3HV1A

Crystal structure of a polar amino acid abc uptake transporter substrate binding protein from streptococcus thermophilus
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
264
structure length
264
Chain Sequence
RSHFATQKDQWQTYTKEKKIKIGFDATFVPMGYEEKDGSYIGFDIDLANAVFKLYGIDVEWQAIDWDMKETELKNGTIDLIWNGYSVTDERKQSADFTEPYMVNEQVLVTKKSSGIDSVAGMAGKTLGAQAGSSGYDAFNASPKILKDVVANQKVVQYSTFTQALIDLNSGRIDGLLIDRVYANYYLEKSGVLDQYNVMPAGYEGESFAVGARKVDKTLIKKINQGFETLYKNGEFQKISNKWFGEDVATDQVKGKREGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polar amino acid ABC uptake transporter substrate binding pr
publication title Crystal structure of a polar amino acid ABC uptake transporter substrate binding protein from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus lmg 18311
molecule tags Transport protein
total genus 90
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hv1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hv1A02
2GFEA 3KFMA 4GRKA 1MPDA 1NKXA 1XC1A 2DVZA 2V84A 2O7UA 5DEXB 3RTWB 1B4HA 3CVGA 3FXQA 2E0SA 4FECA 2VHAA 2NVUB 5CMBA 1B58A 2UXAA 4GXAA 4FAJA 1R6ZA 4RJZA 5KDTA 4GIZA 2O1LA 1N7XA 3HV1A 2QMWA 1N3WA 3PD9A 4KQPA 1B5HA 3QXMA 5J1DA 4LZ8A 3VLWA 1N04A 3HHGA 2RC9A 1MY2A 3TMGA 1Q1KA 2ZNUA 3TZAA 3R7XA 4N13A 1NFTA 4GFRA 3EHUA 3K0VA 3RN8A 1TWYA 4DDDA 4F3BA 2OWTA 1N3XA 3OENA 3MZBA 2XHDA 3Q25A 1PC3A 1YAEA 3OO7A 2DWHA 4F1UA 2XXXA 4X1DA 2DQVA 2O68A 4YB5A 3OOAA 5L9SA 3PPRA 2AIXA 1Y4CA 5DVFA 2ZNTA 4EF2A 2Q2AA 4LQ5A 1P99A 4HCYA 3RT6B 2YLNA 4YMBA 2RF1A 1MY0A 4OEVA 3C36A 5H8HA 3MP8A 3LSLA 2H5YA 4OVJA 1T0KA 5TPAA 2A5TB 1FQBA 2XXIA 2F7CA 5BWJA 4PFWA 2F36A 3IB2A 3PGFA 1NNKA 4WEPA 4LVQA 1SVXB 4FIMA 4IY6A 3KSXA 3I6VA 1R9LA 2O1MA 3K4UA 3DELB 4RA1A 1UTHB 4Z7EA 1PB8A 2F6GA 4NTLA 4JWXA 3KG2A 4YB7A 4H5FA 5I84A 4R6KA 3FVNA 3IR1A 1HSJA 3IO4A 1FTLA 1DTZA 1QKBA 3OEMA 1ZJLA 2O6AA 2ALUA 3VE1B 3OD7A 5ISUA 5H8FA 4QFPA 3MVZA 5EHSA 1LAXA 3GXAA 4U1ZA 3N94A 4H0WA 2Y7KA 3CSBA 5JTYB 4ZE9A 3FVKA 4KYSA 2H99A 5JEIA 1GR2A 2LAOA 2B3BA 3IJXB 3Q28A 4QF9A 1LFGA 3V89B 1POY1 1IITA 2OCUA 2F5XA 3B6TA 1ANFA 1Y4TA 3FXUA 3KJTA 1B4ZA 4GOTA 1VFDA 3LSWA 3VVEA 2RKMA 4LUBA 3S9MC 5CC2A 3QK6A 1S50A 2Q2CA 1SW5A 3C35A 1OVBA 3G3FA 3T9UA 3WAEA 3Q29A 1EU8A 3OELA 4LZ7A 2ABHA 4EXKA 1VFEA 2DSFA 5I2NB 4AB5A 4M4GA 1AH5A 1MXUA 4K3FA 2QRYA 3RQTA 1NNFA 3C32A 1WDNA 1IZ1A 1NH8A 3Q27A 5ITOA 3A09A 2DE4A 2Q89A 2X7PA 4X48A 3KZGA 3KBRA 1EZ9A 2NOOA 4JBZA 2OK2A 1NNTA 2P0SA 3HN0A 4RK2A 3U1OA 2I6EA 4OYVA 1MH3A 1O63A 3ONMA 2Q88A 3SESA 2DE2A 5K2XA 3OO6A 3JZJA 2H4IA 2F78A 5AA1A 1BP5A 1VE4A 4IO2A 2B65A 4U4SA 2F34A 3RT8A 3PPNA 2PMSA 3M8UA 4ZS9A 4NWDA 5DT6A 4EQ9A 1DSNA 3VV5A 4NF5B 3OEKA 1TT1A 3GBAA 2GHAA 1XVYA 4ELQA 4PE5B 1QVSA 1Y9UA 1ELJA 3RGYA 4C0RA 4YZZA 3TCHA 3R26A 3C34A 1URGA 3O6GA 4G68C 3CIJA 2RCBA 3D4GA 1KWHA 3OMBA 2UVIA 1D9YA 3QAXA 5H8SA 3MVWA 5EYFA 4Q8RA 3E4RA 1R9QA 3HCQA 4YKPA 1IXCA 2X7QA 4DZ1A 2DXYA 3MBPA 4G8NA 3ZKLA 1B7HA 1XOCA 3EPEA 2CMOA 4F19A 4F22A 1TXFA 3IL1B 3USDA 3UA8A 5H8QA 3G7WA 4G2ZA 1LLSA 4G68B 3O6HA 1SBPA 3SEXA 4PFUA 2Y7WA 3RPWA 3PPQA 2YPNA 1JVYA 1LCFA 5DEXA 1TFAA 1PBQA 3MPKA 4QFKA 5CBSA 1H43A 5AE4A 2VD3A 3TTMA 4ND9A 4H8IA 3IB0A 1ZLQA 3IOVA 3SEWA 4R2FA 3TTLA 3JV9A 3QUFA 3K1PA 4OTEA 4GWOA 2ZMBA 4P0IA 4BDOA 5LOMA 3T66A 3FVGA 3D4CA 3VFJA 3KOSA 4JB7A 5I56B 2F6PA 4YAHX 3QIMA 1MS7A 2XXUA 5ICTA 3MZ1A 1B0HA 4JSOA 2GHBA 3WAFA 2DWIA 4DE8A 3IORA 1IUDA 4NF4B 1SYIA 3DP8A 2VP1A 5CMMA 3RTFB 4TLMB 4F31B 1SQYA 4FEBA 4AB6A 4OFLA 3G3KA 3K01A 4F3SA 1OQHA 2PX1A 1FQCA 4G77A 2QPQA 3TYHA 4IGRA 4O3BA 3JYRA 3CFXA 3FD3A 3UIFA 1WODA 3T9HB 4R72A 1LCTA 1BIYA 4EXLA 4ESXA 3HPIA 3FV1A 1Y3NA 4OETA 5ITPA 4OENA 4POXA 1FTKA 1QKAA 4QHQA 3H7MA 3V5AA 4ZEDA 3S9EA 1B32A 2Y84A 4ZEFA 2A5TA 3W9VA 2DE3A 5EHMA 1M5BA 1EZOA 1SYHA 1SI1A 1LBBA 3FJMA 4LQ2A 3KN8A 1UTHA 5BUUA 1JVXA 4OESA 5HPQA 1GV8A 4OXVA 4KCCA 2ONRA 1A8FA 1II5A 4ONYA 1N76A 4O3CA 3S9LC 2XX7A 1BKAA 3MVYA 1B1XA 2G29A 5DVJA 2XXWA 1UIVA 2OWSA 3MJNA 4ZDMA 4F3PA 5DYHA 1Z7ME 3H6WA 1YPNA 5H8NB 2D5WA 3EN3A 1JW1A 2DP8A 5JTYA 2UVJA 3M3FA 1N84A 4GL8A 3RLFE 5CM6A 3H4ZA 4U2RA 3T93B 4KI0E 2DWJA 3KN3A 4HCWA 3RNNA 2XXPA 3IOWA 3PUYE 2ZXTA 3PMXA 3U8QA 3UGWA 4H8JA 4NMYA 1EZPA 2Y7PA 4EDPA 2I58A 2QS1A 4PQJA 1F9BA 3CFZA 1S9TA 2I48A 4G8HA 4ZEIA 3OSQA 1LAGE 1JEUA 1AL3A 3U93A 3CG3A 3CRBA 4C1UA 4KPTA 5AA2B 3N5LA 3PUVE 4OEUA 2HXWA 5AA2D 4PP0A 4I62A 2ZYKA 3B6WA 5I2NA 5KCJB 1PBPA 1Y20A 4F1VA 3HHFA 4M1VA 3H6VA 4I8CA 1OLAA 3KSJA 3HO7A 3VDFA 2DXRA 3H06B 3H3GA 4OQOA 4KD5A 1Y3QA 1M5CA 5A5XB 1SDXA 1M5EA 3THIA 4PFYA 1D4NA 3P7IA 1B9JA 4FE8A 4Q0CA 2QS2A 3PUXE 3SEYA 3W9WA 4ZZAA 3V83A 1Y3PA 2G93A 4NF6B 2PVUA 3CSGA 3GBBA 3LBSA 3CFLA 4O3AA 4MLVA 2I3WA 2I4CA 2I4BA 3O97A 4IGTA 1AIVA 5JK4A 1YTVA 3SEUA 1MXWA 3ZKKA 5F7VA 1FTMA 4C1TA 4NF5A 3U94A 5I59B 3K6VA 1N0TA 4HTGA 1JETA 1JQFA 1LFHA 4H1XA 2B3FA 1H76A 2AL4A 1IXGA 1TFDA 4ISUA 5CBRA 1RYXA 1N7WA 3LUYA 4P0GA 4DXBA 5HM4B 4UA8A 1OVTA 1EH3A 5AA4B 2QSXA 2W7YA 2PBWA 4LONB 1LFIA 4Q30B 3H6TA 1SW4A 4XKQA 1H3DA 2GRVA 4F2OA 3IJOB 1FQDA 3K6UA 2BJJX 2ZNSA 1MDQA 5FTHA 1B52A 3TELA 2F35A 4OFJA 1ZMGA 2RINA 4DXUA 1B7ZA 4KYEA 3PPPA 1A99A 2Z8DA 4RPOA 2ZYMA 1SW1A 1P1WA 4KFQA 2OZZA 2V3QA 3M3KA 2Z23A 1B5IA 4F29A 2AL5A 4G68A 4MLQA 5CI5A 2DVCA 2PT1A 3CR9A 2Z8EA 3S2VA 2Y7RA 3U92A 4DCXA 3MPLA 3FATA 2OBGA 3FJ7A 1Z7NE 3TQLA 4EUOA 4XKNA 4JWOA 5HBCA 3C31A 4L17A 4BDMA 1FCKA 1H44A 4LZ5A 1QJMA 2HZKA 2V93A 5FTIA 3K2DA 4OZ9A 2R71A 4XKPA 2GH9A 5I56A 1B6HA 1XVXA 4RY1A 3B6QA 4YKJA 4KCDA 1FQAA 1US5A 3BKIB 4LATA 4G4PA 4GQOA 2FNCA 3L6GA 2X26A 4NF4A 1URDA 3O2AA 4E0XA 2Q8JA 4F2QA 4X9TA 3VVFA 3T9XB 3TUSA 4POWA 2DYXA 2OJTA 4IO3A 2D3IA 4E0WA 1BTJA 3TDJA 3AXFA 2KLFA 3B7DA 3E3KA 2XX9A 2M8CA 4PFTA 4GL0A 3KOTA 5TU0A 3IX1A 4R9FA 3W15C 2V25A 1Y1ZA 1B40A 1NNPA 4TLLB 3RUMA 3OO9A 4BDQA 2F7BA 4WXJA 3IAZA 1Y1MA 1I6QA 1PDAA 5FHOA 2HZLA 4QSCA 3E13X 2I3VA 3UORA 2F97A 1H45A 2IEEA 3K02A 3ZS6A 4R75A 2VD2A 1UQWA 1MQHA 3UK4A 4QRZA 2D21A 2ESNA 4YKIA 1R1NA 1FTJA 4NF8B 4BDNA 1SI0A 2O51A 5I58B 5TP9B 4DXCA 4UACA 3VXCA 4OHNA 2O7IA 4QFOA 4WKMA 1D9VA 4H6DA 4Z0IA 3U72A 3O28A 5L9MA 4MF3A 1A54A 5KZTA 4QSEA 1QUJA 3G3GA 1ATGA 2ZYOA 3MZ9A 3M3LA 4P11A 4YU0A 3I3VA 1MQDA 5H8NA 1LAHE 2XD3A 3ODBA 2HEUA 3IOUA 4ECFA 1BLFA 4RXLA 5FHMA 3EHTA 2Z8FA 3TPAA 5DTBA 1MY4A 2I49A 4ESWA 2NWJA 5M2VA 4G8MA 4KR5A 4DIGA 3TCFA 1MXXA 3MAMA 1MPCA 2UVHA 3H03A 4I1DA 1UIUA 3KEIA 4U21A 3PMWA 1MDP1 3EQ1A 3O29A 5AA2A 4GXSB 4BDRA 3TTNA 1DPPA 3OSRA 1IXHA 2YJPA 4RPNA 3K00A 3FGSA 1IQ7A 1RKMA 2ONKE 2Y7IA 1B2HA 1URSA 2I0BA 4RK9A 5KCJA 4R6YA 3KJ7A 4THIA 3PV0E 4BDLA 3A3CA 2PT2A 3OO8A 5A5XA 2THIA 2PYYA 2XXQA 1MM7A 3KGCA 4MFIA 4ELOA 1NH7A 5I2KB 1J1NA 3PPOA 1MRPA 3SEVA 3FVOA 4ELPA 1B3HA 2F8DA 3TTRA 3TEPA 4DCYA 1GTKA 4NF6A 3K1NA 2V3TA 1B3LA 3C33A 2QMXA 4HS7A 4GVOA 1MQIA 1I6AA 4H5GA 4YICA 2XXVA 2QL3A 2IA4A 1QW0A 1RYOA 1S7YA 3LR1A 4HW8A 1MY3A 3QSLA 3PUWE 3IO6A 5I59A 1ZBMA 3N26A 2Z22A 2XXRA 3UN6A 1MXYA 1UTBB 1USYE 2XXYA 4GD5A 4NEDA 3Q26A 5B7DA 2H25A 4R73A 1B3GA 1FQFA 3PD8A 1B7UA 5I57B 3IK6B 3TCGA 5CRYA 4N6PA 3MP6A 5AA4A 1A40A 3LSXA 4PETA 2NXOA 5B70A 3OXNA 1US4A 3TAJA 4FJPA 4U4XA 1YCJA 1LB8A 1HSEA 3RY3A 2P2AA 4EF1A 2NUVA 4ELRA 4IB2A 4IO5A 3PU5A 3T22A 4RYAA 4QFNA 3K1MA 4RNSA 4XXUA 5KDTB 3G3JA 1JNFA 2O84X 3EF7A 2XXTA 1XS5A 2Q9TA 4U1OA 4GF8A 3S9NC 3R6UA 1LGBC 4F3GA 3S4UA 2FYIA 3FASA 1JW4A 3ECRA 1P1NA 1AMFA 1SW2A 3O9PA 2DOJA 2DWAA 3H6UA 1POTA 1M5DA 1MM6A 2VGQA 3T96B 5ICQA 1P1OA 3BBRA 4JDFA 4F18A 3UP9A 2RC8A 3VXBA 2RC7A 2H9BA 4TQUQ 1PB7A 4AQ4A 3BFTA 1PEBA 1DMBA 3VLVA 3SETA 2WKYA 1JW5A 1AOVA 1MPBA 3C4MA 2DS9A 1MG1A 2HAVA 3QYTA 1LBCA 3A3UA 3F11A 3MQ9A 4FORA 3IB1A 2REJA 1B1HA 1O64A 5K2YA 3FJGA 2H98A 3DLNA 5AA3A 3MUQA 1XT8A 1PB9A 3MW0A 2E1SA 2HAUA 5H8HB 3LSFB 4H65A 1B3EA 1D3KA 1B46A 3PUZE 5ELVA 5TPAB 2UYEA 2XX8A 4FEDA 1OIBA 4EQ7A 1ZTYA 4OMBA 3MWBA 1XHYA 1B05A 1LB9A 1VSOA 3K6XA 4R6HA 3VVDA 1B3FA 4ZEKA 1I69A 4LA9A 1DPEA 1QUIA 2O69A 3CG1A 4LP2B 3FIRA 5H8FB 5F1QA 1Q35A 1A55A 1JEVA 4ZECA 4XKRA 4IO4A 4YKKA 1FQEA 3VLUA 3N6UA 2HFBA 3DP4A 4NF8A 2A5SA 4DLDA 1OLCA 3FUZA 5I58A 5TP9A 1O7TA 4N07A 5CMCA 3ILUB 3FZVA 3ILTB 3GLBA 4NE4A 3IOTA 4R9GA 1FW0A 4ZE8A 4FATA 3TKDA 3G3HA 1ZKBA 1DTGA 2ZYNA 4YB6A 4U22A 4OERA 1NL5A 4NWCA 1MQJA 1IXIA 3MC2A 2OLBA 3TODA 3ZSFA 4YMAA 1QUKA 4KHZE 3MVXA 4JSDA 1WVJA 1A8EA 1GVCA 3I5OA 1GGGA 1MH4A 4I9DA 3N6TA 1MXZA 4BLAA 1QULA 4H67A 3EHSA 1P1QA 3FXRA 3QUJA 3TFLA 1FTOA 1LSTA 3MP1A 4KYDA 3SERA 5DVIA 1MXVA 5CMKA 1ZU0A 1I6BA 2F7AA 2ANJA 3HSTA 3O66A 1MY1A 2REGA 5L9OA 1P1UA 1L5TA 3C9HA 2XD2A 3E9XA 3T9VA 1OQGA 2FA7A 4MBPA 3FV2A 3GZGA 5IAIA 1CB6A 4XTCQ 2QJEA 1HSLA 1VR5A 4F1YA 1IIWA 1CE2A 1SD3A 5L8DA 4U23A 2ONSA 3LC8A 3BFUA 4TOZA 3KN7A 4XIGQ 5IKBA 4QSDA 5I2KA 4IO6A 2UVGA 4F39A 2AYSA 4EQBA 4JXIA 2QS4A 1ZIUA 2HCAA 3DP6A 1B0LA 4Q5TA 4R2BA 3TQWA 2VOZA 5FHNA 2V3UA 3TTKA 3G3IA 1LAFE 3SDFA 3O6IA 4ZZEA 3DM0A 2UYFA 3CI8A 3SKPA 3PMVA 3V8XB 1USYH 2QS3A 1NMUA 1B5JA 4WEDA 1DOTA 4OFOA 4JWYA 2CZLA 4ZEBA 2XXHA 4QFLA 1A7LA 4MH5A 5H8QB 1UTBA 2R9JA 4IY5A 4GLIA 3L6HA 1MQGA 4X1BA 2R6GE 1IEJA 1M5FA 2HQ0A 5I57A 3K6WA 4R74A 1B51A 2I0CA 2P1SA 2RCAA 4IO7A 1OMPA 4OWDA
