4X1DA

Ytterbium-bound human serum transferrin
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
677
structure length
658
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Serotransferrin
publication title "Anion clamp" allows flexible protein to impose coordination geometry on metal ions
pubmed doi rcsb
total genus 201
structure length 658
sequence length 677
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4x1dA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4x1dA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4x1dA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4x1dA03
4PETA 5A5XA 1O63A 5I58A 4YAHX 1MXXA 5IKBA 1SQYA 2GHBA 5B70A 1D9YA 4NF8B 2O84X 3K6WA 3KJTA 4ELPA 3UK4A 3FXRA 4MFIA 2O6AA 4YB5A 5FHMA 4N6PA 3G3KA 2ESNA 4DXCA 5I84A 5CMKA 3TTMA 2VOZA 3MUQA 1IQ7A 2A5TB 2Q2CA 1SD3A 4FEBA 2F6GA 3ODBA 2E0SA 5H8NB 3QUFA 4LONB 4TLLB 3SDFA 3TTNA 4C1UA 1MQJA 2QMWA 4IO4A 3LSFB 3KN8A 2F7BA 4FORA 3TODA 4IB2A 3IORA 3U94A 3RPWA 3C33A 4KFQA 1IEJA 5ICQA 1RKMA 2NUVA 2O51A 3N5LA 1SW1A 1MQDA 1SW5A 3EPEA 3U8QA 1MPBA 1SI1A 4G4PA 1B3HA 3QYTA 3FJ7A 3C31A 2DWAA 3H6VA 2F78A 4IY5A 3MAMA 4EQBA 1B40A 2GRVA 3MQ9A 2RCAA 3CRBA 3OOAA 5I2KA 2I49A 3FVOA 3T9UA 3UIFA 1LFIA 4G2ZA 4EXKA 3PMWA 3IOUA 2LAOA 4FECA 3O6IA 1R9QA 4YICA 3JZJA 5IAIA 1MXYA 3T9VA 2H99A 4YB7A 3FD3A 3PPRA 2F5XA 2BJJX 4ZZEA 1DOTA 4F3PA 3K1MA 4R75A 1TXFA 2X7QA 1A55A 3KJ7A 5CRYA 5DVFA 3FV2A 4Q8RA 2ONRA 3K01A 4GD5A 4OVJA 2UXAA 4YKPA 4QRZA 2RINA 3GZGA 3UORA 3JV9A 1LBBA 1PB7A 1CE2A 2P0SA 1URDA 5ISUA 4XKRA 4BDNA 1IXIA 1D4NA 4KR5A 1MY3A 1B5IA 4U21A 4BLAA 5I56A 2OJTA 3VVDA 3OO7A 1YCJA 1GVCA 4WEPA 3W9VA 1US4A 1B4ZA 4ESWA 4H6DA 3RTWB 3FUZA 4LATA 1B52A 4KI0E 1TWYA 2CZLA 1SW2A 3K02A 1URSA 4C0RA 2Y7IA 3I6VA 4Z0IA 1OIBA 3HO7A 3PD8A 3CFZA 3SEVA 2NXOA 4JDFA 3G3GA 4OESA 3VXCA 5ICTA 1P1NA 3MPLA 3FZVA 3USDA 1N3XA 4RK2A 2DVZA 4HCYA 3EQ1A 4GLIA 3Q25A 3DM0A 2W7YA 5AA1A 1Y3PA 2FYIA 2B3BA 2DXYA 5CMBA 5F1QA 3V8XB 4ZE8A 2XXYA 1JVYA 4OEVA 2GFEA 2PT2A 2F97A 2QPQA 2GHAA 1R9LA 3MC2A 2DWHA 1LAGE 4PQJA 1OQHA 4O3AA 1UIUA 4NWCA 3HCQA 4TLMB 3O2AA 2I0CA 3H7MA 1A8FA 4YU0A 5KZTA 1MXWA 1POTA 3LR1A 2DVCA 2OWSA 4LQ5A 4DXUA 4R6HA 4HW8A 3KOSA 5H8FB 2PYYA 1RYOA 4JSOA 3WAFA 1USYH 4NF5A 4L17A 3KN3A 4PFTA 1F9BA 3TAJA 2UVHA 5H8QB 1I69A 1B05A 4NF6A 3A3CA 4F3BA 4FATA 3OEMA 3H06B 5ELVA 3WAEA 4R6KA 1XC1A 1IITA 3ILUB 2XXPA 2QMXA 4ZEFA 3OO9A 2O1LA 3IOTA 2Z8FA 2VD3A 4ZEDA 3U92A 1I6AA 3Q29A 5ITOA 3IAZA 4MBPA 4MLVA 4KYDA 4GFRA 2XX7A 1Z7NE 1PB8A 4G68A 3C35A 1I6QA 3VVFA 3VVEA 2RC8A 4KQPA 3DP4A 1JEVA 4R2FA 1N04A 2F35A 2DWJA 5L9MA 2VD2A 4QFKA 1UTBA 1US5A 4EF2A 2QS2A 2I4BA 1GR2A 3C36A 2CMOA 1MDP1 3TMGA 4Q30B 4TOZA 3EHSA 3PD9A 2VHAA 3KN7A 3M3KA 3OEKA 1B32A 1ZJLA 5AA2A 4BDRA 3P7IA 4X9TA 2VGQA 1GGGA 1GTKA 3IR1A 5KCJB 2M8CA 3HV1A 1SDXA 2PX1A 5K2XA 5CI5A 3G3JA 3TZAA 3SEWA 3E3KA 1MPDA 4ELQA 1DTGA 3TQLA 1MRPA 1Y1MA 4HTGA 3FXQA 5TPAB 4H8JA 4GXSB 2UVIA 4FJPA 2NOOA 3E13X 3SEUA 4Z7EA 1Q35A 1URGA 2IEEA 2PBWA 2F8DA 1FQAA 3MBPA 3LC8A 2XXHA 1JW1A 3C4MA 4JWYA 3TTKA 1ZMGA 1SI0A 1DPPA 2RC7A 2XXIA 3ZKLA 1R6ZA 4WXJA 4OENA 4F19A 3B6TA 3IK6B 3HSTA 3PV0E 5CMMA 3Q28A 4XXUA 1Y1ZA 1NNTA 4GOTA 3IJOB 1JNFA 1L5TA 3PPQA 3VLWA 4Q5TA 1VE4A 1LCFA 2Q89A 1O7TA 1NH7A 1BKAA 4ISUA 1PDAA 1UIVA 2OLBA 3C32A 1Q1KA 2I4CA 3B6WA 2KLFA 2QL3A 3I3VA 1B5JA 2H9BA 3FVGA 4IGRA 3K6VA 3MP8A 2XHDA 2DE3A 1P1WA 1TT1A 3PMXA 2AIXA 4NF4B 4ZEBA 1A99A 3EHUA 3FV1A 2V84A 3KZGA 1VR5A 4G8NA 2A5SA 5BUUA 4AB6A 5CBRA 3UP9A 3OELA 2ALUA 3PUYE 1B58A 3O6HA 1FQDA 5B7DA 3RY3A 3PUXE 4FEDA 2P2AA 3K0VA 1FQFA 1DTZA 1NL5A 1B3GA 5I2NB 4XTCQ 3PGFA 1AL3A 3C34A 3KEIA 5I56B 2XX9A 5AA3A 4QSCA 4YB6A 3IOVA 5L9SA 2R6GE 1AOVA 4XKNA 1KWHA 5CC2A 1M5DA 4M4GA 2Z8EA 4JWXA 2UVGA 4I8CA 5EHSA 4DZ1A 1A8EA 4P0GA 4PFYA 3TCHA 1NNKA 1SYHA 4BDOA 4LQ2A 4GWOA 4WEDA 3K00A 3H03A 3V5AA 3TEPA 2HZLA 4U2RA 1UTHB 4GRKA 3S2VA 1R1NA 1H45A 4PFUA 4KD5A 3QXMA 1S7YA 1LB8A 3KFMA 3MWBA 5KDTA 4LVQA 3GXAA 3M8UA 3JYRA 1P1OA 3BBRA 3O29A 1B5HA 1OQGA 3S4UA 2XXRA 4EUOA 1WODA 4M1VA 3O28A 1BIYA 1A40A 1MY2A 2D21A 4THIA 1P1UA 3VLUA 1A54A 4POXA 3MW0A 4ELRA 4NF5B 1VFDA 5FTIA 1XVYA 2AL5A 2THIA 3PMVA 1PBPA 1SBPA 3IX1A 1II5A 4I1DA 5JK4A 1MY4A 1B4HA 3N94A 3MP6A 5TP9A 4G8HA 3K6XA 3U93A 3S9MC 5AA4A 3HPIA 4POWA 4OMBA 1MS7A 1ZBMA 3V89B 3H4ZA 1B7UA 4F2QA 1MM7A 1ELJA 5HM4B 4ZECA 2V3UA 4H67A 1LSTA 5DYHA 2DYXA 4G68B 1JW4A 4U1OA 4K3FA 2GH9A 1NFTA 2I0BA 4RJZA 4YMAA 3S9EA 1B3EA 3S9NC 2ZNSA 1UTBB 3T22A 3TKDA 4LP2B 3KOTA 1M5BA 1B46A 1N0TA 1OLCA 1O64A 5AE4A 2VP1A 1IUDA 2Y84A 4KCDA 3ILTB 2DOJA 1SYIA 5I57A 2RKMA 1EZOA 1DSNA 1H3DA 1YAEA 1XHYA 3RGYA 1FQCA 3MP1A 4DDDA 3TUSA 3E9XA 3VDFA 2DSFA 2IA4A 1LAXA 4QSEA 2QSXA 1A7LA 2WKYA 4OFJA 3SEXA 1QUIA 1NNPA 2QRYA 2Y7WA 2ZYKA 5CM6A 2Y7RA 5CBSA 1QKBA 2ZNUA 3FIRA 1OVBA 4G68C 3TTLA 1MH4A 4KYSA 3UGWA 1QJMA 5JTYA 1M5CA 3N26A 1HSEA 2R9JA 2XD2A 1FCKA 3F11A 2XXUA 3C9HA 1B3FA 4H5GA 3RQTA 3RT6B 1B0LA 1XOCA 5FHOA 3IO4A 3OSRA 4HCWA 5FTHA 3PPNA 4I9DA 3ECRA 4F1VA 1JETA 1B0HA 2Y7KA 4MF3A 3HN0A 4R72A 2H98A 4EXLA 4DXBA 2QS3A 4OTEA 1EH3A 5J1DA 3SKPA 1BTJA 1ANFA 3L6HA 4GL0A 2O69A 4ZE9A 4IO7A 4DIGA 4JWOA 1MY0A 2P1SA 3RUMA 4NMYA 5FHNA 3R26A 4BDQA 1MXVA 1YTVA 4RPOA 4R9FA 5EHMA 1LLSA 1S9TA 5DEXB 2HAVA 2D3IA 2PMSA 1B2HA 1N7XA 3MJNA 5L8DA 4QFLA 2B65A 4UA8A 3CR9A 4KHZE 3EN3A 3FVNA 2HCAA 3GBBA 4GXAA 5A5XB 1JW5A 5I58B 1N3WA 1MQHA 2HQ0A 4PE5B 2XXVA 4XKQA 4OXVA 3HHFA 1LB9A 3H6UA 1N7WA 4G77A 1DPEA 4N13A 5F7VA 3O6GA 3VE1B 4R9GA 4UACA 4GVOA 3CFLA 4IY6A 4RPNA 2UYEA 3ZS6A 2I48A 2Q8JA 2XX8A 3A09A 5DTBA 4ONYA 2HZKA 4LZ5A 1M5EA 1IXGA 4RNSA 4ZDMA 1ZKBA 2I3WA 1PC3A 3M3FA 3G3HA 4F29A 3LUYA 5ITPA 3MPKA 4O3CA 5H8FA 3OSQA 3OO6A 1EZ9A 2DS9A 1DMBA 2X26A 5HPQA 1QKAA 3K4UA 4P0IA 2OCUA 4U4XA 4F22A 2R71A 3M3LA 2ZNTA 3FATA 4NE4A 3RT8A 3K1NA 4NTLA 5KDTB 1Y20A 3IJXB 1B1XA 5H8QA 1JQFA 3RTFB 3OENA 1FQBA 1FTOA 4AQ4A 3AXFA 5I2KB 3T66A 4JBZA 2ABHA 1MXZA 2OZZA 3I5OA 4F3SA 1GV8A 2HFBA 3VFJA 4PFWA 2QJEA 4RYAA 4QFPA 3Q27A 3RLFE 4GQOA 3QUJA 4OETA 2DE4A 3SESA 3T9XB 2V93A 3ZKKA 2H4IA 2ONSA 1Y4TA 4DE8A 1N76A 4DCYA 3CVGA 5HBCA 2F36A 5EYFA 2D5WA 3MZBA 3V83A 2XXTA 3PUVE 2RC9A 5TP9B 5DT6A 3ZSFA 4OWDA 4KPTA 4F2OA 1B6HA 1QUKA 3KSXA 4WKMA 3S9LC 2HEUA 3BFTA 4C1TA 3IO6A 1EZPA 3PUZE 1Y9UA 3R7XA 1FW0A 1MQIA 1MPCA 5KCJA 1NH8A 2AL4A 3GBAA 2Z8DA 2Z23A 3DLNA 4ZZAA 5I59A 2I3VA 4FAJA 3RNNA 1IXHA 2PT1A 1RYXA 1VSOA 4OHNA 5TPAA 4XIGQ 4G8MA 1SVXB 1MDQA 5H8HA 3RN8A 2UVJA 4QFNA 5I57B 3QIMA 2QS4A 3D4GA 3OO8A 3OD7A 2DWIA 3ONMA 3CFXA 2B3FA 3SETA 1LFGA 4MH5A 3TDJA 3MVYA 4X1DA 4OERA 1OMPA 3UA8A 4BDMA 4OZ9A 3EHTA 3FJGA 2OWTA 1B51A 4X48A 4JB7A 5M2VA 3H6TA 3N6UA 4RK9A 2OBGA 3H3GA 3PU5A 4GIZA 1JEUA 1AMFA 2DXRA 1FTKA 4ZEKA 4AB5A 1T0KA 5JTYB 1MY1A 4Q0CA 4XKPA 2ZXTA 4NWDA 4EQ7A 1N84A 4RA1A 5L9OA 4NF4A 1LAFE 1FTLA 1QW0A 4QSDA 4NF6B 1SW4A 4H65A 5H8SA 4FIMA 4YKIA 1P1QA 1I6BA 2XXWA 3O66A 4F1UA 1Y4CA 3QK6A 3FVKA 3TPAA 4OFLA 2F7CA 4TQUQ 5DVJA 3QAXA 2ZYOA 4ECFA 1JVXA 2E1SA 5I2NA 4HS7A 4H8IA 3IB2A 4NF8A 4YKJA 1ZIUA 4IO6A 3K6UA 4LZ7A 4X1BA 2G29A 1PEBA 1USYE 3A3UA 1HSLA 3TTRA 3CSBA 1TFAA 2DE2A 1LBCA 4YZZA 3OMBA 2Q9TA 4RXLA 4N07A 3THIA 5AA2D 2A5TA 4JSDA 3K2DA 5H8NA 1J1NA 1LAHE 4KYEA 5AA2B 3G3FA 2REGA 3D4CA 2DQVA 3EF7A 4OQOA 2UYFA 3LSLA 1MH3A 4P11A 3FASA 1D3KA 3KSJA 4MLQA 4R73A 3FXUA 1UTHA 1NNFA 2V3TA 1H76A 4QFOA 3TQWA 2XD3A 2FA7A 2FNCA 2RF1A 1B3LA 3CG1A 3K1PA 4O3BA 4E0XA 1XT8A 2HXWA 3DP6A 4ESXA 2REJA 3BFUA 1QULA 1M5FA 5DVIA 4U23A 3CIJA 3SERA 3O9PA 2XXXA 4F18A 2V3QA 3G7WA 2F6PA 3MVXA 4EDPA 1S50A 4ZS9A 3IOWA 4DCXA 4H1XA 4H5FA 5TU0A 2HAUA 1AH5A 3T93B 1MQGA 1FQEA 1Y3NA 4EQ9A 4U4SA 4I62A 5CMCA 1B9JA 3VXBA 4NEDA 3W9WA 3G3IA 1YPNA 3TFLA 2I6EA 3B7DA 2ONKE 4ND9A 3TCGA 2X7PA 2YPNA 3U72A 4RY1A 1B1HA 1MXUA 4YKKA 1IZ1A 3LBSA 3VV5A 1VFEA 1B7HA 3MZ1A 2PVUA 4BDLA 1QVSA 2O7IA 1ZU0A 3MZ9A 4U22A 1WVJA 1QUJA 1EU8A 3SEYA 4QF9A 4OEUA 1XS5A 2H5YA 4QHQA 3KGCA 3IB1A 1IIWA 2V25A 3T96B 4ELOA 4F1YA 1BP5A 3DELB 2XXQA 3MVWA 4KCCA 1BLFA 4F31B 2I58A 4YMBA 3PPOA 1H43A 2Z22A 2ANJA 4GL8A 3R6UA 1XVXA 4DLDA 4F39A 1ZTYA 4IO3A 1LGBC 4PP0A 2O1MA 5I59B 1NMUA 4OFOA 2DP8A 4IO2A 2ZYNA 5LOMA 2AYSA 1CB6A 3KG2A 2H25A 2Q88A 2OK2A 2O7UA 1PBQA 1B7ZA 4IO5A 3Q26A 1TFDA 1PB9A 2NWJA 5H8HB 3GLBA 1AIVA 3TYHA 1HSJA 2F7AA 2O68A 1Z7ME 1ZLQA 3QSLA 3FJMA 4H0WA 2QS1A 3PPPA 4OYVA 2G93A 3T9HB 1ATGA 4R74A 3L6GA 1IXCA 4E0WA 4IGTA 2ZMBA 4JXIA 3FGSA 3VLVA 1UQWA 1MM6A 3TCFA 3UN6A 1H44A 3CI8A 2F34A 3LSXA 3W15C 3CG3A 3IB0A 2YLNA 3IL1B 1WDNA 1LFHA 4U1ZA 2RCBA 4EF1A 4R6YA 2ZYMA 3KBRA 4F3GA 3CSGA 3OXNA 5K2YA 4LUBA 1P99A 2Q2AA 2NVUB 3LSWA 1FTJA 1D9VA 3E4RA 1FTMA 5JEIA 3DP8A 3N6TA 1OLAA 4LZ8A 1NKXA 3PUWE 2Y7PA 3MVZA 1Y3QA 3TELA 5DEXA 2YJPA 3HHGA 5AA4B 4LA9A 3H6WA 3U1OA 1OVTA 5BWJA 3BKIB 4R2BA 1POY1 1LCTA 3O97A 1MG1A 4FE8A 4GF8A 3B6QA 4ZEIA
