2XWIA

Siap r147k mutant in complex with neu5ac
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLKVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Tripartite ATP-Independent Periplasmic (Trap) Transporters Use an Arginine-Mediated Selectivity Filter for High Affinity Substrate Binding.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 116
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xwiA00
4XEQA 2HZLA 4PAFA 4PFRA 4PC9A 2XWVA 2HZKA 4MHFA 4NHBA 4PGNA 4PFIA 4PBQA 2CEYA 4P56A 4NF0A 4O7MA 5LTCA 4P3LA 4DI4B 4MCOA 3FXBA 4PCDA 5CM6A 4OVRA 4MNCA 4N6DA 4NN3A 4PFBA 4MIJA 3GYYA 2HPGA 4NGUA 4PGPA 4UABA 2CEXA 4X04A 2XXKA 4NG7A 4P1EA 4OVSA 2ZZWA 5I5PA 4MNIA 4OANA 4N8YA 5IM2A 4PDDA 4OVQA 4P1LA 4P9KA 4PAIA 4OVPA 4N8GA 4MEVA 2VPOA 2V4CA 4PE3A 4XFEA 2PFZA 4LN5A 4PBHA 4PF6A 4N4UA 4OA4A 4MAGA 4N15A 4MX6A 4YICA 2ZZVA 2XWKA 3U65A 4OVTA 4N6KA 4N17A 2XWOA 2VPNA 5I7IA 5IGAA 4YZZA 4PDHA 4PETA 4N91A 4P8BA 4O8MA 4P47A 4NX1A 2XWIA 2WX9A 4XF5A 2ZZXA 4MMPA 2XA5A 4PF8A 2WYPA 4DI3D 5IZZA 4NAPA 4O94A 4MNPA 4X8RA 4PAKA 3B50A 4NQ8A 2WYKA 2PFYA
chains in the Genus database with same CATH superfamily
1NKXA 4RJZA 1MQJA 1FPIA 3PPOA 1R6ZA 3A09A 2NWJA 2QMWA 3VE1B 2XXHA 2PYYA 3RTWB 3EN3A 3OEMA 3FXBA 1BKAA 1R9LA 3PUZE 1P1OA 1B3EA 3HFUA 4OEUA 2Q8MA 4NN3A 5EQ9A 3CSGA 4C0RA 3LSXA 3QXMA 3UIFA 3RYDA 1LBZA 5I58B 4JSOA 1GVCA 4Z7EA 2ONSA 3TTKA 1MPBA 4FEDA 1O64A 4PDDA 4FATA 1NMUA 3TCHA 4OVQA 4R2FA 5DW8A 4L17A 4GL0A 3TTNA 2DP8A 4X9TA 4LN5A 2R9JA 2QVRA 2WBDA 4ESWA 2PMSA 1PB8A 1FBDA 5AA4B 2AYSA 1BIYA 4TLMB 2E1SA 3LR1A 3H6VA 1RKMA 2B3FA 2GRVA 2H98A 3KBZA 2V3TA 4IO2A 3PUXE 2QPQA 2ZYOA 1N76A 4EF2A 3BKIB 2XXYA 2RC7A 4MMPA 4PF8A 4DI3D 3BIGA 4OFLA 4DXBA 1B40A 1P1WA 3ZKKA 1PEBA 5LOMA 3VLWA 4RA1A 3O6HA 2DS9A 1XT8A 2F6PA 3MSTA 3B8BA 2XX8A 2XWVA 5ITOA 2KLFA 2Q9TA 4LP2B 3CSBA 3IOUA 3PPPA 1IMFA 4QFLA 2YJPA 4RYAA 5I56A 4ZEFA 4OMBA 5LTCA 4GQOA 4ECFA 2H25A 3K1MA 4IO3A 5K2YA 5IAIA 5KCJB 3LUYA 4QRZA 1HSLA 4OVRA 2O84X 3HHGA 2GHAA 2X7PA 2DE2A 5I84A 1EZ9A 4G68B 2CEXA 3ZSFA 2XXKA 4O3CA 2XHDA 2XX7A 2KQZA 4R9FA 2DE4A 4MJOA 5IM2A 3H4ZA 4OFJA 3ZS6A 4R72A 4GF8A 4U2RA 3A29A 3PD9A 2WEFA 1IITA 2XX9A 1O7TA 3FIRA 4GWSA 2QRYA 5IZ3B 3I3VA 2ZZVA 1OQHA 3UGWA 4U21A 3FXQA 4NF5B 2O7UA 2VPNA 4WEDA 2V84A 1FTKA 1XI6A 3T0JA 5I2NA 2AIXA 2QJEA 1WODA 1DCUA 3KJTA 1JQFA 1KZ8A 1N04A 1FTLA 3E78A 5AA1A 1EZOA 2B4LA 4NF6B 5DT6A 1FBFA 1IQ7A 1LBVA 1N84A 3EPEA 1Y4CA 3OEKA 1US5A 3G3FA 4PE5B 4GX6A 1Z7NE 3EF7A 2HZKA 3EQ1A 4F39A 1PB7A 1D4NA 3G7WA 3OO8A 2F35A 4P3LA 1B05A 4AS4A 3KSXA 5CM6A 1OVTA 1MPCA 5J1DA 4N6DA 4PFBA 2THIA 3PUVE 1MPDA 3G3KA 1POY1 2H9BA 4RPNA 4E0XA 1AH5A 3CRBA 1B6HA 4AB6A 5L9SA 1XS5A 3LUZA 3TUSA 4GFRA 4TLLB 2CMOA 1F9BA 4O3AA 4ZEIA 1A8FA 3RQTA 5ITPA 2ZNUA 3GBBA 3PV0E 1LAXA 1LCTA 2PFZA 2B4MA 4F18A 1IXIA 4LZ8A 4QFOA 4OA4A 4MLQA 3RNNA 1TT1A 2FIXA 3BFUA 3LV0A 1FSAA 3DM0A 4JWXA 3SDFA 1N7XA 1B4HA 1YYZA 5FTHA 3OXNA 4ZEKA 5I57B 5CRYA 5ICTA 1OIBA 1RYOA 3K6UA 1QUJA 5CMBA 3B7DA 3T96B 1LBWA 3QUFA 5K2XA 3ZKLA 1WDNA 1I6BA 1MH4A 2Q89A 5HM4B 4FIMA 3ISPA 2Z8EA 4HCYA 1FBEA 2XXTA 2DDKA 4O7MA 4ZEDA 2XXVA 1DK4A 1MQGA 3RT8A 2HCAA 3UA8A 1B3LA 1NUWA 3T9UA 4HE0A 3FV2A 4KHZE 4NG7A 3K4UA 1G0HA 3MP8A 1G0IA 4KPTA 4PP0A 2OWZA 4QXDA 1I6AA 4IB2A 4OANA 1NFTA 1Y3NA 1B4ZA 3G3HA 5DYHA 1A7LA 4P9KA 1MXUA 4LZ7A 4QSDA 3PMWA 4OETA 2VPOA 3O6GA 3KJ7A 3M8UA 1LLSA 2XXPA 3NOHA 2HHMA 4GLIA 2DQVA 4FBPA 1OLCA 3I6VA 4FEBA 2ZYKA 3ODBA 2I0CA 3MZ1A 3FXUA 3H6UA 3EHUA 4JWOA 3VVFA 1IZ1A 4GX4A 5B70A 5H8FA 2NXOA 1VFDA 2IEEA 4EQ9A 3FGSA 5JTYA 5T3JA 4ZECA 1XOCA 2ONRA 1OLAA 1YZ0A 1IMCA 3M3FA 3C31A 2I3VA 2PX1A 4IR8A 5CBSA 2F8DA 1P99A 3MVYA 3VFJA 4AS5A 4NQ8A 3BIHA 1N3WA 5JK4A 1MG1A 2QSXA 1P1QA 2G93A 3VVEA 4OERA 1AOVA 3TCFA 1OQGA 4R74A 1FTAA 5EHSA 3IFAA 3LSFB 1NNKA 4OESA 5F7VA 4BDNA 1Y3PA 1GTKA 1SQYA 4MH5A 1DMBA 4U1OA 3C9HA 1URSA 1A55A 1DPEA 1UIVA 5DVIA 4ONYA 1B9JA 2I58A 5I56B 3PD8A 4G2ZA 2W7YA 4N8YA 3KN8A 3O97A 2HQ0A 1TXFA 4DLDA 2D5WA 2NUVA 3IB2A 1B3FA 5ET6A 1HSJA 2OX3A 2ZNSA 3FVOA 4YKIA 3G3IA 3PTYA 1LAGE 4MAGA 3OSRA 4YICA 4GOTA 1FCKA 1K9ZA 3S9EA 