  3IB2 A;  5L9O A;  1B1X A;  3CR9 A;  3VLV A;  2O7I A;  3T66 A;  3B6W A;  3FVG A;  1B0H A;  4EUO A;  1MXV A;  3H7M A;  3OSR A;  2I4B A;  4GLI A;  1R9L A;  4DDD A;  1XVY A;  3SES A;  1GV8 A;  1O63 A;  3SEY A;  4TLL B;  4MFI A;  1P1W A;  1VFD A;  1SW4 A;  2OK2 A;  3OEK A;  3H6T A;  3ZS6 A;  1FQF A;  5FTI A;  4O3C A;  2QRY A;  4DCX A;  4DXU A;  1NNF A;  3P7I A;  2QS1 A;  1A54 A;  3HST A;  3OXN A;  3PPQ A;  2A5S A;  3FJM A;  1A99 A;  1ZU0 A;  3KOS A;  2ANJ A;  5CRY A;  1MY0 A;  1BP5 A;  3BFU A;  4I9D A;  2V3Q A;  4GL8 A;  1URD A;  1Y20 A;  5CM6 A;  4IY6 A;  3RTF B;  1DPP A;  4KYD A;  3V5A A;  4TQU Q;  4R75 A;  1ANF A;  3IO4 A;  2X7P A;  3EQ1 A;  3IOR A;  4IO5 A;  2DVZ A;  1TXF A;  4IGR A;  3VLU A;  4DXB A;  1LAG E;  1UIU A;  4IO3 A;  3MPK A;  2GHB A;  5CBS A;  4OES A;  4RJZ A;  3KEI A;  4H8I A;  4ELP A;  4G68 C;  3SEX A;  4N6P A;  1R1N A;  3KJ7 A;  2HAV A;  3N6T A;  3IR1 A;  5B70 A;  2CZL A;  3A3U A;  1PBP A;  2XXQ A;  1Y4T A;  5DEX A;  2Z8E A;  5DEX B;  3MPL A;  4ND9 A;  1XC1 A;  1HSJ A;  4R74 A;  5F7V A;  5I56 A;  5I56 B;  3O66 A;  5EYF A;  2DXY A;  3MVY A;  1LFI A;  3PPR A;  4R2B A;  2PT1 A;  3PUY E;  4IGT A;  4YKK A;  5FHM A;  5H8H A;  5H8H B;  2V3T A;  3HPI A;  3Q27 A;  4QFP A;  1MY4 A;  4IO7 A;  5ICQ A;  3DP4 A;  2DWJ A;  5ITO A;  4NWD A;  3K4U A;  2R6G E;  4HTG A;  4RY1 A;  3RPW A;  4UAC A;  4C1T A;  1Y4C A;  3R26 A;  4QSD A;  3K02 A;  4OXV A;  1NNP A;  2XXP A;  1MXU A;  1B3E A;  1PDA A;  3TEL A;  3UGW A;  3K6V A;  2Y84 A;  3H4Z A;  5AE4 A;  3EN3 A;  4OEV A;  3QXM A;  2IEE A;  3PPP A;  3KZG A;  3GXA A;  1IIT A;  4XKR A;  2O68 A;  1ZMG A;  5F1Q A;  1AL3 A;  3T9V A;  4FOR A;  4E0X A;  4OEN A;  3OEL A;  3PUV E;  2AL4 A;  2HZL A;  3UIF A;  1NKX A;  1FTJ A;  3PUX E;  1ZIU A;  4EXK A;  5TP9 A;  5TP9 B;  1PB9 A;  3PU5 A;  1NH8 A;  4P0I A;  3CSB A;  4GQO A;  1FQE A;  4ZEB A;  1MY2 A;  4NF8 A;  4NF8 B;  1FW0 A;  4F3S A;  2I6E A;  2X7Q A;  5KDT A;  5KDT B;  2PX1 A;  3UA8 A;  2X26 A;  1PB8 A;  1UTB A;  1UTB B;  3EPE A;  1URG A;  4F3P A;  1I69 A;  5L8D A;  3V89 B;  2GRV A;  3EHT A;  1N76 A;  5JEI A;  3RTW B;  1L5T A;  3ZKL A;  3EHU A;  4ZZA A;  3KGC A;  3JYR A;  2QMW A;  3E13 X;  