2XWIA

Siap r147k mutant in complex with neu5ac
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLKVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tripartite ATP-Independent Periplasmic (Trap) Transporters Use an Arginine-Mediated Selectivity Filter for High Affinity Substrate Binding.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 116
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xwiA00
4NHBA 4N8YA 5IGAA 4MNIA 4MNPA 4N6KA 2CEXA 4PE3A 5CM6A 2WX9A 4PCDA 4NF0A 4P1LA 4NX1A 4OVTA 4MHFA 4PC9A 4NG7A 4P1EA 4OVSA 4P8BA 4PBHA 4PBQA 4NQ8A 4PGPA 5I5PA 4LN5A 4P9KA 4YICA 4MCOA 4XEQA 4PFIA 3B50A 4NGUA 4N6DA 4MNCA 5LTCA 4NN3A 5IZZA 3U65A 2XWOA 4MIJA 4PF8A 2CEYA 4PDHA 2XWIA 4O94A 2VPNA 4NAPA 4PGNA 2ZZWA 2WYKA 4P56A 4N15A 4X8RA 4PAIA 3GYYA 4P3LA 2XA5A 4PDDA 2ZZVA 4OA4A 2PFYA 3FXBA 2VPOA 4OVQA 4PFRA 4PF6A 4XF5A 4PAKA 4YZZA 4DI4B 4O8MA 4DI3D 5I7IA 4N91A 2WYPA 4N4UA 4PAFA 2XWKA 4XFEA 4PFBA 2V4CA 4OVRA 2HZKA 4MX6A 4P47A 4MMPA 2XWVA 4MEVA 2XXKA 4OVPA 2HPGA 4MAGA 4PETA 4N8GA 4UABA 4OANA 4O7MA 2ZZXA 4N17A 2HZLA 5IM2A 4X04A 2PFZA
chains in the Genus database with same CATH superfamily
4F19A 4O7IA 3A29A 3TTKA 4O3CA 4PCDA 4R74A 4P1LA 3SEUA 1M5BA 1MQJA 1Y1MA 4ELOA 2O7IA 2F36A 4OVSA 4TLMB 3VV5A 3T0JA 2DP8A 3JYRA 5I5PA 5ISUA 4NF5B 2WKYA 4LN5A 2AIXA 5AA1A 4MCOA 1NV0A 4M1VA 4XEQA 1WODA 4YB6A 1FQAA 1N04A 4MLVA 1XVYA 3ROJA 4ZZEA 3MJNA 2XXTA 4MNCA 5FBPA 5EHMA 1R6ZA 1O63A 4R75A 2XXRA 1Y9UA 4U1OA 5L8DA 3MUQA 1NUWA 1IMDA 1PB7A 3S2VA 4M4GA 2XHDA 2BJIA 2PFYA 4IY6A 3ILUB 4LATA 2QMWA 2V3QA 3LR1A 4F1UA 2ONKE 3KBZA 1T0KA 1LBXA 3LBSA 4I40A 1B4ZA 2V3UA 1B5IA 4OVRA 2ZYNA 2B4LA 5KDTB 3GBAA 2R71A 3PD9A 2HFBA 4PETA 4GOTA 2ONSA 1R9QA 1LBZA 4HE1A 5AA2A 1A40A 2AYSA 3EHTA 1MXYA 1SI0A 5CMBA 4YKIA 2F7CA 1BTJA 1LB9A 3T9HB 3KG2A 1RDXA 3IOVA 3OEMA 1NV6A 3FJ7A 4PE3A 2P3NA 5JEIA 2O7UA 1MXZA 4N13A 3RPLA 2NUVA 3ODBA 4X1DA 2XX7A 4NG7A 4FECA 4LA9A 3TMGA 1EU8A 4DXBA 4XKQA 3PUVE 1P1OA 3UGWA 4PBHA 5EQ8A 1AOVA 3IOTA 4N81A 1IIWA 4FBPA 4X9TA 3K6WA 4GXAA 2Y7WA 3SESA 1FTKA 3DP8A 4Q5TA 3B50A 3Q29A 1N3WA 4JXIA 5I2NB 1FQBA 3K01A 5KZTA 2R9JA 1BLFA 2XWIA 2FYIA 4RPOA 1POTA 3IB2A 3O6HA 4GVOA 4RJZA 1FPLA 4OFJA 3MWBA 3TODA 2VD3A 5H8SA 3FATA 3KC0A 4ZS9A 3SDFA 1TFDA 3T93B 3EQ1A 1IMCA 1B58A 4H1XA 3TQWA 1VFDA 3ONMA 3M8UA 4POXA 1B7UA 1YYZA 4GL0A 4C1UA 2O68A 2THIA 2WBBA 1EZPA 1FBDA 1IEJA 1Q1KA 4LUBA 1KA1A 2P2AA 2XWVA 4KFQA 2DWJA 3KSJA 3B8BA 3TUSA 1B6HA 1FTJA 5EQAA 4HTGA 3H6TA 2DE4A 1Z7NE 4N17A 3IAZA 5IM2A 3VXCA 4YAHX 1R1NA 3PMWA 1XHYA 3VVFA 1XC1A 5I59B 4LZ7A 1IMEA 1FTLA 3FVGA 2X7QA 1IITA 4QSDA 3C31A 2OJTA 3FBPA 3O9PA 4EXLA 1TFAA 2VOZA 3QMFA 3OO9A 1FJ6A 2VHAA 4H8IA 4ND9A 2UVGA 4BDOA 2JJKA 4UA8A 2QVRA 3S9LC 2RCBA 4OXVA 3C36A 3IJXB 1DPPA 3K4UA 3W9VA 4N6DA 5LTCA 2HXRA 1N84A 4AB5A 3GBBA 4O3AA 3KOTA 2QRYA 2O1MA 2XX8A 1NL5A 4EQBA 1WDNA 4PGNA 4JWOA 2Y7IA 1EYJA 2DXYA 2HAUA 2FIEA 4IB2A 1IXCA 4R2BA 1B7HA 3K6VA 1I6QA 2GHBA 4DLDA 3OD7A 3ECRA 4OVQA 2RC9A 4K3FA 4R73A 2CZKA 2Z22A 4PFUA 3KJTA 1FBEA 4KR5A 2I0BA 5H8QB 1FQEA 3QUJA 4GWXA 1B3LA 4XFEA 4C0RA 1LB8A 2D21A 2LAOA 1FPKA 4MEVA 2OX3A 2H5YA 2OWSA 3WAFA 5FTHA 4OANA 2GQ1A 1MXUA 4OZ9A 2HZLA 2E0SA 3H06B 4N6PA 2I48A 4PFYA 4QSEA 3S9NC 4G77A 4N6KA 5H8HA 2WX9A 4NF0A 3VVDA 4GX4A 1B5JA 3KN7A 1PC3A 2O51A 2PMSA 4NEDA 3GXAA 1HSLA 1M5EA 3U72A 4OENA 2Y84A 3HHGA 3A3CA 3PPPA 5EYFA 3C35A 3ZS6A 4PGPA 3IB1A 3K1NA 3U94A 4H5FA 2D3IA 3TELA 4GLIA 2NVUB 4EXKA 1D3KA 2KLFA 1JETA 2OZZA 3FJGA 2BJJX 4PDHA 4O94A 3RYDA 4G68C 4H0WA 3RT6B 3R7XA 1ZJLA 1LFHA 4FEBA 4G68A 1UTBA 4OMBA 4P3LA 3RTFB 1TT1A 1R9LA 1JEVA 4GWYA 1B46A 3K1PA 4JWXA 1NUYA 3SZPA 1SW2A 3O6GA 5CMKA 4OESA 4JVDA 4HCWA 4FE8A 3H03A 1Q35A 1FQDA 5I57B 2PBWA 4ECFA 2XXXA 5JTYA 4NF6B 4Z7EA 5T3JA 4ESWA 1FPFA 5HM4B 3K6UA 4PQJA 3CR9A 3TTLA 3G3KA 1B52A 2VP1A 2F97A 1YTVA 3LSLA 2A5TA 4MH5A 4OQOA 4G8HA 3VDFA 1NKXA 1QUKA 5ET8A 4HW8A 2PVUA 3PUWE 2R8TA 1H3DA 3FXUA 3RNNA 4OTEA 5FHNA 1II5A 4FAJA 4X1BA 1G0IA 4TLLB 1B05A 3VLWA 4OVTA 5L9OA 3FVKA 5I58A 4R6YA 4P1EA 1ZIUA 5DVFA 4GQOA 4ZECA 1NNTA 4GWWA 4P11A 1FPEA 2HAVA 4F22A 1MS7A 