2XWIA

Siap r147k mutant in complex with neu5ac
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLKVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Tripartite ATP-Independent Periplasmic (Trap) Transporters Use an Arginine-Mediated Selectivity Filter for High Affinity Substrate Binding.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 116
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xwiA00
4OVSA 4OANA 5I7IA 5CM6A 4PC9A 4MAGA 4PF6A 4O8MA 5LTCA 4OVQA 4PDDA 4O7MA 4MNCA 4OVRA 2ZZWA 4MCOA 4N4UA 4PAIA 4PF8A 4NAPA 5I5PA 4PFBA 4N6DA 4PCDA 4MMPA 2CEYA 4PAKA 4XF5A 4NF0A 2ZZVA 2ZZXA 2HPGA 4NGUA 3FXBA 4YICA 4NX1A 2CEXA 4NG7A 4N15A 4PFRA 3U65A 4N91A 2XWIA 4MNPA 4PGPA 2VPNA 4LN5A 2HZLA 4MNIA 2HZKA 4PETA 4N6KA 5IZZA 4O94A 4UABA 4OA4A 4X04A 4OVPA 4N17A 2PFYA 4P1LA 2XWKA 4YZZA 4P1EA 4PBQA 2WYKA 2XA5A 4N8GA 4P9KA 2PFZA 4X8RA 2VPOA 2WYPA 4MX6A 4PDHA 4DI4B 4XFEA 2XWVA 4P8BA 5IM2A 4PE3A 4P47A 4DI3D 5IGAA 4N8YA 4OVTA 3B50A 4NHBA 4MHFA 4MIJA 4PBHA 4XEQA 2XWOA 2V4CA 4P56A 4MEVA 4PGNA 4PFIA 2WX9A 4NQ8A 2XXKA 3GYYA 4NN3A 4PAFA 4P3LA
chains in the Genus database with same CATH superfamily
4OVSA 4LA9A 4M4GA 1I69A 5I58B 4NEDA 3R26A 4ELOA 4GWUA 3ROJA 1OMPA 3RNNA 3VE1B 5H8QB 4I8CA 3KSJA 4F18A 3PMWA 1YTVA 4DE8A 1R1NA 5ICQA 3QIMA 3D4GA 1NNFA 2ZZXA 1URGA 4KXPA 4WEDA 2VD2A 4K3FA 1XI6A 3ZKKA 2H25A 3C9HA 3P7IA 3EQ1A 4NF6B 2UYFA 3G3KA 2YLNA 5L8DA 5DEXA 2ONKE 4FATA 4G77A 4OEUA 2Y5KA 1H43A 1MRPA 4OVPA 3S4UA 1QUKA 1FBFA 1B1XA 2Z8FA 1SYHA 2UVGA 3M3FA 3Q28A 3E3KA 2FHYA 1LBWA 2YPNA 5IM2A 1ZU0A 4DI3D 4YU0A 3W15C 3RTWB 2NVUB 3IJXB 4OEVA 4OQOA 4YB5A 2OZZA 1M5EA 4EXLA 4NQ8A 4QFPA 4OETA 4PE5B 2I58A 3MAMA 3B6QA 2Q74A 4HE2A 3EHUA 2V93A 1KWHA 3VVEA 3DM0A 5AA2A 4XKRA 2OLBA 1M5BA 3RUMA 3B7DA 3U92A 5KCJB 3QK6A 4R9GA 1URSA 3D1RA 3FD3A 4U22A 3IFAA 2ZYMA 1PEBA 4U4SA 4DCXA 1LEVA 5CRYA 1FTAA 3ISPA 4I3EA 4KCDA 1H44A 1LBBA 4HS7A 4KQPA 1SDXA 3C35A 3S9LC 4DZ1A 3LSFB 2QS3A 4NG7A 3TUSA 3N6UA 2CZHA 3PMVA 2RINA 2Q88A 4H0WA 1NV4A 1GTKA 4MBPA 4KD5A 1B7UA 1AOVA 4PETA 1US5A 1AWBA 1OVTA 3MVXA 4IO5A 3MSTA 3OO6A 1N84A 4OFLA 4O3BA 1JNFA 3K6XA 4X8RA 1GV8A 2RC7A 3MVWA 1CE2A 3DP6A 2P3NA 2B3FA 4R2FA 4LVQA 4DIGA 4XKPA 4H45A 4H46A 4F3GA 2Q2AA 1MQHA 5IZ3A 4LQ5A 1P1NA 1H76A 2OX3A 2DDKA 4YKIA 1RDZA 3SZPA 1MM6A 4R75A 2THIA 1LGBC 2O7UA 1FPEA 1XC1A 3ODBA 1ANFA 2QS2A 5CM6A 3PUVE 1DSNA 1LBCA 1LAHE 2UYEA 3E79A 4GL0A 4EXKA 4MLVA 4MLQA 4OVRA 3OO9A 5I5PA 5TPAB 2F78A 3RYDA 1FQFA 5AE4A 3K6UA 1Q35A 5H8HA 4TQUQ 1QVSA 2DQVA 4F19A 5HPQA 5IZ1A 1LFHA 4R73A 2I49A 5I2NA 2YJPA 3PV0E 1FQAA 4BDNA 2Q8JA 2DXYA 3LV0A 1MPDA 1VSOA 3CVGA 4PGPA 4RPOA 3OXNA 4LN5A 4IGRA 2HZLA 2Y7RA 4FORA 4O3AA 4GLIA 1NV1A 1NL5A 2PFYA 4EQ7A 4H5GA 1FCKA 3BKIB 2AL5A 1MXUA 4PBQA 2QMXA 2XA5A 1N7XA 1J1NA 2V3TA 3K1NA 5CI5A 5DVJA 3IFCA 3MZ1A 5EQ7A 3RQTA 1NV3A 3TDJA 1B7ZA 4NMYA 3MPKA 4U2RA 2CMOA 1OLAA 4X1BA 4NWCA 3FZVA 1XT8A 3FGSA 4ZEKA 1B4ZA 4PGNA 2WX9A 5I57A 5CMBA 3LSWA 1TT1A 1INPA 1FSAA 2FVZA 2DWJA 4AS5A 4BDRA 3KJ7A 1NNPA 2Z8DA 3OMBA 3GBAA 4KR5A 2D5WA 2DVZA 2NXOA 1ZMGA 3IB0A 1JP4A 1B0LA 4EQBA 3MC2A 1IMBA 4IGTA 5LOMA 1Y9UA 2I48A 5I59B 3LC8A 5H8FA 1MDQA 1AMFA 4YMAA 1BLFA 2H9BA 1Q9DA 2Y5LA 1BK4A 4PFRA 5AA3A 3PTYA 1LBXA 1P1WA 1NV6A 3C33A 2VPNA 5ET8A 3LR1A 2F34A 4HE1A 1FBGA 2HZKA 2IA4A 3CSGA 1I6AA 4UABA 2KQZA 4JVCA 1JW5A 3C4MA 4KYSA 1IITA 2DE2A 2QVVA 3MJNA 4N6PA 3SETA 3KGCA 3Q29A 1LB9A 2VPOA 3F11A 5F7VA 1EH3A 3IX1A 1FPLA 2QS1A 2BJIA 4GQOA 3TQWA 4GWXA 4C0RA 4N8YA 3O6GA 2O51A 3MVZA 2XXPA 4IO3A 1I6QA 3T96B 2XHDA 3H6WA 3LUYA 4F3BA 4ELRA 2PT1A 2RCAA 5EQ8A 1Y3QA 1FJ9A 4GX3A 1A8FA 1VFEA 3CHGA 3VVFA 3KC1A 1RYOA 5ITOA 5A5XA 2AL4A 3FVKA 4GX6A 1MY3A 4O3CA 1UIVA 1JETA 3G3IA 5ESYA 2F3BA 3KN7A 3FASA 3SESA 3Q26A 4LUBA 3K1MA 1N04A 4MF3A 2O68A 3T1BA 4QFLA 1IMEA 2WEFA 2F35A 4BDOA 2XX9A 5HBCA 5EYFA 1PB9A 2XXRA 3O97A 5I58A 1SW4A 2Q89A 1ATGA 5CBSA 4GWYA 3B6WA 5K2YA 2DYXA 1URDA 3O9PA 4Z0IA 3OENA 5J1DA 2I3WA 2DP8A 3S2VA 1IMAA 2HPGA 5H8QA 4R72A 1M5DA 3UIFA 3A3UA 4ZZEA 2RC8A 1EZOA 2DVCA 1FTLA 1RKMA 2XXTA 2QSXA 3K01A 1H45A 4H8JA 1ZJLA 2F5XA 1POTA 1PBQA 