5CMCA

Mnemiopsis leidyi ml032222a iglur lbd e423s mutant glycine complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
247
Chain Sequence
LIGRHLRLGSVESQPFMFFATEGCEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDDRKFGALNKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQDKYKWGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ML032222a iGluR
publication title Molecular lock regulates binding of glycine to a primitive NMDA receptor.
pubmed doi rcsb
source organism Mnemiopsis leidyi
molecule tags Membrane protein
total genus 79
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5cmcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5cmcA02
3TMGA 5K2YA 2OK2A 1N7XA 3BFUA 3G3IA 4U21A 1B7HA 4M4GA 2P1SA 3VVFA 5CBRA 3VLVA 3FD3A 2QS1A 3UN6A 4HCWA 2HFBA 2ZYOA 4GXSB 2OWTA 4YU0A 4H1XA 1P1UA 1FQBA 4Z0IA 1J1NA 5F7VA 4OQOA 5M2VA 5I58B 3H3GA 3Q27A 5I57B 3U93A 4LVQA 1Y9UA 4FJPA 3PPRA 5I56B 2XXIA 5I2KA 3H6TA 1LAGE 2OCUA 4KYEA 5H8HB 4BDMA 4ELRA 1A7LA 1Q35A 4OFLA 4GQOA 1MM7A 1H76A 2Z8FA 1IIWA 1EZOA 2V3UA 3IB2A 4MFIA 1B3GA 4DXCA 3O6GA 3ILUB 3KG2A 3TQLA 2LAOA 3M3LA 2B3FA 5L9SA 3Q28A 1HSLA 4ZEKA 2REGA 1MQGA 3HO7A 4JSOA 2WKYA 1ZMGA 1YPNA 2F8DA 1SW1A 2Q8JA 2O1MA 3LSLA 1B1XA 3VVDA 5TPAA 4AB5A 3TTNA 3WAEA 2GHAA 1SBPA 4IY5A 4I62A 4R74A 4JWXA 2F34A 1P99A 1O63A 1N0TA 4TQUQ 5CM6A 1MQIA 3UGWA 3PD9A 1B3EA 3IB0A 2AYSA 1FQFA 3CFXA 3I5OA 1IXHA 2UVIA 4U1OA 4X1DA 4Q8RA 3P7IA 1NKXA 2VHAA 4O3CA 1WVJA 1FCKA 3LR1A 2DE2A 3H06B 4BDNA 2DWAA 1EH3A 2VP1A 4F3BA 1USYE 5IKBA 4LZ8A 1A40A 1JW5A 2X26A 2NWJA 4EUOA 3K2DA 1PEBA 2GHBA 1JVXA 3CRBA 3T66A 4GOTA 1LB8A 1P1NA 2F6GA 1EZ9A 3B6TA 3PUWE 1FQAA 4U1ZA 4JXIA 4N07A 5H8FB 4X9TA 2CMOA 2QRYA 3H6VA 3UP9A 1PDAA 4IO6A 2OZZA 3CG1A 1B40A 3MVZA 4OHNA 4TLMB 3VE1B 1A99A 5ICQA 1RKMA 1MPDA 3O6HA 3TYHA 3E4RA 2XX9A 5I56A 4PFWA 3CFLA 1N3XA 2E0SA 2O1LA 1OVTA 4I1DA 3FXQA 3CR9A 1FTOA 3U94A 1ANFA 2DXYA 2O68A 1MDQA 4DLDA 1MPCA 3IX1A 3H7MA 4NF5A 4R9GA 3KEIA 2ANJA 1POY1 5DYHA 5JTYB 2XXQA 4G8NA 4Q5TA 1JEVA 3IB1A 3OEMA 3OEKA 4LZ5A 4POXA 1UIUA 4BDLA 3FJGA 1IZ1A 1LFHA 3FJ7A 4XKNA 4DZ1A 4F29A 1MXYA 1KWHA 2Y7RA 4ONYA 3W9WA 4FECA 2F36A 3PPQA 1OIBA 4FIMA 2F6PA 2XXWA 4ESWA 2ESNA 4OERA 2ZYMA 2Q88A 5CI5A 1PB7A 3RPWA 1Y3NA 2ABHA 3PPOA 4F31B 1MQJA 4KD5A 1MY3A 5B7DA 2FNCA 3PU5A 2Y7IA 3PUYE 4NTLA 1QKAA 2RCAA 4ELQA 3PMVA 4ZDMA 4BDRA 3U92A 2DVCA 1LFGA 3MZ9A 4ZECA 1SVXB 3DP4A 3FZVA 4DDDA 4PE5B 4EXKA 4NWDA 3GXAA 1DTZA 5DTBA 5AA4B 3N6UA 4QFPA 4KQPA 4F1VA 4YB7A 1JNFA 4OWDA 3K1MA 2XD2A 3EQ1A 1GV8A 4NF8B 3MPKA 3EN3A 1BTJA 1MM6A 3MW0A 3FV2A 4NF4B 4QFNA 1UTBA 4DCYA 3ILTB 1FQCA 2RC7A 2ONRA 4U4XA 1IUDA 3AXFA 5KDTA 1B3FA 4PQJA 3KN8A 3TCHA 3M3FA 1S9TA 4QSDA 2RCBA 2DE3A 4R2FA 3RT8A 3HN0A 4RPOA 5AA2B 3MJNA 3MPLA 4P0GA 4QHQA 4WXJA 4U22A 3MVWA 3T96B 2DE4A 2QS4A 2NOOA 3K6XA 3L6HA 2DS9A 3M8UA 3QUJA 1IXCA 4C1UA 1AH5A 3C36A 4KHZE 1B3HA 3A3CA 4ISUA 2HQ0A 4LQ5A 3HHFA 4PFUA 4G2ZA 2F7CA 3K6UA 2Q2CA 4N13A 1URSA 2H99A 4QF9A 3DLNA 5KCJB 1Y1MA 3FASA 5FHOA 4OTEA 2AL5A 1B46A 4H65A 4WKMA 3D4GA 1ZU0A 2DP8A 3O28A 2ZYNA 1D4NA 1NNFA 1Y4CA 3EHSA 2PBWA 3A3UA 5I2NB 2Z22A 2NVUB 3BFTA 3PPNA 4IGTA 1B5HA 4IB2A 3QSLA 2XXTA 1MY0A 3IOUA 2A5TA 1A8EA 3TCGA 2B3BA 3VVEA 4XKPA 5H8QB 5B70A 3QIMA 3VV5A 2DWIA 1FTLA 4LA9A 4NF8A 2QJEA 4ELOA 2H4IA 3ZKKA 4RYAA 5EYFA 1QULA 2PMSA 2REJA 2QL3A 3T22A 3FGSA 1POTA 3TKDA 5ITOA 1N84A 1ZBMA 2FYIA 4G8HA 1WDNA 2HAUA 4RK9A 1NL5A 4UA8A 3OO6A 5DVFA 1ZJLA 2QMXA 2AL4A 5EHMA 1BIYA 3CSBA 3VXCA 1P1QA 3HSTA 4EQ9A 3W9VA 3F11A 5L9OA 4ELPA 2YLNA 4THIA 2I0CA 1IXIA 1Y20A 1LCFA 3G3KA 5ICTA 2XX8A 3MC2A 1B7UA 4IGRA 1JVYA 5HM4B 3IO4A 2DYXA 1IXGA 4UACA 2XX7A 1M5DA 2Q89A 2OBGA 4R6KA 1B32A 5H8NA 1MDP1 4KFQA 4JWOA 4H5FA 1ZKBA 2GH9A 2QSXA 2UVHA 4H6DA 4IO5A 4YZZA 1I69A 2Y7KA 4KCCA 2I3VA 1UIVA 1SD3A 5CMCA 3OO9A 2O6AA 3CI8A 1SYIA 1O7TA 3OSRA 3OD7A 2QS3A 3O2AA 3LSXA 2GRVA 1H43A 2F97A 4OZ9A 4KI0E 3RNNA 3LC8A 4Q30B 3T9HB 2OJTA 1LFIA 4JB7A 4GFRA 2YJPA 1B0HA 1Y3QA 2I48A 1NNTA 1QUIA 1BP5A 4ZE8A 1TWYA 1B2HA 3OELA 3TELA 4FE8A 1DPPA 3SKPA 3K02A 3W15C 3OMBA 1US5A 1B58A 3V89B 3KFMA 2UVGA 4YICA 2ONKE 4G68A 3EPEA 4U2RA 3ODBA 1CB6A 4JBZA 4H8IA 1NH7A 4PFYA 1JETA 3N6TA 3TDJA 3SERA 3I6VA 1B5JA 4L17A 1UTHB 4FORA 4YKPA 4F3GA 4LQ2A 2I4CA 1SYHA 1NH8A 4XKQA 1D9YA 1PB8A 2V3QA 1B4ZA 3SDFA 3MZ1A 5LOMA 4K3FA 2IA4A 1B6HA 4GXAA 4G77A 2RF1A 3K01A 1VSOA 1FQDA 1TT1A 1YTVA 2DSFA 5I58A 4JWYA 2Y84A 1SW5A 3DP6A 1NNPA 3VFJA 1B3LA 4G8MA 2B65A 1MY1A 5I57A 3OXNA 1MXWA 5ELVA 3K1NA 5FHNA 1OQHA 1NNKA 4BDOA 3N94A 1MH4A 1SW4A 1GR2A 2QMWA 3FVGA 5H8HA 3KGCA 3C32A 4PETA 3EHUA 4ZZAA 5AA1A 3B7DA 1URGA 1OVBA 1SDXA 1VR5A 2O69A 4MH5A 3GBAA 4F1UA 4G68C 4YMAA 2I3WA 3QXMA 3CFZA 1FQEA 2DWHA 4YB5A 5F1QA 5CC2A 2ZNUA 4EDPA 4RPNA 4R2BA 3CIJA 1AL3A 5TP9B 5DEXB 4FAJA 4JDFA 1N3WA 3O97A 2XXRA 1MY4A 5A5XB 1PBQA 2O51A 1GVCA 2DOJA 2Q9TA 3V5AA 3DM0A 1M5FA 5HPQA 4QFLA 4X1BA 3FATA 3KSXA 3TODA 1ATGA 1N76A 1MXVA 1D3KA 3U8QA 3H6WA 1JW1A 4E0WA 4DXBA 2I0BA 1B5IA 4ECFA 1QVSA 4MBPA 1Y1ZA 3U72A 1PBPA 2W7YA 4GL8A 3FVOA 3N26A 4MLVA 3PPPA 3RLFE 4EF2A 3G3HA 3HCQA 1Z7ME 2FA7A 4ND9A 1B9JA 1FTKA 4TOZA 5H8FA 3R26A 4QFKA 3RQTA 3C9HA 5IAIA 1VFEA 3VLWA 3K00A 1M5CA 3KSJA 3G7WA 4TLLB 2D21A 1WODA 3IOWA 3RUMA 3DELB 3JV9A 3IAZA 1XC1A 1R9QA 3Q29A 4IO2A 4XXUA 4C0RA 3TUSA 4ZS9A 5L8DA 3TZAA 3FIRA 5I59B 3O29A 4POWA 3SEUA 3FV1A 4HW8A 2HEUA 3B6QA 5KZTA 3LUYA 2PVUA 1A8FA 1LCTA 5JTYA 3SEYA 4H67A 1EZPA 1MRPA 1PC3A 2AIXA 1MH3A 1Q1KA 1HSEA 3QYTA 1QKBA 1RYXA 1YCJA 3H6UA 4YAHX 1TXFA 3TCFA 3EHTA 1JW4A 3IJXB 4LP2B 3OSQA 3MP6A 4BLAA 1XS5A 2QPQA 2IEEA 3KOSA 3R7XA 4GF8A 3ECRA 4NMYA 2P2AA 1FTJA 4F2QA 5DVJA 3TQWA 3TTRA 5AE4A 1B05A 1XHYA 3PUVE 5I2KB 3RTWB 3G3FA 2UYEA 1MQDA 3C31A 4HTGA 1T0KA 3SESA 3MUQA 3O66A 5CBSA 5ITPA 1LSTA 1IITA 4EQBA 4YB6A 2F7AA 4FEBA 5BUUA 2RINA 2UXAA 1O64A 3HPIA 3T9XB 5AA4A 3CVGA 2XXPA 3C35A 1XVXA 1FW0A 3TAJA 2Q2AA 3C33A 3H4ZA 1ELJA 3PUZE 1UQWA 3G3JA 4F2OA 1FTMA 3CSGA 5TPAB 2CZLA 4OEVA 1B51A 1M5EA 3I3VA 4NF4A 1B4HA 1S7YA 5FTIA 4R9FA 4XKRA 3K6VA 1LBCA 4HCYA 3BKIB 4F39A 1ZTYA 4GD5A 2XXXA 4F19A 2I49A 4LATA 1YAEA 3SETA 4MLQA 3MZBA 2F7BA 4U4SA 2XXYA 1QUKA 3MAMA 5TU0A 3E13X 5AA2A 2O7IA 1MS7A 3MWBA 1OMPA 1SI1A 3ONMA 4U23A 4PP0A 3C34A 3OO7A 3ZS6A 1S50A 4RXLA 3MVYA 4DXUA 3ZKLA 4KYSA 3HV1A 4F18A 4YMBA 3BBRA 3MVXA 4OFJA 2Z8DA 1QW0A 2Y7WA 2VOZA 4R6HA 1IEJA 1VFDA 2F5XA 3OOAA 4OETA 5KCJA 3N5LA 2XD3A 2ZXTA 1XVYA 4Z7EA 1LBBA 4GWOA 1DPEA 1XT8A 4XIGQ 5DT6A 1RYOA 3TEPA 2V84A 4O3BA 2QS2A 2O7UA 4OVJA 4OYVA 4OENA 5I2NA 4NF5B 4KCDA 1CE2A 3E3KA 2KLFA 4IO4A 1URDA 5CMKA 3IOTA 1ZLQA 4FEDA 4O3AA 1R1NA 1US4A 3IORA 5H8QA 3MQ9A 3S9LC 1EU8A 5CMBA 3K4UA 2HZKA 4LONB 1GGGA 1LGBC 1H3DA 5ISUA 3QAXA 1GTKA 3VXBA 1MPBA 1OQGA 4GL0A 5H8SA 1II5A 2E1SA 4RA1A 4NF6B 1MG1A 4ZE9A 1XOCA 1A54A 3FJMA 3IJOB 1B7ZA 2ZNTA 3GZGA 1JQFA 4KYDA 1MXXA 4DCXA 3TPAA 2VD3A 3UK4A 3E9XA 4EF1A 3H03A 1F9BA 4GVOA 2ALUA 1A55A 2PYYA 4QSCA 3V83A 5AA2D 2ZNSA 3IR1A 2GFEA 3B6WA 3LSWA 5BWJA 3DP8A 4ZZEA 2DQVA 3U1OA 3PUXE 1DTGA 3Q25A 5FHMA 1DMBA 1NMUA 2UYFA 2Z8EA 2ZMBA 4OESA 5AA3A 3V8XB 3LSFB 4YKIA 1SQYA 4HS7A 1AIVA 4RJZA 1Y4TA 1MQHA 1L5TA 4XTCQ 1UTBB 2YPNA 4RNSA 4M1VA 3R6UA 2HCAA 2HZLA 2UVJA 1B1HA 4QSEA 3KZGA 1LAHE 5KDTB 1DOTA 4DE8A 2P0SA 4P11A 3WAFA 4QFOA 1PB9A 3ZSFA 3KJ7A 2BJJX 1USYH 3HHGA 1LB9A 4LUBA 4I8CA 5EHSA 2X7PA 3S9MC 4Q0CA 3A09A 2PT1A 3FXRA 1N7WA 4QRZA 3RN8A 2V25A 2DXRA 3TTLA 3EF7A 2X7QA 1N04A 4OFOA 4F22A 4RY1A 4X48A 3S4UA 2G29A 4KPTA 1LLSA 4JSDA 3GBBA 3RTFB 2XXUA 2R71A 3IK6B 1BLFA 2VD2A 3M3KA 1H45A 1SI0A 5DVIA 3QUFA 1DSNA 1MXZA 2Z23A 1OLCA 4NF6A 3QK6A 1QJMA 1LAFE 3T9UA 1Y3PA 1TFDA 1UTHA 3C4MA 4DIGA 1HSJA 1ZIUA 4IO3A 1IQ7A 2NXOA 4ZEDA 4MF3A 3SEVA 1LAXA 3RY3A 1TFAA 5L9MA 4GRKA 4BDQA 4ZEFA 5CMMA 2PX1A 1QUJA 3IO6A 5J1DA 4P0IA 1P1OA 2D3IA 3TTMA 3RT6B 4EQ7A 2HAVA 3VLUA 1R6ZA 5JEIA 3T9VA 3UA8A 3D4CA 2A5TB 1I6BA 2V93A 1B0LA 3TFLA 2D5WA 2Y7PA 3TTKA 3PGFA 3K0VA 4H0WA 2XXHA 4E0XA 1AMFA 3O6IA 2DVZA 4NWCA 5K2XA 4IO7A 2PT2A 2ONSA 1B52A 4ZEBA 2OWSA 3UORA 3KJTA 3MP1A 2NUVA 2XHDA 3KOTA 3PD8A 2VGQA 2I4BA 4YKJA 1NFTA 4LZ7A 1R9LA 3O9PA 4H5GA 2HXWA 1M5BA 3JZJA 4NEDA 3PV0E 3FVKA 4F3PA 3S2VA 5TP9A 5DEXA 4G4PA 4N6PA 4F3SA 3CG3A 5A5XA 2F78A 3S9EA 4R6YA 1MXUA 3UIFA 2I58A 4I9DA 2V3TA 2XXVA 2F35A 4FATA 3LBSA 4ZEIA 3USDA 3MBPA 3Q26A 1JEUA 4R73A 4R75A 3THIA 3SEWA 2I6EA 3KN3A 5CRYA 5H8NB 3FUZA 3KBRA 4PFTA 3K6WA 1D9VA 1P1WA 4GLIA 4F1YA 1SW2A 4AB6A 1I6AA 4WEPA 3VDFA 2THIA 3PMWA 4RK2A 3S9NC 2A5SA 3OO8A 2RC9A 4YKKA 3G3GA 1Z7NE 4OMBA 2H25A 4ESXA 2H98A 1H44A 3RGYA 2O84X 3KN7A 2R9JA 4WEDA 5HBCA 4IY6A 3FXUA 4EXLA 1OLAA 2RC8A 2M8CA 5I84A 2G93A 4AQ4A 1I6QA 2R6GE 4GIZA 3GLBA 3FVNA 5JK4A 3MP8A 4KR5A 1BKAA 5FTHA 1AOVA 3IL1B 3SEXA 3PMXA 4C1TA 4R72A 3K1PA 3T93B 2OLBA 3IOVA 2H5YA 2ZYKA 4H8JA 2RKMA 3L6GA 3JYRA 4G68B 1VE4A 4NE4A 2DWJA 5I59A 2H9BA 1MY2A 3OENA 4OXVA 4OEUA
