5CMCA

Mnemiopsis leidyi ml032222a iglur lbd e423s mutant glycine complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
247
Chain Sequence
LIGRHLRLGSVESQPFMFFATEGCEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDDRKFGALNKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQDKYKWGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ML032222a iGluR
publication title Molecular lock regulates binding of glycine to a primitive NMDA receptor.
pubmed doi rcsb
source organism Mnemiopsis leidyi
total genus 79
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5cmcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5cmcA02
4RPOA 2DWIA 3THIA 4P0GA 1UTHB 4TOZA 1B46A 3L6GA 3MAMA 4YAHX 4H1XA 3QXMA 1QUJA 1TFDA 3Q25A 2QS2A 5K2XA 3IB2A 5H8QB 2ONRA 4F3SA 1Y4TA 3C4MA 5DT6A 2G93A 3EHTA 3KSJA 1POY1 4TQUQ 3LSWA 5TP9A 3G3IA 3IO6A 1D9VA 3TAJA 4O3CA 3H6UA 2O7UA 1HSLA 5ISUA 1NNFA 2D3IA 4R9GA 3TCHA 4WEPA 2Z8EA 4NF8A 3CVGA 3E4RA 3RNNA 4YB7A 4PFWA 4FEDA 1Y1MA 1PBPA 4OEUA 1LAFE 1FW0A 2M8CA 3U93A 2QJEA 3LC8A 2DVZA 3UORA 1NNKA 2Q9TA 4LVQA 1WDNA 2I4CA 3ODBA 1AL3A 3IO4A 1O64A 2UVIA 4IO6A 4M1VA 5DVFA 1JVYA 1KWHA 3S9EA 5FHMA 2R9JA 4U23A 4G68B 4YB5A 3SETA 1SBPA 4JXIA 4EQBA 1USYE 3H3GA 3N94A 3K2DA 3RN8A 3PMVA 1UQWA 1CE2A 2UVJA 3KN7A 3K1MA 4UA8A 1MQGA 3VLUA 1N0TA 5F1QA 3O2AA 4IO3A 4C0RA 1M5BA 5TPAA 4O3BA 2PMSA 3FXRA 3N26A 3RT6B 1WODA 3CSGA 4MLVA 1N04A 1MY2A 2F78A 1GV8A 2O7IA 1B1XA 4LA9A 4OTEA 2X7QA 3Q29A 1URGA 2I49A 4FIMA 5DYHA 2Q88A 4E0XA 4HCWA 3HPIA 4OWDA 4U4SA 5H8HA 4ZE8A 4H8IA 1MH4A 3UK4A 4IB2A 4UACA 3B7DA 4C1TA 2F7AA 4OHNA 4PQJA 3C35A 4YKKA 1DTGA 4NF5A 3HSTA 1B51A 2X7PA 1MY3A 3A3UA 2A5SA 1B58A 3G3JA 4JWYA 3ZSFA 1OLAA 3KFMA 3MZ1A 4ZEBA 3OXNA 1B0LA 3MVXA 3TCGA 2GH9A 1MQIA 4Z7EA 4DCXA 1Z7ME 5AA4B 4R2FA 2Y7RA 5EYFA 4RK2A 4FEBA 2VD2A 3RQTA 1CB6A 3T9HB 3KEIA 2F34A 2F5XA 2IEEA 1LBBA 3S2VA 4R74A 1SI1A 1S9TA 2F7CA 4LP2B 4BDOA 4IGRA 2ZMBA 2XXVA 4NF5B 3MVYA 3HN0A 4QFOA 4F29A 2GHAA 3BFUA 4P0IA 5ITPA 4OZ9A 1I6QA 4OMBA 1YCJA 1ZU0A 2OBGA 2QSXA 4YU0A 1OLCA 5I56B 2NWJA 1XOCA 5I59A 2HAUA 1VR5A 3MPLA 5L8DA 2V84A 1B4ZA 5I2NA 5AA2A 1LAGE 1LCTA 2UVGA 3I5OA 3KSXA 4G77A 3OMBA 3KZGA 3QSLA 2HZKA 4XTCQ 2IA4A 4OFJA 4L17A 1FTKA 1LAXA 1WVJA 1EZPA 2F36A 3PUVE 3S9NC 5FTIA 2QS1A 3S9LC 1URSA 3E3KA 3IOVA 1TXFA 1R9QA 3PUXE 2HFBA 4PETA 4WKMA 1D4NA 4R2BA 2Q89A 5CC2A 4OESA 4N6PA 3CSBA 5B70A 4G68C 4PE5B 4R9FA 4DIGA 3V83A 3SESA 2Q2AA 2Y7KA 1IXCA 4FE8A 5I2NB 2V93A 3CFLA 1LB8A 2DOJA 2O51A 5CMCA 4ZEKA 4PP0A 2PT2A 2ZNTA 3OSQA 1A8FA 5J1DA 2HAVA 3IAZA 2QRYA 4FORA 4QSCA 1MPBA 4KCDA 4HW8A 3CI8A 3TTRA 3M3LA 1MQJA 5I84A 1NH8A 4N13A 4P11A 2NOOA 1YTVA 4GLIA 4XXUA 4XKPA 1R1NA 2FNCA 3IB0A 5HBCA 5H8SA 5FTHA 1DPPA 4GL8A 1PDAA 4EQ9A 1Y1ZA 2R6GE 3O6IA 3B6WA 3O29A 4ELPA 2I4BA 3QUJA 5DVJA 3C33A 3MQ9A 2XXUA 5CMMA 4Q5TA 1B4HA 4EF2A 3H4ZA 1MRPA 3CFZA 3FJ7A 3T9VA 4H6DA 2BJJX 4IO2A 5H8NA 3AXFA 3TYHA 3LUYA 2DVCA 1HSEA 2QMWA 4KYDA 4I8CA 1IQ7A 1P1WA 4ZZAA 3VVDA 1URDA 2OJTA 2I48A 4YKPA 2UYEA 2OLBA 4LUBA 3RY3A 5A5XA 3R7XA 3C34A 1JETA 1JW5A 1IXHA 4BDMA 2OZZA 5EHMA 3K6WA 3FGSA 1PB9A 1JEVA 4OFLA 4NE4A 2DXRA 3TMGA 3PD9A 2UVHA 4IY6A 3GZGA 5H8NB 4QRZA 1UTHA 3EPEA 2F7BA 4LQ5A 4YMBA 1D3KA 3TTNA 4DE8A 1ZKBA 1TT1A 1Y4CA 5H8QA 2ALUA 2G29A 1ZMGA 3E13X 4RNSA 3MBPA 3R26A 4G2ZA 4MLQA 4FJPA 3OD7A 4BDQA 4GIZA 3G3HA 3KOTA 1XS5A 2UYFA 4DXUA 2OWSA 4OXVA 1L5TA 1XVXA 1IXGA 2O84X 4QHQA 1SDXA 1FQBA 3RUMA 1QVSA 3FD3A 1SYIA 5HM4B 4KPTA 4LZ7A 2Y84A 1NFTA 1DOTA 2ONKE 2DXYA 4OETA 4KQPA 4N07A 5HPQA 1JVXA 2REJA 1N7WA 1B3GA 1M5EA 4WEDA 1B7ZA 5I2KA 1FTJA 3FATA 4GOTA 4QSEA 1QKAA 5ITOA 1DMBA 3FJMA 3R6UA 1PC3A 4G68A 3G3GA 2QL3A 1VFDA 3V89B 1N3WA 2LAOA 1ZIUA 2VP1A 3JV9A 3Q26A 4ZE9A 4IO5A 2D5WA 5M2VA 2REGA 1PB7A 5IAIA 4DXCA 2PYYA 3N6UA 4QFKA 1MDP1 1AIVA 3IL1B 1MH3A 2ANJA 4FAJA 1MXXA 2VHAA 3FV1A 1A99A 3WAEA 5I2KB 4BDNA 1QKBA 3MJNA 4ELRA 3HHGA 3CR9A 2XXTA 4F18A 2Y7IA 3C36A 2I3VA 1N84A 1O7TA 2ZXTA 5I57A 3IJOB 4KCCA 3TTKA 1DSNA 1IEJA 1GVCA 3VFJA 4YKIA 5DVIA 2FA7A 4O3AA 4F3PA 5DEXA 4THIA 1MXWA 1LB9A 4GD5A 4POXA 2H98A 1Y3QA 1EZOA 3W9WA 2H4IA 3PV0E 2W7YA 4E0WA 1P1OA 2DE3A 3MP6A 4LZ5A 1JEUA 3MZ9A 1Z7NE 5AA4A 3CRBA 1GTKA 4RXLA 5I57B 3K1PA 3VVFA 3H06B 2E0SA 1POTA 3KJTA 4F3BA 3MP8A 3QUFA 1MG1A 1UIUA 3O66A 3LBSA 3H03A 5ICQA 3FZVA 5DEXB 4EXKA 4DXBA 3RPWA 2AL5A 4F31B 2GRVA 3S9MC 3UP9A 3K4UA 1VFEA 2ZNUA 2XHDA 4YICA 3TZAA 2QS3A 2E1SA 1PBQA 4OFOA 1S50A 5I56A 2F97A 2XD3A 3VLWA 2Z8DA 3ZKLA 5CMKA 3MVWA 4AQ4A 1R6ZA 3V5AA 1TFAA 4ELQA 3DP4A 1N3XA 3T22A 1B7HA 3FVOA 3W9VA 3IORA 1LAHE 3B6QA 1BKAA 4EDPA 1NNTA 4WXJA 2XXIA 1XVYA 4Q30B 4TLMB 1D9YA 1NMUA 4FATA 4EXLA 3GLBA 3FVKA 3SEYA 2O68A 4OVJA 1JQFA 1SQYA 1GGGA 3TQLA 3UIFA 2Z23A 3DELB 4MF3A 1QW0A 4I1DA 1FQFA 3LSXA 3H6VA 5AA3A 3OSRA 2Q8JA 4LATA 1JW4A 2AYSA 3IK6B 3MC2A 4F19A 2OCUA 3BKIB 4RPNA 3SEUA 1H43A 1MXYA 2QMXA 2GFEA 1QJMA 3U1OA 2RF1A 1MQDA 4QSDA 4ZS9A 1SI0A 2CZLA 3FVNA 1B6HA 1P1UA 1A7LA 1XHYA 3U92A 4GF8A 4F39A 4POWA 3DP8A 3IOWA 3WAFA 4GXAA 4LQ2A 4EQ7A 1Y20A 1MQHA 4H8JA 3IR1A 1II5A 2H25A 4MBPA 4Q0CA 5ICTA 4BDRA 3IB1A 3DP6A 2ESNA 1B3FA 3LR1A 3RLFE 1B3HA 4GFRA 3PMWA 4RK9A 3EHSA 3MP1A 3TKDA 4KD5A 4X48A 3K00A 3QAXA 2XXXA 2B65A 3H7MA 1US5A 1OQHA 4OQOA 3PPOA 1EH3A 1FTLA 1I6BA 2O1LA 2O1MA 4FECA 1PEBA 1RYXA 3T96B 3TQWA 4YB6A 1OIBA 1M5DA 3KJ7A 4KFQA 1ELJA 4KHZE 3I3VA 3ECRA 2HCAA 1NNPA 1LLSA 4ECFA 3G7WA 4GXSB 2P1SA 2NXOA 4H5FA 4G4PA 3CFXA 3FJGA 4NWCA 4RJZA 2O6AA 3F11A 5L9OA 4U4XA 1MS7A 3ONMA 3T9UA 2XX7A 3DLNA 3VE1B 4GVOA 3RT8A 3TTMA 1R9LA 2DSFA 4DZ1A 3E9XA 2I0BA 2I6EA 5CRYA 3O97A 1I6AA 1UTBA 1J1NA 3K0VA 3VVEA 3VXCA 1FQDA 4ZZEA 3M3FA 1USYH 4G8MA 3IOTA 3OO7A 3SEXA 2QPQA 1MDQA 1TWYA 3TDJA 4NF4A 5AA2D 1LFHA 1B3EA 4YMAA 5ELVA 4KI0E 3TCFA 1ATGA 4NEDA 2VD3A 4Q8RA 2B3BA 4I62A 4EF1A 1HSJA 1H44A 3PGFA 1ZLQA 1N7XA 2ZYNA 4ZEFA 4X1BA 4PFUA 2RC7A 1UTBB 4QFLA 1B32A 3G3FA 1FTOA 3MVZA 5B7DA 4PFYA 2Z22A 2Z8FA 2F35A 3T66A 3VV5A 5FHOA 3ILUB 1PB8A 3OO9A 4NF4B 5F7VA 1B52A 5CBRA 5AE4A 1F9BA 2RC9A 4LZ8A 5H8FA 3Q28A 3EHUA 1M5FA 4QFNA 4JB7A 1Y3NA 4BDLA 3UN6A 3K6VA 2DWJA 4GRKA 2H5YA 1FCKA 2CMOA 4OERA 3OEKA 3TPAA 3MW0A 1S7YA 1ZBMA 2R71A 3VDFA 3CIJA 2AL4A 4EUOA 1FTMA 4XKNA 4R73A 4IO7A 3IX1A 5L9MA 4ND9A 1AH5A 3OOAA 5IKBA 3K02A 3K6UA 2DE4A 1B40A 1QUIA 4ESXA 3LSFB 4JDFA 2HXWA 2P0SA 2P2AA 1A55A 5CMBA 2H99A 2A5TA 5H8FB 4ONYA 1VSOA 2THIA 1H76A 3KN3A 1MM7A 3U72A 1H3DA 4YZZA 3PPNA 5KCJB 5JEIA 5JTYB 2WKYA 1B5JA 4XKRA 3C31A 4JWOA 5CM6A 1AMFA 1P1QA 2RCBA 3U94A 2DWAA 4X9TA 5BWJA 1YAEA 3OEMA 3M3KA 1EZ9A 3PPRA 4BLAA 1EU8A 5L9SA 3MUQA 4R72A 1MXUA 3EQ1A 4Z0IA 2XXRA 5TP9B 5AA1A 5FHNA 2PVUA 1MY0A 3HHFA 4H67A 3O6HA 2I3WA 3KGCA 4YKJA 3N6TA 2A5TB 4H65A 3TEPA 4ZDMA 2I58A 2O69A 3OO6A 1LFIA 2VOZA 2ZYOA 2I0CA 3RGYA 1BP5A 2QS4A 4NF8B 3SKPA 2OK2A 1FQEA 1ZTYA 3P7IA 2HQ0A 3N5LA 1IITA 2Y7PA 3JZJA 3O6GA 2PX1A 1O63A 1ANFA 3QYTA 3GBAA 1YPNA 4GWOA 5LOMA 1JNFA 1P99A 3OELA 4ISUA 5JK4A 3RTWB 4HTGA 4R6YA 2XX8A 2DP8A 4ZECA 1H45A 4F1UA 1RKMA 1OVTA 4KYEA 3FV2A 3FASA 3PMXA 3GBBA 4KYSA 4ZEIA 3DM0A 3PUYE 4DDDA 3PU5A 4JBZA 3TODA 2PBWA 4F3GA 4ESWA 1B1HA 3JYRA 2XX9A 1MM6A 2FYIA 4NWDA 2V25A 1IXIA 2XXWA 5EHSA 5TPAB 1LGBC 4QF9A 3PUZE 3G3KA 3KG2A 3TTLA 2D21A 2ABHA 3CG1A 3K01A 1SW5A 2H9BA 1Y3PA 1UIVA 4NMYA 1B2HA 1DTZA 1LSTA 2V3TA 3PPPA 4C1UA 4NTLA 1RYOA 4F2OA 3BFTA 4PFTA 1A8EA 4OEVA 2PT1A 4HS7A 4R75A 2NVUB 1Y9UA 1GR2A 3GXAA 5H8HB 2NUVA 4MFIA 3SEWA 2Q2CA 4OENA 3KOSA 4G8NA 3O9PA 3CG3A 4KR5A 2XD2A 1ZJLA 3KN8A 5CBSA 3K1NA 4X1DA 3HCQA 2DE2A 1SVXB 3EN3A 4RA1A 1SD3A 3BBRA 4AB6A 3O28A 3PPQA 3Q27A 2XXQA 1QUKA 1A54A 1Q1KA 1FQAA 4HCYA 4U2RA 5TU0A 2ONSA 1IZ1A 1B3LA 3FXQA 4QFPA 4U21A 1SW1A 3C9HA 3K6XA 1I69A 4G8HA 1NH7A 4LONB 1QULA 4RY1A 3D4CA 3MWBA 1SW2A 2XXHA 2ZYMA 1LFGA 3KBRA 3SEVA 3A3CA 4F1YA 1FQCA 3HO7A 1MPCA 3TELA 3RTFB 1XT8A 3VLVA 4ELOA 3D4GA 2UXAA 2F8DA 3MPKA 4F2QA 4IGTA 4I9DA 3LSLA 4U1ZA 3PUWE 5I59B 2YPNA 3M8UA 3MZBA 3FIRA 5BUUA 5AA2B 3QK6A 1MXZA 3FVGA 3TFLA 2F6GA 4U1OA 3H6TA 1MXVA 3PD8A 2XXPA 2YLNA 3V8XB 3U8QA 1P1NA 4IO4A 4GL0A 3HV1A 1B5IA 3FXUA 4JSDA 1T0KA 3FUZA 1LBCA 1US4A 3UA8A 2DWHA 4IY5A 1SYHA 2ZYKA 5I58A 2DYXA 4AB5A 1N76A 4XKQA 1B05A 5CI5A 1B7UA 1VE4A 1IUDA 2AIXA 3ZKKA 3USDA 3QIMA 1DPEA 3ILTB 1XC1A 2B3FA 3SDFA 3L6HA 3UGWA 1AOVA 1OVBA 4R6KA 2DS9A 3W15C 1BIYA 3T9XB 1MPDA 3B6TA 3OO8A 4R6HA 1B9JA 4M4GA 1BLFA 2HZLA 2KLFA 2OWTA 2V3UA 4NF6A 3TUSA 2RKMA 3I6VA 4GQOA 4H5GA 4XIGQ 3A09A 5I58B 4JSOA 3S4UA 4MH5A 1MY1A 1B0HA 4OYVA 2YJPA 5KDTA 3IOUA 1B5HA 4RYAA 3T93B 2XXYA 1OQGA 4ZEDA 3SERA 5K2YA 1Q35A 5DTBA 3ZS6A 1A40A 2RC8A 2DQVA 5KZTA 4K3FA 2Y7WA 3IJXB 4F1VA 4DCYA 5A5XB 1NL5A 3H6WA 3VXBA 1SW4A 4H0WA 4NF6B 2V3QA 4TLLB 2HEUA 2F6PA 1NKXA 4U22A 1MY4A 4F22A 3EF7A 1JW1A 4DLDA 2RINA 2GHBA 4JWXA 2ZNSA 1LCFA 3C32A 2RCAA 5KDTB 1M5CA 1IIWA 1OMPA 5KCJA 5JTYA 2VGQA 2X26A 1BTJA 3OENA