4XXUA 1QUIA 2ZMBA 1IXCA 3QUJA 5H8NB 2V3QA 3E4RA 3FVNA 4PFTA 2KLFA 3BIHA 5FHNA 4NF4B 2GQ1A 1OIBA 1GGGA 4BDMA 3JZJA 3N6TA 3CFLA 3I6VA 3OO7A 3TEPA 3RPLA 1B1HA 1TFDA 2OWZA 3UA8A 2DWAA 5JEIA 3PD9A 4HCYA 4Q5TA 3B50A 4XEQA 1B9JA 5JK4A 4H8IA 2DSFA 3HO7A 1LAXA 3NOHA 4AB6A 1LB8A 2F97A 3I3VA 3IL1B 4MH5A 2XX8A 3MWBA 4POWA 4DDDA 3RT6B 2OWTA 4RK9A 1NMUA 1MY2A 1Z7ME 4OANA 2QVRA 4PC9A 4HW8A 1GVCA 3U72A 5AA4B 1PB7A 4HTGA 3KOTA 3MW0A 3HN0A 3TQLA 1FTMA 4RA1A 3HHFA 3CR9A 1MXVA 2HQ0A 1EYIA 3FV1A 5FTIA 1Y3NA 5ET7A 1N76A 4XF5A 2ALUA 4F3PA 2OJTA 1LCFA 4GXAA 3ONMA 2OK2A 3CFZA 4OWDA 3PPQA 4NX1A 2DXRA 5L9SA 4GIZA 1IMCA 4MNPA 3QMFA 3ILUB 3QAXA 5I2KB 3MQ9A 5DYHA 1ZKBA 3N94A 3QSLA 3DELB 1OLCA 3PUYE 5CMKA 4N81A 4JVDA 4OFOA 1XVYA 3G3HA 3TCGA 2XXIA 3MZBA 1QUJA 2RKMA 4MX6A 4PDHA 4ECFA 1UTBB 3KN8A 3H4ZA 1K9YA 1GR2A 1NNTA 4NHBA 3OSQA 4N13A 4PBHA 2I4CA 4BLAA 1Y4CA 4I62A 2XX7A 4ND9A 4GWSA 4QRZA 3GYYA 3MYUA 1BIYA 4KPTA 2FIEA 2R71A 3UK4A 3Q27A 1SW1A 4QSEA 1H3DA 2QPQA 1FPIA 3RT8A 4PFUA 1EU8A 2MKZA 4G4PA 2DE4A 4MFIA 3IJOB 3K0VA 3G7WA 2GH9A 2ANJA 1NNKA 1QW0A 4Z7EA 4U23A 2W7YA 1B7HA 3K4UA 4PFWA 1P1OA 2QVUA 4F3SA 4GX4A 3PUXE 4OERA 1YXIA 3FXBA 4PTKA 1MPCA 4EUOA 3RPWA 5TPAA 2R8TA 3DP4A 1B4HA 4ELPA 1YCJA 4OYVA 1Y20A 4Q8RA 2OCUA 1A55A 4OESA 5ELVA 3AXFA 2ABHA 4N6KA 2X7PA 3IOUA 4ZEIA 4JXIA 4F31B 3TELA 3ZKLA 1M5FA 1UTHB 3SDFA 1WODA 2XXQA 4GWWA 4PP0A 3O28A 3IB2A 4WKMA 1MXWA 2XXUA 3CSBA 2G29A 4ZEDA 4DI4B 2QMWA 4FEBA 5EQAA 2HAVA 2FIXA 1IXIA 1UQWA 1FBCA 1P99A 2DWIA 2F6PA 3G3FA 3BBRA 3LUZA 5DVIA 4GOTA 4TLMB 3E78A 2O7IA 2ZXTA 3N26A 1A8EA 3HV1A 2BJJX 1NV7A 4LP2B 4H65A 1A7LA 2WBDA 4EF2A 2O6AA 4U1OA 2VT5A 3FVOA 4HXVA 3KG2A 1VFDA 4OVQA 1TXFA 1R6ZA 2ZNSA 2XXHA 3USDA 1SD3A 4FEDA 4NF5B 2Y7IA 1KZ8A 3KBRA 4MCOA 4IO7A 3VXCA 4N6DA 3TTMA 4JWXA 4R9FA 1MXXA 3IB1A 4E0XA 4G68C 1IXGA 2HXWA 1S9TA 3ZS6A 4THIA 2PT2A 1NUXA 1YPNA 4TLLB 3DLNA 1L5TA 1FPKA 5DVFA 3VLUA 2CZKA 3K2DA 1N0TA 2AYSA 1AL3A 3V5AA 3B6TA 3H6VA 1MXYA 2PYYA 3A3CA 5AA1A 4QSDA 3EF7A 1B2HA 1JEUA 3FUZA 3OSRA 2P2AA 3CFXA 4AQ4A 3ECRA 2I6EA 2HFBA 1POY1 2HXRA 1TWYA 1DPEA 4PE3A 4P47A 4P0IA 3T93B 2D3IA 2H4IA 3O6IA 1IIWA 5B7DA 1LFIA 3C32A 1B0HA 1DOTA 1KA0A 2VGQA 3LSXA 1WVJA 4OHNA 3SERA 1OQHA 4QF9A 4ZE9A 3SEVA 4F2OA 2Z8EA 1EYJA 2O1LA 1CNQA 1MY1A 2F3DA 1JW4A 2B65A 4UACA 2X7QA 1NUZA 2VD3A 4U1ZA 2H5YA 4PDDA 3GBBA 3PUWE 3O2AA 3PD8A 3R6UA 3TAJA 1I6BA 4JWOA 5FBPA 5M2VA 4NF8B 3T9UA 2HEUA 1NUWA 1US4A 3FJGA 4Q0CA 2QS4A 3M3LA 2I0BA 1NKXA 2I3VA 3K6WA 2P3VA 1LFGA 5IZ3B 1RDYA 4IY6A 4YAHX 2F7AA 3HCQA 3TTLA 1JVYA 3V8XB 2XXVA 3U1OA 3SKPA 4X9TA 3BIGA 1VR5A 1Y1MA 3RLFE 1SVXB 3U94A 2O69A 1IUDA 4FJPA 4NTLA 1EZ9A 5H8NA 4F29A 3TCFA 2O1MA 4NF4A 3FV2A 4FE8A 4RPNA 4YKKA 3SEYA 4OVTA 3PMXA 2HAUA 2Y7KA 4HE0A 3U93A 4O7IA 1R9QA 2V25A 4IB2A 2A5TA 2NWJA 4POXA 5J16A 5TU0A 2FYIA 3PUZE 4R6HA 2F36A 4MJOA 2M8CA 4I9DA 3MP8A 1LCTA 1II5A 1MQDA 4NN3A 4ZZAA 3H6TA 3C31A 1YZ0A 1MH3A 2REJA 3O29A 3PPRA 2G93A 1HSLA 5LTCA 3W9WA 3H7MA 3TFLA 1FPFA 1DK4A 3LSLA 5ISUA 4PFBA 3HHGA 1EYKA 5AA4A 1USYH 4MMPA 4G68A 4IO4A 4LZ8A 1ZLQA 3IORA 1B46A 2GHAA 3WAEA 1SW2A 3H03A 5JTYA 4LATA 1JVXA 3FATA 3IO6A 4FBPA 2HCAA 3VLWA 2REGA 1IXHA 5H8SA 1DMBA 4MNIA 4RK2A 3W9VA 3DP8A 4OA4A 4P1LA 2XWKA 2JJKA 4H6DA 3A29A 5IAIA 5I2KA 4YB6A 3PPOA 4N8GA 1S50A 3SEUA 3T22A 1O7TA 1FQDA 3IOWA 1D9QA 2Q8MA 2RC9A 3UORA 4GBVA 4F1YA 4NF6A 3VVDA 5CC2A 1UTBA 2XWOA 1JEVA 5I56B 5H8FB 2DE3A 2PCRA 5ICTA 1Y1ZA 2F8DA 1MPBA 3IOVA 3QUFA 2QRYA 2F7BA 4U4XA 1FPDA 1EZPA 4C1TA 1D3KA 4ELQA 5TP9B 2B3BA 1MQGA 3HFUA 4MNCA 3H6UA 1NH7A 4PFYA 4PAIA 2I0CA 4PF8A 3CG1A 4NAPA 1FBEA 1NV5A 3T0JA 3PU5A 1IMFA 4AS4A 3FXRA 4ZDMA 2QL3A 4NGUA 2DS9A 1FQCA 3IR1A 1DBZA 3HPIA 4ISUA 3L6HA 1QULA 3FXQA 4P11A 3T9HB 5EYHA 1FTOA 3RN8A 4EDPA 1SBPA 1PDAA 2DWHA 1WDNA 1TFAA 5KCJA 1P1UA 1F9BA 5A5XB 4FAJA 2D21A 5F1QA 1JW1A 4ONYA 4IY5A 3C36A 3FVGA 3E13X 4GL8A 3Q25A 4DCYA 2GFEA 1LLSA 2XWVA 4F39A 1B58A 1UTHA 3FBPA 4KYDA 5L9MA 1R9LA 4NWDA 2ONRA 1SI1A 1MG1A 1DTGA 2FA7A 1IEJA 2UXAA 4IO2A 5KDTB 2PBWA 4QFNA 3FJ7A 1BTJA 1IQ7A 4JSOA 1SYIA 1B5JA 1FBPA 2ZNTA 4PF6A 3K1PA 2E1SA 2UVHA 