1LAGE

Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Amino acid transport
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
publication title Structural basis for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein.
pubmed rcsb
source organism Salmonella typhimurium
total genus 82
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lagE01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lagE02
2FA7A 3UK4A 4IO3A 4QFLA 1M5DA 3H06B 4RPNA 1ATGA 1MQJA 3C33A 3SEWA 4EDPA 5H8QA 1JW1A 3ZKKA 2YLNA 3RY3A 4IO7A 2WKYA 3U8QA 5JEIA 2O51A 5H8QB 4PQJA 1EZOA 2NOOA 3QUFA 5AA4A 2QS1A 4L17A 1LBCA 4KD5A 4KYDA 4KYSA 1QJMA 3TCGA 2THIA 4G68B 1GR2A 5I58A 1P99A 4F19A 3PPQA 3S9MC 1MDQA 1JW4A 2AL4A 3CFZA 3O6IA 2XX7A 3OXNA 1B40A 5KDTB 1B3HA 4RNSA 1SW1A 4UACA 1DTGA 1Y9UA 1PB8A 3CSBA 3SEXA 3CFLA 3C36A 3IB1A 3U1OA 5L9SA 3MW0A 1VR5A 2F5XA 1MY4A 4E0XA 3R26A 4EQ7A 3RT8A 1MPBA 3ZKLA 2XHDA 1D9YA 4H5GA 3TTNA 1MM6A 4GD5A 2QS4A 2YJPA 3FVOA 2QS2A 1GVCA 3S9EA 1OVBA 2Y7KA 1DPPA 1R6ZA 1LB9A 1A8EA 1OLAA 4GLIA 3ONMA 5AA2A 4XKRA 2I0BA 1MQIA 4U1OA 3IR1A 1YPNA 2V25A 4R9GA 2VGQA 1OLCA 5CBSA 4NF6B 5AA2B 4KPTA 3OSQA 5AE4A 5ISUA 2XXUA 4OFOA 4HS7A 4KHZE 3S4UA 1H45A 2CZLA 5TP9A 1YCJA 3EF7A 4EXLA 1YTVA 3KJTA 4GXAA 4GL8A 4QFPA 4RXLA 1SW5A 2OWSA 2Z8EA 4Q5TA 4OXVA 2F6GA 1QUIA 2ALUA 2F6PA 4QSCA 1LGBC 5FHMA 2QJEA 1MY1A 2X26A 4IO4A 4RK9A 4ESXA 4XXUA 4I62A 1EU8A 2PMSA 4QF9A 2Q9TA 4QHQA 3VE1B 3TCFA 5DYHA 3SEVA 2OLBA 1YAEA 1H43A 5I2KB 2ZNSA 1HSJA 2G29A 4GQOA 2V93A 3N6UA 1M5BA 3UORA 3UGWA 3N6TA 3Q25A 1XC1A 3QIMA 5ELVA 2F7BA 4GXSB 3I5OA 4NEDA 3C34A 3TQWA 5TPAA 5DT6A 1FTKA 4MF3A 4O3AA 2DP8A 4RPOA 1TXFA 3V5AA 2D21A 1Y1MA 5I59A 5DEXB 5B70A 1GTKA 1M5FA 5A5XB 1LB8A 4O3CA 5KZTA 1II5A 2H9BA 5I84A 3LR1A 1URSA 5CI5A 1B3LA 3MPLA 2F97A 3MWBA 2RF1A 4Q0CA 4F3BA 4OTEA 2I0CA 2O68A 1H3DA 1MXVA 1R9QA 3V8XB 3GZGA 4F3PA 1L5TA 2REJA 3FXQA 2F34A 4OFJA 1IUDA 1D4NA 2O7IA 4G2ZA 3OSRA 3LSFB 4JSDA 2I3WA 1H76A 1ZJLA 4KYEA 1MRPA 3I3VA 2P0SA 4C1UA 5AA2D 4OFLA 1XOCA 4MFIA 2NUVA 4H6DA 4IY5A 1OIBA 4PFWA 3G3HA 4R6HA 5JTYA 1B32A 4HCWA 2G93A 2PYYA 1B1HA 1FQDA 1MY0A 3D4CA 1Y4CA 5CMKA 3EHSA 2QRYA 4NF5A 4BDQA 1B58A 3QSLA 3KSJA 1B7UA 2Z23A 1Y1ZA 3MVYA 3TELA 1RKMA 1JVXA 1MG1A 4KQPA 4JXIA 1URDA 4PETA 1A8FA 1FCKA 3CIJA 1Y3NA 1NMUA 3MZBA 4MBPA 3RN8A 2RC7A 5I56A 1PEBA 3K1MA 4HTGA 2UVIA 1PBQA 5H8FA 1Y20A 3ILTB 4X1DA 1OMPA 3LSXA 1US4A 5I57A 1I69A 3CVGA 4H1XA 2Y7RA 4NTLA 4FORA 3GLBA 4U2RA 2OK2A 1UTBA 4UA8A 3IK6B 2XXTA 2XD2A 2XXYA 5B7DA 3IORA 3H6VA 1B3EA 1IITA 3KN3A 2I3VA 3G3KA 4Z0IA 4ZEBA 3FV2A 3MZ9A 2RC9A 4POWA 4YZZA 4JWYA 4DXBA 1Y3PA 4M4GA 2DXRA 3FV1A 1WVJA 3S9LC 2DWIA 2UYFA 2UXAA 1NKXA 2ANJA 1DPEA 3ODBA 3KSXA 3PV0E 4ELPA 1FQEA 2Z22A 1ZKBA 2V3UA 2AIXA 4EF1A 4KCCA 4YAHX 3O66A 1Y4TA 1LAHE 4F39A 2RCAA 5H8NA 1SI0A 3PPPA 4RJZA 4IGTA 3Q29A 3RTWB 2M8CA 4PFUA 3TPAA 3CG1A 3SESA 2CMOA 4NF4A 2Q89A 4H8IA 1NH8A 2E1SA 3KN7A 4F2QA 1QKAA 1MQGA 3LSWA 1NH7A 2BJJX 1NFTA 4BDNA 2Q2AA 3PMVA 3UIFA 3JYRA 1MY3A 1POTA 3BKIB 5ITOA 1B4HA 4BDLA 2OZZA 2V3QA 3MQ9A 2F8DA 3IB2A 3I6VA 1B5IA 5L9MA 4AB5A 3FD3A 1N84A 4ELQA 4FAJA 1NNKA 1AIVA 4YB6A 4YMAA 1MDP1 1B5JA 4OQOA 1DTZA 3H4ZA 3BFUA 1BTJA 1AOVA 3KGCA 3OOAA 4F1YA 1I6BA 3IJXB 2PBWA 3IAZA 2XXXA 2HAUA 2A5TA 1GV8A 3TMGA 3EPEA 3USDA 2ONKE 4K3FA 3IOUA 1SD3A 2O69A 2Z8FA 4YKKA 3U94A 1BKAA 3V83A 2F35A 1SW4A 4WEDA 5J1DA 4Z7EA 1FQAA 5AA4B 4JDFA 4QSDA 2AYSA 3PUWE 4LQ2A 1I6QA 2QPQA 2H4IA 2I49A 4Q30B 5I58B 3HHFA 2DVCA 3W15C 5H8HA 2HZKA 1LBBA 3IJOB 1EZPA 1QULA 1FQFA 2H98A 1IXCA 1N04A 3S9NC 2GFEA 5IAIA 2V3TA 3GXAA 4OMBA 4EQ9A 1IXIA 4F31B 1LFIA 4RYAA 3GBAA 1Y3QA 2DE4A 3C32A 4U23A 4ZZEA 2H5YA 3C9HA 4OERA 2ZYOA 3M8UA 2HAVA 4G8MA 4QFNA 4RA1A 3RUMA 1XS5A 4G4PA 2HQ0A 3ILUB 2I58A 4IO2A 5CRYA 4GWOA 3VV5A 3TUSA 3ZSFA 1D9VA 3FVKA 4DXUA 5L9OA 3DLNA 1A55A 3MBPA 1DSNA 2DS9A 1M5EA 2ZYNA 3WAEA 3FXUA 3GBBA 3K6WA 5H8SA 4X1BA 2HZLA 1JEVA 1MQDA 4YKIA 4FATA 5BUUA 3BFTA 4R74A 2F7AA 4MH5A 4JWOA 4IO5A 4LP2B 1IXGA 1A54A 1MY2A 4EF2A 5JK4A 4DLDA 1SI1A 4ZEDA 5TP9B 2QSXA 3HN0A 3KBRA 1B51A 1SYIA 4NWDA 4LONB 2UVJA 3IO4A 2O84X 4NWCA 4DXCA 3K6UA 2DOJA 3E9XA 1F9BA 2XX9A 4Q8RA 3IOTA 1LAXA 3TFLA 1BLFA 4I8CA 3O97A 3DP4A 1SYHA 3W9WA 3PPRA 2HFBA 4DIGA 3W9VA 3OEKA 4QFKA 4M1VA 2YPNA 3MPKA 2XX8A 2PT2A 4GOTA 2DWAA 4G68C 2Y7IA 1OQGA 2DVZA 1VE4A 1JQFA 5CMCA 3K6VA 3MZ1A 5EHMA 2ZNUA 3TEPA 5TPAB 1P1OA 5I59B 2OJTA 4I9DA 2UVHA 2Y7PA 4R2BA 4P11A 4OETA 1MXXA 1JEUA 2ZYKA 3LC8A 1MM7A 1P1UA 2F7CA 1B9JA 2FYIA 1B7HA 3CG3A 1NNPA 1MQHA 4ZEFA 2F78A 3V89B 4YB7A 4ELRA 5M2VA 4AQ4A 3OENA 3G3GA 3A3CA 5HPQA 1ANFA 1A40A 3CRBA 4F1UA 4XTCQ 3T9XB 3K01A 3U92A 1TT1A 2O1MA 3PMWA 3FIRA 4P0IA 2B65A 1LFGA 3H7MA 2ESNA 3B6TA 2KLFA 3KJ7A 1R9LA 2UVGA 1LAFE 3KN8A 3FVNA 3MC2A 3E4RA 3R6UA 3VLWA 4KI0E 2O7UA 2XXQA 5JTYB 1RYOA 2XXVA 3IX1A 3IL1B 5AA3A 1Q35A 4R75A 4OZ9A 3N94A 4O3BA 4NF5B 4ESWA 3F11A 4U22A 2I6EA 4XIGQ 2OWTA 2VHAA 3T9HB 2W7YA 3G3IA 2DQVA 1FW0A 3TTKA 1B3GA 5EHSA 3JZJA 3H6UA 4JBZA 1B7ZA 1SQYA 2OBGA 1LAGE 4XKNA 1MXUA 4R6YA 3RT6B 1P1WA 3SDFA 1J1NA 2Q8JA 3KG2A 1H44A 3KFMA 3RNNA 5KCJA 1JNFA 3MVZA 1DOTA 1S50A 2XXIA 4YB5A 5I56B 1XHYA 4GRKA 3K4UA 2QMXA 4YKJA 1N7WA 3TAJA 5H8FB 2H99A 3A09A 3D4GA 3TTRA 5I2NA 1UTHA 1FTOA 4XKPA 3T66A 3RGYA 5I57B 1VFEA 4LA9A 1UTBB 2P2AA 2H25A 4NF8A 1USYH 2I4BA 4GF8A 3N26A 4BLAA 3SEUA 3TCHA 1XT8A 4ND9A 1OVTA 3H6TA 3TODA 2GHBA 3MUQA 2OCUA 3O9PA 1B0LA 3B6QA 1MXZA 5L8DA 2DYXA 2B3BA 1HSLA 2R6GE 2Y84A 4THIA 3K02A 3T9VA 3KZGA 3TZAA 2RC8A 3EQ1A 5BWJA 4G8HA 4JSOA 4EXKA 1S7YA 3HPIA 4FIMA 3VVFA 3K1NA 3U72A 1S9TA 4X48A 4LZ5A 1AH5A 5FTIA 4YICA 1WODA 1UIUA 1TFDA 5FTHA 4ISUA 5H8NB 1D3KA 2VD2A 1IQ7A 1P1QA 4HCYA 4TLMB 3TTLA 3JV9A 4NF4B 3T22A 3Q27A 4ZEIA 2HCAA 3CSGA 3TQLA 3C31A 3FJMA 4YU0A 2I48A 2PT1A 3KOSA 2GHAA 4H0WA 1USYE 4FE8A 4NE4A 1P1NA 3O2AA 1B4ZA 3RPWA 2GRVA 2QMWA 5IKBA 3IOVA 1LCFA 3VFJA 4RY1A 4F22A 1B2HA 3LSLA 4TLLB 3SETA 3E3KA 2VOZA 2V84A 1NL5A 3KOTA 2B3FA 1US5A 3PD9A 1I6AA 1QUKA 3T9UA 1O7TA 5AA1A 3QUJA 4U4XA 2NWJA 1Q1KA 4BDMA 4ZEKA 4PE5B 4IO6A 2LAOA 1MPCA 3Q28A 3AXFA 1PBPA 3KEIA 2A5TB 1ZTYA 3PD8A 4NMYA 1FQBA 3OO6A 3B6WA 1LSTA 2E0SA 4G68A 4G77A 1UIVA 1POY1 3U93A 1B5HA 2XD3A 3A3UA 4YMBA 4U21A 4H5FA 3H3GA 4AB6A 3WAFA 3IO6A 4C0RA 4RK2A 1MH3A 4H67A 5H8HB 2QS3A 4PFYA 3OO8A 1BIYA 2IA4A 5KDTA 4F3SA 4ZDMA 3OMBA 3S2VA 1FTMA 3IB0A 4PFTA 4FJPA 4F3GA 4ZS9A 3TKDA 3PU5A 1PDAA 3QYTA 4OEVA 4OVJA 2ZXTA 3PUVE 1QUJA 4ONYA 1QKBA 4P0GA 3SKPA 2A5SA 1TFAA 4FEDA 2PX1A 3OELA 5HBCA 1SVXB 4WEPA 2ABHA 2AL5A 4ELOA 4R6KA 1O64A 1O63A 4LZ8A 2UYEA 5DVJA 3PPNA 4ZE9A 3CR9A 2GH9A 4NF6A 4BDRA 3H03A 3O29A 3FJ7A 3MAMA 1A7LA 3G7WA 5ITPA 2NXOA 4GVOA 1UQWA 2FNCA 3MVXA 3MVWA 4IY6A 3HV1A 2XXHA 4LVQA 4OEUA 4U4SA 1IIWA 3BBRA 3O6HA 3DELB 2VD3A 4KCDA 4POXA 3TDJA 1RYXA 3UP9A 3DM0A 2Q2CA 2XXWA 3VXCA 3UN6A 3FVGA 2ONSA 4MLQA 2O1LA 4LUBA 4OYVA 4F1VA 3M3KA 5DVIA 1R1NA 3OEMA 4H8JA 3RQTA 4EQBA 2NVUB 5I2KA 3O6GA 3P7IA 3ZS6A 1Z7ME 2I4CA 1PC3A 2Y7WA 4LATA 4OWDA 2DE3A 1ZIUA 2P1SA 3PGFA 1LFHA 4C1TA 4GIZA 5CC2A 1AL3A 1QW0A 2RCBA 1XVYA 1FTJA 2XXRA 1QVSA 4OESA 5DEXA 4R73A 3VLVA 1IZ1A 3QK6A 3TTMA 5ICQA 4LQ5A 5A5XA 2HEUA 1PB9A 4I1DA 2O6AA 3EHUA 1B0HA 4U1ZA 1N3XA 4MLVA 3FJGA 4DCYA 2DWHA 1MS7A 1DMBA 5ICTA 3K00A 1ZU0A 1B05A 1AMFA 4DCXA 3CI8A 4DE8A 3RTFB 4FEBA 1TWYA 3QXMA 2DWJA 3FXRA 2QL3A 4QFOA 3DP8A 3THIA 2DXYA 3VVEA 3G3FA 3IOWA 1ELJA 3PUXE 1FQCA 1SW2A 1EZ9A 4OENA 4LZ7A 1WDNA 2Z8DA 5LOMA 4N6PA 3M3FA 3PPOA 1XVXA 4YKPA 1NNFA 3VDFA 4H65A 1MPDA 3HSTA 1SBPA 1T0KA 2D3IA 5HM4B 1BP5A 3TYHA 4PP0A 1SDXA 5EYFA 3LUYA 3SERA 4F18A 2X7PA 3N5LA 3PMXA 2R9JA 3HO7A 3C35A 1ZBMA 4JB7A 3ECRA 4DDDA 2ZMBA 4QRZA 3Q26A 5K2YA 1Z7NE 3K6XA 2XXPA 4JWXA 4FECA 3DP6A 1JW5A 4GFRA 1N7XA 1MH4A 3MP6A 3RLFE 1B1XA 2X7QA 2DE2A 3HHGA 3SEYA 3OD7A 3T96B 4HW8A 4GL0A 3VVDA 5KCJB 3MJNA 3PUZE 1FTLA 1N3WA 4ZE8A 3EHTA 3K1PA 4X9TA 1JVYA 2RKMA 1PB7A 1CE2A 5CMBA 4ZECA 4R2FA 2R71A 1IEJA 5TU0A 5DVFA 2Q88A 2F36A 5I2NB 1UTHB 4XKQA 4DZ1A 3VXBA 5CBRA 3C4MA 3K0VA 1N76A 4E0WA 3FASA 3OO7A 1CB6A 1M5CA 3LBSA 3PUYE 4NF8B 4OHNA 2IEEA 3FZVA 3O28A 3G3JA 2D5WA 4ZZAA 1LCTA 5F1QA 3FGSA 2PVUA 4BDOA 4WXJA 3T93B 4F29A 3CFXA 3B7DA 3H6WA 1B6HA 3R7XA 3VLUA 5FHNA 4N07A 4WKMA 5F7VA 3L6GA 3OO9A 3HCQA 5DTBA 3L6HA 4EUOA 4IB2A 5CMMA 2REGA 1B46A 1ZMGA 4ECFA 4TOZA 1N0TA 3MP8A 4R9FA 4QSEA 2ZYMA 5FHOA 4G8NA 4KR5A 4N13A 4TQUQ 3K2DA 5CM6A 4IGRA 1B3FA 4KFQA 1JETA 3E13X 3M3LA 1KWHA 3FATA 1MXYA 2VP1A 1GGGA 1VFDA 1HSEA 1VSOA 3QAXA 3UA8A 1NNTA 1B52A 2DSFA 1LLSA 3FUZA 1URGA 2ZNTA 2HXWA 2ONRA 1IXHA 3MP1A 1OQHA 4R72A 2RINA 3EN3A 1MXWA 5K2XA 1EH3A 1ZLQA 4F2OA 1A99A