chains in the Genus database with same CATH superfamily
4RPOA 1FBFA 2DWIA 3THIA 4P0GA 1UTHB 4TOZA 1B46A 3L6GA 3MAMA 4YAHX 4H1XA 3QXMA 1QUJA 1TFDA 3Q25A 2QS2A 5K2XA 3IB2A 4MCOA 5H8QB 2ONRA 4F3SA 1Y4TA 2Q74A 3C4MA 5DT6A 2G93A 3EHTA 3KSJA 1POY1 4TQUQ 3LSWA 5TP9A 3G3IA 3IO6A 4HXVA 1D9VA 1VDWA 3TAJA 4O3CA 3RYDA 3H6UA 2O7UA 1HSLA 4MAGA 5ISUA 1NNFA 2D3IA 4R9GA 3TCHA 4WEPA 2Z8EA 4NF8A 3CVGA 3E4RA 2WBBA 1FPKA 3RNNA 4YB7A 4PFWA 4FEDA 1Y1MA 2B4LA 1PBPA 4OEUA 1LAFE 1FW0A 2M8CA 3U93A 2QJEA 3LC8A 2DVZA 3UORA 1NNKA 2Y5LA 2Q9TA 4LVQA 1WDNA 2I4CA 5EYHA 3ODBA 1AL3A 3IFCA 3IO4A 1O64A 2UVIA 4IO6A 4M1VA 5DVFA 1JVYA 1KWHA 3S9EA 1LBZA 5FHMA 2R9JA 4U23A 2VPOA 4G68B 4YB5A 3SETA 1SBPA 4JXIA 1NUYA 4EQBA 1USYE 3H3GA 4P47A 2XWKA 3N94A 3K2DA 3RN8A 3PMVA 1UQWA 1CE2A 4X8RA 2UVJA 3KN7A 3K1MA 4UA8A 1MQGA 3VLUA 1N0TA 5F1QA 3O2AA 4IO3A 4C0RA 1M5BA 2FIEA 5TPAA 4O3BA 2PMSA 3FXRA 3N26A 3RT6B 1WODA 4NG7A 3CSGA 4MLVA 1N04A 1MY2A 2F78A 1GV8A 2O7IA 1B1XA 4LA9A 4OTEA 2X7QA 3Q29A 1URGA 2I49A 4FIMA 5DYHA 2Q88A 4E0XA 4I3EA 3ROJA 1IMEA 4HCWA 3HPIA 4OWDA 4U4SA 5H8HA 4ZE8A 4H8IA 4AS4A 1MH4A 3UK4A 4N17A 4IB2A 4UACA 3B7DA 4C1TA 2F7AA 4OHNA 1KA1A 4PQJA 4MX6A 3C35A 1DTGA 4YKKA 2CZHA 4NF5A 4PF8A 3HSTA 1B51A 4GWXA 3RPLB 2X7PA 1MY3A 3A3UA 2HHMA 2A5SA 1B58A 3G3JA 4JWYA 3ZSFA 1OLAA 3KFMA 3MZ1A 2OX3A 4ZEBA 1KZ8A 3OXNA 1B0LA 3MVXA 3TCGA 2GH9A 1MQIA 4Z7EA 4QXDA 4DCXA 1Z7ME 5AA4B 4R2FA 4P8BA 2Y7RA 5EYFA 4RK2A 4FEBA 2VD2A 5LDZA 3RQTA 1CB6A 3T9HB 3KEIA 2F34A 2F5XA 2IEEA 4FBPA 1LBBA 3S2VA 4R74A 1SI1A 1S9TA 2F7CA 4LP2B 4P1EA 4BDOA 4IGRA 2ZMBA 3FBPA 2XXVA 4NF5B 3MVYA 3HN0A 4QFOA 4F29A 2GHAA 3BFUA 1FPDA 4P0IA 5ITPA 4OZ9A 1I6QA 4OMBA 1YCJA 1ZU0A 2OBGA 2QSXA 4P56A 4YU0A 1OLCA 5I56B 1G0HA 1DK4A 3KC1A 2NWJA 1XOCA 5I59A 2HAUA 1VR5A 3MPLA 5L8DA 2V84A 1B4ZA 1IMFA 5ET8A 5I2NA 5AA2A 1LAGE 1LCTA 2UVGA 3I5OA 3KSXA 5EQ7A 4G77A 3OMBA 3KZGA 3QSLA 2HZKA 4XTCQ 2IA4A 4OFJA 4L17A 1FTKA 1QGXA 1LAXA 1WVJA 1EZPA 1JP4A 2F36A 3PUVE 3S9NC 4JVIA 5FTIA 2QS1A 3S9LC 1URSA 2QVUA 3E3KA 1FBDA 3IOVA 1TXFA 1R9QA 3PUXE 2HFBA 3U65A 4PETA 4WKMA 1D4NA 4R2BA 2Q89A 5CC2A 4OESA 4N6PA 3NOHA 3CSBA 5B70A 4G68C 4PE5B 4R9FA 4DIGA 3BIHA 3V83A 3SESA 2Q2AA 2Y7KA 1IXCA 4FE8A 5I2NB 2V93A 3CFLA 1LB8A 2DOJA 2O51A 5CMCA 4ZEKA 4PP0A 4PGNA 2PT2A 2ZNTA 3OSQA 1A8FA 5J1DA 2HAVA 3IAZA 2QRYA 4FORA 4QSCA 1MPBA 4KCDA 4HW8A 3CI8A 3TTRA 3M3LA 1MQJA 2Y5KA 5I84A 1NH8A 4N13A 4GX3A 2NOOA 1YTVA 4P11A 4GLIA 4XXUA 2XXKA 4XKPA 1R1NA 2FNCA 3IB0A 5HBCA 5H8SA 5FTHA 1DPPA 4GL8A 4PDHA 4PTKA 1PDAA 4EQ9A 1Y1ZA 2R6GE 3O6IA 3B6WA 2QFLA 3O29A 4ELPA 2I4BA 5I5PA 3QUJA 5DVJA 3C33A 3MQ9A 2XXUA 5CMMA 4Q5TA 1B4HA 4EF2A 1EYJA 3H4ZA 1EYKA 1MRPA 3CFZA 3FJ7A 3T9VA 4H6DA 2BJJX 4IO2A 5H8NA 3AXFA 3TYHA 1FPLA 3LUYA 4GBVA 2DVCA 1HSEA 1NV1A 2QMWA 4KYDA 4I8CA 4PE3A 1IQ7A 1P1WA 4ZZAA 3VVDA 1URDA 2OJTA 2I48A 4YKPA 2UYEA 2OLBA 4LUBA 4PGPA 3RY3A 5A5XA 3R7XA 3C34A 1JETA 1FPFA 1JW5A 1IXHA 4BDMA 2OZZA 4MNPA 5EHMA 3K6WA 3FGSA 2HXRA 1PB9A 1JEVA 4OFLA 4NE4A 2DXRA 3TMGA 3PD9A 2UVHA 4IY6A 3GZGA 5H8NB 4QRZA 1UTHA 3EPEA 2F7BA 4LQ5A 4YMBA 1D3KA 3TTNA 4DE8A 1ZKBA 1AWBA 1TT1A 1Y4CA 5H8QA 2ALUA 2G29A 1NUXA 1ZMGA 3E13X 2WX9A 4RNSA 3MBPA 3R26A 4G2ZA 4MLQA 4FJPA 3OD7A 4BDQA 4GIZA 3G3HA 4PAKA 2XWOA 3KOTA 1XS5A 2UYFA 4DXUA 2OWSA 4OXVA 3EKIA 1L5TA 1XVXA 1IXGA 2O84X 4QHQA 1SDXA 1FQBA 3RUMA 1QVSA 3FD3A 1SYIA 5HM4B 5J16A 4KPTA 1DCUA 4LZ7A 2Y84A 5ET7A 1NFTA 1DOTA 2ONKE 2DXYA 4OETA 2CEYA 2L5VA 4KQPA 4N07A 4LN5A 5HPQA 1JVXA 2REJA 1FPEA 1N7WA 1B3GA 1M5EA 4GX6A 4WEDA 1B7ZA 5I2KA 1FTJA 3FATA 2F3DA 3FXBA 4GOTA 4QSEA 1QKAA 5ITOA 2VT5A 1DMBA 3FJMA 3R6UA 1PC3A 4G68A 3G3GA 2QL3A 1VFDA 3V89B 1N3WA 2LAOA 1ZIUA 2VP1A 3JV9A 3Q26A 4ZE9A 4IO5A 2D5WA 2V4CA 5M2VA 2REGA 1PB7A 5IM2A 4DXCA 5IAIA 2PYYA 3N6UA 4QFKA 1MDP1 1AIVA 3IL1B 1MH3A 2ANJA 3IFAA 4FAJA 1INPA 1IMCA 2KR0A 5ESYA 1FTAA 1MXXA 2VHAA 3FV1A 5I3SA 1YYZA 1A99A 4XFEA 3WAEA 5I2KB 4BDNA 1QKBA 3MJNA 4ELRA 3HHGA 3CR9A 2HPGA 2XXTA 4F18A 2Y7IA 3C36A 4OVQA 2I3VA 1N84A 1O7TA 2ZXTA 5I57A 3IJOB 4KCCA 3TTKA 1DSNA 1IEJA 1GVCA 3VFJA 4YKIA 5DVIA 2FA7A 4O3AA 4F3PA 5DEXA 4THIA 1MXWA 1LB9A 4GD5A 4POXA 2H98A 4MIJA 1Y3QA 1EZOA 3W9WA 2H4IA 3PV0E 2W7YA 3RPLA 4E0WA 1DBZA 5DW8A 1P1OA 2DE3A 3MP6A 3HFUA 4NGUA 3T0JA 1LBWA 4LZ5A 1JEUA 3MZ9A 1Z7NE 5AA4A 3CRBA 1GTKA 2PFZA 4RXLA 5I57B 3K1PA 3VVFA 1NV0A 3H06B 2E0SA 1POTA 3KJTA 4F3BA 4GBWA 3MP8A 3QUFA 1MG1A 1UIUA 3O66A 3LBSA 3H03A 5ICQA 3FZVA 5DEXB 4EXKA 4DXBA 3RPWA 2AL5A 3LUZA 4F31B 4NHBA 2GRVA 3S9MC 3UP9A 3K4UA 2CEXA 1VFEA 2ZNUA 2XHDA 4PAIA 4YICA 3TZAA 2QS3A 4P3LA 5I7IA 2E1SA 1PBQA 4OFOA 1S50A 5I56A 4MHFA 2F97A 2XD3A 3VLWA 2Z8DA 4GX4A 3ZKLA 5CMKA 2OWZA 3MVWA 4AQ4A 1R6ZA 3V5AA 4MMPA 1TFAA 4ELQA 3DP4A 1N3XA 3T22A 1B7HA 3FVOA 3W9VA 3IORA 5LTCA 1LAHE 3B6QA 1BKAA 4EDPA 1NNTA 4WXJA 2XXIA 1XVYA 4Q30B 1FBPA 4TLMB 1D9YA 1NMUA 4FATA 5IZ3A 4MJOA 4EXLA 3GLBA 3FVKA 2BJIA 3SEYA 2O68A 4OVJA 1RDZA 1JQFA 1SQYA 1GGGA 3TQLA 4XEQA 3UIFA 3LV0A 2Z23A 3DELB 4MF3A 1QW0A 4I1DA 1FQFA 3LSXA 3H6VA 5AA3A 4P1LA 3T1BA 3OSRA 2Q8JA 4LATA 1JW4A 2AYSA 3IK6B 3MC2A 4F19A 2OCUA 3BKIB 4RPNA 3SEUA 1H43A 1MXYA 2QMXA 2GFEA 1QJMA 3U1OA 4OA4A 2RF1A 1MQDA 2FVZA 4QSDA 4ZS9A 1SI0A 2CZLA 3FVNA 1B6HA 1P1UA 1A7LA 1XHYA 3U92A 4GF8A 4N6KA 5IZ3B 4F39A 4POWA 3DP8A 3IOWA 3WAFA 4GXAA 4LQ2A 4EQ7A 1Y20A 1MQHA 4H8JA 3IR1A 1XI6A 1II5A 2H25A 2CZIA 2QVRA 4MBPA 4Q0CA 3E78A 5ICTA 4BDRA 3IB1A 3DP6A 2ESNA 1B3FA 3LR1A 3QMFA 3RLFE 1B3HA 4GFRA 3PMWA 2KQZA 4RK9A 3EHSA 2QVVA 3MP1A 3TKDA 4KD5A 4X48A 3K00A 3QAXA 2XXXA 2B65A 2WBDA 4OVRA 2XWVA 3H7MA 1US5A 2P3NA 4GWZA 1OQHA 4OQOA 3PPOA 1EH3A 1FTLA 1I6BA 2O1LA 2O1MA 4FECA 4NAPA 1PEBA 1RYXA 3T96B 3TQWA 4YB6A 1OIBA 1M5DA 4O94A 3KJ7A 4KFQA 1ELJA 4KHZE 3I3VA 3ECRA 2HCAA 1NNPA 1LLSA 4ECFA 1FPJA 3G7WA 4GXSB 4GWUA 2P1SA 1SPIA 1FPBA 2NXOA 4H5FA 4G4PA 3CFXA 3FJGA 4PCDA 4NWCA 4RJZA 2O6AA 3F11A 5L9OA 4U4XA 1MS7A 3MYUA 3ONMA 3T9UA 2XX7A 3DLNA 3KBZA 3VE1B 4GVOA 3RT8A 4DI3D 3TTMA 1R9LA 2DSFA 4DZ1A 3E9XA 2I0BA 2I6EA 5CRYA 3O97A 1I6AA 1UTBA 1J1NA 1LBXA 3K0VA 3VVEA 3VXCA 4HE0A 1FQDA 4ZZEA 3M3FA 1USYH 4G8MA 3IOTA 3OO7A 3SEXA 2QPQA 1MDQA 1TWYA 3TDJA 4NF4A 1LEVA 5AA2D 1LFHA 1B3EA 4YMAA 5ELVA 2FHYA 4DI4B 4KI0E 3TCFA 2ZZXA 1ATGA 4NEDA 2VD3A 4Q8RA 1YXIA 2B3BA 4I62A 4EF1A 1HSJA 1H44A 3CHGA 3PGFA 1ZLQA 1N7XA 4UABA 2ZYNA 4ZEFA 1KA0A 4X1BA 4PFUA 2RC7A 1UTBB 4QFLA 1FPIA 1B32A 3G3FA 3KC0A 3B8BA 4N8GA 1FTOA 3MVZA 2B4MA 5B7DA 4PFYA 2Z22A 2Z8FA 2F35A 4N8YA 3T66A 2CZKA 3VV5A 5FHOA 3ILUB 1PB8A 3OO9A 1K9ZA 4NF4B 5F7VA 1B52A 4PFBA 5CBRA 4PBHA 5EQ9A 5AE4A 1F9BA 2RC9A 4LZ8A 5H8FA 3Q28A 4OANA 1NV2A 3EHUA 1M5FA 4QFNA 4JB7A 1Y3NA 4BDLA 4NF0A 3UN6A 3K6VA 2DWJA 4GRKA 2H5YA 1G0IA 1FCKA 2CMOA 4OERA 3OEKA 3TPAA 3MW0A 5ET5A 1S7YA 1ZBMA 2R71A 3VDFA 3CIJA 2AL4A 4EUOA 1FTMA 4XKNA 4PBQA 4R73A 4IO7A 3IX1A 5L9MA 2P3VA 4ND9A 4GWSA 1AH5A 3OOAA 5IKBA 1YZ0A 4MNCA 3K02A 3MSTA 1EYIA 2DE4A 1B40A 1QUIA 3K6UA 3ISPA 4ESXA 3LSFB 1FBHA 4JDFA 2HXWA 2P0SA 2P2AA 1A55A 5CMBA 2H99A 1FBEA 2A5TA 5H8FB 4ONYA 1VSOA 2THIA 5ET6A 1H76A 3KN3A 1MM7A 3U72A 1H3DA 4P9KA 1K9YA 4IR8A 4YZZA 3PPNA 5KCJB 5JEIA 5JTYB 2WKYA 1B5JA 4XKRA 3C31A 4JWOA 5CM6A 1AMFA 4N4UA 1P1QA 2RCBA 3U94A 2DWAA 4X9TA 5BWJA 4N15A 1YAEA 3OEMA 2FIXA 2ZZWA 3M3KA 1EZ9A 3PPRA 4BLAA 1EU8A 5L9SA 3MUQA 4R72A 4AS5A 1MXUA 3EQ1A 4Z0IA 2XXRA 5TP9B 5AA1A 5FHNA 4GWWA 2PVUA 1MY0A 3HHFA 4H67A 3O6HA 1NV3A 2I3WA 2XWIA 3KGCA 4YKJA 3N6TA 2A5TB 1NV7A 2WEFA 4H65A 4HE2A 3TEPA 4ZDMA 2I58A 5A5LA 2O69A 2PFYA 3OO6A 1LFIA 2VOZA 2ZYOA 2I0CA 3RGYA 1BP5A 2QS4A 4NF8B 3SKPA 5EQ8A 2OK2A 1FQEA 3P7IA 1ZTYA 2HQ0A 4PC9A 3N5LA 5EQAA 1IITA 2Y7PA 3JZJA 3O6GA 4N81A 2PX1A 1O63A 1ANFA 3QYTA 3GBAA 1YPNA 2MKZA 4H45A 4GWOA 5LOMA 1BK4A 1JNFA 2GQ1A 1P99A 3OELA 4ISUA 5JK4A 3RTWB 4HTGA 1FPGA 4R6YA 2XX8A 2DP8A 4ZECA 1H45A 1RDXA 4F1UA 1RKMA 1OVTA 4KYEA 5EYGA 3FV2A 3FASA 3PMXA 3GBBA 4KYSA 4ZEIA 3DM0A 3PUYE 4DDDA 2WYKA 3PU5A 4JBZA 3TODA 2PBWA 4F3GA 4ESWA 