chains in the Genus database with same CATH superfamily
3E78A 4PETA 5A5XA 3BIGA 1O63A 5I58A 4YAHX 1MXXA 5IKBA 1SQYA 2GHBA 5B70A 1D9YA 4NF8B 2O84X 3K6WA 3KJTA 1FPBA 4ELPA 3UK4A 3FXRA 4MFIA 2O6AA 2KQZA 4YB5A 5FHMA 4P1EA 4N6PA 3G3KA 2ESNA 2MKZA 4DXCA 4MNPA 5I84A 5CMKA 3TTMA 3FXBA 2VOZA 3MUQA 3MYUA 1IQ7A 2Q8MA 4P8BA 2A5TB 2Q2CA 1SD3A 4FEBA 2F6GA 3ODBA 2E0SA 5H8NB 3QUFA 4LONB 4TLLB 3SDFA 1SPIA 3TTNA 4C1UA 1MQJA 2QMWA 4IO4A 3LSFB 4DI4B 3KN8A 2F7BA 4FORA 3TODA 4IB2A 3IORA 3U94A 3RPWA 3C33A 4KFQA 1IEJA 5ICQA 1RKMA 2NUVA 2O51A 2WEFA 3N5LA 1SW1A 5ET7A 1SW5A 1MQDA 3LV0A 3EPEA 3U8QA 1NUWA 2PCRA 1MPBA 1SI1A 4G4PA 2P3VA 1B3HA 3QYTA 3FJ7A 3C31A 2DWAA 3H6VA 2F78A 4IY5A 3MAMA 4EQBA 1B40A 2GRVA 1CNQA 4GBWA 3MQ9A 2RCAA 3CRBA 3OOAA 5I2KA 2I49A 3FVOA 3T9UA 3PTYA 3UIFA 1LFIA 4G2ZA 4EXKA 3PMWA 3IOUA 2LAOA 5ET8A 4PAFA 4FECA 3O6IA 1R9QA 4YICA 3JZJA 3U65A 5IAIA 1MXYA 3T9VA 2H99A 4YB7A 3FD3A 3PPRA 2F5XA 2BJJX 4ZZEA 1DOTA 4F3PA 3K1MA 4R75A 1TXFA 2X7QA 1A55A 4GBVA 4FBPA 3KJ7A 5CRYA 5DVFA 3FV2A 4Q8RA 2ONRA 4MIJA 2ZZWA 3K01A 4GD5A 4OVJA 2UXAA 4YKPA 4QRZA 2RINA 3GZGA 3UORA 3JV9A 1LBBA 1PB7A 1CE2A 2P0SA 1URDA 5ISUA 4XKRA 4BDNA 1IXIA 1D4NA 4HE1A 4KR5A 1MY3A 1B5IA 4OVSA 1BK4A 4U21A 5A5LA 4BLAA 5I56A 4OVQA 2OJTA 3VVDA 3OO7A 1YCJA 1GVCA 4WEPA 3W9VA 1US4A 1B4ZA 1IMEA 3HFUA 4O7MA 4ESWA 4H6DA 3RTWB 3FUZA 4LATA 1B52A 4KI0E 1TWYA 2CZLA 1SW2A 3K02A 1URSA 4C0RA 2Y7IA 3I6VA 4Z0IA 1OIBA 3HO7A 3PD8A 1FPEA 3CFZA 3SEVA 1IMCA 4H45A 2NXOA 4UABA 4JDFA 3G3GA 4OESA 3VXCA 5ICTA 2XXKA 1P1NA 4MAGA 3MPLA 1AWBA 3FZVA 4PAKA 3USDA 1N3XA 2WYKA 4RK2A 1KZ8A 2DVZA 4HCYA 3EQ1A 4GLIA 3Q25A 3DM0A 2FBPA 2W7YA 5AA1A 1Y3PA 2FYIA 5EQ7A 2B3BA 2DXYA 5CMBA 5F1QA 3V8XB 4ZE8A 2XXYA 1JVYA 4OEVA 2GFEA 2PT2A 2F97A 3B50A 2QPQA 1NUXA 2GHAA 1R9LA 3MC2A 2DWHA 4PE3A 4N17A 1LAGE 4PQJA 3T1BA 1OQHA 4O3AA 1UIUA 4NWCA 3HCQA 4TLMB 4XF5A 3O2AA 2I0CA 3H7MA 1A8FA 4YU0A 5KZTA 1MXWA 1POTA 3LR1A 5IM2A 2DVCA 2OWSA 4LQ5A 4DXUA 4R6HA 4GX6A 4MMPA 4HW8A 3KOSA 5H8FB 2PYYA 2HHMA 1RYOA 4JSOA 3WAFA 1USYH 4NF5A 4L17A 3KN3A 4PFTA 1F9BA 4PFRA 4GWZA 3TAJA 2UVHA 5H8QB 1I69A 1B05A 4NF6A 3A3CA 4F3BA 4FATA 3OEMA 3H06B 5ELVA 3WAEA 4R6KA 1XC1A 4O94A 1IITA 3ILUB 2XXPA 2QMXA 3OO9A 4ZEFA 2O1LA 3IOTA 2Z8FA 3ISPA 5IZ3B 3IFCA 2VD3A 4ZEDA 1DK4A 3U92A 1I6AA 3Q29A 5ITOA 3IAZA 4OA4A 4MBPA 4MLVA 4KYDA 1LBWA 4GFRA 2XX7A 5F24A 1Z7NE 1PB8A 4G68A 3C35A 1I6QA 3VVFA 3VVEA 2RC8A 4KQPA 3DP4A 1JEVA 4R2FA 1N04A 2F35A 2DWJA 5L9MA 2VD2A 4QFKA 1UTBA 1US5A 4EF2A 2QS2A 2I4BA 2CZHA 1GR2A 3C36A 2CMOA 1MDP1 4N15A 3TMGA 4Q30B 4TOZA 3EHSA 3PD9A 2VHAA 4MEVA 4N4UA 3KN7A 3M3KA 3OEKA 1B32A 1ZJLA 5AA2A 4BDRA 3P7IA 3B8BA 4X9TA 2VGQA 1GGGA 1GTKA 3IR1A 5KCJB 2M8CA 3HV1A 1FPGA 1SDXA 2PX1A 5K2XA 5CI5A 3G3JA 3TZAA 3SEWA 3E3KA 1MPDA 4ELQA 2XWVA 1DTGA 3TQLA 1MRPA 1Y1MA 4HTGA 3FXQA 1LBVA 5TPAB 4H8JA 2WX9A 4GXSB 2UVIA 3KBZA 4FJPA 2NOOA 3A29A 3E13X 3SEUA 4Z7EA 1Q35A 1URGA 2IEEA 2PBWA 2F8DA 1FQAA 1IMBA 3MBPA 3LC8A 2XXHA 1JW1A 3C4MA 4JWYA 3TTKA 1ZMGA 1SI0A 3KC0A 1DPPA 2RC7A 2XXIA 3ZKLA 1R6ZA 4WXJA 4OENA 4F19A 3B6TA 3IK6B 3HSTA 3PV0E 5CMMA 3Q28A 4XXUA 1Y1ZA 1NNTA 4GOTA 3IJOB 1JNFA 1L5TA 3PPQA 3VLWA 4Q5TA 1VE4A 1LCFA 2Q89A 1O7TA 1NH7A 1BKAA 4ISUA 1PDAA 1UIVA 2OLBA 3C32A 1Q1KA 2I4CA 3B6WA 4MHFA 2KLFA 2QL3A 5J16A 3I3VA 1B5JA 2H9BA 3FVGA 4IGRA 3K6VA 3MP8A 2XHDA 2DE3A 1P1WA 1TT1A 3PMXA 2AIXA 4NF4B 4ZEBA 1A99A 3EHUA 3FV1A 2V84A 2HXRA 4OANA 3KZGA 4P1LA 1VR5A 4G8NA 2A5SA 4PTKA 5BUUA 4AB6A 5CBRA 3UP9A 3OELA 2ALUA 3PUYE 1B58A 3O6HA 1FQDA 5B7DA 3RY3A 3PUXE 4AS4A 4FEDA 2P2AA 3K0VA 1FQFA 1DTZA 1NL5A 1B3GA 1YZ0A 4P47A 5I2NB 4XTCQ 1FRPA 3PGFA 1AL3A 3C34A 3KEIA 4PDDA 5I56B 2XX9A 5AA3A 4QSCA 4YB6A 3IOVA 5L9SA 2R6GE 1AOVA 4XKNA 1KWHA 4KXPA 5CC2A 4I40A 1M5DA 4M4GA 2Z8EA 5EYHA 4JWXA 2UVGA 4I8CA 5EHSA 4DZ1A 1FPKA 1A8EA 4P0GA 4I3EA 4PFYA 3TCHA 1NNKA 1SYHA 3MSTA 4BDOA 1NV1A 4LQ2A 4GWOA 4WEDA 3K00A 3H03A 3V5AA 3TEPA 2HZLA 2VPOA 4U2RA 1UTHB 4GRKA 3S2VA 1K9ZA 1R1NA 1H45A 4PFUA 4KD5A 3QXMA 1S7YA 1LB8A 3KFMA 3MWBA 5KDTA 4LVQA 3GXAA 3M8UA 5I7IA 3JYRA 5IZ1A 1P1OA 3BBRA 3O29A 1B5HA 2ZZXA 1OQGA 3S4UA 3RPLA 2XXRA 4EUOA 1WODA 4QXDA 4M1VA 1LBXA 3O28A 1BIYA 1FSAA 1A40A 1MY2A 2D21A 4THIA 1P1UA 3VLUA 1A54A 4POXA 3MW0A 2FVZA 2B4LA 4ELRA 4NF5B 1FPIA 1VFDA 5LDZA 5FTIA 1XVYA 2AL5A 2THIA 1K9YA 3PMVA 1PBPA 1SBPA 3IX1A 1II5A 4I1DA 5JK4A 1MY4A 5FBPA 4X04A 4PF8A 1B4HA 3N94A 3MP6A 5TP9A 4G8HA 1IMFA 3K6XA 3U93A 3S9MC 5AA4A 3HPIA 4POWA 4OMBA 1MS7A 1ZBMA 1FTAA 3V89B 3H4ZA 1B7UA 4F2QA 1MM7A 1ELJA 5HM4B 4ZECA 4PAIA 2V3UA 4H67A 1LBYA 1LSTA 5DYHA 1FPLA 1FBDA 2DYXA 4G68B 1JW4A 4U1OA 4K3FA 2GH9A 3EKIA 1NFTA 2I0BA 4RJZA 4YMAA 3S9EA 1B3EA 3S9NC 2ZNSA 1UTBB 3T22A 3TKDA 4LP2B 4H46A 3KOTA 1M5BA 4MNIA 1B46A 1N0TA 1INPA 1OLCA 1O64A 5AE4A 2VP1A 1IUDA 2Y84A 4KCDA 4NHBA 3ILTB 2DOJA 1SYIA 5I57A 2RKMA 1EZOA 1DSNA 4I3YA 1H3DA 1YAEA 1FPJA 1XHYA 3RGYA 1FQCA 3MP1A 4N91A 4DDDA 4PBQA 3TUSA 3E9XA 3VDFA 2DSFA 5IGAA 2IA4A 1LAXA 4QSEA 2QSXA 4HE2A 1A7LA 2WKYA 4OFJA 3SEXA 1QUIA 4PGNA 1NNPA 2QRYA 2Y7WA 2ZYKA 1NUZA 5CM6A 2Y7RA 5CBSA 1QKBA 2ZNUA 1EYKA 3FIRA 1NUYA 1OVBA 4G68C 4NG7A 3TTLA 3D1RA 1MH4A 4KYSA 3UGWA 1QJMA 5JTYA 1M5CA 5EQAA 3N26A 1HSEA 2R9JA 2XD2A 1FCKA 3F11A 2XXUA 3C9HA 1B3FA 4H5GA 3RQTA 3RT6B 1B0LA 1XOCA 4LN5A 5FHOA 3IO4A 3RYDA 3OSRA 4HCWA 5FTHA 3PPNA 1FBPA 4I9DA 3ECRA 4F1VA 1IMAA 1JETA 1B0HA 2Y7KA 4MF3A 3HN0A 4R72A 2H98A 4EXLA 4DXBA 2QS3A 4OTEA 1EH3A 5J1DA 3SKPA 1BTJA 1ANFA 3L6HA 1VDWA 1EYIA 4GL0A 2O69A 4N6DA 4ZE9A 4IO7A 4DIGA 4JWOA 1KA1A 1MY0A 2P1SA 3RUMA 1FJ6A 1NV7A 2L5VA 4NMYA 5FHNA 4HE0A 2P3NA 3R26A 4BDQA 1MXVA 1YTVA 4RPOA 4R9FA 5EHMA 1LLSA 1S9TA 5DEXB 2HAVA 2WYPA 2D3IA 2PMSA 1B2HA 1N7XA 3MJNA 5L8DA 4QFLA 2B65A 2FIXA 4UA8A 3CR9A 4GWXA 4KHZE 3EN3A 3FVNA 2HCAA 3GBBA 4GXAA 2OWZA 5A5XB 4JVIA 1JW5A 5I58B 1N3WA 1MQHA 2HQ0A 4PE5B 2XXVA 4XKQA 4OXVA 3HHFA 1LB9A 3H6UA 5LTCA 1NV4A 1N7WA 4G77A 1DPEA 4N13A 5F7VA 3O6GA 3VE1B 4R9GA 2BJIA 4UACA 4GVOA 3CFLA 4IY6A 4RPNA 3BIHA 2UYEA 3ZS6A 2I48A 2JJKA 4MCOA 5EQ8A 2Q8JA 2XX8A 3A09A 5DTBA 4ONYA 3T0JA 2HZKA 4LZ5A 1M5EA 1IXGA 3LUZA 4RNSA 4ZDMA 1ZKBA 3SZPA 2I3WA 1PC3A 3M3FA 3G3HA 4F29A 3LUYA 5ITPA 2XWOA 1FPDA 3MPKA 4O3CA 5H8FA 3OSQA 3OO6A 1EZ9A 2DS9A 1DMBA 2X26A 5HPQA 1QKAA 4PCDA 3K4UA 4P0IA 2OCUA 4U4XA 1FBHA 4X8RA 2WBBA 2R71A 4F22A 3M3LA 2ZNTA 3FATA 4N6KA 4NE4A 2VT5A 3RT8A 3K1NA 4NTLA 5KDTB 1Y20A 2QVRA 4AS5A 3IJXB 1B1XA 5H8QA 1JQFA 3RTFB 2VPNA 3OENA 1FQBA 1FTOA 4AQ4A 3AXFA 5I2KB 3T66A 4JBZA 2ABHA 4JVDA 1MXZA 2OZZA 3I5OA 4F3SA 1GV8A 4PBHA 2HFBA 3VFJA 4PFWA 2QJEA 4RYAA 4QFPA 1FJ9A 3Q27A 4PFIA 3RLFE 4GQOA 3QUJA 4OETA 4NAPA 2DE4A 3SESA 4NN3A 3T9XB 2V93A 3ZKKA 2H4IA 2ONSA 1FPFA 1Y4TA 4DE8A 1N76A 4DCYA 3CVGA 1DBZA 1NV5A 5HBCA 2F36A 5EYFA 2D5WA 3MZBA 4IR8A 3V83A 3GYYA 2XXTA 3PUVE 4XEQA 2RC9A 5TP9B 5DT6A 3ZSFA 4OWDA 4KPTA 4F2OA 1B6HA 1QUKA 3KSXA 4WKMA 3S9LC 2HEUA 2Q74A 3BFTA 4GX4A 4C1TA 3IO6A 1EZPA 3PUZE 1Y9UA 4MX6A 3R7XA 4NGUA 1FW0A 1MQIA 1MPCA 5KCJA 1NH8A 2AL4A 4GWSA 2HPGA 3GBAA 2Z8DA 2Z23A 3DLNA 4ZZAA 2CZKA 4PDHA 5I59A 2I3VA 4FAJA 3RNNA 1IXHA 2PT1A 1RYXA 5EYGA 1VSOA 4O8MA 4OHNA 5TPAA 4XIGQ 4G8MA 3E79A 1DCUA 2V4CA 1SVXB 1MDQA 5H8HA 3RN8A 2UVJA 4QFNA 5ESYA 5I57B 3QIMA 2QS4A 4PC9A 3D4GA 3OO8A 3OD7A 2DWIA 1G0HA 3ONMA 3CFXA 2B3FA 4GWWA 3SETA 1LFGA 4MH5A 4NF0A 3TDJA 1QGXA 3MVYA 4X1DA 1FBCA 4OERA 4PF6A 1OMPA 4GWUA 3UA8A 4BDMA 4OZ9A 3EHTA 3FJGA 1XI6A 2OWTA 1B51A 4X48A 2F3DA 4JB7A 1LEVA 5M2VA 3H6TA 3N6UA 5I5PA 4RK9A 2OBGA 3H3GA 3PU5A 4GIZA 1JEUA 1AMFA 2DXRA 1FTKA 4ZEKA 4AB5A 1T0KA 5JTYB 1MY1A 4Q0CA 4XKPA 1G0IA 4GWYA 2ZXTA 4NWDA 4EQ7A 1N84A 4RA1A 5L9OA 4NF4A 1LAFE 1FTLA 1QW0A 4QSDA 4NF6B 1SW4A 4H65A 5H8SA 4FIMA 1RDYA 4YKIA 1P1QA 1I6BA 2XXWA 3O66A 4F1UA 1Y4CA 3QK6A 2Y5LA 3FVKA 1RDZA 5ET5A 3TPAA 4OFLA 2F7CA 2FHYA 4TQUQ 5DVJA 3QAXA 1D9QA 2ZYOA 4ECFA 1JVXA 2E1SA 5I2NA 4HS7A 4H8IA 3IB2A 4NF8A 4YKJA 1ZIUA 4IO6A 3K6UA 4LZ7A 4X1BA 2G29A 1PEBA 1USYE 3A3UA 1HSLA 3TTRA 3CSBA 