chains in the Genus database with same CATH superfamily
3U65A 2GFEA 3KFMA 4N8GA 4GRKA 1MPDA 1NKXA 1XC1A 2DVZA 2V84A 2O7UA 5DEXB 3RTWB 1B4HA 4MNPA 3CVGA 3FXQA 2E0SA 4FECA 2VHAA 2NVUB 5CMBA 4OVRA 1B58A 1CNQA 2UXAA 4GXAA 4FAJA 1R6ZA 4RJZA 5KDTA 4GIZA 2O1LA 4GBVA 1N7XA 3HV1A 2QMWA 1N3WA 4I3EA 3PD9A 4KQPA 1B5HA 3QXMA 5J1DA 2V4CA 4LZ8A 3VLWA 1N04A 3HHGA 4N81A 1IMDA 2RC9A 1MY2A 3TMGA 1Q1KA 2ZNUA 3TZAA 3R7XA 4DI3D 4N13A 4GX6A 1NFTA 4GFRA 3EHUA 3K0VA 3RN8A 1EYIA 1TWYA 4DDDA 4F3BA 2OWTA 1N3XA 3OENA 3MZBA 5I5PA 4QBAA 2XHDA 3Q25A 1PC3A 1YAEA 3OO7A 2DWHA 4F1UA 2XXXA 4X1DA 2DQVA 2O68A 4YB5A 3OOAA 5L9SA 1DBZA 3PPRA 2AIXA 1JP4A 1Y4CA 5DVFA 2ZNTA 4GBWA 1INPA 4EF2A 2Q2AA 2QVUA 4LQ5A 1P99A 4HCYA 3RT6B 1FPGA 2PFZA 2YLNA 4YMBA 2RF1A 1MY0A 4OEVA 3C36A 5H8HA 3MP8A 3LSLA 1FPFA 2H5YA 4OVJA 1T0KA 5TPAA 2A5TB 1FQBA 2XXIA 2F7CA 4IR8A 5BWJA 4PFWA 2F36A 3IB2A 4MIJA 3PGFA 1NNKA 4NAPA 4WEPA 4DI4B 4LVQA 1SVXB 4FIMA 4IY6A 3KSXA 3I6VA 1R9LA 2O1MA 3K4UA 3DELB 4RA1A 1UTHB 4Z7EA 1PB8A 2F6GA 2VPOA 4NTLA 4JWXA 3KG2A 4YB7A 4H5FA 5I84A 4R6KA 3FVNA 4H45A 4PGPA 3IR1A 1FJ9A 1HSJA 3IO4A 1FTLA 5ET8A 1DTZA 1NV5A 1QKBA 3OEMA 1ZJLA 2O6AA 2ALUA 3VE1B 2DDKA 3OD7A 5ISUA 5H8FA 4NX1A 4QFPA 3MVZA 5EHSA 1LAXA 1NI9A 3GXAA 4U1ZA 3N94A 4H0WA 2Y7KA 4X04A 3CSBA 1FJ6A 5JTYB 4ZE9A 1FBGA 3FVKA 4KYSA 2H99A 5IM2A 5JEIA 1GR2A 2CZKA 2LAOA 2B3BA 3IJXB 4GX4A 3Q28A 4PAIA 4QF9A 1LFGA 3V89B 1POY1 1IITA 2OCUA 2F5XA 3B6TA 1ANFA 1VDWA 1Y4TA 3FXUA 2F3BA 3KJTA 4OVTA 1B4ZA 4GOTA 2FIEA 1VFDA 4UABA 3LSWA 3VVEA 4JVIA 2RKMA 4PCDA 4LUBA 3S9MC 5CC2A 4PGNA 4LN5A 3QK6A 1S50A 2Q2CA 1SW5A 3C35A 1OVBA 3G3FA 3T9UA 4PTKA 3WAEA 3Q29A 3D1RA 1EU8A 3OELA 4LZ7A 2ABHA 4EXKA 1VFEA 2DSFA 5I2NB 2L5VA 3FXBA 4FBPA 4AB5A 4M4GA 1AH5A 1MXUA 4K3FA 4JVCA 3QMFA 2QRYA 3RQTA 1NNFA 3C32A 1WDNA 1IZ1A 1NH8A 3Q27A 5ITOA 3A09A 2DE4A 1IMAA 1FBEA 2Q89A 2X7PA 4X48A 3KZGA 5F24A 3KBRA 1EZ9A 2NOOA 4JBZA 2OK2A 1NNTA 2P0SA 3HN0A 4RK2A 3U1OA 2I6EA 4OYVA 2WX9A 1MH3A 1O63A 3ONMA 2Q88A 3SESA 1FRPA 2DE2A 4N4UA 5IZZA 5K2XA 3OO6A 3JZJA 2H4IA 2F78A 5AA1A 1BP5A 1VE4A 4IO2A 2B65A 4GWZA 4U4SA 2F34A 3RT8A 3PPNA 2PMSA 3M8UA 4ZS9A 4NWDA 5DT6A 4EQ9A 1DSNA 2XWKA 3VV5A 4NF5B 3OEKA 1TT1A 3GBAA 2GHAA 1XVYA 4ELQA 4PE5B 1QVSA 1Y9UA 1ELJA 3RGYA 4C0RA 1BK4A 2VT5A 4YZZA 3R26A 3TCHA 3C34A 1URGA 3O6GA 4G68C 3CIJA 2RCBA 3D4GA 2XWIA 3IFAA 1KWHA 2Q74A 3OMBA 2UVIA 1D9YA 3QAXA 5H8SA 3ISPA 3MVWA 5EYFA 4Q8RA 3E4RA 1R9QA 3HCQA 4GWXA 4YKPA 1IXCA 2X7QA 4DZ1A 2DXYA 1QGXA 3MBPA 4G8NA 4PDDA 4MNIA 3ZKLA 1B7HA 1XOCA 3EPEA 4MMPA 2CMOA 4F19A 4F22A 1TXFA 3IL1B 3USDA 3KBZA 3UA8A 4PFRA 5H8QA 3G7WA 4G2ZA 1LLSA 4G68B 3O6HA 1SBPA 1NV7A 3SEXA 4PFUA 2Y7WA 4N15A 3RPWA 4MHFA 3PPQA 2YPNA 4H46A 1JVYA 1LCFA 5DEXA 1TFAA 1PBQA 3MPKA 5IZ3B 4QFKA 5CBSA 1H43A 5AE4A 2VD3A 3TTMA 4ND9A 4H8IA 1NV6A 3IB0A 4PFBA 1ZLQA 3IOVA 3SEWA 4R2FA 3TTLA 3JV9A 3QUFA 3K1PA 4OTEA 4GWOA 2ZMBA 4KXPA 4P0IA 4BDOA 5LOMA 3T66A 3FVGA 3D4CA 3VFJA 3KOSA 1LBVA 1DCUA 4JB7A 5I56B 2F6PA 4YAHX 3QIMA 1MS7A 2XXKA 2XXUA 5ICTA 3MZ1A 1B0HA 4JSOA 2GHBA 3WAFA 2DWIA 4DE8A 3IORA 1IUDA 4NF4B 1NUXA 1NV1A 1SYIA 3DP8A 2VP1A 5CMMA 3RTFB 4TLMB 5ET6A 4F31B 1SQYA 4FEBA 4AB6A 4OFLA 3G3KA 1DK4A 2WBBA 3K01A 4F3SA 1OQHA 2PX1A 1FQCA 4G77A 2QPQA 3TYHA 4IGRA 4O3BA 3JYRA 3CFXA 1FPLA 3FD3A 2HPGA 3UIFA 1WODA 3NOHA 3T9HB 1FPKA 4R72A 1LCTA 1BIYA 4EXLA 4GWSA 4ESXA 3HPIA 3FV1A 1Y3NA 4OETA 5ITPA 4OENA 4POXA 1FTKA 1QKAA 4QHQA 2WBDA 3H7MA 3V5AA 4ZEDA 3S9EA 1B32A 2Y84A 4ZEFA 2A5TA 3W9VA 2DE3A 1D9QA 5EHMA 1M5BA 1EZOA 1SYHA 1SI1A 1LBBA 3FJMA 4LQ2A 1NV0A 3KN8A 1UTHA 5BUUA 1JVXA 4OESA 5HPQA 3T0JA 1GV8A 4OXVA 5J16A 4KCCA 2ONRA 1A8FA 1II5A 4ONYA 1N76A 4O3CA 3S9LC 2XX7A 1BKAA 3MVYA 1B1XA 2P3VA 2G29A 3T1BA 2P3NA 5DVJA 1LBXA 2XXWA 2BJIA 1UIVA 1EYKA 2OWSA 3MJNA 5I3SA 3EKIA 5LDZA 4ZDMA 4F3PA 5DYHA 1Z7ME 3H6WA 1YPNA 5H8NB 2D5WA 3EN3A 1JW1A 2DP8A 5JTYA 2UVJA 3M3FA 1FSAA 2Q8MA 1N84A 4GL8A 3RLFE 5CM6A 3H4ZA 4U2RA 2OWZA 3T93B 4KI0E 2DWJA 3KN3A 4HCWA 3RNNA 2XXPA 3IFCA 3IOWA 3PUYE 2ZXTA 3PMXA 3U8QA 3UGWA 5EYHA 4H8JA 4NMYA 1EZPA 2Y7PA 4EDPA 2I58A 2QS1A 4PQJA 1F9BA 3CFZA 1S9TA 2I48A 4G8HA 4HXVA 4ZEIA 3OSQA 4PE3A 1LAGE 1JEUA 1AL3A 4GWYA 3CG3A 3U93A 3CRBA 4C1UA 4KPTA 5AA2B 3N5LA 3PUVE 4OEUA 2HXWA 1KZ8A 5AA2D 3RPLB 4PP0A 4I62A 2KR0A 2ZYKA 3B6WA 3SZPA 2QVRA 5I2NA 5KCJB 1PBPA 1Y20A 4F1VA 3HHFA 4M1VA 3H6VA 4NHBA 4I8CA 1OLAA 3KSJA 3HO7A 3VDFA 2DXRA 3H06B 3H3GA 4OQOA 4KD5A 1Y3QA 4G61A 1M5CA 5A5XB 1SDXA 1M5EA 2FVZA 3THIA 1LBZA 4PFYA 1D4NA 3P7IA 1B9JA 4FE8A 4Q0CA 1NUZA 4PBQA 1FBFA 1IMFA 2QS2A 3PUXE 3SEYA 3W9WA 4ZZAA 3V83A 4MCOA 1Y3PA 2G93A 4NF6B 2PVUA 3CSGA 3GBBA 3LBSA 4P56A 3CFLA 5EQ9A 4O3AA 4MLVA 2I3WA 2Y5KA 2I4CA 2I4BA 3O97A 4IGTA 1AIVA 5JK4A 1YTVA 3SEUA 1MXWA 3ZKKA 5F7VA 1FTMA 4C1TA 4NF5A 3U94A 5I59B 3K6VA 1N0TA 4HTGA 1JETA 1JQFA 3LV0A 1LFHA 1YYZA 4H1XA 2B3FA 1H76A 2AL4A 1IXGA 1LBYA 1TFDA 4ISUA 5CBRA 1RYXA 1N7WA 3LUYA 4P0GA 4DXBA 5HM4B 4UA8A 1OVTA 2CEXA 1EH3A 5AA4B 2QSXA 2W7YA 2PBWA 4LONB 1LFIA 4Q30B 3H6TA 1SW4A 4XKQA 1H3DA 2GRVA 4F2OA 3IJOB 1FQDA 3K6UA 2BJJX 4HE0A 2ZNSA 1MDQA 5FTHA 1B52A 3TELA 2F35A 4OFJA 1ZMGA 2RINA 4DXUA 1B7ZA 4KYEA 3PPPA 1A99A 2Z8DA 4RPOA 2ZYMA 1SW1A 1P1WA 4KFQA 2OZZA 2V3QA 3M3KA 2Z23A 1B5IA 4F29A 2AL5A 4G68A 4MLQA 4N8YA 1YXIA 1IMBA 2QFLA 5CI5A 2DVCA 2PT1A 2R8TA 3CR9A 2Z8EA 3S2VA 2Y7RA 3U92A 4OA4A 4DCXA 3MPLA 4X8RA 3FATA 1FBHA 2WYPA 4PFIA 2OBGA 3FJ7A 1Z7NE 3TQLA 3B8BA 4EUOA 4XKNA 2Y5LA 1FPDA 5IZ3A 1IMCA 4JWOA 5HBCA 3C31A 4L17A 4O7IA 4BDMA 1FCKA 1H44A 4N17A 4LZ5A 1QJMA 2HZKA 2V93A 5FTIA 3K2DA 4OZ9A 2R71A 4XKPA 2GH9A 5IGAA 5I56A 1B6HA 1XVXA 4RY1A 3B6QA 4YKJA 4KCDA 1FQAA 1US5A 3BKIB 4O7MA 4LATA 4G4PA 4GQOA 2FNCA 3L6GA 2X26A 4NF4A 1URDA 3O2AA 4E0XA 2Q8JA 4F2QA 4X9TA 3VVFA 3T9XB 1FTAA 3TUSA 4XFEA 5LTCA 4POWA 2DYXA 3HFUA 2OJTA 4IO3A 2D3IA 4E0WA 1BTJA 3TDJA 3AXFA 2KLFA 3B7DA 3E3KA 2XX9A 2M8CA 4PFTA 4MNCA 4GL0A 3KOTA 5TU0A 3IX1A 4R9FA 3W15C 2V25A 1Y1ZA 1B40A 1NNPA 4TLLB 3RUMA 3OO9A 4BDQA 2F7BA 4WXJA 2WYKA 3IAZA 1Y1MA 1I6QA 1PDAA 5FHOA 2HZLA 4QSCA 3E13X 4P1EA 2I3VA 4PDHA 3UORA 2F97A 1H45A 2IEEA 3K02A 3ZS6A 4R75A 2VD2A 1UQWA 1MQHA 3UK4A 4GWUA 4QRZA 2D21A 2ESNA 4YKIA 1LBWA 4P47A 1R1NA 2QVVA 1FTJA 4NF8B 2FIXA 4BDNA 1SI0A 3FBPA 2O51A 5I58B 5TP9B 4DXCA 4UACA 3VXCA 4OHNA 2O7IA 2FHYA 4QFOA 4WKMA 1D9VA 4H6DA 4Z0IA 3U72A 3O28A 5L9MA 4GWWA 1AWBA 4MF3A 5IZ1A 1A54A 5KZTA 4QSEA 1QUJA 3G3GA 4NG7A 1ATGA 2ZYOA 3MZ9A 3M3LA 4P11A 4YU0A 3I3VA 1MQDA 5H8NA 1FPIA 1LAHE 2XD3A 3ODBA 2HEUA 1FPEA 3IOUA 4ECFA 1BLFA 4RXLA 5FHMA 3EHTA 2Z8FA 3KC0A 3TPAA 1NUYA 5DTBA 1MY4A 2I49A 4ESWA 1NV3A 2NWJA 5M2VA 4G8MA 4KR5A 4DIGA 3TCFA 1MXXA 3MAMA 5A5LA 1MPCA 2UVHA 3H03A 4I1DA 2MKZA 1UIUA 3KEIA 4U21A 3PMWA 3E79A 1MDP1 3EQ1A 3O29A 4MEVA 5AA2A 4XF5A 4GXSB 4BDRA 3TTNA 1DPPA 3OSRA 5ET5A 1IXHA 2YJPA 4RPNA 3CHGA 3K00A 3RPLA 3FGSA 1IQ7A 1RKMA 2ONKE 2Y7IA 1B2HA 1URSA 2I0BA 4RK9A 5KCJA 4MJOA 3KJ7A 4R6YA 4PAKA 4THIA 3PV0E 4BDLA 3LUZA 3A3CA 2PT2A 3OO8A 4O8MA 4P9KA 5A5XA 2THIA 2PYYA 2XXQA 1RDYA 3BIGA 1MM7A 1KA1A 3KGCA 4MFIA 4ELOA 1NH7A 5I2KB 1J1NA 3PPOA 1MRPA 3SEVA 2CZHA 3FVOA 4ELPA 1B3HA 2F8DA 3TTRA 3TEPA 4DCYA 1GTKA 4NF6A 3K1NA 4XEQA 2V3TA 1B3LA 3ROJA 1NUWA 3C33A 2QMXA 4HS7A 4GVOA 1MQIA 3PTYA 4NQ8A 4OVSA 1I6AA 4H5GA 4YICA 2XXVA 2QL3A 2IA4A 1QW0A 5T3JA 1RYOA 1IMEA 1S7YA 3LR1A 4HW8A 1MY3A 3QSLA 3PUWE 3IO6A 5I59A 1RDXA 1ZBMA 2XWOA 3RYDA 1SPIA 3N26A 2Z22A 4NF0A 1FPJA 2XXRA 3UN6A 1MXYA 1UTBB 1USYE 2XXYA 4GD5A 4NEDA 3Q26A 2H25A 5B7DA 4R73A 1B3GA 1FQFA 3PD8A 1B7UA 4GX3A 5I57B 3IK6B 3TCGA 5CRYA 4N6PA 3MP6A 5I7IA 5AA4A 1A40A 3LSXA 4PETA 4NGUA 1FPBA 2NXOA 5B70A 3OXNA 1US4A 3TAJA 4FJPA 4U4XA 5FBPA 2F3DA 1YCJA 1LB8A 1HSEA 3RY3A 2P2AA 