2X26A

Crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
308
structure length
308
Chain Sequence
SPEALRIGYQKGSIGMVLAKSHQLLEKRYPESKISWVEFPAGPQMLEALNVGSIDLGSTGDIPPIFAQAAGADLVYVGVEPPKPKAEVILVAENSPIKTVADLKGHKVAFQKGSSSHNLLLRALRQAGLKFTDIQPTYLTPADARAAFQQGNVDAWAIWDPYYSAALLQGGVRVLKDGTDLNQTGSFYLAARPYAEKNGAFIQGVLATFSEADALTRSQREQSIALLAKTMGLPAPVIASYLDHRPPTTIKPVNAEVAALQQQTADLFYENRLVPKKVDIRQRIWQPTQLEGKQLEFRVPGNENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PERIPLASMIC ALIPHATIC SULPHONATES-BINDING PROTEIN
publication title Structure of the Aliphatic Sulfonate-Binding Protein Ssua from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2x26A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2x26A02
1OVBA 4TQUQ 1A55A 4LA9A 1F9BA 2RINA 4ZS9A 4TLMB 5EHSA 3H6UA 4NEDA 3DM0A 1R6ZA 2I58A 3KJ7A 5KCJB 4NTLA 1LGBC 4RK2A 3U1OA 1PB9A 2F78A 2Y7IA 1R9LA 2I48A 3H6TA 2A5SA 3VVEA 3S4UA 3I6VA 5FHOA 3SEWA 2OZZA 1ZLQA 1R9QA 2VP1A 5BWJA 1B7UA 3SEYA 3PMWA 1VSOA 4LUBA 5H8NA 1SW1A 3MQ9A 1OMPA 1JW4A 2XXWA 5I2NA 4Q30B 1TFAA 1NMUA 3MVZA 3K1NA 5CMKA 1PBPA 1QKAA 3P7IA 5ICQA 2NWJA 4HW8A 4EUOA 3I5OA 3TMGA 2XXRA 4WEDA 1GV8A 1DOTA 3MVXA 1LB9A 1IIWA 2GH9A 3PMVA 2V3UA 2YJPA 2W7YA 5H8FB 3IK6B 3O29A 5H8HA 4POXA 4OERA 4G68C 1FQBA 3E9XA 3OENA 5CM6A 2IEEA 2XX9A 4L17A 3IB0A 3KN3A 1TT1A 4NF4B 5EYFA 5LOMA 1N0TA 3QXMA 4IO4A 1IXCA 2DP8A 4XTCQ 3IB2A 3IOUA 3LSFB 5TP9B 5JK4A 4PQJA 1RYOA 3C32A 2I0BA 4WXJA 3KZGA 3Q25A 2UXAA 2Q8JA 1S50A 1VR5A 2VGQA 3DP6A 2XXQA 1JETA 1P1WA 3GXAA 2HAUA 2AIXA 4BLAA 4NF6A 4JB7A 1N3XA 4EQBA 4XKNA 1N04A 3V89B 1B40A 5AA1A 3LBSA 1EU8A 2QMWA 2QPQA 2RKMA 2V3QA 1PEBA 1N7XA 4EQ7A 3OOAA 1ZMGA 2CMOA 4KQPA 4EF1A 1Y3QA 4F3SA 1H76A 4KFQA 1FTKA 2X7QA 2R6GE 3JZJA 1UIUA 3IR1A 3ILUB 2PX1A 4G68B 2D5WA 3E13X 1ATGA 2GHBA 2VD2A 2OLBA 5EHMA 3MVYA 3AXFA 1Y4CA 1H44A 4KCCA 5I58B 3QIMA 1MH3A 4KI0E 3A09A 1LFIA 5DTBA 3T9XB 4KD5A 2XXIA 1CE2A 1QULA 3KSXA 3W9VA 4N07A 1B3GA 4F19A 3PPOA 1JVYA 3PUXE 3TEPA 5A5XA 1XC1A 4E0WA 3EHTA 1SW5A 3RTWB 4UA8A 2XXXA 4FEBA 4QFNA 5K2YA 3TCFA 4DXBA 3HCQA 1MDP1 3TTRA 4ONYA 4G8NA 3OEMA 3T96B 5CBSA 1P1UA 1B1XA 4IO7A 1P1NA 4G68A 4F1UA 2A5TA 2ZYNA 3L6GA 3M3LA 4DIGA 5ISUA 2F5XA 3PUYE 1LFGA 4QHQA 2FNCA 2XD3A 2ZNUA 3TELA 4ZEKA 3PD9A 3VXBA 1LBBA 2O1LA 4Q0CA 3Q26A 1XOCA 2KLFA 4X9TA 4H5FA 2XD2A 4R2FA 4KR5A 3I3VA 2RCAA 2UVIA 3L6HA 2H25A 1WVJA 3O6GA 2H4IA 3FVNA 3WAFA 3FZVA 1Y3PA 2DWAA 2ONKE 1A54A 2Z8FA 3PV0E 3UK4A 4NF8B 4U21A 4MLVA 4G8HA 3R7XA 5L9OA 1LCTA 4X1BA 3T9VA 4YKKA 5H8QB 1LAFE 2YPNA 2UVJA 2G29A 4ZECA 1O7TA 3U94A 1POTA 4XXUA 4R9FA 1FW0A 1NNFA 5KZTA 1TFDA 4OFJA 4F1YA 4JSOA 1USYH 1UTHA 5I2KA 5K2XA 3PGFA 3FXUA 3WAEA 5DVFA 1SDXA 3H3GA 1R1NA 1MY3A 5IKBA 3HO7A 5DVIA 5DEXA 3VVFA 4X48A 3CVGA 5M2VA 1EZ9A 2DVCA 4QFLA 3VLUA 2H98A 1EZOA 1MXUA 2UVHA 2V25A 1IQ7A 1B05A 1MY1A 5B70A 4YMBA 2I3WA 4OYVA 1Q35A 5I57B 2H99A 2G93A 2HFBA 3OEKA 4R73A 3ECRA 3RLFE 3CG3A 2F8DA 4ZEDA 3CSGA 4KHZE 4OXVA 3VVDA 1NNPA 2ESNA 3IORA 1OVTA 3M8UA 4ZDMA 1FTOA 4EDPA 4LP2B 5FTHA 3CI8A 3MPLA 3PMXA 4ZE8A 4U1OA 4MH5A 1SW2A 4YKPA 3RT8A 4AB5A 1SD3A 5F1QA 2DS9A 2DWHA 3V8XB 1BTJA 1RKMA 2O7IA 4OEUA 1A99A 1CB6A 1O63A 1JEVA 2FYIA 4F39A 3MW0A 3MP8A 3IO4A 1Z7NE 1US4A 3MUQA 2PBWA 3QAXA 4KPTA 1MY4A 1YTVA 1M5FA 3THIA 5H8NB 1NH7A 1GVCA 5I2NB 2Z23A 3T9HB 1FTJA 4GXAA 4R75A 1XHYA 1IXIA 3VFJA 3QSLA 2HZLA 1B9JA 2RC8A 2F7BA 2HCAA 2PT1A 3FD3A 1MQJA 5TU0A 3CFLA 1IXGA 2XXHA 4QSCA 5H8HB 2XXYA 3KN8A 3VLWA 3VE1B 3HV1A 3FJMA 3DELB 1OQHA 4HTGA 3T66A 1SQYA 3OELA 4P0IA 1JEUA 3G7WA 1Q1KA 4LONB 5AA4A 1AL3A 1MXYA 2Q9TA 4YB5A 1SW4A 3MVWA 2BJJX 4R6KA 4WEPA 4MBPA 5CBRA 1ELJA 2AL4A 4NMYA 3PUZE 1Y1MA 4PFWA 5J1DA 1URGA 4N13A 1MH4A 4M4GA 4GFRA 3RT6B 2UYEA 2VOZA 4U2RA 1UTBA 4BDRA 3UN6A 3C31A 2ANJA 1MG1A 4NF6B 1OLCA 1KWHA 2I3VA 1I6QA 1IEJA 2FA7A 4EF2A 2Q2AA 5DYHA 3FUZA 1QKBA 3K6XA 4R2BA 1B32A 3UA8A 2B3BA 3C4MA 3V83A 4XIGQ 2Y84A 3F11A 3KN7A 2X7PA 3BFUA 4BDNA 3C35A 3EHUA 3T93B 4ZZAA 4O3CA 3SESA 4PFTA 3K6UA 1B3HA 1XVYA 3CR9A 4QFKA 2B65A 3EQ1A 4KCDA 4H8IA 5ELVA 3UIFA 1US5A 5L9MA 1I6BA 4F22A 3PPRA 1PB8A 1AH5A 5B7DA 4ESXA 3GLBA 4BDLA 4PP0A 3IX1A 5L8DA 2DE2A 1MQGA 3Q28A 3OD7A 1Y3NA 1A7LA 1TXFA 1MRPA 3MAMA 3VV5A 3RGYA 3TCHA 4XKQA 1SVXB 1P99A 3MZBA 3PU5A 4XKRA 1MXXA 3GZGA 4FORA 5A5XB 1IXHA 2XHDA 1I69A 2E1SA 3FXRA 4YKJA 2PMSA 4RPOA 4IO3A 3EN3A 5AA2A 3VXCA 3PPNA 4U4SA 1GTKA 5I59A 1B7ZA 3MZ1A 2DYXA 1A40A 3G3JA 4EXKA 3KFMA 4LVQA 3USDA 2A5TB 3CSBA 3N26A 1BLFA 4DDDA 1I6AA 4DLDA 2O51A 1H3DA 4DE8A 5TPAA 2O69A 4ND9A 2I6EA 2E0SA 3U93A 2Y7RA 1P1OA 4FE8A 2ABHA 5FTIA 3TPAA 4YB6A 4ELQA 1MPDA 4XKPA 4YZZA 3RN8A 3OSRA 5L9SA 3M3FA 1FTMA 5F7VA 3TTNA 3MJNA 4POWA 4F3PA 1FQDA 5DT6A 4RYAA 1NNTA 3CG1A 4MF3A 4P0GA 1WODA 2R9JA 4THIA 4QF9A 3K2DA 3D4CA 4IO5A 4QFPA 2PT2A 3FJ7A 1LCFA 4UACA 4RPNA 5DVJA 1AMFA 4QFOA 4FAJA 5ITOA 3ODBA 4G4PA 2F34A 5BUUA 1MS7A 5ICTA 1OQGA 3R6UA 2GRVA 1M5DA 1B52A 4GLIA 3RPWA 1S7YA 1UTHB 4ZEFA 5I2KB 1D9YA 3TTLA 1N3WA 1MY0A 2PYYA 1MDQA 5AE4A 3JV9A 4R6HA 4YMAA 4DCYA 4M1VA 2QRYA 5DEXB 2DXRA 2OCUA 4H65A 1B4ZA 3B6WA 1MQIA 3H7MA 4FECA 3VLVA 4YU0A 3ILTB 2Q88A 5H8SA 4NWDA 3PUVE 4IY6A 3K00A 3V5AA 3TZAA 3QUFA 2Q2CA 4PFYA 4IGTA 4I9DA 3SKPA 2REJA 1LB8A 3O6IA 1SYHA 4GVOA 2OJTA 1A8FA 3LC8A 3A3UA 2ZYMA 3MBPA 3TODA 2OWSA 1YAEA 5CMCA 3KSJA 1MPCA 4QRZA 4KYDA 1N76A 4YKIA 1MM6A 3EF7A 1ZJLA 1H43A 1FTLA 3G3HA 1B58A 4GD5A 2REGA 4YICA 4GL8A 4FEDA 1ANFA 2M8CA 3DP8A 1UQWA 4AB6A 3OO8A 1B5JA 1T0KA 3EPEA 4R6YA 3GBAA 3ZS6A 2HZKA 3OMBA 4N6PA 2V93A 3RY3A 1UIVA 3O6HA 1FQEA 3KEIA 5KDTA 1LLSA 2P2AA 3G3IA 4GWOA 4ZE9A 5ITPA 3MC2A 1B7HA 4OMBA 4FATA 3ONMA 2HXWA 2H9BA 3H6VA 3GBBA 1LSTA 4OHNA 4IO2A 1B3FA 1POY1 2UVGA 2X26A 1DTZA 1N7WA 3OXNA 3SEVA 1MQDA 2F6GA 2DQVA 4OQOA 3FJGA 1MXWA 4JDFA 1QUKA 2OK2A 3R26A 1DTGA 3O66A 5FHNA 2CZLA 3IO6A 1NFTA 2DVZA 1URSA 4LQ5A 3T9UA 1D4NA 3S9EA 5JEIA 3TDJA 1QUJA 3IJOB 3N6UA 2R71A 2I4CA 1JW1A 1JW5A 2RF1A 1MY2A 4KYEA 4ZEIA 2LAOA 2NXOA 4I8CA 3UORA 2DSFA 1ZKBA 1B0LA 1Z7ME 5CMBA 3K6WA 4GQOA 1FQFA 4DXCA 3TAJA 1O64A 5AA4B 4C0RA 3Q27A 2Z8DA 1MPBA 3SEXA 2VHAA 3TQWA 3K1PA 4LZ8A 1YPNA 3UGWA 2P0SA 1H45A 1WDNA 4PETA 3Q29A 3QUJA 3TCGA 4PFUA 4NF5A 3TYHA 4LQ2A 1ZU0A 4MLQA 1UTBB 1IITA 1EZPA 2P1SA 2O84X 1PC3A 2XXPA 2HAVA 3S9MC 3FVOA 3C33A 3HSTA 2F97A 3RTFB 4JBZA 2F35A 2GHAA 1J1NA 1BP5A 4FIMA 4EXLA 4GRKA 1NH8A 1URDA 3SEUA 2XXVA 3S9NC 3A3CA 4U1ZA 4R9GA 4OFLA 4RJZA 4OFOA 4EQ9A 4OTEA 5JTYA 4G8MA 2DWJA 1JVXA 1B6HA 2IA4A 1OIBA 1YCJA 3OO7A 5CMMA 5I56A 2RC9A 5CI5A 2ZNTA 2WKYA 3DLNA 1QUIA 4U22A 4I1DA 4RA1A 2ZYKA 1BIYA 3LSXA 5HPQA 2F7CA 4F1VA 1HSJA 1FQCA 1M5CA 3RQTA 5IAIA 4Z7EA 3W15C 3B6QA 3O2AA 5I84A 1AOVA 3BFTA 3E3KA 5KCJA 2RCBA 1M5BA 3QYTA 2D21A 3G3GA 3FVGA 3MWBA 1LAGE 3SDFA 5AA2B 2ZNSA 3PUWE 4G2ZA 1Y20A 3KOTA 1M5EA 3HHFA 2Y7PA 1Y4TA 3K01A 3EHSA 1QVSA 1SI0A 5I59B 3G3FA 3OSQA 2UYFA 2QS4A 3IOVA 3TFLA 4F29A 5TPAB 2ZYOA 2THIA 2XXUA 2Q89A 3BBRA 3C34A 3M3KA 4IY5A 2V84A 5AA3A 3H4ZA 4ZZEA 4F31B 3IL1B 2AL5A 3IOTA 3K02A 4OWDA 1SYIA 4E0XA 1B4HA 4GOTA 3KJTA 3TUSA 1XS5A 4ZEBA 5H8FA 4NE4A 1QJMA 2AYSA 3RNNA 4QSDA 1QW0A 3UP9A 3CFZA 1B2HA 3OO9A 2ALUA 4NF4A 4GL0A 1NL5A 4H0WA 4IB2A 1HSEA 3HN0A 1HSLA 3T22A 4H5GA 1VE4A 4DXUA 5TP9A 2QS1A 1ZTYA 4LZ5A 4F2QA 4HCWA 4R74A 3O97A 4DZ1A 3E4RA 3JYRA 2F6PA 2Z22A 1PB7A 2Y7WA 1B3LA 1EH3A 2XX8A 2OWTA 3D4GA 1GR2A 4C1TA 1B1HA 3S9LC 3ZKKA 3KGCA 2NVUB 2DXYA 2PVUA 2Z8EA 2F7AA 2H5YA 3U8QA 1P1QA 1MQHA 3LUYA 3MP6A 2NOOA 4JXIA 4H6DA 3N6TA 2YLNA 5FHMA 4P11A 3CFXA 3QK6A 4LZ7A 3C36A 3H06B 1USYE 4AQ4A 4ECFA 4U23A 1DSNA 1B0HA 1VFEA 4OESA 5HM4B 3N94A 1MM7A 4H67A 4OEVA 1MXZA 1DMBA 3PPQA 2QS2A 3PPPA 4R72A 4RK9A 2XXTA 5AA2D 3MP1A 3H6WA 4ELRA 4I62A 4RXLA 1B5HA 1N84A 1FCKA 2RC7A 2D3IA 1TWYA 5I58A 1L5TA 3PD8A 4TOZA 1JNFA 3O9PA 2DE4A 2I4BA 1Y1ZA 3SETA 3K1MA 1IZ1A 2NUVA 1XVXA 3FIRA 4JWOA 4HS7A 4O3AA 3HPIA 2QJEA 3B6TA 3IOWA 2F36A 1PDAA 5KDTB 4X1DA 2ONSA 5HBCA 2ZXTA 3G3KA 1MXVA 2DOJA 3FV2A 2ONRA 2QMXA 2QS3A 3ZSFA 1BKAA 3TTKA 2O1MA 1S9TA 1OLAA 4Q8RA 4IO6A 3K4UA 3KBRA 4ELPA 3BKIB 4ELOA 4K3FA 3FXQA 3H03A 1B5IA 2V3TA 3MPKA 4BDOA 4WKMA 3DP4A 3FV1A 4RY1A 1AIVA 3C9HA 1A8EA 1II5A 1XT8A 1SBPA 4JSDA 5CRYA 1VFDA 1LAXA 3KOSA 4Z0IA 4F2OA 4GF8A 3MZ9A 3CRBA 4DCXA 1IUDA 2DE3A 4OENA 3TKDA 1D9VA 1LFHA 2I0CA 3W9WA 3ZKLA 3FATA 1NNKA 3IB1A 3N5LA 3OO6A 4QSEA 2O7UA 2DWIA 4ESWA 2QSXA 1B46A 3K6VA 5CC2A 4G77A 4BDQA 3LSLA 4BDMA 1GGGA 3K0VA 4O3BA 2XX7A 1D3KA 3FGSA 3KG2A 3LSWA 3U92A 4PE5B 1NKXA 3S2VA 4MFIA 2HEUA 2GFEA 3VDFA 1PBQA 4OETA 4NF8A 4C1UA 2VD3A 4F3GA 1DPEA 3B7DA 3HHGA 5H8QA 2B3FA 1LBCA 3IAZA 4NF5B 4OZ9A 3FVKA 1LAHE 4YAHX 1FQAA 4KYSA 1DPPA 2O68A 3IJXB 4H1XA 3U72A 1ZBMA 2QL3A 2HQ0A 4IGRA 4YB7A 4U4XA 4NWCA 3FASA 1ZIUA 2Y7KA 2I49A 4JWXA 3RUMA 3TTMA 4F3BA 4F18A 4Q5TA 4GIZA 2O6AA 4ISUA 4LATA 4JWYA 4FJPA 1Y9UA 4RNSA 3LR1A 5JTYB 1JQFA 2OBGA 4TLLB 1RYXA 4GXSB 3CIJA 5I56B 3O28A 4H8JA 4OVJA 4HCYA 5I57A 3TQLA 1B51A 1B3EA 1SI1A 3SERA 2ZMBA