1B1HA 3JYRA 4I40A 4MEVA 2XX9A 1MM6A 2FYIA 4NWDA 2V25A 1IXIA 4O8MA 2XXWA 5EHSA 1IMBA 3A29A 5TPAB 1LGBC 1NUWA 4QF9A 3PUZE 3G3KA 3KG2A 3TTLA 2D21A 2ABHA 3CG1A 5IGAA 3K01A 1SW5A 2H9BA 1Y3PA 1UIVA 4NMYA 1B2HA 1DTZA 1LSTA 2V3TA 1FBCA 3E79A 3PPPA 1FJ6A 4I3YA 4NTLA 4C1UA 1RYOA 4F2OA 4HE1A 4KXPA 3BFTA 4PFTA 1A8EA 4OEVA 2PT1A 4HS7A 2F3BA 2ZZVA 4R75A 2PCRA 2NVUB 1Y9UA 1GR2A 3GXAA 1LBYA 5H8HB 2NUVA 4MFIA 3SEWA 2Q2CA 4OENA 1NUZA 3KOSA 4G8NA 3O9PA 4O7MA 3CG3A 4KR5A 2XD2A 1ZJLA 2VPNA 3KN8A 5CBSA 3K1NA 4X1DA 4PF6A 3HCQA 2DE2A 1SVXB 3EN3A 3BIGA 4RA1A 1SD3A 3BBRA 4AB6A 3O28A 3PPQA 1NV4A 3B50A 3Q27A 2XXQA 1QUKA 1A54A 1Q1KA 1FQAA 1IMAA 4HCYA 4U2RA 5TU0A 2ONSA 1IZ1A 1B3LA 3FXQA 4QFPA 4U21A 1IMDA 1SW1A 3C9HA 3K6XA 1I69A 4G8HA 1NH7A 1CNQA 4GWYA 4LONB 1RDYA 1QULA 4RY1A 3D1RA 3D4CA 1NV5A 2JJKA 3MWBA 1SW2A 2XXHA 2ZYMA 1LFGA 3KBRA 3SEVA 3A3CA 4F1YA 4NX1A 1FQCA 3HO7A 1MPCA 3TELA 4PAFA 3RTFB 1XT8A 3VLVA 4ELOA 1NV6A 3D4GA 2UXAA 2F8DA 3MPKA 4F2QA 5F24A 1NI9A 4IGTA 4I9DA 1LBVA 3LSLA 4U1ZA 3PUWE 2XA5A 5I59B 2YPNA 3M8UA 3MZBA 3FIRA 5BUUA 5AA2B 3QK6A 1MXZA 3FVGA 3TFLA 2WYPA 4MNIA 2F6GA 4U1OA 3H6TA 1MXVA 3PD8A 2XXPA 2YLNA 3V8XB 3U8QA 1P1NA 4PDDA 5IZ1A 4IO4A 1FBGA 4GL0A 3HV1A 1B5IA 3FXUA 4JSDA 1T0KA 3FUZA 1LBCA 1US4A 3UA8A 2DWHA 1FRPA 4IY5A 4XF5A 1SYHA 2ZYKA 5I58A 2DYXA 4AB5A 4OVPA 5T3JA 1N76A 4XKQA 1B05A 4NN3A 4OVTA 5CI5A 1B7UA 1VE4A 1IUDA 2AIXA 3ZKKA 4X04A 3USDA 3QIMA 1DPEA 3ILTB 1FSAA 1XC1A 2B3FA 3SDFA 3L6HA 3UGWA 1AOVA 1OVBA 4R6KA 2DS9A 3W15C 3PTYA 1BIYA 2R8TA 3T9XB 1MPDA 3B6TA 3OO8A 4R6HA 1B9JA 4M4GA 1BLFA 2HZLA 2FBPA 2KLFA 4QBAA 2OWTA 2V3UA 4NF6A 3TUSA 2RKMA 3I6VA 4GQOA 4H5GA 4XIGQ 3A09A 5I58B 4JSOA 4O7IA 1Q9DA 3S4UA 4MH5A 1FJ9A 1MY1A 4NQ8A 1B0HA 4OVSA 4OYVA 2YJPA 5KDTA 3IOUA 1B5HA 4RYAA 3T93B 2XXYA 4JVDA 1D9QA 1OQGA 4ZEDA 3SERA 5K2YA 1Q35A 5DTBA 3ZS6A 4PFIA 1A40A 2RC8A 2DQVA 3SZPA 5KZTA 4K3FA 2DDKA 2Y7WA 3IJXB 4H46A 4F1VA 5FBPA 4DCYA 5A5XB 4JVCA 1NL5A 3H6WA 3VXBA 2Q8MA 4NF6B 4PFRA 1SW4A 4H0WA 2V3QA 4TLLB 2HEUA 2F6PA 1NKXA 4U22A 1MY4A 4F22A 3EF7A 1JW1A 4DLDA 2RINA 2GHBA 3GYYA 4JWXA 2ZNSA 1LCFA 4N6DA 3C32A 4G61A 2RCAA 5KDTB 4N91A 1M5CA 1IIWA 5IZZA 1OMPA 5KCJA 5JTYA 2VGQA 2X26A 1BTJA 3OENA
chains in the Genus database with same CATH topology
4RPOA 2DWIA 3THIA 4P0GA 1UTHB 4TOZA 1B46A 3L6GA 3MAMA 4YAHX 4H1XA 3QXMA 1QUJA 1TFDA 3Q25A 2QS2A 5K2XA 3IB2A 5H8QB 2ONRA 4F3SA 1Y4TA 3C4MA 5DT6A 2G93A 3EHTA 3KSJA 1POY1 4TQUQ 3LSWA 5TP9A 3G3IA 3IO6A 1D9VA 3TAJA 4O3CA 3H6UA 2O7UA 1HSLA 5ISUA 1NNFA 2D3IA 4R9GA 3TCHA 4WEPA 2Z8EA 4NF8A 3CVGA 3E4RA 3RNNA 4YB7A 4PFWA 4FEDA 1Y1MA 1PBPA 4OEUA 1LAFE 1FW0A 2M8CA 3U93A 2QJEA 3LC8A 2DVZA 3UORA 1NNKA 2Q9TA 4LVQA 1WDNA 2I4CA 3ODBA 1AL3A 3IO4A 1O64A 2UVIA 4IO6A 4M1VA 5DVFA 1JVYA 1KWHA 3S9EA 5FHMA 2R9JA 4U23A 4G68B 4YB5A 3SETA 1SBPA 4JXIA 4EQBA 1USYE 3H3GA 3N94A 3K2DA 3RN8A 3PMVA 1UQWA 1CE2A 2UVJA 3KN7A 3K1MA 4UA8A 1MQGA 3VLUA 1N0TA 5F1QA 3O2AA 4IO3A 4C0RA 1M5BA 5TPAA 4O3BA 2PMSA 3FXRA 3N26A 3RT6B 1WODA 3CSGA 4MLVA 1N04A 1MY2A 2F78A 1GV8A 2O7IA 1B1XA 4LA9A 4OTEA 2X7QA 3Q29A 1URGA 2I49A 4FIMA 5DYHA 2Q88A 4E0XA 4HCWA 3HPIA 4OWDA 4U4SA 5H8HA 4ZE8A 4H8IA 1MH4A 3UK4A 4IB2A 4UACA 3B7DA 4C1TA 2F7AA 4OHNA 4PQJA 3C35A 4YKKA 1DTGA 4NF5A 3HSTA 1B51A 2X7PA 1MY3A 3A3UA 2A5SA 1B58A 3G3JA 4JWYA 3ZSFA 1OLAA 3KFMA 3MZ1A 4ZEBA 3OXNA 1B0LA 3MVXA 3TCGA 2GH9A 1MQIA 4Z7EA 4DCXA 1Z7ME 5AA4B 4R2FA 2Y7RA 5EYFA 4RK2A 4FEBA 2VD2A 3RQTA 1CB6A 3T9HB 3KEIA 2F34A 2F5XA 2IEEA 1LBBA 3S2VA 4R74A 1SI1A 1S9TA 2F7CA 4LP2B 4BDOA 4IGRA 2ZMBA 2XXVA 4NF5B 3MVYA 3HN0A 4QFOA 4F29A 2GHAA 3BFUA 4P0IA 5ITPA 4OZ9A 1I6QA 4OMBA 1YCJA 1ZU0A 2OBGA 2QSXA 4YU0A 1OLCA 5I56B 2NWJA 1XOCA 5I59A 2HAUA 1VR5A 3MPLA 5L8DA 2V84A 1B4ZA 5I2NA 5AA2A 1LAGE 1LCTA 2UVGA 3I5OA 3KSXA 4G77A 3OMBA 3KZGA 3QSLA 2HZKA 4XTCQ 2IA4A 4OFJA 4L17A 1FTKA 1LAXA 1WVJA 1EZPA 2F36A 3PUVE 3S9NC 5FTIA 2QS1A 3S9LC 1URSA 3E3KA 3IOVA 1TXFA 1R9QA 3PUXE 2HFBA 4PETA 4WKMA 1D4NA 4R2BA 2Q89A 5CC2A 4OESA 4N6PA 3CSBA 5B70A 4G68C 4PE5B 4R9FA 4DIGA 3V83A 3SESA 2Q2AA 2Y7KA 1IXCA 4FE8A 5I2NB 2V93A 3CFLA 1LB8A 2DOJA 2O51A 5CMCA 4ZEKA 4PP0A 2PT2A 2ZNTA 3OSQA 1A8FA 5J1DA 2HAVA 3IAZA 2QRYA 4FORA 4QSCA 1MPBA 4KCDA 4HW8A 3CI8A 3TTRA 3M3LA 1MQJA 5I84A 1NH8A 4N13A 4P11A 2NOOA 1YTVA 4GLIA 4XXUA 4XKPA 1R1NA 2FNCA 3IB0A 5HBCA 5H8SA 5FTHA 1DPPA 4GL8A 1PDAA 4EQ9A 1Y1ZA 2R6GE 3O6IA 3B6WA 3O29A 4ELPA 2I4BA 3QUJA 5DVJA 3C33A 3MQ9A 2XXUA 5CMMA 4Q5TA 1B4HA 4EF2A 3H4ZA 1MRPA 3CFZA 3FJ7A 3T9VA 4H6DA 2BJJX 4IO2A 5H8NA 3AXFA 3TYHA 3LUYA 2DVCA 1HSEA 2QMWA 4KYDA 4I8CA 1IQ7A 1P1WA 4ZZAA 3VVDA 1URDA 2OJTA 2I48A 4YKPA 2UYEA 2OLBA 4LUBA 3RY3A 5A5XA 3R7XA 3C34A 1JETA 1JW5A 1IXHA 4BDMA 2OZZA 5EHMA 3K6WA 3FGSA 1PB9A 1JEVA 4OFLA 4NE4A 2DXRA 3TMGA 3PD9A 2UVHA 4IY6A 3GZGA 5H8NB 4QRZA 1UTHA 3EPEA 2F7BA 4LQ5A 4YMBA 1D3KA 3TTNA 4DE8A 1ZKBA 1TT1A 1Y4CA 5H8QA 2ALUA 2G29A 1ZMGA 3E13X 4RNSA 3MBPA 3R26A 4G2ZA 4MLQA 4FJPA 3OD7A 4BDQA 4GIZA 3G3HA 3KOTA 1XS5A 2UYFA 4DXUA 2OWSA 4OXVA 1L5TA 1XVXA 1IXGA 2O84X 4QHQA 1SDXA 1FQBA 3RUMA 1QVSA 3FD3A 1SYIA 5HM4B 4KPTA 4LZ7A 2Y84A 1NFTA 1DOTA 2ONKE 2DXYA 4OETA 4KQPA 4N07A 5HPQA 1JVXA 2REJA 1N7WA 1B3GA 1M5EA 4WEDA 1B7ZA 5I2KA 1FTJA 3FATA 4GOTA 4QSEA 1QKAA 5ITOA 1DMBA 3FJMA 3R6UA 1PC3A 4G68A 3G3GA 2QL3A 1VFDA 3V89B 1N3WA 2LAOA 1ZIUA 2VP1A 3JV9A 3Q26A 4ZE9A 4IO5A 2D5WA 5M2VA 2REGA 1PB7A 5IAIA 4DXCA 2PYYA 3N6UA 4QFKA 1MDP1 1AIVA 3IL1B 1MH3A 2ANJA 4FAJA 1MXXA 2VHAA 3FV1A 1A99A 3WAEA 5I2KB 4BDNA 1QKBA 3MJNA 4ELRA 3HHGA 3CR9A 2XXTA 4F18A 2Y7IA 3C36A 2I3VA 1N84A 1O7TA 2ZXTA 5I57A 3IJOB 4KCCA 3TTKA 1DSNA 1IEJA 1GVCA 3VFJA 4YKIA 5DVIA 2FA7A 4O3AA 4F3PA 5DEXA 4THIA 1MXWA 1LB9A 4GD5A 4POXA 2H98A 1Y3QA 1EZOA 3W9WA 2H4IA 3PV0E 2W7YA 4E0WA 1P1OA 2DE3A 3MP6A 4LZ5A 1JEUA 3MZ9A 1Z7NE 5AA4A 3CRBA 1GTKA 4RXLA 5I57B 3K1PA 3VVFA 3H06B 2E0SA 1POTA 3KJTA 4F3BA 3MP8A 3QUFA 1MG1A 1UIUA 3O66A 3LBSA 3H03A 5ICQA 3FZVA 5DEXB 4EXKA 4DXBA 3RPWA 2AL5A 4F31B 2GRVA 3S9MC 3UP9A 3K4UA 1VFEA 2ZNUA 2XHDA 4YICA 3TZAA 2QS3A 2E1SA 1PBQA 4OFOA 1S50A 5I56A 2F97A 2XD3A 3VLWA 2Z8DA 3ZKLA 5CMKA 3MVWA 4AQ4A 1R6ZA 3V5AA 1TFAA 4ELQA 3DP4A 1N3XA 3T22A 1B7HA 3FVOA 3W9VA 3IORA 1LAHE 3B6QA 1BKAA 4EDPA 1NNTA 4WXJA 2XXIA 1XVYA 4Q30B 4TLMB 1D9YA 1NMUA 4FATA 4EXLA 3GLBA 3FVKA 3SEYA 2O68A 4OVJA 1JQFA 1SQYA 1GGGA 3TQLA 3UIFA 2Z23A 3DELB 4MF3A 1QW0A 4I1DA 1FQFA 3LSXA 3H6VA 5AA3A 3OSRA 2Q8JA 4LATA 1JW4A 2AYSA 3IK6B 3MC2A 4F19A 2OCUA 3BKIB 4RPNA 3SEUA 1H43A 1MXYA 2QMXA 2GFEA 1QJMA 3U1OA 2RF1A 1MQDA 4QSDA 4ZS9A 1SI0A 2CZLA 3FVNA 1B6HA 1P1UA 1A7LA 1XHYA 3U92A 4GF8A 4F39A 4POWA 3DP8A 3IOWA 3WAFA 4GXAA 4LQ2A 4EQ7A 1Y20A 1MQHA 4H8JA 3IR1A 1II5A 2H25A 4MBPA 4Q0CA 5ICTA 4BDRA 3IB1A 3DP6A 2ESNA 1B3FA 3LR1A 3RLFE 1B3HA 4GFRA 3PMWA 4RK9A 3EHSA 3MP1A 3TKDA 4KD5A 4X48A 3K00A 3QAXA 2XXXA 2B65A 3H7MA 1US5A 1OQHA 4OQOA 3PPOA 1EH3A 1FTLA 1I6BA 2O1LA 2O1MA 4FECA 1PEBA 1RYXA 3T96B 3TQWA 4YB6A 1OIBA 1M5DA 3KJ7A 4KFQA 1ELJA 4KHZE 3I3VA 3ECRA 2HCAA 1NNPA 1LLSA 4ECFA 3G7WA 4GXSB 2P1SA 2NXOA 4H5FA 4G4PA 3CFXA 3FJGA 4NWCA 4RJZA 2O6AA 3F11A 5L9OA 4U4XA 1MS7A 3ONMA 3T9UA 2XX7A 3DLNA 3VE1B 4GVOA 3RT8A 3TTMA 1R9LA 2DSFA 4DZ1A 3E9XA 2I0BA 2I6EA 5CRYA 3O97A 1I6AA 1UTBA 1J1NA 3K0VA 3VVEA 3VXCA 1FQDA 4ZZEA 3M3FA 1USYH 4G8MA 3IOTA 3OO7A 3SEXA 2QPQA 1MDQA 1TWYA 3TDJA 4NF4A 5AA2D 1LFHA 1B3EA 4YMAA 5ELVA 4KI0E 3TCFA 1ATGA 4NEDA 2VD3A 4Q8RA 2B3BA 4I62A 4EF1A 1HSJA 1H44A 3PGFA 1ZLQA 1N7XA 2ZYNA 4ZEFA 4X1BA 4PFUA 2RC7A 1UTBB 4QFLA 1B32A 3G3FA 1FTOA 3MVZA 5B7DA 4PFYA 2Z22A 2Z8FA 2F35A 3T66A 3VV5A 5FHOA 3ILUB 1PB8A 3OO9A 4NF4B 5F7VA 1B52A 5CBRA 5AE4A 1F9BA 2RC9A 4LZ8A 5H8FA 3Q28A 3EHUA 1M5FA 4QFNA 4JB7A 1Y3NA 4BDLA 3UN6A 3K6VA 2DWJA 4GRKA 2H5YA 1FCKA 2CMOA 4OERA 3OEKA 3TPAA 3MW0A 1S7YA 1ZBMA 2R71A 3VDFA 3CIJA 2AL4A 4EUOA 1FTMA 4XKNA 4R73A 4IO7A 3IX1A 5L9MA 4ND9A 1AH5A 3OOAA 5IKBA 3K02A 3K6UA 2DE4A 1B40A 1QUIA 4ESXA 3LSFB 4JDFA 2HXWA 2P0SA 2P2AA 1A55A 5CMBA 2H99A 2A5TA 5H8FB 4ONYA 1VSOA 2THIA 1H76A 3KN3A 1MM7A 3U72A 1H3DA 4YZZA 3PPNA 5KCJB 5JEIA 5JTYB 2WKYA 1B5JA 4XKRA 3C31A 4JWOA 5CM6A 1AMFA 1P1QA 2RCBA 3U94A 2DWAA 4X9TA 5BWJA 1YAEA 3OEMA 3M3KA 1EZ9A 3PPRA 4BLAA 1EU8A 5L9SA 3MUQA 4R72A 1MXUA 3EQ1A 4Z0IA 2XXRA 5TP9B 5AA1A 5FHNA 2PVUA 1MY0A 3HHFA 4H67A 3O6HA 2I3WA 3KGCA 4YKJA 3N6TA 2A5TB 4H65A 3TEPA 4ZDMA 2I58A 2O69A 3OO6A 1LFIA 2VOZA 2ZYOA 2I0CA 3RGYA 1BP5A 2QS4A 