2X26A

Crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
SPEALRIGYQKGSIGMVLAKSHQLLEKRYPESKISWVEFPAGPQMLEALNVGSIDLGSTGDIPPIFAQAAGADLVYVGVEPPKPKAEVILVAENSPIKTVADLKGHKVAFQKGSSSHNLLLRALRQAGLKFTDIQPTYLTPADARAAFQQGNVDAWAIWDPYYSAALLQGGVRVLKDGTDLNQTGSFYLAARPYAEKNGAFIQGVLATFSEADALTRSQREQSIALLAKTMGLPAPVIASYLDHRPPTTIKPVNAEVAALQQQTADLFYENRLVPKKVDIRQRIWQPTQLEGKQLEFRVPGNENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Aliphatic Sulfonate-Binding Protein Ssua from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords PERIPLASMIC ALIPHATIC SULPHONATES-BINDING PROTEIN
total genus 99
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2x26A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2x26A02
1B40A 2I3VA 2IA4A 3K1NA 2XX8A 2PT1A 2DWJA 2PMSA 3H6VA 1SYIA 3QIMA 3T22A 3PU5A 1Y4TA 2XD2A 3FVNA 5CM6A 1PBQA 3T9XB 5L8DA 3N6UA 3CI8A 1SI1A 2BJJX 4KCCA 4QFKA 5I58B 5M2VA 3HPIA 3M3LA 3QUFA 1Z7NE 2XXTA 3AXFA 5CMKA 3K01A 3MUQA 3V83A 4C1UA 4MH5A 4R9FA 4ELRA 4KCDA 3SEWA 1LCFA 2ONSA 5FHNA 3W9WA 4ZEBA 3C33A 3VE1B 4C1TA 1R9LA 3K00A 3PPNA 3THIA 4RY1A 2VP1A 3QYTA 4TLMB 2V3QA 1SI0A 3H7MA 4DE8A 3RY3A 5IAIA 2PX1A 4MF3A 1MDP1 3DELB 2H99A 3DLNA 3M3FA 3PUVE 4H67A 3LC8A 5TP9A 3S4UA 4DZ1A 2Z23A 3VXBA 4JXIA 4JSDA 1A40A 1FQAA 1NNTA 3FVKA 3UIFA 4G68A 3RGYA 1B5JA 2I48A 4NWDA 4R6KA 2H4IA 5TU0A 5KDTB 2DWAA 3RPWA 4O3BA 4F2QA 1B0LA 3CVGA 3FJ7A 5TP9B 3K2DA 2QS3A 4K3FA 5L9OA 1NNFA 2ZYOA 3U1OA 3D4GA 3MQ9A 1QUIA 4PFTA 1OLCA 3BBRA 4G68B 4OMBA 3TTMA 4NTLA 3Q27A 4FIMA 1MDQA 4Q0CA 1WODA 4X48A 2HAVA 5KDTA 5H8HA 1SYHA 2RINA 2ZYKA 3G3GA 3G7WA 4KQPA 4F29A 4BDNA 2I49A 4ZDMA 1B2HA 1IXIA 4QFLA 3VLUA 1ELJA 2UVIA 3QUJA 4OFJA 3TELA 2XXUA 1B7ZA 1LBBA 1S7YA 3FXRA 1H45A 4OXVA 4ZECA 4HW8A 3C32A 4O3CA 4DLDA 5KCJA 3C4MA 5I2NB 1LFHA 1ZJLA 4FAJA 3E4RA 3GLBA 3S9LC 1XVYA 1OLAA 2O69A 2XXWA 3F11A 2UVJA 3E13X 1JEUA 2FA7A 3FIRA 2G93A 4OFLA 4Z0IA 1MRPA 2WKYA 5TPAA 3RTWB 1B9JA 3MPKA 4R74A 4YKKA 2B65A 3CRBA 3QAXA 4GOTA 3LR1A 4GL8A 4IO5A 4NF6B 4YU0A 3G3KA 5L9SA 4JWXA 4I8CA 2I0CA 1B0HA 1MQHA 1PB8A 2F78A 2GHBA 4POWA 4R2FA 4AQ4A 3GBAA 3CSGA 3TUSA 4PFUA 4R75A 1WVJA 2Q8JA 1DOTA 3IOVA 3PD9A 4KYEA 3ILTB 1JQFA 4KYDA 4PETA 4TLLB 3OELA 1BTJA 1MY4A 2F5XA 3FATA 1NMUA 2NWJA 4F3BA 1FQFA 3LBSA 4QSDA 1EZPA 1GGGA 1R1NA 5B7DA 1IITA 2UYFA 1URSA 5I84A 3I3VA 1GTKA 2VGQA 3UORA 1FTMA 3H6TA 4POXA 3B6WA 3C36A 5H8QA 3ZSFA 1ZKBA 1Y20A 2V3TA 4FORA 3TKDA 2QPQA 4F19A 1Y3NA 1MY2A 3D4CA 4OZ9A 2X7PA 5JTYB 1LBCA 3FXUA 1N3XA 2Y7KA 5AA4B 1H76A 1DPPA 5F1QA 3TTRA 3KGCA 4IGTA 4U4XA 2FYIA 3FGSA 3T9VA 1US4A 4ZEKA 3VVEA 4MLVA 4LZ5A 3RTFB 4Q8RA 5I2NA 1A8FA 3MW0A 4M4GA 4F1UA 5I56A 2REJA 1B3GA 1IXHA 5AA1A 5IKBA 1MPDA 2YLNA 3TZAA 3M3KA 4NF4A 3TFLA 3TTNA 3Q26A 3OO9A 3OSRA 4OESA 1ZMGA 1H44A 2ALUA 4PFWA 5F7VA 2XXVA 1LB8A 1P1OA 4NF5A 2O1LA 1IUDA 3MPLA 3PMVA 4WXJA 4IB2A 3PMXA 4DDDA 3OSQA 1FTOA 1Y1ZA 4F3SA 3S9NC 3SEXA 4L17A 3CFLA 5ITOA 1EZ9A 1LLSA 4LA9A 1AOVA 1TT1A 4GFRA 4LQ5A 4R73A 2QJEA 4M1VA 3TYHA 4QSCA 3L6HA 1N7XA 4ZEFA 4LATA 1L5TA 4F31B 2G29A 4X1BA 2H5YA 5CI5A 3EHSA 2ABHA 1MXUA 4I9DA 4YZZA 3WAEA 1ZU0A 2RCAA 3T9HB 1HSEA 3EPEA 4DXBA 1SD3A 3TDJA 4ESXA 1B5IA 3S2VA 4U1ZA 2HZKA 4OENA 4YAHX 3K4UA 2D21A 2XX7A 4PFYA 1O64A 2I4BA 2O84X 2QMWA 2D5WA 1B46A 4U2RA 3TPAA 5I58A 1EZOA 2OWSA 4I1DA 4F3PA 3T66A 3TTKA 4RYAA 1B4ZA 4F22A 3RT6B 2Q88A 2Q9TA 2Y7IA 4H5GA 4BDOA 1MXXA 3C34A 1SW2A 1QUJA 2RCBA 3IAZA 3OEKA 1B32A 1FTLA 5I57B 1JW1A 3KZGA 3I6VA 2QS2A 1Y9UA 4F2OA 2W7YA 2O1MA 5CMBA 4E0WA 1USYH 4ZS9A 4XKQA 2ZNUA 3HHGA 3IK6B 1R9QA 1SW4A 1I6BA 2IEEA 1FTJA 2X7QA 2ONRA 1SW5A 3N6TA 4GF8A 2I58A 2XXRA 3E3KA 3PPRA 4GLIA 1F9BA 1MS7A 2Z8DA 4GIZA 3V89B 2I6EA 1LCTA 3CFXA 2HCAA 4QHQA 1VSOA 4F1VA 3U92A 4F3GA 3KJTA 5FHMA 3OENA 1NH7A 3TQWA 2GRVA 2PBWA 2QL3A 2F6PA 4XIGQ 1FTKA 3M8UA 5AA2D 1B7HA 1BP5A 1HSLA 2V3UA 4ZZEA 4QFOA 2HEUA 3MZBA 3IR1A 2THIA 4X1DA 4MFIA 4H5FA 1T0KA 2F7AA 1N0TA 2XXXA 3EF7A 1MXYA 4YKPA 3OOAA 2F97A 1O63A 4WEDA 3O2AA 3CG3A 2A5TB 3MAMA 2DS9A 1P1UA 4QF9A 2QS1A 4BDLA 2E1SA 4ZE9A 3MVYA 3PUZE 2Q2AA 2O51A 2F6GA 2AIXA 1FQCA 1LAGE 2DE4A 1M5EA 3A09A 3O6HA 1TXFA 1OVTA 4NEDA 4YB7A 5ICTA 1NNKA 1GVCA 3IJOB 1YAEA 1B6HA 1B05A 1LGBC 3G3JA 3CG1A 1LFGA 3IO4A 3K6VA 3KN3A 2ANJA 2LAOA 2I3WA 3FZVA 3KOSA 4QFPA 5H8NA 4IGRA 1PDAA 3PMWA 3SDFA 2P2AA 2F35A 1POY1 2HAUA 4LUBA 3EN3A 3JYRA 3PUXE 1US5A 3O66A 4YKIA 1LAHE 3JV9A 4XKPA 5EHSA 3DM0A 1MH4A 1MM6A 4GQOA 4ND9A 4P11A 1RKMA 3TQLA 1IQ7A 1XT8A 1B3LA 2ZMBA 3TODA 3PPOA 2VOZA 2HQ0A 1JVYA 1O7TA 1P1NA 4NF5B 4OTEA 4G68C 4OETA 2PT2A 4BDQA 5JTYA 1QW0A 4U4SA 3O6IA 2DVCA 3SKPA 3T96B 4THIA 3BKIB 4F39A 1B3HA 3VVFA 4EXKA 1B58A 1M5FA 2GHAA 3CR9A 2F7BA 2QS4A 2UYEA 2CMOA 3ZS6A 1BIYA 4EUOA 4HS7A 3VDFA 4ESWA 3MVWA 1N3WA 2NUVA 2X26A 2OBGA 1MG1A 1WDNA 3DP4A 3IB0A 4KI0E 3EHUA 3RN8A 5L9MA 1DPEA 2QMXA 3H6WA 1OQHA 4JSOA 4IO3A 4U21A 1FQDA 1Y4CA 1OMPA 1R6ZA 3GZGA 3B7DA 4LVQA 3K6WA 3QSLA 3ILUB 4YICA 2M8CA 4NMYA 4RK9A 2REGA 2QSXA 3ZKLA 3TCGA 4ELOA 1FQBA 1XC1A 3CIJA 4PE5B 2A5SA 1NL5A 2VD2A 3KBRA 4KR5A 4ELPA 3UN6A 2DOJA 3KFMA 5JK4A 4FEDA 1JW5A 3KG2A 1A55A 5TPAB 1NH8A 2DVZA 4ONYA 1I6QA 1Y1MA 2Z8EA 4Q5TA 5H8FB 1FW0A 1S9TA 3KSXA 3V5AA 4BDMA 4EDPA 3SERA 5BWJA 2ZNSA 2Y7PA 4OEVA 5JEIA 3T9UA 2UXAA 4LONB 1AH5A 1B51A 2I4CA 2YPNA 3ECRA 1IIWA 2DWIA 2XXPA 3B6QA 3MWBA 3RQTA 5A5XB 1ZLQA 2OCUA 3H06B 3LUYA 4RXLA 4EXLA 5EYFA 1AIVA 1LSTA 4EQ9A 5CC2A 2O6AA 4BLAA 1MQJA 2V84A 5ISUA 1OIBA 3OEMA 4QSEA 3OO7A 4IY5A 2OWTA 1P99A 2Y7WA 3G3HA 3V8XB 1Y3QA 2RC8A 3C31A 4OVJA 4QRZA 2DE3A 3U93A 3UA8A 4F1YA 1IEJA 1MY0A 3ZKKA 1XOCA 5CMMA 3HN0A 2DE2A 1AL3A 1QJMA 3FJGA 3H03A 3N5LA 3T93B 4DCYA 3L6GA 1XVXA 1NNPA 1N04A 2RC9A 1ZIUA 4KFQA 1RYOA 2Q2CA 3MVZA 1ZBMA 2AYSA 4U22A 4XKNA 3RUMA 5DEXB 3OMBA 5AA3A 5J1DA 3FD3A 1Q35A 4FEBA 4NF8B 4RPOA 1SBPA 2A5TA 5DVJA 3HCQA 3SEVA 1H43A 1A7LA 4GXAA 2O7IA 3S9EA 2NXOA 3MC2A 5I2KB 1MPBA 3FXQA 4OEUA 4XXUA 2PVUA 4G2ZA 4OERA 3C9HA 1MXWA 4NF4B 4UACA 5DEXA 4NE4A 5DVFA 1VE4A 2RKMA 2ZNTA 3U8QA 5AE4A 1MQGA 1DTZA 4GRKA 1QKAA 2I0BA 2DYXA 2H98A 2OZZA 3K0VA 2UVGA 3PPPA 5K2YA 1JEVA 5ELVA 3OO6A 1N84A 4R72A 1OVBA 4G4PA 4RJZA 3G3IA 3LSLA 4EF1A 5H8FA 2DXRA 1MH3A 2ESNA 5BUUA 1ATGA 1VFEA 1IZ1A 4IO4A 4OYVA 4DXUA 3MP6A 3U72A 3ODBA 5A5XA 4MBPA 2E0SA 4G8NA 3K1MA 4YMAA 2ZXTA 4Q30B 3MZ9A 3R7XA 3MBPA 3U94A 2XXYA 3O97A 1AMFA 1NFTA 2OK2A 4GXSB 3MP8A 2PYYA 4UA8A 1DTGA 3Q29A 4G77A 2OLBA 1IXGA 1HSJA 1MY1A 2R6GE 3DP8A 4KD5A 4OHNA 3K6UA 1DMBA 5CRYA 3KSJA 1BKAA 3G3FA 3MVXA 1B3EA 4N13A 3FUZA 3OD7A 1SQYA 4C0RA 3O29A 1XHYA 3QK6A 2H9BA 3K02A 1MQIA 3PUYE 4KPTA 4NF8A 3RLFE 4NWCA 4X9TA 1URDA 2Y7RA 2Y84A 3EQ1A 2DXYA 3P7IA 4R6HA 3KJ7A 1YPNA 3R6UA 4YB6A 2F36A 2VD3A 1M5BA 4FE8A 4R9GA 5H8QB 3VVDA 5H8NB 1MQDA 1VR5A 3FASA 3IJXB 4JBZA 1PC3A 2YJPA 3DP6A 4YKJA 4N6PA 5FHOA 5KCJB 1VFDA 5I2KA 3IORA 1J1NA 3MJNA 4IO2A 4YB5A 1KWHA 1QULA 4YMBA 4N07A 3LSXA 1CE2A 3Q25A 3H4ZA 5FTHA 5LOMA 1P1QA 1B1HA 4MLQA 4NF6A 2DP8A 4FATA 1S50A 3PPQA 4DIGA 1B5HA 1H3DA 1URGA 3W9VA 4JWYA 3EHTA 1Y3PA 3VLVA 2B3BA 2XX9A 1B7UA 3N26A 4GWOA 5HBCA 1I6AA 1M5DA 2P1SA 3K6XA 3O6GA 4TQUQ 5HPQA 5EHMA 1JNFA 4EQBA 1JVXA 2CZLA 1XS5A 3ONMA 4OFOA 4TOZA 2XD3A 1GR2A 2GH9A 2V25A 4O3AA 1UQWA 2ONKE 4EQ7A 4ZEIA 3KEIA 1I69A 3A3CA 3OXNA 4LZ8A 4WKMA 1DSNA 4KYSA 3SETA 2R71A 5AA2B 3VLWA 4U1OA 1LAFE 3A3UA 3CSBA 1YCJA 3O9PA 1D9YA 4JWOA 1QKBA 4LQ2A 3H6UA 5K2XA 3UGWA 4JB7A 4ECFA 3IOUA 2D3IA 3PV0E 1PB9A 2UVHA 1FQEA 1SDXA 4GD5A 4H6DA 3WAFA 4Z7EA 1D3KA 3GBBA 1B3FA 1PEBA 3O28A 1OQGA 5KZTA 2QRYA 3PD8A 1A8EA 2RF1A 2XHDA 2F8DA 3Q28A 4H8IA 4QFNA 3TCHA 4BDRA 4IO7A 2B3FA 2ZYNA 1N7WA 4IY6A 5H8HB 3HHFA 4AB6A 4XKRA 5ITPA 1D9VA 1QUKA 1P1WA 1TFAA 2NOOA 3FJMA 5I56B 3TEPA 2Q89A 1RYXA 4H65A 1SVXB 3R26A 4OQOA 4AB5A 4LZ7A 4KHZE 4H0WA 5HM4B 4R6YA 5I59A 3LSFB 2FNCA 4HTGA 1NKXA 4ZE8A 4U23A 3B6TA 5DTBA 3VV5A 3UK4A 3IB1A 1CB6A 1TFDA 3FVGA 1SW1A 4EF2A 3VXCA 2NVUB 2AL4A 1EH3A 1POTA 4P0GA 1MM7A 5DVIA 1MXZA 1MY3A 1USYE 4PQJA 1JW4A 2F34A 5CMCA 3UP9A 3MP1A 3PUWE 1GV8A 5CBSA 4E0XA 3I5OA 2HFBA 3MZ1A 1A99A 5AA2A 1UTHA 1LB9A 2Z22A 5B70A 4IO6A 1N76A 3BFTA 1UTBA 3IL1B 3K1PA 3OO8A 3KN8A 4P0IA 1B52A 5DT6A 3RT8A 4F18A 4XTCQ 4G8HA 3SESA 2Z8FA 2XXHA 3RNNA 1Z7ME 3C35A 1IXCA 4ZEDA 2DSFA 1YTVA 4HCYA 4ELQA 3FV2A 4OWDA 1UIUA 1BLFA 1PBPA 2OJTA 4GVOA 1Q1KA 5I57A 3USDA 1D4NA 3SEUA 3TCFA 3HSTA 3JZJA 2HXWA 3PGFA 4H1XA 5I59B 2F7CA 4G8MA 4R2BA 1ANFA 3TTLA 4DXCA 4ISUA 3IO6A 3FVOA 4RPNA 1II5A 3H3GA 4WEPA 3IX1A 1A54A 4FJPA 3FV1A 3LSWA 1LAXA 1UIVA 3QXMA 4JDFA 3W15C 3HV1A 1JETA 3KN7A 1B1XA 4H8JA 3TAJA 1B4HA 1TWYA 2DWHA 4PP0A 5H8SA 2AL5A 2VHAA 1LFIA 3CFZA 5DYHA 4ZZAA 3SEYA 5FTIA 3GXAA 3IOWA 5ICQA 4RK2A 1M5CA 3E9XA 2DQVA 4RA1A 4LP2B 2HZLA 3KOTA 1QVSA 3VFJA 3IOTA 1PB7A 2O7UA 2XXIA 3N94A 1MPCA 4I62A 2KLFA 1EU8A 4RNSA 3BFUA 1UTBB 2O68A 2R9JA 2XXQA 2RC7A 2ZYMA 2H25A 2P0SA 4FECA 3TMGA 4DCXA 5CBRA 1UTHB 1MXVA 2V93A 4GL0A 4HCWA 1ZTYA 1FCKA 3S9MC 2GFEA 3HO7A 5AA4A 3IB2A