1ATGA 3MWBA 2R6GE 1B46A 4GXAA 4O8MA 5I2KA 1FQCA 4F3BA 4NX1A 4H5GA 2UVHA 1QULA 2ZZXA 1QVSA 2XA5A 2QS4A 1FQFA 1QKBA 1PBQA 2AL5A 4BDLA 4Z0IA 1LBXA 4P11A 3T93B 2V93A 1UTBA 1SYHA 4YAHX 3FUZA 5I2NB 4YMAA 3DLNA 4GRKA 2KR0A 5M2VA 4QBAA 1S50A 5I3SA 4F1VA 1Q35A 2XXIA 1JNFA 1URGA 3OD7A 2VT5A 2MKZA 1MQIA 4TOZA 3Q26A 2M8CA 3QUJA 5AA2A 4PGPA 3RN8A 1IXHA 2CZKA 2XD2A 1RDYA 1NUZA 1JP4A 3VDFA 3HHFA 3TTRA 1QUIA 2B65A 5I5PA 3CFZA 3UN6A 1XHYA 3K2DA 1MS7A 2XXRA 1LBBA 5AA3A 1FBHA 4X1BA 1QW0A 4H45A 3IB1A 1SDXA 3FJMA 1H76A 1S9TA 2VD3A 4KR5A 2DWAA 2DOJA 4ND9A 2H99A 5B7DA 1MXWA 4AB5A 4H0WA 4ZZAA 3L6HA 3CI8A 3TTMA 4YKKA 3V8XB 5BWJA 2I3WA 3I5OA 2UVJA 1XC1A 1M5DA 4OVTA 2Z8DA 2LAOA 4KQPA 3DELB 5CI5A 1QJMA 2O1MA 1PBPA 1MRPA 2XXWA 4ELQA 4GBWA 2QS1A 1UQWA 3T9XB 1Y3QA 3FJGA 3C36A 1MY1A 5IZZA 2A5TA 3M3LA 1Y4TA 3VXBA 4FORA 3K0VA 1NL5A 4GVOA 5H8HA 5AA2D 1TWYA 1ZBMA 4GD5A 3IB0A 1M5FA 3SEYA 3H6WA 4ELRA 2FVZA 1NV2A 4IO4A 2PT1A 4NF0A 1JW1A 4ESXA 1NV4A 1I6QA 2F7AA 1SW4A 3MW0A 3KC1A 1LB9A 3QK6A 2NVUB 4DCXA 4KCDA 3SEXA 3GYYA 1ZKBA 2FYIA 1NI9A 4KCCA 2ANJA 1LEVA 4H6DA 4QHQA 2Y5LA 3O28A 2DWJA 4U22A 3S2VA 5I59A 4UACA 2REJA 5ICQA 2P0SA 1MY4A 2NOOA 3K6VA 1NV3A 1AWBA 2CZHA 2YPNA 3IK6B 4YB6A 5EYGA 4F3SA 4WKMA 4EDPA 4GWUA 2PCRA 3F11A 2XWKA 3QSLA 4H8IA 3MYUA 1KWHA 4E0WA 2Q74A 1CNQA 4EXKA 1YAEA 3CVGA 3MP6A 4GBVA 4R6HA 1YPNA 1AL3A 4DIGA 2V3UA 1LFIA 1ZTYA 5H8SA 2F34A 3KGCA 3IORA 5EQAA 5KDTA 4JVDA 3SEVA 1MY3A 4O94A 4PTKA 3K00A 5H8FB 4NF4B 3MPKA 4R2BA 3LSLA 5JTYB 3R26A 1LFHA 2UYFA 1SD3A 3KOTA 2HZLA 5L9OA 3D4GA 4Q5TA 3PUYE 4MHFA 1FPGA 3PPRA 4PBQA 4FECA 5DVJA 2Q88A 1MM6A 2YLNA 2UYEA 1M5EA 3Q28A 2R71A 3C35A 1OMPA 3L6GA 1MXZA 4IO6A 4MIJA 2OZZA 2HPGA 1GR2A 1ZMGA 4G68C 1ZU0A 4P1EA 4QFKA 2HAUA 3PPNA 5EYHA 3QMFA 4I9DA 4DDDA 3TAJA 4I62A 3ONMA 2Z22A 3O66A 1GGGA 4Q30B 2VP1A 2OLBA 3S9MC 4OVPA 3VXCA 2V4CA 4KI0E 2RF1A 3T9HB 4PF6A 1YXIA 1FRPA 4LQ2A 4BDMA 1MM7A 3U65A 1MDQA 2P2AA 4MF3A 4LATA 5IKBA 4HE1A 4N17A 4OYVA 4PFTA 3M3KA 1XVYA 2GFEA 3OO9A 1MDP1 1B1XA 1Q9DA 1CE2A 1USYH 1DOTA 2I4CA 1OVBA 3OSQA 4I40A 5ET8A 1QUKA 3KEIA 2D21A 4PAKA 1S7YA 5I2KB 4IO5A 2CZIA 5F1QA 4HTGA 4OENA 3TPAA 1FQEA 1MXVA 1KA1A 1FPLA 4N13A 2BJIA 1HSEA 4R73A 4F1YA 3P7IA 3PMXA 4JVIA 3EKIA 1IXCA 1UTBB 4G8HA 5EYFA 4YMBA 2HAVA 5AA4A 4JXIA 4ZS9A 3PPQA 4MNCA 4N07A 3E3KA 3IAZA 3VLVA 3BFTA 3JYRA 4C1UA 4RXLA 3T1BA 4NE4A 4XXUA 3U92A 3R6UA 4JSDA 4NF8A 1L5TA 5CMCA 3C32A 4F3GA 5H8QA 4YKJA 4MNIA 2V3QA 2VGQA 1UTHA 5AA2B 4P1LA 2UVGA 1B32A 4N8GA 4MEVA 1NV0A 1FPFA 4OEVA 3FATA 3E9XA 2VHAA 4QFPA 4N6PA 1SW1A 3U72A 4GL8A 5A5LA 2HFBA 1SI0A 3S4UA 4I3EA 3PGFA 3BBRA 2HXRA 2AL4A 4ZE9A 5KZTA 2DWHA 3TTLA 5I7IA 5KCJA 2O69A 1FBPA 1P1UA 4GWWA 1FJ9A 1USYE 1IUDA 1NV6A 4G68A 3V5AA 4GWZA 3IOTA 2QL3A 3W15C 1SYIA 3MBPA 1B7UA 2O68A 1YCJA 3FASA 1NH7A 3TFLA 2V25A 3MUQA 3LSWA 4ZDMA 1FPJA 3G3JA 3IOWA 4RK2A 3KN3A 1VFEA 3C34A 3CIJA 1URDA 1LSTA 4ELOA 2RCAA 2A5TB 3K1NA 3TCGA 1N0TA 3ROJA 1B0HA 3N5LA 3VLUA 4MCOA 1FTJA 5H8HB 4O3BA 3K6WA 5IZ3A 2X7QA 4F31B 4ZEBA 2GH9A 1BP5A 1I69A 4F3PA 2P1SA 2FNCA 3QAXA 3Q29A 4GWOA 2DXYA 4OVSA 2ZZWA 3FZVA 2QVVA 4FE8A 4IY5A 5L8DA 2B3BA 1B5HA 4H1XA 2CZLA 5TP9A 1JVYA 3IOVA 4LVQA 2I48A 2UVIA 3KBRA 2I49A 2ZMBA 3FD3A 5I59B 4N4UA 4RK9A 3O6IA 4QSCA 5TU0A 3MQ9A 3O2AA 3IJOB 4PFYA 4R75A 1FPBA 4F19A 3K1PA 3FJ7A 4POWA 4OFOA 4N91A 4DXCA 3TODA 2RKMA 1DSNA 1Y1ZA 1PB9A 5L9MA 2DWIA 2XWIA 4H5FA 1NUYA 1FPEA 4NAPA 2PBWA 4WXJA 4JB7A 3D4CA 5TPAA 1ELJA 3U93A 2F78A 1SW2A 5FHNA 4PFRA 3MVZA 5KDTB 3UP9A 3Q25A 3V89B 4P56A 3C4MA 5EHMA 3RT6B 1YTVA 1JEVA 1AMFA 1EH3A 4GWYA 3SEUA 4KXPA 1EYKA 3MZ9A 4NGUA 4UABA 4X04A 4LONB 2Y7PA 3T9VA 3IR1A 1MH3A 1TFAA 1VSOA 4H67A 1VDWA 3S9LC 3K01A 5HBCA 3WAEA 4MLVA 3H06B 1JEUA 1Z7ME 5CMKA 1QKAA 1MQHA 1B0LA 3CR9A 3FV1A 4KYDA 3U8QA 4PBHA 4U4SA 3H03A 1MY0A 4YU0A 4N15A 4MX6A 4EQ7A 3T22A 3AXFA 3IFCA 4LZ5A 4HW8A 4IGRA 3A3UA 2Q2CA 1M5BA 4PETA 3TDJA 5A5XA 1INPA 3DP6A 3GZGA 1FTOA 3R7XA 3PU5A 3PUWE 3OENA 1NNTA 3TQLA 1O63A 4EXLA 3E4RA 3IO4A 1B5JA 2F97A 1EU8A 2DYXA 4PFWA 4NTLA 3E13X 3H6TA 3SETA 3SEWA 1IXGA 4KYSA 3RGYA 3VVDA 3VV5A 2PT2A 4GIZA 