4NF8B 3SKPA 2OK2A 1FQEA 1ZTYA 3P7IA 2HQ0A 3N5LA 1IITA 2Y7PA 3JZJA 3O6GA 2PX1A 1O63A 1ANFA 3QYTA 3GBAA 1YPNA 4GWOA 5LOMA 1JNFA 1P99A 3OELA 4ISUA 5JK4A 3RTWB 4HTGA 4R6YA 2XX8A 2DP8A 4ZECA 1H45A 4F1UA 1RKMA 1OVTA 4KYEA 3FV2A 3FASA 3PMXA 3GBBA 4KYSA 4ZEIA 3DM0A 3PUYE 4DDDA 3PU5A 4JBZA 3TODA 2PBWA 4F3GA 4ESWA 1B1HA 3JYRA 2XX9A 1MM6A 2FYIA 4NWDA 2V25A 1IXIA 2XXWA 5EHSA 5TPAB 1LGBC 4QF9A 3PUZE 3G3KA 3KG2A 3TTLA 2D21A 2ABHA 3CG1A 3K01A 1SW5A 2H9BA 1Y3PA 1UIVA 4NMYA 1B2HA 1DTZA 1LSTA 2V3TA 3PPPA 4C1UA 4NTLA 1RYOA 4F2OA 3BFTA 4PFTA 1A8EA 4OEVA 2PT1A 4HS7A 4R75A 2NVUB 1Y9UA 1GR2A 3GXAA 5H8HB 2NUVA 4MFIA 3SEWA 2Q2CA 4OENA 3KOSA 4G8NA 3O9PA 3CG3A 4KR5A 2XD2A 1ZJLA 3KN8A 5CBSA 3K1NA 4X1DA 3HCQA 2DE2A 1SVXB 3EN3A 4RA1A 1SD3A 3BBRA 4AB6A 3O28A 3PPQA 3Q27A 2XXQA 1QUKA 1A54A 1Q1KA 1FQAA 4HCYA 4U2RA 5TU0A 2ONSA 1IZ1A 1B3LA 3FXQA 4QFPA 4U21A 1SW1A 3C9HA 3K6XA 1I69A 4G8HA 1NH7A 4LONB 1QULA 4RY1A 3D4CA 3MWBA 1SW2A 2XXHA 2ZYMA 1LFGA 3KBRA 3SEVA 3A3CA 4F1YA 1FQCA 3HO7A 1MPCA 3TELA 3RTFB 1XT8A 3VLVA 4ELOA 3D4GA 2UXAA 2F8DA 3MPKA 4F2QA 4IGTA 4I9DA 3LSLA 4U1ZA 3PUWE 5I59B 2YPNA 3M8UA 3MZBA 3FIRA 5BUUA 5AA2B 3QK6A 1MXZA 3FVGA 3TFLA 2F6GA 4U1OA 3H6TA 1MXVA 3PD8A 2XXPA 2YLNA 3V8XB 3U8QA 1P1NA 4IO4A 4GL0A 3HV1A 1B5IA 3FXUA 4JSDA 1T0KA 3FUZA 1LBCA 1US4A 3UA8A 2DWHA 4IY5A 1SYHA 2ZYKA 5I58A 2DYXA 4AB5A 1N76A 4XKQA 1B05A 5CI5A 1B7UA 1VE4A 1IUDA 2AIXA 3ZKKA 3USDA 3QIMA 1DPEA 3ILTB 1XC1A 2B3FA 3SDFA 3L6HA 3UGWA 1AOVA 1OVBA 4R6KA 2DS9A 3W15C 1BIYA 3T9XB 1MPDA 3B6TA 3OO8A 4R6HA 1B9JA 4M4GA 1BLFA 2HZLA 2KLFA 2OWTA 2V3UA 4NF6A 3TUSA 2RKMA 3I6VA 4GQOA 4H5GA 4XIGQ 3A09A 5I58B 4JSOA 3S4UA 4MH5A 1MY1A 1B0HA 4OYVA 2YJPA 5KDTA 3IOUA 1B5HA 4RYAA 3T93B 2XXYA 1OQGA 4ZEDA 3SERA 5K2YA 1Q35A 5DTBA 3ZS6A 1A40A 2RC8A 2DQVA 5KZTA 4K3FA 2Y7WA 3IJXB 4F1VA 4DCYA 5A5XB 1NL5A 3H6WA 3VXBA 1SW4A 4H0WA 4NF6B 2V3QA 4TLLB 2HEUA 2F6PA 1NKXA 4U22A 1MY4A 4F22A 3EF7A 1JW1A 4DLDA 2RINA 2GHBA 4JWXA 2ZNSA 1LCFA 3C32A 2RCAA 5KDTB 1M5CA 1IIWA 1OMPA 5KCJA 5JTYA 2VGQA 2X26A 1BTJA 3OENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPO A;  2DWI A;  3THI A;  4P0G A;  1UTH B;  4TOZ A;  1B46 A;  3L6G A;  3MAM A;  4YAH X;  4H1X A;  3QXM A;  1QUJ A;  1TFD A;  3Q25 A;  2QS2 A;  5K2X A;  3IB2 A;  5H8Q B;  2ONR A;  4F3S A;  1Y4T A;  3C4M A;  5DT6 A;  2G93 A;  3EHT A;  3KSJ A;  1POY 1;  4TQU Q;  3LSW A;  5TP9 A;  3G3I A;  3IO6 A;  1D9V A;  3TAJ A;  4O3C A;  3H6U A;  2O7U A;  1HSL A;  5ISU A;  1NNF A;  2D3I A;  4R9G A;  3TCH A;  4WEP A;  2Z8E A;  4NF8 A;  3CVG A;  3E4R A;  3RNN A;  4YB7 A;  4PFW A;  4FED A;  1Y1M A;  1PBP A;  4OEU A;  1LAF E;  1FW0 A;  2M8C A;  3U93 A;  2QJE A;  3LC8 A;  2DVZ A;  3UOR A;  1NNK A;  2Q9T A;  4LVQ A;  1WDN A;  2I4C A;  3ODB A;  1AL3 A;  3IO4 A;  1O64 A;  2UVI A;  4IO6 A;  4M1V A;  5DVF A;  1JVY A;  1KWH A;  3S9E A;  5FHM A;  2R9J A;  4U23 A;  4G68 B;  4YB5 A;  3SET A;  1SBP A;  4JXI A;  4EQB A;  1USY E;  3H3G A;  3N94 A;  3K2D A;  3RN8 A;  3PMV A;  1UQW A;  1CE2 A;  2UVJ A;  3KN7 A;  3K1M A;  4UA8 A;  1MQG A;  3VLU A;  1N0T A;  5F1Q A;  3O2A A;  4IO3 A;  4C0R A;  1M5B A;  5TPA A;  4O3B A;  2PMS A;  3FXR A;  3N26 A;  3RT6 B;  1WOD A;  3CSG A;  4MLV A;  1N04 A;  1MY2 A;  2F78 A;  1GV8 A;  2O7I A;  1B1X A;  4LA9 A;  4OTE A;  2X7Q A;  3Q29 A;  1URG A;  2I49 A;  4FIM A;  5DYH A;  2Q88 A;  4E0X A;  4HCW A;  3HPI A;  4OWD A;  4U4S A;  5H8H A;  4ZE8 A;  4H8I A;  1MH4 A;  3UK4 A;  4IB2 A;  4UAC A;  3B7D A;  4C1T A;  2F7A A;  4OHN A;  4PQJ A;  3C35 A;  4YKK A;  1DTG A;  4NF5 A;  3HST A;  1B51 A;  2X7P A;  1MY3 A;  3A3U A;  2A5S A;  1B58 A;  3G3J A;  4JWY A;  3ZSF A;  1OLA A;  3KFM A;  3MZ1 A;  4ZEB A;  3OXN A;  1B0L A;  3MVX A;  3TCG A;  2GH9 A;  1MQI A;  4Z7E A;  4DCX A;  1Z7M E;  5AA4 B;  4R2F A;  2Y7R A;  5EYF A;  4RK2 A;  4FEB A;  2VD2 A;  3RQT A;  1CB6 A;  3T9H B;  3KEI A;  2F34 A;  2F5X A;  2IEE A;  1LBB A;  3S2V A;  4R74 A;  1SI1 A;  1S9T A;  2F7C A;  4LP2 B;  4BDO A;  4IGR A;  2ZMB A;  2XXV A;  4NF5 B;  3MVY A;  3HN0 A;  4QFO A;  4F29 A;  2GHA A;  3BFU A;  4P0I A;  5ITP A;  4OZ9 A;  1I6Q A;  4OMB A;  1YCJ A;  1ZU0 A;  2OBG A;  2QSX A;  4YU0 A;  1OLC A;  5I56 B;  2NWJ A;  1XOC A;  5I59 A;  2HAU A;  1VR5 A;  3MPL A;  5L8D A;  2V84 A;  1B4Z A;  5I2N A;  5AA2 A;  1LAG E;  1LCT A;  2UVG A;  3I5O A;  3KSX A;  4G77 A;  3OMB A;  3KZG A;  3QSL A;  2HZK A;  4XTC Q;  2IA4 A;  4OFJ A;  4L17 A;  1FTK A;  1LAX A;  1WVJ A;  1EZP A;  2F36 A;  3PUV E;  3S9N C;  5FTI A;  2QS1 A;  3S9L C;  1URS A;  3E3K A;  3IOV A;  1TXF A;  1R9Q A;  3PUX E;  2HFB A;  4PET A;  4WKM A;  1D4N A;  4R2B A;  2Q89 A;  5CC2 A;  4OES A;  4N6P A;  3CSB A;  5B70 A;  4G68 C;  4PE5 B;  4R9F A;  4DIG A;  3V83 A;  3SES A;  2Q2A A;  2Y7K A;  1IXC A;  4FE8 A;  5I2N B;  2V93 A;  3CFL A;  1LB8 A;  2DOJ A;  2O51 A;  5CMC A;  4ZEK A;  4PP0 A;  2PT2 A;  2ZNT A;  3OSQ A;  1A8F A;  5J1D A;  2HAV A;  3IAZ A;  2QRY A;  4FOR A;  4QSC A;  1MPB A;  4KCD A;  4HW8 A;  3CI8 A;  3TTR A;  3M3L A;  1MQJ A;  5I84 A;  1NH8 A;  4N13 A;  4P11 A;  2NOO A;  1YTV A;  4GLI A;  4XXU A;  4XKP A;  1R1N A;  2FNC A;  3IB0 A;  5HBC A;  5H8S A;  5FTH A;  1DPP A;  4GL8 A;  1PDA A;  4EQ9 A;  1Y1Z A;  2R6G E;  3O6I A;  3B6W A;  3O29 A;  4ELP A;  2I4B A;  3QUJ A;  5DVJ A;  3C33 A;  3MQ9 A;  2XXU A;  5CMM A;  4Q5T A;  1B4H A;  4EF2 A;  3H4Z A;  1MRP A;  3CFZ A;  3FJ7 A;  3T9V A;  4H6D A;  2BJJ X;  4IO2 A;  5H8N A;  3AXF A;  3TYH A;  3LUY A;  2DVC A;  1HSE A;  2QMW A;  4KYD A;  4I8C A;  1IQ7 A;  1P1W A;  4ZZA A;  3VVD A;  1URD A;  2OJT A;  2I48 A;  4YKP A;  2UYE A;  2OLB A;  4LUB A;  3RY3 A;  5A5X A;  3R7X A;  3C34 A;  1JET A;  1JW5 A;  1IXH A;  4BDM A;  2OZZ A;  5EHM A;  3K6W A;  3FGS A;  1PB9 A;  1JEV A;  4OFL A;  4NE4 A;  2DXR A;  3TMG A;  3PD9 A;  2UVH A;  4IY6 A;  3GZG A;  5H8N B;  4QRZ A;  1UTH A;  3EPE A;  2F7B A;  4LQ5 A;  4YMB A;  1D3K A;  3TTN A;  4DE8 A;  1ZKB A;  1TT1 A;  1Y4C A;  5H8Q A;  2ALU A;  2G29 A;  1ZMG A;  3E13 X;  4RNS A;  3MBP A;  3R26 A;  4G2Z A;  4MLQ A;  4FJP A;  3OD7 A;  4BDQ A;  4GIZ A;  3G3H A;  3KOT A;  1XS5 A;  2UYF A;  4DXU A;  2OWS A;  4OXV A;  1L5T A;  1XVX A;  1IXG A;  2O84 X;  4QHQ A;  1SDX A;  1FQB A;  3RUM A;  1QVS A;  3FD3 A;  1SYI A;  5HM4 B;  4KPT A;  4LZ7 A;  2Y84 A;  1NFT A;  1DOT A;  2ONK E;  2DXY A;  4OET A;  4KQP A;  4N07 A;  5HPQ A;  1JVX A;  2REJ A;  1N7W A;  1B3G A;  1M5E A;  4WED A;  1B7Z A;  5I2K A;  1FTJ A;  3FAT A;  4GOT A;  4QSE A;  1QKA A;  5ITO A;  1DMB A;  3FJM A;  3R6U A;  1PC3 A;  4G68 A;  3G3G A;  2QL3 A;  1VFD A;  3V89 B;  1N3W A;  2LAO A;  1ZIU A;  2VP1 A;  3JV9 A;  3Q26 A;  4ZE9 A;  4IO5 A;  2D5W A;  5M2V A;  2REG A;  1PB7 A;  5IAI A;  4DXC A;  2PYY A;  3N6U A;  4QFK A;  1MDP 1;  1AIV A;  3IL1 B;  1MH3 A;  2ANJ A;  4FAJ A;  1MXX A;  2VHA A;  3FV1 A;  1A99 A;  3WAE A;  5I2K B;  4BDN A;  1QKB A;  3MJN A;  4ELR A;  3HHG A;  3CR9 A;  2XXT A;  4F18 A;  2Y7I A;  3C36 A;  2I3V A;  1N84 A;  1O7T A;  2ZXT A;  5I57 A;  3IJO B;  4KCC A;  3TTK A;  1DSN A;  1IEJ A;  1GVC A;  3VFJ A;  4YKI A;  5DVI A;  2FA7 A;  4O3A A;  4F3P A;  5DEX A;  4THI A;  1MXW A;  1LB9 A;  4GD5 A;  4POX A;  2H98 A;  1Y3Q A;  1EZO A;  3W9W A;  2H4I A;  3PV0 E;  2W7Y A;  4E0W A;  1P1O A;  2DE3 A;  3MP6 A;  4LZ5 A;  1JEU A;  3MZ9 A;  1Z7N E;  5AA4 A;  3CRB A;  1GTK A;  4RXL A;  5I57 B;  3K1P A;  3VVF A;  3H06 B;  2E0S A;  1POT A;  3KJT A;  4F3B A;  3MP8 A;  3QUF A;  1MG1 A;  1UIU A;  3O66 A;  3LBS A;  3H03 A;  5ICQ A;  3FZV A;  5DEX B;  4EXK A;  4DXB A;  3RPW A;  2AL5 A;  4F31 B;  2GRV A;  3S9M C;  3UP9 A;  3K4U A;  1VFE A;  2ZNU A;  2XHD A;  4YIC A;  3TZA A;  2QS3 A;  2E1S A;  1PBQ A;  4OFO A;  1S50 A;  5I56 A;  2F97 A;  2XD3 A;  3VLW A;  2Z8D A;  3ZKL A;  5CMK A;  3MVW A;  4AQ4 A;  1R6Z A;  3V5A A;  1TFA A;  4ELQ A;  3DP4 A;  1N3X A;  3T22 A;  1B7H A;  3FVO A;  3W9V A;  3IOR A;  1LAH E;  3B6Q A;  1BKA A;  4EDP A;  1NNT A;  4WXJ A;  2XXI A;  1XVY A;  4Q30 B;  4TLM B;  1D9Y A;  1NMU A;  4FAT A;  4EXL A;  3GLB A;  3FVK A;  3SEY A;  2O68 A;  4OVJ A;  1JQF A;  1SQY A;  1GGG A;  3TQL A;  3UIF A;  2Z23 A;  3DEL B;  4MF3 A;  1QW0 A;  4I1D A;  1FQF A;  3LSX A;  3H6V A;  5AA3 A;  3OSR A;  2Q8J A;  4LAT A;  1JW4 A;  2AYS A;  3IK6 B;  3MC2 A;  4F19 A;  2OCU A;  3BKI B;  4RPN A;  