chains in the Genus database with same CATH superfamily
2FA7A 3UK4A 4IO3A 4QFLA 1M5DA 3H06B 4RPNA 1ATGA 1MQJA 3C33A 3B8BA 3SEWA 4EDPA 5H8QA 1JW1A 3ZKKA 2YLNA 3RY3A 4IO7A 2WKYA 3U8QA 4GWXA 5JEIA 2O51A 5H8QB 4PQJA 1EZOA 2NOOA 3QUFA 5AA4A 4PF8A 2QS1A 4L17A 1LBCA 4KD5A 4KYDA 4KYSA 1QJMA 3TCGA 2THIA 4G68B 1GR2A 5I58A 1P99A 4F19A 1KA1A 2WEFA 3PPQA 3S9MC 4PE3A 1MDQA 1JW4A 2AL4A 3CFZA 1EYJA 5DW8A 3O6IA 2XX7A 3OXNA 4P47A 1B40A 5KDTB 1B3HA 4JVCA 4RNSA 1SW1A 4UACA 1DTGA 1Y9UA 1FPJA 1PB8A 3CSBA 3SEXA 3CFLA 3C36A 3IB1A 3U1OA 1G0IA 5L9SA 3MW0A 1VR5A 2F5XA 1MY4A 1NV6A 1VDWA 4E0XA 3R26A 4EQ7A 4KXPA 3RT8A 1MPBA 3ZKLA 2XHDA 1D9YA 4H5GA 4OANA 3TTNA 1MM6A 4GD5A 2QS4A 2YJPA 3FVOA 2QS2A 5EQ8A 5T3JA 1GVCA 3S9EA 1OVBA 2Y7KA 1DPPA 1R6ZA 1LB9A 1XI6A 1A8EA 5EQ9A 1OLAA 4GLIA 2KQZA 3ONMA 5AA2A 4XKRA 2I0BA 1MQIA 4U1OA 3IR1A 1YPNA 2V25A 5FBPA 4R9GA 2VGQA 1OLCA 5CBSA 4NF6B 5AA2B 4KPTA 3OSQA 5AE4A 5ISUA 2XXUA 4OFOA 4HS7A 4KHZE 3S4UA 1H45A 3CHGA 2CZLA 4O7MA 5TP9A 1YCJA 3EF7A 4EXLA 1YTVA 3KJTA 4GXAA 4GL8A 1FPIA 4QFPA 4RXLA 1SW5A 2OWSA 2Z8EA 1NUYA 1K9YA 4Q5TA 4I40A 1RDXA 4P9KA 4OXVA 2F6GA 1QUIA 2ALUA 2F6PA 4QSCA 1LGBC 5FHMA 2QJEA 1MY1A 2X26A 4IO4A 4RK9A 4ESXA 4XXUA 4I62A 1EU8A 2PMSA 4QF9A 2Q9TA 4PDHA 4QHQA 3VE1B 3TCFA 5DYHA 3SEVA 2OLBA 1YAEA 1H43A 5I2KB 2ZNSA 2FVZA 1HSJA 5ET5A 2G29A 4GQOA 4OA4A 2V93A 1IMAA 3N6UA 1M5BA 3UORA 3UGWA 3N6TA 1INPA 3Q25A 1XC1A 2P3NA 3QIMA 5ELVA 2F7BA 2OX3A 4GXSB 3I5OA 4NEDA 3C34A 3TQWA 5TPAA 5DT6A 1FTKA 4MF3A 4O3AA 2DP8A 4RPOA 1TXFA 3V5AA 2D21A 1Y1MA 5I59A 5DEXB 5B70A 1GTKA 1D9QA 1M5FA 5A5XB 1LB8A 4O3CA 1FPGA 5KZTA 1II5A 2H9BA 1G0HA 5I84A 3LR1A 1URSA 5CI5A 1B3LA 3MPLA 2F97A 3MWBA 2RF1A 4Q0CA 4F3BA 4OTEA 2I0CA 4N6DA 2DDKA 2O68A 1H3DA 1MXVA 1R9QA 1KA0A 3V8XB 3GZGA 2MKZA 4F3PA 1L5TA 2CEYA 2REJA 3FXQA 2F34A 4OFJA 1IUDA 4OVPA 1D4NA 2O7IA 4G2ZA 3OSRA 3LSFB 5IZ3A 4JSDA 2I3WA 1H76A 1ZJLA 4KYEA 5J16A 1MRPA 3I3VA 2P0SA 4C1UA 5AA2D 4OFLA 1XOCA 4MFIA 2NUVA 4H6DA 4OVQA 1NUXA 4IY5A 1OIBA 4PFWA 3G3HA 4R6HA 5JTYA 1B32A 4HCWA 2G93A 2PYYA 1FPKA 1B1HA 4XF5A 1FQDA 1MY0A 3D4CA 1Y4CA 5CMKA 3EHSA 2QRYA 4GX4A 4NF5A 4BDQA 1B58A 3QSLA 3KSJA 1B7UA 2Z23A 1EYIA 1Y1ZA 3MVYA 2JJKA 3TELA 3NOHA 1RKMA 1JVXA 1MG1A 4X04A 4KQPA 4JXIA 1URDA 4NHBA 1FBCA 4PETA 1A8FA 1FCKA 1KZ8A 3CIJA 1Y3NA 4N15A 1NMUA 4MMPA 3MZBA 4GBWA 2Y5LA 4MBPA 3RN8A 1FJ9A 2RC7A 5I56A 1PEBA 3K1MA 4HTGA 2UVIA 1PBQA 5H8FA 1FBHA 1Y20A 3ILTB 4NN3A 4X1DA 1OMPA 2QVRA 3LSXA 1US4A 5I57A 1I69A 3CVGA 4H1XA 2Y7RA 4NTLA 4FORA 3GLBA 4U2RA 2OK2A 1UTBA 4UA8A 3IK6B 2XXTA 2XD2A 2XXYA 5B7DA 3IORA 3H6VA 1B3EA 3KC1A 1IITA 3KN3A 2I3VA 3G3KA 4Z0IA 4ZEBA 2WX9A 3FV2A 3MZ9A 2RC9A 3RYDA 4POWA 4YZZA 4JWYA 4DXBA 1Y3PA 4M4GA 2DXRA 4MHFA 3FV1A 3ISPA 1WVJA 3S9LC 2DWIA 2UYFA 2UXAA 1NKXA 3A29A 2ANJA 1DPEA 3ODBA 3KSXA 3PV0E 4ELPA 4HE1A 1FQEA 2Z22A 1ZKBA 2V3UA 2AIXA 4EF1A 4KCCA 1IMFA 4YAHX 3O66A 1Y4TA 1LAHE 4F39A 2RCAA 5H8NA 1SI0A 3PPPA 4RJZA 4IGTA 3Q29A 3RTWB 2M8CA 4PFUA 3TPAA 3CG1A 3SESA 2CMOA 4NF4A 2Q89A 4H8IA 1NH8A 2E1SA 2PFYA 1FPBA 3KN7A 4F2QA 1QKAA 1MQGA 3LSWA 1NH7A 2BJJX 1NFTA 3E79A 4BDNA 2Q2AA 3PMVA 3RPLB 3UIFA 3JYRA 1MY3A 1POTA 3BKIB 5ITOA 1B4HA 4BDLA 2OZZA 2XA5A 4GBVA 2V3QA 3MQ9A 2F8DA 3IB2A 3I6VA 1B5IA 1FPLA 4JVIA 5L9MA 4AB5A 1FRPA 3FD3A 1N84A 4IR8A 4ELQA 4FAJA 1NNKA 1AIVA 4YB6A 4YMAA 1MDP1 2WBBA 3QMFA 1B5JA 4OQOA 1DTZA 4GWSA 3H4ZA 3BFUA 1BTJA 1AOVA 3KGCA 3OOAA 4F1YA 1I6BA 3IJXB 1FBDA 2PBWA 3IAZA 2XXXA 2HAUA 2A5TA 1GV8A 5ESYA 4MX6A 2R8TA 3TMGA 3EPEA 3USDA 2ONKE 4K3FA 4PGNA 3IOUA 1SD3A 2O69A 2Z8FA 4YKKA 3U94A 2CZIA 1BKAA 3V83A 2F35A 1SW4A 4WEDA 5J1DA 4Z7EA 1FQAA 5AA4B 4JDFA 4QSDA 2AYSA 3PUWE 3ROJA 4LQ2A 1I6QA 2QPQA 2H4IA 2I49A 4Q30B 5I58B 3HHFA 2DVCA 3W15C 5H8HA 2HZKA 1LBBA 3IJOB 2VPNA 1EZPA 1QULA 1FQFA 2H98A 1IXCA 1N04A 3S9NC 2GFEA 5IAIA 2V3TA 3GXAA 4OMBA 4EQ9A 2Q74A 4N17A 1IXIA 4F31B 4GX6A 1LFIA 4RYAA 3GBAA 1Y3QA 2DE4A 3C32A 4U23A 4ZZEA 2H5YA 3C9HA 4OERA 4N8YA 2ZYOA 3M8UA 3FXBA 2HAVA 4G8MA 4QFNA 3HFUA 5IGAA 4RA1A 2VPOA 3RUMA 1XS5A 4G4PA 2HQ0A 3ILUB 2I58A 4IO2A 3FBPA 5CRYA 4GWOA 3VV5A 3TUSA 3ZSFA 1D9VA 3FVKA 4DI4B 4DXUA 3DLNA 4MNCA 5L9OA 1A55A 4G61A 3U65A 3MBPA 1DSNA 2DS9A 1M5EA 2ZYNA 3WAEA 3FXUA 3GBBA 3K6WA 5H8SA 2WBDA 4X1BA 2HZLA 1JEVA 1MQDA 4YKIA 4FATA 5BUUA 3BFTA 4R74A 2Y5KA 2F7AA 4MH5A 4JWOA 4IO5A 2ZZWA 4LP2B 1IXGA 1A54A 1MY2A 4EF2A 5JK4A 4DLDA 1SI1A 4ZEDA 5TP9B 2QSXA 3HN0A 3KBRA 1B51A 1SYIA 4MNIA 4NWDA 4LONB 4PFRA 2UVJA 3IO4A 2O84X 4NWCA 4OVSA 4DXCA 3K6UA 2DOJA 3E9XA 1F9BA 2XX9A 4Q8RA 3IOTA 1LAXA 3TFLA 4GX3A 4PAIA 1BLFA 2WYPA 4I8CA 4O8MA 4GWUA 3O97A 3DP4A 1SYHA 2ZZVA 3W9WA 1NUWA 3PPRA 2HFBA 4DIGA 4HXVA 3W9VA 3OEKA 2FHYA 4QFKA 4M1VA 2YPNA 3MPKA 2XX8A 2PT2A 4GOTA 2DWAA 3LV0A 4G68C 4N4UA 2Y7IA 1OQGA 2DVZA 1VE4A 1JQFA 5CMCA 3K6VA 3MZ1A 5EHMA 4PGPA 2ZNUA 3TEPA 5TPAB 1P1OA 5I59B 2OJTA 4I9DA 2UVHA 2Y7PA 4N91A 4R2BA 4P11A 4OETA 3GYYA 1MXXA 1JEUA 2ZYKA 3LC8A 1MM7A 1P1UA 2F7CA 2XWIA 1B9JA 4O7IA 2FYIA 1B7HA 4NF0A 3CG3A 1NNPA 2CEXA 1MQHA 4ZEFA 2F78A 3V89B 4YB7A 4ELRA 5M2VA 4AQ4A 1AWBA 3OENA 3G3GA 3A3CA 2FIXA 5HPQA 1ANFA 4UABA 1A40A 3CRBA 4F1UA 4XTCQ 3T9XB 3K01A 3U92A 1TT1A 2O1MA 3PMWA 3FIRA 4X8RA 4P0IA 4MIJA 2B65A 5IZ3B 1LFGA 3H7MA 2CZHA 2PFZA 2ESNA 3B6TA 2KLFA 3KJ7A 1R9LA 2UVGA 4PFBA 1LAFE 3KN8A 3FVNA 3MC2A 3E4RA 3R6UA 3VLWA 4KI0E 2O7UA 2XXQA 5JTYB 2HHMA 1RYOA 2XXVA 3IX1A 3IL1B 4H45A 5AA3A 1Q35A 4R75A 4OZ9A 3N94A 1FPFA 4O3BA 4NF5B 1LEVA 4ESWA 3F11A 4U22A 2I6EA 4PF6A 4XIGQ 2OWTA 2VHAA 2OWZA 4PAKA 4GWYA 4PFIA 3T9HB 2W7YA 3G3IA 2DQVA 1FW0A 3TTKA 1B3GA 5EHSA 3JZJA 3H6UA 4JBZA 1B7ZA 1SQYA 2OBGA 1LAGE 4XKNA 4OVRA 1MXUA 4R6YA 3RT6B 1P1WA 3SDFA 1J1NA 3B50A 2Q8JA 4PAFA 3KG2A 1H44A 3KFMA 5A5LA 3RNNA 5KCJA 1JNFA 3MVZA 1DOTA 1S50A 2XXIA 1NI9A 4N6KA 4YB5A 5I56B 1XHYA 4GRKA 3K4UA 2QMXA 4YKJA 1N7WA 3TAJA 5H8FB 4I3YA 2H99A 3A09A 1SPIA 3D4GA 3TTRA 5I2NA 1UTHA 1FBEA 2XXKA 1FTOA 2F3DA 4XKPA 3T66A 3RGYA 5I57B 1VFEA 4LA9A 1UTBB 2P2AA 2H25A 4NF8A 1USYH 2I4BA 1IMBA 4GF8A 3N26A 4BLAA 3SEUA 3TCHA 1XT8A 4ND9A 1OVTA 3H6TA 3TODA 2GHBA 3MUQA 2OCUA 4PTKA 3O9PA 1B0LA 2F3BA 3B6QA 1MXZA 5L8DA 2DYXA 4OVTA 2B3BA 1HSLA 1FBGA 3MSTA 2R6GE 2Y84A 4THIA 1NV5A 3K02A 2HPGA 3T9VA 3KZGA 3TZAA 2RC8A 3EQ1A 5BWJA 4G8HA 4JSOA 3SZPA 4EXKA 1S7YA 3HPIA 4FIMA 3VVFA 3K1NA 3U72A 1S9TA 3LUZA 1K9ZA 4X48A 4LZ5A 5EQ7A 1AH5A 2QFLA 5FTIA 4YICA 1WODA 4QBAA 1UIUA 1TFDA 4PCDA 5FTHA 4ISUA 5H8NB 1D3KA 2VD2A 1IQ7A 1P1QA 4HCYA 4TLMB 1FTAA 3TTLA 1LBWA 3JV9A 4NF4B 3T22A 3Q27A 4ZEIA 2GQ1A 1NV7A 2HCAA 3CSGA 3TQLA 3C31A 2PCRA 3FJMA 4YU0A 2I48A 2PT1A 3KOSA 2GHAA 4H0WA 5ET6A 1USYE 4FE8A 4NE4A 1P1NA 3O2AA 1B4ZA 4NAPA 1Q9DA 3RPWA 2GRVA 2QMWA 1NV1A 5IKBA 1YYZA 3IOVA 1LCFA 3VFJA 2XWVA 4RY1A 1IMEA 4F22A 1B2HA 3LSLA 4TLLB 3SETA 3E3KA 2VOZA 2V84A 1NL5A 3KOTA 2B3FA 1US5A 3PD9A 1I6AA 1QUKA 3T9UA 1O7TA 1LBVA 4PBQA 5EQAA 4XFEA 5AA1A 3QUJA 2V4CA 4U4XA 1QGXA 2NWJA 1Q1KA 4PBHA 4BDMA 4ZEKA 3EKIA 4PE5B 4IO6A 2LAOA 1MPCA 3Q28A 3AXFA 1PBPA 3KEIA 2A5TB 1ZTYA 3PD8A 5ET8A 4NMYA 1FQBA 4HE0A 3OO6A 5EYGA 3B6WA 1LSTA 2E0SA 4G68A 1LBXA 4G77A 1UIVA 1POY1 3U93A 1B5HA 2XD3A 3A3UA 5ET7A 4YMBA 4U21A 4H5FA 3H3GA 2B4MA 4AB6A 3WAFA 3IO6A 4C0RA 1YZ0A 4RK2A 1MH3A 4PDDA 4H67A 5H8HB 4AS5A 1IMCA 2QS3A 4PFYA 3OO8A 4HE2A 1BIYA 2IA4A 5KDTA 4F3SA 4ZDMA 3OMBA 5LTCA 3S2VA 1FTMA 3IB0A 4PFTA 4FJPA 4F3GA 4ZS9A 3PTYA 3PU5A 3TKDA 1PDAA 1FSAA 3QYTA 4OEVA 4OVJA 2ZXTA 3PUVE 1QUJA 1DCUA 4ONYA 1QKBA 4P0GA 3SKPA 2A5SA 1TFAA 4FEDA 2PX1A 3OELA 5HBCA 4GWZA 1SVXB 4WEPA 4P1EA 2ABHA 2AL5A 4ELOA 4R6KA 1O64A 1O63A 4LZ8A 2UYEA 5DVJA 3PPNA 4ZE9A 3CR9A 2GH9A 4NF6A 4BDRA 3H03A 3O29A 3FJ7A 3MAMA 4NX1A 2B4LA 1A7LA 3G7WA 5ITPA 5IM2A 5F24A 2NXOA 4GVOA 1UQWA 4LN5A 2FNCA 3MVXA 3MVWA 4IY6A 3HV1A 2XXHA 4LVQA 4OEUA 4U4SA 1IIWA 3BBRA 3O6HA 3DELB 4DI3D 2VD3A 3D1RA 4KCDA 4POXA 3TDJA 1RYXA 2KR0A 3UP9A 3DM0A 1NV4A 2Q2CA 2WYKA 2XXWA 3VXCA 4MEVA 3UN6A 1NUZA 3FVGA 2ONSA 4MLQA 2O1LA 4MAGA 4LUBA 4OYVA 4F1VA 4P3LA 3M3KA 5I7IA 2FBPA 4I3EA 4JVDA 5DVIA 4FBPA 1R1NA 3OEMA 4H8JA 3BIGA 3RQTA 4EQBA 2NVUB 5I2KA 3O6GA 3P7IA 3ZS6A 1Z7ME 2I4CA 1PC3A 2Y7WA 4LATA 4OWDA 