2I4BA 4NWCA 4PCDA 3LBSA 1KA0A 1A54A 3IO6A 1A8EA 2F36A 2F5XA 3H7MA 1JETA 4OZ9A 1WVJA 1Y1MA 1JVXA 4RY1A 4M1VA 4LA9A 4JBZA 4QF9A 3GLBA 4DZ1A 4I1DA 4DCYA 3HSTA 1SBPA 3MJNA 5DEXA 2DVZA 2ZNTA 4NF8B 3T66A 3KC0A 5ESYA 5H8QB 1K9YA 2I0BA 4ZZEA 5FHOA 1UTHB 1DTZA 3OMBA 3UK4A 4THIA 2DXRA 1R1NA 4R6KA 2Y7RA 4YB7A 1GV8A 4UA8A 4TQUQ 2XWOA 3C33A 3SZPA 3B6WA 4YB5A 4QSEA 2Z23A 3MAMA 4P47A 3RPLA 3OELA 4WEPA 3RPWA 2ALUA 4O7IA 1FTMA 2UXAA 2WBBA 1NV5A 4AQ4A 2H4IA 5BUUA 3B50A 2RC8A 3TELA 4G4PA 4RPOA 5H8NA 3UORA 3IJXB 3KOSA 2D3IA 1B2HA 3JV9A 5CC2A 2Y84A 4G8MA 1AIVA 2JJKA 2VD2A 1II5A 1SW5A 3G3GA 2IA4A 4P0GA 3MP1A 3SKPA 5ELVA 2GHBA 1CB6A 1JW5A 1H45A 3FXRA 2H5YA 1FPDA 1LAHE 2OK2A 3CFLA 3TZAA 1B3HA 2RCBA 3JZJA 2XD3A 4NWDA 4POXA 4IY6A 4GXSB 4PE3A 4IO7A 3K6XA 3U1OA 1ZJLA 3HCQA 1T0KA 1A99A 2F7BA 2OBGA 3MVWA 4HS7A 3K02A 5TP9B 5FTIA 3H3GA 4IGTA 1ZLQA 4P0IA 4HE2A 4U4XA 2P3NA 4YZZA 3B6TA 1Y20A 3ECRA 3HV1A 4ISUA 4BDRA 4P8BA 3A3CA 5HPQA 3W9WA 4XF5A 2WYPA 4H46A 4F2QA 1B3GA 1LFGA 4F29A 3E79A 4JVCA 1NNFA 4G8NA 5ISUA 4X48A 1B7ZA 2PFYA 5ET5A 2GQ1A 4N81A 3RY3A 3RUMA 4BDQA 4PAFA 1B51A 2WKYA 3PMVA 2RC9A 1EZPA 3HO7A 4PFIA 3KG2A 2QS3A 2OCUA 5I58A 2Z8FA 2Y5KA 5TPAB 4DI4B 4OTEA 4PFUA 4KFQA 4NMYA 4FJPA 2G29A 4C1TA 1XVXA 4RNSA 2L5VA 3OO7A 4X1DA 2QVUA 1BTJA 3N94A 2ZXTA 2FHYA 1FPKA 3Q27A 1LB8A 1FQAA 2ABHA 5ET7A 1BK4A 4XKQA 3MZBA 2QMXA 4GX3A 4F1UA 3FVKA 2QFLA 3D1RA 1VR5A 3TYHA 2Y7WA 2FA7A 4EF1A 4KD5A 4G61A 4U23A 2XXQA 1LCFA 4H65A 3QYTA 2F3BA 5J16A 5DTBA 3FVNA 4Q0CA 2Y7KA 1RDZA 1JW4A 1ANFA 4OHNA 1DTGA 4MFIA 4GWXA 5IGAA 1NV7A 4OXVA 3OOAA 4YKPA 3KN7A 3IL1B 5DVFA 3FVGA 1N3XA 5F24A 3MC2A 1RDXA 4LQ5A 3S9NC 3ILTB 1FBGA 4X8RA 4XIGQ 1IMDA 5A5XB 1US4A 1D9VA 3EHSA 4XEQA 4NHBA 1Q1KA 4JWYA 4PGNA 2CEYA 1SVXB 2Q8JA 1B1HA 3O9PA 2Q2AA 4EQBA 1BLFA 5FHMA 4HCWA 1NH8A 2F3DA 1D9QA 3MPLA 3SERA 3N6TA 1NV1A 4M4GA 4XKRA 4BLAA 4XKNA 1NUXA 3N26A 5IZ1A 2ZYNA 2XXXA 1LAFE 2O1LA 2F6GA 4FAJA 4K3FA 1EYIA 4OWDA 1FBCA 2ONKE 3EHTA 3CG3A 3DP8A 4QFNA 2O6AA 4NF4A 4PAIA 4NF5A 3W9VA 3HPIA 4DXUA 3CHGA 3LC8A 1IIWA 4PQJA 2FIEA 5DEXB 2FBPA 4JDFA 1B52A 3GBAA 1ZIUA 2ESNA 2DVCA 1LBYA 3OO6A 1MXYA 4ZE8A 4NF6A 4LUBA 2A5SA 5EQ8A 5CMMA 4F2OA 4I3YA 3KSJA 3USDA 1M5CA 1D9YA 4U1ZA 3ILUB 2RINA 3MVXA 3N6UA 5EQ7A 1P1NA 3V83A 4R9GA 1EYJA 2ZYMA 4OQOA 2QS2A 3KFMA 2R8TA 4MBPA 1MXXA 2F7CA 3RPLB 4PC9A 1H44A 3WAFA 4R6YA 1SI1A 3RLFE 5JEIA 2OWTA 4G77A 1TFDA 5LDZA 4EUOA 3TKDA 2DE3A 1FW0A 2REGA 2X26A 1FQBA 1UIUA 1PC3A 5H8NB 2HEUA 3DP4A 1IEJA 3FBPA 1PDAA 3QIMA 3O29A 3U94A 4Q8RA 2O51A 1RYXA 1B7HA 3TEPA 3IX1A 1NNPA 1N7WA 3CFXA 1QGXA 3KZGA 3B6QA 4H8JA 1IMBA 1J1NA 4ELPA 4F22A 1FJ6A 1D3KA 1LBCA 4BDOA 2XXUA 1Y9UA 1MQDA 2OJTA 2E0SA 4XFEA 2VOZA 1MY2A 1R9QA 1B58A 5I57A 2OWSA 3RTFB 5CBRA 1DBZA 1H43A 4N6KA 1FQDA 2HXWA 4KYEA 3TQWA 3GXAA 4PDHA 2BJJX 4XTCQ 2PVUA 1POTA 1H3DA 1DPPA 2P3VA 3SESA 2Y7IA 1SPIA 5AE4A 2I6EA 3CG1A 4HXVA 1IMAA 2WX9A 4OVJA 4DE8A 1VE4A 1B5IA 3HN0A 3THIA 4NEDA 4MNPA 2O7IA 1A40A 4XKPA 5FBPA 1IMEA 3TMGA 4I8CA 2DSFA 2WYKA 1LGBC
chains in the Genus database with same CATH topology
5JK4A 2CZIA 1FPIA 1KA1A 1FPLA 2BJIA 1FTAA 4JVIA 3IFAA 3EKIA 3FXBA 2JJKA 3HFUA 2Q8MA 4MNCA 4NN3A 5EQ9A 3RYDA 1LBZA 3T1BA 1FPDA 4MNIA 4N8YA 4PDDA 2V3QA 4OVQA 4P1LA 5ET6A 4N8GA 5DW8A 4MEVA 2OX3A 1NV0A 1FPFA 4PE3A 4X9TA 4LN5A 2QVRA 2WBDA 3PTYA 5A5LA 4MAGA 1FBDA 4YICA 4I3EA 2HXRA 1K9ZA 5I7IA 4HE2A 2P3NA 4YZZA 1FBPA 4GWWA 3KBZA 4P8BA 1FJ9A 4O8MA 2QPQA 4NX1A 1NV6A 4GWZA 3W9WA 4XF5A 2ZZXA 4MMPA 2XA5A 4PF8A 2WYPA 4DI3D 3BIGA 4H46A 3E79A 4JVCA 1LBXA 1FPJA 2PFYA 5ET5A 4N81A 2GQ1A 3MSTA 3B8BA 4PAFA 2XWVA 2Q9TA 4PFIA 2KR0A 1IMFA 4QBAA 5I3SA 4F1VA 2Y5KA 3ROJA 5LTCA 4DI4B 4MCOA 5IZ3A 2VT5A 2MKZA 4OVRA 2DE2A 4PGPA 2L5VA 2CEXA 2CZKA 2XXKA 2QVUA 1RDYA 1NUZA 2FHYA 2KQZA 1JP4A 4OVSA 2ZZWA 2QVVA 1FPKA 5I5PA 2DE4A 4MJOA 5IM2A 5ET7A 1BK4A 1FBHA 4H45A 4GX3A 4F1UA 2QFLA 3A29A 3D1RA 2WEFA 4N4UA 4G61A 4GWSA 2F3BA 5IZ3B 5J16A 2ZZVA 1RDZA 4OVTA 1FPBA 4GWXA 4F19A 2VPNA 5IGAA 1NV7A 4N91A 1XI6A 3T0JA 4GBWA 1DCUA 5F24A 2XWIA 1KZ8A 1RDXA 1NUYA 3E78A 1FBGA 1FPEA 5IZZA 4NAPA 2B4LA 1FBFA 