1TFAA 2DE2A 1IMDA 1LBCA 4YZZA 3OMBA 2Q9TA 4RXLA 1KA0A 4N07A 3THIA 5AA2D 2A5TA 4JSDA 3K2DA 5H8NA 1J1NA 1LAHE 2QFLA 4KYEA 5AA2B 3G3FA 2REGA 3D4CA 2DQVA 3EF7A 4OQOA 2UYFA 3LSLA 1MH3A 4P11A 3FASA 1D3KA 3KSJA 2XWIA 4MLQA 1NV2A 4R73A 3FXUA 1UTHA 4O7IA 1NNFA 2V3TA 1H76A 4QFOA 3TQWA 2XD3A 2FA7A 2FNCA 2RF1A 3QMFA 1B3LA 3CG1A 3K1PA 4O3BA 4E0XA 1XT8A 2HXWA 3DP6A 4ESXA 2REJA 2R8TA 5DW8A 3BFUA 4OVRA 1NV6A 1QULA 1M5FA 4XFEA 3IFAA 2PFZA 5DVIA 4U23A 3CIJA 1FBEA 3O9PA 3SERA 2XXXA 4F18A 2V3QA 2Y5KA 3G7WA 2F6PA 3MVXA 4EDPA 1S50A 2ZZVA 1YYZA 2QVUA 4ZS9A 3IOWA 4DCXA 4H1XA 4H5FA 5TU0A 2HAUA 1EYJA 1AH5A 3T93B 1MQGA 1FQEA 1Y3NA 4EQ9A 2OX3A 4U4SA 2CZIA 4I62A 5CMCA 1B9JA 3VXBA 4NEDA 1JP4A 3W9WA 3G3IA 1YPNA 3TFLA 2I6EA 3B7DA 2ONKE 5EQ9A 4HXVA 3NOHA 4ND9A 3TCGA 1NI9A 2X7PA 2YPNA 3U72A 4RY1A 1YXIA 1B1HA 1MXUA 4YKKA 1IZ1A 2CEYA 3LBSA 2WBDA 3VV5A 1VFEA 1B7HA 3MZ1A 2PVUA 4BDLA 1QVSA 1FBFA 2O7IA 2KR0A 1ZU0A 3MZ9A 1NV0A 4U22A 4NQ8A 1WVJA 1QUJA 3CHGA 5T3JA 1EU8A 2CEXA 3SEYA 5IZZA 1RDXA 4QF9A 4OEUA 1XS5A 2H5YA 4QHQA 3KGCA 3IB1A 4OVPA 4DI3D 1IIWA 2V25A 3T96B 4ELOA 4F1YA 1BP5A 3DELB 2F3BA 2XXQA 3MVWA 1FBGA 4KCCA 2QVVA 1BLFA 4F31B 2I58A 4N8GA 4N81A 4YMBA 2PFYA 3PPOA 1H43A 5I3SA 4P56A 2Z22A 2ANJA 4MJOA 4GL8A 3R6UA 1XVXA 4G61A 4OVTA 4DLDA 4F39A 1ZTYA 4IO3A 1LGBC 4PP0A 2O1MA 5I59B 4GX3A 1NMUA 4OFOA 3FBPA 2DP8A 4IO2A 2ZYNA 5LOMA 2AYSA 1CB6A 3KG2A 2H25A 2Q88A 2OK2A 2O7UA 1PBQA 2FIEA 1B7ZA 4IO5A 3Q26A 4PFBA 1TFDA 1PB9A 2NWJA 5H8HB 3GLBA 1AIVA 4MNCA 3TYHA 2GQ1A 1HSJA 2F7AA 2O68A 1Z7ME 1ZLQA 3QSLA 3FJMA 4H0WA 2QS1A 3PPPA 4OYVA 2G93A 3T9HB 1ATGA 4R74A 3L6GA 1IXCA 4E0WA 4NX1A 4IGTA 2ZMBA 2XA5A 2B4MA 4JXIA 3FGSA 3VLVA 1UQWA 1MM6A 3RPLB 3TCFA 3UN6A 5IZ3A 1H44A 3CI8A 2F34A 3LSXA 3W15C 5ET6A 3CG3A 4PGPA 1LBZA 3IB0A 2YLNA 3IL1B 4JVCA 3ROJA 1WDNA 1LFHA 4U1ZA 2RCBA 4EF1A 4R6YA 2ZYMA 3KBRA 4F3GA 3CSGA 3OXNA 5K2YA 4LUBA 1P99A 2Q2AA 2NVUB 3LSWA 1FTJA 1D9VA 3E4RA 1FTMA 1NV3A 3DP8A 5JEIA 3N6TA 1OLAA 4LZ8A 1NKXA 3PUWE 1Q9DA 2Y7PA 3MVZA 1Y3QA 3TELA 2DDKA 3KC1A 5DEXA 2YJPA 3HHGA 5AA4B 4LA9A 3H6WA 4P9KA 3U1OA 1OVTA 5BWJA 3BKIB 4QBAA 4N8YA 4R2BA 1POY1 4P3LA 1LCTA 3O97A 1MG1A 4FE8A 4GF8A 2XWKA 3B6QA 4ZEIA
chains in the Genus database with same CATH topology
4PETA 5A5XA 1O63A 5I58A 4YAHX 1MXXA 5IKBA 1SQYA 2GHBA 5B70A 1D9YA 4NF8B 2O84X 3K6WA 3KJTA 4ELPA 3UK4A 3FXRA 4MFIA 2O6AA 4YB5A 5FHMA 4N6PA 3G3KA 2ESNA 4DXCA 5I84A 5CMKA 3TTMA 2VOZA 3MUQA 1IQ7A 2A5TB 2Q2CA 1SD3A 4FEBA 2F6GA 3ODBA 2E0SA 5H8NB 3QUFA 4LONB 4TLLB 3SDFA 3TTNA 4C1UA 1MQJA 2QMWA 4IO4A 3LSFB 3KN8A 2F7BA 4FORA 3TODA 4IB2A 3IORA 3U94A 3RPWA 3C33A 4KFQA 1IEJA 5ICQA 1RKMA 2NUVA 2O51A 3N5LA 1SW1A 1MQDA 1SW5A 3EPEA 3U8QA 1MPBA 1SI1A 4G4PA 1B3HA 3QYTA 3FJ7A 3C31A 2DWAA 3H6VA 2F78A 4IY5A 3MAMA 4EQBA 1B40A 2GRVA 3MQ9A 2RCAA 3CRBA 3OOAA 5I2KA 2I49A 3FVOA 3T9UA 3UIFA 1LFIA 4G2ZA 4EXKA 3PMWA 3IOUA 2LAOA 4FECA 3O6IA 1R9QA 4YICA 3JZJA 5IAIA 1MXYA 3T9VA 2H99A 4YB7A 3FD3A 3PPRA 2F5XA 2BJJX 4ZZEA 1DOTA 4F3PA 3K1MA 4R75A 1TXFA 2X7QA 1A55A 3KJ7A 5CRYA 5DVFA 3FV2A 4Q8RA 2ONRA 3K01A 4GD5A 4OVJA 2UXAA 4YKPA 4QRZA 2RINA 3GZGA 3UORA 3JV9A 1LBBA 1PB7A 1CE2A 2P0SA 1URDA 5ISUA 4XKRA 4BDNA 1IXIA 1D4NA 4KR5A 1MY3A 1B5IA 4U21A 4BLAA 5I56A 2OJTA 3VVDA 3OO7A 1YCJA 1GVCA 4WEPA 3W9VA 1US4A 1B4ZA 4ESWA 4H6DA 3RTWB 3FUZA 4LATA 1B52A 4KI0E 1TWYA 2CZLA 1SW2A 3K02A 1URSA 4C0RA 2Y7IA 3I6VA 4Z0IA 1OIBA 3HO7A 3PD8A 3CFZA 3SEVA 2NXOA 4JDFA 3G3GA 4OESA 3VXCA 5ICTA 1P1NA 3MPLA 3FZVA 3USDA 1N3XA 4RK2A 2DVZA 4HCYA 3EQ1A 4GLIA 3Q25A 3DM0A 2W7YA 5AA1A 1Y3PA 2FYIA 2B3BA 2DXYA 5CMBA 5F1QA 3V8XB 4ZE8A 2XXYA 1JVYA 4OEVA 2GFEA 2PT2A 2F97A 2QPQA 2GHAA 1R9LA 3MC2A 2DWHA 1LAGE 4PQJA 1OQHA 4O3AA 1UIUA 4NWCA 3HCQA 4TLMB 3O2AA 2I0CA 3H7MA 1A8FA 4YU0A 5KZTA 1MXWA 1POTA 3LR1A 2DVCA 2OWSA 4LQ5A 4DXUA 4R6HA 4HW8A 3KOSA 5H8FB 2PYYA 1RYOA 4JSOA 3WAFA 1USYH 4NF5A 4L17A 3KN3A 4PFTA 1F9BA 3TAJA 2UVHA 5H8QB 1I69A 1B05A 4NF6A 3A3CA 4F3BA 4FATA 3OEMA 3H06B 5ELVA 3WAEA 4R6KA 1XC1A 1IITA 3ILUB 2XXPA 2QMXA 4ZEFA 3OO9A 2O1LA 3IOTA 2Z8FA 2VD3A 4ZEDA 3U92A 1I6AA 3Q29A 5ITOA 3IAZA 4MBPA 4MLVA 4KYDA 4GFRA 2XX7A 1Z7NE 1PB8A 4G68A 3C35A 1I6QA 3VVFA 3VVEA 2RC8A 4KQPA 3DP4A 1JEVA 4R2FA 1N04A 2F35A 2DWJA 5L9MA 2VD2A 4QFKA 1UTBA 1US5A 4EF2A 2QS2A 2I4BA 1GR2A 3C36A 2CMOA 1MDP1 3TMGA 4Q30B 4TOZA 3EHSA 3PD9A 2VHAA 3KN7A 3M3KA 3OEKA 1B32A 1ZJLA 5AA2A 4BDRA 3P7IA 4X9TA 2VGQA 1GGGA 1GTKA 3IR1A 5KCJB 2M8CA 3HV1A 1SDXA 2PX1A 5K2XA 5CI5A 3G3JA 3TZAA 3SEWA 3E3KA 1MPDA 4ELQA 1DTGA 3TQLA 1MRPA 1Y1MA 4HTGA 3FXQA 5TPAB 4H8JA 4GXSB 2UVIA 4FJPA 2NOOA 3E13X 3SEUA 4Z7EA 1Q35A 1URGA 2IEEA 2PBWA 2F8DA 1FQAA 3MBPA 3LC8A 2XXHA 1JW1A 3C4MA 4JWYA 3TTKA 1ZMGA 1SI0A 1DPPA 2RC7A 2XXIA 3ZKLA 1R6ZA 4WXJA 4OENA 4F19A 3B6TA 3IK6B 3HSTA 3PV0E 5CMMA 3Q28A 4XXUA 1Y1ZA 1NNTA 4GOTA 3IJOB 1JNFA 1L5TA 3PPQA 3VLWA 4Q5TA 1VE4A 1LCFA 2Q89A 1O7TA 1NH7A 1BKAA 4ISUA 1PDAA 1UIVA 2OLBA 3C32A 1Q1KA 2I4CA 3B6WA 2KLFA 2QL3A 3I3VA 1B5JA 2H9BA 3FVGA 4IGRA 3K6VA 3MP8A 2XHDA 2DE3A 1P1WA 1TT1A 3PMXA 2AIXA 4NF4B 4ZEBA 1A99A 3EHUA 3FV1A 2V84A 3KZGA 1VR5A 4G8NA 2A5SA 5BUUA 4AB6A 5CBRA 3UP9A 3OELA 2ALUA 3PUYE 1B58A 3O6HA 1FQDA 5B7DA 3RY3A 3PUXE 4FEDA 2P2AA 3K0VA 1FQFA 1DTZA 1NL5A 1B3GA 5I2NB 4XTCQ 3PGFA 1AL3A 3C34A 3KEIA 5I56B 2XX9A 5AA3A 4QSCA 4YB6A 3IOVA 5L9SA 2R6GE 1AOVA 4XKNA 1KWHA 5CC2A 1M5DA 4M4GA 2Z8EA 4JWXA 2UVGA 4I8CA 5EHSA 4DZ1A 1A8EA 4P0GA 4PFYA 3TCHA 1NNKA 1SYHA 4BDOA 4LQ2A 4GWOA 4WEDA 3K00A 3H03A 3V5AA 3TEPA 2HZLA 4U2RA 1UTHB 4GRKA 3S2VA 1R1NA 1H45A 4PFUA 4KD5A 3QXMA 1S7YA 1LB8A 3KFMA 3MWBA 5KDTA 4LVQA 3GXAA 3M8UA 3JYRA 1P1OA 3BBRA 3O29A 1B5HA 1OQGA 3S4UA 2XXRA 4EUOA 1WODA 4M1VA 3O28A 1BIYA 1A40A 1MY2A 2D21A 4THIA 1P1UA 3VLUA 1A54A 4POXA 3MW0A 4ELRA 4NF5B 1VFDA 5FTIA 1XVYA 2AL5A 2THIA 3PMVA 1PBPA 1SBPA 3IX1A 1II5A 4I1DA 5JK4A 1MY4A 1B4HA 3N94A 3MP6A 5TP9A 4G8HA 3K6XA 3U93A 3S9MC 5AA4A 3HPIA 4POWA 4OMBA 1MS7A 1ZBMA 3V89B 3H4ZA 1B7UA 4F2QA 1MM7A 1ELJA 5HM4B 4ZECA 2V3UA 4H67A 1LSTA 5DYHA 2DYXA 4G68B 1JW4A 4U1OA 4K3FA 2GH9A 1NFTA 2I0BA 4RJZA 4YMAA 3S9EA 1B3EA 3S9NC 2ZNSA 1UTBB 3T22A 3TKDA 4LP2B 3KOTA 1M5BA 1B46A 1N0TA 1OLCA 1O64A 5AE4A 2VP1A 1IUDA 2Y84A 4KCDA 3ILTB 2DOJA 1SYIA 5I57A 2RKMA 1EZOA 1DSNA 1H3DA 1YAEA 1XHYA 3RGYA 1FQCA 3MP1A 4DDDA 3TUSA 3E9XA 3VDFA 2DSFA 2IA4A 1LAXA 4QSEA 2QSXA 1A7LA 2WKYA 4OFJA 3SEXA 1QUIA 1NNPA 2QRYA 2Y7WA 2ZYKA 5CM6A 2Y7RA 5CBSA 1QKBA 2ZNUA 3FIRA 1OVBA 4G68C 3TTLA 1MH4A 4KYSA 3UGWA 1QJMA 5JTYA 1M5CA 3N26A 1HSEA 2R9JA 2XD2A 1FCKA 3F11A 2XXUA 3C9HA 1B3FA 4H5GA 3RQTA 3RT6B 1B0LA 1XOCA 5FHOA 3IO4A 3OSRA 4HCWA 5FTHA 3PPNA 4I9DA 3ECRA 4F1VA 1JETA 1B0HA 2Y7KA 4MF3A 3HN0A 4R72A 2H98A 4EXLA 4DXBA 2QS3A 4OTEA 1EH3A 5J1DA 3SKPA 1BTJA 1ANFA 3L6HA 4GL0A 2O69A 4ZE9A 4IO7A 4DIGA 4JWOA 1MY0A 2P1SA 3RUMA 4NMYA 5FHNA 3R26A 4BDQA 1MXVA 1YTVA 4RPOA 4R9FA 5EHMA 1LLSA 1S9TA 5DEXB 2HAVA 2D3IA 2PMSA 1B2HA 1N7XA 3MJNA 5L8DA 4QFLA 2B65A 4UA8A 3CR9A 4KHZE 3EN3A 3FVNA 2HCAA 3GBBA 4GXAA 5A5XB 1JW5A 5I58B 1N3WA 1MQHA 2HQ0A 4PE5B 2XXVA 4XKQA 4OXVA 3HHFA 1LB9A 3H6UA 1N7WA 4G77A 1DPEA 4N13A 5F7VA 3O6GA 3VE1B 4R9GA 4UACA 4GVOA 3CFLA 4IY6A 4RPNA 2UYEA 3ZS6A 2I48A 2Q8JA 2XX8A 3A09A 5DTBA 4ONYA 2HZKA 4LZ5A 1M5EA 1IXGA 4RNSA 4ZDMA 1ZKBA 2I3WA 1PC3A 3M3FA 3G3HA 4F29A 3LUYA 5ITPA 3MPKA 4O3CA 5H8FA 3OSQA 3OO6A 1EZ9A 2DS9A 1DMBA 2X26A 5HPQA 1QKAA 3K4UA 4P0IA 2OCUA 4U4XA 4F22A 2R71A 3M3LA 2ZNTA 3FATA 4NE4A 3RT8A 3K1NA 4NTLA 5KDTB 1Y20A 3IJXB 1B1XA 5H8QA 1JQFA 3RTFB 3OENA 1FQBA 1FTOA 4AQ4A 3AXFA 5I2KB 3T66A 4JBZA 2ABHA 1MXZA 2OZZA 3I5OA 4F3SA 1GV8A 2HFBA 3VFJA 4PFWA 2QJEA 4RYAA 4QFPA 3Q27A 3RLFE 4GQOA 3QUJA 4OETA 2DE4A 3SESA 3T9XB 2V93A 3ZKKA 2H4IA 2ONSA 1Y4TA 4DE8A 1N76A 4DCYA 3CVGA 5HBCA 2F36A 5EYFA 2D5WA 3MZBA 3V83A 2XXTA 3PUVE 2RC9A 5TP9B 5DT6A 3ZSFA 4OWDA 4KPTA 4F2OA 1B6HA 1QUKA 3KSXA 4WKMA 3S9LC 2HEUA 3BFTA 4C1TA 3IO6A 1EZPA 3PUZE 1Y9UA 3R7XA 1FW0A 1MQIA 1MPCA 5KCJA 1NH8A 2AL4A 3GBAA 2Z8DA 2Z23A 3DLNA 4ZZAA 5I59A 2I3VA 4FAJA 3RNNA 1IXHA 2PT1A 1RYXA 1VSOA 4OHNA 5TPAA 4XIGQ 4G8MA 1SVXB 1MDQA 5H8HA 3RN8A 2UVJA 4QFNA 5I57B 3QIMA 2QS4A 3D4GA 3OO8A 3OD7A 2DWIA 3ONMA 3CFXA 2B3FA 3SETA 1LFGA 4MH5A 3TDJA 3MVYA 4X1DA 4OERA 1OMPA 3UA8A 4BDMA 4OZ9A 3EHTA 3FJGA 2OWTA 1B51A 4X48A 4JB7A 5M2VA 3H6TA 3N6UA 4RK9A 2OBGA 3H3GA 3PU5A 4GIZA 1JEUA 1AMFA 2DXRA 1FTKA 4ZEKA 4AB5A 1T0KA 5JTYB 1MY1A 4Q0CA 4XKPA 2ZXTA 