2Y7WA 4O8MA 2XXYA 3TKDA 4QSCA 1NH8A 4YB7A 3KEIA 2B4MA 2QFLA 1ELJA 1KA1A 4G8MA 1O63A 4ZEBA 1DCUA 1QKAA 4GVOA 5ITPA 3TTRA 4FIMA 1UIUA 3RPLB 5CBRA 1LBZA 3OELA 4NF0A 4NF5A 5EQ9A 3MVYA 2RCBA 1XHYA 5KZTA 4KFQA 4H1XA 1PB8A 2CEXA 2ZYNA 4GXSB 1IZ1A 4G61A 1N3XA 2DOJA 3U65A 3EPEA 3UN6A 4LONB 2KR0A 4YKJA 4EQ9A 2H98A 3EKIA 3V89B 4G8HA 1NFTA 4LZ7A 5IZZA 3S9MC 4I3YA 1BP5A 4P1EA 3OOAA 4E0WA 4ESWA 3MUQA 1T0KA 4R74A 1PC3A 3K00A 4XKQA 1SI0A 4XKNA 3VXBA 1A54A 2V84A 2PMSA 3T9VA 2Y7PA 2R9JA 4R6KA 3M8UA 3A09A 1FW0A 4ESXA 2FNCA 4R2BA 4GWOA 1B3EA 2HHMA 1SQYA 1A40A 2F7CA 3THIA 1LSTA 3B8BA 5I7IA 4M1VA 3OO8A 4OTEA 2AIXA 2E0SA 4OFJA 3TMGA 3K6VA 1Q1KA 1VDWA 5T3JA 4QHQA 2ZYOA 3E9XA 5CMCA 4JVIA 2OWSA 3T66A 2ZYKA 4QBAA 2CEYA 3SEXA 2Z22A 5DEXB 4KI0E 1AH5A 4NF8A 4OXVA 3VV5A 2UVIA 3QYTA 3PPNA 4DLDA 2RF1A 3S9EA 1FPJA 3WAFA 3RTFB 3I5OA 3KN3A 3RY3A 1A99A 2WYKA 4AB5A 2Q2CA 4P9KA 3KOSA 2PFZA 3MBPA 2WYPA 1HSEA 3VLVA 5I59A 1FRPA 4BDLA 1N3WA 4Q30B 4XFEA 3H06B 4KYEA 1B3HA 4MHFA 1K9ZA 3EN3A 4UA8A 3KSXA 1NUYA 5AA2B 1OVBA 3RGYA 2XXKA 2ONSA 3GLBA 4JDFA 5FHOA 3C34A 4P3LA 3M3KA 4RNSA 5ET6A 3D4CA 1D9VA 3OD7A 4NE4A 4ZECA 3JYRA 4MAGA 2CZLA 3G3GA 4XTCQ 1FBDA 2WBBA 4RY1A 3CRBA 4WXJA 3GZGA 2NOOA 2ZZWA 4DXUA 1LBYA 4ZE8A 5I3SA 2XD2A 3N5LA 1MS7A 4GFRA 2V3UA 3H3GA 1NI9A 1B32A 2XD3A 1PBPA 4R6YA 3UGWA 1ZIUA 2PVUA 4N07A 4IO6A 1FBHA 4OENA 2PX1A 4FECA 2XWIA 3SEWA 3G3JA 1QKBA 4U21A 1MDP1 1QGXA 1DTZA 5BUUA 4RYAA 3FJMA 5LDZA 4YZZA 2ZNUA 4LZ5A 3R7XA 3KFMA 4F1VA 4BDQA 2XXWA 1MY4A 1FJ6A 4ZEFA 3IO4A 4GF8A 1FQBA 2P0SA 4KHZE 4H5FA 1AIVA 2WKYA 2R6GE 5HM4B 5ET5A 2Y84A 5DTBA 3KBZA 4LQ2A 1ZTYA 4X48A 2VHAA 1USYE 4MIJA 2NUVA 4C1UA 1LBVA 2P1SA 4F1UA 3OEKA 4QFOA 5I56A 1MQJA 4KCCA 3GXAA 1D4NA 4F2QA 2CZIA 4O7MA 5AA2D 3K02A 4OVJA 5H8HB 1QJMA 2XXXA 4PQJA 3FXUA 5L9OA 1S7YA 5A5LA 3L6GA 5EYGA 3MZ9A 1FPBA 1Y4TA 1B5HA 5EHMA 5TP9A 2VOZA 5I2NB 2VP1A 3CI8A 4PAKA 3TTKA 4YMBA 3PPPA 5I84A 4G8NA 5F24A 3TODA 1D9YA 2I4BA 3CIJA 3JV9A 3TPAA 1Y3PA 3O66A 4WEPA 1G0IA 3TZAA 5EHSA 2LAOA 3V83A 2L5VA 1MH4A 3MPLA 4I40A 4N91A 2IEEA 4EF1A 1G0HA 1B3LA 4HCWA 4JSDA 3IK6B 3MP1A 5FTHA 1XS5A 3T9XB 4O94A 1NV0A 3VFJA 4X1DA 3KJTA 4GD5A 3ZSFA 5IKBA 2Z23A 3IAZA 4GBWA 4TOZA 2X26A 3TCHA 4GRKA 5K2XA 1NV2A 3HSTA 1FQEA 4DXBA 3EHSA 1SW5A 5I57B 5IGAA 3FIRA 1JQFA 2UVJA 1B3GA 3TYHA 1IMDA 1YYZA 1B52A 2H99A 2V4CA 1B3FA 3CG3A 3KC0A 1B6HA 4MEVA 2FBPA 3VDFA 1RYXA 1M5CA 4XIGQ 4YKPA 4RJZA 1ZBMA 5CMMA 3ILTB 4PAFA 4QFKA 3EHTA 1FPGA 3O6HA 1B05A 1BKAA 1XVXA 3KZGA 1CB6A 4DXCA 2QJEA 3U8QA 5KDTA 1FTJA 1O64A 1MQIA 2GHBA 1FTKA 4N4UA 4JB7A 5BWJA 3QXMA 1LAFE 4PCDA 2Q9TA 4JWYA 1XOCA 4JBZA 3BFTA 5DT6A 2ZZVA 2OBGA 1MXZA 5B70A 4F22A 1HSJA 2GRVA 2F6GA 4H67A 4YICA 1RDXA 1B51A 4N15A 3LBSA 2A5TB 4P0GA 4G2ZA 1LAGE 1Z7NE 3BFUA 3TTNA 4OMBA 4X04A 4IR8A 4N17A 1SPIA 2A5SA 3UP9A 3IOTA 5FHMA 1P1QA 2ESNA 2O84X 4RXLA 1OQGA 1B5IA 4OZ9A 4P8BA 3PGFA 1VE4A 2B4LA 3OEMA 1N7WA 4G68B 4QXDA 4GWZA 1DPPA 1MY0A 4L17A 1YAEA 4P56A 1B40A 1MM7A 4ZS9A 4PFIA 5DW8A 3S9NC 5JTYB 4I1DA 3MP6A
chains in the Genus database with same CATH topology
3KC1A 4OVSA 5I7IA 4GX6A 4M1VA 1NUZA 5ESYA 2F3BA 4PDDA 4GWUA 3ROJA 1VDWA 3T1BA 5T3JA 1IMEA 2WEFA 5FBPA 4JVIA 4F18A 4GWYA 4QBAA 2CEYA 1NUWA 5J1DA 2ZZXA 4KXPA 1IMAA 2HPGA 1XI6A 2P3VA 5IZ3B 1RDYA 2F5XA 1FPJA 2V3QA 2Y5KA 4X9TA 4OVPA 3BIGA 3BIHA 2GQ1A 1FBFA 2WYKA 4P9KA 3RPLA 2PFZA 2OWZA 2WYPA 2FHYA 1LBWA 1FRPA 4XFEA 5IM2A 4DI3D 4HCYA 4OVTA 3B50A 4HE0A 4MHFA 1K9ZA 4O7IA 4XEQA 5JK4A 3NOHA 5J16A 1NUYA 4NQ8A 4MJOA 2XXKA 4NN3A 4P3LA 2Q74A 5ET6A 1YZ0A 4OANA 4HE2A 2QVRA 4PC9A 4MAGA 5LTCA 1FBDA 2WBBA 3W9WA 1FPFA 1DK4A 2ZZWA 1LBYA 3D1RA 5I3SA 3IFAA 4PFBA 1EYKA 1EYIA 1LEVA 4MMPA 1FTAA 5ET7A 3ISPA 4XF5A 4I3EA 1NI9A 4FBPA 4NX1A 1FBHA 4NG7A 1IMCA 2CZHA 2XWIA 4MNPA 3QMFA 1NV4A 4MNIA 4PETA 3W9VA 1QGXA 1AWBA 4OA4A 4P1LA 5LDZA 2XWKA 2JJKA 4YZZA 3MSTA 4N81A 4F1VA 3A29A 4JVDA 4N8GA 1FJ6A 4X8RA 4MX6A 2P3NA 4PDHA 1K9YA 5ET5A 3KBZA 1D9QA 4H45A 4H46A 2Q8MA 4NHBA 4GBVA 4MIJA 4PBHA 5IZ3A 2XWOA 2OX3A 2DDKA 1LBVA 1RDZA 2DE3A 3SZPA 2PCRA 4F1UA 4GWSA 3GYYA 3MYUA 1FPEA 2FIEA 2QPQA 5CM6A 