3HV1A

Crystal structure of a polar amino acid abc uptake transporter substrate binding protein from streptococcus thermophilus
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
264
structure length
264
Chain Sequence
RSHFATQKDQWQTYTKEKKIKIGFDATFVPMGYEEKDGSYIGFDIDLANAVFKLYGIDVEWQAIDWDMKETELKNGTIDLIWNGYSVTDERKQSADFTEPYMVNEQVLVTKKSSGIDSVAGMAGKTLGAQAGSSGYDAFNASPKILKDVVANQKVVQYSTFTQALIDLNSGRIDGLLIDRVYANYYLEKSGVLDQYNVMPAGYEGESFAVGARKVDKTLIKKINQGFETLYKNGEFQKISNKWFGEDVATDQVKGKREGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Polar amino acid ABC uptake transporter substrate binding pr
publication title Crystal structure of a polar amino acid ABC uptake transporter substrate binding protein from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
total genus 90
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hv1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hv1A02
1SD3A 2H25A 3K00A 4ZZAA 2OWSA 1VSOA 3FJ7A 1VFDA 3RTWB 3N6TA 1FCKA 4GL0A 4I1DA 4RK9A 4RNSA 3TFLA 2WKYA 4XTCQ 5JTYA 4KHZE 5AE4A 4YKKA 2UYFA 4P0IA 3H03A 2XXPA 4I62A 4OMBA 4KQPA 5AA4B 4NMYA 1H45A 1B5HA 3IB0A 3QK6A 4ELPA 4MLVA 4WEDA 4O3CA 4E0WA 4KYSA 4LP2B 1B2HA 1USYH 1BP5A 3KEIA 4U1OA 4ECFA 3R26A 3FIRA 3A09A 3LSFB 4WKMA 4JWOA 4DDDA 2I4BA 3O6GA 3RPWA 5ITOA 1D3KA 3H7MA 1QUIA 3PPOA 5HPQA 4PETA 2O1LA 1FQEA 5I2NB 5DEXA 4N6PA 3CFLA 4QFNA 4JSDA 1GTKA 1LAHE 4LQ2A 3USDA 4IGTA 1UTBA 2DE4A 4F22A 1B40A 1EH3A 2UXAA 3MW0A 2H4IA 4LZ8A 1JNFA 1POY1 3PPRA 3OO6A 4F1VA 1JEUA 2XD3A 4BDOA 4LA9A 2O51A 1MXUA 3IB1A 3CVGA 3G3FA 1SW5A 1URDA 3LC8A 3D4CA 5F7VA 4NF5B 2ONRA 2NXOA 2QS2A 3V83A 4HCYA 1F9BA 2OJTA 1H44A 3UN6A 4I9DA 2PT1A 4KFQA 4XIGQ 3GXAA 3RNNA 4HS7A 1H3DA 1OVTA 1MDQA 2XXVA 5M2VA 3U93A 1QJMA 4XKRA 1N7WA 2HAVA 3P7IA 5F1QA 4OFJA 4PE5B 4NE4A 5JEIA 4IO4A 4Q30B 3RQTA 1P1UA 4THIA 2R9JA 3TMGA 4LONB 2E0SA 4FORA 2F7CA 3IX1A 5TPAA 2ZYKA 3MP6A 3G7WA 3ILUB 2NUVA 4EXKA 1SW2A 1JEVA 3VXCA 1XT8A 3TCGA 1MXVA 4KCDA 3KJTA 4FE8A 4QHQA 5CBSA 4GFRA 3WAEA 1RYOA 4OHNA 3S9MC 3K2DA 1B7HA 4I8CA 1SBPA 1MY3A 3E3KA 4MBPA 3Q25A 1B9JA 3OO7A 3HPIA 1PB7A 3GBAA 1LAGE 3KG2A 4NF8B 4G8HA 4C1UA 1QVSA 3EN3A 2FNCA 2PMSA 2NOOA 2Y84A 1D4NA 1PBPA 3K01A 3B6TA 3TODA 2RINA 5EHSA 2VGQA 1USYE 3SKPA 5DTBA 3UP9A 3PU5A 4OETA 3G3KA 1IZ1A 4N07A 1Z7NE 4U4XA 4NF6A 5L9MA 5H8NB 1FQBA 2XXTA 1B46A 3EPEA 4GIZA 2D5WA 5TP9A 4ELRA 3MP1A 4YMBA 3MUQA 1JW5A 2XXXA 1Y1MA 3G3JA 3L6HA 1KWHA 3G3HA 3MVXA 5I59B 2QMXA 3VXBA 3PUXE 3A3UA 2Q9TA 4OQOA 2F35A 5K2XA 3CR9A 3JYRA 4KYDA 2B3FA 4ZECA 5HM4B 3PD8A 3OOAA 5AA2D 1VFEA 1Y9UA 5B7DA 3O66A 3IJOB 2LAOA 3MZBA 4OVJA 4DLDA 3OELA 1MM7A 3RLFE 4EQ7A 5A5XA 1B52A 1P1NA 2ZNUA 1NH8A 2B3BA 1OLCA 4OFLA 3OEMA 1ZIUA 2ABHA 3FJMA 4H65A 4MFIA 4KR5A 3KJ7A 3KBRA 2F78A 1QKAA 1GGGA 3G3IA 4JDFA 2QS1A 1BIYA 5FTIA 1HSJA 4QFPA 1B3FA 5DVJA 4MF3A 4JXIA 5DVFA 4R6HA 3S9LC 4U23A 3MP8A 5B70A 1UTHA 5CBRA 1TT1A 3LSWA 1LCTA 5L8DA 2RF1A 3TCHA 1A7LA 4G4PA 3O6IA 1NNKA 2DS9A 2GHAA 2UVGA 3RGYA 1TFDA 1I6QA 5K2YA 1HSEA 2RC8A 2ZMBA 5I58A 4JSOA 3TZAA 3ILTB 4KI0E 4IO3A 1PEBA 3B7DA 3C31A 3TCFA 4WEPA 3QYTA 3VFJA 4FECA 1DPPA 2X26A 4JBZA 2Y7PA 1OQGA 4JB7A 5CC2A 4EQ9A 2Y7IA 1H76A 2F7AA 4GXAA 3UIFA 1YAEA 4DIGA 4JWXA 5DVIA 5FTHA 2YPNA 4U1ZA 1JW1A 1N0TA 1MQGA 1FTMA 1VR5A 4R6KA 4G68A 3ODBA 1VE4A 3VV5A 2H5YA 4C1TA 3HHGA 1MH3A 1M5EA 1MH4A 4G68C 3OD7A 2HZKA 4YKJA 4PQJA 3TEPA 1IITA 5FHMA 4ELQA 3O2AA 5AA2A 3FATA 1MY2A 3OEKA 3ZKLA 1OLAA 2DWJA 3CFXA 1LAXA 3RT6B 1CB6A 4BLAA 3FASA 4QF9A 4GQOA 1D9VA 3W9VA 3FVNA 1MG1A 4F19A 1SYIA 1N3WA 3T9XB 1QULA 1HSLA 1ZU0A 3FV1A 2M8CA 3I3VA 1Y3NA 1NNFA 2E1SA 2X7PA 3H6VA 3PUWE 2F34A 1MY0A 5DYHA 2F6GA 4U22A 2IA4A 3HN0A 1IXHA 1FQFA 5ELVA 4BDQA 1SI1A 2A5TB 1POTA 3T93B 1SW4A 5ICQA 1Y1ZA 4GXSB 2Z8FA 2PBWA 4R72A 2XD2A 2XXWA 3OSQA 4FEDA 1EZPA 5BWJA 2ZNTA 1B51A 1IQ7A 3CIJA 4TOZA 1PBQA 1MQJA 3C32A 2AL5A 2DWAA 4YKPA 4IO5A 1Y4CA 4R73A 1UQWA 3PPPA 1ELJA 2O84X 3IJXB 1B0LA 3KSJA 2XX7A 3HHFA 4Q8RA 4KD5A 3C4MA 3CFZA 4XKPA 4ZEDA 2O7UA 5JK4A 4FIMA 4RPNA 3O97A 3THIA 1P1WA 4AB5A 1M5CA 2V25A 2VP1A 3MZ1A 1IEJA 1WVJA 1OVBA 3N5LA 2VHAA 1PB8A 1QKBA 4IGRA 5KCJB 3KOSA 5I56B 3W9WA 2BJJX 4ZE8A 1P99A 1MXZA 1RYXA 4ZEBA 3PPNA 3TTLA 1Y20A 2PX1A 4FATA 3FXQA 2KLFA 2R71A 5H8SA 4R6YA 3BKIB 4F3SA 5HBCA 3O6HA 1M5BA 3PGFA 4NF4B 5I84A 2V84A 3T9HB 4N13A 4MH5A 2H9BA 4F2OA 4F31B 3S9NC 2H98A 1YCJA 4YB7A 3A3CA 4GRKA 3KGCA 1YTVA 4OXVA 2Z8DA 5CMCA 4TQUQ 1MPCA 4QSCA 5AA4A 3IO4A 3U1OA 1N04A 3Q29A 4IO2A 2X7QA 3EF7A 4H8IA 1Q35A 3WAFA 2I49A 3PUYE 3IB2A 1TXFA 4NWDA 2O68A 4LZ5A 2DVCA 1NKXA 3BBRA 1NNPA 1JQFA 1LFIA 1ZTYA 4MLQA 3VVDA 3CSBA 2O7IA 1B0HA 3M3KA 1JVYA 2V3TA 2HFBA 3VVFA 2V93A 3QUFA 5CMKA 3TTMA 5I2NA 1FQDA 5EHMA 4Z0IA 3UA8A 4OWDA 5H8FB 4OZ9A 4F3PA 1LCFA 3DLNA 2Y7WA 3O28A 2FA7A 4U2RA 2O6AA 3PMVA 4GL8A 3R7XA 3KN7A 4Q5TA 2OZZA 4NF4A 1JW4A 3TYHA 1PC3A 4RYAA 3VE1B 2OBGA 1B6HA 1MXWA 5H8QB 1ZBMA 4NF5A 2F6PA 4ISUA 3K4UA 1B5IA 3V89B 2F36A 3TUSA 1NMUA 3U94A 1AL3A 4ONYA 3SEUA 4IB2A 1ANFA 5KDTB 1B05A 4PFUA 5TU0A 2XXQA 1LSTA 4LUBA 1ZJLA 1JETA 3N26A 5CMBA 2DVZA 3EHSA 4OYVA 2UVHA 2CMOA 1MY1A 4JWYA 4IY6A 1MQDA 4M1VA 3DM0A 4EF1A 3MVWA 5H8HB 1R6ZA 2REGA 3MC2A 4F39A 3JV9A 3TELA 2GRVA 1AIVA 3T9UA 4M4GA 1A8EA 4YU0A 3W15C 2QJEA 2D3IA 3PMWA 3GZGA 2VOZA 4POXA 3CRBA 3EHTA 5CI5A 1XHYA 2OWTA 3SEYA 1CE2A 3IOWA 1AMFA 2GHBA 3JZJA 4ZEFA 2DE3A 2REJA 2HEUA 3K0VA 4OTEA 2Z23A 3L6GA 4XKQA 3T96B 3KN8A 5I2KB 2ZYNA 3K02A 2CZLA 3O29A 1A55A 1US5A 3OSRA 4OESA 4NF8A 4OEUA 3M3FA 5CRYA 2G29A 3UORA 3SEXA 1GR2A 1S7YA 4QRZA 1FQCA 4WXJA 1LB8A 4GOTA 4DXUA 4QFOA 4GWOA 4ZZEA 3OMBA 4HCWA 1BTJA 2QSXA 5H8NA 4X1BA 2ZNSA 4G8MA 1DTZA 3B6QA 4GD5A 2RC7A 3FV2A 3OENA 2Q8JA 2PVUA 2VD2A 3VVEA 1B7ZA 2XXRA 1B1XA 4EDPA 5I59A 3IR1A 5AA1A 1SQYA 5ITPA 1MY4A 4H1XA 2UVIA 4U21A 3I5OA 5JTYB 4IY5A 3PPQA 1I6AA 2Q2AA 4X1DA 4HW8A 5H8HA 1ZKBA 3LSLA 2XXIA 1MPBA 3KOTA 4G8NA 1N84A 1FTKA 3LSXA 4H0WA 4K3FA 3E4RA 3C9HA 3CG1A 3HSTA 2I3VA 4O3AA 1UIUA 4X9TA 3MBPA 4BDNA 3T9VA 2H99A 1OIBA 2ANJA 4ZEIA 4POWA 3E9XA 4P11A 3UGWA 4ZDMA 2I0CA 3TTKA 1NH7A 3TQWA 3ECRA 1B7UA 1TWYA 3HCQA 3HO7A 3VLVA 4G2ZA 3OO8A 1FQAA 3H6TA 1O63A 3N94A 3H6WA 3QIMA 4YMAA 3PUVE 2IEEA 5DEXB 2XX9A 3IORA 1B5JA 4F1UA 4HTGA 1XOCA 3T22A 2HXWA 3KN3A 1UTBB 3C33A 3IOVA 1WODA 2F97A 4P0GA 4C0RA 3EHUA 3K6XA 2GFEA 1DSNA 1NFTA 3TAJA 3TDJA 3TKDA 3LBSA 2GH9A 2ESNA 4ZEKA 1L5TA 3N6UA 3SEWA 3MPLA 1WDNA 1MRPA 4XKNA 2OLBA 3RY3A 4F18A 4PP0A 4IO7A 5ICTA 3SERA 2DXYA 4G77A 4R74A 4TLMB 1B58A 5I57B 4LZ7A 2G93A 1IXCA 1LAFE 1P1QA 3EQ1A 1A99A 2HCAA 2Y7RA 2ZXTA 1N3XA 3SETA 3C36A 1XC1A 4ELOA 1XS5A 3K6VA 4QFLA 3MQ9A 1DPEA 2OCUA 3OXNA 2QPQA 1Y4TA 3S9EA 3Q27A 2A5SA 1M5FA 2ZYOA 5TPAB 4H5GA 5BUUA 2QRYA 3MZ9A 1Y3PA 1S50A 1B1HA 1MS7A 1B3EA 4PFYA 2XX8A 1MPDA 3H4ZA 5IAIA 4DZ1A 2NWJA 1BKAA 2ALUA 1UIVA 4F1YA 1B3GA 3M8UA 2PT2A 4DE8A 2PYYA 3FJGA 2DE2A 3F11A 1GVCA 1JVXA 3FD3A 3IK6B 2D21A 3HV1A 3QAXA 3ZS6A 1TFAA 3Q28A 3IOUA 1B3LA 1N76A 2DOJA 1GV8A 2B65A 2XXYA 4F3GA 1DTGA 1MXXA 4NTLA 3S4UA 2V3UA 4R2BA 2A5TA 1S9TA 2FYIA 3FUZA 1LB9A 4NF6B 1PB9A 2DXRA 1MQIA 4OERA 3FGSA 1IXGA 3ZSFA 1B4HA 3R6UA 2QS4A 5TP9B 3DP8A 4NWCA 1MXYA 3FVGA 4ZE9A 4RXLA 1B4ZA 5CMMA 4GF8A 5I57A 1B3HA 2XXUA 1LFGA 1FTLA 3PUZE 1YPNA 1FTJA 4QFKA 1I69A 2F5XA 3LUYA 2P1SA 3RTFB 1I6BA 2Y7KA 3S2VA 3FXRA 4Q0CA 3RN8A 1A54A 2AYSA 3SEVA 3CSGA 2I4CA 2AIXA 3IAZA 3MJNA 2F8DA 3FVOA 2I48A 1XVYA 5L9SA 5KCJA 5I56A 4F2QA 2VD3A 3K6WA 4AB6A 5A5XB 3GLBA 4FJPA 3TTNA 2ONKE 3T66A 4BDRA 4YB6A 4DXCA 1QUJA 2Q2CA 1Q1KA 2P2AA 4KCCA 3SESA 4NEDA 1M5DA 4DCYA 2DQVA 1URSA 4EUOA 3I6VA 4X48A 4PFWA 4GLIA 3BFUA 2XHDA 3UK4A 1PDAA 4L17A 4YKIA 1SVXB 1URGA 4RY1A 4Z7EA 1UTHB 2O69A 4EXLA 4DCXA 1SDXA 2HZLA 2I3WA 1R9QA 2DP8A 4H67A 3QXMA 3VLWA 4YZZA 3H6UA 4UACA 4O3BA 1MQHA 1B32A 1LFHA 5I58B 3K1PA 3K1NA 3DP4A 5J1DA 3D4GA 3V8XB 2DWIA 3VLUA 4E0XA 4KYEA 2O1MA 2ZYMA 5IKBA 3DP6A 4IO6A 1AH5A 3K6UA 3G3GA 4ESWA 1LGBC 4U4SA 2Z8EA 2RCBA 3MVZA 3IOTA 3MVYA 5KZTA 1XVXA 4RPOA 2RKMA 3VDFA 1O64A 3H3GA 4BDMA 1R1NA 4F3BA 5H8FA 3V5AA 4G68B 5AA3A 1P1OA 3B6WA 4BDLA 1DMBA 3GBBA 4AQ4A 2RC9A 5EYFA 2Q89A 3SDFA 3FXUA 4RJZA 3U8QA 1H43A 4LQ5A 2W7YA 2HAUA 4R75A 1LBCA 1OMPA 1OQHA 4R9FA 3IO6A 2THIA 3QSLA 3H06B 1EZ9A 1EU8A 5AA2B 3FZVA 3ONMA 3KFMA 4OENA 1QW0A 1NNTA 3O9PA 4GVOA 4YAHX 5ISUA 2QMWA 4R2FA 3QUJA 5H8QA 3TTRA 3LR1A 4EQBA 1FTOA 2RCAA 1A40A 2OK2A 3U92A 1MM6A 1MDP1 3TQLA 2I6EA 3KZGA 4KPTA 1US4A 5CM6A 3IL1B 3ZKKA 4ESXA 3M3LA 5KDTA 4ND9A 1SYHA 2NVUB 1N7XA 5DT6A 2DSFA 4RK2A 5LOMA 3CI8A 4YB5A 3PMXA 4YICA 3FVKA 1NL5A 4FEBA 4XXUA 1Z7ME 2QS3A 1ATGA 4LATA 2UYEA 3U72A 2YLNA 3RUMA 2UVJA 4DXBA 1T0KA 3C35A 2ONSA 1SI0A 1FW0A 1LLSA 4PFTA 2HQ0A 3BFTA 1ZMGA 3E13X 1ZLQA 2YJPA 1EZOA 5L9OA 4LVQA 1LBBA 4OEVA 5FHOA 1IUDA 3KSXA 1Y3QA 4RA1A 4TLLB 5FHNA 1IXIA 3K1MA 3Q26A 2I58A 2XXHA 4R9GA 1IIWA 2Z22A 2F7BA 1II5A 4H8JA 1A8FA 2DYXA 5I2KA 3MWBA 3MAMA 1BLFA 2P0SA 1O7TA 2Q88A 3TPAA 2I0BA 2DWHA 2AL4A 4H5FA 4H6DA 4QSEA 3DELB 1DOTA 2R6GE 3C34A 4FAJA 1D9YA 1RKMA 1AOVA 1J1NA 1QUKA 4F29A 2V3QA 3PD9A 1SW1A 4UA8A 3RT8A 4EF2A 4OFOA 4QSDA 4ZS9A 3CG3A 3MPKA 3OO9A 3PV0E 2QL3A 1R9LA 3AXFA
