3VVEA

Crystal structure of ttc0807 complexed with lysine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
241
structure length
241
Chain Sequence
GGSEFQVRSFEEIKRSGEIRIGTEGAFPPFNYFDERNQLTGFEVDLGNAIAERLGLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGGPRTAKDLQGKVVGVQVGTTYMEAAQKIPGIKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKLENTLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two ATP-Binding Cassette Transporters Involved in (S)-2-Aminoethyl-Cysteine Uptake in Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, binding protein
total genus 88
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vveA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vveA02
1OLAA 4IY6A 2OK2A 2O1LA 3L6HA 3FJ7A 4GLIA 4EXKA 5JK4A 1DPPA 4WKMA 5L8DA 3USDA 3E3KA 2H9BA 3G3GA 4R75A 2XXYA 4DLDA 3CFZA 3D4GA 1MM7A 3H6UA 4U23A 1Y1ZA 1MDQA 4YB6A 3RUMA 5L9SA 1IITA 1AMFA 1LAHE 1YPNA 5CMCA 4TQUQ 4QSCA 3PD8A 1P99A 3RGYA 1IQ7A 1USYE 2YPNA 1UTBA 3H4ZA 3MJNA 1H45A 3QIMA 4G68C 1MS7A 3OO8A 1WODA 3SKPA 1R1NA 3UIFA 2XXWA 3B7DA 4QRZA 1DOTA 3OENA 1IIWA 1ZLQA 2DE3A 3CG3A 1FTKA 1MXXA 3IO6A 1N3WA 3M8UA 3MZ1A 3PUXE 2WKYA 2F35A 3GLBA 3OOAA 4ESWA 2V84A 1MXZA 1MXYA 1LFIA 3T9XB 2ZNSA 1NNTA 2HEUA 3PMXA 3K01A 5HPQA 2VD2A 3TTRA 3N6UA 1QW0A 3FATA 4POWA 4R2BA 3RNNA 2UVJA 4HW8A 3HHFA 1ANFA 5CRYA 3KGCA 3TCFA 1MQDA 3ILUB 2NWJA 3C9HA 1Y1MA 3M3KA 1B3FA 2O84X 3M3LA 1PB8A 1DTGA 2YLNA 3IB1A 4GQOA 1B4HA 4LZ8A 2E0SA 1H76A 3ILTB 4ELOA 5AE4A 2I48A 2Y7RA 2I49A 2F8DA 4JXIA 4JWYA 4EUOA 4LVQA 2E1SA 1MQHA 3FJMA 3I5OA 4WEDA 4IO2A 1TT1A 1USYH 1WDNA 3PV0E 4IO5A 4JBZA 4DCXA 4F1UA 5A5XA 3ECRA 1MXUA 3R26A 5AA3A 4JWOA 2QRYA 4K3FA 4OYVA 2AIXA 4NF5A 5AA1A 4C0RA 4RJZA 4BDLA 3K00A 3DP8A 1ZTYA 2RCBA 3U8QA 4R2FA 1FQEA 2Q2CA 4BDQA 3S9MC 1VR5A 4NWCA 4QFPA 2ZNTA 3SDFA 2P2AA 3EHTA 4KI0E 3T66A 1D3KA 3IO4A 3L6GA 4FEBA 3DELB 1MM6A 4YAHX 1I69A 2QS2A 3TQLA 3FVKA 3IL1B 1B0HA 4R6KA 4NE4A 2OZZA 4MF3A 5BUUA 2DE2A 4F19A 5ISUA 1H3DA 2ALUA 1Z7ME 3FJGA 3LR1A 4I8CA 4GWOA 2RCAA 4R72A 3IAZA 4KQPA 4YZZA 1IXGA 1MPDA 3JZJA 4YMAA 5KCJA 4N6PA 5ITOA 4PFYA 2XXHA 3I3VA 1B58A 2XXTA 1BTJA 1MPBA 1MY1A 1B32A 3KEIA 5KCJB 5I57B 5DEXB 5CMKA 3QXMA 2O7UA 3GXAA 4RK9A 2DXYA 4U21A 3G7WA 3FV2A 2I3WA 4EQBA 1ZMGA 4PE5B 3S9LC 1JEUA 3TDJA 1XT8A 1OQHA 2ZYNA 4X1DA 3SEYA 2CMOA 4ZZEA 2I4CA 1B51A 5DVJA 1A54A 2PBWA 3VLUA 2PT2A 3ZKLA 3M3FA 1FQBA 1O7TA 3O6GA 1AOVA 1F9BA 1ZU0A 2R6GE 5CBRA 1LFHA 1NNKA 1URDA 4I1DA 4KR5A 5K2YA 4OXVA 4GXSB 4U4SA 4ELRA 3KSXA 4JSOA 1Q35A 4X9TA 1UTHA 4NF5B 5AA2A 3W9WA 4X1BA 4THIA 1LSTA 1N76A 4YU0A 4ECFA 1SDXA 3T22A 3QAXA 4NF8B 4YB7A 1UTBB 2W7YA 4U1OA 1Y20A 2ESNA 3TZAA 3V5AA 5CMBA 3MQ9A 1Y9UA 2Y7PA 2DVZA 3FVOA 4GFRA 3FXQA 1HSJA 3TPAA 3VVFA 4H5GA 5I2KA 3FV1A 3IOVA 4H1XA 4OEVA 1B7ZA 2I4BA 5AA2D 3OO6A 1B3GA 2DWHA 1PBQA 3ZSFA 5AA2B 3Q26A 2ONSA 3O28A 3H7MA 4DXUA 3TTLA 1POY1 4LP2B 1POTA 4AB6A 2IEEA 2OCUA 3K02A 4H8IA 1IEJA 3C31A 2ZXTA 2PX1A 4F3BA 3JYRA 4FATA 3MVYA 1SBPA 2PMSA 4IO3A 2NVUB 1JW1A 3U92A 2QS3A 3H6WA 1JVYA 3C34A 4QF9A 4UACA 3CVGA 1MH4A 3W9VA 4YKPA 1A8EA 1Y4TA 4ZEBA 3EPEA 3O6HA 2XX9A 1FQDA 1QJMA 3K6UA 4JWXA 4XTCQ 5K2XA 2GHAA 3S4UA 4F31B 1LFGA 1Q1KA 1WVJA 2QPQA 2VP1A 3G3KA 3TELA 1TFAA 3FGSA 3FXRA 4IGRA 2O7IA 3A09A 4GVOA 4HS7A 3HO7A 2DXRA 3VDFA 2HCAA 4F3SA 1XHYA 2REGA 3A3UA 5DEXA 5CBSA 4PFUA 3R6UA 1TFDA 2I3VA 3V8XB 1FTOA 1N7XA 3HV1A 4GRKA 4MLQA 4XIGQ 5ELVA 5L9MA 1IXCA 4TLLB 1M5BA 1N3XA 1Z7NE 3FZVA 4G2ZA 4NWDA 2KLFA 2I58A 1DTZA 2GHBA 2F97A 4H8JA 4FAJA 3ZS6A 1S9TA 3MC2A 4N07A 5H8HA 1MXVA 3K1MA 4G68B 3P7IA 2B3FA 3TCGA 3SEWA 4EF1A 4F3PA 1QULA 5HM4B 1MY0A 4G77A 3W15C 4ELQA 4HTGA 4O3AA 3MPKA 1VE4A 3SEVA 2G93A 2Z22A 3IOWA 3F11A 3KN3A 5H8NB 2O69A 3OEKA 1Y4CA 2Q9TA 3T93B 4KYSA 3SEUA 3TEPA 2AYSA 3TQWA 3THIA 1OIBA 5H8NA 1ATGA 1EZOA 4HCWA 3TODA 3CFXA 1MY3A 1RYOA 1D4NA 1B3LA 1R9QA 1FQFA 4DCYA 5A5XB 1PC3A 1LBBA 3ZKKA 3FIRA 1JEVA 4YKKA 2CZLA 2R9JA 2GRVA 3Q29A 1D9VA 4KHZE 4M1VA 1BKAA 1AL3A 4O3BA 4OMBA 3PGFA 4IB2A 4TLMB 5TP9B 5IAIA 4BLAA 5I56B 3PPPA 5F1QA 5FHMA 4YB5A 2D5WA 1MG1A 4TOZA 1JETA 2B65A 4ZE8A 4X48A 4DZ1A 1YCJA 4UA8A 3GBAA 5FTHA 4GOTA 3Q27A 4NF4A 1J1NA 4MH5A 2XXPA 4ZEFA 3OSRA 3OO9A 1LAFE 1KWHA 1UIVA 3DM0A 1IUDA 3IOTA 4P11A 3KBRA 4OHNA 5JEIA 2XXQA 1SD3A 2FYIA 3T9HB 2AL4A 4C1TA 4EF2A 2O6AA 4XKQA 1QKBA 2PT1A 4PETA 4PFWA 3IR1A 5CI5A 4ONYA 2QJEA 1FCKA 2Z8FA 3C35A 5TP9A 1MDP1 1O64A 3OSQA 5DTBA 5EYFA 1JW5A 3RQTA 4F29A 4RPOA 3PMVA 3SEXA 1CB6A 3LSFB 3HHGA 3U1OA 3PUYE 2Y7KA 4ZZAA 2QSXA 5I2NA 2F34A 2XXVA 4OFOA 3HPIA 5H8SA 1JW4A 2DQVA 5KDTA 1ZIUA 3IJXB 3KZGA 1EU8A 3SESA 1PEBA 1XVYA 1A7LA 1SI1A 2RC9A 3IX1A 1GTKA 3QSLA 4NTLA 4R6YA 1OLCA 4R6HA 4ZEDA 1N04A 5L9OA 3HCQA 2HXWA 1B4ZA 3E9XA 4NF6A 4XKNA 5I2KB 3I6VA 3O97A 1MQGA 2F7BA 2HAUA 2O1MA 3UA8A 3UGWA 3GBBA 2IA4A 1IXHA 2I6EA 4OEUA 4F1YA 3RN8A 2UXAA 4QFKA 3SETA 4E0XA 2XHDA 3UK4A 3V83A 1VSOA 4O3CA 1B6HA 4YICA 3LSXA 3KSJA 5AA4A 5ITPA 1ZJLA 2H4IA 2V3TA 2O68A 1A55A 3BFUA 4I62A 4Q5TA 3MW0A 1YTVA 1T0KA 3H03A 2VGQA 2ABHA 3MPLA 4GF8A 1VFDA 3OD7A 3BBRA 4XKRA 3TFLA 3V89B 4Z0IA 1US4A 4KCDA 3IB0A 5H8QB 3CRBA 2DS9A 3N26A 4QHQA 4U4XA 2ANJA 1QUKA 3FD3A 2ZYMA 4YKIA 3TUSA 3TCHA 3K2DA 1A40A 1I6BA 2XXIA 4PQJA 4G8HA 4WEPA 3G3JA 4FECA 4ZEIA 4IGTA 4GXAA 4KYEA 3TTKA 4N13A 2ZMBA 3IB2A 2YJPA 4RA1A 1B05A 4JB7A 5I59A 1URGA 3MWBA 4IO4A 3UP9A 2XD2A 2VHAA 3C4MA 1YAEA 1ZKBA 3U94A 3MP6A 5I59B 4ZDMA 1M5DA 2GFEA 3AXFA 3G3IA 3MZ9A 4BDMA 1GGGA 5M2VA 4R9FA 1FQAA 1ZBMA 1RYXA 4JSDA 4U1ZA 1UQWA 3CI8A 1GV8A 3RLFE 4EXLA 3LBSA 3G3FA 3MBPA 1JQFA 4U22A 1SQYA 4H67A 4QFNA 4F1VA 2G29A 3LC8A 4P0IA 3K6VA 4G8NA 1FTJA 1B5HA 2Q2AA 2F6GA 4OTEA 5I56A 3O9PA 2DWJA 5HBCA 4E0WA 3KFMA 2F6PA 1LGBC 1B3EA 1LLSA 3IOUA 2Q8JA 3QUFA 4OERA 3CIJA 4F3GA 2P1SA 3O66A 3UORA 4ZECA 1SW5A 1URSA 2VOZA 3FVNA 1M5CA 1PB9A 3E13X 3PPOA 5DVFA 5H8HB 2RINA 4RK2A 2X7PA 4QSEA 4LA9A 5FHNA 3LUYA 2THIA 4G68A 3N6TA 3G3HA 4F18A 1DPEA 5FHOA 5DVIA 3T96B 3FUZA 4KFQA 4F2OA 3KN7A 4R9GA 4QFLA 2Z8EA 3MVWA 4BDNA 4LONB 4KPTA 4H6DA 1UIUA 3GZGA 1UTHB 3MVXA 5I84A 1MQJA 1NH7A 2QL3A 3UN6A 1NFTA 4KCCA 5AA4B 2R71A 3S9EA 1DMBA 1XOCA 2HQ0A 3KG2A 3PUVE 2DOJA 4H65A 4DDDA 2V93A 4POXA 4OESA 2DVCA 1EZ9A 1LCFA 1MY4A 2UYEA 4FORA 3MVZA 1PB7A 3QYTA 4NF4B 4OFJA 1EZPA 2Q89A 1MRPA 1P1WA 3KOSA 3S9NC 1N0TA 2OWTA 3CG1A 1B3HA 1MH3A 2FA7A 1M5EA 1B1HA 1NL5A 4NF6B 1LB8A 5B70A 3K4UA 5F7VA 2ZYKA 2VD3A 3R7XA 3PPRA 2Y84A 4RPNA 2D3IA 3E4RA 2RKMA 3EHUA 2DE4A 3EQ1A 2NOOA 3VXCA 3WAFA 2Y7IA 3TAJA 3CSBA 1BLFA 2OBGA 1B0LA 2HZLA 2UVGA 4F2QA 2H25A 4G8MA 4F39A 4DIGA 5I57A 2DP8A 4ZS9A 5TU0A 1TXFA 2UYFA 2H99A 3K1PA 3Q25A 4H5FA 1P1QA 4OQOA 3QK6A 1B5IA 2B3BA 1XS5A 1MPCA 2F7AA 4IY5A 3OXNA 3KN8A 4LZ5A 5KDTB 2NUVA 2QS4A 5B7DA 1B40A 1B7UA 1H44A 1OVBA 1JNFA 1S7YA 2AL5A 4M4GA 4MBPA 4OFLA 1RKMA 2XX8A 3SERA 2A5SA 3TMGA 3TTNA 5BWJA 2OJTA 4YKJA 1MY2A 3CSGA 5CMMA 1AH5A 2F5XA 3IORA 3VV5A 2QS1A 3EF7A 3C36A 4EQ9A 4ESXA 3B6QA 2F36A 1QVSA 1B5JA 2OLBA 3EHSA 2F78A 3H3GA 3O6IA 3MZBA 4Q0CA 2QMXA 3TTMA 4BDRA 1CE2A 5LOMA 2OWSA 1Y3QA 3MP1A 3T9UA 3PD9A 4MFIA 3PUWE 1NMUA 4RY1A 3VVDA 4QSDA 4OZ9A 4PFTA 3N94A 4R74A 4RNSA 5EHMA 1I6QA 3TYHA 1LAGE 5EHSA 3VLWA 1OVTA 3TKDA 3O2AA 1P1UA 1SW1A 1D9YA 4WXJA 4XXUA 1XC1A 1SVXB 1SYHA 4LUBA 3EN3A 1SW4A 3C33A 3O29A 3OEMA 4U2RA 1HSEA 2F7CA 1MXWA 4GL0A 5TPAA 3RY3A 3HN0A 4LATA 4IO7A 4ZEKA 3T9VA 4PP0A 4EDPA 1SI0A 3K6WA 3DP4A 1B52A 1O63A 3CR9A 1AIVA 5CM6A 1A99A 3U93A 3N5LA 3KJTA 2V3UA 3LSLA 1R9LA 4XKPA 3B6WA 2PVUA 1QKAA 1TWYA 1GVCA 1IZ1A 2RC8A 5IKBA 1FTMA 2V3QA 2Z8DA 2LAOA 1OMPA 2H5YA 2XXRA 3PU5A 3KJ7A 2DWAA 1R6ZA 1Y3PA 2UVIA 5H8QA 5JTYB 4EQ7A 4ELPA 3B6TA 1BP5A 3Q28A 2V25A 3VLVA 4GL8A 1MQIA 4LZ7A 5FTIA 2Q88A 4LQ2A 4ND9A 3CFLA 5TPAB 1FW0A 4DXCA 3A3CA 5JTYA 2PYYA 3D4CA 3IJOB 2UVHA 4G4PA 4F22A 1N7WA 4RYAA 2ONRA 3C32A 3MP8A 4BDOA 3RTWB 5H8FA 4Q8RA 1FTLA 1LBCA 1NKXA 1BIYA 3JV9A 1L5TA 5DYHA 3U72A 2NXOA 3WAEA 2ONKE 2XXXA 1HSLA 1N84A 2P0SA 3IK6B 1B9JA 4OETA 3OO7A 5J1DA 2Z23A 5I58A 1S50A 2A5TB 1Y3NA 2M8CA 4FIMA 4MLVA 5CC2A 3VVEA 1GR2A 1SW2A 2A5TA 3QUJA 4JDFA 3K0VA 1SYIA 1NNFA 2DSFA 3PPNA 4DXBA 3OMBA 1LB9A 2XX7A 2XXUA 4LQ5A 1IXIA 3FXUA 4FEDA 4NEDA 2XD3A 5ICTA 4P0GA 1QUJA 3FASA 4C1UA 1II5A 2HAVA 1B1XA 3BKIB 3ODBA 1P1OA 4OENA 5I2NB 1M5FA 4DE8A 3MUQA 3HSTA 3LSWA 3RT8A 2GH9A 1B46A 1OQGA 4H0WA 1NNPA 3MAMA 3PPQA 3ONMA 3PMWA 1P1NA 1QUIA 3PUZE 4ISUA 3H6TA 4GIZA 4I9DA 4OVJA 4R73A 1XVXA 4OWDA 4AB5A 4Z7EA 1LAXA 2ZYOA 1PDAA 3VXBA 5KZTA 3BFTA 2RC7A 2Y7WA 1PBPA 2HZKA 2D21A 1FQCA 2HFBA 1I6AA 1LCTA 3S2VA 2X26A 3H6VA 4KYDA 3VE1B 2O51A 4YMBA 3VFJA 3DP6A 3FVGA 4NF8A 4NMYA 3KOTA 3H06B 5H8FB 4ZE9A 2BJJX 1A8FA 1JVXA 5ICQA 1ELJA 3K6XA 2FNCA 2X7QA 4FJPA 2I0BA 2RF1A 4QFOA 2DWIA 3RT6B 3K1NA 4IO6A 1B7HA 5I58B 2ZNUA 1DSNA 4FE8A 3DLNA 4KD5A 4AQ4A 3OELA 2DYXA 2I0CA 1H43A 2REJA 4GD5A 4HCYA 1US5A 1B2HA 2H98A 2QMWA 4L17A 1VFEA 4Q30B 5DT6A 3RPWA 3RTFB 1EH3A 1NH8A 4RXLA
