3Q25A

Crystal structure of human alpha-synuclein (1-19) fused to maltose binding protein (mbp)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
388
structure length
388
Chain Sequence
IEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKAKEGVVAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein, protein fibril
molecule keywords Maltose-binding periplasmic protein/alpha-synuclein chimeric
publication title Structures of segments of alpha-synuclein fused to maltose-binding protein suggest intermediate states during amyloid formation
pubmed doi rcsb
source organism Escherichia coli
total genus 120
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q25A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q25A01
3TTMA 3MP6A 1O64A 1A8EA 4GFRA 5JTYB 2HXWA 3TEPA 4KYEA 2DWHA 2R9JA 3LUYA 3PMWA 2F6GA 1I6BA 1ZIUA 3N94A 2REGA 2DQVA 2O68A 4L17A 1MG1A 3M3LA 2HCAA 1MQDA 1N0TA 2B3BA 5ICTA 2D3IA 3HSTA 4NTLA 4U1OA 3O9PA 3MVYA 3PPRA 3U8QA 5A5XA 3O28A 3M3FA 3QIMA 5L8DA 5FHNA 4ESWA 1PDAA 2F35A 3FV1A 4G4PA 3O97A 3PPNA 3LC8A 2FYIA 3E9XA 3MPLA 3LR1A 1CE2A 3CG1A 2F8DA 3MPKA 2V25A 2ALUA 3CRBA 3VVDA 4GD5A 1B5HA 3VFJA 5AA2A 1B58A 4K3FA 4LZ5A 3JZJA 2F7CA 2HZLA 1Y4CA 2GHBA 3SEXA 2VD3A 2GRVA 3C31A 3E3KA 1NNKA 3IK6B 1FCKA 5AE4A 3OO8A 4BDMA 3PD8A 1BTJA 4LZ7A 3IAZA 1D9YA 5TP9A 1Z7ME 4ZEDA 3V8XB 2DOJA 5I59B 4U4XA 1SYHA 1IXCA 3M8UA 3K2DA 1Y9UA 3L6HA 3R6UA 4YB6A 2YPNA 1Y1MA 1QUIA 3PUYE 4DLDA 4PETA 2XD3A 1MXVA 2QJEA 1R1NA 5K2YA 1O63A 3KZGA 3K01A 4YU0A 4LA9A 3KGCA 5DEXB 3G7WA 2DXYA 4GWOA 3TYHA 1M5FA 3G3FA 5EHSA 3SKPA 3WAFA 4ZDMA 1AOVA 3I3VA 2QPQA 4NF5A 1LCTA 3H6TA 2OWTA 4G8HA 1B6HA 4G8NA 4HS7A 1HSLA 1DPPA 4IO2A 3KG2A 3TTNA 4OZ9A 1POY1 5CMKA 1B7ZA 1MM7A 2UYFA 1N76A 4GOTA 4OQOA 1EU8A 1XHYA 3KSJA 1H44A 3BKIB 3EHSA 4R9GA 3JV9A 4YZZA 2QS1A 4X9TA 1DTGA 3KFMA 3OELA 4GVOA 1WVJA 1AL3A 4HCYA 5TPAB 4XKPA 5H8HA 3H4ZA 4F2OA 4H65A 1MY3A 1IZ1A 4Q0CA 5I2NA 2UVJA 3OENA 1Y1ZA 4H67A 4YKIA 4ND9A 1MXWA 4GF8A 3MUQA 1IXGA 1P1OA 1URGA 3PU5A 3B6WA 2DE3A 3WAEA 4XKNA 5A5XB 4N13A 2XXUA 1DPEA 1TFAA 3KN3A 3UA8A 4O3CA 3MP1A 3U93A 3O6GA 1FTMA 1MRPA 2PBWA 4OFLA 1NH7A 3QUJA 4F3PA 3RUMA 3K1PA 1NL5A 3CFZA 1AMFA 2THIA 2XXVA 5F1QA 2RINA 1LBBA 4TLMB 2NOOA 2GFEA 5DYHA 1QKBA 1SW4A 4G68A 2VD2A 4R6YA 2X26A 1TT1A 4FIMA 4QFKA 2Q89A 3SEUA 3KOSA 2E1SA 1DTZA 5AA2B 5AA4A 1USYH 4KD5A 3EHUA 4NE4A 4OETA 3U72A 1TWYA 4OENA 2DE2A 2PX1A 2NVUB 3Q29A 4RJZA 2XXWA 3MQ9A 3MVWA 1QKAA 1URDA 4OYVA 4LQ2A 5FHOA 3IORA 3GXAA 4KI0E 1L5TA 2VP1A 4JSDA 3VVFA 4E0WA 1YAEA 1LBCA 1ZTYA 1LGBC 4O3AA 2YLNA 1IXHA 3SEWA 2UVHA 5KCJA 3IOVA 4QF9A 2OWSA 5CRYA 1OLCA 4TQUQ 2Q88A 3SDFA 3FJGA 3W9VA 3LSWA 2ZMBA 4GXAA 1MY4A 4OVJA 4NF5B 4F3SA 3IOWA 3TODA 4JWOA 1A7LA 5B7DA 3GLBA 2PVUA 1B51A 3V5AA 2O69A 2AIXA 2HEUA 1FQAA 4PFTA 4DZ1A 2A5TB 1RYXA 1EH3A 4JDFA 3EN3A 4NWDA 5I2KA 1Y3QA 4OERA 3JYRA 4R2FA 3TTLA 2F7BA 5M2VA 3M3KA 2XXYA 2QS3A 5L9OA 3DP4A 1LAXA 1OIBA 3OEMA 1A40A 3E4RA 2XXQA 4F2QA 4YB7A 5I2NB 4IO4A 4R2BA 3N6UA 4P0GA 3T9XB 2O84X 3LSFB 4WEDA 3T66A 4F19A 4MF3A 3B7DA 3CFLA 4ZS9A 4ZZEA 2O6AA 3LBSA 5I58A 3T9VA 2ZYNA 2RCBA 1UTHA 3R7XA 1ANFA 2AL4A 2I3WA 2ONSA 3FIRA 3ZKKA 5EHMA 1IITA 1MY2A 3RQTA 3Q28A 3RN8A 1XC1A 4G68C 2OCUA 2DWIA 5I57A 1B05A 4JB7A 4PFWA 5DT6A 2QMWA 3FZVA 3FVOA 1O7TA 3A09A 1BKAA 3H6WA 4G68B 4LZ8A 4LQ5A 5BWJA 4R6KA 4ZE9A 3OOAA 5JK4A 3HHFA 1JQFA 1WDNA 3MW0A 3LSLA 2XXTA 4N6PA 4H5FA 4P0IA 4XKQA 4ELOA 2G29A 3IX1A 1LLSA 4U1ZA 1ZJLA 4IY5A 2Q2CA 2PT1A 3FASA 1H3DA 3IJOB 4KYSA 3BFTA 5ISUA 4X48A 4F31B 1PB8A 3K00A 4RK9A 3IO4A 1QVSA 4R73A 5KCJB 4UA8A 3K6XA 1B4ZA 5ITOA 5AA1A 5H8QA 1Q35A 4LATA 4LUBA 4NMYA 3D4GA 4G8MA 1B40A 3I6VA 2O1LA 2KLFA 1JETA 4IO6A 2F6PA 4OEVA 1JW1A 2Q9TA 3I5OA 5I56A 4EF1A 2DYXA 4KPTA 3CG3A 1EZ9A 4RK2A 1IIWA 4OESA 4ELRA 2I0CA 4P11A 3USDA 1Y3PA 3TCHA 3TELA 2QS2A 3C33A 3EPEA 4ESXA 3VXCA 1MDQA 3UK4A 5TU0A 1OQHA 5LOMA 3O6IA 4YMBA 3EHTA 1FTKA 1NFTA 1SYIA 3A3UA 3FVGA 5DVFA 4F1YA 2YJPA 4F18A 4FECA 4PP0A 1SVXB 1Y3NA 4JWXA 1LB9A 4NF8A 1D4NA 3FV2A 1P99A 1UIUA 1QUKA 3TTRA 1XS5A 1B46A 1XVXA 3TQLA 2REJA 3ZS6A 2I3VA 4MLQA 1USYE 1D3KA 3RT6B 5CMCA 3IO6A 3VVEA 3G3GA 1GTKA 3RNNA 1P1QA 3THIA 3TDJA 2PMSA 1Q1KA 5I58B 1H45A 1UTHB 4AB6A 3UN6A 3KN8A 1YCJA 1QJMA 4KHZE 4RPNA 4EF2A 3QXMA 1VFDA 4Z7EA 1A54A 1VR5A 4POWA 1B32A 5HBCA 5FTIA 2D21A 3U94A 1OLAA 1A99A 3U1OA 1BIYA 4MFIA 3VV5A 3CFXA 1IUDA 4WXJA 1UTBA 2A5SA 2LAOA 2P2AA 2Z8EA 1B3HA 4POXA 1I69A 3G3IA 3K0VA 2DVCA 2ZNTA 4QSCA 2OLBA 3TTKA 1QW0A 4PE5B 3PD9A 3HV1A 3QSLA 3T93B 2F78A 2PYYA 1PBPA 4G77A 4LONB 4BDLA 4KQPA 2VOZA 1FQBA 4Z0IA 3KJTA 3KOTA 4QSDA 3QAXA 4X1DA 5H8QB 1URSA 3S4UA 3PMVA 4DDDA 1JVYA 3OXNA 4FORA 3MZBA 4ZZAA 5I56B 3KJ7A 2XD2A 2V84A 4NF4A 1DOTA 2Y7KA 4I9DA 4UACA 3FJ7A 3OO7A 1H76A 4RYAA 1B5JA 4AB5A 4DXBA 3KN7A 1FQEA 2ZXTA 2VHAA 2Z23A 1GR2A 5HM4B 2ZYMA 1PEBA 1B1HA 3C32A 1MXZA 3C36A 4H8IA 3FVKA 1HSEA 1MXXA 4ZECA 5FTHA 2W7YA 2XXRA 5BUUA 3VE1B 1A55A 3MAMA 5L9MA 1JNFA 1SI0A 4EXKA 2DS9A 4BDRA 3H3GA 3GBAA 4ZEFA 2H5YA 1N7XA 1P1NA 4R74A 1BLFA 2IA4A 3PUVE 3PGFA 1H43A 1NNFA 4FEBA 4EXLA 4H6DA 5TP9B 4F3GA 4ELQA 3UP9A 4BDOA 1JW5A 3O6HA 5IAIA 5CMMA 1XOCA 2UYEA 2F5XA 4U21A 4Q5TA 3PUXE 1UTBB 4FAJA 2RC9A 5H8FA 1US5A 2XHDA 1MPBA 3TCFA 2OBGA 3HN0A 2GHAA 4LP2B 1N04A 4I8CA 4KYDA 3IJXB 3W9WA 1XT8A 2I0BA 2HFBA 3C34A 4C0RA 4EDPA 4HCWA 1VFEA 2QRYA 3UGWA 3C35A 1N3WA 1JVXA 5CI5A 2HZKA 3KBRA 2ZNSA 1LFHA 1UQWA 5AA3A 1TFDA 4R75A 1LAHE 2P1SA 4XXUA 2G93A 1S50A 4XTCQ 2Y7PA 2Y84A 5H8SA 4M1VA 3CVGA 1A8FA 4RPOA 4XIGQ 1N84A 3DELB 5ITPA 4GRKA 4GIZA 3L6GA 3Q27A 2FNCA 3G3HA 5H8HB 3PUWE 3MJNA 4R72A 1D9VA 2WKYA 4NF4B 3PMXA 2Y7WA 3S9NC 3MP8A 3K6UA 1M5EA 1FQCA 3H6UA 3OEKA 3S9EA 3UIFA 3RGYA 1MS7A 3C4MA 3ZSFA 3U92A 1B0HA 5CBSA 4ONYA 3V83A 2QL3A 3TUSA 2XXXA 1EZPA 3N6TA 3ONMA 2ABHA 4N07A 1MXUA 4BDQA 1FTOA 2UXAA 4H0WA 5CC2A 3TPAA 4LVQA 4OEUA 1T0KA 4JWYA 2DXRA 2O1MA 3Q25A 4NF6A 4ELPA 4GL0A 2Z8DA 5AA4B 1I6QA 1FQFA 4OXVA 1P1UA 4R6HA 1CB6A 3O2AA 2QS4A 4PFYA 4IY6A 3SERA 1OMPA 4U2RA 1IQ7A 3VLWA 2RC7A 3ODBA 5JEIA 1MXYA 2OJTA 2RKMA 1Y20A 4QHQA 1LAGE 1RYOA 3G3KA 1I6AA 2PT2A 4M4GA 2BJJX 3PUZE 1SQYA 2XX7A 1DSNA 2DP8A 2O7UA 1B7HA 3HCQA 3OO9A 3OO6A 1R6ZA 4GXSB 2Q8JA 1LB8A 4QSEA 5F7VA 3CSGA 5H8FB 1B52A 4F1VA 4OMBA 5DVIA 5HPQA 4JSOA 3LSXA 1B7UA 1AIVA 2NXOA 1QULA 2CZLA 4WEPA 4F39A 4NWCA 3B6TA 2X7PA 3FGSA 3RY3A 4PQJA 1SI1A 2IEEA 5TPAA 2V3QA 1MPDA 3RPWA 3SETA 1GV8A 4H5GA 3CSBA 4ISUA 2B65A 4MH5A 3ZKLA 4U23A 5I2KB 4EQBA 3GBBA 1B3EA 3SEYA 1Z7NE 3O29A 4OWDA 1N3XA 4YICA 2X7QA 3RTFB 3FXQA 3PV0E 1B3FA 2F34A 3E13X 5EYFA 4DXUA 2QMXA 2AYSA 3VXBA 4C1TA 4E0XA 1AH5A 1US4A 3MBPA 2ZYOA 4F1UA 1QUJA 2H4IA 4ZEKA 4ZE8A 3HPIA 1S7YA 5I84A 3KEIA 2DWJA 4QFOA 2Q2AA 5I57B 4BLAA 3K02A 4IO7A 3TAJA 3VLUA 1VE4A 3SEVA 3V89B 2Y7IA 1LAFE 5B70A 1LFIA 4GLIA 3IB1A 4NF6B 3IOTA 3W15C 3TFLA 2V3UA 4Q8RA 2DWAA 3AXFA 4EQ7A 1YPNA 2HQ0A 3TCGA 4DXCA 4EQ9A 4F29A 2R6GE 3A3CA 3T9HB 3IB0A 3FD3A 3QUFA 2NWJA 1FQDA 1II5A 2D5WA 2I49A 3BFUA 1NH8A 1M5CA 1EZOA 1B5IA 3G3JA 4IB2A 1GVCA 4Q30B 1JW4A 2FA7A 5KZTA 1MY0A 1OVBA 3TMGA 1MQIA 3B6QA 2AL5A 4H8JA 2XXIA 2ANJA 1POTA 3H03A 4JBZA 3K4UA 2RF1A 2A5TA 4AQ4A 1TXFA 2ZNUA 4OTEA 1R9LA 4GQOA 2CMOA 1LFGA 1S9TA 3T96B 1SD3A 1NNPA 4YKJA 4TLLB 3EQ1A 3IL1B 1JEUA 2F97A 2UVGA 3ECRA 1P1WA 4ECFA 4EUOA 4FJPA 3S9MC 4F3BA 3OSRA 4FE8A 1OVTA 2H99A 1ELJA 3H06B 1SW2A 3CR9A 3BBRA 1B1XA 4KCDA 2DE4A 4YMAA 2GH9A 4KR5A 4NF8B 4GL8A 2I48A 2ONKE 5DTBA 4QRZA 4HTGA 1GGGA 2XXHA 5H8NA 1MM6A 1MY1A 2M8CA 1J1NA 3MVXA 1R9QA 2HAVA 1ZU0A 3PPQA 2O51A 4X1BA 3DM0A 1MDP1 2NUVA 3FJMA 1BP5A 4QFNA 1SDXA 3VLVA 5CMBA 1ZKBA 4FATA 1ZBMA 5CM6A 3FATA 4RNSA 1B4HA 4IO5A 4KFQA 3QYTA 3F11A 3CI8A 2H98A 3MC2A 1FW0A 4U22A 1PB9A 2I6EA 5J1DA 1PC3A 1LSTA 1KWHA 5FHMA 2Y7RA 3P7IA 3VDFA 2H9BA 3H7MA 4DCYA 3DP8A 4ZEBA 4OFJA 4QFPA 5KDTA 1MH4A 1UIVA 1SW1A 1N7WA 4OHNA 2Z8FA 2H25A 4U4SA 1YTVA 4WKMA 2V93A 4OFOA 2UVIA 3MZ9A 5JTYA 1B0LA 2V3TA 3OMBA 5L9SA 1SBPA 1M5BA 2XX9A 3DLNA 1FTJA 1FTLA 2ZYKA 1VSOA 4YAHX 3T9UA 4XKRA 3N26A 1IXIA 1JEVA 4R9FA 3CIJA 1MQGA 2O7IA 2Z22A 3FVNA 1MQHA 3GZGA 4YKPA 1ATGA 4PFUA 2ONRA 3OD7A 3RT8A 2HAUA 2F36A 2I4BA 1F9BA 2QSXA 1ZMGA 4F22A 3K6WA 4C1UA 1ZLQA 5IKBA 2VGQA 4YKKA 5CBRA 3D4CA 1DMBA 3S9LC 1LCFA 4BDNA 3K1MA 3IOUA 4G2ZA 1MPCA 4HW8A 4IGTA 4H1XA 1B3GA 3R26A 3KSXA 1B9JA 4TOZA 1MH3A 3OSQA 3RLFE 3MWBA 3EF7A 1PB7A 4I1DA 4MBPA 1XVYA 3RTWB 5K2XA 4MLVA 1B3LA 3DP6A 3HHGA 3TKDA 2XXPA 1IEJA 4ZEIA 2R71A 3O66A 2I4CA 2OZZA 3MVZA 2E0SA 3N5LA 2XX8A 5H8NB 5I59A 4YB5A 3S2VA 3TQWA 3TZAA 1NKXA 1OQGA 3FXUA 3QK6A 2OK2A 1SW5A 2RCAA 4KCCA 3IB2A 5AA2D 4FEDA 2P0SA 3K1NA 3Q26A 5DEXA 1M5DA 3MZ1A 4JXIA 2I58A 3IR1A 3SESA 4DE8A 5ELVA 3ILTB 4O3BA 4NEDA 2RC8A 4QFLA 3C9HA 3FUZA 2DSFA 1NMUA 1WODA 3K6VA 3UORA 1RKMA 4RA1A 4IO3A 5ICQA 1NNTA 4RY1A 3H6VA 1B2HA 4IGRA 1PBQA 3ILUB 3HO7A 1HSJA 2B3FA 3PPPA 3FXRA 4RXLA 3T22A 5KDTB 3PPOA 1MQJA 4DCXA 1Y4TA 5DVJA 2F7AA 4THIA 4I62A 4DIGA 2ESNA 2DVZA