chains in the Genus database with same CATH superfamily
1SD3A 4H45A 4PAFA 2H25A 2ZZVA 3K00A 4ZZAA 2OWSA 3IFCA 2Y5KA 1VSOA 3FJ7A 1VFDA 3LUZA 3RTWB 3N6TA 1FCKA 1EYKA 4N15A 4GL0A 4I1DA 4O94A 4RK9A 4RNSA 3TFLA 2WKYA 4XTCQ 5JTYA 4KHZE 5AE4A 2P3VA 4YKKA 1NV3A 2UYFA 2HHMA 4P0IA 3KBZA 2R8TA 3H03A 2XXPA 4I62A 4OMBA 4KQPA 5AA4B 4NMYA 3BIHA 1H45A 1B5HA 3IB0A 3QK6A 3FBPA 4ELPA 4MLVA 1CNQA 4WEDA 2B4LA 4GBWA 4O3CA 4E0WA 4KYSA 4LP2B 1B2HA 1USYH 5FBPA 1BP5A 3KEIA 4U1OA 4ECFA 4P9KA 3R26A 4GWXA 3FIRA 3A09A 3LSFB 4GBVA 4WKMA 4JWOA 2XWIA 4DDDA 2I4BA 2MKZA 2WYKA 3O6GA 3RPWA 5ITOA 1D3KA 3H7MA 1QUIA 3PPOA 5HPQA 4PETA 2O1LA 1FQEA 5I2NB 4O8MA 5DEXA 4N6PA 3CFLA 4QFNA 4JSDA 1GTKA 1LAHE 1LBZA 1FBDA 1AWBA 4LQ2A 3USDA 5EQAA 1K9YA 4IGTA 1UTBA 2DE4A 4F22A 5ET7A 1B40A 1EH3A 2UXAA 3MW0A 3E78A 2H4IA 4LZ8A 1JNFA 1POY1 3PPRA 3OO6A 4F1VA 1INPA 1JEUA 2XD3A 4MAGA 1KZ8A 4BDOA 4LA9A 2O51A 1MXUA 3IB1A 3CVGA 3G3FA 1SW5A 1URDA 3LC8A 3D4CA 5F7VA 4NF5B 2ONRA 2NXOA 2QS2A 3V83A 4HCYA 1F9BA 2OJTA 1H44A 3UN6A 4I9DA 2PT1A 4KFQA 4XIGQ 3GXAA 3RNNA 4HS7A 1H3DA 2CEXA 1OVTA 1MDQA 2XXVA 5M2VA 3U93A 4AS5A 1QJMA 4XKRA 4PAIA 1N7WA 2HAVA 3P7IA 5F1QA 4OFJA 4PE5B 4NE4A 1Q9DA 5JEIA 4IO4A 4Q30B 3RQTA 1P1UA 4THIA 1FPFA 2R9JA 3TMGA 4LONB 2E0SA 4FORA 2F7CA 3IX1A 5TPAA 2ZYKA 3MP6A 3G7WA 1FBEA 2V4CA 3ILUB 2NUVA 1SW2A 4EXKA 4OVQA 1JEVA 3VXCA 1XT8A 3TCGA 1MXVA 4KCDA 5F24A 3KJTA 4FE8A 4QHQA 5CBSA 4PDDA 4GFRA 3WAEA 1RYOA 4OHNA 3S9MC 3K2DA 1B7HA 4I8CA 1NV6A 1SBPA 1MY3A 4NHBA 3E3KA 4MBPA 3Q25A 1B9JA 3OO7A 3HPIA 1PB7A 3GBAA 1LAGE 3RYDA 4PGPA 3KG2A 4NF8B 4G8HA 3SZPA 4C1UA 1QVSA 3EN3A 2FNCA 2PMSA 2NOOA 2Y84A 1D4NA 1PBPA 1FPBA 3K01A 3B6TA 3TODA 2RINA 5EHSA 2VGQA 1USYE 3SKPA 2QFLA 5DTBA 4JVDA 3UP9A 3PU5A 4OETA 4MX6A 3G3KA 1IZ1A 4N07A 1Z7NE 5ESYA 4U4XA 4NF6A 5L9MA 5H8NB 4PBQA 1FQBA 2XXTA 1B46A 3EPEA 4I40A 4GIZA 2D5WA 5TP9A 4ELRA 3MP1A 4YMBA 3MUQA 1JW5A 2XXXA 1Y1MA 2FVZA 5ET5A 3G3JA 3L6HA 1KWHA 3G3HA 3MVXA 5I59B 2QMXA 3VXBA 3PUXE 3A3UA 2Q9TA 4OQOA 2F35A 5K2XA 3CR9A 3JYRA 4KYDA 2B3FA 2HXRA 4ZECA 5HM4B 3PD8A 3OOAA 4QXDA 3EKIA 5AA2D 1VFEA 1Y9UA 5B7DA 3O66A 2WEFA 4AS4A 3IJOB 2LAOA 3MZBA 4X04A 4OVJA 4DLDA 3OELA 1MM7A 3RLFE 4EQ7A 5A5XA 1B52A 1P1NA 2ZNUA 1NH8A 2B3BA 1OLCA 4OFLA 3OEMA 1ZIUA 2ABHA 2XWOA 3FJMA 4H65A 4MFIA 4KR5A 3KJ7A 3KBRA 2F78A 1QKAA 1GGGA 3G3IA 4JDFA 2QS1A 4IR8A 1BIYA 5FTIA 1HSJA 2XA5A 4QFPA 1B3FA 5DVJA 4MF3A 4JXIA 5DVFA 4PCDA 4R6HA 3S9LC 1NI9A 4U23A 3MP8A 4PBHA 2WX9A 5B70A 1UTHA 5CBRA 1TT1A 3LSWA 1LCTA 5L8DA 2RF1A 3TCHA 1A7LA 1DBZA 4G4PA 3O6IA 1NNKA 2DS9A 4MCOA 2GHAA 2UVGA 1FTAA 3RGYA 1TFDA 1I6QA 4X8RA 5K2YA 1HSEA 2RC8A 2ZMBA 5I58A 4JSOA 3TZAA 3ILTB 4N4UA 4KI0E 4IO3A 3T1BA 1PEBA 2OWZA 3B7DA 3C31A 3TCFA 4WEPA 1FPIA 3QYTA 3VFJA 4FECA 1DPPA 2X26A 4JBZA 2Y7PA 2FBPA 1OQGA 4JB7A 1NV7A 5CC2A 4EQ9A 2Y7IA 1H76A 2F7AA 4GXAA 3UIFA 1YAEA 4DIGA 4NF0A 4JWXA 5DVIA 5FTHA 2YPNA 4U1ZA 1JW1A 1N0TA 1MQGA 1FTMA 1VR5A 4GWYA 3BIGA 4R6KA 4G68A 3ODBA 1VE4A 3VV5A 2H5YA 4C1TA 3HHGA 1MH3A 1M5EA 1MH4A 4P3LA 4G68C 3OD7A 2HZKA 4YKJA 4PQJA 3TEPA 1IITA 5FHMA 4ELQA 3O2AA 5AA2A 3FATA 1MY2A 3OEKA 3ZKLA 4OA4A 1OLAA 2DWJA 2F3DA 3CFXA 1LAXA 3RT6B 1CB6A 4DI4B 4BLAA 3FASA 4QF9A 4GQOA 1FBGA 1D9VA 3W9VA 3FVNA 5ET8A 1MG1A 4N6DA 4F19A 1SYIA 1N3WA 2ZZXA 3T9XB 1QULA 1HSLA 1ZU0A 3FV1A 1NUXA 2OX3A 5IGAA 1RDYA 2M8CA 3I3VA 1Y3NA 1NNFA 2E1SA 5IZ1A 1BK4A 2X7PA 3H6VA 3PUWE 2F34A 1MY0A 4O7MA 5DYHA 2F6GA 4U22A 2IA4A 3HN0A 1IXHA 1FQFA 5ELVA 4BDQA 1SI1A 4MJOA 2A5TB 5EQ7A 1POTA 3T93B 1SW4A 5ICQA 1Y1ZA 2HPGA 4GXSB 2Z8FA 2PBWA 4R72A 2XD2A 2XXWA 3OSQA 3NOHA 4FEDA 1KA1A 1EZPA 5BWJA 2ZNTA 1B51A 1IQ7A 3CIJA 4TOZA 1PBQA 1MQJA 3C32A 2AL5A 2DWAA 4YKPA 4IO5A 1Y4CA 4R73A 1UQWA 3PPPA 1ELJA 2O84X 3IJXB 1B0LA 3KSJA 2XX7A 3HHFA 4Q8RA 4KD5A 3C4MA 3CFZA 4XKPA 4ZEDA 2O7UA 5JK4A 4FIMA 4RPNA 3O97A 3THIA 1P1WA 4AB5A 1M5CA 2PCRA 2V25A 2VP1A 3MZ1A 1IEJA 1WVJA 1OVBA 3N5LA 4PFRA 2VHAA 1PB8A 1QKBA 4IGRA 5KCJB 3KOSA 5I56B 3W9WA 3IFAA 1NV2A 2BJJX 4ZE8A 1P99A 1MXZA 4O7IA 1RYXA 4ZEBA 3QMFA 3PPNA 3TTLA 1Y20A 2PX1A 4FATA 2CZIA 3FXQA 2KLFA 2R71A 5H8SA 5I3SA 3D1RA 4JVCA 4R6YA 3BKIB 4F3SA 5J16A 5HBCA 3O6HA 1M5BA 3PGFA 4NF4B 5I5PA 5I84A 2V84A 3T9HB 4GWWA 4N13A 4OVTA 2JJKA 4MH5A 1FPJA 2H9BA 4F2OA 4F31B 2Y5LA 3S9NC 1FBCA 4I3YA 2H98A 3MSTA 1YCJA 4YB7A 3A3CA 4GRKA 3KGCA 1YTVA 4OXVA 2Z8DA 5CMCA 4TQUQ 1MPCA 4QSCA 5AA4A 3IO4A 3U1OA 1N04A 3Q29A 4PTKA 4IO2A 2X7QA 3EF7A 4H8IA 1Q35A 4P1EA 3WAFA 2I49A 4PE3A 3PUYE 3IB2A 1TXFA 4NWDA 2O68A 4LZ5A 2DVCA 4PAKA 1NKXA 3BBRA 1NNPA 1LBYA 1JQFA 1LFIA 4NX1A 1ZTYA 4MLQA 3VVDA 1EYJA 3E79A 3CSBA 5ET6A 2O7IA 1B0HA 4I3EA 3M3KA 1JVYA 2V3TA 2HFBA 3VVFA 2V93A 3QUFA 5CMKA 3TTMA 5I2NA 1FQDA 5EHMA 4Z0IA 3UA8A 4OWDA 5H8FB 2PFYA 4OZ9A 4F3PA 1LCFA 3DLNA 1DK4A 2Y7WA 3O28A 1LBXA 2QVRA 2FA7A 4U2RA 2O6AA 3PMVA 4GL8A 5IZ3B 4PFBA 3R7XA 3KN7A 4Q5TA 2OZZA 5EQ9A 4NF4A 1JW4A 1PC3A 3TYHA 4RYAA 3VE1B 2OBGA 4HE0A 1B6HA 4NAPA 1MXWA 5H8QB 1ZBMA 4NF5A 2F6PA 4ISUA 3K4UA 1B5IA 1NUYA 3V89B 2F36A 3TUSA 4OANA 1NMUA 3U94A 1AL3A 4ONYA 3SEUA 4IB2A 1ANFA 5KDTB 1B05A 4PFUA 4P47A 4P8BA 1FPDA 5TU0A 2XXQA 1LSTA 4LUBA 1ZJLA 1JETA 3N26A 5CMBA 4PGNA 2DVZA 4MNCA 3EHSA 4OYVA 2UVHA 2CMOA 1MY1A 4JWYA 4IY6A 1MQDA 4M1VA 3DM0A 4EF1A 3MVWA 5H8HB 4NQ8A 1R6ZA 2REGA 3MC2A 4F39A 3JV9A 3TELA 2GRVA 1AIVA 1RDZA 3T9UA 4M4GA 1A8EA 4YU0A 1FPLA 3W15C 2QJEA 2D3IA 3PMWA 3GZGA 2VOZA 4POXA 3CRBA 2XWVA 3EHTA 5CI5A 5EYGA 1XHYA 2OWTA 3SEYA 1CE2A 4PF6A 3IOWA 1AMFA 2GHBA 3JZJA 4ZEFA 2DE3A 2REJA 1IMCA 4XFEA 2HEUA 3K0VA 4OTEA 2Z23A 3L6GA 4XKQA 3T96B 3KN8A 5I2KB 2ZYNA 3K02A 1FPEA 4PDHA 2CZLA 2FIEA 3O29A 1A55A 1US5A 3OSRA 4OESA 2KQZA 4NF8A 4GX6A 4OEUA 5EQ8A 3M3FA 5CRYA 2G29A 3UORA 3KC1A 3SEXA 1GR2A 1S7YA 4QRZA 1FQCA 1FJ6A 4WXJA 1LB8A 4JVIA 4GOTA 4DXUA 4H46A 1IMBA 4QFOA 4GWOA 4ZZEA 3OMBA 4OVSA 4HCWA 1BTJA 2QSXA 5H8NA 4X1BA 2ZNSA 4G8MA 1DTZA 3B6QA 4MNIA 4GD5A 2F3BA 2RC7A 2WYPA 3FV2A 3OENA 2Q8JA 2PVUA 2VD2A 3VVEA 1B7ZA 2XXRA 1B1XA 4EDPA 5I59A 3IR1A 5AA1A 1QGXA 1SQYA 5ITPA 1MY4A 3CHGA 4H1XA 2UVIA 4N8GA 4U21A 3I5OA 1FRPA 5JTYB 4IY5A 2GQ1A 5LTCA 3PPQA 1XI6A 1I6AA 2Q2AA 4X1DA 4HW8A 5H8HA 1ZKBA 3LSLA 2XXIA 4PF8A 1MPBA 4HE1A 2CZKA 2VT5A 3KOTA 4G8NA 1N84A 1FTKA 3LSXA 4H0WA 4K3FA 3E4RA 3C9HA 1DCUA 3CG1A 3HSTA 2I3VA 4O3AA 1NUWA 1UIUA 4X9TA 3MBPA 4BDNA 3T9VA 4XEQA 1VDWA 2H99A 1OIBA 1G0IA 2ANJA 4ZEIA 4POWA 3E9XA 4P11A 3UGWA 4NN3A 4ZDMA 2I0CA 3TTKA 1NH7A 3TQWA 3ECRA 1B7UA 5T3JA 1TWYA 3HCQA 3HO7A 3VLVA 4G2ZA 3OO8A 2FIXA 1FQAA 3H6TA 1O63A 3N94A 3H6WA 3QIMA 4YMAA 3PUVE 2IEEA 5DEXB 3ROJA 2CZHA 2XX9A 3IORA 1B5JA 4GWSA 1NUZA 4F1UA 4HTGA 1XOCA 3T22A 2HXWA 3KN3A 2VPOA 1UTBB 3C33A 3IOVA 1WODA 2F97A 4P0GA 4QBAA 1JP4A 4C0RA 3EHUA 3K6XA 2GFEA 1DSNA 1NFTA 3TAJA 3TDJA 3TKDA 3LBSA 2GH9A 2ESNA 4ZEKA 1L5TA 3N6UA 3SEWA 3MPLA 2QVUA 1WDNA 5DW8A 1MRPA 4XKNA 2OLBA 4HXVA 3RY3A 4F18A 4PP0A 4IO7A 1NV4A 5ICTA 3SERA 2DXYA 4G77A 4R74A 4TLMB 1B58A 5I57B 4LZ7A 2G93A 1IXCA 1K9ZA 1LAFE 1P1QA 3EQ1A 4PFIA 1A99A 2FHYA 2HCAA 2Y7RA 2ZXTA 1N3XA 3SETA 3C36A 1XC1A 4ELOA 1XS5A 3K6VA 4QFLA 3MQ9A 1DPEA 2OCUA 3OXNA 2QPQA 1Y4TA 3S9EA 3Q27A 2A5SA 1M5FA 2ZYOA 5TPAB 5EYHA 4H5GA 3GYYA 2QRYA 3MZ9A 5BUUA 1FBFA 2BJIA 1Y3PA 1S50A 1B1HA 1MS7A 1YYZA 1B3EA 4PFYA 2XX8A 1MPDA 3H4ZA 5IAIA 4DZ1A 3RPLB 2NWJA 1BKAA 2ALUA 3MYUA 1UIVA 1RDXA 4F1YA 1B3GA 3M8UA 4LN5A 2PT2A 3KC0A 4DE8A 2PYYA 3FJGA 2DE2A 3F11A 4N8YA 1GVCA 1JVXA 3FD3A 3IK6B 4P56A 2D21A 3HV1A 3QAXA 3ZS6A 1TFAA 3Q28A 3IOUA 1B3LA 1N76A 2DOJA 2B65A 1GV8A 4P1LA 2XXYA 4F3GA 1DTGA 1MXXA 4NTLA 3S4UA 2V3UA 4R2BA 4OVPA 1FBPA 2A5TA 4N91A 1S9TA 2FYIA 3FUZA 1LB9A 4NF6B 1PB9A 2DXRA 1MQIA 3PTYA 4OERA 3FGSA 1IXGA 3ZSFA 4G61A 1B4HA 4GWZA 3R6UA 2QS4A 5TP9B 3DP8A 4NWCA 1MXYA 1SPIA 3FVGA 1YXIA 