3VVEA

Crystal structure of ttc0807 complexed with lysine
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
241
structure length
241
Chain Sequence
GGSEFQVRSFEEIKRSGEIRIGTEGAFPPFNYFDERNQLTGFEVDLGNAIAERLGLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGGPRTAKDLQGKVVGVQVGTTYMEAAQKIPGIKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKLENTLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, binding protein
publication title Two ATP-Binding Cassette Transporters Involved in (S)-2-Aminoethyl-Cysteine Uptake in Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
total genus 88
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vveA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vveA02
3O97A 1Y9UA 2GRVA 3PPOA 3LUYA 4IO4A 5H8NA 2G29A 2QL3A 1EU8A 1MQGA 4C1UA 3K01A 1UQWA 1FQDA 2Z23A 1GGGA 2D21A 3FVOA 1O63A 5CBSA 5CMMA 3H6UA 3A3CA 1IXGA 2V25A 5A5XA 2I3VA 2CZLA 3UN6A 3A09A 5AE4A 1OIBA 3QIMA 3V5AA 4EDPA 3N6UA 4BDLA 1MXXA 4O3CA 4FECA 2XX9A 1DOTA 2M8CA 2RCBA 2I58A 5EYFA 1B3HA 2R9JA 3K2DA 5DTBA 4PP0A 3U92A 2FA7A 3MUQA 3MZ9A 2AL4A 4EXLA 2XXWA 4U21A 1GVCA 3O9PA 1DPEA 3RTWB 1QJMA 3BFUA 2CMOA 2GFEA 1PB9A 2NOOA 1D3KA 1SW5A 1OQHA 3CIJA 4R9FA 4LZ7A 2XXPA 4E0WA 1LCFA 1LB9A 3SERA 1ELJA 5TP9A 4YKIA 4KCDA 3OO7A 4ZEBA 4DLDA 3C36A 1MXWA 4HS7A 2YLNA 2OK2A 3IO4A 4ZE9A 2YJPA 4POXA 3KJ7A 1QUKA 3MP6A 1BTJA 4PQJA 3WAEA 5ICTA 3VLVA 3ZS6A 3VFJA 1MQHA 1AIVA 2H98A 4LATA 2O68A 2X26A 5M2VA 3C34A 4DZ1A 4NF8A 2D3IA 2F5XA 1IXCA 3O66A 2QRYA 1Q35A 4YU0A 1JW5A 1SW2A 3IOTA 4GFRA 3U72A 2XXRA 4F31B 2AIXA 4NWCA 3CFZA 1SD3A 3UA8A 2H25A 3KOSA 3FVGA 4HCWA 4GIZA 1H3DA 2DP8A 2WKYA 3C4MA 3CG3A 4FE8A 4I62A 1NNTA 1B7UA 1MXYA 2XXVA 1A99A 2GHAA 1B0LA 1MRPA 1P1OA 3MZBA 5FHNA 1XC1A 3FJMA 5H8SA 1NH7A 2DWHA 1LGBC 4GD5A 1ZIUA 2XX7A 1LFIA 1BIYA 1S9TA 3U8QA 4ISUA 3TELA 1M5BA 1BLFA 2Y7KA 3SEWA 1LB8A 2Z8DA 3TKDA 3TEPA 1WDNA 4DXCA 2F78A 4IO3A 2F7AA 1AMFA 5I2KB 1DMBA 1MY0A 3M3FA 3H6WA 1SI0A 4ELOA 4KR5A 1NMUA 1P1NA 3HHGA 3N6TA 2ZXTA 4EQ9A 2VGQA 1LAFE 3B6QA 4EXKA 3LR1A 4GOTA 4OESA 5AA2D 1I6QA 4YKPA 1B58A 4H65A 1JNFA 4LVQA 2P2AA 2OZZA 3U93A 3AXFA 3FASA 2I4CA 4EUOA 3Q26A 4NF5B 2DSFA 1MY4A 2XXIA 2GH9A 4RNSA 2LAOA 4NF4B 2E1SA 4TLMB 5AA4B 1D9VA 3OO9A 3V89B 4R2FA 4BDOA 5EHSA 3PUYE 3VXCA 3ONMA 4FORA 1M5DA 3PMVA 3UK4A 4TLLB 3G3GA 3SEXA 2Q88A 3T22A 1EH3A 3VLWA 3L6HA 3I3VA 1UTBA 1MQIA 5ITPA 2Z8FA 2VHAA 1A55A 1US5A 3B6TA 3OELA 3K02A 3IB2A 1FCKA 1VFEA 4LQ2A 1MY2A 3KN8A 4LA9A 3G7WA 4RY1A 1ANFA 5L9OA 1EZPA 4E0XA 1B5HA 1UIUA 1USYE 4FAJA 1Y4TA 3FXRA 4IO6A 2HCAA 3KJTA 3PPPA 1Y3NA 1ZMGA 3P7IA 1IUDA 3PD9A 1LAGE 3KZGA 2I0BA 3K6XA 2Q9TA 4ELRA 2B3FA 5F7VA 2ZYNA 4U23A 4JXIA 1LAHE 3MJNA 2RCAA 3IJXB 1AL3A 4RXLA 2V3TA 3TFLA 3EQ1A 5H8QA 5I59B 4YKJA 4ZDMA 1LBCA 5I57A 4IY5A 3O6HA 1P99A 4G68A 4DDDA 3QUFA 1AH5A 1TWYA 4F29A 4U2RA 5AA1A 4BDMA 1JEVA 4KPTA 1FQCA 2E0SA 5KDTA 4F3PA 2DXRA 4AQ4A 4F18A 4MH5A 4F2QA 1QKAA 2DE4A 4IO7A 3HO7A 1FQBA 4QFOA 4KCCA 3OEMA 1LSTA 1FTLA 3EN3A 2Y84A 3SEYA 2Y7IA 4NF6B 1B51A 4X1BA 4OXVA 4XTCQ 2H99A 3QUJA 4LZ8A 2IA4A 1M5EA 2ZNTA 3K0VA 4YAHX 3LSXA 1B4HA 4GF8A 2OCUA 1FTMA 1PB7A 4EF1A 3OO8A 3MP1A 5CBRA 2XD2A 1T0KA 1IZ1A 3IK6B 3O2AA 3MBPA 5BUUA 2PMSA 3FJGA 1GTKA 1CB6A 3E3KA 5AA3A 2PVUA 3R6UA 5CMBA 3ZKKA 2XXUA 3PUZE 5L9SA 4OQOA 4M4GA 1VE4A 1B40A 3HV1A 4IO5A 3C35A 3PPNA 4DCXA 1MXZA 1GV8A 2OBGA 5I56B 2FNCA 1B9JA 5K2YA 3MPKA 4G8HA 4GWOA 5CM6A 1JW1A 3EF7A 4F39A 2ABHA 1R9LA 1URDA 4ZZAA 3C31A 3JYRA 3HHFA 1PDAA 1MY1A 4AB5A 3U94A 4ELQA 5H8NB 1XS5A 5DVFA 3MWBA 3E13X 1O64A 3FV1A 4N07A 2I6EA 4TQUQ 3SDFA 3IOUA 3OSQA 3H4ZA 4JBZA 3QK6A 4OEVA 2PYYA 3OMBA 2UVHA 5AA2B 2A5TB 1N7XA 1XHYA 4OMBA 5JTYA 1YTVA 3H7MA 2F8DA 4XKNA 1A8EA 1JW4A 1KWHA 1B3EA 5DEXB 1WVJA 2UYEA 3PPQA 4GXSB 1MY3A 3T66A 1DTGA 1Q1KA 3JZJA 3N5LA 4OFJA 4NTLA 1CE2A 3DP6A 3H6TA 4FJPA 3G3KA 4IY6A 5DT6A 4OWDA 1II5A 1XOCA 3H03A 2GHBA 4GLIA 4RPOA 2XHDA 2F35A 1HSJA 1B0HA 1PB8A 3KSXA 5H8HA 3B7DA 2ESNA 2DWIA 2XXXA 5H8FA 3O29A 3W15C 2I3WA 1I6BA 1FQFA 3S9NC 4G68C 1NKXA 3FJ7A 4OFOA 4OFLA 5FHMA 1QVSA 3DP4A 3F11A 1USYH 2HZLA 3CVGA 1FW0A 3RN8A 1N3WA 4IGRA 1DPPA 1JQFA 2RINA 1XVYA 3TTLA 3PUWE 3V8XB 3VE1B 3DM0A 3MVWA 4NMYA 4YB7A 4LZ5A 3D4CA 2DWAA 1VFDA 3SEUA 3K6VA 3KG2A 3KFMA 3TTMA 4F3SA 4YMAA 3T9UA 3TODA 4NF8B 3UORA 2QPQA 4G4PA 1NL5A 2UXAA 4FEDA 3FUZA 3K1PA 2XD3A 3TPAA 2PX1A 2NUVA 2ZNUA 1R1NA 4G8NA 3S2VA 4H0WA 2H4IA 3H6VA 4QFLA 2NVUB 4K3FA 1PEBA 3CRBA 1B5JA 2F6GA 4GVOA 4GQOA 5KZTA 4EQ7A 4PE5B 3RQTA 1HSLA 3HSTA 4R9GA 5K2XA 5J1DA 3IO6A 3TCGA 3T9HB 4XIGQ 5F1QA 1B3FA 2FYIA 4X48A 1B5IA 4WEDA 4GL8A 1R9QA 2PT1A 3TZAA 4XKPA 4F1VA 5TPAB 4H1XA 4U4SA 1DSNA 3TTNA 3FXUA 4Z0IA 3KBRA 1B3LA 3B6WA 1MXVA 4IB2A 5I2KA 2QS1A 2DE2A 2X7QA 5DVJA 3M3KA 3H06B 2QS3A 4ESXA 2YPNA 3PMXA 3S9MC 3FIRA 4ZECA 5I58A 1LCTA 3MP8A 3GZGA 4MBPA 1Z7NE 1NNKA 2ZMBA 2HZKA 3TTKA 3I6VA 2XX8A 4KFQA 4KYSA 1PBPA 1I69A 1YPNA 4KD5A 4JWOA 4EF2A 1R6ZA 5HPQA 4PFUA 4NWDA 4LONB 1P1UA 2DE3A 2X7PA 4LQ5A 1H43A 4ELPA 4QFKA 3C32A 3GBAA 2O84X 5HM4B 3O6IA 1MPCA 4ZEKA 5FHOA 3RT8A 1LFGA 4F1UA 1OVTA 4Z7EA 4P11A 4XKRA 1VR5A 2V93A 3CFXA 5ELVA 1FTKA 3IOWA 1Z7ME 2HXWA 3EHSA 4ZEIA 2XXTA 4M1VA 2QS4A 3UGWA 2DXYA 1P1WA 2OLBA 3D4GA 1B1HA 3TMGA 3LSFB 4R74A 1Y4CA 1MG1A 1P1QA 3A3UA 4GRKA 4JWXA 1N84A 1SVXB 5JEIA 4MLQA 3SESA 1QUJA 2RC8A 2P0SA 3E4RA 4I9DA 1QKBA 2Z8EA 4YB5A 3T93B 4DCYA 4RA1A 1H76A 2O6AA 4F1YA 2IEEA 4F3BA 3MW0A 3CSGA 3IL1B 1NFTA 5KCJA 2VOZA 3FV2A 5CRYA 2DVCA 1TFDA 1URSA 2F36A 3FZVA 1N76A 4H8JA 2DYXA 1MH4A 3Q27A 5JK4A 2AL5A 2I49A 4Q8RA 3Q25A 5H8QB 4Q0CA 3ILTB 1UTHB 3RGYA 1S50A 2HQ0A 4FEBA 2F6PA 5I84A 4N6PA 4PFYA 4QSDA 4OHNA 4O3AA 4L17A 3IX1A 3RLFE 1RYXA 3DELB 4R6KA 5ICQA 2ONKE 1L5TA 2ALUA 3PV0E 5KDTB 1B6HA 1SYHA 4RJZA 4OTEA 3G3FA 4YB6A 4F2OA 4OETA 3ZKLA 1NH8A 3MPLA 1POY1 4ZS9A 1SDXA 1GR2A 4AB6A 1JEUA 4R6YA 4HTGA 4MF3A 4JSOA 4ZEFA 1EZ9A 1FTJA 3TQWA 1PBQA 3EPEA 1MXUA 2OJTA 4DXUA 3WAFA 3ODBA 1MM6A 1IIWA 3FVNA 3OEKA 4H8IA 3S9EA 4N13A 4U1OA 4U1ZA 3T9XB 3UIFA 1JVXA 4HW8A 2RF1A 4QSCA 3IOVA 1FQEA 1BP5A 5DYHA 3U1OA 2KLFA 4P0IA 2XXYA 2ZYMA 2UYFA 3OO6A 1FQAA 3LBSA 4UACA 5EHMA 2QS2A 2UVIA 3QXMA 3R26A 1MM7A 1A54A 4Q5TA 5I2NA 4DE8A 4OENA 3E9XA 1ZTYA 1DTZA 5I56A 4G8MA 3PUXE 2R6GE 4GXAA 1Y3PA 4QRZA 3VVFA 4DXBA 5CMKA 1Y20A 1N3XA 4H67A 3MAMA 1SQYA 2RC7A 3G3HA 2O7UA 4C1TA 2NWJA 3PU5A 3W9VA 3QYTA 3TCFA 4OEUA 4QFNA 4OYVA 3G3IA 3KGCA 3PPRA 5A5XB 1H45A 4RYAA 4PFTA 