4NWDA 4EQ7A 1N84A 4RA1A 5L9OA 4NF4A 1LAFE 1FTLA 1QW0A 4QSDA 4NF6B 1SW4A 4H65A 5H8SA 4FIMA 4YKIA 1P1QA 1I6BA 2XXWA 3O66A 4F1UA 1Y4CA 3QK6A 3FVKA 3TPAA 4OFLA 2F7CA 4TQUQ 5DVJA 3QAXA 2ZYOA 4ECFA 1JVXA 2E1SA 5I2NA 4HS7A 4H8IA 3IB2A 4NF8A 4YKJA 1ZIUA 4IO6A 3K6UA 4LZ7A 4X1BA 2G29A 1PEBA 1USYE 3A3UA 1HSLA 3TTRA 3CSBA 1TFAA 2DE2A 1LBCA 4YZZA 3OMBA 2Q9TA 4RXLA 4N07A 3THIA 5AA2D 2A5TA 4JSDA 3K2DA 5H8NA 1J1NA 1LAHE 4KYEA 5AA2B 3G3FA 2REGA 3D4CA 2DQVA 3EF7A 4OQOA 2UYFA 3LSLA 1MH3A 4P11A 3FASA 1D3KA 3KSJA 4MLQA 4R73A 3FXUA 1UTHA 1NNFA 2V3TA 1H76A 4QFOA 3TQWA 2XD3A 2FA7A 2FNCA 2RF1A 1B3LA 3CG1A 3K1PA 4O3BA 4E0XA 1XT8A 2HXWA 3DP6A 4ESXA 2REJA 3BFUA 1QULA 1M5FA 5DVIA 4U23A 3CIJA 3SERA 3O9PA 2XXXA 4F18A 2V3QA 3G7WA 2F6PA 3MVXA 4EDPA 1S50A 4ZS9A 3IOWA 4DCXA 4H1XA 4H5FA 5TU0A 2HAUA 1AH5A 3T93B 1MQGA 1FQEA 1Y3NA 4EQ9A 4U4SA 4I62A 5CMCA 1B9JA 3VXBA 4NEDA 3W9WA 3G3IA 1YPNA 3TFLA 2I6EA 3B7DA 2ONKE 4ND9A 3TCGA 2X7PA 2YPNA 3U72A 4RY1A 1B1HA 1MXUA 4YKKA 1IZ1A 3LBSA 3VV5A 1VFEA 1B7HA 3MZ1A 2PVUA 4BDLA 1QVSA 2O7IA 1ZU0A 3MZ9A 4U22A 1WVJA 1QUJA 1EU8A 3SEYA 4QF9A 4OEUA 1XS5A 2H5YA 4QHQA 3KGCA 3IB1A 1IIWA 2V25A 3T96B 4ELOA 4F1YA 1BP5A 3DELB 2XXQA 3MVWA 4KCCA 1BLFA 4F31B 2I58A 4YMBA 3PPOA 1H43A 2Z22A 2ANJA 4GL8A 3R6UA 1XVXA 4DLDA 4F39A 1ZTYA 4IO3A 1LGBC 4PP0A 2O1MA 5I59B 1NMUA 4OFOA 2DP8A 4IO2A 2ZYNA 5LOMA 2AYSA 1CB6A 3KG2A 2H25A 2Q88A 2OK2A 2O7UA 1PBQA 1B7ZA 4IO5A 3Q26A 1TFDA 1PB9A 2NWJA 5H8HB 3GLBA 1AIVA 3TYHA 1HSJA 2F7AA 2O68A 1Z7ME 1ZLQA 3QSLA 3FJMA 4H0WA 2QS1A 3PPPA 4OYVA 2G93A 3T9HB 1ATGA 4R74A 3L6GA 1IXCA 4E0WA 4IGTA 2ZMBA 4JXIA 3FGSA 3VLVA 1UQWA 1MM6A 3TCFA 3UN6A 1H44A 3CI8A 2F34A 3LSXA 3W15C 3CG3A 3IB0A 2YLNA 3IL1B 1WDNA 1LFHA 4U1ZA 2RCBA 4EF1A 4R6YA 2ZYMA 3KBRA 4F3GA 3CSGA 3OXNA 5K2YA 4LUBA 1P99A 2Q2AA 2NVUB 3LSWA 1FTJA 1D9VA 3E4RA 1FTMA 5JEIA 3DP8A 3N6TA 1OLAA 4LZ8A 1NKXA 3PUWE 2Y7PA 3MVZA 1Y3QA 3TELA 5DEXA 2YJPA 3HHGA 5AA4B 4LA9A 3H6WA 3U1OA 1OVTA 5BWJA 3BKIB 4R2BA 1POY1 1LCTA 3O97A 1MG1A 4FE8A 4GF8A 3B6QA 4ZEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PET A;  5A5X A;  1O63 A;  5I58 A;  4YAH X;  1MXX A;  5IKB A;  1SQY A;  2GHB A;  5B70 A;  1D9Y A;  4NF8 B;  2O84 X;  3K6W A;  3KJT A;  4ELP A;  3UK4 A;  3FXR A;  4MFI A;  2O6A A;  4YB5 A;  5FHM A;  4N6P A;  3G3K A;  2ESN A;  4DXC A;  5I84 A;  5CMK A;  3TTM A;  2VOZ A;  3MUQ A;  1IQ7 A;  2A5T B;  2Q2C A;  1SD3 A;  4FEB A;  2F6G A;  3ODB A;  2E0S A;  5H8N B;  3QUF A;  4LON B;  4TLL B;  3SDF A;  3TTN A;  4C1U A;  1MQJ A;  2QMW A;  4IO4 A;  3LSF B;  3KN8 A;  2F7B A;  4FOR A;  3TOD A;  4IB2 A;  3IOR A;  3U94 A;  3RPW A;  3C33 A;  4KFQ A;  1IEJ A;  5ICQ A;  1RKM A;  2NUV A;  2O51 A;  3N5L A;  1SW1 A;  1MQD A;  1SW5 A;  3EPE A;  3U8Q A;  1MPB A;  1SI1 A;  4G4P A;  1B3H A;  3QYT A;  3FJ7 A;  3C31 A;  2DWA A;  3H6V A;  2F78 A;  4IY5 A;  3MAM A;  4EQB A;  1B40 A;  2GRV A;  3MQ9 A;  2RCA A;  3CRB A;  3OOA A;  5I2K A;  2I49 A;  3FVO A;  3T9U A;  3UIF A;  1LFI A;  4G2Z A;  4EXK A;  3PMW A;  3IOU A;  2LAO A;  4FEC A;  3O6I A;  1R9Q A;  4YIC A;  3JZJ A;  5IAI A;  1MXY A;  3T9V A;  2H99 A;  4YB7 A;  3FD3 A;  3PPR A;  2F5X A;  2BJJ X;  4ZZE A;  1DOT A;  4F3P A;  3K1M A;  4R75 A;  1TXF A;  2X7Q A;  1A55 A;  3KJ7 A;  5CRY A;  5DVF A;  3FV2 A;  4Q8R A;  2ONR A;  3K01 A;  4GD5 A;  4OVJ A;  2UXA A;  4YKP A;  4QRZ A;  2RIN A;  3GZG A;  3UOR A;  3JV9 A;  1LBB A;  1PB7 A;  1CE2 A;  2P0S A;  1URD A;  5ISU A;  4XKR A;  4BDN A;  1IXI A;  1D4N A;  4KR5 A;  1MY3 A;  1B5I A;  4U21 A;  4BLA A;  5I56 A;  2OJT A;  3VVD A;  3OO7 A;  1YCJ A;  1GVC A;  4WEP A;  3W9V A;  1US4 A;  1B4Z A;  4ESW A;  4H6D A;  3RTW B;  3FUZ A;  4LAT A;  1B52 A;  4KI0 E;  1TWY A;  2CZL A;  1SW2 A;  3K02 A;  1URS A;  4C0R A;  2Y7I A;  3I6V A;  4Z0I A;  1OIB A;  3HO7 A;  3PD8 A;  3CFZ A;  3SEV A;  2NXO A;  4JDF A;  3G3G A;  4OES A;  3VXC A;  5ICT A;  1P1N A;  3MPL A;  3FZV A;  3USD A;  1N3X A;  4RK2 A;  2DVZ A;  4HCY A;  3EQ1 A;  4GLI A;  3Q25 A;  3DM0 A;  2W7Y A;  5AA1 A;  1Y3P A;  2FYI A;  2B3B A;  2DXY A;  5CMB A;  5F1Q A;  3V8X B;  4ZE8 A;  2XXY A;  1JVY A;  4OEV A;  2GFE A;  2PT2 A;  2F97 A;  2QPQ A;  2GHA A;  1R9L A;  3MC2 A;  2DWH A;  1LAG E;  4PQJ A;  1OQH A;  4O3A A;  1UIU A;  4NWC A;  3HCQ A;  4TLM B;  3O2A A;  2I0C A;  3H7M A;  1A8F A;  4YU0 A;  5KZT A;  1MXW A;  1POT A;  3LR1 A;  2DVC A;  2OWS A;  4LQ5 A;  4DXU A;  4R6H A;  4HW8 A;  3KOS A;  5H8F B;  2PYY A;  1RYO A;  4JSO A;  3WAF A;  1USY H;  4NF5 A;  4L17 A;  3KN3 A;  4PFT A;  1F9B A;  3TAJ A;  2UVH A;  5H8Q B;  1I69 A;  1B05 A;  4NF6 A;  3A3C A;  4F3B A;  4FAT A;  3OEM A;  3H06 B;  5ELV A;  3WAE A;  4R6K A;  1XC1 A;  1IIT A;  3ILU B;  2XXP A;  2QMX A;  4ZEF A;  3OO9 A;  2O1L A;  3IOT A;  2Z8F A;  2VD3 A;  4ZED A;  3U92 A;  1I6A A;  3Q29 A;  5ITO A;  3IAZ A;  4MBP A;  4MLV A;  4KYD A;  4GFR A;  2XX7 A;  1Z7N E;  1PB8 A;  4G68 A;  3C35 A;  1I6Q A;  3VVF A;  3VVE A;  2RC8 A;  4KQP A;  3DP4 A;  1JEV A;  4R2F A;  1N04 A;  2F35 A;  2DWJ A;  5L9M A;  2VD2 A;  4QFK A;  1UTB A;  1US5 A;  4EF2 A;  2QS2 A;  2I4B A;  1GR2 A;  3C36 A;  2CMO A;  1MDP 1;  3TMG A;  4Q30 B;  4TOZ A;  3EHS A;  3PD9 A;  2VHA A;  3KN7 A;  3M3K A;  3OEK A;  1B32 A;  1ZJL A;  5AA2 A;  4BDR A;  3P7I A;  4X9T A;  2VGQ A;  1GGG A;  1GTK A;  3IR1 A;  5KCJ B;  2M8C A;  3HV1 A;  1SDX A;  2PX1 A;  5K2X A;  5CI5 A;  3G3J A;  3TZA A;  3SEW A;  3E3K A;  1MPD A;  4ELQ A;  1DTG A;  3TQL A;  1MRP A;  1Y1M A;  4HTG A;  3FXQ A;  5TPA B;  4H8J A;  4GXS B;  2UVI A;  4FJP A;  2NOO A;  3E13 X;  3SEU A;  4Z7E A;  1Q35 A;  1URG A;  2IEE A;  2PBW A;  2F8D A;  1FQA A;  3MBP A;  3LC8 A;  2XXH A;  1JW1 A;  3C4M A;  4JWY A;  3TTK A;  1ZMG A;  1SI0 A;  1DPP A;  2RC7 A;  2XXI A;  3ZKL A;  1R6Z A;  4WXJ A;  4OEN A;  4F19 A;  3B6T A;  3IK6 B;  3HST A;  3PV0 E;  5CMM A;  3Q28 A;  4XXU A;  1Y1Z A;  1NNT A;  4GOT A;  3IJO B;  1JNF A;  1L5T A;  3PPQ A;  3VLW A;  4Q5T A;  1VE4 A;  1LCF A;  2Q89 A;  1O7T A;  1NH7 A;  1BKA A;  4ISU A;  1PDA A;  1UIV A;  2OLB A;  3C32 A;  1Q1K A;  2I4C A;  3B6W A;  2KLF A;  2QL3 A;  3I3V A;  1B5J A;  2H9B A;  3FVG A;  4IGR A;  3K6V A;  3MP8 A;  2XHD A;  2DE3 A;  1P1W A;  1TT1 A;  3PMX A;  2AIX A;  4NF4 B;  4ZEB A;  1A99 A;  3EHU A;  3FV1 A;  2V84 A;  3KZG A;  1VR5 A;  4G8N A;  2A5S A;  5BUU A;  4AB6 A;  5CBR A;  3UP9 A;  3OEL A;  2ALU A;  3PUY E;  1B58 A;  3O6H A;  1FQD A;  5B7D A;  3RY3 A;  3PUX E;  4FED A;  2P2A A;  3K0V A;  1FQF A;  1DTZ A;  1NL5 A;  1B3G A;  5I2N B;  4XTC Q;  3PGF A;  1AL3 A;  3C34 A;  3KEI A;  5I56 B;  2XX9 A;  5AA3 A;  4QSC A;  4YB6 A;  3IOV A;  5L9S A;  2R6G E;  1AOV A;  4XKN A;  1KWH A;  5CC2 A;  1M5D A;  4M4G A;  2Z8E A;  4JWX A;  2UVG A;  4I8C A;  5EHS A;  4DZ1 A;  1A8E A;  4P0G A;  4PFY A;  3TCH A;  1NNK A;  1SYH A;  4BDO A;  4LQ2 A;  4GWO A;  4WED A;  3K00 A;  3H03 A;  3V5A A;  3TEP A;  2HZL A;  4U2R A;  1UTH B;  4GRK A;  3S2V A;  1R1N A;  1H45 A;  4PFU A;  4KD5 A;  3QXM A;  1S7Y A;  1LB8 A;  3KFM A;  3MWB A;  5KDT A;  4LVQ A;  3GXA A;  3M8U A;  3JYR A;  1P1O A;  3BBR A;  3O29 A;  1B5H A;  1OQG A;  3S4U A;  2XXR A;  4EUO A;  1WOD A;  4M1V A;  3O28 A;  1BIY A;  1A40 A;  1MY2 A;  2D21 A;  4THI A;  1P1U A;  3VLU A;  1A54 A;  4POX A;  3MW0 A;  4ELR A;  4NF5 B;  1VFD A;  5FTI A;  1XVY A;  2AL5 A;  2THI A;  3PMV A;  1PBP A;  1SBP A;  3IX1 A;  1II5 A;  4I1D A;  5JK4 A;  1MY4 A;  1B4H A;  3N94 A;  3MP6 A;  5TP9 A;  4G8H A;  3K6X A;  3U93 A;  3S9M C;  5AA4 A;  3HPI A;  4POW A;  4OMB A;  1MS7 A;  1ZBM A;  3V89 B;  3H4Z A;  1B7U A;  4F2Q A;  1MM7 A;  1ELJ A;  5HM4 B;  4ZEC A;  2V3U A;  4H67 A;  1LST A;  5DYH A;  2DYX A;  4G68 B;  1JW4 A;  4U1O A;  4K3F A;  2GH9 A;  1NFT A;  2I0B A;  4RJZ A;  4YMA A;  3S9E A;  1B3E A;  3S9N C;  2ZNS A;  1UTB B;  3T22 A;  3TKD A;  4LP2 B;  3KOT A;  1M5B A;  1B46 A;  1N0T A;  1OLC A;  1O64 A;  5AE4 A;  2VP1 A;  1IUD A;  2Y84 A;  4KCD A;  3ILT B;  2DOJ A;  1SYI A;  5I57 A;  2RKM A;  1EZO A;  1DSN A;  1H3D A;  1YAE A;  1XHY A;  3RGY A;  1FQC A;  3MP1 A;  4DDD A;  3TUS A;  3E9X A;  3VDF A;  2DSF A;  2IA4 A;  1LAX A;  4QSE A;  2QSX A;  1A7L A;  2WKY A;  4OFJ A;  3SEX A;  1QUI A;  1NNP A;  2QRY A;  2Y7W A;  2ZYK A;  5CM6 A;  2Y7R A;  5CBS A;  1QKB A;  2ZNU A;  3FIR A;  1OVB A;  4G68 C;  3TTL A;  1MH4 A;  