3SEU A;  1H43 A;  1MXY A;  2QMX A;  2GFE A;  1QJM A;  3U1O A;  2RF1 A;  1MQD A;  4QSD A;  4ZS9 A;  1SI0 A;  2CZL A;  3FVN A;  1B6H A;  1P1U A;  1A7L A;  1XHY A;  3U92 A;  4GF8 A;  4F39 A;  4POW A;  3DP8 A;  3IOW A;  3WAF A;  4GXA A;  4LQ2 A;  4EQ7 A;  1Y20 A;  1MQH A;  4H8J A;  3IR1 A;  1II5 A;  2H25 A;  4MBP A;  4Q0C A;  5ICT A;  4BDR A;  3IB1 A;  3DP6 A;  2ESN A;  1B3F A;  3LR1 A;  3RLF E;  1B3H A;  4GFR A;  3PMW A;  4RK9 A;  3EHS A;  3MP1 A;  3TKD A;  4KD5 A;  4X48 A;  3K00 A;  3QAX A;  2XXX A;  2B65 A;  3H7M A;  1US5 A;  1OQH A;  4OQO A;  3PPO A;  1EH3 A;  1FTL A;  1I6B A;  2O1L A;  2O1M A;  4FEC A;  1PEB A;  1RYX A;  3T96 B;  3TQW A;  4YB6 A;  1OIB A;  1M5D A;  3KJ7 A;  4KFQ A;  1ELJ A;  4KHZ E;  3I3V A;  3ECR A;  2HCA A;  1NNP A;  1LLS A;  4ECF A;  3G7W A;  4GXS B;  2P1S A;  2NXO A;  4H5F A;  4G4P A;  3CFX A;  3FJG A;  4NWC A;  4RJZ A;  2O6A A;  3F11 A;  5L9O A;  4U4X A;  1MS7 A;  3ONM A;  3T9U A;  2XX7 A;  3DLN A;  3VE1 B;  4GVO A;  3RT8 A;  3TTM A;  1R9L A;  2DSF A;  4DZ1 A;  3E9X A;  2I0B A;  2I6E A;  5CRY A;  3O97 A;  1I6A A;  1UTB A;  1J1N A;  3K0V A;  3VVE A;  3VXC A;  1FQD A;  4ZZE A;  3M3F A;  1USY H;  4G8M A;  3IOT A;  3OO7 A;  3SEX A;  2QPQ A;  1MDQ A;  1TWY A;  3TDJ A;  4NF4 A;  5AA2 D;  1LFH A;  1B3E A;  4YMA A;  5ELV A;  4KI0 E;  3TCF A;  1ATG A;  4NED A;  2VD3 A;  4Q8R A;  2B3B A;  4I62 A;  4EF1 A;  1HSJ A;  1H44 A;  3PGF A;  1ZLQ A;  1N7X A;  2ZYN A;  4ZEF A;  4X1B A;  4PFU A;  2RC7 A;  1UTB B;  4QFL A;  1B32 A;  3G3F A;  1FTO A;  3MVZ A;  5B7D A;  4PFY A;  2Z22 A;  2Z8F A;  2F35 A;  3T66 A;  3VV5 A;  5FHO A;  3ILU B;  1PB8 A;  3OO9 A;  4NF4 B;  5F7V A;  1B52 A;  5CBR A;  5AE4 A;  1F9B A;  2RC9 A;  4LZ8 A;  5H8F A;  3Q28 A;  3EHU A;  1M5F A;  4QFN A;  4JB7 A;  1Y3N A;  4BDL A;  3UN6 A;  3K6V A;  2DWJ A;  4GRK A;  2H5Y A;  1FCK A;  2CMO A;  4OER A;  3OEK A;  3TPA A;  3MW0 A;  1S7Y A;  1ZBM A;  2R71 A;  3VDF A;  3CIJ A;  2AL4 A;  4EUO A;  1FTM A;  4XKN A;  4R73 A;  4IO7 A;  3IX1 A;  5L9M A;  4ND9 A;  1AH5 A;  3OOA A;  5IKB A;  3K02 A;  3K6U A;  2DE4 A;  1B40 A;  1QUI A;  4ESX A;  3LSF B;  4JDF A;  2HXW A;  2P0S A;  2P2A A;  1A55 A;  5CMB A;  2H99 A;  2A5T A;  5H8F B;  4ONY A;  1VSO A;  2THI A;  1H76 A;  3KN3 A;  1MM7 A;  3U72 A;  1H3D A;  4YZZ A;  3PPN A;  5KCJ B;  5JEI A;  5JTY B;  2WKY A;  1B5J A;  4XKR A;  3C31 A;  4JWO A;  5CM6 A;  1AMF A;  1P1Q A;  2RCB A;  3U94 A;  2DWA A;  4X9T A;  5BWJ A;  1YAE A;  3OEM A;  3M3K A;  1EZ9 A;  3PPR A;  4BLA A;  1EU8 A;  5L9S A;  3MUQ A;  4R72 A;  1MXU A;  3EQ1 A;  4Z0I A;  2XXR A;  5TP9 B;  5AA1 A;  5FHN A;  2PVU A;  1MY0 A;  3HHF A;  4H67 A;  3O6H A;  2I3W A;  3KGC A;  4YKJ A;  3N6T A;  2A5T B;  4H65 A;  3TEP A;  4ZDM A;  2I58 A;  2O69 A;  3OO6 A;  1LFI A;  2VOZ A;  2ZYO A;  2I0C A;  3RGY A;  1BP5 A;  2QS4 A;  4NF8 B;  3SKP A;  2OK2 A;  1FQE A;  1ZTY A;  3P7I A;  2HQ0 A;  3N5L A;  1IIT A;  2Y7P A;  3JZJ A;  3O6G A;  2PX1 A;  1O63 A;  1ANF A;  3QYT A;  3GBA A;  1YPN A;  4GWO A;  5LOM A;  1JNF A;  1P99 A;  3OEL A;  4ISU A;  5JK4 A;  3RTW B;  4HTG A;  4R6Y A;  2XX8 A;  2DP8 A;  4ZEC A;  1H45 A;  4F1U A;  1RKM A;  1OVT A;  4KYE A;  3FV2 A;  3FAS A;  3PMX A;  3GBB A;  4KYS A;  4ZEI A;  3DM0 A;  3PUY E;  4DDD A;  3PU5 A;  4JBZ A;  3TOD A;  2PBW A;  4F3G A;  4ESW A;  1B1H A;  3JYR A;  2XX9 A;  1MM6 A;  2FYI A;  4NWD A;  2V25 A;  1IXI A;  2XXW A;  5EHS A;  5TPA B;  1LGB C;  4QF9 A;  3PUZ E;  3G3K A;  3KG2 A;  3TTL A;  2D21 A;  2ABH A;  3CG1 A;  3K01 A;  1SW5 A;  2H9B A;  1Y3P A;  1UIV A;  4NMY A;  1B2H A;  1DTZ A;  1LST A;  2V3T A;  3PPP A;  4C1U A;  4NTL A;  1RYO A;  4F2O A;  3BFT A;  4PFT A;  1A8E A;  4OEV A;  2PT1 A;  4HS7 A;  4R75 A;  2NVU B;  1Y9U A;  1GR2 A;  3GXA A;  5H8H B;  2NUV A;  4MFI A;  3SEW A;  2Q2C A;  4OEN A;  3KOS A;  4G8N A;  3O9P A;  3CG3 A;  4KR5 A;  2XD2 A;  1ZJL A;  3KN8 A;  5CBS A;  3K1N A;  4X1D A;  3HCQ A;  2DE2 A;  1SVX B;  3EN3 A;  4RA1 A;  1SD3 A;  3BBR A;  4AB6 A;  3O28 A;  3PPQ A;  3Q27 A;  2XXQ A;  1QUK A;  1A54 A;  1Q1K A;  1FQA A;  4HCY A;  4U2R A;  5TU0 A;  2ONS A;  1IZ1 A;  1B3L A;  3FXQ A;  4QFP A;  4U21 A;  1SW1 A;  3C9H A;  3K6X A;  1I69 A;  4G8H A;  1NH7 A;  4LON B;  1QUL A;  4RY1 A;  3D4C A;  3MWB A;  1SW2 A;  2XXH A;  2ZYM A;  1LFG A;  3KBR A;  3SEV A;  3A3C A;  4F1Y A;  1FQC A;  3HO7 A;  1MPC A;  3TEL A;  3RTF B;  1XT8 A;  3VLV A;  4ELO A;  3D4G A;  2UXA A;  2F8D A;  3MPK A;  4F2Q A;  4IGT A;  4I9D A;  3LSL A;  4U1Z A;  3PUW E;  5I59 B;  2YPN A;  3M8U A;  3MZB A;  3FIR A;  5BUU A;  5AA2 B;  3QK6 A;  1MXZ A;  3FVG A;  3TFL A;  2F6G A;  4U1O A;  3H6T A;  1MXV A;  3PD8 A;  2XXP A;  2YLN A;  3V8X B;  3U8Q A;  1P1N A;  4IO4 A;  4GL0 A;  3HV1 A;  1B5I A;  3FXU A;  4JSD A;  1T0K A;  3FUZ A;  1LBC A;  1US4 A;  3UA8 A;  2DWH A;  4IY5 A;  1SYH A;  2ZYK A;  5I58 A;  2DYX A;  4AB5 A;  1N76 A;  4XKQ A;  1B05 A;  5CI5 A;  1B7U A;  1VE4 A;  1IUD A;  2AIX A;  3ZKK A;  3USD A;  3QIM A;  1DPE A;  3ILT B;  1XC1 A;  2B3F A;  3SDF A;  3L6H A;  3UGW A;  1AOV A;  1OVB A;  4R6K A;  2DS9 A;  3W15 C;  1BIY A;  3T9X B;  1MPD A;  3B6T A;  3OO8 A;  4R6H A;  1B9J A;  4M4G A;  1BLF A;  2HZL A;  2KLF A;  2OWT A;  2V3U A;  4NF6 A;  3TUS A;  2RKM A;  3I6V A;  4GQO A;  4H5G A;  4XIG Q;  3A09 A;  5I58 B;  4JSO A;  3S4U A;  4MH5 A;  1MY1 A;  1B0H A;  4OYV A;  2YJP A;  5KDT A;  3IOU A;  1B5H A;  4RYA A;  3T93 B;  2XXY A;  1OQG A;  4ZED A;  3SER A;  5K2Y A;  1Q35 A;  5DTB A;  3ZS6 A;  1A40 A;  2RC8 A;  2DQV A;  5KZT A;  4K3F A;  2Y7W A;  3IJX B;  4F1V A;  4DCY A;  5A5X B;  1NL5 A;  3H6W A;  3VXB A;  1SW4 A;  4H0W A;  4NF6 B;  2V3Q A;  4TLL B;  2HEU A;  2F6P A;  1NKX A;  4U22 A;  1MY4 A;  4F22 A;  3EF7 A;  1JW1 A;  4DLD A;  2RIN A;  2GHB A;  4JWX A;  2ZNS A;  1LCF A;  3C32 A;  2RCA A;  5KDT B;  1M5C A;  1IIW A;  1OMP A;  5KCJ A;  5JTY A;  2VGQ A;  2X26 A;  1BTJ A;  3OEN A; 
#chains in the Genus database with same CATH topology
 4RPO A;  1FBF A;  2DWI A;  3THI A;  4P0G A;  1UTH B;  4TOZ A;  1B46 A;  3L6G A;  3MAM A;  4YAH X;  4H1X A;  3QXM A;  1QUJ A;  1TFD A;  3Q25 A;  2QS2 A;  5K2X A;  3IB2 A;  4MCO A;  5H8Q B;  2ONR A;  4F3S A;  1Y4T A;  2Q74 A;  3C4M A;  5DT6 A;  2G93 A;  3EHT A;  3KSJ A;  1POY 1;  4TQU Q;  3LSW A;  5TP9 A;  3G3I A;  3IO6 A;  4HXV A;  1D9V A;  1VDW A;  3TAJ A;  4O3C A;  3RYD A;  3H6U A;  2O7U A;  1HSL A;  4MAG A;  5ISU A;  1NNF A;  2D3I A;  4R9G A;  3TCH A;  4WEP A;  2Z8E A;  4NF8 A;  3CVG A;  3E4R A;  2WBB A;  1FPK A;  3RNN A;  4YB7 A;  4PFW A;  4FED A;  1Y1M A;  2B4L A;  1PBP A;  4OEU A;  1LAF E;  1FW0 A;  2M8C A;  3U93 A;  2QJE A;  3LC8 A;  2DVZ A;  3UOR A;  1NNK A;  2Y5L A;  2Q9T A;  4LVQ A;  1WDN A;  2I4C A;  5EYH A;  3ODB A;  1AL3 A;  3IFC A;  3IO4 A;  1O64 A;  2UVI A;  4IO6 A;  4M1V A;  5DVF A;  1JVY A;  1KWH A;  3S9E A;  1LBZ A;  5FHM A;  2R9J A;  4U23 A;  2VPO A;  4G68 B;  4YB5 A;  3SET A;  1SBP A;  4JXI A;  1NUY A;  4EQB A;  1USY E;  3H3G A;  4P47 A;  2XWK A;  3N94 A;  3K2D A;  3RN8 A;  3PMV A;  1UQW A;  1CE2 A;  4X8R A;  2UVJ A;  3KN7 A;  3K1M A;  4UA8 A;  1MQG A;  3VLU A;  1N0T A;  5F1Q A;  3O2A A;  4IO3 A;  4C0R A;  1M5B A;  2FIE A;  5TPA A;  4O3B A;  2PMS A;  3FXR A;  3N26 A;  3RT6 B;  1WOD A;  4NG7 A;  3CSG A;  4MLV A;  1N04 A;  1MY2 A;  2F78 A;  1GV8 A;  2O7I A;  1B1X A;  4LA9 A;  4OTE A;  2X7Q A;  3Q29 A;  1URG A;  2I49 A;  4FIM A;  5DYH A;  2Q88 A;  4E0X A;  4I3E A;  3ROJ A;  1IME A;  4HCW A;  3HPI A;  4OWD A;  4U4S A;  5H8H A;  4ZE8 A;  4H8I A;  4AS4 A;  1MH4 A;  3UK4 A;  4N17 A;  4IB2 A;  4UAC A;  3B7D A;  4C1T A;  2F7A A;  4OHN A;  1KA1 A;  4PQJ A;  4MX6 A;  3C35 A;  1DTG A;  4YKK A;  2CZH A;  4NF5 A;  4PF8 A;  3HST A;  1B51 A;  4GWX A;  3RPL B;  2X7P A;  1MY3 A;  3A3U A;  2HHM A;  2A5S A;  1B58 A;  3G3J A;  4JWY A;  3ZSF A;  1OLA A;  3KFM A;  3MZ1 A;  2OX3 A;  4ZEB A;  1KZ8 A;  3OXN A;  1B0L A;  3MVX A;  3TCG A;  2GH9 A;  1MQI A;  4Z7E A;  4QXD A;  4DCX A;  1Z7M E;  5AA4 B;  4R2F A;  4P8B A;  2Y7R A;  5EYF A;  4RK2 A;  4FEB A;  2VD2 A;  5LDZ A;  3RQT A;  1CB6 A;  3T9H B;  3KEI A;  2F34 A;  2F5X A;  2IEE A;  4FBP A;  1LBB A;  3S2V A;  4R74 A;  1SI1 A;  1S9T A;  2F7C A;  4LP2 B;  4P1E A;  4BDO A;  4IGR A;  2ZMB A;  3FBP A;  2XXV A;  4NF5 B;  3MVY A;  3HN0 A;  