1FPDA 1FPIA 2MKZA 3E79A 2CZIA 3HFUA 4O7MA 2DE4A 4MNCA 4OVRA 4PAIA 4PF8A 4NAPA 1FBEA 1NV5A 3T0JA 5A5LA 5I5PA 5EYGA 1FPBA 3RYDA 1IMFA 4PAKA 4AS4A 2QVUA 5F24A 4GX4A 4NGUA 4F19A 1YXIA 5IZ1A 3FXBA 4PTKA 1G0IA 2R8TA 1DBZA 2L5VA 4I40A 4N91A 3LV0A 1G0HA 5EYHA 4PGPA 4LN5A 4HCWA 2HZLA 4N6KA 4O94A 1NV0A 1NV1A 2PFYA 4PBQA 4GBWA 2XA5A 4GWWA 1NV2A 3IFCA 5EQ7A 4DI4B 1NV3A 2XWVA 5EQAA 3FBPA 2FIXA 5IGAA 1FBCA 1IMDA 1YYZA 2V4CA 3KC0A 4MEVA 3LUZA 2FBPA 4PGNA 3E78A 2WX9A 1NV7A 1INPA 4PAFA 1FSAA 2FVZA 2WBDA 1FPGA 1FBPA 2VT5A 4AS5A 4PF6A 4HXVA 4O8MA 4OVQA 2B4MA 2QFLA 1KA1A 2DVZA 1DCUA 4MCOA 1KZ8A 4N4UA 1JP4A 1IMBA 4N6DA 4PCDA 2Q9TA 3RPLB 1LBZA 4NF0A 2ZZVA 5EQ9A 1Q9DA 4YICA 2Y5LA 1RDXA 2CEXA 1NUXA 1BK4A 4N15A 4PFRA 4G61A 3PTYA 3U65A 1FPKA 1LBXA 1NV6A 2KR0A 2VPNA 5ET8A 3EKIA 4HE1A 2CZKA 1FBGA 2HZKA 5IZZA 4UABA 2KQZA 4X04A 4IR8A 4I3YA 4N17A 1SPIA 4JVCA 4P1EA 2DE2A 2QVVA 2VPOA 2HXRA 1FPLA 2BJIA 4P8BA 4PE3A 4P47A 4GWXA 4N8YA 2B4LA 4QXDA 4GWZA 1KA0A 4P56A 5EQ8A 4PFIA 5DW8A 2HHMA 1FJ9A 4GX3A 1EYJA 1CNQA 3CHGA 3B8BA 2F3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVS A;  4OAN A;  5I7I A;  5CM6 A;  4PC9 A;  4MAG A;  4PF6 A;  4O8M A;  5LTC A;  4OVQ A;  4PDD A;  4O7M A;  4MNC A;  4OVR A;  2ZZW A;  4MCO A;  4N4U A;  4PAI A;  4PF8 A;  4NAP A;  5I5P A;  4PFB A;  4N6D A;  4PCD A;  4MMP A;  2CEY A;  4PAK A;  4XF5 A;  4NF0 A;  2ZZV A;  2ZZX A;  2HPG A;  4NGU A;  3FXB A;  4YIC A;  4NX1 A;  2CEX A;  4NG7 A;  4N15 A;  4PFR A;  3U65 A;  4N91 A;  2XWI A;  4MNP A;  4PGP A;  2VPN A;  4LN5 A;  2HZL A;  4MNI A;  2HZK A;  4PET A;  4N6K A;  5IZZ A;  4O94 A;  4UAB A;  4OA4 A;  4X04 A;  4OVP A;  4N17 A;  2PFY A;  4P1L A;  2XWK A;  4YZZ A;  4P1E A;  4PBQ A;  2WYK A;  2XA5 A;  4N8G A;  4P9K A;  2PFZ A;  4X8R A;  2VPO A;  2WYP A;  4MX6 A;  4PDH A;  4DI4 B;  4XFE A;  2XWV A;  4P8B A;  5IM2 A;  4PE3 A;  4P47 A;  4DI3 D;  5IGA A;  4N8Y A;  4OVT A;  3B50 A;  4NHB A;  4MHF A;  4MIJ A;  4PBH A;  4XEQ A;  2XWO A;  2V4C A;  4P56 A;  4MEV A;  4PGN A;  4PFI A;  2WX9 A;  4NQ8 A;  2XXK A;  3GYY A;  4NN3 A;  4PAF A;  4P3L A; 
#chains in the Genus database with same CATH topology
 4OVS A;  4LA9 A;  4M4G A;  1I69 A;  5I58 B;  4NED A;  3R26 A;  4ELO A;  4GWU A;  3ROJ A;  1OMP A;  3RNN A;  3VE1 B;  5H8Q B;  4I8C A;  3KSJ A;  4F18 A;  3PMW A;  1YTV A;  4DE8 A;  1R1N A;  5ICQ A;  3QIM A;  3D4G A;  1NNF A;  2ZZX A;  1URG A;  4KXP A;  4WED A;  2VD2 A;  4K3F A;  1XI6 A;  3ZKK A;  2H25 A;  3C9H A;  3P7I A;  3EQ1 A;  4NF6 B;  2UYF A;  3G3K A;  2YLN A;  5L8D A;  5DEX A;  2ONK E;  4FAT A;  4G77 A;  4OEU A;  2Y5K A;  1H43 A;  1MRP A;  4OVP A;  3S4U A;  1QUK A;  1FBF A;  1B1X A;  2Z8F A;  1SYH A;  2UVG A;  3M3F A;  3Q28 A;  3E3K A;  2FHY A;  1LBW A;  2YPN A;  5IM2 A;  1ZU0 A;  4DI3 D;  4YU0 A;  3W15 C;  3RTW B;  2NVU B;  3IJX B;  4OEV A;  4OQO A;  4YB5 A;  2OZZ A;  1M5E A;  4EXL A;  4NQ8 A;  4QFP A;  4OET A;  4PE5 B;  2I58 A;  3MAM A;  3B6Q A;  2Q74 A;  4HE2 A;  3EHU A;  2V93 A;  1KWH A;  3VVE A;  3DM0 A;  5AA2 A;  4XKR A;  2OLB A;  1M5B A;  3RUM A;  3B7D A;  3U92 A;  5KCJ B;  3QK6 A;  4R9G A;  1URS A;  3D1R A;  3FD3 A;  4U22 A;  3IFA A;  2ZYM A;  1PEB A;  4U4S A;  4DCX A;  1LEV A;  5CRY A;  1FTA A;  3ISP A;  4I3E A;  4KCD A;  1H44 A;  1LBB A;  4HS7 A;  4KQP A;  1SDX A;  3C35 A;  3S9L C;  4DZ1 A;  3LSF B;  2QS3 A;  4NG7 A;  3TUS A;  3N6U A;  2CZH A;  3PMV A;  2RIN A;  2Q88 A;  4H0W A;  1NV4 A;  1GTK A;  4MBP A;  4KD5 A;  1B7U A;  1AOV A;  4PET A;  1US5 A;  1AWB A;  1OVT A;  3MVX A;  4IO5 A;  3MST A;  3OO6 A;  1N84 A;  4OFL A;  4O3B A;  1JNF A;  3K6X A;  4X8R A;  1GV8 A;  2RC7 A;  3MVW A;  1CE2 A;  3DP6 A;  2P3N A;  2B3F A;  4R2F A;  4LVQ A;  4DIG A;  4XKP A;  4H45 A;  4H46 A;  4F3G A;  2Q2A A;  1MQH A;  5IZ3 A;  4LQ5 A;  1P1N A;  1H76 A;  2OX3 A;  2DDK A;  4YKI A;  1RDZ A;  3SZP A;  1MM6 A;  4R75 A;  2THI A;  1LGB C;  2O7U A;  1FPE A;  1XC1 A;  3ODB A;  1ANF A;  2QS2 A;  5CM6 A;  3PUV E;  1DSN A;  1LBC A;  1LAH E;  2UYE A;  3E79 A;  4GL0 A;  4EXK A;  4MLV A;  4MLQ A;  4OVR A;  3OO9 