chains in the Genus database with same CATH superfamily
3TTMA 3MP6A 1O64A 1A8EA 4GFRA 5JTYB 3LUZA 4JVIA 2HXWA 1BK4A 3TEPA 4KYEA 2DWHA 2R9JA 3LUYA 3PMWA 2F6GA 1FBHA 1I6BA 1ZIUA 3N94A 4X04A 2REGA 2DQVA 2O68A 4L17A 1MG1A 3M3LA 2HCAA 4GWYA 4P1EA 2VT5A 1MQDA 1N0TA 2B3BA 5ICTA 2D3IA 3HSTA 4NTLA 4N91A 3A29A 4U1OA 3O9PA 3MVYA 4HE2A 3PPRA 3U8QA 5A5XA 3O28A 3M3FA 2JJKA 3QIMA 5L8DA 5FHNA 4ESWA 1PDAA 2F35A 3FV1A 4G4PA 3O97A 3PPNA 3LC8A 2FYIA 3HFUA 3E9XA 3MPLA 3LR1A 1CE2A 3CG1A 2F8DA 1YXIA 5EQ7A 3MPKA 2V25A 2ALUA 1IMAA 3CRBA 3VVDA 4GD5A 1B5HA 3B8BA 3VFJA 5AA2A 1B58A 2XWVA 4K3FA 4LZ5A 3JZJA 2F7CA 2HZLA 1Y4CA 4P47A 2GHBA 3SEXA 4NHBA 1RDYA 2VD3A 2GRVA 3C31A 3E3KA 1NNKA 3IK6B 1FCKA 5AE4A 3OO8A 4BDMA 3PD8A 1BTJA 4LZ7A 1LBXA 3IAZA 4DI4B 1D9YA 5TP9A 1Z7ME 1FPBA 4ZEDA 3V8XB 2DOJA 5I59B 4U4XA 1SYHA 1IXCA 3M8UA 3K2DA 1Y9UA 3L6HA 3R6UA 4YB6A 2YPNA 1Y1MA 1QUIA 2QVUA 3PUYE 4DLDA 4PETA 2XD3A 1MXVA 2QJEA 1NI9A 1R1NA 5K2YA 1O63A 3KZGA 3K01A 4YU0A 4LA9A 3KGCA 1FPDA 5DEXB 3G7WA 2DXYA 4GWOA 3TYHA 1M5FA 3G3FA 5EHSA 3SKPA 3WAFA 4ZDMA 1AOVA 3I3VA 2QPQA 4NF5A 2OWZA 1LCTA 3H6TA 2FVZA 2OWTA 4G8HA 1B6HA 4G8NA 4HS7A 1HSLA 1DPPA 4IO2A 4PAFA 3KG2A 3TTNA 4OZ9A 1POY1 5CMKA 1FPLA 1FBEA 3ISPA 1B7ZA 1MM7A 2UYFA 1YYZA 1N76A 4GOTA 4OQOA 1EU8A 1XHYA 3KSJA 1H44A 2Y5KA 3BKIB 3EHSA 2R8TA 4R9GA 3JV9A 4YZZA 5ET5A 1G0HA 2QS1A 1FPEA 1DTGA 3KFMA 4X9TA 3OELA 2FIEA 4GVOA 1WVJA 1AL3A 4HCYA 5TPAB 4XKPA 5H8HA 3T0JA 3H4ZA 4PFIA 4F2OA 4H65A 1MY3A 1IZ1A 4Q0CA 5I2NA 2UVJA 3OENA 1Y1ZA 4H67A 4YKIA 4ND9A 1MXWA 4GF8A 3MUQA 5F24A 1IXGA 1P1OA 1URGA 3PU5A 3B6WA 2DE3A 3WAEA 4XKNA 5A5XB 4N13A 2XXUA 1DPEA 1TFAA 3KN3A 3UA8A 4O3CA 3MP1A 3U93A 3O6GA 1FTMA 4PAKA 1MRPA 2PBWA 4OFLA 4X8RA 1NH7A 3QUJA 4F3PA 3RUMA 3K1PA 1NL5A 3CFZA 1AMFA 5EYHA 2THIA 2XXVA 5F1QA 2RINA 1LBBA 1Q9DA 2QVVA 4TLMB 1INPA 2NOOA 2GFEA 5DYHA 1QKBA 1SW4A 4G68A 2VD2A 4R6YA 2X26A 1TT1A 4FIMA 4QFKA 4PDHA 2Q89A 2FHYA 3SEUA 3KOSA 2E1SA 1DTZA 5AA2B 5AA4A 1USYH 4KD5A 2XWKA 3EHUA 4NE4A 4OETA 3U72A 1TWYA 2WYKA 4OENA 2DE2A 2PX1A 2NVUB 3Q29A 4RJZA 2XXWA 3MQ9A 3KC1A 1QKAA 3MVWA 1URDA 4OYVA 4AS5A 4NGUA 4LQ2A 3SZPA 5FHOA 3IORA 3GXAA 4KI0E 1L5TA 1NV3A 2VP1A 4JSDA 3VVFA 4E0WA 1YAEA 1LBCA 1ZTYA 1LGBC 4O3AA 2YLNA 2BJIA 1IXHA 3SEWA 2UVHA 5KCJA 3IOVA 4QF9A 2OWSA 5CRYA 1OLCA 4TQUQ 1CNQA 2Q88A 3SDFA 3FJGA 3QMFA 3W9VA 3LSWA 1LBWA 2ZMBA 4GX3A 4GXAA 1MY4A 4OVJA 4NF5B 3RYDA 4F3SA 3IOWA 3TODA 2V4CA 4JWOA 1A7LA 5B7DA 3GLBA 2PVUA 1B51A 3V5AA 2O69A 4N6KA 2AIXA 2HEUA 5I7IA 4N8GA 1FQAA 4PFTA 4PBHA 1RDXA 3CHGA 4DZ1A 2A5TB 4N17A 1RYXA 1EH3A 4JDFA 3EN3A 4NWDA 5I2KA 1Y3QA 4OERA 3JYRA 4R2FA 3TTLA 2F7BA 5M2VA 5IGAA 3M3KA 4HXVA 2XXYA 2QS3A 5L9OA 3DP4A 1LAXA 1OIBA 3OEMA 1A40A 3E4RA 2XXQA 4F2QA 3GYYA 3MSTA 4YB7A 5I2NB 4IO4A 4R2BA 3N6UA 4P0GA 3ROJA 3T9XB 2O84X 3LSFB 4P3LA 4WEDA 3T66A 4F19A 4MF3A 3B7DA 3CFLA 4ZS9A 4ZZEA 2O6AA 3LBSA 5I58A 1RDZA 3T9VA 2ZYNA 3EKIA 2RCBA 1UTHA 3R7XA 1ANFA 2AL4A 2I3WA 2ONSA 3FIRA 3ZKKA 5EHMA 1IITA 4G61A 1MY2A 3RQTA 3Q28A 3RN8A 4PFBA 1K9ZA 1XC1A 4I3EA 4G68C 2OCUA 2DWIA 5I57A 1B05A 4JB7A 4PFWA 5DT6A 2QMWA 3FZVA 3FVOA 1O7TA 4NX1A 3A09A 1BKAA 4NF0A 3H6WA 4G68B 4LZ8A 4LQ5A 1FBDA 5BWJA 4OVPA 4MCOA 4R6KA 4ZE9A 3OOAA 5JK4A 3HHFA 1JQFA 1WDNA 3MW0A 3LSLA 2XXTA 4N6PA 4H5FA 4P0IA 4XKQA 4ELOA 2G29A 3IX1A 1LLSA 4QBAA 4U1ZA 1ZJLA 4IY5A 2Q2CA 2PT1A 3FASA 1H3DA 3IJOB 4KYSA 3BFTA 5ISUA 4X48A 4F31B 1PB8A 3K00A 4RK9A 3IO4A 1QVSA 4P1LA 4R73A 5KCJB 4UA8A 3K6XA 1B4ZA 5ITOA 5AA1A 5H8QA 1Q35A 4LATA 4LUBA 4NMYA 3D4GA 4G8MA 1B40A 3I6VA 2O1LA 4LN5A 2KLFA 1JETA 4IO6A 2F6PA 4OEVA 1JW1A 2Q9TA 3I5OA 5I56A 4EF1A 2DYXA 4KPTA 3CG3A 1EZ9A 4RK2A 1IIWA 4OESA 4ELRA 2I0CA 4P11A 2PFZA 1FBGA 3USDA 1Y3PA 2QVRA 3TCHA 3TELA 2QS2A 3C33A 3EPEA 4ESXA 5EYGA 3VXCA 1MDQA 3E78A 3UK4A 5TU0A 1OQHA 5LOMA 3O6IA 4YMBA 3EHTA 1FTKA 1NFTA 1SYIA 4P8BA 3A3UA 2OX3A 2L5VA 3FVGA 5DVFA 4F1YA 2YJPA 4F18A 4FECA 4PP0A 1SVXB 4JWXA 1Y3NA 3B50A 1LB9A 4NF8A 1D4NA 3FV2A 1P99A 1UIUA 1QUKA 1XS5A 3TTRA 1B46A 1XVXA 3TQLA 2REJA 3ZS6A 2I3VA 4MLQA 1USYE 1D3KA 3RT6B 5CMCA 5LDZA 3IO6A 3VVEA 3G3GA 1GTKA 3RNNA 1D9QA 1P1QA 1NV7A 3THIA 3IFCA 3TDJA 2PMSA 1Q1KA 4MJOA 5EQ8A 1FBFA 5I58B 1H45A 1UTHB 4AB6A 3UN6A 3KN8A 1YCJA 1QJMA 4KHZE 4RPNA 4EF2A 1NV2A 2Q8MA 3QXMA 1VFDA 4Z7EA 1A54A 1VR5A 4POWA 1B32A 5HBCA 5FTIA 2D21A 3U94A 1OLAA 4PTKA 1A99A 3U1OA 1BIYA 4MFIA 3VV5A 4MX6A 3CFXA 4OA4A 1IUDA 4WXJA 1NV5A 1UTBA 2A5SA 2LAOA 4HE1A 2P2AA 4PF6A 2ZZWA 4HE0A 2Z8EA 1B3HA 4N81A 4POXA 1I69A 3G3IA 3K0VA 2DVCA 2ZNTA 4QSCA 4MHFA 2OLBA 1K9YA 3TTKA 1QW0A 1NUXA 4PE5B 3PD9A 3HV1A 3QSLA 3T93B 2F78A 2PYYA 1PBPA 4G77A 4H46A 4XFEA 4LONB 4MNIA 4BDLA 4KQPA 2VOZA 1FQBA 4Z0IA 3KJTA 4AS4A 3KOTA 4QSDA 4GWUA 4OVSA 4PBQA 3QAXA 4X1DA 5H8QB 1URSA 3S4UA 1IMEA 3PMVA 4DDDA 1JVYA 1XI6A 1AWBA 3OXNA 4FORA 5DW8A 3MZBA 4ZZAA 5I56B 3KJ7A 2XD2A 2V84A 4GBVA 4NF4A 1DOTA 2Y7KA 4I9DA 1EYKA 4UACA 3FJ7A 2B4LA 4MIJA 3OO7A 1H76A 4RYAA 1B5JA 4AB5A 4NAPA 4DXBA 3KN7A 2Q74A 1FQEA 4NQ8A 2ZXTA 2VHAA 2Z23A 1DK4A 1GR2A 5HM4B 2ZYMA 5ET8A 5IZ1A 1PEBA 1B1HA 3C32A 1MXZA 3C36A 4H8IA 3FVKA 1HSEA 1MXXA 4ZECA 5FTHA 1FRPA 2W7YA 2XXRA 3FBPA 5BUUA 3VE1B 1A55A 4GBWA 3MAMA 5L9MA 1JNFA 1SI0A 4EXKA 2P3NA 2DS9A 4BDRA 3H3GA 3GBAA 2PCRA 4ZEFA 2H5YA 1N7XA 1P1NA 5ET6A 4R74A 1BLFA 2IA4A 3PUVE 3PGFA 1H43A 1NNFA 4FEBA 4EXLA 4H6DA 5TP9B 4F3GA 4ELQA 3UP9A 4BDOA 1JW5A 3O6HA 5IAIA 5CMMA 4PC9A 4GX6A 2HPGA 1XOCA 2UYEA 2F5XA 4U21A 4Q5TA 3PUXE 1UTBB 4FAJA 2RC9A 5A5LA 1US5A 2XHDA 5H8FA 1MPBA 3TCFA 1IMBA 2OBGA 3NOHA 3HN0A 2GHAA 4LP2B 1N04A 4I8CA 4KYDA 4OVQA 3IJXB 3W9WA 1XT8A 2I0BA 2HFBA 3C34A 4C0RA 4EDPA 4HCWA 1VFEA 2QRYA 3UGWA 3C35A 1N3WA 1JVXA 5CI5A 2HZKA 3KBRA 2ZNSA 1LFHA 1JP4A 1UQWA 5AA3A 1TFDA 3BIHA 4PDDA 4R75A 1LAHE 2P1SA 4XXUA 2G93A 1S50A 4MNPA 4XTCQ 2Y7PA 2Y84A 5H8SA 4M1VA 3CVGA 1A8FA 4RPOA 4XIGQ 1N84A 3DELB 2GQ1A 5ITPA 4GRKA 5ET7A 4GIZA 3L6GA 3Q27A 2FNCA 3G3HA 5H8HB 3PUWE 3MJNA 4R72A 1D9VA 3KBZA 2WKYA 2CZIA 4NF4B 3PMXA 2Y7WA 3S9NC 3MP8A 3K6UA 1M5EA 1FQCA 3H6UA 3OEKA 3S9EA 3UIFA 3RGYA 1MS7A 5I5PA 2WEFA 3C4MA 3ZSFA 1LBVA 4N8YA 3U92A 1B0HA 5CBSA 4ONYA 1FPFA 3V83A 2KQZA 2QL3A 2XWOA 3TUSA 4H45A 2XXXA 1EZPA 4OVTA 2P3VA 3N6TA 3ONMA 2ABHA 4GWWA 4N07A 1MXUA 4BDQA 1FTOA 2UXAA 1NV0A 4H0WA 2XXKA 3TPAA 5CC2A 4LVQA 4OEUA 1IMDA 1T0KA 4JWYA 2DXRA 2O1MA 3Q25A 4NF6A 4ELPA 1NUWA 4GL0A 2Z8DA 4DI3D 5AA4B 1I6QA 1FQFA 4OXVA 1P1UA 4R6HA 1CB6A 3O2AA 5IZ3A 2QS4A 4PFYA 4IY6A 3SERA 5EQAA 1OMPA 4U2RA 1IQ7A 3VLWA 2RC7A 3ODBA 5JEIA 1MXYA 2OJTA 2RKMA 1Y20A 3IFAA 4QHQA 1LAGE 1RYOA 3G3KA 1I6AA 2PT2A 4M4GA 2BJJX 3D1RA 3PUZE 1SQYA 2ZZVA 2XX7A 1DSNA 2DP8A 2O7UA 1B7HA 3HCQA 3OO9A 3OO6A 1FPGA 1R6ZA 4GXSB 4GWSA 2QFLA 2Q8JA 1FPJA 4NG7A 1LB8A 4QSEA 5F7VA 3CSGA 5H8FB 1NV1A 1B52A 4MEVA 4P56A 4F1VA 4OMBA 5DVIA 5HPQA 4JSOA 3LSXA 4PFRA 1B7UA 1AIVA 2NXOA 2WX9A 1FJ6A 1QULA 2CZLA 4WEPA 4F39A 4NWCA 3B6TA 2XWIA 2X7PA 3FGSA 3RY3A 4PQJA 1SI1A 2IEEA 5TPAA 2V3QA 4GWZA 1MPDA 3RPWA 3SETA 1GV8A 4H5GA 4I40A 2HHMA 3CSBA 4ISUA 2B65A 4MMPA 4MH5A 2CEYA 3ZKLA 4U23A 5I2KB 4EQBA 3GBBA 1SPIA 1B3EA 3SEYA 1Z7NE 3O29A 4OWDA 1N3XA 4YICA 2X7QA 4OANA 3RTFB 3FXQA 3PV0E 1B3FA 2F34A 4I3YA 1DBZA 3E13X 5EYFA 4DXUA 2QMXA 2AYSA 5T3JA 3VXBA 1QGXA 1FPIA 4C1TA 4E0XA 1AH5A 1US4A 4O7IA 3MBPA 2ZYOA 4F1UA 1QUJA 1NUYA 2H4IA 1IMCA 4ZEKA 4ZE8A 3HPIA 1S7YA 5ESYA 3RPLA 4MNCA 5I84A 3KEIA 2DWJA 1DCUA 4GWXA 4QFOA 2Q2AA 5I57B 4BLAA 3K02A 4IO7A 3TAJA 1FBPA 3VLUA 3MYUA 1VE4A 3SEVA 3V89B 2Y7IA 1LAFE 5B70A 1LFIA 4GLIA 3IB1A 4NF6B 5IM2A 3IOTA 1KZ8A 3W15C 3TFLA 2V3UA 4Q8RA 2DWAA 3AXFA 4EQ7A 4PCDA 1YPNA 2HQ0A 3TCGA 4DXCA 5IZ3B 4EQ9A 4F29A 2FIXA 1LBYA 1NV6A 4PE3A 2R6GE 3A3CA 3T9HB 3LV0A 3IB0A 3FD3A 3QUFA 2NWJA 1FQDA 1II5A 2D5WA 5EQ9A 4GX4A 2I49A 3BFUA 1NH8A 1M5CA 1EZOA 1B5IA 3G3JA 4IB2A 4PGPA 1GVCA 4Q30B 1JW4A 2FA7A 4N6DA 1NV4A 5KZTA 1MY0A 1OVBA 3TMGA 1MQIA 