4KYS A;  3UGW A;  1QJM A;  5JTY A;  1M5C A;  3N26 A;  1HSE A;  2R9J A;  2XD2 A;  1FCK A;  3F11 A;  2XXU A;  3C9H A;  1B3F A;  4H5G A;  3RQT A;  3RT6 B;  1B0L A;  1XOC A;  5FHO A;  3IO4 A;  3OSR A;  4HCW A;  5FTH A;  3PPN A;  4I9D A;  3ECR A;  4F1V A;  1JET A;  1B0H A;  2Y7K A;  4MF3 A;  3HN0 A;  4R72 A;  2H98 A;  4EXL A;  4DXB A;  2QS3 A;  4OTE A;  1EH3 A;  5J1D A;  3SKP A;  1BTJ A;  1ANF A;  3L6H A;  4GL0 A;  2O69 A;  4ZE9 A;  4IO7 A;  4DIG A;  4JWO A;  1MY0 A;  2P1S A;  3RUM A;  4NMY A;  5FHN A;  3R26 A;  4BDQ A;  1MXV A;  1YTV A;  4RPO A;  4R9F A;  5EHM A;  1LLS A;  1S9T A;  5DEX B;  2HAV A;  2D3I A;  2PMS A;  1B2H A;  1N7X A;  3MJN A;  5L8D A;  4QFL A;  2B65 A;  4UA8 A;  3CR9 A;  4KHZ E;  3EN3 A;  3FVN A;  2HCA A;  3GBB A;  4GXA A;  5A5X B;  1JW5 A;  5I58 B;  1N3W A;  1MQH A;  2HQ0 A;  4PE5 B;  2XXV A;  4XKQ A;  4OXV A;  3HHF A;  1LB9 A;  3H6U A;  1N7W A;  4G77 A;  1DPE A;  4N13 A;  5F7V A;  3O6G A;  3VE1 B;  4R9G A;  4UAC A;  4GVO A;  3CFL A;  4IY6 A;  4RPN A;  2UYE A;  3ZS6 A;  2I48 A;  2Q8J A;  2XX8 A;  3A09 A;  5DTB A;  4ONY A;  2HZK A;  4LZ5 A;  1M5E A;  1IXG A;  4RNS A;  4ZDM A;  1ZKB A;  2I3W A;  1PC3 A;  3M3F A;  3G3H A;  4F29 A;  3LUY A;  5ITP A;  3MPK A;  4O3C A;  5H8F A;  3OSQ A;  3OO6 A;  1EZ9 A;  2DS9 A;  1DMB A;  2X26 A;  5HPQ A;  1QKA A;  3K4U A;  4P0I A;  2OCU A;  4U4X A;  4F22 A;  2R71 A;  3M3L A;  2ZNT A;  3FAT A;  4NE4 A;  3RT8 A;  3K1N A;  4NTL A;  5KDT B;  1Y20 A;  3IJX B;  1B1X A;  5H8Q A;  1JQF A;  3RTF B;  3OEN A;  1FQB A;  1FTO A;  4AQ4 A;  3AXF A;  5I2K B;  3T66 A;  4JBZ A;  2ABH A;  1MXZ A;  2OZZ A;  3I5O A;  4F3S A;  1GV8 A;  2HFB A;  3VFJ A;  4PFW A;  2QJE A;  4RYA A;  4QFP A;  3Q27 A;  3RLF E;  4GQO A;  3QUJ A;  4OET A;  2DE4 A;  3SES A;  3T9X B;  2V93 A;  3ZKK A;  2H4I A;  2ONS A;  1Y4T A;  4DE8 A;  1N76 A;  4DCY A;  3CVG A;  5HBC A;  2F36 A;  5EYF A;  2D5W A;  3MZB A;  3V83 A;  2XXT A;  3PUV E;  2RC9 A;  5TP9 B;  5DT6 A;  3ZSF A;  4OWD A;  4KPT A;  4F2O A;  1B6H A;  1QUK A;  3KSX A;  4WKM A;  3S9L C;  2HEU A;  3BFT A;  4C1T A;  3IO6 A;  1EZP A;  3PUZ E;  1Y9U A;  3R7X A;  1FW0 A;  1MQI A;  1MPC A;  5KCJ A;  1NH8 A;  2AL4 A;  3GBA A;  2Z8D A;  2Z23 A;  3DLN A;  4ZZA A;  5I59 A;  2I3V A;  4FAJ A;  3RNN A;  1IXH A;  2PT1 A;  1RYX A;  1VSO A;  4OHN A;  5TPA A;  4XIG Q;  4G8M A;  1SVX B;  1MDQ A;  5H8H A;  3RN8 A;  2UVJ A;  4QFN A;  5I57 B;  3QIM A;  2QS4 A;  3D4G A;  3OO8 A;  3OD7 A;  2DWI A;  3ONM A;  3CFX A;  2B3F A;  3SET A;  1LFG A;  4MH5 A;  3TDJ A;  3MVY A;  4X1D A;  4OER A;  1OMP A;  3UA8 A;  4BDM A;  4OZ9 A;  3EHT A;  3FJG A;  2OWT A;  1B51 A;  4X48 A;  4JB7 A;  5M2V A;  3H6T A;  3N6U A;  4RK9 A;  2OBG A;  3H3G A;  3PU5 A;  4GIZ A;  1JEU A;  1AMF A;  2DXR A;  1FTK A;  4ZEK A;  4AB5 A;  1T0K A;  5JTY B;  1MY1 A;  4Q0C A;  4XKP A;  2ZXT A;  4NWD A;  4EQ7 A;  1N84 A;  4RA1 A;  5L9O A;  4NF4 A;  1LAF E;  1FTL A;  1QW0 A;  4QSD A;  4NF6 B;  1SW4 A;  4H65 A;  5H8S A;  4FIM A;  4YKI A;  1P1Q A;  1I6B A;  2XXW A;  3O66 A;  4F1U A;  1Y4C A;  3QK6 A;  3FVK A;  3TPA A;  4OFL A;  2F7C A;  4TQU Q;  5DVJ A;  3QAX A;  2ZYO A;  4ECF A;  1JVX A;  2E1S A;  5I2N A;  4HS7 A;  4H8I A;  3IB2 A;  4NF8 A;  4YKJ A;  1ZIU A;  4IO6 A;  3K6U A;  4LZ7 A;  4X1B A;  2G29 A;  1PEB A;  1USY E;  3A3U A;  1HSL A;  3TTR A;  3CSB A;  1TFA A;  2DE2 A;  1LBC A;  4YZZ A;  3OMB A;  2Q9T A;  4RXL A;  4N07 A;  3THI A;  5AA2 D;  2A5T A;  4JSD A;  3K2D A;  5H8N A;  1J1N A;  1LAH E;  4KYE A;  5AA2 B;  3G3F A;  2REG A;  3D4C A;  2DQV A;  3EF7 A;  4OQO A;  2UYF A;  3LSL A;  1MH3 A;  4P11 A;  3FAS A;  1D3K A;  3KSJ A;  4MLQ A;  4R73 A;  3FXU A;  1UTH A;  1NNF A;  2V3T A;  1H76 A;  4QFO A;  3TQW A;  2XD3 A;  2FA7 A;  2FNC A;  2RF1 A;  1B3L A;  3CG1 A;  3K1P A;  4O3B A;  4E0X A;  1XT8 A;  2HXW A;  3DP6 A;  4ESX A;  2REJ A;  3BFU A;  1QUL A;  1M5F A;  5DVI A;  4U23 A;  3CIJ A;  3SER A;  3O9P A;  2XXX A;  4F18 A;  2V3Q A;  3G7W A;  2F6P A;  3MVX A;  4EDP A;  1S50 A;  4ZS9 A;  3IOW A;  4DCX A;  4H1X A;  4H5F A;  5TU0 A;  2HAU A;  1AH5 A;  3T93 B;  1MQG A;  1FQE A;  1Y3N A;  4EQ9 A;  4U4S A;  4I62 A;  5CMC A;  1B9J A;  3VXB A;  4NED A;  3W9W A;  3G3I A;  1YPN A;  3TFL A;  2I6E A;  3B7D A;  2ONK E;  4ND9 A;  3TCG A;  2X7P A;  2YPN A;  3U72 A;  4RY1 A;  1B1H A;  1MXU A;  4YKK A;  1IZ1 A;  3LBS A;  3VV5 A;  1VFE A;  1B7H A;  3MZ1 A;  2PVU A;  4BDL A;  1QVS A;  2O7I A;  1ZU0 A;  3MZ9 A;  4U22 A;  1WVJ A;  1QUJ A;  1EU8 A;  3SEY A;  4QF9 A;  4OEU A;  1XS5 A;  2H5Y A;  4QHQ A;  3KGC A;  3IB1 A;  1IIW A;  2V25 A;  3T96 B;  4ELO A;  4F1Y A;  1BP5 A;  3DEL B;  2XXQ A;  3MVW A;  4KCC A;  1BLF A;  4F31 B;  2I58 A;  4YMB A;  3PPO A;  1H43 A;  2Z22 A;  2ANJ A;  4GL8 A;  3R6U A;  1XVX A;  4DLD A;  4F39 A;  1ZTY A;  4IO3 A;  1LGB C;  4PP0 A;  2O1M A;  5I59 B;  1NMU A;  4OFO A;  2DP8 A;  4IO2 A;  2ZYN A;  5LOM A;  2AYS A;  1CB6 A;  3KG2 A;  2H25 A;  2Q88 A;  2OK2 A;  2O7U A;  1PBQ A;  1B7Z A;  4IO5 A;  3Q26 A;  1TFD A;  1PB9 A;  2NWJ A;  5H8H B;  3GLB A;  1AIV A;  3TYH A;  1HSJ A;  2F7A A;  2O68 A;  1Z7M E;  1ZLQ A;  3QSL A;  3FJM A;  4H0W A;  2QS1 A;  3PPP A;  4OYV A;  2G93 A;  3T9H B;  1ATG A;  4R74 A;  3L6G A;  1IXC A;  4E0W A;  4IGT A;  2ZMB A;  4JXI A;  3FGS A;  3VLV A;  1UQW A;  1MM6 A;  3TCF A;  3UN6 A;  1H44 A;  3CI8 A;  2F34 A;  3LSX A;  3W15 C;  3CG3 A;  3IB0 A;  2YLN A;  3IL1 B;  1WDN A;  1LFH A;  4U1Z A;  2RCB A;  4EF1 A;  4R6Y A;  2ZYM A;  3KBR A;  4F3G A;  3CSG A;  3OXN A;  5K2Y A;  4LUB A;  1P99 A;  2Q2A A;  2NVU B;  3LSW A;  1FTJ A;  1D9V A;  3E4R A;  1FTM A;  5JEI A;  3DP8 A;  3N6T A;  1OLA A;  4LZ8 A;  1NKX A;  3PUW E;  2Y7P A;  3MVZ A;  1Y3Q A;  3TEL A;  5DEX A;  2YJP A;  3HHG A;  5AA4 B;  4LA9 A;  3H6W A;  3U1O A;  1OVT A;  5BWJ A;  3BKI B;  4R2B A;  1POY 1;  1LCT A;  3O97 A;  1MG1 A;  4FE8 A;  4GF8 A;  3B6Q A;  4ZEI A; 
#chains in the Genus database with same CATH topology
 3E78 A;  4PET A;  5A5X A;  3BIG A;  1O63 A;  5I58 A;  4YAH X;  1MXX A;  5IKB A;  1SQY A;  2GHB A;  5B70 A;  1D9Y A;  4NF8 B;  2O84 X;  3K6W A;  3KJT A;  1FPB A;  4ELP A;  3UK4 A;  3FXR A;  4MFI A;  2O6A A;  2KQZ A;  4YB5 A;  5FHM A;  4P1E A;  4N6P A;  3G3K A;  2ESN A;  2MKZ A;  4DXC A;  4MNP A;  5I84 A;  5CMK A;  3TTM A;  3FXB A;  2VOZ A;  3MUQ A;  3MYU A;  1IQ7 A;  2Q8M A;  4P8B A;  2A5T B;  2Q2C A;  1SD3 A;  4FEB A;  2F6G A;  3ODB A;  2E0S A;  5H8N B;  3QUF A;  4LON B;  4TLL B;  3SDF A;  1SPI A;  3TTN A;  4C1U A;  1MQJ A;  2QMW A;  4IO4 A;  3LSF B;  4DI4 B;  3KN8 A;  2F7B A;  4FOR A;  3TOD A;  4IB2 A;  3IOR A;  3U94 A;  3RPW A;  3C33 A;  4KFQ A;  1IEJ A;  5ICQ A;  1RKM A;  2NUV A;  2O51 A;  2WEF A;  3N5L A;  1SW1 A;  5ET7 A;  1SW5 A;  1MQD A;  3LV0 A;  3EPE A;  3U8Q A;  1NUW A;  2PCR A;  1MPB A;  1SI1 A;  4G4P A;  2P3V A;  1B3H A;  3QYT A;  3FJ7 A;  3C31 A;  2DWA A;  3H6V A;  2F78 A;  4IY5 A;  3MAM A;  4EQB A;  1B40 A;  2GRV A;  1CNQ A;  4GBW A;  3MQ9 A;  2RCA A;  3CRB A;  3OOA A;  5I2K A;  2I49 A;  3FVO A;  3T9U A;  3PTY A;  3UIF A;  1LFI A;  4G2Z A;  4EXK A;  3PMW A;  3IOU A;  2LAO A;  5ET8 A;  4PAF A;  4FEC A;  3O6I A;  1R9Q A;  4YIC A;  3JZJ A;  3U65 A;  5IAI A;  1MXY A;  3T9V A;  2H99 A;  4YB7 A;  3FD3 A;  3PPR A;  2F5X A;  2BJJ X;  4ZZE A;  1DOT A;  4F3P A;  3K1M A;  4R75 A;  1TXF A;  2X7Q A;  1A55 A;  4GBV A;  4FBP A;  3KJ7 A;  5CRY A;  5DVF A;  3FV2 A;  4Q8R A;  2ONR A;  4MIJ A;  2ZZW A;  3K01 A;  4GD5 A;  4OVJ A;  2UXA A;  4YKP A;  4QRZ A;  2RIN A;  3GZG A;  3UOR A;  3JV9 A;  1LBB A;  1PB7 A;  1CE2 A;  2P0S A;  1URD A;  5ISU A;  4XKR A;  4BDN A;  1IXI A;  1D4N A;  4HE1 A;  4KR5 A;  1MY3 A;  1B5I A;  4OVS A;  1BK4 A;  4U21 A;  5A5L A;  4BLA A;  5I56 A;  4OVQ A;  2OJT A;  3VVD A;  3OO7 A;  1YCJ A;  1GVC A;  4WEP A;  3W9V A;  1US4 A;  1B4Z A;  1IME A;  3HFU A;  4O7M A;  4ESW A;  4H6D A;  3RTW B;  3FUZ A;  4LAT A;  1B52 A;  4KI0 E;  1TWY A;  2CZL A;  1SW2 A;  3K02 A;  1URS A;  4C0R A;  2Y7I A;  3I6V A;  4Z0I A;  1OIB A;  3HO7 A;  3PD8 A;  1FPE A;  3CFZ A;  3SEV A;  1IMC A;  4H45 A;  2NXO A;  4UAB A;  4JDF A;  3G3G A;  4OES A;  3VXC A;  5ICT A;  2XXK A;  1P1N A;  4MAG A;  3MPL A;  1AWB A;  3FZV A;  4PAK A;  3USD A;  1N3X A;  2WYK A;  4RK2 A;  1KZ8 A;  2DVZ A;  4HCY A;  3EQ1 A;  