chains in the Genus database with same CATH superfamily
4AS5A 3G3GA 4R75A 3H6UA 1MM7A 5IM2A 4U23A 1YPNA 5CMCA 4TQUQ 3PD8A 1IQ7A 1H45A 4G68C 1MS7A 1WODA 1R1NA 1DOTA 1ZLQA 3WAFA 3GLBA 3OOAA 2MKZA 3T9XB 2PCRA 2UVJA 2VT5A 3KGCA 2NWJA 1Y1MA 2I49A 2F8DA 4EUOA 2E1SA 1MQHA 3I5OA 1TT1A 4DCXA 3PV0E 4JBZA 5IZZA 4JWOA 4K3FA 4OVTA 4NF5A 4RJZA 1FBHA 2VPOA 3S9MC 4BDQA 4OA4A 3IO4A 3L6GA 1MM6A 1I69A 4MF3A 1Z7ME 3LR1A 4PFYA 3KEIA 5I57B 1IMEA 4RK9A 2QVRA 2I3WA 4EQBA 1ZMGA 1XI6A 3SEYA 2Q74A 2P3VA 1B51A 4PGPA 2PBWA 1K9YA 1NNKA 4I1DA 2WBBA 4X9TA 1UTHA 3W9WA 4X1BA 3HFUA 1N76A 2WX9A 3FVOA 5I2KA 3VVFA 4GWWA 3IOVA 1NI9A 1B7ZA 3ZSFA 4NF0A 1RDXA 1NV6A 4H8IA 3C31A 3JYRA 1JVYA 3C34A 3NOHA 4YKPA 4ZEBA 3EPEA 1QJMA 3K6UA 3S4UA 2XXKA 3G3KA 2QPQA 4IGRA 1D9QA 3R6UA 4GRKA 3HV1A 4TLLB 1AWBA 4G2ZA 4NWDA 2KLFA 3MC2A 2B3FA 4EF1A 3W15C 4HTGA 2HPGA 4O3AA 3SEVA 3U65A 5H8NA 4PFIA 3KBZA 1R9QA 2CZKA 4OMBA 2L5VA 3UORA 4I3EA 1BKAA 5IAIA 4TLMB 5FHMA 4YB5A 1MG1A 2B65A 4ZE8A 4DZ1A 3GBAA 4FBPA 3Q27A 1FPIA 1LAFE 5EQ7A 1UIVA 4OHNA 3RYDA 1QKBA 4OVQA 4PFWA 2QJEA 5TP9A 1MDP1 3OSQA 1JW5A 4F29A 3SEXA 3LSFB 4NN3A 2F34A 3HPIA 5H8SA 4GX4A 5KDTA 1ZIUA 1EU8A 3SESA 4NTLA 4R6YA 3QSLA 1OLCA 5L9OA 1N04A 3HCQA 5I2KB 1MQGA 2F7BA 2HAUA 2IA4A 2I6EA 4OEUA 4E0XA 2XHDA 4O3CA 1B6HA 4YICA 3LSXA 5AA4A 4PGNA 1A55A 3MPLA 4GF8A 3OD7A 3V89B 4PAFA 3IB0A 5H8QB 3K2DA 2XXIA 4G8HA 4ZEIA 3TTKA 5EQAA 2VHAA 1M5DA 3G3IA 4U1ZA 1UQWA 3LBSA 4U22A 1SQYA 2HXRA 4QFNA 3K6VA 1B5HA 4OTEA 4H45A 5I56A 2F6PA 3MSTA 1LLSA 4XEQA 3QUFA 1SW5A 5DVFA 4RK2A 1DCUA 3LUYA 3N6TA 3G3HA 2ZZWA 3FUZA 4QFLA 4H6DA 5I84A 1MQJA 5AA4B 1XOCA 2HQ0A 5T3JA 1EZ9A 1LCFA 1MY4A 1NUWA 1PB7A 4QBAA 1B3HA 1LB8A 5F7VA 3ROJA 3TTLA 3PPRA 2Y84A 3EHUA 2NOOA 4O7MA 2OBGA 2H25A 4N4UA 4ZS9A 1XS5A 2F7AA 3OXNA 5KDTB 1B40A 1H44A 1OVBA 2AL5A 4OFLA 1RKMA 2A5SA 3TMGA 4YKJA 2DDKA 3VV5A 4EQ9A 1FBCA 4ESXA 2QS1A 3EF7A 3C36A 2OLBA 3H3GA 3TTMA 3MZBA 4BDRA 3MP1A 4JVIA 3PD9A 4QSDA 3N94A 4I40A 3O2AA 1SW1A 4WXJA 1XC1A 1SYHA 3EN3A 1SW4A 3C33A 3OEMA 3RY3A 2F7CA 1MXWA 3HN0A 4IO7A 2BJIA 2V3UA 4DI4B 1GVCA 4O7IA 2RC8A 2V3QA 3PU5A 1FBPA 2DWAA 5JTYB 3B6TA 2V25A 4GL8A 4X8RA 4ND9A 3WAEA 2NXOA 2P0SA 4MLVA 4OVPA 3VVEA 2A5TA 3QUJA 4JDFA 3K0VA 1SYIA 2DSFA 1KA0A 1LB9A 3PTYA 4FEDA 1YYZA 1QUJA 4C1UA 3BKIB 1P1OA 5I2NB 3RT8A 3PPQA 3TCHA 4OVJA 1P1NA 1VDWA 1XVXA 4HE1A 2HZKA 2HFBA 1LCTA 3S2VA 2O51A 3DP6A 4NMYA 2PFYA 3E78A 2OWZA 2RF1A 4QFOA 4IO6A 5I58B 1DSNA 4FE8A 5AA2A 3OELA 1US5A 2FVZA 3RPWA 1DBZA 1QGXA 4Q30B 1NUYA 3T0JA 2XXUA 2OK2A 3FJ7A 4EXKA 5JK4A 1DPPA 3USDA 4N91A 5L9SA 2CZHA 1P99A 3MJNA 3SKPA 3OO8A 2FIXA 4IR8A 5IZ1A 2XXWA 4QRZA 3OENA 1IIWA 1N3WA 2WKYA 4ESWA 2V84A 1MXYA 1LFIA 2VD2A 3TTRA 3N6UA 4HW8A 1ANFA 3TCFA 2ZZVA 3IB1A 1DTGA 2YLNA 4GQOA 4LZ8A 2E0SA 1H76A 3ILTB 2KR0A 5EQ9A 4IO2A 1USYH 4F1UA 5AA3A 4P56A 3ECRA 3R26A 2XWKA 2QRYA 5AA1A 4BDLA 3DP8A 3U8QA 1FQEA 2ZNTA 2P2AA 3T66A 1D3KA 4FEBA 5BUUA 2DE2A 4QXDA 1H3DA 5L8DA 2RCAA 3IAZA 4KQPA 4YMAA 5KCJA 4N6PA 1B58A 2O7UA 3GXAA 4U21A 3G7WA 3FV2A 1JEUA 3QMFA 2ZYNA 2CMOA 2I4CA 5DVJA 3VLUA 3O6GA 1AOVA 1F9BA 2R6GE 1LFHA 4NQ8A 3KSXA 1Q35A 1G0HA 4ECFA 4NGUA 3T22A 1UTBB 2ESNA 3TZAA 3V5AA 4H46A 3MQ9A 4GFRA 2Y7PA 2DVZA 3TPAA 4ELOA 4H5GA 3FV1A 4OEVA 2I4BA 3OO6A 5AA2B 2ONSA 5I7IA 2P3NA 4LP2B 1IMCA 1POTA 3K02A 4F3BA 4IO3A 2PMSA 3H6WA 5F24A 4I3YA 4XTCQ 2GHAA 2VP1A 1TFAA 3FGSA 2O7IA 3A09A 4F3SA 1XHYA 4NX1A 3V8XB 4N17A 2I3VA 1FTOA 1N7XA 4XIGQ 5ELVA 5L9MA 1M5BA 1N3XA 1Z7NE 2I58A 4H8JA 4FAJA 1S9TA 5H8HA 4G68B 1QULA 5HM4B 1MY0A 3MPKA 1VE4A 4UABA 2G93A 3KN3A 4P47A 4PBHA 3CFXA 4PDDA 1RYOA 4PFBA 4DCYA 1PC3A 3Q29A 1D9VA 3PGFA 4BLAA 5I56B 4GOTA 4XFEA 3SZPA 1J1NA 4ZEFA 3OSRA 1NV5A 3IOTA 3DM0A 3T9HB 4EF2A 4XKQA 2PT1A 4PETA 2Y5KA 3HHGA 2Y7KA 2FBPA 3KZGA 1PEBA 1A7LA 1SI1A 1GTKA 4R6HA 2HXWA 4XKNA 3RPLA 3UA8A 1IXHA 3RN8A 4QFKA 3UK4A 5ITPA 1ZJLA 4P9KA 2H4IA 2V3TA 3BFUA 1T0KA 2ABHA 1VFDA 1US4A 2FIEA 4QHQA 2DS9A 3N26A 4U4XA 3FD3A 4YKIA 1A40A 1I6BA 4PCDA 4WEPA 4KYEA 2YJPA 4RA1A 1B05A 4JB7A 1URGA 3MWBA 3UP9A 3C4MA 1ZKBA 3MP6A 2GFEA 3MZ9A 4BDMA 1GGGA 1FQAA 1ZBMA 3CI8A 1GV8A 3MBPA 1JQFA 3LV0A 4F1VA 3LC8A 4P0IA 4E0WA 5HBCA 3IOUA 1JP4A 3O66A 1PB9A 2RINA 4LA9A 2THIA 3B50A 5FHOA 5DVIA 4KFQA 4F2OA 2Z8EA 3KC0A 3MVXA 4KCCA 3KG2A 3PUVE 2V93A 2DVCA 2UYEA 4OFJA 3MVZA 2Q89A 4HE2A 1MRPA 1P1WA 3S9NC 1N0TA 3CG1A 1MH3A 2FA7A 2WEFA 4NF6B 3K4UA 2ZYKA 3E4RA 4PTKA 2Y7IA 2HZLA 4F2QA 3EKIA 4NG7A 5I57A 5TU0A 2UYFA 4OQOA 1MPCA 4IY5A 2B4LA 4MIJA 1S7YA 4MBPA 2XX8A 3SERA 3TTNA 3CSGA 5CMMA 1AH5A 3B6QA 1B5JA 1IMFA 2OWSA 4MFIA 3PUWE 1YXIA 4RY1A 3VVDA 4OZ9A 4R74A 4RNSA 1I6QA 5EHSA 4GWUA 4U2RA 3O29A 4ZEKA 4EDPA 1SI0A 3K6WA 1KZ8A 1A99A 3LSLA 1R9LA 3B6WA 1QKAA 1TWYA 1IZ1A 4MMPA 2LAOA 1FPFA 2XXRA 3IFAA 5H8QA 1Y3PA 4EQ7A 2XWVA 4MNCA 4X04A 5FTIA 4N15A 5TPAB 5JTYA 2PYYA 4F22A 1N7WA 3C32A 1FPBA 1FPGA 4Q8RA 1LBCA 1L5TA 3JV9A 2XXXA 1HSLA 4OETA 5J1DA 3OO7A 2Z23A 5I58A 1S50A 4FIMA 1Y3NA 2M8CA 1SW2A 3PPNA 2XX7A 4LQ5A 1IXIA 3FASA 4PC9A 3HSTA 3LSWA 4KXPA 4H0WA 3ONMA 3PMWA 3PUZE 4PAIA 4R73A 4Z7EA 2ZYOA 2RC7A 2Y7WA 1PBPA 1FQCA 1I6AA 2GQ1A 3H6VA 3MYUA 1LBVA 1FJ9A 4YMBA 3VFJA 4NF8A 5H8FB 2BJJX 2XWIA 4NAPA 2FNCA 2X7QA 1B7HA 3DLNA 4AQ4A 4GD5A 2REJA 4L17A 1EH3A 4IY6A 3E3KA 2H9BA 3CFZA 4YB6A 3RUMA 1NUZA 1IITA 1LAHE 1YZ0A 3RGYA 2YPNA 1UTBA 3H4ZA 3UIFA 3MZ1A 1FTKA 3FBPA 3PUXE 2F35A 5ET8A 2ZNSA 1NNTA 4O94A 1K9ZA 3K01A 4PF6A 5HPQA 1QW0A 3FATA 4POWA 5CRYA 1MQDA 1B3FA 1PB8A 5AE4A 2I48A 4JWYA 4LVQA 1FJ6A 4WEDA 5A5XA 1WDNA 4IO5A 4OYVA 2AIXA 4C0RA 1ZTYA 4R2FA 2CZIA 2Q2CA 5IZ3A 1VR5A 4NWCA 4QFPA 3EHTA 4KI0E 3DELB 2QS2A 3TQLA 3FVKA 1CNQA 4R6KA 5ISUA 4YZZA 4R72A 2B4MA 1IXGA 5ITOA 2XXTA 1MY1A 3ISPA 1B32A 4GWYA 5KCJB 1NV4A 2DXYA 1FPKA 4PE5B 3TDJA 1XT8A 1OQHA 4X1DA 1A54A 2PT2A 4MHFA 3ZKLA 1O7TA 5CBRA 4KR5A 5K2YA 4OXVA 4U4SA 2WYKA 4JSOA 4THIA 4YU0A 4YB7A 4NF8B 1FBGA 5CMBA 5J16A 1Y9UA 3FXQA 4H1XA 2WBDA 2V4CA 2WYPA 1B3GA 3Q26A 3H7MA 1LBYA 1POY1 2OCUA 5ET6A 1IEJA 2ZXTA 2PX1A 3T1BA 4FATA 1FPLA 1SBPA 3U92A 2NVUB 1JW1A 4LN5A 3W9VA 3CVGA 1MH4A 2R8TA 3O6HA 1NV3A 5K2XA 4JWXA 4F31B 1DK4A 1WVJA 3TELA 3FXRA 3LUZA 4HS7A 3RPLB 1FPDA 3VDFA 2HCAA 4N81A 2GHBA 3ZS6A 3K1MA 3P7IA 3TCGA 3SEWA 4G77A 2Y5LA 2Z22A 3IOWA 3F11A 3OEKA 3T93B 3TEPA 3TQWA 1FBFA 1OIBA 1EZOA 3TODA 1NV0A 3GYYA 1FQFA 1FPJA 1LBBA 1BK4A 1JEVA 4YKKA 2CZLA 2R9JA 1LEVA 4KHZE 4M1VA 1AL3A 5TP9B 5EQ8A 3PPPA 5F1QA 4TOZA 1YCJA 3D1RA 4NF4A 4PFRA 1KWHA 5JEIA 1IUDA 4P11A 3KBRA 4C1TA 2AL4A 3IR1A 4ONYA 4OVRA 3C35A 5DTBA 5EYFA 4RPOA 3U1OA 5I2NA 4OFOA 3IJXB 4N8GA 1XVYA 2RC9A 4ZEDA 3E9XA 4NF6A 3I6VA 3O97A 3UGWA 4F1YA 2PFZA 2UXAA 2KQZA 2O68A 4I62A 3MW0A 1YTVA 3H03A 2VGQA 4XKRA 3BBRA 1IMBA 4KCDA 3TUSA 4IGTA 4N13A 5I59A 1KA1A 1FRPA 4MAGA 4JSDA 3RLFE 1RYXA 5DW8A 4EXLA 4H67A 4G8NA 1FTJA 2F6GA 2DWJA 3KFMA 5I5PA 4OERA 3CIJA 1FBEA 4JVCA 4F3GA 4ZECA 1URSA 2VOZA 1M5CA 5H8HB 1NUXA 4G68A 4F18A 1DPEA 2ZZXA 5ET5A 3KN7A 3MVWA 4LONB 4KPTA 3BIHA 3GZGA 1UTHB 2QL3A 3UN6A 1NFTA 2R71A 1DMBA 1G0IA 4POXA 4NF4B 1NV2A 3QYTA 1EZPA 1NL5A 2VD3A 2RKMA 3TAJA 3CSBA 1B0LA 4G8MA 4N6KA 2QVVA 4GWSA 1B5IA 2B3BA 4P1LA 4LZ5A 5FBPA 4OANA 4XF5A 4JVDA 4M4GA 5BWJA 2OJTA 4MCOA 3O6IA 2F78A 4Q0CA 2QMXA 1CE2A 1LBXA 5LOMA 3T9UA 2CEXA 1NMUA 1RDYA 5EHMA 1OVTA 5IGAA 1IMDA 1P1UA 1D9YA 4HXVA 4PDHA 5A5LA 4LUBA 1HSEA 4LATA 4PP0A 2Q8MA 1INPA 1B52A 1O63A 5CM6A 3KJTA 4GWXA 1FTMA 2Z8DA 1OMPA 2H5YA 3KJ7A 1Q9DA 2UVIA 4ELPA 1BP5A 1SPIA 1MQIA 2Q88A 5LDZA 1FW0A 3A3CA 3D4CA 3IJOB 2UVHA 4G4PA 2CEYA 1EYKA 2ONRA 3MP8A 4AS4A 5H8FA 1FTLA 1NKXA 1BIYA 5DYHA 2ONKE 1N84A 3IK6B 1GR2A 4OVSA 3FXUA 4NEDA 5LTCA 1II5A 3ODBA 4OENA 4DE8A 2GH9A 1B46A 1OQGA 3RTWB 1QUIA 4I9DA 4AB5A 1LAXA 3BFTA 4N6DA 4KYDA 3VE1B 3FVGA 3KOTA 3H06B 1JVXA 3RT6B 3K1NA 4HE0A 4KD5A 2DYXA 2I0CA 1H43A 1B2HA 3RTFB 1NH8A 1FPEA 1OLAA 3L6HA 2O1LA 4GLIA 5IZ3B 4WKMA 4P3LA 4DLDA 2XXYA 3D4GA 1Y1ZA 1MDQA 