chains in the Genus database with same CATH superfamily
1OVBA 2WEFA 4PE3A 4TQUQ 1A55A 4LA9A 2ZZXA 2Y5LA 1CNQA 1F9BA 2RINA 4ZS9A 4TLMB 5EHSA 3H6UA 4NEDA 3DM0A 1R6ZA 2I58A 3KJ7A 5KCJB 4NTLA 1LGBC 4RK2A 3U1OA 1PB9A 4HE2A 2F78A 2Y7IA 1R9LA 2I48A 3H6TA 2A5SA 3VVEA 3S4UA 3I6VA 5FHOA 1QGXA 5J16A 3SEWA 1DCUA 1NUYA 2OZZA 1ZLQA 5IM2A 1R9QA 2VP1A 5BWJA 3E78A 1B7UA 3SEYA 3PMWA 1VSOA 4LUBA 5H8NA 1SW1A 1IMDA 4MNIA 3MQ9A 1OMPA 1JW4A 2XXWA 5I2NA 4Q30B 1TFAA 4N8GA 2WX9A 1NMUA 3MVZA 1LBZA 3K1NA 5CMKA 4P1EA 2HHMA 1PBPA 3T0JA 1QKAA 3P7IA 4IR8A 5ICQA 2NWJA 4HW8A 4EUOA 3I5OA 3TMGA 2XXRA 4WEDA 1GV8A 1DOTA 3MVXA 1LB9A 1IIWA 2GH9A 3PMVA 2CZKA 2V3UA 2YJPA 2W7YA 5H8FB 4JVDA 3IK6B 3O29A 5H8HA 4POXA 4OERA 4G68C 2XWOA 1FQBA 2CZIA 3E9XA 3OENA 3QMFA 5CM6A 2IEEA 2XX9A 4L17A 2L5VA 3IB0A 3KN3A 1TT1A 4NF4B 5EYFA 5LOMA 1N0TA 4AS5A 2B4LA 4N15A 1RDZA 3QXMA 4IO4A 5EQ7A 1K9YA 1IXCA 2DP8A 4XTCQ 3IB2A 3IOUA 3LSFB 5TP9B 5JK4A 4PQJA 1RYOA 3C32A 2I0BA 4WXJA 3KZGA 3Q25A 2UXAA 2Q8JA 1S50A 1VR5A 2VGQA 3DP6A 2XXQA 1JETA 1P1WA 3ROJA 4LN5A 4MJOA 3GXAA 2HAUA 2AIXA 4BLAA 4NF6A 4JB7A 3LV0A 1N3XA 4EQBA 4XKNA 1N04A 4X04A 3V89B 1B40A 5AA1A 3LBSA 1LEVA 1EU8A 2QMWA 2QPQA 2RKMA 2V3QA 1PEBA 2VPNA 1N7XA 4AS4A 3PTYA 4EQ7A 3HFUA 3OOAA 1ZMGA 2CMOA 4KQPA 4EF1A 1XI6A 1Y3QA 4F3SA 1H76A 4KFQA 1D9QA 1FTKA 2X7QA 2R6GE 3JZJA 1UIUA 3IR1A 3ILUB 2PX1A 4G68B 2D5WA 3E13X 1NV0A 1ATGA 2GHBA 2VD2A 2OLBA 5EHMA 3MVYA 5EQAA 3AXFA 1Y4CA 1H44A 4KCCA 5I58B 3QIMA 2ZZVA 1MH3A 4KI0E 4N8YA 3A09A 1LFIA 5DTBA 3T9XB 4KD5A 2XXIA 5A5LA 1CE2A 3KBZA 1QULA 3KSXA 3W9VA 5F24A 4GWZA 4N07A 1B3GA 4F19A 3PPOA 1JVYA 2R8TA 3PUXE 3TEPA 5A5XA 1XC1A 4N17A 4E0WA 3EHTA 1SW5A 4KXPA 1IMBA 3RTWB 4UA8A 2XXXA 4FEBA 4QFNA 5K2YA 3TCFA 4NAPA 3HCQA 4DXBA 1MDP1 3TTRA 4ONYA 3OEMA 3T96B 5CBSA 4H45A 1P1UA 1B1XA 4IO7A 1P1NA 4G68A 4F1UA 2A5TA 4NQ8A 2ZYNA 3L6GA 3M3LA 4DIGA 5ISUA 2F5XA 3PUYE 1LFGA 4PF6A 2WYKA 4QHQA 2FNCA 2XD3A 2ZNUA 3TELA 4ZEKA 3BIHA 3PD9A 3VXBA 4MCOA 1LBBA 2O1LA 4Q0CA 3Q26A 1XOCA 2KLFA 4X9TA 4H5FA 2XD2A 4R2FA 4KR5A 3I3VA 1FRPA 2RCAA 2UVIA 3L6HA 1IMFA 2H25A 1WVJA 3O6GA 2H4IA 3FVNA 5IZ3B 3WAFA 3FZVA 3RPLB 1Y3PA 2DWAA 2ONKE 1A54A 2Z8FA 3PV0E 3UK4A 4NF8B 4U21A 4MLVA 4G8HA 3R7XA 5L9OA 1LCTA 4X1BA 3T9VA 4YKKA 5H8QB 1LAFE 4QXDA 2YPNA 2UVJA 2G29A 4ZECA 2CEXA 1O7TA 3U94A 1POTA 4XXUA 4R9FA 1FW0A 1NNFA 5KZTA 3IFCA 5IZZA 1TFDA 4OFJA 2CZHA 4F1YA 4JSOA 1USYH 4GBVA 1UTHA 5I2KA 5K2XA 3PGFA 3KC1A 3FXUA 3WAEA 5DVFA 1SDXA 3H3GA 4OVRA 1R1NA 1MY3A 5IKBA 2PFZA 3HO7A 5DVIA 4OVSA 5DEXA 3VVFA 4X48A 3CVGA 5M2VA 1EZ9A 2DVCA 4QFLA 3VLUA 2H98A 1EZOA 1MXUA 2UVHA 2V25A 1IQ7A 4O8MA 1B05A 4PF8A 1MY1A 5B70A 4YMBA 2I3WA 3GYYA 1FPLA 4OYVA 1YXIA 1Q35A 5I57B 2H99A 2G93A 2HFBA 2WYPA 3OEKA 4R73A 3ECRA 1FPIA 3RLFE 3CG3A 2F8DA 4ZEDA 3CSGA 2BJIA 4KHZE 1EYKA 1FPKA 4OXVA 3A29A 3VVDA 1NNPA 2ESNA 3IORA 1IMCA 1OVTA 3M8UA 4ZDMA 1FTOA 4EDPA 4LP2B 5FTHA 3CI8A 3MPLA 3PMXA 1LBWA 4ZE8A 4U1OA 4MH5A 1SW2A 4YKPA 4P8BA 3RT8A 3FXBA 4AB5A 1SD3A 5F1QA 2DS9A 2DWHA 3V8XB 3B8BA 2FVZA 1BTJA 1RKMA 2O7IA 2ZZWA 4OEUA 1A99A 3B50A 1CB6A 1O63A 1JEVA 2FYIA 4F39A 3MW0A 3MP8A 1BK4A 3IO4A 1Z7NE 5DW8A 1US4A 3MUQA 5EYHA 2PBWA 4MAGA 1FPEA 3QAXA 4KPTA 1MY4A 1YTVA 1M5FA 3THIA 5H8NB 1NH7A 1GVCA 5I2NB 2Z23A 3T9HB 1FTJA 4GXAA 4R75A 1XHYA 1IXIA 3VFJA 3QSLA 2HZLA 1B9JA 2RC8A 1DK4A 2F7BA 2HCAA 2PT1A 4PDDA 3FD3A 1MQJA 5TU0A 3CFLA 3ISPA 1IXGA 2XXHA 1EYJA 2DDKA 2XWIA 4QSCA 5H8HB 2XXYA 3KN8A 3VLWA 4GWYA 3VE1B 3HV1A 3FJMA 2QVRA 3DELB 1OQHA 4HTGA 3T66A 1SQYA 3OELA 4P0IA 2PFYA 1JEUA 3G7WA 1NV7A 1Q1KA 4LONB 5AA4A 1AL3A 4PBHA 1MXYA 2Q9TA 4N6KA 4YB5A 1SW4A 2V4CA 3MVWA 2BJJX 4R6KA 4WEPA 4MBPA 5CBRA 1ELJA 2AL4A 4NMYA 3PUZE 1Y1MA 1NV4A 1AWBA 4PFWA 4N81A 5J1DA 1URGA 4N13A 1MH4A 4M4GA 4GFRA 3RT6B 1FPGA 2UYEA 3SZPA 2VOZA 1IMEA 4U2RA 5EQ8A 5I5PA 4PFIA 1UTBA 5ET8A 4BDRA 3LUZA 3UN6A 3C31A 2ANJA 1MG1A 4NF6B 1OLCA 1KWHA 5I7IA 2I3VA 1I6QA 1IEJA 4OA4A 2FA7A 4EF2A 2Q2AA 1K9ZA 5DYHA 3FUZA 4P47A 1QKBA 3K6XA 4R2BA 1B32A 3UA8A 2B3BA 4OVQA 3C4MA 3V83A 1KA1A 4XIGQ 2Y84A 3F11A 3KN7A 2X7PA 3BFUA 4BDNA 3C35A 3EHUA 3T93B 4ZZAA 4O3CA 3SESA 3RYDA 4I40A 4PFTA 3K6UA 1B3HA 1XVYA 3CR9A 4QFKA 2B65A 3EQ1A 1SPIA 4KCDA 4H8IA 4P9KA 5ELVA 3UIFA 1US5A 3U65A 2HPGA 5L9MA 1I6BA 3PPRA 1PB8A 4F22A 1AH5A 4ESXA 5B7DA 3GLBA 4BDLA 4PP0A 3IX1A 5L8DA 2DE2A 1MQGA 2QVVA 3Q28A 1FBHA 3BIGA 3OD7A 4I3EA 1Y3NA 1A7LA 1TXFA 1MRPA 3MAMA 3VV5A 3RGYA 3TCHA 4XKQA 1SVXB 4PGPA 1P99A 3MZBA 2P3NA 3PU5A 4XKRA 1MXXA 3GZGA 4FORA 5A5XB 1IXHA 2XHDA 1I69A 2E1SA 3FXRA 4YKJA 2PMSA 4RPOA 4IO3A 4JVCA 3EN3A 5AA2A 2FIEA 3VXCA 3PPNA 4U4SA 1GTKA 5I59A 1NV5A 1B7ZA 3MZ1A 2DYXA 1A40A 3G3JA 4P1LA 4EXKA 2XXKA 3KFMA 4LVQA 3USDA 2A5TB 3CSBA 3N26A 1BLFA 1FSAA 4DDDA 1I6AA 2F3DA 4MX6A 2O51A 1H3DA 4DLDA 4DE8A 5TPAA 2O69A 4ND9A 2I6EA 1NV1A 2E0SA 3U93A 2Y7RA 1P1OA 4DI4B 4FE8A 2ABHA 5FTIA 3TPAA 4YB6A 4ELQA 1MPDA 4XKPA 4YZZA 3RN8A 3SERA 3OSRA 1FPBA 5L9SA 3M3FA 1FTMA 5F7VA 3TTNA 3MJNA 4POWA 4F3PA 1FQDA 5DT6A 4RYAA 1NNTA 3CG1A 4MF3A 4P0GA 1WODA 2R9JA 4THIA 4QF9A 3K2DA 3D4CA 4IO5A 4QFPA 4XFEA 2PT2A 3FJ7A 1LCFA 4UACA 4RPNA 5DVJA 1AMFA 4QFOA 4FAJA 5ITOA 3ODBA 4G4PA 2F34A 4JVIA 5BUUA 2XWKA 1MS7A 5ET6A 5ICTA 1OQGA 3R6UA 2GRVA 1M5DA 1B52A 4GLIA 3RPWA 1S7YA 1UTHB 4ZEFA 5I2KB 1D9YA 3TTLA 1N3WA 1MY0A 2PYYA 1MDQA 5AE4A 3JV9A 4PTKA 4R6HA 1FBGA 4YMAA 4DCYA 4M1VA 2QRYA 4MEVA 5DEXB 2DXRA 2OCUA 4H65A 1B4ZA 3B6WA 1MQIA 3H7MA 4FECA 3VLVA 4YU0A 2MKZA 3ILTB 2Q88A 5H8SA 4NWDA 2F3BA 3PUVE 4IY6A 3K00A 3V5AA 3TZAA 3QUFA 2Q2CA 4PFYA 4IGTA 4I9DA 3SKPA 2REJA 1LB8A 3O6IA 1SYHA 4GVOA 2OJTA 1FBPA 2B4MA 1A8FA 3LC8A 3A3UA 2ZYMA 3MBPA 2FBPA 3E79A 3TODA 2OWSA 1YAEA 5CMCA 3KSJA 1MPCA 4QRZA 4KYDA 1N76A 4YKIA 1MM6A 3EF7A 1ZJLA 1H43A 4NN3A 1FTLA 3G3HA 1B58A 2KQZA 4GD5A 2REGA 4YICA 4GL8A 4FEDA 1ANFA 2M8CA 3DP8A 4I3YA 1UQWA 4AB6A 3OO8A 4GX4A 3EKIA 4PC9A 1RDXA 1B5JA 2CEYA 1T0KA 3EPEA 4R6YA 3GBAA 3ZS6A 2HZKA 3OMBA 4N6PA 2V93A 3RY3A 1UIVA 3O6HA 1FQEA 3KEIA 5KDTA 1LLSA 2P2AA 3G3IA 4GWOA 4UABA 4ZE9A 5ITPA 3MC2A 1B7HA 4OMBA 4FATA 3ONMA 2FIXA 2HXWA 2H9BA 1JP4A 4O94A 3H6VA 4PFBA 3GBBA 1LSTA 4OHNA 1VDWA 4IO2A 4PBQA 1B3FA 1POY1 2UVGA 2X26A 1DTZA 1N7WA 3OXNA 4PAFA 3SEVA 1MQDA 2F6GA 5IZ1A 2DQVA 5EQ9A 4OQOA 3FJGA 1MXWA 4JDFA 5ET5A 1QUKA 4HE0A 2OK2A 3R26A 5LDZA 1DTGA 3O66A 5FHNA 2CZLA 3IO6A 1NFTA 4PDHA 2DVZA 1URSA 4LQ5A 3T9UA 1D4NA 4OVPA 3S9EA 5JEIA 3TDJA 1QUJA 3IJOB 3N6UA 2R71A 2I4CA 1JW1A 4GWSA 1JW5A 2RF1A 1MY2A 4KYEA 4ZEIA 2LAOA 1NV3A 2NXOA 4I8CA 3UORA 2DSFA 1ZKBA 1B0LA 1Z7ME 5CMBA 3K6WA 4GQOA 4GWUA 1FQFA 4DXCA 2XA5A 3TAJA 1O64A 5AA4B 4C0RA 2JJKA 3Q27A 2Z8DA 1MPBA 3SEXA 2VHAA 3TQWA 3K1PA 4LZ8A 1YPNA 3UGWA 2P0SA 1H45A 1WDNA 4NG7A 4PETA 3Q29A 3QUJA 3TCGA 4PFUA 4N91A 4NF5A 3TYHA 2VT5A 4LQ2A 1ZU0A 4MLQA 1UTBB 1IITA 1EZPA 2P1SA 2O84X 1PC3A 2XXPA 2HAVA 3S9MC 3FVOA 3C33A 3HSTA 2F97A 3RTFB 4JBZA 2F35A 3FBPA 2GHAA 1J1NA 1BP5A 4FIMA 4EXLA 4GRKA 1NH8A 1URDA 3SEUA 2XXVA 3S9NC 4MNCA 3A3CA 4U1ZA 2PCRA 4R9GA 4OFLA 4RJZA 4OFOA 4EQ9A 4OTEA 5JTYA 4G8MA 2DWJA 1JVXA 2QFLA 1B6HA 2IA4A 1OIBA 1NUWA 1YCJA 3OO7A 5CMMA 2WBBA 2RC9A 5I56A 5CI5A 5T3JA 2ZNTA 2WKYA 3DLNA 1QUIA 4U22A 4I1DA 4RA1A 2ZYKA 1BIYA 3LSXA 5HPQA 2F7CA 5ESYA 4F1VA 5ET7A 1HSJA 4G61A 2VPOA 1FBCA 1FQCA 1FBDA 1M5CA 3RQTA 5IAIA 4Z7EA 2P3VA 3W15C 4MMPA 3B6QA 3O2AA 5I84A 1AOVA 3BFTA 3E3KA 4PAIA 5KCJA 4O7IA 4NX1A 1NI9A 2RCBA 1M5BA 3QYTA 1FPJA 2D21A 1FBFA 3G3GA 3FVGA 3MWBA 1LAGE 3SDFA 5AA2B 2ZNSA 3PUWE 4G2ZA 1Y20A 3CHGA 3KOTA 1M5EA 3HHFA 4NGUA 2Y7PA 1Y4TA 1KA0A 3K01A 1FPDA 3EHSA 1QVSA 1SI0A 5I59B 3G3FA 5IGAA 3OSQA 2UYFA 2QS4A 3IOVA 3TFLA 4F29A 5TPAB 1FBEA 4N6DA 2ZYOA 2THIA 1G0HA 2XXUA 2Q89A 3BBRA 3C34A 2HXRA 3M3KA 4IY5A 2V84A 4XEQA 5AA3A 3H4ZA 4ZZEA 4F31B 3IL1B 2AL5A 3IOTA 3K02A 4OWDA 1SYIA 1LBYA 4E0XA 1B4HA 4GOTA 3KJTA 3TUSA 4N4UA 1XS5A 4QBAA 4ZEBA 5H8FA 4NE4A 1QJMA 2AYSA 3KC0A 3RNNA 