3OSRA 3KSXA 2RF1A 3CIJA 1QUJA 4YICA 5AA4B 3D1RA 4HS7A 5I2KA 2OK2A 4JB7A 4E0XA 4NE4A 3IK6B 3M3LA 4MIJA 3MVYA 4KQPA 4PFTA 4YU0A 1B7ZA 1A54A 3H3GA 1MG1A 4FORA 3R6UA 1Z7ME 1NMUA 5CI5A 5K2YA 4KCCA 3PGFA 4IO6A 5ICTA 1LAGE 1MQIA 2OBGA 1MXWA 1FBFA 2Q2AA 4TQUQ 1NV3A 3DLNA 1IQ7A 4GWUA 1SI1A 2DVCA 3T9XB 4G68B 5EYGA 5FHOA 3MZ9A 2XX9A 1MM7A 2IEEA 3H4ZA 2ESNA 5B70A 3TDJA 2P1SA 3C32A 4G8NA 1QGXA 3VE1B 1ATGA 1N3XA 1ZMGA 3KN8A 4QHQA 4N8YA 3IO6A 5IGAA 4KPTA 3FD3A 3CVGA 2Q89A 5CM6A 4EDPA 1USYH 3IORA 4QFPA 1IXGA 1N0TA 1OQHA 3QK6A 4ESXA 1D9YA 1VE4A 2F5XA 3MP1A 3TEPA 4H5GA 1SW5A 3GZGA 2DOJA 4QF9A 5H8NB 2XD2A 3T1BA 1DTZA 1B40A 2Y7KA 4Z0IA 4PFIA 4F2OA 3E13X 4NF8B 2G93A 3PU5A 5J16A 3QAXA 3JV9A 2I3WA 4DZ1A 2Y7RA 1O7TA 5TPAB 3C9HA 2UVJA 3CHGA 2QS3A 3IL1B 4IO7A 4EF2A 1DBZA 2FVZA 3AXFA 4DE8A 1B0HA 5ET6A 1AH5A 1IXHA 1FJ9A 3HPIA 4GF8A 4N4UA 3S9EA 1JW1A 3N26A 1FTMA 2DDKA 3HCQA 4P47A 2XXKA 1LBBA 4ISUA 2V93A 4OVPA 3VLUA 4EQ9A 3Q26A 5TPAA 4H67A 2P3VA 3Q25A 1Y3PA 2PYYA 2DXRA 3PPRA 4DIGA 3USDA 4JSDA 4U2RA 1USYE 1LEVA 4GBVA 1N7XA 1KWHA 3E78A 3W9WA 3R26A 4O3BA 1PEBA 1RKMA 3C4MA 1DTGA 3TCGA 4ZE8A 4MFIA 1MQHA 4DCYA 2XD3A 4KD5A 2Z8EA 4P0IA 3EN3A 2X26A 3OO8A 3T22A 5F1QA 3CFZA 2DYXA 1BKAA 1LAFE 3CSGA 3FV2A 3PPQA 3V5AA 1ZLQA 1I6AA 3Q27A 3TAJA 3UIFA 4GX3A 2E1SA 3MYUA 1ANFA 5ELVA 2XWOA 3EF7A 1D9VA 1SVXB 5JTYB 5DEXA 4X8RA 2B3BA 4GFRA 3FZVA 4IGRA 1INPA 1PBQA 3MQ9A 2OCUA 1OVBA 5H8NA 1SYHA 2XXQA 3PPOA 2QL3A 3O29A 1NUXA 5A5LA 4WXJA 4GRKA 2X7PA 3F11A 1FRPA 3A09A 4MX6A 3TCHA 3KC1A 3QYTA 4G8MA 4YKKA 1JEUA 2FHYA 4QRZA 1BP5A 4RNSA 1H43A 4DDDA 3TCFA 2ZZXA 2RCAA 2F7BA 2HXWA 5EYHA 2Y5LA 4OETA 3TKDA 2PT1A 3KOSA 1ZTYA 1VR5A 3QUFA 3P7IA 1TWYA 4ELPA 4RK2A 4JVIA 1B3EA 5DVJA 2I4BA 4QFLA 2I49A 2PT2A 3O28A 1URDA 5ITPA 2DE3A 3I5OA 3KJ7A 5JK4A 4AB6A 1PB8A 3HO7A 4DXUA 4ELRA 3IB0A 4IGTA 1O64A 1MY3A 1DMBA 1QVSA 3K0VA 1MH3A 2MKZA 4U22A 4JDFA 3B6QA 4PAIA 1NV2A 1MDP1 4IO5A 3E9XA 3FXBA 4I62A 4PFRA 1LSTA 4JWYA 3LUZA 3BFUA 3CI8A 1LFIA 4DI3D 1A7LA 1XI6A 3MZ1A 3SEWA 3CG1A 4PAFA 3MZBA 3D4GA 4F31B 4MF3A 3LV0A 2FIXA 2UYEA 4U1ZA 5BWJA 1FQFA 3MPKA 3MW0A 4OYVA 4HE2A 3KEIA 3MVZA 3LSWA 1K9YA 3U8QA 3FASA 2M8CA 3RY3A 4N8GA 5HBCA 1OQGA 4Q0CA 5H8HB 1Y1ZA 1B32A 3PUYE 2DE2A 3TZAA 3G3GA 1RDYA 3K00A 4GWSA 3DELB 1SPIA 1M5DA 4WEDA 3TTNA 5DEXB 3N94A 4ZZAA 1SYIA 4NX1A 3K1MA 1JNFA 1SW4A 4HE0A 1CB6A 3KN3A 3M3FA 2Y7PA 1VSOA 1MQDA 3CRBA 2QS1A 4NQ8A 2XXPA 1A8FA 1NNKA 4KYEA 4LONB 4IO3A 1OLCA 1A99A 5B7DA 5A5XA 1AMFA 5AE4A 2O69A 1B4HA 1P99A 5LOMA 4KXPA 5TP9B 4OVJA 3SKPA 1UQWA 3BFTA 2CZIA 2I4CA 1B51A 2I58A 4IO2A 3SETA 4I3YA 3UK4A 4MBPA 5ET7A 2I0CA 3W15C 3A3UA 1IMBA 3JZJA 3PUZE 5AA4A 4PF6A 1LBYA 2DSFA 5KDTA 1H44A 4GIZA 4FIMA 4I9DA 2XWKA 4BLAA 2RINA 4OERA 3G7WA 4OWDA 3HHFA 1B1HA 2ZNTA 3K02A 3SEYA 3KZGA 1JVYA 3U92A 3VVEA 2NXOA 1OMPA 3VLVA 1XOCA 4IR8A 2F35A 1QKBA 3DP6A 1N76A 3OEKA 2H9BA 5IAIA 4KYDA 3U1OA 2UVHA 3FVOA 1H45A 3E3KA 3V83A 4PP0A 2ALUA 1H76A 2ZNUA 3IO4A 5DW8A 5TU0A 3MAMA 3FV1A 5H8FB 3ISPA 3G3HA 4NWDA 3T9VA 5CC2A 2I6EA 2D5WA 2ABHA 1BK4A 2PX1A 4FJPA 3S9MC 3GLBA 1SD3A 3DM0A 4NF5A 4YKJA 4HCYA 3FXQA 3THIA 4P56A 1HSJA 1FPDA 5BUUA 1P1UA 5F7VA 4XTCQ 3TPAA 1AIVA 4IO4A 2R6GE 3H6WA 4XKNA 1NV5A 5TP9A 3G3JA 4PFBA 3OOAA 5FTIA 1GTKA 1FPBA 4I3EA 2H99A 1IXIA 2QFLA 4ZEKA 2ZMBA 1GVCA 3FVNA 2A5SA 3MC2A 2DQVA 3KFMA 1FCKA 3TFLA 4UABA 1FPGA 3K6XA 4KCDA 1N7WA 4Q30B 1NFTA 4F1YA 1MPCA 1K9ZA 1LBCA 4P0GA 3C33A 1QKAA 2Z8DA 4BDMA 3SEXA 1MY0A 3LC8A 1OVTA 4NF6A 2V84A 2V25A 3QXMA 2CZHA 4QFKA 1B3HA 3L6GA 5I57A 5I2KB 4PE5B 2GRVA 4FATA 1MY2A 4P8BA 3RT8A 2NWJA 1VDWA 3EPEA 1CNQA 3N6TA 4RXLA 3G3IA 3RPLB 4PFWA 3HV1A 2QS4A 5CRYA 3IJOB 4QBAA 1AWBA 2O1LA 4F3BA 4HXVA 1Y20A 4R9GA 1HSEA 2RC8A 4QXDA 3CFXA 4X48A 3FUZA 3TTRA 1FPIA 2QVVA 2ZZVA 4LP2B 2B3FA 2DWAA 2Z8FA 2WBDA 4BDNA 4YZZA 4PAKA 1SW1A 2H4IA 3RGYA 3BBRA 4EF1A 2Q8MA 3RN8A 4U4XA 1B5HA 1P1QA 5DT6A 3IFCA 4F3PA 1F9BA 4YB5A 1PDAA 2FNCA 3O97A 2V4CA 1PB9A 2ONRA 1NH7A 4JBZA 3O6IA 4RYAA 1UIVA 4F3SA 1FQCA 1M5CA 4F3GA 4QSCA 2HCAA 3OELA 2QSXA 3IOUA 4OFOA 4O7MA 3FXRA 1B3GA 2F8DA 1RDZA 3OO7A 1JW5A 4BDRA 5EQ7A 