4XF5A

Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
317
structure length
317
Chain Sequence
PTIKWRMQTYAGAALAEHVAKPAIDLFNRIAGDRMQIELYSADQLVPTGELFRAMQRGTIDAVQSDDDSMASPTEVTVFGGYFPFGCRYSLDVPVLFNQYGLKEIWEEEYAKVGVKHVSAGAWDPCHFATKEPIRSLKDLEGKRVFTFPTAGRFLSRFGVVPVTLPWEDIEVALQTGELDGIAWSGITEDYTVGWANVTNYFLTNNISGAWIGHFFVNMERWEELPEDLRLLFEVCCEQSHYHRQYWYWGGEARLRVHGDKLELTSIPDAEWDQVETAAQEFWDEIAAQSETKAKVVEIFKQYNADMRKAGRPYRYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Twin-arginine translocation pathway signal
publication title Crystal structure of a TRAP periplasmic solute binding protein from Chromohalobacter salexigens DSM 3043 (Csal_0678), Target EFI-501078, with bound (S)-(+)-2-Amino-1-propanol.
rcsb
source organism Chromohalobacter salexigens (strain dsm 3043 / atcc baa-138 / ncimb 13768)
total genus 119
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4xf5A00
4N17A 2XWIA 4PF8A 4N6KA 4OA4A 4XEQA 4NN3A 4PFBA 2PFYA 4O94A 4P1LA 4N15A 4MCOA 4DI4B 4NHBA 4MIJA 4PAIA 5IM2A 4PGPA 4PFRA 2HPGA 2V4CA 4PC9A 4NG7A 2HZLA 2CEYA 4PETA 3FXBA 4PAKA 4N91A 4O7MA 4N6DA 4NAPA 4P56A 4OVSA 2WYPA 4MEVA 2HZKA 4P9KA 4PE3A 4PDHA 4P47A 5IZZA 4P1EA 4XF5A 2ZZWA 4N8YA 2VPNA 4PGNA 4PBQA 4N4UA 4PAFA 2WX9A 4MNCA 2XWVA 3GYYA 2VPOA 4X04A 4MAGA 2XWOA 4YICA 3U65A 2XXKA 3B50A 4LN5A 4OVTA 4P8BA 2WYKA 4NGUA 4PBHA 4PF6A 2XA5A 4XFEA 4MHFA 4MMPA 4MX6A 4NX1A 4OVRA 5I7IA 4PFIA 5I5PA 4NF0A 4OVPA 2ZZXA 5IGAA 4PDDA 2CEXA 4UABA 4X8RA 4PCDA 5LTCA 4OVQA 4YZZA 4P3LA 2ZZVA 4NQ8A 4N8GA 5CM6A 4DI3D 4MNPA 4MNIA 4O8MA 4OANA 2XWKA 2PFZA
chains in the Genus database with same CATH superfamily
3O66A 3PU5A 2QS1A 1MY2A 2OX3A 2I4BA 4XIGQ 1QUKA 1FQBA 1B4HA 4FBPA 4DE8A 1M5FA 3TQLA 3OO9A 4PGPA 3KOSA 1DCUA 5I59A 1L5TA 4WXJA 2B65A 3FXUA 4QFNA 1UQWA 2CZKA 4N91A 5F24A 5HBCA 2B4LA 3ZKLA 3SEXA 3IB0A 4RA1A 2FA7A 2XXXA 5AA4B 5CMKA 2XX9A 3V5AA 5I2NB 2QPQA 1B3EA 1IIWA 4Q30B 4YKIA 3LV0A 1NV2A 2RKMA 4OWDA 3FVNA 3OSRA 4GF8A 3E3KA 4FAJA 1EYJA 1YXIA 2O69A 4G68B 2F3BA 4OFOA 3BFTA 5IZ1A 3OD7A 3OXNA 4GBVA 3Q28A 2XXKA 1Y1ZA 1OQHA 1NV4A 5CMCA 1FQAA 1ATGA 2DE3A 4NF0A 4GBWA 3T9UA 1FBEA 2REJA 2CZLA 1MH3A 4U22A 1US4A 5TPAA 2RCAA 4G68C 1FPLA 1B5HA 2Y7IA 5KZTA 1LCFA 1T0KA 1NV6A 4EQ9A 1FJ9A 5TU0A 3C36A 4KPTA 1QULA 3FBPA 1OVTA 1YYZA 1SDXA 5IZ3A 3K6VA 1MXUA 2DXRA 4MH5A 3IFCA 4GXSB 5IKBA 3OENA 2X7QA 4H1XA 3N5LA 4XKNA 3FXRA 4HE0A 1XI6A 4OESA 1DTGA 4JBZA 5F1QA 4H5FA 1I6AA 3IL1B 1P1OA 3H06B 4OVSA 3F11A 2O7UA 1JETA 3EHTA 2H4IA 2DP8A 5EQAA 4XF5A 2A5TB 3IFAA 4GWOA 1MQJA 4F39A 2Y7PA 3AXFA 4ZZEA 5H8QB 2F7AA 4PFYA 1EYKA 4N4UA 3OMBA 2QVVA 2XXHA 5DYHA 1O7TA 1IMBA 3FASA 4QFPA 2R8TA 2DDKA 1IUDA 3G3IA 1GR2A 5I3SA 2I6EA 4PQJA 3K1NA 4FEBA 2XHDA 2WYKA 2DVCA 4U1OA 4OVRA 4OYVA 5IAIA 3ISPA 1YAEA 1UIVA 2FIXA 4JWYA 4R73A 3FGSA 2I58A 1MRPA 2RCBA 3A3UA 3ONMA 3KJTA 5IGAA 4LQ5A 4YKJA 1QKBA 3K4UA 1FPKA 5ET6A 2O7IA 4BDQA 2H5YA 3GBBA 4XXUA 4DI3D 4AQ4A 1P1WA 3HSTA 4MNPA 4OANA 4GFRA 3JV9A 2YPNA 4MLVA 4NE4A 4QSCA 1BK4A 5DW8A 2OWZA 1QVSA 4NF4B 3SERA 3ZKKA 1UTHB 3CI8A 1EYIA 5AA2D 1IMCA 4H65A 4YKKA 2GHAA 2HZLA 4L17A 1JW5A 1P1NA 4PAKA 2Z8DA 3MJNA 1A8EA 3FZVA 1P1QA 5LOMA 4TLLB 1MXYA 3PPRA 4DCYA 4QBAA 5I56A 3H3GA 4KQPA 4I3YA 4GX3A 3ILTB 3TAJA 5HPQA 1VE4A 5H8NB 4RPNA 1LBCA 1SW1A 4GQOA 5ITPA 3TUSA 3O9PA 1SVXB 1B32A 1BKAA 3IOUA 1FBHA 1B52A 3KZGA 2REGA 1Y3PA 2Z8EA 5FHOA 3HHFA 3A09A 2NOOA 3MWBA 5KDTA 1IMEA 4KCCA 1AL3A 1LFIA 4JSDA 2Z8FA 4HCWA 1FQEA 4OXVA 4ESXA 3K00A 3FUZA 1A8FA 1QW0A 1URGA 3FVKA 2PX1A 1GGGA 4DZ1A 2XA5A 3KC1A 4MMPA 3KN7A 1IXIA 3R6UA 4OEVA 3EF7A 1D4NA 2XD2A 2WEFA 5ESYA 1BIYA 5KCJB 4XKPA 1FPIA 4I62A 1OQGA 1LLSA 4G61A 3IX1A 4UACA 4ZS9A 4HE1A 4YMAA 1LBVA 4EDPA 3D1RA 4BDNA 4FJPA 5BWJA 3A29A 3SDFA 4NHBA 3EPEA 3MVZA 3M3LA 1DK4A 2F8DA 4TQUQ 3QK6A 1MDQA 1LBWA 2V3UA 4O7IA 3B7DA 3LR1A 4O7MA 5H8HB 3Q29A 3K01A 2XXYA 1FTLA 3O29A 1MPDA 4MEVA 3TTNA 2GRVA 1Q35A 5HM4B 3GXAA 3Q27A 2OWTA 2QVUA 4TLMB 4FE8A 1FPGA 1J1NA 1YZ0A 2QVRA 2ZNUA 3JZJA 3IB2A 4QFKA 3PUWE 3VDFA 2IEEA 1S9TA 2O1LA 4R6YA 1KA1A 3KN3A 3MQ9A 1A7LA 4IY6A 3S9EA 1A54A 4I40A 4O3CA 1TXFA 3U92A 2P3NA 3IOWA 3OO8A 1S7YA 3MSTA 2OWSA 1D9QA 2NXOA 