2DE3A 1ZIUA 2P1SA 3PGFA 1LFHA 4C1TA 4GIZA 5EYHA 5CC2A 1AL3A 1QW0A 2RCBA 1XVYA 4NQ8A 1FTJA 2XXRA 1QVSA 4OESA 5DEXA 4R73A 3VLVA 1IZ1A 3KBZA 3QK6A 3TTMA 5ICQA 4LQ5A 2BJIA 5A5XA 2HEUA 1PB9A 4I1DA 2O6AA 3EHUA 1B0HA 4U1ZA 1N3XA 4MLVA 3FJGA 4DCYA 2DWHA 1MS7A 1DMBA 5ICTA 3K00A 1ZU0A 2HXRA 1B05A 1AMFA 4DCXA 3CI8A 4DE8A 3RTFB 4FEBA 1TWYA 3QXMA 2DWJA 3FXRA 2QL3A 4QFOA 3DP8A 3THIA 2DXYA 3VVEA 3G3FA 4O94A 3IOWA 1CNQA 1ELJA 2VT5A 3PUXE 1FQCA 2Q8MA 1SW2A 1EZ9A 4OENA 4LZ7A 4MCOA 1WDNA 2Z8DA 5LOMA 4MNPA 4N6PA 3M3FA 3PPOA 1XVXA 4YKPA 1FPDA 1NNFA 3E78A 3VDFA 5IZZA 4H65A 1MPDA 3HSTA 1SBPA 1T0KA 2D3IA 5HM4B 1RDYA 1BP5A 3TYHA 4PP0A 1NV0A 1SDXA 5EYFA 3LUYA 3SERA 4F18A 4H46A 2L5VA 2X7PA 3N5LA 1NV2A 3PMXA 2R9JA 3HO7A 3C35A 1ZBMA 4JB7A 2CZKA 3ECRA 4DDDA 2ZMBA 4QRZA 4MJOA 3Q26A 5K2YA 2XWKA 1Z7NE 1FPEA 3K6XA 2XXPA 4JWXA 4FECA 1JP4A 3DP6A 4AS4A 1JW5A 3IFAA 4GFRA 1N7XA 1MH4A 3IFCA 3MP6A 3RLFE 1YXIA 2XWOA 1B1XA 2X7QA 2DE2A 3HHGA 3SEYA 3OD7A 3T96B 4HW8A 4GL0A 3VVDA 5KCJB 3MJNA 3PUZE 1FTLA 1N3WA 4ZE8A 3EHTA 5I3SA 3K1PA 4X9TA 1JVYA 2QVUA 1LBZA 4P8BA 2RKMA 1PB7A 1CE2A 4R2FA 5CMBA 4ZECA 2R71A 1IEJA 5TU0A 5LDZA 5DVFA 2Q88A 2F36A 5I2NB 1UTHB 4XKQA 4DZ1A 3VXBA 4P56A 5CBRA 3C4MA 3BIHA 4QXDA 3K0VA 1N76A 1RDZA 4E0WA 3FASA 3OO7A 1CB6A 1M5CA 3LBSA 3PUYE 4NF8B 4OHNA 2IEEA 1EYKA 3FZVA 3O28A 3G3JA 2D5WA 4ZZAA 4XEQA 1LCTA 5F1QA 5IZ1A 4P1LA 3FGSA 2PVUA 4BDOA 4WXJA 3T93B 4F29A 3CFXA 3B7DA 4PC9A 5I5PA 3H6WA 1B6HA 3R7XA 3VLUA 5FHNA 1LBYA 2P3VA 1IMDA 4N07A 1FJ6A 4WKMA 5F7VA 3L6GA 4N8GA 3OO9A 3HCQA 3MYUA 5DTBA 3L6HA 4EUOA 4IB2A 1FBFA 3T0JA 5CMMA 2REGA 1B46A 1ZMGA 2FIEA 4ECFA 4TOZA 1DBZA 1FBPA 1N0TA 3MP8A 4R9FA 4QSEA 2ZYMA 4NG7A 5FHOA 4G8NA 4KR5A 4N13A 4NGUA 4TQUQ 3K2DA 2QVVA 5CM6A 4IGRA 1B3FA 4KFQA 4N81A 1DK4A 1JETA 3E13X 3M3LA 1KWHA 3FATA 3RPLA 1MXYA 2VP1A 1GGGA 1VFDA 1HSEA 1VSOA 3QAXA 3UA8A 1NNTA 1B52A 2DSFA 4GWWA 1LLSA 3FUZA 1BK4A 1URGA 2ZNTA 3KC0A 2HXWA 2ONRA 1IXHA 3MP1A 1OQHA 4R72A 2RINA 2ZZXA 3EN3A 1NV3A 1MXWA 5K2XA 1EH3A 1ZLQA 4F2OA 1A99A 3T1BA
chains in the Genus database with same CATH topology
2FA7A 3UK4A 4IO3A 4QFLA 1M5DA 3H06B 4RPNA 1ATGA 1MQJA 3C33A 3SEWA 4EDPA 5H8QA 1JW1A 3ZKKA 2YLNA 3RY3A 4IO7A 2WKYA 3U8QA 5JEIA 2O51A 5H8QB 4PQJA 1EZOA 2NOOA 3QUFA 5AA4A 2QS1A 4L17A 1LBCA 4KD5A 4KYDA 4KYSA 1QJMA 3TCGA 2THIA 4G68B 1GR2A 5I58A 1P99A 4F19A 3PPQA 3S9MC 1MDQA 1JW4A 2AL4A 3CFZA 3O6IA 2XX7A 3OXNA 1B40A 5KDTB 1B3HA 4RNSA 1SW1A 4UACA 1DTGA 1Y9UA 1PB8A 3CSBA 3SEXA 3CFLA 3C36A 3IB1A 3U1OA 5L9SA 3MW0A 1VR5A 2F5XA 1MY4A 4E0XA 3R26A 4EQ7A 3RT8A 1MPBA 3ZKLA 2XHDA 1D9YA 4H5GA 3TTNA 1MM6A 4GD5A 2QS4A 2YJPA 3FVOA 2QS2A 1GVCA 3S9EA 1OVBA 2Y7KA 1DPPA 1R6ZA 1LB9A 1A8EA 1OLAA 4GLIA 3ONMA 5AA2A 4XKRA 2I0BA 1MQIA 4U1OA 3IR1A 1YPNA 2V25A 4R9GA 2VGQA 1OLCA 5CBSA 4NF6B 5AA2B 4KPTA 3OSQA 5AE4A 5ISUA 2XXUA 4OFOA 4HS7A 4KHZE 3S4UA 1H45A 2CZLA 5TP9A 1YCJA 3EF7A 4EXLA 1YTVA 3KJTA 4GXAA 4GL8A 4QFPA 4RXLA 1SW5A 2OWSA 2Z8EA 4Q5TA 4OXVA 2F6GA 1QUIA 2ALUA 2F6PA 4QSCA 1LGBC 5FHMA 2QJEA 1MY1A 2X26A 4IO4A 4RK9A 4ESXA 4XXUA 4I62A 1EU8A 2PMSA 4QF9A 2Q9TA 4QHQA 3VE1B 3TCFA 5DYHA 3SEVA 2OLBA 1YAEA 1H43A 5I2KB 2ZNSA 1HSJA 2G29A 4GQOA 2V93A 3N6UA 1M5BA 3UORA 3UGWA 3N6TA 3Q25A 1XC1A 3QIMA 5ELVA 2F7BA 4GXSB 3I5OA 4NEDA 3C34A 3TQWA 5TPAA 5DT6A 1FTKA 4MF3A 4O3AA 2DP8A 4RPOA 1TXFA 3V5AA 2D21A 1Y1MA 5I59A 5DEXB 5B70A 1GTKA 1M5FA 5A5XB 1LB8A 4O3CA 5KZTA 1II5A 2H9BA 5I84A 3LR1A 1URSA 5CI5A 1B3LA 3MPLA 2F97A 3MWBA 2RF1A 4Q0CA 4F3BA 4OTEA 2I0CA 2O68A 1H3DA 1MXVA 1R9QA 3V8XB 3GZGA 4F3PA 1L5TA 2REJA 3FXQA 2F34A 4OFJA 1IUDA 1D4NA 2O7IA 4G2ZA 3OSRA 3LSFB 4JSDA 2I3WA 1H76A 1ZJLA 4KYEA 1MRPA 3I3VA 2P0SA 4C1UA 5AA2D 4OFLA 1XOCA 4MFIA 2NUVA 4H6DA 4IY5A 1OIBA 4PFWA 3G3HA 4R6HA 5JTYA 1B32A 4HCWA 2G93A 2PYYA 1B1HA 1FQDA 1MY0A 3D4CA 1Y4CA 5CMKA 3EHSA 2QRYA 4NF5A 4BDQA 1B58A 3QSLA 3KSJA 1B7UA 2Z23A 1Y1ZA 3MVYA 3TELA 1RKMA 1JVXA 1MG1A 4KQPA 4JXIA 1URDA 4PETA 1A8FA 1FCKA 3CIJA 1Y3NA 1NMUA 3MZBA 4MBPA 3RN8A 2RC7A 5I56A 1PEBA 3K1MA 4HTGA 2UVIA 1PBQA 5H8FA 1Y20A 3ILTB 4X1DA 1OMPA 3LSXA 1US4A 5I57A 1I69A 3CVGA 4H1XA 2Y7RA 4NTLA 4FORA 3GLBA 4U2RA 2OK2A 1UTBA 4UA8A 3IK6B 2XXTA 2XD2A 2XXYA 5B7DA 3IORA 3H6VA 1B3EA 1IITA 3KN3A 2I3VA 3G3KA 4Z0IA 4ZEBA 3FV2A 3MZ9A 2RC9A 4POWA 4YZZA 4JWYA 4DXBA 1Y3PA 4M4GA 2DXRA 3FV1A 1WVJA 3S9LC 2DWIA 2UYFA 2UXAA 1NKXA 2ANJA 1DPEA 3ODBA 3KSXA 3PV0E 4ELPA 1FQEA 2Z22A 1ZKBA 2V3UA 2AIXA 4EF1A 4KCCA 4YAHX 3O66A 1Y4TA 1LAHE 4F39A 2RCAA 5H8NA 1SI0A 3PPPA 4RJZA 4IGTA 3Q29A 3RTWB 2M8CA 4PFUA 3TPAA 3CG1A 3SESA 2CMOA 4NF4A 2Q89A 4H8IA 1NH8A 2E1SA 3KN7A 4F2QA 1QKAA 1MQGA 3LSWA 1NH7A 2BJJX 1NFTA 4BDNA 2Q2AA 3PMVA 3UIFA 3JYRA 1MY3A 1POTA 3BKIB 5ITOA 1B4HA 4BDLA 2OZZA 2V3QA 3MQ9A 2F8DA 3IB2A 3I6VA 1B5IA 5L9MA 4AB5A 3FD3A 1N84A 4ELQA 4FAJA 1NNKA 1AIVA 4YB6A 4YMAA 1MDP1 1B5JA 4OQOA 1DTZA 3H4ZA 3BFUA 1BTJA 1AOVA 3KGCA 3OOAA 4F1YA 1I6BA 3IJXB 2PBWA 3IAZA 2XXXA 2HAUA 2A5TA 1GV8A 3TMGA 3EPEA 3USDA 2ONKE 4K3FA 3IOUA 1SD3A 2O69A 2Z8FA 4YKKA 3U94A 1BKAA 3V83A 2F35A 1SW4A 4WEDA 5J1DA 4Z7EA 1FQAA 5AA4B 4JDFA 4QSDA 2AYSA 3PUWE 4LQ2A 1I6QA 2QPQA 2H4IA 2I49A 4Q30B 5I58B 3HHFA 2DVCA 3W15C 5H8HA 2HZKA 1LBBA 3IJOB 1EZPA 1QULA 1FQFA 2H98A 1IXCA 1N04A 3S9NC 2GFEA 5IAIA 2V3TA 3GXAA 4OMBA 4EQ9A 1IXIA 4F31B 1LFIA 4RYAA 3GBAA 1Y3QA 2DE4A 3C32A 4U23A 4ZZEA 2H5YA 3C9HA 4OERA 2ZYOA 3M8UA 2HAVA 4G8MA 4QFNA 4RA1A 3RUMA 1XS5A 4G4PA 2HQ0A 3ILUB 2I58A 4IO2A 5CRYA 4GWOA 3VV5A 3TUSA 3ZSFA 1D9VA 3FVKA 4DXUA 5L9OA 3DLNA 1A55A 3MBPA 1DSNA 2DS9A 1M5EA 2ZYNA 3WAEA 3FXUA 3GBBA 3K6WA 5H8SA 4X1BA 2HZLA 1JEVA 1MQDA 4YKIA 4FATA 5BUUA 3BFTA 4R74A 2F7AA 4MH5A 4JWOA 4IO5A 4LP2B 1IXGA 1A54A 1MY2A 4EF2A 5JK4A 4DLDA 1SI1A 4ZEDA 5TP9B 2QSXA 3HN0A 3KBRA 1B51A 1SYIA 4NWDA 4LONB 2UVJA 3IO4A 2O84X 4NWCA 4DXCA 3K6UA 2DOJA 3E9XA 1F9BA 2XX9A 4Q8RA 3IOTA 1LAXA 3TFLA 1BLFA 4I8CA 3O97A 3DP4A 1SYHA 3W9WA 3PPRA 2HFBA 4DIGA 3W9VA 3OEKA 4QFKA 4M1VA 2YPNA 3MPKA 2XX8A 2PT2A 4GOTA 2DWAA 4G68C 2Y7IA 1OQGA 2DVZA 1VE4A 1JQFA 5CMCA 3K6VA 3MZ1A 5EHMA 2ZNUA 3TEPA 5TPAB 1P1OA 5I59B 2OJTA 4I9DA 2UVHA 2Y7PA 4R2BA 4P11A 4OETA 1MXXA 1JEUA 2ZYKA 3LC8A 1MM7A 1P1UA 2F7CA 1B9JA 2FYIA 1B7HA 3CG3A 1NNPA 1MQHA 4ZEFA 2F78A 3V89B 4YB7A 4ELRA 5M2VA 4AQ4A 3OENA 3G3GA 3A3CA 5HPQA 1ANFA 1A40A 3CRBA 4F1UA 4XTCQ 3T9XB 3K01A 3U92A 1TT1A 2O1MA 3PMWA 3FIRA 4P0IA 2B65A 1LFGA 3H7MA 2ESNA 3B6TA 2KLFA 3KJ7A 1R9LA 2UVGA 1LAFE 3KN8A 3FVNA 3MC2A 3E4RA 3R6UA 3VLWA 4KI0E 2O7UA 2XXQA 5JTYB 1RYOA 2XXVA 3IX1A 3IL1B 5AA3A 1Q35A 4R75A 4OZ9A 3N94A 4O3BA 4NF5B 4ESWA 3F11A 4U22A 2I6EA 4XIGQ 2OWTA 2VHAA 3T9HB 2W7YA 3G3IA 2DQVA 1FW0A 3TTKA 1B3GA 5EHSA 3JZJA 3H6UA 4JBZA 1B7ZA 1SQYA 2OBGA 1LAGE 4XKNA 1MXUA 4R6YA 3RT6B 1P1WA 3SDFA 1J1NA 2Q8JA 3KG2A 1H44A 3KFMA 3RNNA 5KCJA 1JNFA 3MVZA 1DOTA 1S50A 2XXIA 4YB5A 5I56B 1XHYA 4GRKA 3K4UA 2QMXA 4YKJA 1N7WA 3TAJA 5H8FB 2H99A 3A09A 3D4GA 3TTRA 5I2NA 1UTHA 1FTOA 4XKPA 3T66A 3RGYA 5I57B 1VFEA 4LA9A 1UTBB 2P2AA 2H25A 4NF8A 1USYH 2I4BA 4GF8A 3N26A 4BLAA 3SEUA 3TCHA 1XT8A 4ND9A 1OVTA 3H6TA 3TODA 2GHBA 3MUQA 2OCUA 3O9PA 1B0LA 3B6QA 1MXZA 5L8DA 2DYXA 2B3BA 1HSLA 2R6GE 2Y84A 4THIA 3K02A 3T9VA 3KZGA 3TZAA 2RC8A 3EQ1A 5BWJA 4G8HA 4JSOA 4EXKA 1S7YA 3HPIA 4FIMA 3VVFA 3K1NA 3U72A 1S9TA 4X48A 4LZ5A 1AH5A 5FTIA 4YICA 1WODA 1UIUA 1TFDA 5FTHA 4ISUA 5H8NB 1D3KA 2VD2A 1IQ7A 1P1QA 4HCYA 4TLMB 3TTLA 3JV9A 4NF4B 3T22A 3Q27A 4ZEIA 2HCAA 3CSGA 3TQLA 3C31A 3FJMA 4YU0A 2I48A 2PT1A 3KOSA 2GHAA 4H0WA 1USYE 4FE8A 4NE4A 1P1NA 3O2AA 1B4ZA 3RPWA 2GRVA 2QMWA 5IKBA 3IOVA 1LCFA 3VFJA 4RY1A 4F22A 1B2HA 3LSLA 4TLLB 3SETA 3E3KA 2VOZA 2V84A 1NL5A 3KOTA 2B3FA 1US5A 3PD9A 1I6AA 1QUKA 3T9UA 1O7TA 5AA1A 3QUJA 4U4XA 2NWJA 1Q1KA 4BDMA 4ZEKA 4PE5B 4IO6A 2LAOA 1MPCA 3Q28A 3AXFA 1PBPA 3KEIA 2A5TB 1ZTYA 3PD8A 4NMYA 1FQBA 3OO6A 3B6WA 1LSTA 2E0SA 4G68A 4G77A 1UIVA 1POY1 3U93A 1B5HA 2XD3A 3A3UA 4YMBA 4U21A 4H5FA 3H3GA 4AB6A 3WAFA 3IO6A 4C0RA 4RK2A 1MH3A 4H67A 5H8HB 2QS3A 4PFYA 3OO8A 1BIYA 2IA4A 5KDTA 4F3SA 4ZDMA 3OMBA 3S2VA 1FTMA 3IB0A 4PFTA 4FJPA 4F3GA 4ZS9A 3TKDA 3PU5A 1PDAA 3QYTA 4OEVA 4OVJA 2ZXTA 3PUVE 1QUJA 4ONYA 1QKBA 4P0GA 3SKPA 2A5SA 1TFAA 4FEDA 2PX1A 3OELA 5HBCA 1SVXB 4WEPA 2ABHA 2AL5A 4ELOA 4R6KA 1O64A 1O63A 4LZ8A 2UYEA 5DVJA 3PPNA 4ZE9A 3CR9A 2GH9A 4NF6A 4BDRA 3H03A 3O29A 3FJ7A 3MAMA 1A7LA 3G7WA 5ITPA 2NXOA 4GVOA 1UQWA 2FNCA 3MVXA 3MVWA 