5FTHA 4R73A 4R6HA 4RK9A 1US4A 5IKBA 4G2ZA 5B7DA 3FVKA 5AA2A 1XVXA 2A5TA 2DS9A 4F19A 1LFHA 2HAVA 4MFIA 1B05A 1POTA 1B52A 2VD2A 3K1MA 3DLNA 4WKMA 3G3JA 4QF9A 5JTYB 4OZ9A 3LSLA 5DEXA 3KN3A 3M3LA 1AOVA 1NNPA 3T96B 4THIA 2H5YA 1N0TA 3S4UA 1TXFA 2O1LA 3OOAA 3CG1A 2I48A 4R2BA 4IO2A 3GLBA 1Y3QA 4H5FA 1OLCA 4KI0E 3TUSA 2AYSA 1LLSA 4R72A 5BWJA 3TDJA 4FATA 2O69A 3Q28A 5B70A 2NXOA 3TYHA 4IGTA 4KYEA 2Z22A 4ND9A 2Y7WA 4I1DA 5ITOA 4GL0A 2Y7PA 2Q89A 4ESWA 3HCQA 2UVGA 5TP9B 3VXBA 5H8HB 2DOJA 5HBCA 1J1NA 2Y7RA 5H8FB 2I4BA 3UP9A 3EHTA 1RYOA 1SYIA 4JB7A 1PC3A 4FIMA 3MVXA 2P1SA 4TOZA 4H6DA 3USDA 1M5CA 3TAJA 1ZLQA 3K4UA 1JVYA 1ZU0A 1S7YA 3GBBA 4Q30B 2RKMA 3VDFA 4ONYA 1MH3A 2V3UA 2O7IA 5FTIA 3IORA 2RC9A 4POWA 3PMWA 3Q29A 2Q2AA 1OMPA 2F7CA 1IEJA 3RTFB 2VP1A 4I8CA 2XXQA 4YMBA 3QAXA 3PD8A 1D9YA 2F34A 4MLVA 1URGA 2QJEA 3DP8A 1IITA 3MC2A 2ANJA 2XXHA 1ZKBA 4XKQA 4QHQA 4X1DA 4BDRA 4H5GA 1SBPA 4C0RA 4F22A 1B2HA 1BKAA 2A5SA 3N94A 3FD3A 1B7HA 3KN7A 4UA8A 1VSOA 3LC8A 3VVDA 4ECFA 4WEPA 1B7ZA 3MZ1A 1M5FA 3RUMA 3QSLA 2D5WA 1EZOA 5TPAA 3OXNA 3OENA 3SEVA 3KSJA 4P0GA 4LUBA 2HFBA 1H44A 2HEUA 3THIA 5LOMA 1O7TA 3I5OA 2O1MA 3BBRA 3VV5A 1N7WA 3T9VA 3IJOB 4RPNA 3BFTA 4HCYA 1MQDA 1N04A 4RK2A 4OVJA 3IB1A 2QMXA 3H3GA 3C9HA 3EHUA 5L9MA 3TQLA 1A8FA 1YAEA 3K00A 2H9BA 3HN0A 5I58B 3FATA 1IXHA 3K6WA 1A40A 4NF5A 1A7LA 1WODA 3KOTA 5CC2A 3RY3A 1HSEA 4JWYA 4NF4A 2THIA 3GXAA 3CR9A 1MQJA 4EQBA 3O6GA 5AA4A 3O28A 3SKPA 1I6AA 3TTRA 1B4ZA 1SI1A 4JSDA 3R7XA 4ZEDA 4PETA 5CI5A 2ONRA 2VD3A 1ZBMA 4U22A 2QMWA 1IXIA 3K1NA 4BLAA 2PT2A 3IR1A 3N26A 5L8DA 1QULA 1SW4A 1SW1A 4U4XA 1UTBB 1ZJLA 4O3BA 3PUVE 2R71A 3OSRA 1LBBA 4YICA 4X9TA 3IB0A 3C33A 3ILUB 1Y1MA 1Y1ZA 2REJA 4BDNA 3PGFA 2I0CA 3M8UA 3BKIB 1MS7A 3RNNA 2OWTA 2OWSA 1F9BA 2B3BA 1MPBA 1OLAA 3OD7A 2UVJA 5ISUA 1MDQA 4F3GA 3SETA 1LAXA 5TU0A 3IAZA 1OVBA 3RT6B 2Q8JA 4KYDA 5I59A 2ZYOA 2ONSA 3MVYA 5KCJB 4OERA 3JV9A 2DVZA 3W9WA 3MVZA 1FTOA 3CI8A 4YKKA 1UTHA 5I57B 3ZSFA 2F7BA 1B3GA 4YZZA 4G68B 2F97A 3LSWA 4PFWA 4G77A 3FXQA 1TFAA 1IQ7A 1OQGA 3K6UA 3VLUA 2DWJA 2Q2CA 1JETA 4JDFA 3S9LC 2W7YA 1MDP1 1UIVA 2PBWA 2V84A 1RKMA 3CSBA 4R75A 4NEDA 4NF6A 3RPWA 2ZYKA 4KHZE 2G93A 1D4NA 4ZE8A 2QSXA 4NE4A 4WXJA 2O51A 3FGSA 1YCJA 4ZZEA 1TT1A 1ATGA 2REGA 3KEIA 4LP2B 3VVEA 1B32A 3MQ9A 4DIGA 4XXUA 4QSEA 2V3QA 1B46A 1B1XA 3V83A 4QFPA 1QUIA 1MPDA 2BJJX 2HAUA 1NNFA 2ZNSA 1XT8A 1QW0A 3ECRA 5IAIA 3L6GA 4KQPA 3TCHA 2B65A 4BDQA 3CFLA 5I2NB 5CMCA 5DVIA 2DQVA 3HPIA
chains in the Genus database with same CATH superfamily
4H46A 3O97A 1Y9UA 1RDXA 2GRVA 3PPOA 3LUYA 4IO4A 5H8NA 2G29A 2QL3A 1EU8A 1MQGA 4C1UA 4HE0A 3K01A 1UQWA 1FQDA 2Z23A 4P56A 1GGGA 2D21A 1FPKA 3FVOA 1O63A 5CBSA 5CMMA 3H6UA 3A3CA 1IXGA 4PGNA 2V25A 5A5XA 2I3VA 2CZLA 3UN6A 3A09A 5AE4A 1XI6A 1OIBA 3QIMA 3V5AA 4EDPA 3N6UA 4BDLA 1MXXA 4O3CA 4FECA 2XX9A 1DOTA 2M8CA 2RCBA 2I58A 5EYFA 1B3HA 3PTYA 2R9JA 3K2DA 2WEFA 5DTBA 4PP0A 3U92A 2FA7A 2P3VA 3MUQA 3MZ9A 1DBZA 2OWZA 2AL4A 4EXLA 2XXWA 4U21A 1GVCA 3O9PA 2HPGA 1DPEA 5IZ1A 3RTWB 1QJMA 3BFUA 2CMOA 2GFEA 1PB9A 2NOOA 1D3KA 1SW5A 1OQHA 3CIJA 4R9FA 4I3EA 2XXPA 4LZ7A 4E0WA 1LCFA 4MAGA 1LB9A 3SERA 4XEQA 4O94A 1ELJA 4GX4A 3KBZA 5TP9A 4YKIA 4KCDA 3OO7A 4ZEBA 4DLDA 3C36A 2KQZA 1MXWA 4HS7A 2YLNA 2OK2A 3IO4A 4ZE9A 2YJPA 2CZHA 4POXA 3EKIA 3KJ7A 4HXVA 2FIEA 1QUKA 3MP6A 1BTJA 4PQJA 3WAEA 5ICTA 3VLVA 3ZS6A 2VPOA 1FPFA 3VFJA 1MQHA 1AIVA 2H98A 4LATA 2O68A 2X26A 5M2VA 3C34A 4DZ1A 4NG7A 4NF8A 2D3IA 2F5XA 1INPA 4P1EA 1IXCA 3O66A 1EYJA 2QRYA 1Q35A 4YU0A 1JW5A 1SW2A 3IOTA 4GFRA 3U72A 2XXRA 4F31B 2AIXA 4NWCA 3CFZA 4PCDA 1SD3A 3UA8A 2H25A 3KOSA 4JVCA 3FVGA 4HCWA 4GIZA 1H3DA 2DP8A 4PF6A 2WKYA 4G61A 3C4MA 3CG3A 4FE8A 4I62A 1NNTA 1B7UA 1MXYA 2XXVA 1A99A 2GHAA 5ET6A 1B0LA 1MRPA 1P1OA 3MZBA 5FHNA 1XC1A 3FJMA 5H8SA 2Q74A 1NH7A 2DWHA 1LGBC 4GD5A 1ZIUA 2XX7A 1LFIA 1BIYA 1S9TA 3U8QA 4ISUA 3TELA 1M5BA 2FVZA 1VDWA 1BLFA 2OX3A 2Y7KA 3SEWA 1LB8A 2Z8DA 3TKDA 2KR0A 3TEPA 1WDNA 4DXCA 2F78A 4IO3A 2F7AA 1AMFA 5FBPA 5I2KB 1DMBA 2V4CA 1MY0A 5IZZA 3M3FA 3H6WA 1SI0A 4ELOA 4KR5A 1NMUA 1P1NA 3HHGA 3N6TA 2ZXTA 3ISPA 4EQ9A 2VGQA 1LBXA 1LAFE 3B6QA 4EXKA 3LR1A 4GOTA 4OESA 5AA2D 1I6QA 5I7IA 4YKPA 3A29A 1NV1A 1B58A 2JJKA 4H65A 1JNFA 5EQ8A 4LVQA 2P2AA 2OZZA 3U93A 3AXFA 4NF0A 3FASA 2I4CA 4EUOA 2Y5KA 3Q26A 4NF5B 1EYKA 2DSFA 1MY4A 2XXIA 2GH9A 4RNSA 2LAOA 1LEVA 4NF4B 2E1SA 4TLMB 5AA4B 1D9VA 3OO9A 3V89B 2HHMA 4R2FA 4BDOA 5EHSA 3KC0A 3PUYE 3VXCA 3ONMA 4FORA 1FPJA 1M5DA 3PMVA 3UK4A 4TLLB 3G3GA 3SEXA 2Q88A 3T22A 1EH3A 1QGXA 4MJOA 1NV7A 3VLWA 4MNPA 1NV4A 3L6HA 3I3VA 1UTBA 1MQIA 5ITPA 2Z8FA 2VHAA 4MX6A 1A55A 1US5A 4GWZA 3B6TA 3OELA 3K02A 3IB2A 1FCKA 5EYHA 1VFEA 4LQ2A 1MY2A 3KN8A 4AS5A 4LA9A 3G7WA 3RPLA 4RY1A 1ANFA 5L9OA 1EZPA 4E0XA 1B5HA 1UIUA 1USYE 4FAJA 1Y4TA 1SPIA 3FXRA 4IO6A 2HCAA 3KJTA 4XF5A 3PPPA 1Y3NA 2ZZXA 1ZMGA 3P7IA 1IUDA 5EQ9A 3PD9A 1LAGE 3KZGA 2I0BA 3K6XA 2Q9TA 4ELRA 4I3YA 4MEVA 2B3FA 5F7VA 1KA0A 1RDZA 2ZYNA 4U23A 5ET7A 4JXIA 1LAHE 2ZZWA 3MJNA 2RCAA 4N15A 3IJXB 1AL3A 4RXLA 2V3TA 3TFLA 3EQ1A 5H8QA 5I59B 4YKJA 4ZDMA 1NV6A 3KC1A 1FPGA 1LBCA 5I57A 4IY5A 3O6HA 1P99A 4G68A 1FJ6A 4DDDA 3QUFA 1AH5A 1TWYA 4F29A 4U2RA 5AA1A 4BDMA 1JEVA 4KPTA 5I5PA 4NAPA 1FQCA 2E0SA 5KDTA 5ET8A 4F3PA 2DXRA 4AQ4A 4F18A 4UABA 4MH5A 4F2QA 1QKAA 2DE4A 4IO7A 3HO7A 1FQBA 4QFOA 4KCCA 3OEMA 4OVSA 5F24A 4QXDA 1LSTA 1FTLA 3EN3A 1NV2A 2Y84A 3SEYA 2Y7IA 1G0HA 1B51A 4NF6B 4OXVA 4X1BA 4XTCQ 2H99A 3QUJA 4LZ8A 2IA4A 1M5EA 2ZNTA 3K0VA 4YAHX 3LSXA 1B4HA 4GF8A 2OCUA 1FTMA 1PB7A 4EF1A 3OO8A 4PF8A 3MP1A 5CBRA 2XD2A 1T0KA 1LBZA 1IZ1A 3IK6B 1NUZA 3RYDA 3O2AA 3IFAA 3MBPA 5BUUA 2PMSA 1NV0A 3FJGA 1GTKA 1CB6A 3E3KA 5AA3A 2PVUA 3R6UA 5CMBA 3ZKKA 2XXUA 3PUZE 5L9SA 4OQOA 4FBPA 4M4GA 1VE4A 1B40A 3HV1A 4IO5A 3C35A 3PPNA 4NHBA 4DCXA 1MXZA 1GV8A 2OBGA 5I56B 4GWWA 2FNCA 1B9JA 5K2YA 3MPKA 2FIXA 4G8HA 4GWOA 5CM6A 1JW1A 3EF7A 4F39A 2ABHA 1R9LA 1URDA 4ZZAA 3C31A 3JYRA 3HHFA 1PDAA 1MY1A 4AB5A 4PAFA 3QMFA 3U94A 4ELQA 1LBWA 5H8NB 1XS5A 3B50A 4GWYA 5DVFA 3MWBA 2FHYA 3E13X 4PBQA 1O64A 3FV1A 4N07A 2I6EA 4TQUQ 3SDFA 3IOUA 2QVVA 3OSQA 3H4ZA 4N81A 4NQ8A 4JBZA 3QK6A 5IZ3A 4OEVA 2PYYA 3OMBA 2F3BA 2UVHA 5AA2B 1JP4A 2A5TB 1N7XA 2DDKA 1XHYA 4PC9A 4OMBA 3MSTA 5EQAA 5JTYA 1YTVA 3H7MA 2F8DA 4XKNA 1A8EA 1JW4A 3D1RA 4QBAA 1KWHA 1B3EA 4X8RA 5DEXB 1WVJA 2UYEA 3PPQA 4GXSB 1MY3A 3T66A 1FBPA 1DTGA 1Q1KA 3JZJA 3N5LA 4OFJA 4NTLA 1CE2A 3DP6A 4GX6A 3H6TA 