chains in the Genus database with same CATH superfamily
2PT1A 2DWJA 1SYIA 3FVNA 3QUFA 1YYZA 2XXTA 3K01A 4PAIA 4C1UA 4MH5A 2ONSA 5FHNA 4ZEBA 3VE1B 2VP1A 3RY3A 1MDP1 3DELB 2H99A 3VXBA 4JXIA 2XWVA 1B5JA 4AS5A 2DWAA 3RPWA 2QS3A 4K3FA 1NNFA 3MQ9A 1OLCA 1D9QA 1FBFA 4FIMA 1WODA 2ZYKA 1B2HA 3VLUA 4OFJA 3FXRA 4HW8A 4DLDA 5I2NB 4FAJA 3GLBA 1XVYA 2UVJA 1JEUA 4OFLA 3FIRA 2G93A 4Z0IA 1MRPA 3FXBA 4OA4A 3RTWB 4F39A 5KCJB 3TZAA 4NF6B 4GOTA 4IO5A 1FTAA 3G3KA 4POWA 1B0HA 1MQHA 1PB8A 4R75A 1NV0A 4TLLB 1BTJA 1FPGA 2NWJA 2HPGA 1INPA 3EKIA 5B7DA 1EZPA 1IITA 2UYFA 2VGQA 5H8QA 2V3TA 2X7PA 1LBCA 2Y7KA 5I7IA 1H76A 1DPPA 3KGCA 3ROJA 4U4XA 4ZEKA 5I2NA 3MW0A 2REJA 5AA1A 1MPDA 2YLNA 3M3KA 1QGXA 3Q26A 4PFWA 4OESA 2ALUA 1YXIA 3MPLA 3FBPA 1FTOA 2CEYA 1EZ9A 1LLSA 4M1VA 4I40A 5CI5A 1FPBA 1MXUA 4I9DA 4DXBA 2Y5LA 4PDHA 4DI4B 4YAHX 2D21A 2O84X 1B46A 2OWSA 4I1DA 4F3PA 3TTKA 3RT6B 2FIXA 2Q88A 2Q9TA 1MXXA 1B32A 1FTLA 2QS2A 1Y9UA 4E0WA 1USYH 4MCOA 3IK6B 1I6BA 2IEEA 2X7QA 3N6TA 4HE0A 4GF8A 4MNPA 1F9BA 3U92A 5A5LA 3KJTA 5FHMA 3OENA 2PBWA 1BP5A 4ZZEA 2XXXA 1MXYA 4N6KA 1O63A 3O2AA 3CG3A 2A5TB 1TXFA 1GVCA 1YAEA 1LGBC 1NUWA 3IO4A 2LAOA 5H8NA 3SDFA 3TTMA 4F1YA 1NV5A 4LUBA 4XKPA 1LAHE 4ND9A 3TQLA 1XT8A 3TODA 3PPOA 1JVYA 4G68C 4THIA 3BKIB 3VVFA 1M5FA 2QS4A 3ZS6A 4ESWA 4HS7A 2NUVA 2X26A 1WDNA 2QMXA 4JSOA 1OMPA 4LVQA 5LTCA 4H45A 4NMYA 2REGA 3ZKLA 3CIJA 2A5SA 2DOJA 3KFMA 4FEDA 3KG2A 1NH8A 4ONYA 4Q5TA 5H8FB 1FW0A 3V5AA 3KSXA 4BDMA 5BWJA 2ZNSA 4OEVA 5JEIA 4LONB 4MJOA 1AH5A 2XXPA 3SZPA 1AIVA 4EQ9A 5CC2A 5ISUA 3OEMA 2Y7WA 2XXKA 2RC8A 4QRZA 3U93A 5CMMA 2CEXA 1AL3A 3FJGA 3H03A 4O7MA 3TKDA 4XKNA 5DEXB 5AA3A 4P3LA 1Q35A 4RPOA 5EYGA 1NUZA 5DVJA 3SEVA 1A7LA 2O7IA 2NXOA 5I2KB 4OEUA 1SPIA 2PVUA 3C9HA 4NF4B 1QKAA 5ELVA 4R72A 1OVBA 4HE2A 2DXRA 5BUUA 1ATGA 1VFEA 1IZ1A 3ODBA 4MBPA 2E0SA 4G8NA 4YMAA 3MZ9A 3R7XA 5F24A 4MHFA 4PBHA 3Q29A 2H9BA 4X9TA 1DK4A 4P1LA 1YPNA 4R9GA 4YKJA 1PC3A 2YJPA 5I2KA 4IO2A 1NUXA 4N07A 2DP8A 4FATA 3PPQA 4DIGA 1H3DA 1URGA 1NV3A 1DCUA 1M5DA 2P1SA 5HPQA 4OFOA 4TOZA 2XD3A 4ZEIA 1I69A 3OXNA 3VLWA 3A3UA 3O9PA 4QXDA 5K2XA 4LQ2A 4JB7A 4Z7EA 4H6DA 3Q28A 3TCHA 2F8DA 3RPLB 4AB6A 4XKRA 1D9VA 3FJMA 1P1WA 1FBCA 4OQOA 2FNCA 1NKXA 1FPEA 3IB1A 1CB6A 3FVGA 2BJIA 1POTA 1MY3A 1USYE 2F34A 3MP1A 3PUWE 4PF8A 2FIEA 5AA2A 4PDDA 1UTHA 1LB9A 4IO6A 3OO8A 4P0IA 5DT6A 3KN8A 1VDWA 4GBWA 2Z8FA 4N15A 3C35A 3FV2A 4OWDA 1BLFA 2OJTA 1Q1KA 5I57A 1NV7A 3HSTA 3IO6A 4WEPA 2Q8MA 3FV1A 3LSWA 5EQ9A 4JDFA 3TAJA 2VHAA 1LFIA 5FTIA 4RK2A 3E9XA 1QVSA 2XXIA 3HFUA 1MPCA 1Q9DA 4FECA 3BFUA 2O68A 5IZ1A 3TMGA 1UTHB 4GL0A 1ZTYA 1FCKA 4YKKA 5AA4A 3H6VA 3PU5A 1Y4TA 5IGAA 4LN5A 3CI8A 4KCCA 3M3LA 3AXFA 5CMKA 3MUQA 3V83A 4R9FA 3SEWA 2XWOA 1LCFA 3K00A 4JVCA 4RY1A 2V3QA 5IAIA 3DLNA 3PUVE 1NNTA 1B0LA 3CVGA 3FJ7A 5TP9B 3D4GA 3BBRA 4G68B 1MDQA 4KQPA 3G3GA 4BDNA 2I49A 1IXIA 1ELJA 2UVIA 1S7YA 1H45A 4OVPA 3C32A 4P56A 1LFHA 3E4RA 2B4LA 2WKYA 3LR1A 4YU0A 5L9SA 4I8CA 2GHBA 1LBZA 3GBAA 4OANA 1WVJA 3IOVA 4KYDA 3FATA 1NMUA 3LBSA 1YZ0A 4QSDA 1R1NA 5I84A 3I3VA 3UORA 3LV0A 1FTMA 3H6TA 5T3JA 1Y20A 1Y3NA 3D4CA 5F1QA 4IGTA 3FGSA 3T9VA 4FBPA 4MLVA 4LZ5A 5I56A 1LEVA 5EQAA 3TTNA 3OO9A 3S9NC 5F7VA 1H44A 2XXVA 1P1OA 2O1LA 1IUDA 3PMVA 3PMXA 4DDDA 2WYPA 4L17A 1TT1A 4LQ5A 1N7XA 3WAEA 4ESXA 3TDJA 1B5IA 3S2VA 3B8BA 4OENA 4GX3A 4PFYA 1O64A 2I4BA 3TPAA 1EZOA 3T66A 4F22A 4BDOA 4N81A 2WBDA 3C34A 1SW2A 4F2OA 2FHYA 1R9QA 1SW4A 1FTJA 2ONRA 2XXRA 3PPRA 5ET6A 4GLIA 1MS7A 4GIZA 5J16A 1LCTA 2HCAA 4QHQA 1RDXA 1VSOA 2QL3A 2F6PA 4XIGQ 4PC9A 1FTKA 2V4CA 1B7HA 1HSLA 2WEFA 2HEUA 3IR1A 4X1DA 1T0KA 4MFIA 3EF7A 4BDLA 3PUZE 2O51A 3LUZA 3O6HA 1FPKA 1NNKA 3GYYA 5ET8A 1B6HA 1FRPA 3K6VA 3KN3A 4QFPA 2ANJA 3PMWA 2F35A 2HAUA 3EN3A 2HHMA 4YKIA 5EHSA 1MH4A 1IQ7A 2ZMBA 4N8GA 4JVDA 4BDQA 4U4SA 2DVCA 1B58A 2GHAA 2F7BA 2UYEA 4EUOA 3MVWA 3T1BA 2OBGA 4IR8A 3IB0A 3DP4A 4KI0E 3EHUA 3K6WA 3ILUB 2M8CA 1FQBA 1NL5A 4NG7A 1JW5A 4MIJA 1IMCA 1Y1MA 2Z8EA 2ZZWA 4PFRA 3SERA 1FSAA 3ECRA 1IIWA 3B6QA 3LUYA 4RXLA 4MNCA 3V8XB 4OVJA 1IEJA 1MY0A 2DE2A 3N5LA 3T93B 5JTYA 3SKPA 3TFLA 2AYSA 4U22A 5J1DA 4FEBA 4NF8B 2A5TA 3S9EA 1MPBA 3FXQA 4XXUA 4OERA 1MXWA 1MQGA 1DTZA 2OZZA 2H98A 2UVGA 3G3IA 1MH3A 1KA0A 2ZZVA 3MP6A 5A5XA 3K1MA 2ZXTA 4Q30B 3U94A 2F3DA 3MP8A 2PYYA 1IMBA 4UA8A 1DTGA 4KD5A 2OX3A 3K6UA 1DMBA 4C0RA 1XHYA 1LBWA 1MQIA 4NF8A 3VVDA 4PAKA 3DP6A 3IORA 4YMBA 1QULA 1CE2A 3Q25A 1P1QA 4NF6A 2QVRA 3EHTA 2XX9A 4GWOA 3K6XA 1JNFA 1JVXA 1XS5A 2GH9A 2V25A 4O3AA 3D1RA 4WKMA 1FPLA 5AA2B 2VPNA 1YCJA 1QKBA 3PV0E 5IZ3B 1SDXA 1B3FA 3O28A 1OQGA 4H8IA 1K9ZA 2ZYNA 4IY6A 5H8HB 4JVIA 5ITPA 2NOOA 2Q89A 4GWSA 4AB5A 3LSFB 4PF6A 4U23A 3VV5A 1TFDA 4EF2A 1FPFA 3VXCA 2NVUB 2AL4A 1EH3A 1MXZA 2P3VA 5CBSA 3I5OA 2PFYA 2Z22A 5IZ3A 1UTBA 3K1PA 5I3SA 3U65A 3RNNA 2DSFA 1YTVA 2HXWA 3TTLA 4PFIA 1IMAA 2CZKA 3H3GA 3IX1A 3TUSA 1LAXA 4MMPA 4H8JA 5H8SA 5DYHA 2QVVA 3GXAA 3IOWA 4RA1A 2HZLA 3T0JA 3VFJA 2KLFA 4O94A 4RNSA 1UTBB 2JJKA 2ZYMA 3PTYA 3KBZA 2HXRA 1MXVA 2V93A 4HCWA 3S9MC 3HO7A 3IB2A 2IA4A 2I3VA 2PMSA 3QIMA 3T22A 5CM6A 1PBQA 5L8DA 2ZZXA 5I58B 5M2VA 3HPIA 1Z7NE 5EYHA 3C33A 1BK4A 3PPNA 3THIA 4NN3A 2PX1A 4MF3A 4H67A 3M3FA 1EYKA 2Z23A 1A40A 1FQAA 3FVKA 3UIFA 3RGYA 2I48A 4NWDA 2H4IA 5IM2A 4O3BA 1NI9A 5L9OA 4P8BA 3U1OA 4PFTA 3Q27A 5KDTA 5H8HA 2RINA 3G7WA 4F29A 4ZDMA 4QFLA 3TELA 1B7ZA 1LBBA 4OXVA 4ZECA 5KCJA 3C4MA 5ESYA 3S9LC 1OLAA 2O69A 1DBZA 3F11A 3E13X 4HE1A 5TPAA 4GWXA 1B9JA 4R74A 2B65A 3CRBA 3QAXA 4GL8A 4NAPA 4PAFA 1LBXA 4JWXA 4AQ4A 4G61A 3CSGA 2Q8JA 4KYEA 3ILTB 1JQFA 4PGNA 4PETA 3OELA 1MY4A 2F5XA 1GGGA 4PFBA 1URSA 3B6WA 1MY2A 5JTYB 1N3XA 4X04A 2PFZA 3TTRA 3BIHA 5I5PA 4P1EA 4Q8RA 1A8FA 3B50A 4M4GA 1B3GA 1IXHA 2FVZA 4NF4A 3OSRA 1ZMGA 1IMDA 4NF5A 4WXJA 4IB2A 1Y1ZA 4F3SA 1EYIA 2QJEA 4F31B 2P3NA 2H5YA 3MSTA 3EHSA 4GWUA 2ABHA 4YZZA 1ZU0A 2RCAA 1AOVA 1HSEA 3EPEA 1SD3A 4N4UA 4U1ZA 1FPIA 2QVUA 2HZKA 3K4UA 2XX7A 2QMWA 2D5WA 4U2RA 5I58A 1B4ZA 2Y7IA 4H5GA 2RCBA 3IAZA 3I6VA 4P47A 2W7YA 2O1MA 5CMBA 1SW5A 1LBYA 4N91A 2Z8DA 3V89B 2I6EA 3CFXA 4F3GA 1K9YA 2V3UA 2PCRA 3MZBA 2THIA 4H5FA 2F7AA 1N0TA 4YKPA 2F97A 4WEDA 3MAMA 1P1UA 4QF9A 2QS1A 4ZE9A 3MVYA 3RPLA 1LAGE 1M5EA 3IJOB 1B05A 3CG1A 3FZVA 2I3WA 1PDAA 4C1TA 2P2AA 1FBEA 3JV9A 2XWKA 3DM0A 4GQOA 1P1NA 4OTEA 4OETA 1QW0A 3O6IA 3IFAA 1XI6A 3CR9A 4H46A 4GX6A 3VDFA 1NUYA 1N3WA 2VT5A 3H6WA 1OQHA 4IO3A 1FQDA 1Y4CA 3GZGA 1R6ZA 3B7DA 1FPJA 5IZZA 3QSLA 4ELOA 2QSXA 1RDZA 3KBRA 4ELPA 4KR5A 3UN6A 1FJ6A 2FBPA 4EDPA 2Y7PA 2UXAA 2I4CA 5A5XB 2DWIA 4HXVA 3RQTA 1ZLQA 2OCUA 3H06B 4EXLA 4N6DA 1MQJA 1OIBA 3OO7A 2OWTA 3UA8A 4NHBA 1XOCA 4I3YA 4DCYA 1NNPA 3SEXA 4KFQA 1ZIUA 1RYOA 3MVZA 3RUMA 3OMBA 3FD3A 1SBPA 3HCQA 1H43A 4GXAA 5DEXA 5DVFA 5LDZA 5AE4A 4GRKA 2I0BA 3K0VA 3PPPA 4XEQA 3KC1A 1N84A 3OO6A 4RJZA 2ESNA 4GX4A 5EQ8A 3O97A 1AMFA 4G77A 2OLBA 5CRYA 1HSJA 2R6GE 3DP8A 4OHNA 3KSJA 3MVXA 1B3EA 4N13A 3OD7A 1SQYA 3O29A 4KPTA 3PUYE 3RLFE 4NWCA 1URDA 2Y7RA 1KZ8A 3EQ1A 2DXYA 3P7IA 4GWWA 5DW8A 3KJ7A 4YB6A 4FE8A 2VPOA 3FASA 3IJXB 5FHOA 4N6PA 1VFDA 1J1NA 3MJNA 3H4ZA 5FTHA 5LOMA 4O8MA 1B5HA 3VLVA 2B3BA 3A29A 4TQUQ 5EHMA 4EQBA 2CZLA 1GR2A 4EQ7A 1NV1A 1UQWA 2ONKE 3KEIA 3A3CA 4LZ8A 3NOHA 1DSNA 3SETA 2R71A 1FBGA 1LAFE 2WBBA 3E79A 1D9YA 3H6UA 4AS4A 4ECFA 2D3IA 1PB9A 2UVHA 4GD5A 3WAFA 4XF5A 5KZTA 2QFLA 3PD8A 1A8EA 2RF1A 4OVTA 4BDRA 4IO7A 2B3FA 1FBHA 3HHFA 1RYXA 4H65A 4LZ7A 5HM4B 5ET7A 4ZE8A 3B6TA 4O7IA 4P0GA 1MM7A 5CMCA 3QMFA 3UP9A 1GV8A 3MZ1A 1FJ9A 2WX9A 4X8RA 4F18A 3IL1B 4G8HA 1Z7ME 1IXCA 4ZEDA 4HCYA 1PBPA 4GVOA 1D4NA 3SEUA 3TCFA 3PGFA 4R2BA 1ANFA 4DXCA 4PE3A 4ISUA 3FVOA 4RPNA 1II5A 1A54A 3QXMA 1UIVA 3W15C 3HV1A 1B4HA 1NV2A 1TWYA 4ZZAA 3CFZA 2B4MA 1FBDA 1M5CA 2DQVA 3KOTA 3E78A 2R9JA 2P0SA 4OVSA 4DCXA 5CBRA 1B40A 3K1NA 2XX8A 4NX1A 2L5VA 2XD2A 2GQ1A 3T9XB 3N6UA 1SI1A 2BJJX 4QFKA 4ELRA 4KCDA 4OVRA 3W9WA 1R9LA 3ISPA 