4IY6A 3HV1A 2XXHA 4LVQA 4OEUA 4U4SA 1IIWA 3BBRA 3O6HA 3DELB 2VD3A 4KCDA 4POXA 3TDJA 1RYXA 3UP9A 3DM0A 2Q2CA 2XXWA 3VXCA 3UN6A 3FVGA 2ONSA 4MLQA 2O1LA 4LUBA 4OYVA 4F1VA 3M3KA 5DVIA 1R1NA 3OEMA 4H8JA 3RQTA 4EQBA 2NVUB 5I2KA 3O6GA 3P7IA 3ZS6A 1Z7ME 2I4CA 1PC3A 2Y7WA 4LATA 4OWDA 2DE3A 1ZIUA 2P1SA 3PGFA 1LFHA 4C1TA 4GIZA 5CC2A 1AL3A 1QW0A 2RCBA 1XVYA 1FTJA 2XXRA 1QVSA 4OESA 5DEXA 4R73A 3VLVA 1IZ1A 3QK6A 3TTMA 5ICQA 4LQ5A 5A5XA 2HEUA 1PB9A 4I1DA 2O6AA 3EHUA 1B0HA 4U1ZA 1N3XA 4MLVA 3FJGA 4DCYA 2DWHA 1MS7A 1DMBA 5ICTA 3K00A 1ZU0A 1B05A 1AMFA 4DCXA 3CI8A 4DE8A 3RTFB 4FEBA 1TWYA 3QXMA 2DWJA 3FXRA 2QL3A 4QFOA 3DP8A 3THIA 2DXYA 3VVEA 3G3FA 3IOWA 1ELJA 3PUXE 1FQCA 1SW2A 1EZ9A 4OENA 4LZ7A 1WDNA 2Z8DA 5LOMA 4N6PA 3M3FA 3PPOA 1XVXA 4YKPA 1NNFA 3VDFA 4H65A 1MPDA 3HSTA 1SBPA 1T0KA 2D3IA 5HM4B 1BP5A 3TYHA 4PP0A 1SDXA 5EYFA 3LUYA 3SERA 4F18A 2X7PA 3N5LA 3PMXA 2R9JA 3HO7A 3C35A 1ZBMA 4JB7A 3ECRA 4DDDA 2ZMBA 4QRZA 3Q26A 5K2YA 1Z7NE 3K6XA 2XXPA 4JWXA 4FECA 3DP6A 1JW5A 4GFRA 1N7XA 1MH4A 3MP6A 3RLFE 1B1XA 2X7QA 2DE2A 3HHGA 3SEYA 3OD7A 3T96B 4HW8A 4GL0A 3VVDA 5KCJB 3MJNA 3PUZE 1FTLA 1N3WA 4ZE8A 3EHTA 3K1PA 4X9TA 1JVYA 2RKMA 1PB7A 1CE2A 5CMBA 4ZECA 4R2FA 2R71A 1IEJA 5TU0A 5DVFA 2Q88A 2F36A 5I2NB 1UTHB 4XKQA 4DZ1A 3VXBA 5CBRA 3C4MA 3K0VA 1N76A 4E0WA 3FASA 3OO7A 1CB6A 1M5CA 3LBSA 3PUYE 4NF8B 4OHNA 2IEEA 3FZVA 3O28A 3G3JA 2D5WA 4ZZAA 1LCTA 5F1QA 3FGSA 2PVUA 4BDOA 4WXJA 3T93B 4F29A 3CFXA 3B7DA 3H6WA 1B6HA 3R7XA 3VLUA 5FHNA 4N07A 4WKMA 5F7VA 3L6GA 3OO9A 3HCQA 5DTBA 3L6HA 4EUOA 4IB2A 5CMMA 2REGA 1B46A 1ZMGA 4ECFA 4TOZA 1N0TA 3MP8A 4R9FA 4QSEA 2ZYMA 5FHOA 4G8NA 4KR5A 4N13A 4TQUQ 3K2DA 5CM6A 4IGRA 1B3FA 4KFQA 1JETA 3E13X 3M3LA 1KWHA 3FATA 1MXYA 2VP1A 1GGGA 1VFDA 1HSEA 1VSOA 3QAXA 3UA8A 1NNTA 1B52A 2DSFA 1LLSA 3FUZA 1URGA 2ZNTA 2HXWA 2ONRA 1IXHA 3MP1A 1OQHA 4R72A 2RINA 3EN3A 1MXWA 5K2XA 1EH3A 1ZLQA 4F2OA 1A99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FA7 A;  3UK4 A;  4IO3 A;  4QFL A;  1M5D A;  3H06 B;  4RPN A;  1ATG A;  1MQJ A;  3C33 A;  3SEW A;  4EDP A;  5H8Q A;  1JW1 A;  3ZKK A;  2YLN A;  3RY3 A;  4IO7 A;  2WKY A;  3U8Q A;  5JEI A;  2O51 A;  5H8Q B;  4PQJ A;  1EZO A;  2NOO A;  3QUF A;  5AA4 A;  2QS1 A;  4L17 A;  1LBC A;  4KD5 A;  4KYD A;  4KYS A;  1QJM A;  3TCG A;  2THI A;  4G68 B;  1GR2 A;  5I58 A;  1P99 A;  4F19 A;  3PPQ A;  3S9M C;  1MDQ A;  1JW4 A;  2AL4 A;  3CFZ A;  3O6I A;  2XX7 A;  3OXN A;  1B40 A;  5KDT B;  1B3H A;  4RNS A;  1SW1 A;  4UAC A;  1DTG A;  1Y9U A;  1PB8 A;  3CSB A;  3SEX A;  3CFL A;  3C36 A;  3IB1 A;  3U1O A;  5L9S A;  3MW0 A;  1VR5 A;  2F5X A;  1MY4 A;  4E0X A;  3R26 A;  4EQ7 A;  3RT8 A;  1MPB A;  3ZKL A;  2XHD A;  1D9Y A;  4H5G A;  3TTN A;  1MM6 A;  4GD5 A;  2QS4 A;  2YJP A;  3FVO A;  2QS2 A;  1GVC A;  3S9E A;  1OVB A;  2Y7K A;  1DPP A;  1R6Z A;  1LB9 A;  1A8E A;  1OLA A;  4GLI A;  3ONM A;  5AA2 A;  4XKR A;  2I0B A;  1MQI A;  4U1O A;  3IR1 A;  1YPN A;  2V25 A;  4R9G A;  2VGQ A;  1OLC A;  5CBS A;  4NF6 B;  5AA2 B;  4KPT A;  3OSQ A;  5AE4 A;  5ISU A;  2XXU A;  4OFO A;  4HS7 A;  4KHZ E;  3S4U A;  1H45 A;  2CZL A;  5TP9 A;  1YCJ A;  3EF7 A;  4EXL A;  1YTV A;  3KJT A;  4GXA A;  4GL8 A;  4QFP A;  4RXL A;  1SW5 A;  2OWS A;  2Z8E A;  4Q5T A;  4OXV A;  2F6G A;  1QUI A;  2ALU A;  2F6P A;  4QSC A;  1LGB C;  5FHM A;  2QJE A;  1MY1 A;  2X26 A;  4IO4 A;  4RK9 A;  4ESX A;  4XXU A;  4I62 A;  1EU8 A;  2PMS A;  4QF9 A;  2Q9T A;  4QHQ A;  3VE1 B;  3TCF A;  5DYH A;  3SEV A;  2OLB A;  1YAE A;  1H43 A;  5I2K B;  2ZNS A;  1HSJ A;  2G29 A;  4GQO A;  2V93 A;  3N6U A;  1M5B A;  3UOR A;  3UGW A;  3N6T A;  3Q25 A;  1XC1 A;  3QIM A;  5ELV A;  2F7B A;  4GXS B;  3I5O A;  4NED A;  3C34 A;  3TQW A;  5TPA A;  5DT6 A;  1FTK A;  4MF3 A;  4O3A A;  2DP8 A;  4RPO A;  1TXF A;  3V5A A;  2D21 A;  1Y1M A;  5I59 A;  5DEX B;  5B70 A;  1GTK A;  1M5F A;  5A5X B;  1LB8 A;  4O3C A;  5KZT A;  1II5 A;  2H9B A;  5I84 A;  3LR1 A;  1URS A;  5CI5 A;  1B3L A;  3MPL A;  2F97 A;  3MWB A;  2RF1 A;  4Q0C A;  4F3B A;  4OTE A;  2I0C A;  2O68 A;  1H3D A;  1MXV A;  1R9Q A;  3V8X B;  3GZG A;  4F3P A;  1L5T A;  2REJ A;  3FXQ A;  2F34 A;  4OFJ A;  1IUD A;  1D4N A;  2O7I A;  4G2Z A;  3OSR A;  3LSF B;  4JSD A;  2I3W A;  1H76 A;  1ZJL A;  4KYE A;  1MRP A;  3I3V A;  2P0S A;  4C1U A;  5AA2 D;  4OFL A;  1XOC A;  4MFI A;  2NUV A;  4H6D A;  4IY5 A;  1OIB A;  4PFW A;  3G3H A;  4R6H A;  5JTY A;  1B32 A;  4HCW A;  2G93 A;  2PYY A;  1B1H A;  1FQD A;  1MY0 A;  3D4C A;  1Y4C A;  5CMK A;  3EHS A;  2QRY A;  4NF5 A;  4BDQ A;  1B58 A;  3QSL A;  3KSJ A;  1B7U A;  2Z23 A;  1Y1Z A;  3MVY A;  3TEL A;  1RKM A;  1JVX A;  1MG1 A;  4KQP A;  4JXI A;  1URD A;  4PET A;  1A8F A;  1FCK A;  3CIJ A;  1Y3N A;  1NMU A;  3MZB A;  4MBP A;  3RN8 A;  2RC7 A;  5I56 A;  1PEB A;  3K1M A;  4HTG A;  2UVI A;  1PBQ A;  5H8F A;  1Y20 A;  3ILT B;  4X1D A;  1OMP A;  3LSX A;  1US4 A;  5I57 A;  1I69 A;  3CVG A;  4H1X A;  2Y7R A;  4NTL A;  4FOR A;  3GLB A;  4U2R A;  2OK2 A;  1UTB A;  4UA8 A;  3IK6 B;  2XXT A;  2XD2 A;  2XXY A;  5B7D A;  3IOR A;  3H6V A;  1B3E A;  1IIT A;  3KN3 A;  2I3V A;  3G3K A;  4Z0I A;  4ZEB A;  3FV2 A;  3MZ9 A;  2RC9 A;  4POW A;  4YZZ A;  4JWY A;  4DXB A;  1Y3P A;  4M4G A;  2DXR A;  3FV1 A;  1WVJ A;  3S9L C;  2DWI A;  2UYF A;  2UXA A;  1NKX A;  2ANJ A;  1DPE A;  3ODB A;  3KSX A;  3PV0 E;  4ELP A;  1FQE A;  2Z22 A;  1ZKB A;  2V3U A;  2AIX A;  4EF1 A;  4KCC A;  4YAH X;  3O66 A;  1Y4T A;  1LAH E;  4F39 A;  2RCA A;  5H8N A;  1SI0 A;  3PPP A;  4RJZ A;  4IGT A;  3Q29 A;  3RTW B;  2M8C A;  4PFU A;  3TPA A;  3CG1 A;  3SES A;  2CMO A;  4NF4 A;  2Q89 A;  4H8I A;  1NH8 A;  2E1S A;  3KN7 A;  4F2Q A;  1QKA A;  1MQG A;  3LSW A;  1NH7 A;  2BJJ X;  1NFT A;  4BDN A;  2Q2A A;  3PMV A;  3UIF A;  3JYR A;  1MY3 A;  1POT A;  3BKI B;  5ITO A;  1B4H A;  4BDL A;  2OZZ A;  2V3Q A;  3MQ9 A;  2F8D A;  3IB2 A;  3I6V A;  1B5I A;  5L9M A;  4AB5 A;  3FD3 A;  1N84 A;  4ELQ A;  4FAJ A;  1NNK A;  1AIV A;  4YB6 A;  4YMA A;  1MDP 1;  1B5J A;  4OQO A;  1DTZ A;  3H4Z A;  3BFU A;  1BTJ A;  1AOV A;  3KGC A;  3OOA A;  4F1Y A;  1I6B A;  3IJX B;  2PBW A;  3IAZ A;  2XXX A;  2HAU A;  2A5T A;  1GV8 A;  3TMG A;  3EPE A;  3USD A;  2ONK E;  4K3F A;  3IOU A;  1SD3 A;  2O69 A;  2Z8F A;  4YKK A;  3U94 A;  1BKA A;  3V83 A;  2F35 A;  1SW4 A;  4WED A;  5J1D A;  4Z7E A;  1FQA A;  5AA4 B;  4JDF A;  4QSD A;  2AYS A;  3PUW E;  4LQ2 A;  1I6Q A;  2QPQ A;  2H4I A;  2I49 A;  4Q30 B;  5I58 B;  3HHF A;  2DVC A;  3W15 C;  5H8H A;  2HZK A;  1LBB A;  3IJO B;  1EZP A;  1QUL A;  1FQF A;  2H98 A;  1IXC A;  1N04 A;  3S9N C;  2GFE A;  5IAI A;  2V3T A;  3GXA A;  4OMB A;  4EQ9 A;  1IXI A;  4F31 B;  1LFI A;  4RYA A;  3GBA A;  1Y3Q A;  2DE4 A;  3C32 A;  4U23 A;  4ZZE A;  2H5Y A;  3C9H A;  4OER A;  2ZYO A;  3M8U A;  2HAV A;  4G8M A;  4QFN A;  4RA1 A;  3RUM A;  1XS5 A;  4G4P A;  2HQ0 A;  3ILU B;  2I58 A;  4IO2 A;  5CRY A;  4GWO A;  3VV5 A;  3TUS A;  3ZSF A;  1D9V A;  3FVK A;  4DXU A;  5L9O A;  3DLN A;  1A55 A;  3MBP A;  1DSN A;  2DS9 A;  1M5E A;  2ZYN A;  3WAE A;  3FXU A;  3GBB A;  3K6W A;  5H8S A;  4X1B A;  2HZL A;  1JEV A;  1MQD A;  4YKI A;  4FAT A;  5BUU A;  3BFT A;  4R74 A;  2F7A A;  4MH5 A;  4JWO A;  4IO5 A;  4LP2 B;  1IXG A;  1A54 A;  1MY2 A;  4EF2 A;  5JK4 A;  4DLD A;  1SI1 A;  4ZED A;  5TP9 B;  2QSX A;  3HN0 A;  3KBR A;  1B51 A;  1SYI A;  4NWD A;  4LON B;  2UVJ A;  3IO4 A;  2O84 X;  4NWC A;  4DXC A;  3K6U A;  2DOJ A;  3E9X A;  1F9B A;  2XX9 A;  4Q8R A;  3IOT A;  1LAX A;  3TFL A;  1BLF A;  4I8C A;  3O97 A;  3DP4 A;  1SYH A;  3W9W A;  3PPR A;  2HFB A;  4DIG A;  3W9V A;  3OEK A;  4QFK A;  4M1V A;  2YPN A;  3MPK A;  2XX8 A;  2PT2 A;  4GOT A;  2DWA A;  4G68 C;  2Y7I A;  1OQG A;  2DVZ A;  1VE4 A;  1JQF A;  5CMC A;  3K6V A;  3MZ1 A;  5EHM A;  2ZNU A;  3TEP A;  5TPA B;  1P1O A;  5I59 B;  2OJT A;  4I9D A;  2UVH A;  2Y7P A;  4R2B A;  4P11 A;  4OET A;  1MXX A;  1JEU A;  2ZYK A;  3LC8 A;  1MM7 A;  1P1U A;  2F7C A;  1B9J A;  2FYI A;  1B7H A;  3CG3 A;  1NNP A;  1MQH A;  4ZEF A;  2F78 A;  3V89 B;  4YB7 A;  4ELR A;  5M2V A;  4AQ4 A;  3OEN A;  3G3G A;  3A3C A;  5HPQ A;  1ANF A;  1A40 A;  3CRB A;  4F1U A;  4XTC Q;  3T9X B;  3K01 A;  3U92 A;  1TT1 A;  2O1M A;  3PMW A;  3FIR A;  4P0I A;  2B65 A;  1LFG A;  3H7M