4ZE9A 4RXLA 1B4ZA 5CMMA 4GF8A 5I57A 1B3HA 2XXUA 3LV0A 4NG7A 1LFGA 1FTLA 3PUZE 1YPNA 3U65A 5A5LA 1FTJA 4QFKA 4UABA 1I69A 2F5XA 3LUYA 2P1SA 3RTFB 1I6BA 3HFUA 2Y7KA 3S2VA 3FXRA 4Q0CA 3RN8A 1A54A 3ISPA 2AYSA 3SEVA 3CSGA 2I4CA 2AIXA 3IAZA 3MJNA 2F8DA 3FVOA 2I48A 4XF5A 1XVYA 5L9SA 5KCJA 5I56A 4F2QA 2VD3A 3K6WA 4AB6A 5A5XB 3GLBA 4FJPA 3TTNA 1IMEA 2ONKE 3T66A 4BDRA 4YB6A 3RPLA 4DXCA 1QUJA 1IMFA 2Q2CA 1Q1KA 2P2AA 4KCCA 3SESA 4NEDA 1M5DA 1LBVA 4DCYA 2DQVA 1URSA 4EUOA 3I6VA 4X48A 4PFWA 1YZ0A 4GLIA 3A29A 3T0JA 2WBBA 2KR0A 3BFUA 2XHDA 3UK4A 1PDAA 4L17A 4N17A 4YKIA 1SVXB 1URGA 4NGUA 4RY1A 4Z7EA 1UTHB 2O69A 4EXLA 2XWKA 4DCXA 4MHFA 4GX4A 1SDXA 2HZLA 2I3WA 1R9QA 3B8BA 4OVRA 2DP8A 2VPNA 4H67A 4MIJA 3QXMA 3VLWA 2Q8MA 4YZZA 4FBPA 2PFZA 3H6UA 4UACA 4O3BA 1MQHA 1B32A 1LFHA 5I58B 1LBWA 3K1PA 3K1NA 2L5VA 3DP4A 5J1DA 3D4GA 3V8XB 2DWIA 3VLUA 4E0XA 4KYEA 2B4MA 2Q74A 2O1MA 2ZYMA 5IKBA 3DP6A 4IO6A 4GWUA 1AH5A 3K6UA 3G3GA 4ESWA 1LGBC 4U4SA 2Z8EA 2RCBA 3MVZA 1EYIA 3IOTA 3MVYA 5KZTA 1XVXA 4RPOA 2RKMA 3VDFA 1O64A 4N81A 3H3GA 4BDMA 1R1NA 4F3BA 5H8FA 3V5AA 4G68B 5AA3A 1P1OA 3B6WA 5IZZA 4BDLA 1DMBA 3GBBA 4AQ4A 2RC9A 5EYFA 2Q89A 5I7IA 1D9QA 3SDFA 1FPKA 1NV0A 3FXUA 4RJZA 3U8QA 1H43A 4LQ5A 2W7YA 2HAUA 4R75A 1LBCA 1OMPA 1OQHA 1FBHA 1LEVA 4R9FA 3IO6A 2THIA 3QSLA 1NV5A 3H06B 1EZ9A 1EU8A 5AA2B 5IZ3A 3FZVA 3ONMA 3KFMA 4OENA 1QW0A 1NNTA 3O9PA 4MEVA 4GVOA 4YAHX 5ISUA 2P3NA 2QMWA 4R2FA 3QUJA 5H8QA 3TTRA 3LR1A 4EQBA 1FTOA 2RCAA 1A40A 1IMAA 2OK2A 4MNPA 3U92A 1MM6A 1MDP1 1FSAA 2I6EA 3TQLA 2CEYA 3KZGA 4KPTA 1US4A 5CM6A 3IL1B 3ZKKA 4ESXA 3M3LA 5KDTA 4ND9A 1FPGA 1SYHA 2NVUB 1N7XA 5DT6A 2DSFA 4RK2A 4MMPA 5LOMA 3CI8A 4YB5A 3PMXA 2QVVA 2WBDA 1KA0A 4YICA 2XXKA 3FVKA 1NL5A 4FEBA 4XXUA 1Z7ME 2QS3A 1ATGA 4LATA 2UYEA 3U72A 1G0HA 2YLNA 3RUMA 2UVJA 4DXBA 1T0KA 3C35A 2ONSA 1IMDA 1SI0A 2DDKA 1FW0A 4N6KA 1LLSA 4PFTA 3B50A 2HQ0A 3BFTA 1ZMGA 3E13X 1ZLQA 2YJPA 1EZOA 5L9OA 4LVQA 1LBBA 4KXPA 4OEVA 5FHOA 1IUDA 4PC9A 3KSXA 1Y3QA 4RA1A 4TLLB 1NV1A 5FHNA 1IXIA 3K1MA 3FXBA 3Q26A 2I58A 2XXHA 4R9GA 1IIWA 2Z22A 2F7BA 1II5A 4H8JA 1A8FA 2DYXA 5I2KA 3MWBA 3MAMA 1BLFA 2P0SA 1O7TA 2Q88A 3TPAA 2I0BA 2DWHA 2AL4A 4H5FA 4H6DA 4QSEA 3DELB 4DI3D 1DOTA 5LDZA 2R6GE 3C34A 4FAJA 1FJ9A 1D9YA 1RKMA 1AOVA 1J1NA 1QUKA 4F29A 2V3QA 3PD9A 1SW1A 4UA8A 3RT8A 4EF2A 4OFOA 4HE2A 4QSDA 4ZS9A 3CG3A 3MPKA 5IM2A 4GX3A 3OO9A 2ZZWA 3PV0E 2QL3A 1R9LA 3AXFA
chains in the Genus database with same CATH topology
1SD3A 2H25A 3K00A 4ZZAA 2OWSA 1VSOA 3FJ7A 1VFDA 3RTWB 3N6TA 1FCKA 4GL0A 4I1DA 4RK9A 4RNSA 3TFLA 2WKYA 4XTCQ 5JTYA 4KHZE 5AE4A 4YKKA 2UYFA 4P0IA 3H03A 2XXPA 4I62A 4OMBA 4KQPA 5AA4B 4NMYA 1H45A 1B5HA 3IB0A 3QK6A 4ELPA 4MLVA 4WEDA 4O3CA 4E0WA 4KYSA 4LP2B 1B2HA 1USYH 1BP5A 3KEIA 4U1OA 4ECFA 3R26A 3FIRA 3A09A 3LSFB 4WKMA 4JWOA 4DDDA 2I4BA 3O6GA 3RPWA 5ITOA 1D3KA 3H7MA 1QUIA 3PPOA 5HPQA 4PETA 2O1LA 1FQEA 5I2NB 5DEXA 4N6PA 3CFLA 4QFNA 4JSDA 1GTKA 1LAHE 4LQ2A 3USDA 4IGTA 1UTBA 2DE4A 4F22A 1B40A 1EH3A 2UXAA 3MW0A 2H4IA 4LZ8A 1JNFA 1POY1 3PPRA 3OO6A 4F1VA 1JEUA 2XD3A 4BDOA 4LA9A 2O51A 1MXUA 3IB1A 3CVGA 3G3FA 1SW5A 1URDA 3LC8A 3D4CA 5F7VA 4NF5B 2ONRA 2NXOA 2QS2A 3V83A 4HCYA 1F9BA 2OJTA 1H44A 3UN6A 4I9DA 2PT1A 4KFQA 4XIGQ 3GXAA 3RNNA 4HS7A 1H3DA 1OVTA 1MDQA 2XXVA 5M2VA 3U93A 1QJMA 4XKRA 1N7WA 2HAVA 3P7IA 5F1QA 4OFJA 4PE5B 4NE4A 5JEIA 4IO4A 4Q30B 3RQTA 1P1UA 4THIA 2R9JA 3TMGA 4LONB 2E0SA 4FORA 2F7CA 3IX1A 5TPAA 2ZYKA 3MP6A 3G7WA 3ILUB 2NUVA 4EXKA 1SW2A 1JEVA 3VXCA 1XT8A 3TCGA 1MXVA 4KCDA 3KJTA 4FE8A 4QHQA 5CBSA 4GFRA 3WAEA 1RYOA 4OHNA 3S9MC 3K2DA 1B7HA 4I8CA 1SBPA 1MY3A 3E3KA 4MBPA 3Q25A 1B9JA 3OO7A 3HPIA 1PB7A 3GBAA 1LAGE 3KG2A 4NF8B 4G8HA 4C1UA 1QVSA 3EN3A 2FNCA 2PMSA 2NOOA 2Y84A 1D4NA 1PBPA 3K01A 3B6TA 3TODA 2RINA 5EHSA 2VGQA 1USYE 3SKPA 5DTBA 3UP9A 3PU5A 4OETA 3G3KA 1IZ1A 4N07A 1Z7NE 4U4XA 4NF6A 5L9MA 5H8NB 1FQBA 2XXTA 1B46A 3EPEA 4GIZA 2D5WA 5TP9A 4ELRA 3MP1A 4YMBA 3MUQA 1JW5A 2XXXA 1Y1MA 3G3JA 3L6HA 1KWHA 3G3HA 3MVXA 5I59B 2QMXA 3VXBA 3PUXE 3A3UA 2Q9TA 4OQOA 2F35A 5K2XA 3CR9A 3JYRA 4KYDA 2B3FA 4ZECA 5HM4B 3PD8A 3OOAA 5AA2D 1VFEA 1Y9UA 5B7DA 3O66A 3IJOB 2LAOA 3MZBA 4OVJA 4DLDA 3OELA 1MM7A 3RLFE 4EQ7A 5A5XA 1B52A 1P1NA 2ZNUA 1NH8A 2B3BA 1OLCA 4OFLA 3OEMA 1ZIUA 2ABHA 3FJMA 4H65A 4MFIA 4KR5A 3KJ7A 3KBRA 2F78A 1QKAA 1GGGA 3G3IA 4JDFA 2QS1A 1BIYA 5FTIA 1HSJA 4QFPA 1B3FA 5DVJA 4MF3A 4JXIA 5DVFA 4R6HA 3S9LC 4U23A 3MP8A 5B70A 1UTHA 5CBRA 1TT1A 3LSWA 1LCTA 5L8DA 2RF1A 3TCHA 1A7LA 4G4PA 3O6IA 1NNKA 2DS9A 2GHAA 2UVGA 3RGYA 1TFDA 1I6QA 5K2YA 1HSEA 2RC8A 2ZMBA 5I58A 4JSOA 3TZAA 3ILTB 4KI0E 4IO3A 1PEBA 3B7DA 3C31A 3TCFA 4WEPA 3QYTA 3VFJA 4FECA 1DPPA 2X26A 4JBZA 2Y7PA 1OQGA 4JB7A 5CC2A 4EQ9A 2Y7IA 1H76A 2F7AA 4GXAA 3UIFA 1YAEA 4DIGA 4JWXA 5DVIA 5FTHA 2YPNA 4U1ZA 1JW1A 1N0TA 1MQGA 1FTMA 1VR5A 4R6KA 4G68A 3ODBA 1VE4A 3VV5A 2H5YA 4C1TA 3HHGA 1MH3A 1M5EA 1MH4A 4G68C 3OD7A 2HZKA 4YKJA 4PQJA 3TEPA 1IITA 5FHMA 4ELQA 3O2AA 5AA2A 3FATA 1MY2A 3OEKA 3ZKLA 1OLAA 2DWJA 3CFXA 1LAXA 3RT6B 1CB6A 4BLAA 3FASA 4QF9A 4GQOA 1D9VA 3W9VA 3FVNA 1MG1A 4F19A 1SYIA 1N3WA 3T9XB 1QULA 1HSLA 1ZU0A 3FV1A 2M8CA 3I3VA 1Y3NA 1NNFA 2E1SA 2X7PA 3H6VA 3PUWE 2F34A 1MY0A 5DYHA 2F6GA 4U22A 2IA4A 3HN0A 1IXHA 1FQFA 5ELVA 4BDQA 1SI1A 2A5TB 1POTA 3T93B 1SW4A 5ICQA 1Y1ZA 4GXSB 2Z8FA 2PBWA 4R72A 2XD2A 2XXWA 3OSQA 4FEDA 1EZPA 5BWJA 2ZNTA 1B51A 1IQ7A 3CIJA 4TOZA 1PBQA 1MQJA 3C32A 2AL5A 2DWAA 4YKPA 4IO5A 1Y4CA 4R73A 1UQWA 3PPPA 1ELJA 2O84X 3IJXB 1B0LA 3KSJA 2XX7A 3HHFA 4Q8RA 4KD5A 3C4MA 3CFZA 4XKPA 4ZEDA 2O7UA 5JK4A 4FIMA 4RPNA 3O97A 3THIA 1P1WA 4AB5A 1M5CA 2V25A 2VP1A 3MZ1A 1IEJA 1WVJA 1OVBA 3N5LA 2VHAA 1PB8A 1QKBA 4IGRA 5KCJB 3KOSA 5I56B 3W9WA 2BJJX 4ZE8A 1P99A 1MXZA 1RYXA 4ZEBA 3PPNA 3TTLA 1Y20A 2PX1A 4FATA 3FXQA 2KLFA 2R71A 5H8SA 4R6YA 3BKIB 4F3SA 5HBCA 3O6HA 1M5BA 3PGFA 4NF4B 5I84A 2V84A 3T9HB 4N13A 4MH5A 2H9BA 4F2OA 4F31B 3S9NC 2H98A 1YCJA 4YB7A 3A3CA 4GRKA 3KGCA 1YTVA 4OXVA 2Z8DA 5CMCA 4TQUQ 1MPCA 4QSCA 5AA4A 3IO4A 3U1OA 1N04A 3Q29A 4IO2A 2X7QA 3EF7A 4H8IA 1Q35A 3WAFA 2I49A 3PUYE 3IB2A 1TXFA 4NWDA 2O68A 4LZ5A 2DVCA 1NKXA 3BBRA 1NNPA 1JQFA 1LFIA 1ZTYA 4MLQA 3VVDA 3CSBA 2O7IA 1B0HA 3M3KA 1JVYA 2V3TA 2HFBA 3VVFA 2V93A 3QUFA 5CMKA 3TTMA 5I2NA 1FQDA 5EHMA 4Z0IA 3UA8A 4OWDA 5H8FB 4OZ9A 4F3PA 1LCFA 3DLNA 2Y7WA 3O28A 2FA7A 4U2RA 2O6AA 3PMVA 4GL8A 3R7XA 3KN7A 4Q5TA 2OZZA 4NF4A 1JW4A 3TYHA 1PC3A 4RYAA 3VE1B 2OBGA 1B6HA 1MXWA 5H8QB 1ZBMA 4NF5A 2F6PA 4ISUA 3K4UA 1B5IA 3V89B 2F36A 3TUSA 1NMUA 3U94A 1AL3A 4ONYA 3SEUA 4IB2A 1ANFA 5KDTB 1B05A 4PFUA 5TU0A 2XXQA 1LSTA 4LUBA 1ZJLA 1JETA 3N26A 5CMBA 2DVZA 3EHSA 4OYVA 2UVHA 2CMOA 1MY1A 4JWYA 4IY6A 1MQDA 4M1VA 3DM0A 4EF1A 3MVWA 5H8HB 1R6ZA 2REGA 3MC2A 4F39A 3JV9A 3TELA 2GRVA 1AIVA 3T9UA 4M4GA 1A8EA 4YU0A 3W15C 2QJEA 2D3IA 3PMWA 3GZGA 2VOZA 4POXA 3CRBA 3EHTA 5CI5A 1XHYA 2OWTA 3SEYA 1CE2A 3IOWA 1AMFA 2GHBA 3JZJA 4ZEFA 2DE3A 2REJA 2HEUA 3K0VA 4OTEA 2Z23A 3L6GA 4XKQA 3T96B 3KN8A 5I2KB 2ZYNA 3K02A 2CZLA 3O29A 1A55A 1US5A 3OSRA 4OESA 4NF8A 4OEUA 3M3FA 5CRYA 2G29A 3UORA 3SEXA 1GR2A 1S7YA 4QRZA 1FQCA 4WXJA 1LB8A 4GOTA 4DXUA 4QFOA 4GWOA 4ZZEA 3OMBA 4HCWA 1BTJA 2QSXA 5H8NA 4X1BA 2ZNSA 4G8MA 1DTZA 3B6QA 4GD5A 2RC7A 3FV2A 3OENA 2Q8JA 2PVUA 2VD2A 3VVEA 1B7ZA 2XXRA 1B1XA 4EDPA 5I59A 3IR1A 5AA1A 1SQYA 5ITPA 1MY4A 4H1XA 2UVIA 4U21A 3I5OA 5JTYB 4IY5A 3PPQA 1I6AA 2Q2AA 4X1DA 4HW8A 5H8HA 1ZKBA 3LSLA 2XXIA 1MPBA 3KOTA 4G8NA 1N84A 1FTKA 3LSXA 4H0WA 4K3FA 3E4RA 3C9HA 3CG1A 3HSTA 2I3VA 4O3AA 1UIUA 4X9TA 3MBPA 4BDNA 3T9VA 2H99A 1OIBA 2ANJA 4ZEIA 4POWA 3E9XA 4P11A 3UGWA 4ZDMA 2I0CA 3TTKA 1NH7A 3TQWA 3ECRA 1B7UA 1TWYA 3HCQA 3HO7A 3VLVA 4G2ZA 3OO8A 1FQAA 3H6TA 1O63A 3N94A 3H6WA 3QIMA 4YMAA 3PUVE 2IEEA 5DEXB 2XX9A 3IORA 1B5JA 4F1UA 4HTGA 1XOCA 3T22A 2HXWA 3KN3A 1UTBB 3C33A 3IOVA 1WODA 2F97A 4P0GA 4C0RA 3EHUA 3K6XA 2GFEA 1DSNA 1NFTA 3TAJA 3TDJA 3TKDA 3LBSA 2GH9A 2ESNA 4ZEKA 1L5TA 3N6UA 3SEWA 3MPLA 1WDNA 1MRPA 4XKNA 2OLBA 3RY3A 4F18A 4PP0A 4IO7A 5ICTA 3SERA 2DXYA 4G77A 4R74A 4TLMB 1B58A 5I57B 4LZ7A 2G93A 1IXCA 1LAFE 1P1QA 3EQ1A 1A99A 2HCAA 2Y7RA 2ZXTA 1N3XA 3SETA 3C36A 1XC1A 4ELOA 1XS5A 3K6VA 4QFLA 3MQ9A 1DPEA 2OCUA 3OXNA 2QPQA 1Y4TA 3S9EA 3Q27A 2A5SA 1M5FA 2ZYOA 5TPAB 4H5GA 5BUUA 2QRYA 3MZ9A 1Y3PA 1S50A 1B1HA 1MS7A 1B3EA 4PFYA 2XX8A 1MPDA 3H4ZA 5IAIA 4DZ1A 2NWJA 1BKAA 2ALUA 1UIVA 4F1YA 1B3GA 3M8UA 2PT2A 4DE8A 2PYYA 3FJGA 2DE2A 3F11A 1GVCA 1JVXA 3FD3A 