3QYTA 4TLMB 1SI0A 3H7MA 4DE8A 4NQ8A 3S4UA 5TP9A 4DZ1A 3LC8A 4NF0A 4JSDA 4G68A 4R6KA 5KDTB 5TU0A 4F2QA 3K2DA 4GBVA 2ZYOA 3KC0A 1FPDA 1KA1A 4UABA 1QUIA 4OMBA 4NTLA 4Q0CA 4X48A 2HAVA 1SYHA 3QUJA 4PBQA 2XXUA 4O3CA 1ZJLA 1G0HA 2XA5A 2XXWA 4EF1A 2FA7A 3MPKA 2I0CA 2F78A 4R2FA 3RYDA 4PFUA 1DOTA 3PD9A 4GWYA 4F3BA 1FQFA 4OVQA 4N17A 3CHGA 5EQ7A 1GTKA 4POXA 3ZSFA 3C36A 2CZIA 1ZKBA 4FORA 2QPQA 4F19A 4OZ9A 3FXUA 5AA4B 2FYIA 1US4A 3VVEA 5IKBA 3RTFB 2DDKA 4F1UA 4MEVA 1LB8A 4MX6A 4I3EA 3OSQA 3CFLA 5ITOA 4LA9A 4GFRA 1RDYA 4R73A 3TYHA 4QSCA 3L6HA 4ZEFA 1L5TA 4LATA 2G29A 4X1BA 3T9HB 4MNIA 3IFCA 4RYAA 1QUJA 3OEKA 5I57B 1JW1A 3KZGA 4ZS9A 4XKQA 2ZNUA 3HHGA 2I58A 3E3KA 4F1VA 1NH7A 3TQWA 2GRVA 3M8UA 5AA2D 4QFOA 3MYUA 3OOAA 2DS9A 2E1SA 2Q2AA 2F6GA 2AIXA 1FQCA 2DE4A 3A09A 4NEDA 1OVTA 4YB7A 5ICTA 3G3JA 1LFGA 3KOSA 4IGRA 5I56B 1POY1 3JYRA 3PUXE 1US5A 3O66A 5ET5A 4N8YA 1MM6A 4P11A 1RKMA 1B3LA 1G0IA 2VOZA 2HQ0A 1O7TA 4NF5B 2PT2A 3T96B 1B3HA 4EXKA 1CNQA 1EYJA 2CMOA 1NV4A 1BIYA 1IMFA 1MG1A 3RN8A 5L9MA 1DPEA 4U21A 4PCDA 4YICA 4RK9A 3TCGA 1XC1A 4PE5B 2Q74A 2VD2A 5JK4A 1FBPA 4KXPA 1A55A 5TPAB 2DVZA 2R8TA 1I6QA 1S9TA 2CZHA 3T9UA 1B51A 2YPNA 3MWBA 2KQZA 5EYFA 1LSTA 2O6AA 4BLAA 2V84A 4QSEA 4IY5A 1P99A 3G3HA 1Y3QA 2OWZA 3C31A 2DE3A 3ZKKA 3HN0A 1QJMA 3L6GA 1XVXA 2RC9A 1N04A 2Q2CA 1ZBMA 4PTKA 3MC2A 4G2ZA 4UACA 4NE4A 1VE4A 2RKMA 2ZNTA 3U8QA 1IMEA 2DYXA 4PGPA 5K2YA 1JEVA 4G4PA 3LSLA 5H8FA 2WYKA 4IO4A 4OYVA 4DXUA 3U72A 2F3BA 3MBPA 2XXYA 2OK2A 1NFTA 1LBVA 4GXSB 2MKZA 1IXGA 1MY1A 1BKAA 3G3FA 3FUZA 3QK6A 3K02A 2Y84A 4R6HA 3R6UA 5H8QB 2F36A 2VD3A 1M5BA 5H8NB 1MQDA 1VR5A 4JBZA 4YB5A 1KWHA 3LSXA 3BIGA 1B1HA 4MLQA 1S50A 2KR0A 3W9VA 4JWYA 1Y3PA 3N26A 1B7UA 5HBCA 1I6AA 3O6GA 2XWIA 4NGUA 3ONMA 4KYSA 4U1OA 3CSBA 4JWOA 3UGWA 4MAGA 3IOUA 1FQEA 1D3KA 3GBBA 1PEBA 2QRYA 2XHDA 4QFNA 1N7WA 1QUKA 1TFAA 3TEPA 1SVXB 3R26A 4KHZE 4H0WA 5I59A 4R6YA 4HTGA 4P9KA 5DTBA 3UK4A 1SW1A 5DVIA 5FBPA 4PQJA 1JW4A 4GWZA 1JP4A 4E0XA 2HFBA 1A99A 5B70A 1N76A 3BFTA 3RT8A 4DI3D 1B52A 4XTCQ 3SESA 2XXHA 4ELQA 2Y5KA 1UIUA 4QBAA 3USDA 3JZJA 5I59B 4H1XA 2F7CA 4G8MA 4FJPA 1JETA 3KN7A 1B1XA 2DWHA 4PP0A 2AL5A 3SEYA 5ICQA 1NV6A 4LP2B 4XFEA 3IOTA 1PB7A 2O7UA 3N94A 4I62A 1EU8A 2XXQA 2RC7A 1AWBA 2H25A 2GFEA
chains in the Genus database with same CATH topology
1B40A 2I3VA 2IA4A 3K1NA 2XX8A 2PT1A 2DWJA 2PMSA 3H6VA 1SYIA 3QIMA 3T22A 3PU5A 1Y4TA 2XD2A 3FVNA 5CM6A 1PBQA 3T9XB 5L8DA 3N6UA 3CI8A 1SI1A 2BJJX 4KCCA 4QFKA 5I58B 5M2VA 3HPIA 3M3LA 3QUFA 1Z7NE 2XXTA 3AXFA 5CMKA 3K01A 3MUQA 3V83A 4C1UA 4MH5A 4R9FA 4ELRA 4KCDA 3SEWA 1LCFA 2ONSA 5FHNA 3W9WA 4ZEBA 3C33A 3VE1B 4C1TA 1R9LA 3K00A 3PPNA 3THIA 4RY1A 2VP1A 3QYTA 4TLMB 2V3QA 1SI0A 3H7MA 4DE8A 3RY3A 5IAIA 2PX1A 4MF3A 1MDP1 3DELB 2H99A 3DLNA 3M3FA 3PUVE 4H67A 3LC8A 5TP9A 3S4UA 4DZ1A 2Z23A 3VXBA 4JXIA 4JSDA 1A40A 1FQAA 1NNTA 3FVKA 3UIFA 4G68A 3RGYA 1B5JA 2I48A 4NWDA 4R6KA 2H4IA 5TU0A 5KDTB 2DWAA 3RPWA 4O3BA 4F2QA 1B0LA 3CVGA 3FJ7A 5TP9B 3K2DA 2QS3A 4K3FA 5L9OA 1NNFA 2ZYOA 3U1OA 3D4GA 3MQ9A 1QUIA 4PFTA 1OLCA 3BBRA 4G68B 4OMBA 3TTMA 4NTLA 3Q27A 4FIMA 1MDQA 4Q0CA 1WODA 4X48A 2HAVA 5KDTA 5H8HA 1SYHA 2RINA 2ZYKA 3G3GA 3G7WA 4KQPA 4F29A 4BDNA 2I49A 4ZDMA 1B2HA 1IXIA 4QFLA 3VLUA 1ELJA 2UVIA 3QUJA 4OFJA 3TELA 2XXUA 1B7ZA 1LBBA 1S7YA 3FXRA 1H45A 4OXVA 4ZECA 4HW8A 3C32A 4O3CA 4DLDA 5KCJA 3C4MA 5I2NB 1LFHA 1ZJLA 4FAJA 3E4RA 3GLBA 3S9LC 1XVYA 1OLAA 2O69A 2XXWA 3F11A 2UVJA 3E13X 1JEUA 2FA7A 3FIRA 2G93A 4OFLA 4Z0IA 1MRPA 2WKYA 5TPAA 3RTWB 1B9JA 3MPKA 4R74A 4YKKA 2B65A 3CRBA 3QAXA 4GOTA 3LR1A 4GL8A 4IO5A 4NF6B 4YU0A 3G3KA 5L9SA 4JWXA 4I8CA 2I0CA 1B0HA 1MQHA 1PB8A 2F78A 2GHBA 4POWA 4R2FA 4AQ4A 3GBAA 3CSGA 3TUSA 4PFUA 4R75A 1WVJA 2Q8JA 1DOTA 3IOVA 3PD9A 4KYEA 3ILTB 1JQFA 4KYDA 4PETA 4TLLB 3OELA 1BTJA 1MY4A 2F5XA 3FATA 1NMUA 2NWJA 4F3BA 1FQFA 3LBSA 4QSDA 1EZPA 1GGGA 1R1NA 5B7DA 1IITA 2UYFA 1URSA 5I84A 3I3VA 1GTKA 2VGQA 3UORA 1FTMA 3H6TA 4POXA 3B6WA 3C36A 5H8QA 3ZSFA 1ZKBA 1Y20A 2V3TA 4FORA 3TKDA 2QPQA 4F19A 1Y3NA 1MY2A 3D4CA 4OZ9A 2X7PA 5JTYB 1LBCA 3FXUA 1N3XA 2Y7KA 5AA4B 1H76A 1DPPA 5F1QA 3TTRA 3KGCA 4IGTA 4U4XA 2FYIA 3FGSA 3T9VA 1US4A 4ZEKA 3VVEA 4MLVA 4LZ5A 3RTFB 4Q8RA 5I2NA 1A8FA 3MW0A 4M4GA 4F1UA 5I56A 2REJA 1B3GA 1IXHA 5AA1A 5IKBA 1MPDA 2YLNA 3TZAA 3M3KA 4NF4A 3TFLA 3TTNA 3Q26A 3OO9A 3OSRA 4OESA 1ZMGA 1H44A 2ALUA 4PFWA 5F7VA 2XXVA 1LB8A 1P1OA 4NF5A 2O1LA 1IUDA 3MPLA 3PMVA 4WXJA 4IB2A 3PMXA 4DDDA 3OSQA 1FTOA 1Y1ZA 4F3SA 3S9NC 3SEXA 4L17A 3CFLA 5ITOA 1EZ9A 1LLSA 4LA9A 1AOVA 1TT1A 4GFRA 4LQ5A 4R73A 2QJEA 4M1VA 3TYHA 4QSCA 3L6HA 1N7XA 4ZEFA 4LATA 1L5TA 4F31B 2G29A 4X1BA 2H5YA 5CI5A 3EHSA 2ABHA 1MXUA 4I9DA 4YZZA 3WAEA 1ZU0A 2RCAA 3T9HB 1HSEA 3EPEA 4DXBA 1SD3A 3TDJA 4ESXA 1B5IA 3S2VA 4U1ZA 2HZKA 4OENA 4YAHX 3K4UA 2D21A 2XX7A 4PFYA 1O64A 2I4BA 2O84X 2QMWA 2D5WA 1B46A 4U2RA 3TPAA 5I58A 1EZOA 2OWSA 4I1DA 4F3PA 3T66A 3TTKA 4RYAA 1B4ZA 4F22A 3RT6B 2Q88A 2Q9TA 2Y7IA 4H5GA 4BDOA 1MXXA 3C34A 1SW2A 1QUJA 2RCBA 3IAZA 3OEKA 1B32A 1FTLA 5I57B 1JW1A 3KZGA 3I6VA 2QS2A 1Y9UA 4F2OA 2W7YA 2O1MA 5CMBA 4E0WA 1USYH 4ZS9A 4XKQA 2ZNUA 3HHGA 3IK6B 1R9QA 1SW4A 1I6BA 2IEEA 1FTJA 2X7QA 2ONRA 1SW5A 3N6TA 4GF8A 2I58A 2XXRA 3E3KA 3PPRA 4GLIA 1F9BA 1MS7A 2Z8DA 4GIZA 3V89B 2I6EA 1LCTA 3CFXA 2HCAA 4QHQA 1VSOA 4F1VA 3U92A 4F3GA 3KJTA 5FHMA 3OENA 1NH7A 3TQWA 2GRVA 2PBWA 2QL3A 2F6PA 4XIGQ 1FTKA 3M8UA 5AA2D 1B7HA 1BP5A 1HSLA 2V3UA 4ZZEA 4QFOA 2HEUA 3MZBA 3IR1A 2THIA 4X1DA 4MFIA 4H5FA 1T0KA 2F7AA 1N0TA 2XXXA 3EF7A 1MXYA 4YKPA 3OOAA 2F97A 1O63A 4WEDA 3O2AA 3CG3A 2A5TB 3MAMA 2DS9A 1P1UA 4QF9A 2QS1A 4BDLA 2E1SA 4ZE9A 3MVYA 3PUZE 2Q2AA 2O51A 2F6GA 2AIXA 1FQCA 1LAGE 2DE4A 1M5EA 3A09A 3O6HA 1TXFA 1OVTA 4NEDA 4YB7A 5ICTA 1NNKA 1GVCA 3IJOB 1YAEA 1B6HA 1B05A 1LGBC 3G3JA 3CG1A 1LFGA 3IO4A 3K6VA 3KN3A 2ANJA 2LAOA 2I3WA 3FZVA 3KOSA 4QFPA 5H8NA 4IGRA 1PDAA 3PMWA 3SDFA 2P2AA 2F35A 1POY1 2HAUA 4LUBA 3EN3A 3JYRA 3PUXE 1US5A 3O66A 4YKIA 1LAHE 3JV9A 4XKPA 5EHSA 3DM0A 1MH4A 1MM6A 4GQOA 4ND9A 4P11A 1RKMA 3TQLA 1IQ7A 1XT8A 1B3LA 2ZMBA 3TODA 3PPOA 2VOZA 2HQ0A 1JVYA 1O7TA 1P1NA 4NF5B 4OTEA 4G68C 4OETA 2PT2A 4BDQA 5JTYA 1QW0A 4U4SA 3O6IA 2DVCA 3SKPA 3T96B 4THIA 3BKIB 4F39A 1B3HA 3VVFA 4EXKA 1B58A 1M5FA 2GHAA 3CR9A 2F7BA 2QS4A 2UYEA 2CMOA 3ZS6A 1BIYA 4EUOA 4HS7A 3VDFA 4ESWA 3MVWA 1N3WA 2NUVA 2X26A 2OBGA 1MG1A 1WDNA 3DP4A 3IB0A 4KI0E 3EHUA 3RN8A 5L9MA 1DPEA 2QMXA 3H6WA 1OQHA 4JSOA 4IO3A 4U21A 1FQDA 1Y4CA 1OMPA 1R6ZA 3GZGA 3B7DA 4LVQA 3K6WA 3QSLA 3ILUB 4YICA 2M8CA 4NMYA 4RK9A 2REGA 2QSXA 3ZKLA 3TCGA 4ELOA 1FQBA 1XC1A 3CIJA 4PE5B 2A5SA 1NL5A 2VD2A 3KBRA 4KR5A 4ELPA 3UN6A 2DOJA 3KFMA 5JK4A 4FEDA 1JW5A 3KG2A 1A55A 5TPAB 1NH8A 2DVZA 4ONYA 1I6QA 1Y1MA 2Z8EA 4Q5TA 5H8FB 1FW0A 1S9TA 3KSXA 3V5AA 4BDMA 4EDPA 3SERA 5BWJA 2ZNSA 2Y7PA 4OEVA 5JEIA 3T9UA 2UXAA 4LONB 1AH5A 1B51A 2I4CA 2YPNA 3ECRA 1IIWA 2DWIA 2XXPA 3B6QA 3MWBA 3RQTA 5A5XB 1ZLQA 2OCUA 3H06B 3LUYA 4RXLA 4EXLA 5EYFA 1AIVA 1LSTA 4EQ9A 5CC2A 2O6AA 4BLAA 1MQJA 2V84A 5ISUA 1OIBA 3OEMA 4QSEA 3OO7A 4IY5A 2OWTA 1P99A 2Y7WA 3G3HA 3V8XB 1Y3QA 2RC8A 3C31A 4OVJA 4QRZA 2DE3A 3U93A 3UA8A 4F1YA 1IEJA 1MY0A 3ZKKA 1XOCA 5CMMA 3HN0A 2DE2A 1AL3A 1QJMA 3FJGA 3H03A 3N5LA 3T93B 4DCYA 3L6GA 1XVXA 1NNPA 1N04A 2RC9A 1ZIUA 4KFQA 1RYOA 2Q2CA 3MVZA 1ZBMA 2AYSA 4U22A 4XKNA 3RUMA 5DEXB 3OMBA 5AA3A 5J1DA 3FD3A 1Q35A 4FEBA 4NF8B 4RPOA 1SBPA 2A5TA 5DVJA 3HCQA 3SEVA 1H43A 1A7LA 4GXAA 2O7IA 3S9EA 2NXOA 3MC2A 5I2KB 1MPBA 3FXQA 4OEUA 4XXUA 2PVUA 4G2ZA 4OERA 3C9HA 1MXWA 4NF4B 4UACA 5DEXA 4NE4A 5DVFA 1VE4A 2RKMA 2ZNTA 3U8QA 5AE4A 1MQGA 1DTZA 4GRKA 1QKAA 2I0BA 2DYXA 2H98A 2OZZA 3K0VA 2UVGA 3PPPA 5K2YA 1JEVA 5ELVA 3OO6A 1N84A 4R72A 1OVBA 4G4PA 4RJZA 3G3IA 3LSLA 4EF1A 5H8FA 2DXRA 1MH3A 2ESNA 5BUUA 1ATGA 1VFEA 1IZ1A 4IO4A 4OYVA 4DXUA 3MP6A 3U72A 3ODBA 5A5XA 4MBPA 2E0SA 4G8NA 3K1MA 4YMAA 2ZXTA 4Q30B 3MZ9A 3R7XA 3MBPA 3U94A 2XXYA 3O97A 1AMFA 1NFTA 2OK2A 4GXSB 3MP8A 2PYYA 4UA8A 1DTGA 3Q29A 4G77A 2OLBA 1IXGA 1HSJA 1MY1A 2R6GE 3DP8A 4KD5A 4OHNA 3K6UA 1DMBA 5CRYA 3KSJA 1BKAA 3G3FA 3MVXA 1B3EA 4N13A 3FUZA 3OD7A 1SQYA 4C0RA 3O29A 1XHYA 3QK6A 2H9BA 3K02A 1MQIA 3PUYE 4KPTA 4NF8A 3RLFE 4NWCA 4X9TA 1URDA 2Y7RA 2Y84A 3EQ1A 2DXYA 3P7IA 4R6HA 3KJ7A 1YPNA 3R6UA 4YB6A 2F36A 2VD3A 1M5BA 4FE8A 4R9GA 5H8QB 3VVDA 5H8NB 1MQDA 1VR5A 3FASA 3IJXB 4JBZA 1PC3A 2YJPA 3DP6A 4YKJA 4N6PA 5FHOA 5KCJB 1VFDA 5I2KA 3IORA 