A;  2ESN A;  3B6T A;  2KLF A;  3KJ7 A;  1R9L A;  2UVG A;  1LAF E;  3KN8 A;  3FVN A;  3MC2 A;  3E4R A;  3R6U A;  3VLW A;  4KI0 E;  2O7U A;  2XXQ A;  5JTY B;  1RYO A;  2XXV A;  3IX1 A;  3IL1 B;  5AA3 A;  1Q35 A;  4R75 A;  4OZ9 A;  3N94 A;  4O3B A;  4NF5 B;  4ESW A;  3F11 A;  4U22 A;  2I6E A;  4XIG Q;  2OWT A;  2VHA A;  3T9H B;  2W7Y A;  3G3I A;  2DQV A;  1FW0 A;  3TTK A;  1B3G A;  5EHS A;  3JZJ A;  3H6U A;  4JBZ A;  1B7Z A;  1SQY A;  2OBG A;  1LAG E;  4XKN A;  1MXU A;  4R6Y A;  3RT6 B;  1P1W A;  3SDF A;  1J1N A;  2Q8J A;  3KG2 A;  1H44 A;  3KFM A;  3RNN A;  5KCJ A;  1JNF A;  3MVZ A;  1DOT A;  1S50 A;  2XXI A;  4YB5 A;  5I56 B;  1XHY A;  4GRK A;  3K4U A;  2QMX A;  4YKJ A;  1N7W A;  3TAJ A;  5H8F B;  2H99 A;  3A09 A;  3D4G A;  3TTR A;  5I2N A;  1UTH A;  1FTO A;  4XKP A;  3T66 A;  3RGY A;  5I57 B;  1VFE A;  4LA9 A;  1UTB B;  2P2A A;  2H25 A;  4NF8 A;  1USY H;  2I4B A;  4GF8 A;  3N26 A;  4BLA A;  3SEU A;  3TCH A;  1XT8 A;  4ND9 A;  1OVT A;  3H6T A;  3TOD A;  2GHB A;  3MUQ A;  2OCU A;  3O9P A;  1B0L A;  3B6Q A;  1MXZ A;  5L8D A;  2DYX A;  2B3B A;  1HSL A;  2R6G E;  2Y84 A;  4THI A;  3K02 A;  3T9V A;  3KZG A;  3TZA A;  2RC8 A;  3EQ1 A;  5BWJ A;  4G8H A;  4JSO A;  4EXK A;  1S7Y A;  3HPI A;  4FIM A;  3VVF A;  3K1N A;  3U72 A;  1S9T A;  4X48 A;  4LZ5 A;  1AH5 A;  5FTI A;  4YIC A;  1WOD A;  1UIU A;  1TFD A;  5FTH A;  4ISU A;  5H8N B;  1D3K A;  2VD2 A;  1IQ7 A;  1P1Q A;  4HCY A;  4TLM B;  3TTL A;  3JV9 A;  4NF4 B;  3T22 A;  3Q27 A;  4ZEI A;  2HCA A;  3CSG A;  3TQL A;  3C31 A;  3FJM A;  4YU0 A;  2I48 A;  2PT1 A;  3KOS A;  2GHA A;  4H0W A;  1USY E;  4FE8 A;  4NE4 A;  1P1N A;  3O2A A;  1B4Z A;  3RPW A;  2GRV A;  2QMW A;  5IKB A;  3IOV A;  1LCF A;  3VFJ A;  4RY1 A;  4F22 A;  1B2H A;  3LSL A;  4TLL B;  3SET A;  3E3K A;  2VOZ A;  2V84 A;  1NL5 A;  3KOT A;  2B3F A;  1US5 A;  3PD9 A;  1I6A A;  1QUK A;  3T9U A;  1O7T A;  5AA1 A;  3QUJ A;  4U4X A;  2NWJ A;  1Q1K A;  4BDM A;  4ZEK A;  4PE5 B;  4IO6 A;  2LAO A;  1MPC A;  3Q28 A;  3AXF A;  1PBP A;  3KEI A;  2A5T B;  1ZTY A;  3PD8 A;  4NMY A;  1FQB A;  3OO6 A;  3B6W A;  1LST A;  2E0S A;  4G68 A;  4G77 A;  1UIV A;  1POY 1;  3U93 A;  1B5H A;  2XD3 A;  3A3U A;  4YMB A;  4U21 A;  4H5F A;  3H3G A;  4AB6 A;  3WAF A;  3IO6 A;  4C0R A;  4RK2 A;  1MH3 A;  4H67 A;  5H8H B;  2QS3 A;  4PFY A;  3OO8 A;  1BIY A;  2IA4 A;  5KDT A;  4F3S A;  4ZDM A;  3OMB A;  3S2V A;  1FTM A;  3IB0 A;  4PFT A;  4FJP A;  4F3G A;  4ZS9 A;  3TKD A;  3PU5 A;  1PDA A;  3QYT A;  4OEV A;  4OVJ A;  2ZXT A;  3PUV E;  1QUJ A;  4ONY A;  1QKB A;  4P0G A;  3SKP A;  2A5S A;  1TFA A;  4FED A;  2PX1 A;  3OEL A;  5HBC A;  1SVX B;  4WEP A;  2ABH A;  2AL5 A;  4ELO A;  4R6K A;  1O64 A;  1O63 A;  4LZ8 A;  2UYE A;  5DVJ A;  3PPN A;  4ZE9 A;  3CR9 A;  2GH9 A;  4NF6 A;  4BDR A;  3H03 A;  3O29 A;  3FJ7 A;  3MAM A;  1A7L A;  3G7W A;  5ITP A;  2NXO A;  4GVO A;  1UQW A;  2FNC A;  3MVX A;  3MVW A;  4IY6 A;  3HV1 A;  2XXH A;  4LVQ A;  4OEU A;  4U4S A;  1IIW A;  3BBR A;  3O6H A;  3DEL B;  2VD3 A;  4KCD A;  4POX A;  3TDJ A;  1RYX A;  3UP9 A;  3DM0 A;  2Q2C A;  2XXW A;  3VXC A;  3UN6 A;  3FVG A;  2ONS A;  4MLQ A;  2O1L A;  4LUB A;  4OYV A;  4F1V A;  3M3K A;  5DVI A;  1R1N A;  3OEM A;  4H8J A;  3RQT A;  4EQB A;  2NVU B;  5I2K A;  3O6G A;  3P7I A;  3ZS6 A;  1Z7M E;  2I4C A;  1PC3 A;  2Y7W A;  4LAT A;  4OWD A;  2DE3 A;  1ZIU A;  2P1S A;  3PGF A;  1LFH A;  4C1T A;  4GIZ A;  5CC2 A;  1AL3 A;  1QW0 A;  2RCB A;  1XVY A;  1FTJ A;  2XXR A;  1QVS A;  4OES A;  5DEX A;  4R73 A;  3VLV A;  1IZ1 A;  3QK6 A;  3TTM A;  5ICQ A;  4LQ5 A;  5A5X A;  2HEU A;  1PB9 A;  4I1D A;  2O6A A;  3EHU A;  1B0H A;  4U1Z A;  1N3X A;  4MLV A;  3FJG A;  4DCY A;  2DWH A;  1MS7 A;  1DMB A;  5ICT A;  3K00 A;  1ZU0 A;  1B05 A;  1AMF A;  4DCX A;  3CI8 A;  4DE8 A;  3RTF B;  4FEB A;  1TWY A;  3QXM A;  2DWJ A;  3FXR A;  2QL3 A;  4QFO A;  3DP8 A;  3THI A;  2DXY A;  3VVE A;  3G3F A;  3IOW A;  1ELJ A;  3PUX E;  1FQC A;  1SW2 A;  1EZ9 A;  4OEN A;  4LZ7 A;  1WDN A;  2Z8D A;  5LOM A;  4N6P A;  3M3F A;  3PPO A;  1XVX A;  4YKP A;  1NNF A;  3VDF A;  4H65 A;  1MPD A;  3HST A;  1SBP A;  1T0K A;  2D3I A;  5HM4 B;  1BP5 A;  3TYH A;  4PP0 A;  1SDX A;  5EYF A;  3LUY A;  3SER A;  4F18 A;  2X7P A;  3N5L A;  3PMX A;  2R9J A;  3HO7 A;  3C35 A;  1ZBM A;  4JB7 A;  3ECR A;  4DDD A;  2ZMB A;  4QRZ A;  3Q26 A;  5K2Y A;  1Z7N E;  3K6X A;  2XXP A;  4JWX A;  4FEC A;  3DP6 A;  1JW5 A;  4GFR A;  1N7X A;  1MH4 A;  3MP6 A;  3RLF E;  1B1X A;  2X7Q A;  2DE2 A;  3HHG A;  3SEY A;  3OD7 A;  3T96 B;  4HW8 A;  4GL0 A;  3VVD A;  5KCJ B;  3MJN A;  3PUZ E;  1FTL A;  1N3W A;  4ZE8 A;  3EHT A;  3K1P A;  4X9T A;  1JVY A;  2RKM A;  1PB7 A;  1CE2 A;  5CMB A;  4ZEC A;  4R2F A;  2R71 A;  1IEJ A;  5TU0 A;  5DVF A;  2Q88 A;  2F36 A;  5I2N B;  1UTH B;  4XKQ A;  4DZ1 A;  3VXB A;  5CBR A;  3C4M A;  3K0V A;  1N76 A;  4E0W A;  3FAS A;  3OO7 A;  1CB6 A;  1M5C A;  3LBS A;  3PUY E;  4NF8 B;  4OHN A;  2IEE A;  3FZV A;  3O28 A;  3G3J A;  2D5W A;  4ZZA A;  1LCT A;  5F1Q A;  3FGS A;  2PVU A;  4BDO A;  4WXJ A;  3T93 B;  4F29 A;  3CFX A;  3B7D A;  3H6W A;  1B6H A;  3R7X A;  3VLU A;  5FHN A;  4N07 A;  4WKM A;  5F7V A;  3L6G A;  3OO9 A;  3HCQ A;  5DTB A;  3L6H A;  4EUO A;  4IB2 A;  5CMM A;  2REG A;  1B46 A;  1ZMG A;  4ECF A;  4TOZ A;  1N0T A;  3MP8 A;  4R9F A;  4QSE A;  2ZYM A;  5FHO A;  4G8N A;  4KR5 A;  4N13 A;  4TQU Q;  3K2D A;  5CM6 A;  4IGR A;  1B3F A;  4KFQ A;  1JET A;  3E13 X;  3M3L A;  1KWH A;  3FAT A;  1MXY A;  2VP1 A;  1GGG A;  1VFD A;  1HSE A;  1VSO A;  3QAX A;  3UA8 A;  1NNT A;  1B52 A;  2DSF A;  1LLS A;  3FUZ A;  1URG A;  2ZNT A;  2HXW A;  2ONR A;  1IXH A;  3MP1 A;  1OQH A;  4R72 A;  2RIN A;  3EN3 A;  1MXW A;  5K2X A;  1EH3 A;  1ZLQ A;  4F2O A;  1A99 A; 
#chains in the Genus database with same CATH topology
 2FA7 A;  3UK4 A;  4IO3 A;  4QFL A;  1M5D A;  3H06 B;  4RPN A;  1ATG A;  1MQJ A;  3C33 A;  3B8B A;  3SEW A;  4EDP A;  5H8Q A;  1JW1 A;  3ZKK A;  2YLN A;  3RY3 A;  4IO7 A;  2WKY A;  3U8Q A;  4GWX A;  5JEI A;  2O51 A;  5H8Q B;  4PQJ A;  1EZO A;  2NOO A;  3QUF A;  5AA4 A;  4PF8 A;  2QS1 A;  4L17 A;  1LBC A;  4KD5 A;  4KYD A;  4KYS A;  1QJM A;  3TCG A;  2THI A;  4G68 B;  1GR2 A;  5I58 A;  1P99 A;  4F19 A;  1KA1 A;  2WEF A;  3PPQ A;  3S9M C;  4PE3 A;  1MDQ A;  1JW4 A;  2AL4 A;  3CFZ A;  1EYJ A;  5DW8 A;  3O6I A;  2XX7 A;  3OXN A;  4P47 A;  1B40 A;  5KDT B;  1B3H A;  4JVC A;  4RNS A;  1SW1 A;  4UAC A;  1DTG A;  1Y9U A;  1FPJ A;  1PB8 A;  3CSB A;  3SEX A;  3CFL A;  3C36 A;  3IB1 A;  3U1O A;  1G0I A;  5L9S A;  3MW0 A;  1VR5 A;  2F5X A;  1MY4 A;  1NV6 A;  1VDW A;  4E0X A;  3R26 A;  4EQ7 A;  4KXP A;  3RT8 A;  1MPB A;  3ZKL A;  2XHD A;  1D9Y A;  4H5G A;  4OAN A;  3TTN A;  1MM6 A;  4GD5 A;  2QS4 A;  2YJP A;  3FVO A;  2QS2 A;  5EQ8 A;  5T3J A;  1GVC A;  3S9E A;  1OVB A;  2Y7K A;  1DPP A;  1R6Z A;  1LB9 A;  1XI6 A;  1A8E A;  5EQ9 A;  1OLA A;  4GLI A;  2KQZ A;  3ONM A;  5AA2 A;  4XKR A;  2I0B A;  1MQI A;  4U1O A;  3IR1 A;  1YPN A;  2V25 A;  5FBP A;  4R9G A;  2VGQ A;  1OLC A;  5CBS A;  4NF6 B;  5AA2 B;  4KPT A;  3OSQ A;  5AE4 A;  5ISU A;  2XXU A;  4OFO A;  4HS7 A;  4KHZ E;  3S4U A;  1H45 A;  3CHG A;  2CZL A;  4O7M A;  5TP9 A;  1YCJ A;  3EF7 A;  4EXL A;  1YTV A;  3KJT A;  4GXA A;  4GL8 A;  1FPI A;  4QFP A;  4RXL A;  1SW5 A;  2OWS A;  2Z8E A;  1NUY A;  1K9Y A;  4Q5T A;  4I40 A;  1RDX A;  4P9K A;  4OXV A;  2F6G A;  1QUI A;  2ALU A;  2F6P A;  4QSC A;  1LGB C;  5FHM A;  2QJE A;  1MY1 A;  2X26 A;  4IO4 A;  4RK9 A;  4ESX A;  4XXU A;  4I62 A;  1EU8 A;  2PMS A;  4QF9 A;  2Q9T A;  4PDH A;  4QHQ A;  3VE1 B;  3TCF A;  5DYH A;  3SEV A;  2OLB A;  1YAE A;  1H43 A;  5I2K B;  2ZNS A;  2FVZ A;  1HSJ A;  5ET5 A;  2G29 A;  4GQO A;  4OA4 A;  2V93 A;  1IMA A;  3N6U A;  1M5B A;  3UOR A;  3UGW A;  3N6T A;  1INP A;  3Q25 A;  1XC1 A;  2P3N A;  3QIM A;  5ELV A;  2F7B A;  2OX3 A;  4GXS B;  3I5O A;  4NED A;  3C34 A;  3TQW A;  5TPA A;  5DT6 A;  1FTK A;  4MF3 A;  4O3A A;  2DP8 A;  4RPO A;  1TXF A;  3V5A A;  2D21 A;  1Y1M A;  5I59 A;  5DEX B;  5B70 A;  1GTK A;  1D9Q A;  1M5F A;  5A5X B;  1LB8 A;  4O3C A;  1FPG A;  5KZT A;  1II5 A;  2H9B A;  1G0H A;  5I84 A;  3LR1 A;  1URS A;  5CI5 A;  1B3L A;  3MPL A;  