3IK6B 2D21A 3HV1A 3QAXA 3ZS6A 1TFAA 3Q28A 3IOUA 1B3LA 1N76A 2DOJA 1GV8A 2B65A 2XXYA 4F3GA 1DTGA 1MXXA 4NTLA 3S4UA 2V3UA 4R2BA 2A5TA 1S9TA 2FYIA 3FUZA 1LB9A 4NF6B 1PB9A 2DXRA 1MQIA 4OERA 3FGSA 1IXGA 3ZSFA 1B4HA 3R6UA 2QS4A 5TP9B 3DP8A 4NWCA 1MXYA 3FVGA 4ZE9A 4RXLA 1B4ZA 5CMMA 4GF8A 5I57A 1B3HA 2XXUA 1LFGA 1FTLA 3PUZE 1YPNA 1FTJA 4QFKA 1I69A 2F5XA 3LUYA 2P1SA 3RTFB 1I6BA 2Y7KA 3S2VA 3FXRA 4Q0CA 3RN8A 1A54A 2AYSA 3SEVA 3CSGA 2I4CA 2AIXA 3IAZA 3MJNA 2F8DA 3FVOA 2I48A 1XVYA 5L9SA 5KCJA 5I56A 4F2QA 2VD3A 3K6WA 4AB6A 5A5XB 3GLBA 4FJPA 3TTNA 2ONKE 3T66A 4BDRA 4YB6A 4DXCA 1QUJA 2Q2CA 1Q1KA 2P2AA 4KCCA 3SESA 4NEDA 1M5DA 4DCYA 2DQVA 1URSA 4EUOA 3I6VA 4X48A 4PFWA 4GLIA 3BFUA 2XHDA 3UK4A 1PDAA 4L17A 4YKIA 1SVXB 1URGA 4RY1A 4Z7EA 1UTHB 2O69A 4EXLA 4DCXA 1SDXA 2HZLA 2I3WA 1R9QA 2DP8A 4H67A 3QXMA 3VLWA 4YZZA 3H6UA 4UACA 4O3BA 1MQHA 1B32A 1LFHA 5I58B 3K1PA 3K1NA 3DP4A 5J1DA 3D4GA 3V8XB 2DWIA 3VLUA 4E0XA 4KYEA 2O1MA 2ZYMA 5IKBA 3DP6A 4IO6A 1AH5A 3K6UA 3G3GA 4ESWA 1LGBC 4U4SA 2Z8EA 2RCBA 3MVZA 3IOTA 3MVYA 5KZTA 1XVXA 4RPOA 2RKMA 3VDFA 1O64A 3H3GA 4BDMA 1R1NA 4F3BA 5H8FA 3V5AA 4G68B 5AA3A 1P1OA 3B6WA 4BDLA 1DMBA 3GBBA 4AQ4A 2RC9A 5EYFA 2Q89A 3SDFA 3FXUA 4RJZA 3U8QA 1H43A 4LQ5A 2W7YA 2HAUA 4R75A 1LBCA 1OMPA 1OQHA 4R9FA 3IO6A 2THIA 3QSLA 3H06B 1EZ9A 1EU8A 5AA2B 3FZVA 3ONMA 3KFMA 4OENA 1QW0A 1NNTA 3O9PA 4GVOA 4YAHX 5ISUA 2QMWA 4R2FA 3QUJA 5H8QA 3TTRA 3LR1A 4EQBA 1FTOA 2RCAA 1A40A 2OK2A 3U92A 1MM6A 1MDP1 3TQLA 2I6EA 3KZGA 4KPTA 1US4A 5CM6A 3IL1B 3ZKKA 4ESXA 3M3LA 5KDTA 4ND9A 1SYHA 2NVUB 1N7XA 5DT6A 2DSFA 4RK2A 5LOMA 3CI8A 4YB5A 3PMXA 4YICA 3FVKA 1NL5A 4FEBA 4XXUA 1Z7ME 2QS3A 1ATGA 4LATA 2UYEA 3U72A 2YLNA 3RUMA 2UVJA 4DXBA 1T0KA 3C35A 2ONSA 1SI0A 1FW0A 1LLSA 4PFTA 2HQ0A 3BFTA 1ZMGA 3E13X 1ZLQA 2YJPA 1EZOA 5L9OA 4LVQA 1LBBA 4OEVA 5FHOA 1IUDA 3KSXA 1Y3QA 4RA1A 4TLLB 5FHNA 1IXIA 3K1MA 3Q26A 2I58A 2XXHA 4R9GA 1IIWA 2Z22A 2F7BA 1II5A 4H8JA 1A8FA 2DYXA 5I2KA 3MWBA 3MAMA 1BLFA 2P0SA 1O7TA 2Q88A 3TPAA 2I0BA 2DWHA 2AL4A 4H5FA 4H6DA 4QSEA 3DELB 1DOTA 2R6GE 3C34A 4FAJA 1D9YA 1RKMA 1AOVA 1J1NA 1QUKA 4F29A 2V3QA 3PD9A 1SW1A 4UA8A 3RT8A 4EF2A 4OFOA 4QSDA 4ZS9A 3CG3A 3MPKA 3OO9A 3PV0E 2QL3A 1R9LA 3AXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD3 A;  2H25 A;  3K00 A;  4ZZA A;  2OWS A;  1VSO A;  3FJ7 A;  1VFD A;  3RTW B;  3N6T A;  1FCK A;  4GL0 A;  4I1D A;  4RK9 A;  4RNS A;  3TFL A;  2WKY A;  4XTC Q;  5JTY A;  4KHZ E;  5AE4 A;  4YKK A;  2UYF A;  4P0I A;  3H03 A;  2XXP A;  4I62 A;  4OMB A;  4KQP A;  5AA4 B;  4NMY A;  1H45 A;  1B5H A;  3IB0 A;  3QK6 A;  4ELP A;  4MLV A;  4WED A;  4O3C A;  4E0W A;  4KYS A;  4LP2 B;  1B2H A;  1USY H;  1BP5 A;  3KEI A;  4U1O A;  4ECF A;  3R26 A;  3FIR A;  3A09 A;  3LSF B;  4WKM A;  4JWO A;  4DDD A;  2I4B A;  3O6G A;  3RPW A;  5ITO A;  1D3K A;  3H7M A;  1QUI A;  3PPO A;  5HPQ A;  4PET A;  2O1L A;  1FQE A;  5I2N B;  5DEX A;  4N6P A;  3CFL A;  4QFN A;  4JSD A;  1GTK A;  1LAH E;  4LQ2 A;  3USD A;  4IGT A;  1UTB A;  2DE4 A;  4F22 A;  1B40 A;  1EH3 A;  2UXA A;  3MW0 A;  2H4I A;  4LZ8 A;  1JNF A;  1POY 1;  3PPR A;  3OO6 A;  4F1V A;  1JEU A;  2XD3 A;  4BDO A;  4LA9 A;  2O51 A;  1MXU A;  3IB1 A;  3CVG A;  3G3F A;  1SW5 A;  1URD A;  3LC8 A;  3D4C A;  5F7V A;  4NF5 B;  2ONR A;  2NXO A;  2QS2 A;  3V83 A;  4HCY A;  1F9B A;  2OJT A;  1H44 A;  3UN6 A;  4I9D A;  2PT1 A;  4KFQ A;  4XIG Q;  3GXA A;  3RNN A;  4HS7 A;  1H3D A;  1OVT A;  1MDQ A;  2XXV A;  5M2V A;  3U93 A;  1QJM A;  4XKR A;  1N7W A;  2HAV A;  3P7I A;  5F1Q A;  4OFJ A;  4PE5 B;  4NE4 A;  5JEI A;  4IO4 A;  4Q30 B;  3RQT A;  1P1U A;  4THI A;  2R9J A;  3TMG A;  4LON B;  2E0S A;  4FOR A;  2F7C A;  3IX1 A;  5TPA A;  2ZYK A;  3MP6 A;  3G7W A;  3ILU B;  2NUV A;  4EXK A;  1SW2 A;  1JEV A;  3VXC A;  1XT8 A;  3TCG A;  1MXV A;  4KCD A;  3KJT A;  4FE8 A;  4QHQ A;  5CBS A;  4GFR A;  3WAE A;  1RYO A;  4OHN A;  3S9M C;  3K2D A;  1B7H A;  4I8C A;  1SBP A;  1MY3 A;  3E3K A;  4MBP A;  3Q25 A;  1B9J A;  3OO7 A;  3HPI A;  1PB7 A;  3GBA A;  1LAG E;  3KG2 A;  4NF8 B;  4G8H A;  4C1U A;  1QVS A;  3EN3 A;  2FNC A;  2PMS A;  2NOO A;  2Y84 A;  1D4N A;  1PBP A;  3K01 A;  3B6T A;  3TOD A;  2RIN A;  5EHS A;  2VGQ A;  1USY E;  3SKP A;  5DTB A;  3UP9 A;  3PU5 A;  4OET A;  3G3K A;  1IZ1 A;  4N07 A;  1Z7N E;  4U4X A;  4NF6 A;  5L9M A;  5H8N B;  1FQB A;  2XXT A;  1B46 A;  3EPE A;  4GIZ A;  2D5W A;  5TP9 A;  4ELR A;  3MP1 A;  4YMB A;  3MUQ A;  1JW5 A;  2XXX A;  1Y1M A;  3G3J A;  3L6H A;  1KWH A;  3G3H A;  3MVX A;  5I59 B;  2QMX A;  3VXB A;  3PUX E;  3A3U A;  2Q9T A;  4OQO A;  2F35 A;  5K2X A;  3CR9 A;  3JYR A;  4KYD A;  2B3F A;  4ZEC A;  5HM4 B;  3PD8 A;  3OOA A;  5AA2 D;  1VFE A;  1Y9U A;  5B7D A;  3O66 A;  3IJO B;  2LAO A;  3MZB A;  4OVJ A;  4DLD A;  3OEL A;  1MM7 A;  3RLF E;  4EQ7 A;  5A5X A;  1B52 A;  1P1N A;  2ZNU A;  1NH8 A;  2B3B A;  1OLC A;  4OFL A;  3OEM A;  1ZIU A;  2ABH A;  3FJM A;  4H65 A;  4MFI A;  4KR5 A;  3KJ7 A;  3KBR A;  2F78 A;  1QKA A;  1GGG A;  3G3I A;  4JDF A;  2QS1 A;  1BIY A;  5FTI A;  1HSJ A;  4QFP A;  1B3F A;  5DVJ A;  4MF3 A;  4JXI A;  5DVF A;  4R6H A;  3S9L C;  4U23 A;  3MP8 A;  5B70 A;  1UTH A;  5CBR A;  1TT1 A;  3LSW A;  1LCT A;  5L8D A;  2RF1 A;  3TCH A;  1A7L A;  4G4P A;  3O6I A;  1NNK A;  2DS9 A;  2GHA A;  2UVG A;  3RGY A;  1TFD A;  1I6Q A;  5K2Y A;  1HSE A;  2RC8 A;  2ZMB A;  5I58 A;  4JSO A;  3TZA A;  3ILT B;  4KI0 E;  4IO3 A;  1PEB A;  3B7D A;  3C31 A;  3TCF A;  4WEP A;  3QYT A;  3VFJ A;  4FEC A;  1DPP A;  2X26 A;  4JBZ A;  2Y7P A;  1OQG A;  4JB7 A;  5CC2 A;  4EQ9 A;  2Y7I A;  1H76 A;  2F7A A;  4GXA A;  3UIF A;  1YAE A;  4DIG A;  4JWX A;  5DVI A;  5FTH A;  2YPN A;  4U1Z A;  1JW1 A;  1N0T A;  1MQG A;  1FTM A;  1VR5 A;  4R6K A;  4G68 A;  3ODB A;  1VE4 A;  3VV5 A;  2H5Y A;  4C1T A;  3HHG A;  1MH3 A;  1M5E A;  1MH4 A;  4G68 C;  3OD7 A;  2HZK A;  4YKJ A;  4PQJ A;  3TEP A;  1IIT A;  5FHM A;  4ELQ A;  3O2A A;  5AA2 A;  3FAT A;  1MY2 A;  3OEK A;  3ZKL A;  1OLA A;  2DWJ A;  3CFX A;  1LAX A;  3RT6 B;  1CB6 A;  4BLA A;  3FAS A;  4QF9 A;  4GQO A;  1D9V A;  3W9V A;  3FVN A;  1MG1 A;  4F19 A;  1SYI A;  1N3W A;  3T9X B;  1QUL A;  1HSL A;  1ZU0 A;  3FV1 A;  2M8C A;  3I3V A;  1Y3N A;  1NNF A;  2E1S A;  2X7P A;  3H6V A;  3PUW E;  2F34 A;  1MY0 A;  5DYH A;  2F6G A;  4U22 A;  2IA4 A;  3HN0 A;  1IXH A;  1FQF A;  5ELV A;  4BDQ A;  1SI1 A;  2A5T B;  1POT A;  3T93 B;  1SW4 A;  5ICQ A;  1Y1Z A;  4GXS B;  2Z8F A;  2PBW A;  4R72 A;  2XD2 A;  2XXW A;  3OSQ A;  4FED A;  1EZP A;  5BWJ A;  2ZNT A;  1B51 A;  1IQ7 A;  3CIJ A;  4TOZ A;  1PBQ A;  1MQJ A;  3C32 A;  2AL5 A;  2DWA A;  4YKP A;  4IO5 A;  1Y4C A;  4R73 A;  1UQW A;  3PPP A;  1ELJ A;  2O84 X;  3IJX B;  1B0L A;  3KSJ A;  2XX7 A;  3HHF A;  4Q8R A;  4KD5 A;  3C4M A;  3CFZ A;  4XKP A;  4ZED A;  2O7U A;  5JK4 A;  4FIM A;  4RPN A;  3O97 A;  3THI A;  1P1W A;  4AB5 A;  1M5C A;  2V25 A;  2VP1 A;  3MZ1 A;  1IEJ A;  1WVJ A;  1OVB A;  3N5L A;  2VHA A;  1PB8 A;  1QKB A;  4IGR A;  5KCJ B;  3KOS A;  5I56 B;  3W9W A;  2BJJ X;  4ZE8 A;  1P99 A;  1MXZ A;  1RYX A;  4ZEB A;  3PPN A;  3TTL A;  1Y20 A;  2PX1 A;  4FAT A;  3FXQ A;  2KLF A;  2R71 A;  5H8S A;  4R6Y A;  3BKI B;  4F3S A;  5HBC A;  3O6H A;  1M5B A;  3PGF A;  4NF4 B;  5I84 A;  2V84 A;  3T9H B;  4N13 A;  4MH5 A;  2H9B A;  4F2O A;  4F31 B;  3S9N C;  2H98 A;  1YCJ A;  4YB7 A;  3A3C A;  4GRK A;  3KGC A;  1YTV A;  4OXV A;  2Z8D A;  5CMC A;  4TQU Q;  1MPC A;  4QSC A;  5AA4 A;  3IO4 A;  3U1O A;  1N04 A;  3Q29 A;  4IO2 A;  2X7Q A;  3EF7 A;  4H8I A;  1Q35 A;  3WAF A;  2I49 A;  3PUY E;  3IB2 A;  1TXF A;  4NWD A;  2O68 A;  4LZ5 A;  2DVC A;  1NKX A;  3BBR A;  1NNP A;  1JQF A;  1LFI A;  1ZTY A;  4MLQ A;  3VVD A;  3CSB A;  2O7I A;  1B0H A;  3M3K A;  1JVY A;  2V3T A;  2HFB A;  3VVF A;  2V93 A;  3QUF A;  5CMK A;  3TTM A;  5I2N A;  1FQD A;  5EHM A;  4Z0I A;  3UA8 A;  4OWD A;  5H8F B;  4OZ9 A;  4F3P A;  1LCF A;  3DLN A;  2Y7W A;  3O28 A;  2FA7 A;  4U2R A;  2O6A A;  3PMV A;  4GL8 A;  3R7X A;  3KN7 A;  4Q5T A;  2OZZ A;  4NF4 A;  1JW4 A;  3TYH A;  1PC3 A;  4RYA A;  3VE1 B;  2OBG A;  1B6H A;  1MXW A;  5H8Q B;  1ZBM A;  4NF5 A;  2F6P A;  4ISU A;  3K4U A;  1B5I A;  3V89 B;  2F36 A;  3TUS A;  1NMU A;  3U94 A;  1AL3 A;  4ONY A;  3SEU A;  4IB2 A;  1ANF A;  5KDT B;  1B05 A;  4PFU A;  5TU0 A;  2XXQ A;  