4WXJ A;  1MH4 A;  3SKP A;  1OVT A;  5DTB A;  1M5B A;  5DVI A;  2ALU A;  2QS3 A;  4ZEC A;  2PYY A;  3LBS A;  4PFW A;  3PPO A;  3GBB A;  4NF5 A;  2Q2A A;  4NF5 B;  5TPA A;  5TPA B;  1O64 A;  4LP2 B;  3IJX B;  1VFE A;  1N7X A;  4KYE A;  5EHS A;  3RUM A;  4FJP A;  2R71 A;  2VHA A;  1D9Y A;  2DWH A;  3HN0 A;  3VXB A;  3DM0 A;  4PE5 B;  2Q88 A;  2H99 A;  2UVG A;  4QRZ A;  4ZED A;  4GD5 A;  3N94 A;  2DOJ A;  1NL5 A;  5L9M A;  1PEB A;  3FIR A;  3TCH A;  1N0T A;  5CMB A;  3W15 C;  3MBP A;  3TPA A;  3FJ7 A;  1JET A;  3PD8 A;  3OEN A;  3O6G A;  2Z8D A;  3TTR A;  3MZB A;  3O6H A;  4OZ9 A;  4POW A;  4KCC A;  4YMA A;  3L6H A;  4F1U A;  5B7D A;  2DYX A;  4U2R A;  3T22 A;  4OER A;  3VXC A;  2YJP A;  4XIG Q;  3R6U A;  1H44 A;  4XKP A;  2UYE A;  4MBP A;  5CC2 A;  3RT6 B;  3R7X A;  1B9J A;  3H03 A;  3I3V A;  2PBW A;  1B6H A;  4XTC Q;  3PPN A;  3TAJ A;  4LA9 A;  4F3G A;  4HS7 A;  1YPN A;  5JK4 A;  1XOC A;  3HHF A;  1B5I A;  3U92 A;  4Q30 B;  3V8X B;  5I84 A;  1MQD A;  4LZ8 A;  4NTL A;  4IY5 A;  3T9U A;  2O6A A;  4UA8 A;  2ZYO A;  2DQV A;  1MM6 A;  2D21 A;  5EHM A;  4MLV A;  3TEP A;  3UK4 A;  1YTV A;  3G3F A;  3M3K A;  1B0L A;  3ODB A;  1AH5 A;  5AA4 A;  5AA4 B;  3U94 A;  4OHN A;  1UTH A;  1UTH B;  3O97 A;  1R6Z A;  5AA2 A;  5AA2 B;  1FTM A;  2Y7K A;  2IA4 A;  1VSO A;  2HZK A;  3I6V A;  4QFO A;  4H1X A;  3C31 A;  2VGQ A;  2DWA A;  3IJO B;  3CRB A;  2UVJ A;  2OWT A;  1ATG A;  1H76 A;  4U4X A;  3D4G A;  1AMF A;  3LSF B;  3O28 A;  1LAX A;  1S50 A;  1H43 A;  1R9Q A;  3H6U A;  4ESW A;  1A8F A;  2E0S A;  1SW5 A;  4RPN A;  1FTL A;  1LST A;  3MAM A;  1LB8 A;  3U1O A;  2PT2 A;  1US5 A;  5HM4 B;  3PV0 E;  1QKB A;  1JNF A;  1B1H A;  5I2K A;  5I2K B;  4BDR A;  5BWJ A;  4HCY A;  2DE3 A;  1JVY A;  2O7U A;  3RGY A;  1PB7 A;  2B3F A;  2H9B A;  3TTM A;  1DMB A;  1RYX A;  1I6A A;  3ZKK A;  5IKB A;  2UXA A;  4XKN A;  1QUK A;  2HCA A;  4OFJ A;  1N84 A;  1GGG A;  3KSJ A;  2B65 A;  1XVX A;  5I58 A;  5I58 B;  2UYF A;  4OET A;  3A09 A;  3G3H A;  4E0W A;  1IZ1 A;  2OZZ A;  4QSE A;  2P2A A;  2XXH A;  2Z22 A;  4I8C A;  2HFB A;  4GIZ A;  1FCK A;  4L17 A;  4QSC A;  2I3W A;  4F1Y A;  3JV9 A;  4EDP A;  2ZMB A;  3CG3 A;  3V83 