3B6QA 2AL5A 4H8JA 2XXIA 2ANJA 1POTA 3H03A 4JBZA 3K4UA 2F3BA 2RF1A 4IR8A 2A5TA 4AQ4A 1TXFA 2ZNUA 4OTEA 4P9KA 1R9LA 2PFYA 4GQOA 2CMOA 1LFGA 1S9TA 3T96B 1SD3A 1NNPA 4YKJA 4TLLB 3EQ1A 3IL1B 1JEUA 2F97A 2UVGA 3ECRA 1P1WA 4ECFA 4EUOA 4FJPA 3S9MC 4F3BA 3OSRA 4PF8A 4FE8A 1OVTA 2H99A 1ELJA 3H06B 1SW2A 2CZKA 3CR9A 3BBRA 5IZZA 1B1XA 1LBZA 4KCDA 2DE4A 4YMAA 2GH9A 4KR5A 2WBDA 4NF8B 4GL8A 2I48A 4XF5A 1VDWA 2ONKE 5DTBA 2DDKA 4QRZA 4HTGA 1GGGA 4MAGA 2XXHA 5H8NA 1MM6A 1MY1A 2M8CA 1J1NA 3MVXA 1R9QA 2HAVA 1ZU0A 3PPQA 2O51A 4OVRA 4X1BA 3DM0A 1MDP1 2NUVA 3FJMA 1NUZA 2F3DA 2VPOA 1BP5A 4QFNA 1SDXA 3VLVA 5CMBA 3RPLB 1ZKBA 4FATA 1FJ9A 1ZBMA 5CM6A 3FATA 4RNSA 1B4HA 5LTCA 4IO5A 4KFQA 3FXBA 3F11A 3QYTA 3CI8A 2H98A 3MC2A 2ZZXA 4UABA 4JVDA 1FW0A 4U22A 1PB9A 2I6EA 5J1DA 1PC3A 1LSTA 1KWHA 5FHMA 2Y7RA 3P7IA 3VDFA 2H9BA 3H7MA 4DCYA 3DP8A 1FTAA 4ZEBA 4OFJA 4QFPA 5KDTA 1MH4A 1UIVA 1SW1A 4OHNA 1N7WA 4O94A 2WBBA 2Z8FA 4PGNA 2H25A 4U4SA 1IMFA 1YTVA 4WKMA 2V93A 2WYPA 4OFOA 2UVIA 3MZ9A 3U65A 5JTYA 1B0LA 2CEXA 2V3TA 3OMBA 5L9SA 1SBPA 1M5BA 2XX9A 3BIGA 3DLNA 1FTJA 1FTLA 2ZYKA 1VSOA 4YAHX 3T9UA 4XKRA 3N26A 1IXIA 1JEVA 4R9FA 3CIJA 1MQGA 2O7IA 2Z22A 2FBPA 3FVNA 1MQHA 3GZGA 4YKPA 1ATGA 4PFUA 1FSAA 4O7MA 2ONRA 3E79A 3OD7A 3RT8A 2HAUA 2F36A 2I4BA 1F9BA 2QSXA 1ZMGA 4F22A 3K6WA 4C1UA 1ZLQA 5IKBA 2VGQA 4YKKA 5CBRA 3D4CA 1DMBA 1LEVA 3S9LC 1LCFA 4BDNA 3K1MA 3IOUA 4G2ZA 4O8MA 2KR0A 1MPCA 4HW8A 4IGTA 4H1XA 2HXRA 1B3GA 3R26A 3KSXA 1B9JA 4TOZA 1MH3A 1KA1A 3OSQA 4XEQA 4N15A 3T1BA 3PTYA 3RLFE 3MWBA 4QXDA 3EF7A 1PB7A 1KA0A 2B4MA 4I1DA 4MBPA 1XVYA 3RTWB 5K2XA 4MLVA 5FBPA 4FBPA 1EYJA 1B3LA 3DP6A 3HHGA 4KXPA 3TKDA 2XXPA 1IEJA 4ZEIA 2R71A 3O66A 1G0IA 4NN3A 2I4CA 1YZ0A 2OZZA 2VPNA 3MVZA 4N4UA 2E0SA 3N5LA 2XX8A 5I3SA 5H8NB 2CZHA 5I59A 4YB5A 3S2VA 3TQWA 1FPKA 3TZAA 1NKXA 1OQGA 3KC0A 3FXUA 3QK6A 2OK2A 1SW5A 2RCAA 4KCCA 3IB2A 5AA2D 4FEDA 2P0SA 3K1NA 3Q26A 5DEXA 1M5DA 3MZ1A 4JXIA 2XA5A 2I58A 3IR1A 3SESA 4DE8A 5ELVA 3ILTB 4O3BA 4NEDA 2RC8A 4QFLA 3C9HA 3FUZA 2DSFA 1NMUA 5J16A 1WODA 3K6VA 3UORA 1RKMA 4RA1A 4PAIA 4IO3A 5ICQA 4JVCA 1NNTA 4RY1A 3H6VA 2MKZA 1B2HA 4IGRA 1PBQA 3ILUB 3HO7A 1HSJA 2B3FA 1FBCA 2Y5LA 3PPPA 3FXRA 4RXLA 3T22A 5KDTB 3PPOA 1MQJA 4DCXA 1Y4TA 5DVJA 2F7AA 4THIA 1EYIA 4I62A 4DIGA 2ESNA 2DVZA
chains in the Genus database with same CATH topology
3TTMA 3MP6A 1O64A 1A8EA 4GFRA 5JTYB 2HXWA 3TEPA 4KYEA 2DWHA 2R9JA 3LUYA 3PMWA 2F6GA 1I6BA 1ZIUA 3N94A 2REGA 2DQVA 2O68A 4L17A 1MG1A 3M3LA 2HCAA 1MQDA 1N0TA 2B3BA 5ICTA 2D3IA 3HSTA 4NTLA 4U1OA 3O9PA 3MVYA 3PPRA 3U8QA 5A5XA 3O28A 3M3FA 3QIMA 5L8DA 5FHNA 4ESWA 1PDAA 2F35A 3FV1A 4G4PA 3O97A 3PPNA 3LC8A 2FYIA 3E9XA 3MPLA 3LR1A 1CE2A 3CG1A 2F8DA 3MPKA 2V25A 2ALUA 3CRBA 3VVDA 4GD5A 1B5HA 3VFJA 5AA2A 1B58A 4K3FA 4LZ5A 3JZJA 2F7CA 2HZLA 1Y4CA 2GHBA 3SEXA 2VD3A 2GRVA 3C31A 3E3KA 1NNKA 3IK6B 1FCKA 5AE4A 3OO8A 4BDMA 3PD8A 1BTJA 4LZ7A 3IAZA 1D9YA 5TP9A 1Z7ME 4ZEDA 3V8XB 2DOJA 5I59B 4U4XA 1SYHA 1IXCA 3M8UA 3K2DA 1Y9UA 3L6HA 3R6UA 4YB6A 2YPNA 1Y1MA 1QUIA 3PUYE 4DLDA 4PETA 2XD3A 1MXVA 2QJEA 1R1NA 5K2YA 1O63A 3KZGA 3K01A 4YU0A 4LA9A 3KGCA 5DEXB 3G7WA 2DXYA 4GWOA 3TYHA 1M5FA 3G3FA 5EHSA 3SKPA 3WAFA 4ZDMA 1AOVA 3I3VA 2QPQA 4NF5A 1LCTA 3H6TA 2OWTA 4G8HA 1B6HA 4G8NA 4HS7A 1HSLA 1DPPA 4IO2A 3KG2A 3TTNA 4OZ9A 1POY1 5CMKA 1B7ZA 1MM7A 2UYFA 1N76A 4GOTA 4OQOA 1EU8A 1XHYA 3KSJA 1H44A 3BKIB 3EHSA 4R9GA 3JV9A 4YZZA 2QS1A 4X9TA 1DTGA 3KFMA 3OELA 4GVOA 1WVJA 1AL3A 4HCYA 5TPAB 4XKPA 5H8HA 3H4ZA 4F2OA 4H65A 1MY3A 1IZ1A 4Q0CA 5I2NA 2UVJA 3OENA 1Y1ZA 4H67A 4YKIA 4ND9A 1MXWA 4GF8A 3MUQA 1IXGA 1P1OA 1URGA 3PU5A 3B6WA 2DE3A 3WAEA 4XKNA 5A5XB 4N13A 2XXUA 1DPEA 1TFAA 3KN3A 3UA8A 4O3CA 3MP1A 3U93A 3O6GA 1FTMA 1MRPA 2PBWA 4OFLA 1NH7A 3QUJA 4F3PA 3RUMA 3K1PA 1NL5A 3CFZA 1AMFA 2THIA 2XXVA 5F1QA 2RINA 1LBBA 4TLMB 2NOOA 2GFEA 5DYHA 1QKBA 1SW4A 4G68A 2VD2A 4R6YA 2X26A 1TT1A 4FIMA 4QFKA 2Q89A 3SEUA 3KOSA 2E1SA 1DTZA 5AA2B 5AA4A 1USYH 4KD5A 3EHUA 4NE4A 4OETA 3U72A 1TWYA 4OENA 2DE2A 2PX1A 2NVUB 3Q29A 4RJZA 2XXWA 3MQ9A 3MVWA 1QKAA 1URDA 4OYVA 4LQ2A 5FHOA 3IORA 3GXAA 4KI0E 1L5TA 2VP1A 4JSDA 3VVFA 4E0WA 1YAEA 1LBCA 1ZTYA 1LGBC 4O3AA 2YLNA 1IXHA 3SEWA 2UVHA 5KCJA 3IOVA 4QF9A 2OWSA 5CRYA 1OLCA 4TQUQ 2Q88A 3SDFA 3FJGA 3W9VA 3LSWA 2ZMBA 4GXAA 1MY4A 4OVJA 4NF5B 4F3SA 3IOWA 3TODA 4JWOA 1A7LA 5B7DA 3GLBA 2PVUA 1B51A 3V5AA 2O69A 2AIXA 2HEUA 1FQAA 4PFTA 4DZ1A 2A5TB 1RYXA 1EH3A 4JDFA 3EN3A 4NWDA 5I2KA 1Y3QA 4OERA 3JYRA 4R2FA 3TTLA 2F7BA 5M2VA 3M3KA 2XXYA 2QS3A 5L9OA 3DP4A 1LAXA 1OIBA 3OEMA 1A40A 3E4RA 2XXQA 4F2QA 4YB7A 5I2NB 4IO4A 4R2BA 3N6UA 4P0GA 3T9XB 2O84X 3LSFB 4WEDA 3T66A 4F19A 4MF3A 3B7DA 3CFLA 4ZS9A 4ZZEA 2O6AA 3LBSA 5I58A 3T9VA 2ZYNA 2RCBA 1UTHA 3R7XA 1ANFA 2AL4A 2I3WA 2ONSA 3FIRA 3ZKKA 5EHMA 1IITA 1MY2A 3RQTA 3Q28A 3RN8A 1XC1A 4G68C 2OCUA 2DWIA 5I57A 1B05A 4JB7A 4PFWA 5DT6A 2QMWA 3FZVA 3FVOA 1O7TA 3A09A 1BKAA 3H6WA 4G68B 4LZ8A 4LQ5A 5BWJA 4R6KA 4ZE9A 3OOAA 5JK4A 3HHFA 1JQFA 1WDNA 3MW0A 3LSLA 2XXTA 4N6PA 4H5FA 4P0IA 4XKQA 4ELOA 2G29A 3IX1A 1LLSA 4U1ZA 1ZJLA 4IY5A 2Q2CA 2PT1A 3FASA 1H3DA 3IJOB 4KYSA 3BFTA 5ISUA 4X48A 4F31B 1PB8A 3K00A 4RK9A 3IO4A 1QVSA 4R73A 5KCJB 4UA8A 3K6XA 1B4ZA 5ITOA 5AA1A 5H8QA 1Q35A 4LATA 4LUBA 4NMYA 3D4GA 4G8MA 1B40A 3I6VA 2O1LA 2KLFA 1JETA 4IO6A 2F6PA 4OEVA 1JW1A 2Q9TA 3I5OA 5I56A 4EF1A 2DYXA 4KPTA 3CG3A 1EZ9A 4RK2A 1IIWA 4OESA 4ELRA 2I0CA 4P11A 3USDA 1Y3PA 3TCHA 3TELA 2QS2A 3C33A 3EPEA 4ESXA 3VXCA 1MDQA 3UK4A 5TU0A 1OQHA 5LOMA 3O6IA 4YMBA 3EHTA 1FTKA 1NFTA 1SYIA 3A3UA 3FVGA 5DVFA 4F1YA 2YJPA 4F18A 4FECA 4PP0A 1SVXB 1Y3NA 4JWXA 1LB9A 4NF8A 1D4NA 3FV2A 1P99A 1UIUA 1QUKA 3TTRA 1XS5A 1B46A 1XVXA 3TQLA 2REJA 3ZS6A 2I3VA 4MLQA 1USYE 1D3KA 3RT6B 5CMCA 3IO6A 3VVEA 3G3GA 1GTKA 3RNNA 1P1QA 3THIA 3TDJA 2PMSA 1Q1KA 5I58B 1H45A 1UTHB 4AB6A 3UN6A 3KN8A 1YCJA 1QJMA 4KHZE 4RPNA 4EF2A 3QXMA 1VFDA 4Z7EA 1A54A 1VR5A 4POWA 1B32A 5HBCA 5FTIA 2D21A 3U94A 1OLAA 1A99A 3U1OA 1BIYA 4MFIA 3VV5A 3CFXA 1IUDA 4WXJA 1UTBA 2A5SA 2LAOA 2P2AA 2Z8EA 1B3HA 4POXA 1I69A 3G3IA 3K0VA 2DVCA 2ZNTA 4QSCA 2OLBA 3TTKA 1QW0A 4PE5B 3PD9A 3HV1A 3QSLA 3T93B 2F78A 2PYYA 1PBPA 4G77A 4LONB 4BDLA 4KQPA 2VOZA 1FQBA 4Z0IA 3KJTA 3KOTA 4QSDA 3QAXA 4X1DA 5H8QB 1URSA 3S4UA 3PMVA 4DDDA 1JVYA 3OXNA 4FORA 3MZBA 4ZZAA 5I56B 3KJ7A 2XD2A 2V84A 4NF4A 1DOTA 2Y7KA 4I9DA 4UACA 3FJ7A 3OO7A 1H76A 4RYAA 1B5JA 4AB5A 4DXBA 3KN7A 1FQEA 2ZXTA 2VHAA 2Z23A 1GR2A 5HM4B 2ZYMA 1PEBA 1B1HA 3C32A 1MXZA 3C36A 4H8IA 3FVKA 1HSEA 1MXXA 4ZECA 5FTHA 2W7YA 2XXRA 5BUUA 3VE1B 1A55A 3MAMA 5L9MA 1JNFA 1SI0A 4EXKA 2DS9A 4BDRA 3H3GA 3GBAA 4ZEFA 2H5YA 1N7XA 1P1NA 4R74A 1BLFA 2IA4A 3PUVE 3PGFA 1H43A 1NNFA 4FEBA 4EXLA 4H6DA 5TP9B 4F3GA 4ELQA 3UP9A 4BDOA 1JW5A 3O6HA 5IAIA 5CMMA 1XOCA 2UYEA 2F5XA 4U21A 4Q5TA 3PUXE 1UTBB 4FAJA 2RC9A 5H8FA 1US5A 2XHDA 1MPBA 3TCFA 2OBGA 3HN0A 2GHAA 4LP2B 1N04A 4I8CA 4KYDA 3IJXB 3W9WA 1XT8A 2I0BA 2HFBA 3C34A 4C0RA 4EDPA 4HCWA 1VFEA 2QRYA 3UGWA 3C35A 1N3WA 1JVXA 5CI5A 2HZKA 3KBRA 2ZNSA 1LFHA 1UQWA 5AA3A 1TFDA 4R75A 1LAHE 2P1SA 4XXUA 2G93A 1S50A 4XTCQ 2Y7PA 2Y84A 5H8SA 4M1VA 3CVGA 1A8FA 4RPOA 4XIGQ 1N84A 3DELB 5ITPA 4GRKA 4GIZA 3L6GA 3Q27A 2FNCA 3G3HA 5H8HB 3PUWE 3MJNA 4R72A 1D9VA 2WKYA 4NF4B 3PMXA 2Y7WA 3S9NC 3MP8A 3K6UA 1M5EA 1FQCA 3H6UA 3OEKA 3S9EA 3UIFA 3RGYA 1MS7A 3C4MA 3ZSFA 3U92A 1B0HA 5CBSA 4ONYA 3V83A 2QL3A 3TUSA 2XXXA 1EZPA 3N6TA 3ONMA 2ABHA 4N07A 1MXUA 4BDQA 1FTOA 2UXAA 4H0WA 5CC2A 3TPAA 4LVQA 4OEUA 1T0KA 4JWYA 2DXRA 2O1MA 3Q25A 4NF6A 4ELPA 4GL0A 2Z8DA 5AA4B 1I6QA 1FQFA 4OXVA 1P1UA 4R6HA 1CB6A 3O2AA 2QS4A 4PFYA 4IY6A 3SERA 1OMPA 4U2RA 1IQ7A 3VLWA 2RC7A 3ODBA 5JEIA 1MXYA 2OJTA 2RKMA 1Y20A 4QHQA 1LAGE 1RYOA 3G3KA 1I6AA 2PT2A 4M4GA 2BJJX 3PUZE 1SQYA 2XX7A 1DSNA 2DP8A 2O7UA 1B7HA 3HCQA 3OO9A 3OO6A 1R6ZA 4GXSB 2Q8JA 1LB8A 4QSEA 5F7VA 3CSGA 5H8FB 1B52A 4F1VA 4OMBA 5DVIA 5HPQA 4JSOA 3LSXA 1B7UA 1AIVA 2NXOA 1QULA 2CZLA 4WEPA 4F39A 4NWCA 3B6TA 2X7PA 3FGSA 3RY3A 4PQJA 1SI1A 2IEEA 5TPAA 2V3QA 1MPDA 3RPWA 3SETA 1GV8A 4H5GA 3CSBA 4ISUA 2B65A 4MH5A 3ZKLA 4U23A 5I2KB 4EQBA 3GBBA 1B3EA 3SEYA 1Z7NE 3O29A 4OWDA 1N3XA 4YICA 2X7QA 3RTFB 3FXQA 3PV0E 1B3FA 2F34A 3E13X 5EYFA 4DXUA 2QMXA 2AYSA 3VXBA 4C1TA 4E0XA 1AH5A 1US4A 3MBPA 2ZYOA 4F1UA 1QUJA 2H4IA 4ZEKA 4ZE8A 3HPIA 1S7YA 5I84A 3KEIA 2DWJA 4QFOA 2Q2AA 5I57B 4BLAA 3K02A 4IO7A 3TAJA 3VLUA 1VE4A 3SEVA 3V89B 2Y7IA 1LAFE 5B70A 1LFIA 4GLIA 3IB1A 