4QSDA 1QW0A 3UP9A 3CFZA 1B2HA 3OO9A 2ALUA 4NF4A 2Y5KA 4GL0A 4MHFA 1NL5A 4H0WA 4IB2A 1HSEA 3HN0A 1HSLA 3T22A 4H5GA 1VE4A 4DXUA 4PAKA 5TP9A 2QS1A 1ZTYA 4LZ5A 4F2QA 4HCWA 4R74A 3O97A 1NUZA 4DZ1A 3E4RA 3JYRA 3T1BA 2F6PA 2Z22A 1PB7A 2Y7WA 1B3LA 1EH3A 2XX8A 2OWTA 3D4GA 4O7MA 2OWZA 1GR2A 4C1TA 1B1HA 3S9LC 1RDYA 3ZKKA 3KGCA 2NVUB 2DXYA 2PVUA 2Z8EA 2F7AA 2H5YA 3U8QA 1P1QA 1MQHA 3LUYA 3MP6A 1IMAA 2NOOA 3MYUA 4JXIA 4H6DA 3N6TA 2YLNA 5FHMA 4P11A 3CFXA 4PCDA 3QK6A 4LZ7A 3C36A 3H06B 1USYE 4AQ4A 4ECFA 4U23A 1NUXA 1DSNA 1B0HA 1VFEA 4OESA 5HM4B 4NHBA 3N94A 1MM7A 4H67A 4OEVA 1MXZA 1DMBA 3PPQA 2QS2A 4P56A 2OX3A 3PPPA 4R72A 4RK9A 2XXTA 5AA2D 3MP1A 3H6WA 4ELRA 4I62A 4RXLA 1B5HA 1N84A 1FCKA 2RC7A 2D3IA 1TWYA 5I58A 1L5TA 2FHYA 3PD8A 4TOZA 1JNFA 3O9PA 2DE4A 2I4BA 4DI3D 1Y1ZA 3SETA 3K1MA 1IZ1A 2NUVA 1XVXA 3FIRA 4PFRA 4JWOA 4HS7A 4O3AA 3HPIA 2QJEA 3B6TA 3IOWA 2F36A 1PDAA 1FJ9A 5KDTB 4X1DA 2ONSA 5HBCA 2ZXTA 3G3KA 1MXVA 2DOJA 3FV2A 1INPA 2ONRA 4NF0A 5I3SA 2QMXA 2Q74A 2QS3A 3ZSFA 1BKAA 3TTKA 2O1MA 1YYZA 1S9TA 1OLAA 4Q8RA 4IO6A 3K4UA 3KBRA 4ELPA 3BKIB 4ELOA 4K3FA 3FXQA 1LBVA 2WBDA 3H03A 1B5IA 2V3TA 3MPKA 4BDOA 4WKMA 3DP4A 3FV1A 2Q8MA 4RY1A 1AIVA 3C9HA 4X8RA 1A8EA 1II5A 1XT8A 1SBPA 4P3LA 4JSDA 1G0IA 5CRYA 1VFDA 1LAXA 3KOSA 4Z0IA 4F2OA 4GF8A 3MZ9A 3CRBA 4DCXA 1IUDA 2DE3A 4OENA 3TKDA 1D9VA 1FPFA 1LFHA 2I0CA 3W9WA 3ZKLA 2QVUA 4HE1A 3FATA 4GBWA 1NNKA 3IB1A 3N5LA 4QSEA 1Q9DA 3OO6A 1NV6A 2O7UA 2DWIA 4ESWA 2QSXA 1B46A 3K6VA 5CC2A 4PGNA 4G77A 4BDQA 3LSLA 1LBXA 4BDMA 5IZ3A 1GGGA 3K0VA 4O3BA 1EYIA 2XX7A 3RPLA 1D3KA 3FGSA 3KG2A 3LSWA 3U92A 4PE5B 1NKXA 3S2VA 4MFIA 4MIJA 2HEUA 2GFEA 3VDFA 5EYGA 1PBQA 4OETA 4NF8A 4C1UA 2KR0A 1FJ6A 2VD3A 4FBPA 4F3GA 1DPEA 3B7DA 3HHGA 5H8QA 2B3FA 1LBCA 3IAZA 4NF5B 4OZ9A 3FVKA 2XWVA 3D1RA 1LAHE 4YAHX 1FQAA 4KYSA 5FBPA 1DPPA 4GX6A 3IFAA 2O68A 3IJXB 3MSTA 4H1XA 4GX3A 4MNPA 3U72A 1ZBMA 2QL3A 2HQ0A 4HXVA 4IGRA 4YB7A 1YZ0A 2GQ1A 4U4XA 4NWCA 3FASA 1ZIUA 2Y7KA 4GWWA 2I49A 4JWXA 3RUMA 1FTAA 3TTMA 4F3BA 4F18A 4Q5TA 1KZ8A 4GIZA 2O6AA 4ISUA 4LATA 1DBZA 4JWYA 4FJPA 1Y9UA 4RNSA 3LR1A 5JTYB 1JQFA 4OANA 3NOHA 2OBGA 4XF5A 4H46A 4GWXA 4TLLB 1NV2A 1RYXA 4GXSB 3CIJA 4OVTA 5I56B 5LTCA 3O28A 4H8JA 4OVJA 4HCYA 5I57A 3TQLA 1B51A 1B3EA 1SI1A 4G8NA 2ZMBA
chains in the Genus database with same CATH topology
1OVBA 4TQUQ 1A55A 4LA9A 1F9BA 2RINA 4ZS9A 4TLMB 5EHSA 3H6UA 4NEDA 3DM0A 1R6ZA 2I58A 3KJ7A 5KCJB 4NTLA 1LGBC 4RK2A 3U1OA 1PB9A 2F78A 2Y7IA 1R9LA 2I48A 3H6TA 2A5SA 3VVEA 3S4UA 3I6VA 5FHOA 3SEWA 2OZZA 1ZLQA 1R9QA 2VP1A 5BWJA 1B7UA 3SEYA 3PMWA 1VSOA 4LUBA 5H8NA 1SW1A 3MQ9A 1OMPA 1JW4A 2XXWA 5I2NA 4Q30B 1TFAA 1NMUA 3MVZA 3K1NA 5CMKA 1PBPA 1QKAA 3P7IA 5ICQA 2NWJA 4HW8A 4EUOA 3I5OA 3TMGA 2XXRA 4WEDA 1GV8A 1DOTA 3MVXA 1LB9A 1IIWA 2GH9A 3PMVA 2V3UA 2YJPA 2W7YA 5H8FB 3IK6B 3O29A 5H8HA 4POXA 4OERA 4G68C 1FQBA 3E9XA 3OENA 5CM6A 2IEEA 2XX9A 4L17A 3IB0A 3KN3A 1TT1A 4NF4B 5EYFA 5LOMA 1N0TA 3QXMA 4IO4A 1IXCA 2DP8A 4XTCQ 3IB2A 3IOUA 3LSFB 5TP9B 5JK4A 4PQJA 1RYOA 3C32A 2I0BA 4WXJA 3KZGA 3Q25A 2UXAA 2Q8JA 1S50A 1VR5A 2VGQA 3DP6A 2XXQA 1JETA 1P1WA 3GXAA 2HAUA 2AIXA 4BLAA 4NF6A 4JB7A 1N3XA 4EQBA 4XKNA 1N04A 3V89B 1B40A 5AA1A 3LBSA 1EU8A 2QMWA 2QPQA 2RKMA 2V3QA 1PEBA 1N7XA 4EQ7A 3OOAA 1ZMGA 2CMOA 4KQPA 4EF1A 1Y3QA 4F3SA 1H76A 4KFQA 1FTKA 2X7QA 2R6GE 3JZJA 1UIUA 3IR1A 3ILUB 2PX1A 4G68B 2D5WA 3E13X 1ATGA 2GHBA 2VD2A 2OLBA 5EHMA 3MVYA 3AXFA 1Y4CA 1H44A 4KCCA 5I58B 3QIMA 1MH3A 4KI0E 3A09A 1LFIA 5DTBA 3T9XB 4KD5A 2XXIA 1CE2A 1QULA 3KSXA 3W9VA 4N07A 1B3GA 4F19A 3PPOA 1JVYA 3PUXE 3TEPA 5A5XA 1XC1A 4E0WA 3EHTA 1SW5A 3RTWB 4UA8A 2XXXA 4FEBA 4QFNA 5K2YA 3TCFA 4DXBA 3HCQA 1MDP1 3TTRA 4ONYA 4G8NA 3OEMA 3T96B 5CBSA 1P1UA 1B1XA 4IO7A 1P1NA 4G68A 4F1UA 2A5TA 2ZYNA 3L6GA 3M3LA 4DIGA 5ISUA 2F5XA 3PUYE 1LFGA 4QHQA 2FNCA 2XD3A 2ZNUA 3TELA 4ZEKA 3PD9A 3VXBA 1LBBA 2O1LA 4Q0CA 3Q26A 1XOCA 2KLFA 4X9TA 4H5FA 2XD2A 4R2FA 4KR5A 3I3VA 2RCAA 2UVIA 3L6HA 2H25A 1WVJA 3O6GA 2H4IA 3FVNA 3WAFA 3FZVA 1Y3PA 2DWAA 2ONKE 1A54A 2Z8FA 3PV0E 3UK4A 4NF8B 4U21A 4MLVA 4G8HA 3R7XA 5L9OA 1LCTA 4X1BA 3T9VA 4YKKA 5H8QB 1LAFE 2YPNA 2UVJA 2G29A 4ZECA 1O7TA 3U94A 1POTA 4XXUA 4R9FA 1FW0A 1NNFA 5KZTA 1TFDA 4OFJA 4F1YA 4JSOA 1USYH 1UTHA 5I2KA 5K2XA 3PGFA 3FXUA 3WAEA 5DVFA 1SDXA 3H3GA 1R1NA 1MY3A 5IKBA 3HO7A 5DVIA 5DEXA 3VVFA 4X48A 3CVGA 5M2VA 1EZ9A 2DVCA 4QFLA 3VLUA 2H98A 1EZOA 1MXUA 2UVHA 2V25A 1IQ7A 1B05A 1MY1A 5B70A 4YMBA 2I3WA 4OYVA 1Q35A 5I57B 2H99A 2G93A 2HFBA 3OEKA 4R73A 3ECRA 3RLFE 3CG3A 2F8DA 4ZEDA 3CSGA 4KHZE 4OXVA 3VVDA 1NNPA 2ESNA 3IORA 1OVTA 3M8UA 4ZDMA 1FTOA 4EDPA 4LP2B 5FTHA 3CI8A 3MPLA 3PMXA 4ZE8A 4U1OA 4MH5A 1SW2A 4YKPA 3RT8A 4AB5A 1SD3A 5F1QA 2DS9A 2DWHA 3V8XB 1BTJA 1RKMA 2O7IA 4OEUA 1A99A 1CB6A 1O63A 1JEVA 2FYIA 4F39A 3MW0A 3MP8A 3IO4A 1Z7NE 1US4A 3MUQA 2PBWA 3QAXA 4KPTA 1MY4A 1YTVA 1M5FA 3THIA 5H8NB 1NH7A 1GVCA 5I2NB 2Z23A 3T9HB 1FTJA 4GXAA 4R75A 1XHYA 1IXIA 3VFJA 3QSLA 2HZLA 1B9JA 2RC8A 2F7BA 2HCAA 2PT1A 3FD3A 1MQJA 5TU0A 3CFLA 1IXGA 2XXHA 4QSCA 5H8HB 2XXYA 3KN8A 3VLWA 3VE1B 3HV1A 3FJMA 3DELB 1OQHA 4HTGA 3T66A 1SQYA 3OELA 4P0IA 1JEUA 3G7WA 1Q1KA 4LONB 5AA4A 1AL3A 1MXYA 2Q9TA 4YB5A 1SW4A 3MVWA 2BJJX 4R6KA 4WEPA 4MBPA 5CBRA 1ELJA 2AL4A 4NMYA 3PUZE 1Y1MA 4PFWA 5J1DA 1URGA 4N13A 1MH4A 4M4GA 4GFRA 3RT6B 2UYEA 2VOZA 4U2RA 1UTBA 4BDRA 3UN6A 3C31A 2ANJA 1MG1A 4NF6B 1OLCA 1KWHA 2I3VA 1I6QA 1IEJA 2FA7A 4EF2A 2Q2AA 5DYHA 3FUZA 1QKBA 3K6XA 4R2BA 1B32A 3UA8A 2B3BA 3C4MA 3V83A 4XIGQ 2Y84A 3F11A 3KN7A 2X7PA 3BFUA 4BDNA 3C35A 3EHUA 3T93B 4ZZAA 4O3CA 3SESA 4PFTA 3K6UA 1B3HA 1XVYA 3CR9A 4QFKA 2B65A 3EQ1A 4KCDA 4H8IA 5ELVA 3UIFA 1US5A 5L9MA 1I6BA 4F22A 3PPRA 1PB8A 1AH5A 5B7DA 4ESXA 3GLBA 4BDLA 4PP0A 3IX1A 5L8DA 2DE2A 1MQGA 3Q28A 3OD7A 1Y3NA 1A7LA 1TXFA 1MRPA 3MAMA 3VV5A 3RGYA 3TCHA 4XKQA 1SVXB 1P99A 3MZBA 3PU5A 4XKRA 1MXXA 3GZGA 4FORA 5A5XB 1IXHA 2XHDA 1I69A 2E1SA 3FXRA 4YKJA 2PMSA 4RPOA 4IO3A 3EN3A 5AA2A 3VXCA 3PPNA 4U4SA 1GTKA 5I59A 1B7ZA 3MZ1A 2DYXA 1A40A 3G3JA 4EXKA 3KFMA 4LVQA 3USDA 2A5TB 3CSBA 3N26A 1BLFA 4DDDA 1I6AA 4DLDA 2O51A 1H3DA 4DE8A 5TPAA 2O69A 4ND9A 2I6EA 2E0SA 3U93A 2Y7RA 1P1OA 4FE8A 2ABHA 5FTIA 3TPAA 4YB6A 4ELQA 1MPDA 4XKPA 4YZZA 3RN8A 3OSRA 5L9SA 3M3FA 1FTMA 5F7VA 3TTNA 3MJNA 4POWA 4F3PA 1FQDA 5DT6A 4RYAA 1NNTA 3CG1A 4MF3A 4P0GA 1WODA 2R9JA 4THIA 4QF9A 3K2DA 3D4CA 4IO5A 4QFPA 2PT2A 3FJ7A 1LCFA 4UACA 4RPNA 5DVJA 1AMFA 4QFOA 4FAJA 5ITOA 3ODBA 4G4PA 2F34A 5BUUA 1MS7A 5ICTA 1OQGA 3R6UA 2GRVA 1M5DA 1B52A 4GLIA 3RPWA 1S7YA 1UTHB 4ZEFA 5I2KB 1D9YA 3TTLA 1N3WA 1MY0A 2PYYA 1MDQA 5AE4A 3JV9A 4R6HA 4YMAA 4DCYA 4M1VA 2QRYA 5DEXB 2DXRA 2OCUA 4H65A 1B4ZA 3B6WA 1MQIA 3H7MA 4FECA 3VLVA 4YU0A 3ILTB 2Q88A 5H8SA 4NWDA 3PUVE 4IY6A 3K00A 3V5AA 3TZAA 3QUFA 2Q2CA 4PFYA 4IGTA 4I9DA 3SKPA 2REJA 1LB8A 3O6IA 1SYHA 4GVOA 2OJTA 1A8FA 3LC8A 3A3UA 2ZYMA 3MBPA 3TODA 2OWSA 1YAEA 5CMCA 3KSJA 1MPCA 4QRZA 4KYDA 1N76A 4YKIA 1MM6A 3EF7A 1ZJLA 1H43A 1FTLA 3G3HA 1B58A 4GD5A 2REGA 4YICA 4GL8A 4FEDA 1ANFA 2M8CA 3DP8A 1UQWA 4AB6A 3OO8A 1B5JA 1T0KA 3EPEA 4R6YA 3GBAA 3ZS6A 2HZKA 3OMBA 4N6PA 2V93A 3RY3A 1UIVA 3O6HA 1FQEA 3KEIA 5KDTA 1LLSA 2P2AA 3G3IA 4GWOA 4ZE9A 5ITPA 3MC2A 1B7HA 4OMBA 4FATA 3ONMA 2HXWA 2H9BA 3H6VA 3GBBA 1LSTA 4OHNA 4IO2A 1B3FA 1POY1 2UVGA 2X26A 1DTZA 1N7WA 3OXNA 3SEVA 1MQDA 2F6GA 2DQVA 4OQOA 3FJGA 1MXWA 4JDFA 1QUKA 2OK2A 3R26A 1DTGA 3O66A 5FHNA 2CZLA 3IO6A 1NFTA 2DVZA 1URSA 4LQ5A 3T9UA 1D4NA 3S9EA 5JEIA 3TDJA 1QUJA 3IJOB 3N6UA 2R71A 2I4CA 1JW1A 1JW5A 2RF1A 1MY2A 4KYEA 4ZEIA 2LAOA 2NXOA 4I8CA 3UORA 2DSFA 1ZKBA 1B0LA 1Z7ME 5CMBA 3K6WA 4GQOA 1FQFA 4DXCA 3TAJA 1O64A 5AA4B 4C0RA 3Q27A 2Z8DA 1MPBA 3SEXA 2VHAA 3TQWA 3K1PA 4LZ8A 1YPNA 3UGWA 2P0SA 1H45A 1WDNA 4PETA 3Q29A 3QUJA 3TCGA 4PFUA 4NF5A 3TYHA 4LQ2A 1ZU0A 4MLQA 1UTBB 1IITA 1EZPA 2P1SA 2O84X 1PC3A 2XXPA 2HAVA 3S9MC 3FVOA 3C33A 3HSTA 2F97A 3RTFB 4JBZA 2F35A 2GHAA 1J1NA 1BP5A 4FIMA 4EXLA 4GRKA 1NH8A 1URDA 3SEUA 2XXVA 3S9NC 3A3CA 4U1ZA 4R9GA 4OFLA 4RJZA 4OFOA 4EQ9A 4OTEA 5JTYA 4G8MA 2DWJA 1JVXA 1B6HA 2IA4A 1OIBA 1YCJA 3OO7A 5CMMA 5I56A 2RC9A 5CI5A 2ZNTA 2WKYA 3DLNA 1QUIA 4U22A 4I1DA 4RA1A 2ZYKA 1BIYA 3LSXA 5HPQA 2F7CA 4F1VA 1HSJA 1FQCA 1M5CA 3RQTA 5IAIA 4Z7EA 3W15C 3B6QA 3O2AA 5I84A 1AOVA 3BFTA 3E3KA 5KCJA 2RCBA 1M5BA 3QYTA 2D21A 3G3GA 3FVGA 3MWBA 1LAGE 3SDFA 5AA2B 2ZNSA 3PUWE 4G2ZA 1Y20A 3KOTA 1M5EA 3HHFA 2Y7PA 1Y4TA 3K01A 3EHSA 