1AMFA 4QSCA 1USYE 2XWOA 3QIMA 3B7DA 5I3SA 2DE3A 3CG3A 3M8UA 1MXXA 3IO6A 1MXZA 2HEUA 3PMXA 4MNIA 4R2BA 3RNNA 3HHFA 4GX6A 3ILUB 3C9HA 3M3KA 2O84X 3M3LA 2OX3A 1B4HA 2Y7RA 4JXIA 3FJMA 1IMAA 1MXUA 1FTAA 3K00A 2RCBA 3SDFA 4YAHX 4PAKA 3IL1B 1B0HA 4NE4A 2OZZA 4F19A 2ALUA 3FJGA 4I8CA 3U93A 4GWOA 5B70A 4PF8A 4GX3A 1MPDA 3JZJA 1EYIA 2XXHA 3I3VA 1BTJA 1MPBA 5DEXB 5CMKA 3QXMA 3S9LC 4MNPA 4ZZEA 3M3FA 1FQBA 1ZU0A 1URDA 4ELRA 4GXSB 4NF5B 1LSTA 1SDXA 3QAXA 2W7YA 4U1OA 1Y20A 1HSJA 5EYHA 5AA2D 1PBQA 2DWHA 1RDZA 3O28A 4DXUA 3E79A 4AB6A 2IEEA 3MVYA 2QS3A 4QF9A 4UACA 1A8EA 1Y4TA 2XX9A 1FQDA 1LFGA 1Q1KA 5ET7A 4GVOA 3HO7A 2DXRA 2REGA 3A3UA 5DEXA 5CBSA 4PFUA 1TFDA 2FHYA 4MLQA 1IXCA 3FZVA 2XA5A 1DTZA 2F97A 4N07A 1EYJA 1MXVA 4F3PA 3FXBA 4ELQA 5H8NB 2O69A 1Y4CA 2JJKA 2Q9TA 4KYSA 3SEUA 2AYSA 3THIA 1ATGA 4HCWA 1MY3A 1D4NA 1B3LA 5A5XB 3ZKKA 3FIRA 2GRVA 4O3BA 4IB2A 2D5WA 1JETA 4X48A 4UA8A 5FTHA 4MH5A 2XXPA 3OO9A 4DI3D 2XXQA 1SD3A 2FYIA 2O6AA 4MEVA 5CI5A 1FCKA 2Z8FA 1O64A 3RQTA 3PMVA 1CB6A 3PUYE 4ZZAA 2QSXA 4MX6A 2XXVA 1JW4A 2DQVA 2QVUA 2VPNA 3IX1A 1B4ZA 2O1MA 3GBBA 3SETA 3V83A 5ESYA 1VSOA 3KSJA 4Q5TA 3TFLA 4Z0IA 3CRBA 2ANJA 1QUKA 2ZYMA 4PQJA 3G3JA 4FECA 4GXAA 2ZMBA 3IB2A 5EYGA 4IO4A 2XD2A 1YAEA 3U94A 5I59B 4ZDMA 3AXFA 5M2VA 4R9FA 3G3FA 2G29A 2Q2AA 3O9PA 1LGBC 1B3EA 2Q8JA 2P1SA 4PBQA 3FVNA 3E13X 3PPOA 4P8BA 2X7PA 4QSEA 5FHNA 2F3DA 3T96B 4R9GA 4P1EA 1UIUA 1NH7A 4N8YA 3S9EA 4DDDA 2DOJA 4H65A 4OESA 4G61A 4FORA 2HHMA 3KOSA 2OWTA 4MJOA 1M5EA 1B1HA 3R7XA 4RPNA 2D3IA 3EQ1A 2DE4A 3VXCA 1BLFA 2UVGA 4F39A 4DIGA 2DP8A 1TXFA 3K1PA 2H99A 3Q25A 4H5FA 1P1QA 4GWZA 3QK6A 3KN8A 3IFCA 2NUVA 2QS4A 4O8MA 5B7DA 1B7UA 1JNFA 1MY2A 2F5XA 3IORA 2F36A 1QVSA 3EHSA 1Y3QA 2F3BA 4PFTA 3TYHA 1LAGE 3A29A 3VLWA 3TKDA 1FBDA 4XXUA 1SVXB 3CHGA 4GL0A 5TPAA 3T9VA 1AIVA 3DP4A 3CR9A 3N5LA 4XKPA 2PVUA 5IKBA 1NV1A 1R6ZA 3Q28A 3VLVA 4LZ7A 4LQ2A 4DXCA 3CFLA 1NV7A 3KC1A 4RYAA 4BDOA 1FSAA 4GBWA 2QFLA 3U72A 1B9JA 4PE3A 2A5TB 4NHBA 5CC2A 1LBZA 1NNFA 4DXBA 3OMBA 3BIGA 2XD3A 5ICTA 4P0GA 2HAVA 1B1XA 1M5FA 3MUQA 1NNPA 3MAMA 4ISUA 4BDNA 3H6TA 4GIZA 4GBVA 4OWDA 1LBWA 1PDAA 5KZTA 3B8BA 2D21A 2X26A 4ZE9A 1A8FA 5ICQA 1ELJA 3K6XA 4FJPA 2I0BA 2DWIA 2ZNUA 3VXBA 4HCYA 2H98A 2QMWA 5DT6A 1VFEA 4RXLA
chains in the Genus database with same CATH topology
1OLAA 4IY6A 2OK2A 2O1LA 3L6HA 3FJ7A 4GLIA 4EXKA 5JK4A 1DPPA 4WKMA 5L8DA 3USDA 3E3KA 2H9BA 3G3GA 4R75A 2XXYA 4DLDA 3CFZA 3D4GA 1MM7A 3H6UA 4U23A 1Y1ZA 1MDQA 4YB6A 3RUMA 5L9SA 1IITA 1AMFA 1LAHE 1YPNA 5CMCA 4TQUQ 4QSCA 3PD8A 1P99A 3RGYA 1IQ7A 1USYE 2YPNA 1UTBA 3H4ZA 3MJNA 1H45A 3QIMA 4G68C 1MS7A 3OO8A 1WODA 3SKPA 1R1NA 3UIFA 2XXWA 3B7DA 4QRZA 1DOTA 3OENA 1IIWA 1ZLQA 2DE3A 3CG3A 1FTKA 1MXXA 3IO6A 1N3WA 3M8UA 3MZ1A 3PUXE 2WKYA 2F35A 3GLBA 3OOAA 4ESWA 2V84A 1MXZA 1MXYA 1LFIA 3T9XB 2ZNSA 1NNTA 2HEUA 3PMXA 3K01A 5HPQA 2VD2A 3TTRA 3N6UA 1QW0A 3FATA 4POWA 4R2BA 3RNNA 2UVJA 4HW8A 3HHFA 1ANFA 5CRYA 3KGCA 3TCFA 1MQDA 3ILUB 2NWJA 3C9HA 1Y1MA 3M3KA 1B3FA 2O84X 3M3LA 1PB8A 1DTGA 2YLNA 3IB1A 4GQOA 1B4HA 4LZ8A 2E0SA 1H76A 3ILTB 4ELOA 5AE4A 2I48A 2Y7RA 2I49A 2F8DA 4JXIA 4JWYA 4EUOA 4LVQA 2E1SA 1MQHA 3FJMA 3I5OA 4WEDA 4IO2A 1TT1A 1USYH 1WDNA 3PV0E 4IO5A 4JBZA 4DCXA 4F1UA 5A5XA 3ECRA 1MXUA 3R26A 5AA3A 4JWOA 2QRYA 4K3FA 4OYVA 2AIXA 4NF5A 5AA1A 4C0RA 4RJZA 4BDLA 3K00A 3DP8A 1ZTYA 2RCBA 3U8QA 4R2FA 1FQEA 2Q2CA 4BDQA 3S9MC 1VR5A 4NWCA 4QFPA 2ZNTA 3SDFA 2P2AA 3EHTA 4KI0E 3T66A 1D3KA 3IO4A 3L6GA 4FEBA 3DELB 1MM6A 4YAHX 1I69A 2QS2A 3TQLA 3FVKA 3IL1B 1B0HA 4R6KA 4NE4A 2OZZA 4MF3A 5BUUA 2DE2A 4F19A 5ISUA 1H3DA 2ALUA 1Z7ME 3FJGA 3LR1A 4I8CA 4GWOA 2RCAA 4R72A 3IAZA 4KQPA 4YZZA 1IXGA 1MPDA 3JZJA 4YMAA 5KCJA 4N6PA 5ITOA 4PFYA 2XXHA 3I3VA 1B58A 2XXTA 1BTJA 1MPBA 1MY1A 1B32A 3KEIA 5KCJB 5I57B 5DEXB 5CMKA 3QXMA 2O7UA 3GXAA 4RK9A 2DXYA 4U21A 3G7WA 3FV2A 2I3WA 4EQBA 1ZMGA 4PE5B 3S9LC 1JEUA 3TDJA 1XT8A 1OQHA 2ZYNA 4X1DA 3SEYA 2CMOA 4ZZEA 2I4CA 1B51A 5DVJA 1A54A 2PBWA 3VLUA 2PT2A 3ZKLA 3M3FA 1FQBA 1O7TA 3O6GA 1AOVA 1F9BA 1ZU0A 2R6GE 5CBRA 1LFHA 1NNKA 1URDA 4I1DA 4KR5A 5K2YA 4OXVA 4GXSB 4U4SA 4ELRA 3KSXA 4JSOA 1Q35A 4X9TA 1UTHA 4NF5B 5AA2A 3W9WA 4X1BA 4THIA 1LSTA 1N76A 4YU0A 4ECFA 1SDXA 3T22A 3QAXA 4NF8B 4YB7A 1UTBB 2W7YA 4U1OA 1Y20A 2ESNA 3TZAA 3V5AA 5CMBA 3MQ9A 1Y9UA 2Y7PA 2DVZA 3FVOA 4GFRA 3FXQA 1HSJA 3TPAA 3VVFA 4H5GA 5I2KA 3FV1A 3IOVA 4H1XA 4OEVA 1B7ZA 2I4BA 5AA2D 3OO6A 1B3GA 2DWHA 1PBQA 3ZSFA 5AA2B 3Q26A 2ONSA 3O28A 3H7MA 4DXUA 3TTLA 1POY1 4LP2B 1POTA 4AB6A 2IEEA 2OCUA 3K02A 4H8IA 1IEJA 3C31A 2ZXTA 2PX1A 4F3BA 3JYRA 4FATA 3MVYA 1SBPA 2PMSA 4IO3A 2NVUB 1JW1A 3U92A 2QS3A 3H6WA 1JVYA 3C34A 4QF9A 4UACA 3CVGA 1MH4A 3W9VA 4YKPA 1A8EA 1Y4TA 4ZEBA 3EPEA 3O6HA 2XX9A 1FQDA 1QJMA 3K6UA 4JWXA 4XTCQ 5K2XA 2GHAA 3S4UA 4F31B 1LFGA 1Q1KA 1WVJA 2QPQA 2VP1A 3G3KA 3TELA 1TFAA 3FGSA 3FXRA 4IGRA 2O7IA 3A09A 4GVOA 4HS7A 3HO7A 2DXRA 3VDFA 2HCAA 4F3SA 1XHYA 2REGA 3A3UA 5DEXA 5CBSA 4PFUA 3R6UA 1TFDA 2I3VA 3V8XB 1FTOA 1N7XA 3HV1A 4GRKA 4MLQA 4XIGQ 5ELVA 5L9MA 1IXCA 4TLLB 1M5BA 1N3XA 1Z7NE 3FZVA 4G2ZA 4NWDA 2KLFA 2I58A 1DTZA 2GHBA 2F97A 4H8JA 4FAJA 3ZS6A 1S9TA 3MC2A 4N07A 5H8HA 1MXVA 3K1MA 4G68B 3P7IA 2B3FA 3TCGA 3SEWA 4EF1A 4F3PA 1QULA 5HM4B 1MY0A 4G77A 3W15C 4ELQA 4HTGA 4O3AA 3MPKA 1VE4A 3SEVA 2G93A 2Z22A 3IOWA 3F11A 3KN3A 5H8NB 2O69A 3OEKA 1Y4CA 2Q9TA 3T93B 4KYSA 3SEUA 3TEPA 2AYSA 3TQWA 3THIA 1OIBA 5H8NA 1ATGA 1EZOA 4HCWA 3TODA 3CFXA 1MY3A 1RYOA 1D4NA 1B3LA 1R9QA 1FQFA 4DCYA 5A5XB 1PC3A 1LBBA 3ZKKA 3FIRA 1JEVA 4YKKA 2CZLA 2R9JA 2GRVA 3Q29A 1D9VA 4KHZE 4M1VA 1BKAA 1AL3A 4O3BA 4OMBA 3PGFA 4IB2A 4TLMB 5TP9B 5IAIA 4BLAA 5I56B 3PPPA 5F1QA 5FHMA 4YB5A 2D5WA 1MG1A 4TOZA 1JETA 2B65A 4ZE8A 4X48A 4DZ1A 1YCJA 4UA8A 3GBAA 5FTHA 4GOTA 3Q27A 4NF4A 1J1NA 4MH5A 2XXPA 4ZEFA 3OSRA 3OO9A 1LAFE 1KWHA 1UIVA 3DM0A 1IUDA 3IOTA 4P11A 3KBRA 4OHNA 5JEIA 2XXQA 1SD3A 2FYIA 3T9HB 2AL4A 4C1TA 4EF2A 2O6AA 4XKQA 1QKBA 2PT1A 4PETA 4PFWA 3IR1A 5CI5A 4ONYA 2QJEA 1FCKA 2Z8FA 3C35A 5TP9A 1MDP1 1O64A 3OSQA 5DTBA 5EYFA 1JW5A 3RQTA 4F29A 4RPOA 3PMVA 3SEXA 1CB6A 3LSFB 3HHGA 3U1OA 3PUYE 2Y7KA 4ZZAA 2QSXA 5I2NA 2F34A 2XXVA 4OFOA 3HPIA 5H8SA 1JW4A 2DQVA 5KDTA 1ZIUA 3IJXB 3KZGA 1EU8A 3SESA 1PEBA 1XVYA 1A7LA 1SI1A 2RC9A 3IX1A 1GTKA 3QSLA 4NTLA 4R6YA 1OLCA 4R6HA 4ZEDA 1N04A 5L9OA 3HCQA 2HXWA 1B4ZA 3E9XA 4NF6A 4XKNA 5I2KB 3I6VA 3O97A 1MQGA 2F7BA 2HAUA 2O1MA 3UA8A 3UGWA 3GBBA 2IA4A 1IXHA 2I6EA 4OEUA 4F1YA 3RN8A 2UXAA 4QFKA 3SETA 4E0XA 2XHDA 3UK4A 3V83A 1VSOA 4O3CA 1B6HA 4YICA 3LSXA 3KSJA 5AA4A 5ITPA 1ZJLA 2H4IA 2V3TA 2O68A 1A55A 3BFUA 4I62A 4Q5TA 3MW0A 1YTVA 1T0KA 3H03A 2VGQA 2ABHA 3MPLA 4GF8A 1VFDA 3OD7A 3BBRA 4XKRA 3TFLA 3V89B 4Z0IA 1US4A 4KCDA 3IB0A 5H8QB 3CRBA 2DS9A 3N26A 4QHQA 4U4XA 2ANJA 1QUKA 3FD3A 2ZYMA 4YKIA 3TUSA 3TCHA 3K2DA 1A40A 1I6BA 2XXIA 4PQJA 4G8HA 4WEPA 3G3JA 4FECA 4ZEIA 4IGTA 4GXAA 4KYEA 3TTKA 4N13A 2ZMBA 3IB2A 2YJPA 4RA1A 1B05A 4JB7A 5I59A 1URGA 3MWBA 4IO4A 3UP9A 2XD2A 2VHAA 3C4MA 1YAEA 1ZKBA 3U94A 3MP6A 5I59B 4ZDMA 1M5DA 2GFEA 3AXFA 3G3IA 3MZ9A 4BDMA 1GGGA 5M2VA 4R9FA 1FQAA 1ZBMA 1RYXA 4JSDA 4U1ZA 1UQWA 3CI8A 1GV8A 3RLFE 4EXLA 3LBSA 3G3FA 3MBPA 1JQFA 4U22A 1SQYA 4H67A 4QFNA 4F1VA 2G29A 3LC8A 4P0IA 3K6VA 4G8NA 1FTJA 1B5HA 2Q2AA 2F6GA 4OTEA 5I56A 3O9PA 2DWJA 5HBCA 4E0WA 3KFMA 2F6PA 1LGBC 1B3EA 1LLSA 3IOUA 2Q8JA 3QUFA 4OERA 3CIJA 4F3GA 2P1SA 3O66A 3UORA 4ZECA 1SW5A 1URSA 2VOZA 3FVNA 1M5CA 1PB9A 3E13X 3PPOA 5DVFA 5H8HB 2RINA 4RK2A 2X7PA 4QSEA 4LA9A 5FHNA 3LUYA 2THIA 4G68A 3N6TA 3G3HA 4F18A 1DPEA 5FHOA 5DVIA 3T96B 3FUZA 4KFQA 4F2OA 3KN7A 4R9GA 4QFLA 2Z8EA 3MVWA 4BDNA 4LONB 4KPTA 4H6DA 1UIUA 3GZGA 1UTHB 3MVXA 5I84A 1MQJA 1NH7A 2QL3A 3UN6A 1NFTA 4KCCA 5AA4B 2R71A 3S9EA 1DMBA 1XOCA 2HQ0A 3KG2A 3PUVE 2DOJA 4H65A 4DDDA 2V93A 4POXA 4OESA 2DVCA 1EZ9A 1LCFA 1MY4A 2UYEA 4FORA 3MVZA 1PB7A 3QYTA 4NF4B 4OFJA 1EZPA 2Q89A 1MRPA 1P1WA 3KOSA 3S9NC 1N0TA 2OWTA 3CG1A 1B3HA 1MH3A 2FA7A 1M5EA 1B1HA 1NL5A 4NF6B 1LB8A 5B70A 3K4UA 5F7VA 2ZYKA 2VD3A 3R7XA 3PPRA 2Y84A 4RPNA 2D3IA 3E4RA 2RKMA 3EHUA 2DE4A 3EQ1A 2NOOA 3VXCA 3WAFA 2Y7IA 3TAJA 3CSBA 1BLFA 2OBGA 1B0LA 2HZLA 2UVGA 4F2QA 2H25A 4G8MA 4F39A 4DIGA 5I57A 2DP8A 4ZS9A 5TU0A 1TXFA 2UYFA 2H99A 3K1PA 3Q25A 4H5FA 1P1QA 4OQOA 3QK6A 1B5IA 2B3BA 1XS5A 1MPCA 2F7AA 4IY5A 3OXNA 3KN8A 4LZ5A 5KDTB 2NUVA 2QS4A 5B7DA 1B40A 1B7UA 1H44A 1OVBA 1JNFA 1S7YA 2AL5A 4M4GA 4MBPA 4OFLA 1RKMA 