1LST A;  4LUB A;  1ZJL A;  1JET A;  3N26 A;  5CMB A;  2DVZ A;  3EHS A;  4OYV A;  2UVH A;  2CMO A;  1MY1 A;  4JWY A;  4IY6 A;  1MQD A;  4M1V A;  3DM0 A;  4EF1 A;  3MVW A;  5H8H B;  1R6Z A;  2REG A;  3MC2 A;  4F39 A;  3JV9 A;  3TEL A;  2GRV A;  1AIV A;  3T9U A;  4M4G A;  1A8E A;  4YU0 A;  3W15 C;  2QJE A;  2D3I A;  3PMW A;  3GZG A;  2VOZ A;  4POX A;  3CRB A;  3EHT A;  5CI5 A;  1XHY A;  2OWT A;  3SEY A;  1CE2 A;  3IOW A;  1AMF A;  2GHB A;  3JZJ A;  4ZEF A;  2DE3 A;  2REJ A;  2HEU A;  3K0V A;  4OTE A;  2Z23 A;  3L6G A;  4XKQ A;  3T96 B;  3KN8 A;  5I2K B;  2ZYN A;  3K02 A;  2CZL A;  3O29 A;  1A55 A;  1US5 A;  3OSR A;  4OES A;  4NF8 A;  4OEU A;  3M3F A;  5CRY A;  2G29 A;  3UOR A;  3SEX A;  1GR2 A;  1S7Y A;  4QRZ A;  1FQC A;  4WXJ A;  1LB8 A;  4GOT A;  4DXU A;  4QFO A;  4GWO A;  4ZZE A;  3OMB A;  4HCW A;  1BTJ A;  2QSX A;  5H8N A;  4X1B A;  2ZNS A;  4G8M A;  1DTZ A;  3B6Q A;  4GD5 A;  2RC7 A;  3FV2 A;  3OEN A;  2Q8J A;  2PVU A;  2VD2 A;  3VVE A;  1B7Z A;  2XXR A;  1B1X A;  4EDP A;  5I59 A;  3IR1 A;  5AA1 A;  1SQY A;  5ITP A;  1MY4 A;  4H1X A;  2UVI A;  4U21 A;  3I5O A;  5JTY B;  4IY5 A;  3PPQ A;  1I6A A;  2Q2A A;  4X1D A;  4HW8 A;  5H8H A;  1ZKB A;  3LSL A;  2XXI A;  1MPB A;  3KOT A;  4G8N A;  1N84 A;  1FTK A;  3LSX A;  4H0W A;  4K3F A;  3E4R A;  3C9H A;  3CG1 A;  3HST A;  2I3V A;  4O3A A;  1UIU A;  4X9T A;  3MBP A;  4BDN A;  3T9V A;  2H99 A;  1OIB A;  2ANJ A;  4ZEI A;  4POW A;  3E9X A;  4P11 A;  3UGW A;  4ZDM A;  2I0C A;  3TTK A;  1NH7 A;  3TQW A;  3ECR A;  1B7U A;  1TWY A;  3HCQ A;  3HO7 A;  3VLV A;  4G2Z A;  3OO8 A;  1FQA A;  3H6T A;  1O63 A;  3N94 A;  3H6W A;  3QIM A;  4YMA A;  3PUV E;  2IEE A;  5DEX B;  2XX9 A;  3IOR A;  1B5J A;  4F1U A;  4HTG A;  1XOC A;  3T22 A;  2HXW A;  3KN3 A;  1UTB B;  3C33 A;  3IOV A;  1WOD A;  2F97 A;  4P0G A;  4C0R A;  3EHU A;  3K6X A;  2GFE A;  1DSN A;  1NFT A;  3TAJ A;  3TDJ A;  3TKD A;  3LBS A;  2GH9 A;  2ESN A;  4ZEK A;  1L5T A;  3N6U A;  3SEW A;  3MPL A;  1WDN A;  1MRP A;  4XKN A;  2OLB A;  3RY3 A;  4F18 A;  4PP0 A;  4IO7 A;  5ICT A;  3SER A;  2DXY A;  4G77 A;  4R74 A;  4TLM B;  1B58 A;  5I57 B;  4LZ7 A;  2G93 A;  1IXC A;  1LAF E;  1P1Q A;  3EQ1 A;  1A99 A;  2HCA A;  2Y7R A;  2ZXT A;  1N3X A;  3SET A;  3C36 A;  1XC1 A;  4ELO A;  1XS5 A;  3K6V A;  4QFL A;  3MQ9 A;  1DPE A;  2OCU A;  3OXN A;  2QPQ A;  1Y4T A;  3S9E A;  3Q27 A;  2A5S A;  1M5F A;  2ZYO A;  5TPA B;  4H5G A;  5BUU A;  2QRY A;  3MZ9 A;  1Y3P A;  1S50 A;  1B1H A;  1MS7 A;  1B3E A;  4PFY A;  2XX8 A;  1MPD A;  3H4Z A;  5IAI A;  4DZ1 A;  2NWJ A;  1BKA A;  2ALU A;  1UIV A;  4F1Y A;  1B3G A;  3M8U A;  2PT2 A;  4DE8 A;  2PYY A;  3FJG A;  2DE2 A;  3F11 A;  1GVC A;  1JVX A;  3FD3 A;  3IK6 B;  2D21 A;  3HV1 A;  3QAX A;  3ZS6 A;  1TFA A;  3Q28 A;  3IOU A;  1B3L A;  1N76 A;  2DOJ A;  1GV8 A;  2B65 A;  2XXY A;  4F3G A;  1DTG A;  1MXX A;  4NTL A;  3S4U A;  2V3U A;  4R2B A;  2A5T A;  1S9T A;  2FYI A;  3FUZ A;  1LB9 A;  4NF6 B;  1PB9 A;  2DXR A;  1MQI A;  4OER A;  3FGS A;  1IXG A;  3ZSF A;  1B4H A;  3R6U A;  2QS4 A;  5TP9 B;  3DP8 A;  4NWC A;  1MXY A;  3FVG A;  4ZE9 A;  4RXL A;  1B4Z A;  5CMM A;  4GF8 A;  5I57 A;  1B3H A;  2XXU A;  1LFG A;  1FTL A;  3PUZ E;  1YPN A;  1FTJ A;  4QFK A;  1I69 A;  2F5X A;  3LUY A;  2P1S A;  3RTF B;  1I6B A;  2Y7K A;  3S2V A;  3FXR A;  4Q0C A;  3RN8 A;  1A54 A;  2AYS A;  3SEV A;  3CSG A;  2I4C A;  2AIX A;  3IAZ A;  3MJN A;  2F8D A;  3FVO A;  2I48 A;  1XVY A;  5L9S A;  5KCJ A;  5I56 A;  4F2Q A;  2VD3 A;  3K6W A;  4AB6 A;  5A5X B;  3GLB A;  4FJP A;  3TTN A;  2ONK E;  3T66 A;  4BDR A;  4YB6 A;  4DXC A;  1QUJ A;  2Q2C A;  1Q1K A;  2P2A A;  4KCC A;  3SES A;  4NED A;  1M5D A;  4DCY A;  2DQV A;  1URS A;  4EUO A;  3I6V A;  4X48 A;  4PFW A;  4GLI A;  3BFU A;  2XHD A;  3UK4 A;  1PDA A;  4L17 A;  4YKI A;  1SVX B;  1URG A;  4RY1 A;  4Z7E A;  1UTH B;  2O69 A;  4EXL A;  4DCX A;  1SDX A;  2HZL A;  2I3W A;  1R9Q A;  2DP8 A;  4H67 A;  3QXM A;  3VLW A;  4YZZ A;  3H6U A;  4UAC A;  4O3B A;  1MQH A;  1B32 A;  1LFH A;  5I58 B;  3K1P A;  3K1N A;  3DP4 A;  5J1D A;  3D4G A;  3V8X B;  2DWI A;  3VLU A;  4E0X A;  4KYE A;  2O1M A;  2ZYM A;  5IKB A;  3DP6 A;  4IO6 A;  1AH5 A;  3K6U A;  3G3G A;  4ESW A;  1LGB C;  4U4S A;  2Z8E A;  2RCB A;  3MVZ A;  3IOT A;  3MVY A;  5KZT A;  1XVX A;  4RPO A;  2RKM A;  3VDF A;  1O64 A;  3H3G A;  4BDM A;  1R1N A;  4F3B A;  5H8F A;  3V5A A;  4G68 B;  5AA3 A;  1P1O A;  3B6W A;  4BDL A;  1DMB A;  3GBB A;  4AQ4 A;  2RC9 A;  5EYF A;  2Q89 A;  3SDF A;  3FXU A;  4RJZ A;  3U8Q A;  1H43 A;  4LQ5 A;  2W7Y A;  2HAU A;  4R75 A;  1LBC A;  1OMP A;  1OQH A;  4R9F A;  3IO6 A;  2THI A;  3QSL A;  3H06 B;  1EZ9 A;  1EU8 A;  5AA2 B;  3FZV A;  3ONM A;  3KFM A;  4OEN A;  1QW0 A;  1NNT A;  3O9P A;  4GVO A;  4YAH X;  5ISU A;  2QMW A;  4R2F A;  3QUJ A;  5H8Q A;  3TTR A;  3LR1 A;  4EQB A;  1FTO A;  2RCA A;  1A40 A;  2OK2 A;  3U92 A;  1MM6 A;  1MDP 1;  3TQL A;  2I6E A;  3KZG A;  4KPT A;  1US4 A;  5CM6 A;  3IL1 B;  3ZKK A;  4ESX A;  3M3L A;  5KDT A;  4ND9 A;  1SYH A;  2NVU B;  1N7X A;  5DT6 A;  2DSF A;  4RK2 A;  5LOM A;  3CI8 A;  4YB5 A;  3PMX A;  4YIC A;  3FVK A;  1NL5 A;  4FEB A;  4XXU A;  1Z7M E;  2QS3 A;  1ATG A;  4LAT A;  2UYE A;  3U72 A;  2YLN A;  3RUM A;  2UVJ A;  4DXB A;  1T0K A;  3C35 A;  2ONS A;  1SI0 A;  1FW0 A;  1LLS A;  4PFT A;  2HQ0 A;  3BFT A;  1ZMG A;  3E13 X;  1ZLQ A;  2YJP A;  1EZO A;  5L9O A;  4LVQ A;  1LBB A;  4OEV A;  5FHO A;  1IUD A;  3KSX A;  1Y3Q A;  4RA1 A;  4TLL B;  5FHN A;  1IXI A;  3K1M A;  3Q26 A;  2I58 A;  2XXH A;  4R9G A;  1IIW A;  2Z22 A;  2F7B A;  1II5 A;  4H8J A;  1A8F A;  2DYX A;  5I2K A;  3MWB A;  3MAM A;  1BLF A;  2P0S A;  1O7T A;  2Q88 A;  3TPA A;  2I0B A;  2DWH A;  2AL4 A;  4H5F A;  4H6D A;  4QSE A;  3DEL B;  1DOT A;  2R6G E;  3C34 A;  4FAJ A;  1D9Y A;  1RKM A;  1AOV A;  1J1N A;  1QUK A;  4F29 A;  2V3Q A;  3PD9 A;  1SW1 A;  4UA8 A;  3RT8 A;  4EF2 A;  4OFO A;  4QSD A;  4ZS9 A;  3CG3 A;  3MPK A;  3OO9 A;  3PV0 E;  2QL3 A;  1R9L A;  3AXF A; 
#chains in the Genus database with same CATH topology
 1SD3 A;  4H45 A;  4PAF A;  2H25 A;  2ZZV A;  3K00 A;  4ZZA A;  2OWS A;  3IFC A;  2Y5K A;  1VSO A;  3FJ7 A;  1VFD A;  3LUZ A;  3RTW B;  3N6T A;  1FCK A;  1EYK A;  4N15 A;  4GL0 A;  4I1D A;  4O94 A;  4RK9 A;  4RNS A;  3TFL A;  2WKY A;  4XTC Q;  5JTY A;  4KHZ E;  5AE4 A;  2P3V A;  4YKK A;  1NV3 A;  2UYF A;  2HHM A;  4P0I A;  3KBZ A;  2R8T A;  3H03 A;  2XXP A;  4I62 A;  4OMB A;  4KQP A;  5AA4 B;  4NMY A;  3BIH A;  1H45 A;  1B5H A;  3IB0 A;  3QK6 A;  3FBP A;  4ELP A;  4MLV A;  1CNQ A;  4WED A;  2B4L A;  4GBW A;  4O3C A;  4E0W A;  4KYS A;  4LP2 B;  1B2H A;  1USY H;  5FBP A;  1BP5 A;  3KEI A;  4U1O A;  4ECF A;  4P9K A;  3R26 A;  4GWX A;  3FIR A;  3A09 A;  3LSF B;  4GBV A;  4WKM A;  4JWO A;  2XWI A;  4DDD A;  2I4B A;  2MKZ A;  2WYK A;  3O6G A;  3RPW A;  5ITO A;  1D3K A;  3H7M A;  1QUI A;  3PPO A;  5HPQ A;  4PET A;  2O1L A;  1FQE A;  5I2N B;  4O8M A;  5DEX A;  4N6P A;  3CFL A;  4QFN A;  4JSD A;  1GTK A;  1LAH E;  1LBZ A;  1FBD A;  1AWB A;  4LQ2 A;  3USD A;  5EQA A;  1K9Y A;  4IGT A;  1UTB A;  2DE4 A;  4F22 A;  5ET7 A;  1B40 A;  1EH3 A;  2UXA A;  3MW0 A;  3E78 A;  2H4I A;  4LZ8 A;  1JNF A;  1POY 1;  3PPR A;  3OO6 A;  4F1V A;  1INP A;  1JEU A;  2XD3 A;  4MAG A;  1KZ8 A;  4BDO A;  4LA9 A;  2O51 A;  1MXU A;  3IB1 A;  3CVG A;  3G3F A;  1SW5 A;  1URD A;  3LC8 A;  3D4C A;  5F7V A;  4NF5 B;  2ONR A;  2NXO A;  2QS2 A;  3V83 A;  4HCY A;  1F9B A;  2OJT A;  1H44 A;  3UN6 A;  4I9D A;  2PT1 A;  4KFQ A;  4XIG Q;  3GXA A;  3RNN A;  4HS7 A;  1H3D A;  2CEX A;  1OVT A;  1MDQ A;  2XXV A;  5M2V A;  3U93 A;  4AS5 A;  1QJM A;  4XKR A;  4PAI A;  1N7W A;  2HAV A;  3P7I A;  5F1Q A;  4OFJ A;  4PE5 B;  4NE4 A;  1Q9D A;  5JEI A;  4IO4 A;  4Q30 B;  3RQT A;  1P1U A;  4THI A;  1FPF A;  2R9J A;  3TMG A;  4LON B;  2E0S A;  4FOR A;  2F7C A;  3IX1 A;  5TPA A;  2ZYK A;  3MP6 A;  3G7W A;  1FBE A;  2V4C A;  3ILU B;  2NUV A;  1SW2 A;  4EXK A;  4OVQ A;  1JEV A;  3VXC A;  1XT8 A;  3TCG A;  1MXV A;  4KCD A;  5F24 A;  3KJT A;  4FE8 A;  4QHQ A;  5CBS A;  4PDD A;  4GFR A;  3WAE A;  1RYO A;  4OHN A;  3S9M C;  3K2D A;  1B7H A;  4I8C A;  1NV6 A;  1SBP A;  1MY3 A;  4NHB A;  3E3K A;  4MBP A;  3Q25 A;  1B9J A;  3OO7 A;  3HPI A;  1PB7 A;  