2Q2CA 5ESYA 1MXVA 1XVXA 2XXVA 4WKMA 2UYFA 4PC9A 3UORA 4DXCA 4XKPA 1YCJA 4AQ4A 4F1VA 1B1XA 3MP6A 1EYKA 1NV7A 2ZYMA 3T66A 4P9KA 2UXAA 1YAEA 3M3KA 1IUDA 2RC7A 4EUOA 1LGBC 2ZXTA 4LQ5A 3T96B 4F18A 1I6BA 1D9QA 4ZEDA 1LBWA 4THIA 1NNPA 3VXBA 4OEVA 4I8CA 3MPLA 1MQGA 4Q8RA 4NF4B 2GFEA 4NTLA 2GH9A 1SBPA 1M5FA 5F24A 3IOWA 3B6WA 3MVXA 4XKRA 3TYHA 3KGCA 4ZEIA 4F2QA 1A8EA 4O8MA 4H6DA 1EZ9A 2WEFA 1DK4A 3RLFE 4PTKA 4H46A 4MMPA 4U4SA 2Q8JA 4AS4A 4R6HA 1UTBB 3OSQA 1XT8A 5I58B 3OMBA 4OHNA 2PFZA 1NUZA 2QJEA 4NHBA 4F29A 2XXIA 4ZEFA 1KZ8A 1FTOA 1LCFA 2O84X 1S50A 3PUXE 3B6TA 1OLAA 4G4PA 3H6VA 3PTYA 3EHUA 1GR2A 4MHFA 4XIGQ 1MPBA 1EYIA 4YMAA 4R6KA 1WVJA 1FBCA 4UACA 2F34A 1S9TA 4JSOA 4PBQA 2Z23A 3EKIA 2Q9TA 1GGGA 1GV8A 4C1TA 3DP4A 1ZU0A 3H6UA 1PBPA 1KA0A 4RY1A 3U93A 4FEDA 2B65A 3BKIB 3U65A 4PF8A 1US5A 4U23A 2F6PA 1IMFA 3H7MA 3NOHA 4F39A 3CG3A 1QJMA 2ZZWA 3PD8A 3ILTB 2RKMA 1DOTA 2PCRA 3GYYA 1ELJA 5IZ3A 2H98A 2HQ0A 4EQ7A 4OA4A 5EHSA 2G29A 4ZDMA 4IY5A 2I3VA 1NNFA 2YPNA 3LSFB 2KQZA 3ZSFA 1QW0A 1URSA 3C34A 5K2XA 3O66A 2XXUA 4OEUA 2OWTA 2QPQA 1ZBMA 2HZKA 3FJMA 5AA2D 3RPWA 3HSTA 2HPGA 4MAGA 1NV4A 1FSAA 3IX1A 3LSXA 3OXNA 5IZ3B 4GBWA 4ZE9A 1OIBA 1B9JA 1LFGA 1G0HA 4MNIA 2VGQA 5L9SA 4H8JA 3WAEA 4L17A 4NF8A 4YMBA 5CBSA 3D4CA 1FBGA 4GXSB 3T9UA 2CZLA 1LLSA 2F3DA 5I2NA 3OENA 2F6GA 3RQTA 3MBPA 4GX6A 4G2ZA 3HN0A 4TOZA 4ELQA 4QFOA 4E0WA 3PPNA 1MY4A 2ANJA 2O6AA 3V89B 1MM6A 3OO6A 1CE2A 3E79A 1MY1A 3TQLA 4R2FA 5DVIA 5EQ9A 4RA1A 3TTMA 3MP8A 1JP4A 4KHZE 5LDZA 2VPOA 4H45A 4BDLA 4LVQA 2AL5A 5AA3A 3B7DA 3LUYA 4R9FA 2Q88A 3UP9A 2HEUA 4GL8A 2KR0A 1YPNA 1DSNA 1SQYA 1DPEA 4JVCA 4NMYA 5ICQA 1MDQA 4NF4A 1B2HA 2YJPA 4X04A 2REGA 2VD2A 1B0LA 2CEXA 1JQFA 2DWHA 1LAHE 1P1NA 3BIHA 3BIGA 1UTHB 1YXIA 4R72A 4KYSA 1SDXA 2CMOA 4AS5A 5DTBA 4YB7A 3N5LA 4MJOA 2QMXA 5CMMA 1EZOA 2Y5KA 5A5XB 3VFJA 1MRPA 2F78A 3K2DA 4OFLA 2A5TB 1JVXA 5KCJB 4GWOA 3PV0E 4RK9A 2GHAA 1FBPA 1ZKBA 2Q74A 4GWZA 2CEYA 1US4A 3ZKKA 3UN6A 1XS5A 4GD5A 4NAPA 1FTAA 5H8FA 2F7AA 2WYKA 5AA2B 5IKBA 4N15A 5I56B 1A55A 5I84A 3ZKLA 1FBHA 1RYOA 5I59A 2XA5A 5KCJA 3KBRA 1RYXA 1IMAA 4DI4B 2F3BA 3IFAA 1DCUA 1FPJA 4N91A 2WYPA 3Q28A 2L5VA 4LQ2A 1LBVA 4MLQA 2DS9A 4KI0E 5ITOA 2P0SA 1UTHA 1Y3QA 3I3VA 4DCXA 3CSBA 4LZ5A 2XXHA 5CBRA 4LZ8A 5I56A 3MVWA 4U21A 1NV1A 3IR1A 2UVIA 4N07A 1EH3A 1P1WA 3CFLA 1QUIA 2OWZA 1UIUA 3V8XB 2H25A 4MNPA 1VFEA 2V3TA 1URGA 2AL4A 3QSLA 4ONYA 1LAXA 3S4UA 5CMCA 3MSTA 1Y4CA 2DVZA 5ET5A 4G61A 1JW4A 1YZ0A 3RUMA 1MPDA 3EHSA 5FHMA 2XXYA 3PMVA 2ZYKA 1FW0A 1QULA 1NI9A 4H65A 4I1DA 1POY1 5I3SA 5DYHA 1B3FA 3QIMA 1LCTA 4NWCA 1BIYA 5IZ1A 4NGUA 4NN3A 4POWA 5L9MA 5M2VA 5IZZA 1AL3A 2VT5A 2YLNA 2DWIA 1TXFA 3L6HA 5HPQA 1D4NA 3UA8A 3G3FA 1IZ1A 2VPNA 3FIRA 3FGSA 2B4MA 5H8QA 4YKPA 4PDDA 2QS2A 4ZEBA 4RPNA 1Y3NA 2IA4A 3SEVA 2W7YA 2QVUA 4XF5A 3O2AA 1Y4TA 2NOOA 5I7IA 1I69A 4XXUA 4QFNA 2XXWA 1MH4A 1S7YA 1Q9DA 5J1DA 3E4RA 3RTWB 1MXXA 1L5TA 3PMXA 1J1NA 2FA7A 2OLBA 3SERA 2FBPA 2ZYOA 3N6UA 4BDQA 2ZNSA 3HFUA 2REJA 2HHMA 3I6VA 4WEPA 1NH8A
chains in the Genus database with same CATH topology
2DE2A 4F19A 1NUZA 2OWZA 4NHBA 4IR8A 2R8TA 4N8YA 3E78A 1G0HA 1RDXA 4O7IA 5IGAA 1RDYA 4GWSA 1KZ8A 4MNPA 4MNIA 3W9WA 4N6KA 1NV6A 1IMEA 2CEXA 1SPIA 3A29A 4PE3A 5EQ7A 2P3NA 5CM6A 4JVIA 1FBGA 2WX9A 3FBPA 4PCDA 5ESYA 4NF0A 4P1LA 4NX1A 1G0IA 3BIHA 3BIGA 4GX4A 1YXIA 3MSTA 3PTYA 4HE0A 2DVZA 3RPLA 4AS5A 4OVTA 5ET5A 4MHFA 2CZHA 4G61A 2F3DA 5J1DA 1EYIA 1YZ0A 3QMFA 4PC9A 1FBCA 2F5XA 4NG7A 1FJ6A 4MJOA 4P1EA 4F1VA 4OVSA 4GX6A 2Y5KA 4P8BA 4PBHA 4PBQA 5EQ8A 1VDWA 2JJKA 4GWWA 1EYKA 1NV7A 5DW8A 3EKIA 1FPEA 2Q9TA 4N81A 4NQ8A 3T1BA 4FBPA 4PGPA 3T0JA 1CNQA 5I5PA 2DE3A 4X9TA 3RPLB 1NI9A 2QVRA 4LN5A 4P9KA 4YICA 5JK4A 5ET6A 4MCOA 1NV0A 3ISPA 4X04A 4M1VA 5I3SA 3D1RA 4XEQA 1KA0A 4GX3A 4QBAA 4PFIA 3B50A 3ROJA 3MYUA 5IZ1A 4NGUA 4N6DA 3W9VA 4MNCA 5FBPA 1AWBA 4NN3A 5LTCA 2HXRA 5IZZA 1BK4A 5A5LA 4HXVA 3U65A 1FBPA 2VT5A 2XWOA 4MIJA 4KXPA 4PF8A 2Q74A 4GWZA 2CEYA 3E79A 4PDHA 1IMFA 2XWIA 3NOHA 4O94A 3RYDA 4QXDA 4F18A 2VPNA 1D9QA 4HCYA 4NAPA 4PGNA 2ZZWA 1FTAA 1LBWA 1FPLA 2CZIA 2WYKA 1EYJA 