2XX8A 3SERA 2A5SA 3TMGA 3TTNA 5BWJA 2OJTA 4YKJA 1MY2A 3CSGA 5CMMA 1AH5A 2F5XA 3IORA 3VV5A 2QS1A 3EF7A 3C36A 4EQ9A 4ESXA 3B6QA 2F36A 1QVSA 1B5JA 2OLBA 3EHSA 2F78A 3H3GA 3O6IA 3MZBA 4Q0CA 2QMXA 3TTMA 4BDRA 1CE2A 5LOMA 2OWSA 1Y3QA 3MP1A 3T9UA 3PD9A 4MFIA 3PUWE 1NMUA 4RY1A 3VVDA 4QSDA 4OZ9A 4PFTA 3N94A 4R74A 4RNSA 5EHMA 1I6QA 3TYHA 1LAGE 5EHSA 3VLWA 1OVTA 3TKDA 3O2AA 1P1UA 1SW1A 1D9YA 4WXJA 4XXUA 1XC1A 1SVXB 1SYHA 4LUBA 3EN3A 1SW4A 3C33A 3O29A 3OEMA 4U2RA 1HSEA 2F7CA 1MXWA 4GL0A 5TPAA 3RY3A 3HN0A 4LATA 4IO7A 4ZEKA 3T9VA 4PP0A 4EDPA 1SI0A 3K6WA 3DP4A 1B52A 1O63A 3CR9A 1AIVA 5CM6A 1A99A 3U93A 3N5LA 3KJTA 2V3UA 3LSLA 1R9LA 4XKPA 3B6WA 2PVUA 1QKAA 1TWYA 1GVCA 1IZ1A 2RC8A 5IKBA 1FTMA 2V3QA 2Z8DA 2LAOA 1OMPA 2H5YA 2XXRA 3PU5A 3KJ7A 2DWAA 1R6ZA 1Y3PA 2UVIA 5H8QA 5JTYB 4EQ7A 4ELPA 3B6TA 1BP5A 3Q28A 2V25A 3VLVA 4GL8A 1MQIA 4LZ7A 5FTIA 2Q88A 4LQ2A 4ND9A 3CFLA 5TPAB 1FW0A 4DXCA 3A3CA 5JTYA 2PYYA 3D4CA 3IJOB 2UVHA 4G4PA 4F22A 1N7WA 4RYAA 2ONRA 3C32A 3MP8A 4BDOA 3RTWB 5H8FA 4Q8RA 1FTLA 1LBCA 1NKXA 1BIYA 3JV9A 1L5TA 5DYHA 3U72A 2NXOA 3WAEA 2ONKE 2XXXA 1HSLA 1N84A 2P0SA 3IK6B 1B9JA 4OETA 3OO7A 5J1DA 2Z23A 5I58A 1S50A 2A5TB 1Y3NA 2M8CA 4FIMA 4MLVA 5CC2A 3VVEA 1GR2A 1SW2A 2A5TA 3QUJA 4JDFA 3K0VA 1SYIA 1NNFA 2DSFA 3PPNA 4DXBA 3OMBA 1LB9A 2XX7A 2XXUA 4LQ5A 1IXIA 3FXUA 4FEDA 4NEDA 2XD3A 5ICTA 4P0GA 1QUJA 3FASA 4C1UA 1II5A 2HAVA 1B1XA 3BKIB 3ODBA 1P1OA 4OENA 5I2NB 1M5FA 4DE8A 3MUQA 3HSTA 3LSWA 3RT8A 2GH9A 1B46A 1OQGA 4H0WA 1NNPA 3MAMA 3PPQA 3ONMA 3PMWA 1P1NA 1QUIA 3PUZE 4ISUA 3H6TA 4GIZA 4I9DA 4OVJA 4R73A 1XVXA 4OWDA 4AB5A 4Z7EA 1LAXA 2ZYOA 1PDAA 3VXBA 5KZTA 3BFTA 2RC7A 2Y7WA 1PBPA 2HZKA 2D21A 1FQCA 2HFBA 1I6AA 1LCTA 3S2VA 2X26A 3H6VA 4KYDA 3VE1B 2O51A 4YMBA 3VFJA 3DP6A 3FVGA 4NF8A 4NMYA 3KOTA 3H06B 5H8FB 4ZE9A 2BJJX 1A8FA 1JVXA 5ICQA 1ELJA 3K6XA 2FNCA 2X7QA 4FJPA 2I0BA 2RF1A 4QFOA 2DWIA 3RT6B 3K1NA 4IO6A 1B7HA 5I58B 2ZNUA 1DSNA 4FE8A 3DLNA 4KD5A 4AQ4A 3OELA 2DYXA 2I0CA 1H43A 2REJA 4GD5A 4HCYA 1US5A 1B2HA 2H98A 2QMWA 4L17A 1VFEA 4Q30B 5DT6A 3RPWA 3RTFB 1EH3A 1NH8A 4RXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OLA A;  4IY6 A;  2OK2 A;  2O1L A;  3L6H A;  3FJ7 A;  4GLI A;  4EXK A;  5JK4 A;  1DPP A;  4WKM A;  5L8D A;  3USD A;  3E3K A;  2H9B A;  3G3G A;  4R75 A;  2XXY A;  4DLD A;  3CFZ A;  3D4G A;  1MM7 A;  3H6U A;  4U23 A;  1Y1Z A;  1MDQ A;  4YB6 A;  3RUM A;  5L9S A;  1IIT A;  1AMF A;  1LAH E;  1YPN A;  5CMC A;  4TQU Q;  4QSC A;  3PD8 A;  1P99 A;  3RGY A;  1IQ7 A;  1USY E;  2YPN A;  1UTB A;  3H4Z A;  3MJN A;  1H45 A;  3QIM A;  4G68 C;  1MS7 A;  3OO8 A;  1WOD A;  3SKP A;  1R1N A;  3UIF A;  2XXW A;  3B7D A;  4QRZ A;  1DOT A;  3OEN A;  1IIW A;  1ZLQ A;  2DE3 A;  3CG3 A;  1FTK A;  1MXX A;  3IO6 A;  1N3W A;  3M8U A;  3MZ1 A;  3PUX E;  2WKY A;  2F35 A;  3GLB A;  3OOA A;  4ESW A;  2V84 A;  1MXZ A;  1MXY A;  1LFI A;  3T9X B;  2ZNS A;  1NNT A;  2HEU A;  3PMX A;  3K01 A;  5HPQ A;  2VD2 A;  3TTR A;  3N6U A;  1QW0 A;  3FAT A;  4POW A;  4R2B A;  3RNN A;  2UVJ A;  4HW8 A;  3HHF A;  1ANF A;  5CRY A;  3KGC A;  3TCF A;  1MQD A;  3ILU B;  2NWJ A;  3C9H A;  1Y1M A;  3M3K A;  1B3F A;  2O84 X;  3M3L A;  1PB8 A;  1DTG A;  2YLN A;  3IB1 A;  4GQO A;  1B4H A;  4LZ8 A;  2E0S A;  1H76 A;  3ILT B;  4ELO A;  5AE4 A;  2I48 A;  2Y7R A;  2I49 A;  2F8D A;  4JXI A;  4JWY A;  4EUO A;  4LVQ A;  2E1S A;  1MQH A;  3FJM A;  3I5O A;  4WED A;  4IO2 A;  1TT1 A;  1USY H;  1WDN A;  3PV0 E;  4IO5 A;  4JBZ A;  4DCX A;  4F1U A;  5A5X A;  3ECR A;  1MXU A;  3R26 A;  5AA3 A;  4JWO A;  2QRY A;  4K3F A;  4OYV A;  2AIX A;  4NF5 A;  5AA1 A;  4C0R A;  4RJZ A;  4BDL A;  3K00 A;  3DP8 A;  1ZTY A;  2RCB A;  3U8Q A;  4R2F A;  1FQE A;  2Q2C A;  4BDQ A;  3S9M C;  1VR5 A;  4NWC A;  4QFP A;  2ZNT A;  3SDF A;  2P2A A;  3EHT A;  4KI0 E;  3T66 A;  1D3K A;  3IO4 A;  3L6G A;  4FEB A;  3DEL B;  1MM6 A;  4YAH X;  1I69 A;  2QS2 A;  3TQL A;  3FVK A;  3IL1 B;  1B0H A;  4R6K A;  4NE4 A;  2OZZ A;  4MF3 A;  5BUU A;  2DE2 A;  4F19 A;  5ISU A;  1H3D A;  2ALU A;  1Z7M E;  3FJG A;  3LR1 A;  4I8C A;  4GWO A;  2RCA A;  4R72 A;  3IAZ A;  4KQP A;  4YZZ A;  1IXG A;  1MPD A;  3JZJ A;  4YMA A;  5KCJ A;  4N6P A;  5ITO A;  4PFY A;  2XXH A;  3I3V A;  1B58 A;  2XXT A;  1BTJ A;  1MPB A;  1MY1 A;  1B32 A;  3KEI A;  5KCJ B;  5I57 B;  5DEX B;  5CMK A;  3QXM A;  2O7U A;  3GXA A;  4RK9 A;  2DXY A;  4U21 A;  3G7W A;  3FV2 A;  2I3W A;  4EQB A;  1ZMG A;  4PE5 B;  3S9L C;  1JEU A;  3TDJ A;  1XT8 A;  1OQH A;  2ZYN A;  4X1D A;  3SEY A;  2CMO A;  4ZZE A;  2I4C A;  1B51 A;  5DVJ A;  1A54 A;  2PBW A;  3VLU A;  2PT2 A;  3ZKL A;  3M3F A;  1FQB A;  1O7T A;  3O6G A;  1AOV A;  1F9B A;  1ZU0 A;  2R6G E;  5CBR A;  1LFH A;  1NNK A;  1URD A;  4I1D A;  4KR5 A;  5K2Y A;  4OXV A;  4GXS B;  4U4S A;  4ELR A;  3KSX A;  4JSO A;  1Q35 A;  4X9T A;  1UTH A;  4NF5 B;  5AA2 A;  3W9W A;  4X1B A;  4THI A;  1LST A;  1N76 A;  4YU0 A;  4ECF A;  1SDX A;  3T22 A;  3QAX A;  4NF8 B;  4YB7 A;  1UTB B;  2W7Y A;  4U1O A;  1Y20 A;  2ESN A;  3TZA A;  3V5A A;  5CMB A;  3MQ9 A;  1Y9U A;  2Y7P A;  2DVZ A;  3FVO A;  4GFR A;  3FXQ A;  1HSJ A;  3TPA A;  3VVF A;  4H5G A;  5I2K A;  3FV1 A;  3IOV A;  4H1X A;  4OEV A;  1B7Z A;  2I4B A;  5AA2 D;  3OO6 A;  1B3G A;  2DWH A;  1PBQ A;  3ZSF A;  5AA2 B;  3Q26 A;  2ONS A;  3O28 A;  3H7M A;  4DXU A;  3TTL A;  1POY 1;  4LP2 B;  1POT A;  4AB6 A;  2IEE A;  2OCU A;  3K02 A;  4H8I A;  1IEJ A;  3C31 A;  2ZXT A;  2PX1 A;  4F3B A;  3JYR A;  4FAT A;  3MVY A;  1SBP A;  2PMS A;  4IO3 A;  2NVU B;  1JW1 A;  3U92 A;  2QS3 A;  3H6W A;  1JVY A;  3C34 A;  4QF9 A;  4UAC A;  3CVG A;  1MH4 A;  3W9V A;  4YKP A;  1A8E A;  1Y4T A;  4ZEB A;  3EPE A;  3O6H A;  2XX9 A;  1FQD A;  1QJM A;  3K6U A;  4JWX A;  4XTC Q;  5K2X A;  2GHA A;  3S4U A;  4F31 B;  1LFG A;  1Q1K A;  1WVJ A;  2QPQ A;  2VP1 A;  3G3K A;  3TEL A;  1TFA A;  3FGS A;  3FXR A;  4IGR A;  2O7I A;  3A09 A;  4GVO A;  4HS7 A;  3HO7 A;  2DXR A;  3VDF A;  2HCA A;  4F3S A;  1XHY A;  2REG A;  3A3U A;  5DEX A;  5CBS A;  4PFU A;  3R6U A;  1TFD A;  2I3V A;  3V8X B;  1FTO A;  1N7X A;  3HV1 A;  4GRK A;  4MLQ A;  4XIG Q;  5ELV A;  5L9M A;  1IXC A;  4TLL B;  1M5B A;  1N3X A;  1Z7N E;  3FZV A;  4G2Z A;  4NWD A;  2KLF A;  2I58 A;  1DTZ A;  2GHB A;  2F97 A;  4H8J A;  4FAJ A;  3ZS6 A;  1S9T A;  3MC2 A;  4N07 A;  5H8H A;  1MXV A;  3K1M A;  4G68 B;  3P7I A;  2B3F A;  3TCG A;  3SEW A;  4EF1 A;  4F3P A;  1QUL A;  5HM4 B;  1MY0 A;  4G77 A;  3W15 C;  4ELQ A;  4HTG A;  4O3A A;  3MPK A;  1VE4 A;  3SEV A;  2G93 A;  2Z22 A;  3IOW A;  3F11 A;  3KN3 A;  5H8N B;  2O69 A;  3OEK A;  1Y4C A;  2Q9T A;  3T93 B;  4KYS A;  3SEU A;  3TEP A;  2AYS A;  3TQW A;  3THI A;  1OIB A;  5H8N A;  1ATG A;  1EZO A;  4HCW A;  3TOD A;  3CFX A;  1MY3 A;  1RYO A;  1D4N A;  1B3L A;  1R9Q A;  1FQF A;  4DCY A;  5A5X B;  1PC3 A;  1LBB A;  3ZKK A;  3FIR A;  1JEV A;  4YKK A;  2CZL A;  2R9J A;  2GRV A;  3Q29 A;  1D9V A;  4KHZ E;  4M1V A;  1BKA A;  1AL3 A;  4O3B A;  4OMB A;  3PGF A;  4IB2 A;  4TLM B;  5TP9 B;  5IAI A;  4BLA A;  5I56 B;  3PPP A;  5F1Q A;  5FHM A;  4YB5 A;  2D5W A;  1MG1 A;  4TOZ A;  1JET A;  2B65 A;  4ZE8 A;  4X48 A;  4DZ1 A;  1YCJ A;  4UA8 A;  3GBA A;  5FTH A;  4GOT A;  3Q27 A;  4NF4 A;  1J1N A;  4MH5 A;  2XXP A;  4ZEF A;  3OSR A;  3OO9 A;  1LAF E;  1KWH A;  1UIV A;  3DM0 A;  1IUD A;  3IOT A;  4P11 A;  3KBR A;  4OHN A;  5JEI A;  2XXQ A;  1SD3 A;  2FYI A;  3T9H B;  2AL4 A;  4C1T A;  4EF2 A;  2O6A A;  4XKQ A;  1QKB A;  2PT1 A;  4PET A;  4PFW A;  3IR1 A;  5CI5 A;  4ONY A;  2QJE A;  1FCK A;  2Z8F A;  3C35 A;  5TP9 A;  1MDP 1;  1O64 A;  3OSQ A;  5DTB A;  5EYF A;  1JW5 A;  3RQT A;  4F29 A;  4RPO A;  3PMV A;  3SEX A;  1CB6 A;  3LSF B;  3HHG A;  3U1O A;  3PUY E;  2Y7K A;  4ZZA A;  2QSX A;  5I2N A;  2F34 A;  2XXV A;  4OFO A;  3HPI A;  5H8S A;  1JW4 A;  2DQV A;  5KDT A;  1ZIU A;  3IJX B;  3KZG A;  1EU8 A;  3SES A;  1PEB A;  1XVY A;  1A7L A;  1SI1 A;  2RC9 A;  3IX1 A;  1GTK A;  3QSL A;  4NTL A;  4R6Y A;  1OLC A;  4R6H A;  4ZED A;  1N04 A;  5L9O A;  3HCQ A;  2HXW A;  1B4Z A;  3E9X A;  4NF6 A;  4XKN A;  5I2K B;  3I6V A;  3O97 A;  1MQG A;  2F7B A;  2HAU A;  2O1M A;  3UA8 A;  3UGW A;  3GBB A;  2IA4 A;  1IXH A;  2I6E A;  4OEU A;  4F1Y A;  3RN8 A;  2UXA A;  4QFK A;  3SET A;  4E0X A;  2XHD A;  3UK4 A;  3V83 A;  