3GBA A;  1LAG E;  3RYD A;  4PGP A;  3KG2 A;  4NF8 B;  4G8H A;  3SZP A;  4C1U A;  1QVS A;  3EN3 A;  2FNC A;  2PMS A;  2NOO A;  2Y84 A;  1D4N A;  1PBP A;  1FPB A;  3K01 A;  3B6T A;  3TOD A;  2RIN A;  5EHS A;  2VGQ A;  1USY E;  3SKP A;  2QFL A;  5DTB A;  4JVD A;  3UP9 A;  3PU5 A;  4OET A;  4MX6 A;  3G3K A;  1IZ1 A;  4N07 A;  1Z7N E;  5ESY A;  4U4X A;  4NF6 A;  5L9M A;  5H8N B;  4PBQ A;  1FQB A;  2XXT A;  1B46 A;  3EPE A;  4I40 A;  4GIZ A;  2D5W A;  5TP9 A;  4ELR A;  3MP1 A;  4YMB A;  3MUQ A;  1JW5 A;  2XXX A;  1Y1M A;  2FVZ A;  5ET5 A;  3G3J A;  3L6H A;  1KWH A;  3G3H A;  3MVX A;  5I59 B;  2QMX A;  3VXB A;  3PUX E;  3A3U A;  2Q9T A;  4OQO A;  2F35 A;  5K2X A;  3CR9 A;  3JYR A;  4KYD A;  2B3F A;  2HXR A;  4ZEC A;  5HM4 B;  3PD8 A;  3OOA A;  4QXD A;  3EKI A;  5AA2 D;  1VFE A;  1Y9U A;  5B7D A;  3O66 A;  2WEF A;  4AS4 A;  3IJO B;  2LAO A;  3MZB A;  4X04 A;  4OVJ A;  4DLD A;  3OEL A;  1MM7 A;  3RLF E;  4EQ7 A;  5A5X A;  1B52 A;  1P1N A;  2ZNU A;  1NH8 A;  2B3B A;  1OLC A;  4OFL A;  3OEM A;  1ZIU A;  2ABH A;  2XWO A;  3FJM A;  4H65 A;  4MFI A;  4KR5 A;  3KJ7 A;  3KBR A;  2F78 A;  1QKA A;  1GGG A;  3G3I A;  4JDF A;  2QS1 A;  4IR8 A;  1BIY A;  5FTI A;  1HSJ A;  2XA5 A;  4QFP A;  1B3F A;  5DVJ A;  4MF3 A;  4JXI A;  5DVF A;  4PCD A;  4R6H A;  3S9L C;  1NI9 A;  4U23 A;  3MP8 A;  4PBH A;  2WX9 A;  5B70 A;  1UTH A;  5CBR A;  1TT1 A;  3LSW A;  1LCT A;  5L8D A;  2RF1 A;  3TCH A;  1A7L A;  1DBZ A;  4G4P A;  3O6I A;  1NNK A;  2DS9 A;  4MCO A;  2GHA A;  2UVG A;  1FTA A;  3RGY A;  1TFD A;  1I6Q A;  4X8R A;  5K2Y A;  1HSE A;  2RC8 A;  2ZMB A;  5I58 A;  4JSO A;  3TZA A;  3ILT B;  4N4U A;  4KI0 E;  4IO3 A;  3T1B A;  1PEB A;  2OWZ A;  3B7D A;  3C31 A;  3TCF A;  4WEP A;  1FPI A;  3QYT A;  3VFJ A;  4FEC A;  1DPP A;  2X26 A;  4JBZ A;  2Y7P A;  2FBP A;  1OQG A;  4JB7 A;  1NV7 A;  5CC2 A;  4EQ9 A;  2Y7I A;  1H76 A;  2F7A A;  4GXA A;  3UIF A;  1YAE A;  4DIG A;  4NF0 A;  4JWX A;  5DVI A;  5FTH A;  2YPN A;  4U1Z A;  1JW1 A;  1N0T A;  1MQG A;  1FTM A;  1VR5 A;  4GWY A;  3BIG A;  4R6K A;  4G68 A;  3ODB A;  1VE4 A;  3VV5 A;  2H5Y A;  4C1T A;  3HHG A;  1MH3 A;  1M5E A;  1MH4 A;  4P3L A;  4G68 C;  3OD7 A;  2HZK A;  4YKJ A;  4PQJ A;  3TEP A;  1IIT A;  5FHM A;  4ELQ A;  3O2A A;  5AA2 A;  3FAT A;  1MY2 A;  3OEK A;  3ZKL A;  4OA4 A;  1OLA A;  2DWJ A;  2F3D A;  3CFX A;  1LAX A;  3RT6 B;  1CB6 A;  4DI4 B;  4BLA A;  3FAS A;  4QF9 A;  4GQO A;  1FBG A;  1D9V A;  3W9V A;  3FVN A;  5ET8 A;  1MG1 A;  4N6D A;  4F19 A;  1SYI A;  1N3W A;  2ZZX A;  3T9X B;  1QUL A;  1HSL A;  1ZU0 A;  3FV1 A;  1NUX A;  2OX3 A;  5IGA A;  1RDY A;  2M8C A;  3I3V A;  1Y3N A;  1NNF A;  2E1S A;  5IZ1 A;  1BK4 A;  2X7P A;  3H6V A;  3PUW E;  2F34 A;  1MY0 A;  4O7M A;  5DYH A;  2F6G A;  4U22 A;  2IA4 A;  3HN0 A;  1IXH A;  1FQF A;  5ELV A;  4BDQ A;  1SI1 A;  4MJO A;  2A5T B;  5EQ7 A;  1POT A;  3T93 B;  1SW4 A;  5ICQ A;  1Y1Z A;  2HPG A;  4GXS B;  2Z8F A;  2PBW A;  4R72 A;  2XD2 A;  2XXW A;  3OSQ A;  3NOH A;  4FED A;  1KA1 A;  1EZP A;  5BWJ A;  2ZNT A;  1B51 A;  1IQ7 A;  3CIJ A;  4TOZ A;  1PBQ A;  1MQJ A;  3C32 A;  2AL5 A;  2DWA A;  4YKP A;  4IO5 A;  1Y4C A;  4R73 A;  1UQW A;  3PPP A;  1ELJ A;  2O84 X;  3IJX B;  1B0L A;  3KSJ A;  2XX7 A;  3HHF A;  4Q8R A;  4KD5 A;  3C4M A;  3CFZ A;  4XKP A;  4ZED A;  2O7U A;  5JK4 A;  4FIM A;  4RPN A;  3O97 A;  3THI A;  1P1W A;  4AB5 A;  1M5C A;  2PCR A;  2V25 A;  2VP1 A;  3MZ1 A;  1IEJ A;  1WVJ A;  1OVB A;  3N5L A;  4PFR A;  2VHA A;  1PB8 A;  1QKB A;  4IGR A;  5KCJ B;  3KOS A;  5I56 B;  3W9W A;  3IFA A;  1NV2 A;  2BJJ X;  4ZE8 A;  1P99 A;  1MXZ A;  4O7I A;  1RYX A;  4ZEB A;  3QMF A;  3PPN A;  3TTL A;  1Y20 A;  2PX1 A;  4FAT A;  2CZI A;  3FXQ A;  2KLF A;  2R71 A;  5H8S A;  5I3S A;  3D1R A;  4JVC A;  4R6Y A;  3BKI B;  4F3S A;  5J16 A;  5HBC A;  3O6H A;  1M5B A;  3PGF A;  4NF4 B;  5I5P A;  5I84 A;  2V84 A;  3T9H B;  4GWW A;  4N13 A;  4OVT A;  2JJK A;  4MH5 A;  1FPJ A;  2H9B A;  4F2O A;  4F31 B;  2Y5L A;  3S9N C;  1FBC A;  4I3Y A;  2H98 A;  3MST A;  1YCJ A;  4YB7 A;  3A3C A;  4GRK A;  3KGC A;  1YTV A;  4OXV A;  2Z8D A;  5CMC A;  4TQU Q;  1MPC A;  4QSC A;  5AA4 A;  3IO4 A;  3U1O A;  1N04 A;  3Q29 A;  4PTK A;  4IO2 A;  2X7Q A;  3EF7 A;  4H8I A;  1Q35 A;  4P1E A;  3WAF A;  2I49 A;  4PE3 A;  3PUY E;  3IB2 A;  1TXF A;  4NWD A;  2O68 A;  4LZ5 A;  2DVC A;  4PAK A;  1NKX A;  3BBR A;  1NNP A;  1LBY A;  1JQF A;  1LFI A;  4NX1 A;  1ZTY A;  4MLQ A;  3VVD A;  1EYJ A;  3E79 A;  3CSB A;  5ET6 A;  2O7I A;  1B0H A;  4I3E A;  3M3K A;  1JVY A;  2V3T A;  2HFB A;  3VVF A;  2V93 A;  3QUF A;  5CMK A;  3TTM A;  5I2N A;  1FQD A;  5EHM A;  4Z0I A;  3UA8 A;  4OWD A;  5H8F B;  2PFY A;  4OZ9 A;  4F3P A;  1LCF A;  3DLN A;  1DK4 A;  2Y7W A;  3O28 A;  1LBX A;  2QVR A;  2FA7 A;  4U2R A;  2O6A A;  3PMV A;  4GL8 A;  5IZ3 B;  4PFB A;  3R7X A;  3KN7 A;  4Q5T A;  2OZZ A;  5EQ9 A;  4NF4 A;  1JW4 A;  1PC3 A;  3TYH A;  4RYA A;  3VE1 B;  2OBG A;  4HE0 A;  1B6H A;  4NAP A;  1MXW A;  5H8Q B;  1ZBM A;  4NF5 A;  2F6P A;  4ISU A;  3K4U A;  1B5I A;  1NUY A;  3V89 B;  2F36 A;  3TUS A;  4OAN A;  1NMU A;  3U94 A;  1AL3 A;  4ONY A;  3SEU A;  4IB2 A;  1ANF A;  5KDT B;  1B05 A;  4PFU A;  4P47 A;  4P8B A;  1FPD A;  5TU0 A;  2XXQ A;  1LST A;  4LUB A;  1ZJL A;  1JET A;  3N26 A;  5CMB A;  4PGN A;  2DVZ A;  4MNC A;  3EHS A;  4OYV A;  2UVH A;  2CMO A;  1MY1 A;  4JWY A;  4IY6 A;  1MQD A;  4M1V A;  3DM0 A;  4EF1 A;  3MVW A;  5H8H B;  4NQ8 A;  1R6Z A;  2REG A;  3MC2 A;  4F39 A;  3JV9 A;  3TEL A;  2GRV A;  1AIV A;  1RDZ A;  3T9U A;  4M4G A;  1A8E A;  4YU0 A;  1FPL A;  3W15 C;  2QJE A;  2D3I A;  3PMW A;  3GZG A;  2VOZ A;  4POX A;  3CRB A;  2XWV A;  3EHT A;  5CI5 A;  5EYG A;  1XHY A;  2OWT A;  3SEY A;  1CE2 A;  4PF6 A;  3IOW A;  1AMF A;  2GHB A;  3JZJ A;  4ZEF A;  2DE3 A;  2REJ A;  1IMC A;  4XFE A;  2HEU A;  3K0V A;  4OTE A;  2Z23 A;  3L6G A;  4XKQ A;  3T96 B;  3KN8 A;  5I2K B;  2ZYN A;  3K02 A;  1FPE A;  4PDH A;  2CZL A;  2FIE A;  3O29 A;  1A55 A;  1US5 A;  3OSR A;  4OES A;  2KQZ A;  4NF8 A;  4GX6 A;  4OEU A;  5EQ8 A;  3M3F A;  5CRY A;  2G29 A;  3UOR A;  3KC1 A;  3SEX A;  1GR2 A;  1S7Y A;  4QRZ A;  1FQC A;  1FJ6 A;  4WXJ A;  1LB8 A;  4JVI A;  4GOT A;  4DXU A;  4H46 A;  1IMB A;  4QFO A;  4GWO A;  4ZZE A;  3OMB A;  4OVS A;  4HCW A;  1BTJ A;  2QSX A;  5H8N A;  4X1B A;  2ZNS A;  4G8M A;  1DTZ A;  3B6Q A;  4MNI A;  4GD5 A;  2F3B A;  2RC7 A;  2WYP A;  3FV2 A;  3OEN A;  2Q8J A;  2PVU A;  2VD2 A;  3VVE A;  1B7Z A;  2XXR A;  1B1X A;  4EDP A;  5I59 A;  3IR1 A;  5AA1 A;  1QGX A;  1SQY A;  5ITP A;  1MY4 A;  3CHG A;  4H1X A;  2UVI A;  4N8G A;  4U21 A;  3I5O A;  1FRP A;  5JTY B;  4IY5 A;  2GQ1 A;  5LTC A;  3PPQ A;  1XI6 A;  1I6A A;  2Q2A A;  4X1D A;  4HW8 A;  5H8H A;  1ZKB A;  3LSL A;  2XXI A;  4PF8 A;  1MPB A;  4HE1 A;  2CZK A;  2VT5 A;  3KOT A;  4G8N A;  1N84 A;  1FTK A;  3LSX A;  4H0W A;  4K3F A;  3E4R A;  3C9H A;  1DCU A;  3CG1 A;  3HST A;  2I3V A;  4O3A A;  1NUW A;  1UIU A;  4X9T A;  3MBP A;  4BDN A;  3T9V A;  4XEQ A;  1VDW A;  2H99 A;  1OIB A;  1G0I A;  2ANJ A;  4ZEI A;  4POW A;  3E9X A;  4P11 A;  3UGW A;  4NN3 A;  4ZDM A;  2I0C A;  3TTK A;  1NH7 A;  3TQW A;  3ECR A;  1B7U A;  5T3J A;  1TWY A;  3HCQ A;  3HO7 A;  3VLV A;  4G2Z A;  3OO8 A;  2FIX A;  1FQA A;  3H6T A;  1O63 A;  3N94 A;  3H6W A;  3QIM A;  4YMA A;  3PUV E;  2IEE A;  5DEX B;  3ROJ A;  2CZH A;  2XX9 A;  3IOR A;  1B5J A;  4GWS A;  1NUZ A;  4F1U A;  4HTG A;  1XOC A;  3T22 A;  2HXW A;  3KN3 A;  2VPO A;  1UTB B;  3C33 A;  3IOV A;  1WOD A;  2F97 A;  4P0G A;  4QBA A;  1JP4 A;  4C0R A;  3EHU A;  3K6X A;  2GFE A;  1DSN A;  1NFT A;  3TAJ A;  3TDJ A;  3TKD A;  3LBS A;  2GH9 A;  2ESN A;  4ZEK A;  1L5T A;  3N6U A;  3SEW A;  3MPL A;  2QVU A;  1WDN A;  5DW8 A;  1MRP A;  4XKN A;  2OLB A;  4HXV A;  3RY3 A;  4F18 A;  4PP0 A;  4IO7 A;  1NV4 A;  5ICT A;  3SER A;  2DXY A;  4G77 A;  4R74 A;  4TLM B;  1B58 A;  5I57 B;  4LZ7 A;  2G93 A;  1IXC A;  1K9Z A;  1LAF E;  1P1Q A;  3EQ1 A;  4PFI A;  1A99 A;  2FHY A;  2HCA A;  2Y7R A;  2ZXT A;  1N3X A;  3SET A;  3C36 A;  1XC1 A;  4ELO A;  1XS5 A;  3K6V A;  4QFL A;  3MQ9 A;  1DPE A;  2OCU A;  3OXN A;  2QPQ A;  1Y4T A;  3S9E A;  3Q27 A;  2A5S A;  1M5F A;  2ZYO A;  5TPA B;  5EYH A;  4H5G A;  3GYY A;  2QRY A;  3MZ9 A;  5BUU A;  1FBF