A;  5I5P A;  5TPA B;  2F78 A;  3RYD A;  1FQF A;  5AE4 A;  3K6U A;  1Q35 A;  5H8H A;  4TQU Q;  1QVS A;  2DQV A;  4F19 A;  5HPQ A;  5IZ1 A;  1LFH A;  4R73 A;  2I49 A;  5I2N A;  2YJP A;  3PV0 E;  1FQA A;  4BDN A;  2Q8J A;  2DXY A;  3LV0 A;  1MPD A;  1VSO A;  3CVG A;  4PGP A;  4RPO A;  3OXN A;  4LN5 A;  4IGR A;  2HZL A;  2Y7R A;  4FOR A;  4O3A A;  4GLI A;  1NV1 A;  1NL5 A;  2PFY A;  4EQ7 A;  4H5G A;  1FCK A;  3BKI B;  2AL5 A;  1MXU A;  4PBQ A;  2QMX A;  2XA5 A;  1N7X A;  1J1N A;  2V3T A;  3K1N A;  5CI5 A;  5DVJ A;  3IFC A;  3MZ1 A;  5EQ7 A;  3RQT A;  1NV3 A;  3TDJ A;  1B7Z A;  4NMY A;  3MPK A;  4U2R A;  2CMO A;  1OLA A;  4X1B A;  4NWC A;  3FZV A;  1XT8 A;  3FGS A;  4ZEK A;  1B4Z A;  4PGN A;  2WX9 A;  5I57 A;  5CMB A;  3LSW A;  1TT1 A;  1INP A;  1FSA A;  2FVZ A;  2DWJ A;  4AS5 A;  4BDR A;  3KJ7 A;  1NNP A;  2Z8D A;  3OMB A;  3GBA A;  4KR5 A;  2D5W A;  2DVZ A;  2NXO A;  1ZMG A;  3IB0 A;  1JP4 A;  1B0L A;  4EQB A;  3MC2 A;  1IMB A;  4IGT A;  5LOM A;  1Y9U A;  2I48 A;  5I59 B;  3LC8 A;  5H8F A;  1MDQ A;  1AMF A;  4YMA A;  1BLF A;  2H9B A;  1Q9D A;  2Y5L A;  1BK4 A;  4PFR A;  5AA3 A;  3PTY A;  1LBX A;  1P1W A;  1NV6 A;  3C33 A;  2VPN A;  5ET8 A;  3LR1 A;  2F34 A;  4HE1 A;  1FBG A;  2HZK A;  2IA4 A;  3CSG A;  1I6A A;  4UAB A;  2KQZ A;  4JVC A;  1JW5 A;  3C4M A;  4KYS A;  1IIT A;  2DE2 A;  2QVV A;  3MJN A;  4N6P A;  3SET A;  3KGC A;  3Q29 A;  1LB9 A;  2VPO A;  3F11 A;  5F7V A;  1EH3 A;  3IX1 A;  1FPL A;  2QS1 A;  2BJI A;  4GQO A;  3TQW A;  4GWX A;  4C0R A;  4N8Y A;  3O6G A;  2O51 A;  3MVZ A;  2XXP A;  4IO3 A;  1I6Q A;  3T96 B;  2XHD A;  3H6W A;  3LUY A;  4F3B A;  4ELR A;  2PT1 A;  2RCA A;  5EQ8 A;  1Y3Q A;  1FJ9 A;  4GX3 A;  1A8F A;  1VFE A;  3CHG A;  3VVF A;  3KC1 A;  1RYO A;  5ITO A;  5A5X A;  2AL4 A;  3FVK A;  4GX6 A;  1MY3 A;  4O3C A;  1UIV A;  1JET A;  3G3I A;  5ESY A;  2F3B A;  3KN7 A;  3FAS A;  3SES A;  3Q26 A;  4LUB A;  3K1M A;  1N04 A;  4MF3 A;  2O68 A;  3T1B A;  4QFL A;  1IME A;  2WEF A;  2F35 A;  4BDO A;  2XX9 A;  5HBC A;  5EYF A;  1PB9 A;  2XXR A;  3O97 A;  5I58 A;  1SW4 A;  2Q89 A;  1ATG A;  5CBS A;  4GWY A;  3B6W A;  5K2Y A;  2DYX A;  1URD A;  3O9P A;  4Z0I A;  3OEN A;  5J1D A;  2I3W A;  2DP8 A;  3S2V A;  1IMA A;  2HPG A;  5H8Q A;  4R72 A;  1M5D A;  3UIF A;  3A3U A;  4ZZE A;  2RC8 A;  1EZO A;  2DVC A;  1FTL A;  1RKM A;  2XXT A;  2QSX A;  3K01 A;  1H45 A;  4H8J A;  1ZJL A;  2F5X A;  1POT A;  1PBQ A;  4XXU A;  1QUI A;  2ZMB A;  1IXC A;  3QUJ A;  5H8N B;  2V3Q A;  3E4R A;  3FVN A;  4PFT A;  2KLF A;  3BIH A;  5FHN A;  4NF4 B;  2GQ1 A;  1OIB A;  1GGG A;  4BDM A;  3JZJ A;  3N6T A;  3CFL A;  3I6V A;  3OO7 A;  3TEP A;  3RPL A;  1B1H A;  1TFD A;  2OWZ A;  3UA8 A;  2DWA A;  5JEI A;  3PD9 A;  4HCY A;  4Q5T A;  3B50 A;  4XEQ A;  1B9J A;  5JK4 A;  4H8I A;  2DSF A;  3HO7 A;  1LAX A;  3NOH A;  4AB6 A;  1LB8 A;  2F97 A;  3I3V A;  3IL1 B;  4MH5 A;  2XX8 A;  3MWB A;  4POW A;  4DDD A;  3RT6 B;  2OWT A;  4RK9 A;  1NMU A;  1MY2 A;  1Z7M E;  4OAN A;  2QVR A;  4PC9 A;  4HW8 A;  1GVC A;  3U72 A;  5AA4 B;  1PB7 A;  4HTG A;  3KOT A;  3MW0 A;  3HN0 A;  3TQL A;  1FTM A;  4RA1 A;  3HHF A;  3CR9 A;  1MXV A;  2HQ0 A;  1EYI A;  3FV1 A;  5FTI A;  1Y3N A;  5ET7 A;  1N76 A;  4XF5 A;  2ALU A;  4F3P A;  2OJT A;  1LCF A;  4GXA A;  3ONM A;  2OK2 A;  3CFZ A;  4OWD A;  3PPQ A;  4NX1 A;  2DXR A;  5L9S A;  4GIZ A;  1IMC A;  4MNP A;  3QMF A;  3ILU B;  3QAX A;  5I2K B;  3MQ9 A;  5DYH A;  1ZKB A;  3N94 A;  3QSL A;  3DEL B;  1OLC A;  3PUY E;  5CMK A;  4N81 A;  4JVD A;  4OFO A;  1XVY A;  3G3H A;  3TCG A;  2XXI A;  3MZB A;  1QUJ A;  2RKM A;  4MX6 A;  4PDH A;  4ECF A;  1UTB B;  3KN8 A;  3H4Z A;  1K9Y A;  1GR2 A;  1NNT A;  4NHB A;  3OSQ A;  4N13 A;  4PBH A;  2I4C A;  4BLA A;  1Y4C A;  4I62 A;  2XX7 A;  4ND9 A;  4GWS A;  4QRZ A;  3GYY A;  3MYU A;  1BIY A;  4KPT A;  2FIE A;  2R71 A;  3UK4 A;  3Q27 A;  1SW1 A;  4QSE A;  1H3D A;  2QPQ A;  1FPI A;  3RT8 A;  4PFU A;  1EU8 A;  2MKZ A;  4G4P A;  2DE4 A;  4MFI A;  3IJO B;  3K0V A;  3G7W A;  2GH9 A;  2ANJ A;  1NNK