1J1NA 3MJNA 4IO2A 4YB5A 1KWHA 1QULA 4YMBA 4N07A 3LSXA 1CE2A 3Q25A 3H4ZA 5FTHA 5LOMA 1P1QA 1B1HA 4MLQA 4NF6A 2DP8A 4FATA 1S50A 3PPQA 4DIGA 1B5HA 1H3DA 1URGA 3W9VA 4JWYA 3EHTA 1Y3PA 3VLVA 2B3BA 2XX9A 1B7UA 3N26A 4GWOA 5HBCA 1I6AA 1M5DA 2P1SA 3K6XA 3O6GA 4TQUQ 5HPQA 5EHMA 1JNFA 4EQBA 1JVXA 2CZLA 1XS5A 3ONMA 4OFOA 4TOZA 2XD3A 1GR2A 2GH9A 2V25A 4O3AA 1UQWA 2ONKE 4EQ7A 4ZEIA 3KEIA 1I69A 3A3CA 3OXNA 4LZ8A 4WKMA 1DSNA 4KYSA 3SETA 2R71A 5AA2B 3VLWA 4U1OA 1LAFE 3A3UA 3CSBA 1YCJA 3O9PA 1D9YA 4JWOA 1QKBA 4LQ2A 3H6UA 5K2XA 3UGWA 4JB7A 4ECFA 3IOUA 2D3IA 3PV0E 1PB9A 2UVHA 1FQEA 1SDXA 4GD5A 4H6DA 3WAFA 4Z7EA 1D3KA 3GBBA 1B3FA 1PEBA 3O28A 1OQGA 5KZTA 2QRYA 3PD8A 1A8EA 2RF1A 2XHDA 2F8DA 3Q28A 4H8IA 4QFNA 3TCHA 4BDRA 4IO7A 2B3FA 2ZYNA 1N7WA 4IY6A 5H8HB 3HHFA 4AB6A 4XKRA 5ITPA 1D9VA 1QUKA 1P1WA 1TFAA 2NOOA 3FJMA 5I56B 3TEPA 2Q89A 1RYXA 4H65A 1SVXB 3R26A 4OQOA 4AB5A 4LZ7A 4KHZE 4H0WA 5HM4B 4R6YA 5I59A 3LSFB 2FNCA 4HTGA 1NKXA 4ZE8A 4U23A 3B6TA 5DTBA 3VV5A 3UK4A 3IB1A 1CB6A 1TFDA 3FVGA 1SW1A 4EF2A 3VXCA 2NVUB 2AL4A 1EH3A 1POTA 4P0GA 1MM7A 5DVIA 1MXZA 1MY3A 1USYE 4PQJA 1JW4A 2F34A 5CMCA 3UP9A 3MP1A 3PUWE 1GV8A 5CBSA 4E0XA 3I5OA 2HFBA 3MZ1A 1A99A 5AA2A 1UTHA 1LB9A 2Z22A 5B70A 4IO6A 1N76A 3BFTA 1UTBA 3IL1B 3K1PA 3OO8A 3KN8A 4P0IA 1B52A 5DT6A 3RT8A 4F18A 4XTCQ 4G8HA 3SESA 2Z8FA 2XXHA 3RNNA 1Z7ME 3C35A 1IXCA 4ZEDA 2DSFA 1YTVA 4HCYA 4ELQA 3FV2A 4OWDA 1UIUA 1BLFA 1PBPA 2OJTA 4GVOA 1Q1KA 5I57A 3USDA 1D4NA 3SEUA 3TCFA 3HSTA 3JZJA 2HXWA 3PGFA 4H1XA 5I59B 2F7CA 4G8MA 4R2BA 1ANFA 3TTLA 4DXCA 4ISUA 3IO6A 3FVOA 4RPNA 1II5A 3H3GA 4WEPA 3IX1A 1A54A 4FJPA 3FV1A 3LSWA 1LAXA 1UIVA 3QXMA 4JDFA 3W15C 3HV1A 1JETA 3KN7A 1B1XA 4H8JA 3TAJA 1B4HA 1TWYA 2DWHA 4PP0A 5H8SA 2AL5A 2VHAA 1LFIA 3CFZA 5DYHA 4ZZAA 3SEYA 5FTIA 3GXAA 3IOWA 5ICQA 4RK2A 1M5CA 3E9XA 2DQVA 4RA1A 4LP2B 2HZLA 3KOTA 1QVSA 3VFJA 3IOTA 1PB7A 2O7UA 2XXIA 3N94A 1MPCA 4I62A 2KLFA 1EU8A 4RNSA 3BFUA 1UTBB 2O68A 2R9JA 2XXQA 2RC7A 2ZYMA 2H25A 2P0SA 4FECA 3TMGA 4DCXA 5CBRA 1UTHB 1MXVA 2V93A 4GL0A 4HCWA 1ZTYA 1FCKA 3S9MC 2GFEA 3HO7A 5AA4A 3IB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B40 A;  2I3V A;  2IA4 A;  3K1N A;  2XX8 A;  2PT1 A;  2DWJ A;  2PMS A;  3H6V A;  1SYI A;  3QIM A;  3T22 A;  3PU5 A;  1Y4T A;  2XD2 A;  3FVN A;  5CM6 A;  1PBQ A;  3T9X B;  5L8D A;  3N6U A;  3CI8 A;  1SI1 A;  2BJJ X;  4KCC A;  4QFK A;  5I58 B;  5M2V A;  3HPI A;  3M3L A;  3QUF A;  1Z7N E;  2XXT A;  3AXF A;  5CMK A;  3K01 A;  3MUQ A;  3V83 A;  4C1U A;  4MH5 A;  4R9F A;  4ELR A;  4KCD A;  3SEW A;  1LCF A;  2ONS A;  5FHN A;  3W9W A;  4ZEB A;  3C33 A;  3VE1 B;  4C1T A;  1R9L A;  3K00 A;  3PPN A;  3THI A;  4RY1 A;  2VP1 A;  3QYT A;  4TLM B;  2V3Q A;  1SI0 A;  3H7M A;  4DE8 A;  3RY3 A;  5IAI A;  2PX1 A;  4MF3 A;  1MDP 1;  3DEL B;  2H99 A;  3DLN A;  3M3F A;  3PUV E;  4H67 A;  3LC8 A;  5TP9 A;  3S4U A;  4DZ1 A;  2Z23 A;  3VXB A;  4JXI A;  4JSD A;  1A40 A;  1FQA A;  1NNT A;  3FVK A;  3UIF A;  4G68 A;  3RGY A;  1B5J A;  2I48 A;  4NWD A;  4R6K A;  2H4I A;  5TU0 A;  5KDT B;  2DWA A;  3RPW A;  4O3B A;  4F2Q A;  1B0L A;  3CVG A;  3FJ7 A;  5TP9 B;  3K2D A;  2QS3 A;  4K3F A;  5L9O A;  1NNF A;  2ZYO A;  3U1O A;  3D4G A;  3MQ9 A;  1QUI A;  4PFT A;  1OLC A;  3BBR A;  4G68 B;  4OMB A;  3TTM A;  4NTL A;  3Q27 A;  4FIM A;  1MDQ A;  4Q0C A;  1WOD A;  4X48 A;  2HAV A;  5KDT A;  5H8H A;  1SYH A;  2RIN A;  2ZYK A;  3G3G A;  3G7W A;  4KQP A;  4F29 A;  4BDN A;  2I49 A;  4ZDM A;  1B2H A;  1IXI A;  4QFL A;  3VLU A;  1ELJ A;  2UVI A;  3QUJ A;  4OFJ A;  3TEL A;  2XXU A;  1B7Z A;  1LBB A;  1S7Y A;  3FXR A;  1H45 A;  4OXV A;  4ZEC A;  4HW8 A;  3C32 A;  4O3C A;  4DLD A;  5KCJ A;  3C4M A;  5I2N B;  1LFH A;  1ZJL A;  4FAJ A;  3E4R A;  3GLB A;  3S9L C;  1XVY A;  1OLA A;  2O69 A;  2XXW A;  3F11 A;  2UVJ A;  3E13 X;  1JEU A;  2FA7 A;  3FIR A;  2G93 A;  4OFL A;  4Z0I A;  1MRP A;  2WKY A;  5TPA A;  3RTW B;  1B9J A;  3MPK A;  4R74 A;  4YKK A;  2B65 A;  3CRB A;  3QAX A;  4GOT A;  3LR1 A;  4GL8 A;  4IO5 A;  4NF6 B;  4YU0 A;  3G3K A;  5L9S A;  4JWX A;  4I8C A;  2I0C A;  1B0H A;  1MQH A;  1PB8 A;  2F78 A;  2GHB A;  4POW A;  4R2F A;  4AQ4 A;  3GBA A;  3CSG A;  3TUS A;  4PFU A;  4R75 A;  1WVJ A;  2Q8J A;  1DOT A;  3IOV A;  3PD9 A;  4KYE A;  3ILT B;  1JQF A;  4KYD A;  4PET A;  4TLL B;  3OEL A;  1BTJ A;  1MY4 A;  2F5X A;  3FAT A;  1NMU A;  2NWJ A;  4F3B A;  1FQF A;  3LBS A;  4QSD A;  1EZP A;  1GGG A;  1R1N A;  5B7D A;  1IIT A;  2UYF A;  1URS A;  5I84 A;  3I3V A;  1GTK A;  2VGQ A;  3UOR A;  1FTM A;  3H6T A;  4POX A;  3B6W A;  3C36 A;  5H8Q A;  3ZSF A;  1ZKB A;  1Y20 A;  2V3T A;  4FOR A;  3TKD A;  2QPQ A;  4F19 A;  1Y3N A;  1MY2 A;  3D4C A;  4OZ9 A;  2X7P A;  5JTY B;  1LBC A;  3FXU A;  1N3X A;  2Y7K A;  5AA4 B;  1H76 A;  1DPP A;  5F1Q A;  3TTR A;  3KGC A;  4IGT A;  4U4X A;  2FYI A;  3FGS A;  3T9V A;  1US4 A;  4ZEK A;  3VVE A;  4MLV A;  4LZ5 A;  3RTF B;  4Q8R A;  5I2N A;  1A8F A;  3MW0 A;  4M4G A;  4F1U A;  5I56 A;  2REJ A;  1B3G A;  1IXH A;  5AA1 A;  5IKB A;  1MPD A;  2YLN A;  3TZA A;  3M3K A;  4NF4 A;  3TFL A;  3TTN A;  3Q26 A;  3OO9 A;  3OSR A;  4OES A;  1ZMG A;  1H44 A;  2ALU A;  4PFW A;  5F7V A;  2XXV A;  1LB8 A;  1P1O A;  4NF5 A;  2O1L A;  1IUD A;  3MPL A;  3PMV A;  4WXJ A;  4IB2 A;  3PMX A;  4DDD A;  3OSQ A;  1FTO A;  1Y1Z A;  4F3S A;  3S9N C;  3SEX A;  4L17 A;  3CFL A;  5ITO A;  1EZ9 A;  1LLS A;  4LA9 A;  1AOV A;  1TT1 A;  4GFR A;  4LQ5 A;  4R73 A;  2QJE A;  4M1V A;  3TYH A;  4QSC A;  3L6H A;  1N7X A;  4ZEF A;  4LAT A;  1L5T A;  4F31 B;  2G29 A;  4X1B A;  2H5Y A;  5CI5 A;  3EHS A;  2ABH A;  1MXU A;  4I9D A;  4YZZ A;  3WAE A;  1ZU0 A;  2RCA A;  3T9H B;  1HSE A;  3EPE A;  4DXB A;  1SD3 A;  3TDJ A;  4ESX A;  1B5I A;  3S2V A;  4U1Z A;  2HZK A;  4OEN A;  4YAH X;  3K4U A;  2D21 A;  2XX7 A;  4PFY A;  1O64 A;  2I4B A;  2O84 X;  2QMW A;  2D5W A;  1B46 A;  4U2R A;  3TPA A;  5I58 A;  1EZO A;  2OWS A;  4I1D A;  4F3P A;  3T66 A;  3TTK A;  4RYA A;  1B4Z A;  4F22 A;  3RT6 B;  2Q88 A;  2Q9T A;  2Y7I A;  4H5G A;  4BDO A;  1MXX A;  3C34 A;  1SW2 A;  1QUJ A;  2RCB A;  3IAZ A;  3OEK A;  1B32 A;  1FTL A;  5I57 B;  1JW1 A;  3KZG A;  3I6V A;  2QS2 A;  1Y9U A;  4F2O A;  2W7Y A;  2O1M A;  5CMB A;  4E0W A;  1USY H;  4ZS9 A;  4XKQ A;  2ZNU A;  3HHG A;  3IK6 B;  1R9Q A;  1SW4 A;  1I6B A;  2IEE A;  1FTJ A;  2X7Q A;  2ONR A;  1SW5 A;  3N6T A;  4GF8 A;  2I58 A;  2XXR A;  3E3K A;  3PPR A;  4GLI A;  1F9B A;  1MS7 A;  2Z8D A;  4GIZ A;  3V89 B;  2I6E A;  1LCT A;  3CFX A;  2HCA A;  4QHQ A;  1VSO A;  4F1V A;  3U92 A;  4F3G A;  3KJT A;  5FHM A;  3OEN A;  1NH7 A;  3TQW A;  2GRV A;  2PBW A;  2QL3 A;  2F6P A;  4XIG Q;  1FTK A;  3M8U A;  5AA2 D;  1B7H A;  1BP5 A;  1HSL A;  2V3U A;  4ZZE A;  4QFO A;  2HEU A;  3MZB A;  3IR1 A;  2THI A;  4X1D A;  4MFI A;  4H5F A;  1T0K A;  2F7A A;  1N0T A;  2XXX A;  3EF7 A;  1MXY A;  4YKP A;  3OOA A;  2F97 A;  1O63 A;  4WED A;  3O2A A;  3CG3 A;  2A5T B;  3MAM A;  2DS9 A;  1P1U A;  4QF9 A;  2QS1 A;  4BDL A;  2E1S A;  4ZE9 A;  3MVY A;  3PUZ E;  2Q2A A;  2O51 A;  2F6G A;  2AIX A;  1FQC A;  1LAG E;  2DE4 A;  1M5E A;  3A09 A;  3O6H A;  1TXF A;  1OVT A;  4NED A;  4YB7 A;  5ICT A;  1NNK A;  1GVC A;  3IJO B;  1YAE A;  1B6H A;  1B05 A;  1LGB C;  3G3J A;  3CG1 A;  1LFG A;  3IO4 A;  3K6V A;  3KN3 A;  2ANJ A;  2LAO A;  2I3W A;  3FZV A;  3KOS A;  4QFP A;  5H8N A;  4IGR A;  1PDA A;  3PMW A;  3SDF A;  2P2A A;  2F35 A;  1POY 1;  2HAU A;  4LUB A;  3EN3 A;  3JYR A;  3PUX E;  1US5 A;  3O66 A;  4YKI A;  1LAH E;  3JV9 A;  4XKP A;  5EHS A;  3DM0 A;  1MH4 A;  1MM6 A;  4GQO A;  4ND9 A;  4P11 A;  1RKM A;  3TQL A;  1IQ7 A;  1XT8 A;  1B3L A;  2ZMB A;  3TOD A;  3PPO A;  2VOZ A;  2HQ0 A;  1JVY A;  1O7T A;  1P1N A;  4NF5 B;  4OTE A;  4G68 C;  4OET A;  2PT2 A;  4BDQ A;  5JTY A;  1QW0 A;  4U4S A;  3O6I A;  2DVC A;  3SKP A;  3T96 B;  4THI A;  3BKI B;  4F39 A;  1B3H A;  3VVF A;  4EXK A;  1B58 A;  1M5F A;  2GHA A;  3CR9 A;  2F7B A;  2QS4 A;  2UYE A;  2CMO A;  3ZS6 A;  1BIY A;  4EUO A;  4HS7 A;  3VDF A;  4ESW A;  3MVW A;  1N3W A;  2NUV A;  2X26 A;  2OBG A;  1MG1 A;  1WDN A;  3DP4 A;  3IB0 A;  4KI0 E;  3EHU A;  3RN8 A;  5L9M A;  1DPE A;  2QMX A;  3H6W A;  1OQH A;  4JSO A;  4IO3 A;  4U21 A;  1FQD A;  1Y4C A;  1OMP A;  1R6Z A;  3GZG A;  3B7D A;  4LVQ A;  3K6W