3B8BA 4FJPA 3G3KA 3IFCA 4IY6A 5DT6A 4OWDA 1II5A 1XOCA 1FPIA 3H03A 2GHBA 2WBDA 4GLIA 4RPOA 2WBBA 4GBVA 2XHDA 2F35A 1HSJA 1B0HA 1PB8A 3KSXA 5H8HA 3B7DA 2ESNA 2DWIA 2XXXA 1CNQA 5H8FA 3O29A 3W15C 4N6DA 2I3WA 1I6BA 1FQFA 4MNIA 3S9NC 4G68C 1NKXA 1IMFA 3FJ7A 4OFOA 4OFLA 4GX3A 5FHMA 1QVSA 3DP4A 3F11A 1USYH 2HZLA 3CVGA 4H45A 1FW0A 3RN8A 1N3WA 4IGRA 5ESYA 1DPPA 1JQFA 2RINA 1XVYA 3E78A 3TTLA 3PUWE 3V8XB 3VE1B 1NV3A 3DM0A 2PCRA 3MVWA 4NMYA 4YB7A 4LZ5A 3D4CA 2DWAA 1VFDA 3SEUA 3K6VA 2WX9A 3KG2A 3KFMA 3TTMA 4F3SA 4YMAA 3T9UA 3TODA 4N17A 4MNCA 4I40A 4NF8B 3UORA 1G0IA 2QPQA 2WYPA 4G4PA 1NL5A 2UXAA 5LDZA 4FEDA 3FUZA 3K1PA 2XD3A 3TPAA 2PX1A 2NUVA 2ZNUA 1R1NA 4G8NA 3ROJA 3S2VA 4H0WA 2H4IA 3H6VA 4QFLA 2VT5A 2NVUB 4K3FA 1PEBA 3CRBA 1B5JA 3FXBA 1IMEA 2F6GA 4GVOA 4GQOA 5KZTA 4MCOA 4EQ7A 4PE5B 3SZPA 3RQTA 1HSLA 3HSTA 4R9GA 5K2XA 5J1DA 3IO6A 3TCGA 3T9HB 4XIGQ 5F1QA 1B3FA 2FYIA 4X48A 4N4UA 1B5IA 4WEDA 4GL8A 1R9QA 2PT1A 3TZAA 5LTCA 4XKPA 4PE3A 1IMBA 4GWXA 4F1VA 5TPAB 4IR8A 4H1XA 4U4SA 2VPNA 1DSNA 3TTNA 3FXUA 4Z0IA 3KBRA 1B3LA 3B6WA 1MXVA 4IB2A 5I2KA 2QS1A 2DE2A 2X7QA 5DVJA 3M3KA 3H06B 2QS3A 4ESXA 2YPNA 1FSAA 3PMXA 3S9MC 3FIRA 4ZECA 5I58A 1LCTA 3MP8A 3GZGA 4MBPA 1Z7NE 1NNKA 2ZMBA 4PFIA 2HZKA 3TTKA 3I6VA 2XX8A 4KFQA 4KYSA 1PBPA 1I69A 1YPNA 4KD5A 4JWOA 5EYGA 4EF2A 1R6ZA 5HPQA 4PFUA 4NWDA 4LONB 1P1UA 2DE3A 2X7PA 4LQ5A 1H43A 4ELPA 4QFKA 3C32A 3BIHA 3GBAA 2O84X 1AWBA 5HM4B 3O6IA 4OANA 1MPCA 4ZEKA 4O7IA 5FHOA 3RT8A 1LFGA 4F1UA 1OVTA 4O8MA 4KXPA 4Z7EA 4P11A 4XKRA 1IMDA 1VR5A 1IMAA 2V93A 3CFXA 5ELVA 2QVUA 1FTKA 3IOWA 1Z7ME 2HXWA 3EHSA 4ZEIA 2XXTA 4M1VA 2QS4A 3UGWA 2DXYA 1P1WA 2OLBA 3D4GA 1B1HA 3TMGA 3LSFB 4R74A 3RPLB 4PGPA 1Y4CA 1MG1A 2PFZA 1P1QA 3A3UA 4GRKA 4JWXA 1N84A 1SVXB 3GYYA 5JEIA 4MLQA 3SESA 1QUJA 2RC8A 2P0SA 3E4RA 4JVDA 1Q9DA 4I9DA 1QKBA 2Z8EA 4YB5A 4N91A 3T93B 2WYKA 4DCYA 4RA1A 1H76A 2O6AA 1FBCA 4F1YA 3NOHA 2IEEA 2ZZVA 4F3BA 3MW0A 2MKZA 3CSGA 3IL1B 1NFTA 5KCJA 2VOZA 3FV2A 3FBPA 5CRYA 1EYIA 2L5VA 2DVCA 1TFDA 1URSA 2F36A 3FZVA 4P3LA 4NN3A 1N76A 4H8JA 2DYXA 1MH4A 3Q27A 5JK4A 2AL5A 2I49A 4Q8RA 3Q25A 5H8QB 4Q0CA 3ILTB 1UTHB 4NX1A 3RGYA 1S50A 2HQ0A 4FEBA 4MIJA 1LBYA 2F6PA 5I84A 4N6PA 4PFYA 4QSDA 4OHNA 4O3AA 4L17A 4GBWA 3U65A 1K9YA 3IX1A 3RLFE 1RYXA 3DELB 4R6KA 5ICQA 2ONKE 1L5TA 2ALUA 3PV0E 5KDTB 1B6HA 1SYHA 4RJZA 4OTEA 3G3FA 4YB6A 4F2OA 4OVQA 4OETA 3ZKLA 1NH8A 3MPLA 1POY1 4ZS9A 1SDXA 1GR2A 1FPEA 4AB6A 1JEUA 2CEYA 4PAKA 4R6YA 4HTGA 4MF3A 2FBPA 4JSOA 4ZEFA 1EZ9A 1FTJA 1PBQA 3TQWA 3EPEA 1MXUA 2OJTA 3WAFA 4DXUA 3ODBA 1MM6A 5J16A 4OVPA 1IIWA 3FVNA 3OEKA 4H8IA 3S9EA 4N13A 4U1OA 4U1ZA 3T9XB 3UIFA 1JVXA 4HW8A 4JVIA 2RF1A 4QSCA 3IOVA 1FQEA 3E79A 1BP5A 5DYHA 3U1OA 2KLFA 4P0IA 2XXYA 2ZYMA 2UYFA 3OO6A 1FQAA 3LBSA 4UACA 5EHMA 2QS2A 2UVIA 1D9QA 1FBGA 3QXMA 3R26A 1MM7A 1A54A 4Q5TA 5I2NA 4DE8A 4OENA 3E9XA 3MYUA 1ZTYA 1DTZA 1YXIA 5I56A 4G8MA 4GWSA 3PUXE 2R6GE 4GXAA 1Y3PA 2Y5LA 4QRZA 3VVFA 4DXBA 5CMKA 4LN5A 1Y20A 1N3XA 4H67A 3MAMA 1SQYA 2RC7A 3G3HA 2O7UA 4C1TA 2NWJA 3PU5A 3W9VA 3BIGA 1YZ0A 3QYTA 3TCFA 4OEUA 4QFNA 1FRPA 4OYVA 3G3IA 2B4MA 3KGCA 3PPRA 5A5XB 1H45A 4RYAA 4PFTA 5FTHA 4R73A 4R6HA 4RK9A 2XWVA 1US4A 5IKBA 4G2ZA 4HE2A 4PFRA 1FPLA 5IZ3B 5B7DA 3FVKA 5AA2A 1XVXA 2A5TA 2DS9A 4F19A 1LFHA 2HAVA 1FBDA 4MFIA 1KZ8A 2PFYA 1B05A 1POTA 1B52A 2VD2A 3K1MA 5A5LA 4MHFA 3DLNA 4WKMA 3G3JA 4QF9A 5JTYB 4OZ9A 3LSLA 5DEXA 1RDYA 3KN3A 3M3LA 1AOVA 1NNPA 3T96B 4THIA 2H5YA 1N0TA 3S4UA 1TXFA 2O1LA 3OOAA 3CG1A 2I48A 4R2BA 4IO2A 3GLBA 2XXKA 1Y3QA 4H5FA 1OLCA 4KI0E 4N8YA 3TUSA 2AYSA 1LLSA 4R72A 5BWJA 3TDJA 4FATA 2O69A 3Q28A 5B70A 2NXOA 3TYHA 4IGTA 4KYEA 2Z22A 4ND9A 2Y7WA 4I1DA 5ITOA 4GL0A 2Y7PA 2Q89A 4ESWA 3HCQA 4N8GA 3T1BA 2UVGA 5TP9B 3VXBA 5H8HB 5I3SA 2DOJA 5HBCA 1J1NA 5IM2A 2Y7RA 5H8FB 4PDDA 1DK4A 1FTAA 2I4BA 3UP9A 1NUWA 3EHTA 1IMCA 1RYOA 1SYIA 4JB7A 1PC3A 4FIMA 2CZKA 3MVXA 2P1SA 4TOZA 4H6DA 3USDA 4N6KA 1M5CA 3TAJA 2XWIA 1ZLQA 3K4UA 1JVYA 1ZU0A 1S7YA 1LBVA 4OVRA 3GBBA 4NGUA 4Q30B 2RKMA 2Q8MA 3VDFA 4ONYA 1MH3A 2V3UA 5EQ7A 2O7IA 5FTIA 3CHGA 3IORA 2RC9A 2R8TA 4POWA 3PMWA 3Q29A 2HXRA 2Q2AA 1OMPA 2F7CA 1IEJA 3RTFB 2VP1A 4I8CA 2F3DA 2XXQA 3T0JA 4YMBA 3QAXA 3PD8A 1D9YA 4PDHA 2F34A 1KA1A 4MLVA 1URGA 2QJEA 3DP8A 1IITA 3MC2A 2ANJA 2XXHA 1ZKBA 4XKQA 4QHQA 4X1DA 4OA4A 4HE1A 4BDRA 2B4LA 4H5GA 1SBPA 4C0RA 4F22A 1B2HA 1BKAA 2A5SA 3N94A 3FD3A 1BK4A 1B7HA 3KN7A 4UA8A 1VSOA 3LC8A 3VVDA 4ECFA 3LUZA 4WEPA 1NUYA 1B7ZA 1K9ZA 3MZ1A 1M5FA 3RUMA 3QSLA 2D5WA 1EZOA 5TPAA 4GWUA 3OXNA 3OENA 3SEVA 3LV0A 2XWOA 3KSJA 4P0GA 4LUBA 2HFBA 1H44A 2HEUA 3THIA 5LOMA 1O7TA 3I5OA 2O1MA 3BBRA 3VV5A 1N7WA 3T9VA 1FBFA 3IJOB 4RPNA 3BFTA 4HCYA 1MQDA 1N04A 4PBHA 4RK2A 4PAIA 4OVJA 4P8BA 3IB1A 2QMXA 3H3GA 3C9HA 3EHUA 5L9MA 3TQLA 1A8FA 1YAEA 3K00A 2H9BA 3HN0A 5I58B 3FATA 1IXHA 3K6WA 1A40A 4NF5A 1A7LA 1WODA 3KOTA 5CC2A 3RY3A 1HSEA 5DW8A 4JWYA 4NF4A 2THIA 3GXAA 3CR9A 1MQJA 4EQBA 3O6GA 5AA4A 3O28A 3SKPA 1I6AA 3TTRA 1B4ZA 1SI1A 4JSDA 3R7XA 4ZEDA 4DI4B 4PETA 5CI5A 2ONRA 2VD3A 4P1LA 1ZBMA 4U22A 2QMWA 1FJ9A 1IXIA 3K1NA 4BLAA 2PT2A 3IR1A 2P3NA 3N26A 5L8DA 1QULA 1SW4A 2BJIA 2QFLA 1SW1A 1NUXA 4U4XA 1UTBB 1ZJLA 4O3BA 3PUVE 2R71A 3OSRA 1LBBA 4YICA 4X9TA 4X04A 3IB0A 4MMPA 3C33A 3ILUB 4P9KA 1Y1MA 1Y1ZA 2REJA 4BDNA 3PGFA 2I0CA 3M8UA 3BKIB 1MS7A 4PFBA 3RNNA 4PTKA 2OWTA 2OWSA 1F9BA 2B3BA 1MPBA 1OLAA 3OD7A 2UVJA 5ISUA 1MDQA 4F3GA 3SETA 1LAXA 5TU0A 3IAZA 1OVBA 3RT6B 4DI3D 2Q8JA 4KYDA 5I59A 1DCUA 1FBEA 2ONSA 2ZYOA 3MVYA 5KCJB 4OERA 3JV9A 2DVZA 1FPDA 4OVTA 3W9WA 3MVZA 1FTOA 3CI8A 4YKKA 1UTHA 5I57B 3ZSFA 2F7BA 1B3GA 4YZZA 4G68B 2XWKA 1NV5A 2F97A 3LSWA 4PFWA 4G77A 4AS4A 3FXQA 1TFAA 1IQ7A 5T3JA 1OQGA 3K6UA 3VLUA 2DWJA 2Q2CA 2QVRA 1JETA 4JDFA 3S9LC 2GQ1A 2W7YA 1MDP1 1FPBA 1UIVA 2PBWA 2V84A 1RKMA 1YYZA 3CSBA 4R75A 4NEDA 4O7MA 4NF6A 3RPWA 3HFUA 2ZYKA 4XFEA 4KHZE 2G93A 1D4NA 4ZE8A 2QSXA 2XA5A 1NI9A 4NE4A 4WXJA 2O51A 3FGSA 1YCJA 2CZIA 4ZZEA 1TT1A 1FBHA 4P47A 1ATGA 2REGA 3KEIA 4LP2B 3VVEA 1B32A 3MQ9A 4DIGA 4XXUA 4QSEA 2V3QA 1B46A 1B1XA 3V83A 4QFPA 1QUIA 1MPDA 2BJJX 2CEXA 2HAUA 1NNFA 2ZNSA 1XT8A 1QW0A 3ECRA 5IAIA 3L6GA 5IGAA 4KQPA 3TCHA 2B65A 4BDQA 3CFLA 5ET5A 5I2NB 5CMCA 5DVIA 2DQVA 3HPIA
chains in the Genus database with same CATH topology
3O97A 1Y9UA 2GRVA 3PPOA 3LUYA 4IO4A 5H8NA 2G29A 2QL3A 1EU8A 1MQGA 4C1UA 3K01A 1UQWA 1FQDA 2Z23A 1GGGA 2D21A 3FVOA 1O63A 5CBSA 5CMMA 3H6UA 3A3CA 1IXGA 2V25A 5A5XA 2I3VA 2CZLA 3UN6A 3A09A 5AE4A 1OIBA 3QIMA 3V5AA 4EDPA 3N6UA 4BDLA 1MXXA 4O3CA 4FECA 2XX9A 1DOTA 2M8CA 2RCBA 2I58A 5EYFA 1B3HA 2R9JA 3K2DA 5DTBA 4PP0A 3U92A 2FA7A 3MUQA 3MZ9A 2AL4A 4EXLA 2XXWA 4U21A 1GVCA 3O9PA 1DPEA 3RTWB 1QJMA 3BFUA 2CMOA 2GFEA 1PB9A 2NOOA 1D3KA 1SW5A 1OQHA 3CIJA 4R9FA 4LZ7A 2XXPA 4E0WA 1LCFA 1LB9A 3SERA 1ELJA 5TP9A 4YKIA 4KCDA 3OO7A 4ZEBA 4DLDA 3C36A 1MXWA 4HS7A 2YLNA 2OK2A 3IO4A 4ZE9A 2YJPA 4POXA 3KJ7A 1QUKA 3MP6A 1BTJA 4PQJA 3WAEA 5ICTA 3VLVA 3ZS6A 3VFJA 1MQHA 1AIVA 2H98A 4LATA 2O68A 2X26A 5M2VA 3C34A 4DZ1A 4NF8A 2D3IA 2F5XA 1IXCA 3O66A 2QRYA 1Q35A 4YU0A 1JW5A 1SW2A 3IOTA 4GFRA 3U72A 2XXRA 4F31B 2AIXA 4NWCA 3CFZA 1SD3A 3UA8A 2H25A 3KOSA 3FVGA 4HCWA 4GIZA 1H3DA 2DP8A 2WKYA 3C4MA 3CG3A 4FE8A 4I62A 1NNTA 1B7UA 1MXYA 2XXVA 1A99A 2GHAA 1B0LA 1MRPA 1P1OA 3MZBA 5FHNA 1XC1A 3FJMA 5H8SA 1NH7A 2DWHA 1LGBC 4GD5A 1ZIUA 2XX7A 1LFIA 1BIYA 1S9TA 3U8QA 4ISUA 3TELA 1M5BA 1BLFA 2Y7KA 3SEWA 1LB8A 2Z8DA 3TKDA 3TEPA 1WDNA 4DXCA 2F78A 4IO3A 2F7AA 1AMFA 5I2KB 1DMBA 1MY0A 3M3FA 3H6WA 1SI0A 4ELOA 4KR5A 1NMUA 1P1NA 3HHGA 3N6TA 2ZXTA 4EQ9A 2VGQA 1LAFE 3B6QA 4EXKA 3LR1A 4GOTA 4OESA 5AA2D 1I6QA 4YKPA 1B58A 4H65A 1JNFA 4LVQA 2P2AA 2OZZA 3U93A 3AXFA 3FASA 2I4CA 4EUOA 3Q26A 4NF5B 2DSFA 1MY4A 2XXIA 2GH9A 4RNSA 2LAOA 4NF4B 2E1SA 4TLMB 5AA4B 1D9VA 3OO9A 3V89B 4R2FA 4BDOA 5EHSA 3PUYE 3VXCA 3ONMA 4FORA 1M5DA 3PMVA 3UK4A 4TLLB 3G3GA 3SEXA 2Q88A 3T22A 1EH3A 3VLWA 3L6HA 3I3VA 1UTBA 1MQIA 5ITPA 2Z8FA 2VHAA 1A55A 1US5A 3B6TA 3OELA 3K02A 3IB2A 1FCKA 1VFEA 4LQ2A 1MY2A 3KN8A 4LA9A 3G7WA 4RY1A 1ANFA 5L9OA 1EZPA 4E0XA 1B5HA 1UIUA 1USYE 4FAJA 1Y4TA 3FXRA 4IO6A 2HCAA 3KJTA 3PPPA 1Y3NA 1ZMGA 3P7IA 1IUDA 3PD9A 1LAGE 3KZGA 2I0BA 3K6XA 2Q9TA 4ELRA 2B3FA 5F7VA 2ZYNA 4U23A 4JXIA 1LAHE 3MJNA 2RCAA 3IJXB 1AL3A 4RXLA 2V3TA 3TFLA 3EQ1A 5H8QA 5I59B 4YKJA 4ZDMA 1LBCA 5I57A 4IY5A 3O6HA 1P99A 4G68A 4DDDA 3QUFA 1AH5A 1TWYA 4F29A 4U2RA 5AA1A 4BDMA 1JEVA 4KPTA 1FQCA 2E0SA 5KDTA 4F3PA 2DXRA 4AQ4A 4F18A 4MH5A 4F2QA 1QKAA 2DE4A 4IO7A 3HO7A 1FQBA 4QFOA 4KCCA 3OEMA 1LSTA 1FTLA 3EN3A 2Y84A 3SEYA 2Y7IA 4NF6B 1B51A 4X1BA 4OXVA 4XTCQ 2H99A 3QUJA 4LZ8A 2IA4A 1M5EA 2ZNTA 3K0VA 4YAHX 3LSXA 1B4HA 4GF8A 2OCUA 1FTMA 1PB7A 4EF1A 3OO8A 3MP1A 5CBRA 2XD2A 1T0KA 1IZ1A 3IK6B 3O2AA 3MBPA 5BUUA 2PMSA 3FJGA 1GTKA 1CB6A 3E3KA 5AA3A 2PVUA 3R6UA 5CMBA 3ZKKA 2XXUA 3PUZE 5L9SA 4OQOA 4M4GA 1VE4A 1B40A 3HV1A 4IO5A 3C35A 3PPNA 4DCXA 1MXZA 1GV8A 2OBGA 5I56B 2FNCA 1B9JA 5K2YA 3MPKA 4G8HA 4GWOA 5CM6A 1JW1A 3EF7A 4F39A 2ABHA 1R9LA 1URDA 4ZZAA 3C31A 3JYRA 3HHFA 1PDAA 1MY1A 4AB5A 3U94A 4ELQA 5H8NB 1XS5A 5DVFA 3MWBA 3E13X 1O64A 3FV1A 4N07A 2I6EA 4TQUQ 3SDFA 3IOUA 3OSQA 3H4ZA 4JBZA 3QK6A 4OEVA 2PYYA 3OMBA 2UVHA 5AA2B 2A5TB 1N7XA 1XHYA 4OMBA 5JTYA 1YTVA 3H7MA 2F8DA 4XKNA 1A8EA 1JW4A 1KWHA 1B3EA 5DEXB 1WVJA 2UYEA 3PPQA 4GXSB 1MY3A 3T66A 1DTGA 1Q1KA 3JZJA 3N5LA 4OFJA 4NTLA 1CE2A 3DP6A 3H6TA 4FJPA 3G3KA 4IY6A 5DT6A 4OWDA 1II5A 1XOCA 3H03A 2GHBA 4GLIA 4RPOA 2XHDA 2F35A 1HSJA 1B0HA 1PB8A 3KSXA 5H8HA 3B7DA 2ESNA 2DWIA 2XXXA 5H8FA 3O29A 3W15C 2I3WA 1I6BA 1FQFA 3S9NC 4G68C 1NKXA 3FJ7A 4OFOA 4OFLA 5FHMA 1QVSA 3DP4A 3F11A 1USYH 2HZLA 3CVGA 1FW0A 3RN8A 1N3WA 4IGRA 1DPPA 1JQFA 2RINA 1XVYA 3TTLA 3PUWE 3V8XB 3VE1B 3DM0A 3MVWA 4NMYA 4YB7A 4LZ5A 3D4CA 2DWAA 1VFDA 3SEUA 3K6VA 3KG2A 3KFMA 3TTMA 4F3SA 4YMAA 3T9UA 3TODA 4NF8B 3UORA 2QPQA 4G4PA 1NL5A 2UXAA 4FEDA 3FUZA 3K1PA 2XD3A 3TPAA 2PX1A 2NUVA 2ZNUA 1R1NA 4G8NA 3S2VA 4H0WA 2H4IA 3H6VA 4QFLA 2NVUB 4K3FA 1PEBA 3CRBA 1B5JA 2F6GA 4GVOA 4GQOA 5KZTA 4EQ7A 4PE5B 3RQTA 1HSLA 3HSTA 4R9GA 5K2XA 5J1DA 3IO6A 3TCGA 3T9HB 4XIGQ 5F1QA 1B3FA 2FYIA 4X48A 1B5IA 4WEDA 4GL8A 1R9QA 2PT1A 3TZAA 4XKPA 4F1VA 5TPAB 4H1XA 4U4SA 1DSNA 3TTNA 3FXUA 4Z0IA 3KBRA 1B3LA 3B6WA 1MXVA 4IB2A 5I2KA 2QS1A 2DE2A 2X7QA 5DVJA 3M3KA 3H06B 2QS3A 4ESXA 2YPNA 3PMXA 3S9MC 3FIRA 4ZECA 5I58A 1LCTA 3MP8A 3GZGA 4MBPA 1Z7NE 1NNKA 2ZMBA 2HZKA 3TTKA 3I6VA 2XX8A 4KFQA 4KYSA 1PBPA 1I69A 1YPNA 4KD5A 4JWOA 4EF2A 1R6ZA 5HPQA 4PFUA 4NWDA 4LONB 1P1UA 2DE3A 2X7PA 4LQ5A 1H43A 4ELPA 4QFKA 3C32A 3GBAA 2O84X 5HM4B 3O6IA 1MPCA 4ZEKA 5FHOA 3RT8A 1LFGA 4F1UA 1OVTA 4Z7EA 4P11A 4XKRA 1VR5A 2V93A 3CFXA 5ELVA 1FTKA 3IOWA 1Z7ME 2HXWA 3EHSA 4ZEIA 2XXTA 4M1VA 2QS4A 3UGWA 2DXYA 1P1WA 2OLBA 3D4GA 1B1HA 3TMGA 3LSFB 4R74A 1Y4CA 1MG1A 1P1QA 3A3UA 4GRKA 4JWXA 1N84A 1SVXB 5JEIA 4MLQA 3SESA 1QUJA 2RC8A 2P0SA 3E4RA 4I9DA 1QKBA 2Z8EA 4YB5A 3T93B 4DCYA 4RA1A 1H76A 2O6AA 4F1YA 2IEEA 4F3BA 3MW0A 3CSGA 3IL1B 1NFTA 5KCJA 2VOZA 3FV2A 5CRYA 2DVCA 1TFDA 1URSA 2F36A 3FZVA 1N76A 4H8JA 2DYXA 1MH4A 3Q27A 5JK4A 2AL5A 2I49A 4Q8RA 3Q25A 5H8QB 4Q0CA 3ILTB 1UTHB 3RGYA 1S50A 2HQ0A 4FEBA 2F6PA 5I84A 4N6PA 4PFYA 4QSDA 4OHNA 4O3AA 4L17A 3IX1A 3RLFE 1RYXA 3DELB 4R6KA 5ICQA 2ONKE 1L5TA 2ALUA 3PV0E 5KDTB 1B6HA 1SYHA 4RJZA 4OTEA 3G3FA 4YB6A 4F2OA 4OETA 3ZKLA 1NH8A 3MPLA 1POY1 4ZS9A 1SDXA 1GR2A 4AB6A 1JEUA 4R6YA 4HTGA 4MF3A 4JSOA 4ZEFA 1EZ9A 1FTJA 3TQWA 1PBQA 3EPEA 1MXUA 2OJTA 4DXUA 3WAFA 3ODBA 1MM6A 1IIWA 3FVNA 3OEKA 4H8IA 3S9EA 4N13A 4U1OA 4U1ZA 3T9XB 3UIFA 1JVXA 4HW8A 2RF1A 4QSCA 3IOVA 1FQEA 1BP5A 5DYHA 3U1OA 2KLFA 4P0IA 2XXYA 2ZYMA 2UYFA 3OO6A 1FQAA 3LBSA 4UACA 5EHMA 2QS2A 2UVIA 3QXMA 3R26A 1MM7A 1A54A 4Q5TA 5I2NA 4DE8A 4OENA 3E9XA 1ZTYA 1DTZA 5I56A 4G8MA 3PUXE 2R6GE 4GXAA 1Y3PA 4QRZA 3VVFA 4DXBA 5CMKA 1Y20A 1N3XA 4H67A 3MAMA 1SQYA 2RC7A 3G3HA 2O7UA 4C1TA 2NWJA 3PU5A 3W9VA 3QYTA 3TCFA 4OEUA 4QFNA 4OYVA 3G3IA 3KGCA 3PPRA 5A5XB 1H45A 4RYAA 4PFTA 5FTHA 4R73A 4R6HA 4RK9A 1US4A 5IKBA 4G2ZA 5B7DA 3FVKA 5AA2A 1XVXA 2A5TA 2DS9A 4F19A 1LFHA 2HAVA 4MFIA 1B05A 1POTA 1B52A 2VD2A 3K1MA 3DLNA 4WKMA 3G3JA 4QF9A 5JTYB 4OZ9A 3LSLA 5DEXA 3KN3A 3M3LA 1AOVA 1NNPA 3T96B 4THIA 2H5YA 1N0TA 3S4UA 1TXFA 2O1LA 3OOAA 3CG1A 2I48A 4R2BA 4IO2A 3GLBA 1Y3QA 4H5FA 1OLCA 4KI0E 3TUSA 2AYSA 1LLSA 4R72A 5BWJA 3TDJA 4FATA 2O69A 3Q28A 5B70A 2NXOA 3TYHA 4IGTA 4KYEA 2Z22A 4ND9A 2Y7WA 4I1DA 5ITOA 4GL0A 2Y7PA 2Q89A 4ESWA 3HCQA 2UVGA 5TP9B 3VXBA 5H8HB 2DOJA 5HBCA 1J1NA 2Y7RA 5H8FB 2I4BA 3UP9A 3EHTA 1RYOA 1SYIA 4JB7A 1PC3A 4FIMA 3MVXA 2P1SA 4TOZA 4H6DA 3USDA 1M5CA 3TAJA 1ZLQA 3K4UA 1JVYA 1ZU0A 1S7YA 3GBBA 4Q30B 2RKMA 3VDFA 4ONYA 1MH3A 2V3UA 2O7IA 5FTIA 3IORA 2RC9A 4POWA 3PMWA 3Q29A 2Q2AA 1OMPA 2F7CA 1IEJA 3RTFB 2VP1A 4I8CA 2XXQA 4YMBA 3QAXA 3PD8A 1D9YA 2F34A 4MLVA 1URGA 2QJEA 3DP8A 1IITA 3MC2A 2ANJA 2XXHA 1ZKBA 4XKQA 4QHQA 4X1DA 4BDRA 4H5GA 1SBPA 