4NF6B 3IOTA 3W15C 3TFLA 2V3UA 4Q8RA 2DWAA 3AXFA 4EQ7A 1YPNA 2HQ0A 3TCGA 4DXCA 4EQ9A 4F29A 2R6GE 3A3CA 3T9HB 3IB0A 3FD3A 3QUFA 2NWJA 1FQDA 1II5A 2D5WA 2I49A 3BFUA 1NH8A 1M5CA 1EZOA 1B5IA 3G3JA 4IB2A 1GVCA 4Q30B 1JW4A 2FA7A 5KZTA 1MY0A 1OVBA 3TMGA 1MQIA 3B6QA 2AL5A 4H8JA 2XXIA 2ANJA 1POTA 3H03A 4JBZA 3K4UA 2RF1A 2A5TA 4AQ4A 1TXFA 2ZNUA 4OTEA 1R9LA 4GQOA 2CMOA 1LFGA 1S9TA 3T96B 1SD3A 1NNPA 4YKJA 4TLLB 3EQ1A 3IL1B 1JEUA 2F97A 2UVGA 3ECRA 1P1WA 4ECFA 4EUOA 4FJPA 3S9MC 4F3BA 3OSRA 4FE8A 1OVTA 2H99A 1ELJA 3H06B 1SW2A 3CR9A 3BBRA 1B1XA 4KCDA 2DE4A 4YMAA 2GH9A 4KR5A 4NF8B 4GL8A 2I48A 2ONKE 5DTBA 4QRZA 4HTGA 1GGGA 2XXHA 5H8NA 1MM6A 1MY1A 2M8CA 1J1NA 3MVXA 1R9QA 2HAVA 1ZU0A 3PPQA 2O51A 4X1BA 3DM0A 1MDP1 2NUVA 3FJMA 1BP5A 4QFNA 1SDXA 3VLVA 5CMBA 1ZKBA 4FATA 1ZBMA 5CM6A 3FATA 4RNSA 1B4HA 4IO5A 4KFQA 3QYTA 3F11A 3CI8A 2H98A 3MC2A 1FW0A 4U22A 1PB9A 2I6EA 5J1DA 1PC3A 1LSTA 1KWHA 5FHMA 2Y7RA 3P7IA 3VDFA 2H9BA 3H7MA 4DCYA 3DP8A 4ZEBA 4OFJA 4QFPA 5KDTA 1MH4A 1UIVA 1SW1A 1N7WA 4OHNA 2Z8FA 2H25A 4U4SA 1YTVA 4WKMA 2V93A 4OFOA 2UVIA 3MZ9A 5JTYA 1B0LA 2V3TA 3OMBA 5L9SA 1SBPA 1M5BA 2XX9A 3DLNA 1FTJA 1FTLA 2ZYKA 1VSOA 4YAHX 3T9UA 4XKRA 3N26A 1IXIA 1JEVA 4R9FA 3CIJA 1MQGA 2O7IA 2Z22A 3FVNA 1MQHA 3GZGA 4YKPA 1ATGA 4PFUA 2ONRA 3OD7A 3RT8A 2HAUA 2F36A 2I4BA 1F9BA 2QSXA 1ZMGA 4F22A 3K6WA 4C1UA 1ZLQA 5IKBA 2VGQA 4YKKA 5CBRA 3D4CA 1DMBA 3S9LC 1LCFA 4BDNA 3K1MA 3IOUA 4G2ZA 1MPCA 4HW8A 4IGTA 4H1XA 1B3GA 3R26A 3KSXA 1B9JA 4TOZA 1MH3A 3OSQA 3RLFE 3MWBA 3EF7A 1PB7A 4I1DA 4MBPA 1XVYA 3RTWB 5K2XA 4MLVA 1B3LA 3DP6A 3HHGA 3TKDA 2XXPA 1IEJA 4ZEIA 2R71A 3O66A 2I4CA 2OZZA 3MVZA 2E0SA 3N5LA 2XX8A 5H8NB 5I59A 4YB5A 3S2VA 3TQWA 3TZAA 1NKXA 1OQGA 3FXUA 3QK6A 2OK2A 1SW5A 2RCAA 4KCCA 3IB2A 5AA2D 4FEDA 2P0SA 3K1NA 3Q26A 5DEXA 1M5DA 3MZ1A 4JXIA 2I58A 3IR1A 3SESA 4DE8A 5ELVA 3ILTB 4O3BA 4NEDA 2RC8A 4QFLA 3C9HA 3FUZA 2DSFA 1NMUA 1WODA 3K6VA 3UORA 1RKMA 4RA1A 4IO3A 5ICQA 1NNTA 4RY1A 3H6VA 1B2HA 4IGRA 1PBQA 3ILUB 3HO7A 1HSJA 2B3FA 3PPPA 3FXRA 4RXLA 3T22A 5KDTB 3PPOA 1MQJA 4DCXA 1Y4TA 5DVJA 2F7AA 4THIA 4I62A 4DIGA 2ESNA 2DVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTM A;  3MP6 A;  1O64 A;  1A8E A;  4GFR A;  5JTY B;  2HXW A;  3TEP A;  4KYE A;  2DWH A;  2R9J A;  3LUY A;  3PMW A;  2F6G A;  1I6B A;  1ZIU A;  3N94 A;  2REG A;  2DQV A;  2O68 A;  4L17 A;  1MG1 A;  3M3L A;  2HCA A;  1MQD A;  1N0T A;  2B3B A;  5ICT A;  2D3I A;  3HST A;  4NTL A;  4U1O A;  3O9P A;  3MVY A;  3PPR A;  3U8Q A;  5A5X A;  3O28 A;  3M3F A;  3QIM A;  5L8D A;  5FHN A;  4ESW A;  1PDA A;  2F35 A;  3FV1 A;  4G4P A;  3O97 A;  3PPN A;  3LC8 A;  2FYI A;  3E9X A;  3MPL A;  3LR1 A;  1CE2 A;  3CG1 A;  2F8D A;  3MPK A;  2V25 A;  2ALU A;  3CRB A;  3VVD A;  4GD5 A;  1B5H A;  3VFJ A;  5AA2 A;  1B58 A;  4K3F A;  4LZ5 A;  3JZJ A;  2F7C A;  2HZL A;  1Y4C A;  2GHB A;  3SEX A;  2VD3 A;  2GRV A;  3C31 A;  3E3K A;  1NNK A;  3IK6 B;  1FCK A;  5AE4 A;  3OO8 A;  4BDM A;  3PD8 A;  1BTJ A;  4LZ7 A;  3IAZ A;  1D9Y A;  5TP9 A;  1Z7M E;  4ZED A;  3V8X B;  2DOJ A;  5I59 B;  4U4X A;  1SYH A;  1IXC A;  3M8U A;  3K2D A;  1Y9U A;  3L6H A;  3R6U A;  4YB6 A;  2YPN A;  1Y1M A;  1QUI A;  3PUY E;  4DLD A;  4PET A;  2XD3 A;  1MXV A;  2QJE A;  1R1N A;  5K2Y A;  1O63 A;  3KZG A;  3K01 A;  4YU0 A;  4LA9 A;  3KGC A;  5DEX B;  3G7W A;  2DXY A;  4GWO A;  3TYH A;  1M5F A;  3G3F A;  5EHS A;  3SKP A;  3WAF A;  4ZDM A;  1AOV A;  3I3V A;  2QPQ A;  4NF5 A;  1LCT A;  3H6T A;  2OWT A;  4G8H A;  1B6H A;  4G8N A;  4HS7 A;  1HSL A;  1DPP A;  4IO2 A;  3KG2 A;  3TTN A;  4OZ9 A;  1POY 1;  5CMK A;  1B7Z A;  1MM7 A;  2UYF A;  1N76 A;  4GOT A;  4OQO A;  1EU8 A;  1XHY A;  3KSJ A;  1H44 A;  3BKI B;  3EHS A;  4R9G A;  3JV9 A;  4YZZ A;  2QS1 A;  4X9T A;  1DTG A;  3KFM A;  3OEL A;  4GVO A;  1WVJ A;  1AL3 A;  4HCY A;  5TPA B;  4XKP A;  5H8H A;  3H4Z A;  4F2O A;  4H65 A;  1MY3 A;  1IZ1 A;  4Q0C A;  5I2N A;  2UVJ A;  3OEN A;  1Y1Z A;  4H67 A;  4YKI A;  4ND9 A;  1MXW A;  4GF8 A;  3MUQ A;  1IXG A;  1P1O A;  1URG A;  3PU5 A;  3B6W A;  2DE3 A;  3WAE A;  4XKN A;  5A5X B;  4N13 A;  2XXU A;  1DPE A;  1TFA A;  3KN3 A;  3UA8 A;  4O3C A;  3MP1 A;  3U93 A;  3O6G A;  1FTM A;  1MRP A;  2PBW A;  4OFL A;  1NH7 A;  3QUJ A;  4F3P A;  3RUM A;  3K1P A;  1NL5 A;  3CFZ A;  1AMF A;  2THI A;  2XXV A;  5F1Q A;  2RIN A;  1LBB A;  4TLM B;  2NOO A;  2GFE A;  5DYH A;  1QKB A;  1SW4 A;  4G68 A;  2VD2 A;  4R6Y A;  2X26 A;  1TT1 A;  4FIM A;  4QFK A;  2Q89 A;  3SEU A;  3KOS A;  2E1S A;  1DTZ A;  5AA2 B;  5AA4 A;  1USY H;  4KD5 A;  3EHU A;  4NE4 A;  4OET A;  3U72 A;  1TWY A;  4OEN A;  2DE2 A;  2PX1 A;  2NVU B;  3Q29 A;  4RJZ A;  2XXW A;  3MQ9 A;  3MVW A;  1QKA A;  1URD A;  4OYV A;  4LQ2 A;  5FHO A;  3IOR A;  3GXA A;  4KI0 E;  1L5T A;  2VP1 A;  4JSD A;  3VVF A;  4E0W A;  1YAE A;  1LBC A;  1ZTY A;  1LGB C;  4O3A A;  2YLN A;  1IXH A;  3SEW A;  2UVH A;  5KCJ A;  3IOV A;  4QF9 A;  2OWS A;  5CRY A;  1OLC A;  4TQU Q;  2Q88 A;  3SDF A;  3FJG A;  3W9V A;  3LSW A;  2ZMB A;  4GXA A;  1MY4 A;  4OVJ A;  4NF5 B;  4F3S A;  3IOW A;  3TOD A;  4JWO A;  1A7L A;  5B7D A;  3GLB A;  2PVU A;  1B51 A;  3V5A A;  2O69 A;  2AIX A;  2HEU A;  1FQA A;  4PFT A;  4DZ1 A;  2A5T B;  1RYX A;  1EH3 A;  4JDF A;  3EN3 A;  4NWD A;  5I2K A;  1Y3Q A;  4OER A;  3JYR A;  4R2F A;  3TTL A;  2F7B A;  5M2V A;  3M3K A;  2XXY A;  2QS3 A;  5L9O A;  3DP4 A;  1LAX A;  1OIB A;  3OEM A;  1A40 A;  3E4R A;  2XXQ A;  4F2Q A;  4YB7 A;  5I2N B;  4IO4 A;  4R2B A;  3N6U A;  4P0G A;  3T9X B;  2O84 X;  3LSF B;  4WED A;  3T66 A;  4F19 A;  4MF3 A;  3B7D A;  3CFL A;  4ZS9 A;  4ZZE A;  2O6A A;  3LBS A;  5I58 A;  3T9V A;  2ZYN A;  2RCB A;  1UTH A;  3R7X A;  1ANF A;  2AL4 A;  2I3W A;  2ONS A;  3FIR A;  3ZKK A;  5EHM A;  1IIT A;  1MY2 A;  3RQT A;  3Q28 A;  3RN8 A;  1XC1 A;  4G68 C;  2OCU A;  2DWI A;  5I57 A;  1B05 A;  4JB7 A;  4PFW A;  5DT6 A;  2QMW A;  3FZV A;  3FVO A;  1O7T A;  3A09 A;  1BKA A;  3H6W A;  4G68 B;  4LZ8 A;  4LQ5 A;  5BWJ A;  4R6K A;  4ZE9 A;  3OOA A;  5JK4 A;  3HHF A;  1JQF A;  1WDN A;  3MW0 A;  3LSL A;  2XXT A;  4N6P A;  4H5F A;  4P0I A;  4XKQ A;  4ELO A;  2G29 A;  3IX1 A;  1LLS A;  4U1Z A;  1ZJL A;  4IY5 A;  2Q2C A;  2PT1 A;  3FAS A;  1H3D A;  3IJO B;  4KYS A;  3BFT A;  5ISU A;  4X48 A;  4F31 B;  1PB8 A;  3K00 A;  4RK9 A;  3IO4 A;  1QVS A;  4R73 A;  5KCJ B;  4UA8 A;  3K6X A;  1B4Z A;  5ITO A;  5AA1 A;  5H8Q A;  1Q35 A;  4LAT A;  4LUB A;  4NMY A;  3D4G A;  4G8M A;  1B40 A;  3I6V A;  2O1L A;  2KLF A;  1JET A;  4IO6 A;  2F6P A;  4OEV A;  1JW1 A;  2Q9T A;  3I5O A;  5I56 A;  4EF1 A;  2DYX A;  4KPT A;  3CG3 A;  1EZ9 A;  4RK2 A;  1IIW A;  4OES A;  4ELR A;  2I0C A;  4P11 A;  3USD A;  1Y3P A;  3TCH A;  3TEL A;  2QS2 A;  3C33 A;  3EPE A;  4ESX A;  3VXC A;  1MDQ A;  3UK4 A;  5TU0 A;  1OQH A;  5LOM A;  3O6I A;  4YMB A;  3EHT A;  1FTK A;  1NFT A;  1SYI A;  3A3U A;  3FVG A;  5DVF A;  4F1Y A;  2YJP A;  4F18 A;  4FEC A;  4PP0 A;  1SVX B;  1Y3N A;  4JWX A;  1LB9 A;  4NF8 A;  1D4N A;  3FV2 A;  1P99 A;  1UIU A;  1QUK A;  3TTR A;  1XS5 A;  1B46 A;  1XVX A;  3TQL A;  2REJ A;  3ZS6 A;  2I3V A;  4MLQ A;  1USY E;  1D3K A;  3RT6 B;  5CMC A;  3IO6 A;  3VVE A;  3G3G A;  1GTK A;  3RNN A;  1P1Q A;  3THI A;  3TDJ A;  2PMS A;  1Q1K A;  5I58 B;  1H45 A;  1UTH B;  4AB6 A;  3UN6 A;  3KN8 A;  1YCJ A;  1QJM A;  4KHZ E;  4RPN A;  4EF2 A;  3QXM A;  1VFD A;  4Z7E A;  1A54 A;  1VR5 A;  4POW A;  1B32 A;  5HBC A;  5FTI A;  2D21 A;  3U94 A;  1OLA A;  1A99 A;  3U1O A;  1BIY A;  4MFI A;  3VV5 A;  3CFX A;  1IUD A;  4WXJ A;  1UTB A;  2A5S A;  2LAO A;  2P2A A;  2Z8E A;  1B3H A;  4POX A;  1I69 A;  3G3I A;  3K0V A;  2DVC A;  2ZNT A;  4QSC A;  2OLB A;  3TTK A;  1QW0 A;  4PE5 B;  3PD9 A;  3HV1 A;  3QSL A;  3T93 B;  2F78 A;  2PYY A;  1PBP A;  4G77 A;  4LON B;  4BDL A;  4KQP A;  2VOZ A;  1FQB A;  4Z0I A;  3KJT A;  3KOT A;  4QSD A;  3QAX A;  4X1D A;  5H8Q B;  1URS A;  3S4U A;  3PMV A;  4DDD A;  1JVY A;  3OXN A;  4FOR A;  3MZB A;  4ZZA A;  5I56 B;  3KJ7 A;  2XD2 A;  2V84 A;  4NF4 A;  1DOT A;  2Y7K A;  4I9D A;  4UAC A;  3FJ7 A;  3OO7 A;  1H76 A;  4RYA A;  1B5J A;  4AB5 A;  4DXB A;  3KN7 A;  1FQE A;  2ZXT A;  2VHA A;  2Z23 A;  1GR2 A;  5HM4 B;  2ZYM A;  1PEB A;  1B1H A;  3C32 A;  1MXZ A;  3C36 A;  4H8I A;  3FVK A;  1HSE A;  1MXX A;  4ZEC A;  5FTH A;  