4EF1A 2NUVA 4ELRA 4NN3A 4IB2A 4IO5A 3PU5A 3T22A 1Q9DA 4RYAA 4QFNA 3K1MA 2XA5A 4RNSA 4XXUA 5KDTB 3G3JA 1JNFA 2O84X 3EF7A 2XXTA 1XS5A 2Q9TA 4U1OA 4GF8A 2ZZXA 3S9NC 3R6UA 1LGBC 5EQAA 1FBDA 4F3GA 1G0IA 3S4UA 2FYIA 3FASA 1JW4A 4PF8A 3ECRA 4PAFA 1P1NA 1AMFA 1SW2A 3O9PA 4MAGA 2DOJA 2DWAA 3H6UA 4PC9A 1POTA 1M5DA 1MM6A 2VGQA 3T96B 5ICQA 1P1OA 3BBRA 2HXRA 4JDFA 4F18A 3UP9A 2RC8A 3VXBA 2RC7A 2H9BA 4TQUQ 1PB7A 4AQ4A 3BFTA 1PEBA 1DMBA 3VLVA 3SETA 2WKYA 1JW5A 1AOVA 3B50A 1MPBA 3C4MA 2DS9A 1K9ZA 5ET7A 1MG1A 2HAVA 5ESYA 3QYTA 1LBCA 3A3UA 3F11A 3MQ9A 4FORA 3IB1A 1G0HA 2KQZA 2REJA 5EYGA 1B1HA 1O64A 5K2YA 2JJKA 3FJGA 2H98A 3A29A 3DLNA 5AA3A 3MUQA 1XT8A 1PB9A 4N91A 3MW0A 2E1SA 2ZZWA 2HAUA 5H8HB 3LSFB 4H65A 1B3EA 1D3KA 4I3YA 2WEFA 1B46A 3PUZE 5ELVA 5TPAB 2UYEA 2XX8A 4FEDA 1OIBA 4EQ7A 1ZTYA 4OMBA 3MWBA 1XHYA 1B05A 1LB9A 1VSOA 4PBHA 1FBCA 2B4LA 3K6XA 4R6HA 3VVDA 2CEYA 4N6DA 1B3FA 4ZEKA 1I69A 4LA9A 1DPEA 1QUIA 2O69A 1XI6A 4JVDA 3CG1A 4LP2B 1KA0A 3FIRA 5H8FB 5F1QA 4OANA 1Q35A 2VPNA 1A55A 1JEVA 4ZECA 4I40A 4XKRA 4IO4A 4YKKA 1FQEA 3MSTA 3VLUA 3E78A 4PF6A 3N6UA 2HFBA 3DP4A 4NF8A 5EQ8A 1YZ0A 2A5SA 4DLDA 5EQ7A 1OLCA 3FUZA 5I58A 5TP9A 1O7TA 3GYYA 2GQ1A 4N07A 1FBPA 5CMCA 3ILUB 3FZVA 3ILTB 3GLBA 4HE2A 4NE4A 2ZZVA 3IOTA 4R9GA 1FW0A 4ZE8A 4FATA 3TKDA 4N6KA 4OVPA 3G3HA 1ZKBA 1DTGA 2ZYNA 4YB6A 4U22A 4OERA 1NL5A 4NWCA 1MQJA 1IXIA 3MC2A 2OLBA 3TODA 3ZSFA 4YMAA 1QUKA 1NV2A 4KHZE 3MVXA 2B4MA 4JSDA 1WVJA 1A8EA 1GVCA 3I5OA 1GGGA 1MH4A 4I9DA 3N6TA 1MXZA 4BLAA 1QULA 4H67A 3EHSA 4QXDA 1P1QA 3FXRA 3QUJA 3TFLA 1FTOA 1LSTA 3MP1A 4KYDA 4MX6A 1LEVA 3SERA 5DVIA 1MXVA 5CMKA 1ZU0A 1I6BA 2F7AA 2ANJA 3HSTA 3O66A 1MY1A 2REGA 5L9OA 1P1UA 1L5TA 3C9HA 2XD2A 3E9XA 3T9VA 4P3LA 1OQGA 2PFYA 2FA7A 4MBPA 3FV2A 3GZGA 2FBPA 5IAIA 1CB6A 2HHMA 4XTCQ 2QJEA 4O94A 4OVQA 3KC1A 1HSLA 1VR5A 4F1YA 1IIWA 1CE2A 1SD3A 4P1LA 5L8DA 2PCRA 4U23A 2ONSA 3LC8A 3BFUA 4TOZA 3KN7A 4XIGQ 5IKBA 4QSDA 5I2KA 4IO6A 2UVGA 4F39A 2AYSA 4HE1A 4EQBA 4JXIA 2QS4A 1ZIUA 2HCAA 3DP6A 1B0LA 4Q5TA 4R2BA 3TQWA 2VOZA 3MYUA 5FHNA 2V3UA 4AS4A 4AS5A 3TTKA 3G3IA 1K9YA 1LAFE 3SDFA 3O6IA 4ZZEA 3DM0A 2CZIA 2UYFA 1NV4A 3CI8A 3SKPA 3PMVA 3V8XB 1USYH 2QS3A 1NMUA 1B5JA 4WEDA 1DOTA 4OFOA 2OX3A 4JWYA 2CZLA 4ZEBA 2XXHA 4QFLA 1A7LA 1RDZA 4MH5A 5H8QB 1UTBA 2R9JA 2XWVA 4IY5A 4GLIA 3L6HA 1EYJA 1MQGA 4X1BA 2R6GE 1IEJA 1M5FA 2HQ0A 5I57A 3K6WA 4R74A 1B51A 2I0CA 2P1SA 3BIHA 5DW8A 2RCAA 4IO7A 1OMPA 4OWDA 4P8BA
chains in the Genus database with same CATH topology
2GFEA 3KFMA 4GRKA 1MPDA 1NKXA 1XC1A 2DVZA 2V84A 2O7UA 5DEXB 3RTWB 1B4HA 3CVGA 3FXQA 2E0SA 4FECA 2VHAA 2NVUB 5CMBA 1B58A 2UXAA 4GXAA 4FAJA 1R6ZA 4RJZA 5KDTA 4GIZA 2O1LA 1N7XA 3HV1A 2QMWA 1N3WA 3PD9A 4KQPA 1B5HA 3QXMA 5J1DA 4LZ8A 3VLWA 1N04A 3HHGA 2RC9A 1MY2A 3TMGA 1Q1KA 2ZNUA 3TZAA 3R7XA 4N13A 1NFTA 4GFRA 3EHUA 3K0VA 3RN8A 1TWYA 4DDDA 4F3BA 2OWTA 1N3XA 3OENA 3MZBA 2XHDA 3Q25A 1PC3A 1YAEA 3OO7A 2DWHA 4F1UA 2XXXA 4X1DA 2DQVA 2O68A 4YB5A 3OOAA 5L9SA 3PPRA 2AIXA 1Y4CA 5DVFA 2ZNTA 4EF2A 2Q2AA 4LQ5A 1P99A 4HCYA 3RT6B 2YLNA 4YMBA 2RF1A 1MY0A 4OEVA 3C36A 5H8HA 3MP8A 3LSLA 2H5YA 4OVJA 1T0KA 5TPAA 2A5TB 1FQBA 2XXIA 2F7CA 5BWJA 4PFWA 2F36A 3IB2A 3PGFA 1NNKA 4WEPA 4LVQA 1SVXB 4FIMA 4IY6A 3KSXA 3I6VA 1R9LA 2O1MA 3K4UA 3DELB 4RA1A 1UTHB 4Z7EA 1PB8A 2F6GA 4NTLA 4JWXA 3KG2A 4YB7A 4H5FA 5I84A 4R6KA 3FVNA 3IR1A 1HSJA 3IO4A 1FTLA 1DTZA 1QKBA 3OEMA 1ZJLA 2O6AA 2ALUA 3VE1B 3OD7A 5ISUA 5H8FA 4QFPA 3MVZA 5EHSA 1LAXA 3GXAA 4U1ZA 3N94A 4H0WA 2Y7KA 3CSBA 5JTYB 4ZE9A 3FVKA 4KYSA 2H99A 5JEIA 1GR2A 2LAOA 2B3BA 3IJXB 3Q28A 4QF9A 1LFGA 3V89B 1POY1 1IITA 2OCUA 2F5XA 3B6TA 1ANFA 1Y4TA 3FXUA 3KJTA 1B4ZA 4GOTA 1VFDA 3LSWA 3VVEA 2RKMA 4LUBA 3S9MC 5CC2A 3QK6A 1S50A 2Q2CA 1SW5A 3C35A 1OVBA 3G3FA 3T9UA 3WAEA 3Q29A 1EU8A 3OELA 4LZ7A 2ABHA 4EXKA 1VFEA 2DSFA 5I2NB 4AB5A 4M4GA 1AH5A 1MXUA 4K3FA 2QRYA 3RQTA 1NNFA 3C32A 1WDNA 1IZ1A 1NH8A 3Q27A 5ITOA 3A09A 2DE4A 2Q89A 2X7PA 4X48A 3KZGA 3KBRA 1EZ9A 2NOOA 4JBZA 2OK2A 1NNTA 2P0SA 3HN0A 4RK2A 3U1OA 2I6EA 4OYVA 1MH3A 1O63A 3ONMA 2Q88A 3SESA 2DE2A 5K2XA 3OO6A 3JZJA 2H4IA 2F78A 5AA1A 1BP5A 1VE4A 4IO2A 2B65A 4U4SA 2F34A 3RT8A 3PPNA 2PMSA 3M8UA 4ZS9A 4NWDA 5DT6A 4EQ9A 1DSNA 3VV5A 4NF5B 3OEKA 1TT1A 3GBAA 2GHAA 1XVYA 4ELQA 4PE5B 1QVSA 1Y9UA 1ELJA 3RGYA 4C0RA 4YZZA 3TCHA 3R26A 3C34A 1URGA 3O6GA 4G68C 3CIJA 2RCBA 3D4GA 1KWHA 3OMBA 2UVIA 1D9YA 3QAXA 5H8SA 3MVWA 5EYFA 4Q8RA 3E4RA 1R9QA 3HCQA 4YKPA 1IXCA 2X7QA 4DZ1A 2DXYA 3MBPA 4G8NA 3ZKLA 1B7HA 1XOCA 3EPEA 2CMOA 4F19A 4F22A 1TXFA 3IL1B 3USDA 3UA8A 5H8QA 3G7WA 4G2ZA 1LLSA 4G68B 3O6HA 1SBPA 3SEXA 4PFUA 2Y7WA 3RPWA 3PPQA 2YPNA 1JVYA 1LCFA 5DEXA 1TFAA 1PBQA 3MPKA 4QFKA 5CBSA 1H43A 5AE4A 2VD3A 3TTMA 4ND9A 4H8IA 3IB0A 1ZLQA 3IOVA 3SEWA 4R2FA 3TTLA 3JV9A 3QUFA 3K1PA 4OTEA 4GWOA 2ZMBA 4P0IA 4BDOA 5LOMA 3T66A 3FVGA 3D4CA 3VFJA 3KOSA 4JB7A 5I56B 2F6PA 4YAHX 3QIMA 1MS7A 2XXUA 5ICTA 3MZ1A 1B0HA 4JSOA 2GHBA 3WAFA 2DWIA 4DE8A 3IORA 1IUDA 4NF4B 1SYIA 3DP8A 2VP1A 5CMMA 3RTFB 4TLMB 4F31B 1SQYA 4FEBA 4AB6A 4OFLA 3G3KA 3K01A 4F3SA 1OQHA 2PX1A 1FQCA 4G77A 2QPQA 3TYHA 4IGRA 4O3BA 3JYRA 3CFXA 3FD3A 3UIFA 1WODA 3T9HB 4R72A 1LCTA 1BIYA 4EXLA 4ESXA 3HPIA 3FV1A 1Y3NA 4OETA 5ITPA 4OENA 4POXA 1FTKA 1QKAA 4QHQA 3H7MA 3V5AA 4ZEDA 3S9EA 1B32A 2Y84A 4ZEFA 2A5TA 3W9VA 2DE3A 5EHMA 1M5BA 1EZOA 1SYHA 1SI1A 1LBBA 3FJMA 4LQ2A 3KN8A 1UTHA 5BUUA 1JVXA 4OESA 5HPQA 1GV8A 4OXVA 4KCCA 2ONRA 1A8FA 1II5A 4ONYA 1N76A 4O3CA 3S9LC 2XX7A 1BKAA 3MVYA 1B1XA 2G29A 5DVJA 2XXWA 1UIVA 2OWSA 3MJNA 4ZDMA 4F3PA 5DYHA 1Z7ME 3H6WA 1YPNA 5H8NB 2D5WA 3EN3A 1JW1A 2DP8A 5JTYA 2UVJA 3M3FA 1N84A 4GL8A 3RLFE 5CM6A 3H4ZA 4U2RA 3T93B 4KI0E 2DWJA 3KN3A 4HCWA 3RNNA 2XXPA 3IOWA 3PUYE 2ZXTA 3PMXA 3U8QA 3UGWA 4H8JA 4NMYA 1EZPA 2Y7PA 4EDPA 2I58A 2QS1A 4PQJA 1F9BA 3CFZA 1S9TA 2I48A 4G8HA 4ZEIA 3OSQA 1LAGE 1JEUA 1AL3A 3U93A 3CG3A 3CRBA 4C1UA 4KPTA 5AA2B 3N5LA 3PUVE 4OEUA 2HXWA 5AA2D 4PP0A 4I62A 2ZYKA 3B6WA 5I2NA 5KCJB 1PBPA 1Y20A 4F1VA 3HHFA 4M1VA 3H6VA 4I8CA 1OLAA 3KSJA 3HO7A 3VDFA 2DXRA 3H06B 3H3GA 4OQOA 4KD5A 1Y3QA 1M5CA 5A5XB 1SDXA 1M5EA 3THIA 4PFYA 1D4NA 3P7IA 1B9JA 4FE8A 4Q0CA 2QS2A 3PUXE 3SEYA 3W9WA 4ZZAA 3V83A 1Y3PA 2G93A 4NF6B 2PVUA 3CSGA 3GBBA 3LBSA 3CFLA 4O3AA 4MLVA 2I3WA 2I4CA 2I4BA 3O97A 4IGTA 1AIVA 5JK4A 1YTVA 3SEUA 1MXWA 3ZKKA 5F7VA 1FTMA 4C1TA 4NF5A 3U94A 5I59B 3K6VA 1N0TA 4HTGA 1JETA 1JQFA 1LFHA 4H1XA 2B3FA 1H76A 2AL4A 1IXGA 1TFDA 4ISUA 5CBRA 1RYXA 1N7WA 3LUYA 4P0GA 4DXBA 5HM4B 4UA8A 1OVTA 1EH3A 5AA4B 2QSXA 2W7YA 2PBWA 4LONB 1LFIA 4Q30B 3H6TA 1SW4A 4XKQA 1H3DA 2GRVA 4F2OA 3IJOB 1FQDA 3K6UA 2BJJX 2ZNSA 1MDQA 5FTHA 1B52A 3TELA 2F35A 4OFJA 1ZMGA 2RINA 4DXUA 1B7ZA 4KYEA 3PPPA 1A99A 2Z8DA 4RPOA 2ZYMA 1SW1A 1P1WA 4KFQA 2OZZA 2V3QA 3M3KA 2Z23A 1B5IA 4F29A 2AL5A 4G68A 4MLQA 5CI5A 2DVCA 2PT1A 3CR9A 2Z8EA 3S2VA 2Y7RA 3U92A 4DCXA 3MPLA 3FATA 2OBGA 3FJ7A 1Z7NE 3TQLA 4EUOA 4XKNA 4JWOA 5HBCA 3C31A 4L17A 4BDMA 1FCKA 1H44A 4LZ5A 1QJMA 2HZKA 2V93A 5FTIA 3K2DA 4OZ9A 2R71A 4XKPA 2GH9A 5I56A 1B6HA 1XVXA 4RY1A 3B6QA 4YKJA 4KCDA 1FQAA 1US5A 3BKIB 4LATA 4G4PA 4GQOA 2FNCA 3L6GA 2X26A 4NF4A 1URDA 3O2AA 4E0XA 2Q8JA 4F2QA 4X9TA 3VVFA 3T9XB 3TUSA 4POWA 2DYXA 2OJTA 4IO3A 2D3IA 4E0WA 1BTJA 3TDJA 3AXFA 2KLFA 3B7DA 3E3KA 2XX9A 2M8CA 4PFTA 4GL0A 3KOTA 5TU0A 3IX1A 4R9FA 3W15C 2V25A 1Y1ZA 1B40A 1NNPA 4TLLB 3RUMA 3OO9A 4BDQA 2F7BA 4WXJA 3IAZA 1Y1MA 1I6QA 1PDAA 5FHOA 2HZLA 4QSCA 3E13X 2I3VA 3UORA 2F97A 1H45A 2IEEA 3K02A 3ZS6A 4R75A 2VD2A 1UQWA 1MQHA 3UK4A 4QRZA 2D21A 2ESNA 4YKIA 1R1NA 1FTJA 4NF8B 4BDNA 1SI0A 2O51A 5I58B 5TP9B 4DXCA 4UACA 3VXCA 4OHNA 2O7IA 4QFOA 4WKMA 1D9VA 4H6DA 4Z0IA 3U72A 3O28A 5L9MA 4MF3A 1A54A 5KZTA 4QSEA 1QUJA 3G3GA 1ATGA 2ZYOA 3MZ9A 3M3LA 4P11A 4YU0A 3I3VA 1MQDA 5H8NA 1LAHE 2XD3A 3ODBA 2HEUA 3IOUA 4ECFA 1BLFA 4RXLA 5FHMA 3EHTA 2Z8FA 3TPAA 5DTBA 1MY4A 2I49A 4ESWA 2NWJA 5M2VA 4G8MA 4KR5A 4DIGA 3TCFA 1MXXA 3MAMA 1MPCA 2UVHA 3H03A 4I1DA 1UIUA 3KEIA 4U21A 3PMWA 1MDP1 3EQ1A 3O29A 5AA2A 4GXSB 4BDRA 3TTNA 1DPPA 3OSRA 1IXHA 2YJPA 4RPNA 3K00A 3FGSA 1IQ7A 1RKMA 2ONKE 2Y7IA 1B2HA 1URSA 2I0BA 4RK9A 5KCJA 4R6YA 3KJ7A 4THIA 3PV0E 4BDLA 3A3CA 2PT2A 3OO8A 5A5XA 2THIA 2PYYA 2XXQA 1MM7A 3KGCA 4MFIA 4ELOA 1NH7A 5I2KB 1J1NA 3PPOA 1MRPA 3SEVA 3FVOA 4ELPA 1B3HA 2F8DA 3TTRA 3TEPA 4DCYA 1GTKA 4NF6A 3K1NA 2V3TA 1B3LA 3C33A 2QMXA 4HS7A 4GVOA 1MQIA 1I6AA 4H5GA 4YICA 2XXVA 2QL3A 2IA4A 1QW0A 1RYOA 1S7YA 3LR1A 4HW8A 1MY3A 