chains in the Genus database with same CATH superfamily
2QFLA 3TMGA 2FVZA 5K2YA 2OK2A 1N7XA 3BFUA 3G3IA 4N4UA 4U21A 1B7HA 3A29A 4M4GA 2P1SA 3VVFA 5CBRA 3VLVA 3FD3A 2QS1A 2QVRA 4PBHA 3UN6A 1NV5A 4N17A 4HCWA 2HFBA 2ZYOA 4GXSB 2OWTA 2XXKA 4YU0A 4H1XA 1P1UA 1FQBA 4Z0IA 1J1NA 5F7VA 4OQOA 5M2VA 4N15A 4GBVA 1YXIA 5I58B 2CEXA 3H3GA 1LBVA 1FRPA 3Q27A 5I57B 5ET5A 4MNCA 3U93A 1FPGA 4LVQA 1Y9UA 4FJPA 3PPRA 5I56B 2XXIA 5I2KA 3H6TA 1LAGE 2OCUA 4KYEA 5H8HB 4BDMA 4ELRA 1A7LA 1Q35A 4GWZA 4OFLA 4GQOA 1MM7A 1H76A 2Z8FA 4LN5A 5A5LA 3RPLB 1D9QA 1IIWA 1EZOA 2QVUA 2V3UA 3IB2A 4MFIA 1B3GA 4DXCA 3O6GA 2XWOA 3ILUB 3KG2A 3TQLA 2LAOA 3M3LA 2B3FA 2F3DA 5L9SA 3Q28A 4X04A 1HSLA 4ZEKA 2REGA 4NF0A 1MQGA 3HO7A 4JSOA 2WKYA 1ZMGA 4HE0A 1YPNA 4OANA 2F8DA 2VT5A 2WEFA 1SW1A 2Q8JA 2O1MA 3LSLA 2P3NA 1B1XA 4PGNA 3VVDA 5TPAA 4AB5A 3TTNA 1FPJA 3WAEA 2GHAA 1SBPA 4IY5A 4I62A 3T0JA 4R74A 4JWXA 2F34A 1P99A 1O63A 1N0TA 4TQUQ 5CM6A 1MQIA 3UGWA 3PD9A 1B3EA 1JP4A 4O94A 3IB0A 2AYSA 1FQFA 3CFXA 1IMBA 3I5OA 1IXHA 2UVIA 4U1OA 4X1DA 4Q8RA 3P7IA 1NKXA 2VHAA 2FIXA 3EKIA 4O3CA 4MIJA 1WVJA 4XEQA 1FCKA 3GYYA 3LR1A 3U65A 2DE2A 3H06B 4BDNA 2DWAA 1EH3A 2VP1A 4F3BA 1USYE 5IKBA 4LZ8A 1A40A 1JW5A 1NV2A 2X26A 2NWJA 4EUOA 3K2DA 1PEBA 2GHBA 1JVXA 3CRBA 3T66A 4GOTA 1LB8A 1P1NA 2F6GA 1EZ9A 3B6TA 3PUWE 1FQAA 4U1ZA 4JXIA 4N07A 5H8FB 4X9TA 2CMOA 2QRYA 3H6VA 3UP9A 1PDAA 4IO6A 2OZZA 3CG1A 1B40A 3MVZA 4OHNA 4TLMB 3VE1B 1A99A 5ICQA 1RKMA 1FBPA 1MPDA 1K9ZA 3O6HA 3TYHA 3E4RA 2XX9A 5I56A 4PFWA 2WYPA 3CFLA 1NV6A 1N3XA 2E0SA 5ET7A 2O1LA 1OVTA 4I1DA 3FXQA 3CR9A 1FTOA 1KA0A 3U94A 1ANFA 2DXYA 2O68A 4PAFA 4O8MA 1MDQA 4N8GA 4DLDA 4HXVA 4MEVA 1MPCA 3IX1A 3H7MA 4JVCA 4NF5A 4R9GA 3KEIA 2ANJA 1POY1 1DK4A 2XWKA 5DYHA 5JTYB 2XXQA 4G8NA 4Q5TA 1JEVA 3IB1A 3OEMA 3OEKA 4LZ5A 4POXA 1UIUA 4BDLA 3FJGA 1IZ1A 1LFHA 3FJ7A 4XKNA 3IFAA 4DZ1A 4F29A 1MXYA 1KWHA 2Y7RA 3LV0A 4ONYA 3W9WA 4FECA 2F36A 3PPQA 1OIBA 4FIMA 4NG7A 2F6PA 2XXWA 3QMFA 4ESWA 2ESNA 4OERA 2ZYMA 2Q88A 5CI5A 1PB7A 5ET8A 3RPWA 1Y3NA 2ABHA 3PPOA 4F31B 1MQJA 4KD5A 1MY3A 5B7DA 2FNCA 3PU5A 2Y7IA 3PUYE 4NTLA 4PAKA 1QKAA 2RCAA 4ELQA 3PMVA 4ZDMA 4BDRA 3U92A 2DVCA 1LFGA 3MZ9A 1NUZA 4ZECA 2VPNA 1SVXB 3DP4A 3FZVA 4DDDA 4PE5B 4EXKA 4NWDA 4DI3D 3GXAA 1DTZA 5FBPA 1FPFA 2MKZA 5DTBA 5AA4B 3N6UA 4QFPA 4KQPA 4F1VA 4YB7A 1JNFA 1EYKA 4OWDA 3K1MA 2XD2A 3EQ1A 1GV8A 4NF8B 3MPKA 3EN3A 1BTJA 1MM6A 1DCUA 3MW0A 3FV2A 5LDZA 4NF4B 4QFNA 1UTBA 4AS5A 4DCYA 2WBBA 3ILTB 1FQCA 2RC7A 2ONRA 4U4XA 2WYKA 1IUDA 3AXFA 5KDTA 1B3FA 4PQJA 3BIHA 3KN8A 3TCHA 3M3FA 1S9TA 4QSDA 2RCBA 2DE3A 4R2FA 3RT8A 3B50A 1QGXA 5IZ3A 3HN0A 4RPOA 5AA2B 3MJNA 3MPLA 4P0GA 2P3VA 5IZZA 4QHQA 4WXJA 4U22A 4JVDA 3MVWA 3T96B 2DE4A 2PFYA 2QS4A 2NOOA 3K6XA 3L6HA 2DS9A 3M8UA 2HHMA 3QUJA 2WX9A 1IXCA 4C1UA 1AH5A 3C36A 4KHZE 1B3HA 3A3CA 4ISUA 1IMFA 2HQ0A 4LQ5A 3HHFA 4PFUA 4G2ZA 2F7CA 3K6UA 1NUWA 2Q2CA 4N13A 1URSA 2WBDA 2H99A 4QF9A 3DLNA 5KCJB 1SPIA 1Y1MA 3E79A 3FASA 3ISPA 5FHOA 4OTEA 2AL5A 1EYIA 1B46A 4H65A 4WKMA 3D4GA 1ZU0A 2DP8A 3O28A 2ZYNA 1FSAA 1D4NA 1IMCA 1NNFA 1Y4CA 3EHSA 1NV7A 2PBWA 3A3UA 5I2NB 2Z22A 2NVUB 3RYDA 1LBZA 3BFTA 3PPNA 1NV1A 4IGTA 1B5HA 4IB2A 3QSLA 2XXTA 1MY0A 3IOUA 3T1BA 2A5TA 1A8EA 3TCGA 2B3BA 3VVEA 4XKPA 5H8QB 5B70A 4N91A 3QIMA 2Y5LA 3VV5A 2DWIA 1FTLA 4LA9A 4NF8A 2QJEA 4ELOA 2H4IA 3ZKKA 4RYAA 1FPEA 5EYFA 1QULA 2PMSA 2REJA 2QL3A 3T22A 3FGSA 5J16A 1POTA 4DI4B 3TKDA 5ITOA 1N84A 1ZBMA 2FYIA 1IMAA 4G8HA 1WDNA 2B4MA 2HAUA 2PFZA 4RK9A 1NL5A 4UA8A 3OO6A 5DVFA 1ZJLA 2QMXA 1FPDA 2AL4A 5EHMA 1BIYA 3CSBA 3VXCA 1P1QA 3HSTA 4HE1A 4N6DA 4EQ9A 3W9VA 3F11A 2DDKA 4OVPA 5L9OA 4ELPA 1FBCA 2YLNA 4THIA 2I0CA 1IXIA 2CEYA 1Y20A 1LCFA 4PDHA 3G3KA 5ICTA 2XX8A 5EYHA 3MC2A 1B7UA 2F3BA 4IGRA 1JVYA 5HM4B 3IO4A 2DYXA 1EYJA 1IXGA 4UACA 2XX7A 1M5DA 2Q89A 2OBGA 4GWSA 4XFEA 4R6KA 1B32A 5H8NA 1MDP1 5DW8A 4KFQA 4JWOA 4H5FA 1ZKBA 2GH9A 5ESYA 2QSXA 2UVHA 4H6DA 4IO5A 4YZZA 3B8BA 1I69A 2Y7KA 4KCCA 2I3VA 4HE2A 1UIVA 1SD3A 5CMCA 3OO9A 2O6AA 3CI8A 1SYIA 1O7TA 3OSRA 3OD7A 2QS3A 3O2AA 3LSXA 2Q74A 1KZ8A 2GRVA 1H43A 3HFUA 2F97A 4OZ9A 4KI0E 3RNNA 3LC8A 4Q30B 3T9HB 2OJTA 1LFIA 4JB7A 4GFRA 2YJPA 1B0HA 1G0HA 1Y3QA 4MAGA 2I48A 1NNTA 1QUIA 1BP5A 4ZE8A 1TWYA 1B2HA 3OELA 3TELA 4FE8A 1DPPA 1INPA 3SKPA 3K02A 3W15C 3OMBA 1US5A 1B58A 3V89B 3KFMA 2UVGA 4YICA 2ONKE 4G68A 4O7MA 3EPEA 4U2RA 3ODBA 2XWVA 1CB6A 4JBZA 4H8IA 1NH7A 4PFYA 1JETA 3N6TA 1AWBA 3TDJA 3SERA 3I6VA 1B5JA 4L17A 1UTHB 4FORA 4P56A 4YKPA 4F3GA 4LQ2A 2I4CA 1SYHA 1NH8A 4XKQA 1D9YA 1PB8A 2V3QA 1B4ZA 3SDFA 3MZ1A 1LBWA 2GQ1A 2KQZA 5LOMA 4K3FA 2IA4A 1B6HA 4GXAA 4G77A 2RF1A 3K01A 1VSOA 1FQDA 1TT1A 1YTVA 2DSFA 5I58A 4JWYA 2Y84A 1SW5A 3DP6A 2FBPA 3KC0A 1NNPA 1B3LA 3VFJA 4G8MA 2B65A 1MY1A 5I57A 3OXNA 1MXWA 5ELVA 3K1NA 4GX3A 5FHNA 2XA5A 4OVQA 1OQHA 1NNKA 4BDOA 3N94A 1MH4A 1SW4A 1GR2A 2QMWA 3FVGA 2ZZWA 2KR0A 5H8HA 3KGCA 3C32A 4PETA 3EHUA 4ZZAA 5AA1A 3B7DA 1URGA 4MHFA 1OVBA 1SDXA 5ET6A 3RPLA 1VR5A 2O69A 4MH5A 3GBAA 4F1UA 4G68C 4YMAA 4NAPA 2I3WA 3QXMA 5EQ7A 3CFZA 1FQEA 1YZ0A 2DWHA 4YB5A 5F1QA 3FXBA 5CC2A 1CNQA 2ZNUA 4EDPA 4RPNA 4FBPA 4R2BA 3KBZA 3CIJA 1AL3A 5TP9B 5DEXB 4FAJA 5EQ9A 4JDFA 1N3WA 3O97A 2XXRA 1MY4A 5A5XB 1PBQA 2O51A 1GVCA 2DOJA 5I7IA 2Q9TA 3V5AA 3DM0A 4PF8A 1M5FA 1FPBA 5HPQA 4QFLA 4X1BA 3FATA 3KSXA 3TODA 1ATGA 1N76A 1MXVA 1D3KA 3U8QA 3H6WA 4MCOA 1JW1A 2ZZVA 4E0WA 4DXBA 4X8RA 2I0BA 1B5IA 4ECFA 1QVSA 4MBPA 4PDDA 1Y1ZA 3U72A 2HPGA 1PBPA 2W7YA 4GL8A 5EQ8A 4QXDA 4QBAA 4PAIA 5IGAA 3FVOA 3N26A 4OVRA 4MLVA 3PPPA 3RLFE 1NV0A 4EF2A 3G3HA 3HCQA 1Z7ME 2FA7A 4ND9A 1B9JA 1FTKA 4TOZA 5H8FA 3R26A 4QFKA 2OX3A 3RQTA 3C9HA 5IAIA 1VFEA 1RDZA 5I3SA 3VLWA 3K00A 1M5CA 3KSJA 3G7WA 4TLLB 2D21A 1WODA 3IOWA 3RUMA 3DELB 3MSTA 3JV9A 3IAZA 1XC1A 1R9QA 3Q29A 4IO2A 4XXUA 4C0RA 3TUSA 4ZS9A 5L8DA 3TZAA 3FIRA 5I59B 2Y5KA 3O29A 5IM2A 1IMEA 4POWA 3SEUA 3FV1A 4HW8A 3PTYA 2HEUA 3B6QA 5KZTA 3LUYA 2PVUA 4GWYA 1A8FA 1LCTA 5JTYA 3SEYA 4H67A 1FBDA 1NUXA 1EZPA 1MRPA 1PC3A 3E78A 1FPIA 1FBFA 2AIXA 2R8TA 4I40A 4IR8A 1MH3A 1Q1KA 1HSEA 3QYTA 4OA4A 1QKBA 1RYXA 1YCJA 3H6UA 4YAHX 1TXFA 2JJKA 3TCFA 3EHTA 1JW4A 3IJXB 4LP2B 3NOHA 3OSQA 3MP6A 4BLAA 1RDXA 1XS5A 2QPQA 2IEEA 3KOSA 3R7XA 4GF8A 3ECRA 4NMYA 4NQ8A 2P2AA 1FTJA 4F2QA 5DVJA 4I3EA 4NGUA 3TQWA 3TTRA 5AE4A 1B05A 1XHYA 3PUVE 5I2KB 3D1RA 2BJIA 4PFIA 3RTWB 3G3FA 2UYEA 1MQDA 2OWZA 3C31A 4HTGA 1T0KA 3SESA 3MUQA 3O66A 5CBSA 5ITPA 1LSTA 4NN3A 1IITA 4EQBA 4YB6A 2F7AA 4FEBA 5EYGA 5BUUA 2RINA 2UXAA 1O64A 3HPIA 4O7IA 2QVVA 3T9XB 5AA4A 3CVGA 4PC9A 2XXPA 3C35A 1XVXA 1FW0A 4JVIA 3TAJA 2Q2AA 3C33A 3H4ZA 1ELJA 3PUZE 1UQWA 3G3JA 4F2OA 1FTMA 3CSGA 5TPAB 2CZLA 4P9KA 4OEVA 4NF4A 1B51A 1M5EA 3I3VA 1B4HA 1S7YA 5FTIA 4R9FA 4XKRA 3FBPA 3K6VA 1LBCA 4HCYA 3BKIB 4P8BA 4F39A 1ZTYA 4GD5A 2XXXA 4F19A 2I49A 4LATA 1YAEA 3SETA 4MLQA 3MZBA 2F7BA 4PCDA 4U4SA 2XXYA 1QUKA 3MAMA 2PCRA 5TU0A 2CZIA 3E13X 5AA2A 2O7IA 1MS7A 3MWBA 1OMPA 1SI1A 3ONMA 4PBQA 4U23A 4PP0A 3C34A 3OO7A 3ZS6A 5LTCA 1S50A 4RXLA 3MVYA 4DXUA 3ZKLA 4KYSA 3HV1A 4F18A 4YMBA 4P47A 1BK4A 3BBRA 3MVXA 4OFJA 2Z8DA 1QW0A 2Y7WA 2VOZA 4R6HA 1IEJA 1VFDA 2F5XA 4OETA 3OOAA 5KCJA 3N5LA 2XD3A 2ZXTA 1XVYA 4Z7EA 1LBBA 4GWOA 1DPEA 5IZ1A 1XT8A 4XIGQ 4I3YA 5DT6A 1FBEA 1RYOA 3TEPA 4PTKA 2V84A 4O3BA 2QS2A 2O7UA 4OVJA 4OYVA 4H46A 4OENA 5I2NA 2FHYA 4KCDA 4NF5B 1CE2A 3E3KA 2KLFA 4IO4A 4KXPA 1URDA 3LUZA 5CMKA 3IOTA 1ZLQA 4FEDA 4O3AA 4GX6A 4P1LA 1R1NA 1US4A 3IORA 2ZZXA 4PFBA 5H8QA 3MQ9A 3S9LC 1EU8A 5CMBA 3K4UA 2HZKA 4OVTA 1FJ6A 4LONB 1GGGA 1LGBC 1H3DA 5ISUA 3QAXA 1GTKA 5F24A 3VXBA 1MPBA 1OQGA 4GL0A 5H8SA 1II5A 2E1SA 4RA1A 1KA1A 4NF6B 1MG1A 4GWUA 4ZE9A 1XOCA 1A54A 3FJMA 3IJOB 1B7ZA 2ZNTA 3GZGA 1JQFA 4KYDA 1MXXA 4DCXA 3TPAA 2VD3A 3UK4A 1FBHA 3E9XA 4EF1A 1NV3A 3H03A 1F9BA 4GVOA 2ALUA 1A55A 2PYYA 4QSCA 3V83A 5AA2D 2ZNSA 3IR1A 2GFEA 3B6WA 3LSWA 5BWJA 4H45A 3DP8A 3SZPA 4ZZEA 2DQVA 3U1OA 3PUXE 1DTGA 3Q25A 5FHMA 