A;  1QW0 A;  4Z7E A;  4U23 A;  2W7Y A;  1B7H A;  3K4U A;  4PFW A;  1P1O A;  2QVU A;  4F3S A;  4GX4 A;  3PUX E;  4OER A;  1YXI A;  3FXB A;  4PTK A;  1MPC A;  4EUO A;  3RPW A;  5TPA A;  2R8T A;  3DP4 A;  1B4H A;  4ELP A;  1YCJ A;  4OYV A;  1Y20 A;  4Q8R A;  2OCU A;  1A55 A;  4OES A;  5ELV A;  3AXF A;  2ABH A;  4N6K A;  2X7P A;  3IOU A;  4ZEI A;  4JXI A;  4F31 B;  3TEL A;  3ZKL A;  1M5F A;  1UTH B;  3SDF A;  1WOD A;  2XXQ A;  4GWW A;  4PP0 A;  3O28 A;  3IB2 A;  4WKM A;  1MXW A;  2XXU A;  3CSB A;  2G29 A;  4ZED A;  4DI4 B;  2QMW A;  4FEB A;  5EQA A;  2HAV A;  2FIX A;  1IXI A;  1UQW A;  1FBC A;  1P99 A;  2DWI A;  2F6P A;  3G3F A;  3BBR A;  3LUZ A;  5DVI A;  4GOT A;  4TLM B;  3E78 A;  2O7I A;  2ZXT A;  3N26 A;  1A8E A;  3HV1 A;  2BJJ X;  1NV7 A;  4LP2 B;  4H65 A;  1A7L A;  2WBD A;  4EF2 A;  2O6A A;  4U1O A;  2VT5 A;  3FVO A;  4HXV A;  3KG2 A;  1VFD A;  4OVQ A;  1TXF A;  1R6Z A;  2ZNS A;  2XXH A;  3USD A;  1SD3 A;  4FED A;  4NF5 B;  2Y7I A;  1KZ8 A;  3KBR A;  4MCO A;  4IO7 A;  3VXC A;  4N6D A;  3TTM A;  4JWX A;  4R9F A;  1MXX A;  3IB1 A;  4E0X A;  4G68 C;  1IXG A;  2HXW A;  1S9T A;  3ZS6 A;  4THI A;  2PT2 A;  1NUX A;  1YPN A;  4TLL B;  3DLN A;  1L5T A;  1FPK A;  5DVF A;  3VLU A;  2CZK A;  3K2D A;  1N0T A;  2AYS A;  1AL3 A;  3V5A A;  3B6T A;  3H6V A;  1MXY A;  2PYY A;  3A3C A;  5AA1 A;  4QSD A;  3EF7 A;  1B2H A;  1JEU A;  3FUZ A;  3OSR A;  2P2A A;  3CFX A;  4AQ4 A;  3ECR A;  2I6E A;  2HFB A;  1POY 1;  2HXR A;  1TWY A;  1DPE A;  4PE3 A;  4P47 A;  4P0I A;  3T93 B;  2D3I A;  2H4I A;  3O6I A;  1IIW A;  5B7D A;  1LFI A;  3C32 A;  1B0H A;  1DOT A;  1KA0 A;  2VGQ A;  3LSX A;  1WVJ A;  4OHN A;  3SER A;  1OQH A;  4QF9 A;  4ZE9 A;  3SEV A;  4F2O A;  2Z8E A;  1EYJ A;  2O1L A;  1CNQ A;  1MY1 A;  2F3D A;  1JW4 A;  2B65 A;  4UAC A;  2X7Q A;  1NUZ A;  2VD3 A;  4U1Z A;  2H5Y A;  4PDD A;  3GBB A;  3PUW E;  3O2A A;  3PD8 A;  3R6U A;  3TAJ A;  1I6B A;  4JWO A;  5FBP A;  5M2V A;  4NF8 B;  3T9U A;  2HEU A;  1NUW A;  1US4 A;  3FJG A;  4Q0C A;  2QS4 A;  3M3L A;  2I0B A;  1NKX A;  2I3V A;  3K6W A;  2P3V A;  1LFG A;  5IZ3 B;  1RDY A;  4IY6 A;  4YAH X;  2F7A A;  3HCQ A;  3TTL A;  1JVY A;  3V8X B;  2XXV A;  3U1O A;  3SKP A;  4X9T A;  3BIG A;  1VR5 A;  1Y1M A;  3RLF E;  1SVX B;  3U94 A;  2O69 A;  1IUD A;  4FJP A;  4NTL A;  1EZ9 A;  5H8N A;  4F29 A;  3TCF A;  2O1M A;  4NF4 A;  3FV2 A;  4FE8 A;  4RPN A;  4YKK A;  3SEY A;  4OVT A;  3PMX A;  2HAU A;  2Y7K A;  4HE0 A;  3U93 A;  4O7I A;  1R9Q A;  2V25 A;  4IB2 A;  2A5T A;  2NWJ A;  4POX A;  5J16 A;  5TU0 A;  2FYI A;  3PUZ E;  4R6H A;  2F36 A;  4MJO A;  2M8C A;  4I9D A;  3MP8 A;  1LCT A;  1II5 A;  1MQD A;  4NN3 A;  4ZZA A;  3H6T A;  3C31 A;  1YZ0 A;  1MH3 A;  2REJ A;  3O29 A;  3PPR A;  2G93 A;  1HSL A;  5LTC A;  3W9W A;  3H7M A;  3TFL A;  1FPF A;  1DK4 A;  3LSL A;  5ISU A;  4PFB A;  3HHG A;  1EYK A;  5AA4 A;  1USY H;  4MMP A;  4G68 A;  4IO4 A;  4LZ8 A;  1ZLQ A;  3IOR A;  1B46 A;  2GHA A;  3WAE A;  1SW2 A;  3H03 A;  5JTY A;  4LAT A;  1JVX A;  3FAT A;  3IO6 A;  4FBP A;  2HCA A;  3VLW A;  2REG A;  1IXH A;  5H8S A;  1DMB A;  4MNI A;  4RK2 A;  3W9V A;  3DP8 A;  4OA4 A;  4P1L A;  2XWK A;  2JJK A;  4H6D A;  3A29 A;  5IAI A;  5I2K A;  4YB6 A;  3PPO A;  4N8G A;  1S50 A;  3SEU A;  3T22 A;  1O7T A;  1FQD A;  3IOW A;  1D9Q A;  2Q8M A;  2RC9 A;  3UOR A;  4GBV A;  4F1Y A;  4NF6 A;  3VVD A;  5CC2 A;  1UTB A;  2XWO A;  1JEV A;  5I56 B;  5H8F B;  2DE3 A;  2PCR A;  5ICT A;  1Y1Z A;  2F8D A;  1MPB A;  3IOV A;  3QUF A;  2QRY A;  2F7B A;  4U4X A;  1FPD A;  1EZP A;  4C1T A;  1D3K A;  4ELQ A;  5TP9 B;  2B3B A;  1MQG A;  3HFU A;  4MNC A;  3H6U A;  1NH7 A;  4PFY A;  4PAI A;  2I0C A;  4PF8 A;  3CG1 A;  4NAP A;  1FBE A;  1NV5 A;  3T0J A;  3PU5 A;  1IMF A;  4AS4 A;  3FXR A;  4ZDM A;  2QL3 A;  4NGU A;  2DS9 A;  1FQC A;  3IR1 A;  1DBZ A;  3HPI A;  4ISU A;  3L6H A;  1QUL A;  3FXQ A;  4P11 A;  3T9H B;  5EYH A;  1FTO A;  3RN8 A;  4EDP A;  1SBP A;  1PDA A;  2DWH A;  1WDN A;  1TFA A;  5KCJ A;  1P1U A;  1F9B A;  5A5X B;  4FAJ A;  