1VSO A;  4O3C A;  1B6H A;  4YIC A;  3LSX A;  3KSJ A;  5AA4 A;  5ITP A;  1ZJL A;  2H4I A;  2V3T A;  2O68 A;  1A55 A;  3BFU A;  4I62 A;  4Q5T A;  3MW0 A;  1YTV A;  1T0K A;  3H03 A;  2VGQ A;  2ABH A;  3MPL A;  4GF8 A;  1VFD A;  3OD7 A;  3BBR A;  4XKR A;  3TFL A;  3V89 B;  4Z0I A;  1US4 A;  4KCD A;  3IB0 A;  5H8Q B;  3CRB A;  2DS9 A;  3N26 A;  4QHQ A;  4U4X A;  2ANJ A;  1QUK A;  3FD3 A;  2ZYM A;  4YKI A;  3TUS A;  3TCH A;  3K2D A;  1A40 A;  1I6B A;  2XXI A;  4PQJ A;  4G8H A;  4WEP A;  3G3J A;  4FEC A;  4ZEI A;  4IGT A;  4GXA A;  4KYE A;  3TTK A;  4N13 A;  2ZMB A;  3IB2 A;  2YJP A;  4RA1 A;  1B05 A;  4JB7 A;  5I59 A;  1URG A;  3MWB A;  4IO4 A;  3UP9 A;  2XD2 A;  2VHA A;  3C4M A;  1YAE A;  1ZKB A;  3U94 A;  3MP6 A;  5I59 B;  4ZDM A;  1M5D A;  2GFE A;  3AXF A;  3G3I A;  3MZ9 A;  4BDM A;  1GGG A;  5M2V A;  4R9F A;  1FQA A;  1ZBM A;  1RYX A;  4JSD A;  4U1Z A;  1UQW A;  3CI8 A;  1GV8 A;  3RLF E;  4EXL A;  3LBS A;  3G3F A;  3MBP A;  1JQF A;  4U22 A;  1SQY A;  4H67 A;  4QFN A;  4F1V A;  2G29 A;  3LC8 A;  4P0I A;  3K6V A;  4G8N A;  1FTJ A;  1B5H A;  2Q2A A;  2F6G A;  4OTE A;  5I56 A;  3O9P A;  2DWJ A;  5HBC A;  4E0W A;  3KFM A;  2F6P A;  1LGB C;  1B3E A;  1LLS A;  3IOU A;  2Q8J A;  3QUF A;  4OER A;  3CIJ A;  4F3G A;  2P1S A;  3O66 A;  3UOR A;  4ZEC A;  1SW5 A;  1URS A;  2VOZ A;  3FVN A;  1M5C A;  1PB9 A;  3E13 X;  3PPO A;  5DVF A;  5H8H B;  2RIN A;  4RK2 A;  2X7P A;  4QSE A;  4LA9 A;  5FHN A;  3LUY A;  2THI A;  4G68 A;  3N6T A;  3G3H A;  4F18 A;  1DPE A;  5FHO A;  5DVI A;  3T96 B;  3FUZ A;  4KFQ A;  4F2O A;  3KN7 A;  4R9G A;  4QFL A;  2Z8E A;  3MVW A;  4BDN A;  4LON B;  4KPT A;  4H6D A;  1UIU A;  3GZG A;  1UTH B;  3MVX A;  5I84 A;  1MQJ A;  1NH7 A;  2QL3 A;  3UN6 A;  1NFT A;  4KCC A;  5AA4 B;  2R71 A;  3S9E A;  1DMB A;  1XOC A;  2HQ0 A;  3KG2 A;  3PUV E;  2DOJ A;  4H65 A;  4DDD A;  2V93 A;  4POX A;  4OES A;  2DVC A;  1EZ9 A;  1LCF A;  1MY4 A;  2UYE A;  4FOR A;  3MVZ A;  1PB7 A;  3QYT A;  4NF4 B;  4OFJ A;  1EZP A;  2Q89 A;  1MRP A;  1P1W A;  3KOS A;  3S9N C;  1N0T A;  2OWT A;  3CG1 A;  1B3H A;  1MH3 A;  2FA7 A;  1M5E A;  1B1H A;  1NL5 A;  4NF6 B;  1LB8 A;  5B70 A;  3K4U A;  5F7V A;  2ZYK A;  2VD3 A;  3R7X A;  3PPR A;  2Y84 A;  4RPN A;  2D3I A;  3E4R A;  2RKM A;  3EHU A;  2DE4 A;  3EQ1 A;  2NOO A;  3VXC A;  3WAF A;  2Y7I A;  3TAJ A;  3CSB A;  1BLF A;  2OBG A;  1B0L A;  2HZL A;  2UVG A;  4F2Q A;  2H25 A;  4G8M A;  4F39 A;  4DIG A;  5I57 A;  2DP8 A;  4ZS9 A;  5TU0 A;  1TXF A;  2UYF A;  2H99 A;  3K1P A;  3Q25 A;  4H5F A;  1P1Q A;  4OQO A;  3QK6 A;  1B5I A;  2B3B A;  1XS5 A;  1MPC A;  2F7A A;  4IY5 A;  3OXN A;  3KN8 A;  4LZ5 A;  5KDT B;  2NUV A;  2QS4 A;  5B7D A;  1B40 A;  1B7U A;  1H44 A;  1OVB A;  1JNF A;  1S7Y A;  2AL5 A;  4M4G A;  4MBP A;  4OFL A;  1RKM A;  2XX8 A;  3SER A;  2A5S A;  3TMG A;  3TTN A;  5BWJ A;  2OJT A;  4YKJ A;  1MY2 A;  3CSG A;  5CMM A;  1AH5 A;  2F5X A;  3IOR A;  3VV5 A;  2QS1 A;  3EF7 A;  3C36 A;  4EQ9 A;  4ESX A;  3B6Q A;  2F36 A;  1QVS A;  1B5J A;  2OLB A;  3EHS A;  2F78 A;  3H3G A;  3O6I A;  3MZB A;  4Q0C A;  2QMX A;  3TTM A;  4BDR A;  1CE2 A;  5LOM A;  2OWS A;  1Y3Q A;  3MP1 A;  3T9U A;  3PD9 A;  4MFI A;  3PUW E;  1NMU A;  4RY1 A;  3VVD A;  4QSD A;  4OZ9 A;  4PFT A;  3N94 A;  4R74 A;  4RNS A;  5EHM A;  1I6Q A;  3TYH A;  1LAG E;  5EHS A;  3VLW A;  1OVT A;  3TKD A;  3O2A A;  1P1U A;  1SW1 A;  1D9Y A;  4WXJ A;  4XXU A;  1XC1 A;  1SVX B;  1SYH A;  4LUB A;  3EN3 A;  1SW4 A;  3C33 A;  3O29 A;  3OEM A;  4U2R A;  1HSE A;  2F7C A;  1MXW A;  4GL0 A;  5TPA A;  3RY3 A;  3HN0 A;  4LAT A;  4IO7 A;  4ZEK A;  3T9V A;  4PP0 A;  4EDP A;  1SI0 A;  3K6W A;  3DP4 A;  1B52 A;  1O63 A;  3CR9 A;  1AIV A;  5CM6 A;  1A99 A;  3U93 A;  3N5L A;  3KJT A;  2V3U A;  3LSL A;  1R9L A;  4XKP A;  3B6W A;  2PVU A;  1QKA A;  1TWY A;  1GVC A;  1IZ1 A;  2RC8 A;  5IKB A;  1FTM A;  2V3Q A;  2Z8D A;  2LAO A;  1OMP A;  2H5Y A;  2XXR A;  3PU5 A;  3KJ7 A;  2DWA A;  1R6Z A;  1Y3P A;  2UVI A;  5H8Q A;  5JTY B;  4EQ7 A;  4ELP A;  3B6T A;  1BP5 A;  3Q28 A;  2V25 A;  3VLV A;  4GL8 A;  1MQI A;  4LZ7 A;  5FTI A;  2Q88 A;  4LQ2 A;  4ND9 A;  3CFL A;  5TPA B;  1FW0 A;  4DXC A;  3A3C A;  5JTY A;  2PYY A;  3D4C A;  3IJO B;  2UVH A;  4G4P A;  4F22 A;  1N7W A;  4RYA A;  2ONR A;  3C32 A;  3MP8 A;  4BDO A;  3RTW B;  5H8F A;  4Q8R A;  1FTL A;  1LBC A;  1NKX A;  1BIY A;  3JV9 A;  1L5T A;  5DYH A;  3U72 A;  2NXO A;  3WAE A;  2ONK E;  2XXX A;  1HSL A;  1N84 A;  2P0S A;  3IK6 B;  1B9J A;  4OET A;  3OO7 A;  5J1D A;  2Z23 A;  5I58 A;  1S50 A;  2A5T B;  1Y3N A;  2M8C A;  4FIM A;  4MLV A;  5CC2 A;  3VVE A;  1GR2 A;  1SW2 A;  2A5T A;  3QUJ A;  4JDF A;  3K0V A;  1SYI A;  1NNF A;  2DSF A;  3PPN A;  4DXB A;  3OMB A;  1LB9 A;  2XX7 A;  2XXU A;  4LQ5 A;  1IXI A;  3FXU A;  4FED A;  4NED A;  2XD3 A;  5ICT A;  4P0G A;  1QUJ A;  3FAS A;  4C1U A;  1II5 A;  2HAV A;  1B1X A;  3BKI B;  3ODB A;  1P1O A;  4OEN A;  5I2N B;  1M5F A;  4DE8 A;  3MUQ A;  3HST A;  3LSW A;  3RT8 A;  2GH9 A;  1B46 A;  1OQG A;  4H0W A;  1NNP A;  3MAM A;  3PPQ A;  3ONM A;  3PMW A;  1P1N A;  1QUI A;  3PUZ E;  4ISU A;  3H6T A;  4GIZ A;  4I9D A;  4OVJ A;  4R73 A;  1XVX A;  4OWD A;  4AB5 A;  4Z7E A;  1LAX A;  2ZYO A;  1PDA A;  3VXB A;  5KZT A;  3BFT A;  2RC7 A;  2Y7W A;  1PBP A;  2HZK A;  2D21 A;  1FQC A;  2HFB A;  1I6A A;  1LCT A;  3S2V A;  2X26 A;  3H6V A;  4KYD A;  3VE1 B;  2O51 A;  4YMB A;  3VFJ A;  3DP6 A;  3FVG A;  4NF8 A;  4NMY A;  3KOT A;  3H06 B;  5H8F B;  4ZE9 A;  2BJJ X;  1A8F A;  1JVX A;  5ICQ A;  1ELJ A;  3K6X A;  2FNC A;  2X7Q A;  4FJP A;  2I0B A;  2RF1 A;  4QFO A;  2DWI A;  3RT6 B;  3K1N A;  4IO6 A;  1B7H A;  5I58 B;  2ZNU A;  1DSN A;  4FE8 A;  3DLN A;  4KD5 A;  4AQ4 A;  3OEL A;  2DYX A;  2I0C A;  1H43 A;  2REJ A;  4GD5 A;  4HCY A;  1US5 A;  1B2H A;  2H98 A;  2QMW A;  4L17 A;  1VFE A;  4Q30 B;  5DT6 A;  3RPW A;  3RTF B;  1EH3 A;  1NH8 A;  4RXL A; 
#chains in the Genus database with same CATH topology
 4AS5 A;  3G3G A;  4R75 A;  3H6U A;  1MM7 A;  5IM2 A;  4U23 A;  1YPN A;  5CMC A;  4TQU Q;  3PD8 A;  1IQ7 A;  1H45 A;  4G68 C;  1MS7 A;  1WOD A;  1R1N A;  1DOT A;  1ZLQ A;  3WAF A;  3GLB A;  3OOA A;  2MKZ A;  3T9X B;  2PCR A;  2UVJ A;  2VT5 A;  3KGC A;  2NWJ A;  1Y1M A;  2I49 A;  2F8D A;  4EUO A;  2E1S A;  1MQH A;  3I5O A;  1TT1 A;  4DCX A;  3PV0 E;  4JBZ A;  5IZZ A;  4JWO A;  4K3F A;  4OVT A;  4NF5 A;  4RJZ A;  1FBH A;  2VPO A;  3S9M C;  4BDQ A;  4OA4 A;  3IO4 A;  3L6G A;  1MM6 A;  1I69 A;  4MF3 A;  1Z7M E;  3LR1 A;  4PFY A;  3KEI A;  5I57 B;  1IME A;  4RK9 A;  2QVR A;  2I3W A;  4EQB A;  1ZMG A;  1XI6 A;  3SEY A;  2Q74 A;  2P3V A;  1B51 A;  4PGP A;  2PBW A;  1K9Y A;  1NNK A;  4I1D A;  2WBB A;  4X9T A;  1UTH A;  3W9W A;  4X1B A;  3HFU A;  1N76 A;  2WX9 A;  3FVO A;  5I2K A;  3VVF A;  4GWW A;  3IOV A;  1NI9 A;  1B7Z A;  3ZSF A;  4NF0 A;  1RDX A;  1NV6 A;  4H8I A;  3C31 A;  3JYR A;  1JVY A;  3C34 A;  3NOH A;  4YKP A;  4ZEB A;  3EPE A;  1QJM A;  3K6U A;  3S4U A;  2XXK A;  3G3K A;  2QPQ A;  4IGR A;  1D9Q A;  3R6U A;  4GRK A;  3HV1 A;  4TLL B;  1AWB A;  4G2Z A;  4NWD A;  2KLF A;  3MC2 A;  2B3F A;  4EF1 A;  3W15 C;  4HTG A;  2HPG A;  4O3A A;  3SEV A;  3U65 A;  5H8N A;  4PFI A;  3KBZ A;  1R9Q A;  2CZK A;  4OMB A;  2L5V A;  3UOR A;  4I3E A;  1BKA A;  5IAI A;  4TLM B;  5FHM A;  4YB5 A;  1MG1 A;  2B65 A;  4ZE8 A;  4DZ1 A;  3GBA A;  4FBP A;  3Q27 A;  1FPI A;  1LAF E;  5EQ7 A;  1UIV A;  4OHN A;  3RYD A;  1QKB A;  4OVQ A;  4PFW A;  2QJE A;  5TP9 A;  1MDP 1;  3OSQ A;  1JW5 A;  4F29 A;  3SEX A;  3LSF B;  4NN3 A;  2F34 A;  3HPI A;  5H8S A;  4GX4 A;  5KDT A;  1ZIU A;  1EU8 A;  3SES A;  4NTL A;  4R6Y A;  3QSL A;  1OLC A;  5L9O A;  1N04 A;  3HCQ A;  5I2K B;  1MQG A;  2F7B A;  2HAU A;  2IA4 A;  2I6E A;  4OEU A;  4E0X A;  2XHD A;  4O3C A;  1B6H A;  4YIC A;  3LSX A;  5AA4 A;  4PGN A;  1A55 A;  3MPL A;  4GF8 A;  3OD7 A;  3V89 B;  4PAF A;  3IB0 A;  5H8Q B;  3K2D A;  2XXI A;  4G8H A;  4ZEI A;  3TTK A;  5EQA A;  2VHA A;  1M5D A;  3G3I A;  4U1Z A;  1UQW A;  3LBS A;  4U22 A;  1SQY A;  2HXR A;  4QFN A;  3K6V A;  1B5H A;  4OTE A;  4H45 A;  5I56 A;  2F6P A;  3MST A;  1LLS A;  4XEQ A;  3QUF A;  1SW5 A;  5DVF A;  4RK2 A;  1DCU A;  3LUY A;  3N6T A;  3G3H A;  2ZZW A;  3FUZ A;  4QFL A;  4H6D