4GLI A;  3Q25 A;  3DM0 A;  2FBP A;  2W7Y A;  5AA1 A;  1Y3P A;  2FYI A;  5EQ7 A;  2B3B A;  2DXY A;  5CMB A;  5F1Q A;  3V8X B;  4ZE8 A;  2XXY A;  1JVY A;  4OEV A;  2GFE A;  2PT2 A;  2F97 A;  3B50 A;  2QPQ A;  1NUX A;  2GHA A;  1R9L A;  3MC2 A;  2DWH A;  4PE3 A;  4N17 A;  1LAG E;  4PQJ A;  3T1B A;  1OQH A;  4O3A A;  1UIU A;  4NWC A;  3HCQ A;  4TLM B;  4XF5 A;  3O2A A;  2I0C A;  3H7M A;  1A8F A;  4YU0 A;  5KZT A;  1MXW A;  1POT A;  3LR1 A;  5IM2 A;  2DVC A;  2OWS A;  4LQ5 A;  4DXU A;  4R6H A;  4GX6 A;  4MMP A;  4HW8 A;  3KOS A;  5H8F B;  2PYY A;  2HHM A;  1RYO A;  4JSO A;  3WAF A;  1USY H;  4NF5 A;  4L17 A;  3KN3 A;  4PFT A;  1F9B A;  4PFR A;  4GWZ A;  3TAJ A;  2UVH A;  5H8Q B;  1I69 A;  1B05 A;  4NF6 A;  3A3C A;  4F3B A;  4FAT A;  3OEM A;  3H06 B;  5ELV A;  3WAE A;  4R6K A;  1XC1 A;  4O94 A;  1IIT A;  3ILU B;  2XXP A;  2QMX A;  3OO9 A;  4ZEF A;  2O1L A;  3IOT A;  2Z8F A;  3ISP A;  5IZ3 B;  3IFC A;  2VD3 A;  4ZED A;  1DK4 A;  3U92 A;  1I6A A;  3Q29 A;  5ITO A;  3IAZ A;  4OA4 A;  4MBP A;  4MLV A;  4KYD A;  1LBW A;  4GFR A;  2XX7 A;  5F24 A;  1Z7N E;  1PB8 A;  4G68 A;  3C35 A;  1I6Q A;  3VVF A;  3VVE A;  2RC8 A;  4KQP A;  3DP4 A;  1JEV A;  4R2F A;  1N04 A;  2F35 A;  2DWJ A;  5L9M A;  2VD2 A;  4QFK A;  1UTB A;  1US5 A;  4EF2 A;  2QS2 A;  2I4B A;  2CZH A;  1GR2 A;  3C36 A;  2CMO A;  1MDP 1;  4N15 A;  3TMG A;  4Q30 B;  4TOZ A;  3EHS A;  3PD9 A;  2VHA A;  4MEV A;  4N4U A;  3KN7 A;  3M3K A;  3OEK A;  1B32 A;  1ZJL A;  5AA2 A;  4BDR A;  3P7I A;  3B8B A;  4X9T A;  2VGQ A;  1GGG A;  1GTK A;  3IR1 A;  5KCJ B;  2M8C A;  3HV1 A;  1FPG A;  1SDX A;  2PX1 A;  5K2X A;  5CI5 A;  3G3J A;  3TZA A;  3SEW A;  3E3K A;  1MPD A;  4ELQ A;  2XWV A;  1DTG A;  3TQL A;  1MRP A;  1Y1M A;  4HTG A;  3FXQ A;  1LBV A;  5TPA B;  4H8J A;  2WX9 A;  4GXS B;  2UVI A;  3KBZ A;  4FJP A;  2NOO A;  3A29 A;  3E13 X;  3SEU A;  4Z7E A;  1Q35 A;  1URG A;  2IEE A;  2PBW A;  2F8D A;  1FQA A;  1IMB A;  3MBP A;  3LC8 A;  2XXH A;  1JW1 A;  3C4M A;  4JWY A;  3TTK A;  1ZMG A;  1SI0 A;  3KC0 A;  1DPP A;  2RC7 A;  2XXI A;  3ZKL A;  1R6Z A;  4WXJ A;  4OEN A;  4F19 A;  3B6T A;  3IK6 B;  3HST A;  3PV0 E;  5CMM A;  3Q28 A;  4XXU A;  1Y1Z A;  1NNT A;  4GOT A;  3IJO B;  1JNF A;  1L5T A;  3PPQ A;  3VLW A;  4Q5T A;  1VE4 A;  1LCF A;  2Q89 A;  1O7T A;  1NH7 A;  1BKA A;  4ISU A;  1PDA A;  1UIV A;  2OLB A;  3C32 A;  1Q1K A;  2I4C A;  3B6W A;  4MHF A;  2KLF A;  2QL3 A;  5J16 A;  3I3V A;  1B5J A;  2H9B A;  3FVG A;  4IGR A;  3K6V A;  3MP8 A;  2XHD A;  2DE3 A;  1P1W A;  1TT1 A;  3PMX A;  2AIX A;  4NF4 B;  4ZEB A;  1A99 A;  3EHU A;  3FV1 A;  2V84 A;  2HXR A;  4OAN A;  3KZG A;  4P1L A;  1VR5 A;  4G8N A;  2A5S A;  4PTK A;  5BUU A;  4AB6 A;  5CBR A;  3UP9 A;  3OEL A;  2ALU A;  3PUY E;  1B58 A;  3O6H A;  1FQD A;  5B7D A;  3RY3 A;  3PUX E;  4AS4 A;  4FED A;  2P2A A;  3K0V A;  1FQF A;  1DTZ A;  1NL5 A;  1B3G A;  1YZ0 A;  4P47 A;  5I2N B;  4XTC Q;  1FRP A;  3PGF A;  1AL3 A;  3C34 A;  3KEI A;  4PDD A;  5I56 B;  2XX9 A;  5AA3 A;  4QSC A;  4YB6 A;  3IOV A;  5L9S A;  2R6G E;  1AOV A;  4XKN A;  1KWH A;  4KXP A;  5CC2 A;  4I40 A;  1M5D A;  4M4G A;  2Z8E A;  5EYH A;  4JWX A;  2UVG A;  4I8C A;  5EHS A;  4DZ1 A;  1FPK A;  1A8E A;  4P0G A;  4I3E A;  4PFY A;  3TCH A;  1NNK A;  1SYH A;  3MST A;  4BDO A;  1NV1 A;  4LQ2 A;  4GWO A;  4WED A;  3K00 A;  3H03 A;  3V5A A;  3TEP A;  2HZL A;  2VPO A;  4U2R A;  1UTH B;  4GRK A;  3S2V A;  1K9Z A;  1R1N A;  1H45 A;  4PFU A;  4KD5 A;  3QXM A;  1S7Y A;  1LB8 A;  3KFM A;  3MWB A;  5KDT A;  4LVQ A;  3GXA A;  3M8U A;  5I7I A;  3JYR A;  5IZ1 A;  1P1O A;  3BBR A;  3O29 A;  1B5H A;  2ZZX A;  1OQG A;  3S4U A;  3RPL A;  2XXR A;  4EUO A;  1WOD A;  4QXD A;  4M1V A;  1LBX A;  3O28 A;  1BIY A;  1FSA A;  1A40 A;  1MY2 A;  2D21 A;  4THI A;  1P1U A;  3VLU A;  1A54 A;  4POX A;  3MW0 A;  2FVZ A;  2B4L A;  4ELR A;  4NF5 B;  1FPI A;  1VFD A;  5LDZ A;  5FTI A;  1XVY A;  2AL5 A;  2THI A;  1K9Y A;  3PMV A;  1PBP A;  1SBP A;  3IX1 A;  1II5 A;  4I1D A;  5JK4 A;  1MY4 A;  5FBP A;  4X04 A;  4PF8 A;  1B4H A;  3N94 A;  3MP6 A;  5TP9 A;  4G8H A;  1IMF A;  3K6X A;  3U93 A;  3S9M C;  5AA4 A;  3HPI A;  4POW A;  4OMB A;  1MS7 A;  1ZBM A;  1FTA A;  3V89 B;  3H4Z A;  1B7U A;  4F2Q A;  1MM7 A;  1ELJ A;  5HM4 B;  4ZEC A;  4PAI A;  2V3U A;  4H67 A;  1LBY A;  1LST A;  5DYH A;  1FPL A;  1FBD A;  2DYX A;  4G68 B;  1JW4 A;  4U1O A;  4K3F A;  2GH9 A;  3EKI A;  1NFT A;  2I0B A;  4RJZ A;  4YMA A;  3S9E A;  1B3E A;  3S9N C;  2ZNS A;  1UTB B;  3T22 A;  3TKD A;  4LP2 B;  4H46 A;  3KOT A;  1M5B A;  4MNI A;  1B46 A;  1N0T A;  1INP A;  1OLC A;  1O64 A;  5AE4 A;  2VP1 A;  1IUD A;  2Y84 A;  4KCD A;  4NHB A;  3ILT B;  2DOJ A;  1SYI A;  5I57 A;  2RKM A;  1EZO A;  1DSN A;  4I3Y A;  1H3D A;  1YAE A;  1FPJ A;  1XHY A;  3RGY A;  1FQC A;  3MP1 A;  4N91 A;  4DDD A;  4PBQ A;  3TUS A;  3E9X A;  3VDF A;  2DSF A;  5IGA A;  2IA4 A;  1LAX A;  4QSE A;  2QSX A;  4HE2 A;  1A7L A;  2WKY A;  4OFJ A;  3SEX A;  1QUI A;  4PGN A;  1NNP A;  2QRY A;  2Y7W A;  2ZYK A;  1NUZ A;  5CM6 A;  2Y7R A;  5CBS A;  1QKB A;  2ZNU A;  1EYK A;  3FIR A;  1NUY A;  1OVB A;  4G68 C;  4NG7 A;  3TTL A;  3D1R A;  1MH4 A;  4KYS A;  3UGW A;  1QJM A;  5JTY A;  1M5C A;  5EQA A;  3N26 A;  1HSE A;  2R9J A;  2XD2 A;  1FCK A;  3F11 A;  2XXU A;  3C9H A;  1B3F A;  4H5G A;  3RQT A;  3RT6 B;  1B0L A;  1XOC A;  4LN5 A;  5FHO A;  3IO4 A;  3RYD A;  3OSR A;  4HCW A;  5FTH A;  3PPN A;  1FBP A;  4I9D A;  3ECR A;  4F1V A;  1IMA A;  1JET A;  1B0H A;  2Y7K A;  4MF3 A;  3HN0 A;  4R72 A;  2H98 A;  4EXL A;  4DXB A;  2QS3 A;  4OTE A;  1EH3 A;  5J1D A;  3SKP A;  1BTJ A;  1ANF A;  3L6H A;  1VDW A;  1EYI A;  4GL0 A;  2O69 A;  4N6D A;  4ZE9 A;  4IO7 A;  4DIG A;  4JWO A;  1KA1 A;  1MY0 A;  2P1S A;  3RUM A;  1FJ6 A;  1NV7 A;  2L5V A;  4NMY A;  5FHN A;  4HE0 A;  2P3N A;  3R26 A;  4BDQ A;  1MXV A;  1YTV A;  4RPO A;  4R9F A;  5EHM A;  1LLS A;  1S9T A;  5DEX B;  2HAV A;  2WYP A;  2D3I A;  2PMS A;  1B2H A;  1N7X A;  3MJN A;  5L8D A;  4QFL A;  2B65 A;  2FIX A;  4UA8 A;  3CR9 A;  4GWX A;  4KHZ E;  3EN3 A;  3FVN A;  2HCA A;  3GBB A;  4GXA A;  2OWZ A;  5A5X B;  4JVI A;  1JW5 A;  5I58 B;  1N3W A;  1MQH A;  2HQ0 A;  4PE5 B;  2XXV A;  4XKQ A;  4OXV A;  3HHF A;  1LB9 A;  3H6U A;  5LTC A;  1NV4 A;  1N7W A;  4G77 A;  1DPE A;  4N13 A;  5F7V A;  3O6G A;  3VE1 B;  4R9G A;  2BJI A;  4UAC A;  4GVO A;  3CFL A;  4IY6 A;  4RPN A;  3BIH A;  2UYE A;  3ZS6 A;  2I48 A;  2JJK A;  4MCO A;  5EQ8 A;  2Q8J A;  2XX8 A;  3A09 A;  5DTB A;  4ONY A;  3T0J A;  2HZK A;  4LZ5 A;  1M5E A;  1IXG A;  3LUZ A;  4RNS A;  4ZDM A;  1ZKB A;  3SZP A;  2I3W A;  1PC3 A;  3M3F A;  3G3H A;  4F29 A;  3LUY A;  5ITP A;  2XWO A;  1FPD A;  3MPK A;  4O3C A;  5H8F A;  3OSQ A;  3OO6 A;  1EZ9 A;  2DS9 A;  1DMB A;  2X26 A;  5HPQ A;  1QKA A;  4PCD A;  3K4U A;  4P0I A;  2OCU A;  4U4X A;  1FBH A;  4X8R A;  2WBB A;  2R71 A;  4F22 A;  3M3L A;  2ZNT A;  3FAT A;  4N6K A;  4NE4 A;  2VT5 A;  3RT8 A;  3K1N A;  4NTL A;  5KDT B;  1Y20 A;  2QVR A;  4AS5 A;  3IJX B;  1B1X A;  5H8Q A;  1JQF A;  3RTF B;  2VPN A;  3OEN A;  1FQB A;  1FTO A;  4AQ4 A;  3AXF A;  5I2K B;  3T66 A;  4JBZ A;  2ABH A;  4JVD A;  1MXZ A;  2OZZ A;  3I5O A;  4F3S A;  1GV8 A;  4PBH A;  2HFB A;  3VFJ A;  4PFW A;  2QJE A;  4RYA A;  4QFP A;  1FJ9 A;  3Q27 A;  4PFI A;  3RLF E;  4GQO A;  3QUJ A;  4OET A;  4NAP A;  2DE4 A;  3SES A;  4NN3 A;  3T9X B;  2V93 A;  3ZKK A;  2H4I A;  2ONS A;  1FPF A;  1Y4T A;  4DE8 A;  1N76 A;  4DCY A;  3CVG A;  1DBZ A;  1NV5 A;  5HBC A;  2F36 A;  5EYF A;  2D5W A;  3MZB A;  4IR8 A;  3V83 A;  3GYY A;  2XXT A;  3PUV E;  4XEQ A;  2RC9 A;  5TP9 B;  5DT6 A;  3ZSF A;  4OWD A;  4KPT A;  4F2O A;  1B6H A;  1QUK A;  3KSX A;  4WKM A;  3S9L C;  2HEU A;  2Q74 A;  3BFT A;  4GX4 A;  4C1T A;  3IO6 A;  1EZP A;  3PUZ E;  1Y9U A;  4MX6 A;  3R7X A;  4NGU A;  1FW0 A;  1MQI A;  1MPC A;  5KCJ A;  1NH8 A;  2AL4 A;  4GWS A;  2HPG A;  3GBA A;  2Z8D A;  2Z23 A;  3DLN A;  4ZZA A;  2CZK A;  4PDH A;  5I59 A;  2I3V A;  4FAJ A;  3RNN A;  1IXH A;  2PT1 A;  1RYX A;  5EYG A;  1VSO A;  4O8M A;  4OHN A;  5TPA A;  4XIG Q;  4G8M A;  3E79 A;  1DCU A;  2V4C A;  1SVX B;  1MDQ A;  5H8H A;  3RN8 A;  2UVJ A;  4QFN A;  5ESY A;  5I57 B;  3QIM A;  2QS4 A;  4PC9 A;  