1FW0A 2DE4A 5EHMA 4DDDA 1MM7A 3PMXA 3T66A 1OMPA 1B7HA 2ZZVA 4YMBA 3MPKA 2V93A 4DXBA 4JVIA 4KYEA 1G0HA 3QSLA 2DWIA 4RJZA 3IJOB 2ONKE 3O28A 3MAMA 1HSEA 3TCGA 3H6UA 4O94A 4GIZA 4EXKA 2HHMA 5KCJA 2PBWA 5A5XA 1VFEA 4Q5TA 5JTYA 5CI5A 1DPEA 5IM2A 2UVIA 2THIA 5I59B 3S2VA 3LSWA 1VDWA 4R2BA 5ICQA 2ZYKA 4ELRA 3B6WA 2AL4A 4R74A 4KR5A 3ODBA 1USYH 1UTBA 2DXYA 2UXAA 2XXVA 2DYXA 1YCJA 3PUZE 3KG2A 3IOTA 4ZECA 2XD3A 5FTHA 1N3WA 1TFAA 4U2RA 4JWXA 1IITA 2RC8A 3PV0E 2KLFA 4AS5A 4QSEA 3O2AA 3OEMA 4KYDA 1R6ZA 1MDP1 4E0WA 3RT8A 2PCRA 4P8BA 1H76A 2XXRA 3DLNA 4MX6A 5CC2A 2F7BA 5AA2A 1DPPA 4G2ZA 4GRKA 5AE4A 3IOVA 2R6GE 3CRBA 5TP9A 2UVHA 3IAZA 1N7WA 2ALUA 1MM6A 2GH9A 3H6TA 1LBYA 3RPLA 4GWWA 4ESWA 5ISUA 3CHGA 3TMGA 3T9VA 4U4XA 2Q88A 3V8XB 3GLBA 4OVQA 3B8BA 5TPAB 3JYRA 5CBRA 4ELOA 1SD3A 4PFUA 5DVJA 3BBRA 2UVGA 4N17A 4R9FA 4GWSA 3S9LC 3U72A 1BTJA 5IZ3B 3FJ7A 1SI1A 3G3FA 4N15A 1LAFE 4OENA 5DEXA 2AIXA 4QF9A 2OK2A 3HHGA 2D21A 4MIJA 2Y5KA 5L9MA 4JWOA 2V4CA 1XT8A 3LUZA 3PD8A 3O6HA 3BFUA 3SKPA 4HXVA 4N6DA 1F9BA 3VFJA 4OETA 1IMAA 3PD9A 1IXGA 1US5A 2VD3A 1FRPA 1H44A 3QMFA 2NWJA 2Q2CA 3M8UA 1SW2A 4MBPA 4F18A 4OMBA 1FQCA 4QRZA 2AL5A 4KYSA 1LB9A 5I58A 2B4MA 1EZOA 2PYYA 2XWVA 4LVQA 5JK4A 3CIJA 4DXCA 1WDNA 4RXLA 4NWCA 2VGQA 4F3BA 4OVPA 2ZZXA 1MXZA 1FTMA 1WODA 1MY0A 4UABA 4H6DA 1URDA 3VXCA 3PMVA 1MY4A 5ITOA 3HO7A 4ELPA 1ZIUA 4N81A 3ZSFA 3C31A 3G3GA 2PT2A 4NF5A 3C9HA 4PF8A 3ROJA 1GTKA 2F36A 4XEQA 1LFGA 4YU0A 3IR1A 4P1LA 1FBFA 1JEVA 1R1NA 1UIUA 3C4MA 4LUBA 4POXA 2R9JA 3FVOA 3LBSA 3PPPA 2HPGA 3N94A 2Q8MA 2RF1A 1JW1A 2F34A 5DVFA 2I48A 3UP9A 4EQ7A 3FXBA 2OBGA 5FBPA 3C32A 4PFTA 4U23A 4NAPA 4P0IA 1M5BA 5B7DA 1MQHA 1IEJA 5I56B 4DCXA 1P99A 1Y9UA 2P2AA 3L6HA 1Z7ME 4NWDA 3S4UA 2YLNA 4PDHA 2V3QA 4OHNA 1TT1A 2HAUA 3C33A 3I3VA 1FTAA 4G8MA 2FVZA 5L9SA 4PGNA 1PDAA 4G77A 3DM0A 3UIFA 4NF8A 1NV3A 4Q8RA 1MXXA 3K1PA 5KDTB 1PB9A 1D9YA 3TYHA 3EHSA 5K2XA 2X26A 2XWOA 4LN5A 3TPAA 1LGBC 4PBHA 1EH3A 4EF1A 2RC7A 1I6QA 3LSXA 3FVGA 4MFIA 4ZE8A 3FV2A 4KI0E 4IO3A 3SEUA 1NMUA 5A5LA 4H5GA 4QSDA 1R9QA 1JQFA 3KC0A 4RK2A 4ZDMA 2NVUB 3Q26A 1NV0A 1NNKA 1CE2A 2PFZA 4OZ9A 4ZEFA 1Z7NE 1OIBA 1FBGA 4POWA 3VLVA 4BDRA 2F7CA 1AH5A 2O6AA 1B5IA 4H46A 1AOVA 2Y84A 1PBPA 1ANFA 3KGCA 5DVIA 4I1DA 3MZ1A 4MLQA 1I6BA 1B6HA 3M3KA 4P56A 2WBDA 1B2HA 1XC1A 1LSTA 2F6PA 1SW4A 3VV5A 4KFQA 3LC8A 2HZKA 4HW8A 4RPOA 1O63A 4ZEBA 3PTYA 3VE1B 3PPOA 5LDZA 1BP5A 4X9TA 3UN6A 4M1VA 2DS9A 1DTZA 2FIEA 2V25A 4QFLA 3SESA 4JVCA 4Z7EA 4XTCQ 2F35A 2XXIA 3R7XA 1FCKA 3T9HB 4ZZAA 4OFLA 4PP0A 2IA4A 5K2YA 4P11A 3G3KA 2ZYOA 1LAGE 2I0CA 1IXCA 2QRYA 1RKMA 2Y7RA 3L6GA 2I3WA 2UYEA 2XXQA 1XVXA 2DWAA 5L9OA 2BJIA 1HSLA 2Y7KA 3KFMA 3H6WA 1QUIA 3UORA 4F31B 2H98A 3CVGA 4LATA 1RYXA 2KQZA 1B5JA 3TDJA 5A5XB 2HXWA 2FNCA 4XKQA 3KN8A 5JTYB 4F29A 3H03A 4GL8A 2PVUA 4PC9A 4GVOA 1FTKA 2FBPA 1B7UA 3RN8A 1YPNA 2QJEA 2FYIA 2HQ0A 3T1BA 3TZAA 1JEUA 1UTBB 4LP2B 3HV1A 1JVYA 3U8QA 1B7ZA 4U4SA 4P9KA 3ECRA 1GV8A 1FBPA 1N84A 4Z0IA 3D4CA 1MS7A 3UA8A 1MXVA 3VLUA 2ONRA 1AIVA 2O68A 1FPJA 3G3JA 3PPNA 1H45A 1USYE 3TTLA 5I7IA 1PB7A 2F6GA 5AA2B 3LSLA 2O84X 4F2OA 1IMFA 3OSQA 2QFLA 3ILUB 5TP9B 3EKIA 3OOAA 1LCTA 2F78A 4FEDA 3RPLB 1FBCA 4JB7A 5LTCA 4ZEIA 4XKRA 3W15C 2ZMBA 3TCHA 2RC9A 2P1SA 1AMFA 4AB5A 1M5DA 4YB5A 4YAHX 4KCDA 4IB2A 1B4ZA 3MP8A 2ZYMA 3TKDA 4IGRA 1A99A 3O6GA 2JJKA 5DEXB 3MYUA 4PAIA 4LZ5A 1SBPA 1SPIA 3E9XA 2QS2A 1D9VA 3KOTA 2FHYA 2ONSA 4PETA 3W9WA 1NKXA 3B6QA 2W7YA 5M2VA 2QS3A 3SEYA 5BUUA 2VHAA 1CB6A 3KBZA 2Y7WA 1OVBA 3H6VA 2QS4A 2ZZWA 1LAHE 3THIA 3RY3A 1B1XA 1NV7A 5ET8A 2F3DA 3G7WA 5I58B 1FSAA 2L5VA 1B40A 2BJJX 2VPOA 2B3BA 3K1MA 1QJMA 1RYOA 4HTGA 3IO6A 3U65A 2OLBA 3ZS6A 2UYFA 2ESNA 1ZJLA 4EXLA 4PFIA 3MBPA 2XXUA 1N7XA 1A55A 4PDDA 4ONYA 3WAFA 1KWHA 3RTFB 2PMSA 2WKYA 4RNSA 3I6VA 2V3TA 1B58A 2ANJA 4YZZA 4P3LA 4N6PA 2DE2A 5CM6A 3T22A 3EN3A 2MKZA 4O3BA 1I69A 2HFBA 3CFLA 4NF5B 4NTLA 2YJPA 4YB6A 2OCUA 4F3PA 2DWHA 1DMBA 2KR0A 1ZLQA 1LFHA 4YKPA 4C0RA 3U94A 3C35A 5ELVA 4DIGA 1NFTA 3FJMA 3E79A 1XOCA 1QUJA 4GX6A 1FPDA 2Q2AA 4BLAA 3W9VA 2VOZA 3GZGA 3RTWB 5H8FA 3K02A 2OJTA 2XXTA 1OLCA 3RLFE 4I3EA 5FTIA 3HN0A 4ND9A 4R6HA 1H43A 4JSOA 4PTKA 