A;  5I84 A;  1MQJ A;  5AA4 B;  1XOC A;  2HQ0 A;  5T3J A;  1EZ9 A;  1LCF A;  1MY4 A;  1NUW A;  1PB7 A;  4QBA A;  1B3H A;  1LB8 A;  5F7V A;  3ROJ A;  3TTL A;  3PPR A;  2Y84 A;  3EHU A;  2NOO A;  4O7M A;  2OBG A;  2H25 A;  4N4U A;  4ZS9 A;  1XS5 A;  2F7A A;  3OXN A;  5KDT B;  1B40 A;  1H44 A;  1OVB A;  2AL5 A;  4OFL A;  1RKM A;  2A5S A;  3TMG A;  4YKJ A;  2DDK A;  3VV5 A;  4EQ9 A;  1FBC A;  4ESX A;  2QS1 A;  3EF7 A;  3C36 A;  2OLB A;  3H3G A;  3TTM A;  3MZB A;  4BDR A;  3MP1 A;  4JVI A;  3PD9 A;  4QSD A;  3N94 A;  4I40 A;  3O2A A;  1SW1 A;  4WXJ A;  1XC1 A;  1SYH A;  3EN3 A;  1SW4 A;  3C33 A;  3OEM A;  3RY3 A;  2F7C A;  1MXW A;  3HN0 A;  4IO7 A;  2BJI A;  2V3U A;  4DI4 B;  1GVC A;  4O7I A;  2RC8 A;  2V3Q A;  3PU5 A;  1FBP A;  2DWA A;  5JTY B;  3B6T A;  2V25 A;  4GL8 A;  4X8R A;  4ND9 A;  3WAE A;  2NXO A;  2P0S A;  4MLV A;  4OVP A;  3VVE A;  2A5T A;  3QUJ A;  4JDF A;  3K0V A;  1SYI A;  2DSF A;  1KA0 A;  1LB9 A;  3PTY A;  4FED A;  1YYZ A;  1QUJ A;  4C1U A;  3BKI B;  1P1O A;  5I2N B;  3RT8 A;  3PPQ A;  3TCH A;  4OVJ A;  1P1N A;  1VDW A;  1XVX A;  4HE1 A;  2HZK A;  2HFB A;  1LCT A;  3S2V A;  2O51 A;  3DP6 A;  4NMY A;  2PFY A;  3E78 A;  2OWZ A;  2RF1 A;  4QFO A;  4IO6 A;  5I58 B;  1DSN A;  4FE8 A;  5AA2 A;  3OEL A;  1US5 A;  2FVZ A;  3RPW A;  1DBZ A;  1QGX A;  4Q30 B;  1NUY A;  3T0J A;  2XXU A;  2OK2 A;  3FJ7 A;  4EXK A;  5JK4 A;  1DPP A;  3USD A;  4N91 A;  5L9S A;  2CZH A;  1P99 A;  3MJN A;  3SKP A;  3OO8 A;  2FIX A;  4IR8 A;  5IZ1 A;  2XXW A;  4QRZ A;  3OEN A;  1IIW A;  1N3W A;  2WKY A;  4ESW A;  2V84 A;  1MXY A;  1LFI A;  2VD2 A;  3TTR A;  3N6U A;  4HW8 A;  1ANF A;  3TCF A;  2ZZV A;  3IB1 A;  1DTG A;  2YLN A;  4GQO A;  4LZ8 A;  2E0S A;  1H76 A;  3ILT B;  2KR0 A;  5EQ9 A;  4IO2 A;  1USY H;  4F1U A;  5AA3 A;  4P56 A;  3ECR A;  3R26 A;  2XWK A;  2QRY A;  5AA1 A;  4BDL A;  3DP8 A;  3U8Q A;  1FQE A;  2ZNT A;  2P2A A;  3T66 A;  1D3K A;  4FEB A;  5BUU A;  2DE2 A;  4QXD A;  1H3D A;  5L8D A;  2RCA A;  3IAZ A;  4KQP A;  4YMA A;  5KCJ A;  4N6P A;  1B58 A;  2O7U A;  3GXA A;  4U21 A;  3G7W A;  3FV2 A;  1JEU A;  3QMF A;  2ZYN A;  2CMO A;  2I4C A;  5DVJ A;  3VLU A;  3O6G A;  1AOV A;  1F9B A;  2R6G E;  1LFH A;  4NQ8 A;  3KSX A;  1Q35 A;  1G0H A;  4ECF A;  4NGU A;  3T22 A;  1UTB B;  2ESN A;  3TZA A;  3V5A A;  4H46 A;  3MQ9 A;  4GFR A;  2Y7P A;  2DVZ A;  3TPA A;  4ELO A;  4H5G A;  3FV1 A;  4OEV A;  2I4B A;  3OO6 A;  5AA2 B;  2ONS A;  5I7I A;  2P3N A;  4LP2 B;  1IMC A;  1POT A;  3K02 A;  4F3B A;  4IO3 A;  2PMS A;  3H6W A;  5F24 A;  4I3Y A;  4XTC Q;  2GHA A;  2VP1 A;  1TFA A;  3FGS A;  2O7I A;  3A09 A;  4F3S A;  1XHY A;  4NX1 A;  3V8X B;  4N17 A;  2I3V A;  1FTO A;  1N7X A;  4XIG Q;  5ELV A;  5L9M A;  1M5B A;  1N3X A;  1Z7N E;  2I58 A;  4H8J A;  4FAJ A;  1S9T A;  5H8H A;  4G68 B;  1QUL A;  5HM4 B;  1MY0 A;  3MPK A;  1VE4 A;  4UAB A;  2G93 A;  3KN3 A;  4P47 A;  4PBH A;  3CFX A;  4PDD A;  1RYO A;  4PFB A;  4DCY A;  1PC3 A;  3Q29 A;  1D9V A;  3PGF A;  4BLA A;  5I56 B;  4GOT A;  4XFE A;  3SZP A;  1J1N A;  4ZEF A;  3OSR A;  1NV5 A;  3IOT A;  3DM0 A;  3T9H B;  4EF2 A;  4XKQ A;  2PT1 A;  4PET A;  2Y5K A;  3HHG A;  2Y7K A;  2FBP A;  3KZG A;  1PEB A;  1A7L A;  1SI1 A;  1GTK A;  4R6H A;  2HXW A;  4XKN A;  3RPL A;  3UA8 A;  1IXH A;  3RN8 A;  4QFK A;  3UK4 A;  5ITP A;  1ZJL A;  4P9K A;  2H4I A;  2V3T A;  3BFU A;  1T0K A;  2ABH A;  1VFD A;  1US4 A;  2FIE A;  4QHQ A;  2DS9 A;  3N26 A;  4U4X A;  3FD3 A;  4YKI A;  1A40 A;  1I6B A;  4PCD A;  4WEP A;  4KYE A;  2YJP A;  4RA1 A;  1B05 A;  4JB7 A;  1URG A;  3MWB A;  3UP9 A;  3C4M A;  1ZKB A;  3MP6 A;  2GFE A;  3MZ9 A;  4BDM A;  1GGG A;  1FQA A;  1ZBM A;  3CI8 A;  1GV8 A;  3MBP A;  1JQF A;  3LV0 A;  4F1V A;  3LC8 A;  4P0I A;  4E0W A;  5HBC A;  3IOU A;  1JP4 A;  3O66 A;  1PB9 A;  2RIN A;  4LA9 A;  2THI A;  3B50 A;  5FHO A;  5DVI A;  4KFQ A;  4F2O A;  2Z8E A;  3KC0 A;  3MVX A;  4KCC A;  3KG2 A;  3PUV E;  2V93 A;  2DVC A;  2UYE A;  4OFJ A;  3MVZ A;  2Q89 A;  4HE2 A;  1MRP A;  1P1W A;  3S9N C;  1N0T A;  3CG1 A;  1MH3 A;  2FA7 A;  2WEF A;  4NF6 B;  3K4U A;  2ZYK A;  3E4R A;  4PTK A;  2Y7I A;  2HZL A;  4F2Q A;  3EKI A;  4NG7 A;  5I57 A;  5TU0 A;  2UYF A;  4OQO A;  1MPC A;  4IY5 A;  2B4L A;  4MIJ A;  1S7Y A;  4MBP A;  2XX8 A;  3SER A;  3TTN A;  3CSG A;  5CMM A;  1AH5 A;  3B6Q A;  1B5J A;  1IMF A;  2OWS A;  4MFI A;  3PUW E;  1YXI A;  4RY1 A;  3VVD A;  4OZ9 A;  4R74 A;  4RNS A;  1I6Q A;  5EHS A;  4GWU A;  4U2R A;  3O29 A;  4ZEK A;  4EDP A;  1SI0 A;  3K6W A;  1KZ8 A;  1A99 A;  3LSL A;  1R9L A;  3B6W A;  1QKA A;  1TWY A;  1IZ1 A;  4MMP A;  2LAO A;  1FPF A;  2XXR A;  3IFA A;  5H8Q A;  1Y3P A;  4EQ7 A;  2XWV A;  4MNC A;  4X04 A;  5FTI A;  4N15 A;  5TPA B;  5JTY A;  2PYY A;  4F22 A;  1N7W A;  3C32 A;  1FPB A;  1FPG A;  4Q8R A;  1LBC A;  1L5T A;  3JV9 A;  2XXX A;  1HSL A;  4OET A;  5J1D A;  3OO7 A;  2Z23 A;  5I58 A;  1S50 A;  4FIM A;  1Y3N A;  2M8C A;  1SW2 A;  3PPN A;  2XX7 A;  4LQ5 A;  1IXI A;  3FAS A;  4PC9 A;  3HST A;  3LSW A;  4KXP A;  4H0W A;  3ONM A;  3PMW A;  3PUZ E;  4PAI A;  4R73 A;  4Z7E A;  2ZYO A;  2RC7 A;  2Y7W A;  1PBP A;  1FQC A;  1I6A A;  2GQ1 A;  3H6V A;  3MYU A;  1LBV A;  1FJ9 A;  4YMB A;  3VFJ A;  4NF8 A;  5H8F B;  2BJJ X;  2XWI A;  4NAP A;  2FNC A;  2X7Q A;  1B7H A;  3DLN A;  4AQ4 A;  4GD5 A;  2REJ A;  4L17 A;  1EH3 A;  4IY6 A;  3E3K A;  2H9B A;  3CFZ A;  4YB6 A;  3RUM A;  1NUZ A;  1IIT A;  1LAH E;  1YZ0 A;  3RGY A;  2YPN A;  1UTB A;  3H4Z A;  3UIF A;  3MZ1 A;  1FTK A;  3FBP A;  3PUX E;  2F35 A;  5ET8 A;  2ZNS A;  1NNT A;  4O94 A;  1K9Z A;  3K01 A;  4PF6 A;  5HPQ A;  1QW0 A;  3FAT A;  4POW A;  5CRY A;  1MQD A;  1B3F A;  1PB8 A;  5AE4 A;  2I48 A;  4JWY A;  4LVQ A;  1FJ6 A;  4WED A;  5A5X A;  1WDN A;  4IO5 A;  4OYV A;  2AIX A;  4C0R A;  1ZTY A;  4R2F A;  2CZI A;  2Q2C A;  5IZ3 A;  1VR5 A;  4NWC A;  4QFP A;  3EHT A;  4KI0 E;  3DEL B;  2QS2 A;  3TQL A;  3FVK A;  1CNQ A;  4R6K A;  5ISU A;  4YZZ A;  4R72 A;  2B4M A;  1IXG A;  5ITO A;  2XXT A;  1MY1 A;  3ISP A;  1B32 A;  4GWY A;  5KCJ B;  1NV4 A;  2DXY A;  1FPK A;  4PE5 B;  3TDJ A;  1XT8 A;  1OQH A;  4X1D A;  1A54 A;  2PT2 A;  4MHF A;  3ZKL A;  1O7T A;  5CBR A;  4KR5 A;  5K2Y A;  4OXV A;  4U4S A;  2WYK A;  4JSO A;  4THI A;  4YU0 A;  4YB7 A;  4NF8 B;  1FBG A;  5CMB A;  5J16 A;  1Y9U A;  3FXQ A;  4H1X A;  2WBD A;  2V4C A;  2WYP A;  1B3G A;  3Q26 A;  3H7M A;  1LBY A;  1POY 1;  2OCU A;  5ET6 A;  1IEJ A;  2ZXT A;  2PX1 A;  3T1B A;  4FAT A;  1FPL A;  1SBP A;  3U92 A;  2NVU B;  1JW1 A;  4LN5 A;  3W9V A;  3CVG A;  1MH4 A;  2R8T A;  3O6H A;  1NV3 A;  5K2X A;  4JWX A;  4F31 B;  1DK4 A;  1WVJ A;  3TEL A;  3FXR A;  3LUZ A;  4HS7 A;  3RPL B;  1FPD A;  3VDF A;  2HCA A;  4N81 A;  2GHB A;  3ZS6 A;  3K1M A;  3P7I A;  3TCG A;  3SEW A;  4G77 A;  2Y5L A;  2Z22 A;  3IOW A;  3F11 A;  3OEK A;  3T93 B;  3TEP A;  3TQW A;  1FBF A;  1OIB A;  1EZO A;  3TOD A;  1NV0 A;  3GYY A;  1FQF A;  1FPJ A;  1LBB A;  1BK4 A;  1JEV A;  4YKK A;  2CZL A;  2R9J A;  1LEV A;  4KHZ E;  4M1V A;  1AL3 A;  5TP9 B;  5EQ8 A;  3PPP A;  5F1Q A;  4TOZ A;  1YCJ A;  3D1R A;  4NF4 A;  4PFR A;  1KWH A;  5JEI A;  1IUD A;  4P11 A;  3KBR A;  4C1T A;  2AL4 A;  3IR1 A;  4ONY A;  4OVR A;  3C35 A;  5DTB A;  5EYF A;  4RPO A;  3U1O A;  5I2N A;  4OFO A;  3IJX B;  4N8G A;  1XVY A;  2RC9 A;  4ZED A;  3E9X A;  4NF6 A;  3I6V A;  3O97 A;  3UGW A;  4F1Y A;  2PFZ A;  2UXA A;  2KQZ A;  2O68 A;  4I62 A;  3MW0 A;  1YTV A;  3H03 A;  2VGQ A;  4XKR A;  3BBR A;  1IMB A;  4KCD A;  3TUS A;  4IGT A;  4N13 A;  5I59 A;  1KA1 A;  1FRP A;  4MAG A;  4JSD A;  3RLF E;  1RYX A;  5DW8 A;  4EXL A;  4H67 A;  4G8N A;  1FTJ A;  2F6G A;  2DWJ A;  3KFM A;  5I5P A;  4OER A;  3CIJ A;  1FBE A;  4JVC A;  4F3G A;  4ZEC A;  1URS A;  2VOZ A;  1M5C A;  5H8H B;  1NUX A;  4G68 A;  4F18 A;  1DPE A;  2ZZX A;  5ET5 A;  3KN7 A;  3MVW A;  4LON B;  4KPT A;  3BIH A;  3GZG A;  1UTH B;  2QL3 A;  3UN6 A;  1NFT A;  2R71 A;  1DMB A;  1G0I A;  4POX A;  4NF4 B;  1NV2 A;  3QYT A;  1EZP A;  1NL5 A;  2VD3 A;  2RKM A;  3TAJ A;  3CSB A;  1B0L A;  4G8M A;  4N6K A;  2QVV A;  4GWS A;  1B5I A;  2B3B A;  4P1L A;  4LZ5 A;  5FBP A;  4OAN A;  4XF5 A;  4JVD A;  4M4G A;  5BWJ A;  2OJT A;  4MCO A;  3O6I A;  2F78 A;  4Q0C A;  2QMX A;  1CE2 A;  