3D4G A;  3OO8 A;  3OD7 A;  2DWI A;  1G0H A;  3ONM A;  3CFX A;  2B3F A;  4GWW A;  3SET A;  1LFG A;  4MH5 A;  4NF0 A;  3TDJ A;  1QGX A;  3MVY A;  4X1D A;  1FBC A;  4OER A;  4PF6 A;  1OMP A;  4GWU A;  3UA8 A;  4BDM A;  4OZ9 A;  3EHT A;  3FJG A;  1XI6 A;  2OWT A;  1B51 A;  4X48 A;  2F3D A;  4JB7 A;  1LEV A;  5M2V A;  3H6T A;  3N6U A;  5I5P A;  4RK9 A;  2OBG A;  3H3G A;  3PU5 A;  4GIZ A;  1JEU A;  1AMF A;  2DXR A;  1FTK A;  4ZEK A;  4AB5 A;  1T0K A;  5JTY B;  1MY1 A;  4Q0C A;  4XKP A;  1G0I A;  4GWY A;  2ZXT A;  4NWD A;  4EQ7 A;  1N84 A;  4RA1 A;  5L9O A;  4NF4 A;  1LAF E;  1FTL A;  1QW0 A;  4QSD A;  4NF6 B;  1SW4 A;  4H65 A;  5H8S A;  4FIM A;  1RDY A;  4YKI A;  1P1Q A;  1I6B A;  2XXW A;  3O66 A;  4F1U A;  1Y4C A;  3QK6 A;  2Y5L A;  3FVK A;  1RDZ A;  5ET5 A;  3TPA A;  4OFL A;  2F7C A;  2FHY A;  4TQU Q;  5DVJ A;  3QAX A;  1D9Q A;  2ZYO A;  4ECF A;  1JVX A;  2E1S A;  5I2N A;  4HS7 A;  4H8I A;  3IB2 A;  4NF8 A;  4YKJ A;  1ZIU A;  4IO6 A;  3K6U A;  4LZ7 A;  4X1B A;  2G29 A;  1PEB A;  1USY E;  3A3U A;  1HSL A;  3TTR A;  3CSB A;  1TFA A;  2DE2 A;  1IMD A;  1LBC A;  4YZZ A;  3OMB A;  2Q9T A;  4RXL A;  1KA0 A;  4N07 A;  3THI A;  5AA2 D;  2A5T A;  4JSD A;  3K2D A;  5H8N A;  1J1N A;  1LAH E;  2QFL A;  4KYE A;  5AA2 B;  3G3F A;  2REG A;  3D4C A;  2DQV A;  3EF7 A;  4OQO A;  2UYF A;  3LSL A;  1MH3 A;  4P11 A;  3FAS A;  1D3K A;  3KSJ A;  2XWI A;  4MLQ A;  1NV2 A;  4R73 A;  3FXU A;  1UTH A;  4O7I A;  1NNF A;  2V3T A;  1H76 A;  4QFO A;  3TQW A;  2XD3 A;  2FA7 A;  2FNC A;  2RF1 A;  3QMF A;  1B3L A;  3CG1 A;  3K1P A;  4O3B A;  4E0X A;  1XT8 A;  2HXW A;  3DP6 A;  4ESX A;  2REJ A;  2R8T A;  5DW8 A;  3BFU A;  4OVR A;  1NV6 A;  1QUL A;  1M5F A;  4XFE A;  3IFA A;  2PFZ A;  5DVI A;  4U23 A;  3CIJ A;  1FBE A;  3O9P A;  3SER A;  2XXX A;  4F18 A;  2V3Q A;  2Y5K A;  3G7W A;  2F6P A;  3MVX A;  4EDP A;  1S50 A;  2ZZV A;  1YYZ A;  2QVU A;  4ZS9 A;  3IOW A;  4DCX A;  4H1X A;  4H5F A;  5TU0 A;  2HAU A;  1EYJ A;  1AH5 A;  3T93 B;  1MQG A;  1FQE A;  1Y3N A;  4EQ9 A;  2OX3 A;  4U4S A;  2CZI A;  4I62 A;  5CMC A;  1B9J A;  3VXB A;  4NED A;  1JP4 A;  3W9W A;  3G3I A;  1YPN A;  3TFL A;  2I6E A;  3B7D A;  2ONK E;  5EQ9 A;  4HXV A;  3NOH A;  4ND9 A;  3TCG A;  1NI9 A;  2X7P A;  2YPN A;  3U72 A;  4RY1 A;  1YXI A;  1B1H A;  1MXU A;  4YKK A;  1IZ1 A;  2CEY A;  3LBS A;  2WBD A;  3VV5 A;  1VFE A;  1B7H A;  3MZ1 A;  2PVU A;  4BDL A;  1QVS A;  1FBF A;  2O7I A;  2KR0 A;  1ZU0 A;  3MZ9 A;  1NV0 A;  4U22 A;  4NQ8 A;  1WVJ A;  1QUJ A;  3CHG A;  5T3J A;  1EU8 A;  2CEX A;  3SEY A;  5IZZ A;  1RDX A;  4QF9 A;  4OEU A;  1XS5 A;  2H5Y A;  4QHQ A;  3KGC A;  3IB1 A;  4OVP A;  4DI3 D;  1IIW A;  2V25 A;  3T96 B;  4ELO A;  4F1Y A;  1BP5 A;  3DEL B;  2F3B A;  2XXQ A;  3MVW A;  1FBG A;  4KCC A;  2QVV A;  1BLF A;  4F31 B;  2I58 A;  4N8G A;  4N81 A;  4YMB A;  2PFY A;  3PPO A;  1H43 A;  5I3S A;  4P56 A;  2Z22 A;  2ANJ A;  4MJO A;  4GL8 A;  3R6U A;  1XVX A;  4G61 A;  4OVT A;  4DLD A;  4F39 A;  1ZTY A;  4IO3 A;  1LGB C;  4PP0 A;  2O1M A;  5I59 B;  4GX3 A;  1NMU A;  4OFO A;  3FBP A;  2DP8 A;  4IO2 A;  2ZYN A;  5LOM A;  2AYS A;  1CB6 A;  3KG2 A;  2H25 A;  2Q88 A;  2OK2 A;  2O7U A;  1PBQ A;  2FIE A;  1B7Z A;  4IO5 A;  3Q26 A;  4PFB A;  1TFD A;  1PB9 A;  2NWJ A;  5H8H B;  3GLB A;  1AIV A;  4MNC A;  3TYH A;  2GQ1 A;  1HSJ A;  2F7A A;  2O68 A;  1Z7M E;  1ZLQ A;  3QSL A;  3FJM A;  4H0W A;  2QS1 A;  3PPP A;  4OYV A;  2G93 A;  3T9H B;  1ATG A;  4R74 A;  3L6G A;  1IXC A;  4E0W A;  4NX1 A;  4IGT A;  2ZMB A;  2XA5 A;  2B4M A;  4JXI A;  3FGS A;  3VLV A;  1UQW A;  1MM6 A;  3RPL B;  3TCF A;  3UN6 A;  5IZ3 A;  1H44 A;  3CI8 A;  2F34 A;  3LSX A;  3W15 C;  5ET6 A;  3CG3 A;  4PGP A;  1LBZ A;  3IB0 A;  2YLN A;  3IL1 B;  4JVC A;  3ROJ A;  1WDN A;  1LFH A;  4U1Z A;  2RCB A;  4EF1 A;  4R6Y A;  2ZYM A;  3KBR A;  4F3G A;  3CSG A;  3OXN A;  5K2Y A;  4LUB A;  1P99 A;  2Q2A A;  2NVU B;  3LSW A;  1FTJ A;  1D9V A;  3E4R A;  1FTM A;  1NV3 A;  3DP8 A;  5JEI A;  3N6T A;  1OLA A;  4LZ8 A;  1NKX A;  3PUW E;  1Q9D A;  2Y7P A;  3MVZ A;  1Y3Q A;  3TEL A;  2DDK A;  3KC1 A;  5DEX A;  2YJP A;  3HHG A;  5AA4 B;  4LA9 A;  3H6W A;  4P9K A;  3U1O A;  1OVT A;  5BWJ A;  3BKI B;  4QBA A;  4N8Y A;  4R2B A;  1POY 1;  4P3L A;  1LCT A;  3O97 A;  1MG1 A;  4FE8 A;  4GF8 A;  2XWK A;  3B6Q A;  4ZEI A; 
#chains in the Genus database with same CATH homology
 4PET A;  5A5X A;  1O63 A;  5I58 A;  4YAH X;  1MXX A;  5IKB A;  1SQY A;  2GHB A;  5B70 A;  1D9Y A;  4NF8 B;  2O84 X;  3K6W A;  3KJT A;  4ELP A;  3UK4 A;  3FXR A;  4MFI A;  2O6A A;  4YB5 A;  5FHM A;  4N6P A;  3G3K A;  2ESN A;  4DXC A;  5I84 A;  5CMK A;  3TTM A;  2VOZ A;  3MUQ A;  1IQ7 A;  2A5T B;  2Q2C A;  1SD3 A;  4FEB A;  2F6G A;  3ODB A;  2E0S A;  5H8N B;  3QUF A;  4LON B;  4TLL B;  3SDF A;  3TTN A;  4C1U A;  1MQJ A;  2QMW A;  4IO4 A;  3LSF B;  3KN8 A;  2F7B A;  4FOR A;  3TOD A;  4IB2 A;  3IOR A;  3U94 A;  3RPW A;  3C33 A;  4KFQ A;  1IEJ A;  5ICQ A;  1RKM A;  2NUV A;  2O51 A;  3N5L A;  1SW1 A;  1MQD A;  1SW5 A;  3EPE A;  3U8Q A;  1MPB A;  1SI1 A;  4G4P A;  1B3H A;  3QYT A;  3FJ7 A;  3C31 A;  2DWA A;  3H6V A;  2F78 A;  4IY5 A;  3MAM A;  4EQB A;  1B40 A;  2GRV A;  3MQ9 A;  2RCA A;  3CRB A;  3OOA A;  5I2K A;  2I49 A;  3FVO A;  3T9U A;  3UIF A;  1LFI A;  4G2Z A;  4EXK A;  3PMW A;  3IOU A;  2LAO A;  4FEC A;  3O6I A;  1R9Q A;  4YIC A;  3JZJ A;  5IAI A;  1MXY A;  3T9V A;  2H99 A;  4YB7 A;  3FD3 A;  3PPR A;  2F5X A;  2BJJ X;  4ZZE A;  1DOT A;  4F3P A;  3K1M A;  4R75 A;  1TXF A;  2X7Q A;  1A55 A;  3KJ7 A;  5CRY A;  5DVF A;  3FV2 A;  4Q8R A;  2ONR A;  3K01 A;  4GD5 A;  4OVJ A;  2UXA A;  4YKP A;  4QRZ A;  2RIN A;  3GZG A;  3UOR A;  3JV9 A;  1LBB A;  1PB7 A;  1CE2 A;  2P0S A;  1URD A;  5ISU A;  4XKR A;  4BDN A;  1IXI A;  1D4N A;  4KR5 A;  1MY3 A;  1B5I A;  4U21 A;  4BLA A;  5I56 A;  2OJT A;  3VVD A;  3OO7 A;  1YCJ A;  1GVC A;  4WEP A;  3W9V A;  1US4 A;  1B4Z A;  4ESW A;  4H6D A;  3RTW B;  3FUZ A;  4LAT A;  1B52 A;  4KI0 E;  1TWY A;  2CZL A;  1SW2 A;  3K02 A;  1URS A;  4C0R A;  2Y7I A;  3I6V A;  4Z0I A;  1OIB A;  3HO7 A;  3PD8 A;  3CFZ A;  3SEV A;  2NXO A;  4JDF A;  3G3G A;  4OES A;  3VXC A;  5ICT A;  1P1N A;  3MPL A;  3FZV A;  3USD A;  1N3X A;  4RK2 A;  2DVZ A;  4HCY A;  3EQ1 A;  4GLI A;  3Q25 A;  3DM0 A;  2W7Y A;  5AA1 A;  1Y3P A;  2FYI A;  2B3B A;  2DXY A;  5CMB A;  5F1Q A;  3V8X B;  4ZE8 A;  2XXY A;  1JVY A;  4OEV A;  2GFE A;  2PT2 A;  2F97 A;  2QPQ A;  2GHA A;  1R9L A;  3MC2 A;  2DWH A;  1LAG E;  4PQJ A;  1OQH A;  4O3A A;  1UIU A;  4NWC A;  3HCQ A;  4TLM B;  3O2A A;  2I0C A;  3H7M A;  1A8F A;  4YU0 A;  5KZT A;  1MXW A;  1POT A;  3LR1 A;  2DVC A;  2OWS A;  4LQ5 A;  4DXU A;  4R6H A;  4HW8 A;  3KOS A;  5H8F B;  2PYY A;  1RYO A;  4JSO A;  3WAF A;  1USY H;  4NF5 A;  4L17 A;  3KN3 A;  4PFT A;  1F9B A;  3TAJ A;  2UVH A;  5H8Q B;  1I69 A;  1B05 A;  4NF6 A;  3A3C A;  4F3B A;  4FAT A;  3OEM A;  3H06 B;  5ELV A;  3WAE A;  4R6K A;  1XC1 A;  1IIT A;  3ILU B;  2XXP A;  2QMX A;  4ZEF A;  3OO9 A;  2O1L A;  3IOT A;  2Z8F A;  2VD3 A;  4ZED A;  3U92 A;  1I6A A;  3Q29 A;  5ITO A;  3IAZ A;  4MBP A;  4MLV A;  4KYD A;  4GFR A;  2XX7 A;  1Z7N E;  1PB8 A;  4G68 A;  3C35 A;  1I6Q A;  3VVF A;  3VVE A;  2RC8 A;  4KQP A;  3DP4 A;  1JEV A;  4R2F A;  1N04 A;  2F35 A;  2DWJ A;  5L9M A;  2VD2 A;  4QFK A;  1UTB A;  1US5 A;  4EF2 A;  2QS2 A;  2I4B A;  1GR2 A;  3C36 A;  2CMO A;  1MDP 1;  3TMG A;  4Q30 B;  4TOZ A;  3EHS A;  3PD9 A;  2VHA A;  3KN7 A;  3M3K A;  3OEK A;  1B32 A;  1ZJL A;  5AA2 A;  4BDR A;  3P7I A;  4X9T A;  2VGQ A;  1GGG A;  1GTK A;  3IR1 A;  5KCJ B;  2M8C A;  3HV1 A;  1SDX A;  2PX1 A;  5K2X A;  5CI5 A;  3G3J A;  3TZA A;  3SEW A;  3E3K A;  1MPD A;  4ELQ A;  1DTG A;  3TQL A;  1MRP A;  1Y1M A;  4HTG A;  3FXQ A;  5TPA B;  4H8J A;  4GXS B;  2UVI A;  4FJP A;  2NOO A;  3E13 X;  3SEU A;  4Z7E A;  1Q35 A;  1URG A;  2IEE A;  2PBW A;  2F8D A;  1FQA A;  3MBP A;  3LC8 A;  2XXH A;  1JW1 A;  3C4M A;  4JWY A;  3TTK A;  1ZMG A;  1SI0 A;  1DPP A;  2RC7 A;  2XXI A;  3ZKL A;  1R6Z A;  4WXJ A;  4OEN A;  4F19 A;  3B6T A;  3IK6 B;  3HST A;  3PV0 E;  5CMM A;  3Q28 A;  4XXU A;  1Y1Z A;  1NNT A;  4GOT A;  3IJO B;  1JNF A;  1L5T A;  3PPQ A;  3VLW A;  4Q5T A;  1VE4 A;  1LCF A;  2Q89 