1B46A 3T9XB 1PEBA 1AWBA 4NF8B 3FJGA 3H4ZA 4LONB 1NH8A 4H0WA 4X04A 4YICA 3OO6A 4OEUA 1POY1 1Q9DA 1XHYA 2Q74A 4NF6A 4FIMA 3TELA 4PFWA 4RY1A 1PC3A 2ABHA 3U93A 3K2DA 4GX4A 4F1YA 2O1MA 1LAXA 5FHNA 2DOJA 3P7IA 5I57A 1G0IA 4N8GA 1CNQA 4MNIA 5DTBA 1XVYA 5CBSA 5EQ7A 2ZXTA 4WEDA 4N6KA 4QFOA 1NNPA 2PFYA 1Y1MA 4G8NA 3KJ7A 4F22A 3B6TA 2Q8JA 1ZKBA 4ELQA 5ET5A 1PBQA 4YB7A 3CG3A 1JVXA 3RPWA 3SETA 4PFRA 1D3KA 4LA9A 2QSXA 4GOTA 4OVJA 2CMOA 2LAOA 3QIMA 3QXMA 1B3LA 1S50A 1A40A 2X7PA 2WBBA 2VP1A 5I2KA 1K9YA 2VD2A 3PPQA 1FPEA 4F3GA 4OTEA 3FIRA 4PE3A 1NL5A 4X48A 4P47A 4ISUA 4U21A 4H45A 3NOHA 2F97A 4K3FA 1ZBMA 1MH4A 1MXWA 3CSBA 4WEPA 3LUYA 1DBZA 2R71A 3GYYA 1B51A 2DVZA 3MPLA 3HCQA 4QXDA 1NV5A 1EZPA 1MG1A 2NUVA 4G4PA 4MHFA 3PUYE 1FTJA 3QUFA 1EZ9A 2GHBA 2VT5A 2XXWA 1ELJA 3VVEA 1Y4CA 2CEXA 4KHZE 3PUVE 5EHSA 4IGTA 4GL0A 1K9ZA 1MY1A 3R26A 1OLAA 4WKMA 3T96B 4JVDA 1NV1A 1NUZA 3IO4A 1JW4A 3K6UA 3MVYA 1PB8A 2A5SA 1VR5A 4DXUA 3RUMA 1SI0A 2CZIA 1NNTA 4MCOA 4DI4B 4E0XA 4GLIA 1FJ6A 3CG1A 3MUQA 4R75A 3QAXA 4F2QA 1ZMGA 1DSNA 3IB1A 1M5EA 2CEYA 2Y5LA 3H7MA 3HPIA 3MVWA 4HE2A 5J1DA 4G8HA 1JP4A 1ZU0A 3MP6A 5AA4A 4HS7A 3QUJA 3CFXA 2G29A 2ZYNA 5I2NA 2F5XA 1II5A 3MVXA 3TEPA 4IO7A 1NI9A 4EUOA 3VLWA 1URSA 3USDA 4PBQA 1B0HA 3IK6B 4EQBA 5EYGA 1QGXA 3BKIB 4G68A 4MNCA 3RQTA 5CRYA 3KSJA 4AB6A 4EF2A 4OVTA 1KA0A 2Z22A 5I84A 3TQWA 5ET7A 1FQDA 1INPA 1Q1KA 4MF3A 2CZHA 4M4GA 4LZ8A 3LSFB 2H9BA 4MJOA 4ZEKA 3SZPA 4C1UA 1LBXA 4PCDA 2GQ1A 3IORA 5EQ8A 4GWYA 4IY5A 2DQVA 5CMMA 2RINA 1Y3QA 4C1TA 4GD5A 2E0SA 3TTRA 5H8SA 3MW0A 1YTVA 1IQ7A 1KZ8A 4OA4A 1Y3NA 3OEKA 5JEIA 3C34A 3FATA 4FATA 3E13X 2AYSA 4AS4A 1R9LA 1NNFA 3K6WA 5ICTA 2HAVA 4BDOA 3UGWA 1B3HA 2H99A 2I3VA 4IR8A 2WYPA 3DELB 2E1SA 4F3SA 4NEDA 1Y20A 3OO7A 1H3DA 2D3IA 3CFZA 1B0LA 1RDXA 5IZZA 4P1EA 2A5TA 4JDFA 3SEVA 3CR9A 5H8QA 2VPNA 1B3GA 3HFUA 3TTMA 1O64A 4BDMA 5FHMA 4IO2A 3VXBA 1M5CA 4F19A 2WX9A 4GXAA 3VVFA 1BLFA 4JXIA 2HCAA 3EQ1A 1TWYA 4FORA 1IMDA 5EQ9A 4HCYA 3N6UA 2I49A 5B70A 4P0GA 3PGFA 5EYFA 3RT6B 1Y4TA 4R72A 4X8RA 3EHUA 3MP1A 3S9NC 3RYDA 1MQGA 1RDYA 1NUWA 5DT6A 1XS5A 4NQ8A 4KD5A 2D5WA 4O3AA 4X1DA 3QYTA 1SW5A 4R2FA 3TFLA 2Z23A 4NN3A 3V83A 1FTOA 4BDLA 1POTA 1RDZA 1MPCA 3MZ9A 4NF4A 1SYHA 4GWUA 3PMWA 4R6KA 4I9DA 2ZNSA 3UK4A 3N26A 1UTHA 4FECA 2PT1A 4THIA 1SYIA 3GBAA 4I8CA 1B1HA 1QKAA 3CSGA 4PE5B 3IJXB 4IO4A 3PUXE 4QHQA 3MZBA 4IO6A 3U1OA 2P3VA 3FXQA 4OFJA 3T0JA 2O51A 3O97A 3VVDA 5H8FB 5AA3A 1LBBA 5H8NA 4ZEDA 2M8CA 2HXRA 5F7VA 4NMYA 1FQFA 3RNNA 4X1BA 2DWJA 2ZNTA 3KSXA 3DP6A 3FD3A 1FPFA 3E78A 1JNFA 4N13A 5J16A 1LB8A 1MQDA 3MC2A 4R9GA 3N6TA 2XXPA 3A3CA 2UVJA 4GWZA 1IZ1A 3B50A 4PF6A 4U1ZA 4XFEA 3KEIA 1SQYA 4H67A 2HEUA 5I5PA 3K0VA 2P0SA 5AA1A 1TFDA 4UA8A 4NF6B 3SEWA 3FV1A 1B9JA 1LBZA 3Q25A 3D4GA 2G93A 1B3FA 4Q0CA 4ZE9A 4ECFA 1NH7A 2QL3A 3RGYA 1FPBA 5I57B 2Q89A 4O8MA 3T93B 1NUXA 1HSJA 4F1VA 5T3JA 2B3FA 2XX8A 2XWIA 2Q9TA 4KXPA 1EU8A 4PFBA 4TOZA 1IXHA 2H25A 3I5OA 4GWXA 2V84A 1N0TA 1N04A 4NG7A 5EYHA 4DLDA 1WVJA 3DP8A 3G3HA 5H8HA 2OZZA 4H8JA 2GFEA 4OQOA 5I2KB 3S9MC 4RYAA 1FBDA 3V89B 2DSFA 1N76A 3DP4A 3E4RA 1GVCA 1B05A 2I0BA 1MQIA 3O6IA 1N3XA 1NUYA 1VSOA 2QMWA 4N8YA 4OERA 4F1UA 1VFDA 3K6XA 3M3FA 3BIGA 1P1UA 4PAFA 2XX7A 3OELA 4RK9A 4MAGA 3TCFA 1DOTA 4H8IA 4N07A 4NGUA 4NX1A 2QMXA 2I4CA 1MY3A 4LQ2A 1LEVA 3KBRA 3WAEA 1ZTYA 5CMBA 3BIHA 3TTKA 1MPBA 4LZ7A 4IO5A 5L8DA 2XWKA 3TODA
chains in the Genus database with same CATH topology
4JVDA 1G0HA 2BJIA 1NV1A 2OX3A 1NUZA 4O94A 4FBPA 2HHMA 2KQZA 2CZIA 4MCOA 4DI4B 5IM2A 1FJ6A 4PGPA 1DCUA 4PC9A 1VDWA 2CEYA 2Y5LA 2FBPA 2CZKA 4N91A 4HE2A 5J1DA 3T1BA 1JP4A 5F24A 2B4LA 4P9KA 2F5XA 2QPQA 1FBPA 1NI9A 3LV0A 1NV2A 4PBQA 5EYGA 4AS5A 1QGXA 1FPJA 1EYJA 1YXIA 4MNCA 2F3BA 5IZ1A 4GBVA 2XXKA 4OVTA 1KA0A 2PCRA 1NV4A 4P8BA 4MX6A 5I7IA 5ET7A 2DE3A 1INPA 1IMFA 2QFLA 4GBWA 4NF0A 3EKIA 2CZHA 1FBEA 1LBYA 3RPLA 4GWWA 4MJOA 3SZPA 3RPLB 3CHGA 1FBCA 1LBXA 4PCDA 5LTCA 2GQ1A 4OVQA 5EQ8A 4GWYA 3B8BA 1FPLA 1NV6A 4N17A 1FJ9A 1KZ8A 4OA4A 4GWSA 3FBPA 1YYZA 5IZ3A 5IZ3B 4N15A 2JJKA 3MYUA 4AS4A 3IFCA 4MIJA 4PAIA 1SPIA 2Y5KA 2V4CA 3LUZA 2FHYA 4HE0A 4PETA 1XI6A 3W9WA 4HXVA 4N6DA 1IMAA 4OVSA 