1DMBA 1NMUA 2UYFA 2Z8EA 2ZMBA 4OESA 5AA3A 3V8XB 4PGPA 3LSFB 4GWXA 4YKIA 1SQYA 4HS7A 1AIVA 4RJZA 1Y4TA 1MQHA 1L5TA 4XTCQ 1UTBB 2YPNA 4P1EA 4RNSA 4M1VA 3R6UA 2HCAA 2HZLA 2UVJA 1B1HA 4QSEA 3KZGA 1LAHE 5KDTB 1DOTA 4DE8A 3KC1A 2P0SA 4P11A 3WAFA 4QFOA 1PB9A 3ZSFA 4N6KA 3KJ7A 4PE3A 2BJJX 1LEVA 1USYH 3HHGA 1LB9A 4LUBA 4I8CA 5IZ3B 3CHGA 5EHSA 2X7PA 3S9MC 4Q0CA 3A09A 2PT1A 3FXRA 1N7WA 4QRZA 3RN8A 2V25A 4NX1A 2DXRA 3TTLA 3EF7A 4GBWA 2X7QA 1N04A 4OFOA 4F22A 2CZHA 4RY1A 4X48A 2VPOA 3S4UA 2G29A 4KPTA 1IMDA 1FPKA 1LLSA 4JSDA 1K9YA 3GBBA 3RTFB 2XXUA 2R71A 3IK6B 1BLFA 2VD2A 3M3KA 1H45A 1SI0A 5DVIA 3QUFA 1DSNA 1MXZA 2Z23A 1OLCA 4NF6A 3QK6A 1QJMA 1LAFE 4P3LA 4GWWA 3T9UA 1Y3PA 1TFDA 1UTHA 3C4MA 4DIGA 4UABA 1FBGA 1HSJA 1ZIUA 4IO3A 1IQ7A 2NXOA 4ZEDA 4MF3A 3SEVA 1LAXA 3RY3A 1TFAA 5L9MA 4GRKA 4BDQA 4ZEFA 5CMMA 2PX1A 1QUJA 3IO6A 5J1DA 4P0IA 1P1OA 1FPLA 2D3IA 3TTMA 3RT6B 4EQ7A 2HAVA 3VLUA 4MJOA 1R6ZA 5JEIA 3T9VA 3UA8A 3D4CA 2Q8MA 2A5TB 1I6BA 2V93A 1B0LA 3TFLA 2FIEA 2D5WA 2Y7PA 3TTKA 3PGFA 3K0VA 4H0WA 2XXHA 4E0XA 1AMFA 3O6IA 2DVZA 4NWCA 5K2XA 4IO7A 2PT2A 2ONSA 1B52A 4ZEBA 2OWSA 3UORA 2V4CA 3KJTA 4PF6A 2B4LA 3MP1A 2NUVA 2XHDA 3KOTA 4GX4A 1DBZA 3PD8A 2VGQA 2I4BA 4OVSA 4YKJA 1NFTA 4LZ7A 1FJ9A 1R9LA 3O9PA 4H5GA 2HXWA 1M5BA 3JZJA 4NEDA 3PV0E 5I5PA 3FVKA 4F3PA 3S2VA 1G0IA 5TP9A 1NUYA 5DEXA 4G4PA 1FTAA 4N6PA 4F3SA 5EQAA 3CG3A 5A5XA 4XF5A 4MNPA 2F78A 3S9EA 4R6YA 1MXUA 3UIFA 4G61A 2I58A 4I9DA 2V3TA 2XXVA 2F35A 4FATA 3LBSA 4ZEIA 3USDA 3MBPA 3Q26A 1JEUA 4R73A 4R75A 3THIA 3SEWA 2I6EA 3KN3A 5CRYA 5H8NB 3FUZA 3KBRA 4PFTA 3K6WA 1D9VA 1P1WA 4GLIA 4F1YA 1NI9A 1SW2A 4AB6A 1I6AA 4WEPA 3VDFA 1NV4A 2THIA 3PMWA 4RK2A 4N81A 3IFCA 3S9NC 2A5SA 4MMPA 3OO8A 1Q9DA 2RC9A 4YKKA 2L5VA 3G3GA 1Z7NE 4OMBA 2H25A 4ESXA 2H98A 1H44A 3RGYA 2O84X 3KN7A 2R9JA 4WEDA 5HBCA 4IY6A 4MX6A 3FXUA 1LBXA 4EXLA 1OLAA 2RC8A 3BIGA 2M8CA 5I84A 2XWIA 1RDYA 4PFRA 1LBYA 2G93A 4AQ4A 1I6QA 1VDWA 2R6GE 4GIZA 3GLBA 3FVNA 5JK4A 3MP8A 4KR5A 1BKAA 4AS4A 4N8YA 1XI6A 5FTHA 1AOVA 3IL1B 3SEXA 3PMXA 3MYUA 4MNIA 4R72A 4C1TA 3K1PA 3T93B 1YYZA 2OLBA 3IOVA 2H5YA 2ZYKA 5T3JA 4H8JA 2HXRA 2RKMA 4NHBA 3L6GA 3JYRA 4G68B 1VE4A 4NE4A 2DWJA 3ROJA 5I59A 2H9BA 2CZKA 1MY2A 3OENA 4OXVA 4OEUA
chains in the Genus database with same CATH topology
3TMGA 5K2YA 2OK2A 1N7XA 3BFUA 3G3IA 4U21A 1B7HA 4M4GA 2P1SA 3VVFA 5CBRA 3VLVA 3FD3A 2QS1A 3UN6A 4HCWA 2HFBA 2ZYOA 4GXSB 2OWTA 4YU0A 4H1XA 1P1UA 1FQBA 4Z0IA 1J1NA 5F7VA 4OQOA 5M2VA 5I58B 3H3GA 3Q27A 5I57B 3U93A 4LVQA 1Y9UA 4FJPA 3PPRA 5I56B 2XXIA 5I2KA 3H6TA 1LAGE 2OCUA 4KYEA 5H8HB 4BDMA 4ELRA 1A7LA 1Q35A 4OFLA 4GQOA 1MM7A 1H76A 2Z8FA 1IIWA 1EZOA 2V3UA 3IB2A 4MFIA 1B3GA 4DXCA 3O6GA 3ILUB 3KG2A 3TQLA 2LAOA 3M3LA 2B3FA 5L9SA 3Q28A 1HSLA 4ZEKA 2REGA 1MQGA 3HO7A 4JSOA 2WKYA 1ZMGA 1YPNA 2F8DA 1SW1A 2Q8JA 2O1MA 3LSLA 1B1XA 3VVDA 5TPAA 4AB5A 3TTNA 3WAEA 2GHAA 1SBPA 4IY5A 4I62A 4R74A 4JWXA 2F34A 1P99A 1O63A 1N0TA 4TQUQ 5CM6A 1MQIA 3UGWA 3PD9A 1B3EA 3IB0A 2AYSA 1FQFA 3CFXA 3I5OA 1IXHA 2UVIA 4U1OA 4X1DA 4Q8RA 3P7IA 1NKXA 2VHAA 4O3CA 1WVJA 1FCKA 3LR1A 2DE2A 3H06B 4BDNA 2DWAA 1EH3A 2VP1A 4F3BA 1USYE 5IKBA 4LZ8A 1A40A 1JW5A 2X26A 2NWJA 4EUOA 3K2DA 1PEBA 2GHBA 1JVXA 3CRBA 3T66A 4GOTA 1LB8A 1P1NA 2F6GA 1EZ9A 3B6TA 3PUWE 1FQAA 4U1ZA 4JXIA 4N07A 5H8FB 4X9TA 2CMOA 2QRYA 3H6VA 3UP9A 1PDAA 4IO6A 2OZZA 3CG1A 1B40A 3MVZA 4OHNA 4TLMB 3VE1B 1A99A 5ICQA 1RKMA 1MPDA 3O6HA 3TYHA 3E4RA 2XX9A 5I56A 4PFWA 3CFLA 1N3XA 2E0SA 2O1LA 1OVTA 4I1DA 3FXQA 3CR9A 1FTOA 3U94A 1ANFA 2DXYA 2O68A 1MDQA 4DLDA 1MPCA 3IX1A 3H7MA 4NF5A 4R9GA 3KEIA 2ANJA 1POY1 5DYHA 5JTYB 2XXQA 4G8NA 4Q5TA 1JEVA 3IB1A 3OEMA 3OEKA 4LZ5A 4POXA 1UIUA 4BDLA 3FJGA 1IZ1A 1LFHA 3FJ7A 4XKNA 4DZ1A 4F29A 1MXYA 1KWHA 2Y7RA 4ONYA 3W9WA 4FECA 2F36A 3PPQA 1OIBA 4FIMA 2F6PA 2XXWA 4ESWA 2ESNA 4OERA 2ZYMA 2Q88A 5CI5A 1PB7A 3RPWA 1Y3NA 2ABHA 3PPOA 4F31B 1MQJA 4KD5A 1MY3A 5B7DA 2FNCA 3PU5A 2Y7IA 3PUYE 4NTLA 1QKAA 2RCAA 4ELQA 3PMVA 4ZDMA 4BDRA 3U92A 2DVCA 1LFGA 3MZ9A 4ZECA 1SVXB 3DP4A 3FZVA 4DDDA 4PE5B 4EXKA 4NWDA 3GXAA 1DTZA 5DTBA 5AA4B 3N6UA 4QFPA 4KQPA 4F1VA 4YB7A 1JNFA 4OWDA 3K1MA 2XD2A 3EQ1A 1GV8A 4NF8B 3MPKA 3EN3A 1BTJA 1MM6A 3MW0A 3FV2A 4NF4B 4QFNA 1UTBA 4DCYA 3ILTB 1FQCA 2RC7A 2ONRA 4U4XA 1IUDA 3AXFA 5KDTA 1B3FA 4PQJA 3KN8A 3TCHA 3M3FA 1S9TA 4QSDA 2RCBA 2DE3A 4R2FA 3RT8A 3HN0A 4RPOA 5AA2B 3MJNA 3MPLA 4P0GA 4QHQA 4WXJA 4U22A 3MVWA 3T96B 2DE4A 2QS4A 2NOOA 3K6XA 3L6HA 2DS9A 3M8UA 3QUJA 1IXCA 4C1UA 1AH5A 3C36A 4KHZE 1B3HA 3A3CA 4ISUA 2HQ0A 4LQ5A 3HHFA 4PFUA 4G2ZA 2F7CA 3K6UA 2Q2CA 4N13A 1URSA 2H99A 4QF9A 3DLNA 5KCJB 1Y1MA 3FASA 5FHOA 4OTEA 2AL5A 1B46A 4H65A 4WKMA 3D4GA 1ZU0A 2DP8A 3O28A 2ZYNA 1D4NA 1NNFA 1Y4CA 3EHSA 2PBWA 3A3UA 5I2NB 2Z22A 2NVUB 3BFTA 3PPNA 4IGTA 1B5HA 4IB2A 3QSLA 2XXTA 1MY0A 3IOUA 2A5TA 1A8EA 3TCGA 2B3BA 3VVEA 4XKPA 5H8QB 5B70A 3QIMA 3VV5A 2DWIA 1FTLA 4LA9A 4NF8A 2QJEA 4ELOA 2H4IA 3ZKKA 4RYAA 5EYFA 1QULA 2PMSA 2REJA 2QL3A 3T22A 3FGSA 1POTA 3TKDA 5ITOA 1N84A 1ZBMA 2FYIA 4G8HA 1WDNA 2HAUA 4RK9A 1NL5A 4UA8A 3OO6A 5DVFA 1ZJLA 2QMXA 2AL4A 5EHMA 1BIYA 3CSBA 3VXCA 1P1QA 3HSTA 4EQ9A 3W9VA 3F11A 5L9OA 4ELPA 2YLNA 4THIA 2I0CA 1IXIA 1Y20A 1LCFA 3G3KA 5ICTA 2XX8A 3MC2A 1B7UA 4IGRA 1JVYA 5HM4B 3IO4A 2DYXA 1IXGA 4UACA 2XX7A 1M5DA 2Q89A 2OBGA 4R6KA 1B32A 5H8NA 1MDP1 4KFQA 4JWOA 4H5FA 1ZKBA 2GH9A 2QSXA 2UVHA 4H6DA 4IO5A 4YZZA 1I69A 2Y7KA 4KCCA 2I3VA 1UIVA 1SD3A 5CMCA 3OO9A 2O6AA 3CI8A 1SYIA 1O7TA 3OSRA 3OD7A 2QS3A 3O2AA 3LSXA 2GRVA 1H43A 2F97A 4OZ9A 4KI0E 3RNNA 3LC8A 4Q30B 3T9HB 2OJTA 1LFIA 4JB7A 4GFRA 2YJPA 1B0HA 1Y3QA 2I48A 1NNTA 1QUIA 1BP5A 4ZE8A 1TWYA 1B2HA 3OELA 3TELA 4FE8A 1DPPA 3SKPA 3K02A 3W15C 3OMBA 1US5A 1B58A 3V89B 3KFMA 2UVGA 4YICA 2ONKE 4G68A 3EPEA 4U2RA 3ODBA 1CB6A 4JBZA 4H8IA 1NH7A 4PFYA 1JETA 3N6TA 3TDJA 3SERA 3I6VA 1B5JA 4L17A 1UTHB 4FORA 4YKPA 4F3GA 4LQ2A 2I4CA 1SYHA 1NH8A 4XKQA 1D9YA 1PB8A 2V3QA 1B4ZA 3SDFA 3MZ1A 5LOMA 4K3FA 2IA4A 1B6HA 4GXAA 4G77A 2RF1A 3K01A 1VSOA 1FQDA 1TT1A 1YTVA 2DSFA 5I58A 4JWYA 2Y84A 1SW5A 3DP6A 1NNPA 3VFJA 1B3LA 4G8MA 2B65A 1MY1A 5I57A 3OXNA 1MXWA 5ELVA 3K1NA 5FHNA 1OQHA 1NNKA 4BDOA 3N94A 1MH4A 1SW4A 1GR2A 2QMWA 3FVGA 5H8HA 3KGCA 3C32A 4PETA 3EHUA 4ZZAA 5AA1A 3B7DA 1URGA 1OVBA 1SDXA 1VR5A 2O69A 4MH5A 3GBAA 4F1UA 4G68C 4YMAA 2I3WA 3QXMA 3CFZA 1FQEA 2DWHA 4YB5A 5F1QA 5CC2A 2ZNUA 4EDPA 4RPNA 4R2BA 3CIJA 1AL3A 5TP9B 5DEXB 4FAJA 4JDFA 1N3WA 3O97A 2XXRA 1MY4A 5A5XB 1PBQA 2O51A 1GVCA 2DOJA 2Q9TA 3V5AA 3DM0A 1M5FA 5HPQA 4QFLA 4X1BA 3FATA 3KSXA 3TODA 1ATGA 1N76A 1MXVA 1D3KA 3U8QA 3H6WA 1JW1A 4E0WA 4DXBA 2I0BA 1B5IA 4ECFA 1QVSA 4MBPA 1Y1ZA 3U72A 1PBPA 2W7YA 4GL8A 3FVOA 3N26A 4MLVA 3PPPA 3RLFE 4EF2A 3G3HA 3HCQA 1Z7ME 2FA7A 4ND9A 1B9JA 1FTKA 4TOZA 5H8FA 3R26A 4QFKA 3RQTA 3C9HA 5IAIA 1VFEA 3VLWA 3K00A 1M5CA 3KSJA 3G7WA 4TLLB 2D21A 1WODA 3IOWA 3RUMA 3DELB 3JV9A 3IAZA 1XC1A 1R9QA 3Q29A 4IO2A 4XXUA 4C0RA 3TUSA 4ZS9A 5L8DA 3TZAA 3FIRA 5I59B 3O29A 4POWA 3SEUA 3FV1A 4HW8A 2HEUA 3B6QA 5KZTA 3LUYA 2PVUA 1A8FA 1LCTA 5JTYA 3SEYA 4H67A 1EZPA 1MRPA 1PC3A 2AIXA 1MH3A 1Q1KA 1HSEA 3QYTA 1QKBA 1RYXA 1YCJA 3H6UA 4YAHX 1TXFA 3TCFA 3EHTA 1JW4A 3IJXB 4LP2B 3OSQA 3MP6A 4BLAA 1XS5A 2QPQA 2IEEA 3KOSA 3R7XA 4GF8A 3ECRA 4NMYA 2P2AA 1FTJA 4F2QA 5DVJA 3TQWA 3TTRA 5AE4A 1B05A 1XHYA 3PUVE 5I2KB 3RTWB 3G3FA 2UYEA 1MQDA 3C31A 4HTGA 1T0KA 3SESA 3MUQA 3O66A 5CBSA 5ITPA 1LSTA 1IITA 4EQBA 4YB6A 2F7AA 4FEBA 5BUUA 2RINA 2UXAA 1O64A 3HPIA 3T9XB 5AA4A 3CVGA 2XXPA 3C35A 1XVXA 1FW0A 3TAJA 2Q2AA 3C33A 3H4ZA 1ELJA 3PUZE 1UQWA 3G3JA 4F2OA 1FTMA 3CSGA 5TPAB 2CZLA 4OEVA 1B51A 1M5EA 3I3VA 4NF4A 1B4HA 1S7YA 5FTIA 4R9FA 4XKRA 3K6VA 1LBCA 4HCYA 3BKIB 4F39A 1ZTYA 4GD5A 2XXXA 4F19A 2I49A 4LATA 1YAEA 3SETA 4MLQA 3MZBA 2F7BA 4U4SA 2XXYA 1QUKA 3MAMA 5TU0A 3E13X 5AA2A 2O7IA 1MS7A 3MWBA 1OMPA 1SI1A 3ONMA 4U23A 4PP0A 3C34A 3OO7A 3ZS6A 1S50A 4RXLA 3MVYA 4DXUA 3ZKLA 4KYSA 3HV1A 4F18A 4YMBA 3BBRA 3MVXA 4OFJA 2Z8DA 1QW0A 2Y7WA 2VOZA 4R6HA 1IEJA 1VFDA 2F5XA 3OOAA 4OETA 5KCJA 3N5LA 2XD3A 2ZXTA 1XVYA 4Z7EA 1LBBA 4GWOA 1DPEA 1XT8A 4XIGQ 5DT6A 1RYOA 3TEPA 2V84A 4O3BA 2QS2A 2O7UA 4OVJA 4OYVA 4OENA 5I2NA 4NF5B 4KCDA 1CE2A 3E3KA 2KLFA 4IO4A 1URDA 5CMKA 3IOTA 1ZLQA 4FEDA 4O3AA 1R1NA 1US4A 3IORA 5H8QA 3MQ9A 3S9LC 1EU8A 5CMBA 3K4UA 2HZKA 4LONB 1GGGA 1LGBC 1H3DA 5ISUA 3QAXA 1GTKA 3VXBA 1MPBA 1OQGA 4GL0A 5H8SA 1II5A 2E1SA 4RA1A 4NF6B 1MG1A 4ZE9A 