2MKZA 4P56A 1NUWA 2B4MA 4N15A 5EQ9A 1IMDA 4X8RA 5J16A 4PAIA 2FIEA 4I3YA 1FBHA 1NV2A 1FPIA 2PCRA 3GYYA 5IZ3A 4P3LA 1JP4A 2XA5A 3KC0A 4PDDA 2QVVA 1FPDA 5ET7A 2ZZVA 2BJIA 4OA4A 2PFYA 5F24A 3FXBA 1IMBA 4GWYA 2VPOA 1IMCA 5LDZA 3CHGA 1NUYA 4OVQA 4PFRA 2WBDA 3SZPA 2CZKA 4H45A 4PF6A 2QVUA 4XF5A 1LBYA 1IMAA 3LUZA 1INPA 4JVDA 2F3BA 2KQZA 4PAKA 4YZZA 4DI4B 4HCWA 2V3QA 4O8MA 2Q8MA 3IFAA 4DI3D 1DBZA 1XI6A 1FBEA 5I7IA 1FBFA 2FVZA 4F1UA 1DCUA 5T3JA 1FPJA 4N91A 3KBZA 2WYPA 1Q9DA 1LBXA 2WEFA 1NUXA 3IFCA 1DK4A 1FJ9A 1YYZA 4I40A 1NV5A 2XWKA 4GWXA 4N4UA 4PAFA 2QPQA 1NV3A 4XFEA 4PFBA 2L5VA 2V4CA 1LBVA 4OVRA 4GWUA 4PTKA 1FRPA 1FPBA 2HZKA 2KR0A 2DDKA 2WBBA 3LV0A 1FBDA 4H46A 4I3EA 2FIXA 4MX6A 3KC1A 4P47A 5EYGA 4MMPA 1KA1A 1FPFA 1FPKA 2B4LA 2QFLA 2OX3A 2XWVA 4MEVA 2XXKA 2FHYA 4OVPA 2HPGA 3B8BA 4HE2A 2PFZA 4MAGA 1K9YA 2FBPA 4PETA 1LBZA 4AS4A 5EQAA 1NV4A 2P3VA 4HE1A 4JVCA 4N8GA 1FSAA 4UABA 4OANA 1FPGA 1NV1A 2DE4A 2ZZXA 2GQ1A 3HFUA 4O7MA 5IZ3B 4N17A 2HHMA 2HZLA 4GBWA 5EYHA 1QGXA 5IM2A 1LEVA 2Y5LA 1RDZA 5ET8A 4GBVA 1K9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHB A;  4N8Y A;  5IGA A;  4MNI A;  4MNP A;  4N6K A;  2CEX A;  4PE3 A;  5CM6 A;  2WX9 A;  4PCD A;  4NF0 A;  4P1L A;  4NX1 A;  4OVT A;  4MHF A;  4PC9 A;  4NG7 A;  4P1E A;  4OVS A;  4P8B A;  4PBH A;  4PBQ A;  4NQ8 A;  4PGP A;  5I5P A;  4LN5 A;  4P9K A;  4YIC A;  4MCO A;  4XEQ A;  4PFI A;  3B50 A;  4NGU A;  4N6D A;  4MNC A;  5LTC A;  4NN3 A;  5IZZ A;  3U65 A;  2XWO A;  4MIJ A;  4PF8 A;  2CEY A;  4PDH A;  2XWI A;  4O94 A;  2VPN A;  4NAP A;  4PGN A;  2ZZW A;  2WYK A;  4P56 A;  4N15 A;  4X8R A;  4PAI A;  3GYY A;  4P3L A;  2XA5 A;  4PDD A;  2ZZV A;  4OA4 A;  2PFY A;  3FXB A;  2VPO A;  4OVQ A;  4PFR A;  4PF6 A;  4XF5 A;  4PAK A;  4YZZ A;  4DI4 B;  4O8M A;  4DI3 D;  5I7I A;  4N91 A;  2WYP A;  4N4U A;  4PAF A;  2XWK A;  4XFE A;  4PFB A;  2V4C A;  4OVR A;  2HZK A;  4MX6 A;  4P47 A;  4MMP A;  2XWV A;  4MEV A;  2XXK A;  4OVP A;  2HPG A;  4MAG A;  4PET A;  4N8G A;  4UAB A;  4OAN A;  4O7M A;  2ZZX A;  4N17 A;  2HZL A;  5IM2 A;  4X04 A;  2PFZ A; 
#chains in the Genus database with same CATH topology
 4F19 A;  4O7I A;  3A29 A;  3TTK A;  4O3C A;  4PCD A;  4R74 A;  4P1L A;  3SEU A;  1M5B A;  1MQJ A;  1Y1M A;  4ELO A;  2O7I A;  2F36 A;  4OVS A;  4TLM B;  3VV5 A;  3T0J A;  2DP8 A;  3JYR A;  5I5P A;  5ISU A;  4NF5 B;  2WKY A;  4LN5 A;  2AIX A;  5AA1 A;  4MCO A;  1NV0 A;  4M1V A;  4XEQ A;  1WOD A;  4YB6 A;  1FQA A;  1N04 A;  4MLV A;  1XVY A;  3ROJ A;  4ZZE A;  3MJN A;  2XXT A;  4MNC A;  5FBP A;  5EHM A;  1R6Z A;  1O63 A;  4R75 A;  2XXR A;  1Y9U A;  4U1O A;  5L8D A;  3MUQ A;  1NUW A;  1IMD A;  1PB7 A;  3S2V A;  4M4G A;  2XHD A;  2BJI A;  2PFY A;  4IY6 A;  3ILU B;  4LAT A;  2QMW A;  2V3Q A;  3LR1 A;  4F1U A;  2ONK E;  3KBZ A;  1T0K A;  1LBX A;  3LBS A;  4I40 A;  1B4Z A;  2V3U A;  1B5I A;  4OVR A;  2ZYN A;  2B4L A;  5KDT B;  3GBA A;  2R71 A;  3PD9 A;  2HFB A;  4PET A;  4GOT A;  2ONS A;  1R9Q A;  1LBZ A;  4HE1 A;  5AA2 A;  1A40 A;  2AYS A;  3EHT A;  1MXY A;  1SI0 A;  5CMB A;  4YKI A;  2F7C A;  1BTJ A;  1LB9 A;  3T9H B;  3KG2 A;  1RDX A;  3IOV A;  3OEM A;  1NV6 A;  3FJ7 A;  4PE3 A;  2P3N A;  5JEI A;  2O7U A;  1MXZ A;  4N13 A;  3RPL A;  2NUV A;  3ODB A;  4X1D A;  2XX7 A;  4NG7 A;  4FEC A;  4LA9 A;  3TMG A;  1EU8 A;  4DXB A;  4XKQ A;  3PUV E;  1P1O A;  3UGW A;  4PBH A;  5EQ8 A;  1AOV A;  3IOT A;  4N81 A;  1IIW A;  4FBP A;  4X9T A;  3K6W A;  4GXA A;  2Y7W A;  3SES A;  1FTK A;  3DP8 A;  4Q5T A;  3B50 A;  3Q29 A;  1N3W A;  4JXI A;  5I2N B;  1FQB A;  3K01 A;  5KZT A;  2R9J A;  1BLF A;  2XWI A;  2FYI A;  4RPO A;  1POT A;  3IB2 A;  3O6H A;  4GVO A;  4RJZ A;  1FPL A;  4OFJ A;  3MWB A;  3TOD A;  2VD3 A;  5H8S A;  3FAT A;  3KC0 A;  4ZS9 A;  3SDF A;  1TFD A;  3T93 B;  3EQ1 A;  1IMC A;  1B58 A;  4H1X A;  3TQW A;  1VFD A;  3ONM A;  3M8U A;  4POX A;  1B7U A;  1YYZ A;  4GL0 A;  4C1U A;  2O68 A;  2THI A;  2WBB A;  1EZP A;  1FBD A;  1IEJ A;  1Q1K A;  4LUB A;  1KA1 A;  2P2A A;  2XWV A;  4KFQ A;  2DWJ A;  3KSJ A;  3B8B