1QVSA 1SI0A 5I59B 3G3FA 3OSQA 2UYFA 2QS4A 3IOVA 3TFLA 4F29A 5TPAB 2ZYOA 2THIA 2XXUA 2Q89A 3BBRA 3C34A 3M3KA 4IY5A 2V84A 5AA3A 3H4ZA 4ZZEA 4F31B 3IL1B 2AL5A 3IOTA 3K02A 4OWDA 1SYIA 4E0XA 1B4HA 4GOTA 3KJTA 3TUSA 1XS5A 4ZEBA 5H8FA 4NE4A 1QJMA 2AYSA 3RNNA 4QSDA 1QW0A 3UP9A 3CFZA 1B2HA 3OO9A 2ALUA 4NF4A 4GL0A 1NL5A 4H0WA 4IB2A 1HSEA 3HN0A 1HSLA 3T22A 4H5GA 1VE4A 4DXUA 5TP9A 2QS1A 1ZTYA 4LZ5A 4F2QA 4HCWA 4R74A 3O97A 4DZ1A 3E4RA 3JYRA 2F6PA 2Z22A 1PB7A 2Y7WA 1B3LA 1EH3A 2XX8A 2OWTA 3D4GA 1GR2A 4C1TA 1B1HA 3S9LC 3ZKKA 3KGCA 2NVUB 2DXYA 2PVUA 2Z8EA 2F7AA 2H5YA 3U8QA 1P1QA 1MQHA 3LUYA 3MP6A 2NOOA 4JXIA 4H6DA 3N6TA 2YLNA 5FHMA 4P11A 3CFXA 3QK6A 4LZ7A 3C36A 3H06B 1USYE 4AQ4A 4ECFA 4U23A 1DSNA 1B0HA 1VFEA 4OESA 5HM4B 3N94A 1MM7A 4H67A 4OEVA 1MXZA 1DMBA 3PPQA 2QS2A 3PPPA 4R72A 4RK9A 2XXTA 5AA2D 3MP1A 3H6WA 4ELRA 4I62A 4RXLA 1B5HA 1N84A 1FCKA 2RC7A 2D3IA 1TWYA 5I58A 1L5TA 3PD8A 4TOZA 1JNFA 3O9PA 2DE4A 2I4BA 1Y1ZA 3SETA 3K1MA 1IZ1A 2NUVA 1XVXA 3FIRA 4JWOA 4HS7A 4O3AA 3HPIA 2QJEA 3B6TA 3IOWA 2F36A 1PDAA 5KDTB 4X1DA 2ONSA 5HBCA 2ZXTA 3G3KA 1MXVA 2DOJA 3FV2A 2ONRA 2QMXA 2QS3A 3ZSFA 1BKAA 3TTKA 2O1MA 1S9TA 1OLAA 4Q8RA 4IO6A 3K4UA 3KBRA 4ELPA 3BKIB 4ELOA 4K3FA 3FXQA 3H03A 1B5IA 2V3TA 3MPKA 4BDOA 4WKMA 3DP4A 3FV1A 4RY1A 1AIVA 3C9HA 1A8EA 1II5A 1XT8A 1SBPA 4JSDA 5CRYA 1VFDA 1LAXA 3KOSA 4Z0IA 4F2OA 4GF8A 3MZ9A 3CRBA 4DCXA 1IUDA 2DE3A 4OENA 3TKDA 1D9VA 1LFHA 2I0CA 3W9WA 3ZKLA 3FATA 1NNKA 3IB1A 3N5LA 3OO6A 4QSEA 2O7UA 2DWIA 4ESWA 2QSXA 1B46A 3K6VA 5CC2A 4G77A 4BDQA 3LSLA 4BDMA 1GGGA 3K0VA 4O3BA 2XX7A 1D3KA 3FGSA 3KG2A 3LSWA 3U92A 4PE5B 1NKXA 3S2VA 4MFIA 2HEUA 2GFEA 3VDFA 1PBQA 4OETA 4NF8A 4C1UA 2VD3A 4F3GA 1DPEA 3B7DA 3HHGA 5H8QA 2B3FA 1LBCA 3IAZA 4NF5B 4OZ9A 3FVKA 1LAHE 4YAHX 1FQAA 4KYSA 1DPPA 2O68A 3IJXB 4H1XA 3U72A 1ZBMA 2QL3A 2HQ0A 4IGRA 4YB7A 4U4XA 4NWCA 3FASA 1ZIUA 2Y7KA 2I49A 4JWXA 3RUMA 3TTMA 4F3BA 4F18A 4Q5TA 4GIZA 2O6AA 4ISUA 4LATA 4JWYA 4FJPA 1Y9UA 4RNSA 3LR1A 5JTYB 1JQFA 2OBGA 4TLLB 1RYXA 4GXSB 3CIJA 5I56B 3O28A 4H8JA 4OVJA 4HCYA 5I57A 3TQLA 1B51A 1B3EA 1SI1A 3SERA 2ZMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVB A;  4TQU Q;  1A55 A;  4LA9 A;  1F9B A;  2RIN A;  4ZS9 A;  4TLM B;  5EHS A;  3H6U A;  4NED A;  3DM0 A;  1R6Z A;  2I58 A;  3KJ7 A;  5KCJ B;  4NTL A;  1LGB C;  4RK2 A;  3U1O A;  1PB9 A;  2F78 A;  2Y7I A;  1R9L A;  2I48 A;  3H6T A;  2A5S A;  3VVE A;  3S4U A;  3I6V A;  5FHO A;  3SEW A;  2OZZ A;  1ZLQ A;  1R9Q A;  2VP1 A;  5BWJ A;  1B7U A;  3SEY A;  3PMW A;  1VSO A;  4LUB A;  5H8N A;  1SW1 A;  3MQ9 A;  1OMP A;  1JW4 A;  2XXW A;  5I2N A;  4Q30 B;  1TFA A;  1NMU A;  3MVZ A;  3K1N A;  5CMK A;  1PBP A;  1QKA A;  3P7I A;  5ICQ A;  2NWJ A;  4HW8 A;  4EUO A;  3I5O A;  3TMG A;  2XXR A;  4WED A;  1GV8 A;  1DOT A;  3MVX A;  1LB9 A;  1IIW A;  2GH9 A;  3PMV A;  2V3U A;  2YJP A;  2W7Y A;  5H8F B;  3IK6 B;  3O29 A;  5H8H A;  4POX A;  4OER A;  4G68 C;  1FQB A;  3E9X A;  3OEN A;  5CM6 A;  2IEE A;  2XX9 A;  4L17 A;  3IB0 A;  3KN3 A;  1TT1 A;  4NF4 B;  5EYF A;  5LOM A;  1N0T A;  3QXM A;  4IO4 A;  1IXC A;  2DP8 A;  4XTC Q;  3IB2 A;  3IOU A;  3LSF B;  5TP9 B;  5JK4 A;  4PQJ A;  1RYO A;  3C32 A;  2I0B A;  4WXJ A;  3KZG A;  3Q25 A;  2UXA A;  2Q8J A;  1S50 A;  1VR5 A;  2VGQ A;  3DP6 A;  2XXQ A;  1JET A;  1P1W A;  3GXA A;  2HAU A;  2AIX A;  4BLA A;  4NF6 A;  4JB7 A;  1N3X A;  4EQB A;  4XKN A;  1N04 A;  3V89 B;  1B40 A;  5AA1 A;  3LBS A;  1EU8 A;  2QMW A;  2QPQ A;  2RKM A;  2V3Q A;  1PEB A;  1N7X A;  4EQ7 A;  3OOA A;  1ZMG A;  2CMO A;  4KQP A;  4EF1 A;  1Y3Q A;  4F3S A;  1H76 A;  4KFQ A;  1FTK A;  2X7Q A;  2R6G E;  3JZJ A;  1UIU A;  3IR1 A;  3ILU B;  2PX1 A;  4G68 B;  2D5W A;  3E13 X;  1ATG A;  2GHB A;  2VD2 A;  2OLB A;  5EHM A;  3MVY A;  3AXF A;  1Y4C A;  1H44 A;  4KCC A;  5I58 B;  3QIM A;  1MH3 A;  4KI0 E;  3A09 A;  1LFI A;  5DTB A;  3T9X B;  4KD5 A;  2XXI A;  1CE2 A;  1QUL A;  3KSX A;  3W9V A;  4N07 A;  1B3G A;  4F19 A;  3PPO A;  1JVY A;  3PUX E;  3TEP A;  5A5X A;  1XC1 A;  4E0W A;  3EHT A;  1SW5 A;  3RTW B;  4UA8 A;  2XXX A;  4FEB A;  4QFN A;  5K2Y A;  3TCF A;  4DXB A;  3HCQ A;  1MDP 1;  3TTR A;  4ONY A;  4G8N A;  3OEM A;  3T96 B;  5CBS A;  1P1U A;  1B1X A;  4IO7 A;  1P1N A;  4G68 A;  4F1U A;  2A5T A;  2ZYN A;  3L6G A;  3M3L A;  4DIG A;  5ISU A;  2F5X A;  3PUY E;  1LFG A;  4QHQ A;  2FNC A;  2XD3 A;  2ZNU A;  3TEL A;  4ZEK A;  3PD9 A;  3VXB A;  1LBB A;  2O1L A;  4Q0C A;  3Q26 A;  1XOC A;  2KLF A;  4X9T A;  4H5F A;  2XD2 A;  4R2F A;  4KR5 A;  3I3V A;  2RCA A;  2UVI A;  3L6H A;  2H25 A;  1WVJ A;  3O6G A;  2H4I A;  3FVN A;  3WAF A;  3FZV A;  1Y3P A;  2DWA A;  2ONK E;  1A54 A;  2Z8F A;  3PV0 E;  3UK4 A;  4NF8 B;  4U21 A;  4MLV A;  4G8H A;  3R7X A;  5L9O A;  1LCT A;  4X1B A;  3T9V A;  4YKK A;  5H8Q B;  1LAF E;  2YPN A;  2UVJ A;  2G29 A;  4ZEC A;  1O7T A;  3U94 A;  1POT A;  4XXU A;  4R9F A;  1FW0 A;  1NNF A;  5KZT A;  1TFD A;  4OFJ A;  4F1Y A;  4JSO A;  1USY H;  1UTH A;  5I2K A;  5K2X A;  3PGF A;  3FXU A;  3WAE A;  5DVF A;  1SDX A;  3H3G A;  1R1N A;  1MY3 A;  5IKB A;  3HO7 A;  5DVI A;  5DEX A;  3VVF A;  4X48 A;  3CVG A;  5M2V A;  1EZ9 A;  2DVC A;  4QFL A;  3VLU A;  2H98 A;  1EZO A;  1MXU A;  2UVH A;  2V25 A;  1IQ7 A;  1B05 A;  1MY1 A;  5B70 A;  4YMB A;  2I3W A;  4OYV A;  1Q35 A;  5I57 B;  2H99 A;  2G93 A;  2HFB A;  3OEK A;  4R73 A;  3ECR A;  3RLF E;  3CG3 A;  2F8D A;  4ZED A;  3CSG A;  4KHZ E;  4OXV A;  3VVD A;  1NNP A;  2ESN A;  3IOR A;  1OVT A;  3M8U A;  4ZDM A;  1FTO A;  4EDP A;  4LP2 B;  5FTH A;  3CI8 A;  3MPL A;  3PMX A;  4ZE8 A;  4U1O A;  4MH5 A;  1SW2 A;  4YKP A;  3RT8 A;  4AB5 A;  1SD3 A;  5F1Q A;  2DS9 A;  2DWH A;  3V8X B;  1BTJ A;  1RKM A;  2O7I A;  4OEU A;  1A99 A;  1CB6 A;  1O63 A;  1JEV A;  2FYI A;  4F39 A;  3MW0 A;  3MP8 A;  3IO4 A;  1Z7N E;  1US4 A;  3MUQ A;  2PBW A;  3QAX A;  4KPT A;  1MY4 A;  1YTV A;  1M5F A;  3THI A;  5H8N B;  1NH7 A;  1GVC A;  5I2N B;  2Z23 A;  3T9H B;  1FTJ A;  4GXA A;  4R75 A;  1XHY A;  1IXI A;  3VFJ A;  3QSL A;  2HZL A;  1B9J A;  2RC8 A;  2F7B A;  2HCA A;  2PT1 A;  3FD3 A;  1MQJ A;  5TU0 A;  3CFL A;  1IXG A;  2XXH A;  4QSC A;  5H8H B;  2XXY A;  3KN8 A;  3VLW A;  3VE1 B;  3HV1 A;  3FJM A;  3DEL B;  1OQH A;  4HTG A;  3T66 A;  1SQY A;  3OEL A;  4P0I A;  1JEU A;  3G7W A;  1Q1K A;  4LON B;  5AA4 A;  1AL3 A;  1MXY A;  2Q9T A;  4YB5 A;  1SW4 A;  3MVW A;  2BJJ X;  4R6K A;  4WEP A;  4MBP A;  5CBR A;  1ELJ A;  2AL4 A;  4NMY A;  3PUZ E;  1Y1M A;  4PFW A;  5J1D A;  1URG A;  4N13 A;  1MH4 A;  4M4G A;  4GFR A;  3RT6 B;  2UYE A;  2VOZ A;  4U2R A;  1UTB A;  4BDR A;  3UN6 A;  3C31 A;  2ANJ A;  1MG1 A;  4NF6 B;  1OLC A;  1KWH A;  2I3V A;  1I6Q A;  1IEJ A;  2FA7 A;  4EF2 A;  2Q2A A;  5DYH A;  3FUZ A;  1QKB A;  3K6X A;  4R2B A;  1B32 A;  3UA8 A;  2B3B A;  3C4M A;  3V83 A;  4XIG Q;  2Y84 A;  3F11 A;  3KN7 A;  2X7P A;  3BFU A;  4BDN A;  3C35 A;  3EHU A;  3T93 B;  4ZZA A;  4O3C A;  3SES A;  4PFT A;  3K6U A;  1B3H A;  1XVY A;  3CR9 A;  4QFK A;  2B65 A;  3EQ1 A;  4KCD A;  4H8I A;  5ELV A;  3UIF A;  1US5 A;  5L9M A;  1I6B A;  4F22 A;  3PPR A;  1PB8 A;  1AH5 A;  5B7D A;  4ESX A;  3GLB A;  4BDL A;  4PP0 A;  3IX1 A;  5L8D A;  2DE2 A;  1MQG A;  3Q28 A;  3OD7 A;  1Y3N A;  1A7L A;  1TXF A;  1MRP A;  3MAM A;  3VV5 A;  3RGY A;  3TCH A;  4XKQ A;  1SVX B;  1P99 A;  3MZB A;  3PU5 A;  4XKR A;  1MXX A;  3GZG A;  4FOR A;  5A5X B;  1IXH A;  2XHD A;  1I69 A;  2E1S A;  3FXR A;  4YKJ A;  2PMS A;  4RPO A;  4IO3 A;  3EN3 A;  5AA2 A;  3VXC A;  3PPN A;  4U4S A;  1GTK A;  5I59 A;  1B7Z A;  3MZ1 A;  2DYX A;  1A40 A;  3G3J A;  4EXK A;  3KFM A;  4LVQ A;  3USD A;  2A5T B;  3CSB A;  3N26 A;  1BLF A;  4DDD A;  1I6A A;  4DLD A;  2O51 A;  1H3D A;  4DE8 A;  5TPA A;  2O69 A;  4ND9 A;  2I6E A;  2E0S A;  3U93 A;  2Y7R A;  1P1O A;  4FE8 A;  2ABH A;  5FTI A;  3TPA A;  4YB6 A;  4ELQ A;  1MPD A;  4XKP A;  4YZZ A;  3RN8 A;  3OSR A;  5L9S A;  3M3F A;  1FTM A;  5F7V A;  3TTN A;  3MJN A;  4POW A;  4F3P A;  1FQD A;  5DT6 A;  4RYA A;  1NNT A;  3CG1 A;  4MF3 A;  4P0G A;  1WOD A;  2R9J A;  4THI A;  4QF9 A;  3K2D A;  3D4C A;  4IO5 A;  4QFP A;  2PT2 A;  3FJ7 A;  1LCF A;  4UAC A;  4RPN A;  5DVJ A;  1AMF A;  4QFO A;  4FAJ A;  5ITO A;  3ODB A;  4G4P A;  2F34 A;  5BUU A;  1MS7 A;  5ICT A;  1OQG A;  3R6U A;  2GRV A;  1M5D A;  