A;  3QSL A;  3ILU B;  4YIC A;  2M8C A;  4NMY A;  4RK9 A;  2REG A;  2QSX A;  3ZKL A;  3TCG A;  4ELO A;  1FQB A;  1XC1 A;  3CIJ A;  4PE5 B;  2A5S A;  1NL5 A;  2VD2 A;  3KBR A;  4KR5 A;  4ELP A;  3UN6 A;  2DOJ A;  3KFM A;  5JK4 A;  4FED A;  1JW5 A;  3KG2 A;  1A55 A;  5TPA B;  1NH8 A;  2DVZ A;  4ONY A;  1I6Q A;  1Y1M A;  2Z8E A;  4Q5T A;  5H8F B;  1FW0 A;  1S9T A;  3KSX A;  3V5A A;  4BDM A;  4EDP A;  3SER A;  5BWJ A;  2ZNS A;  2Y7P A;  4OEV A;  5JEI A;  3T9U A;  2UXA A;  4LON B;  1AH5 A;  1B51 A;  2I4C A;  2YPN A;  3ECR A;  1IIW A;  2DWI A;  2XXP A;  3B6Q A;  3MWB A;  3RQT A;  5A5X B;  1ZLQ A;  2OCU A;  3H06 B;  3LUY A;  4RXL A;  4EXL A;  5EYF A;  1AIV A;  1LST A;  4EQ9 A;  5CC2 A;  2O6A A;  4BLA A;  1MQJ A;  2V84 A;  5ISU A;  1OIB A;  3OEM A;  4QSE A;  3OO7 A;  4IY5 A;  2OWT A;  1P99 A;  2Y7W A;  3G3H A;  3V8X B;  1Y3Q A;  2RC8 A;  3C31 A;  4OVJ A;  4QRZ A;  2DE3 A;  3U93 A;  3UA8 A;  4F1Y A;  1IEJ A;  1MY0 A;  3ZKK A;  1XOC A;  5CMM A;  3HN0 A;  2DE2 A;  1AL3 A;  1QJM A;  3FJG A;  3H03 A;  3N5L A;  3T93 B;  4DCY A;  3L6G A;  1XVX A;  1NNP A;  1N04 A;  2RC9 A;  1ZIU A;  4KFQ A;  1RYO A;  2Q2C A;  3MVZ A;  1ZBM A;  2AYS A;  4U22 A;  4XKN A;  3RUM A;  5DEX B;  3OMB A;  5AA3 A;  5J1D A;  3FD3 A;  1Q35 A;  4FEB A;  4NF8 B;  4RPO A;  1SBP A;  2A5T A;  5DVJ A;  3HCQ A;  3SEV A;  1H43 A;  1A7L A;  4GXA A;  2O7I A;  3S9E A;  2NXO A;  3MC2 A;  5I2K B;  1MPB A;  3FXQ A;  4OEU A;  4XXU A;  2PVU A;  4G2Z A;  4OER A;  3C9H A;  1MXW A;  4NF4 B;  4UAC A;  5DEX A;  4NE4 A;  5DVF A;  1VE4 A;  2RKM A;  2ZNT A;  3U8Q A;  5AE4 A;  1MQG A;  1DTZ A;  4GRK A;  1QKA A;  2I0B A;  2DYX A;  2H98 A;  2OZZ A;  3K0V A;  2UVG A;  3PPP A;  5K2Y A;  1JEV A;  5ELV A;  3OO6 A;  1N84 A;  4R72 A;  1OVB A;  4G4P A;  4RJZ A;  3G3I A;  3LSL A;  4EF1 A;  5H8F A;  2DXR A;  1MH3 A;  2ESN A;  5BUU A;  1ATG A;  1VFE A;  1IZ1 A;  4IO4 A;  4OYV A;  4DXU A;  3MP6 A;  3U72 A;  3ODB A;  5A5X A;  4MBP A;  2E0S A;  4G8N A;  3K1M A;  4YMA A;  2ZXT A;  4Q30 B;  3MZ9 A;  3R7X A;  3MBP A;  3U94 A;  2XXY A;  3O97 A;  1AMF A;  1NFT A;  2OK2 A;  4GXS B;  3MP8 A;  2PYY A;  4UA8 A;  1DTG A;  3Q29 A;  4G77 A;  2OLB A;  1IXG A;  1HSJ A;  1MY1 A;  2R6G E;  3DP8 A;  4KD5 A;  4OHN A;  3K6U A;  1DMB A;  5CRY A;  3KSJ A;  1BKA A;  3G3F A;  3MVX A;  1B3E A;  4N13 A;  3FUZ A;  3OD7 A;  1SQY A;  4C0R A;  3O29 A;  1XHY A;  3QK6 A;  2H9B A;  3K02 A;  1MQI A;  3PUY E;  4KPT A;  4NF8 A;  3RLF E;  4NWC A;  4X9T A;  1URD A;  2Y7R A;  2Y84 A;  3EQ1 A;  2DXY A;  3P7I A;  4R6H A;  3KJ7 A;  1YPN A;  3R6U A;  4YB6 A;  2F36 A;  2VD3 A;  1M5B A;  4FE8 A;  4R9G A;  5H8Q B;  3VVD A;  5H8N B;  1MQD A;  1VR5 A;  3FAS A;  3IJX B;  4JBZ A;  1PC3 A;  2YJP A;  3DP6 A;  4YKJ A;  4N6P A;  5FHO A;  5KCJ B;  1VFD A;  5I2K A;  3IOR A;  1J1N A;  3MJN A;  4IO2 A;  4YB5 A;  1KWH A;  1QUL A;  4YMB A;  4N07 A;  3LSX A;  1CE2 A;  3Q25 A;  3H4Z A;  5FTH A;  5LOM A;  1P1Q A;  1B1H A;  4MLQ A;  4NF6 A;  2DP8 A;  4FAT A;  1S50 A;  3PPQ A;  4DIG A;  1B5H A;  1H3D A;  1URG A;  3W9V A;  4JWY A;  3EHT A;  1Y3P A;  3VLV A;  2B3B A;  2XX9 A;  1B7U A;  3N26 A;  4GWO A;  5HBC A;  1I6A A;  1M5D A;  2P1S A;  3K6X A;  3O6G A;  4TQU Q;  5HPQ A;  5EHM A;  1JNF A;  4EQB A;  1JVX A;  2CZL A;  1XS5 A;  3ONM A;  4OFO A;  4TOZ A;  2XD3 A;  1GR2 A;  2GH9 A;  2V25 A;  4O3A A;  1UQW A;  2ONK E;  4EQ7 A;  4ZEI A;  3KEI A;  1I69 A;  3A3C A;  3OXN A;  4LZ8 A;  4WKM A;  1DSN A;  4KYS A;  3SET A;  2R71 A;  5AA2 B;  3VLW A;  4U1O A;  1LAF E;  3A3U A;  3CSB A;  1YCJ A;  3O9P A;  1D9Y A;  4JWO A;  1QKB A;  4LQ2 A;  3H6U A;  5K2X A;  3UGW A;  4JB7 A;  4ECF A;  3IOU A;  2D3I A;  3PV0 E;  1PB9 A;  2UVH A;  1FQE A;  1SDX A;  4GD5 A;  4H6D A;  3WAF A;  4Z7E A;  1D3K A;  3GBB A;  1B3F A;  1PEB A;  3O28 A;  1OQG A;  5KZT A;  2QRY A;  3PD8 A;  1A8E A;  2RF1 A;  2XHD A;  2F8D A;  3Q28 A;  4H8I A;  4QFN A;  3TCH A;  4BDR A;  4IO7 A;  2B3F A;  2ZYN A;  1N7W A;  4IY6 A;  5H8H B;  3HHF A;  4AB6 A;  4XKR A;  5ITP A;  1D9V A;  1QUK A;  1P1W A;  1TFA A;  2NOO A;  3FJM A;  5I56 B;  3TEP A;  2Q89 A;  1RYX A;  4H65 A;  1SVX B;  3R26 A;  4OQO A;  4AB5 A;  4LZ7 A;  4KHZ E;  4H0W A;  5HM4 B;  4R6Y A;  5I59 A;  3LSF B;  2FNC A;  4HTG A;  1NKX A;  4ZE8 A;  4U23 A;  3B6T A;  5DTB A;  3VV5 A;  3UK4 A;  3IB1 A;  1CB6 A;  1TFD A;  3FVG A;  1SW1 A;  4EF2 A;  3VXC A;  2NVU B;  2AL4 A;  1EH3 A;  1POT A;  4P0G A;  1MM7 A;  5DVI A;  1MXZ A;  1MY3 A;  1USY E;  4PQJ A;  1JW4 A;  2F34 A;  5CMC A;  3UP9 A;  3MP1 A;  3PUW E;  1GV8 A;  5CBS A;  4E0X A;  3I5O A;  2HFB A;  3MZ1 A;  1A99 A;  5AA2 A;  1UTH A;  1LB9 A;  2Z22 A;  5B70 A;  4IO6 A;  1N76 A;  3BFT A;  1UTB A;  3IL1 B;  3K1P A;  3OO8 A;  3KN8 A;  4P0I A;  1B52 A;  5DT6 A;  3RT8 A;  4F18 A;  4XTC Q;  4G8H A;  3SES A;  2Z8F A;  2XXH A;  3RNN A;  1Z7M E;  3C35 A;  1IXC A;  4ZED A;  2DSF A;  1YTV A;  4HCY A;  4ELQ A;  3FV2 A;  4OWD A;  1UIU A;  1BLF A;  1PBP A;  2OJT A;  4GVO A;  1Q1K A;  5I57 A;  3USD A;  1D4N A;  3SEU A;  3TCF A;  3HST A;  3JZJ A;  2HXW A;  3PGF A;  4H1X A;  5I59 B;  2F7C A;  4G8M A;  4R2B A;  1ANF A;  3TTL A;  4DXC A;  4ISU A;  3IO6 A;  3FVO A;  4RPN A;  1II5 A;  3H3G A;  4WEP A;  3IX1 A;  1A54 A;  4FJP A;  3FV1 A;  3LSW A;  1LAX A;  1UIV A;  3QXM A;  4JDF A;  3W15 C;  3HV1 A;  1JET A;  3KN7 A;  1B1X A;  4H8J A;  3TAJ A;  1B4H A;  1TWY A;  2DWH A;  4PP0 A;  5H8S A;  2AL5 A;  2VHA A;  1LFI A;  3CFZ A;  5DYH A;  4ZZA A;  3SEY A;  5FTI A;  3GXA A;  3IOW A;  5ICQ A;  4RK2 A;  1M5C A;  3E9X A;  2DQV A;  4RA1 A;  4LP2 B;  2HZL A;  3KOT A;  1QVS A;  3VFJ A;  3IOT A;  1PB7 A;  2O7U A;  2XXI A;  3N94 A;  1MPC A;  4I62 A;  2KLF A;  1EU8 A;  4RNS A;  3BFU A;  1UTB B;  2O68 A;  2R9J A;  2XXQ A;  2RC7 A;  2ZYM A;  2H25 A;  2P0S A;  4FEC A;  3TMG A;  4DCX A;  5CBR A;  1UTH B;  1MXV A;  2V93 A;  4GL0 A;  4HCW A;  1ZTY A;  1FCK A;  3S9M C;  2GFE A;  3HO7 A;  5AA4 A;  3IB2 A; 
#chains in the Genus database with same CATH topology
 2PT1 A;  2DWJ A;  1SYI A;  3FVN A;  3QUF A;  1YYZ A;  2XXT A;  3K01 A;  4PAI A;  4C1U A;  4MH5 A;  2ONS A;  5FHN A;  4ZEB A;  3VE1 B;  2VP1 A;  3RY3 A;  1MDP 1;  3DEL B;  2H99 A;  3VXB A;  4JXI A;  2XWV A;  1B5J A;  4AS5 A;  2DWA A;  3RPW A;  2QS3 A;  4K3F A;  1NNF A;  3MQ9 A;  1OLC A;  1D9Q A;  1FBF A;  4FIM A;  1WOD A;  2ZYK A;  1B2H A;  3VLU A;  4OFJ A;  3FXR A;  4HW8 A;  4DLD A;  5I2N B;  4FAJ A;  3GLB A;  1XVY A;  2UVJ A;  1JEU A;  4OFL A;  3FIR A;  2G93 A;  4Z0I A;  1MRP A;  3FXB A;  4OA4 A;  3RTW B;  4F39 A;  5KCJ B;  3TZA A;  4NF6 B;  4GOT A;  4IO5 A;  1FTA A;  3G3K A;  4POW A;  1B0H A;  1MQH A;  1PB8 A;  4R75 A;  1NV0 A;  4TLL B;  1BTJ A;  1FPG A;  2NWJ A;  2HPG A;  1INP A;  3EKI A;  5B7D A;  1EZP A;  1IIT A;  2UYF A;  2VGQ A;  5H8Q A;  2V3T A;  2X7P A;  1LBC A;  2Y7K A;  5I7I A;  1H76 A;  1DPP A;  3KGC A;  3ROJ A;  4U4X A;  4ZEK A;  5I2N A;  3MW0 A;  2REJ A;  5AA1 A;  1MPD A;  2YLN A;  3M3K A;  1QGX A;  3Q26 A;  4PFW A;  4OES A;  2ALU A;  1YXI A;  3MPL A;  3FBP A;  1FTO A;  2CEY A;  1EZ9 A;  1LLS A;  4M1V A;  4I40 A;  5CI5 A;  1FPB A;  1MXU A;  4I9D A;  4DXB A;  2Y5L A;  4PDH A;  4DI4 B;  4YAH X;  2D21 A;  2O84 X;  1B46 A;  2OWS A;  4I1D A;  4F3P A;  3TTK A;  3RT6 B;  2FIX A;  2Q88 A;  2Q9T A;  1MXX A;  1B32 A;  1FTL A;  2QS2 A;  1Y9U A;  4E0W A;  1USY H;  4MCO A;  3IK6 B;  1I6B A;  2IEE A;  2X7Q A;  3N6T A;  4HE0 A;  4GF8 A;  4MNP A;  1F9B A;  3U92 A;  5A5L A;  3KJT A;  5FHM A;  3OEN A;  2PBW A;  1BP5 A;  4ZZE A;  2XXX A;  1MXY A;  4N6K A;  1O63 A;  3O2A A;  3CG3 A;  2A5T B;  1TXF A;  1GVC A;  1YAE A;  1LGB C;  1NUW A;  3IO4 A;  2LAO A;  5H8N A;  3SDF A;  3TTM A;  4F1Y A;  1NV5 A;  4LUB A;  4XKP A;  1LAH E;  4ND9 A;  3TQL A;  1XT8 A;  3TOD A;  3PPO A;  1JVY A;  4G68 C;  4THI A;  3BKI B;  3VVF A;  1M5F A;  2QS4 A;  3ZS6 A;  4ESW A;  4HS7 A;  2NUV A;  2X26 A;  1WDN A;  2QMX A;  4JSO A;  1OMP A;  4LVQ A;  5LTC A;  4H45 A;  4NMY A;  2REG A;  3ZKL A;  3CIJ A;  2A5S A;  2DOJ A;  3KFM A;  4FED A;  3KG2 A;  1NH8 A;  4ONY A;  4Q5T A;  5H8F B;  1FW0 A;  3V5A A;  3KSX A;  4BDM A;  5BWJ A;  2ZNS A;  4OEV A;  5JEI A;  4LON B;  4MJO A;  1AH5 A;  2XXP A;  3SZP A;  1AIV A;  4EQ9 A;  5CC2 A;  5ISU A;  3OEM A;  2Y7W A;  2XXK A;  2RC8 A;  4QRZ A;  3U93 A;  