A;  3TUS A;  1B6H A;  1FTJ A;  5EQA A;  4HTG A;  3H6T A;  2DE4 A;  1Z7N E;  4N17 A;  3IAZ A;  5IM2 A;  3VXC A;  4YAH X;  1R1N A;  3PMW A;  1XHY A;  3VVF A;  1XC1 A;  5I59 B;  4LZ7 A;  1IME A;  1FTL A;  3FVG A;  2X7Q A;  1IIT A;  4QSD A;  3C31 A;  2OJT A;  3FBP A;  3O9P A;  4EXL A;  1TFA A;  2VOZ A;  3QMF A;  3OO9 A;  1FJ6 A;  2VHA A;  4H8I A;  4ND9 A;  2UVG A;  4BDO A;  2JJK A;  4UA8 A;  2QVR A;  3S9L C;  2RCB A;  4OXV A;  3C36 A;  3IJX B;  1DPP A;  3K4U A;  3W9V A;  4N6D A;  5LTC A;  2HXR A;  1N84 A;  4AB5 A;  3GBB A;  4O3A A;  3KOT A;  2QRY A;  2O1M A;  2XX8 A;  1NL5 A;  4EQB A;  1WDN A;  4PGN A;  4JWO A;  2Y7I A;  1EYJ A;  2DXY A;  2HAU A;  2FIE A;  4IB2 A;  1IXC A;  4R2B A;  1B7H A;  3K6V A;  1I6Q A;  2GHB A;  4DLD A;  3OD7 A;  3ECR A;  4OVQ A;  2RC9 A;  4K3F A;  4R73 A;  2CZK A;  2Z22 A;  4PFU A;  3KJT A;  1FBE A;  4KR5 A;  2I0B A;  5H8Q B;  1FQE A;  3QUJ A;  4GWX A;  1B3L A;  4XFE A;  4C0R A;  1LB8 A;  2D21 A;  2LAO A;  1FPK A;  4MEV A;  2OX3 A;  2H5Y A;  2OWS A;  3WAF A;  5FTH A;  4OAN A;  2GQ1 A;  1MXU A;  4OZ9 A;  2HZL A;  2E0S A;  3H06 B;  4N6P A;  2I48 A;  4PFY A;  4QSE A;  3S9N C;  4G77 A;  4N6K A;  5H8H A;  2WX9 A;  4NF0 A;  3VVD A;  4GX4 A;  1B5J A;  3KN7 A;  1PC3 A;  2O51 A;  2PMS A;  4NED A;  3GXA A;  1HSL A;  1M5E A;  3U72 A;  4OEN A;  2Y84 A;  3HHG A;  3A3C A;  3PPP A;  5EYF A;  3C35 A;  3ZS6 A;  4PGP A;  3IB1 A;  3K1N A;  3U94 A;  4H5F A;  2D3I A;  3TEL A;  4GLI A;  2NVU B;  4EXK A;  1D3K A;  2KLF A;  1JET A;  2OZZ A;  3FJG A;  2BJJ X;  4PDH A;  4O94 A;  3RYD A;  4G68 C;  4H0W A;  3RT6 B;  3R7X A;  1ZJL A;  1LFH A;  4FEB A;  4G68 A;  1UTB A;  4OMB A;  4P3L A;  3RTF B;  1TT1 A;  1R9L A;  1JEV A;  4GWY A;  1B46 A;  3K1P A;  4JWX A;  1NUY A;  3SZP A;  1SW2 A;  3O6G A;  5CMK A;  4OES A;  4JVD A;  4HCW A;  4FE8 A;  3H03 A;  1Q35 A;  1FQD A;  5I57 B;  2PBW A;  4ECF A;  2XXX A;  5JTY A;  4NF6 B;  4Z7E A;  5T3J A;  4ESW A;  1FPF A;  5HM4 B;  3K6U A;  4PQJ A;  3CR9 A;  3TTL A;  3G3K A;  1B52 A;  2VP1 A;  2F97 A;  1YTV A;  3LSL A;  2A5T A;  4MH5 A;  4OQO A;  4G8H A;  3VDF A;  1NKX A;  1QUK A;  5ET8 A;  4HW8 A;  2PVU A;  3PUW E;  2R8T A;  1H3D A;  3FXU A;  3RNN A;  4OTE A;  5FHN A;  1II5 A;  4FAJ A;  4X1B A;  1G0I A;  4TLL B;  1B05 A;  3VLW A;  4OVT A;  5L9O A;  3FVK A;  5I58 A;  4R6Y A;  4P1E A;  1ZIU A;  5DVF A;  4GQO A;  4ZEC A;  1NNT A;  4GWW A;  4P11 A;  1FPE A;  2HAV A;  4F22 A;  1MS7 A;  3OSR A;  3KSX A;  2RF1 A;  3CIJ A;  1QUJ A;  4YIC A;  5AA4 B;  3D1R A;  4HS7 A;  5I2K A;  2OK2 A;  4JB7 A;  4E0X A;  4NE4 A;  3IK6 B;  3M3L A;  4MIJ A;  3MVY A;  4KQP A;  4PFT A;  4YU0 A;  1B7Z A;  1A54 A;  3H3G A;  1MG1 A;  4FOR A;  3R6U A;  1Z7M E;  1NMU A;  5CI5 A;  5K2Y A;  4KCC A;  3PGF A;  4IO6 A;  5ICT A;  1LAG E;  1MQI A;  2OBG A;  1MXW A;  1FBF A;  2Q2A A;  4TQU Q;  1NV3 A;  3DLN A;  1IQ7 A;  4GWU A;  1SI1 A;  2DVC A;  3T9X B;  4G68 B;  5EYG A;  5FHO A;  3MZ9 A;  2XX9 A;  1MM7 A;  2IEE A;  3H4Z A;  2ESN A;  5B70 A;  3TDJ A;  2P1S A;  3C32 A;  4G8N A;  1QGX A;  3VE1 B;  1ATG A;  1N3X A;  1ZMG A;  3KN8 A;  4QHQ A;  4N8Y A;  3IO6 A;  5IGA A;  4KPT A;  3FD3 A;  3CVG A;  2Q89 A;  5CM6 A;  4EDP A;  1USY H;  3IOR A;  4QFP A;  1IXG A;  1N0T A;  1OQH A;  3QK6 A;  4ESX A;  1D9Y A;  1VE4 A;  2F5X A;  3MP1 A;  3TEP A;  4H5G A;  1SW5 A;  3GZG A;  2DOJ A;  4QF9 A;  5H8N B;  2XD2 A;  3T1B A;  1DTZ A;  1B40 A;  2Y7K A;  4Z0I A;  4PFI A;  4F2O A;  3E13 X;  4NF8 B;  2G93 A;  3PU5 A;  5J16 A;  3QAX A;  3JV9 A;  2I3W A;  4DZ1 A;  2Y7R A;  1O7T A;  5TPA B;  3C9H A;  2UVJ A;  3CHG A;  2QS3 A;  3IL1 B;  4IO7 A;  4EF2 A;  1DBZ A;  2FVZ A;  3AXF A;  4DE8 A;  1B0H A;  5ET6 A;  1AH5 A;  1IXH A;  1FJ9 A;  3HPI A;  4GF8 A;  4N4U A;  3S9E A;  1JW1 A;  3N26 A;  1FTM A;  2DDK A;  3HCQ A;  4P47 A;  2XXK A;  1LBB A;  4ISU A;  2V93 A;  4OVP A;  3VLU A;  4EQ9 A;  3Q26 A;  5TPA A;  4H67 A;  2P3V A;  3Q25 A;  1Y3P A;  2PYY A;  2DXR A;  3PPR A;  4DIG A;  3USD A;  4JSD A;  4U2R A;  1USY E;  1LEV A;  4GBV A;  1N7X A;  1KWH A;  3E78 A;  3W9W