4QFO A;  4F29 A;  2GHA A;  3BFU A;  1FPD A;  4P0I A;  5ITP A;  4OZ9 A;  1I6Q A;  4OMB A;  1YCJ A;  1ZU0 A;  2OBG A;  2QSX A;  4P56 A;  4YU0 A;  1OLC A;  5I56 B;  1G0H A;  1DK4 A;  3KC1 A;  2NWJ A;  1XOC A;  5I59 A;  2HAU A;  1VR5 A;  3MPL A;  5L8D A;  2V84 A;  1B4Z A;  1IMF A;  5ET8 A;  5I2N A;  5AA2 A;  1LAG E;  1LCT A;  2UVG A;  3I5O A;  3KSX A;  5EQ7 A;  4G77 A;  3OMB A;  3KZG A;  3QSL A;  2HZK A;  4XTC Q;  2IA4 A;  4OFJ A;  4L17 A;  1FTK A;  1QGX A;  1LAX A;  1WVJ A;  1EZP A;  1JP4 A;  2F36 A;  3PUV E;  3S9N C;  4JVI A;  5FTI A;  2QS1 A;  3S9L C;  1URS A;  2QVU A;  3E3K A;  1FBD A;  3IOV A;  1TXF A;  1R9Q A;  3PUX E;  2HFB A;  3U65 A;  4PET A;  4WKM A;  1D4N A;  4R2B A;  2Q89 A;  5CC2 A;  4OES A;  4N6P A;  3NOH A;  3CSB A;  5B70 A;  4G68 C;  4PE5 B;  4R9F A;  4DIG A;  3BIH A;  3V83 A;  3SES A;  2Q2A A;  2Y7K A;  1IXC A;  4FE8 A;  5I2N B;  2V93 A;  3CFL A;  1LB8 A;  2DOJ A;  2O51 A;  5CMC A;  4ZEK A;  4PP0 A;  4PGN A;  2PT2 A;  2ZNT A;  3OSQ A;  1A8F A;  5J1D A;  2HAV A;  3IAZ A;  2QRY A;  4FOR A;  4QSC A;  1MPB A;  4KCD A;  4HW8 A;  3CI8 A;  3TTR A;  3M3L A;  1MQJ A;  2Y5K A;  5I84 A;  1NH8 A;  4N13 A;  4GX3 A;  2NOO A;  1YTV A;  4P11 A;  4GLI A;  4XXU A;  2XXK A;  4XKP A;  1R1N A;  2FNC A;  3IB0 A;  5HBC A;  5H8S A;  5FTH A;  1DPP A;  4GL8 A;  4PDH A;  4PTK A;  1PDA A;  4EQ9 A;  1Y1Z A;  2R6G E;  3O6I A;  3B6W A;  2QFL A;  3O29 A;  4ELP A;  2I4B A;  5I5P A;  3QUJ A;  5DVJ A;  3C33 A;  3MQ9 A;  2XXU A;  5CMM A;  4Q5T A;  1B4H A;  4EF2 A;  1EYJ A;  3H4Z A;  1EYK A;  1MRP A;  3CFZ A;  3FJ7 A;  3T9V A;  4H6D A;  2BJJ X;  4IO2 A;  5H8N A;  3AXF A;  3TYH A;  1FPL A;  3LUY A;  4GBV A;  2DVC A;  1HSE A;  1NV1 A;  2QMW A;  4KYD A;  4I8C A;  4PE3 A;  1IQ7 A;  1P1W A;  4ZZA A;  3VVD A;  1URD A;  2OJT A;  2I48 A;  4YKP A;  2UYE A;  2OLB A;  4LUB A;  4PGP A;  3RY3 A;  5A5X A;  3R7X A;  3C34 A;  1JET A;  1FPF A;  1JW5 A;  1IXH A;  4BDM A;  2OZZ A;  4MNP A;  5EHM A;  3K6W A;  3FGS A;  2HXR A;  1PB9 A;  1JEV A;  4OFL A;  4NE4 A;  2DXR A;  3TMG A;  3PD9 A;  2UVH A;  4IY6 A;  3GZG A;  5H8N B;  4QRZ A;  1UTH A;  3EPE A;  2F7B A;  4LQ5 A;  4YMB A;  1D3K A;  3TTN A;  4DE8 A;  1ZKB A;  1AWB A;  1TT1 A;  1Y4C A;  5H8Q A;  2ALU A;  2G29 A;  1NUX A;  1ZMG A;  3E13 X;  2WX9 A;  4RNS A;  3MBP A;  3R26 A;  4G2Z A;  4MLQ A;  4FJP A;  3OD7 A;  4BDQ A;  4GIZ A;  3G3H A;  4PAK A;  2XWO A;  3KOT A;  1XS5 A;  2UYF A;  4DXU A;  2OWS A;  4OXV A;  3EKI A;  1L5T A;  1XVX A;  1IXG A;  2O84 X;  4QHQ A;  1SDX A;  1FQB A;  3RUM A;  1QVS A;  3FD3 A;  1SYI A;  5HM4 B;  5J16 A;  4KPT A;  1DCU A;  4LZ7 A;  2Y84 A;  5ET7 A;  1NFT A;  1DOT A;  2ONK E;  2DXY A;  4OET A;  2CEY A;  2L5V A;  4KQP A;  4N07 A;  4LN5 A;  5HPQ A;  1JVX A;  2REJ A;  1FPE A;  1N7W A;  1B3G A;  1M5E A;  4GX6 A;  4WED A;  1B7Z A;  5I2K A;  1FTJ A;  3FAT A;  2F3D A;  3FXB A;  4GOT A;  4QSE A;  1QKA A;  5ITO A;  2VT5 A;  1DMB A;  3FJM A;  3R6U A;  1PC3 A;  4G68 A;  3G3G A;  2QL3 A;  1VFD A;  3V89 B;  1N3W A;  2LAO A;  1ZIU A;  2VP1 A;  3JV9 A;  3Q26 A;  4ZE9 A;  4IO5 A;  2D5W A;  2V4C A;  5M2V A;  2REG A;  1PB7 A;  5IM2 A;  4DXC A;  5IAI A;  2PYY A;  3N6U A;  4QFK A;  1MDP 1;  1AIV A;  3IL1 B;  1MH3 A;  2ANJ A;  3IFA A;  4FAJ A;  1INP A;  1IMC A;  2KR0 A;  5ESY A;  1FTA A;  1MXX A;  2VHA A;  3FV1 A;  5I3S A;  1YYZ A;  1A99 A;  4XFE A;  3WAE A;  5I2K B;  4BDN A;  1QKB A;  3MJN A;  4ELR A;  3HHG A;  3CR9 A;  2HPG A;  2XXT A;  4F18 A;  2Y7I A;  3C36 A;  4OVQ A;  2I3V A;  1N84 A;  1O7T A;  2ZXT A;  5I57 A;  3IJO B;  4KCC A;  3TTK A;  1DSN A;  1IEJ A;  1GVC A;  3VFJ A;  4YKI A;  5DVI A;  2FA7 A;  4O3A A;  4F3P A;  5DEX A;  4THI A;  1MXW A;  1LB9 A;  4GD5 A;  4POX A;  2H98 A;  4MIJ A;  1Y3Q A;  1EZO A;  3W9W A;  2H4I A;  3PV0 E;  2W7Y A;  3RPL A;  4E0W A;  1DBZ A;  5DW8 A;  1P1O A;  2DE3 A;  3MP6 A;  3HFU A;  4NGU A;  3T0J A;  1LBW A;  4LZ5 A;  1JEU A;  3MZ9 A;  1Z7N E;  5AA4 A;  3CRB A;  1GTK A;  2PFZ A;  4RXL A;  5I57 B;  3K1P A;  3VVF A;  1NV0 A;  3H06 B;  2E0S A;  1POT A;  3KJT A;  4F3B A;  4GBW A;  3MP8 A;  3QUF A;  1MG1 A;  1UIU A;  3O66 A;  3LBS A;  3H03 A;  5ICQ A;  3FZV A;  5DEX B;  4EXK A;  4DXB A;  3RPW A;  2AL5 A;  3LUZ A;  4F31 B;  4NHB A;  2GRV A;  3S9M C;  3UP9 A;  3K4U A;  2CEX A;  1VFE A;  2ZNU A;  2XHD A;  4PAI A;  4YIC A;  3TZA A;  2QS3 A;  4P3L A;  5I7I A;  2E1S A;  1PBQ A;  4OFO A;  1S50 A;  5I56 A;  4MHF A;  2F97 A;  2XD3 A;  3VLW A;  2Z8D A;  4GX4 A;  3ZKL A;  5CMK A;  2OWZ A;  3MVW A;  4AQ4 A;  1R6Z A;  3V5A A;  4MMP A;  1TFA A;  4ELQ A;  3DP4 A;  1N3X A;  3T22 A;  1B7H A;  3FVO A;  3W9V A;  3IOR A;  5LTC A;  1LAH E;  3B6Q A;  1BKA A;  4EDP A;  1NNT A;  4WXJ A;  2XXI A;  1XVY A;  4Q30 B;  1FBP A;  4TLM B;  1D9Y A;  1NMU A;  4FAT A;  5IZ3 A;  4MJO A;  4EXL A;  3GLB A;  3FVK A;  2BJI A;  3SEY A;  2O68 A;  4OVJ A;  1RDZ A;  1JQF A;  1SQY A;  1GGG A;  3TQL A;  4XEQ A;  3UIF A;  3LV0 A;  2Z23 A;  3DEL B;  4MF3 A;  1QW0 A;  4I1D A;  1FQF A;  3LSX A;  3H6V A;  5AA3 A;  4P1L A;  3T1B A;  3OSR A;  2Q8J A;  4LAT A;  1JW4 A;  2AYS A;  3IK6 B;  3MC2 A;  4F19 A;  2OCU A;  3BKI B;  4RPN A;  3SEU A;  1H43 A;  1MXY A;  2QMX A;  2GFE A;  1QJM A;  3U1O A;  4OA4 A;  2RF1 A;  1MQD A;  2FVZ A;  4QSD A;  4ZS9 A;  1SI0 A;  2CZL A;  3FVN A;  1B6H A;  1P1U A;  1A7L A;  1XHY A;  3U92 A;  4GF8 A;  4N6K A;  5IZ3 B;  4F39 A;  4POW A;  3DP8 A;  3IOW A;  3WAF A;  4GXA A;  4LQ2 A;  4EQ7 A;  1Y20 A;  1MQH A;  4H8J A;  3IR1 A;  1XI6 A;  1II5 A;  2H25 A;  2CZI A;  2QVR A;  4MBP A;  4Q0C A;  3E78 A;  5ICT A;  4BDR A;  3IB1 A;  3DP6 A;  2ESN A;  1B3F A;  3LR1 A;  3QMF A;  3RLF E;  1B3H A;  4GFR A;  3PMW A;  2KQZ A;  4RK9 A;  3EHS A;  2QVV A;  3MP1 A;  3TKD A;  4KD5 A;  4X48 A;  3K00 A;  3QAX A;  2XXX A;  2B65 A;  2WBD A;  4OVR A;  2XWV A;  3H7M A;  1US5 A;  2P3N A;  4GWZ A;  1OQH A;  4OQO A;  3PPO A;  1EH3 A;  1FTL A;  1I6B A;  2O1L A;  2O1M A;  4FEC A;  4NAP A;  1PEB A;  1RYX A;  3T96 B;  3TQW A;  4YB6 A;  1OIB A;  1M5D A;  4O94 A;  3KJ7 A;  4KFQ A;  1ELJ A;  4KHZ E;  3I3V A;  3ECR A;  2HCA A;  1NNP A;  1LLS A;  4ECF A;  1FPJ A;  3G7W A;  4GXS B;  4GWU A;  2P1S A;  1SPI A;  1FPB A;  2NXO A;  4H5F A;  4G4P A;  3CFX A;  3FJG A;  4PCD A;  4NWC A;  4RJZ A;  2O6A A;  3F11 A;  5L9O A;  4U4X A;  1MS7 A;  3MYU A;  3ONM A;  3T9U A;  2XX7 A;  3DLN A;  3KBZ A;  3VE1 B;  4GVO A;  3RT8 A;  4DI3 D;  3TTM A;  1R9L A;  2DSF A;  4DZ1 A;  3E9X A;  2I0B A;  2I6E A;  5CRY A;  3O97 A;  1I6A A;  1UTB A;  1J1N A;  1LBX A;  3K0V A;  3VVE A;  3VXC A;  4HE0 A;  1FQD A;  4ZZE A;  3M3F A;  1USY H;  4G8M A;  3IOT A;  3OO7 A;  3SEX A;  2QPQ A;  1MDQ A;  1TWY A;  3TDJ A;  4NF4 A;  1LEV A;  5AA2 D;  1LFH A;  1B3E A;  4YMA A;  5ELV A;  2FHY A;  4DI4 B;  4KI0 E;  3TCF A;  2ZZX A;  1ATG A;  4NED A;  2VD3 A;  4Q8R A;  1YXI A;  2B3B A;  4I62 A;  4EF1 A;  1HSJ A;  1H44 A;  3CHG A;  3PGF A;  1ZLQ A;  1N7X A;  4UAB A;  2ZYN A;  4ZEF A;  1KA0 A;  4X1B A;  4PFU A;  2RC7 A;  1UTB B;  4QFL A;  1FPI A;  1B32 A;  3G3F A;  3KC0 A;  3B8B A;  4N8G A;  1FTO A;  3MVZ A;  2B4M A;  5B7D A;  4PFY A;  2Z22 A;  2Z8F A;  2F35 A;  4N8Y A;  3T66 A;  2CZK A;  3VV5 A;  5FHO A;  3ILU B;  1PB8 A;  3OO9 A;  1K9Z A;  4NF4 B;  5F7V A;  1B52 A;  4PFB A;  5CBR A;  4PBH A;  5EQ9 A;  5AE4 A;  1F9B A;  2RC9 A;  4LZ8 A;  5H8F A;  3Q28 A;  4OAN A;  1NV2 A;  3EHU A;  1M5F A;  4QFN A;  4JB7 A;  1Y3N A;  4BDL A;  4NF0 A;  3UN6 A;  3K6V A;  2DWJ A;  4GRK A;  2H5Y A;  1G0I A;  1FCK A;  2CMO A;  4OER A;  3OEK A;  3TPA A;  3MW0 A;  5ET5 A;  1S7Y A;  1ZBM A;  2R71 A;  3VDF A;  3CIJ A;  2AL4 A;  4EUO A;  1FTM A;  4XKN A;  4PBQ A;  4R73 A;  4IO7 A;  3IX1 A;  5L9M A;  2P3V A;  4ND9 A;  4GWS A;  1AH5 A;  3OOA A;  5IKB A;  1YZ0 A;  4MNC A;  3K02 A;  3MST A;  1EYI A;  2DE4 A;  1B40 A;  1QUI A;  3K6U A;  3ISP A;  4ESX A;  3LSF B;  1FBH A;  4JDF A;  2HXW A;  2P0S A;  2P2A A;  1A55 A;  5CMB A;  2H99 A;  1FBE A;  2A5T A;  5H8F B;  4ONY A;  1VSO A;  2THI A;  5ET6 A;  1H76 A;  3KN3 A;  1MM7 A;  3U72 A;  1H3D A;  4P9K A;  1K9Y A;  4IR8 A;  4YZZ A;  3PPN A;  5KCJ B;  5JEI A;  5JTY B;  2WKY A;  1B5J A;  4XKR A;  3C31 A;  4JWO A;  5CM6 A;  1AMF A;  4N4U A;  1P1Q A;  2RCB A;  3U94 A;  2DWA A;  4X9T A;  5BWJ A;  4N15 A;  1YAE A;  3OEM