4X8RA 1LBVA 1IMDA 4XEQA 4GX6A 4PFRA 2HZKA 4NHBA 4PGNA 2CEYA 2FVZA 4P56A 1NV2A 4NF0A 1NV4A 4P3LA 4AS4A 4GWYA 4HCWA 4KXPA 5CM6A 1EYKA 3KC1A 2F3DA 1D9QA 5J1DA 4N6DA 4PFBA 1NV1A 3GYYA 4NGUA 1NUXA 1NI9A 4UABA 5IZ1A 4X04A 1LEVA 2Y5LA 1VDWA 1EYIA 1FBCA 3LUZA 4PAIA 1NV3A 3W9VA 1AWBA 2PFZA 2B4MA 2CZHA 3CHGA 4PBHA 4F18A 2FIEA 4OA4A 5EYGA 4GWUA 4N15A 2FBPA 2FIXA 4MX6A 2PCRA 3LV0A 1FSAA 2XWKA 3IFCA 3MYUA 1LBYA 1YYZA 2Q74A 1CNQA 4GBVA 4PETA 5EQ8A 4I3YA 1INPA 5EQAA 4JVDA 5EQ7A 1LBWA 4O94A 1EYJA 4PTKA 2R8TA 3RPLB 2HZLA 3ISPA 4PC9A 4HCYA 4MHFA 1FBEA 1FPGA 4PBQA 4O7MA 2DDKA 5LDZA 2DE3A 4PCDA 1KA0A 1DK4A 2F5XA 3FBPA 4MIJA 2HPGA 1NUWA 4HE0A 4NG7A 1G0HA 4M1VA 4P1EA 1G0IA 1QGXA 5EYHA 2OWZA 3QMFA 4QXDA 4OANA 1IMBA 2DVZA 1FJ6A 4P9KA 4OVPA 2VPOA 2V4CA 3KC0A 5ESYA 3NOHA 2HHMA 4XFEA 4FBPA 4PF6A 1K9YA 1YXIA 1FRPA 1DBZA 3U65A 4N6KA 4HE1A 4GX4A 2XWOA 4N17A 3SZPA 4PDHA 5T3JA 2P3VA 4P47A 1SPIA 3RPLA 4HXVA 1YZ0A 1Q9DA 1IMAA 2WX9A 1IMCA 4I40A 5ET8A 4IR8A 4MNPA 4O7IA 2WBBA 5FBPA 1NV5A 1IMEA 4PAKA 3B50A 4AS5A 4NQ8A 2WYKA 3BIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEQ A;  2HZL A;  4PAF A;  4PFR A;  4PC9 A;  2XWV A;  2HZK A;  4MHF A;  4NHB A;  4PGN A;  4PFI A;  4PBQ A;  2CEY A;  4P56 A;  4NF0 A;  4O7M A;  5LTC A;  4P3L A;  4DI4 B;  4MCO A;  3FXB A;  4PCD A;  5CM6 A;  4OVR A;  4MNC A;  4N6D A;  4NN3 A;  4PFB A;  4MIJ A;  3GYY A;  2HPG A;  4NGU A;  4PGP A;  4UAB A;  2CEX A;  4X04 A;  2XXK A;  4NG7 A;  4P1E A;  4OVS A;  2ZZW A;  5I5P A;  4MNI A;  4OAN A;  4N8Y A;  5IM2 A;  4PDD A;  4OVQ A;  4P1L A;  4P9K A;  4PAI A;  4OVP A;  4N8G A;  4MEV A;  2VPO A;  2V4C A;  4PE3 A;  4XFE A;  2PFZ A;  4LN5 A;  4PBH A;  4PF6 A;  4N4U A;  4OA4 A;  4MAG A;  4N15 A;  4MX6 A;  4YIC A;  2ZZV A;  2XWK A;  3U65 A;  4OVT A;  4N6K A;  4N17 A;  2XWO A;  2VPN A;  5I7I A;  5IGA A;  4YZZ A;  4PDH A;  4PET A;  4N91 A;  4P8B A;  4O8M A;  4P47 A;  4NX1 A;  2XWI A;  2WX9 A;  4XF5 A;  2ZZX A;  4MMP A;  2XA5 A;  4PF8 A;  2WYP A;  4DI3 D;  5IZZ A;  4NAP A;  4O94 A;  4MNP A;  4X8R A;  4PAK A;  3B50 A;  4NQ8 A;  2WYK A;  2PFY A; 
#chains in the Genus database with same CATH topology
 1NKX A;  4RJZ A;  1MQJ A;  1FPI A;  3PPO A;  1R6Z A;  3A09 A;  2NWJ A;  2QMW A;  3VE1 B;  2XXH A;  2PYY A;  3RTW B;  3EN3 A;  3OEM A;  3FXB A;  1BKA A;  1R9L A;  3PUZ E;  1P1O A;  1B3E A;  3HFU A;  4OEU A;  2Q8M A;  4NN3 A;  5EQ9 A;  3CSG A;  4C0R A;  3LSX A;  3QXM A;  3UIF A;  3RYD A;  1LBZ A;  5I58 B;  4JSO A;  1GVC A;  4Z7E A;  2ONS A;  3TTK A;  1MPB A;  4FED A;  1O64 A;  4PDD A;  4FAT A;  1NMU A;  3TCH A;  4OVQ A;  4R2F A;  5DW8 A;  4L17 A;  4GL0 A;  3TTN A;  2DP8 A;  4X9T A;  4LN5 A;  2R9J A;  2QVR A;  2WBD A;  4ESW A;  2PMS A;  1PB8 A;  1FBD A;  5AA4 B;  2AYS A;  1BIY A;  4TLM B;  2E1S A;  3LR1 A;  3H6V A;  1RKM A;  2B3F A;  2GRV A;  2H98 A;  3KBZ A;  2V3T A;  4IO2 A;  3PUX E;  2QPQ A;  2ZYO A;  1N76 A;  4EF2 A;  3BKI B;  2XXY A;  2RC7 A;  4MMP A;  4PF8 A;  4DI3 D;  3BIG A;  4OFL A;  4DXB A;  1B40 A;  1P1W A;  3ZKK A;  1PEB A;  5LOM A;  3VLW A;  4RA1 A;  3O6H A;  2DS9 A;  1XT8 A;  2F6P A;  3MST A;  3B8B A;  2XX8 A;  2XWV A;  5ITO A;  2KLF A;  2Q9T A;  4LP2 B;  3CSB A;  3IOU A;  3PPP A;  1IMF A;  4QFL A;  2YJP A;  4RYA A;  5I56 A;  4ZEF A;  4OMB A;  5LTC A;  4GQO A;  4ECF A;  2H25 A;  3K1M A;  4IO3 A;  5K2Y A;  5IAI A;  5KCJ B;  3LUY A;  4QRZ A;  1HSL A;  4OVR A;  2O84 X;  3HHG A;  2GHA A;  2X7P A;  2DE2 A;  5I84 A;  1EZ9 A;  4G68 B;  2CEX A;  3ZSF A;  2XXK A;  4O3C A;  2XHD A;  2XX7 A;  2KQZ A;  4R9F A;  2DE4 A;  4MJO A;  5IM2 A;  3H4Z A;  4OFJ A;  3ZS6 A;  4R72 A;  4GF8 A;  4U2R A;  3A29 A;  3PD9 A;  2WEF A;  1IIT A;  2XX9 A;  1O7T A;  3FIR A;  4GWS A;  2QRY A;  5IZ3 B;  3I3V A;  2ZZV A;  1OQH A;  3UGW A;  4U21 A;  3FXQ A;  4NF5 B;  2O7U A;  2VPN A;  4WED A;  2V84 A;  1FTK A;  1XI6 A;  3T0J A;  5I2N A;  2AIX A;  2QJE A;  1WOD A;  1DCU A;  3KJT A;  1JQF A;  1KZ8 A;  1N04 A;  1FTL A;  3E78 A;  5AA1 A;  1EZO A;  2B4L A;  4NF6 B;  5DT6 A;  1FBF A;  1IQ7 A;  1LBV A;  1N84 A;  3EPE A;  1Y4C