1LBX A;  5LOM A;  3T9U A;  2CEX A;  1NMU A;  1RDY A;  5EHM A;  1OVT A;  5IGA A;  1IMD A;  1P1U A;  1D9Y A;  4HXV A;  4PDH A;  5A5L A;  4LUB A;  1HSE A;  4LAT A;  4PP0 A;  2Q8M A;  1INP A;  1B52 A;  1O63 A;  5CM6 A;  3KJT A;  4GWX A;  1FTM A;  2Z8D A;  1OMP A;  2H5Y A;  3KJ7 A;  1Q9D A;  2UVI A;  4ELP A;  1BP5 A;  1SPI A;  1MQI A;  2Q88 A;  5LDZ A;  1FW0 A;  3A3C A;  3D4C A;  3IJO B;  2UVH A;  4G4P A;  2CEY A;  1EYK A;  2ONR A;  3MP8 A;  4AS4 A;  5H8F A;  1FTL A;  1NKX A;  1BIY A;  5DYH A;  2ONK E;  1N84 A;  3IK6 B;  1GR2 A;  4OVS A;  3FXU A;  4NED A;  5LTC A;  1II5 A;  3ODB A;  4OEN A;  4DE8 A;  2GH9 A;  1B46 A;  1OQG A;  3RTW B;  1QUI A;  4I9D A;  4AB5 A;  1LAX A;  3BFT A;  4N6D A;  4KYD A;  3VE1 B;  3FVG A;  3KOT A;  3H06 B;  1JVX A;  3RT6 B;  3K1N A;  4HE0 A;  4KD5 A;  2DYX A;  2I0C A;  1H43 A;  1B2H A;  3RTF B;  1NH8 A;  1FPE A;  1OLA A;  3L6H A;  2O1L A;  4GLI A;  5IZ3 B;  4WKM A;  4P3L A;  4DLD A;  2XXY A;  3D4G A;  1Y1Z A;  1MDQ A;  1AMF A;  4QSC A;  1USY E;  2XWO A;  3QIM A;  3B7D A;  5I3S A;  2DE3 A;  3CG3 A;  3M8U A;  1MXX A;  3IO6 A;  1MXZ A;  2HEU A;  3PMX A;  4MNI A;  4R2B A;  3RNN A;  3HHF A;  4GX6 A;  3ILU B;  3C9H A;  3M3K A;  2O84 X;  3M3L A;  2OX3 A;  1B4H A;  2Y7R A;  4JXI A;  3FJM A;  1IMA A;  1MXU A;  1FTA A;  3K00 A;  2RCB A;  3SDF A;  4YAH X;  4PAK A;  3IL1 B;  1B0H A;  4NE4 A;  2OZZ A;  4F19 A;  2ALU A;  3FJG A;  4I8C A;  3U93 A;  4GWO A;  5B70 A;  4PF8 A;  4GX3 A;  1MPD A;  3JZJ A;  1EYI A;  2XXH A;  3I3V A;  1BTJ A;  1MPB A;  5DEX B;  5CMK A;  3QXM A;  3S9L C;  4MNP A;  4ZZE A;  3M3F A;  1FQB A;  1ZU0 A;  1URD A;  4ELR A;  4GXS B;  4NF5 B;  1LST A;  1SDX A;  3QAX A;  2W7Y A;  4U1O A;  1Y20 A;  1HSJ A;  5EYH A;  5AA2 D;  1PBQ A;  2DWH A;  1RDZ A;  3O28 A;  4DXU A;  3E79 A;  4AB6 A;  2IEE A;  3MVY A;  2QS3 A;  4QF9 A;  4UAC A;  1A8E A;  1Y4T A;  2XX9 A;  1FQD A;  1LFG A;  1Q1K A;  5ET7 A;  4GVO A;  3HO7 A;  2DXR A;  2REG A;  3A3U A;  5DEX A;  5CBS A;  4PFU A;  1TFD A;  2FHY A;  4MLQ A;  1IXC A;  3FZV A;  2XA5 A;  1DTZ A;  2F97 A;  4N07 A;  1EYJ A;  1MXV A;  4F3P A;  3FXB A;  4ELQ A;  5H8N B;  2O69 A;  1Y4C A;  2JJK A;  2Q9T A;  4KYS A;  3SEU A;  2AYS A;  3THI A;  1ATG A;  4HCW A;  1MY3 A;  1D4N A;  1B3L A;  5A5X B;  3ZKK A;  3FIR A;  2GRV A;  4O3B A;  4IB2 A;  2D5W A;  1JET A;  4X48 A;  4UA8 A;  5FTH A;  4MH5 A;  2XXP A;  3OO9 A;  4DI3 D;  2XXQ A;  1SD3 A;  2FYI A;  2O6A A;  4MEV A;  5CI5 A;  1FCK A;  2Z8F A;  1O64 A;  3RQT A;  3PMV A;  1CB6 A;  3PUY E;  4ZZA A;  2QSX A;  4MX6 A;  2XXV A;  1JW4 A;  2DQV A;  2QVU A;  2VPN A;  3IX1 A;  1B4Z A;  2O1M A;  3GBB A;  3SET A;  3V83 A;  5ESY A;  1VSO A;  3KSJ A;  4Q5T A;  3TFL A;  4Z0I A;  3CRB A;  2ANJ A;  1QUK A;  2ZYM A;  4PQJ A;  3G3J A;  4FEC A;  4GXA A;  2ZMB A;  3IB2 A;  5EYG A;  4IO4 A;  2XD2 A;  1YAE A;  3U94 A;  5I59 B;  4ZDM A;  3AXF A;  5M2V A;  4R9F A;  3G3F A;  2G29 A;  2Q2A A;  3O9P A;  1LGB C;  1B3E A;  2Q8J A;  2P1S A;  4PBQ A;  3FVN A;  3E13 X;  3PPO A;  4P8B A;  2X7P A;  4QSE A;  5FHN A;  2F3D A;  3T96 B;  4R9G A;  4P1E A;  1UIU A;  1NH7 A;  4N8Y A;  3S9E A;  4DDD A;  2DOJ A;  4H65 A;  4OES A;  4G61 A;  4FOR A;  2HHM A;  3KOS A;  2OWT A;  4MJO A;  1M5E A;  1B1H A;  3R7X A;  4RPN A;  2D3I A;  3EQ1 A;  2DE4 A;  3VXC A;  1BLF A;  2UVG A;  4F39 A;  4DIG A;  2DP8 A;  1TXF A;  3K1P A;  2H99 A;  3Q25 A;  4H5F A;  1P1Q A;  4GWZ A;  3QK6 A;  3KN8 A;  3IFC A;  2NUV A;  2QS4 A;  4O8M A;  5B7D A;  1B7U A;  1JNF A;  1MY2 A;  2F5X A;  3IOR A;  2F36 A;  1QVS A;  3EHS A;  1Y3Q A;  2F3B A;  4PFT A;  3TYH A;  1LAG E;  3A29 A;  3VLW A;  3TKD A;  1FBD A;  4XXU A;  1SVX B;  3CHG A;  4GL0 A;  5TPA A;  3T9V A;  1AIV A;  3DP4 A;  3CR9 A;  3N5L A;  4XKP A;  2PVU A;  5IKB A;  1NV1 A;  1R6Z A;  3Q28 A;  3VLV A;  4LZ7 A;  4LQ2 A;  4DXC A;  3CFL A;  1NV7 A;  3KC1 A;  4RYA A;  4BDO A;  1FSA A;  4GBW A;  2QFL A;  3U72 A;  1B9J A;  4PE3 A;  2A5T B;  4NHB A;  5CC2 A;  1LBZ A;  1NNF A;  4DXB A;  3OMB A;  3BIG A;  2XD3 A;  5ICT A;  4P0G A;  2HAV A;  1B1X A;  1M5F A;  3MUQ A;  1NNP A;  3MAM A;  4ISU A;  4BDN A;  3H6T A;  4GIZ A;  4GBV A;  4OWD A;  1LBW A;  1PDA A;  5KZT A;  3B8B A;  2D21 A;  2X26 A;  4ZE9 A;  1A8F A;  5ICQ A;  1ELJ A;  3K6X A;  4FJP A;  2I0B A;  2DWI A;  2ZNU A;  3VXB A;  4HCY A;  2H98 A;  2QMW A;  5DT6 A;  1VFE A;  4RXL A; 
#chains in the Genus database with same CATH homology
 1OLA A;  4IY6 A;  2OK2 A;  2O1L A;  3L6H A;  3FJ7 A;  4GLI A;  4EXK A;  5JK4 A;  1DPP A;  4WKM A;  5L8D A;  3USD A;  3E3K A;  2H9B A;  3G3G A;  4R75 A;  2XXY A;  4DLD A;  3CFZ A;  3D4G A;  1MM7 A;  3H6U A;  4U23 A;  1Y1Z A;  1MDQ A;  4YB6 A;  3RUM A;  5L9S A;  1IIT A;  1AMF A;  1LAH E;  1YPN A;  5CMC A;  4TQU Q;  4QSC A;  3PD8 A;  1P99 A;  3RGY A;  1IQ7 A;  1USY E;  2YPN A;  1UTB A;  3H4Z A;  3MJN A;  1H45 A;  3QIM A;  4G68 C;  1MS7 A;  3OO8 A;  1WOD A;  3SKP A;  1R1N A;  3UIF A;  2XXW A;  3B7D A;  4QRZ A;  1DOT A;  3OEN A;  1IIW A;  1ZLQ A;  2DE3 A;  3CG3 A;  1FTK A;  1MXX A;  3IO6 A;  1N3W A;  3M8U A;  3MZ1 A;  3PUX E;  2WKY A;  2F35 A;  3GLB A;  3OOA A;  4ESW A;  2V84 A;  1MXZ A;  1MXY A;  1LFI A;  3T9X B;  2ZNS A;  1NNT A;  2HEU A;  3PMX A;  3K01 A;  5HPQ A;  2VD2 A;  3TTR A;  3N6U A;  1QW0 A;  3FAT A;  4POW A;  4R2B A;  3RNN A;  2UVJ A;  4HW8 A;  3HHF A;  1ANF A;  5CRY A;  3KGC A;  3TCF A;  1MQD A;  3ILU B;  2NWJ A;  3C9H A;  1Y1M A;  3M3K A;  1B3F A;  2O84 X;  3M3L A;  1PB8 A;  1DTG A;  2YLN A;  3IB1 A;  4GQO A;  1B4H A;  4LZ8 A;  2E0S A;  1H76 A;  3ILT B;  4ELO A;  5AE4 A;  2I48 A;  2Y7R A;  2I49 A;  2F8D A;  4JXI A;  4JWY A;  4EUO A;  4LVQ A;  2E1S A;  1MQH A;  3FJM A;  3I5O A;  4WED A;  4IO2 A;  1TT1 A;  1USY H;  1WDN A;  3PV0 E;  4IO5 A;  4JBZ A;  4DCX A;  4F1U A;  5A5X A;  3ECR A;  1MXU A;  3R26 A;  5AA3 A;  4JWO A;  2QRY A;  4K3F A;  4OYV A;  2AIX A;  4NF5 A;  5AA1 A;  4C0R A;  4RJZ A;  4BDL A;  3K00 A;  3DP8 A;  1ZTY A;  2RCB A;  3U8Q A;  4R2F A;  1FQE A;  2Q2C A;  4BDQ A;  3S9M C;  1VR5 A;  4NWC A;  4QFP A;  2ZNT A;  3SDF A;  2P2A A;  3EHT A;  4KI0 E;  3T66 A;  1D3K A;  3IO4 A;  3L6G A;  4FEB A;  3DEL B;  1MM6 A;  4YAH X;  1I69 A;  2QS2 A;  3TQL A;  3FVK A;  3IL1 B;  1B0H A;  4R6K A;  4NE4 A;  2OZZ A;  4MF3 A;  5BUU A;  2DE2 A;  4F19 A;  5ISU A;  1H3D A;  2ALU A;  1Z7M E;  3FJG A;  3LR1 A;  4I8C A;  4GWO A;  2RCA A;  4R72 A;  3IAZ A;  4KQP A;  4YZZ A;  1IXG A;  1MPD A;  3JZJ A;  4YMA A;  5KCJ A;  4N6P A;  5ITO A;  4PFY A;  2XXH A;  3I3V A;  1B58 A;  2XXT A;  1BTJ A;  1MPB A;  1MY1 A;  1B32 A;  3KEI A;  5KCJ B;  5I57 B;  5DEX B;  5CMK A;  3QXM A;  2O7U A;  3GXA A;  4RK9 A;  2DXY A;  4U21 A;  3G7W A;  3FV2 A;  2I3W A;  4EQB A;  1ZMG A;  4PE5 B;  3S9L C;  1JEU A;  3TDJ A;  1XT8 A;  1OQH A;  2ZYN A;  4X1D A;  3SEY A;  2CMO A;  4ZZE A;  2I4C A;  1B51 A;  5DVJ A;  1A54 A;  2PBW A;  3VLU A;  2PT2 A;  3ZKL A;  3M3F A;  1FQB A;  1O7T A;  3O6G A;  1AOV A;  1F9B A;  1ZU0 A;  2R6G E;  5CBR A;  1LFH A;  1NNK A;  1URD A;  4I1D A;  4KR5 A;  5K2Y A;  4OXV A;  4GXS B;  4U4S A;  4ELR A;  3KSX A;  4JSO A;  1Q35 A;  4X9T A;  1UTH A;  4NF5 B;  5AA2 A;  3W9W A;  4X1B A;  4THI A;  1LST A;  1N76 A;  4YU0 A;  4ECF A;  1SDX A;  3T22 A;  3QAX A;  4NF8 B;  4YB7 A;  1UTB B;  2W7Y A;  4U1O A;  1Y20 A;  2ESN A;  3TZA A;  3V5A A;  5CMB A;  3MQ9 A;  1Y9U A;  2Y7P A;  2DVZ A;  3FVO A;  4GFR A;  3FXQ A;  1HSJ A;  3TPA A;  3VVF A;  4H5G A;  5I2K A;  3FV1 A;  3IOV A;  4H1X A;  4OEV A;  1B7Z A;  2I4B A;  5AA2 D;  3OO6 A;  1B3G A;  2DWH A;  1PBQ A;  3ZSF A;  5AA2 B;  3Q26 A;  2ONS A;  3O28 A;  3H7M A;  4DXU A;  3TTL A;  1POY 1;  4LP2 B;  1POT A;  4AB6 A;  2IEE A;  2OCU A;  3K02 A;  4H8I A;  1IEJ A;  3C31 A;  2ZXT A;  2PX1 A;  4F3B A;  3JYR A;  4FAT A;  3MVY A;  1SBP A;  2PMS A;  4IO3 A;  2NVU B;  1JW1 A;  3U92 A;  2QS3 A;  3H6W A;  1JVY A;  3C34 A;  4QF9 A;  4UAC A;  3CVG A;  1MH4 A;  3W9V A;  4YKP A;  1A8E A;  1Y4T A;  4ZEB A;  3EPE A;  3O6H A;  2XX9 A;  1FQD A;  1QJM A;  3K6U A;  4JWX A;  4XTC Q;  5K2X A;  2GHA A;  3S4U A;  4F31 B;  1LFG A;  1Q1K A;  1WVJ A;  2QPQ A;  2VP1 A;  3G3K A;  3TEL A;  1TFA A;  3FGS A;  3FXR A;  4IGR A;  2O7I A;  3A09 A;  4GVO A;  4HS7 A;  3HO7 A;  2DXR A;  3VDF A;  2HCA A;  4F3S A;  1XHY A;  2REG A;  3A3U A;  