4IR8A 2WYPA 1FRPA 3KBZA 3QMFA 1RDXA 5IZZA 5EQAA 4P1EA 4XF5A 2ZZWA 4F18A 3IFAA 1NV7A 2VPNA 3HFUA 5ET8A 1EYKA 4N4UA 2F3DA 2QVVA 2B4MA 4F19A 2WX9A 1IMBA 2R8TA 1FSAA 2XWVA 2DDKA 2L5VA 2VPOA 5I3SA 1IMDA 3U65A 5EQ9A 5JK4A 4HCYA 2WYKA 4OVRA 3ISPA 4PFIA 2FIXA 4OVPA 2ZZXA 5IGAA 4PDDA 4UABA 4X8RA 1FPKA 5ET6A 3RYDA 4YZZA 1RDYA 4P3LA 1NUWA 2DE2A 4NQ8A 4N81A 5CM6A 4DI3D 4MNPA 2MKZA 4OANA 4PF8A 3ROJA 4XEQA 4NN3A 4P1LA 1RDZA 1BK4A 1FBFA 5DW8A 2OWZA 2KR0A 4GWUA 1EYIA 1IMCA 3E79A 2HPGA 2Q8MA 2HZLA 4GX6A 3FXBA 1FPDA 4PAKA 5FBPA 4NAPA 2P3VA 3W9VA 3T0JA 4QBAA 4I3YA 4GX3A 2HXRA 4PDHA 4I3EA 2V3QA 1FTAA 2FVZA 1FBHA 4PGNA 4PTKA 1NV3A 1IMEA 1AWBA 1FPFA 3E78A 5J16A 4HCWA 4GWZA 4X04A 2XWOA 4YICA 4LN5A 3B50A 4PBHA 4PF6A 2XA5A 4XFEA 3KC1A 4MMPA 1Q9DA 5I5PA 2Q74A 1LBZA 2WEFA 5ESYA 5A5LA 4GX4A 1FPBA 1FPIA 3KC0A 1G0IA 4N8GA 1CNQA 4MNIA 4O8MA 1NUXA 1NV0A 4F1VA 5T3JA 2PFZA 5EQ7A 4G61A 2XWIA 2Q9TA 4KXPA 4N6KA 4HE1A 1FBGA 4PFBA 2PFYA 1LBVA 3D1RA 5ET5A 3A29A 4GWXA 4NHBA 4H46A 1DK4A 1LBWA 4PFRA 4NG7A 5EYHA 4O7IA 4O7MA 2WBBA 4P56A 2WBDA 1K9YA 1FBDA 4MEVA 1FPEA 2HZKA 4PE3A 3PTYA 4P47A 2QVUA 5LDZA 1FPGA 1NUYA 4X9TA 4H45A 3NOHA 4N8YA 4M1VA 4F1UA 1YZ0A 2QVRA 2FIEA 3BIGA 4PAFA 1DBZA 3GYYA 4JVCA 1KA1A 2DVZA 4MAGA 4QXDA 1NV5A 4I40A 4NGUA 2P3NA 4MHFA 4NX1A 3MSTA 2VT5A 1D9QA 2DE4A 2CEXA 1LEVA 3BIHA 2ZZVA 1K9ZA 4JVIA 2XWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N17 A;  2XWI A;  4PF8 A;  4N6K A;  4OA4 A;  4XEQ A;  4NN3 A;  4PFB A;  2PFY A;  4O94 A;  4P1L A;  4N15 A;  4MCO A;  4DI4 B;  4NHB A;  4MIJ A;  4PAI A;  5IM2 A;  4PGP A;  4PFR A;  2HPG A;  2V4C A;  4PC9 A;  4NG7 A;  2HZL A;  2CEY A;  4PET A;  3FXB A;  4PAK A;  4N91 A;  4O7M A;  4N6D A;  4NAP A;  4P56 A;  4OVS A;  2WYP A;  4MEV A;  2HZK A;  4P9K A;  4PE3 A;  4PDH A;  4P47 A;  5IZZ A;  4P1E A;  4XF5 A;  2ZZW A;  4N8Y A;  2VPN A;  4PGN A;  4PBQ A;  4N4U A;  4PAF A;  2WX9 A;  4MNC A;  2XWV A;  3GYY A;  2VPO A;  4X04 A;  4MAG A;  2XWO A;  4YIC A;  3U65 A;  2XXK A;  3B50 A;  4LN5 A;  4OVT A;  4P8B A;  2WYK A;  4NGU A;  4PBH A;  4PF6 A;  2XA5 A;  4XFE A;  4MHF A;  4MMP A;  4MX6 A;  4NX1 A;  4OVR A;  5I7I A;  4PFI A;  5I5P A;  4NF0 A;  4OVP A;  2ZZX A;  5IGA A;  4PDD A;  2CEX A;  4UAB A;  4X8R A;  4PCD A;  5LTC A;  4OVQ A;  4YZZ A;  4P3L A;  2ZZV A;  4NQ8 A;  4N8G A;  5CM6 A;  4DI3 D;  4MNP A;  4MNI A;  4O8M A;  4OAN A;  2XWK A;  2PFZ A; 
#chains in the Genus database with same CATH topology
 3O66 A;  3PU5 A;  2QS1 A;  1MY2 A;  2OX3 A;  2I4B A;  4XIG Q;  1QUK A;  1FQB A;  1B4H A;  4FBP A;  4DE8 A;  1M5F A;  3TQL A;  3OO9 A;  4PGP A;  3KOS A;  1DCU A;  5I59 A;  1L5T A;  4WXJ A;  2B65 A;  3FXU A;  4QFN A;  1UQW A;  2CZK A;  4N91 A;  5F24 A;  5HBC A;  2B4L A;  3ZKL A;  3SEX A;  3IB0 A;  4RA1 A;  2FA7 A;  2XXX A;  5AA4 B;  5CMK A;  2XX9 A;  3V5A A;  5I2N B;  2QPQ A;  1B3E A;  1IIW A;  4Q30 B;  4YKI A;  3LV0 A;  1NV2 A;  2RKM A;  4OWD A;  3FVN A;  3OSR A;  4GF8 A;  3E3K A;  4FAJ A;  1EYJ A;  1YXI A;  2O69 A;  4G68 B;  2F3B A;  4OFO A;  3BFT A;  5IZ1 A;  3OD7 A;  3OXN A;  4GBV A;  3Q28 A;  2XXK A;  1Y1Z A;  1OQH A;  1NV4 A;  5CMC A;  1FQA A;  1ATG A;  2DE3 A;  4NF0 A;  4GBW A;  3T9U A;  1FBE A;  2REJ A;  2CZL A;  1MH3 A;  4U22 A;  1US4 A;  5TPA A;  2RCA A;  4G68 C;  1FPL A;  1B5H A;  2Y7I A;  5KZT A;  1LCF A;  1T0K A;  1NV6 A;  4EQ9 A;  1FJ9 A;  5TU0 A;  3C36 A;  4KPT A;  1QUL A;  3FBP A;  1OVT A;  1YYZ A;  1SDX A;  5IZ3 A;  3K6V A;  1MXU A;  2DXR A;  4MH5 A;  3IFC A;  4GXS B;  5IKB A;  3OEN A;  2X7Q A;  4H1X A;  3N5L A;  4XKN A;  3FXR A;  4HE0 A;  1XI6 A;  4OES A;  1DTG A;  4JBZ A;  5F1Q A;  4H5F A;  1I6A A;  3IL1 B;  1P1O A;  3H06 B;  4OVS A;  3F11 A;  2O7U A;  1JET A;  3EHT A;  2H4I A;  2DP8 A;  5EQA A;  4XF5 A;  2A5T B;  3IFA A;  4GWO A;  1MQJ A;  4F39 A;  2Y7P A;  3AXF A;  4ZZE A;  5H8Q B;  2F7A A;  4PFY A;  1EYK A;  4N4U A;  3OMB A;  2QVV A;  2XXH A;  5DYH A;  1O7T A;  1IMB A;  3FAS A;  4QFP A;  2R8T A;  2DDK A;  1IUD A;  3G3I A;  1GR2 A;  5I3S A;  2I6E A;  4PQJ A;  3K1N A;  4FEB A;  2XHD A;  2WYK A;  2DVC A;  4U1O A;  4OVR A;  4OYV A;  5IAI A;  3ISP