2W7Y A;  2XXR A;  5BUU A;  3VE1 B;  1A55 A;  3MAM A;  5L9M A;  1JNF A;  1SI0 A;  4EXK A;  2DS9 A;  4BDR A;  3H3G A;  3GBA A;  4ZEF A;  2H5Y A;  1N7X A;  1P1N A;  4R74 A;  1BLF A;  2IA4 A;  3PUV E;  3PGF A;  1H43 A;  1NNF A;  4FEB A;  4EXL A;  4H6D A;  5TP9 B;  4F3G A;  4ELQ A;  3UP9 A;  4BDO A;  1JW5 A;  3O6H A;  5IAI A;  5CMM A;  1XOC A;  2UYE A;  2F5X A;  4U21 A;  4Q5T A;  3PUX E;  1UTB B;  4FAJ A;  2RC9 A;  5H8F A;  1US5 A;  2XHD A;  1MPB A;  3TCF A;  2OBG A;  3HN0 A;  2GHA A;  4LP2 B;  1N04 A;  4I8C A;  4KYD A;  3IJX B;  3W9W A;  1XT8 A;  2I0B A;  2HFB A;  3C34 A;  4C0R A;  4EDP A;  4HCW A;  1VFE A;  2QRY A;  3UGW A;  3C35 A;  1N3W A;  1JVX A;  5CI5 A;  2HZK A;  3KBR A;  2ZNS A;  1LFH A;  1UQW A;  5AA3 A;  1TFD A;  4R75 A;  1LAH E;  2P1S A;  4XXU A;  2G93 A;  1S50 A;  4XTC Q;  2Y7P A;  2Y84 A;  5H8S A;  4M1V A;  3CVG A;  1A8F A;  4RPO A;  4XIG Q;  1N84 A;  3DEL B;  5ITP A;  4GRK A;  4GIZ A;  3L6G A;  3Q27 A;  2FNC A;  3G3H A;  5H8H B;  3PUW E;  3MJN A;  4R72 A;  1D9V A;  2WKY A;  4NF4 B;  3PMX A;  2Y7W A;  3S9N C;  3MP8 A;  3K6U A;  1M5E A;  1FQC A;  3H6U A;  3OEK A;  3S9E A;  3UIF A;  3RGY A;  1MS7 A;  3C4M A;  3ZSF A;  3U92 A;  1B0H A;  5CBS A;  4ONY A;  3V83 A;  2QL3 A;  3TUS A;  2XXX A;  1EZP A;  3N6T A;  3ONM A;  2ABH A;  4N07 A;  1MXU A;  4BDQ A;  1FTO A;  2UXA A;  4H0W A;  5CC2 A;  3TPA A;  4LVQ A;  4OEU A;  1T0K A;  4JWY A;  2DXR A;  2O1M A;  3Q25 A;  4NF6 A;  4ELP A;  4GL0 A;  2Z8D A;  5AA4 B;  1I6Q A;  1FQF A;  4OXV A;  1P1U A;  4R6H A;  1CB6 A;  3O2A A;  2QS4 A;  4PFY A;  4IY6 A;  3SER A;  1OMP A;  4U2R A;  1IQ7 A;  3VLW A;  2RC7 A;  3ODB A;  5JEI A;  1MXY A;  2OJT A;  2RKM A;  1Y20 A;  4QHQ A;  1LAG E;  1RYO A;  3G3K A;  1I6A A;  2PT2 A;  4M4G A;  2BJJ X;  3PUZ E;  1SQY A;  2XX7 A;  1DSN A;  2DP8 A;  2O7U A;  1B7H A;  3HCQ A;  3OO9 A;  3OO6 A;  1R6Z A;  4GXS B;  2Q8J A;  1LB8 A;  4QSE A;  5F7V A;  3CSG A;  5H8F B;  1B52 A;  4F1V A;  4OMB A;  5DVI A;  5HPQ A;  4JSO A;  3LSX A;  1B7U A;  1AIV A;  2NXO A;  1QUL A;  2CZL A;  4WEP A;  4F39 A;  4NWC A;  3B6T A;  2X7P A;  3FGS A;  3RY3 A;  4PQJ A;  1SI1 A;  2IEE A;  5TPA A;  2V3Q A;  1MPD A;  3RPW A;  3SET A;  1GV8 A;  4H5G A;  3CSB A;  4ISU A;  2B65 A;  4MH5 A;  3ZKL A;  4U23 A;  5I2K B;  4EQB A;  3GBB A;  1B3E A;  3SEY A;  1Z7N E;  3O29 A;  4OWD A;  1N3X A;  4YIC A;  2X7Q A;  3RTF B;  3FXQ A;  3PV0 E;  1B3F A;  2F34 A;  3E13 X;  5EYF A;  4DXU A;  2QMX A;  2AYS A;  3VXB A;  4C1T A;  4E0X A;  1AH5 A;  1US4 A;  3MBP A;  2ZYO A;  4F1U A;  1QUJ A;  2H4I A;  4ZEK A;  4ZE8 A;  3HPI A;  1S7Y A;  5I84 A;  3KEI A;  2DWJ A;  4QFO A;  2Q2A A;  5I57 B;  4BLA A;  3K02 A;  4IO7 A;  3TAJ A;  3VLU A;  1VE4 A;  3SEV A;  3V89 B;  2Y7I A;  1LAF E;  5B70 A;  1LFI A;  4GLI A;  3IB1 A;  4NF6 B;  3IOT A;  3W15 C;  3TFL A;  2V3U A;  4Q8R A;  2DWA A;  3AXF A;  4EQ7 A;  1YPN A;  2HQ0 A;  3TCG A;  4DXC A;  4EQ9 A;  4F29 A;  2R6G E;  3A3C A;  3T9H B;  3IB0 A;  3FD3 A;  3QUF A;  2NWJ A;  1FQD A;  1II5 A;  2D5W A;  2I49 A;  3BFU A;  1NH8 A;  1M5C A;  1EZO A;  1B5I A;  3G3J A;  4IB2 A;  1GVC A;  4Q30 B;  1JW4 A;  2FA7 A;  5KZT A;  1MY0 A;  1OVB A;  3TMG A;  1MQI A;  3B6Q A;  2AL5 A;  4H8J A;  2XXI A;  2ANJ A;  1POT A;  3H03 A;  4JBZ A;  3K4U A;  2RF1 A;  2A5T A;  4AQ4 A;  1TXF A;  2ZNU A;  4OTE A;  1R9L A;  4GQO A;  2CMO A;  1LFG A;  1S9T A;  3T96 B;  1SD3 A;  1NNP A;  4YKJ A;  4TLL B;  3EQ1 A;  3IL1 B;  1JEU A;  2F97 A;  2UVG A;  3ECR A;  1P1W A;  4ECF A;  4EUO A;  4FJP A;  3S9M C;  4F3B A;  3OSR A;  4FE8 A;  1OVT A;  2H99 A;  1ELJ A;  3H06 B;  1SW2 A;  3CR9 A;  3BBR A;  1B1X A;  4KCD A;  2DE4 A;  4YMA A;  2GH9 A;  4KR5 A;  4NF8 B;  4GL8 A;  2I48 A;  2ONK E;  5DTB A;  4QRZ A;  4HTG A;  1GGG A;  2XXH A;  5H8N A;  1MM6 A;  1MY1 A;  2M8C A;  1J1N A;  3MVX A;  1R9Q A;  2HAV A;  1ZU0 A;  3PPQ A;  2O51 A;  4X1B A;  3DM0 A;  1MDP 1;  2NUV A;  3FJM A;  1BP5 A;  4QFN A;  1SDX A;  3VLV A;  5CMB A;  1ZKB A;  4FAT A;  1ZBM A;  5CM6 A;  3FAT A;  4RNS A;  1B4H A;  4IO5 A;  4KFQ A;  3QYT A;  3F11 A;  3CI8 A;  2H98 A;  3MC2 A;  1FW0 A;  4U22 A;  1PB9 A;  2I6E A;  5J1D A;  1PC3 A;  1LST A;  1KWH A;  5FHM A;  2Y7R A;  3P7I A;  3VDF A;  2H9B A;  3H7M A;  4DCY A;  3DP8 A;  4ZEB A;  4OFJ A;  4QFP A;  5KDT A;  1MH4 A;  1UIV A;  1SW1 A;  1N7W A;  4OHN A;  2Z8F A;  2H25 A;  4U4S A;  1YTV A;  4WKM A;  2V93 A;  4OFO A;  2UVI A;  3MZ9 A;  5JTY A;  1B0L A;  2V3T A;  3OMB A;  5L9S A;  1SBP A;  1M5B A;  2XX9 A;  3DLN A;  1FTJ A;  1FTL A;  2ZYK A;  1VSO A;  4YAH X;  3T9U A;  4XKR A;  3N26 A;  1IXI A;  1JEV A;  4R9F A;  3CIJ A;  1MQG A;  2O7I A;  2Z22 A;  3FVN A;  1MQH A;  3GZG A;  4YKP A;  1ATG A;  4PFU A;  2ONR A;  3OD7 A;  3RT8 A;  2HAU A;  2F36 A;  2I4B A;  1F9B A;  2QSX A;  1ZMG A;  4F22 A;  3K6W A;  4C1U A;  1ZLQ A;  5IKB A;  2VGQ A;  4YKK A;  5CBR A;  3D4C A;  1DMB A;  3S9L C;  1LCF A;  4BDN A;  3K1M A;  3IOU A;  4G2Z A;  1MPC A;  4HW8 A;  4IGT A;  4H1X A;  1B3G A;  3R26 A;  3KSX A;  1B9J A;  4TOZ A;  1MH3 A;  3OSQ A;  3RLF E;  3MWB A;  3EF7 A;  1PB7 A;  4I1D A;  4MBP A;  1XVY A;  3RTW B;  5K2X A;  4MLV A;  1B3L A;  3DP6 A;  3HHG A;  3TKD A;  2XXP A;  1IEJ A;  4ZEI A;  2R71 A;  3O66 A;  2I4C A;  2OZZ A;  3MVZ A;  2E0S A;  3N5L A;  2XX8 A;  5H8N B;  5I59 A;  4YB5 A;  3S2V A;  3TQW A;  3TZA A;  1NKX A;  1OQG A;  3FXU A;  3QK6 A;  2OK2 A;  1SW5 A;  2RCA A;  4KCC A;  3IB2 A;  5AA2 D;  4FED A;  2P0S A;  3K1N A;  3Q26 A;  5DEX A;  1M5D A;  3MZ1 A;  4JXI A;  2I58 A;  3IR1 A;  3SES A;  4DE8 A;  5ELV A;  3ILT B;  4O3B A;  4NED A;  2RC8 A;  4QFL A;  3C9H A;  3FUZ A;  2DSF A;  1NMU A;  1WOD A;  3K6V A;  3UOR A;  1RKM A;  4RA1 A;  4IO3 A;  5ICQ A;  1NNT A;  4RY1 A;  3H6V A;  1B2H A;  4IGR A;  1PBQ A;  3ILU B;  3HO7 A;  1HSJ A;  2B3F A;  3PPP A;  3FXR A;  4RXL A;  3T22 A;  5KDT B;  3PPO A;  1MQJ A;  4DCX A;  1Y4T A;  5DVJ A;  2F7A A;  4THI A;  4I62 A;  4DIG A;  2ESN A;  2DVZ A; 
#chains in the Genus database with same CATH topology
 3TTM A;  3MP6 A;  1O64 A;  1A8E A;  4GFR A;  5JTY B;  3LUZ A;  4JVI A;  2HXW A;  1BK4 A;  3TEP A;  4KYE A;  2DWH A;  2R9J A;  3LUY A;  3PMW A;  2F6G A;  1FBH A;  1I6B A;  1ZIU A;  3N94 A;  4X04 A;  2REG A;  2DQV A;  2O68 A;  4L17 A;  1MG1 A;  3M3L A;  2HCA A;  4GWY A;  4P1E A;  2VT5 A;  1MQD A;  1N0T A;  2B3B A;  5ICT A;  2D3I A;  3HST A;  4NTL A;  4N91 A;  3A29 A;  4U1O A;  3O9P A;  3MVY A;  4HE2 A;  3PPR A;  3U8Q A;  5A5X A;  3O28 A;  3M3F A;  2JJK A;  3QIM A;  5L8D A;  5FHN A;  4ESW A;  1PDA A;  2F35 A;  3FV1 A;  4G4P A;  3O97 A;  3PPN A;  3LC8 A;  2FYI A;  3HFU A;  3E9X A;  3MPL A;  3LR1 A;  1CE2 A;  3CG1 A;  2F8D A;  1YXI A;  5EQ7 A;  3MPK A;  2V25 A;  2ALU A;  1IMA A;  3CRB A;  3VVD A;  4GD5 A;  1B5H A;  3B8B A;  3VFJ A;  5AA2 A;  1B58 A;  2XWV A;  4K3F A;  4LZ5 A;  3JZJ A;  2F7C A;  2HZL A;  1Y4C A;  4P47 A;  2GHB A;  3SEX A;  4NHB A;  1RDY A;  2VD3 A;  2GRV A;  3C31 A;  3E3K A;  1NNK A;  3IK6 B;  1FCK A;  5AE4 A;  3OO8 A;  4BDM A;  3PD8 A;  1BTJ A;  4LZ7 A;  1LBX A;  3IAZ A;  4DI4 B;  1D9Y A;  5TP9 A;  1Z7M E;  1FPB A;  4ZED A;  3V8X B;  2DOJ A;  5I59 B;  4U4X A;  1SYH A;  1IXC A;  3M8U A;  3K2D A;  1Y9U A;  3L6H A;  3R6U A;  4YB6 A;  2YPN A;  1Y1M A;  1QUI A;  2QVU A;  3PUY E;  4DLD A;  4PET A;  2XD3 A;  1MXV A;  2QJE A;  1NI9 A;  1R1N A;  5K2Y A;  1O63 A;  3KZG A;  3K01 A;  4YU0 A;  4LA9 A;  3KGC A;  1FPD A;  5DEX B;  3G7W A;  2DXY A;  4GWO A;  3TYH A;  1M5F A;  3G3F A;  5EHS A;  3SKP A;  3WAF A;  4ZDM A;  1AOV A;  3I3V A;  2QPQ A;  4NF5 A;  2OWZ A;  1LCT A;  3H6T A;  2FVZ A;  2OWT A;  4G8H A;  1B6H A;  4G8N A;  4HS7 A;  1HSL A;  1DPP A;  4IO2 A;  4PAF A;  3KG2 A;  3TTN A;  4OZ9 A;  1POY 1;  5CMK A;  1FPL A;  1FBE A;  3ISP A;  1B7Z A;  1MM7 A;  2UYF A;  1YYZ A;  1N76 A;  4GOT A;  4OQO A;  1EU8 A;  1XHY A;  3KSJ A;  1H44 A;  2Y5K A;  3BKI B;  3EHS A;  2R8T A;  4R9G A;  3JV9 A;  4YZZ A;  5ET5 A;  1G0H A;  2QS1 A;  1FPE A;  1DTG A;  3KFM A;  4X9T A;  3OEL A;  2FIE A;  4GVO A;  1WVJ A;  1AL3 A;  4HCY A;  5TPA B;  4XKP A;  5H8H A;  3T0J A;  3H4Z A;  4PFI A;  4F2O A;  4H65 A;  1MY3 A;  1IZ1 A;  4Q0C A;  5I2N A;  2UVJ A;  3OEN A;  1Y1Z A;  4H67 A;  4YKI A;  4ND9 A;  1MXW A;  4GF8 A;  3MUQ A;  5F24 A;  1IXG A;  1P1O A;  1URG A;  3PU5 A;  