A;  3OEK A;  1US5 A;  3G3F A;  4PE5 B;  4GX6 A;  1Z7N E;  3EF7 A;  2HZK A;  3EQ1 A;  4F39 A;  1PB7 A;  1D4N A;  3G7W A;  3OO8 A;  2F35 A;  4P3L A;  1B05 A;  4AS4 A;  3KSX A;  5CM6 A;  1OVT A;  1MPC A;  5J1D A;  4N6D A;  4PFB A;  2THI A;  3PUV E;  1MPD A;  3G3K A;  1POY 1;  2H9B A;  4RPN A;  4E0X A;  1AH5 A;  3CRB A;  1B6H A;  4AB6 A;  5L9S A;  1XS5 A;  3LUZ A;  3TUS A;  4GFR A;  4TLL B;  2CMO A;  1F9B A;  4O3A A;  4ZEI A;  1A8F A;  3RQT A;  5ITP A;  2ZNU A;  3GBB A;  3PV0 E;  1LAX A;  1LCT A;  2PFZ A;  2B4M A;  4F18 A;  1IXI A;  4LZ8 A;  4QFO A;  4OA4 A;  4MLQ A;  3RNN A;  1TT1 A;  2FIX A;  3BFU A;  3LV0 A;  1FSA A;  3DM0 A;  4JWX A;  3SDF A;  1N7X A;  1B4H A;  1YYZ A;  5FTH A;  3OXN A;  4ZEK A;  5I57 B;  5CRY A;  5ICT A;  1OIB A;  1RYO A;  3K6U A;  1QUJ A;  5CMB A;  3B7D A;  3T96 B;  1LBW A;  3QUF A;  5K2X A;  3ZKL A;  1WDN A;  1I6B A;  1MH4 A;  2Q89 A;  5HM4 B;  4FIM A;  3ISP A;  2Z8E A;  4HCY A;  1FBE A;  2XXT A;  2DDK A;  4O7M A;  4ZED A;  2XXV A;  1DK4 A;  1MQG A;  3RT8 A;  2HCA A;  3UA8 A;  1B3L A;  1NUW A;  3T9U A;  4HE0 A;  3FV2 A;  4KHZ E;  4NG7 A;  3K4U A;  1G0H A;  3MP8 A;  1G0I A;  4KPT A;  4PP0 A;  2OWZ A;  4QXD A;  1I6A A;  4IB2 A;  4OAN A;  1NFT A;  1Y3N A;  1B4Z A;  3G3H A;  5DYH A;  1A7L A;  4P9K A;  1MXU A;  4LZ7 A;  4QSD A;  3PMW A;  4OET A;  2VPO A;  3O6G A;  3KJ7 A;  3M8U A;  1LLS A;  2XXP A;  3NOH A;  2HHM A;  4GLI A;  2DQV A;  4FBP A;  1OLC A;  3I6V A;  4FEB A;  2ZYK A;  3ODB A;  2I0C A;  3MZ1 A;  3FXU A;  3H6U A;  3EHU A;  4JWO A;  3VVF A;  1IZ1 A;  4GX4 A;  5B70 A;  5H8F A;  2NXO A;  1VFD A;  2IEE A;  4EQ9 A;  3FGS A;  5JTY A;  5T3J A;  4ZEC A;  1XOC A;  2ONR A;  1OLA A;  1YZ0 A;  1IMC A;  3M3F A;  3C31 A;  2I3V A;  2PX1 A;  4IR8 A;  5CBS A;  2F8D A;  1P99 A;  3MVY A;  3VFJ A;  4AS5 A;  4NQ8 A;  3BIH A;  1N3W A;  5JK4 A;  1MG1 A;  2QSX A;  1P1Q A;  2G93 A;  3VVE A;  4OER A;  1AOV A;  3TCF A;  1OQG A;  4R74 A;  1FTA A;  5EHS A;  3IFA A;  3LSF B;  1NNK A;  4OES A;  5F7V A;  4BDN A;  1Y3P A;  1GTK A;  1SQY A;  4MH5 A;  1DMB A;  4U1O A;  3C9H A;  1URS A;  1A55 A;  1DPE A;  1UIV A;  5DVI A;  4ONY A;  1B9J A;  2I58 A;  5I56 B;  3PD8 A;  4G2Z A;  2W7Y A;  4N8Y A;  3KN8 A;  3O97 A;  2HQ0 A;  1TXF A;  4DLD A;  2D5W A;  2NUV A;  3IB2 A;  1B3F A;  5ET6 A;  1HSJ A;  2OX3 A;  2ZNS A;  3FVO A;  4YKI A;  3G3I A;  3PTY A;  1LAG E;  4MAG A;  3OSR A;  4YIC A;  4GOT A;  1FCK A;  1K9Z A;  3S9E A;  1ATG A;  3MWB A;  2R6G E;  1B46 A;  4GXA A;  4O8M A;  5I2K A;  1FQC A;  4F3B A;  4NX1 A;  4H5G A;  2UVH A;  1QUL A;  2ZZX A;  1QVS A;  2XA5 A;  2QS4 A;  1FQF A;  1QKB A;  1PBQ A;  2AL5 A;  4BDL A;  4Z0I A;  1LBX A;  4P11 A;  3T93 B;  2V93 A;  1UTB A;  1SYH A;  4YAH X;  3FUZ A;  5I2N B;  4YMA A;  3DLN A;  4GRK A;  2KR0 A;  5M2V A;  4QBA A;  1S50 A;  5I3S A;  4F1V A;  1Q35 A;  2XXI A;  1JNF A;  1URG A;  3OD7 A;  2VT5 A;  2MKZ A;  1MQI A;  4TOZ A;  3Q26 A;  2M8C A;  3QUJ A;  5AA2 A;  4PGP A;  3RN8 A;  1IXH A;  2CZK A;  2XD2 A;  1RDY A;  1NUZ A;  1JP4 A;  3VDF A;  3HHF A;  3TTR A;  1QUI A;  2B65 A;  5I5P A;  3CFZ A;  3UN6 A;  1XHY A;  3K2D A;  1MS7 A;  2XXR A;  1LBB A;  5AA3 A;  1FBH A;  4X1B A;  1QW0 A;  4H45 A;  3IB1 A;  1SDX A;  3FJM A;  1H76 A;  1S9T A;  2VD3 A;  4KR5 A;  2DWA A;  2DOJ A;  4ND9 A;  2H99 A;  5B7D A;  1MXW A;  4AB5 A;  4H0W A;  4ZZA A;  3L6H A;  3CI8 A;  3TTM A;  4YKK A;  3V8X B;  5BWJ A;  2I3W A;  3I5O A;  2UVJ A;  1XC1 A;  1M5D A;  4OVT A;  2Z8D A;  2LAO A;  4KQP A;  3DEL B;  5CI5 A;  1QJM A;  2O1M A;  1PBP A;  1MRP A;  2XXW A;  4ELQ A;  4GBW A;  2QS1 A;  1UQW A;  3T9X B;  1Y3Q A;  3FJG A;  3C36 A;  1MY1 A;  5IZZ A;  2A5T A;  3M3L A;  1Y4T A;  3VXB A;  4FOR A;  3K0V A;  1NL5 A;  4GVO A;  5H8H A;  5AA2 D;  1TWY A;  1ZBM A;  4GD5 A;  3IB0 A;  1M5F A;  3SEY A;  3H6W A;  4ELR A;  2FVZ A;  1NV2 A;  4IO4 A;  2PT1 A;  4NF0 A;  1JW1 A;  4ESX A;  1NV4 A;  1I6Q A;  2F7A A;  1SW4 A;  3MW0 A;  3KC1 A;  1LB9 A;  3QK6 A;  2NVU B;  4DCX A;  4KCD A;  3SEX A;  3GYY A;  1ZKB A;  2FYI A;  1NI9 A;  4KCC A;  2ANJ A;  1LEV A;  4H6D A;  4QHQ A;  2Y5L A;  3O28 A;  2DWJ A;  4U22 A;  3S2V A;  5I59 A;  4UAC A;  2REJ A;  5ICQ A;  2P0S A;  1MY4 A;  2NOO A;  3K6V A;  1NV3 A;  1AWB A;  2CZH A;  2YPN A;  3IK6 B;  4YB6 A;  5EYG A;  4F3S A;  4WKM A;  4EDP A;  4GWU A;  2PCR A;  3F11 A;  2XWK A;  3QSL A;  4H8I A;  3MYU A;  1KWH A;  4E0W A;  2Q74 A;  1CNQ A;  4EXK A;  1YAE A;  3CVG A;  3MP6 A;  4GBV A;  4R6H A;  1YPN A;  1AL3 A;  4DIG A;  2V3U A;  1LFI A;  1ZTY A;  5H8S A;  2F34 A;  3KGC A;  3IOR A;  5EQA A;  5KDT A;  4JVD A;  3SEV A;  1MY3 A;  4O94 A;  4PTK A;  3K00 A;  5H8F B;  4NF4 B;  3MPK A;  4R2B A;  3LSL A;  5JTY B;  3R26 A;  1LFH A;  2UYF A;  1SD3 A;  3KOT A;  2HZL A;  5L9O A;  3D4G A;  4Q5T A;  3PUY E;  4MHF A;  1FPG A;  3PPR A;  4PBQ A;  4FEC A;  5DVJ A;  2Q88 A;  1MM6 A;  2YLN A;  2UYE A;  1M5E A;  3Q28 A;  2R71 A;  3C35 A;  1OMP A;  3L6G A;  1MXZ A;  4IO6 A;  4MIJ A;  2OZZ A;  2HPG A;  1GR2 A;  1ZMG A;  4G68 C;  1ZU0 A;  4P1E A;  4QFK A;  2HAU A;  3PPN A;  5EYH A;  3QMF A;  4I9D A;  4DDD A;  3TAJ A;  4I62 A;  3ONM A;  2Z22 A;  3O66 A;  1GGG A;  4Q30 B;  2VP1 A;  2OLB A;  3S9M C;  4OVP A;  3VXC A;  2V4C A;  4KI0 E;  2RF1 A;  3T9H B;  4PF6 A;  1YXI A;  1FRP A;  4LQ2 A;  4BDM A;  1MM7 A;  3U65 A;  1MDQ A;  2P2A A;  4MF3 A;  4LAT A;  5IKB A;  4HE1 A;  4N17 A;  4OYV A;  4PFT A;  3M3K A;  1XVY A;  2GFE A;  3OO9 A;  1MDP 1;  1B1X A;  1Q9D A;  1CE2 A;  1USY H;  1DOT A;  2I4C A;  1OVB A;  3OSQ A;  4I40 A;  5ET8 A;  1QUK A;  3KEI A;  2D21 A;  4PAK A;  1S7Y A;  5I2K B;  4IO5 A;  2CZI A;  5F1Q A;  4HTG A;  4OEN A;  3TPA A;  1FQE A;  1MXV A;  1KA1 A;  1FPL A;  4N13 A;  2BJI A;  1HSE A;  4R73 A;  4F1Y A;  3P7I A;  3PMX A;  4JVI A;  3EKI A;  1IXC A;  1UTB B;  4G8H A;  5EYF A;  4YMB A;  2HAV A;  5AA4 A;  4JXI A;  4ZS9 A;  3PPQ A;  4MNC A;  4N07 A;  3E3K A;  3IAZ A;  3VLV A;  3BFT A;  3JYR A;  4C1U A;  4RXL A;  3T1B A;  4NE4 A;  4XXU A;  3U92 A;  3R6U A;  4JSD A;  4NF8 A;  1L5T A;  5CMC A;  3C32 A;  4F3G A;  5H8Q A;  4YKJ A;  4MNI A;  2V3Q A;  2VGQ A;  1UTH A;  5AA2 B;  4P1L A;  2UVG A;  1B32 A;  4N8G A;  4MEV A;  1NV0 A;  1FPF A;  4OEV A;  3FAT A;  3E9X A;  2VHA A;  4QFP A;  4N6P A;  1SW1 A;  3U72 A;  4GL8 A;  5A5L A;  2HFB A;  1SI0 A;  3S4U A;  4I3E A;  3PGF A;  3BBR A;  2HXR A;  2AL4 A;  4ZE9 A;  5KZT A;  2DWH A;  3TTL A;  5I7I A;  5KCJ A;  2O69 A;  1FBP A;  1P1U A;  4GWW A;  1FJ9 A;  1USY E;  1IUD A;  1NV6 A;  4G68 A;  3V5A A;  4GWZ A;  3IOT A;  2QL3 A;  3W15 C;  1SYI A;  3MBP A;  1B7U A;  2O68 A;  1YCJ A;  3FAS A;  1NH7 A;  3TFL A;  2V25 A;  3MUQ A;  3LSW A;  4ZDM A;  1FPJ A;  3G3J A;  3IOW A;  4RK2 A;  3KN3 A;  1VFE A;  3C34 A;  3CIJ A;  1URD A;  1LST A;  4ELO A;  2RCA A;  2A5T B;  3K1N A;  3TCG A;  1N0T A;  3ROJ A;  1B0H A;  3N5L A;  3VLU A;  4MCO A;  1FTJ A;  5H8H B;  4O3B A;  3K6W A;  5IZ3 A;  2X7Q A;  4F31 B;  4ZEB A;  2GH9 A;  1BP5 A;  1I69 A;  4F3P A;  2P1S A;  2FNC A;  3QAX A;  3Q29 A;  4GWO A;  2DXY A;  4OVS A;  2ZZW A;  3FZV A;  2QVV A;  4FE8 A;  4IY5 A;  5L8D A;  2B3B A;  1B5H A;  4H1X A;  2CZL A;  5TP9 A;  1JVY A;  3IOV A;  4LVQ A;  2I48 A;  2UVI A;  3KBR A;  2I49 A;  2ZMB A;  3FD3 A;  5I59 B;  4N4U A;  4RK9 A;  3O6I A;  4QSC A;  5TU0 A;  3MQ9 A;  3O2A A;  3IJO B;  4PFY A;  4R75 A;  1FPB A;  4F19 A;  3K1P A;  3FJ7 A;  4POW A;  4OFO A;  4N91 A;  4DXC A;  3TOD A;  2RKM A;  1DSN A;  1Y1Z A;  1PB9 A;  5L9M A;  2DWI A;  2XWI A;  4H5F A;  1NUY A;  1FPE A;  4NAP A;  2PBW A;  4WXJ A;  4JB7 A;  3D4C A;  5TPA A;  1ELJ A;  3U93 A;  2F78 A;  1SW2 A;  5FHN A;  4PFR A;  3MVZ A;  5KDT B;  3UP9 A;  3Q25 A;  3V89 B;  4P56 A;  3C4M A;  5EHM A;  3RT6 B;  1YTV A;  1JEV A;  1AMF A;  1EH3 A;  4GWY A;  3SEU A;  4KXP A;  1EYK A;  3MZ9 A;  4NGU A;  4UAB A;  4X04 A;  4LON B;  2Y7P A;  3T9V A;  3IR1 A;  1MH3 A;  1TFA A;  1VSO A;  4H67 A;  1VDW A;  3S9L C;  3K01 A;  5HBC A;  3WAE A;  4MLV A;  3H06 B;  1JEU A;  1Z7M E;  5CMK A;  1QKA A;  1MQH A;  1B0L A;  3CR9 A;  3FV1 A;  4KYD A;  3U8Q A;  4PBH A;  4U4S A;  3H03 A;  1MY0 A;  4YU0 A;  4N15 A;  