A;  1YAE A;  1UIV A;  2FIX A;  4JWY A;  4R73 A;  3FGS A;  2I58 A;  1MRP A;  2RCB A;  3A3U A;  3ONM A;  3KJT A;  5IGA A;  4LQ5 A;  4YKJ A;  1QKB A;  3K4U A;  1FPK A;  5ET6 A;  2O7I A;  4BDQ A;  2H5Y A;  3GBB A;  4XXU A;  4DI3 D;  4AQ4 A;  1P1W A;  3HST A;  4MNP A;  4OAN A;  4GFR A;  3JV9 A;  2YPN A;  4MLV A;  4NE4 A;  4QSC A;  1BK4 A;  5DW8 A;  2OWZ A;  1QVS A;  4NF4 B;  3SER A;  3ZKK A;  1UTH B;  3CI8 A;  1EYI A;  5AA2 D;  1IMC A;  4H65 A;  4YKK A;  2GHA A;  2HZL A;  4L17 A;  1JW5 A;  1P1N A;  4PAK A;  2Z8D A;  3MJN A;  1A8E A;  3FZV A;  1P1Q A;  5LOM A;  4TLL B;  1MXY A;  3PPR A;  4DCY A;  4QBA A;  5I56 A;  3H3G A;  4KQP A;  4I3Y A;  4GX3 A;  3ILT B;  3TAJ A;  5HPQ A;  1VE4 A;  5H8N B;  4RPN A;  1LBC A;  1SW1 A;  4GQO A;  5ITP A;  3TUS A;  3O9P A;  1SVX B;  1B32 A;  1BKA A;  3IOU A;  1FBH A;  1B52 A;  3KZG A;  2REG A;  1Y3P A;  2Z8E A;  5FHO A;  3HHF A;  3A09 A;  2NOO A;  3MWB A;  5KDT A;  1IME A;  4KCC A;  1AL3 A;  1LFI A;  4JSD A;  2Z8F A;  4HCW A;  1FQE A;  4OXV A;  4ESX A;  3K00 A;  3FUZ A;  1A8F A;  1QW0 A;  1URG A;  3FVK A;  2PX1 A;  1GGG A;  4DZ1 A;  2XA5 A;  3KC1 A;  4MMP A;  3KN7 A;  1IXI A;  3R6U A;  4OEV A;  3EF7 A;  1D4N A;  2XD2 A;  2WEF A;  5ESY A;  1BIY A;  5KCJ B;  4XKP A;  1FPI A;  4I62 A;  1OQG A;  1LLS A;  4G61 A;  3IX1 A;  4UAC A;  4ZS9 A;  4HE1 A;  4YMA A;  1LBV A;  4EDP A;  3D1R A;  4BDN A;  4FJP A;  5BWJ A;  3A29 A;  3SDF A;  4NHB A;  3EPE A;  3MVZ A;  3M3L A;  1DK4 A;  2F8D A;  4TQU Q;  3QK6 A;  1MDQ A;  1LBW A;  2V3U A;  4O7I A;  3B7D A;  3LR1 A;  4O7M A;  5H8H B;  3Q29 A;  3K01 A;  2XXY A;  1FTL A;  3O29 A;  1MPD A;  4MEV A;  3TTN A;  2GRV A;  1Q35 A;  5HM4 B;  3GXA A;  3Q27 A;  2OWT A;  2QVU A;  4TLM B;  4FE8 A;  1FPG A;  1J1N A;  1YZ0 A;  2QVR A;  2ZNU A;  3JZJ A;  3IB2 A;  4QFK A;  3PUW E;  3VDF A;  2IEE A;  1S9T A;  2O1L A;  4R6Y A;  1KA1 A;  3KN3 A;  3MQ9 A;  1A7L A;  4IY6 A;  3S9E A;  1A54 A;  4I40 A;  4O3C A;  1TXF A;  3U92 A;  2P3N A;  3IOW A;  3OO8 A;  1S7Y A;  3MST A;  2OWS A;  1D9Q A;  2NXO A;  1FW0 A;  2DE4 A;  5EHM A;  4DDD A;  1MM7 A;  3PMX A;  3T66 A;  1OMP A;  1B7H A;  2ZZV A;  4YMB A;  3MPK A;  2V93 A;  4DXB A;  4JVI A;  4KYE A;  1G0H A;  3QSL A;  2DWI A;  4RJZ A;  3IJO B;  2ONK E;  3O28 A;  3MAM A;  1HSE A;  3TCG A;  3H6U A;  4O94 A;  4GIZ A;  4EXK A;  2HHM A;  5KCJ A;  2PBW A;  5A5X A;  1VFE A;  4Q5T A;  5JTY A;  5CI5 A;  1DPE A;  5IM2 A;  2UVI A;  2THI A;  5I59 B;  3S2V A;  3LSW A;  1VDW A;  4R2B A;  5ICQ A;  2ZYK A;  4ELR A;  3B6W A;  2AL4 A;  4R74 A;  4KR5 A;  3ODB A;  1USY H;  1UTB A;  2DXY A;  2UXA A;  2XXV A;  2DYX A;  1YCJ A;  3PUZ E;  3KG2 A;  3IOT A;  4ZEC A;  2XD3 A;  5FTH A;  1N3W A;  1TFA A;  4U2R A;  4JWX A;  1IIT A;  2RC8 A;  3PV0 E;  2KLF A;  4AS5 A;  4QSE A;  3O2A A;  3OEM A;  4KYD A;  1R6Z A;  1MDP 1;  4E0W A;  3RT8 A;  2PCR A;  4P8B A;  1H76 A;  2XXR A;  3DLN A;  4MX6 A;  5CC2 A;  2F7B A;  5AA2 A;  1DPP A;  4G2Z A;  4GRK A;  5AE4 A;  3IOV A;  2R6G E;  3CRB A;  5TP9 A;  2UVH A;  3IAZ A;  1N7W A;  2ALU A;  1MM6 A;  2GH9 A;  3H6T A;  1LBY A;  3RPL A;  4GWW A;  4ESW A;  5ISU A;  3CHG A;  3TMG A;  3T9V A;  4U4X A;  2Q88 A;  3V8X B;  3GLB A;  4OVQ A;  3B8B A;  5TPA B;  3JYR A;  5CBR A;  4ELO A;  1SD3 A;  4PFU A;  5DVJ A;  3BBR A;  2UVG A;  4N17 A;  4R9F A;  4GWS A;  3S9L C;  3U72 A;  1BTJ A;  5IZ3 B;  3FJ7 A;  1SI1 A;  3G3F A;  4N15 A;  1LAF E;  4OEN A;  5DEX A;  2AIX A;  4QF9 A;  2OK2 A;  3HHG A;  2D21 A;  4MIJ A;  2Y5K A;  5L9M A;  4JWO A;  2V4C A;  1XT8 A;  3LUZ A;  3PD8 A;  3O6H A;  3BFU A;  3SKP A;  4HXV A;  4N6D A;  1F9B A;  3VFJ A;  4OET A;  1IMA A;  3PD9 A;  1IXG A;  1US5 A;  2VD3 A;  1FRP A;  1H44 A;  3QMF A;  2NWJ A;  2Q2C A;  3M8U A;  1SW2 A;  4MBP A;  4F18 A;  4OMB A;  1FQC A;  4QRZ A;  2AL5 A;  4KYS A;  1LB9 A;  5I58 A;  2B4M A;  1EZO A;  2PYY A;  2XWV A;  4LVQ A;  5JK4 A;  3CIJ A;  4DXC A;  1WDN A;  4RXL A;  4NWC A;  2VGQ A;  4F3B A;  4OVP A;  2ZZX A;  1MXZ A;  1FTM A;  1WOD A;  1MY0 A;  4UAB A;  4H6D A;  1URD A;  3VXC A;  3PMV A;  1MY4 A;  5ITO A;  3HO7 A;  4ELP A;  1ZIU A;  4N81 A;  3ZSF A;  