1XOCA 1A54A 3FJMA 3IJOB 1B7ZA 2ZNTA 3GZGA 1JQFA 4KYDA 1MXXA 4DCXA 3TPAA 2VD3A 3UK4A 3E9XA 4EF1A 3H03A 1F9BA 4GVOA 2ALUA 1A55A 2PYYA 4QSCA 3V83A 5AA2D 2ZNSA 3IR1A 2GFEA 3B6WA 3LSWA 5BWJA 3DP8A 4ZZEA 2DQVA 3U1OA 3PUXE 1DTGA 3Q25A 5FHMA 1DMBA 1NMUA 2UYFA 2Z8EA 2ZMBA 4OESA 5AA3A 3V8XB 3LSFB 4YKIA 1SQYA 4HS7A 1AIVA 4RJZA 1Y4TA 1MQHA 1L5TA 4XTCQ 1UTBB 2YPNA 4RNSA 4M1VA 3R6UA 2HCAA 2HZLA 2UVJA 1B1HA 4QSEA 3KZGA 1LAHE 5KDTB 1DOTA 4DE8A 2P0SA 4P11A 3WAFA 4QFOA 1PB9A 3ZSFA 3KJ7A 2BJJX 1USYH 3HHGA 1LB9A 4LUBA 4I8CA 5EHSA 2X7PA 3S9MC 4Q0CA 3A09A 2PT1A 3FXRA 1N7WA 4QRZA 3RN8A 2V25A 2DXRA 3TTLA 3EF7A 2X7QA 1N04A 4OFOA 4F22A 4RY1A 4X48A 3S4UA 2G29A 4KPTA 1LLSA 4JSDA 3GBBA 3RTFB 2XXUA 2R71A 3IK6B 1BLFA 2VD2A 3M3KA 1H45A 1SI0A 5DVIA 3QUFA 1DSNA 1MXZA 2Z23A 1OLCA 4NF6A 3QK6A 1QJMA 1LAFE 3T9UA 1Y3PA 1TFDA 1UTHA 3C4MA 4DIGA 1HSJA 1ZIUA 4IO3A 1IQ7A 2NXOA 4ZEDA 4MF3A 3SEVA 1LAXA 3RY3A 1TFAA 5L9MA 4GRKA 4BDQA 4ZEFA 5CMMA 2PX1A 1QUJA 3IO6A 5J1DA 4P0IA 1P1OA 2D3IA 3TTMA 3RT6B 4EQ7A 2HAVA 3VLUA 1R6ZA 5JEIA 3T9VA 3UA8A 3D4CA 2A5TB 1I6BA 2V93A 1B0LA 3TFLA 2D5WA 2Y7PA 3TTKA 3PGFA 3K0VA 4H0WA 2XXHA 4E0XA 1AMFA 3O6IA 2DVZA 4NWCA 5K2XA 4IO7A 2PT2A 2ONSA 1B52A 4ZEBA 2OWSA 3UORA 3KJTA 3MP1A 2NUVA 2XHDA 3KOTA 3PD8A 2VGQA 2I4BA 4YKJA 1NFTA 4LZ7A 1R9LA 3O9PA 4H5GA 2HXWA 1M5BA 3JZJA 4NEDA 3PV0E 3FVKA 4F3PA 3S2VA 5TP9A 5DEXA 4G4PA 4N6PA 4F3SA 3CG3A 5A5XA 2F78A 3S9EA 4R6YA 1MXUA 3UIFA 2I58A 4I9DA 2V3TA 2XXVA 2F35A 4FATA 3LBSA 4ZEIA 3USDA 3MBPA 3Q26A 1JEUA 4R73A 4R75A 3THIA 3SEWA 2I6EA 3KN3A 5CRYA 5H8NB 3FUZA 3KBRA 4PFTA 3K6WA 1D9VA 1P1WA 4GLIA 4F1YA 1SW2A 4AB6A 1I6AA 4WEPA 3VDFA 2THIA 3PMWA 4RK2A 3S9NC 2A5SA 3OO8A 2RC9A 4YKKA 3G3GA 1Z7NE 4OMBA 2H25A 4ESXA 2H98A 1H44A 3RGYA 2O84X 3KN7A 2R9JA 4WEDA 5HBCA 4IY6A 3FXUA 4EXLA 1OLAA 2RC8A 2M8CA 5I84A 2G93A 4AQ4A 1I6QA 2R6GE 4GIZA 3GLBA 3FVNA 5JK4A 3MP8A 4KR5A 1BKAA 5FTHA 1AOVA 3IL1B 3SEXA 3PMXA 4C1TA 4R72A 3K1PA 3T93B 2OLBA 3IOVA 2H5YA 2ZYKA 4H8JA 2RKMA 3L6GA 3JYRA 4G68B 1VE4A 4NE4A 2DWJA 5I59A 2H9BA 1MY2A 3OENA 4OXVA 4OEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TMG A;  5K2Y A;  2OK2 A;  1N7X A;  3BFU A;  3G3I A;  4U21 A;  1B7H A;  4M4G A;  2P1S A;  3VVF A;  5CBR A;  3VLV A;  3FD3 A;  2QS1 A;  3UN6 A;  4HCW A;  2HFB A;  2ZYO A;  4GXS B;  2OWT A;  4YU0 A;  4H1X A;  1P1U A;  1FQB A;  4Z0I A;  1J1N A;  5F7V A;  4OQO A;  5M2V A;  5I58 B;  3H3G A;  3Q27 A;  5I57 B;  3U93 A;  4LVQ A;  1Y9U A;  4FJP A;  3PPR A;  5I56 B;  2XXI A;  5I2K A;  3H6T A;  1LAG E;  2OCU A;  4KYE A;  5H8H B;  4BDM A;  4ELR A;  1A7L A;  1Q35 A;  4OFL A;  4GQO A;  1MM7 A;  1H76 A;  2Z8F A;  1IIW A;  1EZO A;  2V3U A;  3IB2 A;  4MFI A;  1B3G A;  4DXC A;  3O6G A;  3ILU B;  3KG2 A;  3TQL A;  2LAO A;  3M3L A;  2B3F A;  5L9S A;  3Q28 A;  1HSL A;  4ZEK A;  2REG A;  1MQG A;  3HO7 A;  4JSO A;  2WKY A;  1ZMG A;  1YPN A;  2F8D A;  1SW1 A;  2Q8J A;  2O1M A;  3LSL A;  1B1X A;  3VVD A;  5TPA A;  4AB5 A;  3TTN A;  3WAE A;  2GHA A;  1SBP A;  4IY5 A;  4I62 A;  4R74 A;  4JWX A;  2F34 A;  1P99 A;  1O63 A;  1N0T A;  4TQU Q;  5CM6 A;  1MQI A;  3UGW A;  3PD9 A;  1B3E A;  3IB0 A;  2AYS A;  1FQF A;  3CFX A;  3I5O A;  1IXH A;  2UVI A;  4U1O A;  4X1D A;  4Q8R A;  3P7I A;  1NKX A;  2VHA A;  4O3C A;  1WVJ A;  1FCK A;  3LR1 A;  2DE2 A;  3H06 B;  4BDN A;  2DWA A;  1EH3 A;  2VP1 A;  4F3B A;  1USY E;  5IKB A;  4LZ8 A;  1A40 A;  1JW5 A;  2X26 A;  2NWJ A;  4EUO A;  3K2D A;  1PEB A;  2GHB A;  1JVX A;  3CRB A;  3T66 A;  4GOT A;  1LB8 A;  1P1N A;  2F6G A;  1EZ9 A;  3B6T A;  3PUW E;  1FQA A;  4U1Z A;  4JXI A;  4N07 A;  5H8F B;  4X9T A;  2CMO A;  2QRY A;  3H6V A;  3UP9 A;  1PDA A;  4IO6 A;  2OZZ A;  3CG1 A;  1B40 A;  3MVZ A;  4OHN A;  4TLM B;  3VE1 B;  1A99 A;  5ICQ A;  1RKM A;  1MPD A;  3O6H A;  3TYH A;  3E4R A;  2XX9 A;  5I56 A;  4PFW A;  3CFL A;  1N3X A;  2E0S A;  2O1L A;  1OVT A;  4I1D A;  3FXQ A;  3CR9 A;  1FTO A;  3U94 A;  1ANF A;  2DXY A;  2O68 A;  1MDQ A;  4DLD A;  1MPC A;  3IX1 A;  3H7M A;  4NF5 A;  4R9G A;  3KEI A;  2ANJ A;  1POY 1;  5DYH A;  5JTY B;  2XXQ A;  4G8N A;  4Q5T A;  1JEV A;  3IB1 A;  3OEM A;  3OEK A;  4LZ5 A;  4POX A;  1UIU A;  4BDL A;  3FJG A;  1IZ1 A;  1LFH A;  3FJ7 A;  4XKN A;  4DZ1 A;  4F29 A;  1MXY A;  1KWH A;  2Y7R A;  4ONY A;  3W9W A;  4FEC A;  2F36 A;  3PPQ A;  1OIB A;  4FIM A;  2F6P A;  2XXW A;  4ESW A;  2ESN A;  4OER A;  2ZYM A;  2Q88 A;  5CI5 A;  1PB7 A;  3RPW A;  1Y3N A;  2ABH A;  3PPO A;  4F31 B;  1MQJ A;  4KD5 A;  1MY3 A;  5B7D A;  2FNC A;  3PU5 A;  2Y7I A;  3PUY E;  4NTL A;  1QKA A;  2RCA A;  4ELQ A;  3PMV A;  4ZDM A;  4BDR A;  3U92 A;  2DVC A;  1LFG A;  3MZ9 A;  4ZEC A;  1SVX B;  3DP4 A;  3FZV A;  4DDD A;  4PE5 B;  4EXK A;  4NWD A;  3GXA A;  1DTZ A;  5DTB A;  5AA4 B;  3N6U A;  4QFP A;  4KQP A;  4F1V A;  4YB7 A;  1JNF A;  4OWD A;  3K1M A;  2XD2 A;  3EQ1 A;  1GV8 A;  4NF8 B;  3MPK A;  3EN3 A;  1BTJ A;  1MM6 A;  3MW0 A;  3FV2 A;  4NF4 B;  4QFN A;  1UTB A;  4DCY A;  3ILT B;  1FQC A;  2RC7 A;  2ONR A;  4U4X A;  1IUD A;  3AXF A;  5KDT A;  1B3F A;  4PQJ A;  3KN8 A;  3TCH A;  3M3F A;  1S9T A;  4QSD A;  2RCB A;  2DE3 A;  4R2F A;  3RT8 A;  3HN0 A;  4RPO A;  5AA2 B;  3MJN A;  3MPL A;  4P0G A;  4QHQ A;  4WXJ A;  4U22 A;  3MVW A;  3T96 B;  2DE4 A;  2QS4 A;  2NOO A;  3K6X A;  3L6H A;  2DS9 A;  3M8U A;  3QUJ A;  1IXC A;  4C1U A;  1AH5 A;  3C36 A;  4KHZ E;  1B3H A;  3A3C A;  4ISU A;  2HQ0 A;  4LQ5 A;  3HHF A;  4PFU A;  4G2Z A;  2F7C A;  3K6U A;  2Q2C A;  4N13 A;  1URS A;  2H99 A;  4QF9 A;  3DLN A;  5KCJ B;  1Y1M A;  3FAS A;  5FHO A;  4OTE A;  2AL5 A;  1B46 A;  4H65 A;  4WKM A;  3D4G A;  1ZU0 A;  2DP8 A;  3O28 A;  2ZYN A;  1D4N A;  1NNF A;  1Y4C A;  3EHS A;  2PBW A;  3A3U A;  5I2N B;  2Z22 A;  2NVU B;  3BFT A;  3PPN A;  4IGT A;  1B5H A;  4IB2 A;  3QSL A;  2XXT A;  1MY0 A;  3IOU A;  2A5T A;  1A8E A;  3TCG A;  2B3B A;  3VVE A;  4XKP A;  5H8Q B;  5B70 A;  3QIM A;  3VV5 A;  2DWI A;  1FTL A;  4LA9 A;  4NF8 A;  2QJE A;  4ELO A;  2H4I A;  3ZKK A;  4RYA A;  5EYF A;  1QUL A;  2PMS A;  2REJ A;  2QL3 A;  3T22 A;  3FGS A;  1POT A;  3TKD A;  5ITO A;  1N84 A;  1ZBM A;  2FYI A;  4G8H A;  1WDN A;  2HAU A;  4RK9 A;  1NL5 A;  4UA8 A;  3OO6 A;  5DVF A;  1ZJL A;  2QMX A;  2AL4 A;  5EHM A;  1BIY A;  3CSB A;  3VXC A;  1P1Q A;  3HST A;  4EQ9 A;  3W9V A;  3F11 A;  5L9O A;  4ELP A;  2YLN A;  4THI A;  2I0C A;  1IXI A;  1Y20 A;  1LCF A;  3G3K A;  5ICT A;  2XX8 A;  3MC2 A;  1B7U A;  4IGR A;  1JVY A;  5HM4 B;  3IO4 A;  2DYX A;  1IXG A;  4UAC A;  2XX7 A;  1M5D A;  2Q89 A;  2OBG A;  4R6K A;  1B32 A;  5H8N A;  1MDP 1;  4KFQ A;  4JWO A;  4H5F A;  1ZKB A;  2GH9 A;  2QSX A;  2UVH A;  4H6D A;  4IO5 A;  4YZZ A;  1I69 A;  2Y7K A;  4KCC A;  2I3V A;  1UIV A;  1SD3 A;  5CMC A;  3OO9 A;  2O6A A;  3CI8 A;  1SYI A;  1O7T A;  3OSR A;  3OD7 A;  2QS3 A;  3O2A A;  3LSX A;  2GRV A;  1H43 A;  2F97 A;  4OZ9 A;  4KI0 E;  3RNN A;  3LC8 A;  4Q30 B;  3T9H B;  2OJT A;  1LFI A;  4JB7 A;  4GFR A;  2YJP A;  1B0H A;  1Y3Q A;  2I48 A;  1NNT A;  1QUI A;  1BP5 A;  4ZE8 A;  1TWY A;  1B2H A;  3OEL A;  3TEL A;  4FE8 A;  1DPP A;  3SKP A;  3K02 A;  3W15 C;  3OMB A;  1US5 A;  1B58 A;  3V89 B;  3KFM A;  2UVG A;  4YIC A;  2ONK E;  4G68 A;  3EPE A;  4U2R A;  3ODB A;  1CB6 A;  4JBZ A;  4H8I A;  1NH7 A;  4PFY A;  1JET A;  3N6T A;  3TDJ A;  3SER A;  3I6V A;  1B5J A;  4L17 A;  1UTH B;  4FOR A;  4YKP A;  4F3G A;  4LQ2 A;  2I4C A;  1SYH A;  1NH8 A;  4XKQ A;  1D9Y A;  1PB8 A;  2V3Q A;  1B4Z A;  3SDF A;  3MZ1 A;  5LOM A;  4K3F A;  2IA4 A;  1B6H A;  4GXA A;  4G77 A;  2RF1 A;  3K01 A;  1VSO A;  1FQD A;  1TT1 A;  1YTV A;  2DSF A;  5I58 A;  4JWY A;  2Y84 A;  1SW5 A;  3DP6 A;  1NNP A;  3VFJ A;  1B3L A;  4G8M A;  2B65 A;  1MY1 A;  5I57 A;  3OXN A;  1MXW A;  5ELV A;  3K1N A;  5FHN A;  1OQH A;  1NNK A;  4BDO A;  3N94 A;  1MH4 A;  1SW4 A;  1GR2 A;  2QMW A;  3FVG A;  5H8H A;  3KGC A;  3C32 A;  4PET A;  3EHU A;  4ZZA A;  5AA1 A;  3B7D A;  1URG A;  1OVB A;  1SDX A;  1VR5 A;  2O69 A;  4MH5 A;  3GBA A;  4F1U A;  4G68 C;  4YMA A;  2I3W A;  3QXM A;  3CFZ A;  1FQE A;  2DWH A;  4YB5 A;  5F1Q A;  5CC2 A;  2ZNU A;  4EDP A;  4RPN A;  4R2B A;  3CIJ A;  1AL3 A;  5TP9 B;  5DEX B;  4FAJ A;  4JDF A;  1N3W A;  3O97 A;  2XXR A;  1MY4 A;  5A5X B;  1PBQ A;  2O51 A;  1GVC A;  2DOJ A;  2Q9T A;  3V5A