4C0RA 4F22A 1B2HA 1BKAA 2A5SA 3N94A 3FD3A 1B7HA 3KN7A 4UA8A 1VSOA 3LC8A 3VVDA 4ECFA 4WEPA 1B7ZA 3MZ1A 1M5FA 3RUMA 3QSLA 2D5WA 1EZOA 5TPAA 3OXNA 3OENA 3SEVA 3KSJA 4P0GA 4LUBA 2HFBA 1H44A 2HEUA 3THIA 5LOMA 1O7TA 3I5OA 2O1MA 3BBRA 3VV5A 1N7WA 3T9VA 3IJOB 4RPNA 3BFTA 4HCYA 1MQDA 1N04A 4RK2A 4OVJA 3IB1A 2QMXA 3H3GA 3C9HA 3EHUA 5L9MA 3TQLA 1A8FA 1YAEA 3K00A 2H9BA 3HN0A 5I58B 3FATA 1IXHA 3K6WA 1A40A 4NF5A 1A7LA 1WODA 3KOTA 5CC2A 3RY3A 1HSEA 4JWYA 4NF4A 2THIA 3GXAA 3CR9A 1MQJA 4EQBA 3O6GA 5AA4A 3O28A 3SKPA 1I6AA 3TTRA 1B4ZA 1SI1A 4JSDA 3R7XA 4ZEDA 4PETA 5CI5A 2ONRA 2VD3A 1ZBMA 4U22A 2QMWA 1IXIA 3K1NA 4BLAA 2PT2A 3IR1A 3N26A 5L8DA 1QULA 1SW4A 1SW1A 4U4XA 1UTBB 1ZJLA 4O3BA 3PUVE 2R71A 3OSRA 1LBBA 4YICA 4X9TA 3IB0A 3C33A 3ILUB 1Y1MA 1Y1ZA 2REJA 4BDNA 3PGFA 2I0CA 3M8UA 3BKIB 1MS7A 3RNNA 2OWTA 2OWSA 1F9BA 2B3BA 1MPBA 1OLAA 3OD7A 2UVJA 5ISUA 1MDQA 4F3GA 3SETA 1LAXA 5TU0A 3IAZA 1OVBA 3RT6B 2Q8JA 4KYDA 5I59A 2ZYOA 2ONSA 3MVYA 5KCJB 4OERA 3JV9A 2DVZA 3W9WA 3MVZA 1FTOA 3CI8A 4YKKA 1UTHA 5I57B 3ZSFA 2F7BA 1B3GA 4YZZA 4G68B 2F97A 3LSWA 4PFWA 4G77A 3FXQA 1TFAA 1IQ7A 1OQGA 3K6UA 3VLUA 2DWJA 2Q2CA 1JETA 4JDFA 3S9LC 2W7YA 1MDP1 1UIVA 2PBWA 2V84A 1RKMA 3CSBA 4R75A 4NEDA 4NF6A 3RPWA 2ZYKA 4KHZE 2G93A 1D4NA 4ZE8A 2QSXA 4NE4A 4WXJA 2O51A 3FGSA 1YCJA 4ZZEA 1TT1A 1ATGA 2REGA 3KEIA 4LP2B 3VVEA 1B32A 3MQ9A 4DIGA 4XXUA 4QSEA 2V3QA 1B46A 1B1XA 3V83A 4QFPA 1QUIA 1MPDA 2BJJX 2HAUA 1NNFA 2ZNSA 1XT8A 1QW0A 3ECRA 5IAIA 3L6GA 4KQPA 3TCHA 2B65A 4BDQA 3CFLA 5I2NB 5CMCA 5DVIA 2DQVA 3HPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O97 A;  1Y9U A;  2GRV A;  3PPO A;  3LUY A;  4IO4 A;  5H8N A;  2G29 A;  2QL3 A;  1EU8 A;  1MQG A;  4C1U A;  3K01 A;  1UQW A;  1FQD A;  2Z23 A;  1GGG A;  2D21 A;  3FVO A;  1O63 A;  5CBS A;  5CMM A;  3H6U A;  3A3C A;  1IXG A;  2V25 A;  5A5X A;  2I3V A;  2CZL A;  3UN6 A;  3A09 A;  5AE4 A;  1OIB A;  3QIM A;  3V5A A;  4EDP A;  3N6U A;  4BDL A;  1MXX A;  4O3C A;  4FEC A;  2XX9 A;  1DOT A;  2M8C A;  2RCB A;  2I58 A;  5EYF A;  1B3H A;  2R9J A;  3K2D A;  5DTB A;  4PP0 A;  3U92 A;  2FA7 A;  3MUQ A;  3MZ9 A;  2AL4 A;  4EXL A;  2XXW A;  4U21 A;  1GVC A;  3O9P A;  1DPE A;  3RTW B;  1QJM A;  3BFU A;  2CMO A;  2GFE A;  1PB9 A;  2NOO A;  1D3K A;  1SW5 A;  1OQH A;  3CIJ A;  4R9F A;  4LZ7 A;  2XXP A;  4E0W A;  1LCF A;  1LB9 A;  3SER A;  1ELJ A;  5TP9 A;  4YKI A;  4KCD A;  3OO7 A;  4ZEB A;  4DLD A;  3C36 A;  1MXW A;  4HS7 A;  2YLN A;  2OK2 A;  3IO4 A;  4ZE9 A;  2YJP A;  4POX A;  3KJ7 A;  1QUK A;  3MP6 A;  1BTJ A;  4PQJ A;  3WAE A;  5ICT A;  3VLV A;  3ZS6 A;  3VFJ A;  1MQH A;  1AIV A;  2H98 A;  4LAT A;  2O68 A;  2X26 A;  5M2V A;  3C34 A;  4DZ1 A;  4NF8 A;  2D3I A;  2F5X A;  1IXC A;  3O66 A;  2QRY A;  1Q35 A;  4YU0 A;  1JW5 A;  1SW2 A;  3IOT A;  4GFR A;  3U72 A;  2XXR A;  4F31 B;  2AIX A;  4NWC A;  3CFZ A;  1SD3 A;  3UA8 A;  2H25 A;  3KOS A;  3FVG A;  4HCW A;  4GIZ A;  1H3D A;  2DP8 A;  2WKY A;  3C4M A;  3CG3 A;  4FE8 A;  4I62 A;  1NNT A;  1B7U A;  1MXY A;  2XXV A;  1A99 A;  2GHA A;  1B0L A;  1MRP A;  1P1O A;  3MZB A;  5FHN A;  1XC1 A;  3FJM A;  5H8S A;  1NH7 A;  2DWH A;  1LGB C;  4GD5 A;  1ZIU A;  2XX7 A;  1LFI A;  1BIY A;  1S9T A;  3U8Q A;  4ISU A;  3TEL A;  1M5B A;  1BLF A;  2Y7K A;  3SEW A;  1LB8 A;  2Z8D A;  3TKD A;  3TEP A;  1WDN A;  4DXC A;  2F78 A;  4IO3 A;  2F7A A;  1AMF A;  5I2K B;  1DMB A;  1MY0 A;  3M3F A;  3H6W A;  1SI0 A;  4ELO A;  4KR5 A;  1NMU A;  1P1N A;  3HHG A;  3N6T A;  2ZXT A;  4EQ9 A;  2VGQ A;  1LAF E;  3B6Q A;  4EXK A;  3LR1 A;  4GOT A;  4OES A;  5AA2 D;  1I6Q A;  4YKP A;  1B58 A;  4H65 A;  1JNF A;  4LVQ A;  2P2A A;  2OZZ A;  3U93 A;  3AXF A;  3FAS A;  2I4C A;  4EUO A;  3Q26 A;  4NF5 B;  2DSF A;  1MY4 A;  2XXI A;  2GH9 A;  4RNS A;  2LAO A;  4NF4 B;  2E1S A;  4TLM B;  5AA4 B;  1D9V A;  3OO9 A;  3V89 B;  4R2F A;  4BDO A;  5EHS A;  3PUY E;  3VXC A;  3ONM A;  4FOR A;  1M5D A;  3PMV A;  3UK4 A;  4TLL B;  3G3G A;  3SEX A;  2Q88 A;  3T22 A;  1EH3 A;  3VLW A;  3L6H A;  3I3V A;  1UTB A;  1MQI A;  5ITP A;  2Z8F A;  2VHA A;  1A55 A;  1US5 A;  3B6T A;  3OEL A;  3K02 A;  3IB2 A;  1FCK A;  1VFE A;  4LQ2 A;  1MY2 A;  3KN8 A;  4LA9 A;  3G7W A;  4RY1 A;  1ANF A;  5L9O A;  1EZP A;  4E0X A;  1B5H A;  1UIU A;  1USY E;  4FAJ A;  1Y4T A;  3FXR A;  4IO6 A;  2HCA A;  3KJT A;  3PPP A;  1Y3N A;  1ZMG A;  3P7I A;  1IUD A;  3PD9 A;  1LAG E;  3KZG A;  2I0B A;  3K6X A;  2Q9T A;  4ELR A;  2B3F A;  5F7V A;  2ZYN A;  4U23 A;  4JXI A;  1LAH E;  3MJN A;  2RCA A;  3IJX B;  1AL3 A;  4RXL A;  2V3T A;  3TFL A;  3EQ1 A;  5H8Q A;  5I59 B;  4YKJ A;  4ZDM A;  1LBC A;  5I57 A;  4IY5 A;  3O6H A;  1P99 A;  4G68 A;  4DDD A;  3QUF A;  1AH5 A;  1TWY A;  4F29 A;  4U2R A;  5AA1 A;  4BDM A;  1JEV A;  4KPT A;  1FQC A;  2E0S A;  5KDT A;  4F3P A;  2DXR A;  4AQ4 A;  4F18 A;  4MH5 A;  4F2Q A;  1QKA A;  2DE4 A;  4IO7 A;  3HO7 A;  1FQB A;  4QFO A;  4KCC A;  3OEM A;  1LST A;  1FTL A;  3EN3 A;  2Y84 A;  3SEY A;  2Y7I A;  4NF6 B;  1B51 A;  4X1B A;  4OXV A;  4XTC Q;  2H99 A;  3QUJ A;  4LZ8 A;  2IA4 A;  1M5E A;  2ZNT A;  3K0V A;  4YAH X;  3LSX A;  1B4H A;  4GF8 A;  2OCU A;  1FTM A;  1PB7 A;  4EF1 A;  3OO8 A;  3MP1 A;  5CBR A;  2XD2 A;  1T0K A;  1IZ1 A;  3IK6 B;  3O2A A;  3MBP A;  5BUU A;  2PMS A;  3FJG A;  1GTK A;  1CB6 A;  3E3K A;  5AA3 A;  2PVU A;  3R6U A;  5CMB A;  3ZKK A;  2XXU A;  3PUZ E;  5L9S A;  4OQO A;  4M4G A;  1VE4 A;  1B40 A;  3HV1 A;  4IO5 A;  3C35 A;  3PPN A;  4DCX A;  1MXZ A;  1GV8 A;  2OBG A;  5I56 B;  2FNC A;  1B9J A;  5K2Y A;  3MPK A;  4G8H A;  4GWO A;  5CM6 A;  1JW1 A;  3EF7 A;  4F39 A;  2ABH A;  1R9L A;  1URD A;  4ZZA A;  3C31 A;  3JYR A;  3HHF A;  1PDA A;  1MY1 A;  4AB5 A;  3U94 A;  4ELQ A;  5H8N B;  1XS5 A;  5DVF A;  3MWB A;  3E13 X;  1O64 A;  3FV1 A;  4N07 A;  2I6E A;  4TQU Q;  3SDF A;  3IOU A;  3OSQ A;  3H4Z A;  4JBZ A;  3QK6 A;  4OEV A;  2PYY A;  3OMB A;  2UVH A;  5AA2 B;  2A5T B;  1N7X A;  1XHY A;  4OMB A;  5JTY A;  1YTV A;  3H7M A;  2F8D A;  4XKN A;  1A8E A;  1JW4 A;  1KWH A;  1B3E A;  5DEX B;  1WVJ A;  2UYE A;  3PPQ A;  4GXS B;  1MY3 A;  3T66 A;  1DTG A;  1Q1K A;  3JZJ A;  3N5L A;  4OFJ A;  4NTL A;  1CE2 A;  3DP6 A;  3H6T A;  4FJP A;  3G3K A;  4IY6 A;  5DT6 A;  4OWD A;  1II5 A;  1XOC A;  3H03 A;  2GHB A;  4GLI A;  4RPO A;  2XHD A;  2F35 A;  1HSJ A;  1B0H A;  1PB8 A;  3KSX A;  5H8H A;  3B7D A;  