3C31 A;  3G3G A;  2PT2 A;  4NF5 A;  3C9H A;  4PF8 A;  3ROJ A;  1GTK A;  2F36 A;  4XEQ A;  1LFG A;  4YU0 A;  3IR1 A;  4P1L A;  1FBF A;  1JEV A;  1R1N A;  1UIU A;  3C4M A;  4LUB A;  4POX A;  2R9J A;  3FVO A;  3LBS A;  3PPP A;  2HPG A;  3N94 A;  2Q8M A;  2RF1 A;  1JW1 A;  2F34 A;  5DVF A;  2I48 A;  3UP9 A;  4EQ7 A;  3FXB A;  2OBG A;  5FBP A;  3C32 A;  4PFT A;  4U23 A;  4NAP A;  4P0I A;  1M5B A;  5B7D A;  1MQH A;  1IEJ A;  5I56 B;  4DCX A;  1P99 A;  1Y9U A;  2P2A A;  3L6H A;  1Z7M E;  4NWD A;  3S4U A;  2YLN A;  4PDH A;  2V3Q A;  4OHN A;  1TT1 A;  2HAU A;  3C33 A;  3I3V A;  1FTA A;  4G8M A;  2FVZ A;  5L9S A;  4PGN A;  1PDA A;  4G77 A;  3DM0 A;  3UIF A;  4NF8 A;  1NV3 A;  4Q8R A;  1MXX A;  3K1P A;  5KDT B;  1PB9 A;  1D9Y A;  3TYH A;  3EHS A;  5K2X A;  2X26 A;  2XWO A;  4LN5 A;  3TPA A;  1LGB C;  4PBH A;  1EH3 A;  4EF1 A;  2RC7 A;  1I6Q A;  3LSX A;  3FVG A;  4MFI A;  4ZE8 A;  3FV2 A;  4KI0 E;  4IO3 A;  3SEU A;  1NMU A;  5A5L A;  4H5G A;  4QSD A;  1R9Q A;  1JQF A;  3KC0 A;  4RK2 A;  4ZDM A;  2NVU B;  3Q26 A;  1NV0 A;  1NNK A;  1CE2 A;  2PFZ A;  4OZ9 A;  4ZEF A;  1Z7N E;  1OIB A;  1FBG A;  4POW A;  3VLV A;  4BDR A;  2F7C A;  1AH5 A;  2O6A A;  1B5I A;  4H46 A;  1AOV A;  2Y84 A;  1PBP A;  1ANF A;  3KGC A;  5DVI A;  4I1D A;  3MZ1 A;  4MLQ A;  1I6B A;  1B6H A;  3M3K A;  4P56 A;  2WBD A;  1B2H A;  1XC1 A;  1LST A;  2F6P A;  1SW4 A;  3VV5 A;  4KFQ A;  3LC8 A;  2HZK A;  4HW8 A;  4RPO A;  1O63 A;  4ZEB A;  3PTY A;  3VE1 B;  3PPO A;  5LDZ A;  1BP5 A;  4X9T A;  3UN6 A;  4M1V A;  2DS9 A;  1DTZ A;  2FIE A;  2V25 A;  4QFL A;  3SES A;  4JVC A;  4Z7E A;  4XTC Q;  2F35 A;  2XXI A;  3R7X A;  1FCK A;  3T9H B;  4ZZA A;  4OFL A;  4PP0 A;  2IA4 A;  5K2Y A;  4P11 A;  3G3K A;  2ZYO A;  1LAG E;  2I0C A;  1IXC A;  2QRY A;  1RKM A;  2Y7R A;  3L6G A;  2I3W A;  2UYE A;  2XXQ A;  1XVX A;  2DWA A;  5L9O A;  2BJI A;  1HSL A;  2Y7K A;  3KFM A;  3H6W A;  1QUI A;  3UOR A;  4F31 B;  2H98 A;  3CVG A;  4LAT A;  1RYX A;  2KQZ A;  1B5J A;  3TDJ A;  5A5X B;  2HXW A;  2FNC A;  4XKQ A;  3KN8 A;  5JTY B;  4F29 A;  3H03 A;  4GL8 A;  2PVU A;  4PC9 A;  4GVO A;  1FTK A;  2FBP A;  1B7U A;  3RN8 A;  1YPN A;  2QJE A;  2FYI A;  2HQ0 A;  3T1B A;  3TZA A;  1JEU A;  1UTB B;  4LP2 B;  3HV1 A;  1JVY A;  3U8Q A;  1B7Z A;  4U4S A;  4P9K A;  3ECR A;  1GV8 A;  1FBP A;  1N84 A;  4Z0I A;  3D4C A;  1MS7 A;  3UA8 A;  1MXV A;  3VLU A;  2ONR A;  1AIV A;  2O68 A;  1FPJ A;  3G3J A;  3PPN A;  1H45 A;  1USY E;  3TTL A;  5I7I A;  1PB7 A;  2F6G A;  5AA2 B;  3LSL A;  2O84 X;  4F2O A;  1IMF A;  3OSQ A;  2QFL A;  3ILU B;  5TP9 B;  3EKI A;  3OOA A;  1LCT A;  2F78 A;  4FED A;  3RPL B;  1FBC A;  4JB7 A;  5LTC A;  4ZEI A;  4XKR A;  3W15 C;  2ZMB A;  3TCH A;  2RC9 A;  2P1S A;  1AMF A;  4AB5 A;  1M5D A;  4YB5 A;  4YAH X;  4KCD A;  4IB2 A;  1B4Z A;  3MP8 A;  2ZYM A;  3TKD A;  4IGR A;  1A99 A;  3O6G A;  2JJK A;  5DEX B;  3MYU A;  4PAI A;  4LZ5 A;  1SBP A;  1SPI A;  3E9X A;  2QS2 A;  1D9V A;  3KOT A;  2FHY A;  2ONS A;  4PET A;  3W9W A;  1NKX A;  3B6Q A;  2W7Y A;  5M2V A;  2QS3 A;  3SEY A;  5BUU A;  2VHA A;  1CB6 A;  3KBZ A;  2Y7W A;  1OVB A;  3H6V A;  2QS4 A;  2ZZW A;  1LAH E;  3THI A;  3RY3 A;  1B1X A;  1NV7 A;  5ET8 A;  2F3D A;  3G7W A;  5I58 B;  1FSA A;  2L5V A;  1B40 A;  2BJJ X;  2VPO A;  2B3B A;  3K1M A;  1QJM A;  1RYO A;  4HTG A;  3IO6 A;  3U65 A;  2OLB A;  3ZS6 A;  2UYF A;  2ESN A;  1ZJL A;  4EXL A;  4PFI A;  3MBP A;  2XXU A;  1N7X A;  1A55 A;  4PDD A;  4ONY A;  3WAF A;  1KWH A;  3RTF B;  2PMS A;  2WKY A;  4RNS A;  3I6V A;  2V3T A;  1B58 A;  2ANJ A;  4YZZ A;  4P3L A;  4N6P A;  2DE2 A;  5CM6 A;  3T22 A;  3EN3 A;  2MKZ A;  4O3B A;  1I69 A;  2HFB A;  3CFL A;  4NF5 B;  4NTL A;  2YJP A;  4YB6 A;  2OCU A;  4F3P A;  2DWH A;  1DMB A;  2KR0 A;  1ZLQ A;  1LFH A;  4YKP A;  4C0R A;  3U94 A;  3C35 A;  5ELV A;  4DIG A;  1NFT A;  3FJM A;  3E79 A;  1XOC A;  1QUJ A;  4GX6 A;  1FPD A;  2Q2A A;  4BLA A;  3W9V A;  2VOZ A;  3GZG A;  3RTW B;  5H8F A;  3K02 A;  2OJT A;  2XXT A;  1OLC A;  3RLF E;  4I3E A;  5FTI A;  3HN0 A;  4ND9 A;  4R6H A;  1H43 A;  4JSO A;  4PTK A;  