1B52 A;  4GLI A;  3RPW A;  1S7Y A;  1UTH B;  4ZEF A;  5I2K B;  1D9Y A;  3TTL A;  1N3W A;  1MY0 A;  2PYY A;  1MDQ A;  5AE4 A;  3JV9 A;  4R6H A;  4YMA A;  4DCY A;  4M1V A;  2QRY A;  5DEX B;  2DXR A;  2OCU A;  4H65 A;  1B4Z A;  3B6W A;  1MQI A;  3H7M A;  4FEC A;  3VLV A;  4YU0 A;  3ILT B;  2Q88 A;  5H8S A;  4NWD A;  3PUV E;  4IY6 A;  3K00 A;  3V5A A;  3TZA A;  3QUF A;  2Q2C A;  4PFY A;  4IGT A;  4I9D A;  3SKP A;  2REJ A;  1LB8 A;  3O6I A;  1SYH A;  4GVO A;  2OJT A;  1A8F A;  3LC8 A;  3A3U A;  2ZYM A;  3MBP A;  3TOD A;  2OWS A;  1YAE A;  5CMC A;  3KSJ A;  1MPC A;  4QRZ A;  4KYD A;  1N76 A;  4YKI A;  1MM6 A;  3EF7 A;  1ZJL A;  1H43 A;  1FTL A;  3G3H A;  1B58 A;  4GD5 A;  2REG A;  4YIC A;  4GL8 A;  4FED A;  1ANF A;  2M8C A;  3DP8 A;  1UQW A;  4AB6 A;  3OO8 A;  1B5J A;  1T0K A;  3EPE A;  4R6Y A;  3GBA A;  3ZS6 A;  2HZK A;  3OMB A;  4N6P A;  2V93 A;  3RY3 A;  1UIV A;  3O6H A;  1FQE A;  3KEI A;  5KDT A;  1LLS A;  2P2A A;  3G3I A;  4GWO A;  4ZE9 A;  5ITP A;  3MC2 A;  1B7H A;  4OMB A;  4FAT A;  3ONM A;  2HXW A;  2H9B A;  3H6V A;  3GBB A;  1LST A;  4OHN A;  4IO2 A;  1B3F A;  1POY 1;  2UVG A;  2X26 A;  1DTZ A;  1N7W A;  3OXN A;  3SEV A;  1MQD A;  2F6G A;  2DQV A;  4OQO A;  3FJG A;  1MXW A;  4JDF A;  1QUK A;  2OK2 A;  3R26 A;  1DTG A;  3O66 A;  5FHN A;  2CZL A;  3IO6 A;  1NFT A;  2DVZ A;  1URS A;  4LQ5 A;  3T9U A;  1D4N A;  3S9E A;  5JEI A;  3TDJ A;  1QUJ A;  3IJO B;  3N6U A;  2R71 A;  2I4C A;  1JW1 A;  1JW5 A;  2RF1 A;  1MY2 A;  4KYE A;  4ZEI A;  2LAO A;  2NXO A;  4I8C A;  3UOR A;  2DSF A;  1ZKB A;  1B0L A;  1Z7M E;  5CMB A;  3K6W A;  4GQO A;  1FQF A;  4DXC A;  3TAJ A;  1O64 A;  5AA4 B;  4C0R A;  3Q27 A;  2Z8D A;  1MPB A;  3SEX A;  2VHA A;  3TQW A;  3K1P A;  4LZ8 A;  1YPN A;  3UGW A;  2P0S A;  1H45 A;  1WDN A;  4PET A;  3Q29 A;  3QUJ A;  3TCG A;  4PFU A;  4NF5 A;  3TYH A;  4LQ2 A;  1ZU0 A;  4MLQ A;  1UTB B;  1IIT A;  1EZP A;  2P1S A;  2O84 X;  1PC3 A;  2XXP A;  2HAV A;  3S9M C;  3FVO A;  3C33 A;  3HST A;  2F97 A;  3RTF B;  4JBZ A;  2F35 A;  2GHA A;  1J1N A;  1BP5 A;  4FIM A;  4EXL A;  4GRK A;  1NH8 A;  1URD A;  3SEU A;  2XXV A;  3S9N C;  3A3C A;  4U1Z A;  4R9G A;  4OFL A;  4RJZ A;  4OFO A;  4EQ9 A;  4OTE A;  5JTY A;  4G8M A;  2DWJ A;  1JVX A;  1B6H A;  2IA4 A;  1OIB A;  1YCJ A;  3OO7 A;  5CMM A;  5I56 A;  2RC9 A;  5CI5 A;  2ZNT A;  2WKY A;  3DLN A;  1QUI A;  4U22 A;  4I1D A;  4RA1 A;  2ZYK A;  1BIY A;  3LSX A;  5HPQ A;  2F7C A;  4F1V A;  1HSJ A;  1FQC A;  1M5C A;  3RQT A;  5IAI A;  4Z7E A;  3W15 C;  3B6Q A;  3O2A A;  5I84 A;  1AOV A;  3BFT A;  3E3K A;  5KCJ A;  2RCB A;  1M5B A;  3QYT A;  2D21 A;  3G3G A;  3FVG A;  3MWB A;  1LAG E;  3SDF A;  5AA2 B;  2ZNS A;  3PUW E;  4G2Z A;  1Y20 A;  3KOT A;  1M5E A;  3HHF A;  2Y7P A;  1Y4T A;  3K01 A;  3EHS A;  1QVS A;  1SI0 A;  5I59 B;  3G3F A;  3OSQ A;  2UYF A;  2QS4 A;  3IOV A;  3TFL A;  4F29 A;  5TPA B;  2ZYO A;  2THI A;  2XXU A;  2Q89 A;  3BBR A;  3C34 A;  3M3K A;  4IY5 A;  2V84 A;  5AA3 A;  3H4Z A;  4ZZE A;  4F31 B;  3IL1 B;  2AL5 A;  3IOT A;  3K02 A;  4OWD A;  1SYI A;  4E0X A;  1B4H A;  4GOT A;  3KJT A;  3TUS A;  1XS5 A;  4ZEB A;  5H8F A;  4NE4 A;  1QJM A;  2AYS A;  3RNN A;  4QSD A;  1QW0 A;  3UP9 A;  3CFZ A;  1B2H A;  3OO9 A;  2ALU A;  4NF4 A;  4GL0 A;  1NL5 A;  4H0W A;  4IB2 A;  1HSE A;  3HN0 A;  1HSL A;  3T22 A;  4H5G A;  1VE4 A;  4DXU A;  5TP9 A;  2QS1 A;  1ZTY A;  4LZ5 A;  4F2Q A;  4HCW A;  4R74 A;  3O97 A;  4DZ1 A;  3E4R A;  3JYR A;  2F6P A;  2Z22 A;  1PB7 A;  2Y7W A;  1B3L A;  1EH3 A;  2XX8 A;  2OWT A;  3D4G A;  1GR2 A;  4C1T A;  1B1H A;  3S9L C;  3ZKK A;  3KGC A;  2NVU B;  2DXY A;  2PVU A;  2Z8E A;  2F7A A;  2H5Y A;  3U8Q A;  1P1Q A;  1MQH A;  3LUY A;  3MP6 A;  2NOO A;  4JXI A;  4H6D A;  3N6T A;  2YLN A;  5FHM A;  4P11 A;  3CFX A;  3QK6 A;  4LZ7 A;  3C36 A;  3H06 B;  1USY E;  4AQ4 A;  4ECF A;  4U23 A;  1DSN A;  1B0H A;  1VFE A;  4OES A;  5HM4 B;  3N94 A;  1MM7 A;  4H67 A;  4OEV A;  1MXZ A;  1DMB A;  3PPQ A;  2QS2 A;  3PPP A;  4R72 A;  4RK9 A;  2XXT A;  5AA2 D;  3MP1 A;  3H6W A;  4ELR A;  4I62 A;  4RXL A;  1B5H A;  1N84 A;  1FCK A;  2RC7 A;  2D3I A;  1TWY A;  5I58 A;  1L5T A;  3PD8 A;  4TOZ A;  1JNF A;  3O9P A;  2DE4 A;  2I4B A;  1Y1Z A;  3SET A;  3K1M A;  1IZ1 A;  2NUV A;  1XVX A;  3FIR A;  4JWO A;  4HS7 A;  4O3A A;  3HPI A;  2QJE A;  3B6T A;  3IOW A;  2F36 A;  1PDA A;  5KDT B;  4X1D A;  2ONS A;  5HBC A;  2ZXT A;  3G3K A;  1MXV A;  2DOJ A;  3FV2 A;  2ONR A;  2QMX A;  2QS3 A;  3ZSF A;  1BKA A;  3TTK A;  2O1M A;  1S9T A;  1OLA A;  4Q8R A;  4IO6 A;  3K4U A;  3KBR A;  4ELP A;  3BKI B;  4ELO A;  4K3F A;  3FXQ A;  3H03 A;  1B5I A;  2V3T A;  3MPK A;  4BDO A;  4WKM A;  3DP4 A;  3FV1 A;  4RY1 A;  1AIV A;  3C9H A;  1A8E A;  1II5 A;  1XT8 A;  1SBP A;  4JSD A;  5CRY A;  1VFD A;  1LAX A;  3KOS A;  4Z0I A;  4F2O A;  4GF8 A;  3MZ9 A;  3CRB A;  4DCX A;  1IUD A;  2DE3 A;  4OEN A;  3TKD A;  1D9V A;  1LFH A;  2I0C A;  3W9W A;  3ZKL A;  3FAT A;  1NNK A;  3IB1 A;  3N5L A;  3OO6 A;  4QSE A;  2O7U A;  2DWI A;  4ESW A;  2QSX A;  1B46 A;  3K6V A;  5CC2 A;  4G77 A;  4BDQ A;  3LSL A;  4BDM A;  1GGG A;  3K0V A;  4O3B A;  2XX7 A;  1D3K A;  3FGS A;  3KG2 A;  3LSW A;  3U92 A;  4PE5 B;  1NKX A;  3S2V A;  4MFI A;  2HEU A;  2GFE A;  3VDF A;  1PBQ A;  4OET A;  4NF8 A;  4C1U A;  2VD3 A;  4F3G A;  1DPE A;  3B7D A;  3HHG A;  5H8Q A;  2B3F A;  1LBC A;  3IAZ A;  4NF5 B;  4OZ9 A;  3FVK A;  1LAH E;  4YAH X;  1FQA A;  4KYS A;  1DPP A;  2O68 A;  3IJX B;  4H1X A;  3U72 A;  1ZBM A;  2QL3 A;  2HQ0 A;  4IGR A;  4YB7 A;  4U4X A;  4NWC A;  3FAS A;  1ZIU A;  2Y7K A;  2I49 A;  4JWX A;  3RUM A;  3TTM A;  4F3B A;  4F18 A;  4Q5T A;  4GIZ A;  2O6A A;  4ISU A;  4LAT A;  4JWY A;  4FJP A;  1Y9U A;  4RNS A;  3LR1 A;  5JTY B;  1JQF A;  2OBG A;  4TLL B;  1RYX A;  4GXS B;  3CIJ A;  5I56 B;  3O28 A;  4H8J A;  4OVJ A;  4HCY A;  5I57 A;  3TQL A;  1B51 A;  1B3E A;  1SI1 A;  3SER A;  2ZMB A; 
#chains in the Genus database with same CATH topology
 1OVB A;  2WEF A;  4PE3 A;  4TQU Q;  1A55 A;  4LA9 A;  2ZZX A;  2Y5L A;  1CNQ A;  1F9B A;  2RIN A;  4ZS9 A;  4TLM B;  5EHS A;  3H6U A;  4NED A;  3DM0 A;  1R6Z A;  2I58 A;  3KJ7 A;  5KCJ B;  4NTL A;  1LGB C;  4RK2 A;  3U1O A;  1PB9 A;  4HE2 A;  2F78 A;  2Y7I A;  1R9L A;  2I48 A;  3H6T A;  2A5S A;  3VVE A;  3S4U A;  3I6V A;  5FHO A;  1QGX A;  5J16 A;  3SEW A;  1DCU A;  1NUY A;  2OZZ A;  1ZLQ A;  5IM2 A;  1R9Q A;  2VP1 A;  5BWJ A;  3E78 A;  1B7U A;  3SEY A;  3PMW A;  1VSO A;  4LUB A;  5H8N A;  1SW1 A;  1IMD A;  4MNI A;  3MQ9 A;  1OMP A;  1JW4 A;  2XXW A;  5I2N A;  4Q30 B;  1TFA A;  4N8G A;  2WX9 A;  1NMU A;  3MVZ A;  1LBZ A;  3K1N A;  5CMK A;  4P1E A;  2HHM A;  1PBP A;  3T0J A;  1QKA A;  3P7I A;  4IR8 A;  5ICQ A;  2NWJ A;  4HW8 A;  4EUO A;  3I5O A;  3TMG A;  2XXR A;  4WED A;  1GV8 A;  1DOT A;  3MVX A;  1LB9 A;  1IIW A;  2GH9 A;  3PMV A;  2CZK A;  2V3U A;  2YJP A;  2W7Y A;  5H8F B;  4JVD A;  3IK6 B;  3O29 A;  5H8H A;  4POX A;  4OER A;  4G68 C;  2XWO A;  1FQB A;  2CZI A;  3E9X A;  3OEN A;  3QMF A;  5CM6 A;  2IEE A;  2XX9 A;  4L17 A;  2L5V A;  3IB0 A;  3KN3 A;  1TT1 A;  4NF4 B;  5EYF A;  5LOM A;  1N0T A;  4AS5 A;  2B4L A;  4N15 A;  1RDZ A;  3QXM A;  4IO4 A;  5EQ7 A;  1K9Y A;  1IXC A;  2DP8 A;  4XTC Q;  3IB2 A;  3IOU A;  3LSF B;  5TP9 B;  5JK4 A;  4PQJ A;  1RYO A;  3C32 A;  2I0B A;  4WXJ A;  3KZG A;  3Q25 A;  2UXA A;  2Q8J A;  1S50 A;  1VR5 A;  2VGQ A;  3DP6 A;  2XXQ A;  1JET A;  1P1W A;  3ROJ A;  4LN5 A;  4MJO A;  3GXA A;  2HAU A;  2AIX A;  4BLA A;  4NF6 A;  4JB7 A;  3LV0 A;  1N3X A;  4EQB A;  4XKN A;  1N04 A;  4X04 A;  3V89 B;  1B40 A;  5AA1 A;  3LBS A;  1LEV A;  1EU8 A;  2QMW A;  2QPQ A;  2RKM A;  2V3Q A;  1PEB A;  2VPN A;  1N7X A;  4AS4 A;  3PTY A;  4EQ7 A;  3HFU A;  3OOA A;  1ZMG A;  2CMO A;  4KQP A;  4EF1 A;  1XI6 A;  1Y3Q A;  4F3S A;  1H76 A;  4KFQ A;  1D9Q A;  1FTK A;  2X7Q A;  2R6G E;  3JZJ A;  1UIU A;  3IR1 A;  3ILU B;  2PX1 A;  4G68 B;  2D5W A;  3E13 X;  1NV0 A;  1ATG A;  2GHB A;  2VD2 A;  2OLB A;  5EHM A;  3MVY A;  5EQA A;  3AXF A;  1Y4C A;  1H44 A;  4KCC A;  5I58 B;  3QIM A;  2ZZV A;  1MH3 A;  4KI0 E;  4N8Y A;  3A09 A;  1LFI A;  5DTB A;  3T9X B;  4KD5 A;  2XXI A;  5A5L A;  1CE2 A;  3KBZ A;  1QUL A;  3KSX A;  3W9V A;  5F24 A;  4GWZ A;  4N07 A;  