2ESN A;  2DWI A;  2XXX A;  5H8F A;  3O29 A;  3W15 C;  2I3W A;  1I6B A;  1FQF A;  3S9N C;  4G68 C;  1NKX A;  3FJ7 A;  4OFO A;  4OFL A;  5FHM A;  1QVS A;  3DP4 A;  3F11 A;  1USY H;  2HZL A;  3CVG A;  1FW0 A;  3RN8 A;  1N3W A;  4IGR A;  1DPP A;  1JQF A;  2RIN A;  1XVY A;  3TTL A;  3PUW E;  3V8X B;  3VE1 B;  3DM0 A;  3MVW A;  4NMY A;  4YB7 A;  4LZ5 A;  3D4C A;  2DWA A;  1VFD A;  3SEU A;  3K6V A;  3KG2 A;  3KFM A;  3TTM A;  4F3S A;  4YMA A;  3T9U A;  3TOD A;  4NF8 B;  3UOR A;  2QPQ A;  4G4P A;  1NL5 A;  2UXA A;  4FED A;  3FUZ A;  3K1P A;  2XD3 A;  3TPA A;  2PX1 A;  2NUV A;  2ZNU A;  1R1N A;  4G8N A;  3S2V A;  4H0W A;  2H4I A;  3H6V A;  4QFL A;  2NVU B;  4K3F A;  1PEB A;  3CRB A;  1B5J A;  2F6G A;  4GVO A;  4GQO A;  5KZT A;  4EQ7 A;  4PE5 B;  3RQT A;  1HSL A;  3HST A;  4R9G A;  5K2X A;  5J1D A;  3IO6 A;  3TCG A;  3T9H B;  4XIG Q;  5F1Q A;  1B3F A;  2FYI A;  4X48 A;  1B5I A;  4WED A;  4GL8 A;  1R9Q A;  2PT1 A;  3TZA A;  4XKP A;  4F1V A;  5TPA B;  4H1X A;  4U4S A;  1DSN A;  3TTN A;  3FXU A;  4Z0I A;  3KBR A;  1B3L A;  3B6W A;  1MXV A;  4IB2 A;  5I2K A;  2QS1 A;  2DE2 A;  2X7Q A;  5DVJ A;  3M3K A;  3H06 B;  2QS3 A;  4ESX A;  2YPN A;  3PMX A;  3S9M C;  3FIR A;  4ZEC A;  5I58 A;  1LCT A;  3MP8 A;  3GZG A;  4MBP A;  1Z7N E;  1NNK A;  2ZMB A;  2HZK A;  3TTK A;  3I6V A;  2XX8 A;  4KFQ A;  4KYS A;  1PBP A;  1I69 A;  1YPN A;  4KD5 A;  4JWO A;  4EF2 A;  1R6Z A;  5HPQ A;  4PFU A;  4NWD A;  4LON B;  1P1U A;  2DE3 A;  2X7P A;  4LQ5 A;  1H43 A;  4ELP A;  4QFK A;  3C32 A;  3GBA A;  2O84 X;  5HM4 B;  3O6I A;  1MPC A;  4ZEK A;  5FHO A;  3RT8 A;  1LFG A;  4F1U A;  1OVT A;  4Z7E A;  4P11 A;  4XKR A;  1VR5 A;  2V93 A;  3CFX A;  5ELV A;  1FTK A;  3IOW A;  1Z7M E;  2HXW A;  3EHS A;  4ZEI A;  2XXT A;  4M1V A;  2QS4 A;  3UGW A;  2DXY A;  1P1W A;  2OLB A;  3D4G A;  1B1H A;  3TMG A;  3LSF B;  4R74 A;  1Y4C A;  1MG1 A;  1P1Q A;  3A3U A;  4GRK A;  4JWX A;  1N84 A;  1SVX B;  5JEI A;  4MLQ A;  3SES A;  1QUJ A;  2RC8 A;  2P0S A;  3E4R A;  4I9D A;  1QKB A;  2Z8E A;  4YB5 A;  3T93 B;  4DCY A;  4RA1 A;  1H76 A;  2O6A A;  4F1Y A;  2IEE A;  4F3B A;  3MW0 A;  3CSG A;  3IL1 B;  1NFT A;  5KCJ A;  2VOZ A;  3FV2 A;  5CRY A;  2DVC A;  1TFD A;  1URS A;  2F36 A;  3FZV A;  1N76 A;  4H8J A;  2DYX A;  1MH4 A;  3Q27 A;  5JK4 A;  2AL5 A;  2I49 A;  4Q8R A;  3Q25 A;  5H8Q B;  4Q0C A;  3ILT B;  1UTH B;  3RGY A;  1S50 A;  2HQ0 A;  4FEB A;  2F6P A;  5I84 A;  4N6P A;  4PFY A;  4QSD A;  4OHN A;  4O3A A;  4L17 A;  3IX1 A;  3RLF E;  1RYX A;  3DEL B;  4R6K A;  5ICQ A;  2ONK E;  1L5T A;  2ALU A;  3PV0 E;  5KDT B;  1B6H A;  1SYH A;  4RJZ A;  4OTE A;  3G3F A;  4YB6 A;  4F2O A;  4OET A;  3ZKL A;  1NH8 A;  3MPL A;  1POY 1;  4ZS9 A;  1SDX A;  1GR2 A;  4AB6 A;  1JEU A;  4R6Y A;  4HTG A;  4MF3 A;  4JSO A;  4ZEF A;  1EZ9 A;  1FTJ A;  3TQW A;  1PBQ A;  3EPE A;  1MXU A;  2OJT A;  4DXU A;  3WAF A;  3ODB A;  1MM6 A;  1IIW A;  3FVN A;  3OEK A;  4H8I A;  3S9E A;  4N13 A;  4U1O A;  4U1Z A;  3T9X B;  3UIF A;  1JVX A;  4HW8 A;  2RF1 A;  4QSC A;  3IOV A;  1FQE A;  1BP5 A;  5DYH A;  3U1O A;  2KLF A;  4P0I A;  2XXY A;  2ZYM A;  2UYF A;  3OO6 A;  1FQA A;  3LBS A;  4UAC A;  5EHM A;  2QS2 A;  2UVI A;  3QXM A;  3R26 A;  1MM7 A;  1A54 A;  4Q5T A;  5I2N A;  4DE8 A;  4OEN A;  3E9X A;  1ZTY A;  1DTZ A;  5I56 A;  4G8M A;  3PUX E;  2R6G E;  4GXA A;  1Y3P A;  4QRZ A;  3VVF A;  4DXB A;  5CMK A;  1Y20 A;  1N3X A;  4H67 A;  3MAM A;  1SQY A;  2RC7 A;  3G3H A;  2O7U A;  4C1T A;  2NWJ A;  3PU5 A;  3W9V A;  3QYT A;  3TCF A;  4OEU A;  4QFN A;  4OYV A;  3G3I A;  3KGC A;  3PPR A;  5A5X B;  1H45 A;  4RYA A;  4PFT A;  5FTH A;  4R73 A;  4R6H A;  4RK9 A;  1US4 A;  5IKB A;  4G2Z A;  5B7D A;  3FVK A;  5AA2 A;  1XVX A;  2A5T A;  2DS9 A;  4F19 A;  1LFH A;  2HAV A;  4MFI A;  1B05 A;  1POT A;  1B52 A;  2VD2 A;  3K1M A;  3DLN A;  4WKM A;  3G3J A;  4QF9 A;  5JTY B;  4OZ9 A;  3LSL A;  5DEX A;  3KN3 A;  3M3L A;  1AOV A;  1NNP A;  3T96 B;  4THI A;  2H5Y A;  1N0T A;  3S4U A;  1TXF A;  2O1L A;  3OOA A;  3CG1 A;  2I48 A;  4R2B A;  4IO2 A;  3GLB A;  1Y3Q A;  4H5F A;  1OLC A;  4KI0 E;  3TUS A;  2AYS A;  1LLS A;  4R72 A;  5BWJ A;  3TDJ A;  4FAT A;  2O69 A;  3Q28 A;  5B70 A;  2NXO A;  3TYH A;  4IGT A;  4KYE A;  2Z22 A;  4ND9 A;  2Y7W A;  4I1D A;  5ITO A;  4GL0 A;  2Y7P A;  2Q89 A;  4ESW A;  3HCQ A;  2UVG A;  5TP9 B;  3VXB A;  5H8H B;  2DOJ A;  5HBC A;  1J1N A;  2Y7R A;  5H8F B;  2I4B A;  3UP9 A;  3EHT A;  1RYO A;  1SYI A;  4JB7 A;  1PC3 A;  4FIM A;  3MVX A;  2P1S A;  4TOZ A;  4H6D A;  3USD A;  1M5C A;  3TAJ A;  1ZLQ A;  3K4U A;  1JVY A;  1ZU0 A;  1S7Y A;  3GBB A;  4Q30 B;  2RKM A;  3VDF A;  4ONY A;  1MH3 A;  2V3U A;  2O7I A;  5FTI A;  3IOR A;  2RC9 A;  4POW A;  3PMW A;  3Q29 A;  2Q2A A;  1OMP A;  2F7C A;  1IEJ A;  3RTF B;  2VP1 A;  4I8C A;  2XXQ A;  4YMB A;  3QAX A;  3PD8 A;  1D9Y A;  2F34 A;  4MLV A;  1URG A;  2QJE A;  3DP8 A;  1IIT A;  3MC2 A;  2ANJ A;  2XXH A;  1ZKB A;  4XKQ A;  4QHQ A;  4X1D A;  4BDR A;  4H5G A;  1SBP A;  4C0R A;  4F22 A;  1B2H A;  1BKA A;  2A5S A;  3N94 A;  3FD3 A;  1B7H A;  3KN7 A;  4UA8 A;  1VSO A;  3LC8 A;  3VVD A;  4ECF A;  4WEP A;  1B7Z A;  3MZ1 A;  1M5F A;  3RUM A;  3QSL A;  2D5W A;  1EZO A;  5TPA A;  3OXN A;  3OEN A;  3SEV A;  3KSJ A;  4P0G A;  4LUB A;  2HFB A;  1H44 A;  2HEU A;  3THI A;  5LOM A;  1O7T A;  3I5O A;  2O1M A;  3BBR A;  3VV5 A;  1N7W A;  3T9V A;  3IJO B;  4RPN A;  3BFT A;  4HCY A;  1MQD A;  1N04 A;  4RK2 A;  4OVJ A;  3IB1 A;  2QMX A;  3H3G A;  3C9H A;  3EHU A;  5L9M A;  3TQL A;  1A8F A;  1YAE A;  3K00 A;  2H9B A;  3HN0 A;  5I58 B;  3FAT A;  1IXH A;  3K6W A;  1A40 A;  4NF5 A;  1A7L A;  1WOD A;  3KOT A;  5CC2 A;  3RY3 A;  1HSE A;  4JWY A;  4NF4 A;  2THI A;  3GXA A;  3CR9 A;  1MQJ A;  4EQB A;  3O6G A;  5AA4 A;  3O28 A;  3SKP A;  1I6A A;  3TTR A;  1B4Z A;  1SI1 A;  4JSD A;  3R7X A;  4ZED A;  4PET A;  5CI5 A;  2ONR A;  2VD3 A;  1ZBM A;  4U22 A;  2QMW A;  1IXI A;  3K1N A;  4BLA A;  2PT2 A;  3IR1 A;  3N26 A;  5L8D A;  1QUL A;  1SW4 A;  1SW1 A;  4U4X A;  1UTB B;  1ZJL A;  4O3B A;  3PUV E;  2R71 A;  3OSR A;  1LBB A;  4YIC A;  4X9T A;  3IB0 A;  3C33 A;  3ILU B;  1Y1M A;  1Y1Z A;  2REJ A;  4BDN A;  3PGF A;  2I0C A;  3M8U A;  3BKI B;  1MS7 A;  3RNN A;  2OWT A;  2OWS A;  1F9B A;  2B3B A;  1MPB A;  1OLA A;  3OD7 A;  2UVJ A;  5ISU A;  1MDQ A;  4F3G