1B46 A;  3T9X B;  1PEB A;  1AWB A;  4NF8 B;  3FJG A;  3H4Z A;  4LON B;  1NH8 A;  4H0W A;  4X04 A;  4YIC A;  3OO6 A;  4OEU A;  1POY 1;  1Q9D A;  1XHY A;  2Q74 A;  4NF6 A;  4FIM A;  3TEL A;  4PFW A;  4RY1 A;  1PC3 A;  2ABH A;  3U93 A;  3K2D A;  4GX4 A;  4F1Y A;  2O1M A;  1LAX A;  5FHN A;  2DOJ A;  3P7I A;  5I57 A;  1G0I A;  4N8G A;  1CNQ A;  4MNI A;  5DTB A;  1XVY A;  5CBS A;  5EQ7 A;  2ZXT A;  4WED A;  4N6K A;  4QFO A;  1NNP A;  2PFY A;  1Y1M A;  4G8N A;  3KJ7 A;  4F22 A;  3B6T A;  2Q8J A;  1ZKB A;  4ELQ A;  5ET5 A;  1PBQ A;  4YB7 A;  3CG3 A;  1JVX A;  3RPW A;  3SET A;  4PFR A;  1D3K A;  4LA9 A;  2QSX A;  4GOT A;  4OVJ A;  2CMO A;  2LAO A;  3QIM A;  3QXM A;  1B3L A;  1S50 A;  1A40 A;  2X7P A;  2WBB A;  2VP1 A;  5I2K A;  1K9Y A;  2VD2 A;  3PPQ A;  1FPE A;  4F3G A;  4OTE A;  3FIR A;  4PE3 A;  1NL5 A;  4X48 A;  4P47 A;  4ISU A;  4U21 A;  4H45 A;  3NOH A;  2F97 A;  4K3F A;  1ZBM A;  1MH4 A;  1MXW A;  3CSB A;  4WEP A;  3LUY A;  1DBZ A;  2R71 A;  3GYY A;  1B51 A;  2DVZ A;  3MPL A;  3HCQ A;  4QXD A;  1NV5 A;  1EZP A;  1MG1 A;  2NUV A;  4G4P A;  4MHF A;  3PUY E;  1FTJ A;  3QUF A;  1EZ9 A;  2GHB A;  2VT5 A;  2XXW A;  1ELJ A;  3VVE A;  1Y4C A;  2CEX A;  4KHZ E;  3PUV E;  5EHS A;  4IGT A;  4GL0 A;  1K9Z A;  1MY1 A;  3R26 A;  1OLA A;  4WKM A;  3T96 B;  4JVD A;  1NV1 A;  1NUZ A;  3IO4 A;  1JW4 A;  3K6U A;  3MVY A;  1PB8 A;  2A5S A;  1VR5 A;  4DXU A;  3RUM A;  1SI0 A;  2CZI A;  1NNT A;  4MCO A;  4DI4 B;  4E0X A;  4GLI A;  1FJ6 A;  3CG1 A;  3MUQ A;  4R75 A;  3QAX A;  4F2Q A;  1ZMG A;  1DSN A;  3IB1 A;  1M5E A;  2CEY A;  2Y5L A;  3H7M A;  3HPI A;  3MVW A;  4HE2 A;  5J1D A;  4G8H A;  1JP4 A;  1ZU0 A;  3MP6 A;  5AA4 A;  4HS7 A;  3QUJ A;  3CFX A;  2G29 A;  2ZYN A;  5I2N A;  2F5X A;  1II5 A;  3MVX A;  3TEP A;  4IO7 A;  1NI9 A;  4EUO A;  3VLW A;  1URS A;  3USD A;  4PBQ A;  1B0H A;  3IK6 B;  4EQB A;  5EYG A;  1QGX A;  3BKI B;  4G68 A;  4MNC A;  3RQT A;  5CRY A;  3KSJ A;  4AB6 A;  4EF2 A;  4OVT A;  1KA0 A;  2Z22 A;  5I84 A;  3TQW A;  5ET7 A;  1FQD A;  1INP A;  1Q1K A;  4MF3 A;  2CZH A;  4M4G A;  4LZ8 A;  3LSF B;  2H9B A;  4MJO A;  4ZEK A;  3SZP A;  4C1U A;  1LBX A;  4PCD A;  2GQ1 A;  3IOR A;  5EQ8 A;  4GWY A;  4IY5 A;  2DQV A;  5CMM A;  2RIN A;  1Y3Q A;  4C1T A;  4GD5 A;  2E0S A;  3TTR A;  5H8S A;  3MW0 A;  1YTV A;  1IQ7 A;  1KZ8 A;  4OA4 A;  1Y3N A;  3OEK A;  5JEI A;  3C34 A;  3FAT A;  4FAT A;  3E13 X;  2AYS A;  4AS4 A;  1R9L A;  1NNF A;  3K6W A;  5ICT A;  2HAV A;  4BDO A;  3UGW A;  1B3H A;  2H99 A;  2I3V A;  4IR8 A;  2WYP A;  3DEL B;  2E1S A;  4F3S A;  4NED A;  1Y20 A;  3OO7 A;  1H3D A;  2D3I A;  3CFZ A;  1B0L A;  1RDX A;  5IZZ A;  4P1E A;  2A5T A;  4JDF A;  3SEV A;  3CR9 A;  5H8Q A;  2VPN A;  1B3G A;  3HFU A;  3TTM A;  1O64 A;  4BDM A;  5FHM A;  4IO2 A;  3VXB A;  1M5C A;  4F19 A;  2WX9 A;  4GXA A;  3VVF A;  1BLF A;  4JXI A;  2HCA A;  3EQ1 A;  1TWY A;  4FOR A;  1IMD A;  5EQ9 A;  4HCY A;  3N6U A;  2I49 A;  5B70 A;  4P0G A;  3PGF A;  5EYF A;  3RT6 B;  1Y4T A;  4R72 A;  4X8R A;  3EHU A;  3MP1 A;  3S9N C;  3RYD A;  1MQG A;  1RDY A;  1NUW A;  5DT6 A;  1XS5 A;  4NQ8 A;  4KD5 A;  2D5W A;  4O3A A;  4X1D A;  3QYT A;  1SW5 A;  4R2F A;  3TFL A;  2Z23 A;  4NN3 A;  3V83 A;  1FTO A;  4BDL A;  1POT A;  1RDZ A;  1MPC A;  3MZ9 A;  4NF4 A;  1SYH A;  4GWU A;  3PMW A;  4R6K A;  4I9D A;  2ZNS A;  3UK4 A;  3N26 A;  1UTH A;  4FEC A;  2PT1 A;  4THI A;  1SYI A;  3GBA A;  4I8C A;  1B1H A;  1QKA A;  3CSG A;  4PE5 B;  3IJX B;  4IO4 A;  3PUX E;  4QHQ A;  3MZB A;  4IO6 A;  3U1O A;  2P3V A;  3FXQ A;  4OFJ A;  3T0J A;  2O51 A;  3O97 A;  3VVD A;  5H8F B;  5AA3 A;  1LBB A;  5H8N A;  4ZED A;  2M8C A;  2HXR A;  5F7V A;  4NMY A;  1FQF A;  3RNN A;  4X1B A;  2DWJ A;  2ZNT A;  3KSX A;  3DP6 A;  3FD3 A;  1FPF A;  3E78 A;  1JNF A;  4N13 A;  5J16 A;  1LB8 A;  1MQD A;  3MC2 A;  4R9G A;  3N6T A;  2XXP A;  3A3C A;  2UVJ A;  4GWZ A;  1IZ1 A;  3B50 A;  4PF6 A;  4U1Z A;  4XFE A;  3KEI A;  1SQY A;  4H67 A;  2HEU A;  5I5P A;  3K0V A;  2P0S A;  5AA1 A;  1TFD A;  4UA8 A;  4NF6 B;  3SEW A;  3FV1 A;  1B9J A;  1LBZ A;  3Q25 A;  3D4G A;  2G93 