A;  3DM0 A;  1M5F A;  5HPQ A;  4QFL A;  4X1B A;  3FAT A;  3KSX A;  3TOD A;  1ATG A;  1N76 A;  1MXV A;  1D3K A;  3U8Q A;  3H6W A;  1JW1 A;  4E0W A;  4DXB A;  2I0B A;  1B5I A;  4ECF A;  1QVS A;  4MBP A;  1Y1Z A;  3U72 A;  1PBP A;  2W7Y A;  4GL8 A;  3FVO A;  3N26 A;  4MLV A;  3PPP A;  3RLF E;  4EF2 A;  3G3H A;  3HCQ A;  1Z7M E;  2FA7 A;  4ND9 A;  1B9J A;  1FTK A;  4TOZ A;  5H8F A;  3R26 A;  4QFK A;  3RQT A;  3C9H A;  5IAI A;  1VFE A;  3VLW A;  3K00 A;  1M5C A;  3KSJ A;  3G7W A;  4TLL B;  2D21 A;  1WOD A;  3IOW A;  3RUM A;  3DEL B;  3JV9 A;  3IAZ A;  1XC1 A;  1R9Q A;  3Q29 A;  4IO2 A;  4XXU A;  4C0R A;  3TUS A;  4ZS9 A;  5L8D A;  3TZA A;  3FIR A;  5I59 B;  3O29 A;  4POW A;  3SEU A;  3FV1 A;  4HW8 A;  2HEU A;  3B6Q A;  5KZT A;  3LUY A;  2PVU A;  1A8F A;  1LCT A;  5JTY A;  3SEY A;  4H67 A;  1EZP A;  1MRP A;  1PC3 A;  2AIX A;  1MH3 A;  1Q1K A;  1HSE A;  3QYT A;  1QKB A;  1RYX A;  1YCJ A;  3H6U A;  4YAH X;  1TXF A;  3TCF A;  3EHT A;  1JW4 A;  3IJX B;  4LP2 B;  3OSQ A;  3MP6 A;  4BLA A;  1XS5 A;  2QPQ A;  2IEE A;  3KOS A;  3R7X A;  4GF8 A;  3ECR A;  4NMY A;  2P2A A;  1FTJ A;  4F2Q A;  5DVJ A;  3TQW A;  3TTR A;  5AE4 A;  1B05 A;  1XHY A;  3PUV E;  5I2K B;  3RTW B;  3G3F A;  2UYE A;  1MQD A;  3C31 A;  4HTG A;  1T0K A;  3SES A;  3MUQ A;  3O66 A;  5CBS A;  5ITP A;  1LST A;  1IIT A;  4EQB A;  4YB6 A;  2F7A A;  4FEB A;  5BUU A;  2RIN A;  2UXA A;  1O64 A;  3HPI A;  3T9X B;  5AA4 A;  3CVG A;  2XXP A;  3C35 A;  1XVX A;  1FW0 A;  3TAJ A;  2Q2A A;  3C33 A;  3H4Z A;  1ELJ A;  3PUZ E;  1UQW A;  3G3J A;  4F2O A;  1FTM A;  3CSG A;  5TPA B;  2CZL A;  4OEV A;  1B51 A;  1M5E A;  3I3V A;  4NF4 A;  1B4H A;  1S7Y A;  5FTI A;  4R9F A;  4XKR A;  3K6V A;  1LBC A;  4HCY A;  3BKI B;  4F39 A;  1ZTY A;  4GD5 A;  2XXX A;  4F19 A;  2I49 A;  4LAT A;  1YAE A;  3SET A;  4MLQ A;  3MZB A;  2F7B A;  4U4S A;  2XXY A;  1QUK A;  3MAM A;  5TU0 A;  3E13 X;  5AA2 A;  2O7I A;  1MS7 A;  3MWB A;  1OMP A;  1SI1 A;  3ONM A;  4U23 A;  4PP0 A;  3C34 A;  3OO7 A;  3ZS6 A;  1S50 A;  4RXL A;  3MVY A;  4DXU A;  3ZKL A;  4KYS A;  3HV1 A;  4F18 A;  4YMB A;  3BBR A;  3MVX A;  4OFJ A;  2Z8D A;  1QW0 A;  2Y7W A;  2VOZ A;  4R6H A;  1IEJ A;  1VFD A;  2F5X A;  3OOA A;  4OET A;  5KCJ A;  3N5L A;  2XD3 A;  2ZXT A;  1XVY A;  4Z7E A;  1LBB A;  4GWO A;  1DPE A;  1XT8 A;  4XIG Q;  5DT6 A;  1RYO A;  3TEP A;  2V84 A;  4O3B A;  2QS2 A;  2O7U A;  4OVJ A;  4OYV A;  4OEN A;  5I2N A;  4NF5 B;  4KCD A;  1CE2 A;  3E3K A;  2KLF A;  4IO4 A;  1URD A;  5CMK A;  3IOT A;  1ZLQ A;  4FED A;  4O3A A;  1R1N A;  1US4 A;  3IOR A;  5H8Q A;  3MQ9 A;  3S9L C;  1EU8 A;  5CMB A;  3K4U A;  2HZK A;  4LON B;  1GGG A;  1LGB C;  1H3D A;  5ISU A;  3QAX A;  1GTK A;  3VXB A;  1MPB A;  1OQG A;  4GL0 A;  5H8S A;  1II5 A;  2E1S A;  4RA1 A;  4NF6 B;  1MG1 A;  4ZE9 A;  1XOC A;  1A54 A;  3FJM A;  3IJO B;  1B7Z A;  2ZNT A;  3GZG A;  1JQF A;  4KYD A;  1MXX A;  4DCX A;  3TPA A;  2VD3 A;  3UK4 A;  3E9X A;  4EF1 A;  3H03 A;  1F9B A;  4GVO A;  2ALU A;  1A55 A;  2PYY A;  4QSC A;  3V83 A;  5AA2 D;  2ZNS A;  3IR1 A;  2GFE A;  3B6W A;  3LSW A;  5BWJ A;  3DP8 A;  4ZZE A;  2DQV A;  3U1O A;  3PUX E;  1DTG A;  3Q25 A;  5FHM A;  1DMB A;  1NMU A;  2UYF A;  2Z8E A;  2ZMB A;  4OES A;  5AA3 A;  3V8X B;  3LSF B;  4YKI A;  1SQY A;  4HS7 A;  1AIV A;  4RJZ A;  1Y4T A;  1MQH A;  1L5T A;  4XTC Q;  1UTB B;  2YPN A;  4RNS A;  4M1V A;  3R6U A;  2HCA A;  2HZL A;  2UVJ A;  1B1H A;  4QSE A;  3KZG A;  1LAH E;  5KDT B;  1DOT A;  4DE8 A;  2P0S A;  4P11 A;  3WAF A;  4QFO A;  1PB9 A;  3ZSF A;  3KJ7 A;  2BJJ X;  1USY H;  3HHG A;  1LB9 A;  4LUB A;  4I8C A;  5EHS A;  2X7P A;  3S9M C;  4Q0C A;  3A09 A;  2PT1 A;  3FXR A;  1N7W A;  4QRZ A;  3RN8 A;  2V25 A;  2DXR A;  3TTL A;  3EF7 A;  2X7Q A;  1N04 A;  4OFO A;  4F22 A;  4RY1 A;  4X48 A;  3S4U A;  2G29 A;  4KPT A;  1LLS A;  4JSD A;  3GBB A;  3RTF B;  2XXU A;  2R71 A;  3IK6 B;  1BLF A;  2VD2 A;  3M3K A;  1H45 A;  1SI0 A;  5DVI A;  3QUF A;  1DSN A;  1MXZ A;  2Z23 A;  1OLC A;  4NF6 A;  3QK6 A;  1QJM A;  1LAF E;  3T9U A;  1Y3P A;  1TFD A;  1UTH A;  3C4M A;  4DIG A;  1HSJ A;  1ZIU A;  4IO3 A;  1IQ7 A;  2NXO A;  4ZED A;  4MF3 A;  3SEV A;  1LAX A;  3RY3 A;  1TFA A;  5L9M A;  4GRK A;  4BDQ A;  4ZEF A;  5CMM A;  2PX1 A;  1QUJ A;  3IO6 A;  5J1D A;  4P0I A;  1P1O A;  2D3I A;  3TTM A;  3RT6 B;  4EQ7 A;  2HAV A;  3VLU A;  1R6Z A;  5JEI A;  3T9V A;  3UA8 A;  3D4C A;  2A5T B;  1I6B A;  2V93 A;  1B0L A;  3TFL A;  2D5W A;  2Y7P A;  3TTK A;  3PGF A;  3K0V A;  4H0W A;  2XXH A;  4E0X A;  1AMF A;  3O6I A;  2DVZ A;  4NWC A;  5K2X A;  4IO7 A;  2PT2 A;  2ONS A;  1B52 A;  4ZEB A;  2OWS A;  3UOR A;  3KJT A;  3MP1 A;  2NUV A;  2XHD A;  3KOT A;  3PD8 A;  2VGQ A;  2I4B A;  4YKJ A;  1NFT A;  4LZ7 A;  1R9L A;  3O9P A;  4H5G A;  2HXW A;  1M5B A;  3JZJ A;  4NED A;  3PV0 E;  3FVK A;  4F3P A;  3S2V A;  5TP9 A;  5DEX A;  4G4P A;  4N6P A;  4F3S A;  3CG3 A;  5A5X A;  2F78 A;  3S9E A;  4R6Y A;  1MXU A;  3UIF A;  2I58 A;  4I9D A;  2V3T A;  2XXV A;  2F35 A;  4FAT A;  3LBS A;  4ZEI A;  3USD A;  3MBP A;  3Q26 A;  1JEU A;  4R73 A;  4R75 A;  3THI A;  3SEW A;  2I6E A;  3KN3 A;  5CRY A;  5H8N B;  3FUZ A;  3KBR A;  4PFT A;  3K6W A;  1D9V A;  1P1W A;  4GLI A;  4F1Y A;  1SW2 A;  4AB6 A;  1I6A A;  4WEP A;  3VDF A;  2THI A;  3PMW A;  4RK2 A;  3S9N C;  2A5S A;  3OO8 A;  2RC9 A;  4YKK A;  3G3G A;  1Z7N E;  4OMB A;  2H25 A;  4ESX A;  2H98 A;  1H44 A;  3RGY A;  2O84 X;  3KN7 A;  2R9J A;  4WED A;  5HBC A;  4IY6 A;  3FXU A;  4EXL A;  1OLA A;  2RC8 A;  2M8C A;  5I84 A;  2G93 A;  4AQ4 A;  1I6Q A;  2R6G E;  4GIZ A;  3GLB A;  3FVN A;  5JK4 A;  3MP8 A;  4KR5 A;  1BKA A;  5FTH A;  1AOV A;  3IL1 B;  3SEX A;  3PMX A;  4C1T A;  4R72 A;  3K1P A;  3T93 B;  2OLB A;  3IOV A;  2H5Y A;  2ZYK A;  4H8J A;  2RKM A;  3L6G A;  3JYR A;  4G68 B;  1VE4 A;  4NE4 A;  2DWJ A;  5I59 A;  2H9B A;  1MY2 A;  3OEN A;  4OXV A;  4OEU A; 
#chains in the Genus database with same CATH topology
 2QFL A;  3TMG A;  2FVZ A;  5K2Y A;  2OK2 A;  1N7X A;  3BFU A;  3G3I A;  4N4U A;  4U21 A;  1B7H A;  3A29 A;  4M4G A;  2P1S A;  3VVF A;  5CBR A;  3VLV A;  3FD3 A;  2QS1 A;  2QVR A;  4PBH A;  3UN6 A;  1NV5 A;  4N17 A;  4HCW A;  2HFB A;  2ZYO A;  4GXS B;  2OWT A;  2XXK A;  4YU0 A;  4H1X A;  1P1U A;  1FQB A;  4Z0I A;  1J1N A;  5F7V A;  4OQO A;  5M2V A;  4N15 A;  4GBV A;  1YXI A;  5I58 B;  2CEX A;  3H3G A;  1LBV A;  1FRP A;  3Q27 A;  5I57 B;  5ET5 A;  4MNC A;  3U93 A;  1FPG A;  4LVQ A;  1Y9U A;  4FJP A;  3PPR A;  5I56 B;  2XXI A;  5I2K A;  3H6T A;  1LAG E;  2OCU A;  4KYE A;  5H8H B;  4BDM A;  4ELR A;  1A7L A;  1Q35 A;  4GWZ A;  4OFL A;  4GQO A;  1MM7 A;  1H76 A;  2Z8F A;  4LN5 A;  5A5L A;  3RPL B;  1D9Q A;  1IIW A;  1EZO A;  2QVU A;  2V3U A;  3IB2 A;  4MFI A;  1B3G A;  4DXC A;  3O6G A;  2XWO A;  3ILU B;  3KG2 A;  3TQL A;  2LAO A;  3M3L A;  2B3F A;  2F3D A;  5L9S A;  3Q28 A;  4X04 A;  1HSL A;  4ZEK A;  2REG A;  4NF0 A;  1MQG A;  3HO7 A;  4JSO A;  2WKY A;  1ZMG A;  4HE0 A;  1YPN A;  4OAN A;  2F8D A;  2VT5 A;  2WEF A;  1SW1 A;  2Q8J A;  2O1M A;  3LSL A;  2P3N A;  1B1X A;  4PGN A;  3VVD A;  5TPA A;  4AB5 A;  3TTN A;  1FPJ A;  3WAE A;  2GHA A;  1SBP A;  4IY5 A;  4I62 A;  3T0J A;  4R74 A;  4JWX A;  2F34 A;  1P99 A;  1O63 A;  1N0T A;  4TQU Q;  5CM6 A;  1MQI A;  3UGW A;  3PD9 A;  1B3E A;  1JP4 A;  4O94 A;  3IB0 A;  2AYS A;  1FQF A;  3CFX A;  1IMB A;  3I5O A;  1IXH A;  2UVI A;  4U1O A;  4X1D A;  4Q8R A;  3P7I A;  1NKX A;  2VHA A;  2FIX A;  3EKI A;  4O3C A;  4MIJ A;  1WVJ A;  4XEQ A;  1FCK A;  3GYY A;  3LR1 A;  3U65 A;  2DE2 A;  3H06 B;  4BDN A;  2DWA A;  1EH3 A;  2VP1 A;  4F3B A;  1USY E;  5IKB A;  4LZ8 A;  1A40 A;  1JW5 A;  1NV2 A;  2X26 A;  2NWJ A;  4EUO A;  3K2D A;  1PEB A;  2GHB A;  1JVX A;  3CRB A;  3T66 A;  4GOT A;  1LB8 A;  1P1N A;  2F6G A;  1EZ9 A;  3B6T A;  3PUW E;  1FQA A;  4U1Z A;  4JXI A;  4N07 A;  5H8F B;  4X9T A;  2CMO A;  2QRY A;  3H6V A;  3UP9 A;  1PDA A;  4IO6 A;  2OZZ A;  3CG1 A;  1B40 A;  3MVZ A;  4OHN A;  4TLM B;  3VE1 B;  1A99 A;  5ICQ A;  1RKM A;  1FBP A;  1MPD A;  1K9Z A;  3O6H A;  3TYH A;  3E4R A;  2XX9 A;  5I56 A;  4PFW A;  2WYP A;  3CFL A;  1NV6 A;  1N3X A;  2E0S A;  5ET7 A;  2O1L A;  1OVT A;  4I1D A;  3FXQ A;  3CR9 A;  1FTO A;  1KA0 A;  3U94 A;  1ANF