A;  3SET A;  1LAX A;  5TU0 A;  3IAZ A;  1OVB A;  3RT6 B;  2Q8J A;  4KYD A;  5I59 A;  2ZYO A;  2ONS A;  3MVY A;  5KCJ B;  4OER A;  3JV9 A;  2DVZ A;  3W9W A;  3MVZ A;  1FTO A;  3CI8 A;  4YKK A;  1UTH A;  5I57 B;  3ZSF A;  2F7B A;  1B3G A;  4YZZ A;  4G68 B;  2F97 A;  3LSW A;  4PFW A;  4G77 A;  3FXQ A;  1TFA A;  1IQ7 A;  1OQG A;  3K6U A;  3VLU A;  2DWJ A;  2Q2C A;  1JET A;  4JDF A;  3S9L C;  2W7Y A;  1MDP 1;  1UIV A;  2PBW A;  2V84 A;  1RKM A;  3CSB A;  4R75 A;  4NED A;  4NF6 A;  3RPW A;  2ZYK A;  4KHZ E;  2G93 A;  1D4N A;  4ZE8 A;  2QSX A;  4NE4 A;  4WXJ A;  2O51 A;  3FGS A;  1YCJ A;  4ZZE A;  1TT1 A;  1ATG A;  2REG A;  3KEI A;  4LP2 B;  3VVE A;  1B32 A;  3MQ9 A;  4DIG A;  4XXU A;  4QSE A;  2V3Q A;  1B46 A;  1B1X A;  3V83 A;  4QFP A;  1QUI A;  1MPD A;  2BJJ X;  2HAU A;  1NNF A;  2ZNS A;  1XT8 A;  1QW0 A;  3ECR A;  5IAI A;  3L6G A;  4KQP A;  3TCH A;  2B65 A;  4BDQ A;  3CFL A;  5I2N B;  5CMC A;  5DVI A;  2DQV A;  3HPI A; 
#chains in the Genus database with same CATH topology
 4H46 A;  3O97 A;  1Y9U A;  1RDX A;  2GRV A;  3PPO A;  3LUY A;  4IO4 A;  5H8N A;  2G29 A;  2QL3 A;  1EU8 A;  1MQG A;  4C1U A;  4HE0 A;  3K01 A;  1UQW A;  1FQD A;  2Z23 A;  4P56 A;  1GGG A;  2D21 A;  1FPK A;  3FVO A;  1O63 A;  5CBS A;  5CMM A;  3H6U A;  3A3C A;  1IXG A;  4PGN A;  2V25 A;  5A5X A;  2I3V A;  2CZL A;  3UN6 A;  3A09 A;  5AE4 A;  1XI6 A;  1OIB A;  3QIM A;  3V5A A;  4EDP A;  3N6U A;  4BDL A;  1MXX A;  4O3C A;  4FEC A;  2XX9 A;  1DOT A;  2M8C A;  2RCB A;  2I58 A;  5EYF A;  1B3H A;  3PTY A;  2R9J A;  3K2D A;  2WEF A;  5DTB A;  4PP0 A;  3U92 A;  2FA7 A;  2P3V A;  3MUQ A;  3MZ9 A;  1DBZ A;  2OWZ A;  2AL4 A;  4EXL A;  2XXW A;  4U21 A;  1GVC A;  3O9P A;  2HPG A;  1DPE A;  5IZ1 A;  3RTW B;  1QJM A;  3BFU A;  2CMO A;  2GFE A;  1PB9 A;  2NOO A;  1D3K A;  1SW5 A;  1OQH A;  3CIJ A;  4R9F A;  4I3E A;  2XXP A;  4LZ7 A;  4E0W A;  1LCF A;  4MAG A;  1LB9 A;  3SER A;  4XEQ A;  4O94 A;  1ELJ A;  4GX4 A;  3KBZ A;  5TP9 A;  4YKI A;  4KCD A;  3OO7 A;  4ZEB A;  4DLD A;  3C36 A;  2KQZ A;  1MXW A;  4HS7 A;  2YLN A;  2OK2 A;  3IO4 A;  4ZE9 A;  2YJP A;  2CZH A;  4POX A;  3EKI A;  3KJ7 A;  4HXV A;  2FIE A;  1QUK A;  3MP6 A;  1BTJ A;  4PQJ A;  3WAE A;  5ICT A;  3VLV A;  3ZS6 A;  2VPO A;  1FPF A;  3VFJ A;  1MQH A;  1AIV A;  2H98 A;  4LAT A;  2O68 A;  2X26 A;  5M2V A;  3C34 A;  4DZ1 A;  4NG7 A;  4NF8 A;  2D3I A;  2F5X A;  1INP A;  4P1E A;  1IXC A;  3O66 A;  1EYJ A;  2QRY A;  1Q35 A;  4YU0 A;  1JW5 A;  1SW2 A;  3IOT A;  4GFR A;  3U72 A;  2XXR A;  4F31 B;  2AIX A;  4NWC A;  3CFZ A;  4PCD A;  1SD3 A;  3UA8 A;  2H25 A;  3KOS A;  4JVC A;  3FVG A;  4HCW A;  4GIZ A;  1H3D A;  2DP8 A;  4PF6 A;  2WKY A;  4G61 A;  3C4M A;  3CG3 A;  4FE8 A;  4I62 A;  1NNT A;  1B7U A;  1MXY A;  2XXV A;  1A99 A;  2GHA A;  5ET6 A;  1B0L A;  1MRP A;  1P1O A;  3MZB A;  5FHN A;  1XC1 A;  3FJM A;  5H8S A;  2Q74 A;  1NH7 A;  2DWH A;  1LGB C;  4GD5 A;  1ZIU A;  2XX7 A;  1LFI A;  1BIY A;  1S9T A;  3U8Q A;  4ISU A;  3TEL A;  1M5B A;  2FVZ A;  1VDW A;  1BLF A;  2OX3 A;  2Y7K A;  3SEW A;  1LB8 A;  2Z8D A;  3TKD A;  2KR0 A;  3TEP A;  1WDN A;  4DXC A;  2F78 A;  4IO3 A;  2F7A A;  1AMF A;  5FBP A;  5I2K B;  1DMB A;  2V4C A;  1MY0 A;  5IZZ A;  3M3F A;  3H6W A;  1SI0 A;  4ELO A;  4KR5 A;  1NMU A;  1P1N A;  3HHG A;  3N6T A;  2ZXT A;  3ISP A;  4EQ9 A;  2VGQ A;  1LBX A;  1LAF E;  3B6Q A;  4EXK A;  3LR1 A;  4GOT A;  4OES A;  5AA2 D;  1I6Q A;  5I7I A;  4YKP A;  3A29 A;  1NV1 A;  1B58 A;  2JJK A;  4H65 A;  1JNF A;  5EQ8 A;  4LVQ A;  2P2A A;  2OZZ A;  3U93 A;  3AXF A;  4NF0 A;  3FAS A;  2I4C A;  4EUO A;  2Y5K A;  3Q26 A;  4NF5 B;  1EYK A;  2DSF A;  1MY4 A;  2XXI A;  2GH9 A;  4RNS A;  2LAO A;  1LEV A;  4NF4 B;  2E1S A;  4TLM B;  5AA4 B;  1D9V A;  3OO9 A;  3V89 B;  2HHM A;  4R2F A;  4BDO A;  5EHS A;  3KC0 A;  3PUY E;  3VXC A;  3ONM A;  4FOR A;  1FPJ A;  1M5D A;  3PMV A;  3UK4 A;  4TLL B;  3G3G A;  3SEX A;  2Q88 A;  3T22 A;  1EH3 A;  1QGX A;  4MJO A;  1NV7 A;  3VLW A;  4MNP A;  1NV4 A;  3L6H A;  3I3V A;  1UTB A;  1MQI A;  5ITP A;  2Z8F A;  2VHA A;  4MX6 A;  1A55 A;  1US5 A;  4GWZ A;  3B6T A;  3OEL A;  3K02 A;  3IB2 A;  1FCK A;  5EYH A;  1VFE A;  4LQ2 A;  1MY2 A;  3KN8 A;  4AS5 A;  4LA9 A;  3G7W A;  3RPL A;  4RY1 A;  1ANF A;  5L9O A;  1EZP A;  4E0X A;  1B5H A;  1UIU A;  1USY E;  4FAJ A;  1Y4T A;  1SPI A;  3FXR A;  4IO6 A;  2HCA A;  3KJT A;  4XF5 A;  3PPP A;  1Y3N A;  2ZZX A;  1ZMG A;  3P7I A;  1IUD A;  5EQ9 A;  3PD9 A;  1LAG E;  3KZG A;  2I0B A;  3K6X A;  2Q9T A;  4ELR A;  4I3Y A;  4MEV A;  2B3F A;  5F7V A;  1KA0 A;  1RDZ A;  2ZYN A;  4U23 A;  5ET7 A;  4JXI A;  1LAH E;  2ZZW A;  3MJN A;  2RCA A;  4N15 A;  3IJX B;  1AL3 A;  4RXL A;  2V3T A;  3TFL A;  3EQ1 A;  5H8Q A;  5I59 B;  4YKJ A;  4ZDM A;  1NV6 A;  3KC1 A;  1FPG A;  1LBC A;  5I57 A;  4IY5 A;  3O6H A;  1P99 A;  4G68 A;  1FJ6 A;  4DDD A;  3QUF A;  1AH5 A;  1TWY A;  4F29 A;  4U2R A;  5AA1 A;  4BDM A;  1JEV A;  4KPT A;  5I5P A;  4NAP A;  1FQC A;  2E0S A;  5KDT A;  5ET8 A;  4F3P A;  2DXR A;  4AQ4 A;  4F18 A;  4UAB A;  4MH5 A;  4F2Q A;  1QKA A;  2DE4 A;  4IO7 A;  3HO7 A;  1FQB A;  4QFO A;  4KCC A;  3OEM A;  4OVS A;  5F24 A;  4QXD A;  1LST A;  1FTL A;  3EN3 A;  1NV2 A;  2Y84 A;  3SEY A;  2Y7I A;  1G0H A;  1B51 A;  4NF6 B;  4OXV A;  4X1B A;  4XTC Q;  2H99 A;  3QUJ A;  4LZ8 A;  2IA4 A;  1M5E A;  2ZNT A;  3K0V A;  4YAH X;  3LSX A;  1B4H A;  4GF8 A;  2OCU A;  1FTM A;  1PB7 A;  4EF1 A;  3OO8 A;  4PF8 A;  3MP1 A;  5CBR A;  2XD2 A;  1T0K A;  1LBZ A;  1IZ1 A;  3IK6 B;  1NUZ A;  3RYD A;  3O2A A;  3IFA A;  3MBP A;  5BUU A;  2PMS A;  1NV0 A;  3FJG A;  1GTK A;  1CB6 A;  3E3K A;  5AA3 A;  2PVU A;  3R6U A;  5CMB A;  3ZKK A;  2XXU A;  3PUZ E;  5L9S A;  4OQO A;  4FBP A;  4M4G A;  1VE4 A;  1B40 A;  3HV1 A;  4IO5 A;  3C35 A;  3PPN A;  4NHB A;  4DCX A;  1MXZ A;  1GV8 A;  2OBG A;  5I56 B;  4GWW A;  2FNC A;  1B9J A;  5K2Y A;  3MPK A;  2FIX A;  4G8H A;  4GWO A;  5CM6 A;  1JW1 A;  3EF7 A;  4F39 A;  2ABH A;  1R9L A;  1URD A;  4ZZA A;  3C31 A;  3JYR A;  3HHF A;  1PDA A;  1MY1 A;  4AB5 A;  4PAF A;  3QMF A;  3U94 A;  4ELQ A;  1LBW A;  5H8N B;  1XS5 A;  3B50 A;  4GWY A;  5DVF A;  3MWB A;  2FHY A;  3E13 X;  4PBQ A;  1O64 A;  3FV1 A;  4N07 A;  2I6E A;  4TQU Q;  3SDF A;  3IOU A;  2QVV A;  3OSQ A;  3H4Z A;  4N81 A;  4NQ8 A;  4JBZ A;  3QK6 A;  