4MX6 A;  4EQ7 A;  3T22 A;  3AXF A;  3IFC A;  4LZ5 A;  4HW8 A;  4IGR A;  3A3U A;  2Q2C A;  1M5B A;  4PET A;  3TDJ A;  5A5X A;  1INP A;  3DP6 A;  3GZG A;  1FTO A;  3R7X A;  3PU5 A;  3PUW E;  3OEN A;  1NNT A;  3TQL A;  1O63 A;  4EXL A;  3E4R A;  3IO4 A;  1B5J A;  2F97 A;  1EU8 A;  2DYX A;  4PFW A;  4NTL A;  3E13 X;  3H6T A;  3SET A;  3SEW A;  1IXG A;  4KYS A;  3RGY A;  3VVD A;  3VV5 A;  2PT2 A;  4GIZ A;  2I4B A;  4NWC A;  4PCD A;  3LBS A;  1KA0 A;  1A54 A;  3IO6 A;  1A8E A;  2F36 A;  2F5X A;  3H7M A;  1JET A;  4OZ9 A;  1WVJ A;  1Y1M A;  1JVX A;  4RY1 A;  4M1V A;  4LA9 A;  4JBZ A;  4QF9 A;  3GLB A;  4DZ1 A;  4I1D A;  4DCY A;  3HST A;  1SBP A;  3MJN A;  5DEX A;  2DVZ A;  2ZNT A;  4NF8 B;  3T66 A;  3KC0 A;  5ESY A;  5H8Q B;  1K9Y A;  2I0B A;  4ZZE A;  5FHO A;  1UTH B;  1DTZ A;  3OMB A;  3UK4 A;  4THI A;  2DXR A;  1R1N A;  4R6K A;  2Y7R A;  4YB7 A;  1GV8 A;  4UA8 A;  4TQU Q;  2XWO A;  3C33 A;  3SZP A;  3B6W A;  4YB5 A;  4QSE A;  2Z23 A;  3MAM A;  4P47 A;  3RPL A;  3OEL A;  4WEP A;  3RPW A;  2ALU A;  4O7I A;  1FTM A;  2UXA A;  2WBB A;  1NV5 A;  4AQ4 A;  2H4I A;  5BUU A;  3B50 A;  2RC8 A;  3TEL A;  4G4P A;  4RPO A;  5H8N A;  3UOR A;  3IJX B;  3KOS A;  2D3I A;  1B2H A;  3JV9 A;  5CC2 A;  2Y84 A;  4G8M A;  1AIV A;  2JJK A;  2VD2 A;  1II5 A;  1SW5 A;  3G3G A;  2IA4 A;  4P0G A;  3MP1 A;  3SKP A;  5ELV A;  2GHB A;  1CB6 A;  1JW5 A;  1H45 A;  3FXR A;  2H5Y A;  1FPD A;  1LAH E;  2OK2 A;  3CFL A;  3TZA A;  1B3H A;  2RCB A;  3JZJ A;  2XD3 A;  4NWD A;  4POX A;  4IY6 A;  4GXS B;  4PE3 A;  4IO7 A;  3K6X A;  3U1O A;  1ZJL A;  3HCQ A;  1T0K A;  1A99 A;  2F7B A;  2OBG A;  3MVW A;  4HS7 A;  3K02 A;  5TP9 B;  5FTI A;  3H3G A;  4IGT A;  1ZLQ A;  4P0I A;  4HE2 A;  4U4X A;  2P3N A;  4YZZ A;  3B6T A;  1Y20 A;  3ECR A;  3HV1 A;  4ISU A;  4BDR A;  4P8B A;  3A3C A;  5HPQ A;  3W9W A;  4XF5 A;  2WYP A;  4H46 A;  4F2Q A;  1B3G A;  1LFG A;  4F29 A;  3E79 A;  4JVC A;  1NNF A;  4G8N A;  5ISU A;  4X48 A;  1B7Z A;  2PFY A;  5ET5 A;  2GQ1 A;  4N81 A;  3RY3 A;  3RUM A;  4BDQ A;  4PAF A;  1B51 A;  2WKY A;  3PMV A;  2RC9 A;  1EZP A;  3HO7 A;  4PFI A;  3KG2 A;  2QS3 A;  2OCU A;  5I58 A;  2Z8F A;  2Y5K A;  5TPA B;  4DI4 B;  4OTE A;  4PFU A;  4KFQ A;  4NMY A;  4FJP A;  2G29 A;  4C1T A;  1XVX A;  4RNS A;  2L5V A;  3OO7 A;  4X1D A;  2QVU A;  1BTJ A;  3N94 A;  2ZXT A;  2FHY A;  1FPK A;  3Q27 A;  1LB8 A;  1FQA A;  2ABH A;  5ET7 A;  1BK4 A;  4XKQ A;  3MZB A;  2QMX A;  4GX3 A;  4F1U A;  3FVK A;  2QFL A;  3D1R A;  1VR5 A;  3TYH A;  2Y7W A;  2FA7 A;  4EF1 A;  4KD5 A;  4G61 A;  4U23 A;  2XXQ A;  1LCF A;  4H65 A;  3QYT A;  2F3B A;  5J16 A;  5DTB A;  3FVN A;  4Q0C A;  2Y7K A;  1RDZ A;  1JW4 A;  1ANF A;  4OHN A;  1DTG A;  4MFI A;  4GWX A;  5IGA A;  1NV7 A;  4OXV A;  3OOA A;  4YKP A;  3KN7 A;  3IL1 B;  5DVF A;  3FVG A;  1N3X A;  5F24 A;  3MC2 A;  1RDX A;  4LQ5 A;  3S9N C;  3ILT B;  1FBG A;  4X8R A;  4XIG Q;  1IMD A;  5A5X B;  1US4 A;  1D9V A;  3EHS A;  4XEQ A;  4NHB A;  1Q1K A;  4JWY A;  4PGN A;  2CEY A;  1SVX B;  2Q8J A;  1B1H A;  3O9P A;  2Q2A A;  4EQB A;  1BLF A;  5FHM A;  4HCW A;  1NH8 A;  2F3D A;  1D9Q A;  3MPL A;  3SER A;  3N6T A;  1NV1 A;  4M4G A;  4XKR A;  4BLA A;  4XKN A;  1NUX A;  3N26 A;  5IZ1 A;  2ZYN A;  2XXX A;  1LAF E;  2O1L A;  2F6G A;  4FAJ A;  4K3F A;  1EYI A;  4OWD A;  1FBC A;  2ONK E;  3EHT A;  3CG3 A;  3DP8 A;  4QFN A;  2O6A A;  4NF4 A;  4PAI A;  4NF5 A;  3W9V A;  3HPI A;  4DXU A;  3CHG A;  3LC8 A;  1IIW A;  4PQJ A;  2FIE A;  5DEX B;  2FBP A;  4JDF A;  1B52 A;  3GBA A;  1ZIU A;  2ESN A;  2DVC A;  1LBY A;  3OO6 A;  1MXY A;  4ZE8 A;  4NF6 A;  4LUB A;  2A5S A;  5EQ8 A;  5CMM A;  4F2O A;  4I3Y A;  3KSJ A;  3USD A;  1M5C A;  1D9Y A;  4U1Z A;  3ILU B;  2RIN A;  3MVX A;  3N6U A;  5EQ7 A;  1P1N A;  3V83 A;  4R9G A;  1EYJ A;  2ZYM A;  4OQO A;  2QS2 A;  3KFM A;  2R8T A;  4MBP A;  1MXX A;  2F7C A;  3RPL B;  4PC9 A;  1H44 A;  3WAF A;  4R6Y A;  1SI1 A;  3RLF E;  5JEI A;  2OWT A;  4G77 A;  1TFD A;  5LDZ A;  4EUO A;  3TKD A;  2DE3 A;  1FW0 A;  2REG A;  2X26 A;  