5CMM A;  2CEX A;  1AL3 A;  3FJG A;  3H03 A;  4O7M A;  3TKD A;  4XKN A;  5DEX B;  5AA3 A;  4P3L A;  1Q35 A;  4RPO A;  5EYG A;  1NUZ A;  5DVJ A;  3SEV A;  1A7L A;  2O7I A;  2NXO A;  5I2K B;  4OEU A;  1SPI A;  2PVU A;  3C9H A;  4NF4 B;  1QKA A;  5ELV A;  4R72 A;  1OVB A;  4HE2 A;  2DXR A;  5BUU A;  1ATG A;  1VFE A;  1IZ1 A;  3ODB A;  4MBP A;  2E0S A;  4G8N A;  4YMA A;  3MZ9 A;  3R7X A;  5F24 A;  4MHF A;  4PBH A;  3Q29 A;  2H9B A;  4X9T A;  1DK4 A;  4P1L A;  1YPN A;  4R9G A;  4YKJ A;  1PC3 A;  2YJP A;  5I2K A;  4IO2 A;  1NUX A;  4N07 A;  2DP8 A;  4FAT A;  3PPQ A;  4DIG A;  1H3D A;  1URG A;  1NV3 A;  1DCU A;  1M5D A;  2P1S A;  5HPQ A;  4OFO A;  4TOZ A;  2XD3 A;  4ZEI A;  1I69 A;  3OXN A;  3VLW A;  3A3U A;  3O9P A;  4QXD A;  5K2X A;  4LQ2 A;  4JB7 A;  4Z7E A;  4H6D A;  3Q28 A;  3TCH A;  2F8D A;  3RPL B;  4AB6 A;  4XKR A;  1D9V A;  3FJM A;  1P1W A;  1FBC A;  4OQO A;  2FNC A;  1NKX A;  1FPE A;  3IB1 A;  1CB6 A;  3FVG A;  2BJI A;  1POT A;  1MY3 A;  1USY E;  2F34 A;  3MP1 A;  3PUW E;  4PF8 A;  2FIE A;  5AA2 A;  4PDD A;  1UTH A;  1LB9 A;  4IO6 A;  3OO8 A;  4P0I A;  5DT6 A;  3KN8 A;  1VDW A;  4GBW A;  2Z8F A;  4N15 A;  3C35 A;  3FV2 A;  4OWD A;  1BLF A;  2OJT A;  1Q1K A;  5I57 A;  1NV7 A;  3HST A;  3IO6 A;  4WEP A;  2Q8M A;  3FV1 A;  3LSW A;  5EQ9 A;  4JDF A;  3TAJ A;  2VHA A;  1LFI A;  5FTI A;  4RK2 A;  3E9X A;  1QVS A;  2XXI A;  3HFU A;  1MPC A;  1Q9D A;  4FEC A;  3BFU A;  2O68 A;  5IZ1 A;  3TMG A;  1UTH B;  4GL0 A;  1ZTY A;  1FCK A;  4YKK A;  5AA4 A;  3H6V A;  3PU5 A;  1Y4T A;  5IGA A;  4LN5 A;  3CI8 A;  4KCC A;  3M3L A;  3AXF A;  5CMK A;  3MUQ A;  3V83 A;  4R9F A;  3SEW A;  2XWO A;  1LCF A;  3K00 A;  4JVC A;  4RY1 A;  2V3Q A;  5IAI A;  3DLN A;  3PUV E;  1NNT A;  1B0L A;  3CVG A;  3FJ7 A;  5TP9 B;  3D4G A;  3BBR A;  4G68 B;  1MDQ A;  4KQP A;  3G3G A;  4BDN A;  2I49 A;  1IXI A;  1ELJ A;  2UVI A;  1S7Y A;  1H45 A;  4OVP A;  3C32 A;  4P56 A;  1LFH A;  3E4R A;  2B4L A;  2WKY A;  3LR1 A;  4YU0 A;  5L9S A;  4I8C A;  2GHB A;  1LBZ A;  3GBA A;  4OAN A;  1WVJ A;  3IOV A;  4KYD A;  3FAT A;  1NMU A;  3LBS A;  1YZ0 A;  4QSD A;  1R1N A;  5I84 A;  3I3V A;  3UOR A;  3LV0 A;  1FTM A;  3H6T A;  5T3J A;  1Y20 A;  1Y3N A;  3D4C A;  5F1Q A;  4IGT A;  3FGS A;  3T9V A;  4FBP A;  4MLV A;  4LZ5 A;  5I56 A;  1LEV A;  5EQA A;  3TTN A;  3OO9 A;  3S9N C;  5F7V A;  1H44 A;  2XXV A;  1P1O A;  2O1L A;  1IUD A;  3PMV A;  3PMX A;  4DDD A;  2WYP A;  4L17 A;  1TT1 A;  4LQ5 A;  1N7X A;  3WAE A;  4ESX A;  3TDJ A;  1B5I A;  3S2V A;  3B8B A;  4OEN A;  4GX3 A;  4PFY A;  1O64 A;  2I4B A;  3TPA A;  1EZO A;  3T66 A;  4F22 A;  4BDO A;  4N81 A;  2WBD A;  3C34 A;  1SW2 A;  4F2O A;  2FHY A;  1R9Q A;  1SW4 A;  1FTJ A;  2ONR A;  2XXR A;  3PPR A;  5ET6 A;  4GLI A;  1MS7 A;  4GIZ A;  5J16 A;  1LCT A;  2HCA A;  4QHQ A;  1RDX A;  1VSO A;  2QL3 A;  2F6P A;  4XIG Q;  4PC9 A;  1FTK A;  2V4C A;  1B7H A;  1HSL A;  2WEF A;  2HEU A;  3IR1 A;  4X1D A;  1T0K A;  4MFI A;  3EF7 A;  4BDL A;  3PUZ E;  2O51 A;  3LUZ A;  3O6H A;  1FPK A;  1NNK A;  3GYY A;  5ET8 A;  1B6H A;  1FRP A;  3K6V A;  3KN3 A;  4QFP A;  2ANJ A;  3PMW A;  2F35 A;  2HAU A;  3EN3 A;  2HHM A;  4YKI A;  5EHS A;  1MH4 A;  1IQ7 A;  2ZMB A;  4N8G A;  4JVD A;  4BDQ A;  4U4S A;  2DVC A;  1B58 A;  2GHA A;  2F7B A;  2UYE A;  4EUO A;  3MVW A;  3T1B A;  2OBG A;  4IR8 A;  3IB0 A;  3DP4 A;  4KI0 E;  3EHU A;  3K6W A;  3ILU B;  2M8C A;  1FQB A;  1NL5 A;  4NG7 A;  1JW5 A;  4MIJ A;  1IMC A;  1Y1M A;  2Z8E A;  2ZZW A;  4PFR A;  3SER A;  1FSA A;  3ECR A;  1IIW A;  3B6Q A;  3LUY A;  4RXL A;  4MNC A;  3V8X B;  4OVJ A;  1IEJ A;  1MY0 A;  2DE2 A;  3N5L A;  3T93 B;  5JTY A;  3SKP A;  3TFL A;  2AYS A;  4U22 A;  5J1D A;  4FEB A;  4NF8 B;  2A5T A;  3S9E A;  1MPB A;  3FXQ A;  4XXU A;  4OER A;  1MXW A;  1MQG A;  1DTZ A;  2OZZ A;  2H98 A;  2UVG A;  3G3I A;  1MH3 A;  1KA0 A;  2ZZV A;  3MP6 A;  5A5X A;  3K1M A;  2ZXT A;  4Q30 B;  3U94 A;  2F3D A;  3MP8 A;  2PYY A;  1IMB A;  4UA8 A;  1DTG A;  4KD5 A;  2OX3 A;  3K6U A;  1DMB A;  4C0R A;  1XHY A;  1LBW A;  1MQI A;  4NF8 A;  3VVD A;  4PAK A;  3DP6 A;  3IOR A;  4YMB A;  1QUL A;  1CE2 A;  3Q25 A;  1P1Q A;  4NF6 A;  2QVR A;  3EHT A;  2XX9 A;  4GWO A;  3K6X A;  1JNF A;  1JVX A;  1XS5 A;  2GH9 A;  2V25 A;  4O3A A;  3D1R A;  4WKM A;  1FPL A;  5AA2 B;  2VPN A;  1YCJ A;  1QKB A;  3PV0 E;  5IZ3 B;  1SDX A;  1B3F A;  3O28 A;  1OQG A;  4H8I A;  1K9Z A;  2ZYN A;  4IY6 A;  5H8H B;  4JVI A;  5ITP A;  2NOO A;  2Q89 A;  4GWS A;  4AB5 A;  3LSF B;  4PF6 A;  4U23 A;  3VV5 A;  1TFD A;  4EF2 A;  1FPF A;  3VXC A;  2NVU B;  2AL4 A;  1EH3 A;  1MXZ A;  2P3V A;  5CBS A;  3I5O A;  2PFY A;  2Z22 A;  5IZ3 A;  1UTB A;  3K1P A;  5I3S A;  3U65 A;  3RNN A;  2DSF A;  1YTV A;  2HXW A;  3TTL A;  4PFI A;  1IMA A;  2CZK A;  3H3G A;  3IX1 A;  3TUS A;  1LAX A;  4MMP A;  4H8J A;  5H8S A;  5DYH A;  2QVV A;  3GXA A;  3IOW A;  4RA1 A;  2HZL A;  3T0J A;  3VFJ A;  2KLF A;  4O94 A;  4RNS A;  1UTB B;  2JJK A;  2ZYM A;  3PTY A;  3KBZ A;  2HXR A;  1MXV A;  2V93 A;  4HCW A;  3S9M C;  3HO7 A;  3IB2 A;  2IA4 A;  2I3V A;  2PMS A;  3QIM A;  3T22 A;  5CM6 A;  1PBQ A;  5L8D A;  2ZZX A;  5I58 B;  5M2V A;  3HPI A;  1Z7N E;  5EYH A;  3C33 A;  1BK4 A;  3PPN A;  3THI A;  4NN3 A;  2PX1 A;  4MF3 A;  4H67 A;  3M3F A;  1EYK A;  2Z23 A;  1A40 A;  1FQA A;  3FVK A;  3UIF A;  3RGY A;  2I48 A;  4NWD A;  2H4I A;  5IM2 A;  4O3B A;  1NI9 A;  5L9O A;  4P8B A;  3U1O A;  4PFT A;  3Q27 A;  5KDT A;  5H8H A;  2RIN A;  3G7W A;  4F29 A;  4ZDM A;  4QFL A;  3TEL A;  1B7Z A;  1LBB A;  4OXV A;  4ZEC A;  5KCJ A;  3C4M A;  5ESY A;  3S9L C;  1OLA A;  2O69 A;  1DBZ A;  3F11 A;  3E13 X;  4HE1 A;  5TPA A;  4GWX A;  1B9J A;  4R74 A;  2B65 A;  3CRB A;  3QAX A;  4GL8 A;  4NAP A;  4PAF A;  1LBX A;  4JWX A;  4AQ4 A;  4G61 A;  3CSG A;  2Q8J A;  4KYE A;  3ILT B;  1JQF A;  4PGN A;  4PET A;  3OEL A;  1MY4 A;  2F5X A;  1GGG A;  4PFB A;  1URS A;  3B6W A;  1MY2 A;  5JTY B;  1N3X A;  4X04 A;  2PFZ A;  3TTR A;  3BIH A;  5I5P A;  4P1E A;  4Q8R A;  1A8F A;  3B50 A;  4M4G A;  1B3G A;  1IXH A;  2FVZ A;  4NF4 A;  3OSR A;  1ZMG A;  1IMD A;  4NF5 A;  4WXJ A;  4IB2 A;  1Y1Z A;  4F3S A;  1EYI A;  2QJE A;  4F31 B;  2P3N A;  2H5Y A;  3MST A;  3EHS A;  4GWU A;  2ABH A;  4YZZ A;  1ZU0 A;  2RCA A;  1AOV A;  1HSE A;  3EPE A;  1SD3 A;  4N4U A;  4U1Z A;  1FPI A;  2QVU A;  2HZK A;  3K4U A;  2XX7 A;  2QMW A;  2D5W A;  4U2R A;  5I58 A;  1B4Z A;  2Y7I A;  4H5G A;  2RCB A;  3IAZ A;  3I6V A;  4P47 A;  2W7Y A;  2O1M A;  5CMB A;  1SW5 A;  1LBY A;  4N91 A;  2Z8D A;  3V89 B;  2I6E A;  3CFX A;  4F3G A;  1K9Y A;  2V3U A;  2PCR A;  3MZB A;  2THI A;  4H5F A;  2F7A A;  1N0T A;  4YKP A;  2F97 A;  4WED A;  3MAM A;  1P1U A;  4QF9 A;  2QS1 A;  4ZE9 A;  3MVY A;  3RPL A;  1LAG E;  1M5E A;  3IJO B;  1B05 A;  3CG1 A;  3FZV A;  2I3W A;  1PDA A;  4C1T A;  2P2A A;  1FBE A;  3JV9 A;  2XWK A;  3DM0 A;  4GQO A;  1P1N A;  4OTE A;  4OET A;  1QW0 A;  3O6I A;  3IFA A;  1XI6 A;  3CR9 A;  4H46 A;  4GX6 A;  3VDF A;  1NUY A;  1N3W A;  2VT5 A;  3H6W A;  1OQH A;  4IO3 A;  1FQD A;  1Y4C A;  3GZG A;  1R6Z A;  3B7D A;  1FPJ A;  5IZZ A;  3QSL A;  4ELO A;  2QSX A;  1RDZ A;  3KBR A;  4ELP A;  4KR5 A;  3UN6 A;  1FJ6 A;  2FBP A;  4EDP A;  2Y7P A;  2UXA A;  2I4C A;  5A5X B;  2DWI A;  4HXV A;  3RQT A;  1ZLQ A;  2OCU A;  3H06 B;  4EXL A;  4N6D A;  1MQJ A;  1OIB A;  3OO7 A;  2OWT A;  3UA8 A;  4NHB A;  1XOC A;  4I3Y A;  4DCY A;  1NNP A;  3SEX A;  4KFQ A;  1ZIU A;  1RYO A;  3MVZ A;  3RUM A;  3OMB A;  3FD3 A;  1SBP A;  3HCQ A;  1H43 A;  4GXA A;  5DEX A;  5DVF A;  5LDZ A;  5AE4 A;  4GRK A;  2I0B A;  3K0V A;  3PPP A;  4XEQ A;  3KC1 A;  1N84 A;  3OO6 A;  4RJZ A;  2ESN A;  4GX4 A;  5EQ8 A;  3O97 A;  1AMF A;  4G77 A;  2OLB A;  5CRY A;  1HSJ A;  2R6G E;  3DP8 A;  4OHN A;  3KSJ A;  3MVX A;  1B3E A;  4N13 A;  3OD7 A;  1SQY A;  3O29 A;  4KPT A;  3PUY E;  3RLF E;  4NWC A;  1URD A;  2Y7R A;  1KZ8 A;  3EQ1 A;  2DXY A;  3P7I A;  4GWW A;  5DW8 A;  3KJ7 A;  4YB6 A;  4FE8 A;  2VPO A;  3FAS A;  3IJX B;  5FHO A;  4N6P A;  1VFD A;  1J1N A;  3MJN A;  3H4Z A;  5FTH A;  5LOM A;  4O8M A;  1B5H A;  3VLV A;  2B3B A;  3A29 A;  4TQU Q;  5EHM A;  4EQB A;  2CZL A;  1GR2 A;  4EQ7 A;  1NV1 A;  1UQW A;  2ONK E;  3KEI A;  3A3C A;  4LZ8 A;  3NOH A;  1DSN