A;  3R26 A;  4O3B A;  1PEB A;  1RKM A;  3C4M A;  1DTG A;  3TCG A;  4ZE8 A;  4MFI A;  1MQH A;  4DCY A;  2XD3 A;  4KD5 A;  2Z8E A;  4P0I A;  3EN3 A;  2X26 A;  3OO8 A;  3T22 A;  5F1Q A;  3CFZ A;  2DYX A;  1BKA A;  1LAF E;  3CSG A;  3FV2 A;  3PPQ A;  3V5A A;  1ZLQ A;  1I6A A;  3Q27 A;  3TAJ A;  3UIF A;  4GX3 A;  2E1S A;  3MYU A;  1ANF A;  5ELV A;  2XWO A;  3EF7 A;  1D9V A;  1SVX B;  5JTY B;  5DEX A;  4X8R A;  2B3B A;  4GFR A;  3FZV A;  4IGR A;  1INP A;  1PBQ A;  3MQ9 A;  2OCU A;  1OVB A;  5H8N A;  1SYH A;  2XXQ A;  3PPO A;  2QL3 A;  3O29 A;  1NUX A;  5A5L A;  4WXJ A;  4GRK A;  2X7P A;  3F11 A;  1FRP A;  3A09 A;  4MX6 A;  3TCH A;  3KC1 A;  3QYT A;  4G8M A;  4YKK A;  1JEU A;  2FHY A;  4QRZ A;  1BP5 A;  4RNS A;  1H43 A;  4DDD A;  3TCF A;  2ZZX A;  2RCA A;  2F7B A;  2HXW A;  5EYH A;  2Y5L A;  4OET A;  3TKD A;  2PT1 A;  3KOS A;  1ZTY A;  1VR5 A;  3QUF A;  3P7I A;  1TWY A;  4ELP A;  4RK2 A;  4JVI A;  1B3E A;  5DVJ A;  2I4B A;  4QFL A;  2I49 A;  2PT2 A;  3O28 A;  1URD A;  5ITP A;  2DE3 A;  3I5O A;  3KJ7 A;  5JK4 A;  4AB6 A;  1PB8 A;  3HO7 A;  4DXU A;  4ELR A;  3IB0 A;  4IGT A;  1O64 A;  1MY3 A;  1DMB A;  1QVS A;  3K0V A;  1MH3 A;  2MKZ A;  4U22 A;  4JDF A;  3B6Q A;  4PAI A;  1NV2 A;  1MDP 1;  4IO5 A;  3E9X A;  3FXB A;  4I62 A;  4PFR A;  1LST A;  4JWY A;  3LUZ A;  3BFU A;  3CI8 A;  1LFI A;  4DI3 D;  1A7L A;  1XI6 A;  3MZ1 A;  3SEW A;  3CG1 A;  4PAF A;  3MZB A;  3D4G A;  4F31 B;  4MF3 A;  3LV0 A;  2FIX A;  2UYE A;  4U1Z A;  5BWJ A;  1FQF A;  3MPK A;  3MW0 A;  4OYV A;  4HE2 A;  3KEI A;  3MVZ A;  3LSW A;  1K9Y A;  3U8Q A;  3FAS A;  2M8C A;  3RY3 A;  4N8G A;  5HBC A;  1OQG A;  4Q0C A;  5H8H B;  1Y1Z A;  1B32 A;  3PUY E;  2DE2 A;  3TZA A;  3G3G A;  1RDY A;  3K00 A;  4GWS A;  3DEL B;  1SPI A;  1M5D A;  4WED A;  3TTN A;  5DEX B;  3N94 A;  4ZZA A;  1SYI A;  4NX1 A;  3K1M A;  1JNF A;  1SW4 A;  4HE0 A;  1CB6 A;  3KN3 A;  3M3F A;  2Y7P A;  1VSO A;  1MQD A;  3CRB A;  2QS1 A;  4NQ8 A;  2XXP A;  1A8F A;  1NNK A;  4KYE A;  4LON B;  4IO3 A;  1OLC A;  1A99 A;  5B7D A;  5A5X A;  1AMF A;  5AE4 A;  2O69 A;  1B4H A;  1P99 A;  5LOM A;  4KXP A;  5TP9 B;  4OVJ A;  3SKP A;  1UQW A;  3BFT A;  2CZI A;  2I4C A;  1B51 A;  2I58 A;  4IO2 A;  3SET A;  4I3Y A;  3UK4 A;  4MBP A;  5ET7 A;  2I0C A;  3W15 C;  3A3U A;  1IMB A;  3JZJ A;  3PUZ E;  5AA4 A;  4PF6 A;  1LBY A;  2DSF A;  5KDT A;  1H44 A;  4GIZ A;  4FIM A;  4I9D A;  2XWK A;  4BLA A;  2RIN A;  4OER A;  3G7W A;  4OWD A;  3HHF A;  1B1H A;  2ZNT A;  3K02 A;  3SEY A;  3KZG A;  1JVY A;  3U92 A;  3VVE A;  2NXO A;  1OMP A;  3VLV A;  1XOC A;  4IR8 A;  2F35 A;  1QKB A;  3DP6 A;  1N76 A;  3OEK A;  2H9B A;  5IAI A;  4KYD A;  3U1O A;  2UVH A;  3FVO A;  1H45 A;  3E3K A;  3V83 A;  4PP0 A;  2ALU A;  1H76 A;  2ZNU A;  3IO4 A;  5DW8 A;  5TU0 A;  3MAM A;  3FV1 A;  5H8F B;  3ISP A;  3G3H A;  4NWD A;  3T9V A;  5CC2 A;  2I6E A;  2D5W A;  2ABH A;  1BK4 A;  2PX1 A;  4FJP A;  3S9M C;  3GLB A;  1SD3 A;  3DM0 A;  4NF5 A;  4YKJ A;  4HCY A;  3FXQ A;  3THI A;  4P56 A;  1HSJ A;  1FPD A;  5BUU A;  1P1U A;  5F7V A;  4XTC Q;  3TPA A;  1AIV A;  4IO4 A;  2R6G E;  3H6W A;  4XKN A;  1NV5 A;  5TP9 A;  3G3J A;  4PFB A;  3OOA A;  5FTI A;  1GTK A;  1FPB A;  4I3E A;  2H99 A;  1IXI A;  2QFL A;  4ZEK A;  2ZMB A;  1GVC A;  3FVN A;  2A5S A;  3MC2 A;  2DQV A;  3KFM A;  1FCK A;  3TFL A;  4UAB A;  1FPG A;  3K6X A;  4KCD A;  1N7W A;  4Q30 B;  1NFT A;  4F1Y A;  1MPC A;  1K9Z A;  1LBC A;  4P0G A;  3C33 A;  1QKA A;  2Z8D A;  4BDM A;  3SEX A;  1MY0 A;  3LC8 A;  1OVT A;  4NF6 A;  2V84 A;  2V25 A;  3QXM A;  2CZH A;  4QFK A;  1B3H A;  3L6G A;  5I57 A;  5I2K B;  4PE5 B;  2GRV A;  4FAT A;  1MY2 A;  4P8B A;  3RT8 A;  2NWJ A;  1VDW A;  3EPE A;  1CNQ A;  3N6T A;  4RXL A;  3G3I A;  3RPL B;  4PFW A;  3HV1 A;  2QS4 A;  5CRY A;  3IJO B;  4QBA A;  1AWB A;  2O1L A;  4F3B A;  4HXV A;  1Y20 A;  4R9G A;  1HSE A;  2RC8 A;  4QXD A;  3CFX A;  4X48 A;  3FUZ A;  3TTR A;  1FPI A;  2QVV A;  2ZZV A;  4LP2 B;  2B3F A;  2DWA A;  2Z8F A;  2WBD A;  4BDN A;  4YZZ A;  4PAK A;  