3QSLA 3PUWE 3IO6A 5I59A 1ZBMA 3N26A 2Z22A 2XXRA 3UN6A 1MXYA 1UTBB 1USYE 2XXYA 4GD5A 4NEDA 3Q26A 5B7DA 2H25A 4R73A 1B3GA 1FQFA 3PD8A 1B7UA 5I57B 3IK6B 3TCGA 5CRYA 4N6PA 3MP6A 5AA4A 1A40A 3LSXA 4PETA 2NXOA 5B70A 3OXNA 1US4A 3TAJA 4FJPA 4U4XA 1YCJA 1LB8A 1HSEA 3RY3A 2P2AA 4EF1A 2NUVA 4ELRA 4IB2A 4IO5A 3PU5A 3T22A 4RYAA 4QFNA 3K1MA 4RNSA 4XXUA 5KDTB 3G3JA 1JNFA 2O84X 3EF7A 2XXTA 1XS5A 2Q9TA 4U1OA 4GF8A 3S9NC 3R6UA 1LGBC 4F3GA 3S4UA 2FYIA 3FASA 1JW4A 3ECRA 1P1NA 1AMFA 1SW2A 3O9PA 2DOJA 2DWAA 3H6UA 1POTA 1M5DA 1MM6A 2VGQA 3T96B 5ICQA 1P1OA 3BBRA 4JDFA 4F18A 3UP9A 2RC8A 3VXBA 2RC7A 2H9BA 4TQUQ 1PB7A 4AQ4A 3BFTA 1PEBA 1DMBA 3VLVA 3SETA 2WKYA 1JW5A 1AOVA 1MPBA 3C4MA 2DS9A 1MG1A 2HAVA 3QYTA 1LBCA 3A3UA 3F11A 3MQ9A 4FORA 3IB1A 2REJA 1B1HA 1O64A 5K2YA 3FJGA 2H98A 3DLNA 5AA3A 3MUQA 1XT8A 1PB9A 3MW0A 2E1SA 2HAUA 5H8HB 3LSFB 4H65A 1B3EA 1D3KA 1B46A 3PUZE 5ELVA 5TPAB 2UYEA 2XX8A 4FEDA 1OIBA 4EQ7A 1ZTYA 4OMBA 3MWBA 1XHYA 1B05A 1LB9A 1VSOA 3K6XA 4R6HA 3VVDA 1B3FA 4ZEKA 1I69A 4LA9A 1DPEA 1QUIA 2O69A 3CG1A 4LP2B 3FIRA 5H8FB 5F1QA 1Q35A 1A55A 1JEVA 4ZECA 4XKRA 4IO4A 4YKKA 1FQEA 3VLUA 3N6UA 2HFBA 3DP4A 4NF8A 2A5SA 4DLDA 1OLCA 3FUZA 5I58A 5TP9A 1O7TA 4N07A 5CMCA 3ILUB 3FZVA 3ILTB 3GLBA 4NE4A 3IOTA 4R9GA 1FW0A 4ZE8A 4FATA 3TKDA 3G3HA 1ZKBA 1DTGA 2ZYNA 4YB6A 4U22A 4OERA 1NL5A 4NWCA 1MQJA 1IXIA 3MC2A 2OLBA 3TODA 3ZSFA 4YMAA 1QUKA 4KHZE 3MVXA 4JSDA 1WVJA 1A8EA 1GVCA 3I5OA 1GGGA 1MH4A 4I9DA 3N6TA 1MXZA 4BLAA 1QULA 4H67A 3EHSA 1P1QA 3FXRA 3QUJA 3TFLA 1FTOA 1LSTA 3MP1A 4KYDA 3SERA 5DVIA 1MXVA 5CMKA 1ZU0A 1I6BA 2F7AA 2ANJA 3HSTA 3O66A 1MY1A 2REGA 5L9OA 1P1UA 1L5TA 3C9HA 2XD2A 3E9XA 3T9VA 1OQGA 2FA7A 4MBPA 3FV2A 3GZGA 5IAIA 1CB6A 4XTCQ 2QJEA 1HSLA 1VR5A 4F1YA 1IIWA 1CE2A 1SD3A 5L8DA 4U23A 2ONSA 3LC8A 3BFUA 4TOZA 3KN7A 4XIGQ 5IKBA 4QSDA 5I2KA 4IO6A 2UVGA 4F39A 2AYSA 4EQBA 4JXIA 2QS4A 1ZIUA 2HCAA 3DP6A 1B0LA 4Q5TA 4R2BA 3TQWA 2VOZA 5FHNA 2V3UA 3TTKA 3G3IA 1LAFE 3SDFA 3O6IA 4ZZEA 3DM0A 2UYFA 3CI8A 3SKPA 3PMVA 3V8XB 1USYH 2QS3A 1NMUA 1B5JA 4WEDA 1DOTA 4OFOA 4JWYA 2CZLA 4ZEBA 2XXHA 4QFLA 1A7LA 4MH5A 5H8QB 1UTBA 2R9JA 4IY5A 4GLIA 3L6HA 1MQGA 4X1BA 2R6GE 1IEJA 1M5FA 2HQ0A 5I57A 3K6WA 4R74A 1B51A 2I0CA 2P1SA 2RCAA 4IO7A 1OMPA 4OWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFE A;  3KFM A;  4GRK A;  1MPD A;  1NKX A;  1XC1 A;  2DVZ A;  2V84 A;  2O7U A;  5DEX B;  3RTW B;  1B4H A;  3CVG A;  3FXQ A;  2E0S A;  4FEC A;  2VHA A;  2NVU B;  5CMB A;  1B58 A;  2UXA A;  4GXA A;  4FAJ A;  1R6Z A;  4RJZ A;  5KDT A;  4GIZ A;  2O1L A;  1N7X A;  3HV1 A;  2QMW A;  1N3W A;  3PD9 A;  4KQP A;  1B5H A;  3QXM A;  5J1D A;  4LZ8 A;  3VLW A;  1N04 A;  3HHG A;  2RC9 A;  1MY2 A;  3TMG A;  1Q1K A;  2ZNU A;  3TZA A;  3R7X A;  4N13 A;  1NFT A;  4GFR A;  3EHU A;  3K0V A;  3RN8 A;  1TWY A;  4DDD A;  4F3B A;  2OWT A;  1N3X A;  3OEN A;  3MZB A;  2XHD A;  3Q25 A;  1PC3 A;  1YAE A;  3OO7 A;  2DWH A;  4F1U A;  2XXX A;  4X1D A;  2DQV A;  2O68 A;  4YB5 A;  3OOA A;  5L9S A;  3PPR A;  2AIX A;  1Y4C A;  5DVF A;  2ZNT A;  4EF2 A;  2Q2A A;  4LQ5 A;  1P99 A;  4HCY A;  3RT6 B;  2YLN A;  4YMB A;  2RF1 A;  1MY0 A;  4OEV A;  3C36 A;  5H8H A;  3MP8 A;  3LSL A;  2H5Y A;  4OVJ A;  1T0K A;  5TPA A;  2A5T B;  1FQB A;  2XXI A;  2F7C A;  5BWJ A;  4PFW A;  2F36 A;  3IB2 A;  3PGF A;  1NNK A;  4WEP A;  4LVQ A;  1SVX B;  4FIM A;  4IY6 A;  3KSX A;  3I6V A;  1R9L A;  2O1M A;  3K4U A;  3DEL B;  4RA1 A;  1UTH B;  4Z7E A;  1PB8 A;  2F6G A;  4NTL A;  4JWX A;  3KG2 A;  4YB7 A;  4H5F A;  5I84 A;  4R6K A;  3FVN A;  3IR1 A;  1HSJ A;  3IO4 A;  1FTL A;  1DTZ A;  1QKB A;  3OEM A;  1ZJL A;  2O6A A;  2ALU A;  3VE1 B;  3OD7 A;  5ISU A;  5H8F A;  4QFP A;  3MVZ A;  5EHS A;  1LAX A;  3GXA A;  4U1Z A;  3N94 A;  4H0W A;  2Y7K A;  3CSB A;  5JTY B;  4ZE9 A;  3FVK A;  4KYS A;  2H99 A;  5JEI A;  1GR2 A;  2LAO A;  2B3B A;  3IJX B;  3Q28 A;  4QF9 A;  1LFG A;  3V89 B;  1POY 1;  1IIT A;  2OCU A;  2F5X A;  3B6T A;  1ANF A;  1Y4T A;  3FXU A;  3KJT A;  1B4Z A;  4GOT A;  1VFD A;  3LSW A;  3VVE A;  2RKM A;  4LUB A;  3S9M C;  5CC2 A;  3QK6 A;  1S50 A;  2Q2C A;  1SW5 A;  3C35 A;  1OVB A;  3G3F A;  3T9U A;  3WAE A;  3Q29 A;  1EU8 A;  3OEL A;  4LZ7 A;  2ABH A;  4EXK A;  1VFE A;  2DSF A;  5I2N B;  4AB5 A;  4M4G A;  1AH5 A;  1MXU A;  4K3F A;  2QRY A;  3RQT A;  1NNF A;  3C32 A;  1WDN A;  1IZ1 A;  1NH8 A;  3Q27 A;  5ITO A;  3A09 A;  2DE4 A;  2Q89 A;  2X7P A;  4X48 A;  3KZG A;  3KBR A;  1EZ9 A;  2NOO A;  4JBZ A;  2OK2 A;  1NNT A;  2P0S A;  3HN0 A;  4RK2 A;  3U1O A;  2I6E A;  4OYV A;  1MH3 A;  1O63 A;  3ONM A;  2Q88 A;  3SES A;  2DE2 A;  5K2X A;  3OO6 A;  3JZJ A;  2H4I A;  2F78 A;  5AA1 A;  1BP5 A;  1VE4 A;  4IO2 A;  2B65 A;  4U4S A;  2F34 A;  3RT8 A;  3PPN A;  2PMS A;  3M8U A;  4ZS9 A;  4NWD A;  5DT6 A;  4EQ9 A;  1DSN A;  3VV5 A;  4NF5 B;  3OEK A;  1TT1 A;  3GBA A;  2GHA A;  1XVY A;  4ELQ A;  4PE5 B;  1QVS A;  1Y9U A;  1ELJ A;  3RGY A;  4C0R A;  4YZZ A;  3TCH A;  3R26 A;  3C34 A;  1URG A;  3O6G A;  4G68 C;  3CIJ A;  2RCB A;  3D4G A;  1KWH A;  3OMB A;  2UVI A;  1D9Y A;  3QAX A;  5H8S A;  3MVW A;  5EYF A;  4Q8R A;  3E4R A;  1R9Q A;  3HCQ A;  4YKP A;  1IXC A;  2X7Q A;  4DZ1 A;  2DXY A;  3MBP A;  4G8N A;  3ZKL A;  1B7H A;  1XOC A;  3EPE A;  2CMO A;  4F19 A;  4F22 A;  1TXF A;  3IL1 B;  3USD A;  3UA8 A;  5H8Q A;  3G7W A;  4G2Z A;  1LLS A;  4G68 B;  3O6H A;  1SBP A;  3SEX A;  4PFU A;  2Y7W A;  3RPW A;  3PPQ A;  2YPN A;  1JVY A;  1LCF A;  5DEX A;  1TFA A;  1PBQ A;  3MPK A;  4QFK A;  5CBS A;  1H43 A;  5AE4 A;  2VD3 A;  3TTM A;  4ND9 A;  4H8I A;  3IB0 A;  1ZLQ A;  3IOV A;  3SEW A;  4R2F A;  3TTL A;  3JV9 A;  3QUF A;  3K1P A;  4OTE A;  4GWO A;  2ZMB A;  4P0I A;  4BDO A;  5LOM A;  3T66 A;  3FVG A;  3D4C A;  3VFJ A;  3KOS A;  4JB7 A;  5I56 B;  2F6P A;  4YAH X;  3QIM A;  1MS7 A;  2XXU A;  5ICT A;  3MZ1 A;  1B0H A;  4JSO A;  2GHB A;  3WAF A;  2DWI A;  4DE8 A;  3IOR A;  1IUD A;  4NF4 B;  1SYI A;  3DP8 A;  2VP1 A;  5CMM A;  3RTF B;  4TLM B;  4F31 B;  1SQY A;  4FEB A;  4AB6 A;  4OFL A;  3G3K A;  3K01 A;  4F3S A;  1OQH A;  2PX1 A;  1FQC A;  4G77 A;  2QPQ A;  3TYH A;  4IGR A;  4O3B A;  3JYR A;  3CFX A;  3FD3 A;  3UIF A;  1WOD A;  3T9H B;  4R72 A;  1LCT A;  1BIY A;  4EXL A;  4ESX A;  3HPI A;  3FV1 A;  1Y3N A;  4OET A;  5ITP A;  4OEN A;  4POX A;  1FTK A;  1QKA A;  4QHQ A;  3H7M A;  3V5A A;  4ZED A;  3S9E A;  1B32 A;  2Y84 A;  4ZEF A;  2A5T A;  3W9V A;  2DE3 A;  5EHM A;  1M5B A;  1EZO A;  1SYH A;  1SI1 A;  1LBB A;  3FJM A;  4LQ2 A;  3KN8 A;  1UTH A;  5BUU A;  1JVX A;  4OES A;  5HPQ A;  1GV8 A;  4OXV A;  4KCC A;  2ONR A;  1A8F A;  1II5 A;  4ONY A;  1N76 A;  4O3C A;  3S9L C;  2XX7 A;  1BKA A;  3MVY A;  1B1X A;  2G29 A;  5DVJ A;  2XXW A;  1UIV A;  2OWS A;  3MJN A;  4ZDM A;  4F3P A;  5DYH A;  1Z7M E;  3H6W A;  1YPN A;  5H8N B;  2D5W A;  3EN3 A;  1JW1 A;  2DP8 A;  5JTY A;  2UVJ A;  3M3F A;  1N84 A;  4GL8 A;  3RLF E;  5CM6 A;  3H4Z A;  4U2R A;  3T93 B;  4KI0 E;  2DWJ A;  3KN3 A;  4HCW A;  3RNN A;  2XXP A;  3IOW A;  3PUY E;  2ZXT A;  3PMX A;  3U8Q A;  3UGW A;  4H8J A;  4NMY A;  1EZP A;  2Y7P A;  4EDP A;  2I58 A;  2QS1 A;  4PQJ A;  1F9B A;  3CFZ A;  1S9T A;  2I48 A;  4G8H A;  4ZEI A;  3OSQ A;  1LAG E;  1JEU A;  1AL3 A;  3U93 A;  3CG3 A;  3CRB A;  4C1U A;  4KPT A;  5AA2 B;  3N5L A;  3PUV E;  4OEU A;  2HXW A;  5AA2 D;  4PP0 A;  4I62 A;  2ZYK A;  3B6W A;  5I2N A;  5KCJ B;  1PBP A;  1Y20 A;  4F1V A;  3HHF A;  4M1V A;  3H6V A;  4I8C A;  1OLA A;  3KSJ A;  3HO7 A;  3VDF A;  2DXR A;  3H06 B;  3H3G A;  4OQO A;  4KD5 A;  1Y3Q A;  1M5C A;  5A5X B;  1SDX A;  1M5E A;  3THI A;  4PFY A;  1D4N A;  3P7I A;  1B9J A;  4FE8 A;  4Q0C A;  2QS2 A;  3PUX E;  3SEY A;  3W9W A;  4ZZA A;  3V83 A;  1Y3P A;  2G93 A;  4NF6 B;  2PVU A;  3CSG A;  3GBB A;  3LBS A;  3CFL A;  4O3A A;  4MLV A;  2I3W A;  2I4C A;  2I4B A;  3O97 A;  4IGT A;  1AIV A;  5JK4 A;  1YTV A;  3SEU A;  1MXW A;  3ZKK A;  5F7V A;  1FTM A;  4C1T A;  4NF5 A;  3U94 A;  5I59 B;  3K6V A;  1N0T A;  4HTG A;  1JET A;  1JQF A;  1LFH A;  4H1X A;  2B3F A;  1H76 A;  2AL4 A;  1IXG A;  1TFD A;  4ISU A;  5CBR A;  1RYX A;  1N7W A;  3LUY A;  4P0G A;  4DXB A;  5HM4 B;  4UA8 A;  1OVT A;  1EH3 A;  5AA4 B;  2QSX A;  2W7Y A;  2PBW A;  4LON B;  1LFI A;  4Q30 B;  3H6T A;  1SW4 A;  4XKQ A;  1H3D A;  2GRV A;  4F2O A;  3IJO B;  1FQD A;  3K6U