3B6W A;  2DE3 A;  3WAE A;  4XKN A;  5A5X B;  4N13 A;  2XXU A;  1DPE A;  1TFA A;  3KN3 A;  3UA8 A;  4O3C A;  3MP1 A;  3U93 A;  3O6G A;  1FTM A;  4PAK A;  1MRP A;  2PBW A;  4OFL A;  4X8R A;  1NH7 A;  3QUJ A;  4F3P A;  3RUM A;  3K1P A;  1NL5 A;  3CFZ A;  1AMF A;  5EYH A;  2THI A;  2XXV A;  5F1Q A;  2RIN A;  1LBB A;  1Q9D A;  2QVV A;  4TLM B;  1INP A;  2NOO A;  2GFE A;  5DYH A;  1QKB A;  1SW4 A;  4G68 A;  2VD2 A;  4R6Y A;  2X26 A;  1TT1 A;  4FIM A;  4QFK A;  4PDH A;  2Q89 A;  2FHY A;  3SEU A;  3KOS A;  2E1S A;  1DTZ A;  5AA2 B;  5AA4 A;  1USY H;  4KD5 A;  2XWK A;  3EHU A;  4NE4 A;  4OET A;  3U72 A;  1TWY A;  2WYK A;  4OEN A;  2DE2 A;  2PX1 A;  2NVU B;  3Q29 A;  4RJZ A;  2XXW A;  3MQ9 A;  3KC1 A;  1QKA A;  3MVW A;  1URD A;  4OYV A;  4AS5 A;  4NGU A;  4LQ2 A;  3SZP A;  5FHO A;  3IOR A;  3GXA A;  4KI0 E;  1L5T A;  1NV3 A;  2VP1 A;  4JSD A;  3VVF A;  4E0W A;  1YAE A;  1LBC A;  1ZTY A;  1LGB C;  4O3A A;  2YLN A;  2BJI A;  1IXH A;  3SEW A;  2UVH A;  5KCJ A;  3IOV A;  4QF9 A;  2OWS A;  5CRY A;  1OLC A;  4TQU Q;  1CNQ A;  2Q88 A;  3SDF A;  3FJG A;  3QMF A;  3W9V A;  3LSW A;  1LBW A;  2ZMB A;  4GX3 A;  4GXA A;  1MY4 A;  4OVJ A;  4NF5 B;  3RYD A;  4F3S A;  3IOW A;  3TOD A;  2V4C A;  4JWO A;  1A7L A;  5B7D A;  3GLB A;  2PVU A;  1B51 A;  3V5A A;  2O69 A;  4N6K A;  2AIX A;  2HEU A;  5I7I A;  4N8G A;  1FQA A;  4PFT A;  4PBH A;  1RDX A;  3CHG A;  4DZ1 A;  2A5T B;  4N17 A;  1RYX A;  1EH3 A;  4JDF A;  3EN3 A;  4NWD A;  5I2K A;  1Y3Q A;  4OER A;  3JYR A;  4R2F A;  3TTL A;  2F7B A;  5M2V A;  5IGA A;  3M3K A;  4HXV A;  2XXY A;  2QS3 A;  5L9O A;  3DP4 A;  1LAX A;  1OIB A;  3OEM A;  1A40 A;  3E4R A;  2XXQ A;  4F2Q A;  3GYY A;  3MST A;  4YB7 A;  5I2N B;  4IO4 A;  4R2B A;  3N6U A;  4P0G A;  3ROJ A;  3T9X B;  2O84 X;  3LSF B;  4P3L A;  4WED A;  3T66 A;  4F19 A;  4MF3 A;  3B7D A;  3CFL A;  4ZS9 A;  4ZZE A;  2O6A A;  3LBS A;  5I58 A;  1RDZ A;  3T9V A;  2ZYN A;  3EKI A;  2RCB A;  1UTH A;  3R7X A;  1ANF A;  2AL4 A;  2I3W A;  2ONS A;  3FIR A;  3ZKK A;  5EHM A;  1IIT A;  4G61 A;  1MY2 A;  3RQT A;  3Q28 A;  3RN8 A;  4PFB A;  1K9Z A;  1XC1 A;  4I3E A;  4G68 C;  2OCU A;  2DWI A;  5I57 A;  1B05 A;  4JB7 A;  4PFW A;  5DT6 A;  2QMW A;  3FZV A;  3FVO A;  1O7T A;  4NX1 A;  3A09 A;  1BKA A;  4NF0 A;  3H6W A;  4G68 B;  4LZ8 A;  4LQ5 A;  1FBD A;  5BWJ A;  4OVP A;  4MCO A;  4R6K A;  4ZE9 A;  3OOA A;  5JK4 A;  3HHF A;  1JQF A;  1WDN A;  3MW0 A;  3LSL A;  2XXT A;  4N6P A;  4H5F A;  4P0I A;  4XKQ A;  4ELO A;  2G29 A;  3IX1 A;  1LLS A;  4QBA A;  4U1Z A;  1ZJL A;  4IY5 A;  2Q2C A;  2PT1 A;  3FAS A;  1H3D A;  3IJO B;  4KYS A;  3BFT A;  5ISU A;  4X48 A;  4F31 B;  1PB8 A;  3K00 A;  4RK9 A;  3IO4 A;  1QVS A;  4P1L A;  4R73 A;  5KCJ B;  4UA8 A;  3K6X A;  1B4Z A;  5ITO A;  5AA1 A;  5H8Q A;  1Q35 A;  4LAT A;  4LUB A;  4NMY A;  3D4G A;  4G8M A;  1B40 A;  3I6V A;  2O1L A;  4LN5 A;  2KLF A;  1JET A;  4IO6 A;  2F6P A;  4OEV A;  1JW1 A;  2Q9T A;  3I5O A;  5I56 A;  4EF1 A;  2DYX A;  4KPT A;  3CG3 A;  1EZ9 A;  4RK2 A;  1IIW A;  4OES A;  4ELR A;  2I0C A;  4P11 A;  2PFZ A;  1FBG A;  3USD A;  1Y3P A;  2QVR A;  3TCH A;  3TEL A;  2QS2 A;  3C33 A;  3EPE A;  4ESX A;  5EYG A;  3VXC A;  1MDQ A;  3E78 A;  3UK4 A;  5TU0 A;  1OQH A;  5LOM A;  3O6I A;  4YMB A;  3EHT A;  1FTK A;  1NFT A;  1SYI A;  4P8B A;  3A3U A;  2OX3 A;  2L5V A;  3FVG A;  5DVF A;  4F1Y A;  2YJP A;  4F18 A;  4FEC A;  4PP0 A;  1SVX B;  4JWX A;  1Y3N A;  3B50 A;  1LB9 A;  4NF8 A;  1D4N A;  3FV2 A;  1P99 A;  1UIU A;  1QUK A;  1XS5 A;  3TTR A;  1B46 A;  1XVX A;  3TQL A;  2REJ A;  3ZS6 A;  2I3V A;  4MLQ A;  1USY E;  1D3K A;  3RT6 B;  5CMC A;  5LDZ A;  3IO6 A;  3VVE A;  3G3G A;  1GTK A;  3RNN A;  1D9Q A;  1P1Q A;  1NV7 A;  3THI A;  3IFC A;  3TDJ A;  2PMS A;  1Q1K A;  4MJO A;  5EQ8 A;  1FBF A;  5I58 B;  1H45 A;  1UTH B;  4AB6 A;  3UN6 A;  3KN8 A;  1YCJ A;  1QJM A;  4KHZ E;  4RPN A;  4EF2 A;  1NV2 A;  2Q8M A;  3QXM A;  1VFD A;  4Z7E A;  1A54 A;  1VR5 A;  4POW A;  1B32 A;  5HBC A;  5FTI A;  2D21 A;  3U94 A;  1OLA A;  4PTK A;  1A99 A;  3U1O A;  1BIY A;  4MFI A;  3VV5 A;  4MX6 A;  3CFX A;  4OA4 A;  1IUD A;  4WXJ A;  1NV5 A;  1UTB A;  2A5S A;  2LAO A;  4HE1 A;  2P2A A;  4PF6 A;  2ZZW A;  4HE0 A;  2Z8E A;  1B3H A;  4N81 A;  4POX A;  1I69 A;  3G3I A;  3K0V A;  2DVC A;  2ZNT A;  4QSC A;  4MHF A;  2OLB A;  1K9Y A;  3TTK A;  1QW0 A;  1NUX A;  4PE5 B;  3PD9 A;  3HV1 A;  3QSL A;  3T93 B;  2F78 A;  2PYY A;  1PBP A;  4G77 A;  4H46 A;  4XFE A;  4LON B;  4MNI A;  4BDL A;  4KQP A;  2VOZ A;  1FQB A;  4Z0I A;  3KJT A;  4AS4 A;  3KOT A;  4QSD A;  4GWU A;  4OVS A;  4PBQ A;  3QAX A;  4X1D A;  5H8Q B;  1URS A;  3S4U A;  1IME A;  3PMV A;  4DDD A;  1JVY A;  1XI6 A;  1AWB A;  3OXN A;  4FOR A;  5DW8 A;  3MZB A;  4ZZA A;  5I56 B;  3KJ7 A;  2XD2 A;  2V84 A;  4GBV A;  4NF4 A;  1DOT A;  2Y7K A;  4I9D A;  1EYK A;  4UAC A;  3FJ7 A;  2B4L A;  4MIJ A;  3OO7 A;  1H76 A;  4RYA A;  1B5J A;  4AB5 A;  4NAP A;  4DXB A;  3KN7 A;  2Q74 A;  1FQE A;  4NQ8 A;  2ZXT A;  2VHA A;  2Z23 A;  1DK4 A;  1GR2 A;  5HM4 B;  2ZYM A;  5ET8 A;  5IZ1 A;  1PEB A;  1B1H A;  3C32 A;  1MXZ A;  3C36 A;  4H8I A;  3FVK A;  1HSE A;  1MXX A;  4ZEC A;  5FTH A;  1FRP A;  2W7Y A;  2XXR A;  3FBP A;  5BUU A;  3VE1 B;  1A55 A;  4GBW A;  3MAM A;  5L9M A;  1JNF A;  1SI0 A;  4EXK A;  2P3N A;  2DS9 A;  4BDR A;  3H3G A;  3GBA A;  2PCR A;  4ZEF A;  2H5Y A;  1N7X A;  1P1N A;  5ET6 A;  4R74 A;  1BLF A;  2IA4 A;  3PUV E;  3PGF A;  1H43 A;  1NNF A;  4FEB A;  4EXL A;  4H6D A;  5TP9 B;  4F3G A;  4ELQ A;  3UP9 A;  4BDO A;  1JW5 A;  3O6H A;  5IAI A;  5CMM A;  4PC9 A;  4GX6 A;  2HPG A;  1XOC A;  2UYE A;  2F5X A;  4U21 A;  4Q5T A;  3PUX E;  1UTB B;  4FAJ A;  2RC9 A;  5A5L A;  1US5 A;  2XHD A;  5H8F A;  1MPB A;  3TCF A;  1IMB A;  2OBG A;  3NOH A;  3HN0 A;  2GHA A;  4LP2 B;  1N04 A;  4I8C A;  4KYD A;  4OVQ A;  3IJX B;  3W9W A;  1XT8 A;  2I0B A;  2HFB A;  3C34 A;  4C0R A;  4EDP A;  4HCW A;  1VFE A;  2QRY A;  3UGW A;  3C35 A;  1N3W A;  1JVX A;  5CI5 A;  2HZK A;  3KBR A;  2ZNS A;  1LFH A;  1JP4 A;  1UQW A;  5AA3 A;  1TFD A;  3BIH A;  4PDD A;  4R75 A;  1LAH E;  2P1S A;  4XXU A;  2G93 A;  1S50 A;  4MNP A;  4XTC Q;  2Y7P A;  2Y84 A;  5H8S A;  4M1V A;  3CVG A;  1A8F A;  4RPO A;  4XIG Q;  1N84 A;  3DEL B;  2GQ1 A;  5ITP A;  4GRK A;  5ET7 A;  4GIZ A;  3L6G A;  3Q27 A;  2FNC A;  3G3H A;  5H8H B;  3PUW E;  3MJN A;  4R72 A;  1D9V A;  3KBZ A;  2WKY A;  2CZI A;  4NF4 B;  3PMX A;  2Y7W A;  3S9N C;  3MP8 A;  3K6U A;  1M5E A;  1FQC A;  3H6U A;  3OEK A;  3S9E A;  3UIF A;  3RGY A;  1MS7 A;  5I5P A;  2WEF A;  3C4M A;  3ZSF A;  1LBV A;  4N8Y A;  3U92 A;  1B0H A;  5CBS A;  4ONY A;  1FPF A;  3V83 A;  2KQZ A;  2QL3 A;  2XWO A;  3TUS A;  4H45 A;  2XXX A;  1EZP A;  4OVT A;  2P3V A;  3N6T A;  3ONM A;  2ABH A;  4GWW A;  4N07 A;  1MXU A;  4BDQ A;  1FTO A;  2UXA A;  1NV0 A;  4H0W A;  2XXK A;  3TPA A;  5CC2 A;  4LVQ A;  4OEU A;  1IMD A;  1T0K A;  4JWY A;  2DXR A;  2O1M A;  3Q25 A;  4NF6 A;  4ELP A;  1NUW A;  4GL0 A;  2Z8D A;  4DI3 D;  5AA4 B;  1I6Q A;  1FQF A;  4OXV A;  1P1U A;  4R6H A;  1CB6 A;  3O2A A;  5IZ3 A;  2QS4 A;  4PFY A;  4IY6 A;  3SER A;  5EQA A;  1OMP A;  4U2R A;  1IQ7 A;  3VLW A;  2RC7 A;  3ODB A;  5JEI A;  1MXY A;  2OJT A;  2RKM A;  1Y20 A;  3IFA A;  4QHQ A;  1LAG E;  1RYO A;  3G3K A;  1I6A A;  2PT2 A;  4M4G A;  2BJJ X;  3D1R A;  3PUZ E;  1SQY A;  2ZZV A;  2XX7 A;  1DSN A;  2DP8 A;  2O7U A;  1B7H A;  3HCQ A;  3OO9 A;  3OO6 A;  1FPG A;  1R6Z A;  4GXS B;  4GWS A;  2QFL A;  2Q8J A;  1FPJ A;  4NG7 A;  1LB8 A;  4QSE A;  5F7V A;  3CSG A;  5H8F B;  1NV1 A;  1B52 A;  4MEV A;  4P56 A;  4F1V A;  4OMB A;  5DVI A;  5HPQ A;  4JSO A;  3LSX A;  4PFR A;  1B7U A;  1AIV A;  2NXO A;  2WX9 A;  1FJ6 A;  1QUL A;  2CZL A;  4WEP A;  4F39 A;  4NWC A;  3B6T A;  2XWI A;  2X7P A;  3FGS A;  3RY3 A;  4PQJ A;  1SI1 A;  2IEE A;  5TPA A;  2V3Q A;  4GWZ A;  1MPD A;  3RPW A;  3SET A;  1GV8 A;  4H5G A;  4I40 A;  2HHM A;  3CSB A;  4ISU A;  2B65 A;  4MMP A;  4MH5 A;  2CEY A;  3ZKL A;  4U23 A;  5I2K B;  4EQB A;  3GBB A;  1SPI A;  1B3E A;  3SEY A;  1Z7N E;  3O29 A;  4OWD A;  1N3X A;  4YIC A;  2X7Q A;  4OAN A;  3RTF B;  3FXQ A;  3PV0 E;  1B3F A;  2F34 A;  4I3Y A;  1DBZ A;  3E13 X;  5EYF A;  4DXU A;  2QMX A;  2AYS A;  5T3J