1SW1 A;  2H4I A;  3RGY A;  3BBR A;  4EF1 A;  2Q8M A;  3RN8 A;  4U4X A;  1B5H A;  1P1Q A;  5DT6 A;  3IFC A;  4F3P A;  1F9B A;  4YB5 A;  1PDA A;  2FNC A;  3O97 A;  2V4C A;  1PB9 A;  2ONR A;  1NH7 A;  4JBZ A;  3O6I A;  4RYA A;  1UIV A;  4F3S A;  1FQC A;  1M5C A;  4F3G A;  4QSC A;  2HCA A;  3OEL A;  2QSX A;  3IOU A;  4OFO A;  4O7M A;  3FXR A;  1B3G A;  2F8D A;  1RDZ A;  3OO7 A;  1JW5 A;  4BDR A;  5EQ7 A;  2Q2C A;  5ESY A;  1MXV A;  1XVX A;  2XXV A;  4WKM A;  2UYF A;  4PC9 A;  3UOR A;  4DXC A;  4XKP A;  1YCJ A;  4AQ4 A;  4F1V A;  1B1X A;  3MP6 A;  1EYK A;  1NV7 A;  2ZYM A;  3T66 A;  4P9K A;  2UXA A;  1YAE A;  3M3K A;  1IUD A;  2RC7 A;  4EUO A;  1LGB C;  2ZXT A;  4LQ5 A;  3T96 B;  4F18 A;  1I6B A;  1D9Q A;  4ZED A;  1LBW A;  4THI A;  1NNP A;  3VXB A;  4OEV A;  4I8C A;  3MPL A;  1MQG A;  4Q8R A;  4NF4 B;  2GFE A;  4NTL A;  2GH9 A;  1SBP A;  1M5F A;  5F24 A;  3IOW A;  3B6W A;  3MVX A;  4XKR A;  3TYH A;  3KGC A;  4ZEI A;  4F2Q A;  1A8E A;  4O8M A;  4H6D A;  1EZ9 A;  2WEF A;  1DK4 A;  3RLF E;  4PTK A;  4H46 A;  4MMP A;  4U4S A;  2Q8J A;  4AS4 A;  4R6H A;  1UTB B;  3OSQ A;  1XT8 A;  5I58 B;  3OMB A;  4OHN A;  2PFZ A;  1NUZ A;  2QJE A;  4NHB A;  4F29 A;  2XXI A;  4ZEF A;  1KZ8 A;  1FTO A;  1LCF A;  2O84 X;  1S50 A;  3PUX E;  3B6T A;  1OLA A;  4G4P A;  3H6V A;  3PTY A;  3EHU A;  1GR2 A;  4MHF A;  4XIG Q;  1MPB A;  1EYI A;  4YMA A;  4R6K A;  1WVJ A;  1FBC A;  4UAC A;  2F34 A;  1S9T A;  4JSO A;  4PBQ A;  2Z23 A;  3EKI A;  2Q9T A;  1GGG A;  1GV8 A;  4C1T A;  3DP4 A;  1ZU0 A;  3H6U A;  1PBP A;  1KA0 A;  4RY1 A;  3U93 A;  4FED A;  2B65 A;  3BKI B;  3U65 A;  4PF8 A;  1US5 A;  4U23 A;  2F6P A;  1IMF A;  3H7M A;  3NOH A;  4F39 A;  3CG3 A;  1QJM A;  2ZZW A;  3PD8 A;  3ILT B;  2RKM A;  1DOT A;  2PCR A;  3GYY A;  1ELJ A;  5IZ3 A;  2H98 A;  2HQ0 A;  4EQ7 A;  4OA4 A;  5EHS A;  2G29 A;  4ZDM A;  4IY5 A;  2I3V A;  1NNF A;  2YPN A;  3LSF B;  2KQZ A;  3ZSF A;  1QW0 A;  1URS A;  3C34 A;  5K2X A;  3O66 A;  2XXU A;  4OEU A;  2OWT A;  2QPQ A;  1ZBM A;  2HZK A;  3FJM A;  5AA2 D;  3RPW A;  3HST A;  2HPG A;  4MAG A;  1NV4 A;  1FSA A;  3IX1 A;  3LSX A;  3OXN A;  5IZ3 B;  4GBW A;  4ZE9 A;  1OIB A;  1B9J A;  1LFG A;  1G0H A;  4MNI A;  2VGQ A;  5L9S A;  4H8J A;  3WAE A;  4L17 A;  4NF8 A;  4YMB A;  5CBS A;  3D4C A;  1FBG A;  4GXS B;  3T9U A;  2CZL A;  1LLS A;  2F3D A;  5I2N A;  3OEN A;  2F6G A;  3RQT A;  3MBP A;  4GX6 A;  4G2Z A;  3HN0 A;  4TOZ A;  4ELQ A;  4QFO A;  4E0W A;  3PPN A;  1MY4 A;  2ANJ A;  2O6A A;  3V89 B;  1MM6 A;  3OO6 A;  1CE2 A;  3E79 A;  1MY1 A;  3TQL A;  4R2F A;  5DVI A;  5EQ9 A;  4RA1 A;  3TTM A;  3MP8 A;  1JP4 A;  4KHZ E;  5LDZ A;  2VPO A;  4H45 A;  4BDL A;  4LVQ A;  2AL5 A;  5AA3 A;  3B7D A;  3LUY A;  4R9F A;  2Q88 A;  3UP9 A;  2HEU A;  4GL8 A;  2KR0 A;  1YPN A;  1DSN A;  1SQY A;  1DPE A;  4JVC A;  4NMY A;  5ICQ A;  1MDQ A;  4NF4 A;  1B2H A;  2YJP A;  4X04 A;  2REG A;  2VD2 A;  1B0L A;  2CEX A;  1JQF A;  2DWH A;  1LAH E;  1P1N A;  3BIH A;  3BIG A;  1UTH B;  1YXI A;  4R72 A;  4KYS A;  1SDX A;  2CMO A;  4AS5 A;  5DTB A;  4YB7 A;  3N5L A;  4MJO A;  2QMX A;  5CMM A;  1EZO A;  2Y5K A;  5A5X B;  3VFJ A;  1MRP A;  2F78 A;  3K2D A;  4OFL A;  2A5T B;  1JVX A;  5KCJ B;  4GWO A;  3PV0 E;  4RK9 A;  2GHA A;  1FBP A;  1ZKB A;  2Q74 A;  4GWZ A;  2CEY A;  1US4 A;  3ZKK A;  3UN6 A;  1XS5 A;  4GD5 A;  4NAP A;  1FTA A;  5H8F A;  2F7A A;  2WYK A;  5AA2 B;  5IKB A;  4N15 A;  5I56 B;  1A55 A;  5I84 A;  3ZKL A;  1FBH A;  1RYO A;  5I59 A;  2XA5 A;  5KCJ A;  3KBR A;  1RYX A;  1IMA A;  4DI4 B;  2F3B A;  3IFA A;  1DCU A;  1FPJ A;  4N91 A;  2WYP A;  3Q28 A;  2L5V A;  4LQ2 A;  1LBV A;  4MLQ A;  2DS9 A;  4KI0 E;  5ITO A;  2P0S A;  1UTH A;  1Y3Q A;  3I3V A;  4DCX A;  3CSB A;  4LZ5 A;  2XXH A;  5CBR A;  4LZ8 A;  5I56 A;  3MVW A;  4U21 A;  1NV1 A;  3IR1 A;  2UVI A;  4N07 A;  1EH3 A;  1P1W A;  3CFL A;  1QUI A;  2OWZ A;  1UIU A;  3V8X B;  2H25 A;  4MNP A;  1VFE A;  2V3T A;  1URG A;  2AL4 A;  3QSL A;  4ONY A;  1LAX A;  3S4U A;  5CMC A;  3MST A;  1Y4C A;  2DVZ A;  