5DEX A;  5CBS A;  4PFU A;  3R6U A;  1TFD A;  2I3V A;  3V8X B;  1FTO A;  1N7X A;  3HV1 A;  4GRK A;  4MLQ A;  4XIG Q;  5ELV A;  5L9M A;  1IXC A;  4TLL B;  1M5B A;  1N3X A;  1Z7N E;  3FZV A;  4G2Z A;  4NWD A;  2KLF A;  2I58 A;  1DTZ A;  2GHB A;  2F97 A;  4H8J A;  4FAJ A;  3ZS6 A;  1S9T A;  3MC2 A;  4N07 A;  5H8H A;  1MXV A;  3K1M A;  4G68 B;  3P7I A;  2B3F A;  3TCG A;  3SEW A;  4EF1 A;  4F3P A;  1QUL A;  5HM4 B;  1MY0 A;  4G77 A;  3W15 C;  4ELQ A;  4HTG A;  4O3A A;  3MPK A;  1VE4 A;  3SEV A;  2G93 A;  2Z22 A;  3IOW A;  3F11 A;  3KN3 A;  5H8N B;  2O69 A;  3OEK A;  1Y4C A;  2Q9T A;  3T93 B;  4KYS A;  3SEU A;  3TEP A;  2AYS A;  3TQW A;  3THI A;  1OIB A;  5H8N A;  1ATG A;  1EZO A;  4HCW A;  3TOD A;  3CFX A;  1MY3 A;  1RYO A;  1D4N A;  1B3L A;  1R9Q A;  1FQF A;  4DCY A;  5A5X B;  1PC3 A;  1LBB A;  3ZKK A;  3FIR A;  1JEV A;  4YKK A;  2CZL A;  2R9J A;  2GRV A;  3Q29 A;  1D9V A;  4KHZ E;  4M1V A;  1BKA A;  1AL3 A;  4O3B A;  4OMB A;  3PGF A;  4IB2 A;  4TLM B;  5TP9 B;  5IAI A;  4BLA A;  5I56 B;  3PPP A;  5F1Q A;  5FHM A;  4YB5 A;  2D5W A;  1MG1 A;  4TOZ A;  1JET A;  2B65 A;  4ZE8 A;  4X48 A;  4DZ1 A;  1YCJ A;  4UA8 A;  3GBA A;  5FTH A;  4GOT A;  3Q27 A;  4NF4 A;  1J1N A;  4MH5 A;  2XXP A;  4ZEF A;  3OSR A;  3OO9 A;  1LAF E;  1KWH A;  1UIV A;  3DM0 A;  1IUD A;  3IOT A;  4P11 A;  3KBR A;  4OHN A;  5JEI A;  2XXQ A;  1SD3 A;  2FYI A;  3T9H B;  2AL4 A;  4C1T A;  4EF2 A;  2O6A A;  4XKQ A;  1QKB A;  2PT1 A;  4PET A;  4PFW A;  3IR1 A;  5CI5 A;  4ONY A;  2QJE A;  1FCK A;  2Z8F A;  3C35 A;  5TP9 A;  1MDP 1;  1O64 A;  3OSQ A;  5DTB A;  5EYF A;  1JW5 A;  3RQT A;  4F29 A;  4RPO A;  3PMV A;  3SEX A;  1CB6 A;  3LSF B;  3HHG A;  3U1O A;  3PUY E;  2Y7K A;  4ZZA A;  2QSX A;  5I2N A;  2F34 A;  2XXV A;  4OFO A;  3HPI A;  5H8S A;  1JW4 A;  2DQV A;  5KDT A;  1ZIU A;  3IJX B;  3KZG A;  1EU8 A;  3SES A;  1PEB A;  1XVY A;  1A7L A;  1SI1 A;  2RC9 A;  3IX1 A;  1GTK A;  3QSL A;  4NTL A;  4R6Y A;  1OLC A;  4R6H A;  4ZED A;  1N04 A;  5L9O A;  3HCQ A;  2HXW A;  1B4Z A;  3E9X A;  4NF6 A;  4XKN A;  5I2K B;  3I6V A;  3O97 A;  1MQG A;  2F7B A;  2HAU A;  2O1M A;  3UA8 A;  3UGW A;  3GBB A;  2IA4 A;  1IXH A;  2I6E A;  4OEU A;  4F1Y A;  3RN8 A;  2UXA A;  4QFK A;  3SET A;  4E0X A;  2XHD A;  3UK4 A;  3V83 A;  1VSO A;  4O3C A;  1B6H A;  4YIC A;  3LSX A;  3KSJ A;  5AA4 A;  5ITP A;  1ZJL A;  2H4I A;  2V3T A;  2O68 A;  1A55 A;  3BFU A;  4I62 A;  4Q5T A;  3MW0 A;  1YTV A;  1T0K A;  3H03 A;  2VGQ A;  2ABH A;  3MPL A;  4GF8 A;  1VFD A;  3OD7 A;  3BBR A;  4XKR A;  3TFL A;  3V89 B;  4Z0I A;  1US4 A;  4KCD A;  3IB0 A;  5H8Q B;  3CRB A;  2DS9 A;  3N26 A;  4QHQ A;  4U4X A;  2ANJ A;  1QUK A;  3FD3 A;  2ZYM A;  4YKI A;  3TUS A;  3TCH A;  3K2D A;  1A40 A;  1I6B A;  2XXI A;  4PQJ A;  4G8H A;  4WEP A;  3G3J A;  4FEC A;  4ZEI A;  4IGT A;  4GXA A;  4KYE A;  3TTK A;  4N13 A;  2ZMB A;  3IB2 A;  2YJP A;  4RA1 A;  1B05 A;  4JB7 A;  5I59 A;  1URG A;  3MWB A;  4IO4 A;  3UP9 A;  2XD2 A;  2VHA A;  3C4M A;  1YAE A;  1ZKB A;  3U94 A;  3MP6 A;  5I59 B;  4ZDM A;  1M5D A;  2GFE A;  3AXF A;  3G3I A;  3MZ9 A;  4BDM A;  1GGG A;  5M2V A;  4R9F A;  1FQA A;  1ZBM A;  1RYX A;  4JSD A;  4U1Z A;  1UQW A;  3CI8 A;  1GV8 A;  3RLF E;  4EXL A;  3LBS A;  3G3F A;  3MBP A;  1JQF A;  4U22 A;  1SQY A;  4H67 A;  4QFN A;  4F1V A;  2G29 A;  3LC8 A;  4P0I A;  3K6V A;  4G8N A;  1FTJ A;  1B5H A;  2Q2A A;  2F6G A;  4OTE A;  5I56 A;  3O9P A;  2DWJ A;  5HBC A;  4E0W A;  3KFM A;  2F6P A;  1LGB C;  1B3E A;  1LLS A;  3IOU A;  2Q8J A;  3QUF A;  4OER A;  3CIJ A;  4F3G A;  2P1S A;  3O66 A;  3UOR A;  4ZEC A;  1SW5 A;  1URS A;  2VOZ A;  3FVN A;  1M5C A;  1PB9 A;  3E13 X;  3PPO A;  5DVF A;  5H8H B;  2RIN A;  4RK2 A;  2X7P A;  4QSE A;  4LA9 A;  5FHN A;  3LUY A;  2THI A;  4G68 A;  3N6T A;  3G3H A;  4F18 A;  1DPE A;  5FHO A;  5DVI A;  3T96 B;  3FUZ A;  4KFQ A;  4F2O A;  3KN7 A;  4R9G A;  4QFL A;  2Z8E A;  3MVW A;  4BDN A;  4LON B;  4KPT A;  4H6D A;  1UIU A;  3GZG A;  1UTH B;  3MVX A;  5I84 A;  1MQJ A;  1NH7 A;  2QL3 A;  3UN6 A;  1NFT A;  4KCC A;  5AA4 B;  2R71 A;  3S9E A;  1DMB A;  1XOC A;  2HQ0 A;  3KG2 A;  3PUV E;  2DOJ A;  4H65 A;  4DDD A;  2V93 A;  4POX A;  4OES A;  2DVC A;  1EZ9 A;  1LCF A;  1MY4 A;  2UYE A;  4FOR A;  3MVZ A;  1PB7 A;  3QYT A;  4NF4 B;  4OFJ A;  1EZP A;  2Q89 A;  1MRP A;  1P1W A;  3KOS A;  3S9N C;  1N0T A;  2OWT A;  3CG1 A;  1B3H A;  1MH3 A;  2FA7 A;  1M5E A;  1B1H A;  1NL5 A;  4NF6 B;  1LB8 A;  5B70 A;  3K4U A;  5F7V A;  2ZYK A;  2VD3 A;  3R7X A;  3PPR A;  2Y84 A;  4RPN A;  2D3I A;  3E4R A;  2RKM A;  3EHU A;  2DE4 A;  3EQ1 A;  2NOO A;  3VXC A;  3WAF A;  2Y7I A;  3TAJ A;  3CSB A;  1BLF A;  2OBG A;  1B0L A;  2HZL A;  2UVG A;  4F2Q A;  2H25 A;  4G8M A;  4F39 A;  4DIG A;  5I57 A;  2DP8 A;  4ZS9 A;  5TU0 A;  1TXF A;  2UYF A;  2H99 A;  3K1P A;  3Q25 A;  4H5F A;  1P1Q A;  4OQO A;  3QK6 A;  1B5I A;  2B3B A;  1XS5 A;  1MPC A;  2F7A A;  4IY5 A;  3OXN A;  3KN8 A;  4LZ5 A;  5KDT B;  2NUV A;  2QS4 A;  5B7D A;  1B40 A;  1B7U A;  1H44 A;  1OVB A;  1JNF A;  1S7Y A;  2AL5 A;  4M4G A;  4MBP A;  4OFL A;  1RKM A;  2XX8 A;  3SER A;  2A5S A;  3TMG A;  3TTN A;  5BWJ A;  2OJT A;  4YKJ A;  1MY2 A;  3CSG A;  5CMM A;  1AH5 A;  2F5X A;  3IOR A;  3VV5 A;  2QS1 A;  3EF7 A;  3C36 A;  4EQ9 A;  4ESX A;  3B6Q A;  2F36 A;  1QVS A;  1B5J A;  2OLB A;  3EHS A;  2F78 A;  3H3G A;  3O6I A;  3MZB A;  4Q0C A;  2QMX A;  3TTM A;  4BDR A;  1CE2 A;  5LOM A;  2OWS A;  1Y3Q A;  3MP1 A;  3T9U A;  3PD9 A;  4MFI A;  3PUW E;  1NMU A;  4RY1 A;  3VVD A;  4QSD A;  4OZ9 A;  4PFT A;  3N94 A;  4R74 A;  4RNS A;  5EHM A;  1I6Q A;  3TYH A;  1LAG E;  5EHS A;  3VLW A;  1OVT A;  3TKD A;  3O2A A;  1P1U A;  1SW1 A;  1D9Y A;  4WXJ A;  4XXU A;  1XC1 A;  1SVX B;  1SYH A;  4LUB A;  3EN3 A;  1SW4 A;  3C33 A;  3O29 A;  3OEM A;  4U2R A;  1HSE A;  2F7C A;  1MXW A;  4GL0 A;  5TPA A;  3RY3 A;  3HN0 A;  4LAT A;  4IO7 A;  4ZEK A;  3T9V A;  4PP0 A;  4EDP A;  1SI0 A;  3K6W A;  3DP4 A;  1B52 A;  1O63 A;  3CR9 A;  1AIV A;  5CM6 A;  1A99 A;  3U93 A;  3N5L A;  3KJT A;  2V3U A;  3LSL A;  1R9L A;  4XKP A;  3B6W A;  2PVU A;  1QKA A;  1TWY A;  1GVC A;  1IZ1 A;  2RC8 A;  5IKB A;  1FTM A;  2V3Q A;  2Z8D A;  2LAO A;  1OMP A;  2H5Y A;  2XXR A;  3PU5 A;  3KJ7 A;  2DWA A;  1R6Z A;  1Y3P A;  2UVI A;  5H8Q A;  5JTY B;  4EQ7 A;  4ELP A;  3B6T A;  1BP5 A;  3Q28 A;  2V25 A;  3VLV A;  4GL8 A;  1MQI A;  4LZ7 A;  5FTI A;  2Q88 A;  4LQ2 A;  4ND9 A;  3CFL A;  5TPA B;  1FW0 A;  4DXC A;  3A3C A;  5JTY A;  2PYY A;  3D4C A;  3IJO B;  2UVH A;  4G4P A;  4F22 A;  1N7W A;  4RYA A;  2ONR A;  3C32 A;  3MP8 A;  4BDO A;  3RTW B;  5H8F A;  4Q8R A;  1FTL A;  1LBC A;  1NKX A;  1BIY A;  3JV9 A;  1L5T A;  5DYH A;  3U72 A;  2NXO A;  3WAE A;  2ONK E;  2XXX A;  1HSL A;  1N84 A;  2P0S A;  3IK6 B;  1B9J A;  4OET A;  3OO7 A;  5J1D A;  2Z23 A;  5I58 A;  1S50 A;  2A5T B;  1Y3N A;  2M8C A;  4FIM A;  4MLV A;  5CC2 A;  3VVE A;  1GR2 A;  1SW2 A;  2A5T A;  3QUJ A;  4JDF A;  3K0V A;  1SYI A;  1NNF A;  2DSF A;  3PPN A;  4DXB A;  3OMB A;  1LB9 A;  2XX7 A;  2XXU A;  4LQ5 A;  1IXI A;  3FXU A;  4FED A;  4NED A;  2XD3 A;  5ICT A;  4P0G A;  1QUJ A;  3FAS A;  4C1U A;  1II5 A;  2HAV A;  1B1X A;  3BKI B;  3ODB A;  1P1O A;  4OEN A;  5I2N B;  1M5F A;  4DE8 A;  3MUQ A;  3HST A;  3LSW A;  3RT8 A;  2GH9 A;  1B46 A;  1OQG A;  4H0W A;  1NNP A;  3MAM A;  3PPQ A;  3ONM A;  3PMW A;  1P1N A;  1QUI A;  3PUZ E;  4ISU A;  3H6T A;  4GIZ A;  4I9D A;  4OVJ A;  4R73 A;  1XVX A;  4OWD A;  4AB5 A;  4Z7E A;  1LAX A;  2ZYO A;  1PDA A;  3VXB A;  5KZT A;  3BFT A;  2RC7 A;  2Y7W A;  1PBP A;  2HZK A;  2D21 A;  1FQC A;  2HFB A;  1I6A A;  1LCT A;  3S2V A;  2X26 A;  3H6V A;  4KYD A;  3VE1 B;  2O51 A;  4YMB A;  3VFJ A;  3DP6 A;  3FVG A;  4NF8 A;  4NMY A;  3KOT A;  3H06 B;  5H8F B;  4ZE9 A;  2BJJ X;  1A8F A;  1JVX A;  5ICQ A;  1ELJ A;  3K6X A;  2FNC A;  2X7Q A;  4FJP A;  2I0B A;  2RF1 A;  4QFO A;  2DWI A;  3RT6 B;  3K1N A;  4IO6 A;  1B7H A;  5I58 B;  2ZNU A;  1DSN A;  4FE8 A;  3DLN A;  4KD5 A;  4AQ4 A;  3OEL A;  2DYX A;  2I0C A;  1H43 A;  2REJ A;  4GD5 A;  4HCY A;  1US5 A;  1B2H A;  2H98 A;  2QMW A;  4L17 A;  1VFE A;  4Q30 B;  5DT6 A;  3RPW A;  3RTF B;  1EH3 A;  1NH8 A;  4RXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...