A;  2BJI A;  1Y3P A;  1S50 A;  1B1H A;  1MS7 A;  1YYZ A;  1B3E A;  4PFY A;  2XX8 A;  1MPD A;  3H4Z A;  5IAI A;  4DZ1 A;  3RPL B;  2NWJ A;  1BKA A;  2ALU A;  3MYU A;  1UIV A;  1RDX A;  4F1Y A;  1B3G A;  3M8U A;  4LN5 A;  2PT2 A;  3KC0 A;  4DE8 A;  2PYY A;  3FJG A;  2DE2 A;  3F11 A;  4N8Y A;  1GVC A;  1JVX A;  3FD3 A;  3IK6 B;  4P56 A;  2D21 A;  3HV1 A;  3QAX A;  3ZS6 A;  1TFA A;  3Q28 A;  3IOU A;  1B3L A;  1N76 A;  2DOJ A;  2B65 A;  1GV8 A;  4P1L A;  2XXY A;  4F3G A;  1DTG A;  1MXX A;  4NTL A;  3S4U A;  2V3U A;  4R2B A;  4OVP A;  1FBP A;  2A5T A;  4N91 A;  1S9T A;  2FYI A;  3FUZ A;  1LB9 A;  4NF6 B;  1PB9 A;  2DXR A;  1MQI A;  3PTY A;  4OER A;  3FGS A;  1IXG A;  3ZSF A;  4G61 A;  1B4H A;  4GWZ A;  3R6U A;  2QS4 A;  5TP9 B;  3DP8 A;  4NWC A;  1MXY A;  1SPI A;  3FVG A;  1YXI A;  4ZE9 A;  4RXL A;  1B4Z A;  5CMM A;  4GF8 A;  5I57 A;  1B3H A;  2XXU A;  3LV0 A;  4NG7 A;  1LFG A;  1FTL A;  3PUZ E;  1YPN A;  3U65 A;  5A5L A;  1FTJ A;  4QFK A;  4UAB A;  1I69 A;  2F5X A;  3LUY A;  2P1S A;  3RTF B;  1I6B A;  3HFU A;  2Y7K A;  3S2V A;  3FXR A;  4Q0C A;  3RN8 A;  1A54 A;  3ISP A;  2AYS A;  3SEV A;  3CSG A;  2I4C A;  2AIX A;  3IAZ A;  3MJN A;  2F8D A;  3FVO A;  2I48 A;  4XF5 A;  1XVY A;  5L9S A;  5KCJ A;  5I56 A;  4F2Q A;  2VD3 A;  3K6W A;  4AB6 A;  5A5X B;  3GLB A;  4FJP A;  3TTN A;  1IME A;  2ONK E;  3T66 A;  4BDR A;  4YB6 A;  3RPL A;  4DXC A;  1QUJ A;  1IMF A;  2Q2C A;  1Q1K A;  2P2A A;  4KCC A;  3SES A;  4NED A;  1M5D A;  1LBV A;  4DCY A;  2DQV A;  1URS A;  4EUO A;  3I6V A;  4X48 A;  4PFW A;  1YZ0 A;  4GLI A;  3A29 A;  3T0J A;  2WBB A;  2KR0 A;  3BFU A;  2XHD A;  3UK4 A;  1PDA A;  4L17 A;  4N17 A;  4YKI A;  1SVX B;  1URG A;  4NGU A;  4RY1 A;  4Z7E A;  1UTH B;  2O69 A;  4EXL A;  2XWK A;  4DCX A;  4MHF A;  4GX4 A;  1SDX A;  2HZL A;  2I3W A;  1R9Q A;  3B8B A;  4OVR A;  2DP8 A;  2VPN A;  4H67 A;  4MIJ A;  3QXM A;  3VLW A;  2Q8M A;  4YZZ A;  4FBP A;  2PFZ A;  3H6U A;  4UAC A;  4O3B A;  1MQH A;  1B32 A;  1LFH A;  5I58 B;  1LBW A;  3K1P A;  3K1N A;  2L5V A;  3DP4 A;  5J1D A;  3D4G A;  3V8X B;  2DWI A;  3VLU A;  4E0X A;  4KYE A;  2B4M A;  2Q74 A;  2O1M A;  2ZYM A;  5IKB A;  3DP6 A;  4IO6 A;  4GWU A;  1AH5 A;  3K6U A;  3G3G A;  4ESW A;  1LGB C;  4U4S A;  2Z8E A;  2RCB A;  3MVZ A;  1EYI A;  3IOT A;  3MVY A;  5KZT A;  1XVX A;  4RPO A;  2RKM A;  3VDF A;  1O64 A;  4N81 A;  3H3G A;  4BDM A;  1R1N A;  4F3B A;  5H8F A;  3V5A A;  4G68 B;  5AA3 A;  1P1O A;  3B6W A;  5IZZ A;  4BDL A;  1DMB A;  3GBB A;  4AQ4 A;  2RC9 A;  5EYF A;  2Q89 A;  5I7I A;  1D9Q A;  3SDF A;  1FPK A;  1NV0 A;  3FXU A;  4RJZ A;  3U8Q A;  1H43 A;  4LQ5 A;  2W7Y A;  2HAU A;  4R75 A;  1LBC A;  1OMP A;  1OQH A;  1FBH A;  1LEV A;  4R9F A;  3IO6 A;  2THI A;  3QSL A;  1NV5 A;  3H06 B;  1EZ9 A;  1EU8 A;  5AA2 B;  5IZ3 A;  3FZV A;  3ONM A;  3KFM A;  4OEN A;  1QW0 A;  1NNT A;  3O9P A;  4MEV A;  4GVO A;  4YAH X;  5ISU A;  2P3N A;  2QMW A;  4R2F A;  3QUJ A;  5H8Q A;  3TTR A;  3LR1 A;  4EQB A;  1FTO A;  2RCA A;  1A40 A;  1IMA A;  2OK2 A;  4MNP A;  3U92 A;  1MM6 A;  1MDP 1;  1FSA A;  2I6E A;  3TQL A;  2CEY A;  3KZG A;  4KPT A;  1US4 A;  5CM6 A;  3IL1 B;  3ZKK A;  4ESX A;  3M3L A;  5KDT A;  4ND9 A;  1FPG A;  1SYH A;  2NVU B;  1N7X A;  5DT6 A;  2DSF A;  4RK2 A;  4MMP A;  5LOM A;  3CI8 A;  4YB5 A;  3PMX A;  2QVV A;  2WBD A;  1KA0 A;  4YIC A;  2XXK A;  3FVK A;  1NL5 A;  4FEB A;  4XXU A;  1Z7M E;  2QS3 A;  1ATG A;  4LAT A;  2UYE A;  3U72 A;  1G0H A;  2YLN A;  3RUM A;  2UVJ A;  4DXB A;  1T0K A;  3C35 A;  2ONS A;  1IMD A;  1SI0 A;  2DDK A;  1FW0 A;  4N6K A;  1LLS A;  4PFT A;  3B50 A;  2HQ0 A;  3BFT A;  1ZMG A;  3E13 X;  1ZLQ A;  2YJP A;  1EZO A;  5L9O A;  4LVQ A;  1LBB A;  4KXP A;  4OEV A;  5FHO A;  1IUD A;  4PC9 A;  3KSX A;  1Y3Q A;  4RA1 A;  4TLL B;  1NV1 A;  5FHN A;  1IXI A;  3K1M A;  3FXB A;  3Q26 A;  2I58 A;  2XXH A;  4R9G A;  1IIW A;  2Z22 A;  2F7B A;  1II5 A;  4H8J A;  1A8F A;  2DYX A;  5I2K A;  3MWB A;  3MAM A;  1BLF A;  2P0S A;  1O7T A;  2Q88 A;  3TPA A;  2I0B A;  2DWH A;  2AL4 A;  4H5F A;  4H6D A;  4QSE A;  3DEL B;  4DI3 D;  1DOT A;  5LDZ A;  2R6G E;  3C34 A;  4FAJ A;  1FJ9 A;  1D9Y A;  1RKM A;  1AOV A;  1J1N A;  1QUK A;  4F29 A;  2V3Q A;  3PD9 A;  1SW1 A;  4UA8 A;  3RT8 A;  4EF2 A;  4OFO A;  4HE2 A;  4QSD A;  4ZS9 A;  3CG3 A;  3MPK A;  5IM2 A;  4GX3 A;  3OO9 A;  2ZZW A;  3PV0 E;  2QL3 A;  1R9L A;  3AXF A; 
#chains in the Genus database with same CATH homology
 1SD3 A;  2H25 A;  3K00 A;  4ZZA A;  2OWS A;  1VSO A;  3FJ7 A;  1VFD A;  3RTW B;  3N6T A;  1FCK A;  4GL0 A;  4I1D A;  4RK9 A;  4RNS A;  3TFL A;  2WKY A;  4XTC Q;  5JTY A;  4KHZ E;  5AE4 A;  4YKK A;  2UYF A;  4P0I A;  3H03 A;  2XXP A;  4I62 A;  4OMB A;  4KQP A;  5AA4 B;  4NMY A;  1H45 A;  1B5H A;  3IB0 A;  3QK6 A;  4ELP A;  4MLV A;  4WED A;  4O3C A;  4E0W A;  4KYS A;  4LP2 B;  1B2H A;  1USY H;  1BP5 A;  3KEI A;  4U1O A;  4ECF A;  3R26 A;  3FIR A;  3A09 A;  3LSF B;  4WKM A;  4JWO A;  4DDD A;  2I4B A;  3O6G A;  3RPW A;  5ITO A;  1D3K A;  3H7M A;  1QUI A;  3PPO A;  5HPQ A;  4PET A;  2O1L A;  1FQE A;  5I2N B;  5DEX A;  4N6P A;  3CFL A;  4QFN A;  4JSD A;  1GTK A;  1LAH E;  4LQ2 A;  3USD A;  4IGT A;  1UTB A;  2DE4 A;  4F22 A;  1B40 A;  1EH3 A;  2UXA A;  3MW0 A;  2H4I A;  4LZ8 A;  1JNF A;  1POY 1;  3PPR A;  3OO6 A;  4F1V A;  1JEU A;  2XD3 A;  4BDO A;  4LA9 A;  2O51 A;  1MXU A;  3IB1 A;  3CVG A;  3G3F A;  1SW5 A;  1URD A;  3LC8 A;  3D4C A;  5F7V A;  4NF5 B;  2ONR A;  2NXO A;  2QS2 A;  3V83 A;  4HCY A;  1F9B A;  2OJT A;  1H44 A;  3UN6 A;  4I9D A;  2PT1 A;  4KFQ A;  4XIG Q;  3GXA A;  3RNN A;  4HS7 A;  1H3D A;  1OVT A;  1MDQ A;  2XXV A;  5M2V A;  3U93 A;  1QJM A;  4XKR A;  1N7W A;  2HAV A;  3P7I A;  5F1Q A;  4OFJ A;  4PE5 B;  4NE4 A;  5JEI A;  4IO4 A;  4Q30 B;  3RQT A;  1P1U A;  4THI A;  2R9J A;  3TMG A;  4LON B;  2E0S A;  4FOR A;  2F7C A;  3IX1 A;  5TPA A;  2ZYK A;  3MP6 A;  3G7W A;  3ILU B;  2NUV A;  4EXK A;  1SW2 A;  1JEV A;  3VXC A;  1XT8 A;  3TCG A;  1MXV A;  4KCD A;  3KJT A;  4FE8 A;  4QHQ A;  5CBS A;  4GFR A;  3WAE A;  1RYO A;  4OHN A;  3S9M C;  3K2D A;  1B7H A;  4I8C A;  1SBP A;  1MY3 A;  3E3K A;  4MBP A;  3Q25 A;  1B9J A;  3OO7 A;  3HPI A;  1PB7 A;  3GBA A;  1LAG E;  3KG2 A;  4NF8 B;  4G8H A;  4C1U A;  1QVS A;  3EN3 A;  2FNC A;  2PMS A;  2NOO A;  2Y84 A;  1D4N A;  1PBP A;  3K01 A;  3B6T A;  3TOD A;  2RIN A;  5EHS A;  2VGQ A;  1USY E;  3SKP A;  5DTB A;  3UP9 A;  3PU5 A;  4OET A;  3G3K A;  1IZ1 A;  4N07 A;  1Z7N E;  4U4X A;  4NF6 A;  5L9M A;  5H8N B;  1FQB A;  2XXT A;  1B46 A;  3EPE A;  4GIZ A;  2D5W A;  5TP9 A;  4ELR A;  3MP1 A;  4YMB A;  3MUQ A;  1JW5 A;  2XXX A;  1Y1M A;  3G3J A;  3L6H A;  1KWH A;  3G3H A;  3MVX A;  5I59 B;  2QMX A;  3VXB A;  3PUX E;  3A3U A;  2Q9T A;  4OQO A;  2F35 A;  5K2X A;  3CR9 A;  3JYR A;  4KYD A;  2B3F A;  4ZEC A;  5HM4 B;  3PD8 A;  3OOA A;  5AA2 D;  1VFE A;  1Y9U A;  5B7D A;  3O66 A;  3IJO B;  2LAO A;  3MZB A;  4OVJ A;  4DLD A;  3OEL A;  1MM7 A;  3RLF E;  4EQ7 A;  5A5X A;  1B52 A;  1P1N A;  2ZNU A;  1NH8 A;  2B3B A;  1OLC A;  4OFL A;  3OEM A;  1ZIU A;  2ABH A;  3FJM A;  4H65 A;  4MFI A;  4KR5 A;  3KJ7 A;  3KBR A;  2F78 A;  1QKA A;  1GGG A;  3G3I A;  4JDF A;  2QS1 A;  1BIY A;  5FTI A;  1HSJ A;  4QFP A;  1B3F A;  5DVJ A;  4MF3 A;  4JXI A;  5DVF A;  4R6H A;  3S9L C;  4U23 A;  3MP8 A;  5B70 A;  1UTH A;  5CBR A;  1TT1 A;  3LSW A;  1LCT A;  5L8D A;  2RF1 A;  3TCH A;  1A7L A;  4G4P A;  3O6I A;  1NNK A;  2DS9 A;  2GHA A;  2UVG A;  3RGY A;  1TFD A;  1I6Q A;  5K2Y A;  1HSE A;  2RC8 A;  2ZMB A;  5I58 A;  4JSO A;  3TZA A;  3ILT B;  4KI0 E;  4IO3 A;  1PEB A;  3B7D A;  3C31 A;  3TCF A;  4WEP A;  3QYT A;  3VFJ A;  4FEC A;  1DPP A;  2X26 A;  4JBZ A;  2Y7P A;  1OQG A;  4JB7 A;  5CC2 A;  4EQ9 A;  2Y7I A;  1H76 A;  2F7A A;  4GXA A;  3UIF A;  1YAE A;  4DIG A;  4JWX A;  5DVI A;  5FTH A;  2YPN A;  4U1Z A;  1JW1 A;  1N0T A;  1MQG A;  1FTM A;  1VR5 A;  4R6K A;  4G68 A;  3ODB A;  1VE4 A;  3VV5 A;  2H5Y A;  4C1T A;  3HHG A;  1MH3 A;  1M5E A;  1MH4 A;  4G68 C;  3OD7 A;  2HZK A;  4YKJ A;  4PQJ A;  3TEP A;  1IIT A;  5FHM A;  4ELQ A;  3O2A A;  5AA2 A;  3FAT A;  1MY2 A;  3OEK A;  3ZKL A;  1OLA A;  2DWJ A;  3CFX A;  1LAX A;  3RT6 B;  1CB6 A;  4BLA A;  3FAS A;  4QF9 A;  4GQO A;  1D9V A;  3W9V A;  3FVN