2F97 A;  3MWB A;  2RF1 A;  4Q0C A;  4F3B A;  4OTE A;  2I0C A;  4N6D A;  2DDK A;  2O68 A;  1H3D A;  1MXV A;  1R9Q A;  1KA0 A;  3V8X B;  3GZG A;  2MKZ A;  4F3P A;  1L5T A;  2CEY A;  2REJ A;  3FXQ A;  2F34 A;  4OFJ A;  1IUD A;  4OVP A;  1D4N A;  2O7I A;  4G2Z A;  3OSR A;  3LSF B;  5IZ3 A;  4JSD A;  2I3W A;  1H76 A;  1ZJL A;  4KYE A;  5J16 A;  1MRP A;  3I3V A;  2P0S A;  4C1U A;  5AA2 D;  4OFL A;  1XOC A;  4MFI A;  2NUV A;  4H6D A;  4OVQ A;  1NUX A;  4IY5 A;  1OIB A;  4PFW A;  3G3H A;  4R6H A;  5JTY A;  1B32 A;  4HCW A;  2G93 A;  2PYY A;  1FPK A;  1B1H A;  4XF5 A;  1FQD A;  1MY0 A;  3D4C A;  1Y4C A;  5CMK A;  3EHS A;  2QRY A;  4GX4 A;  4NF5 A;  4BDQ A;  1B58 A;  3QSL A;  3KSJ A;  1B7U A;  2Z23 A;  1EYI A;  1Y1Z A;  3MVY A;  2JJK A;  3TEL A;  3NOH A;  1RKM A;  1JVX A;  1MG1 A;  4X04 A;  4KQP A;  4JXI A;  1URD A;  4NHB A;  1FBC A;  4PET A;  1A8F A;  1FCK A;  1KZ8 A;  3CIJ A;  1Y3N A;  4N15 A;  1NMU A;  4MMP A;  3MZB A;  4GBW A;  2Y5L A;  4MBP A;  3RN8 A;  1FJ9 A;  2RC7 A;  5I56 A;  1PEB A;  3K1M A;  4HTG A;  2UVI A;  1PBQ A;  5H8F A;  1FBH A;  1Y20 A;  3ILT B;  4NN3 A;  4X1D A;  1OMP A;  2QVR A;  3LSX A;  1US4 A;  5I57 A;  1I69 A;  3CVG A;  4H1X A;  2Y7R A;  4NTL A;  4FOR A;  3GLB A;  4U2R A;  2OK2 A;  1UTB A;  4UA8 A;  3IK6 B;  2XXT A;  2XD2 A;  2XXY A;  5B7D A;  3IOR A;  3H6V A;  1B3E A;  3KC1 A;  1IIT A;  3KN3 A;  2I3V A;  3G3K A;  4Z0I A;  4ZEB A;  2WX9 A;  3FV2 A;  3MZ9 A;  2RC9 A;  3RYD A;  4POW A;  4YZZ A;  4JWY A;  4DXB A;  1Y3P A;  4M4G A;  2DXR A;  4MHF A;  3FV1 A;  3ISP A;  1WVJ A;  3S9L C;  2DWI A;  2UYF A;  2UXA A;  1NKX A;  3A29 A;  2ANJ A;  1DPE A;  3ODB A;  3KSX A;  3PV0 E;  4ELP A;  4HE1 A;  1FQE A;  2Z22 A;  1ZKB A;  2V3U A;  2AIX A;  4EF1 A;  4KCC A;  1IMF A;  4YAH X;  3O66 A;  1Y4T A;  1LAH E;  4F39 A;  2RCA A;  5H8N A;  1SI0 A;  3PPP A;  4RJZ A;  4IGT A;  3Q29 A;  3RTW B;  2M8C A;  4PFU A;  3TPA A;  3CG1 A;  3SES A;  2CMO A;  4NF4 A;  2Q89 A;  4H8I A;  1NH8 A;  2E1S A;  2PFY A;  1FPB A;  3KN7 A;  4F2Q A;  1QKA A;  1MQG A;  3LSW A;  1NH7 A;  2BJJ X;  1NFT A;  3E79 A;  4BDN A;  2Q2A A;  3PMV A;  3RPL B;  3UIF A;  3JYR A;  1MY3 A;  1POT A;  3BKI B;  5ITO A;  1B4H A;  4BDL A;  2OZZ A;  2XA5 A;  4GBV A;  2V3Q A;  3MQ9 A;  2F8D A;  3IB2 A;  3I6V A;  1B5I A;  1FPL A;  4JVI A;  5L9M A;  4AB5 A;  1FRP A;  3FD3 A;  1N84 A;  4IR8 A;  4ELQ A;  4FAJ A;  1NNK A;  1AIV A;  4YB6 A;  4YMA A;  1MDP 1;  2WBB A;  3QMF A;  1B5J A;  4OQO A;  1DTZ A;  4GWS A;  3H4Z A;  3BFU A;  1BTJ A;  1AOV A;  3KGC A;  3OOA A;  4F1Y A;  1I6B A;  3IJX B;  1FBD A;  2PBW A;  3IAZ A;  2XXX A;  2HAU A;  2A5T A;  1GV8 A;  5ESY A;  4MX6 A;  2R8T A;  3TMG A;  3EPE A;  3USD A;  2ONK E;  4K3F A;  4PGN A;  3IOU A;  1SD3 A;  2O69 A;  2Z8F A;  4YKK A;  3U94 A;  2CZI A;  1BKA A;  3V83 A;  2F35 A;  1SW4 A;  4WED A;  5J1D A;  4Z7E A;  1FQA A;  5AA4 B;  4JDF A;  4QSD A;  2AYS A;  3PUW E;  3ROJ A;  4LQ2 A;  1I6Q A;  2QPQ A;  2H4I A;  2I49 A;  4Q30 B;  5I58 B;  3HHF A;  2DVC A;  3W15 C;  5H8H A;  2HZK A;  1LBB A;  3IJO B;  2VPN A;  1EZP A;  1QUL A;  1FQF A;  2H98 A;  1IXC A;  1N04 A;  3S9N C;  2GFE A;  5IAI A;  2V3T A;  3GXA A;  4OMB A;  4EQ9 A;  2Q74 A;  4N17 A;  1IXI A;  4F31 B;  4GX6 A;  1LFI A;  4RYA A;  3GBA A;  1Y3Q A;  2DE4 A;  3C32 A;  4U23 A;  4ZZE A;  2H5Y A;  3C9H A;  4OER A;  4N8Y A;  2ZYO A;  3M8U A;  3FXB A;  2HAV A;  4G8M A;  4QFN A;  3HFU A;  5IGA A;  4RA1 A;  2VPO A;  3RUM A;  1XS5 A;  4G4P A;  2HQ0 A;  3ILU B;  2I58 A;  4IO2 A;  3FBP A;  5CRY A;  4GWO A;  3VV5 A;  3TUS A;  3ZSF A;  1D9V A;  3FVK A;  4DI4 B;  4DXU A;  3DLN A;  4MNC A;  5L9O A;  1A55 A;  4G61 A;  3U65 A;  3MBP A;  1DSN A;  2DS9 A;  1M5E A;  2ZYN A;  3WAE A;  3FXU A;  3GBB A;  3K6W A;  5H8S A;  2WBD A;  4X1B A;  2HZL A;  1JEV A;  1MQD A;  4YKI A;  4FAT A;  5BUU A;  3BFT A;  4R74 A;  2Y5K A;  2F7A A;  4MH5 A;  4JWO A;  4IO5 A;  2ZZW A;  4LP2 B;  1IXG A;  1A54 A;  1MY2 A;  4EF2 A;  5JK4 A;  4DLD A;  1SI1 A;  4ZED A;  5TP9 B;  2QSX A;  3HN0 A;  3KBR A;  1B51 A;  1SYI A;  4MNI A;  4NWD A;  4LON B;  4PFR A;  2UVJ A;  3IO4 A;  2O84 X;  4NWC A;  4OVS A;  4DXC A;  3K6U A;  2DOJ A;  3E9X A;  1F9B A;  2XX9 A;  4Q8R A;  3IOT A;  1LAX A;  3TFL A;  4GX3 A;  4PAI A;  1BLF A;  2WYP A;  4I8C A;  4O8M A;  4GWU A;  3O97 A;  3DP4 A;  1SYH A;  2ZZV A;  3W9W A;  1NUW A;  3PPR A;  2HFB A;  4DIG A;  4HXV A;  3W9V A;  3OEK A;  2FHY A;  4QFK A;  4M1V A;  2YPN A;  3MPK A;  2XX8 A;  2PT2 A;  4GOT A;  2DWA A;  3LV0 A;  4G68 C;  4N4U A;  2Y7I A;  1OQG A;  2DVZ A;  1VE4 A;  1JQF A;  5CMC A;  3K6V A;  3MZ1 A;  5EHM A;  4PGP A;  2ZNU A;  3TEP A;  5TPA B;  1P1O A;  5I59 B;  2OJT A;  4I9D A;  2UVH A;  2Y7P A;  4N91 A;  4R2B A;  4P11 A;  4OET A;  3GYY A;  1MXX A;  1JEU A;  2ZYK A;  3LC8 A;  1MM7 A;  1P1U A;  2F7C A;  2XWI A;  1B9J A;  4O7I A;  2FYI A;  1B7H A;  4NF0 A;  3CG3 A;  1NNP A;  2CEX A;  1MQH A;  4ZEF A;  2F78 A;  3V89 B;  4YB7 A;  4ELR A;  5M2V A;  4AQ4 A;  1AWB A;  3OEN A;  3G3G A;  3A3C A;  2FIX A;  5HPQ A;  1ANF A;  4UAB A;  1A40 A;  3CRB A;  4F1U A;  4XTC Q;  3T9X B;  3K01 A;  3U92 A;  1TT1 A;  2O1M A;  3PMW A;  3FIR A;  4X8R A;  4P0I A;  4MIJ A;  2B65 A;  5IZ3 B;  1LFG A;  3H7M A;  2CZH A;  2PFZ A;  2ESN A;  3B6T A;  2KLF A;  3KJ7 A;  1R9L A;  2UVG A;  4PFB A;  1LAF E;  3KN8 A;  3FVN A;  3MC2 A;  3E4R A;  3R6U A;  3VLW A;  4KI0 E;  2O7U A;  2XXQ A;  5JTY B;  2HHM A;  1RYO A;  2XXV A;  3IX1 A;  3IL1 B;  4H45 A;  5AA3 A;  1Q35 A;  4R75 A;  4OZ9 A;  3N94 A;  1FPF A;  4O3B A;  4NF5 B;  1LEV A;  4ESW A;  3F11 A;  4U22 A;  2I6E A;  4PF6 A;  4XIG Q;  2OWT A;  2VHA A;  2OWZ A;  4PAK A;  4GWY A;  4PFI A;  3T9H B;  2W7Y A;  3G3I A;  2DQV A;  1FW0 A;  3TTK A;  1B3G A;  5EHS A;  3JZJ A;  3H6U A;  4JBZ A;  1B7Z A;  1SQY A;  2OBG A;  1LAG E;  4XKN A;  4OVR A;  1MXU A;  4R6Y A;  3RT6 B;  1P1W A;  3SDF A;  1J1N A;  3B50 A;  2Q8J A;  4PAF A;  3KG2 A;  1H44 A;  3KFM A;  5A5L A;  3RNN A;  5KCJ A;  1JNF A;  3MVZ A;  1DOT A;  1S50 A;  2XXI A;  1NI9 A;  4N6K A;  4YB5 A;  5I56 B;  1XHY A;  4GRK A;  3K4U A;  2QMX A;  4YKJ A;  1N7W A;  3TAJ A;  5H8F B;  4I3Y A;  2H99 A;  3A09 A;  1SPI A;  3D4G A;  3TTR A;  5I2N A;  1UTH A;  1FBE A;  2XXK A;  1FTO A;  2F3D A;  4XKP A;  3T66 A;  3RGY A;  5I57 B;  1VFE A;  4LA9 A;  1UTB B;  2P2A A;  2H25 A;  4NF8 A;  1USY H;  2I4B A;  1IMB A;  4GF8 A;  3N26 A;  4BLA A;  3SEU A;  3TCH A;  1XT8 A;  4ND9 A;  1OVT A;  3H6T A;  3TOD A;  2GHB A;  3MUQ A;  2OCU A;  4PTK A;  3O9P A;  1B0L A;  2F3B A;  3B6Q A;  1MXZ A;  5L8D A;  2DYX A;  4OVT A;  2B3B A;  1HSL A;  1FBG A;  3MST A;  2R6G E;  2Y84 A;  4THI A;  1NV5 A;  3K02 A;  2HPG A;  3T9V A;  3KZG A;  3TZA A;  2RC8 A;  3EQ1 A;  5BWJ A;  4G8H A;  4JSO A;  3SZP A;  4EXK A;  1S7Y A;  3HPI A;  4FIM A;  3VVF A;  3K1N A;  3U72 A;  1S9T A;  3LUZ A;  1K9Z A;  4X48 A;  4LZ5 A;  5EQ7 A;  1AH5 A;  2QFL A;  5FTI A;  4YIC A;  1WOD A;  4QBA A;  1UIU A;  1TFD A;  4PCD A;  5FTH A;  4ISU A;  5H8N B;  1D3K A;  2VD2 A;  1IQ7 A;  1P1Q A;  4HCY A;  4TLM B;  1FTA A;  3TTL A;  1LBW A;  3JV9 A;  4NF4 B;  3T22 A;  3Q27 A;  4ZEI A;  2GQ1 A;  1NV7 A;  2HCA A;  3CSG A;  3TQL A;  3C31 A;  2PCR A;  3FJM A;  4YU0 A;  2I48 A;  2PT1 A;  3KOS A;  2GHA A;  4H0W A;  5ET6 A;  1USY E;  4FE8 A;  4NE4 A;  1P1N A;  3O2A A;  1B4Z A;  4NAP A;  1Q9D A;  3RPW A;  2GRV A;  2QMW A;  1NV1 A;  5IKB A;  1YYZ A;  3IOV A;  1LCF A;  3VFJ A;  2XWV A;  4RY1 A;  1IME A;  4F22 A;  1B2H A;  3LSL A;  4TLL B;  3SET A;  3E3K A;  2VOZ A;  2V84 A;  1NL5 A;  3KOT A;  2B3F A;  1US5 A;  3PD9 A;  1I6A A;  1QUK A;  3T9U A;  1O7T A;  1LBV A;  4PBQ A;  5EQA A;  4XFE A;  5AA1 A;  3QUJ A;  2V4C A;  4U4X A;  1QGX A;  2NWJ A;  1Q1K A;  4PBH A;  4BDM A;  4ZEK A;  3EKI A;  4PE5 B;  4IO6 A;  2LAO A;  1MPC A;  3Q28 A;  3AXF A;  1PBP A;  3KEI A;  2A5T B;  1ZTY A;  3PD8 A;  5ET8 A;  4NMY A;  1FQB A;  4HE0 A;  3OO6 A;  5EYG A;  3B6W A;  1LST A;  2E0S A;  4G68 A;  1LBX A;  4G77 A;  1UIV A;  1POY 1;  3U93 A;  1B5H A;  2XD3 A;  3A3U A;  5ET7 A;  4YMB A;  4U21 A;  4H5F A;  3H3G A;  2B4M A;  4AB6 A;  3WAF A;  3IO6 A;  4C0R A;  1YZ0 A;  4RK2 A;  1MH3 A;  4PDD A;  4H67 A;  5H8H B;  4AS5 A;  1IMC A;  2QS3 A;  4PFY A;  3OO8 A;  4HE2 A;  1BIY