2D21 A;  5F1Q A;  1JW1 A;  4ONY A;  4IY5 A;  3C36 A;  3FVG A;  3E13 X;  4GL8 A;  3Q25 A;  4DCY A;  2GFE A;  1LLS A;  2XWV A;  4F39 A;  1B58 A;  1UTH A;  3FBP A;  4KYD A;  5L9M A;  1R9L A;  4NWD A;  2ONR A;  1SI1 A;  1MG1 A;  1DTG A;  2FA7 A;  1IEJ A;  2UXA A;  4IO2 A;  5KDT B;  2PBW A;  4QFN A;  3FJ7 A;  1BTJ A;  1IQ7 A;  4JSO A;  1SYI A;  1B5J A;  1FBP A;  2ZNT A;  4PF6 A;  3K1P A;  2E1S A;  2UVH A;  2Y7W A;  4O8M A;  2XXY A;  3TKD A;  4QSC A;  1NH8 A;  4YB7 A;  3KEI A;  2B4M A;  2QFL A;  1ELJ A;  1KA1 A;  4G8M A;  1O63 A;  4ZEB A;  1DCU A;  1QKA A;  4GVO A;  5ITP A;  3TTR A;  4FIM A;  1UIU A;  3RPL B;  5CBR A;  1LBZ A;  3OEL A;  4NF0 A;  4NF5 A;  5EQ9 A;  3MVY A;  2RCB A;  1XHY A;  5KZT A;  4KFQ A;  4H1X A;  1PB8 A;  2CEX A;  2ZYN A;  4GXS B;  1IZ1 A;  4G61 A;  1N3X A;  2DOJ A;  3U65 A;  3EPE A;  3UN6 A;  4LON B;  2KR0 A;  4YKJ A;  4EQ9 A;  2H98 A;  3EKI A;  3V89 B;  4G8H A;  1NFT A;  4LZ7 A;  5IZZ A;  3S9M C;  4I3Y A;  1BP5 A;  4P1E A;  3OOA A;  4E0W A;  4ESW A;  3MUQ A;  1T0K A;  4R74 A;  1PC3 A;  3K00 A;  4XKQ A;  1SI0 A;  4XKN A;  3VXB A;  1A54 A;  2V84 A;  2PMS A;  3T9V A;  2Y7P A;  2R9J A;  4R6K A;  3M8U A;  3A09 A;  1FW0 A;  4ESX A;  2FNC A;  4R2B A;  4GWO A;  1B3E A;  2HHM A;  1SQY A;  1A40 A;  2F7C A;  3THI A;  1LST A;  3B8B A;  5I7I A;  4M1V A;  3OO8 A;  4OTE A;  2AIX A;  2E0S A;  4OFJ A;  3TMG A;  3K6V A;  1Q1K A;  1VDW A;  5T3J A;  4QHQ A;  2ZYO A;  3E9X A;  5CMC A;  4JVI A;  2OWS A;  3T66 A;  2ZYK A;  4QBA A;  2CEY A;  3SEX A;  2Z22 A;  5DEX B;  4KI0 E;  1AH5 A;  4NF8 A;  4OXV A;  3VV5 A;  2UVI A;  3QYT A;  3PPN A;  4DLD A;  2RF1 A;  3S9E A;  1FPJ A;  3WAF A;  3RTF B;  3I5O A;  3KN3 A;  3RY3 A;  1A99 A;  2WYK A;  4AB5 A;  2Q2C A;  4P9K A;  3KOS A;  2PFZ A;  3MBP A;  2WYP A;  1HSE A;  3VLV A;  5I59 A;  1FRP A;  4BDL A;  1N3W A;  4Q30 B;  4XFE A;  3H06 B;  4KYE A;  1B3H A;  4MHF A;  1K9Z A;  3EN3 A;  4UA8 A;  3KSX A;  1NUY A;  5AA2 B;  1OVB A;  3RGY A;  2XXK A;  2ONS A;  3GLB A;  4JDF A;  5FHO A;  3C34 A;  4P3L A;  3M3K A;  4RNS A;  5ET6 A;  3D4C A;  1D9V A;  3OD7 A;  4NE4 A;  4ZEC A;  3JYR A;  4MAG A;  2CZL A;  3G3G A;  4XTC Q;  1FBD A;  2WBB A;  4RY1 A;  3CRB A;  4WXJ A;  3GZG A;  2NOO A;  2ZZW A;  4DXU A;  1LBY A;  4ZE8 A;  5I3S A;  2XD2 A;  3N5L A;  1MS7 A;  4GFR A;  2V3U A;  3H3G A;  1NI9 A;  1B32 A;  2XD3 A;  1PBP A;  4R6Y A;  3UGW A;  1ZIU A;  2PVU A;  4N07 A;  4IO6 A;  1FBH A;  4OEN A;  2PX1 A;  4FEC A;  2XWI A;  3SEW A;  3G3J A;  1QKB A;  4U21 A;  1MDP 1;  1QGX A;  1DTZ A;  5BUU A;  4RYA A;  3FJM A;  5LDZ A;  4YZZ A;  2ZNU A;  4LZ5 A;  3R7X A;  3KFM A;  4F1V A;  4BDQ A;  2XXW A;  1MY4 A;  1FJ6 A;  4ZEF A;  3IO4 A;  4GF8 A;  1FQB A;  2P0S A;  4KHZ E;  4H5F A;  1AIV A;  2WKY A;  2R6G E;  5HM4 B;  5ET5 A;  2Y84 A;  5DTB A;  3KBZ A;  4LQ2 A;  1ZTY A;  4X48 A;  2VHA A;  1USY E;  4MIJ A;  2NUV A;  4C1U A;  1LBV A;  2P1S A;  4F1U A;  3OEK A;  4QFO A;  5I56 A;  1MQJ A;  4KCC A;  3GXA A;  1D4N A;  4F2Q A;  2CZI A;  4O7M A;  5AA2 D;  3K02 A;  4OVJ A;  5H8H B;  1QJM A;  2XXX A;  4PQJ A;  3FXU A;  5L9O A;  1S7Y A;  5A5L A;  3L6G A;  5EYG A;  3MZ9 A;  1FPB A;  1Y4T A;  1B5H A;  5EHM A;  5TP9 A;  2VOZ A;  5I2N B;  2VP1 A;  3CI8 A;  4PAK A;  3TTK A;  4YMB A;  3PPP A;  5I84 A;  4G8N A;  5F24 A;  3TOD A;  1D9Y A;  2I4B A;  3CIJ A;  3JV9 A;  3TPA A;  1Y3P A;  3O66 A;  4WEP A;  1G0I A;  3TZA A;  5EHS A;  2LAO A;  3V83 A;  2L5V A;  1MH4 A;  3MPL A;  4I40 A;  4N91 A;  2IEE A;  4EF1 A;  1G0H A;  1B3L A;  4HCW A;  4JSD A;  3IK6 B;  3MP1 A;  5FTH A;  1XS5 A;  3T9X B;  4O94 A;  1NV0 A;  3VFJ A;  4X1D A;  3KJT A;  4GD5 A;  3ZSF A;  5IKB A;  2Z23 A;  3IAZ A;  4GBW A;  4TOZ A;  2X26 A;  3TCH A;  4GRK A;  5K2X A;  1NV2 A;  3HST A;  1FQE A;  4DXB A;  3EHS A;  1SW5 A;  5I57 B;  5IGA A;  3FIR A;  1JQF A;  2UVJ A;  1B3G A;  3TYH A;  1IMD A;  1YYZ A;  1B52 A;  2H99 A;  2V4C A;  1B3F A;  3CG3 A;  3KC0 A;  1B6H A;  4MEV A;  2FBP A;  3VDF A;  1RYX A;  1M5C A;  4XIG Q;  4YKP A;  4RJZ A;  1ZBM A;  5CMM A;  3ILT B;  4PAF A;  