A;  4WEP A;  3KN7 A;  2V93 A;  3TDJ A;  3KJT A;  3TMG A;  3EF7 A;  3QIM A;  4QFL A;  4F2Q A;  1YAE A;  3DP8 A;  2BJJ X;  4YB5 A;  1OLA A;  3KN8 A;  5H8N A;  5H8N B;  3QAX A;  2NWJ A;  3FXR A;  4LZ7 A;  2I0C A;  1IXH A;  1IQ7 A;  3PUW E;  4OQO A;  4EF2 A;  2F6P A;  3MVZ A;  3E4R A;  1LBB A;  1N3W A;  3TTK A;  4IO6 A;  4QF9 A;  4LUB A;  2XD3 A;  3C34 A;  3FVN A;  2XXW A;  1IIW A;  1TWY A;  3MP1 A;  4R2F A;  4KCD A;  4ZEF A;  1B2H A;  4HW8 A;  2XXI A;  2F35 A;  4PP0 A;  3VVF A;  3OO9 A;  5ITP A;  2QS4 A;  3OOA A;  2RCA A;  3C33 A;  2VOZ A;  3TTN A;  1T0K A;  1SW1 A;  5I2N A;  5I2N B;  1A7L A;  3ECR A;  1JEV A;  3RN8 A;  3PMV A;  1BTJ A;  3UP9 A;  3TOD A;  3KG2 A;  3LSW A;  1TT1 A;  3CFZ A;  4KFQ A;  1B3G A;  3D4C A;  4OEU A;  1DOT A;  1D4N A;  1POY 1;  3S4U A;  4R9F A;  3GLB A;  4BDN A;  1DTG A;  3H3G A;  3HV1 A;  4DXC A;  2RKM A;  2GH9 A;  1PC3 A;  5FHN A;  3K1N A;  3CG1 A;  4JWY A;  4ECF A;  4AB6 A;  1P1U A;  3GZG A;  2QJE A;  4R6Y A;  5HPQ A;  4OTE A;  2F97 A;  3K01 A;  1USY H;  2NUV A;  1JVX A;  3MWB A;  1FTO A;  4YAH X;  4F18 A;  2XXR A;  1JW1 A;  1LCT A;  4PET A;  3VVE A;  4GF8 A;  4TLM B;  1SD3 A;  3LC8 A;  1MQH A;  4FIM A;  1MQJ A;  2QL3 A;  2ONK E;  1B46 A;  1SYI A;  2M8C A;  2ZYK A;  2AL5 A;  1OVB A;  3OO8 A;  1ZLQ A;  1FQA A;  3K6U A;  1IXC A;  1A55 A;  3Q26 A;  1NH7 A;  1A40 A;  3U72 A;  3FAS A;  2I48 A;  4GVO A;  3UN6 A;  4GXA A;  1EZO A;  3BKI B;  2ONR A;  3RY3 A;  4G68 A;  4G68 B;  3M3L A;  3CVG A;  2XXV A;  2D5W A;  2I58 A;  3MUQ A;  1MXZ A;  1JEU A;  2XD2 A;  5ELV A;  5ICT A;  1URS A;  4BLA A;  1GR2 A;  2AIX A;  3N6U A;  2O1M A;  4RK2 A;  4XKQ A;  2V3U A;  4G77 A;  3TYH A;  1IXG A;  3SEV A;  1SI0 A;  3B7D A;  4MF3 A;  2ZNU A;  4WKM A;  4C1U A;  5H8Q A;  5H8Q B;  3FVK A;  3VV5 A;  3DP6 A;  1YCJ A;  5M2V A;  2DE4 A;  1QUJ A;  1AOV A;  4X1B A;  2Q2C A;  2OBG A;  1M5E A;  2WKY A;  2F34 A;  3Q25 A;  1S7Y A;  3G3G A;  4JXI A;  4LQ2 A;  1B3L A;  1B40 A;  3TCF A;  3Q29 A;  1B32 A;  4F22 A;  5CMK A;  4MH5 A;  3T93 B;  3ZSF A;  4QFK A;  1B05 A;  2I0B A;  4U23 A;  2UVI A;  2QPQ A;  3LUY A;  1B3F A;  1OMP A;  4NE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...