A;  2IA4 A;  5KDT A;  4F3S A;  4ZDM A;  3OMB A;  5LTC A;  3S2V A;  1FTM A;  3IB0 A;  4PFT A;  4FJP A;  4F3G A;  4ZS9 A;  3PTY A;  3PU5 A;  3TKD A;  1PDA A;  1FSA A;  3QYT A;  4OEV A;  4OVJ A;  2ZXT A;  3PUV E;  1QUJ A;  1DCU A;  4ONY A;  1QKB A;  4P0G A;  3SKP A;  2A5S A;  1TFA A;  4FED A;  2PX1 A;  3OEL A;  5HBC A;  4GWZ A;  1SVX B;  4WEP A;  4P1E A;  2ABH A;  2AL5 A;  4ELO A;  4R6K A;  1O64 A;  1O63 A;  4LZ8 A;  2UYE A;  5DVJ A;  3PPN A;  4ZE9 A;  3CR9 A;  2GH9 A;  4NF6 A;  4BDR A;  3H03 A;  3O29 A;  3FJ7 A;  3MAM A;  4NX1 A;  2B4L A;  1A7L A;  3G7W A;  5ITP A;  5IM2 A;  5F24 A;  2NXO A;  4GVO A;  1UQW A;  4LN5 A;  2FNC A;  3MVX A;  3MVW A;  4IY6 A;  3HV1 A;  2XXH A;  4LVQ A;  4OEU A;  4U4S A;  1IIW A;  3BBR A;  3O6H A;  3DEL B;  4DI3 D;  2VD3 A;  3D1R A;  4KCD A;  4POX A;  3TDJ A;  1RYX A;  2KR0 A;  3UP9 A;  3DM0 A;  1NV4 A;  2Q2C A;  2WYK A;  2XXW A;  3VXC A;  4MEV A;  3UN6 A;  1NUZ A;  3FVG A;  2ONS A;  4MLQ A;  2O1L A;  4MAG A;  4LUB A;  4OYV A;  4F1V A;  4P3L A;  3M3K A;  5I7I A;  2FBP A;  4I3E A;  4JVD A;  5DVI A;  4FBP A;  1R1N A;  3OEM A;  4H8J A;  3BIG A;  3RQT A;  4EQB A;  2NVU B;  5I2K A;  3O6G A;  3P7I A;  3ZS6 A;  1Z7M E;  2I4C A;  1PC3 A;  2Y7W A;  4LAT A;  4OWD A;  2DE3 A;  1ZIU A;  2P1S A;  3PGF A;  1LFH A;  4C1T A;  4GIZ A;  5EYH A;  5CC2 A;  1AL3 A;  1QW0 A;  2RCB A;  1XVY A;  4NQ8 A;  1FTJ A;  2XXR A;  1QVS A;  4OES A;  5DEX A;  4R73 A;  3VLV A;  1IZ1 A;  3KBZ A;  3QK6 A;  3TTM A;  5ICQ A;  4LQ5 A;  2BJI A;  5A5X A;  2HEU A;  1PB9 A;  4I1D A;  2O6A A;  3EHU A;  1B0H A;  4U1Z A;  1N3X A;  4MLV A;  3FJG A;  4DCY A;  2DWH A;  1MS7 A;  1DMB A;  5ICT A;  3K00 A;  1ZU0 A;  2HXR A;  1B05 A;  1AMF A;  4DCX A;  3CI8 A;  4DE8 A;  3RTF B;  4FEB A;  1TWY A;  3QXM A;  2DWJ A;  3FXR A;  2QL3 A;  4QFO A;  3DP8 A;  3THI A;  2DXY A;  3VVE A;  3G3F A;  4O94 A;  3IOW A;  1CNQ A;  1ELJ A;  2VT5 A;  3PUX E;  1FQC A;  2Q8M A;  1SW2 A;  1EZ9 A;  4OEN A;  4LZ7 A;  4MCO A;  1WDN A;  2Z8D A;  5LOM A;  4MNP A;  4N6P A;  3M3F A;  3PPO A;  1XVX A;  4YKP A;  1FPD A;  1NNF A;  3E78 A;  3VDF A;  5IZZ A;  4H65 A;  1MPD A;  3HST A;  1SBP A;  1T0K A;  2D3I A;  5HM4 B;  1RDY A;  1BP5 A;  3TYH A;  4PP0 A;  1NV0 A;  1SDX A;  5EYF A;  3LUY A;  3SER A;  4F18 A;  4H46 A;  2L5V A;  2X7P A;  3N5L A;  1NV2 A;  3PMX A;  2R9J A;  3HO7 A;  3C35 A;  1ZBM A;  4JB7 A;  2CZK A;  3ECR A;  4DDD A;  2ZMB A;  4QRZ A;  4MJO A;  3Q26 A;  5K2Y A;  2XWK A;  1Z7N E;  1FPE A;  3K6X A;  2XXP A;  4JWX A;  4FEC A;  1JP4 A;  3DP6 A;  4AS4 A;  1JW5 A;  3IFA A;  4GFR A;  1N7X A;  1MH4 A;  3IFC A;  3MP6 A;  3RLF E;  1YXI A;  2XWO A;  1B1X A;  2X7Q A;  2DE2 A;  3HHG A;  3SEY A;  3OD7 A;  3T96 B;  4HW8 A;  4GL0 A;  3VVD A;  5KCJ B;  3MJN A;  3PUZ E;  1FTL A;  1N3W A;  4ZE8 A;  3EHT A;  5I3S A;  3K1P A;  4X9T A;  1JVY A;  2QVU A;  1LBZ A;  4P8B A;  2RKM A;  1PB7 A;  1CE2 A;  4R2F A;  5CMB A;  4ZEC A;  2R71 A;  1IEJ A;  5TU0 A;  5LDZ A;  5DVF A;  2Q88 A;  2F36 A;  5I2N B;  1UTH B;  4XKQ A;  4DZ1 A;  3VXB A;  4P56 A;  5CBR A;  3C4M A;  3BIH A;  4QXD A;  3K0V A;  1N76 A;  1RDZ A;  4E0W A;  3FAS A;  3OO7 A;  1CB6 A;  1M5C A;  3LBS A;  3PUY E;  4NF8 B;  4OHN A;  2IEE A;  1EYK A;  3FZV A;  3O28 A;  3G3J A;  2D5W A;  4ZZA A;  4XEQ A;  1LCT A;  5F1Q A;  5IZ1 A;  4P1L A;  3FGS A;  2PVU A;  4BDO A;  4WXJ A;  3T93 B;  4F29 A;  3CFX A;  3B7D A;  4PC9 A;  5I5P A;  3H6W A;  1B6H A;  3R7X A;  3VLU A;  5FHN A;  1LBY A;  2P3V A;  1IMD A;  4N07 A;  1FJ6 A;  4WKM A;  5F7V A;  3L6G A;  4N8G A;  3OO9 A;  3HCQ A;  3MYU A;  5DTB A;  3L6H A;  4EUO A;  4IB2 A;  1FBF A;  3T0J A;  5CMM A;  2REG A;  1B46 A;  1ZMG A;  2FIE A;  4ECF A;  4TOZ A;  1DBZ A;  1FBP A;  1N0T A;  3MP8 A;  4R9F A;  4QSE A;  2ZYM A;  4NG7 A;  5FHO A;  4G8N A;  4KR5 A;  4N13 A;  4NGU A;  4TQU Q;  3K2D A;  2QVV A;  5CM6 A;  4IGR A;  1B3F A;  4KFQ A;  4N81 A;  1DK4 A;  1JET A;  3E13 X;  3M3L A;  1KWH A;  3FAT A;  3RPL A;  1MXY A;  2VP1 A;  1GGG A;  1VFD A;  1HSE A;  1VSO A;  3QAX A;  3UA8 A;  1NNT A;  1B52 A;  2DSF A;  4GWW A;  1LLS A;  3FUZ A;  1BK4 A;  1URG A;  2ZNT A;  3KC0 A;  2HXW A;  2ONR A;  1IXH A;  3MP1 A;  1OQH A;  4R72 A;  2RIN A;  2ZZX A;  3EN3 A;  1NV3 A;  1MXW A;  5K2X A;  1EH3 A;  1ZLQ A;  4F2O A;  1A99 A;  3T1B A; 
#chains in the Genus database with same CATH homology
 2FA7 A;  3UK4 A;  4IO3 A;  4QFL A;  1M5D A;  3H06 B;  4RPN A;  1ATG A;  1MQJ A;  3C33 A;  3SEW A;  4EDP A;  5H8Q A;  1JW1 A;  3ZKK A;  2YLN A;  3RY3 A;  4IO7 A;  2WKY A;  3U8Q A;  5JEI A;  2O51 A;  5H8Q B;  4PQJ A;  1EZO A;  2NOO A;  3QUF A;  5AA4 A;  2QS1 A;  4L17 A;  1LBC A;  4KD5 A;  4KYD A;  4KYS A;  1QJM A;  3TCG A;  2THI A;  4G68 B;  1GR2 A;  5I58 A;  1P99 A;  4F19 A;  3PPQ A;  3S9M C;  1MDQ A;  1JW4 A;  2AL4 A;  3CFZ A;  3O6I A;  2XX7 A;  3OXN A;  1B40 A;  5KDT B;  1B3H A;  4RNS A;  1SW1 A;  4UAC A;  1DTG A;  1Y9U A;  1PB8 A;  3CSB A;  3SEX A;  3CFL A;  3C36 A;  3IB1 A;  3U1O A;  5L9S A;  3MW0 A;  1VR5 A;  2F5X A;  1MY4 A;  4E0X A;  3R26 A;  4EQ7 A;  3RT8 A;  1MPB A;  3ZKL A;  2XHD A;  1D9Y A;  4H5G A;  3TTN A;  1MM6 A;  4GD5 A;  2QS4 A;  2YJP A;  3FVO A;  2QS2 A;  1GVC A;  3S9E A;  1OVB A;  2Y7K A;  1DPP A;  1R6Z A;  1LB9 A;  1A8E A;  1OLA A;  4GLI A;  3ONM A;  5AA2 A;  4XKR A;  2I0B A;  1MQI A;  4U1O A;  3IR1 A;  1YPN A;  2V25 A;  4R9G A;  2VGQ A;  1OLC A;  5CBS A;  4NF6 B;  5AA2 B;  4KPT A;  3OSQ A;  5AE4 A;  5ISU A;  2XXU A;  4OFO A;  4HS7 A;  4KHZ E;  3S4U A;  1H45 A;  2CZL A;  5TP9 A;  1YCJ A;  3EF7 A;  4EXL A;  1YTV A;  3KJT A;  4GXA A;  4GL8 A;  4QFP A;  4RXL A;  1SW5 A;  2OWS A;  2Z8E A;  4Q5T A;  4OXV A;  2F6G A;  1QUI A;  2ALU A;  2F6P A;  4QSC A;  1LGB C;  5FHM A;  2QJE A;  1MY1 A;  2X26 A;  4IO4 A;  4RK9 A;  4ESX A;  4XXU A;  4I62 A;  1EU8 A;  2PMS A;  4QF9 A;  2Q9T A;  4QHQ A;  3VE1 B;  3TCF A;  5DYH A;  3SEV A;  2OLB A;  1YAE A;  1H43 A;  5I2K B;  2ZNS A;  1HSJ A;  2G29 A;  4GQO A;  2V93 A;  3N6U A;  1M5B A;  3UOR A;  3UGW A;  3N6T A;  3Q25 A;  1XC1 A;  3QIM A;  5ELV A;  2F7B A;  4GXS B;  3I5O A;  4NED A;  3C34 A;  3TQW A;  5TPA A;  5DT6 A;  1FTK A;  4MF3 A;  4O3A A;  2DP8 A;  4RPO A;  1TXF A;  3V5A A;  2D21 A;  1Y1M A;  5I59 A;  5DEX B;  5B70 A;  1GTK A;  1M5F A;  5A5X B;  1LB8 A;  4O3C A;  5KZT A;  1II5 A;  2H9B A;  5I84 A;  3LR1 A;  1URS A;  5CI5 A;  1B3L A;  3MPL A;  2F97 A;  3MWB A;  2RF1 A;  4Q0C A;  4F3B A;  4OTE A;  2I0C A;  2O68 A;  1H3D A;  1MXV A;  1R9Q A;  3V8X B;  3GZG A;  4F3P A;  1L5T A;  2REJ A;  3FXQ A;  2F34 A;  4OFJ A;  1IUD A;  1D4N A;  2O7I A;  4G2Z A;  3OSR A;  3LSF B;  4JSD A;  2I3W A;  1H76 A;  1ZJL A;  4KYE A;  1MRP A;  3I3V A;  2P0S A;  4C1U A;  5AA2 D;  4OFL A;  1XOC A;  4MFI A;  2NUV A;  4H6D A;  4IY5 A;  1OIB A;  4PFW A;  3G3H A;  4R6H A;  5JTY A;  1B32 A;  4HCW A;  2G93 A;  2PYY A;  1B1H A;  1FQD A;  1MY0 A;  3D4C A;  1Y4C A;  5CMK A;  3EHS A;  2QRY A;  4NF5 A;  4BDQ A;  1B58 A;  3QSL A;  3KSJ A;  1B7U A;  2Z23 A;  1Y1Z A;  3MVY A;  3TEL A;  1RKM A;  1JVX A;  1MG1 A;  4KQP A;  4JXI A;  1URD A;  4PET A;  1A8F A;  1FCK A;  3CIJ A;  1Y3N A;  1NMU A;  3MZB A;  4MBP A;  3RN8 A;  2RC7 A;  5I56 A;  1PEB A;  3K1M A;  4HTG A;  2UVI A;  1PBQ A;  5H8F A;  1Y20 A;  3ILT B;  4X1D A;  1OMP A;  3LSX A;  1US4 A;  5I57 A;  1I69 A;  3CVG A;  4H1X A;  2Y7R A;  4NTL A;  4FOR A;  3GLB A;  4U2R A;  2OK2 A;  1UTB A;  4UA8 A;  3IK6 B;  2XXT A;  2XD2 A;  2XXY A;  5B7D A;  3IOR A;  3H6V A;  1B3E A;  1IIT A;  3KN3 A;  2I3V A;  3G3K A;  4Z0I A;  4ZEB A;  3FV2 A;  3MZ9 A;  2RC9 A;  4POW A;  4YZZ A;  4JWY A;  4DXB A;  1Y3P A;  4M4G A;  2DXR A;  3FV1 A;  1WVJ A;  3S9L C;  2DWI A;  2UYF A;  2UXA A;  1NKX A;  2ANJ A;  1DPE A;  3ODB A;  3KSX A;  3PV0 E;  4ELP A;  1FQE A;  2Z22 A;  1ZKB A;  2V3U A;  2AIX A;  4EF1 A;  4KCC A;  4YAH X;  3O66 A;  1Y4T A;  1LAH E;  4F39 A;  2RCA A;  5H8N A;  1SI0 A;  3PPP A;  4RJZ A;  4IGT A;  3Q29 A;  3RTW B;  2M8C A;  4PFU A;  3TPA A;  3CG1 A;  3SES A;  2CMO A;  4NF4 A;  2Q89 A;  4H8I A;  1NH8 A;  2E1S A;  3KN7 A;  4F2Q A;  1QKA A;  1MQG A;  3LSW A;  1NH7 A;  2BJJ X;  1NFT A;  4BDN A;  2Q2A A;  3PMV A;  3UIF A;  3JYR A;  1MY3 A;  1POT A;  3BKI B;  5ITO A;  1B4H A;  4BDL A;  2OZZ A;  2V3Q A;  3MQ9 A;  