4QFK A;  3EHT A;  1FPG A;  3O6H A;  1B05 A;  1BKA A;  1XVX A;  3KZG A;  1CB6 A;  4DXC A;  2QJE A;  3U8Q A;  5KDT A;  1FTJ A;  1O64 A;  1MQI A;  2GHB A;  1FTK A;  4N4U A;  4JB7 A;  5BWJ A;  3QXM A;  1LAF E;  4PCD A;  2Q9T A;  4JWY A;  1XOC A;  4JBZ A;  3BFT A;  5DT6 A;  2ZZV A;  2OBG A;  1MXZ A;  5B70 A;  4F22 A;  1HSJ A;  2GRV A;  2F6G A;  4H67 A;  4YIC A;  1RDX A;  1B51 A;  4N15 A;  3LBS A;  2A5T B;  4P0G A;  4G2Z A;  1LAG E;  1Z7N E;  3BFU A;  3TTN A;  4OMB A;  4X04 A;  4IR8 A;  4N17 A;  1SPI A;  2A5S A;  3UP9 A;  3IOT A;  5FHM A;  1P1Q A;  2ESN A;  2O84 X;  4RXL A;  1OQG A;  1B5I A;  4OZ9 A;  4P8B A;  3PGF A;  1VE4 A;  2B4L A;  3OEM A;  1N7W A;  4G68 B;  4QXD A;  4GWZ A;  1DPP A;  1MY0 A;  4L17 A;  1YAE A;  4P56 A;  1B40 A;  1MM7 A;  4ZS9 A;  4PFI A;  5DW8 A;  3S9N C;  5JTY B;  4I1D A;  3MP6 A; 
#chains in the Genus database with same CATH homology
 3KC1 A;  4OVS A;  5I7I A;  4GX6 A;  4M1V A;  1NUZ A;  5ESY A;  2F3B A;  4PDD A;  4GWU A;  3ROJ A;  1VDW A;  3T1B A;  5T3J A;  1IME A;  2WEF A;  5FBP A;  4JVI A;  4F18 A;  4GWY A;  4QBA A;  2CEY A;  1NUW A;  5J1D A;  2ZZX A;  4KXP A;  1IMA A;  2HPG A;  1XI6 A;  2P3V A;  5IZ3 B;  1RDY A;  2F5X A;  1FPJ A;  2V3Q A;  2Y5K A;  4X9T A;  4OVP A;  3BIG A;  3BIH A;  2GQ1 A;  1FBF A;  2WYK A;  4P9K A;  3RPL A;  2PFZ A;  2OWZ A;  2WYP A;  2FHY A;  1LBW A;  1FRP A;  4XFE A;  5IM2 A;  4DI3 D;  4HCY A;  4OVT A;  3B50 A;  4HE0 A;  4MHF A;  1K9Z A;  4O7I A;  4XEQ A;  5JK4 A;  3NOH A;  5J16 A;  1NUY A;  4NQ8 A;  4MJO A;  2XXK A;  4NN3 A;  4P3L A;  2Q74 A;  5ET6 A;  1YZ0 A;  4OAN A;  4HE2 A;  2QVR A;  4PC9 A;  4MAG A;  5LTC A;  1FBD A;  2WBB A;  3W9W A;  1FPF A;  1DK4 A;  2ZZW A;  1LBY A;  3D1R A;  5I3S A;  3IFA A;  4PFB A;  1EYK A;  1EYI A;  1LEV A;  4MMP A;  1FTA A;  5ET7 A;  3ISP A;  4XF5 A;  4I3E A;  1NI9 A;  4FBP A;  4NX1 A;  1FBH A;  4NG7 A;  1IMC A;  2CZH A;  2XWI A;  4MNP A;  3QMF A;  1NV4 A;  4MNI A;  4PET A;  3W9V A;  1QGX A;  1AWB A;  4OA4 A;  4P1L A;  5LDZ A;  2XWK A;  2JJK A;  4YZZ A;  3MST A;  4N81 A;  4F1V A;  3A29 A;  4JVD A;  4N8G A;  1FJ6 A;  4X8R A;  4MX6 A;  2P3N A;  4PDH A;  1K9Y A;  5ET5 A;  3KBZ A;  1D9Q A;  4H45 A;  4H46 A;  2Q8M A;  4NHB A;  4GBV A;  4MIJ A;  4PBH A;  5IZ3 A;  2XWO A;  2OX3 A;  2DDK A;  1LBV A;  1RDZ A;  2DE3 A;  3SZP A;  2PCR A;  4F1U A;  4GWS A;  3GYY A;  3MYU A;  1FPE A;  2FIE A;  2QPQ A;  5CM6 A;  1FPD A;  1FPI A;  2MKZ A;  3E79 A;  2CZI A;  3HFU A;  4O7M A;  2DE4 A;  4MNC A;  4OVR A;  4PAI A;  4PF8 A;  4NAP A;  1FBE A;  1NV5 A;  3T0J A;  5A5L A;  5I5P A;  5EYG A;  1FPB A;  3RYD A;  1IMF A;  4PAK A;  4AS4 A;  2QVU A;  5F24 A;  4GX4 A;  4NGU A;  4F19 A;  1YXI A;  5IZ1 A;  3FXB A;  4PTK A;  1G0I A;  2R8T A;  1DBZ A;  2L5V A;  4I40 A;  4N91 A;  3LV0 A;  1G0H A;  5EYH A;  4PGP A;  4LN5 A;  4HCW A;  2HZL A;  4N6K A;  4O94 A;  1NV0 A;  1NV1 A;  2PFY A;  4PBQ A;  4GBW A;  2XA5 A;  4GWW A;  1NV2 A;  3IFC A;  5EQ7 A;  4DI4 B;  1NV3 A;  2XWV A;  5EQA A;  3FBP A;  2FIX A;  5IGA A;  1FBC A;  1IMD A;  1YYZ A;  2V4C A;  3KC0 A;  4MEV A;  3LUZ A;  2FBP A;  4PGN A;  3E78 A;  2WX9 A;  1NV7 A;  1INP A;  4PAF A;  1FSA A;  2FVZ A;  2WBD A;  1FPG A;  1FBP A;  2VT5 A;  4AS5 A;  4PF6 A;  4HXV A;  4O8M A;  4OVQ A;  2B4M A;  2QFL A;  1KA1 A;  2DVZ A;  1DCU A;  4MCO A;  1KZ8 A;  4N4U A;  1JP4 A;  1IMB A;  4N6D A;  4PCD A;  2Q9T A;  3RPL B;  1LBZ A;  4NF0 A;  2ZZV A;  5EQ9 A;  1Q9D A;  4YIC A;  2Y5L A;  1RDX A;  2CEX A;  1NUX A;  1BK4 A;  4N15 A;  4PFR A;  4G61 A;  3PTY A;  3U65 A;  1FPK A;  1LBX A;  1NV6 A;  2KR0 A;  2VPN A;  5ET8 A;  3EKI A;  4HE1 A;  2CZK A;  1FBG A;  2HZK A;  5IZZ A;  4UAB A;  2KQZ A;  4X04 A;  4IR8 A;  4I3Y A;  4N17 A;  1SPI A;  4JVC A;  4P1E A;  2DE2 A;  2QVV A;  2VPO A;  2HXR A;  1FPL A;  2BJI A;  4P8B A;  4PE3 A;  4P47 A;  4GWX A;  4N8Y A;  2B4L A;  4QXD A;  4GWZ A;  1KA0 A;  4P56 A;  5EQ8 A;  4PFI A;  5DW8 A;  2HHM A;  1FJ9 A;  4GX3 A;  1EYJ A;  1CNQ A;  3CHG A;  3B8B A;  2F3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...