1B3G A;  4F19 A;  3PPO A;  1JVY A;  2R8T A;  3PUX E;  3TEP A;  5A5X A;  1XC1 A;  4N17 A;  4E0W A;  3EHT A;  1SW5 A;  4KXP A;  1IMB A;  3RTW B;  4UA8 A;  2XXX A;  4FEB A;  4QFN A;  5K2Y A;  3TCF A;  4NAP A;  3HCQ A;  4DXB A;  1MDP 1;  3TTR A;  4ONY A;  3OEM A;  3T96 B;  5CBS A;  4H45 A;  1P1U A;  1B1X A;  4IO7 A;  1P1N A;  4G68 A;  4F1U A;  2A5T A;  4NQ8 A;  2ZYN A;  3L6G A;  3M3L A;  4DIG A;  5ISU A;  2F5X A;  3PUY E;  1LFG A;  4PF6 A;  2WYK A;  4QHQ A;  2FNC A;  2XD3 A;  2ZNU A;  3TEL A;  4ZEK A;  3BIH A;  3PD9 A;  3VXB A;  4MCO A;  1LBB A;  2O1L A;  4Q0C A;  3Q26 A;  1XOC A;  2KLF A;  4X9T A;  4H5F A;  2XD2 A;  4R2F A;  4KR5 A;  3I3V A;  1FRP A;  2RCA A;  2UVI A;  3L6H A;  1IMF A;  2H25 A;  1WVJ A;  3O6G A;  2H4I A;  3FVN A;  5IZ3 B;  3WAF A;  3FZV A;  3RPL B;  1Y3P A;  2DWA A;  2ONK E;  1A54 A;  2Z8F A;  3PV0 E;  3UK4 A;  4NF8 B;  4U21 A;  4MLV A;  4G8H A;  3R7X A;  5L9O A;  1LCT A;  4X1B A;  3T9V A;  4YKK A;  5H8Q B;  1LAF E;  4QXD A;  2YPN A;  2UVJ A;  2G29 A;  4ZEC A;  2CEX A;  1O7T A;  3U94 A;  1POT A;  4XXU A;  4R9F A;  1FW0 A;  1NNF A;  5KZT A;  3IFC A;  5IZZ A;  1TFD A;  4OFJ A;  2CZH A;  4F1Y A;  4JSO A;  1USY H;  4GBV A;  1UTH A;  5I2K A;  5K2X A;  3PGF A;  3KC1 A;  3FXU A;  3WAE A;  5DVF A;  1SDX A;  3H3G A;  4OVR A;  1R1N A;  1MY3 A;  5IKB A;  2PFZ A;  3HO7 A;  5DVI A;  4OVS A;  5DEX A;  3VVF A;  4X48 A;  3CVG A;  5M2V A;  1EZ9 A;  2DVC A;  4QFL A;  3VLU A;  2H98 A;  1EZO A;  1MXU A;  2UVH A;  2V25 A;  1IQ7 A;  4O8M A;  1B05 A;  4PF8 A;  1MY1 A;  5B70 A;  4YMB A;  2I3W A;  3GYY A;  1FPL A;  4OYV A;  1YXI A;  1Q35 A;  5I57 B;  2H99 A;  2G93 A;  2HFB A;  2WYP A;  3OEK A;  4R73 A;  3ECR A;  1FPI A;  3RLF E;  3CG3 A;  2F8D A;  4ZED A;  3CSG A;  2BJI A;  4KHZ E;  1EYK A;  1FPK A;  4OXV A;  3A29 A;  3VVD A;  1NNP A;  2ESN A;  3IOR A;  1IMC A;  1OVT A;  3M8U A;  4ZDM A;  1FTO A;  4EDP A;  4LP2 B;  5FTH A;  3CI8 A;  3MPL A;  3PMX A;  1LBW A;  4ZE8 A;  4U1O A;  4MH5 A;  1SW2 A;  4YKP A;  4P8B A;  3RT8 A;  3FXB A;  4AB5 A;  1SD3 A;  5F1Q A;  2DS9 A;  2DWH A;  3V8X B;  3B8B A;  2FVZ A;  1BTJ A;  1RKM A;  2O7I A;  2ZZW A;  4OEU A;  1A99 A;  3B50 A;  1CB6 A;  1O63 A;  1JEV A;  2FYI A;  4F39 A;  3MW0 A;  3MP8 A;  1BK4 A;  3IO4 A;  1Z7N E;  5DW8 A;  1US4 A;  3MUQ A;  5EYH A;  2PBW A;  4MAG A;  1FPE A;  3QAX A;  4KPT A;  1MY4 A;  1YTV A;  1M5F A;  3THI A;  5H8N B;  1NH7 A;  1GVC A;  5I2N B;  2Z23 A;  3T9H B;  1FTJ A;  4GXA A;  4R75 A;  1XHY A;  1IXI A;  3VFJ A;  3QSL A;  2HZL A;  1B9J A;  2RC8 A;  1DK4 A;  2F7B A;  2HCA A;  2PT1 A;  4PDD A;  3FD3 A;  1MQJ A;  5TU0 A;  3CFL A;  3ISP A;  1IXG A;  2XXH A;  1EYJ A;  2DDK A;  2XWI A;  4QSC A;  5H8H B;  2XXY A;  3KN8 A;  3VLW A;  4GWY A;  3VE1 B;  3HV1 A;  3FJM A;  2QVR A;  3DEL B;  1OQH A;  4HTG A;  3T66 A;  1SQY A;  3OEL A;  4P0I A;  2PFY A;  1JEU A;  3G7W A;  1NV7 A;  1Q1K A;  4LON B;  5AA4 A;  1AL3 A;  4PBH A;  1MXY A;  2Q9T A;  4N6K A;  4YB5 A;  1SW4 A;  2V4C A;  3MVW A;  2BJJ X;  4R6K A;  4WEP A;  4MBP A;  5CBR A;  1ELJ A;  2AL4 A;  4NMY A;  3PUZ E;  1Y1M A;  1NV4 A;  1AWB A;  4PFW A;  4N81 A;  5J1D A;  1URG A;  4N13 A;  1MH4 A;  4M4G A;  4GFR A;  3RT6 B;  1FPG A;  2UYE A;  3SZP A;  2VOZ A;  1IME A;  4U2R A;  5EQ8 A;  5I5P A;  4PFI A;  1UTB A;  5ET8 A;  4BDR A;  3LUZ A;  3UN6 A;  3C31 A;  2ANJ A;  1MG1 A;  4NF6 B;  1OLC A;  1KWH A;  5I7I A;  2I3V A;  1I6Q A;  1IEJ A;  4OA4 A;  2FA7 A;  4EF2 A;  2Q2A A;  1K9Z A;  5DYH A;  3FUZ A;  4P47 A;  1QKB A;  3K6X A;  4R2B A;  1B32 A;  3UA8 A;  2B3B A;  4OVQ A;  3C4M A;  3V83 A;  1KA1 A;  4XIG Q;  2Y84 A;  3F11 A;  3KN7 A;  2X7P A;  3BFU A;  4BDN A;  3C35 A;  3EHU A;  3T93 B;  4ZZA A;  4O3C A;  3SES A;  3RYD A;  4I40 A;  4PFT A;  3K6U A;  1B3H A;  1XVY A;  3CR9 A;  4QFK A;  2B65 A;  3EQ1 A;  1SPI A;  4KCD A;  4H8I A;  4P9K A;  5ELV A;  3UIF A;  1US5 A;  3U65 A;  2HPG A;  5L9M A;  1I6B A;  3PPR A;  1PB8 A;  4F22 A;  1AH5 A;  4ESX A;  5B7D A;  3GLB A;  4BDL A;  4PP0 A;  3IX1 A;  5L8D A;  2DE2 A;  1MQG A;  2QVV A;  3Q28 A;  1FBH A;  3BIG A;  3OD7 A;  4I3E A;  1Y3N A;  1A7L A;  1TXF A;  1MRP A;  3MAM A;  3VV5 A;  3RGY A;  3TCH A;  4XKQ A;  1SVX B;  4PGP A;  1P99 A;  3MZB A;  2P3N A;  3PU5 A;  4XKR A;  1MXX A;  3GZG A;  4FOR A;  5A5X B;  1IXH A;  2XHD A;  1I69 A;  2E1S A;  3FXR A;  4YKJ A;  2PMS A;  4RPO A;  4IO3 A;  4JVC A;  3EN3 A;  5AA2 A;  2FIE A;  3VXC A;  3PPN A;  4U4S A;  1GTK A;  5I59 A;  1NV5 A;  1B7Z A;  3MZ1 A;  2DYX A;  1A40 A;  3G3J A;  4P1L A;  4EXK A;  2XXK A;  3KFM A;  4LVQ A;  3USD A;  2A5T B;  3CSB A;  3N26 A;  1BLF A;  1FSA A;  4DDD A;  1I6A A;  2F3D A;  4MX6 A;  2O51 A;  1H3D A;  4DLD A;  4DE8 A;  5TPA A;  2O69 A;  4ND9 A;  2I6E A;  1NV1 A;  2E0S A;  3U93 A;  2Y7R A;  1P1O A;  4DI4 B;  4FE8 A;  2ABH A;  5FTI A;  3TPA A;  4YB6 A;  4ELQ A;  1MPD A;  4XKP A;  4YZZ A;  3RN8 A;  3SER A;  3OSR A;  1FPB A;  5L9S A;  3M3F A;  1FTM A;  5F7V A;  3TTN A;  3MJN A;  4POW A;  4F3P A;  1FQD A;  5DT6 A;  4RYA A;  1NNT A;  3CG1 A;  4MF3 A;  4P0G A;  1WOD A;  2R9J A;  4THI A;  4QF9 A;  3K2D A;  3D4C A;  4IO5 A;  4QFP A;  4XFE A;  2PT2 A;  3FJ7 A;  1LCF A;  4UAC A;  4RPN A;  5DVJ A;  1AMF A;  4QFO A;  4FAJ A;  5ITO A;  3ODB A;  4G4P A;  2F34 A;  4JVI A;  5BUU A;  2XWK A;  1MS7 A;  5ET6 A;  5ICT A;  1OQG A;  3R6U A;  2GRV A;  1M5D A;  1B52 A;  4GLI A;  3RPW A;  1S7Y A;  1UTH B;  4ZEF A;  5I2K B;  1D9Y A;  3TTL A;  1N3W A;  1MY0 A;  2PYY A;  1MDQ A;  5AE4 A;  3JV9 A;  4PTK A;  4R6H A;  1FBG A;  4YMA A;  4DCY A;  4M1V A;  2QRY A;  4MEV A;  5DEX B;  2DXR A;  2OCU A;  4H65 A;  1B4Z A;  3B6W A;  1MQI A;  3H7M A;  4FEC A;  3VLV A;  4YU0 A;  2MKZ A;  3ILT B;  2Q88 A;  5H8S A;  4NWD A;  2F3B A;  3PUV E;  4IY6 A;  3K00 A;  3V5A A;  3TZA A;  3QUF A;  2Q2C A;  4PFY A;  4IGT A;  4I9D A;  3SKP A;  2REJ A;  1LB8 A;  3O6I A;  1SYH A;  4GVO A;  2OJT A;  1FBP A;  2B4M A;  1A8F A;  3LC8 A;  3A3U A;  2ZYM A;  3MBP A;  2FBP A;  3E79 A;  3TOD A;  2OWS A;  1YAE A;  5CMC A;  3KSJ A;  1MPC A;  4QRZ A;  4KYD A;  1N76 A;  4YKI A;  1MM6 A;  3EF7 A;  1ZJL A;  1H43 A;  4NN3 A;  1FTL A;  3G3H A;  1B58 A;  2KQZ A;  4GD5 A;  2REG A;  4YIC A;  4GL8 A;  4FED A;  1ANF A;  2M8C A;  3DP8 A;  4I3Y A;  1UQW A;  4AB6 A;  3OO8 A;  4GX4 A;  3EKI A;  4PC9 A;  1RDX A;  1B5J A;  2CEY A;  1T0K A;  3EPE A;  4R6Y A;  3GBA A;  3ZS6 A;  2HZK A;  3OMB A;  4N6P A;  2V93 A;  3RY3 A;  1UIV A;  3O6H A;  1FQE A;  3KEI A;  5KDT A;  1LLS A;  2P2A A;  3G3I A;  4GWO A;  4UAB A;  4ZE9 A;  5ITP A;  3MC2 A;  1B7H A;  4OMB A;  4FAT A;  3ONM A;  2FIX A;  2HXW A;  2H9B A;  1JP4 A;  4O94 A;  3H6V A;  4PFB A;  3GBB A;  1LST A;  4OHN A;  1VDW A;  4IO2 A;  4PBQ A;  1B3F A;  1POY 1;  2UVG A;  2X26 A;  1DTZ A;  1N7W A;  3OXN A;  4PAF A;  3SEV A;  1MQD A;  2F6G A;  5IZ1 A;  2DQV A;  5EQ9 A;  4OQO A;  3FJG A;  1MXW A;  4JDF A;  5ET5 A;  1QUK A;  4HE0 A;  2OK2 A;  3R26 A;  5LDZ A;  1DTG A;  3O66 A;  5FHN A;  2CZL A;  3IO6 A;  1NFT A;  4PDH A;  2DVZ A;  1URS A;  4LQ5 A;  3T9U A;  1D4N A;  4OVP A;  3S9E A;  5JEI A;  3TDJ A;  1QUJ A;  3IJO B;  3N6U A;  2R71 A;  2I4C A;  1JW1 A;  4GWS A;  1JW5 A;  2RF1 A;  1MY2 A;  4KYE A;  4ZEI A;  2LAO A;  1NV3 A;  2NXO A;  4I8C A;  3UOR A;  2DSF A;  1ZKB A;  1B0L A;  1Z7M E;  5CMB A;  3K6W A;  4GQO A;  4GWU A;  1FQF A;  4DXC A;  2XA5 A;  3TAJ A;  1O64 A;  5AA4 B;  4C0R A;  2JJK A;  3Q27 A;  2Z8D A;  1MPB A;  3SEX A;  2VHA A;  3TQW A;  3K1P A;  4LZ8 A;  1YPN A;  3UGW A;  2P0S A;  1H45 A;  1WDN A;  4NG7 A;  4PET A;  3Q29 A;  3QUJ A;  3TCG A;  4PFU A;  4N91 A;  4NF5 A;  3TYH A;  2VT5 A;  4LQ2 A;  1ZU0 A;  4MLQ A;  1UTB B;  1IIT A;  1EZP A;  2P1S A;  2O84 X;  1PC3 A;  2XXP A;  2HAV A;  3S9M C;  3FVO A;  3C33 A;  3HST A;  2F97 A;  3RTF B;  4JBZ A;  2F35 A;  3FBP A;  2GHA A;  1J1N A;  1BP5 A;  4FIM A;  4EXL A;  4GRK A;  1NH8 A;  1URD A;  3SEU A;  2XXV A;  3S9N C;  4MNC A;  3A3C A;  4U1Z A;  2PCR A;  4R9G A;  4OFL A;  4RJZ A;  4OFO A;  4EQ9 A;  4OTE A;  5JTY A;  4G8M A;  2DWJ A;  1JVX A;  2QFL A;  1B6H A;  2IA4 A;  1OIB A;  1NUW A;  1YCJ A;  3OO7 A;  5CMM A;  2WBB A;  2RC9 A;  5I56 A;  5CI5 A;  5T3J A;  2ZNT A;  2WKY A;  3DLN A;  1QUI A;  4U22 A;  4I1D A;  4RA1 A;  2ZYK A;  1BIY A;  3LSX A;  5HPQ A;  2F7C A;  5ESY A;  4F1V