1FQB A;  1UIU A;  1PC3 A;  5H8N B;  2HEU A;  3DP4 A;  1IEJ A;  3FBP A;  1PDA A;  3QIM A;  3O29 A;  3U94 A;  4Q8R A;  2O51 A;  1RYX A;  1B7H A;  3TEP A;  3IX1 A;  1NNP A;  1N7W A;  3CFX A;  1QGX A;  3KZG A;  3B6Q A;  4H8J A;  1IMB A;  1J1N A;  4ELP A;  4F22 A;  1FJ6 A;  1D3K A;  1LBC A;  4BDO A;  2XXU A;  1Y9U A;  1MQD A;  2OJT A;  2E0S A;  4XFE A;  2VOZ A;  1MY2 A;  1R9Q A;  1B58 A;  5I57 A;  2OWS A;  3RTF B;  5CBR A;  1DBZ A;  1H43 A;  4N6K A;  1FQD A;  2HXW A;  4KYE A;  3TQW A;  3GXA A;  4PDH A;  2BJJ X;  4XTC Q;  2PVU A;  1POT A;  1H3D A;  1DPP A;  2P3V A;  3SES A;  2Y7I A;  1SPI A;  5AE4 A;  2I6E A;  3CG1 A;  4HXV A;  1IMA A;  2WX9 A;  4OVJ A;  4DE8 A;  1VE4 A;  1B5I A;  3HN0 A;  3THI A;  4NED A;  4MNP A;  2O7I A;  1A40 A;  4XKP A;  5FBP A;  1IME A;  3TMG A;  4I8C A;  2DSF A;  2WYK A;  1LGB C; 
#chains in the Genus database with same CATH homology
 5JK4 A;  2CZI A;  1FPI A;  1KA1 A;  1FPL A;  2BJI A;  1FTA A;  4JVI A;  3IFA A;  3EKI A;  3FXB A;  2JJK A;  3HFU A;  2Q8M A;  4MNC A;  4NN3 A;  5EQ9 A;  3RYD A;  1LBZ A;  3T1B A;  1FPD A;  4MNI A;  4N8Y A;  4PDD A;  2V3Q A;  4OVQ A;  4P1L A;  5ET6 A;  4N8G A;  5DW8 A;  4MEV A;  2OX3 A;  1NV0 A;  1FPF A;  4PE3 A;  4X9T A;  4LN5 A;  2QVR A;  2WBD A;  3PTY A;  5A5L A;  4MAG A;  1FBD A;  4YIC A;  4I3E A;  2HXR A;  1K9Z A;  5I7I A;  4HE2 A;  2P3N A;  4YZZ A;  1FBP A;  4GWW A;  3KBZ A;  4P8B A;  1FJ9 A;  4O8M A;  2QPQ A;  4NX1 A;  1NV6 A;  4GWZ A;  3W9W A;  4XF5 A;  2ZZX A;  4MMP A;  2XA5 A;  4PF8 A;  2WYP A;  4DI3 D;  3BIG A;  4H46 A;  3E79 A;  4JVC A;  1LBX A;  1FPJ A;  2PFY A;  5ET5 A;  4N81 A;  2GQ1 A;  3MST A;  3B8B A;  4PAF A;  2XWV A;  2Q9T A;  4PFI A;  2KR0 A;  1IMF A;  4QBA A;  5I3S A;  4F1V A;  2Y5K A;  3ROJ A;  5LTC A;  4DI4 B;  4MCO A;  5IZ3 A;  2VT5 A;  2MKZ A;  4OVR A;  2DE2 A;  4PGP A;  2L5V A;  2CEX A;  2CZK A;  2XXK A;  2QVU A;  1RDY A;  1NUZ A;  2FHY A;  2KQZ A;  1JP4 A;  4OVS A;  2ZZW A;  2QVV A;  1FPK A;  5I5P A;  2DE4 A;  4MJO A;  5IM2 A;  5ET7 A;  1BK4 A;  1FBH A;  4H45 A;  4GX3 A;  4F1U A;  2QFL A;  3A29 A;  3D1R A;  2WEF A;  4N4U A;  4G61 A;  4GWS A;  2F3B A;  5IZ3 B;  5J16 A;  2ZZV A;  1RDZ A;  4OVT A;  1FPB A;  4GWX A;  4F19 A;  2VPN A;  5IGA A;  1NV7 A;  4N91 A;  1XI6 A;  3T0J A;  4GBW A;  1DCU A;  5F24 A;  2XWI A;  1KZ8 A;  1RDX A;  1NUY A;  3E78 A;  1FBG A;  1FPE A;  5IZZ A;  4NAP A;  2B4L A;  1FBF A;  4X8R A;  1LBV A;  1IMD A;  4XEQ A;  4GX6 A;  4PFR A;  2HZK A;  4NHB A;  4PGN A;  2CEY A;  2FVZ A;  4P56 A;  1NV2 A;  4NF0 A;  1NV4 A;  4P3L A;  4AS4 A;  4GWY A;  4HCW A;  4KXP A;  5CM6 A;  1EYK A;  3KC1 A;  2F3D A;  1D9Q A;  5J1D A;  4N6D A;  4PFB A;  1NV1 A;  3GYY A;  4NGU A;  1NUX A;  1NI9 A;  4UAB A;  5IZ1 A;  4X04 A;  1LEV A;  2Y5L A;  1VDW A;  1EYI A;  1FBC A;  3LUZ A;  4PAI A;  1NV3 A;  3W9V A;  1AWB A;  2PFZ A;  2B4M A;  2CZH A;  3CHG A;  4PBH A;  4F18 A;  2FIE A;  4OA4 A;  5EYG A;  4GWU A;  4N15 A;  2FBP A;  2FIX A;  4MX6 A;  2PCR A;  3LV0 A;  1FSA A;  2XWK A;  3IFC A;  3MYU A;  1LBY A;  1YYZ A;  2Q74 A;  1CNQ A;  4GBV A;  4PET A;  5EQ8 A;  4I3Y A;  1INP A;  5EQA A;  4JVD A;  5EQ7 A;  1LBW A;  4O94 A;  1EYJ A;  4PTK A;  2R8T A;  3RPL B;  2HZL A;  3ISP A;  4PC9 A;  4HCY A;  4MHF A;  1FBE A;  1FPG A;  4PBQ A;  4O7M A;  2DDK A;  5LDZ A;  2DE3 A;  4PCD A;  1KA0 A;  1DK4 A;  2F5X A;  3FBP A;  4MIJ A;  2HPG A;  1NUW A;  4HE0 A;  4NG7 A;  1G0H A;  4M1V A;  4P1E A;  1G0I A;  1QGX A;  5EYH A;  2OWZ A;  3QMF A;  4QXD A;  4OAN A;  1IMB A;  2DVZ A;  1FJ6 A;  4P9K A;  4OVP A;  2VPO A;  2V4C A;  3KC0 A;  5ESY A;  3NOH A;  2HHM A;  4XFE A;  4FBP A;  4PF6 A;  1K9Y A;  1YXI A;  1FRP A;  1DBZ A;  3U65 A;  4N6K A;  4HE1 A;  4GX4 A;  2XWO A;  4N17 A;  3SZP A;  4PDH A;  5T3J A;  2P3V A;  4P47 A;  1SPI A;  3RPL A;  4HXV A;  1YZ0 A;  1Q9D A;  1IMA A;  2WX9 A;  1IMC A;  4I40 A;  5ET8 A;  4IR8 A;  4MNP A;  4O7I A;  2WBB A;  5FBP A;  1NV5 A;  1IME A;  4PAK A;  3B50 A;  4AS5 A;  4NQ8 A;  2WYK A;  3BIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...