A;  2FIX A;  2ZZW A;  3M3K A;  1EZ9 A;  3PPR A;  4BLA A;  1EU8 A;  5L9S A;  3MUQ A;  4R72 A;  4AS5 A;  1MXU A;  3EQ1 A;  4Z0I A;  2XXR A;  5TP9 B;  5AA1 A;  5FHN A;  4GWW A;  2PVU A;  1MY0 A;  3HHF A;  4H67 A;  3O6H A;  1NV3 A;  2I3W A;  2XWI A;  3KGC A;  4YKJ A;  3N6T A;  2A5T B;  1NV7 A;  2WEF A;  4H65 A;  4HE2 A;  3TEP A;  4ZDM A;  2I58 A;  5A5L A;  2O69 A;  2PFY A;  3OO6 A;  1LFI A;  2VOZ A;  2ZYO A;  2I0C A;  3RGY A;  1BP5 A;  2QS4 A;  4NF8 B;  3SKP A;  5EQ8 A;  2OK2 A;  1FQE A;  3P7I A;  1ZTY A;  2HQ0 A;  4PC9 A;  3N5L A;  5EQA A;  1IIT A;  2Y7P A;  3JZJ A;  3O6G A;  4N81 A;  2PX1 A;  1O63 A;  1ANF A;  3QYT A;  3GBA A;  1YPN A;  2MKZ A;  4H45 A;  4GWO A;  5LOM A;  1BK4 A;  1JNF A;  2GQ1 A;  1P99 A;  3OEL A;  4ISU A;  5JK4 A;  3RTW B;  4HTG A;  1FPG A;  4R6Y A;  2XX8 A;  2DP8 A;  4ZEC A;  1H45 A;  1RDX A;  4F1U A;  1RKM A;  1OVT A;  4KYE A;  5EYG A;  3FV2 A;  3FAS A;  3PMX A;  3GBB A;  4KYS A;  4ZEI A;  3DM0 A;  3PUY E;  4DDD A;  2WYK A;  3PU5 A;  4JBZ A;  3TOD A;  2PBW A;  4F3G A;  4ESW A;  1B1H A;  3JYR A;  4I40 A;  4MEV A;  2XX9 A;  1MM6 A;  2FYI A;  4NWD A;  2V25 A;  1IXI A;  4O8M A;  2XXW A;  5EHS A;  1IMB A;  3A29 A;  5TPA B;  1LGB C;  1NUW A;  4QF9 A;  3PUZ E;  3G3K A;  3KG2 A;  3TTL A;  2D21 A;  2ABH A;  3CG1 A;  5IGA A;  3K01 A;  1SW5 A;  2H9B A;  1Y3P A;  1UIV A;  4NMY A;  1B2H A;  1DTZ A;  1LST A;  2V3T A;  1FBC A;  3E79 A;  3PPP A;  1FJ6 A;  4I3Y A;  4NTL A;  4C1U A;  1RYO A;  4F2O A;  4HE1 A;  4KXP A;  3BFT A;  4PFT A;  1A8E A;  4OEV A;  2PT1 A;  4HS7 A;  2F3B A;  2ZZV A;  4R75 A;  2PCR A;  2NVU B;  1Y9U A;  1GR2 A;  3GXA A;  1LBY A;  5H8H B;  2NUV A;  4MFI A;  3SEW A;  2Q2C A;  4OEN A;  1NUZ A;  3KOS A;  4G8N A;  3O9P A;  4O7M A;  3CG3 A;  4KR5 A;  2XD2 A;  1ZJL A;  2VPN A;  3KN8 A;  5CBS A;  3K1N A;  4X1D A;  4PF6 A;  3HCQ A;  2DE2 A;  1SVX B;  3EN3 A;  3BIG A;  4RA1 A;  1SD3 A;  3BBR A;  4AB6 A;  3O28 A;  3PPQ A;  1NV4 A;  3B50 A;  3Q27 A;  2XXQ A;  1QUK A;  1A54 A;  1Q1K A;  1FQA A;  1IMA A;  4HCY A;  4U2R A;  5TU0 A;  2ONS A;  1IZ1 A;  1B3L A;  3FXQ A;  4QFP A;  4U21 A;  1IMD A;  1SW1 A;  3C9H A;  3K6X A;  1I69 A;  4G8H A;  1NH7 A;  1CNQ A;  4GWY A;  4LON B;  1RDY A;  1QUL A;  4RY1 A;  3D1R A;  3D4C A;  1NV5 A;  2JJK A;  3MWB A;  1SW2 A;  2XXH A;  2ZYM A;  1LFG A;  3KBR A;  3SEV A;  3A3C A;  4F1Y A;  4NX1 A;  1FQC A;  3HO7 A;  1MPC A;  3TEL A;  4PAF A;  3RTF B;  1XT8 A;  3VLV A;  4ELO A;  1NV6 A;  3D4G A;  2UXA A;  2F8D A;  3MPK A;  4F2Q A;  5F24 A;  1NI9 A;  4IGT A;  4I9D A;  1LBV A;  3LSL A;  4U1Z A;  3PUW E;  2XA5 A;  5I59 B;  2YPN A;  3M8U A;  3MZB A;  3FIR A;  5BUU A;  5AA2 B;  3QK6 A;  1MXZ A;  3FVG A;  3TFL A;  2WYP A;  4MNI A;  2F6G A;  4U1O A;  3H6T A;  1MXV A;  3PD8 A;  2XXP A;  2YLN A;  3V8X B;  3U8Q A;  1P1N A;  4PDD A;  5IZ1 A;  4IO4 A;  1FBG A;  4GL0 A;  3HV1 A;  1B5I A;  3FXU A;  4JSD A;  1T0K A;  3FUZ A;  1LBC A;  1US4 A;  3UA8 A;  2DWH A;  1FRP A;  4IY5 A;  4XF5 A;  1SYH A;  2ZYK A;  5I58 A;  2DYX A;  4AB5 A;  4OVP A;  5T3J A;  1N76 A;  4XKQ A;  1B05 A;  4NN3 A;  4OVT A;  5CI5 A;  1B7U A;  1VE4 A;  1IUD A;  2AIX A;  3ZKK A;  4X04 A;  3USD A;  3QIM A;  1DPE A;  3ILT B;  1FSA A;  1XC1 A;  2B3F A;  3SDF A;  3L6H A;  3UGW A;  1AOV A;  1OVB A;  4R6K A;  2DS9 A;  3W15 C;  3PTY A;  1BIY A;  2R8T A;  3T9X B;  1MPD A;  3B6T A;  3OO8 A;  4R6H A;  1B9J A;  4M4G A;  1BLF A;  2HZL A;  2FBP A;  2KLF A;  4QBA A;  2OWT A;  2V3U A;  4NF6 A;  3TUS A;  2RKM A;  3I6V A;  4GQO A;  4H5G A;  4XIG Q;  3A09 A;  5I58 B;  4JSO A;  4O7I A;  1Q9D A;  3S4U A;  4MH5 A;  1FJ9 A;  1MY1 A;  4NQ8 A;  1B0H A;  4OVS A;  4OYV A;  2YJP A;  5KDT A;  3IOU A;  1B5H A;  4RYA A;  3T93 B;  2XXY A;  4JVD A;  1D9Q A;  1OQG A;  4ZED A;  3SER A;  5K2Y A;  1Q35 A;  5DTB A;  3ZS6 A;  4PFI A;  1A40 A;  2RC8 A;  2DQV A;  3SZP A;  5KZT A;  4K3F A;  2DDK A;  2Y7W A;  3IJX B;  4H46 A;  4F1V A;  5FBP A;  4DCY A;  5A5X B;  4JVC A;  1NL5 A;  3H6W A;  3VXB A;  2Q8M A;  4NF6 B;  4PFR A;  1SW4 A;  4H0W A;  2V3Q A;  4TLL B;  2HEU A;  2F6P A;  1NKX A;  4U22 A;  1MY4 A;  4F22 A;  3EF7 A;  1JW1 A;  4DLD A;  2RIN A;  2GHB A;  3GYY A;  4JWX A;  2ZNS A;  1LCF A;  4N6D A;  3C32 A;  4G61 A;  2RCA A;  5KDT B;  4N91 A;  1M5C A;  1IIW A;  5IZZ A;  1OMP A;  5KCJ A;  5JTY A;  2VGQ A;  2X26 A;  1BTJ A;  3OEN A; 
#chains in the Genus database with same CATH homology
 4RPO A;  2DWI A;  3THI A;  4P0G A;  1UTH B;  4TOZ A;  1B46 A;  3L6G A;  3MAM A;  4YAH X;  4H1X A;  3QXM A;  1QUJ A;  1TFD A;  3Q25 A;  2QS2 A;  5K2X A;  3IB2 A;  5H8Q B;  2ONR A;  4F3S A;  1Y4T A;  3C4M A;  5DT6 A;  2G93 A;  3EHT A;  3KSJ A;  1POY 1;  4TQU Q;  3LSW A;  5TP9 A;  3G3I A;  3IO6 A;  1D9V A;  3TAJ A;  4O3C A;  3H6U A;  2O7U A;  1HSL A;  5ISU A;  1NNF A;  2D3I A;  4R9G A;  3TCH A;  4WEP A;  2Z8E A;  4NF8 A;  3CVG A;  3E4R A;  3RNN A;  4YB7 A;  4PFW A;  4FED A;  1Y1M A;  1PBP A;  4OEU A;  1LAF E;  1FW0 A;  2M8C A;  3U93 A;  2QJE A;  3LC8 A;  2DVZ A;  3UOR A;  1NNK A;  2Q9T A;  4LVQ A;  1WDN A;  2I4C A;  3ODB A;  1AL3 A;  3IO4 A;  1O64 A;  2UVI A;  4IO6 A;  4M1V A;  5DVF A;  1JVY A;  1KWH A;  3S9E A;  5FHM A;  2R9J A;  4U23 A;  4G68 B;  4YB5 A;  3SET A;  1SBP A;  4JXI A;  4EQB A;  1USY E;  3H3G A;  3N94 A;  3K2D A;  3RN8 A;  3PMV A;  1UQW A;  1CE2 A;  2UVJ A;  3KN7 A;  3K1M A;  4UA8 A;  1MQG A;  3VLU A;  1N0T A;  5F1Q A;  3O2A A;  4IO3 A;  4C0R A;  1M5B A;  5TPA A;  4O3B A;  2PMS A;  3FXR A;  3N26 A;  3RT6 B;  1WOD A;  3CSG A;  4MLV A;  1N04 A;  1MY2 A;  2F78 A;  1GV8 A;  2O7I A;  1B1X A;  4LA9 A;  4OTE A;  2X7Q A;  3Q29 A;  1URG A;  2I49 A;  4FIM A;  5DYH A;  2Q88 A;  4E0X A;  4HCW A;  3HPI A;  4OWD A;  4U4S A;  5H8H A;  4ZE8 A;  4H8I A;  1MH4 A;  3UK4 A;  4IB2 A;  4UAC A;  3B7D A;  4C1T A;  2F7A A;  4OHN A;  4PQJ A;  3C35 A;  4YKK A;  1DTG A;  4NF5 A;  3HST A;  1B51 A;  2X7P A;  1MY3 A;  3A3U A;  2A5S A;  1B58 A;  3G3J A;  4JWY A;  3ZSF A;  1OLA A;  3KFM A;  3MZ1 A;  4ZEB A;  3OXN A;  1B0L A;  3MVX A;  3TCG A;  2GH9 A;  1MQI A;  4Z7E A;  4DCX A;  1Z7M E;  5AA4 B;  4R2F A;  2Y7R A;  5EYF A;  4RK2 A;  4FEB A;  2VD2 A;  3RQT A;  1CB6 A;  3T9H B;  3KEI A;  2F34 A;  2F5X A;  2IEE A;  1LBB A;  3S2V A;  4R74 A;  1SI1 A;  1S9T A;  2F7C A;  4LP2 B;  4BDO A;  4IGR A;  2ZMB A;  2XXV A;  4NF5 B;  3MVY A;  3HN0 A;  4QFO A;  4F29 A;  2GHA A;  3BFU A;  4P0I A;  5ITP A;  4OZ9 A;  1I6Q A;  4OMB A;  1YCJ A;  1ZU0 A;  2OBG A;  2QSX A;  4YU0 A;  1OLC A;  5I56 B;  2NWJ A;  1XOC A;  5I59 A;  2HAU A;  1VR5 A;  3MPL A;  5L8D A;  2V84 A;  1B4Z A;  5I2N A;  5AA2 A;  1LAG E;  1LCT A;  2UVG A;  3I5O A;  3KSX A;  4G77 A;  3OMB A;  3KZG A;  3QSL A;  2HZK A;  4XTC Q;  2IA4 A;  4OFJ A;  4L17 A;  1FTK A;  1LAX A;  1WVJ A;  1EZP A;  2F36 A;  3PUV E;  3S9N C;  5FTI A;  2QS1 A;  3S9L C;  1URS A;  3E3K A;  3IOV A;  1TXF A;  1R9Q A;  3PUX E;  2HFB A;  4PET A;  4WKM A;  1D4N A;  4R2B A;  2Q89 A;  5CC2 A;  4OES A;  4N6P A;  3CSB A;  5B70 A;  4G68 C;  4PE5 B;  4R9F A;  4DIG A;  3V83 A;  3SES A;  2Q2A A;  2Y7K A;  1IXC A;  4FE8 A;  5I2N B;  2V93 A;  3CFL A;  1LB8 A;  2DOJ A;  2O51 A;  5CMC A;  4ZEK A;  4PP0 A;  2PT2 A;  2ZNT A;  3OSQ A;  1A8F A;  5J1D A;  2HAV A;  3IAZ A;  2QRY A;  4FOR A;  4QSC A;  1MPB A;  4KCD A;  4HW8 A;  3CI8 A;  3TTR A;  3M3L A;  1MQJ A;  5I84 A;  1NH8 A;  4N13 A;  4P11 A;  2NOO A;  1YTV A;  4GLI A;  4XXU A;  4XKP A;  1R1N A;  2FNC A;  3IB0 A;  5HBC A;  5H8S A;  5FTH A;  1DPP A;  4GL8 A;  1PDA A;  4EQ9 A;  1Y1Z A;  2R6G E;  3O6I A;  3B6W A;  3O29 A;  4ELP A;  2I4B A;  3QUJ A;  5DVJ A;  3C33 A;  3MQ9 A;  2XXU A;  5CMM A;  4Q5T A;  1B4H A;  4EF2 A;  3H4Z A;  1MRP A;  3CFZ A;  3FJ7 A;  3T9V A;  4H6D A;  2BJJ X;  4IO2 A;  5H8N A;  3AXF A;  3TYH A;  3LUY A;  2DVC A;  1HSE A;  2QMW A;  4KYD A;  4I8C A;  1IQ7 A;  1P1W A;  4ZZA A;  3VVD A;  1URD A;  2OJT A;  2I48 A;  4YKP A;  2UYE A;  2OLB A;  4LUB A;  3RY3 A;  5A5X A;  3R7X A;  3C34 A;  1JET A;  1JW5 A;  1IXH A;  4BDM A;  2OZZ A;  5EHM A;  3K6W A;  3FGS A;  1PB9 A;  1JEV A;  4OFL A;  4NE4 A;  2DXR A;  3TMG A;  3PD9 A;  2UVH A;  4IY6 A;  3GZG A;  5H8N B;  4QRZ A;  1UTH A;  3EPE A;  2F7B A;  4LQ5 A;  4YMB A;  1D3K A;  3TTN A;  4DE8 A;  1ZKB A;  1TT1 A;  1Y4C A;  5H8Q A;  2ALU A;  2G29 A;  