A;  2BJJ X;  2ZNS A;  1MDQ A;  5FTH A;  1B52 A;  3TEL A;  2F35 A;  4OFJ A;  1ZMG A;  2RIN A;  4DXU A;  1B7Z A;  4KYE A;  3PPP A;  1A99 A;  2Z8D A;  4RPO A;  2ZYM A;  1SW1 A;  1P1W A;  4KFQ A;  2OZZ A;  2V3Q A;  3M3K A;  2Z23 A;  1B5I A;  4F29 A;  2AL5 A;  4G68 A;  4MLQ A;  5CI5 A;  2DVC A;  2PT1 A;  3CR9 A;  2Z8E A;  3S2V A;  2Y7R A;  3U92 A;  4DCX A;  3MPL A;  3FAT A;  2OBG A;  3FJ7 A;  1Z7N E;  3TQL A;  4EUO A;  4XKN A;  4JWO A;  5HBC A;  3C31 A;  4L17 A;  4BDM A;  1FCK A;  1H44 A;  4LZ5 A;  1QJM A;  2HZK A;  2V93 A;  5FTI A;  3K2D A;  4OZ9 A;  2R71 A;  4XKP A;  2GH9 A;  5I56 A;  1B6H A;  1XVX A;  4RY1 A;  3B6Q A;  4YKJ A;  4KCD A;  1FQA A;  1US5 A;  3BKI B;  4LAT A;  4G4P A;  4GQO A;  2FNC A;  3L6G A;  2X26 A;  4NF4 A;  1URD A;  3O2A A;  4E0X A;  2Q8J A;  4F2Q A;  4X9T A;  3VVF A;  3T9X B;  3TUS A;  4POW A;  2DYX A;  2OJT A;  4IO3 A;  2D3I A;  4E0W A;  1BTJ A;  3TDJ A;  3AXF A;  2KLF A;  3B7D A;  3E3K A;  2XX9 A;  2M8C A;  4PFT A;  4GL0 A;  3KOT A;  5TU0 A;  3IX1 A;  4R9F A;  3W15 C;  2V25 A;  1Y1Z A;  1B40 A;  1NNP A;  4TLL B;  3RUM A;  3OO9 A;  4BDQ A;  2F7B A;  4WXJ A;  3IAZ A;  1Y1M A;  1I6Q A;  1PDA A;  5FHO A;  2HZL A;  4QSC A;  3E13 X;  2I3V A;  3UOR A;  2F97 A;  1H45 A;  2IEE A;  3K02 A;  3ZS6 A;  4R75 A;  2VD2 A;  1UQW A;  1MQH A;  3UK4 A;  4QRZ A;  2D21 A;  2ESN A;  4YKI A;  1R1N A;  1FTJ A;  4NF8 B;  4BDN A;  1SI0 A;  2O51 A;  5I58 B;  5TP9 B;  4DXC A;  4UAC A;  3VXC A;  4OHN A;  2O7I A;  4QFO A;  4WKM A;  1D9V A;  4H6D A;  4Z0I A;  3U72 A;  3O28 A;  5L9M A;  4MF3 A;  1A54 A;  5KZT A;  4QSE A;  1QUJ A;  3G3G A;  1ATG A;  2ZYO A;  3MZ9 A;  3M3L A;  4P11 A;  4YU0 A;  3I3V A;  1MQD A;  5H8N A;  1LAH E;  2XD3 A;  3ODB A;  2HEU A;  3IOU A;  4ECF A;  1BLF A;  4RXL A;  5FHM A;  3EHT A;  2Z8F A;  3TPA A;  5DTB A;  1MY4 A;  2I49 A;  4ESW A;  2NWJ A;  5M2V A;  4G8M A;  4KR5 A;  4DIG A;  3TCF A;  1MXX A;  3MAM A;  1MPC A;  2UVH A;  3H03 A;  4I1D A;  1UIU A;  3KEI A;  4U21 A;  3PMW A;  1MDP 1;  3EQ1 A;  3O29 A;  5AA2 A;  4GXS B;  4BDR A;  3TTN A;  1DPP A;  3OSR A;  1IXH A;  2YJP A;  4RPN A;  3K00 A;  3FGS A;  1IQ7 A;  1RKM A;  2ONK E;  2Y7I A;  1B2H A;  1URS A;  2I0B A;  4RK9 A;  5KCJ A;  4R6Y A;  3KJ7 A;  4THI A;  3PV0 E;  4BDL A;  3A3C A;  2PT2 A;  3OO8 A;  5A5X A;  2THI A;  2PYY A;  2XXQ A;  1MM7 A;  3KGC A;  4MFI A;  4ELO A;  1NH7 A;  5I2K B;  1J1N A;  3PPO A;  1MRP A;  3SEV A;  3FVO A;  4ELP A;  1B3H A;  2F8D A;  3TTR A;  3TEP A;  4DCY A;  1GTK A;  4NF6 A;  3K1N A;  2V3T A;  1B3L A;  3C33 A;  2QMX A;  4HS7 A;  4GVO A;  1MQI A;  1I6A A;  4H5G A;  4YIC A;  2XXV A;  2QL3 A;  2IA4 A;  1QW0 A;  1RYO A;  1S7Y A;  3LR1 A;  4HW8 A;  1MY3 A;  3QSL A;  3PUW E;  3IO6 A;  5I59 A;  1ZBM A;  3N26 A;  2Z22 A;  2XXR A;  3UN6 A;  1MXY A;  1UTB B;  1USY E;  2XXY A;  4GD5 A;  4NED A;  3Q26 A;  5B7D A;  2H25 A;  4R73 A;  1B3G A;  1FQF A;  3PD8 A;  1B7U A;  5I57 B;  3IK6 B;  3TCG A;  5CRY A;  4N6P A;  3MP6 A;  5AA4 A;  1A40 A;  3LSX A;  4PET A;  2NXO A;  5B70 A;  3OXN A;  1US4 A;  3TAJ A;  4FJP A;  4U4X A;  1YCJ A;  1LB8 A;  1HSE A;  3RY3 A;  2P2A A;  4EF1 A;  2NUV A;  4ELR A;  4IB2 A;  4IO5 A;  3PU5 A;  3T22 A;  4RYA A;  4QFN A;  3K1M A;  4RNS A;  4XXU A;  5KDT B;  3G3J A;  1JNF A;  2O84 X;  3EF7 A;  2XXT A;  1XS5 A;  2Q9T A;  4U1O A;  4GF8 A;  3S9N C;  3R6U A;  1LGB C;  4F3G A;  3S4U A;  2FYI A;  3FAS A;  1JW4 A;  3ECR A;  1P1N A;  1AMF A;  1SW2 A;  3O9P A;  2DOJ A;  2DWA A;  3H6U A;  1POT A;  1M5D A;  1MM6 A;  2VGQ A;  3T96 B;  5ICQ A;  1P1O A;  3BBR A;  4JDF A;  4F18 A;  3UP9 A;  2RC8 A;  3VXB A;  2RC7 A;  2H9B A;  4TQU Q;  1PB7 A;  4AQ4 A;  3BFT A;  1PEB A;  1DMB A;  3VLV A;  3SET A;  2WKY A;  1JW5 A;  1AOV A;  1MPB A;  3C4M A;  2DS9 A;  1MG1 A;  2HAV A;  3QYT A;  1LBC A;  3A3U A;  3F11 A;  3MQ9 A;  4FOR A;  3IB1 A;  2REJ A;  1B1H A;  1O64 A;  5K2Y A;  3FJG A;  2H98 A;  3DLN A;  5AA3 A;  3MUQ A;  1XT8 A;  1PB9 A;  3MW0 A;  2E1S A;  2HAU A;  5H8H B;  3LSF B;  4H65 A;  1B3E A;  1D3K A;  1B46 A;  3PUZ E;  5ELV A;  5TPA B;  2UYE A;  2XX8 A;  4FED A;  1OIB A;  4EQ7 A;  1ZTY A;  4OMB A;  3MWB A;  1XHY A;  1B05 A;  1LB9 A;  1VSO A;  3K6X A;  4R6H A;  3VVD A;  1B3F A;  4ZEK A;  1I69 A;  4LA9 A;  1DPE A;  1QUI A;  2O69 A;  3CG1 A;  4LP2 B;  3FIR A;  5H8F B;  5F1Q A;  1Q35 A;  1A55 A;  1JEV A;  4ZEC A;  4XKR A;  4IO4 A;  4YKK A;  1FQE A;  3VLU A;  3N6U A;  2HFB A;  3DP4 A;  4NF8 A;  2A5S A;  4DLD A;  1OLC A;  3FUZ A;  5I58 A;  5TP9 A;  1O7T A;  4N07 A;  5CMC A;  3ILU B;  3FZV A;  3ILT B;  3GLB A;  4NE4 A;  3IOT A;  4R9G A;  1FW0 A;  4ZE8 A;  4FAT A;  3TKD A;  3G3H A;  1ZKB A;  1DTG A;  2ZYN A;  4YB6 A;  4U22 A;  4OER A;  1NL5 A;  4NWC A;  1MQJ A;  1IXI A;  3MC2 A;  2OLB A;  3TOD A;  3ZSF A;  4YMA A;  1QUK A;  4KHZ E;  3MVX A;  4JSD A;  1WVJ A;  1A8E A;  1GVC A;  3I5O A;  1GGG A;  1MH4 A;  4I9D A;  3N6T A;  1MXZ A;  4BLA A;  1QUL A;  4H67 A;  3EHS A;  1P1Q A;  3FXR A;  3QUJ A;  3TFL A;  1FTO A;  1LST A;  3MP1 A;  4KYD A;  3SER A;  5DVI A;  1MXV A;  5CMK A;  1ZU0 A;  1I6B A;  2F7A A;  2ANJ A;  3HST A;  3O66 A;  1MY1 A;  2REG A;  5L9O A;  1P1U A;  1L5T A;  3C9H A;  2XD2 A;  3E9X A;  3T9V A;  1OQG A;  2FA7 A;  4MBP A;  3FV2 A;  3GZG A;  5IAI A;  1CB6 A;  4XTC Q;  2QJE A;  1HSL A;  1VR5 A;  4F1Y A;  1IIW A;  1CE2 A;  1SD3 A;  5L8D A;  4U23 A;  2ONS A;  3LC8 A;  3BFU A;  4TOZ A;  3KN7 A;  4XIG Q;  5IKB A;  4QSD A;  5I2K A;  4IO6 A;  2UVG A;  4F39 A;  2AYS A;  4EQB A;  4JXI A;  2QS4 A;  1ZIU A;  2HCA A;  3DP6 A;  1B0L A;  4Q5T A;  4R2B A;  3TQW A;  2VOZ A;  5FHN A;  2V3U A;  3TTK A;  3G3I A;  1LAF E;  3SDF A;  3O6I A;  4ZZE A;  3DM0 A;  2UYF A;  3CI8 A;  3SKP A;  3PMV A;  3V8X B;  1USY H;  2QS3 A;  1NMU A;  1B5J A;  4WED A;  1DOT A;  4OFO A;  4JWY A;  2CZL A;  4ZEB A;  2XXH A;  4QFL A;  1A7L A;  4MH5 A;  5H8Q B;  1UTB A;  2R9J A;  4IY5 A;  4GLI A;  3L6H A;  1MQG A;  4X1B A;  2R6G E;  1IEJ A;  1M5F A;  2HQ0 A;  5I57 A;  3K6W A;  4R74 A;  1B51 A;  2I0C A;  2P1S A;  2RCA A;  4IO7 A;  1OMP A;  4OWD A; 
#chains in the Genus database with same CATH topology
 3U65 A;  2GFE A;  3KFM A;  4N8G A;  4GRK A;  1MPD A;  1NKX A;  1XC1 A;  2DVZ A;  2V84 A;  2O7U A;  5DEX B;  3RTW B;  1B4H A;  4MNP A;  3CVG A;  3FXQ A;  2E0S A;  4FEC A;  2VHA A;  2NVU B;  5CMB A;  4OVR A;  1B58 A;  1CNQ A;  2UXA A;  4GXA A;  4FAJ A;  1R6Z A;  4RJZ A;  5KDT A;  4GIZ A;  2O1L A;  4GBV A;  1N7X A;  3HV1 A;  2QMW A;  1N3W A;  4I3E A;  3PD9 A;  4KQP A;  1B5H A;  3QXM A;  5J1D A;  2V4C A;  4LZ8 A;  3VLW A;  1N04 A;  3HHG A;  4N81 A;  1IMD A;  2RC9 A;  1MY2 A;  3TMG A;  1Q1K A;  2ZNU A;  3TZA A;  3R7X A;  4DI3 D;  4N13 A;  4GX6 A;  1NFT A;  4GFR A;  3EHU A;  3K0V A;  3RN8 A;  1EYI A;  1TWY A;  4DDD A;  4F3B A;  2OWT A;  1N3X A;  3OEN A;  3MZB A;  5I5P A;  4QBA A;  2XHD A;  3Q25 A;  1PC3 A;  1YAE A;  3OO7 A;  2DWH A;  4F1U A;  2XXX A;  4X1D A;  2DQV A;  2O68 A;  4YB5 A;  3OOA A;  5L9S A;  1DBZ A;  3PPR A;  2AIX A;  1JP4 A;  1Y4C A;  5DVF A;  2ZNT A;  4GBW A;  1INP A;  4EF2 A;  2Q2A A;  2QVU A;  4LQ5 A;  1P99 A;  4HCY A;  3RT6 B;  1FPG A;  2PFZ A;  2YLN A;  4YMB A;  2RF1 A;  1MY0 A;  4OEV A;  3C36 A;  5H8H A;  3MP8 A;  3LSL A;  1FPF A;  2H5Y A;  4OVJ A;  1T0K A;  5TPA A;  2A5T B;  1FQB A;  2XXI A;  2F7C A;  4IR8 A;  5BWJ A;  4PFW A;  2F36 A;  3IB2 A;  4MIJ A;  3PGF A;  1NNK A;  4NAP A;  4WEP A;  4DI4 B;  4LVQ A;  1SVX B;  4FIM A;  4IY6 A;  3KSX A;  3I6V A;  1R9L A;  2O1M A;  3K4U A;  3DEL B;  4RA1 A;  1UTH B;  4Z7E A;  1PB8 A;  2F6G A;  2VPO A;  4NTL A;  4JWX A;  3KG2 A;  4YB7 A;  4H5F A;  5I84 A;  4R6K A;  3FVN A;  4H45 A;  4PGP A;  3IR1 A;  1FJ9 A;  1HSJ A;  3IO4 A;  1FTL A;  5ET8 A;  1DTZ A;  1NV5 A;  1QKB A;  3OEM A;  1ZJL A;  2O6A A;  2ALU A;  3VE1 B;  2DDK A;  3OD7 A;  5ISU A;  5H8F A;  4NX1 A;  4QFP A;  3MVZ A;  5EHS A;  1LAX A;  1NI9 A;  3GXA A;  4U1Z A;  3N94 A;  4H0W A;  2Y7K A;  4X04 A;  3CSB A;  1FJ6 A;  5JTY B;  4ZE9 A;  1FBG A;  3FVK A;  4KYS A;  2H99 A;  5IM2 A;  5JEI A;  1GR2 A;  2CZK A;  2LAO A;  2B3B A;  3IJX B;  4GX4 A;  3Q28 A;  4PAI A;  4QF9 A;  1LFG A;  3V89 B;  1POY 1;  1IIT A;  2OCU A;  2F5X A;  3B6T A;  1ANF A;  1VDW A;  1Y4T A;  3FXU A;  2F3B A;  3KJT A;  4OVT A;  1B4Z A;  4GOT A;  2FIE A;  1VFD A;  4UAB A;  3LSW A;  3VVE A;  4JVI