A;  2DXY A;  2O68 A;  4PAF A;  4O8M A;  1MDQ A;  4N8G A;  4DLD A;  4HXV A;  4MEV A;  1MPC A;  3IX1 A;  3H7M A;  4JVC A;  4NF5 A;  4R9G A;  3KEI A;  2ANJ A;  1POY 1;  1DK4 A;  2XWK A;  5DYH A;  5JTY B;  2XXQ A;  4G8N A;  4Q5T A;  1JEV A;  3IB1 A;  3OEM A;  3OEK A;  4LZ5 A;  4POX A;  1UIU A;  4BDL A;  3FJG A;  1IZ1 A;  1LFH A;  3FJ7 A;  4XKN A;  3IFA A;  4DZ1 A;  4F29 A;  1MXY A;  1KWH A;  2Y7R A;  3LV0 A;  4ONY A;  3W9W A;  4FEC A;  2F36 A;  3PPQ A;  1OIB A;  4FIM A;  4NG7 A;  2F6P A;  2XXW A;  3QMF A;  4ESW A;  2ESN A;  4OER A;  2ZYM A;  2Q88 A;  5CI5 A;  1PB7 A;  5ET8 A;  3RPW A;  1Y3N A;  2ABH A;  3PPO A;  4F31 B;  1MQJ A;  4KD5 A;  1MY3 A;  5B7D A;  2FNC A;  3PU5 A;  2Y7I A;  3PUY E;  4NTL A;  4PAK A;  1QKA A;  2RCA A;  4ELQ A;  3PMV A;  4ZDM A;  4BDR A;  3U92 A;  2DVC A;  1LFG A;  3MZ9 A;  1NUZ A;  4ZEC A;  2VPN A;  1SVX B;  3DP4 A;  3FZV A;  4DDD A;  4PE5 B;  4EXK A;  4NWD A;  4DI3 D;  3GXA A;  1DTZ A;  5FBP A;  1FPF A;  2MKZ A;  5DTB A;  5AA4 B;  3N6U A;  4QFP A;  4KQP A;  4F1V A;  4YB7 A;  1JNF A;  1EYK A;  4OWD A;  3K1M A;  2XD2 A;  3EQ1 A;  1GV8 A;  4NF8 B;  3MPK A;  3EN3 A;  1BTJ A;  1MM6 A;  1DCU A;  3MW0 A;  3FV2 A;  5LDZ A;  4NF4 B;  4QFN A;  1UTB A;  4AS5 A;  4DCY A;  2WBB A;  3ILT B;  1FQC A;  2RC7 A;  2ONR A;  4U4X A;  2WYK A;  1IUD A;  3AXF A;  5KDT A;  1B3F A;  4PQJ A;  3BIH A;  3KN8 A;  3TCH A;  3M3F A;  1S9T A;  4QSD A;  2RCB A;  2DE3 A;  4R2F A;  3RT8 A;  3B50 A;  1QGX A;  5IZ3 A;  3HN0 A;  4RPO A;  5AA2 B;  3MJN A;  3MPL A;  4P0G A;  2P3V A;  5IZZ A;  4QHQ A;  4WXJ A;  4U22 A;  4JVD A;  3MVW A;  3T96 B;  2DE4 A;  2PFY A;  2QS4 A;  2NOO A;  3K6X A;  3L6H A;  2DS9 A;  3M8U A;  2HHM A;  3QUJ A;  2WX9 A;  1IXC A;  4C1U A;  1AH5 A;  3C36 A;  4KHZ E;  1B3H A;  3A3C A;  4ISU A;  1IMF A;  2HQ0 A;  4LQ5 A;  3HHF A;  4PFU A;  4G2Z A;  2F7C A;  3K6U A;  1NUW A;  2Q2C A;  4N13 A;  1URS A;  2WBD A;  2H99 A;  4QF9 A;  3DLN A;  5KCJ B;  1SPI A;  1Y1M A;  3E79 A;  3FAS A;  3ISP A;  5FHO A;  4OTE A;  2AL5 A;  1EYI A;  1B46 A;  4H65 A;  4WKM A;  3D4G A;  1ZU0 A;  2DP8 A;  3O28 A;  2ZYN A;  1FSA A;  1D4N A;  1IMC A;  1NNF A;  1Y4C A;  3EHS A;  1NV7 A;  2PBW A;  3A3U A;  5I2N B;  2Z22 A;  2NVU B;  3RYD A;  1LBZ A;  3BFT A;  3PPN A;  1NV1 A;  4IGT A;  1B5H A;  4IB2 A;  3QSL A;  2XXT A;  1MY0 A;  3IOU A;  3T1B A;  2A5T A;  1A8E A;  3TCG A;  2B3B A;  3VVE A;  4XKP A;  5H8Q B;  5B70 A;  4N91 A;  3QIM A;  2Y5L A;  3VV5 A;  2DWI A;  1FTL A;  4LA9 A;  4NF8 A;  2QJE A;  4ELO A;  2H4I A;  3ZKK A;  4RYA A;  1FPE A;  5EYF A;  1QUL A;  2PMS A;  2REJ A;  2QL3 A;  3T22 A;  3FGS A;  5J16 A;  1POT A;  4DI4 B;  3TKD A;  5ITO A;  1N84 A;  1ZBM A;  2FYI A;  1IMA A;  4G8H A;  1WDN A;  2B4M A;  2HAU A;  2PFZ A;  4RK9 A;  1NL5 A;  4UA8 A;  3OO6 A;  5DVF A;  1ZJL A;  2QMX A;  1FPD A;  2AL4 A;  5EHM A;  1BIY A;  3CSB A;  3VXC A;  1P1Q A;  3HST A;  4HE1 A;  4N6D A;  4EQ9 A;  3W9V A;  3F11 A;  2DDK A;  4OVP A;  5L9O A;  4ELP A;  1FBC A;  2YLN A;  4THI A;  2I0C A;  1IXI A;  2CEY A;  1Y20 A;  1LCF A;  4PDH A;  3G3K A;  5ICT A;  2XX8 A;  5EYH A;  3MC2 A;  1B7U A;  2F3B A;  4IGR A;  1JVY A;  5HM4 B;  3IO4 A;  2DYX A;  1EYJ A;  1IXG A;  4UAC A;  2XX7 A;  1M5D A;  2Q89 A;  2OBG A;  4GWS A;  4XFE A;  4R6K A;  1B32 A;  5H8N A;  1MDP 1;  5DW8 A;  4KFQ A;  4JWO A;  4H5F A;  1ZKB A;  2GH9 A;  5ESY A;  2QSX A;  2UVH A;  4H6D A;  4IO5 A;  4YZZ A;  3B8B A;  1I69 A;  2Y7K A;  4KCC A;  2I3V A;  4HE2 A;  1UIV A;  1SD3 A;  5CMC A;  3OO9 A;  2O6A A;  3CI8 A;  1SYI A;  1O7T A;  3OSR A;  3OD7 A;  2QS3 A;  3O2A A;  3LSX A;  2Q74 A;  1KZ8 A;  2GRV A;  1H43 A;  3HFU A;  2F97 A;  4OZ9 A;  4KI0 E;  3RNN A;  3LC8 A;  4Q30 B;  3T9H B;  2OJT A;  1LFI A;  4JB7 A;  4GFR A;  2YJP A;  1B0H A;  1G0H A;  1Y3Q A;  4MAG A;  2I48 A;  1NNT A;  1QUI A;  1BP5 A;  4ZE8 A;  1TWY A;  1B2H A;  3OEL A;  3TEL A;  4FE8 A;  1DPP A;  1INP A;  3SKP A;  3K02 A;  3W15 C;  3OMB A;  1US5 A;  1B58 A;  3V89 B;  3KFM A;  2UVG A;  4YIC A;  2ONK E;  4G68 A;  4O7M A;  3EPE A;  4U2R A;  3ODB A;  2XWV A;  1CB6 A;  4JBZ A;  4H8I A;  1NH7 A;  4PFY A;  1JET A;  3N6T A;  1AWB A;  3TDJ A;  3SER A;  3I6V A;  1B5J A;  4L17 A;  1UTH B;  4FOR A;  4P56 A;  4YKP A;  4F3G A;  4LQ2 A;  2I4C A;  1SYH A;  1NH8 A;  4XKQ A;  1D9Y A;  1PB8 A;  2V3Q A;  1B4Z A;  3SDF A;  3MZ1 A;  1LBW A;  2GQ1 A;  2KQZ A;  5LOM A;  4K3F A;  2IA4 A;  1B6H A;  4GXA A;  4G77 A;  2RF1 A;  3K01 A;  1VSO A;  1FQD A;  1TT1 A;  1YTV A;  2DSF A;  5I58 A;  4JWY A;  2Y84 A;  1SW5 A;  3DP6 A;  2FBP A;  3KC0 A;  1NNP A;  1B3L A;  3VFJ A;  4G8M A;  2B65 A;  1MY1 A;  5I57 A;  3OXN A;  1MXW A;  5ELV A;  3K1N A;  4GX3 A;  5FHN A;  2XA5 A;  4OVQ A;  1OQH A;  1NNK A;  4BDO A;  3N94 A;  1MH4 A;  1SW4 A;  1GR2 A;  2QMW A;  3FVG A;  2ZZW A;  2KR0 A;  5H8H A;  3KGC A;  3C32 A;  4PET A;  3EHU A;  4ZZA A;  5AA1 A;  3B7D A;  1URG A;  4MHF A;  1OVB A;  1SDX A;  5ET6 A;  3RPL A;  1VR5 A;  2O69 A;  4MH5 A;  3GBA A;  4F1U A;  4G68 C;  4YMA A;  4NAP A;  2I3W A;  3QXM A;  5EQ7 A;  3CFZ A;  1FQE A;  1YZ0 A;  2DWH A;  4YB5 A;  5F1Q A;  3FXB A;  5CC2 A;  1CNQ A;  2ZNU A;  4EDP A;  4RPN A;  4FBP A;  4R2B A;  3KBZ A;  3CIJ A;  1AL3 A;  5TP9 B;  5DEX B;  4FAJ A;  5EQ9 A;  4JDF A;  1N3W A;  3O97 A;  2XXR A;  1MY4 A;  5A5X B;  1PBQ A;  2O51 A;  1GVC A;  2DOJ A;  5I7I A;  2Q9T A;  3V5A A;  3DM0 A;  4PF8 A;  1M5F A;  1FPB A;  5HPQ A;  4QFL A;  4X1B A;  3FAT A;  3KSX A;  3TOD A;  1ATG A;  1N76 A;  1MXV A;  1D3K A;  3U8Q A;  3H6W A;  4MCO A;  1JW1 A;  2ZZV A;  4E0W A;  4DXB A;  4X8R A;  2I0B A;  1B5I A;  4ECF A;  1QVS A;  4MBP A;  4PDD A;  1Y1Z A;  3U72 A;  2HPG A;  1PBP A;  2W7Y A;  4GL8 A;  5EQ8 A;  4QXD A;  4QBA A;  4PAI A;  5IGA A;  3FVO A;  3N26 A;  4OVR A;  4MLV A;  3PPP A;  3RLF E;  1NV0 A;  4EF2 A;  3G3H A;  3HCQ A;  1Z7M E;  2FA7 A;  4ND9 A;  1B9J A;  1FTK A;  4TOZ A;  5H8F A;  3R26 A;  4QFK A;  2OX3 A;  3RQT A;  3C9H A;  5IAI A;  1VFE A;  1RDZ A;  5I3S A;  3VLW A;  3K00 A;  1M5C A;  3KSJ A;  3G7W A;  4TLL B;  2D21 A;  1WOD A;  3IOW A;  3RUM A;  3DEL B;  3MST A;  3JV9 A;  3IAZ A;  1XC1 A;  1R9Q A;  3Q29 A;  4IO2 A;  4XXU A;  4C0R A;  3TUS A;  4ZS9 A;  5L8D A;  3TZA A;  3FIR A;  5I59 B;  2Y5K A;  3O29 A;  5IM2 A;  1IME A;  4POW A;  3SEU A;  3FV1 A;  4HW8 A;  3PTY A;  2HEU A;  3B6Q A;  5KZT A;  3LUY A;  2PVU A;  4GWY A;  1A8F A;  1LCT A;  5JTY A;  3SEY A;  4H67 A;  1FBD A;  1NUX A;  1EZP A;  1MRP A;  1PC3 A;  3E78 A;  1FPI A;  1FBF A;  2AIX A;  2R8T A;  4I40 A;  4IR8 A;  1MH3 A;  1Q1K A;  1HSE A;  3QYT A;  4OA4 A;  1QKB A;  1RYX A;  1YCJ A;  3H6U A;  4YAH X;  1TXF A;  2JJK A;  3TCF A;  3EHT A;  1JW4 A;  3IJX B;  4LP2 B;  3NOH A;  3OSQ A;  3MP6 A;  4BLA A;  1RDX A;  1XS5 A;  2QPQ A;  2IEE A;  3KOS A;  3R7X A;  4GF8 A;  3ECR A;  4NMY A;  4NQ8 A;  2P2A A;  1FTJ A;  4F2Q A;  5DVJ A;  4I3E A;  4NGU A;  3TQW A;  3TTR A;  5AE4 A;  1B05 A;  1XHY A;  3PUV E;  5I2K B;  3D1R A;  2BJI A;  4PFI A;  3RTW B;  3G3F A;  2UYE A;  1MQD A;  2OWZ A;  3C31 A;  4HTG A;  1T0K A;  3SES A;  3MUQ A;  3O66 A;  5CBS A;  5ITP A;  1LST A;  4NN3 A;  1IIT A;  4EQB A;  4YB6 A;  2F7A A;  4FEB A;  5EYG A;  5BUU A;  2RIN A;  2UXA A;  1O64 A;  3HPI A;  4O7I A;  2QVV A;  3T9X B;  5AA4 A;  3CVG A;  4PC9 A;  2XXP A;  3C35 A;  1XVX A;  1FW0 A;  4JVI A;  3TAJ A;  2Q2A A;  3C33 A;  3H4Z A;  1ELJ A;  3PUZ E;  1UQW A;  3G3J A;  4F2O A;  1FTM A;  3CSG A;  5TPA B;  2CZL A;  4P9K A;  4OEV A;  4NF4 A;  1B51 A;  1M5E A;  3I3V A;  1B4H A;  1S7Y A;  5FTI A;  4R9F A;  4XKR A;  3FBP A;  3K6V A;  1LBC A;  4HCY A;  3BKI B;  4P8B A;  4F39 A;  1ZTY A;  4GD5 A;  2XXX A;  4F19 A;  2I49 A;  4LAT A;  1YAE A;  3SET A;  4MLQ A;  3MZB A;  2F7B A;  4PCD A;  4U4S A;  2XXY A;  1QUK A;  3MAM A;  2PCR A;  5TU0 A;  2CZI A;  3E13 X;  5AA2 A;  2O7I A;  1MS7 A;  3MWB A;  1OMP A;  1SI1 A;  3ONM A;  4PBQ A;  4U23 A;  4PP0 A;  3C34 A;  3OO7 A;  3ZS6 A;  5LTC A;  1S50 A;  4RXL A;  3MVY A;  4DXU A;  3ZKL A;  4KYS A;  3HV1 A;  4F18 A;  4YMB A;  4P47 A;  1BK4 A;  3BBR A;  3MVX A;  4OFJ A;  2Z8D A;  1QW0 A;  2Y7W A;  2VOZ A;  4R6H A;  1IEJ A;  1VFD A;  2F5X A;  4OET A;  3OOA A;  5KCJ A;  3N5L A;  2XD3 A;  2ZXT A;  1XVY A;  4Z7E A;  1LBB A;  4GWO A;  1DPE A;  5IZ1 A;  1XT8 A;  4XIG Q;  4I3Y