1ZMG A;  3E13 X;  4RNS A;  3MBP A;  3R26 A;  4G2Z A;  4MLQ A;  4FJP A;  3OD7 A;  4BDQ A;  4GIZ A;  3G3H A;  3KOT A;  1XS5 A;  2UYF A;  4DXU A;  2OWS A;  4OXV A;  1L5T A;  1XVX A;  1IXG A;  2O84 X;  4QHQ A;  1SDX A;  1FQB A;  3RUM A;  1QVS A;  3FD3 A;  1SYI A;  5HM4 B;  4KPT A;  4LZ7 A;  2Y84 A;  1NFT A;  1DOT A;  2ONK E;  2DXY A;  4OET A;  4KQP A;  4N07 A;  5HPQ A;  1JVX A;  2REJ A;  1N7W A;  1B3G A;  1M5E A;  4WED A;  1B7Z A;  5I2K A;  1FTJ A;  3FAT A;  4GOT A;  4QSE A;  1QKA A;  5ITO A;  1DMB A;  3FJM A;  3R6U A;  1PC3 A;  4G68 A;  3G3G A;  2QL3 A;  1VFD A;  3V89 B;  1N3W A;  2LAO A;  1ZIU A;  2VP1 A;  3JV9 A;  3Q26 A;  4ZE9 A;  4IO5 A;  2D5W A;  5M2V A;  2REG A;  1PB7 A;  5IAI A;  4DXC A;  2PYY A;  3N6U A;  4QFK A;  1MDP 1;  1AIV A;  3IL1 B;  1MH3 A;  2ANJ A;  4FAJ A;  1MXX A;  2VHA A;  3FV1 A;  1A99 A;  3WAE A;  5I2K B;  4BDN A;  1QKB A;  3MJN A;  4ELR A;  3HHG A;  3CR9 A;  2XXT A;  4F18 A;  2Y7I A;  3C36 A;  2I3V A;  1N84 A;  1O7T A;  2ZXT A;  5I57 A;  3IJO B;  4KCC A;  3TTK A;  1DSN A;  1IEJ A;  1GVC A;  3VFJ A;  4YKI A;  5DVI A;  2FA7 A;  4O3A A;  4F3P A;  5DEX A;  4THI A;  1MXW A;  1LB9 A;  4GD5 A;  4POX A;  2H98 A;  1Y3Q A;  1EZO A;  3W9W A;  2H4I A;  3PV0 E;  2W7Y A;  4E0W A;  1P1O A;  2DE3 A;  3MP6 A;  4LZ5 A;  1JEU A;  3MZ9 A;  1Z7N E;  5AA4 A;  3CRB A;  1GTK A;  4RXL A;  5I57 B;  3K1P A;  3VVF A;  3H06 B;  2E0S A;  1POT A;  3KJT A;  4F3B A;  3MP8 A;  3QUF A;  1MG1 A;  1UIU A;  3O66 A;  3LBS A;  3H03 A;  5ICQ A;  3FZV A;  5DEX B;  4EXK A;  4DXB A;  3RPW A;  2AL5 A;  4F31 B;  2GRV A;  3S9M C;  3UP9 A;  3K4U A;  1VFE A;  2ZNU A;  2XHD A;  4YIC A;  3TZA A;  2QS3 A;  2E1S A;  1PBQ A;  4OFO A;  1S50 A;  5I56 A;  2F97 A;  2XD3 A;  3VLW A;  2Z8D A;  3ZKL A;  5CMK A;  3MVW A;  4AQ4 A;  1R6Z A;  3V5A A;  1TFA A;  4ELQ A;  3DP4 A;  1N3X A;  3T22 A;  1B7H A;  3FVO A;  3W9V A;  3IOR A;  1LAH E;  3B6Q A;  1BKA A;  4EDP A;  1NNT A;  4WXJ A;  2XXI A;  1XVY A;  4Q30 B;  4TLM B;  1D9Y A;  1NMU A;  4FAT A;  4EXL A;  3GLB A;  3FVK A;  3SEY A;  2O68 A;  4OVJ A;  1JQF A;  1SQY A;  1GGG A;  3TQL A;  3UIF A;  2Z23 A;  3DEL B;  4MF3 A;  1QW0 A;  4I1D A;  1FQF A;  3LSX A;  3H6V A;  5AA3 A;  3OSR A;  2Q8J A;  4LAT A;  1JW4 A;  2AYS A;  3IK6 B;  3MC2 A;  4F19 A;  2OCU A;  3BKI B;  4RPN A;  3SEU A;  1H43 A;  1MXY A;  2QMX A;  2GFE A;  1QJM A;  3U1O A;  2RF1 A;  1MQD A;  4QSD A;  4ZS9 A;  1SI0 A;  2CZL A;  3FVN A;  1B6H A;  1P1U A;  1A7L A;  1XHY A;  3U92 A;  4GF8 A;  4F39 A;  4POW A;  3DP8 A;  3IOW A;  3WAF A;  4GXA A;  4LQ2 A;  4EQ7 A;  1Y20 A;  1MQH A;  4H8J A;  3IR1 A;  1II5 A;  2H25 A;  4MBP A;  4Q0C A;  5ICT A;  4BDR A;  3IB1 A;  3DP6 A;  2ESN A;  1B3F A;  3LR1 A;  3RLF E;  1B3H A;  4GFR A;  3PMW A;  4RK9 A;  3EHS A;  3MP1 A;  3TKD A;  4KD5 A;  4X48 A;  3K00 A;  3QAX A;  2XXX A;  2B65 A;  3H7M A;  1US5 A;  1OQH A;  4OQO A;  3PPO A;  1EH3 A;  1FTL A;  1I6B A;  2O1L A;  2O1M A;  4FEC A;  1PEB A;  1RYX A;  3T96 B;  3TQW A;  4YB6 A;  1OIB A;  1M5D A;  3KJ7 A;  4KFQ A;  1ELJ A;  4KHZ E;  3I3V A;  3ECR A;  2HCA A;  1NNP A;  1LLS A;  4ECF A;  3G7W A;  4GXS B;  2P1S A;  2NXO A;  4H5F A;  4G4P A;  3CFX A;  3FJG A;  4NWC A;  4RJZ A;  2O6A A;  3F11 A;  5L9O A;  4U4X A;  1MS7 A;  3ONM A;  3T9U A;  2XX7 A;  3DLN A;  3VE1 B;  4GVO A;  3RT8 A;  3TTM A;  1R9L A;  2DSF A;  4DZ1 A;  3E9X A;  2I0B A;  2I6E A;  5CRY A;  3O97 A;  1I6A A;  1UTB A;  1J1N A;  3K0V A;  3VVE A;  3VXC A;  1FQD A;  4ZZE A;  3M3F A;  1USY H;  4G8M A;  3IOT A;  3OO7 A;  3SEX A;  2QPQ A;  1MDQ A;  1TWY A;  3TDJ A;  4NF4 A;  5AA2 D;  1LFH A;  1B3E A;  4YMA A;  5ELV A;  4KI0 E;  3TCF A;  1ATG A;  4NED A;  2VD3 A;  4Q8R A;  2B3B A;  4I62 A;  4EF1 A;  1HSJ A;  1H44 A;  3PGF A;  1ZLQ A;  1N7X A;  2ZYN A;  4ZEF A;  4X1B A;  4PFU A;  2RC7 A;  1UTB B;  4QFL A;  1B32 A;  3G3F A;  1FTO A;  3MVZ A;  5B7D A;  4PFY A;  2Z22 A;  2Z8F A;  2F35 A;  3T66 A;  3VV5 A;  5FHO A;  3ILU B;  1PB8 A;  3OO9 A;  4NF4 B;  5F7V A;  1B52 A;  5CBR A;  5AE4 A;  1F9B A;  2RC9 A;  4LZ8 A;  5H8F A;  3Q28 A;  3EHU A;  1M5F A;  4QFN A;  4JB7 A;  1Y3N A;  4BDL A;  3UN6 A;  3K6V A;  2DWJ A;  4GRK A;  2H5Y A;  1FCK A;  2CMO A;  4OER A;  3OEK A;  3TPA A;  3MW0 A;  1S7Y A;  1ZBM A;  2R71 A;  3VDF A;  3CIJ A;  2AL4 A;  4EUO A;  1FTM A;  4XKN A;  4R73 A;  4IO7 A;  3IX1 A;  5L9M A;  4ND9 A;  1AH5 A;  3OOA A;  5IKB A;  3K02 A;  3K6U A;  2DE4 A;  1B40 A;  1QUI A;  4ESX A;  3LSF B;  4JDF A;  2HXW A;  2P0S A;  2P2A A;  1A55 A;  5CMB A;  2H99 A;  2A5T A;  5H8F B;  4ONY A;  1VSO A;  2THI A;  1H76 A;  3KN3 A;  1MM7 A;  3U72 A;  1H3D A;  4YZZ A;  3PPN A;  5KCJ B;  5JEI A;  5JTY B;  2WKY A;  1B5J A;  4XKR A;  3C31 A;  4JWO A;  5CM6 A;  1AMF A;  1P1Q A;  2RCB A;  3U94 A;  2DWA A;  4X9T A;  5BWJ A;  1YAE A;  3OEM A;  3M3K A;  1EZ9 A;  3PPR A;  4BLA A;  1EU8 A;  5L9S A;  3MUQ A;  4R72 A;  1MXU A;  3EQ1 A;  4Z0I A;  2XXR A;  5TP9 B;  5AA1 A;  5FHN A;  2PVU A;  1MY0 A;  3HHF A;  4H67 A;  3O6H A;  2I3W A;  3KGC A;  4YKJ A;  3N6T A;  2A5T B;  4H65 A;  3TEP A;  4ZDM A;  2I58 A;  2O69 A;  3OO6 A;  1LFI A;  2VOZ A;  2ZYO A;  2I0C A;  3RGY A;  1BP5 A;  2QS4 A;  4NF8 B;  3SKP A;  2OK2 A;  1FQE A;  1ZTY A;  3P7I A;  2HQ0 A;  3N5L A;  1IIT A;  2Y7P A;  3JZJ A;  3O6G A;  2PX1 A;  1O63 A;  1ANF A;  3QYT A;  3GBA A;  1YPN A;  4GWO A;  5LOM A;  1JNF A;  1P99 A;  3OEL A;  4ISU A;  5JK4 A;  3RTW B;  4HTG A;  4R6Y A;  2XX8 A;  2DP8 A;  4ZEC A;  1H45 A;  4F1U A;  1RKM A;  1OVT A;  4KYE A;  3FV2 A;  3FAS A;  3PMX A;  3GBB A;  4KYS A;  4ZEI A;  3DM0 A;  3PUY E;  4DDD A;  3PU5 A;  4JBZ A;  3TOD A;  2PBW A;  4F3G A;  4ESW A;  1B1H A;  3JYR A;  2XX9 A;  1MM6 A;  2FYI A;  4NWD A;  2V25 A;  1IXI A;  2XXW A;  5EHS A;  5TPA B;  1LGB C;  4QF9 A;  3PUZ E;  3G3K A;  3KG2 A;  3TTL A;  2D21 A;  2ABH A;  3CG1 A;  3K01 A;  1SW5 A;  2H9B A;  1Y3P A;  1UIV A;  4NMY A;  1B2H A;  1DTZ A;  1LST A;  2V3T A;  3PPP A;  4C1U A;  4NTL A;  1RYO A;  4F2O A;  3BFT A;  4PFT A;  1A8E A;  4OEV A;  2PT1 A;  4HS7 A;  4R75 A;  2NVU B;  1Y9U A;  1GR2 A;  3GXA A;  5H8H B;  2NUV A;  4MFI A;  3SEW A;  2Q2C A;  4OEN A;  3KOS A;  4G8N A;  3O9P A;  3CG3 A;  4KR5 A;  2XD2 A;  1ZJL A;  3KN8 A;  5CBS A;  3K1N A;  4X1D A;  3HCQ A;  2DE2 A;  1SVX B;  3EN3 A;  4RA1 A;  1SD3 A;  3BBR A;  4AB6 A;  3O28 A;  3PPQ A;  3Q27 A;  2XXQ A;  1QUK A;  1A54 A;  1Q1K A;  1FQA A;  4HCY A;  4U2R A;  5TU0 A;  2ONS A;  1IZ1 A;  1B3L A;  3FXQ A;  4QFP A;  4U21 A;  1SW1 A;  3C9H A;  3K6X A;  1I69 A;  4G8H A;  1NH7 A;  4LON B;  1QUL A;  4RY1 A;  3D4C A;  3MWB A;  1SW2 A;  2XXH A;  2ZYM A;  1LFG A;  3KBR A;  3SEV A;  3A3C A;  4F1Y A;  1FQC A;  3HO7 A;  1MPC A;  3TEL A;  3RTF B;  1XT8 A;  3VLV A;  4ELO A;  3D4G A;  2UXA A;  2F8D A;  3MPK A;  4F2Q A;  4IGT A;  4I9D A;  3LSL A;  4U1Z A;  3PUW E;  5I59 B;  2YPN A;  3M8U A;  3MZB A;  3FIR A;  5BUU A;  5AA2 B;  3QK6 A;  1MXZ A;  3FVG A;  3TFL A;  2F6G A;  4U1O A;  3H6T A;  1MXV A;  3PD8 A;  2XXP A;  2YLN A;  3V8X B;  3U8Q A;  1P1N A;  4IO4 A;  4GL0 A;  3HV1 A;  1B5I A;  3FXU A;  4JSD A;  1T0K A;  3FUZ A;  1LBC A;  1US4 A;  3UA8 A;  2DWH A;  4IY5 A;  1SYH A;  2ZYK A;  5I58 A;  2DYX A;  4AB5 A;  1N76 A;  4XKQ A;  1B05 A;  5CI5 A;  1B7U A;  1VE4 A;  1IUD A;  2AIX A;  3ZKK A;  3USD A;  3QIM A;  1DPE A;  3ILT B;  1XC1 A;  2B3F A;  3SDF A;  3L6H A;  3UGW A;  1AOV A;  1OVB A;  4R6K A;  2DS9 A;  3W15 C;  1BIY A;  3T9X B;  1MPD A;  3B6T A;  3OO8 A;  4R6H A;  1B9J A;  4M4G A;  1BLF A;  2HZL A;  2KLF A;  2OWT A;  2V3U A;  4NF6 A;  3TUS A;  2RKM A;  3I6V A;  4GQO A;  4H5G A;  4XIG Q;  3A09 A;  5I58 B;  4JSO A;  3S4U A;  4MH5 A;  1MY1 A;  1B0H A;  4OYV A;  2YJP A;  5KDT A;  3IOU A;  1B5H A;  4RYA A;  3T93 B;  2XXY A;  1OQG A;  4ZED A;  3SER A;  5K2Y A;  1Q35 A;  5DTB A;  3ZS6 A;  1A40 A;  2RC8 A;  2DQV A;  5KZT A;  4K3F A;  2Y7W A;  3IJX B;  4F1V A;  4DCY A;  5A5X B;  1NL5 A;  3H6W A;  3VXB A;  1SW4 A;  4H0W A;  4NF6 B;  2V3Q A;  4TLL B;  2HEU A;  2F6P A;  1NKX A;  4U22 A;  1MY4 A;  4F22 A;  3EF7 A;  1JW1 A;  4DLD A;  2RIN A;  2GHB A;  4JWX A;  2ZNS A;  1LCF A;  3C32 A;  2RCA A;  5KDT B;  1M5C A;  1IIW A;  1OMP A;  5KCJ A;  5JTY A;  2VGQ A;  2X26 A;  1BTJ A;  3OEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...