A;  3VXB A;  1QGX A;  1FPI A;  4C1T A;  4E0X A;  1AH5 A;  1US4 A;  4O7I A;  3MBP A;  2ZYO A;  4F1U A;  1QUJ A;  1NUY A;  2H4I A;  1IMC A;  4ZEK A;  4ZE8 A;  3HPI A;  1S7Y A;  5ESY A;  3RPL A;  4MNC A;  5I84 A;  3KEI A;  2DWJ A;  1DCU A;  4GWX A;  4QFO A;  2Q2A A;  5I57 B;  4BLA A;  3K02 A;  4IO7 A;  3TAJ A;  1FBP A;  3VLU A;  3MYU A;  1VE4 A;  3SEV A;  3V89 B;  2Y7I A;  1LAF E;  5B70 A;  1LFI A;  4GLI A;  3IB1 A;  4NF6 B;  5IM2 A;  3IOT A;  1KZ8 A;  3W15 C;  3TFL A;  2V3U A;  4Q8R A;  2DWA A;  3AXF A;  4EQ7 A;  4PCD A;  1YPN A;  2HQ0 A;  3TCG A;  4DXC A;  5IZ3 B;  4EQ9 A;  4F29 A;  2FIX A;  1LBY A;  1NV6 A;  4PE3 A;  2R6G E;  3A3C A;  3T9H B;  3LV0 A;  3IB0 A;  3FD3 A;  3QUF A;  2NWJ A;  1FQD A;  1II5 A;  2D5W A;  5EQ9 A;  4GX4 A;  2I49 A;  3BFU A;  1NH8 A;  1M5C A;  1EZO A;  1B5I A;  3G3J A;  4IB2 A;  4PGP A;  1GVC A;  4Q30 B;  1JW4 A;  2FA7 A;  4N6D A;  1NV4 A;  5KZT A;  1MY0 A;  1OVB A;  3TMG A;  1MQI A;  3B6Q A;  2AL5 A;  4H8J A;  2XXI A;  2ANJ A;  1POT A;  3H03 A;  4JBZ A;  3K4U A;  2F3B A;  2RF1 A;  4IR8 A;  2A5T A;  4AQ4 A;  1TXF A;  2ZNU A;  4OTE A;  4P9K A;  1R9L A;  2PFY A;  4GQO A;  2CMO A;  1LFG A;  1S9T A;  3T96 B;  1SD3 A;  1NNP A;  4YKJ A;  4TLL B;  3EQ1 A;  3IL1 B;  1JEU A;  2F97 A;  2UVG A;  3ECR A;  1P1W A;  4ECF A;  4EUO A;  4FJP A;  3S9M C;  4F3B A;  3OSR A;  4PF8 A;  4FE8 A;  1OVT A;  2H99 A;  1ELJ A;  3H06 B;  1SW2 A;  2CZK A;  3CR9 A;  3BBR A;  5IZZ A;  1B1X A;  1LBZ A;  4KCD A;  2DE4 A;  4YMA A;  2GH9 A;  4KR5 A;  2WBD A;  4NF8 B;  4GL8 A;  2I48 A;  4XF5 A;  1VDW A;  2ONK E;  5DTB A;  2DDK A;  4QRZ A;  4HTG A;  1GGG A;  4MAG A;  2XXH A;  5H8N A;  1MM6 A;  1MY1 A;  2M8C A;  1J1N A;  3MVX A;  1R9Q A;  2HAV A;  1ZU0 A;  3PPQ A;  2O51 A;  4OVR A;  4X1B A;  3DM0 A;  1MDP 1;  2NUV A;  3FJM A;  1NUZ A;  2F3D A;  2VPO A;  1BP5 A;  4QFN A;  1SDX A;  3VLV A;  5CMB A;  3RPL B;  1ZKB A;  4FAT A;  1FJ9 A;  1ZBM A;  5CM6 A;  3FAT A;  4RNS A;  1B4H A;  5LTC A;  4IO5 A;  4KFQ A;  3FXB A;  3F11 A;  3QYT A;  3CI8 A;  2H98 A;  3MC2 A;  2ZZX A;  4UAB A;  4JVD A;  1FW0 A;  4U22 A;  1PB9 A;  2I6E A;  5J1D A;  1PC3 A;  1LST A;  1KWH A;  5FHM A;  2Y7R A;  3P7I A;  3VDF A;  2H9B A;  3H7M A;  4DCY A;  3DP8 A;  1FTA A;  4ZEB A;  4OFJ A;  4QFP A;  5KDT A;  1MH4 A;  1UIV A;  1SW1 A;  4OHN A;  1N7W A;  4O94 A;  2WBB A;  2Z8F A;  4PGN A;  2H25 A;  4U4S A;  1IMF A;  1YTV A;  4WKM A;  2V93 A;  2WYP A;  4OFO A;  2UVI A;  3MZ9 A;  3U65 A;  5JTY A;  1B0L A;  2CEX A;  2V3T A;  3OMB A;  5L9S A;  1SBP A;  1M5B A;  2XX9 A;  3BIG A;  3DLN A;  1FTJ A;  1FTL A;  2ZYK A;  1VSO A;  4YAH X;  3T9U A;  4XKR A;  3N26 A;  1IXI A;  1JEV A;  4R9F A;  3CIJ A;  1MQG A;  2O7I A;  2Z22 A;  2FBP A;  3FVN A;  1MQH A;  3GZG A;  4YKP A;  1ATG A;  4PFU A;  1FSA A;  4O7M A;  2ONR A;  3E79 A;  3OD7 A;  3RT8 A;  2HAU A;  2F36 A;  2I4B A;  1F9B A;  2QSX A;  1ZMG A;  4F22 A;  3K6W A;  4C1U A;  1ZLQ A;  5IKB A;  2VGQ A;  4YKK A;  5CBR A;  3D4C A;  1DMB A;  1LEV A;  3S9L C;  1LCF A;  4BDN A;  3K1M A;  3IOU A;  4G2Z A;  4O8M A;  2KR0 A;  1MPC A;  4HW8 A;  4IGT A;  4H1X A;  2HXR A;  1B3G A;  3R26 A;  3KSX A;  1B9J A;  4TOZ A;  1MH3 A;  1KA1 A;  3OSQ A;  4XEQ A;  4N15 A;  3T1B A;  3PTY A;  3RLF E;  3MWB A;  4QXD A;  3EF7 A;  1PB7 A;  1KA0 A;  2B4M A;  4I1D A;  4MBP A;  1XVY A;  3RTW B;  5K2X A;  4MLV A;  5FBP A;  4FBP A;  1EYJ A;  1B3L A;  3DP6 A;  3HHG A;  4KXP A;  3TKD A;  2XXP A;  1IEJ A;  4ZEI A;  2R71 A;  3O66 A;  1G0I A;  4NN3 A;  2I4C A;  1YZ0 A;  2OZZ A;  2VPN A;  3MVZ A;  4N4U A;  2E0S A;  3N5L A;  2XX8 A;  5I3S A;  5H8N B;  2CZH A;  5I59 A;  4YB5 A;  3S2V A;  3TQW A;  1FPK A;  3TZA A;  1NKX A;  1OQG A;  3KC0 A;  3FXU A;  3QK6 A;  2OK2 A;  1SW5 A;  2RCA A;  4KCC A;  3IB2 A;  5AA2 D;  4FED A;  2P0S A;  3K1N A;  3Q26 A;  5DEX A;  1M5D A;  3MZ1 A;  4JXI A;  2XA5 A;  2I58 A;  3IR1 A;  3SES A;  4DE8 A;  5ELV A;  3ILT B;  4O3B A;  4NED A;  2RC8 A;  4QFL A;  3C9H A;  3FUZ A;  2DSF A;  1NMU A;  5J16 A;  1WOD A;  3K6V A;  3UOR A;  1RKM A;  4RA1 A;  4PAI A;  4IO3 A;  5ICQ A;  4JVC A;  1NNT A;  4RY1 A;  3H6V A;  2MKZ A;  1B2H A;  4IGR A;  1PBQ A;  3ILU B;  3HO7 A;  1HSJ A;  2B3F A;  1FBC A;  2Y5L A;  3PPP A;  3FXR A;  4RXL A;  3T22 A;  5KDT B;  3PPO A;  1MQJ A;  4DCX A;  1Y4T A;  5DVJ A;  2F7A A;  4THI A;  1EYI A;  4I62 A;  4DIG A;  2ESN A;  2DVZ A; 
#chains in the Genus database with same CATH homology
 3TTM A;  3MP6 A;  1O64 A;  1A8E A;  4GFR A;  5JTY B;  2HXW A;  3TEP A;  4KYE A;  2DWH A;  2R9J A;  3LUY A;  3PMW A;  2F6G A;  1I6B A;  1ZIU A;  3N94 A;  2REG A;  2DQV A;  2O68 A;  4L17 A;  1MG1 A;  3M3L A;  2HCA A;  1MQD A;  1N0T A;  2B3B A;  5ICT A;  2D3I A;  3HST A;  4NTL A;  4U1O A;  3O9P A;  3MVY A;  3PPR A;  3U8Q A;  5A5X A;  3O28 A;  3M3F A;  3QIM A;  5L8D A;  5FHN A;  4ESW A;  1PDA A;  2F35 A;  3FV1 A;  4G4P A;  3O97 A;  3PPN A;  3LC8 A;  2FYI A;  3E9X A;  3MPL A;  3LR1 A;  1CE2 A;  3CG1 A;  2F8D A;  3MPK A;  2V25 A;  2ALU A;  3CRB A;  3VVD A;  4GD5 A;  1B5H A;  3VFJ A;  5AA2 A;  1B58 A;  4K3F A;  4LZ5 A;  3JZJ A;  2F7C A;  2HZL A;  1Y4C A;  2GHB A;  3SEX A;  2VD3 A;  2GRV A;  3C31 A;  3E3K A;  1NNK A;  3IK6 B;  1FCK A;  5AE4 A;  3OO8 A;  4BDM A;  3PD8 A;  1BTJ A;  4LZ7 A;  3IAZ A;  1D9Y A;  5TP9 A;  1Z7M E;  4ZED A;  3V8X B;  2DOJ A;  5I59 B;  4U4X A;  1SYH A;  1IXC A;  3M8U A;  3K2D A;  1Y9U A;  3L6H A;  3R6U A;  4YB6 A;  2YPN A;  1Y1M A;  1QUI A;  3PUY E;  4DLD A;  4PET A;  2XD3 A;  1MXV A;  2QJE A;  1R1N A;  5K2Y A;  1O63 A;  3KZG A;  3K01 A;  4YU0 A;  4LA9 A;  3KGC A;  5DEX B;  3G7W A;  2DXY A;  4GWO A;  3TYH A;  1M5F A;  3G3F A;  5EHS A;  3SKP A;  3WAF A;  4ZDM A;  1AOV A;  3I3V A;  2QPQ A;  4NF5 A;  1LCT A;  3H6T A;  2OWT A;  4G8H A;  1B6H A;  4G8N A;  4HS7 A;  1HSL A;  1DPP A;  4IO2 A;  3KG2 A;  3TTN A;  4OZ9 A;  1POY 1;  5CMK A;  1B7Z A;  1MM7 A;  2UYF A;  1N76 A;  4GOT A;  4OQO A;  1EU8 A;  1XHY A;  3KSJ A;  1H44 A;  3BKI B;  3EHS A;  4R9G A;  3JV9 A;  4YZZ A;  2QS1 A;  4X9T A;  1DTG A;  3KFM A;  3OEL A;  4GVO A;  1WVJ A;  1AL3 A;  4HCY A;  5TPA B;  4XKP A;  5H8H A;  3H4Z A;  4F2O A;  4H65 A;  1MY3 A;  1IZ1 A;  4Q0C A;  5I2N A;  2UVJ A;  3OEN A;  1Y1Z A;  4H67 A;  4YKI A;  4ND9 A;  1MXW A;  4GF8 A;  3MUQ A;  1IXG A;  1P1O A;  1URG A;  3PU5 A;  3B6W A;  2DE3 A;  3WAE A;  4XKN A;  5A5X B;  4N13 A;  2XXU A;  1DPE A;  1TFA A;  3KN3 A;  3UA8 A;  4O3C A;  3MP1 A;  3U93 A;  3O6G A;  1FTM A;  1MRP A;  2PBW A;  4OFL A;  1NH7 A;  3QUJ A;  4F3P A;  3RUM A;  3K1P A;  1NL5 A;  3CFZ A;  1AMF A;  2THI A;  2XXV A;  5F1Q A;  2RIN A;  1LBB A;  4TLM B;  2NOO A;  2GFE A;  5DYH A;  1QKB A;  1SW4 A;  4G68 A;  2VD2 A;  4R6Y A;  2X26 A;  1TT1 A;  4FIM A;  4QFK A;  2Q89 A;  3SEU A;  3KOS A;  2E1S A;  1DTZ A;  5AA2 B;  5AA4 A;  1USY H;  4KD5 A;  3EHU A;  4NE4 A;  4OET A;  3U72 A;  1TWY A;  4OEN A;  2DE2 A;  2PX1 A;  2NVU B;  3Q29 A;  4RJZ A;  2XXW A;  3MQ9 A;  3MVW A;  1QKA A;  1URD A;  4OYV A;  4LQ2 A;  5FHO A;  3IOR A;  3GXA A;  4KI0 E;  1L5T A;  2VP1 A;  4JSD A;  3VVF A;  4E0W A;  1YAE A;  1LBC A;  1ZTY A;  1LGB C;  4O3A A;  2YLN A;  1IXH A;  3SEW A;  2UVH A;  5KCJ A;  3IOV A;  4QF9 A;  2OWS A;  5CRY A;  1OLC A;  4TQU Q;  2Q88 A;  3SDF A;  3FJG A;  3W9V A;  3LSW A;  2ZMB A;  4GXA A;  1MY4 A;  4OVJ A;  4NF5 B;  4F3S A;  3IOW A;  3TOD A;  4JWO A;  1A7L A;  5B7D A;  3GLB A;  2PVU A;  1B51 A;  3V5A A;  2O69 A;  2AIX A;  2HEU A;  1FQA A;  4PFT A;  4DZ1 A;  2A5T B;  1RYX A;  1EH3 A;  4JDF A;  3EN3 A;  4NWD A;  5I2K A;  1Y3Q A;  4OER A;  3JYR A;  4R2F A;  3TTL A;  2F7B A;  5M2V A;  3M3K A;  2XXY A;  2QS3 A;  5L9O A;  3DP4 A;  1LAX A;  1OIB A;  3OEM A;  1A40 A;  3E4R A;  2XXQ A;  4F2Q A;  4YB7 A;  5I2N B;  4IO4 A;  4R2B A;  3N6U A;  4P0G A;  3T9X B;  2O84 X;  3LSF B;  4WED A;  3T66 A;  4F19 A;  4MF3 A;  3B7D A;  3CFL A;  4ZS9 A;  4ZZE A;  2O6A A;  3LBS A;  5I58 A;  3T9V A;  2ZYN A;  2RCB A;  1UTH A;  3R7X A;  1ANF A;  2AL4 A;  2I3W A;  2ONS A;  3FIR A;  3ZKK A;  5EHM A;  1IIT A;  1MY2 A;  3RQT A;  3Q28 A;  3RN8 A;  1XC1 A;  4G68 C;  2OCU A;  2DWI A;  5I57 A;  1B05 A;  4JB7 A;  4PFW A;  5DT6 A;  2QMW A;  3FZV A;  3FVO A;  1O7T A;  3A09 A;  1BKA A;  3H6W A;  4G68 B;  4LZ8 A;  4LQ5 A;  5BWJ A;  4R6K A;  4ZE9 A;  3OOA A;  5JK4 