A;  5ET7 A;  1HSJ A;  4G61 A;  2VPO A;  1FBC A;  1FQC A;  1FBD A;  1M5C A;  3RQT A;  5IAI A;  4Z7E A;  2P3V A;  3W15 C;  4MMP A;  3B6Q A;  3O2A A;  5I84 A;  1AOV A;  3BFT A;  3E3K A;  4PAI A;  5KCJ A;  4O7I A;  4NX1 A;  1NI9 A;  2RCB A;  1M5B A;  3QYT A;  1FPJ A;  2D21 A;  1FBF A;  3G3G A;  3FVG A;  3MWB A;  1LAG E;  3SDF A;  5AA2 B;  2ZNS A;  3PUW E;  4G2Z A;  1Y20 A;  3CHG A;  3KOT A;  1M5E A;  3HHF A;  4NGU A;  2Y7P A;  1Y4T A;  1KA0 A;  3K01 A;  1FPD A;  3EHS A;  1QVS A;  1SI0 A;  5I59 B;  3G3F A;  5IGA A;  3OSQ A;  2UYF A;  2QS4 A;  3IOV A;  3TFL A;  4F29 A;  5TPA B;  1FBE A;  4N6D A;  2ZYO A;  2THI A;  1G0H A;  2XXU A;  2Q89 A;  3BBR A;  3C34 A;  2HXR A;  3M3K A;  4IY5 A;  2V84 A;  4XEQ A;  5AA3 A;  3H4Z A;  4ZZE A;  4F31 B;  3IL1 B;  2AL5 A;  3IOT A;  3K02 A;  4OWD A;  1SYI A;  1LBY A;  4E0X A;  1B4H A;  4GOT A;  3KJT A;  3TUS A;  4N4U A;  1XS5 A;  4QBA A;  4ZEB A;  5H8F A;  4NE4 A;  1QJM A;  2AYS A;  3KC0 A;  3RNN A;  4QSD A;  1QW0 A;  3UP9 A;  3CFZ A;  1B2H A;  3OO9 A;  2ALU A;  4NF4 A;  2Y5K A;  4GL0 A;  4MHF A;  1NL5 A;  4H0W A;  4IB2 A;  1HSE A;  3HN0 A;  1HSL A;  3T22 A;  4H5G A;  1VE4 A;  4DXU A;  4PAK A;  5TP9 A;  2QS1 A;  1ZTY A;  4LZ5 A;  4F2Q A;  4HCW A;  4R74 A;  3O97 A;  1NUZ A;  4DZ1 A;  3E4R A;  3JYR A;  3T1B A;  2F6P A;  2Z22 A;  1PB7 A;  2Y7W A;  1B3L A;  1EH3 A;  2XX8 A;  2OWT A;  3D4G A;  4O7M A;  2OWZ A;  1GR2 A;  4C1T A;  1B1H A;  3S9L C;  1RDY A;  3ZKK A;  3KGC A;  2NVU B;  2DXY A;  2PVU A;  2Z8E A;  2F7A A;  2H5Y A;  3U8Q A;  1P1Q A;  1MQH A;  3LUY A;  3MP6 A;  1IMA A;  2NOO A;  3MYU A;  4JXI A;  4H6D A;  3N6T A;  2YLN A;  5FHM A;  4P11 A;  3CFX A;  4PCD A;  3QK6 A;  4LZ7 A;  3C36 A;  3H06 B;  1USY E;  4AQ4 A;  4ECF A;  4U23 A;  1NUX A;  1DSN A;  1B0H A;  1VFE A;  4OES A;  5HM4 B;  4NHB A;  3N94 A;  1MM7 A;  4H67 A;  4OEV A;  1MXZ A;  1DMB A;  3PPQ A;  2QS2 A;  4P56 A;  2OX3 A;  3PPP A;  4R72 A;  4RK9 A;  2XXT A;  5AA2 D;  3MP1 A;  3H6W A;  4ELR A;  4I62 A;  4RXL A;  1B5H A;  1N84 A;  1FCK A;  2RC7 A;  2D3I A;  1TWY A;  5I58 A;  1L5T A;  2FHY A;  3PD8 A;  4TOZ A;  1JNF A;  3O9P A;  2DE4 A;  2I4B A;  4DI3 D;  1Y1Z A;  3SET A;  3K1M A;  1IZ1 A;  2NUV A;  1XVX A;  3FIR A;  4PFR A;  4JWO A;  4HS7 A;  4O3A A;  3HPI A;  2QJE A;  3B6T A;  3IOW A;  2F36 A;  1PDA A;  1FJ9 A;  5KDT B;  4X1D A;  2ONS A;  5HBC A;  2ZXT A;  3G3K A;  1MXV A;  2DOJ A;  3FV2 A;  1INP A;  2ONR A;  4NF0 A;  5I3S A;  2QMX A;  2Q74 A;  2QS3 A;  3ZSF A;  1BKA A;  3TTK A;  2O1M A;  1YYZ A;  1S9T A;  1OLA A;  4Q8R A;  4IO6 A;  3K4U A;  3KBR A;  4ELP A;  3BKI B;  4ELO A;  4K3F A;  3FXQ A;  1LBV A;  2WBD A;  3H03 A;  1B5I A;  2V3T A;  3MPK A;  4BDO A;  4WKM A;  3DP4 A;  3FV1 A;  2Q8M A;  4RY1 A;  1AIV A;  3C9H A;  4X8R A;  1A8E A;  1II5 A;  1XT8 A;  1SBP A;  4P3L A;  4JSD A;  1G0I A;  5CRY A;  1VFD A;  1LAX A;  3KOS A;  4Z0I A;  4F2O A;  4GF8 A;  3MZ9 A;  3CRB A;  4DCX A;  1IUD A;  2DE3 A;  4OEN A;  3TKD A;  1D9V A;  1FPF A;  1LFH A;  2I0C A;  3W9W A;  3ZKL A;  2QVU A;  4HE1 A;  3FAT A;  4GBW A;  1NNK A;  3IB1 A;  3N5L A;  4QSE A;  1Q9D A;  3OO6 A;  1NV6 A;  2O7U A;  2DWI A;  4ESW A;  2QSX A;  1B46 A;  3K6V A;  5CC2 A;  4PGN A;  4G77 A;  4BDQ A;  3LSL A;  1LBX A;  4BDM A;  5IZ3 A;  1GGG A;  3K0V A;  4O3B A;  1EYI A;  2XX7 A;  3RPL A;  1D3K A;  3FGS A;  3KG2 A;  3LSW A;  3U92 A;  4PE5 B;  1NKX A;  3S2V A;  4MFI A;  4MIJ A;  2HEU A;  2GFE A;  3VDF A;  5EYG A;  1PBQ A;  4OET A;  4NF8 A;  4C1U A;  2KR0 A;  1FJ6 A;  2VD3 A;  4FBP A;  4F3G A;  1DPE A;  3B7D A;  3HHG A;  5H8Q A;  2B3F A;  1LBC A;  3IAZ A;  4NF5 B;  4OZ9 A;  3FVK A;  2XWV A;  3D1R A;  1LAH E;  4YAH X;  1FQA A;  4KYS A;  5FBP A;  1DPP A;  4GX6 A;  3IFA A;  2O68 A;  3IJX B;  3MST A;  4H1X A;  4GX3 A;  4MNP A;  3U72 A;  1ZBM A;  2QL3 A;  2HQ0 A;  4HXV A;  4IGR A;  4YB7 A;  1YZ0 A;  2GQ1 A;  4U4X A;  4NWC A;  3FAS A;  1ZIU A;  2Y7K A;  4GWW A;  2I49 A;  4JWX A;  3RUM A;  1FTA A;  3TTM A;  4F3B A;  4F18 A;  4Q5T A;  1KZ8 A;  4GIZ A;  2O6A A;  4ISU A;  4LAT A;  1DBZ A;  4JWY A;  4FJP A;  1Y9U A;  4RNS A;  3LR1 A;  5JTY B;  1JQF A;  4OAN A;  3NOH A;  2OBG A;  4XF5 A;  4H46 A;  4GWX A;  4TLL B;  1NV2 A;  1RYX A;  4GXS B;  3CIJ A;  4OVT A;  5I56 B;  5LTC A;  3O28 A;  4H8J A;  4OVJ A;  4HCY A;  5I57 A;  3TQL A;  1B51 A;  1B3E A;  1SI1 A;  4G8N A;  2ZMB A; 
#chains in the Genus database with same CATH homology
 1OVB A;  4TQU Q;  1A55 A;  4LA9 A;  1F9B A;  2RIN A;  4ZS9 A;  4TLM B;  5EHS A;  3H6U A;  4NED A;  3DM0 A;  1R6Z A;  2I58 A;  3KJ7 A;  5KCJ B;  4NTL A;  1LGB C;  4RK2 A;  3U1O A;  1PB9 A;  2F78 A;  2Y7I A;  1R9L A;  2I48 A;  3H6T A;  2A5S A;  3VVE A;  3S4U A;  3I6V A;  5FHO A;  3SEW A;  2OZZ A;  1ZLQ A;  1R9Q A;  2VP1 A;  5BWJ A;  1B7U A;  3SEY A;  3PMW A;  1VSO A;  4LUB A;  5H8N A;  1SW1 A;  3MQ9 A;  1OMP A;  1JW4 A;  2XXW A;  5I2N A;  4Q30 B;  1TFA A;  1NMU A;  3MVZ A;  3K1N A;  5CMK A;  1PBP A;  1QKA A;  3P7I A;  5ICQ A;  2NWJ A;  4HW8 A;  4EUO A;  3I5O A;  3TMG A;  2XXR A;  4WED A;  1GV8 A;  1DOT A;  3MVX A;  1LB9 A;  1IIW A;  2GH9 A;  3PMV A;  2V3U A;  2YJP A;  2W7Y A;  5H8F B;  3IK6 B;  3O29 A;  5H8H A;  4POX A;  4OER A;  4G68 C;  1FQB A;  3E9X A;  3OEN A;  5CM6 A;  2IEE A;  2XX9 A;  4L17 A;  3IB0 A;  3KN3 A;  1TT1 A;  4NF4 B;  5EYF A;  5LOM A;  1N0T A;  3QXM A;  4IO4 A;  1IXC A;  2DP8 A;  4XTC Q;  3IB2 A;  3IOU A;  3LSF B;  5TP9 B;  5JK4 A;  4PQJ A;  1RYO A;  3C32 A;  2I0B A;  4WXJ A;  3KZG A;  3Q25 A;  2UXA A;  2Q8J A;  1S50 A;  1VR5 A;  2VGQ A;  3DP6 A;  2XXQ A;  1JET A;  1P1W A;  3GXA A;  2HAU A;  2AIX A;  4BLA A;  4NF6 A;  4JB7 A;  1N3X A;  4EQB A;  4XKN A;  1N04 A;  3V89 B;  1B40 A;  5AA1 A;  3LBS A;  1EU8 A;  2QMW A;  2QPQ A;  2RKM A;  2V3Q A;  1PEB A;  1N7X A;  4EQ7 A;  3OOA A;  1ZMG A;  2CMO A;  4KQP A;  4EF1 A;  1Y3Q A;  4F3S A;  1H76 A;  4KFQ A;  1FTK A;  2X7Q A;  2R6G E;  3JZJ A;  1UIU A;  3IR1 A;  3ILU B;  2PX1 A;  4G68 B;  2D5W A;  3E13 X;  1ATG A;  2GHB A;  2VD2 A;  2OLB A;  5EHM A;  3MVY A;  3AXF A;  1Y4C A;  1H44 A;  4KCC A;  5I58 B;  3QIM A;  1MH3 A;  4KI0 E;  3A09 A;  1LFI A;  5DTB A;  3T9X B;  4KD5 A;  2XXI A;  1CE2 A;  1QUL A;  3KSX A;  3W9V A;  4N07 A;  1B3G A;  4F19 A;  3PPO A;  1JVY A;  3PUX E;  3TEP A;  5A5X A;  1XC1 A;  4E0W A;  3EHT A;  1SW5 A;  3RTW B;  4UA8 A;  2XXX A;  4FEB A;  4QFN A;  5K2Y A;  3TCF A;  4DXB A;  3HCQ A;  1MDP 1;  3TTR A;  4ONY A;  4G8N A;  3OEM A;  3T96 B;  5CBS A;  1P1U A;  1B1X A;  4IO7 A;  1P1N A;  4G68 A;  4F1U A;  2A5T A;  2ZYN A;  3L6G A;  3M3L A;  4DIG A;  5ISU A;  2F5X A;  3PUY E;  1LFG A;  4QHQ A;  2FNC A;  2XD3 A;  2ZNU A;  3TEL A;  4ZEK A;  3PD9 A;  3VXB A;  1LBB A;  2O1L A;  4Q0C A;  3Q26 A;  1XOC A;  2KLF A;  4X9T A;  4H5F A;  2XD2 A;  4R2F A;  4KR5 A;  3I3V A;  2RCA A;  2UVI A;  3L6H A;  2H25 A;  1WVJ A;  3O6G A;  2H4I A;  3FVN A;  3WAF A;  3FZV A;  1Y3P A;  2DWA A;  2ONK E;  1A54 A;  2Z8F A;  3PV0 E;  3UK4 A;  4NF8 B;  4U21 A;  4MLV A;  4G8H A;  3R7X A;  5L9O A;  1LCT A;  4X1B A;  3T9V A;  4YKK A;  5H8Q B;  1LAF E;  2YPN A;  2UVJ A;  2G29 A;  4ZEC A;  1O7T A;  3U94 A;  1POT A;  4XXU A;  4R9F A;  1FW0 A;  1NNF A;  5KZT A;  1TFD A;  4OFJ A;  4F1Y A;  4JSO A;  1USY H;  1UTH A;  5I2K A;  5K2X A;  3PGF A;  3FXU A;  3WAE A;  5DVF A;  1SDX A;  3H3G A;  1R1N A;  1MY3 A;  5IKB A;  3HO7 A;  5DVI A;  5DEX A;  3VVF A;  4X48 A;  3CVG A;  5M2V A;  1EZ9 A;  2DVC A;  4QFL A;  3VLU A;  2H98 A;  1EZO A;  1MXU A;  2UVH A;  2V25 A;  1IQ7 A;  1B05 A;  1MY1 A;  5B70 A;  4YMB A;  2I3W A;  4OYV A;  1Q35 A;  5I57 B;  2H99 A;  2G93 A;  2HFB A;  3OEK A;  4R73 A;  3ECR A;  3RLF E;  3CG3 A;  2F8D A;  4ZED A;  3CSG A;  4KHZ E;  4OXV A;  3VVD A;  1NNP A;  2ESN A;  3IOR A;  1OVT A;  3M8U A;  4ZDM A;  1FTO A;  4EDP A;  4LP2 B;  5FTH A;  3CI8 A;  3MPL A;  3PMX A;  4ZE8 A;  4U1O A;  4MH5 A;  1SW2 A;  4YKP A;  3RT8 A;  4AB5 A;  1SD3 A;  5F1Q A;  2DS9 A;  2DWH A;  3V8X B;  1BTJ A;  1RKM A;  2O7I A;  4OEU A;  1A99 A;  1CB6 A;  1O63 A;  1JEV A;  2FYI A;  4F39 A;  3MW0 A;  3MP8 A;  3IO4 A;  1Z7N E;  1US4 A;  3MUQ A;  2PBW A;  3QAX A;  4KPT A;  1MY4 A;  1YTV A;  1M5F A;  3THI A;  5H8N B;  1NH7 A;  1GVC A;  5I2N B;  2Z23 A;  3T9H B;  1FTJ A;  4GXA A;  4R75 A;  1XHY A;  1IXI A;  3VFJ A;  