A;  3SET A;  2R71 A;  1FBG A;  1LAF E;  2WBB A;  3E79 A;  1D9Y A;  3H6U A;  4AS4 A;  4ECF A;  2D3I A;  1PB9 A;  2UVH A;  4GD5 A;  3WAF A;  4XF5 A;  5KZT A;  2QFL A;  3PD8 A;  1A8E A;  2RF1 A;  4OVT A;  4BDR A;  4IO7 A;  2B3F A;  1FBH A;  3HHF A;  1RYX A;  4H65 A;  4LZ7 A;  5HM4 B;  5ET7 A;  4ZE8 A;  3B6T A;  4O7I A;  4P0G A;  1MM7 A;  5CMC A;  3QMF A;  3UP9 A;  1GV8 A;  3MZ1 A;  1FJ9 A;  2WX9 A;  4X8R A;  4F18 A;  3IL1 B;  4G8H A;  1Z7M E;  1IXC A;  4ZED A;  4HCY A;  1PBP A;  4GVO A;  1D4N A;  3SEU A;  3TCF A;  3PGF A;  4R2B A;  1ANF A;  4DXC A;  4PE3 A;  4ISU A;  3FVO A;  4RPN A;  1II5 A;  1A54 A;  3QXM A;  1UIV A;  3W15 C;  3HV1 A;  1B4H A;  1NV2 A;  1TWY A;  4ZZA A;  3CFZ A;  2B4M A;  1FBD A;  1M5C A;  2DQV A;  3KOT A;  3E78 A;  2R9J A;  2P0S A;  4OVS A;  4DCX A;  5CBR A;  1B40 A;  3K1N A;  2XX8 A;  4NX1 A;  2L5V A;  2XD2 A;  2GQ1 A;  3T9X B;  3N6U A;  1SI1 A;  2BJJ X;  4QFK A;  4ELR A;  4KCD A;  4OVR A;  3W9W A;  1R9L A;  3ISP A;  3QYT A;  4TLM B;  1SI0 A;  3H7M A;  4DE8 A;  4NQ8 A;  3S4U A;  5TP9 A;  4DZ1 A;  3LC8 A;  4NF0 A;  4JSD A;  4G68 A;  4R6K A;  5KDT B;  5TU0 A;  4F2Q A;  3K2D A;  4GBV A;  2ZYO A;  3KC0 A;  1FPD A;  1KA1 A;  4UAB A;  1QUI A;  4OMB A;  4NTL A;  4Q0C A;  4X48 A;  2HAV A;  1SYH A;  3QUJ A;  4PBQ A;  2XXU A;  4O3C A;  1ZJL A;  1G0H A;  2XA5 A;  2XXW A;  4EF1 A;  2FA7 A;  3MPK A;  2I0C A;  2F78 A;  4R2F A;  3RYD A;  4PFU A;  1DOT A;  3PD9 A;  4GWY A;  4F3B A;  1FQF A;  4OVQ A;  4N17 A;  3CHG A;  5EQ7 A;  1GTK A;  4POX A;  3ZSF A;  3C36 A;  2CZI A;  1ZKB A;  4FOR A;  2QPQ A;  4F19 A;  4OZ9 A;  3FXU A;  5AA4 B;  2FYI A;  1US4 A;  3VVE A;  5IKB A;  3RTF B;  2DDK A;  4F1U A;  4MEV A;  1LB8 A;  4MX6 A;  4I3E A;  3OSQ A;  3CFL A;  5ITO A;  4LA9 A;  4GFR A;  1RDY A;  4R73 A;  3TYH A;  4QSC A;  3L6H A;  4ZEF A;  1L5T A;  4LAT A;  2G29 A;  4X1B A;  3T9H B;  4MNI A;  3IFC A;  4RYA A;  1QUJ A;  3OEK A;  5I57 B;  1JW1 A;  3KZG A;  4ZS9 A;  4XKQ A;  2ZNU A;  3HHG A;  2I58 A;  3E3K A;  4F1V A;  1NH7 A;  3TQW A;  2GRV A;  3M8U A;  5AA2 D;  4QFO A;  3MYU A;  3OOA A;  2DS9 A;  2E1S A;  2Q2A A;  2F6G A;  2AIX A;  1FQC A;  2DE4 A;  3A09 A;  4NED A;  1OVT A;  4YB7 A;  5ICT A;  3G3J A;  1LFG A;  3KOS A;  4IGR A;  5I56 B;  1POY 1;  3JYR A;  3PUX E;  1US5 A;  3O66 A;  5ET5 A;  4N8Y A;  1MM6 A;  4P11 A;  1RKM A;  1B3L A;  1G0I A;  2VOZ A;  2HQ0 A;  1O7T A;  4NF5 B;  2PT2 A;  3T96 B;  1B3H A;  4EXK A;  1CNQ A;  1EYJ A;  2CMO A;  1NV4 A;  1BIY A;  1IMF A;  1MG1 A;  3RN8 A;  5L9M A;  1DPE A;  4U21 A;  4PCD A;  4YIC A;  4RK9 A;  3TCG A;  1XC1 A;  4PE5 B;  2Q74 A;  2VD2 A;  5JK4 A;  1FBP A;  4KXP A;  1A55 A;  5TPA B;  2DVZ A;  2R8T A;  1I6Q A;  1S9T A;  2CZH A;  3T9U A;  1B51 A;  2YPN A;  3MWB A;  2KQZ A;  5EYF A;  1LST A;  2O6A A;  4BLA A;  2V84 A;  4QSE A;  4IY5 A;  1P99 A;  3G3H A;  1Y3Q A;  2OWZ A;  3C31 A;  2DE3 A;  3ZKK A;  3HN0 A;  1QJM A;  3L6G A;  1XVX A;  2RC9 A;  1N04 A;  2Q2C A;  1ZBM A;  4PTK A;  3MC2 A;  4G2Z A;  4UAC A;  4NE4 A;  1VE4 A;  2RKM A;  2ZNT A;  3U8Q A;  1IME A;  2DYX A;  4PGP A;  5K2Y A;  1JEV A;  4G4P A;  3LSL A;  5H8F A;  2WYK A;  4IO4 A;  4OYV A;  4DXU A;  3U72 A;  2F3B A;  3MBP A;  2XXY A;  2OK2 A;  1NFT A;  1LBV A;  4GXS B;  2MKZ A;  1IXG A;  1MY1 A;  1BKA A;  3G3F A;  3FUZ A;  3QK6 A;  3K02 A;  2Y84 A;  4R6H A;  3R6U A;  5H8Q B;  2F36 A;  2VD3 A;  1M5B A;  5H8N B;  1MQD A;  1VR5 A;  4JBZ A;  4YB5 A;  1KWH A;  3LSX A;  3BIG A;  1B1H A;  4MLQ A;  1S50 A;  2KR0 A;  3W9V A;  4JWY A;  1Y3P A;  3N26 A;  1B7U A;  5HBC A;  1I6A A;  3O6G A;  2XWI A;  4NGU A;  3ONM A;  4KYS A;  4U1O A;  3CSB A;  4JWO A;  3UGW A;  4MAG A;  3IOU A;  1FQE A;  1D3K A;  3GBB A;  1PEB A;  2QRY A;  2XHD A;  4QFN A;  1N7W A;  1QUK A;  1TFA A;  3TEP A;  1SVX B;  3R26 A;  4KHZ E;  4H0W A;  5I59 A;  4R6Y A;  4HTG A;  4P9K A;  5DTB A;  3UK4 A;  1SW1 A;  5DVI A;  5FBP A;  4PQJ A;  1JW4 A;  4GWZ A;  1JP4 A;  4E0X A;  2HFB A;  1A99 A;  5B70 A;  1N76 A;  3BFT A;  3RT8 A;  4DI3 D;  1B52 A;  4XTC Q;  3SES A;  2XXH A;  4ELQ A;  2Y5K A;  1UIU A;  4QBA A;  3USD A;  3JZJ A;  5I59 B;  4H1X A;  2F7C A;  4G8M A;  4FJP A;  1JET A;  3KN7 A;  1B1X A;  2DWH A;  4PP0 A;  2AL5 A;  3SEY A;  5ICQ A;  1NV6 A;  4LP2 B;  4XFE A;  3IOT A;  1PB7 A;  2O7U A;  3N94 A;  4I62 A;  1EU8 A;  2XXQ A;  2RC7 A;  1AWB A;  2H25 A;  2GFE A; 
#chains in the Genus database with same CATH homology
 1B40 A;  2I3V A;  2IA4 A;  3K1N A;  2XX8 A;  2PT1 A;  2DWJ A;  2PMS A;  3H6V A;  1SYI A;  3QIM A;  3T22 A;  3PU5 A;  1Y4T A;  2XD2 A;  3FVN A;  5CM6 A;  1PBQ A;  3T9X B;  5L8D A;  3N6U A;  3CI8 A;  1SI1 A;  2BJJ X;  4KCC A;  4QFK A;  5I58 B;  5M2V A;  3HPI A;  3M3L A;  3QUF A;  1Z7N E;  2XXT A;  3AXF A;  5CMK A;  3K01 A;  3MUQ A;  3V83 A;  4C1U A;  4MH5 A;  4R9F A;  4ELR A;  4KCD A;  3SEW A;  1LCF A;  2ONS A;  5FHN A;  3W9W A;  4ZEB A;  3C33 A;  3VE1 B;  4C1T A;  1R9L A;  3K00 A;  3PPN A;  3THI A;  4RY1 A;  2VP1 A;  3QYT A;  4TLM B;  2V3Q A;  1SI0 A;  3H7M A;  4DE8 A;  3RY3 A;  5IAI A;  2PX1 A;  4MF3 A;  1MDP 1;  3DEL B;  2H99 A;  3DLN A;  3M3F A;  3PUV E;  4H67 A;  3LC8 A;  5TP9 A;  3S4U A;  4DZ1 A;  2Z23 A;  3VXB A;  4JXI A;  4JSD A;  1A40 A;  1FQA A;  1NNT A;  3FVK A;  3UIF A;  4G68 A;  3RGY A;  1B5J A;  2I48 A;  4NWD A;  4R6K A;  2H4I A;  5TU0 A;  5KDT B;  2DWA A;  3RPW A;  4O3B A;  4F2Q A;  1B0L A;  3CVG A;  3FJ7 A;  5TP9 B;  3K2D A;  2QS3 A;  4K3F A;  5L9O A;  1NNF A;  2ZYO A;  3U1O A;  3D4G A;  3MQ9 A;  1QUI A;  4PFT A;  1OLC A;  3BBR A;  4G68 B;  4OMB A;  3TTM A;  4NTL A;  3Q27 A;  4FIM A;  1MDQ A;  4Q0C A;  1WOD A;  4X48 A;  2HAV A;  5KDT A;  5H8H A;  1SYH A;  2RIN A;  2ZYK A;  3G3G A;  3G7W A;  4KQP A;  4F29 A;  4BDN A;  2I49 A;  4ZDM A;  1B2H A;  1IXI A;  4QFL A;  3VLU A;  1ELJ A;  2UVI A;  3QUJ A;  4OFJ A;  3TEL A;  2XXU A;  1B7Z A;  1LBB A;  1S7Y A;  3FXR A;  1H45 A;  4OXV A;  4ZEC A;  4HW8 A;  3C32 A;  4O3C A;  4DLD A;  5KCJ A;  3C4M A;  5I2N B;  1LFH A;  1ZJL A;  4FAJ A;  3E4R A;  3GLB A;  3S9L C;  1XVY A;  1OLA A;  2O69 A;  2XXW A;  3F11 A;  2UVJ A;  3E13 X;  1JEU A;  2FA7 A;  3FIR A;  2G93 A;  4OFL A;  4Z0I A;  1MRP A;  2WKY A;  5TPA A;  3RTW B;  1B9J A;  3MPK A;  4R74 A;  4YKK A;  2B65 A;  3CRB A;  3QAX A;  4GOT A;  3LR1 A;  4GL8 A;  4IO5 A;  4NF6 B;  4YU0 A;  3G3K A;  5L9S A;  4JWX A;  4I8C A;  2I0C A;  1B0H A;  1MQH A;  1PB8 A;  2F78 A;  2GHB A;  4POW A;  4R2F A;  4AQ4 A;  3GBA A;  3CSG A;  3TUS A;  4PFU A;  4R75 A;  1WVJ A;  2Q8J A;  1DOT A;  3IOV A;  3PD9 A;  4KYE A;  3ILT B;  1JQF A;  4KYD A;  4PET A;  4TLL B;  3OEL A;  1BTJ A;  1MY4 A;  2F5X A;  3FAT A;  1NMU A;  2NWJ A;  4F3B A;  1FQF A;  3LBS A;  4QSD A;  1EZP A;  1GGG A;  1R1N A;  5B7D A;  1IIT A;  2UYF A;  1URS A;  5I84 A;  3I3V A;  1GTK A;  2VGQ A;  3UOR A;  1FTM A;  3H6T A;  4POX A;  3B6W A;  3C36 A;  5H8Q A;  3ZSF A;  1ZKB A;  1Y20 A;  2V3T A;  4FOR A;  3TKD A;  2QPQ A;  4F19 A;  1Y3N A;  1MY2 A;  3D4C A;  4OZ9 A;  2X7P A;  5JTY B;  1LBC A;  3FXU A;  1N3X A;  2Y7K A;  5AA4 B;  1H76 A;  1DPP A;  5F1Q A;  3TTR A;  3KGC A;  4IGT A;  4U4X A;  2FYI A;  3FGS A;  3T9V A;  1US4 A;  4ZEK A;  3VVE A;  4MLV A;  4LZ5 A;  3RTF B;  4Q8R A;  5I2N A;  1A8F A;  3MW0 A;  4M4G A;  4F1U A;  5I56 A;  2REJ A;  1B3G A;  1IXH A;  5AA1 A;  5IKB A;  1MPD A;  2YLN A;  3TZA A;  3M3K A;  4NF4 A;  3TFL A;  3TTN A;  3Q26 A;  3OO9 A;  3OSR A;  4OES A;  1ZMG A;  1H44 A;  2ALU A;  4PFW A;  5F7V A;  2XXV A;  1LB8 A;  1P1O A;  4NF5 A;  2O1L A;  1IUD A;  3MPL A;  3PMV A;  4WXJ A;  4IB2 A;  3PMX A;  4DDD A;  3OSQ A;  1FTO A;  1Y1Z A;  4F3S A;  3S9N C;  3SEX A;  4L17 A;  3CFL A;  5ITO A;  1EZ9 A;  1LLS A;  4LA9 A;  1AOV A;  1TT1 A;  4GFR A;  4LQ5 A;  4R73 A;  2QJE A;  4M1V A;  3TYH A;  4QSC A;  3L6H A;  1N7X A;  4ZEF A;  4LAT A;  1L5T A;  4F31 B;  2G29 A;  4X1B A;  2H5Y A;  5CI5 A;  3EHS A;  2ABH A;  1MXU A;  4I9D A;  4YZZ A;  3WAE A;  1ZU0 A;  2RCA A;  3T9H B;  1HSE A;  3EPE A;  4DXB A;  1SD3 A;  3TDJ A;  4ESX A;  1B5I A;  3S2V A;  4U1Z A;  2HZK A;  4OEN A;  4YAH X;  3K4U A;  2D21 A;  2XX7 A;  4PFY A;  1O64 A;  2I4B A;  2O84 X;  2QMW A;  2D5W A;  1B46 A;  4U2R A;  3TPA A;  5I58 A;  1EZO A;  2OWS A;  4I1D A;  4F3P A;  3T66 A;  3TTK A;  4RYA A;  1B4Z A;  4F22 A;  3RT6 B;  