A;  1MG1 A;  4F19 A;  1SYI A;  1N3W A;  3T9X B;  1QUL A;  1HSL A;  1ZU0 A;  3FV1 A;  2M8C A;  3I3V A;  1Y3N A;  1NNF A;  2E1S A;  2X7P A;  3H6V A;  3PUW E;  2F34 A;  1MY0 A;  5DYH A;  2F6G A;  4U22 A;  2IA4 A;  3HN0 A;  1IXH A;  1FQF A;  5ELV A;  4BDQ A;  1SI1 A;  2A5T B;  1POT A;  3T93 B;  1SW4 A;  5ICQ A;  1Y1Z A;  4GXS B;  2Z8F A;  2PBW A;  4R72 A;  2XD2 A;  2XXW A;  3OSQ A;  4FED A;  1EZP A;  5BWJ A;  2ZNT A;  1B51 A;  1IQ7 A;  3CIJ A;  4TOZ A;  1PBQ A;  1MQJ A;  3C32 A;  2AL5 A;  2DWA A;  4YKP A;  4IO5 A;  1Y4C A;  4R73 A;  1UQW A;  3PPP A;  1ELJ A;  2O84 X;  3IJX B;  1B0L A;  3KSJ A;  2XX7 A;  3HHF A;  4Q8R A;  4KD5 A;  3C4M A;  3CFZ A;  4XKP A;  4ZED A;  2O7U A;  5JK4 A;  4FIM A;  4RPN A;  3O97 A;  3THI A;  1P1W A;  4AB5 A;  1M5C A;  2V25 A;  2VP1 A;  3MZ1 A;  1IEJ A;  1WVJ A;  1OVB A;  3N5L A;  2VHA A;  1PB8 A;  1QKB A;  4IGR A;  5KCJ B;  3KOS A;  5I56 B;  3W9W A;  2BJJ X;  4ZE8 A;  1P99 A;  1MXZ A;  1RYX A;  4ZEB A;  3PPN A;  3TTL A;  1Y20 A;  2PX1 A;  4FAT A;  3FXQ A;  2KLF A;  2R71 A;  5H8S A;  4R6Y A;  3BKI B;  4F3S A;  5HBC A;  3O6H A;  1M5B A;  3PGF A;  4NF4 B;  5I84 A;  2V84 A;  3T9H B;  4N13 A;  4MH5 A;  2H9B A;  4F2O A;  4F31 B;  3S9N C;  2H98 A;  1YCJ A;  4YB7 A;  3A3C A;  4GRK A;  3KGC A;  1YTV A;  4OXV A;  2Z8D A;  5CMC A;  4TQU Q;  1MPC A;  4QSC A;  5AA4 A;  3IO4 A;  3U1O A;  1N04 A;  3Q29 A;  4IO2 A;  2X7Q A;  3EF7 A;  4H8I A;  1Q35 A;  3WAF A;  2I49 A;  3PUY E;  3IB2 A;  1TXF A;  4NWD A;  2O68 A;  4LZ5 A;  2DVC A;  1NKX A;  3BBR A;  1NNP A;  1JQF A;  1LFI A;  1ZTY A;  4MLQ A;  3VVD A;  3CSB A;  2O7I A;  1B0H A;  3M3K A;  1JVY A;  2V3T A;  2HFB A;  3VVF A;  2V93 A;  3QUF A;  5CMK A;  3TTM A;  5I2N A;  1FQD A;  5EHM A;  4Z0I A;  3UA8 A;  4OWD A;  5H8F B;  4OZ9 A;  4F3P A;  1LCF A;  3DLN A;  2Y7W A;  3O28 A;  2FA7 A;  4U2R A;  2O6A A;  3PMV A;  4GL8 A;  3R7X A;  3KN7 A;  4Q5T A;  2OZZ A;  4NF4 A;  1JW4 A;  3TYH A;  1PC3 A;  4RYA A;  3VE1 B;  2OBG A;  1B6H A;  1MXW A;  5H8Q B;  1ZBM A;  4NF5 A;  2F6P A;  4ISU A;  3K4U A;  1B5I A;  3V89 B;  2F36 A;  3TUS A;  1NMU A;  3U94 A;  1AL3 A;  4ONY A;  3SEU A;  4IB2 A;  1ANF A;  5KDT B;  1B05 A;  4PFU A;  5TU0 A;  2XXQ A;  1LST A;  4LUB A;  1ZJL A;  1JET A;  3N26 A;  5CMB A;  2DVZ A;  3EHS A;  4OYV A;  2UVH A;  2CMO A;  1MY1 A;  4JWY A;  4IY6 A;  1MQD A;  4M1V A;  3DM0 A;  4EF1 A;  3MVW A;  5H8H B;  1R6Z A;  2REG A;  3MC2 A;  4F39 A;  3JV9 A;  3TEL A;  2GRV A;  1AIV A;  3T9U A;  4M4G A;  1A8E A;  4YU0 A;  3W15 C;  2QJE A;  2D3I A;  3PMW A;  3GZG A;  2VOZ A;  4POX A;  3CRB A;  3EHT A;  5CI5 A;  1XHY A;  2OWT A;  3SEY A;  1CE2 A;  3IOW A;  1AMF A;  2GHB A;  3JZJ A;  4ZEF A;  2DE3 A;  2REJ A;  2HEU A;  3K0V A;  4OTE A;  2Z23 A;  3L6G A;  4XKQ A;  3T96 B;  3KN8 A;  5I2K B;  2ZYN A;  3K02 A;  2CZL A;  3O29 A;  1A55 A;  1US5 A;  3OSR A;  4OES A;  4NF8 A;  4OEU A;  3M3F A;  5CRY A;  2G29 A;  3UOR A;  3SEX A;  1GR2 A;  1S7Y A;  4QRZ A;  1FQC A;  4WXJ A;  1LB8 A;  4GOT A;  4DXU A;  4QFO A;  4GWO A;  4ZZE A;  3OMB A;  4HCW A;  1BTJ A;  2QSX A;  5H8N A;  4X1B A;  2ZNS A;  4G8M A;  1DTZ A;  3B6Q A;  4GD5 A;  2RC7 A;  3FV2 A;  3OEN A;  2Q8J A;  2PVU A;  2VD2 A;  3VVE A;  1B7Z A;  2XXR A;  1B1X A;  4EDP A;  5I59 A;  3IR1 A;  5AA1 A;  1SQY A;  5ITP A;  1MY4 A;  4H1X A;  2UVI A;  4U21 A;  3I5O A;  5JTY B;  4IY5 A;  3PPQ A;  1I6A A;  2Q2A A;  4X1D A;  4HW8 A;  5H8H A;  1ZKB A;  3LSL A;  2XXI A;  1MPB A;  3KOT A;  4G8N A;  1N84 A;  1FTK A;  3LSX A;  4H0W A;  4K3F A;  3E4R A;  3C9H A;  3CG1 A;  3HST A;  2I3V A;  4O3A A;  1UIU A;  4X9T A;  3MBP A;  4BDN A;  3T9V A;  2H99 A;  1OIB A;  2ANJ A;  4ZEI A;  4POW A;  3E9X A;  4P11 A;  3UGW A;  4ZDM A;  2I0C A;  3TTK A;  1NH7 A;  3TQW A;  3ECR A;  1B7U A;  1TWY A;  3HCQ A;  3HO7 A;  3VLV A;  4G2Z A;  3OO8 A;  1FQA A;  3H6T A;  1O63 A;  3N94 A;  3H6W A;  3QIM A;  4YMA A;  3PUV E;  2IEE A;  5DEX B;  2XX9 A;  3IOR A;  1B5J A;  4F1U A;  4HTG A;  1XOC A;  3T22 A;  2HXW A;  3KN3 A;  1UTB B;  3C33 A;  3IOV A;  1WOD A;  2F97 A;  4P0G A;  4C0R A;  3EHU A;  3K6X A;  2GFE A;  1DSN A;  1NFT A;  3TAJ A;  3TDJ A;  3TKD A;  3LBS A;  2GH9 A;  2ESN A;  4ZEK A;  1L5T A;  3N6U A;  3SEW A;  3MPL A;  1WDN A;  1MRP A;  4XKN A;  2OLB A;  3RY3 A;  4F18 A;  4PP0 A;  4IO7 A;  5ICT A;  3SER A;  2DXY A;  4G77 A;  4R74 A;  4TLM B;  1B58 A;  5I57 B;  4LZ7 A;  2G93 A;  1IXC A;  1LAF E;  1P1Q A;  3EQ1 A;  1A99 A;  2HCA A;  2Y7R A;  2ZXT A;  1N3X A;  3SET A;  3C36 A;  1XC1 A;  4ELO A;  1XS5 A;  3K6V A;  4QFL A;  3MQ9 A;  1DPE A;  2OCU A;  3OXN A;  2QPQ A;  1Y4T A;  3S9E A;  3Q27 A;  2A5S A;  1M5F A;  2ZYO A;  5TPA B;  4H5G A;  5BUU A;  2QRY A;  3MZ9 A;  1Y3P A;  1S50 A;  1B1H A;  1MS7 A;  1B3E A;  4PFY A;  2XX8 A;  1MPD A;  3H4Z A;  5IAI A;  4DZ1 A;  2NWJ A;  1BKA A;  2ALU A;  1UIV A;  4F1Y A;  1B3G A;  3M8U A;  2PT2 A;  4DE8 A;  2PYY A;  3FJG A;  2DE2 A;  3F11 A;  1GVC A;  1JVX A;  3FD3 A;  3IK6 B;  2D21 A;  3HV1 A;  3QAX A;  3ZS6 A;  1TFA A;  3Q28 A;  3IOU A;  1B3L A;  1N76 A;  2DOJ A;  1GV8 A;  2B65 A;  2XXY A;  4F3G A;  1DTG A;  1MXX A;  4NTL A;  3S4U A;  2V3U A;  4R2B A;  2A5T A;  1S9T A;  2FYI A;  3FUZ A;  1LB9 A;  4NF6 B;  1PB9 A;  2DXR A;  1MQI A;  4OER A;  3FGS A;  1IXG A;  3ZSF A;  1B4H A;  3R6U A;  2QS4 A;  5TP9 B;  3DP8 A;  4NWC A;  1MXY A;  3FVG A;  4ZE9 A;  4RXL A;  1B4Z A;  5CMM A;  4GF8 A;  5I57 A;  1B3H A;  2XXU A;  1LFG A;  1FTL A;  3PUZ E;  1YPN A;  1FTJ A;  4QFK A;  1I69 A;  2F5X A;  3LUY A;  2P1S A;  3RTF B;  1I6B A;  2Y7K A;  3S2V A;  3FXR A;  4Q0C A;  3RN8 A;  1A54 A;  2AYS A;  3SEV A;  3CSG A;  2I4C A;  2AIX A;  3IAZ A;  3MJN A;  2F8D A;  3FVO A;  2I48 A;  1XVY A;  5L9S A;  5KCJ A;  5I56 A;  4F2Q A;  2VD3 A;  3K6W A;  4AB6 A;  5A5X B;  3GLB A;  4FJP A;  3TTN A;  2ONK E;  3T66 A;  4BDR A;  4YB6 A;  4DXC A;  1QUJ A;  2Q2C A;  1Q1K A;  2P2A A;  4KCC A;  3SES A;  4NED A;  1M5D A;  4DCY A;  2DQV A;  1URS A;  4EUO A;  3I6V A;  4X48 A;  4PFW A;  4GLI A;  3BFU A;  2XHD A;  3UK4 A;  1PDA A;  4L17 A;  4YKI A;  1SVX B;  1URG A;  4RY1 A;  4Z7E A;  1UTH B;  2O69 A;  4EXL A;  4DCX A;  1SDX A;  2HZL A;  2I3W A;  1R9Q A;  2DP8 A;  4H67 A;  3QXM A;  3VLW A;  4YZZ A;  3H6U A;  4UAC A;  4O3B A;  1MQH A;  1B32 A;  1LFH A;  5I58 B;  3K1P A;  3K1N A;  3DP4 A;  5J1D A;  3D4G A;  3V8X B;  2DWI A;  3VLU A;  4E0X A;  4KYE A;  2O1M A;  2ZYM A;  5IKB A;  3DP6 A;  4IO6 A;  1AH5 A;  3K6U A;  3G3G A;  4ESW A;  1LGB C;  4U4S A;  2Z8E A;  2RCB A;  3MVZ A;  3IOT A;  3MVY A;  5KZT A;  1XVX A;  4RPO A;  2RKM A;  3VDF A;  1O64 A;  3H3G A;  4BDM A;  1R1N A;  4F3B A;  5H8F A;  3V5A A;  4G68 B;  5AA3 A;  1P1O A;  3B6W A;  4BDL A;  1DMB A;  3GBB A;  4AQ4 A;  2RC9 A;  5EYF A;  2Q89 A;  3SDF A;  3FXU A;  4RJZ A;  3U8Q A;  1H43 A;  4LQ5 A;  2W7Y A;  2HAU A;  4R75 A;  1LBC A;  1OMP A;  1OQH A;  4R9F A;  3IO6 A;  2THI A;  3QSL A;  3H06 B;  1EZ9 A;  1EU8 A;  5AA2 B;  3FZV A;  3ONM A;  3KFM A;  4OEN A;  1QW0 A;  1NNT A;  3O9P A;  4GVO A;  4YAH X;  5ISU A;  2QMW A;  4R2F A;  3QUJ A;  5H8Q A;  3TTR A;  3LR1 A;  4EQB A;  1FTO A;  2RCA A;  1A40 A;  2OK2 A;  3U92 A;  1MM6 A;  1MDP 1;  3TQL A;  2I6E A;  3KZG A;  4KPT A;  1US4 A;  5CM6 A;  3IL1 B;  3ZKK A;  4ESX A;  3M3L A;  5KDT A;  4ND9 A;  1SYH A;  2NVU B;  1N7X A;  5DT6 A;  2DSF A;  4RK2 A;  5LOM A;  3CI8 A;  4YB5 A;  3PMX A;  4YIC A;  3FVK A;  1NL5 A;  4FEB A;  4XXU A;  1Z7M E;  2QS3 A;  1ATG A;  4LAT A;  2UYE A;  3U72 A;  2YLN A;  3RUM A;  2UVJ A;  4DXB A;  1T0K A;  3C35 A;  2ONS A;  1SI0 A;  1FW0 A;  1LLS A;  4PFT A;  2HQ0 A;  3BFT A;  1ZMG A;  3E13 X;  1ZLQ A;  2YJP A;  1EZO A;  5L9O A;  4LVQ A;  1LBB A;  4OEV A;  5FHO A;  1IUD A;  3KSX A;  1Y3Q A;  4RA1 A;  4TLL B;  5FHN A;  1IXI A;  3K1M A;  3Q26 A;  2I58 A;  2XXH A;  4R9G A;  1IIW A;  2Z22 A;  2F7B A;  1II5 A;  4H8J A;  1A8F A;  2DYX A;  5I2K A;  3MWB A;  3MAM A;  1BLF A;  2P0S A;  1O7T A;  2Q88 A;  3TPA A;  2I0B A;  2DWH A;  2AL4 A;  4H5F A;  4H6D A;  4QSE A;  3DEL B;  1DOT A;  2R6G E;  3C34 A;  4FAJ A;  1D9Y A;  1RKM A;  1AOV A;  1J1N A;  1QUK A;  4F29 A;  2V3Q A;  3PD9 A;  1SW1 A;  4UA8 A;  3RT8 A;  4EF2 A;  4OFO A;  4QSD A;  4ZS9 A;  3CG3 A;  3MPK A;  3OO9 A;  3PV0 E;  2QL3 A;  1R9L A;  3AXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...