3QSL A;  2HZL A;  1B9J A;  2RC8 A;  2F7B A;  2HCA A;  2PT1 A;  3FD3 A;  1MQJ A;  5TU0 A;  3CFL A;  1IXG A;  2XXH A;  4QSC A;  5H8H B;  2XXY A;  3KN8 A;  3VLW A;  3VE1 B;  3HV1 A;  3FJM A;  3DEL B;  1OQH A;  4HTG A;  3T66 A;  1SQY A;  3OEL A;  4P0I A;  1JEU A;  3G7W A;  1Q1K A;  4LON B;  5AA4 A;  1AL3 A;  1MXY A;  2Q9T A;  4YB5 A;  1SW4 A;  3MVW A;  2BJJ X;  4R6K A;  4WEP A;  4MBP A;  5CBR A;  1ELJ A;  2AL4 A;  4NMY A;  3PUZ E;  1Y1M A;  4PFW A;  5J1D A;  1URG A;  4N13 A;  1MH4 A;  4M4G A;  4GFR A;  3RT6 B;  2UYE A;  2VOZ A;  4U2R A;  1UTB A;  4BDR A;  3UN6 A;  3C31 A;  2ANJ A;  1MG1 A;  4NF6 B;  1OLC A;  1KWH A;  2I3V A;  1I6Q A;  1IEJ A;  2FA7 A;  4EF2 A;  2Q2A A;  5DYH A;  3FUZ A;  1QKB A;  3K6X A;  4R2B A;  1B32 A;  3UA8 A;  2B3B A;  3C4M A;  3V83 A;  4XIG Q;  2Y84 A;  3F11 A;  3KN7 A;  2X7P A;  3BFU A;  4BDN A;  3C35 A;  3EHU A;  3T93 B;  4ZZA A;  4O3C A;  3SES A;  4PFT A;  3K6U A;  1B3H A;  1XVY A;  3CR9 A;  4QFK A;  2B65 A;  3EQ1 A;  4KCD A;  4H8I A;  5ELV A;  3UIF A;  1US5 A;  5L9M A;  1I6B A;  4F22 A;  3PPR A;  1PB8 A;  1AH5 A;  5B7D A;  4ESX A;  3GLB A;  4BDL A;  4PP0 A;  3IX1 A;  5L8D A;  2DE2 A;  1MQG A;  3Q28 A;  3OD7 A;  1Y3N A;  1A7L A;  1TXF A;  1MRP A;  3MAM A;  3VV5 A;  3RGY A;  3TCH A;  4XKQ A;  1SVX B;  1P99 A;  3MZB A;  3PU5 A;  4XKR A;  1MXX A;  3GZG A;  4FOR A;  5A5X B;  1IXH A;  2XHD A;  1I69 A;  2E1S A;  3FXR A;  4YKJ A;  2PMS A;  4RPO A;  4IO3 A;  3EN3 A;  5AA2 A;  3VXC A;  3PPN A;  4U4S A;  1GTK A;  5I59 A;  1B7Z A;  3MZ1 A;  2DYX A;  1A40 A;  3G3J A;  4EXK A;  3KFM A;  4LVQ A;  3USD A;  2A5T B;  3CSB A;  3N26 A;  1BLF A;  4DDD A;  1I6A A;  4DLD A;  2O51 A;  1H3D A;  4DE8 A;  5TPA A;  2O69 A;  4ND9 A;  2I6E A;  2E0S A;  3U93 A;  2Y7R A;  1P1O A;  4FE8 A;  2ABH A;  5FTI A;  3TPA A;  4YB6 A;  4ELQ A;  1MPD A;  4XKP A;  4YZZ A;  3RN8 A;  3OSR A;  5L9S A;  3M3F A;  1FTM A;  5F7V A;  3TTN A;  3MJN A;  4POW A;  4F3P A;  1FQD A;  5DT6 A;  4RYA A;  1NNT A;  3CG1 A;  4MF3 A;  4P0G A;  1WOD A;  2R9J A;  4THI A;  4QF9 A;  3K2D A;  3D4C A;  4IO5 A;  4QFP A;  2PT2 A;  3FJ7 A;  1LCF A;  4UAC A;  4RPN A;  5DVJ A;  1AMF A;  4QFO A;  4FAJ A;  5ITO A;  3ODB A;  4G4P A;  2F34 A;  5BUU A;  1MS7 A;  5ICT A;  1OQG A;  3R6U A;  2GRV A;  1M5D A;  1B52 A;  4GLI A;  3RPW A;  1S7Y A;  1UTH B;  4ZEF A;  5I2K B;  1D9Y A;  3TTL A;  1N3W A;  1MY0 A;  2PYY A;  1MDQ A;  5AE4 A;  3JV9 A;  4R6H A;  4YMA A;  4DCY A;  4M1V A;  2QRY A;  5DEX B;  2DXR A;  2OCU A;  4H65 A;  1B4Z A;  3B6W A;  1MQI A;  3H7M A;  4FEC A;  3VLV A;  4YU0 A;  3ILT B;  2Q88 A;  5H8S A;  4NWD A;  3PUV E;  4IY6 A;  3K00 A;  3V5A A;  3TZA A;  3QUF A;  2Q2C A;  4PFY A;  4IGT A;  4I9D A;  3SKP A;  2REJ A;  1LB8 A;  3O6I A;  1SYH A;  4GVO A;  2OJT A;  1A8F A;  3LC8 A;  3A3U A;  2ZYM A;  3MBP A;  3TOD A;  2OWS A;  1YAE A;  5CMC A;  3KSJ A;  1MPC A;  4QRZ A;  4KYD A;  1N76 A;  4YKI A;  1MM6 A;  3EF7 A;  1ZJL A;  1H43 A;  1FTL A;  3G3H A;  1B58 A;  4GD5 A;  2REG A;  4YIC A;  4GL8 A;  4FED A;  1ANF A;  2M8C A;  3DP8 A;  1UQW A;  4AB6 A;  3OO8 A;  1B5J A;  1T0K A;  3EPE A;  4R6Y A;  3GBA A;  3ZS6 A;  2HZK A;  3OMB A;  4N6P A;  2V93 A;  3RY3 A;  1UIV A;  3O6H A;  1FQE A;  3KEI A;  5KDT A;  1LLS A;  2P2A A;  3G3I A;  4GWO A;  4ZE9 A;  5ITP A;  3MC2 A;  1B7H A;  4OMB A;  4FAT A;  3ONM A;  2HXW A;  2H9B A;  3H6V A;  3GBB A;  1LST A;  4OHN A;  4IO2 A;  1B3F A;  1POY 1;  2UVG A;  2X26 A;  1DTZ A;  1N7W A;  3OXN A;  3SEV A;  1MQD A;  2F6G A;  2DQV A;  4OQO A;  3FJG A;  1MXW A;  4JDF A;  1QUK A;  2OK2 A;  3R26 A;  1DTG A;  3O66 A;  5FHN A;  2CZL A;  3IO6 A;  1NFT A;  2DVZ A;  1URS A;  4LQ5 A;  3T9U A;  1D4N A;  3S9E A;  5JEI A;  3TDJ A;  1QUJ A;  3IJO B;  3N6U A;  2R71 A;  2I4C A;  1JW1 A;  1JW5 A;  2RF1 A;  1MY2 A;  4KYE A;  4ZEI A;  2LAO A;  2NXO A;  4I8C A;  3UOR A;  2DSF A;  1ZKB A;  1B0L A;  1Z7M E;  5CMB A;  3K6W A;  4GQO A;  1FQF A;  4DXC A;  3TAJ A;  1O64 A;  5AA4 B;  4C0R A;  3Q27 A;  2Z8D A;  1MPB A;  3SEX A;  2VHA A;  3TQW A;  3K1P A;  4LZ8 A;  1YPN A;  3UGW A;  2P0S A;  1H45 A;  1WDN A;  4PET A;  3Q29 A;  3QUJ A;  3TCG A;  4PFU A;  4NF5 A;  3TYH A;  4LQ2 A;  1ZU0 A;  4MLQ A;  1UTB B;  1IIT A;  1EZP A;  2P1S A;  2O84 X;  1PC3 A;  2XXP A;  2HAV A;  3S9M C;  3FVO A;  3C33 A;  3HST A;  2F97 A;  3RTF B;  4JBZ A;  2F35 A;  2GHA A;  1J1N A;  1BP5 A;  4FIM A;  4EXL A;  4GRK A;  1NH8 A;  1URD A;  3SEU A;  2XXV A;  3S9N C;  3A3C A;  4U1Z A;  4R9G A;  4OFL A;  4RJZ A;  4OFO A;  4EQ9 A;  4OTE A;  5JTY A;  4G8M A;  2DWJ A;  1JVX A;  1B6H A;  2IA4 A;  1OIB A;  1YCJ A;  3OO7 A;  5CMM A;  5I56 A;  2RC9 A;  5CI5 A;  2ZNT A;  2WKY A;  3DLN A;  1QUI A;  4U22 A;  4I1D A;  4RA1 A;  2ZYK A;  1BIY A;  3LSX A;  5HPQ A;  2F7C A;  4F1V A;  1HSJ A;  1FQC A;  1M5C A;  3RQT A;  5IAI A;  4Z7E A;  3W15 C;  3B6Q A;  3O2A A;  5I84 A;  1AOV A;  3BFT A;  3E3K A;  5KCJ A;  2RCB A;  1M5B A;  3QYT A;  2D21 A;  3G3G A;  3FVG A;  3MWB A;  1LAG E;  3SDF A;  5AA2 B;  2ZNS A;  3PUW E;  4G2Z A;  1Y20 A;  3KOT A;  1M5E A;  3HHF A;  2Y7P A;  1Y4T A;  3K01 A;  3EHS A;  1QVS A;  1SI0 A;  5I59 B;  3G3F A;  3OSQ A;  2UYF A;  2QS4 A;  3IOV A;  3TFL A;  4F29 A;  5TPA B;  2ZYO A;  2THI A;  2XXU A;  2Q89 A;  3BBR A;  3C34 A;  3M3K A;  4IY5 A;  2V84 A;  5AA3 A;  3H4Z A;  4ZZE A;  4F31 B;  3IL1 B;  2AL5 A;  3IOT A;  3K02 A;  4OWD A;  1SYI A;  4E0X A;  1B4H A;  4GOT A;  3KJT A;  3TUS A;  1XS5 A;  4ZEB A;  5H8F A;  4NE4 A;  1QJM A;  2AYS A;  3RNN A;  4QSD A;  1QW0 A;  3UP9 A;  3CFZ A;  1B2H A;  3OO9 A;  2ALU A;  4NF4 A;  4GL0 A;  1NL5 A;  4H0W A;  4IB2 A;  1HSE A;  3HN0 A;  1HSL A;  3T22 A;  4H5G A;  1VE4 A;  4DXU A;  5TP9 A;  2QS1 A;  1ZTY A;  4LZ5 A;  4F2Q A;  4HCW A;  4R74 A;  3O97 A;  4DZ1 A;  3E4R A;  3JYR A;  2F6P A;  2Z22 A;  1PB7 A;  2Y7W A;  1B3L A;  1EH3 A;  2XX8 A;  2OWT A;  3D4G A;  1GR2 A;  4C1T A;  1B1H A;  3S9L C;  3ZKK A;  3KGC A;  2NVU B;  2DXY A;  2PVU A;  2Z8E A;  2F7A A;  2H5Y A;  3U8Q A;  1P1Q A;  1MQH A;  3LUY A;  3MP6 A;  2NOO A;  4JXI A;  4H6D A;  3N6T A;  2YLN A;  5FHM A;  4P11 A;  3CFX A;  3QK6 A;  4LZ7 A;  3C36 A;  3H06 B;  1USY E;  4AQ4 A;  4ECF A;  4U23 A;  1DSN A;  1B0H A;  1VFE A;  4OES A;  5HM4 B;  3N94 A;  1MM7 A;  4H67 A;  4OEV A;  1MXZ A;  1DMB A;  3PPQ A;  2QS2 A;  3PPP A;  4R72 A;  4RK9 A;  2XXT A;  5AA2 D;  3MP1 A;  3H6W A;  4ELR A;  4I62 A;  4RXL A;  1B5H A;  1N84 A;  1FCK A;  2RC7 A;  2D3I A;  1TWY A;  5I58 A;  1L5T A;  3PD8 A;  4TOZ A;  1JNF A;  3O9P A;  2DE4 A;  2I4B A;  1Y1Z A;  3SET A;  3K1M A;  1IZ1 A;  2NUV A;  1XVX A;  3FIR A;  4JWO A;  4HS7 A;  4O3A A;  3HPI A;  2QJE A;  3B6T A;  3IOW A;  2F36 A;  1PDA A;  5KDT B;  4X1D A;  2ONS A;  5HBC A;  2ZXT A;  3G3K A;  1MXV A;  2DOJ A;  3FV2 A;  2ONR A;  2QMX A;  2QS3 A;  3ZSF A;  1BKA A;  3TTK A;  2O1M A;  1S9T A;  1OLA A;  4Q8R A;  4IO6 A;  3K4U A;  3KBR A;  4ELP A;  3BKI B;  4ELO A;  4K3F A;  3FXQ A;  3H03 A;  1B5I A;  2V3T A;  3MPK A;  4BDO A;  4WKM A;  3DP4 A;  3FV1 A;  4RY1 A;  1AIV A;  3C9H A;  1A8E A;  1II5 A;  1XT8 A;  1SBP A;  4JSD A;  5CRY A;  1VFD A;  1LAX A;  3KOS A;  4Z0I A;  4F2O A;  4GF8 A;  3MZ9 A;  3CRB A;  4DCX A;  1IUD A;  2DE3 A;  4OEN A;  3TKD A;  1D9V A;  1LFH A;  2I0C A;  3W9W A;  3ZKL A;  3FAT A;  1NNK A;  3IB1 A;  3N5L A;  3OO6 A;  4QSE A;  2O7U A;  2DWI A;  4ESW A;  2QSX A;  1B46 A;  3K6V A;  5CC2 A;  4G77 A;  4BDQ A;  3LSL A;  4BDM A;  1GGG A;  3K0V A;  4O3B A;  2XX7 A;  1D3K A;  3FGS A;  3KG2 A;  3LSW A;  3U92 A;  4PE5 B;  1NKX A;  3S2V A;  4MFI A;  2HEU A;  2GFE A;  3VDF A;  1PBQ A;  4OET A;  4NF8 A;  4C1U A;  2VD3 A;  4F3G A;  1DPE A;  3B7D A;  3HHG A;  5H8Q A;  2B3F A;  1LBC A;  3IAZ A;  4NF5 B;  4OZ9 A;  3FVK A;  1LAH E;  4YAH X;  1FQA A;  4KYS A;  1DPP A;  2O68 A;  3IJX B;  4H1X A;  3U72 A;  1ZBM A;  2QL3 A;  2HQ0 A;  4IGR A;  4YB7 A;  4U4X A;  4NWC A;  3FAS A;  1ZIU A;  2Y7K A;  2I49 A;  4JWX A;  3RUM A;  3TTM A;  4F3B A;  4F18 A;  4Q5T A;  4GIZ A;  2O6A A;  4ISU A;  4LAT A;  4JWY A;  4FJP A;  1Y9U A;  4RNS A;  3LR1 A;  5JTY B;  1JQF A;  2OBG A;  4TLL B;  1RYX A;  4GXS B;  3CIJ A;  5I56 B;  3O28 A;  4H8J A;  4OVJ A;  4HCY A;  5I57 A;  3TQL A;  1B51 A;  1B3E A;  1SI1 A;  3SER A;  2ZMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...