A;  1B3F A;  4Q0C A;  4ZE9 A;  4ECF A;  1NH7 A;  2QL3 A;  3RGY A;  1FPB A;  5I57 B;  2Q89 A;  4O8M A;  3T93 B;  1NUX A;  1HSJ A;  4F1V A;  5T3J A;  2B3F A;  2XX8 A;  2XWI A;  2Q9T A;  4KXP A;  1EU8 A;  4PFB A;  4TOZ A;  1IXH A;  2H25 A;  3I5O A;  4GWX A;  2V84 A;  1N0T A;  1N04 A;  4NG7 A;  5EYH A;  4DLD A;  1WVJ A;  3DP8 A;  3G3H A;  5H8H A;  2OZZ A;  4H8J A;  2GFE A;  4OQO A;  5I2K B;  3S9M C;  4RYA A;  1FBD A;  3V89 B;  2DSF A;  1N76 A;  3DP4 A;  3E4R A;  1GVC A;  1B05 A;  2I0B A;  1MQI A;  3O6I A;  1N3X A;  1NUY A;  1VSO A;  2QMW A;  4N8Y A;  4OER A;  4F1U A;  1VFD A;  3K6X A;  3M3F A;  3BIG A;  1P1U A;  4PAF A;  2XX7 A;  3OEL A;  4RK9 A;  4MAG A;  3TCF A;  1DOT A;  4H8I A;  4N07 A;  4NGU A;  4NX1 A;  2QMX A;  2I4C A;  1MY3 A;  4LQ2 A;  1LEV A;  3KBR A;  3WAE A;  1ZTY A;  5CMB A;  3BIH A;  3TTK A;  1MPB A;  4LZ7 A;  4IO5 A;  5L8D A;  2XWK A;  3TOD A; 
#chains in the Genus database with same CATH homology
 4JVD A;  1G0H A;  2BJI A;  1NV1 A;  2OX3 A;  1NUZ A;  4O94 A;  4FBP A;  2HHM A;  2KQZ A;  2CZI A;  4MCO A;  4DI4 B;  5IM2 A;  1FJ6 A;  4PGP A;  1DCU A;  4PC9 A;  1VDW A;  2CEY A;  2Y5L A;  2FBP A;  2CZK A;  4N91 A;  4HE2 A;  5J1D A;  3T1B A;  1JP4 A;  5F24 A;  2B4L A;  4P9K A;  2F5X A;  2QPQ A;  1FBP A;  1NI9 A;  3LV0 A;  1NV2 A;  4PBQ A;  5EYG A;  4AS5 A;  1QGX A;  1FPJ A;  1EYJ A;  1YXI A;  4MNC A;  2F3B A;  5IZ1 A;  4GBV A;  2XXK A;  4OVT A;  1KA0 A;  2PCR A;  1NV4 A;  4P8B A;  4MX6 A;  5I7I A;  5ET7 A;  2DE3 A;  1INP A;  1IMF A;  2QFL A;  4GBW A;  4NF0 A;  3EKI A;  2CZH A;  1FBE A;  1LBY A;  3RPL A;  4GWW A;  4MJO A;  3SZP A;  3RPL B;  3CHG A;  1FBC A;  1LBX A;  4PCD A;  5LTC A;  2GQ1 A;  4OVQ A;  5EQ8 A;  4GWY A;  3B8B A;  1FPL A;  1NV6 A;  4N17 A;  1FJ9 A;  1KZ8 A;  4OA4 A;  4GWS A;  3FBP A;  1YYZ A;  5IZ3 A;  5IZ3 B;  4N15 A;  2JJK A;  3MYU A;  4AS4 A;  3IFC A;  4MIJ A;  4PAI A;  1SPI A;  2Y5K A;  2V4C A;  3LUZ A;  2FHY A;  4HE0 A;  4PET A;  1XI6 A;  3W9W A;  4HXV A;  4N6D A;  1IMA A;  4OVS A;  4IR8 A;  2WYP A;  1FRP A;  3KBZ A;  3QMF A;  1RDX A;  5IZZ A;  5EQA A;  4P1E A;  4XF5 A;  2ZZW A;  4F18 A;  3IFA A;  1NV7 A;  2VPN A;  3HFU A;  5ET8 A;  1EYK A;  4N4U A;  2F3D A;  2QVV A;  2B4M A;  4F19 A;  2WX9 A;  1IMB A;  2R8T A;  1FSA A;  2XWV A;  2DDK A;  2L5V A;  2VPO A;  5I3S A;  1IMD A;  3U65 A;  5EQ9 A;  5JK4 A;  4HCY A;  2WYK A;  4OVR A;  3ISP A;  4PFI A;  2FIX A;  4OVP A;  2ZZX A;  5IGA A;  4PDD A;  4UAB A;  4X8R A;  1FPK A;  5ET6 A;  3RYD A;  4YZZ A;  1RDY A;  4P3L A;  1NUW A;  2DE2 A;  4NQ8 A;  4N81 A;  5CM6 A;  4DI3 D;  4MNP A;  2MKZ A;  4OAN A;  4PF8 A;  3ROJ A;  4XEQ A;  4NN3 A;  4P1L A;  1RDZ A;  1BK4 A;  1FBF A;  5DW8 A;  2OWZ A;  2KR0 A;  4GWU A;  1EYI A;  1IMC A;  3E79 A;  2HPG A;  2Q8M A;  2HZL A;  4GX6 A;  3FXB A;  1FPD A;  4PAK A;  5FBP A;  4NAP A;  2P3V A;  3W9V A;  3T0J A;  4QBA A;  4I3Y A;  4GX3 A;  2HXR A;  4PDH A;  4I3E A;  2V3Q A;  1FTA A;  2FVZ A;  1FBH A;  4PGN A;  4PTK A;  1NV3 A;  1IME A;  1AWB A;  1FPF A;  3E78 A;  5J16 A;  4HCW A;  4GWZ A;  4X04 A;  2XWO A;  4YIC A;  4LN5 A;  3B50 A;  4PBH A;  4PF6 A;  2XA5 A;  4XFE A;  3KC1 A;  4MMP A;  1Q9D A;  5I5P A;  2Q74 A;  1LBZ A;  2WEF A;  5ESY A;  5A5L A;  4GX4 A;  1FPB A;  1FPI A;  3KC0 A;  1G0I A;  4N8G A;  1CNQ A;  4MNI A;  4O8M A;  1NUX A;  1NV0 A;  4F1V A;  5T3J A;  2PFZ A;  5EQ7 A;  4G61 A;  2XWI A;  2Q9T A;  4KXP A;  4N6K A;  4HE1 A;  1FBG A;  4PFB A;  2PFY A;  1LBV A;  3D1R A;  5ET5 A;  3A29 A;  4GWX A;  4NHB A;  4H46 A;  1DK4 A;  1LBW A;  4PFR A;  4NG7 A;  5EYH A;  4O7I A;  4O7M A;  2WBB A;  4P56 A;  2WBD A;  1K9Y A;  1FBD A;  4MEV A;  1FPE A;  2HZK A;  4PE3 A;  3PTY A;  4P47 A;  2QVU A;  5LDZ A;  1FPG A;  1NUY A;  4X9T A;  4H45 A;  3NOH A;  4N8Y A;  4M1V A;  4F1U A;  1YZ0 A;  2QVR A;  2FIE A;  3BIG A;  4PAF A;  1DBZ A;  3GYY A;  4JVC A;  1KA1 A;  2DVZ A;  4MAG A;  4QXD A;  1NV5 A;  4I40 A;  4NGU A;  2P3N A;  4MHF A;  4NX1 A;  3MST A;  2VT5 A;  1D9Q A;  2DE4 A;  2CEX A;  1LEV A;  3BIH A;  2ZZV A;  1K9Z A;  4JVI A;  2XWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...