2F8D A;  3IB2 A;  3I6V A;  1B5I A;  5L9M A;  4AB5 A;  3FD3 A;  1N84 A;  4ELQ A;  4FAJ A;  1NNK A;  1AIV A;  4YB6 A;  4YMA A;  1MDP 1;  1B5J A;  4OQO A;  1DTZ A;  3H4Z A;  3BFU A;  1BTJ A;  1AOV A;  3KGC A;  3OOA A;  4F1Y A;  1I6B A;  3IJX B;  2PBW A;  3IAZ A;  2XXX A;  2HAU A;  2A5T A;  1GV8 A;  3TMG A;  3EPE A;  3USD A;  2ONK E;  4K3F A;  3IOU A;  1SD3 A;  2O69 A;  2Z8F A;  4YKK A;  3U94 A;  1BKA A;  3V83 A;  2F35 A;  1SW4 A;  4WED A;  5J1D A;  4Z7E A;  1FQA A;  5AA4 B;  4JDF A;  4QSD A;  2AYS A;  3PUW E;  4LQ2 A;  1I6Q A;  2QPQ A;  2H4I A;  2I49 A;  4Q30 B;  5I58 B;  3HHF A;  2DVC A;  3W15 C;  5H8H A;  2HZK A;  1LBB A;  3IJO B;  1EZP A;  1QUL A;  1FQF A;  2H98 A;  1IXC A;  1N04 A;  3S9N C;  2GFE A;  5IAI A;  2V3T A;  3GXA A;  4OMB A;  4EQ9 A;  1IXI A;  4F31 B;  1LFI A;  4RYA A;  3GBA A;  1Y3Q A;  2DE4 A;  3C32 A;  4U23 A;  4ZZE A;  2H5Y A;  3C9H A;  4OER A;  2ZYO A;  3M8U A;  2HAV A;  4G8M A;  4QFN A;  4RA1 A;  3RUM A;  1XS5 A;  4G4P A;  2HQ0 A;  3ILU B;  2I58 A;  4IO2 A;  5CRY A;  4GWO A;  3VV5 A;  3TUS A;  3ZSF A;  1D9V A;  3FVK A;  4DXU A;  5L9O A;  3DLN A;  1A55 A;  3MBP A;  1DSN A;  2DS9 A;  1M5E A;  2ZYN A;  3WAE A;  3FXU A;  3GBB A;  3K6W A;  5H8S A;  4X1B A;  2HZL A;  1JEV A;  1MQD A;  4YKI A;  4FAT A;  5BUU A;  3BFT A;  4R74 A;  2F7A A;  4MH5 A;  4JWO A;  4IO5 A;  4LP2 B;  1IXG A;  1A54 A;  1MY2 A;  4EF2 A;  5JK4 A;  4DLD A;  1SI1 A;  4ZED A;  5TP9 B;  2QSX A;  3HN0 A;  3KBR A;  1B51 A;  1SYI A;  4NWD A;  4LON B;  2UVJ A;  3IO4 A;  2O84 X;  4NWC A;  4DXC A;  3K6U A;  2DOJ A;  3E9X A;  1F9B A;  2XX9 A;  4Q8R A;  3IOT A;  1LAX A;  3TFL A;  1BLF A;  4I8C A;  3O97 A;  3DP4 A;  1SYH A;  3W9W A;  3PPR A;  2HFB A;  4DIG A;  3W9V A;  3OEK A;  4QFK A;  4M1V A;  2YPN A;  3MPK A;  2XX8 A;  2PT2 A;  4GOT A;  2DWA A;  4G68 C;  2Y7I A;  1OQG A;  2DVZ A;  1VE4 A;  1JQF A;  5CMC A;  3K6V A;  3MZ1 A;  5EHM A;  2ZNU A;  3TEP A;  5TPA B;  1P1O A;  5I59 B;  2OJT A;  4I9D A;  2UVH A;  2Y7P A;  4R2B A;  4P11 A;  4OET A;  1MXX A;  1JEU A;  2ZYK A;  3LC8 A;  1MM7 A;  1P1U A;  2F7C A;  1B9J A;  2FYI A;  1B7H A;  3CG3 A;  1NNP A;  1MQH A;  4ZEF A;  2F78 A;  3V89 B;  4YB7 A;  4ELR A;  5M2V A;  4AQ4 A;  3OEN A;  3G3G A;  3A3C A;  5HPQ A;  1ANF A;  1A40 A;  3CRB A;  4F1U A;  4XTC Q;  3T9X B;  3K01 A;  3U92 A;  1TT1 A;  2O1M A;  3PMW A;  3FIR A;  4P0I A;  2B65 A;  1LFG A;  3H7M A;  2ESN A;  3B6T A;  2KLF A;  3KJ7 A;  1R9L A;  2UVG A;  1LAF E;  3KN8 A;  3FVN A;  3MC2 A;  3E4R A;  3R6U A;  3VLW A;  4KI0 E;  2O7U A;  2XXQ A;  5JTY B;  1RYO A;  2XXV A;  3IX1 A;  3IL1 B;  5AA3 A;  1Q35 A;  4R75 A;  4OZ9 A;  3N94 A;  4O3B A;  4NF5 B;  4ESW A;  3F11 A;  4U22 A;  2I6E A;  4XIG Q;  2OWT A;  2VHA A;  3T9H B;  2W7Y A;  3G3I A;  2DQV A;  1FW0 A;  3TTK A;  1B3G A;  5EHS A;  3JZJ A;  3H6U A;  4JBZ A;  1B7Z A;  1SQY A;  2OBG A;  1LAG E;  4XKN A;  1MXU A;  4R6Y A;  3RT6 B;  1P1W A;  3SDF A;  1J1N A;  2Q8J A;  3KG2 A;  1H44 A;  3KFM A;  3RNN A;  5KCJ A;  1JNF A;  3MVZ A;  1DOT A;  1S50 A;  2XXI A;  4YB5 A;  5I56 B;  1XHY A;  4GRK A;  3K4U A;  2QMX A;  4YKJ A;  1N7W A;  3TAJ A;  5H8F B;  2H99 A;  3A09 A;  3D4G A;  3TTR A;  5I2N A;  1UTH A;  1FTO A;  4XKP A;  3T66 A;  3RGY A;  5I57 B;  1VFE A;  4LA9 A;  1UTB B;  2P2A A;  2H25 A;  4NF8 A;  1USY H;  2I4B A;  4GF8 A;  3N26 A;  4BLA A;  3SEU A;  3TCH A;  1XT8 A;  4ND9 A;  1OVT A;  3H6T A;  3TOD A;  2GHB A;  3MUQ A;  2OCU A;  3O9P A;  1B0L A;  3B6Q A;  1MXZ A;  5L8D A;  2DYX A;  2B3B A;  1HSL A;  2R6G E;  2Y84 A;  4THI A;  3K02 A;  3T9V A;  3KZG A;  3TZA A;  2RC8 A;  3EQ1 A;  5BWJ A;  4G8H A;  4JSO A;  4EXK A;  1S7Y A;  3HPI A;  4FIM A;  3VVF A;  3K1N A;  3U72 A;  1S9T A;  4X48 A;  4LZ5 A;  1AH5 A;  5FTI A;  4YIC A;  1WOD A;  1UIU A;  1TFD A;  5FTH A;  4ISU A;  5H8N B;  1D3K A;  2VD2 A;  1IQ7 A;  1P1Q A;  4HCY A;  4TLM B;  3TTL A;  3JV9 A;  4NF4 B;  3T22 A;  3Q27 A;  4ZEI A;  2HCA A;  3CSG A;  3TQL A;  3C31 A;  3FJM A;  4YU0 A;  2I48 A;  2PT1 A;  3KOS A;  2GHA A;  4H0W A;  1USY E;  4FE8 A;  4NE4 A;  1P1N A;  3O2A A;  1B4Z A;  3RPW A;  2GRV A;  2QMW A;  5IKB A;  3IOV A;  1LCF A;  3VFJ A;  4RY1 A;  4F22 A;  1B2H A;  3LSL A;  4TLL B;  3SET A;  3E3K A;  2VOZ A;  2V84 A;  1NL5 A;  3KOT A;  2B3F A;  1US5 A;  3PD9 A;  1I6A A;  1QUK A;  3T9U A;  1O7T A;  5AA1 A;  3QUJ A;  4U4X A;  2NWJ A;  1Q1K A;  4BDM A;  4ZEK A;  4PE5 B;  4IO6 A;  2LAO A;  1MPC A;  3Q28 A;  3AXF A;  1PBP A;  3KEI A;  2A5T B;  1ZTY A;  3PD8 A;  4NMY A;  1FQB A;  3OO6 A;  3B6W A;  1LST A;  2E0S A;  4G68 A;  4G77 A;  1UIV A;  1POY 1;  3U93 A;  1B5H A;  2XD3 A;  3A3U A;  4YMB A;  4U21 A;  4H5F A;  3H3G A;  4AB6 A;  3WAF A;  3IO6 A;  4C0R A;  4RK2 A;  1MH3 A;  4H67 A;  5H8H B;  2QS3 A;  4PFY A;  3OO8 A;  1BIY A;  2IA4 A;  5KDT A;  4F3S A;  4ZDM A;  3OMB A;  3S2V A;  1FTM A;  3IB0 A;  4PFT A;  4FJP A;  4F3G A;  4ZS9 A;  3TKD A;  3PU5 A;  1PDA A;  3QYT A;  4OEV A;  4OVJ A;  2ZXT A;  3PUV E;  1QUJ A;  4ONY A;  1QKB A;  4P0G A;  3SKP A;  2A5S A;  1TFA A;  4FED A;  2PX1 A;  3OEL A;  5HBC A;  1SVX B;  4WEP A;  2ABH A;  2AL5 A;  4ELO A;  4R6K A;  1O64 A;  1O63 A;  4LZ8 A;  2UYE A;  5DVJ A;  3PPN A;  4ZE9 A;  3CR9 A;  2GH9 A;  4NF6 A;  4BDR A;  3H03 A;  3O29 A;  3FJ7 A;  3MAM A;  1A7L A;  3G7W A;  5ITP A;  2NXO A;  4GVO A;  1UQW A;  2FNC A;  3MVX A;  3MVW A;  4IY6 A;  3HV1 A;  2XXH A;  4LVQ A;  4OEU A;  4U4S A;  1IIW A;  3BBR A;  3O6H A;  3DEL B;  2VD3 A;  4KCD A;  4POX A;  3TDJ A;  1RYX A;  3UP9 A;  3DM0 A;  2Q2C A;  2XXW A;  3VXC A;  3UN6 A;  3FVG A;  2ONS A;  4MLQ A;  2O1L A;  4LUB A;  4OYV A;  4F1V A;  3M3K A;  5DVI A;  1R1N A;  3OEM A;  4H8J A;  3RQT A;  4EQB A;  2NVU B;  5I2K A;  3O6G A;  3P7I A;  3ZS6 A;  1Z7M E;  2I4C A;  1PC3 A;  2Y7W A;  4LAT A;  4OWD A;  2DE3 A;  1ZIU A;  2P1S A;  3PGF A;  1LFH A;  4C1T A;  4GIZ A;  5CC2 A;  1AL3 A;  1QW0 A;  2RCB A;  1XVY A;  1FTJ A;  2XXR A;  1QVS A;  4OES A;  5DEX A;  4R73 A;  3VLV A;  1IZ1 A;  3QK6 A;  3TTM A;  5ICQ A;  4LQ5 A;  5A5X A;  2HEU A;  1PB9 A;  4I1D A;  2O6A A;  3EHU A;  1B0H A;  4U1Z A;  1N3X A;  4MLV A;  3FJG A;  4DCY A;  2DWH A;  1MS7 A;  1DMB A;  5ICT A;  3K00 A;  1ZU0 A;  1B05 A;  1AMF A;  4DCX A;  3CI8 A;  4DE8 A;  3RTF B;  4FEB A;  1TWY A;  3QXM A;  2DWJ A;  3FXR A;  2QL3 A;  4QFO A;  3DP8 A;  3THI A;  2DXY A;  3VVE A;  3G3F A;  3IOW A;  1ELJ A;  3PUX E;  1FQC A;  1SW2 A;  1EZ9 A;  4OEN A;  4LZ7 A;  1WDN A;  2Z8D A;  5LOM A;  4N6P A;  3M3F A;  3PPO A;  1XVX A;  4YKP A;  1NNF A;  3VDF A;  4H65 A;  1MPD A;  3HST A;  1SBP A;  1T0K A;  2D3I A;  5HM4 B;  1BP5 A;  3TYH A;  4PP0 A;  1SDX A;  5EYF A;  3LUY A;  3SER A;  4F18 A;  2X7P A;  3N5L A;  3PMX A;  2R9J A;  3HO7 A;  3C35 A;  1ZBM A;  4JB7 A;  3ECR A;  4DDD A;  2ZMB A;  4QRZ A;  3Q26 A;  5K2Y A;  1Z7N E;  3K6X A;  2XXP A;  4JWX A;  4FEC A;  3DP6 A;  1JW5 A;  4GFR A;  1N7X A;  1MH4 A;  3MP6 A;  3RLF E;  1B1X A;  2X7Q A;  2DE2 A;  3HHG A;  3SEY A;  3OD7 A;  3T96 B;  4HW8 A;  4GL0 A;  3VVD A;  5KCJ B;  3MJN A;  3PUZ E;  1FTL A;  1N3W A;  4ZE8 A;  3EHT A;  3K1P A;  4X9T A;  1JVY A;  2RKM A;  1PB7 A;  1CE2 A;  5CMB A;  4ZEC A;  4R2F A;  2R71 A;  1IEJ A;  5TU0 A;  5DVF A;  2Q88 A;  2F36 A;  5I2N B;  1UTH B;  4XKQ A;  4DZ1 A;  3VXB A;  5CBR A;  3C4M A;  3K0V A;  1N76 A;  4E0W A;  3FAS A;  3OO7 A;  1CB6 A;  1M5C A;  3LBS A;  3PUY E;  4NF8 B;  4OHN A;  2IEE A;  3FZV A;  3O28 A;  3G3J A;  2D5W A;  4ZZA A;  1LCT A;  5F1Q A;  3FGS A;  2PVU A;  4BDO A;  4WXJ A;  3T93 B;  4F29 A;  3CFX A;  3B7D A;  3H6W A;  1B6H A;  3R7X A;  3VLU A;  5FHN A;  4N07 A;  4WKM A;  5F7V A;  3L6G A;  3OO9 A;  3HCQ A;  5DTB A;  3L6H A;  4EUO A;  4IB2 A;  5CMM A;  2REG A;  1B46 A;  1ZMG A;  4ECF A;  4TOZ A;  1N0T A;  3MP8 A;  4R9F A;  4QSE A;  2ZYM A;  5FHO A;  4G8N A;  4KR5 A;  4N13 A;  4TQU Q;  3K2D A;  5CM6 A;  4IGR A;  1B3F A;  4KFQ A;  1JET A;  3E13 X;  3M3L A;  1KWH A;  3FAT A;  1MXY A;  2VP1 A;  1GGG A;  1VFD A;  1HSE A;  1VSO A;  3QAX A;  3UA8 A;  1NNT A;  1B52 A;  2DSF A;  1LLS A;  3FUZ A;  1URG A;  2ZNT A;  2HXW A;  2ONR A;  1IXH A;  3MP1 A;  1OQH A;  4R72 A;  2RIN A;  3EN3 A;  1MXW A;  5K2X A;  1EH3 A;  1ZLQ A;  4F2O A;  1A99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...