A;  5DT6 A;  1FBE A;  1RYO A;  3TEP A;  4PTK A;  2V84 A;  4O3B A;  2QS2 A;  2O7U A;  4OVJ A;  4OYV A;  4H46 A;  4OEN A;  5I2N A;  2FHY A;  4KCD A;  4NF5 B;  1CE2 A;  3E3K A;  2KLF A;  4IO4 A;  4KXP A;  1URD A;  3LUZ A;  5CMK A;  3IOT A;  1ZLQ A;  4FED A;  4O3A A;  4GX6 A;  4P1L A;  1R1N A;  1US4 A;  3IOR A;  2ZZX A;  4PFB A;  5H8Q A;  3MQ9 A;  3S9L C;  1EU8 A;  5CMB A;  3K4U A;  2HZK A;  4OVT A;  1FJ6 A;  4LON B;  1GGG A;  1LGB C;  1H3D A;  5ISU A;  3QAX A;  1GTK A;  5F24 A;  3VXB A;  1MPB A;  1OQG A;  4GL0 A;  5H8S A;  1II5 A;  2E1S A;  4RA1 A;  1KA1 A;  4NF6 B;  1MG1 A;  4GWU A;  4ZE9 A;  1XOC A;  1A54 A;  3FJM A;  3IJO B;  1B7Z A;  2ZNT A;  3GZG A;  1JQF A;  4KYD A;  1MXX A;  4DCX A;  3TPA A;  2VD3 A;  3UK4 A;  1FBH A;  3E9X A;  4EF1 A;  1NV3 A;  3H03 A;  1F9B A;  4GVO A;  2ALU A;  1A55 A;  2PYY A;  4QSC A;  3V83 A;  5AA2 D;  2ZNS A;  3IR1 A;  2GFE A;  3B6W A;  3LSW A;  5BWJ A;  4H45 A;  3DP8 A;  3SZP A;  4ZZE A;  2DQV A;  3U1O A;  3PUX E;  1DTG A;  3Q25 A;  5FHM A;  1DMB A;  1NMU A;  2UYF A;  2Z8E A;  2ZMB A;  4OES A;  5AA3 A;  3V8X B;  4PGP A;  3LSF B;  4GWX A;  4YKI A;  1SQY A;  4HS7 A;  1AIV A;  4RJZ A;  1Y4T A;  1MQH A;  1L5T A;  4XTC Q;  1UTB B;  2YPN A;  4P1E A;  4RNS A;  4M1V A;  3R6U A;  2HCA A;  2HZL A;  2UVJ A;  1B1H A;  4QSE A;  3KZG A;  1LAH E;  5KDT B;  1DOT A;  4DE8 A;  3KC1 A;  2P0S A;  4P11 A;  3WAF A;  4QFO A;  1PB9 A;  3ZSF A;  4N6K A;  3KJ7 A;  4PE3 A;  2BJJ X;  1LEV A;  1USY H;  3HHG A;  1LB9 A;  4LUB A;  4I8C A;  5IZ3 B;  3CHG A;  5EHS A;  2X7P A;  3S9M C;  4Q0C A;  3A09 A;  2PT1 A;  3FXR A;  1N7W A;  4QRZ A;  3RN8 A;  2V25 A;  4NX1 A;  2DXR A;  3TTL A;  3EF7 A;  4GBW A;  2X7Q A;  1N04 A;  4OFO A;  4F22 A;  2CZH A;  4RY1 A;  4X48 A;  2VPO A;  3S4U A;  2G29 A;  4KPT A;  1IMD A;  1FPK A;  1LLS A;  4JSD A;  1K9Y A;  3GBB A;  3RTF B;  2XXU A;  2R71 A;  3IK6 B;  1BLF A;  2VD2 A;  3M3K A;  1H45 A;  1SI0 A;  5DVI A;  3QUF A;  1DSN A;  1MXZ A;  2Z23 A;  1OLC A;  4NF6 A;  3QK6 A;  1QJM A;  1LAF E;  4P3L A;  4GWW A;  3T9U A;  1Y3P A;  1TFD A;  1UTH A;  3C4M A;  4DIG A;  4UAB A;  1FBG A;  1HSJ A;  1ZIU A;  4IO3 A;  1IQ7 A;  2NXO A;  4ZED A;  4MF3 A;  3SEV A;  1LAX A;  3RY3 A;  1TFA A;  5L9M A;  4GRK A;  4BDQ A;  4ZEF A;  5CMM A;  2PX1 A;  1QUJ A;  3IO6 A;  5J1D A;  4P0I A;  1P1O A;  1FPL A;  2D3I A;  3TTM A;  3RT6 B;  4EQ7 A;  2HAV A;  3VLU A;  4MJO A;  1R6Z A;  5JEI A;  3T9V A;  3UA8 A;  3D4C A;  2Q8M A;  2A5T B;  1I6B A;  2V93 A;  1B0L A;  3TFL A;  2FIE A;  2D5W A;  2Y7P A;  3TTK A;  3PGF A;  3K0V A;  4H0W A;  2XXH A;  4E0X A;  1AMF A;  3O6I A;  2DVZ A;  4NWC A;  5K2X A;  4IO7 A;  2PT2 A;  2ONS A;  1B52 A;  4ZEB A;  2OWS A;  3UOR A;  2V4C A;  3KJT A;  4PF6 A;  2B4L A;  3MP1 A;  2NUV A;  2XHD A;  3KOT A;  4GX4 A;  1DBZ A;  3PD8 A;  2VGQ A;  2I4B A;  4OVS A;  4YKJ A;  1NFT A;  4LZ7 A;  1FJ9 A;  1R9L A;  3O9P A;  4H5G A;  2HXW A;  1M5B A;  3JZJ A;  4NED A;  3PV0 E;  5I5P A;  3FVK A;  4F3P A;  3S2V A;  1G0I A;  5TP9 A;  1NUY A;  5DEX A;  4G4P A;  1FTA A;  4N6P A;  4F3S A;  5EQA A;  3CG3 A;  5A5X A;  4XF5 A;  4MNP A;  2F78 A;  3S9E A;  4R6Y A;  1MXU A;  3UIF A;  4G61 A;  2I58 A;  4I9D A;  2V3T A;  2XXV A;  2F35 A;  4FAT A;  3LBS A;  4ZEI A;  3USD A;  3MBP A;  3Q26 A;  1JEU A;  4R73 A;  4R75 A;  3THI A;  3SEW A;  2I6E A;  3KN3 A;  5CRY A;  5H8N B;  3FUZ A;  3KBR A;  4PFT A;  3K6W A;  1D9V A;  1P1W A;  4GLI A;  4F1Y A;  1NI9 A;  1SW2 A;  4AB6 A;  1I6A A;  4WEP A;  3VDF A;  1NV4 A;  2THI A;  3PMW A;  4RK2 A;  4N81 A;  3IFC A;  3S9N C;  2A5S A;  4MMP A;  3OO8 A;  1Q9D A;  2RC9 A;  4YKK A;  2L5V A;  3G3G A;  1Z7N E;  4OMB A;  2H25 A;  4ESX A;  2H98 A;  1H44 A;  3RGY A;  2O84 X;  3KN7 A;  2R9J A;  4WED A;  5HBC A;  4IY6 A;  4MX6 A;  3FXU A;  1LBX A;  4EXL A;  1OLA A;  2RC8 A;  3BIG A;  2M8C A;  5I84 A;  2XWI A;  1RDY A;  4PFR A;  1LBY A;  2G93 A;  4AQ4 A;  1I6Q A;  1VDW A;  2R6G E;  4GIZ A;  3GLB A;  3FVN A;  5JK4 A;  3MP8 A;  4KR5 A;  1BKA A;  4AS4 A;  4N8Y A;  1XI6 A;  5FTH A;  1AOV A;  3IL1 B;  3SEX A;  3PMX A;  3MYU A;  4MNI A;  4R72 A;  4C1T A;  3K1P A;  3T93 B;  1YYZ A;  2OLB A;  3IOV A;  2H5Y A;  2ZYK A;  5T3J A;  4H8J A;  2HXR A;  2RKM A;  4NHB A;  3L6G A;  3JYR A;  4G68 B;  1VE4 A;  4NE4 A;  2DWJ A;  3ROJ A;  5I59 A;  2H9B A;  2CZK A;  1MY2 A;  3OEN A;  4OXV A;  4OEU A; 
#chains in the Genus database with same CATH homology
 3TMG A;  5K2Y A;  2OK2 A;  1N7X A;  3BFU A;  3G3I A;  4U21 A;  1B7H A;  4M4G A;  2P1S A;  3VVF A;  5CBR A;  3VLV A;  3FD3 A;  2QS1 A;  3UN6 A;  4HCW A;  2HFB A;  2ZYO A;  4GXS B;  2OWT A;  4YU0 A;  4H1X A;  1P1U A;  1FQB A;  4Z0I A;  1J1N A;  5F7V A;  4OQO A;  5M2V A;  5I58 B;  3H3G A;  3Q27 A;  5I57 B;  3U93 A;  4LVQ A;  1Y9U A;  4FJP A;  3PPR A;  5I56 B;  2XXI A;  5I2K A;  3H6T A;  1LAG E;  2OCU A;  4KYE A;  5H8H B;  4BDM A;  4ELR A;  1A7L A;  1Q35 A;  4OFL A;  4GQO A;  1MM7 A;  1H76 A;  2Z8F A;  1IIW A;  1EZO A;  2V3U A;  3IB2 A;  4MFI A;  1B3G A;  4DXC A;  3O6G A;  3ILU B;  3KG2 A;  3TQL A;  2LAO A;  3M3L A;  2B3F A;  5L9S A;  3Q28 A;  1HSL A;  4ZEK A;  2REG A;  1MQG A;  3HO7 A;  4JSO A;  2WKY A;  1ZMG A;  1YPN A;  2F8D A;  1SW1 A;  2Q8J A;  2O1M A;  3LSL A;  1B1X A;  3VVD A;  5TPA A;  4AB5 A;  3TTN A;  3WAE A;  2GHA A;  1SBP A;  4IY5 A;  4I62 A;  4R74 A;  4JWX A;  2F34 A;  1P99 A;  1O63 A;  1N0T A;  4TQU Q;  5CM6 A;  1MQI A;  3UGW A;  3PD9 A;  1B3E A;  3IB0 A;  2AYS A;  1FQF A;  3CFX A;  3I5O A;  1IXH A;  2UVI A;  4U1O A;  4X1D A;  4Q8R A;  3P7I A;  1NKX A;  2VHA A;  4O3C A;  1WVJ A;  1FCK A;  3LR1 A;  2DE2 A;  3H06 B;  4BDN A;  2DWA A;  1EH3 A;  2VP1 A;  4F3B A;  1USY E;  5IKB A;  4LZ8 A;  1A40 A;  1JW5 A;  2X26 A;  2NWJ A;  4EUO A;  3K2D A;  1PEB A;  2GHB A;  1JVX A;  3CRB A;  3T66 A;  4GOT A;  1LB8 A;  1P1N A;  2F6G A;  1EZ9 A;  3B6T A;  3PUW E;  1FQA A;  4U1Z A;  4JXI A;  4N07 A;  5H8F B;  4X9T A;  2CMO A;  2QRY A;  3H6V A;  3UP9 A;  1PDA A;  4IO6 A;  2OZZ A;  3CG1 A;  1B40 A;  3MVZ A;  4OHN A;  4TLM B;  3VE1 B;  1A99 A;  5ICQ A;  1RKM A;  1MPD A;  3O6H A;  3TYH A;  3E4R A;  2XX9 A;  5I56 A;  4PFW A;  3CFL A;  1N3X A;  2E0S A;  2O1L A;  1OVT A;  4I1D A;  3FXQ A;  3CR9 A;  1FTO A;  3U94 A;  1ANF A;  2DXY A;  2O68 A;  1MDQ A;  4DLD A;  1MPC A;  3IX1 A;  3H7M A;  4NF5 A;  4R9G A;  3KEI A;  2ANJ A;  1POY 1;  5DYH A;  5JTY B;  2XXQ A;  4G8N A;  4Q5T A;  1JEV A;  3IB1 A;  3OEM A;  3OEK A;  4LZ5 A;  4POX A;  1UIU A;  4BDL A;  3FJG A;  1IZ1 A;  1LFH A;  3FJ7 A;  4XKN A;  4DZ1 A;  4F29 A;  1MXY A;  1KWH A;  2Y7R A;  4ONY A;  3W9W A;  4FEC A;  2F36 A;  3PPQ A;  1OIB A;  4FIM A;  2F6P A;  2XXW A;  4ESW A;  2ESN A;  4OER A;  2ZYM A;  2Q88 A;  5CI5 A;  1PB7 A;  3RPW A;  1Y3N A;  2ABH A;  3PPO A;  4F31 B;  1MQJ A;  4KD5 A;  1MY3 A;  5B7D A;  2FNC A;  3PU5 A;  2Y7I A;  3PUY E;  4NTL A;  1QKA A;  2RCA A;  4ELQ A;  3PMV A;  4ZDM A;  4BDR A;  3U92 A;  2DVC A;  1LFG A;  3MZ9 A;  4ZEC A;  1SVX B;  3DP4 A;  3FZV A;  4DDD A;  4PE5 B;  4EXK A;  4NWD A;  3GXA A;  1DTZ A;  5DTB A;  5AA4 B;  3N6U A;  4QFP A;  4KQP A;  4F1V A;  4YB7 A;  1JNF A;  4OWD A;  3K1M A;  2XD2 A;  3EQ1 A;  1GV8 A;  4NF8 B;  3MPK A;  3EN3 A;  1BTJ A;  1MM6 A;  3MW0 A;  3FV2 A;  4NF4 B;  4QFN A;  1UTB A;  4DCY A;  3ILT B;  1FQC A;  2RC7 A;  2ONR A;  4U4X A;  1IUD A;  3AXF A;  5KDT A;  1B3F A;  4PQJ A;  3KN8 A;  3TCH A;  3M3F A;  1S9T A;  4QSD A;  2RCB A;  2DE3 A;  4R2F A;  3RT8 A;  3HN0 A;  4RPO A;  5AA2 B;  3MJN A;  3MPL A;  4P0G A;  4QHQ A;  4WXJ A;  4U22 A;  3MVW A;  3T96 B;  2DE4 A;  2QS4 A;  2NOO A;  3K6X A;  3L6H A;  2DS9 A;  3M8U A;  3QUJ A;  1IXC A;  4C1U A;  1AH5 A;  3C36 A;  4KHZ E;  1B3H A;  3A3C A;  4ISU A;  2HQ0 A;  4LQ5 A;  3HHF A;  4PFU A;  4G2Z A;  2F7C A;  3K6U A;  2Q2C A;  4N13 A;  1URS A;  2H99 A;  4QF9 A;  3DLN A;  5KCJ B;  1Y1M A;  3FAS A;  5FHO A;  4OTE A;  2AL5 A;  1B46 A;  4H65 A;  4WKM A;  3D4G A;  1ZU0 A;  2DP8 A;  3O28 A;  2ZYN A;  1D4N A;  1NNF A;  1Y4C A;  3EHS A;  2PBW A;  3A3U A;  5I2N B;  2Z22 A;  2NVU B;  3BFT A;  3PPN A;  4IGT A;  1B5H A;  4IB2 A;  3QSL A;  2XXT A;  1MY0 A;  3IOU A;  2A5T A;  1A8E A;  3TCG A;  2B3B A;  3VVE A;  4XKP A;  5H8Q B;  5B70 A;  3QIM A;  3VV5 A;  2DWI A;  1FTL A;  4LA9 A;  4NF8 A;  2QJE A;  4ELO A;  2H4I