A;  2RKM A;  4PCD A;  4LUB A;  3S9M C;  5CC2 A;  4PGN A;  4LN5 A;  3QK6 A;  1S50 A;  2Q2C A;  1SW5 A;  3C35 A;  1OVB A;  3G3F A;  3T9U A;  4PTK A;  3WAE A;  3Q29 A;  3D1R A;  1EU8 A;  3OEL A;  4LZ7 A;  2ABH A;  4EXK A;  1VFE A;  2DSF A;  5I2N B;  2L5V A;  3FXB A;  4FBP A;  4AB5 A;  4M4G A;  1AH5 A;  1MXU A;  4K3F A;  4JVC A;  3QMF A;  2QRY A;  3RQT A;  1NNF A;  3C32 A;  1WDN A;  1IZ1 A;  1NH8 A;  3Q27 A;  5ITO A;  3A09 A;  2DE4 A;  1IMA A;  1FBE A;  2Q89 A;  2X7P A;  4X48 A;  3KZG A;  5F24 A;  3KBR A;  1EZ9 A;  2NOO A;  4JBZ A;  2OK2 A;  1NNT A;  2P0S A;  3HN0 A;  4RK2 A;  3U1O A;  2I6E A;  4OYV A;  2WX9 A;  1MH3 A;  1O63 A;  3ONM A;  2Q88 A;  3SES A;  1FRP A;  2DE2 A;  4N4U A;  5IZZ A;  5K2X A;  3OO6 A;  3JZJ A;  2H4I A;  2F78 A;  5AA1 A;  1BP5 A;  1VE4 A;  4IO2 A;  2B65 A;  4GWZ A;  4U4S A;  2F34 A;  3RT8 A;  3PPN A;  2PMS A;  3M8U A;  4ZS9 A;  4NWD A;  5DT6 A;  4EQ9 A;  1DSN A;  2XWK A;  3VV5 A;  4NF5 B;  3OEK A;  1TT1 A;  3GBA A;  2GHA A;  1XVY A;  4ELQ A;  4PE5 B;  1QVS A;  1Y9U A;  1ELJ A;  3RGY A;  4C0R A;  1BK4 A;  2VT5 A;  4YZZ A;  3R26 A;  3TCH A;  3C34 A;  1URG A;  3O6G A;  4G68 C;  3CIJ A;  2RCB A;  3D4G A;  2XWI A;  3IFA A;  1KWH A;  2Q74 A;  3OMB A;  2UVI A;  1D9Y A;  3QAX A;  5H8S A;  3ISP A;  3MVW A;  5EYF A;  4Q8R A;  3E4R A;  1R9Q A;  3HCQ A;  4GWX A;  4YKP A;  1IXC A;  2X7Q A;  4DZ1 A;  2DXY A;  1QGX A;  3MBP A;  4G8N A;  4PDD A;  4MNI A;  3ZKL A;  1B7H A;  1XOC A;  3EPE A;  4MMP A;  2CMO A;  4F19 A;  4F22 A;  1TXF A;  3IL1 B;  3USD A;  3KBZ A;  3UA8 A;  4PFR A;  5H8Q A;  3G7W A;  4G2Z A;  1LLS A;  4G68 B;  3O6H A;  1SBP A;  1NV7 A;  3SEX A;  4PFU A;  2Y7W A;  4N15 A;  3RPW A;  4MHF A;  3PPQ A;  2YPN A;  4H46 A;  1JVY A;  1LCF A;  5DEX A;  1TFA A;  1PBQ A;  3MPK A;  5IZ3 B;  4QFK A;  5CBS A;  1H43 A;  5AE4 A;  2VD3 A;  3TTM A;  4ND9 A;  4H8I A;  1NV6 A;  3IB0 A;  4PFB A;  1ZLQ A;  3IOV A;  3SEW A;  4R2F A;  3TTL A;  3JV9 A;  3QUF A;  3K1P A;  4OTE A;  4GWO A;  2ZMB A;  4KXP A;  4P0I A;  4BDO A;  5LOM A;  3T66 A;  3FVG A;  3D4C A;  3VFJ A;  3KOS A;  1LBV A;  1DCU A;  4JB7 A;  5I56 B;  2F6P A;  4YAH X;  3QIM A;  1MS7 A;  2XXK A;  2XXU A;  5ICT A;  3MZ1 A;  1B0H A;  4JSO A;  2GHB A;  3WAF A;  2DWI A;  4DE8 A;  3IOR A;  1IUD A;  4NF4 B;  1NUX A;  1NV1 A;  1SYI A;  3DP8 A;  2VP1 A;  5CMM A;  3RTF B;  4TLM B;  5ET6 A;  4F31 B;  1SQY A;  4FEB A;  4AB6 A;  4OFL A;  3G3K A;  1DK4 A;  2WBB A;  3K01 A;  4F3S A;  1OQH A;  2PX1 A;  1FQC A;  4G77 A;  2QPQ A;  3TYH A;  4IGR A;  4O3B A;  3JYR A;  3CFX A;  1FPL A;  3FD3 A;  2HPG A;  3UIF A;  1WOD A;  3NOH A;  3T9H B;  1FPK A;  4R72 A;  1LCT A;  1BIY A;  4EXL A;  4GWS A;  4ESX A;  3HPI A;  3FV1 A;  1Y3N A;  4OET A;  5ITP A;  4OEN A;  4POX A;  1FTK A;  1QKA A;  4QHQ A;  2WBD A;  3H7M A;  3V5A A;  4ZED A;  3S9E A;  1B32 A;  2Y84 A;  4ZEF A;  2A5T A;  3W9V A;  2DE3 A;  1D9Q A;  5EHM A;  1M5B A;  1EZO A;  1SYH A;  1SI1 A;  1LBB A;  3FJM A;  4LQ2 A;  1NV0 A;  3KN8 A;  1UTH A;  5BUU A;  1JVX A;  4OES A;  5HPQ A;  3T0J A;  1GV8 A;  4OXV A;  5J16 A;  4KCC A;  2ONR A;  1A8F A;  1II5 A;  4ONY A;  1N76 A;  4O3C A;  3S9L C;  2XX7 A;  1BKA A;  3MVY A;  1B1X A;  2P3V A;  2G29 A;  3T1B A;  2P3N A;  5DVJ A;  1LBX A;  2XXW A;  2BJI A;  1UIV A;  1EYK A;  2OWS A;  3MJN A;  5I3S A;  3EKI A;  5LDZ A;  4ZDM A;  4F3P A;  5DYH A;  1Z7M E;  3H6W A;  1YPN A;  5H8N B;  2D5W A;  3EN3 A;  1JW1 A;  2DP8 A;  5JTY A;  2UVJ A;  3M3F A;  1FSA A;  2Q8M A;  1N84 A;  4GL8 A;  3RLF E;  5CM6 A;  3H4Z A;  4U2R A;  2OWZ A;  3T93 B;  4KI0 E;  2DWJ A;  3KN3 A;  4HCW A;  3RNN A;  2XXP A;  3IFC A;  3IOW A;  3PUY E;  2ZXT A;  3PMX A;  3U8Q A;  3UGW A;  5EYH A;  4H8J A;  4NMY A;  1EZP A;  2Y7P A;  4EDP A;  2I58 A;  2QS1 A;  4PQJ A;  1F9B A;  3CFZ A;  1S9T A;  2I48 A;  4G8H A;  4HXV A;  4ZEI A;  3OSQ A;  4PE3 A;  1LAG E;  1JEU A;  1AL3 A;  4GWY A;  3CG3 A;  3U93 A;  3CRB A;  4C1U A;  4KPT A;  5AA2 B;  3N5L A;  3PUV E;  4OEU A;  2HXW A;  1KZ8 A;  5AA2 D;  3RPL B;  4PP0 A;  4I62 A;  2KR0 A;  2ZYK A;  3B6W A;  3SZP A;  2QVR A;  5I2N A;  5KCJ B;  1PBP A;  1Y20 A;  4F1V A;  3HHF A;  4M1V A;  3H6V A;  4NHB A;  4I8C A;  1OLA A;  3KSJ A;  3HO7 A;  3VDF A;  2DXR A;  3H06 B;  3H3G A;  4OQO A;  4KD5 A;  1Y3Q A;  4G61 A;  1M5C A;  5A5X B;  1SDX A;  1M5E A;  2FVZ A;  3THI A;  1LBZ A;  4PFY A;  1D4N A;  3P7I A;  1B9J A;  4FE8 A;  4Q0C A;  1NUZ A;  4PBQ A;  1FBF A;  1IMF A;  2QS2 A;  3PUX E;  3SEY A;  3W9W A;  4ZZA A;  3V83 A;  4MCO A;  1Y3P A;  2G93 A;  4NF6 B;  2PVU A;  3CSG A;  3GBB A;  3LBS A;  4P56 A;  3CFL A;  5EQ9 A;  4O3A A;  4MLV A;  2I3W A;  2Y5K A;  2I4C A;  2I4B A;  3O97 A;  4IGT A;  1AIV A;  5JK4 A;  1YTV A;  3SEU A;  1MXW A;  3ZKK A;  5F7V A;  1FTM A;  4C1T A;  4NF5 A;  3U94 A;  5I59 B;  3K6V A;  1N0T A;  4HTG A;  1JET A;  1JQF A;  3LV0 A;  1LFH A;  1YYZ A;  4H1X A;  2B3F A;  1H76 A;  2AL4 A;  1IXG A;  1LBY A;  1TFD A;  4ISU A;  5CBR A;  1RYX A;  1N7W A;  3LUY A;  4P0G A;  4DXB A;  5HM4 B;  4UA8 A;  1OVT A;  2CEX A;  1EH3 A;  5AA4 B;  2QSX A;  2W7Y A;  2PBW A;  4LON B;  1LFI A;  4Q30 B;  3H6T A;  1SW4 A;  4XKQ A;  1H3D A;  2GRV A;  4F2O A;  3IJO B;  1FQD A;  3K6U A;  2BJJ X;  4HE0 A;  2ZNS A;  1MDQ A;  5FTH A;  1B52 A;  3TEL A;  2F35 A;  4OFJ A;  1ZMG A;  2RIN A;  4DXU A;  1B7Z A;  4KYE A;  3PPP A;  1A99 A;  2Z8D A;  4RPO A;  2ZYM A;  1SW1 A;  1P1W A;  4KFQ A;  2OZZ A;  2V3Q A;  3M3K A;  2Z23 A;  1B5I A;  4F29 A;  2AL5 A;  4G68 A;  4MLQ A;  4N8Y A;  1YXI A;  1IMB A;  2QFL A;  5CI5 A;  2DVC A;  2PT1 A;  2R8T A;  3CR9 A;  2Z8E A;  3S2V A;  2Y7R A;  3U92 A;  4OA4 A;  4DCX A;  3MPL A;  4X8R A;  3FAT A;  1FBH A;  2WYP A;  4PFI A;  2OBG A;  3FJ7 A;  1Z7N E;  3TQL A;  3B8B A;  4EUO A;  4XKN A;  2Y5L A;  1FPD A;  5IZ3 A;  1IMC A;  4JWO A;  5HBC A;  3C31 A;  4L17 A;  4O7I A;  4BDM A;  1FCK A;  1H44 A;  4N17 A;  4LZ5 A;  1QJM A;  2HZK A;  2V93 A;  5FTI A;  3K2D A;  4OZ9 A;  2R71 A;  4XKP A;  2GH9 A;  5IGA A;  5I56 A;  1B6H A;  1XVX A;  4RY1 A;  3B6Q A;  4YKJ A;  4KCD A;  1FQA A;  1US5 A;  3BKI B;  4O7M A;  4LAT A;  4G4P A;  4GQO A;  2FNC A;  3L6G A;  2X26 A;  4NF4 A;  1URD A;  3O2A A;  4E0X A;  2Q8J A;  4F2Q A;  4X9T A;  3VVF A;  3T9X B;  1FTA A;  3TUS A;  4XFE A;  5LTC A;  4POW A;  2DYX A;  3HFU A;  2OJT A;  4IO3 A;  2D3I A;  4E0W A;  1BTJ A;  3TDJ A;  3AXF A;  2KLF A;  3B7D A;  3E3K A;  2XX9 A;  2M8C A;  4PFT A;  4MNC A;  4GL0 A;  3KOT A;  5TU0 A;  3IX1 A;  4R9F A;  3W15 C;  2V25 A;  1Y1Z A;  1B40 A;  1NNP A;  4TLL B;  3RUM A;  3OO9 A;  4BDQ A;  2F7B A;  4WXJ A;  2WYK A;  3IAZ A;  1Y1M A;  1I6Q A;  1PDA A;  5FHO A;  2HZL A;  4QSC A;  3E13 X;  4P1E A;  2I3V A;  4PDH A;  3UOR A;  2F97 A;  1H45 A;  2IEE A;  3K02 A;  3ZS6 A;  4R75 A;  2VD2 A;  1UQW A;  1MQH A;  3UK4 A;  4GWU A;  4QRZ A;  2D21 A;  2ESN A;  4YKI A;  1LBW A;  4P47 A;  1R1N A;  2QVV A;  1FTJ A;  4NF8 B;  2FIX A;  4BDN A;  1SI0 A;  3FBP A;  2O51 A;  5I58 B;  5TP9 B;  4DXC A;  4UAC A;  3VXC A;  4OHN A;  2O7I A;  2FHY A;  4QFO A;  4WKM A;  1D9V A;  4H6D A;  4Z0I A;  3U72 A;  3O28 A;  5L9M A;  4GWW A;  1AWB A;  4MF3 A;  5IZ1 A;  1A54 A;  5KZT A;  4QSE A;  1QUJ A;  3G3G A;  4NG7 A;  1ATG A;  2ZYO A;  3MZ9 A;  3M3L A;  4P11 A;  4YU0 A;  3I3V A;  1MQD A;  5H8N A;  1FPI A;  1LAH E;  2XD3 A;  3ODB A;  2HEU A;  1FPE A;  3IOU A;  4ECF A;  1BLF A;  4RXL A;  5FHM A;  3EHT A;  2Z8F A;  3KC0 A;  3TPA A;  1NUY A;  5DTB A;  1MY4 A;  2I49 A;  4ESW A;  1NV3 A;  2NWJ A;  5M2V A;  4G8M A;  4KR5 A;  4DIG A;  3TCF A;  1MXX A;  3MAM A;  5A5L A;  1MPC A;  2UVH A;  3H03 A;  4I1D A;  2MKZ A;  1UIU A;  3KEI A;  4U21 A;  3PMW A;  3E79 A;  1MDP 1;  3EQ1 A;  3O29 A;  4MEV A;  5AA2 A;  4XF5 A;  4GXS B;  4BDR A;  3TTN A;  1DPP A;  3OSR A;  5ET5 A;  1IXH A;  2YJP A;  4RPN A;  3CHG A;  3K00 A;  3RPL A;  3FGS A;  1IQ7 A;  1RKM A;  2ONK E;  2Y7I A;  1B2H A;  1URS A;  2I0B A;  4RK9 A;  5KCJ A;  4MJO A;  3KJ7 A;  4R6Y A;  4PAK A;  4THI A;  3PV0 E;  4BDL A;  3LUZ A;  3A3C A;  2PT2 A;  3OO8 A;  4O8M A;  4P9K A;  5A5X A;  2THI A;  2PYY A;  2XXQ A;  1RDY A;  3BIG A;  1MM7 A;  1KA1 A;  3KGC A;  4MFI A;  4ELO A;  1NH7 A;  5I2K B;  1J1N A;  3PPO A;  1MRP A;  3SEV A;  2CZH A;  3FVO A;  4ELP A;  1B3H A;  2F8D A;  3TTR A;  3TEP A;  4DCY A;  1GTK A;  4NF6 A;  3K1N A;  4XEQ A;  