A;  3HHF A;  1JQF A;  1WDN A;  3MW0 A;  3LSL A;  2XXT A;  4N6P A;  4H5F A;  4P0I A;  4XKQ A;  4ELO A;  2G29 A;  3IX1 A;  1LLS A;  4U1Z A;  1ZJL A;  4IY5 A;  2Q2C A;  2PT1 A;  3FAS A;  1H3D A;  3IJO B;  4KYS A;  3BFT A;  5ISU A;  4X48 A;  4F31 B;  1PB8 A;  3K00 A;  4RK9 A;  3IO4 A;  1QVS A;  4R73 A;  5KCJ B;  4UA8 A;  3K6X A;  1B4Z A;  5ITO A;  5AA1 A;  5H8Q A;  1Q35 A;  4LAT A;  4LUB A;  4NMY A;  3D4G A;  4G8M A;  1B40 A;  3I6V A;  2O1L A;  2KLF A;  1JET A;  4IO6 A;  2F6P A;  4OEV A;  1JW1 A;  2Q9T A;  3I5O A;  5I56 A;  4EF1 A;  2DYX A;  4KPT A;  3CG3 A;  1EZ9 A;  4RK2 A;  1IIW A;  4OES A;  4ELR A;  2I0C A;  4P11 A;  3USD A;  1Y3P A;  3TCH A;  3TEL A;  2QS2 A;  3C33 A;  3EPE A;  4ESX A;  3VXC A;  1MDQ A;  3UK4 A;  5TU0 A;  1OQH A;  5LOM A;  3O6I A;  4YMB A;  3EHT A;  1FTK A;  1NFT A;  1SYI A;  3A3U A;  3FVG A;  5DVF A;  4F1Y A;  2YJP A;  4F18 A;  4FEC A;  4PP0 A;  1SVX B;  1Y3N A;  4JWX A;  1LB9 A;  4NF8 A;  1D4N A;  3FV2 A;  1P99 A;  1UIU A;  1QUK A;  3TTR A;  1XS5 A;  1B46 A;  1XVX A;  3TQL A;  2REJ A;  3ZS6 A;  2I3V A;  4MLQ A;  1USY E;  1D3K A;  3RT6 B;  5CMC A;  3IO6 A;  3VVE A;  3G3G A;  1GTK A;  3RNN A;  1P1Q A;  3THI A;  3TDJ A;  2PMS A;  1Q1K A;  5I58 B;  1H45 A;  1UTH B;  4AB6 A;  3UN6 A;  3KN8 A;  1YCJ A;  1QJM A;  4KHZ E;  4RPN A;  4EF2 A;  3QXM A;  1VFD A;  4Z7E A;  1A54 A;  1VR5 A;  4POW A;  1B32 A;  5HBC A;  5FTI A;  2D21 A;  3U94 A;  1OLA A;  1A99 A;  3U1O A;  1BIY A;  4MFI A;  3VV5 A;  3CFX A;  1IUD A;  4WXJ A;  1UTB A;  2A5S A;  2LAO A;  2P2A A;  2Z8E A;  1B3H A;  4POX A;  1I69 A;  3G3I A;  3K0V A;  2DVC A;  2ZNT A;  4QSC A;  2OLB A;  3TTK A;  1QW0 A;  4PE5 B;  3PD9 A;  3HV1 A;  3QSL A;  3T93 B;  2F78 A;  2PYY A;  1PBP A;  4G77 A;  4LON B;  4BDL A;  4KQP A;  2VOZ A;  1FQB A;  4Z0I A;  3KJT A;  3KOT A;  4QSD A;  3QAX A;  4X1D A;  5H8Q B;  1URS A;  3S4U A;  3PMV A;  4DDD A;  1JVY A;  3OXN A;  4FOR A;  3MZB A;  4ZZA A;  5I56 B;  3KJ7 A;  2XD2 A;  2V84 A;  4NF4 A;  1DOT A;  2Y7K A;  4I9D A;  4UAC A;  3FJ7 A;  3OO7 A;  1H76 A;  4RYA A;  1B5J A;  4AB5 A;  4DXB A;  3KN7 A;  1FQE A;  2ZXT A;  2VHA A;  2Z23 A;  1GR2 A;  5HM4 B;  2ZYM A;  1PEB A;  1B1H A;  3C32 A;  1MXZ A;  3C36 A;  4H8I A;  3FVK A;  1HSE A;  1MXX A;  4ZEC A;  5FTH A;  2W7Y A;  2XXR A;  5BUU A;  3VE1 B;  1A55 A;  3MAM A;  5L9M A;  1JNF A;  1SI0 A;  4EXK A;  2DS9 A;  4BDR A;  3H3G A;  3GBA A;  4ZEF A;  2H5Y A;  1N7X A;  1P1N A;  4R74 A;  1BLF A;  2IA4 A;  3PUV E;  3PGF A;  1H43 A;  1NNF A;  4FEB A;  4EXL A;  4H6D A;  5TP9 B;  4F3G A;  4ELQ A;  3UP9 A;  4BDO A;  1JW5 A;  3O6H A;  5IAI A;  5CMM A;  1XOC A;  2UYE A;  2F5X A;  4U21 A;  4Q5T A;  3PUX E;  1UTB B;  4FAJ A;  2RC9 A;  5H8F A;  1US5 A;  2XHD A;  1MPB A;  3TCF A;  2OBG A;  3HN0 A;  2GHA A;  4LP2 B;  1N04 A;  4I8C A;  4KYD A;  3IJX B;  3W9W A;  1XT8 A;  2I0B A;  2HFB A;  3C34 A;  4C0R A;  4EDP A;  4HCW A;  1VFE A;  2QRY A;  3UGW A;  3C35 A;  1N3W A;  1JVX A;  5CI5 A;  2HZK A;  3KBR A;  2ZNS A;  1LFH A;  1UQW A;  5AA3 A;  1TFD A;  4R75 A;  1LAH E;  2P1S A;  4XXU A;  2G93 A;  1S50 A;  4XTC Q;  2Y7P A;  2Y84 A;  5H8S A;  4M1V A;  3CVG A;  1A8F A;  4RPO A;  4XIG Q;  1N84 A;  3DEL B;  5ITP A;  4GRK A;  4GIZ A;  3L6G A;  3Q27 A;  2FNC A;  3G3H A;  5H8H B;  3PUW E;  3MJN A;  4R72 A;  1D9V A;  2WKY A;  4NF4 B;  3PMX A;  2Y7W A;  3S9N C;  3MP8 A;  3K6U A;  1M5E A;  1FQC A;  3H6U A;  3OEK A;  3S9E A;  3UIF A;  3RGY A;  1MS7 A;  3C4M A;  3ZSF A;  3U92 A;  1B0H A;  5CBS A;  4ONY A;  3V83 A;  2QL3 A;  3TUS A;  2XXX A;  1EZP A;  3N6T A;  3ONM A;  2ABH A;  4N07 A;  1MXU A;  4BDQ A;  1FTO A;  2UXA A;  4H0W A;  5CC2 A;  3TPA A;  4LVQ A;  4OEU A;  1T0K A;  4JWY A;  2DXR A;  2O1M A;  3Q25 A;  4NF6 A;  4ELP A;  4GL0 A;  2Z8D A;  5AA4 B;  1I6Q A;  1FQF A;  4OXV A;  1P1U A;  4R6H A;  1CB6 A;  3O2A A;  2QS4 A;  4PFY A;  4IY6 A;  3SER A;  1OMP A;  4U2R A;  1IQ7 A;  3VLW A;  2RC7 A;  3ODB A;  5JEI A;  1MXY A;  2OJT A;  2RKM A;  1Y20 A;  4QHQ A;  1LAG E;  1RYO A;  3G3K A;  1I6A A;  2PT2 A;  4M4G A;  2BJJ X;  3PUZ E;  1SQY A;  2XX7 A;  1DSN A;  2DP8 A;  2O7U A;  1B7H A;  3HCQ A;  3OO9 A;  3OO6 A;  1R6Z A;  4GXS B;  2Q8J A;  1LB8 A;  4QSE A;  5F7V A;  3CSG A;  5H8F B;  1B52 A;  4F1V A;  4OMB A;  5DVI A;  5HPQ A;  4JSO A;  3LSX A;  1B7U A;  1AIV A;  2NXO A;  1QUL A;  2CZL A;  4WEP A;  4F39 A;  4NWC A;  3B6T A;  2X7P A;  3FGS A;  3RY3 A;  4PQJ A;  1SI1 A;  2IEE A;  5TPA A;  2V3Q A;  1MPD A;  3RPW A;  3SET A;  1GV8 A;  4H5G A;  3CSB A;  4ISU A;  2B65 A;  4MH5 A;  3ZKL A;  4U23 A;  5I2K B;  4EQB A;  3GBB A;  1B3E A;  3SEY A;  1Z7N E;  3O29 A;  4OWD A;  1N3X A;  4YIC A;  2X7Q A;  3RTF B;  3FXQ A;  3PV0 E;  1B3F A;  2F34 A;  3E13 X;  5EYF A;  4DXU A;  2QMX A;  2AYS A;  3VXB A;  4C1T A;  4E0X A;  1AH5 A;  1US4 A;  3MBP A;  2ZYO A;  4F1U A;  1QUJ A;  2H4I A;  4ZEK A;  4ZE8 A;  3HPI A;  1S7Y A;  5I84 A;  3KEI A;  2DWJ A;  4QFO A;  2Q2A A;  5I57 B;  4BLA A;  3K02 A;  4IO7 A;  3TAJ A;  3VLU A;  1VE4 A;  3SEV A;  3V89 B;  2Y7I A;  1LAF E;  5B70 A;  1LFI A;  4GLI A;  3IB1 A;  4NF6 B;  3IOT A;  3W15 C;  3TFL A;  2V3U A;  4Q8R A;  2DWA A;  3AXF A;  4EQ7 A;  1YPN A;  2HQ0 A;  3TCG A;  4DXC A;  4EQ9 A;  4F29 A;  2R6G E;  3A3C A;  3T9H B;  3IB0 A;  3FD3 A;  3QUF A;  2NWJ A;  1FQD A;  1II5 A;  2D5W A;  2I49 A;  3BFU A;  1NH8 A;  1M5C A;  1EZO A;  1B5I A;  3G3J A;  4IB2 A;  1GVC A;  4Q30 B;  1JW4 A;  2FA7 A;  5KZT A;  1MY0 A;  1OVB A;  3TMG A;  1MQI A;  3B6Q A;  2AL5 A;  4H8J A;  2XXI A;  2ANJ A;  1POT A;  3H03 A;  4JBZ A;  3K4U A;  2RF1 A;  2A5T A;  4AQ4 A;  1TXF A;  2ZNU A;  4OTE A;  1R9L A;  4GQO A;  2CMO A;  1LFG A;  1S9T A;  3T96 B;  1SD3 A;  1NNP A;  4YKJ A;  4TLL B;  3EQ1 A;  3IL1 B;  1JEU A;  2F97 A;  2UVG A;  3ECR A;  1P1W A;  4ECF A;  4EUO A;  4FJP A;  3S9M C;  4F3B A;  3OSR A;  4FE8 A;  1OVT A;  2H99 A;  1ELJ A;  3H06 B;  1SW2 A;  3CR9 A;  3BBR A;  1B1X A;  4KCD A;  2DE4 A;  4YMA A;  2GH9 A;  4KR5 A;  4NF8 B;  4GL8 A;  2I48 A;  2ONK E;  5DTB A;  4QRZ A;  4HTG A;  1GGG A;  2XXH A;  5H8N A;  1MM6 A;  1MY1 A;  2M8C A;  1J1N A;  3MVX A;  1R9Q A;  2HAV A;  1ZU0 A;  3PPQ A;  2O51 A;  4X1B A;  3DM0 A;  1MDP 1;  2NUV A;  3FJM A;  1BP5 A;  4QFN A;  1SDX A;  3VLV A;  5CMB A;  1ZKB A;  4FAT A;  1ZBM A;  5CM6 A;  3FAT A;  4RNS A;  1B4H A;  4IO5 A;  4KFQ A;  3QYT A;  3F11 A;  3CI8 A;  2H98 A;  3MC2 A;  1FW0 A;  4U22 A;  1PB9 A;  2I6E A;  5J1D A;  1PC3 A;  1LST A;  1KWH A;  5FHM A;  2Y7R A;  3P7I A;  3VDF A;  2H9B A;  3H7M A;  4DCY A;  3DP8 A;  4ZEB A;  4OFJ A;  4QFP A;  5KDT A;  1MH4 A;  1UIV A;  1SW1 A;  1N7W A;  4OHN A;  2Z8F A;  2H25 A;  4U4S A;  1YTV A;  4WKM A;  2V93 A;  4OFO A;  2UVI A;  3MZ9 A;  5JTY A;  1B0L A;  2V3T A;  3OMB A;  5L9S A;  1SBP A;  1M5B A;  2XX9 A;  3DLN A;  1FTJ A;  1FTL A;  2ZYK A;  1VSO A;  4YAH X;  3T9U A;  4XKR A;  3N26 A;  1IXI A;  1JEV A;  4R9F A;  3CIJ A;  1MQG A;  2O7I A;  2Z22 A;  3FVN A;  1MQH A;  3GZG A;  4YKP A;  1ATG A;  4PFU A;  2ONR A;  3OD7 A;  3RT8 A;  2HAU A;  2F36 A;  2I4B A;  1F9B A;  2QSX A;  1ZMG A;  4F22 A;  3K6W A;  4C1U A;  1ZLQ A;  5IKB A;  2VGQ A;  4YKK A;  5CBR A;  3D4C A;  1DMB A;  3S9L C;  1LCF A;  4BDN A;  3K1M A;  3IOU A;  4G2Z A;  1MPC A;  4HW8 A;  4IGT A;  4H1X A;  1B3G A;  3R26 A;  3KSX A;  1B9J A;  4TOZ A;  1MH3 A;  3OSQ A;  3RLF E;  3MWB A;  3EF7 A;  1PB7 A;  4I1D A;  4MBP A;  1XVY A;  3RTW B;  5K2X A;  4MLV A;  1B3L A;  3DP6 A;  3HHG A;  3TKD A;  2XXP A;  1IEJ A;  4ZEI A;  2R71 A;  3O66 A;  2I4C A;  2OZZ A;  3MVZ A;  2E0S A;  3N5L A;  2XX8 A;  5H8N B;  5I59 A;  4YB5 A;  3S2V A;  3TQW A;  3TZA A;  1NKX A;  1OQG A;  3FXU A;  3QK6 A;  2OK2 A;  1SW5 A;  2RCA A;  4KCC A;  3IB2 A;  5AA2 D;  4FED A;  2P0S A;  3K1N A;  3Q26 A;  5DEX A;  1M5D A;  3MZ1 A;  4JXI A;  2I58 A;  3IR1 A;  3SES A;  4DE8 A;  5ELV A;  3ILT B;  4O3B A;  4NED A;  2RC8 A;  4QFL A;  3C9H A;  3FUZ A;  2DSF A;  1NMU A;  1WOD A;  3K6V A;  3UOR A;  1RKM A;  4RA1 A;  4IO3 A;  5ICQ A;  1NNT A;  4RY1 A;  3H6V A;  1B2H A;  4IGR A;  1PBQ A;  3ILU B;  3HO7 A;  1HSJ A;  2B3F A;  3PPP A;  3FXR A;  4RXL A;  3T22 A;  5KDT B;  3PPO A;  1MQJ A;  4DCX A;  1Y4T A;  5DVJ A;  2F7A A;  4THI A;  4I62 A;  4DIG A;  2ESN A;  2DVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...