2Q88 A;  2Q9T A;  2Y7I A;  4H5G A;  4BDO A;  1MXX A;  3C34 A;  1SW2 A;  1QUJ A;  2RCB A;  3IAZ A;  3OEK A;  1B32 A;  1FTL A;  5I57 B;  1JW1 A;  3KZG A;  3I6V A;  2QS2 A;  1Y9U A;  4F2O A;  2W7Y A;  2O1M A;  5CMB A;  4E0W A;  1USY H;  4ZS9 A;  4XKQ A;  2ZNU A;  3HHG A;  3IK6 B;  1R9Q A;  1SW4 A;  1I6B A;  2IEE A;  1FTJ A;  2X7Q A;  2ONR A;  1SW5 A;  3N6T A;  4GF8 A;  2I58 A;  2XXR A;  3E3K A;  3PPR A;  4GLI A;  1F9B A;  1MS7 A;  2Z8D A;  4GIZ A;  3V89 B;  2I6E A;  1LCT A;  3CFX A;  2HCA A;  4QHQ A;  1VSO A;  4F1V A;  3U92 A;  4F3G A;  3KJT A;  5FHM A;  3OEN A;  1NH7 A;  3TQW A;  2GRV A;  2PBW A;  2QL3 A;  2F6P A;  4XIG Q;  1FTK A;  3M8U A;  5AA2 D;  1B7H A;  1BP5 A;  1HSL A;  2V3U A;  4ZZE A;  4QFO A;  2HEU A;  3MZB A;  3IR1 A;  2THI A;  4X1D A;  4MFI A;  4H5F A;  1T0K A;  2F7A A;  1N0T A;  2XXX A;  3EF7 A;  1MXY A;  4YKP A;  3OOA A;  2F97 A;  1O63 A;  4WED A;  3O2A A;  3CG3 A;  2A5T B;  3MAM A;  2DS9 A;  1P1U A;  4QF9 A;  2QS1 A;  4BDL A;  2E1S A;  4ZE9 A;  3MVY A;  3PUZ E;  2Q2A A;  2O51 A;  2F6G A;  2AIX A;  1FQC A;  1LAG E;  2DE4 A;  1M5E A;  3A09 A;  3O6H A;  1TXF A;  1OVT A;  4NED A;  4YB7 A;  5ICT A;  1NNK A;  1GVC A;  3IJO B;  1YAE A;  1B6H A;  1B05 A;  1LGB C;  3G3J A;  3CG1 A;  1LFG A;  3IO4 A;  3K6V A;  3KN3 A;  2ANJ A;  2LAO A;  2I3W A;  3FZV A;  3KOS A;  4QFP A;  5H8N A;  4IGR A;  1PDA A;  3PMW A;  3SDF A;  2P2A A;  2F35 A;  1POY 1;  2HAU A;  4LUB A;  3EN3 A;  3JYR A;  3PUX E;  1US5 A;  3O66 A;  4YKI A;  1LAH E;  3JV9 A;  4XKP A;  5EHS A;  3DM0 A;  1MH4 A;  1MM6 A;  4GQO A;  4ND9 A;  4P11 A;  1RKM A;  3TQL A;  1IQ7 A;  1XT8 A;  1B3L A;  2ZMB A;  3TOD A;  3PPO A;  2VOZ A;  2HQ0 A;  1JVY A;  1O7T A;  1P1N A;  4NF5 B;  4OTE A;  4G68 C;  4OET A;  2PT2 A;  4BDQ A;  5JTY A;  1QW0 A;  4U4S A;  3O6I A;  2DVC A;  3SKP A;  3T96 B;  4THI A;  3BKI B;  4F39 A;  1B3H A;  3VVF A;  4EXK A;  1B58 A;  1M5F A;  2GHA A;  3CR9 A;  2F7B A;  2QS4 A;  2UYE A;  2CMO A;  3ZS6 A;  1BIY A;  4EUO A;  4HS7 A;  3VDF A;  4ESW A;  3MVW A;  1N3W A;  2NUV A;  2X26 A;  2OBG A;  1MG1 A;  1WDN A;  3DP4 A;  3IB0 A;  4KI0 E;  3EHU A;  3RN8 A;  5L9M A;  1DPE A;  2QMX A;  3H6W A;  1OQH A;  4JSO A;  4IO3 A;  4U21 A;  1FQD A;  1Y4C A;  1OMP A;  1R6Z A;  3GZG A;  3B7D A;  4LVQ A;  3K6W A;  3QSL A;  3ILU B;  4YIC A;  2M8C A;  4NMY A;  4RK9 A;  2REG A;  2QSX A;  3ZKL A;  3TCG A;  4ELO A;  1FQB A;  1XC1 A;  3CIJ A;  4PE5 B;  2A5S A;  1NL5 A;  2VD2 A;  3KBR A;  4KR5 A;  4ELP A;  3UN6 A;  2DOJ A;  3KFM A;  5JK4 A;  4FED A;  1JW5 A;  3KG2 A;  1A55 A;  5TPA B;  1NH8 A;  2DVZ A;  4ONY A;  1I6Q A;  1Y1M A;  2Z8E A;  4Q5T A;  5H8F B;  1FW0 A;  1S9T A;  3KSX A;  3V5A A;  4BDM A;  4EDP A;  3SER A;  5BWJ A;  2ZNS A;  2Y7P A;  4OEV A;  5JEI A;  3T9U A;  2UXA A;  4LON B;  1AH5 A;  1B51 A;  2I4C A;  2YPN A;  3ECR A;  1IIW A;  2DWI A;  2XXP A;  3B6Q A;  3MWB A;  3RQT A;  5A5X B;  1ZLQ A;  2OCU A;  3H06 B;  3LUY A;  4RXL A;  4EXL A;  5EYF A;  1AIV A;  1LST A;  4EQ9 A;  5CC2 A;  2O6A A;  4BLA A;  1MQJ A;  2V84 A;  5ISU A;  1OIB A;  3OEM A;  4QSE A;  3OO7 A;  4IY5 A;  2OWT A;  1P99 A;  2Y7W A;  3G3H A;  3V8X B;  1Y3Q A;  2RC8 A;  3C31 A;  4OVJ A;  4QRZ A;  2DE3 A;  3U93 A;  3UA8 A;  4F1Y A;  1IEJ A;  1MY0 A;  3ZKK A;  1XOC A;  5CMM A;  3HN0 A;  2DE2 A;  1AL3 A;  1QJM A;  3FJG A;  3H03 A;  3N5L A;  3T93 B;  4DCY A;  3L6G A;  1XVX A;  1NNP A;  1N04 A;  2RC9 A;  1ZIU A;  4KFQ A;  1RYO A;  2Q2C A;  3MVZ A;  1ZBM A;  2AYS A;  4U22 A;  4XKN A;  3RUM A;  5DEX B;  3OMB A;  5AA3 A;  5J1D A;  3FD3 A;  1Q35 A;  4FEB A;  4NF8 B;  4RPO A;  1SBP A;  2A5T A;  5DVJ A;  3HCQ A;  3SEV A;  1H43 A;  1A7L A;  4GXA A;  2O7I A;  3S9E A;  2NXO A;  3MC2 A;  5I2K B;  1MPB A;  3FXQ A;  4OEU A;  4XXU A;  2PVU A;  4G2Z A;  4OER A;  3C9H A;  1MXW A;  4NF4 B;  4UAC A;  5DEX A;  4NE4 A;  5DVF A;  1VE4 A;  2RKM A;  2ZNT A;  3U8Q A;  5AE4 A;  1MQG A;  1DTZ A;  4GRK A;  1QKA A;  2I0B A;  2DYX A;  2H98 A;  2OZZ A;  3K0V A;  2UVG A;  3PPP A;  5K2Y A;  1JEV A;  5ELV A;  3OO6 A;  1N84 A;  4R72 A;  1OVB A;  4G4P A;  4RJZ A;  3G3I A;  3LSL A;  4EF1 A;  5H8F A;  2DXR A;  1MH3 A;  2ESN A;  5BUU A;  1ATG A;  1VFE A;  1IZ1 A;  4IO4 A;  4OYV A;  4DXU A;  3MP6 A;  3U72 A;  3ODB A;  5A5X A;  4MBP A;  2E0S A;  4G8N A;  3K1M A;  4YMA A;  2ZXT A;  4Q30 B;  3MZ9 A;  3R7X A;  3MBP A;  3U94 A;  2XXY A;  3O97 A;  1AMF A;  1NFT A;  2OK2 A;  4GXS B;  3MP8 A;  2PYY A;  4UA8 A;  1DTG A;  3Q29 A;  4G77 A;  2OLB A;  1IXG A;  1HSJ A;  1MY1 A;  2R6G E;  3DP8 A;  4KD5 A;  4OHN A;  3K6U A;  1DMB A;  5CRY A;  3KSJ A;  1BKA A;  3G3F A;  3MVX A;  1B3E A;  4N13 A;  3FUZ A;  3OD7 A;  1SQY A;  4C0R A;  3O29 A;  1XHY A;  3QK6 A;  2H9B A;  3K02 A;  1MQI A;  3PUY E;  4KPT A;  4NF8 A;  3RLF E;  4NWC A;  4X9T A;  1URD A;  2Y7R A;  2Y84 A;  3EQ1 A;  2DXY A;  3P7I A;  4R6H A;  3KJ7 A;  1YPN A;  3R6U A;  4YB6 A;  2F36 A;  2VD3 A;  1M5B A;  4FE8 A;  4R9G A;  5H8Q B;  3VVD A;  5H8N B;  1MQD A;  1VR5 A;  3FAS A;  3IJX B;  4JBZ A;  1PC3 A;  2YJP A;  3DP6 A;  4YKJ A;  4N6P A;  5FHO A;  5KCJ B;  1VFD A;  5I2K A;  3IOR A;  1J1N A;  3MJN A;  4IO2 A;  4YB5 A;  1KWH A;  1QUL A;  4YMB A;  4N07 A;  3LSX A;  1CE2 A;  3Q25 A;  3H4Z A;  5FTH A;  5LOM A;  1P1Q A;  1B1H A;  4MLQ A;  4NF6 A;  2DP8 A;  4FAT A;  1S50 A;  3PPQ A;  4DIG A;  1B5H A;  1H3D A;  1URG A;  3W9V A;  4JWY A;  3EHT A;  1Y3P A;  3VLV A;  2B3B A;  2XX9 A;  1B7U A;  3N26 A;  4GWO A;  5HBC A;  1I6A A;  1M5D A;  2P1S A;  3K6X A;  3O6G A;  4TQU Q;  5HPQ A;  5EHM A;  1JNF A;  4EQB A;  1JVX A;  2CZL A;  1XS5 A;  3ONM A;  4OFO A;  4TOZ A;  2XD3 A;  1GR2 A;  2GH9 A;  2V25 A;  4O3A A;  1UQW A;  2ONK E;  4EQ7 A;  4ZEI A;  3KEI A;  1I69 A;  3A3C A;  3OXN A;  4LZ8 A;  4WKM A;  1DSN A;  4KYS A;  3SET A;  2R71 A;  5AA2 B;  3VLW A;  4U1O A;  1LAF E;  3A3U A;  3CSB A;  1YCJ A;  3O9P A;  1D9Y A;  4JWO A;  1QKB A;  4LQ2 A;  3H6U A;  5K2X A;  3UGW A;  4JB7 A;  4ECF A;  3IOU A;  2D3I A;  3PV0 E;  1PB9 A;  2UVH A;  1FQE A;  1SDX A;  4GD5 A;  4H6D A;  3WAF A;  4Z7E A;  1D3K A;  3GBB A;  1B3F A;  1PEB A;  3O28 A;  1OQG A;  5KZT A;  2QRY A;  3PD8 A;  1A8E A;  2RF1 A;  2XHD A;  2F8D A;  3Q28 A;  4H8I A;  4QFN A;  3TCH A;  4BDR A;  4IO7 A;  2B3F A;  2ZYN A;  1N7W A;  4IY6 A;  5H8H B;  3HHF A;  4AB6 A;  4XKR A;  5ITP A;  1D9V A;  1QUK A;  1P1W A;  1TFA A;  2NOO A;  3FJM A;  5I56 B;  3TEP A;  2Q89 A;  1RYX A;  4H65 A;  1SVX B;  3R26 A;  4OQO A;  4AB5 A;  4LZ7 A;  4KHZ E;  4H0W A;  5HM4 B;  4R6Y A;  5I59 A;  3LSF B;  2FNC A;  4HTG A;  1NKX A;  4ZE8 A;  4U23 A;  3B6T A;  5DTB A;  3VV5 A;  3UK4 A;  3IB1 A;  1CB6 A;  1TFD A;  3FVG A;  1SW1 A;  4EF2 A;  3VXC A;  2NVU B;  2AL4 A;  1EH3 A;  1POT A;  4P0G A;  1MM7 A;  5DVI A;  1MXZ A;  1MY3 A;  1USY E;  4PQJ A;  1JW4 A;  2F34 A;  5CMC A;  3UP9 A;  3MP1 A;  3PUW E;  1GV8 A;  5CBS A;  4E0X A;  3I5O A;  2HFB A;  3MZ1 A;  1A99 A;  5AA2 A;  1UTH A;  1LB9 A;  2Z22 A;  5B70 A;  4IO6 A;  1N76 A;  3BFT A;  1UTB A;  3IL1 B;  3K1P A;  3OO8 A;  3KN8 A;  4P0I A;  1B52 A;  5DT6 A;  3RT8 A;  4F18 A;  4XTC Q;  4G8H A;  3SES A;  2Z8F A;  2XXH A;  3RNN A;  1Z7M E;  3C35 A;  1IXC A;  4ZED A;  2DSF A;  1YTV A;  4HCY A;  4ELQ A;  3FV2 A;  4OWD A;  1UIU A;  1BLF A;  1PBP A;  2OJT A;  4GVO A;  1Q1K A;  5I57 A;  3USD A;  1D4N A;  3SEU A;  3TCF A;  3HST A;  3JZJ A;  2HXW A;  3PGF A;  4H1X A;  5I59 B;  2F7C A;  4G8M A;  4R2B A;  1ANF A;  3TTL A;  4DXC A;  4ISU A;  3IO6 A;  3FVO A;  4RPN A;  1II5 A;  3H3G A;  4WEP A;  3IX1 A;  1A54 A;  4FJP A;  3FV1 A;  3LSW A;  1LAX A;  1UIV A;  3QXM A;  4JDF A;  3W15 C;  3HV1 A;  1JET A;  3KN7 A;  1B1X A;  4H8J A;  3TAJ A;  1B4H A;  1TWY A;  2DWH A;  4PP0 A;  5H8S A;  2AL5 A;  2VHA A;  1LFI A;  3CFZ A;  5DYH A;  4ZZA A;  3SEY A;  5FTI A;  3GXA A;  3IOW A;  5ICQ A;  4RK2 A;  1M5C A;  3E9X A;  2DQV A;  4RA1 A;  4LP2 B;  2HZL A;  3KOT A;  1QVS A;  3VFJ A;  3IOT A;  1PB7 A;  2O7U A;  2XXI A;  3N94 A;  1MPC A;  4I62 A;  2KLF A;  1EU8 A;  4RNS A;  3BFU A;  1UTB B;  2O68 A;  2R9J A;  2XXQ A;  2RC7 A;  2ZYM A;  2H25 A;  2P0S A;  4FEC A;  3TMG A;  4DCX A;  5CBR A;  1UTH B;  1MXV A;  2V93 A;  4GL0 A;  4HCW A;  1ZTY A;  1FCK A;  3S9M C;  2GFE A;  3HO7 A;  5AA4 A;  3IB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...