2V3T A;  1B3L A;  3ROJ A;  1NUW A;  3C33 A;  2QMX A;  4HS7 A;  4GVO A;  1MQI A;  3PTY A;  4NQ8 A;  4OVS A;  1I6A A;  4H5G A;  4YIC A;  2XXV A;  2QL3 A;  2IA4 A;  1QW0 A;  5T3J A;  1RYO A;  1IME A;  1S7Y A;  3LR1 A;  4HW8 A;  1MY3 A;  3QSL A;  3PUW E;  3IO6 A;  5I59 A;  1RDX A;  1ZBM A;  2XWO A;  3RYD A;  1SPI A;  3N26 A;  2Z22 A;  4NF0 A;  1FPJ A;  2XXR A;  3UN6 A;  1MXY A;  1UTB B;  1USY E;  2XXY A;  4GD5 A;  4NED A;  3Q26 A;  2H25 A;  5B7D A;  4R73 A;  1B3G A;  1FQF A;  3PD8 A;  1B7U A;  4GX3 A;  5I57 B;  3IK6 B;  3TCG A;  5CRY A;  4N6P A;  3MP6 A;  5I7I A;  5AA4 A;  1A40 A;  3LSX A;  4PET A;  4NGU A;  1FPB A;  2NXO A;  5B70 A;  3OXN A;  1US4 A;  3TAJ A;  4FJP A;  4U4X A;  5FBP A;  2F3D A;  1YCJ A;  1LB8 A;  1HSE A;  3RY3 A;  2P2A A;  4EF1 A;  2NUV A;  4ELR A;  4NN3 A;  4IB2 A;  4IO5 A;  3PU5 A;  3T22 A;  1Q9D A;  4RYA A;  4QFN A;  3K1M A;  2XA5 A;  4RNS A;  4XXU A;  5KDT B;  3G3J A;  1JNF A;  2O84 X;  3EF7 A;  2XXT A;  1XS5 A;  2Q9T A;  4U1O A;  4GF8 A;  2ZZX A;  3S9N C;  3R6U A;  1LGB C;  5EQA A;  1FBD A;  4F3G A;  1G0I A;  3S4U A;  2FYI A;  3FAS A;  1JW4 A;  4PF8 A;  3ECR A;  4PAF A;  1P1N A;  1AMF A;  1SW2 A;  3O9P A;  4MAG A;  2DOJ A;  2DWA A;  3H6U A;  4PC9 A;  1POT A;  1M5D A;  1MM6 A;  2VGQ A;  3T96 B;  5ICQ A;  1P1O A;  3BBR A;  2HXR A;  4JDF A;  4F18 A;  3UP9 A;  2RC8 A;  3VXB A;  2RC7 A;  2H9B A;  4TQU Q;  1PB7 A;  4AQ4 A;  3BFT A;  1PEB A;  1DMB A;  3VLV A;  3SET A;  2WKY A;  1JW5 A;  1AOV A;  3B50 A;  1MPB A;  3C4M A;  2DS9 A;  1K9Z A;  5ET7 A;  1MG1 A;  2HAV A;  5ESY A;  3QYT A;  1LBC A;  3A3U A;  3F11 A;  3MQ9 A;  4FOR A;  3IB1 A;  1G0H A;  2KQZ A;  2REJ A;  5EYG A;  1B1H A;  1O64 A;  5K2Y A;  2JJK A;  3FJG A;  2H98 A;  3A29 A;  3DLN A;  5AA3 A;  3MUQ A;  1XT8 A;  1PB9 A;  4N91 A;  3MW0 A;  2E1S A;  2ZZW A;  2HAU A;  5H8H B;  3LSF B;  4H65 A;  1B3E A;  1D3K A;  4I3Y A;  2WEF A;  1B46 A;  3PUZ E;  5ELV A;  5TPA B;  2UYE A;  2XX8 A;  4FED A;  1OIB A;  4EQ7 A;  1ZTY A;  4OMB A;  3MWB A;  1XHY A;  1B05 A;  1LB9 A;  1VSO A;  4PBH A;  1FBC A;  2B4L A;  3K6X A;  4R6H A;  3VVD A;  2CEY A;  4N6D A;  1B3F A;  4ZEK A;  1I69 A;  4LA9 A;  1DPE A;  1QUI A;  2O69 A;  1XI6 A;  4JVD A;  3CG1 A;  4LP2 B;  1KA0 A;  3FIR A;  5H8F B;  5F1Q A;  4OAN A;  1Q35 A;  2VPN A;  1A55 A;  1JEV A;  4ZEC A;  4I40 A;  4XKR A;  4IO4 A;  4YKK A;  1FQE A;  3MST A;  3VLU A;  3E78 A;  4PF6 A;  3N6U A;  2HFB A;  3DP4 A;  4NF8 A;  5EQ8 A;  1YZ0 A;  2A5S A;  4DLD A;  5EQ7 A;  1OLC A;  3FUZ A;  5I58 A;  5TP9 A;  1O7T A;  3GYY A;  2GQ1 A;  4N07 A;  1FBP A;  5CMC A;  3ILU B;  3FZV A;  3ILT B;  3GLB A;  4HE2 A;  4NE4 A;  2ZZV A;  3IOT A;  4R9G A;  1FW0 A;  4ZE8 A;  4FAT A;  3TKD A;  4N6K A;  4OVP A;  3G3H A;  1ZKB A;  1DTG A;  2ZYN A;  4YB6 A;  4U22 A;  4OER A;  1NL5 A;  4NWC A;  1MQJ A;  1IXI A;  3MC2 A;  2OLB A;  3TOD A;  3ZSF A;  4YMA A;  1QUK A;  1NV2 A;  4KHZ E;  3MVX A;  2B4M A;  4JSD A;  1WVJ A;  1A8E A;  1GVC A;  3I5O A;  1GGG A;  1MH4 A;  4I9D A;  3N6T A;  1MXZ A;  4BLA A;  1QUL A;  4H67 A;  3EHS A;  4QXD A;  1P1Q A;  3FXR A;  3QUJ A;  3TFL A;  1FTO A;  1LST A;  3MP1 A;  4KYD A;  4MX6 A;  1LEV A;  3SER A;  5DVI A;  1MXV A;  5CMK A;  1ZU0 A;  1I6B A;  2F7A A;  2ANJ A;  3HST A;  3O66 A;  1MY1 A;  2REG A;  5L9O A;  1P1U A;  1L5T A;  3C9H A;  2XD2 A;  3E9X A;  3T9V A;  4P3L A;  1OQG A;  2PFY A;  2FA7 A;  4MBP A;  3FV2 A;  3GZG A;  2FBP A;  5IAI A;  1CB6 A;  2HHM A;  4XTC Q;  2QJE A;  4O94 A;  4OVQ A;  3KC1 A;  1HSL A;  1VR5 A;  4F1Y A;  1IIW A;  1CE2 A;  1SD3 A;  4P1L A;  5L8D A;  2PCR A;  4U23 A;  2ONS A;  3LC8 A;  3BFU A;  4TOZ A;  3KN7 A;  4XIG Q;  5IKB A;  4QSD A;  5I2K A;  4IO6 A;  2UVG A;  4F39 A;  2AYS A;  4HE1 A;  4EQB A;  4JXI A;  2QS4 A;  1ZIU A;  2HCA A;  3DP6 A;  1B0L A;  4Q5T A;  4R2B A;  3TQW A;  2VOZ A;  3MYU A;  5FHN A;  2V3U A;  4AS4 A;  4AS5 A;  3TTK A;  3G3I A;  1K9Y A;  1LAF E;  3SDF A;  3O6I A;  4ZZE A;  3DM0 A;  2CZI A;  2UYF A;  1NV4 A;  3CI8 A;  3SKP A;  3PMV A;  3V8X B;  1USY H;  2QS3 A;  1NMU A;  1B5J A;  4WED A;  1DOT A;  4OFO A;  2OX3 A;  4JWY A;  2CZL A;  4ZEB A;  2XXH A;  4QFL A;  1A7L A;  1RDZ A;  4MH5 A;  5H8Q B;  1UTB A;  2R9J A;  2XWV A;  4IY5 A;  4GLI A;  3L6H A;  1EYJ A;  1MQG A;  4X1B A;  2R6G E;  1IEJ A;  1M5F A;  2HQ0 A;  5I57 A;  3K6W A;  4R74 A;  1B51 A;  2I0C A;  2P1S A;  3BIH A;  5DW8 A;  2RCA A;  4IO7 A;  1OMP A;  4OWD A;  4P8B A; 
#chains in the Genus database with same CATH homology
 2GFE A;  3KFM A;  4GRK A;  1MPD A;  1NKX A;  1XC1 A;  2DVZ A;  2V84 A;  2O7U A;  5DEX B;  3RTW B;  1B4H A;  3CVG A;  3FXQ A;  2E0S A;  4FEC A;  2VHA A;  2NVU B;  5CMB A;  1B58 A;  2UXA A;  4GXA A;  4FAJ A;  1R6Z A;  4RJZ A;  5KDT A;  4GIZ A;  2O1L A;  1N7X A;  3HV1 A;  2QMW A;  1N3W A;  3PD9 A;  4KQP A;  1B5H A;  3QXM A;  5J1D A;  4LZ8 A;  3VLW A;  1N04 A;  3HHG A;  2RC9 A;  1MY2 A;  3TMG A;  1Q1K A;  2ZNU A;  3TZA A;  3R7X A;  4N13 A;  1NFT A;  4GFR A;  3EHU A;  3K0V A;  3RN8 A;  1TWY A;  4DDD A;  4F3B A;  2OWT A;  1N3X A;  3OEN A;  3MZB A;  2XHD A;  3Q25 A;  1PC3 A;  1YAE A;  3OO7 A;  2DWH A;  4F1U A;  2XXX A;  4X1D A;  2DQV A;  2O68 A;  4YB5 A;  3OOA A;  5L9S A;  3PPR A;  2AIX A;  1Y4C A;  5DVF A;  2ZNT A;  4EF2 A;  2Q2A A;  4LQ5 A;  1P99 A;  4HCY A;  3RT6 B;  2YLN A;  4YMB A;  2RF1 A;  1MY0 A;  4OEV A;  3C36 A;  5H8H A;  3MP8 A;  3LSL A;  2H5Y A;  4OVJ A;  1T0K A;  5TPA A;  2A5T B;  1FQB A;  2XXI A;  2F7C A;  5BWJ A;  4PFW A;  2F36 A;  3IB2 A;  3PGF A;  1NNK A;  4WEP A;  4LVQ A;  1SVX B;  4FIM A;  4IY6 A;  3KSX A;  3I6V A;  1R9L A;  2O1M A;  3K4U A;  3DEL B;  4RA1 A;  1UTH B;  4Z7E A;  1PB8 A;  2F6G A;  4NTL A;  4JWX A;  3KG2 A;  4YB7 A;  4H5F A;  5I84 A;  4R6K A;  3FVN A;  3IR1 A;  1HSJ A;  3IO4 A;  1FTL A;  1DTZ A;  1QKB A;  3OEM A;  1ZJL A;  2O6A A;  2ALU A;  3VE1 B;  3OD7 A;  5ISU A;  5H8F A;  4QFP A;  3MVZ A;  5EHS A;  1LAX A;  3GXA A;  4U1Z A;  3N94 A;  4H0W A;  2Y7K A;  3CSB A;  5JTY B;  4ZE9 A;  3FVK A;  4KYS A;  2H99 A;  5JEI A;  1GR2 A;  2LAO A;  2B3B A;  3IJX B;  3Q28 A;  4QF9 A;  1LFG A;  3V89 B;  1POY 1;  1IIT A;  2OCU A;  2F5X A;  3B6T A;  1ANF A;  1Y4T A;  3FXU A;  3KJT A;  1B4Z A;  4GOT A;  1VFD A;  3LSW A;  3VVE A;  2RKM A;  4LUB A;  3S9M C;  5CC2 A;  3QK6 A;  1S50 A;  2Q2C A;  1SW5 A;  3C35 A;  1OVB A;  3G3F A;  3T9U A;  3WAE A;  3Q29 A;  1EU8 A;  3OEL A;  4LZ7 A;  2ABH A;  4EXK A;  1VFE A;  2DSF A;  5I2N B;  4AB5 A;  4M4G A;  1AH5 A;  1MXU A;  4K3F A;  2QRY A;  3RQT A;  1NNF A;  3C32 A;  1WDN A;  1IZ1 A;  1NH8 A;  3Q27 A;  5ITO A;  3A09 A;  2DE4 A;  2Q89 A;  2X7P A;  4X48 A;  3KZG A;  3KBR A;  1EZ9 A;  2NOO A;  4JBZ A;  2OK2 A;  1NNT A;  2P0S A;  3HN0 A;  4RK2 A;  3U1O A;  2I6E A;  4OYV A;  1MH3 A;  1O63 A;  3ONM A;  2Q88 A;  3SES A;  2DE2 A;  5K2X A;  3OO6 A;  3JZJ A;  2H4I A;  2F78 A;  5AA1 A;  1BP5 A;  1VE4 A;  4IO2 A;  2B65 A;  4U4S A;  2F34 A;  3RT8 A;  3PPN A;  2PMS A;  3M8U A;  4ZS9 A;  4NWD A;  5DT6 A;  4EQ9 A;  1DSN A;  3VV5 A;  4NF5 B;  3OEK A;  1TT1 A;  3GBA A;  2GHA A;  1XVY A;  4ELQ A;  4PE5 B;  1QVS A;  1Y9U A;  1ELJ A;  3RGY A;  4C0R A;  4YZZ A;  3TCH A;  3R26 A;  3C34 A;  1URG A;  3O6G A;  4G68 C;  3CIJ A;  2RCB A;  3D4G A;  1KWH A;  3OMB A;  2UVI A;  1D9Y A;  3QAX A;  5H8S A;  3MVW A;  5EYF A;  4Q8R A;  3E4R A;  1R9Q A;  3HCQ A;  4YKP A;  1IXC A;  2X7Q A;  4DZ1 A;  2DXY A;  3MBP A;  4G8N A;  3ZKL A;  1B7H A;  1XOC A;  3EPE A;  2CMO A;  4F19 A;  4F22 A;  1TXF A;  3IL1 B;  3USD A;  3UA8 A;  5H8Q A;  3G7W A;  4G2Z A;  1LLS A;  4G68 B;  3O6H A;  1SBP A;  3SEX A;  4PFU A;  2Y7W A;  3RPW A;  3PPQ A;  2YPN A;  1JVY A;  1LCF A;  5DEX A;  1TFA A;  1PBQ A;  3MPK A;  4QFK A;  5CBS A;  1H43 A;  5AE4 A;  2VD3 A;  3TTM A;  4ND9 A;  4H8I A;  3IB0 A;  1ZLQ A;  3IOV A;  3SEW A;  4R2F A;  3TTL A;  3JV9 A;  3QUF A;  3K1P A;  4OTE A;  4GWO A;  2ZMB A;  4P0I A;  4BDO A;  5LOM A;  3T66 A;  3FVG A;  3D4C A;  3VFJ A;  3KOS A;  4JB7 A;  5I56 B;  2F6P A;  4YAH X;  3QIM A;  1MS7 A;  2XXU A;  5ICT A;  3MZ1 A;  1B0H A;  4JSO A;  2GHB A;  3WAF A;  2DWI A;  4DE8 A;  3IOR A;  1IUD A;  4NF4 B;  1SYI A;  3DP8 A;  2VP1 A;  5CMM A;  3RTF B;  4TLM B;  4F31 B;  1SQY A;  4FEB A;  4AB6 A;  4OFL A;  3G3K A;  3K01 A;  4F3S A;  1OQH A;  2PX1 A;  1FQC A;  4G77 A;  2QPQ A;  3TYH A;  4IGR A;  