5ET5 A;  4G61 A;  1JW4 A;  1YZ0 A;  3RUM A;  1MPD A;  3EHS A;  5FHM A;  2XXY A;  3PMV A;  2ZYK A;  1FW0 A;  1QUL A;  1NI9 A;  4H65 A;  4I1D A;  1POY 1;  5I3S A;  5DYH A;  1B3F A;  3QIM A;  1LCT A;  4NWC A;  1BIY A;  5IZ1 A;  4NGU A;  4NN3 A;  4POW A;  5L9M A;  5M2V A;  5IZZ A;  1AL3 A;  2VT5 A;  2YLN A;  2DWI A;  1TXF A;  3L6H A;  5HPQ A;  1D4N A;  3UA8 A;  3G3F A;  1IZ1 A;  2VPN A;  3FIR A;  3FGS A;  2B4M A;  5H8Q A;  4YKP A;  4PDD A;  2QS2 A;  4ZEB A;  4RPN A;  1Y3N A;  2IA4 A;  3SEV A;  2W7Y A;  2QVU A;  4XF5 A;  3O2A A;  1Y4T A;  2NOO A;  5I7I A;  1I69 A;  4XXU A;  4QFN A;  2XXW A;  1MH4 A;  1S7Y A;  1Q9D A;  5J1D A;  3E4R A;  3RTW B;  1MXX A;  1L5T A;  3PMX A;  1J1N A;  2FA7 A;  2OLB A;  3SER A;  2FBP A;  2ZYO A;  3N6U A;  4BDQ A;  2ZNS A;  3HFU A;  2REJ A;  2HHM A;  3I6V A;  4WEP A;  1NH8 A; 
#chains in the Genus database with same CATH homology
 2DE2 A;  4F19 A;  1NUZ A;  2OWZ A;  4NHB A;  4IR8 A;  2R8T A;  4N8Y A;  3E78 A;  1G0H A;  1RDX A;  4O7I A;  5IGA A;  1RDY A;  4GWS A;  1KZ8 A;  4MNP A;  4MNI A;  3W9W A;  4N6K A;  1NV6 A;  1IME A;  2CEX A;  1SPI A;  3A29 A;  4PE3 A;  5EQ7 A;  2P3N A;  5CM6 A;  4JVI A;  1FBG A;  2WX9 A;  3FBP A;  4PCD A;  5ESY A;  4NF0 A;  4P1L A;  4NX1 A;  1G0I A;  3BIH A;  3BIG A;  4GX4 A;  1YXI A;  3MST A;  3PTY A;  4HE0 A;  2DVZ A;  3RPL A;  4AS5 A;  4OVT A;  5ET5 A;  4MHF A;  2CZH A;  4G61 A;  2F3D A;  5J1D A;  1EYI A;  1YZ0 A;  3QMF A;  4PC9 A;  1FBC A;  2F5X A;  4NG7 A;  1FJ6 A;  4MJO A;  4P1E A;  4F1V A;  4OVS A;  4GX6 A;  2Y5K A;  4P8B A;  4PBH A;  4PBQ A;  5EQ8 A;  1VDW A;  2JJK A;  4GWW A;  1EYK A;  1NV7 A;  5DW8 A;  3EKI A;  1FPE A;  2Q9T A;  4N81 A;  4NQ8 A;  3T1B A;  4FBP A;  4PGP A;  3T0J A;  1CNQ A;  5I5P A;  2DE3 A;  4X9T A;  3RPL B;  1NI9 A;  2QVR A;  4LN5 A;  4P9K A;  4YIC A;  5JK4 A;  5ET6 A;  4MCO A;  1NV0 A;  3ISP A;  4X04 A;  4M1V A;  5I3S A;  3D1R A;  4XEQ A;  1KA0 A;  4GX3 A;  4QBA A;  4PFI A;  3B50 A;  3ROJ A;  3MYU A;  5IZ1 A;  4NGU A;  4N6D A;  3W9V A;  4MNC A;  5FBP A;  1AWB A;  4NN3 A;  5LTC A;  2HXR A;  5IZZ A;  1BK4 A;  5A5L A;  4HXV A;  3U65 A;  1FBP A;  2VT5 A;  2XWO A;  4MIJ A;  4KXP A;  4PF8 A;  2Q74 A;  4GWZ A;  2CEY A;  3E79 A;  4PDH A;  1IMF A;  2XWI A;  3NOH A;  4O94 A;  3RYD A;  4QXD A;  4F18 A;  2VPN A;  1D9Q A;  4HCY A;  4NAP A;  4PGN A;  2ZZW A;  1FTA A;  1LBW A;  1FPL A;  2CZI A;  2WYK A;  1EYJ A;  2MKZ A;  4P56 A;  1NUW A;  2B4M A;  4N15 A;  5EQ9 A;  1IMD A;  4X8R A;  5J16 A;  4PAI A;  2FIE A;  4I3Y A;  1FBH A;  1NV2 A;  1FPI A;  2PCR A;  3GYY A;  5IZ3 A;  4P3L A;  1JP4 A;  2XA5 A;  3KC0 A;  4PDD A;  2QVV A;  1FPD A;  5ET7 A;  2ZZV A;  2BJI A;  4OA4 A;  2PFY A;  5F24 A;  3FXB A;  1IMB A;  4GWY A;  2VPO A;  1IMC A;  5LDZ A;  3CHG A;  1NUY A;  4OVQ A;  4PFR A;  2WBD A;  3SZP A;  2CZK A;  4H45 A;  4PF6 A;  2QVU A;  4XF5 A;  1LBY A;  1IMA A;  3LUZ A;  1INP A;  4JVD A;  2F3B A;  2KQZ A;  4PAK A;  4YZZ A;  4DI4 B;  4HCW A;  2V3Q A;  4O8M A;  2Q8M A;  3IFA A;  4DI3 D;  1DBZ A;  1XI6 A;  1FBE A;  5I7I A;  1FBF A;  2FVZ A;  4F1U A;  1DCU A;  5T3J A;  1FPJ A;  4N91 A;  3KBZ A;  2WYP A;  1Q9D A;  1LBX A;  2WEF A;  1NUX A;  3IFC A;  1DK4 A;  1FJ9 A;  1YYZ A;  4I40 A;  1NV5 A;  2XWK A;  4GWX A;  4N4U A;  4PAF A;  2QPQ A;  1NV3 A;  4XFE A;  4PFB A;  2L5V A;  2V4C A;  1LBV A;  4OVR A;  4GWU A;  4PTK A;  1FRP A;  1FPB A;  2HZK A;  2KR0 A;  2DDK A;  2WBB A;  3LV0 A;  1FBD A;  4H46 A;  4I3E A;  2FIX A;  4MX6 A;  3KC1 A;  4P47 A;  5EYG A;  4MMP A;  1KA1 A;  1FPF A;  1FPK A;  2B4L A;  2QFL A;  2OX3 A;  2XWV A;  4MEV A;  2XXK A;  2FHY A;  4OVP A;  2HPG A;  3B8B A;  4HE2 A;  2PFZ A;  4MAG A;  1K9Y A;  2FBP A;  4PET A;  1LBZ A;  4AS4 A;  5EQA A;  1NV4 A;  2P3V A;  4HE1 A;  4JVC A;  4N8G A;  1FSA A;  4UAB A;  4OAN A;  1FPG A;  1NV1 A;  2DE4 A;  2ZZX A;  2GQ1 A;  3HFU A;  4O7M A;  5IZ3 B;  4N17 A;  2HHM A;  2HZL A;  4GBW A;  5EYH A;  1QGX A;  5IM2 A;  1LEV A;  2Y5L A;  1RDZ A;  5ET8 A;  4GBV A;  1K9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...