A;  1O7T A;  1NH7 A;  1BKA A;  4ISU A;  1PDA A;  1UIV A;  2OLB A;  3C32 A;  1Q1K A;  2I4C A;  3B6W A;  2KLF A;  2QL3 A;  3I3V A;  1B5J A;  2H9B A;  3FVG A;  4IGR A;  3K6V A;  3MP8 A;  2XHD A;  2DE3 A;  1P1W A;  1TT1 A;  3PMX A;  2AIX A;  4NF4 B;  4ZEB A;  1A99 A;  3EHU A;  3FV1 A;  2V84 A;  3KZG A;  1VR5 A;  4G8N A;  2A5S A;  5BUU A;  4AB6 A;  5CBR A;  3UP9 A;  3OEL A;  2ALU A;  3PUY E;  1B58 A;  3O6H A;  1FQD A;  5B7D A;  3RY3 A;  3PUX E;  4FED A;  2P2A A;  3K0V A;  1FQF A;  1DTZ A;  1NL5 A;  1B3G A;  5I2N B;  4XTC Q;  3PGF A;  1AL3 A;  3C34 A;  3KEI A;  5I56 B;  2XX9 A;  5AA3 A;  4QSC A;  4YB6 A;  3IOV A;  5L9S A;  2R6G E;  1AOV A;  4XKN A;  1KWH A;  5CC2 A;  1M5D A;  4M4G A;  2Z8E A;  4JWX A;  2UVG A;  4I8C A;  5EHS A;  4DZ1 A;  1A8E A;  4P0G A;  4PFY A;  3TCH A;  1NNK A;  1SYH A;  4BDO A;  4LQ2 A;  4GWO A;  4WED A;  3K00 A;  3H03 A;  3V5A A;  3TEP A;  2HZL A;  4U2R A;  1UTH B;  4GRK A;  3S2V A;  1R1N A;  1H45 A;  4PFU A;  4KD5 A;  3QXM A;  1S7Y A;  1LB8 A;  3KFM A;  3MWB A;  5KDT A;  4LVQ A;  3GXA A;  3M8U A;  3JYR A;  1P1O A;  3BBR A;  3O29 A;  1B5H A;  1OQG A;  3S4U A;  2XXR A;  4EUO A;  1WOD A;  4M1V A;  3O28 A;  1BIY A;  1A40 A;  1MY2 A;  2D21 A;  4THI A;  1P1U A;  3VLU A;  1A54 A;  4POX A;  3MW0 A;  4ELR A;  4NF5 B;  1VFD A;  5FTI A;  1XVY A;  2AL5 A;  2THI A;  3PMV A;  1PBP A;  1SBP A;  3IX1 A;  1II5 A;  4I1D A;  5JK4 A;  1MY4 A;  1B4H A;  3N94 A;  3MP6 A;  5TP9 A;  4G8H A;  3K6X A;  3U93 A;  3S9M C;  5AA4 A;  3HPI A;  4POW A;  4OMB A;  1MS7 A;  1ZBM A;  3V89 B;  3H4Z A;  1B7U A;  4F2Q A;  1MM7 A;  1ELJ A;  5HM4 B;  4ZEC A;  2V3U A;  4H67 A;  1LST A;  5DYH A;  2DYX A;  4G68 B;  1JW4 A;  4U1O A;  4K3F A;  2GH9 A;  1NFT A;  2I0B A;  4RJZ A;  4YMA A;  3S9E A;  1B3E A;  3S9N C;  2ZNS A;  1UTB B;  3T22 A;  3TKD A;  4LP2 B;  3KOT A;  1M5B A;  1B46 A;  1N0T A;  1OLC A;  1O64 A;  5AE4 A;  2VP1 A;  1IUD A;  2Y84 A;  4KCD A;  3ILT B;  2DOJ A;  1SYI A;  5I57 A;  2RKM A;  1EZO A;  1DSN A;  1H3D A;  1YAE A;  1XHY A;  3RGY A;  1FQC A;  3MP1 A;  4DDD A;  3TUS A;  3E9X A;  3VDF A;  2DSF A;  2IA4 A;  1LAX A;  4QSE A;  2QSX A;  1A7L A;  2WKY A;  4OFJ A;  3SEX A;  1QUI A;  1NNP A;  2QRY A;  2Y7W A;  2ZYK A;  5CM6 A;  2Y7R A;  5CBS A;  1QKB A;  2ZNU A;  3FIR A;  1OVB A;  4G68 C;  3TTL A;  1MH4 A;  4KYS A;  3UGW A;  1QJM A;  5JTY A;  1M5C A;  3N26 A;  1HSE A;  2R9J A;  2XD2 A;  1FCK A;  3F11 A;  2XXU A;  3C9H A;  1B3F A;  4H5G A;  3RQT A;  3RT6 B;  1B0L A;  1XOC A;  5FHO A;  3IO4 A;  3OSR A;  4HCW A;  5FTH A;  3PPN A;  4I9D A;  3ECR A;  4F1V A;  1JET A;  1B0H A;  2Y7K A;  4MF3 A;  3HN0 A;  4R72 A;  2H98 A;  4EXL A;  4DXB A;  2QS3 A;  4OTE A;  1EH3 A;  5J1D A;  3SKP A;  1BTJ A;  1ANF A;  3L6H A;  4GL0 A;  2O69 A;  4ZE9 A;  4IO7 A;  4DIG A;  4JWO A;  1MY0 A;  2P1S A;  3RUM A;  4NMY A;  5FHN A;  3R26 A;  4BDQ A;  1MXV A;  1YTV A;  4RPO A;  4R9F A;  5EHM A;  1LLS A;  1S9T A;  5DEX B;  2HAV A;  2D3I A;  2PMS A;  1B2H A;  1N7X A;  3MJN A;  5L8D A;  4QFL A;  2B65 A;  4UA8 A;  3CR9 A;  4KHZ E;  3EN3 A;  3FVN A;  2HCA A;  3GBB A;  4GXA A;  5A5X B;  1JW5 A;  5I58 B;  1N3W A;  1MQH A;  2HQ0 A;  4PE5 B;  2XXV A;  4XKQ A;  4OXV A;  3HHF A;  1LB9 A;  3H6U A;  1N7W A;  4G77 A;  1DPE A;  4N13 A;  5F7V A;  3O6G A;  3VE1 B;  4R9G A;  4UAC A;  4GVO A;  3CFL A;  4IY6 A;  4RPN A;  2UYE A;  3ZS6 A;  2I48 A;  2Q8J A;  2XX8 A;  3A09 A;  5DTB A;  4ONY A;  2HZK A;  4LZ5 A;  1M5E A;  1IXG A;  4RNS A;  4ZDM A;  1ZKB A;  2I3W A;  1PC3 A;  3M3F A;  3G3H A;  4F29 A;  3LUY A;  5ITP A;  3MPK A;  4O3C A;  5H8F A;  3OSQ A;  3OO6 A;  1EZ9 A;  2DS9 A;  1DMB A;  2X26 A;  5HPQ A;  1QKA A;  3K4U A;  4P0I A;  2OCU A;  4U4X A;  4F22 A;  2R71 A;  3M3L A;  2ZNT A;  3FAT A;  4NE4 A;  3RT8 A;  3K1N A;  4NTL A;  5KDT B;  1Y20 A;  3IJX B;  1B1X A;  5H8Q A;  1JQF A;  3RTF B;  3OEN A;  1FQB A;  1FTO A;  4AQ4 A;  3AXF A;  5I2K B;  3T66 A;  4JBZ A;  2ABH A;  1MXZ A;  2OZZ A;  3I5O A;  4F3S A;  1GV8 A;  2HFB A;  3VFJ A;  4PFW A;  2QJE A;  4RYA A;  4QFP A;  3Q27 A;  3RLF E;  4GQO A;  3QUJ A;  4OET A;  2DE4 A;  3SES A;  3T9X B;  2V93 A;  3ZKK A;  2H4I A;  2ONS A;  1Y4T A;  4DE8 A;  1N76 A;  4DCY A;  3CVG A;  5HBC A;  2F36 A;  5EYF A;  2D5W A;  3MZB A;  3V83 A;  2XXT A;  3PUV E;  2RC9 A;  5TP9 B;  5DT6 A;  3ZSF A;  4OWD A;  4KPT A;  4F2O A;  1B6H A;  1QUK A;  3KSX A;  4WKM A;  3S9L C;  2HEU A;  3BFT A;  4C1T A;  3IO6 A;  1EZP A;  3PUZ E;  1Y9U A;  3R7X A;  1FW0 A;  1MQI A;  1MPC A;  5KCJ A;  1NH8 A;  2AL4 A;  3GBA A;  2Z8D A;  2Z23 A;  3DLN A;  4ZZA A;  5I59 A;  2I3V A;  4FAJ A;  3RNN A;  1IXH A;  2PT1 A;  1RYX A;  1VSO A;  4OHN A;  5TPA A;  4XIG Q;  4G8M A;  1SVX B;  1MDQ A;  5H8H A;  3RN8 A;  2UVJ A;  4QFN A;  5I57 B;  3QIM A;  2QS4 A;  3D4G A;  3OO8 A;  3OD7 A;  2DWI A;  3ONM A;  3CFX A;  2B3F A;  3SET A;  1LFG A;  4MH5 A;  3TDJ A;  3MVY A;  4X1D A;  4OER A;  1OMP A;  3UA8 A;  4BDM A;  4OZ9 A;  3EHT A;  3FJG A;  2OWT A;  1B51 A;  4X48 A;  4JB7 A;  5M2V A;  3H6T A;  3N6U A;  4RK9 A;  2OBG A;  3H3G A;  3PU5 A;  4GIZ A;  1JEU A;  1AMF A;  2DXR A;  1FTK A;  4ZEK A;  4AB5 A;  1T0K A;  5JTY B;  1MY1 A;  4Q0C A;  4XKP A;  2ZXT A;  4NWD A;  4EQ7 A;  1N84 A;  4RA1 A;  5L9O A;  4NF4 A;  1LAF E;  1FTL A;  1QW0 A;  4QSD A;  4NF6 B;  1SW4 A;  4H65 A;  5H8S A;  4FIM A;  4YKI A;  1P1Q A;  1I6B A;  2XXW A;  3O66 A;  4F1U A;  1Y4C A;  3QK6 A;  3FVK A;  3TPA A;  4OFL A;  2F7C A;  4TQU Q;  5DVJ A;  3QAX A;  2ZYO A;  4ECF A;  1JVX A;  2E1S A;  5I2N A;  4HS7 A;  4H8I A;  3IB2 A;  4NF8 A;  4YKJ A;  1ZIU A;  4IO6 A;  3K6U A;  4LZ7 A;  4X1B A;  2G29 A;  1PEB A;  1USY E;  3A3U A;  1HSL A;  3TTR A;  3CSB A;  1TFA A;  2DE2 A;  1LBC A;  4YZZ A;  3OMB A;  2Q9T A;  4RXL A;  4N07 A;  3THI A;  5AA2 D;  2A5T A;  4JSD A;  3K2D A;  5H8N A;  1J1N A;  1LAH E;  4KYE A;  5AA2 B;  3G3F A;  2REG A;  3D4C A;  2DQV A;  3EF7 A;  4OQO A;  2UYF A;  3LSL A;  1MH3 A;  4P11 A;  3FAS A;  1D3K A;  3KSJ A;  4MLQ A;  4R73 A;  3FXU A;  1UTH A;  1NNF A;  2V3T A;  1H76 A;  4QFO A;  3TQW A;  2XD3 A;  2FA7 A;  2FNC A;  2RF1 A;  1B3L A;  3CG1 A;  3K1P A;  4O3B A;  4E0X A;  1XT8 A;  2HXW A;  3DP6 A;  4ESX A;  2REJ A;  3BFU A;  1QUL A;  1M5F A;  5DVI A;  4U23 A;  3CIJ A;  3SER A;  3O9P A;  2XXX A;  4F18 A;  2V3Q A;  3G7W A;  2F6P A;  3MVX A;  4EDP A;  1S50 A;  4ZS9 A;  3IOW A;  4DCX A;  4H1X A;  4H5F A;  5TU0 A;  2HAU A;  1AH5 A;  3T93 B;  1MQG A;  1FQE A;  1Y3N A;  4EQ9 A;  4U4S A;  4I62 A;  5CMC A;  1B9J A;  3VXB A;  4NED A;  3W9W A;  3G3I A;  1YPN A;  3TFL A;  2I6E A;  3B7D A;  2ONK E;  4ND9 A;  3TCG A;  2X7P A;  2YPN A;  3U72 A;  4RY1 A;  1B1H A;  1MXU A;  4YKK A;  1IZ1 A;  3LBS A;  3VV5 A;  1VFE A;  1B7H A;  3MZ1 A;  2PVU A;  4BDL A;  1QVS A;  2O7I A;  1ZU0 A;  3MZ9 A;  4U22 A;  1WVJ A;  1QUJ A;  1EU8 A;  3SEY A;  4QF9 A;  4OEU A;  1XS5 A;  2H5Y A;  4QHQ A;  3KGC A;  3IB1 A;  1IIW A;  2V25 A;  3T96 B;  4ELO A;  4F1Y A;  1BP5 A;  3DEL B;  2XXQ A;  3MVW A;  4KCC A;  1BLF A;  4F31 B;  2I58 A;  4YMB A;  3PPO A;  1H43 A;  2Z22 A;  2ANJ A;  4GL8 A;  3R6U A;  1XVX A;  4DLD A;  4F39 A;  1ZTY A;  4IO3 A;  1LGB C;  4PP0 A;  2O1M A;  5I59 B;  1NMU A;  4OFO A;  2DP8 A;  4IO2 A;  2ZYN A;  5LOM A;  2AYS A;  1CB6 A;  3KG2 A;  2H25 A;  2Q88 A;  2OK2 A;  2O7U A;  1PBQ A;  1B7Z A;  4IO5 A;  3Q26 A;  1TFD A;  1PB9 A;  2NWJ A;  5H8H B;  3GLB A;  1AIV A;  3TYH A;  1HSJ A;  2F7A A;  2O68 A;  1Z7M E;  1ZLQ A;  3QSL A;  3FJM A;  4H0W A;  2QS1 A;  3PPP A;  4OYV A;  2G93 A;  3T9H B;  1ATG A;  4R74 A;  3L6G A;  1IXC A;  4E0W A;  4IGT A;  2ZMB A;  4JXI A;  3FGS A;  3VLV A;  1UQW A;  1MM6 A;  3TCF A;  3UN6 A;  1H44 A;  3CI8 A;  2F34 A;  3LSX A;  3W15 C;  3CG3 A;  3IB0 A;  2YLN A;  3IL1 B;  1WDN A;  1LFH A;  4U1Z A;  2RCB A;  4EF1 A;  4R6Y A;  2ZYM A;  3KBR A;  4F3G A;  3CSG A;  3OXN A;  5K2Y A;  4LUB A;  1P99 A;  2Q2A A;  2NVU B;  3LSW A;  1FTJ A;  1D9V A;  3E4R A;  1FTM A;  5JEI A;  3DP8 A;  3N6T A;  1OLA A;  4LZ8 A;  1NKX A;  3PUW E;  2Y7P A;  3MVZ A;  1Y3Q A;  3TEL A;  5DEX A;  2YJP A;  3HHG A;  5AA4 B;  4LA9 A;  3H6W A;  3U1O A;  1OVT A;  5BWJ A;  3BKI B;  4R2B A;  1POY 1;  1LCT A;  3O97 A;  1MG1 A;  4FE8 A;  4GF8 A;  3B6Q A;  4ZEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...