4O3B A;  3JYR A;  3CFX A;  3FD3 A;  3UIF A;  1WOD A;  3T9H B;  4R72 A;  1LCT A;  1BIY A;  4EXL A;  4ESX A;  3HPI A;  3FV1 A;  1Y3N A;  4OET A;  5ITP A;  4OEN A;  4POX A;  1FTK A;  1QKA A;  4QHQ A;  3H7M A;  3V5A A;  4ZED A;  3S9E A;  1B32 A;  2Y84 A;  4ZEF A;  2A5T A;  3W9V A;  2DE3 A;  5EHM A;  1M5B A;  1EZO A;  1SYH A;  1SI1 A;  1LBB A;  3FJM A;  4LQ2 A;  3KN8 A;  1UTH A;  5BUU A;  1JVX A;  4OES A;  5HPQ A;  1GV8 A;  4OXV A;  4KCC A;  2ONR A;  1A8F A;  1II5 A;  4ONY A;  1N76 A;  4O3C A;  3S9L C;  2XX7 A;  1BKA A;  3MVY A;  1B1X A;  2G29 A;  5DVJ A;  2XXW A;  1UIV A;  2OWS A;  3MJN A;  4ZDM A;  4F3P A;  5DYH A;  1Z7M E;  3H6W A;  1YPN A;  5H8N B;  2D5W A;  3EN3 A;  1JW1 A;  2DP8 A;  5JTY A;  2UVJ A;  3M3F A;  1N84 A;  4GL8 A;  3RLF E;  5CM6 A;  3H4Z A;  4U2R A;  3T93 B;  4KI0 E;  2DWJ A;  3KN3 A;  4HCW A;  3RNN A;  2XXP A;  3IOW A;  3PUY E;  2ZXT A;  3PMX A;  3U8Q A;  3UGW A;  4H8J A;  4NMY A;  1EZP A;  2Y7P A;  4EDP A;  2I58 A;  2QS1 A;  4PQJ A;  1F9B A;  3CFZ A;  1S9T A;  2I48 A;  4G8H A;  4ZEI A;  3OSQ A;  1LAG E;  1JEU A;  1AL3 A;  3U93 A;  3CG3 A;  3CRB A;  4C1U A;  4KPT A;  5AA2 B;  3N5L A;  3PUV E;  4OEU A;  2HXW A;  5AA2 D;  4PP0 A;  4I62 A;  2ZYK A;  3B6W A;  5I2N A;  5KCJ B;  1PBP A;  1Y20 A;  4F1V A;  3HHF A;  4M1V A;  3H6V A;  4I8C A;  1OLA A;  3KSJ A;  3HO7 A;  3VDF A;  2DXR A;  3H06 B;  3H3G A;  4OQO A;  4KD5 A;  1Y3Q A;  1M5C A;  5A5X B;  1SDX A;  1M5E A;  3THI A;  4PFY A;  1D4N A;  3P7I A;  1B9J A;  4FE8 A;  4Q0C A;  2QS2 A;  3PUX E;  3SEY A;  3W9W A;  4ZZA A;  3V83 A;  1Y3P A;  2G93 A;  4NF6 B;  2PVU A;  3CSG A;  3GBB A;  3LBS A;  3CFL A;  4O3A A;  4MLV A;  2I3W A;  2I4C A;  2I4B A;  3O97 A;  4IGT A;  1AIV A;  5JK4 A;  1YTV A;  3SEU A;  1MXW A;  3ZKK A;  5F7V A;  1FTM A;  4C1T A;  4NF5 A;  3U94 A;  5I59 B;  3K6V A;  1N0T A;  4HTG A;  1JET A;  1JQF A;  1LFH A;  4H1X A;  2B3F A;  1H76 A;  2AL4 A;  1IXG A;  1TFD A;  4ISU A;  5CBR A;  1RYX A;  1N7W A;  3LUY A;  4P0G A;  4DXB A;  5HM4 B;  4UA8 A;  1OVT A;  1EH3 A;  5AA4 B;  2QSX A;  2W7Y A;  2PBW A;  4LON B;  1LFI A;  4Q30 B;  3H6T A;  1SW4 A;  4XKQ A;  1H3D A;  2GRV A;  4F2O A;  3IJO B;  1FQD A;  3K6U A;  2BJJ X;  2ZNS A;  1MDQ A;  5FTH A;  1B52 A;  3TEL A;  2F35 A;  4OFJ A;  1ZMG A;  2RIN A;  4DXU A;  1B7Z A;  4KYE A;  3PPP A;  1A99 A;  2Z8D A;  4RPO A;  2ZYM A;  1SW1 A;  1P1W A;  4KFQ A;  2OZZ A;  2V3Q A;  3M3K A;  2Z23 A;  1B5I A;  4F29 A;  2AL5 A;  4G68 A;  4MLQ A;  5CI5 A;  2DVC A;  2PT1 A;  3CR9 A;  2Z8E A;  3S2V A;  2Y7R A;  3U92 A;  4DCX A;  3MPL A;  3FAT A;  2OBG A;  3FJ7 A;  1Z7N E;  3TQL A;  4EUO A;  4XKN A;  4JWO A;  5HBC A;  3C31 A;  4L17 A;  4BDM A;  1FCK A;  1H44 A;  4LZ5 A;  1QJM A;  2HZK A;  2V93 A;  5FTI A;  3K2D A;  4OZ9 A;  2R71 A;  4XKP A;  2GH9 A;  5I56 A;  1B6H A;  1XVX A;  4RY1 A;  3B6Q A;  4YKJ A;  4KCD A;  1FQA A;  1US5 A;  3BKI B;  4LAT A;  4G4P A;  4GQO A;  2FNC A;  3L6G A;  2X26 A;  4NF4 A;  1URD A;  3O2A A;  4E0X A;  2Q8J A;  4F2Q A;  4X9T A;  3VVF A;  3T9X B;  3TUS A;  4POW A;  2DYX A;  2OJT A;  4IO3 A;  2D3I A;  4E0W A;  1BTJ A;  3TDJ A;  3AXF A;  2KLF A;  3B7D A;  3E3K A;  2XX9 A;  2M8C A;  4PFT A;  4GL0 A;  3KOT A;  5TU0 A;  3IX1 A;  4R9F A;  3W15 C;  2V25 A;  1Y1Z A;  1B40 A;  1NNP A;  4TLL B;  3RUM A;  3OO9 A;  4BDQ A;  2F7B A;  4WXJ A;  3IAZ A;  1Y1M A;  1I6Q A;  1PDA A;  5FHO A;  2HZL A;  4QSC A;  3E13 X;  2I3V A;  3UOR A;  2F97 A;  1H45 A;  2IEE A;  3K02 A;  3ZS6 A;  4R75 A;  2VD2 A;  1UQW A;  1MQH A;  3UK4 A;  4QRZ A;  2D21 A;  2ESN A;  4YKI A;  1R1N A;  1FTJ A;  4NF8 B;  4BDN A;  1SI0 A;  2O51 A;  5I58 B;  5TP9 B;  4DXC A;  4UAC A;  3VXC A;  4OHN A;  2O7I A;  4QFO A;  4WKM A;  1D9V A;  4H6D A;  4Z0I A;  3U72 A;  3O28 A;  5L9M A;  4MF3 A;  1A54 A;  5KZT A;  4QSE A;  1QUJ A;  3G3G A;  1ATG A;  2ZYO A;  3MZ9 A;  3M3L A;  4P11 A;  4YU0 A;  3I3V A;  1MQD A;  5H8N A;  1LAH E;  2XD3 A;  3ODB A;  2HEU A;  3IOU A;  4ECF A;  1BLF A;  4RXL A;  5FHM A;  3EHT A;  2Z8F A;  3TPA A;  5DTB A;  1MY4 A;  2I49 A;  4ESW A;  2NWJ A;  5M2V A;  4G8M A;  4KR5 A;  4DIG A;  3TCF A;  1MXX A;  3MAM A;  1MPC A;  2UVH A;  3H03 A;  4I1D A;  1UIU A;  3KEI A;  4U21 A;  3PMW A;  1MDP 1;  3EQ1 A;  3O29 A;  5AA2 A;  4GXS B;  4BDR A;  3TTN A;  1DPP A;  3OSR A;  1IXH A;  2YJP A;  4RPN A;  3K00 A;  3FGS A;  1IQ7 A;  1RKM A;  2ONK E;  2Y7I A;  1B2H A;  1URS A;  2I0B A;  4RK9 A;  5KCJ A;  4R6Y A;  3KJ7 A;  4THI A;  3PV0 E;  4BDL A;  3A3C A;  2PT2 A;  3OO8 A;  5A5X A;  2THI A;  2PYY A;  2XXQ A;  1MM7 A;  3KGC A;  4MFI A;  4ELO A;  1NH7 A;  5I2K B;  1J1N A;  3PPO A;  1MRP A;  3SEV A;  3FVO A;  4ELP A;  1B3H A;  2F8D A;  3TTR A;  3TEP A;  4DCY A;  1GTK A;  4NF6 A;  3K1N A;  2V3T A;  1B3L A;  3C33 A;  2QMX A;  4HS7 A;  4GVO A;  1MQI A;  1I6A A;  4H5G A;  4YIC A;  2XXV A;  2QL3 A;  2IA4 A;  1QW0 A;  1RYO A;  1S7Y A;  3LR1 A;  4HW8 A;  1MY3 A;  3QSL A;  3PUW E;  3IO6 A;  5I59 A;  1ZBM A;  3N26 A;  2Z22 A;  2XXR A;  3UN6 A;  1MXY A;  1UTB B;  1USY E;  2XXY A;  4GD5 A;  4NED A;  3Q26 A;  5B7D A;  2H25 A;  4R73 A;  1B3G A;  1FQF A;  3PD8 A;  1B7U A;  5I57 B;  3IK6 B;  3TCG A;  5CRY A;  4N6P A;  3MP6 A;  5AA4 A;  1A40 A;  3LSX A;  4PET A;  2NXO A;  5B70 A;  3OXN A;  1US4 A;  3TAJ A;  4FJP A;  4U4X A;  1YCJ A;  1LB8 A;  1HSE A;  3RY3 A;  2P2A A;  4EF1 A;  2NUV A;  4ELR A;  4IB2 A;  4IO5 A;  3PU5 A;  3T22 A;  4RYA A;  4QFN A;  3K1M A;  4RNS A;  4XXU A;  5KDT B;  3G3J A;  1JNF A;  2O84 X;  3EF7 A;  2XXT A;  1XS5 A;  2Q9T A;  4U1O A;  4GF8 A;  3S9N C;  3R6U A;  1LGB C;  4F3G A;  3S4U A;  2FYI A;  3FAS A;  1JW4 A;  3ECR A;  1P1N A;  1AMF A;  1SW2 A;  3O9P A;  2DOJ A;  2DWA A;  3H6U A;  1POT A;  1M5D A;  1MM6 A;  2VGQ A;  3T96 B;  5ICQ A;  1P1O A;  3BBR A;  4JDF A;  4F18 A;  3UP9 A;  2RC8 A;  3VXB A;  2RC7 A;  2H9B A;  4TQU Q;  1PB7 A;  4AQ4 A;  3BFT A;  1PEB A;  1DMB A;  3VLV A;  3SET A;  2WKY A;  1JW5 A;  1AOV A;  1MPB A;  3C4M A;  2DS9 A;  1MG1 A;  2HAV A;  3QYT A;  1LBC A;  3A3U A;  3F11 A;  3MQ9 A;  4FOR A;  3IB1 A;  2REJ A;  1B1H A;  1O64 A;  5K2Y A;  3FJG A;  2H98 A;  3DLN A;  5AA3 A;  3MUQ A;  1XT8 A;  1PB9 A;  3MW0 A;  2E1S A;  2HAU A;  5H8H B;  3LSF B;  4H65 A;  1B3E A;  1D3K A;  1B46 A;  3PUZ E;  5ELV A;  5TPA B;  2UYE A;  2XX8 A;  4FED A;  1OIB A;  4EQ7 A;  1ZTY A;  4OMB A;  3MWB A;  1XHY A;  1B05 A;  1LB9 A;  1VSO A;  3K6X A;  4R6H A;  3VVD A;  1B3F A;  4ZEK A;  1I69 A;  4LA9 A;  1DPE A;  1QUI A;  2O69 A;  3CG1 A;  4LP2 B;  3FIR A;  5H8F B;  5F1Q A;  1Q35 A;  1A55 A;  1JEV A;  4ZEC A;  4XKR A;  4IO4 A;  4YKK A;  1FQE A;  3VLU A;  3N6U A;  2HFB A;  3DP4 A;  4NF8 A;  2A5S A;  4DLD A;  1OLC A;  3FUZ A;  5I58 A;  5TP9 A;  1O7T A;  4N07 A;  5CMC A;  3ILU B;  3FZV A;  3ILT B;  3GLB A;  4NE4 A;  3IOT A;  4R9G A;  1FW0 A;  4ZE8 A;  4FAT A;  3TKD A;  3G3H A;  1ZKB A;  1DTG A;  2ZYN A;  4YB6 A;  4U22 A;  4OER A;  1NL5 A;  4NWC A;  1MQJ A;  1IXI A;  3MC2 A;  2OLB A;  3TOD A;  3ZSF A;  4YMA A;  1QUK A;  4KHZ E;  3MVX A;  4JSD A;  1WVJ A;  1A8E A;  1GVC A;  3I5O A;  1GGG A;  1MH4 A;  4I9D A;  3N6T A;  1MXZ A;  4BLA A;  1QUL A;  4H67 A;  3EHS A;  1P1Q A;  3FXR A;  3QUJ A;  3TFL A;  1FTO A;  1LST A;  3MP1 A;  4KYD A;  3SER A;  5DVI A;  1MXV A;  5CMK A;  1ZU0 A;  1I6B A;  2F7A A;  2ANJ A;  3HST A;  3O66 A;  1MY1 A;  2REG A;  5L9O A;  1P1U A;  1L5T A;  3C9H A;  2XD2 A;  3E9X A;  3T9V A;  1OQG A;  2FA7 A;  4MBP A;  3FV2 A;  3GZG A;  5IAI A;  1CB6 A;  4XTC Q;  2QJE A;  1HSL A;  1VR5 A;  4F1Y A;  1IIW A;  1CE2 A;  1SD3 A;  5L8D A;  4U23 A;  2ONS A;  3LC8 A;  3BFU A;  4TOZ A;  3KN7 A;  4XIG Q;  5IKB A;  4QSD A;  5I2K A;  4IO6 A;  2UVG A;  4F39 A;  2AYS A;  4EQB A;  4JXI A;  2QS4 A;  1ZIU A;  2HCA A;  3DP6 A;  1B0L A;  4Q5T A;  4R2B A;  3TQW A;  2VOZ A;  5FHN A;  2V3U A;  3TTK A;  3G3I A;  1LAF E;  3SDF A;  3O6I A;  4ZZE A;  3DM0 A;  2UYF A;  3CI8 A;  3SKP A;  3PMV A;  3V8X B;  1USY H;  2QS3 A;  1NMU A;  1B5J A;  4WED A;  1DOT A;  4OFO A;  4JWY A;  2CZL A;  4ZEB A;  2XXH A;  4QFL A;  1A7L A;  4MH5 A;  5H8Q B;  1UTB A;  2R9J A;  4IY5 A;  4GLI A;  3L6H A;  1MQG A;  4X1B A;  2R6G E;  1IEJ A;  1M5F A;  2HQ0 A;  5I57 A;  3K6W A;  4R74 A;  1B51 A;  2I0C A;  2P1S A;  2RCA A;  4IO7 A;  1OMP A;  4OWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...