A;  3ZKK A;  4RYA A;  5EYF A;  1QUL A;  2PMS A;  2REJ A;  2QL3 A;  3T22 A;  3FGS A;  1POT A;  3TKD A;  5ITO A;  1N84 A;  1ZBM A;  2FYI A;  4G8H A;  1WDN A;  2HAU A;  4RK9 A;  1NL5 A;  4UA8 A;  3OO6 A;  5DVF A;  1ZJL A;  2QMX A;  2AL4 A;  5EHM A;  1BIY A;  3CSB A;  3VXC A;  1P1Q A;  3HST A;  4EQ9 A;  3W9V A;  3F11 A;  5L9O A;  4ELP A;  2YLN A;  4THI A;  2I0C A;  1IXI A;  1Y20 A;  1LCF A;  3G3K A;  5ICT A;  2XX8 A;  3MC2 A;  1B7U A;  4IGR A;  1JVY A;  5HM4 B;  3IO4 A;  2DYX A;  1IXG A;  4UAC A;  2XX7 A;  1M5D A;  2Q89 A;  2OBG A;  4R6K A;  1B32 A;  5H8N A;  1MDP 1;  4KFQ A;  4JWO A;  4H5F A;  1ZKB A;  2GH9 A;  2QSX A;  2UVH A;  4H6D A;  4IO5 A;  4YZZ A;  1I69 A;  2Y7K A;  4KCC A;  2I3V A;  1UIV A;  1SD3 A;  5CMC A;  3OO9 A;  2O6A A;  3CI8 A;  1SYI A;  1O7T A;  3OSR A;  3OD7 A;  2QS3 A;  3O2A A;  3LSX A;  2GRV A;  1H43 A;  2F97 A;  4OZ9 A;  4KI0 E;  3RNN A;  3LC8 A;  4Q30 B;  3T9H B;  2OJT A;  1LFI A;  4JB7 A;  4GFR A;  2YJP A;  1B0H A;  1Y3Q A;  2I48 A;  1NNT A;  1QUI A;  1BP5 A;  4ZE8 A;  1TWY A;  1B2H A;  3OEL A;  3TEL A;  4FE8 A;  1DPP A;  3SKP A;  3K02 A;  3W15 C;  3OMB A;  1US5 A;  1B58 A;  3V89 B;  3KFM A;  2UVG A;  4YIC A;  2ONK E;  4G68 A;  3EPE A;  4U2R A;  3ODB A;  1CB6 A;  4JBZ A;  4H8I A;  1NH7 A;  4PFY A;  1JET A;  3N6T A;  3TDJ A;  3SER A;  3I6V A;  1B5J A;  4L17 A;  1UTH B;  4FOR A;  4YKP A;  4F3G A;  4LQ2 A;  2I4C A;  1SYH A;  1NH8 A;  4XKQ A;  1D9Y A;  1PB8 A;  2V3Q A;  1B4Z A;  3SDF A;  3MZ1 A;  5LOM A;  4K3F A;  2IA4 A;  1B6H A;  4GXA A;  4G77 A;  2RF1 A;  3K01 A;  1VSO A;  1FQD A;  1TT1 A;  1YTV A;  2DSF A;  5I58 A;  4JWY A;  2Y84 A;  1SW5 A;  3DP6 A;  1NNP A;  3VFJ A;  1B3L A;  4G8M A;  2B65 A;  1MY1 A;  5I57 A;  3OXN A;  1MXW A;  5ELV A;  3K1N A;  5FHN A;  1OQH A;  1NNK A;  4BDO A;  3N94 A;  1MH4 A;  1SW4 A;  1GR2 A;  2QMW A;  3FVG A;  5H8H A;  3KGC A;  3C32 A;  4PET A;  3EHU A;  4ZZA A;  5AA1 A;  3B7D A;  1URG A;  1OVB A;  1SDX A;  1VR5 A;  2O69 A;  4MH5 A;  3GBA A;  4F1U A;  4G68 C;  4YMA A;  2I3W A;  3QXM A;  3CFZ A;  1FQE A;  2DWH A;  4YB5 A;  5F1Q A;  5CC2 A;  2ZNU A;  4EDP A;  4RPN A;  4R2B A;  3CIJ A;  1AL3 A;  5TP9 B;  5DEX B;  4FAJ A;  4JDF A;  1N3W A;  3O97 A;  2XXR A;  1MY4 A;  5A5X B;  1PBQ A;  2O51 A;  1GVC A;  2DOJ A;  2Q9T A;  3V5A A;  3DM0 A;  1M5F A;  5HPQ A;  4QFL A;  4X1B A;  3FAT A;  3KSX A;  3TOD A;  1ATG A;  1N76 A;  1MXV A;  1D3K A;  3U8Q A;  3H6W A;  1JW1 A;  4E0W A;  4DXB A;  2I0B A;  1B5I A;  4ECF A;  1QVS A;  4MBP A;  1Y1Z A;  3U72 A;  1PBP A;  2W7Y A;  4GL8 A;  3FVO A;  3N26 A;  4MLV A;  3PPP A;  3RLF E;  4EF2 A;  3G3H A;  3HCQ A;  1Z7M E;  2FA7 A;  4ND9 A;  1B9J A;  1FTK A;  4TOZ A;  5H8F A;  3R26 A;  4QFK A;  3RQT A;  3C9H A;  5IAI A;  1VFE A;  3VLW A;  3K00 A;  1M5C A;  3KSJ A;  3G7W A;  4TLL B;  2D21 A;  1WOD A;  3IOW A;  3RUM A;  3DEL B;  3JV9 A;  3IAZ A;  1XC1 A;  1R9Q A;  3Q29 A;  4IO2 A;  4XXU A;  4C0R A;  3TUS A;  4ZS9 A;  5L8D A;  3TZA A;  3FIR A;  5I59 B;  3O29 A;  4POW A;  3SEU A;  3FV1 A;  4HW8 A;  2HEU A;  3B6Q A;  5KZT A;  3LUY A;  2PVU A;  1A8F A;  1LCT A;  5JTY A;  3SEY A;  4H67 A;  1EZP A;  1MRP A;  1PC3 A;  2AIX A;  1MH3 A;  1Q1K A;  1HSE A;  3QYT A;  1QKB A;  1RYX A;  1YCJ A;  3H6U A;  4YAH X;  1TXF A;  3TCF A;  3EHT A;  1JW4 A;  3IJX B;  4LP2 B;  3OSQ A;  3MP6 A;  4BLA A;  1XS5 A;  2QPQ A;  2IEE A;  3KOS A;  3R7X A;  4GF8 A;  3ECR A;  4NMY A;  2P2A A;  1FTJ A;  4F2Q A;  5DVJ A;  3TQW A;  3TTR A;  5AE4 A;  1B05 A;  1XHY A;  3PUV E;  5I2K B;  3RTW B;  3G3F A;  2UYE A;  1MQD A;  3C31 A;  4HTG A;  1T0K A;  3SES A;  3MUQ A;  3O66 A;  5CBS A;  5ITP A;  1LST A;  1IIT A;  4EQB A;  4YB6 A;  2F7A A;  4FEB A;  5BUU A;  2RIN A;  2UXA A;  1O64 A;  3HPI A;  3T9X B;  5AA4 A;  3CVG A;  2XXP A;  3C35 A;  1XVX A;  1FW0 A;  3TAJ A;  2Q2A A;  3C33 A;  3H4Z A;  1ELJ A;  3PUZ E;  1UQW A;  3G3J A;  4F2O A;  1FTM A;  3CSG A;  5TPA B;  2CZL A;  4OEV A;  1B51 A;  1M5E A;  3I3V A;  4NF4 A;  1B4H A;  1S7Y A;  5FTI A;  4R9F A;  4XKR A;  3K6V A;  1LBC A;  4HCY A;  3BKI B;  4F39 A;  1ZTY A;  4GD5 A;  2XXX A;  4F19 A;  2I49 A;  4LAT A;  1YAE A;  3SET A;  4MLQ A;  3MZB A;  2F7B A;  4U4S A;  2XXY A;  1QUK A;  3MAM A;  5TU0 A;  3E13 X;  5AA2 A;  2O7I A;  1MS7 A;  3MWB A;  1OMP A;  1SI1 A;  3ONM A;  4U23 A;  4PP0 A;  3C34 A;  3OO7 A;  3ZS6 A;  1S50 A;  4RXL A;  3MVY A;  4DXU A;  3ZKL A;  4KYS A;  3HV1 A;  4F18 A;  4YMB A;  3BBR A;  3MVX A;  4OFJ A;  2Z8D A;  1QW0 A;  2Y7W A;  2VOZ A;  4R6H A;  1IEJ A;  1VFD A;  2F5X A;  3OOA A;  4OET A;  5KCJ A;  3N5L A;  2XD3 A;  2ZXT A;  1XVY A;  4Z7E A;  1LBB A;  4GWO A;  1DPE A;  1XT8 A;  4XIG Q;  5DT6 A;  1RYO A;  3TEP A;  2V84 A;  4O3B A;  2QS2 A;  2O7U A;  4OVJ A;  4OYV A;  4OEN A;  5I2N A;  4NF5 B;  4KCD A;  1CE2 A;  3E3K A;  2KLF A;  4IO4 A;  1URD A;  5CMK A;  3IOT A;  1ZLQ A;  4FED A;  4O3A A;  1R1N A;  1US4 A;  3IOR A;  5H8Q A;  3MQ9 A;  3S9L C;  1EU8 A;  5CMB A;  3K4U A;  2HZK A;  4LON B;  1GGG A;  1LGB C;  1H3D A;  5ISU A;  3QAX A;  1GTK A;  3VXB A;  1MPB A;  1OQG A;  4GL0 A;  5H8S A;  1II5 A;  2E1S A;  4RA1 A;  4NF6 B;  1MG1 A;  4ZE9 A;  1XOC A;  1A54 A;  3FJM A;  3IJO B;  1B7Z A;  2ZNT A;  3GZG A;  1JQF A;  4KYD A;  1MXX A;  4DCX A;  3TPA A;  2VD3 A;  3UK4 A;  3E9X A;  4EF1 A;  3H03 A;  1F9B A;  4GVO A;  2ALU A;  1A55 A;  2PYY A;  4QSC A;  3V83 A;  5AA2 D;  2ZNS A;  3IR1 A;  2GFE A;  3B6W A;  3LSW A;  5BWJ A;  3DP8 A;  4ZZE A;  2DQV A;  3U1O A;  3PUX E;  1DTG A;  3Q25 A;  5FHM A;  1DMB A;  1NMU A;  2UYF A;  2Z8E A;  2ZMB A;  4OES A;  5AA3 A;  3V8X B;  3LSF B;  4YKI A;  1SQY A;  4HS7 A;  1AIV A;  4RJZ A;  1Y4T A;  1MQH A;  1L5T A;  4XTC Q;  1UTB B;  2YPN A;  4RNS A;  4M1V A;  3R6U A;  2HCA A;  2HZL A;  2UVJ A;  1B1H A;  4QSE A;  3KZG A;  1LAH E;  5KDT B;  1DOT A;  4DE8 A;  2P0S A;  4P11 A;  3WAF A;  4QFO A;  1PB9 A;  3ZSF A;  3KJ7 A;  2BJJ X;  1USY H;  3HHG A;  1LB9 A;  4LUB A;  4I8C A;  5EHS A;  2X7P A;  3S9M C;  4Q0C A;  3A09 A;  2PT1 A;  3FXR A;  1N7W A;  4QRZ A;  3RN8 A;  2V25 A;  2DXR A;  3TTL A;  3EF7 A;  2X7Q A;  1N04 A;  4OFO A;  4F22 A;  4RY1 A;  4X48 A;  3S4U A;  2G29 A;  4KPT A;  1LLS A;  4JSD A;  3GBB A;  3RTF B;  2XXU A;  2R71 A;  3IK6 B;  1BLF A;  2VD2 A;  3M3K A;  1H45 A;  1SI0 A;  5DVI A;  3QUF A;  1DSN A;  1MXZ A;  2Z23 A;  1OLC A;  4NF6 A;  3QK6 A;  1QJM A;  1LAF E;  3T9U A;  1Y3P A;  1TFD A;  1UTH A;  3C4M A;  4DIG A;  1HSJ A;  1ZIU A;  4IO3 A;  1IQ7 A;  2NXO A;  4ZED A;  4MF3 A;  3SEV A;  1LAX A;  3RY3 A;  1TFA A;  5L9M A;  4GRK A;  4BDQ A;  4ZEF A;  5CMM A;  2PX1 A;  1QUJ A;  3IO6 A;  5J1D A;  4P0I A;  1P1O A;  2D3I A;  3TTM A;  3RT6 B;  4EQ7 A;  2HAV A;  3VLU A;  1R6Z A;  5JEI A;  3T9V A;  3UA8 A;  3D4C A;  2A5T B;  1I6B A;  2V93 A;  1B0L A;  3TFL A;  2D5W A;  2Y7P A;  3TTK A;  3PGF A;  3K0V A;  4H0W A;  2XXH A;  4E0X A;  1AMF A;  3O6I A;  2DVZ A;  4NWC A;  5K2X A;  4IO7 A;  2PT2 A;  2ONS A;  1B52 A;  4ZEB A;  2OWS A;  3UOR A;  3KJT A;  3MP1 A;  2NUV A;  2XHD A;  3KOT A;  3PD8 A;  2VGQ A;  2I4B A;  4YKJ A;  1NFT A;  4LZ7 A;  1R9L A;  3O9P A;  4H5G A;  2HXW A;  1M5B A;  3JZJ A;  4NED A;  3PV0 E;  3FVK A;  4F3P A;  3S2V A;  5TP9 A;  5DEX A;  4G4P A;  4N6P A;  4F3S A;  3CG3 A;  5A5X A;  2F78 A;  3S9E A;  4R6Y A;  1MXU A;  3UIF A;  2I58 A;  4I9D A;  2V3T A;  2XXV A;  2F35 A;  4FAT A;  3LBS A;  4ZEI A;  3USD A;  3MBP A;  3Q26 A;  1JEU A;  4R73 A;  4R75 A;  3THI A;  3SEW A;  2I6E A;  3KN3 A;  5CRY A;  5H8N B;  3FUZ A;  3KBR A;  4PFT A;  3K6W A;  1D9V A;  1P1W A;  4GLI A;  4F1Y A;  1SW2 A;  4AB6 A;  1I6A A;  4WEP A;  3VDF A;  2THI A;  3PMW A;  4RK2 A;  3S9N C;  2A5S A;  3OO8 A;  2RC9 A;  4YKK A;  3G3G A;  1Z7N E;  4OMB A;  2H25 A;  4ESX A;  2H98 A;  1H44 A;  3RGY A;  2O84 X;  3KN7 A;  2R9J A;  4WED A;  5HBC A;  4IY6 A;  3FXU A;  4EXL A;  1OLA A;  2RC8 A;  2M8C A;  5I84 A;  2G93 A;  4AQ4 A;  1I6Q A;  2R6G E;  4GIZ A;  3GLB A;  3FVN A;  5JK4 A;  3MP8 A;  4KR5 A;  1BKA A;  5FTH A;  1AOV A;  3IL1 B;  3SEX A;  3PMX A;  4C1T A;  4R72 A;  3K1P A;  3T93 B;  2OLB A;  3IOV A;  2H5Y A;  2ZYK A;  4H8J A;  2RKM A;  3L6G A;  3JYR A;  4G68 B;  1VE4 A;  4NE4 A;  2DWJ A;  5I59 A;  2H9B A;  1MY2 A;  3OEN A;  4OXV A;  4OEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...