5IZ3 A;  4OEV A;  2PYY A;  3OMB A;  2F3B A;  2UVH A;  5AA2 B;  1JP4 A;  2A5T B;  1N7X A;  2DDK A;  1XHY A;  4PC9 A;  4OMB A;  3MST A;  5EQA A;  5JTY A;  1YTV A;  3H7M A;  2F8D A;  4XKN A;  1A8E A;  1JW4 A;  3D1R A;  4QBA A;  1KWH A;  1B3E A;  4X8R A;  5DEX B;  1WVJ A;  2UYE A;  3PPQ A;  4GXS B;  1MY3 A;  3T66 A;  1FBP A;  1DTG A;  1Q1K A;  3JZJ A;  3N5L A;  4OFJ A;  4NTL A;  1CE2 A;  3DP6 A;  4GX6 A;  3H6T A;  3B8B A;  4FJP A;  3G3K A;  3IFC A;  4IY6 A;  5DT6 A;  4OWD A;  1II5 A;  1XOC A;  1FPI A;  3H03 A;  2GHB A;  2WBD A;  4GLI A;  4RPO A;  2WBB A;  4GBV A;  2XHD A;  2F35 A;  1HSJ A;  1B0H A;  1PB8 A;  3KSX A;  5H8H A;  3B7D A;  2ESN A;  2DWI A;  2XXX A;  1CNQ A;  5H8F A;  3O29 A;  3W15 C;  4N6D A;  2I3W A;  1I6B A;  1FQF A;  4MNI A;  3S9N C;  4G68 C;  1NKX A;  1IMF A;  3FJ7 A;  4OFO A;  4OFL A;  4GX3 A;  5FHM A;  1QVS A;  3DP4 A;  3F11 A;  1USY H;  2HZL A;  3CVG A;  4H45 A;  1FW0 A;  3RN8 A;  1N3W A;  4IGR A;  5ESY A;  1DPP A;  1JQF A;  2RIN A;  1XVY A;  3E78 A;  3TTL A;  3PUW E;  3V8X B;  3VE1 B;  1NV3 A;  3DM0 A;  2PCR A;  3MVW A;  4NMY A;  4YB7 A;  4LZ5 A;  3D4C A;  2DWA A;  1VFD A;  3SEU A;  3K6V A;  2WX9 A;  3KG2 A;  3KFM A;  3TTM A;  4F3S A;  4YMA A;  3T9U A;  3TOD A;  4N17 A;  4MNC A;  4I40 A;  4NF8 B;  3UOR A;  1G0I A;  2QPQ A;  2WYP A;  4G4P A;  1NL5 A;  2UXA A;  5LDZ A;  4FED A;  3FUZ A;  3K1P A;  2XD3 A;  3TPA A;  2PX1 A;  2NUV A;  2ZNU A;  1R1N A;  4G8N A;  3ROJ A;  3S2V A;  4H0W A;  2H4I A;  3H6V A;  4QFL A;  2VT5 A;  2NVU B;  4K3F A;  1PEB A;  3CRB A;  1B5J A;  3FXB A;  1IME A;  2F6G A;  4GVO A;  4GQO A;  5KZT A;  4MCO A;  4EQ7 A;  4PE5 B;  3SZP A;  3RQT A;  1HSL A;  3HST A;  4R9G A;  5K2X A;  5J1D A;  3IO6 A;  3TCG A;  3T9H B;  4XIG Q;  5F1Q A;  1B3F A;  2FYI A;  4X48 A;  4N4U A;  1B5I A;  4WED A;  4GL8 A;  1R9Q A;  2PT1 A;  3TZA A;  5LTC A;  4XKP A;  4PE3 A;  1IMB A;  4GWX A;  4F1V A;  5TPA B;  4IR8 A;  4H1X A;  4U4S A;  2VPN A;  1DSN A;  3TTN A;  3FXU A;  4Z0I A;  3KBR A;  1B3L A;  3B6W A;  1MXV A;  4IB2 A;  5I2K A;  2QS1 A;  2DE2 A;  2X7Q A;  5DVJ A;  3M3K A;  3H06 B;  2QS3 A;  4ESX A;  2YPN A;  1FSA A;  3PMX A;  3S9M C;  3FIR A;  4ZEC A;  5I58 A;  1LCT A;  3MP8 A;  3GZG A;  4MBP A;  1Z7N E;  1NNK A;  2ZMB A;  4PFI A;  2HZK A;  3TTK A;  3I6V A;  2XX8 A;  4KFQ A;  4KYS A;  1PBP A;  1I69 A;  1YPN A;  4KD5 A;  4JWO A;  5EYG A;  4EF2 A;  1R6Z A;  5HPQ A;  4PFU A;  4NWD A;  4LON B;  1P1U A;  2DE3 A;  2X7P A;  4LQ5 A;  1H43 A;  4ELP A;  4QFK A;  3C32 A;  3BIH A;  3GBA A;  2O84 X;  1AWB A;  5HM4 B;  3O6I A;  4OAN A;  1MPC A;  4ZEK A;  4O7I A;  5FHO A;  3RT8 A;  1LFG A;  4F1U A;  1OVT A;  4O8M A;  4KXP A;  4Z7E A;  4P11 A;  4XKR A;  1IMD A;  1VR5 A;  1IMA A;  2V93 A;  3CFX A;  5ELV A;  2QVU A;  1FTK A;  3IOW A;  1Z7M E;  2HXW A;  3EHS A;  4ZEI A;  2XXT A;  4M1V A;  2QS4 A;  3UGW A;  2DXY A;  1P1W A;  2OLB A;  3D4G A;  1B1H A;  3TMG A;  3LSF B;  4R74 A;  3RPL B;  4PGP A;  1Y4C A;  1MG1 A;  2PFZ A;  1P1Q A;  3A3U A;  4GRK A;  4JWX A;  1N84 A;  1SVX B;  3GYY A;  5JEI A;  4MLQ A;  3SES A;  1QUJ A;  2RC8 A;  2P0S A;  3E4R A;  4JVD A;  1Q9D A;  4I9D A;  1QKB A;  2Z8E A;  4YB5 A;  4N91 A;  3T93 B;  2WYK A;  4DCY A;  4RA1 A;  1H76 A;  2O6A A;  1FBC A;  4F1Y A;  3NOH A;  2IEE A;  2ZZV A;  4F3B A;  3MW0 A;  2MKZ A;  3CSG A;  3IL1 B;  1NFT A;  5KCJ A;  2VOZ A;  3FV2 A;  3FBP A;  5CRY A;  1EYI A;  2L5V A;  2DVC A;  1TFD A;  1URS A;  2F36 A;  3FZV A;  4P3L A;  4NN3 A;  1N76 A;  4H8J A;  2DYX A;  1MH4 A;  3Q27 A;  5JK4 A;  2AL5 A;  2I49 A;  4Q8R A;  3Q25 A;  5H8Q B;  4Q0C A;  3ILT B;  1UTH B;  4NX1 A;  3RGY A;  1S50 A;  2HQ0 A;  4FEB A;  4MIJ A;  1LBY A;  2F6P A;  5I84 A;  4N6P A;  4PFY A;  4QSD A;  4OHN A;  4O3A A;  4L17 A;  4GBW A;  3U65 A;  1K9Y A;  3IX1 A;  3RLF E;  1RYX A;  3DEL B;  4R6K A;  5ICQ A;  2ONK E;  1L5T A;  2ALU A;  3PV0 E;  5KDT B;  1B6H A;  1SYH A;  4RJZ A;  4OTE A;  3G3F A;  4YB6 A;  4F2O A;  4OVQ A;  4OET A;  3ZKL A;  1NH8 A;  3MPL A;  1POY 1;  4ZS9 A;  1SDX A;  1GR2 A;  1FPE A;  4AB6 A;  1JEU A;  2CEY A;  4PAK A;  4R6Y A;  4HTG A;  4MF3 A;  2FBP A;  4JSO A;  4ZEF A;  1EZ9 A;  1FTJ A;  1PBQ A;  3TQW A;  3EPE A;  1MXU A;  2OJT A;  3WAF A;  4DXU A;  3ODB A;  1MM6 A;  5J16 A;  4OVP A;  1IIW A;  3FVN A;  3OEK A;  4H8I A;  3S9E A;  4N13 A;  4U1O A;  4U1Z A;  3T9X B;  3UIF A;  1JVX A;  4HW8 A;  4JVI A;  2RF1 A;  4QSC A;  3IOV A;  1FQE A;  3E79 A;  1BP5 A;  5DYH A;  3U1O A;  2KLF A;  4P0I A;  2XXY A;  2ZYM A;  2UYF A;  3OO6 A;  1FQA A;  3LBS A;  4UAC A;  5EHM A;  2QS2 A;  2UVI A;  1D9Q A;  1FBG A;  3QXM A;  3R26 A;  1MM7 A;  1A54 A;  4Q5T A;  5I2N A;  4DE8 A;  4OEN A;  3E9X A;  3MYU A;  1ZTY A;  1DTZ A;  1YXI A;  5I56 A;  4G8M A;  4GWS A;  3PUX E;  2R6G E;  4GXA A;  1Y3P A;  2Y5L A;  4QRZ A;  3VVF A;  4DXB A;  5CMK A;  4LN5 A;  1Y20 A;  1N3X A;  4H67 A;  3MAM A;  1SQY A;  2RC7 A;  3G3H A;  2O7U A;  4C1T A;  2NWJ A;  3PU5 A;  3W9V A;  3BIG A;  1YZ0 A;  3QYT A;  3TCF A;  4OEU A;  4QFN A;  1FRP A;  4OYV A;  3G3I A;  2B4M A;  3KGC A;  3PPR A;  5A5X B;  1H45 A;  4RYA A;  4PFT A;  5FTH A;  4R73 A;  4R6H A;  4RK9 A;  2XWV A;  1US4 A;  5IKB A;  4G2Z A;  4HE2 A;  4PFR A;  1FPL A;  5IZ3 B;  5B7D A;  3FVK A;  5AA2 A;  1XVX A;  2A5T A;  2DS9 A;  4F19 A;  1LFH A;  2HAV A;  1FBD A;  4MFI A;  1KZ8 A;  2PFY A;  1B05 A;  1POT A;  1B52 A;  2VD2 A;  3K1M A;  5A5L A;  4MHF A;  3DLN A;  4WKM A;  3G3J A;  4QF9 A;  5JTY B;  4OZ9 A;  3LSL A;  5DEX A;  1RDY A;  3KN3 A;  3M3L A;  1AOV A;  1NNP A;  3T96 B;  4THI A;  2H5Y A;  1N0T A;  3S4U A;  1TXF A;  2O1L A;  3OOA A;  3CG1 A;  2I48 A;  4R2B A;  4IO2 A;  3GLB A;  2XXK A;  1Y3Q A;  4H5F A;  1OLC A;  4KI0 E;  4N8Y A;  3TUS A;  2AYS A;  1LLS A;  4R72 A;  5BWJ A;  3TDJ A;  4FAT A;  2O69 A;  3Q28 A;  5B70 A;  2NXO A;  3TYH A;  4IGT A;  4KYE A;  2Z22 A;  4ND9 A;  2Y7W A;  4I1D A;  5ITO A;  4GL0 A;  2Y7P A;  2Q89 A;  4ESW A;  3HCQ A;  4N8G A;  3T1B A;  2UVG A;  5TP9 B;  3VXB A;  5H8H B;  5I3S A;  2DOJ A;  5HBC A;  1J1N A;  5IM2 A;  2Y7R A;  5H8F B;  4PDD A;  1DK4 A;  1FTA A;  2I4B A;  3UP9 A;  1NUW A;  3EHT A;  1IMC A;  1RYO A;  1SYI A;  4JB7 A;  1PC3 A;  4FIM A;  2CZK A;  3MVX A;  2P1S A;  4TOZ A;  4H6D A;  3USD A;  4N6K A;  1M5C A;  3TAJ A;  2XWI A;  1ZLQ A;  3K4U A;  1JVY A;  1ZU0 A;  1S7Y A;  1LBV A;  4OVR A;  3GBB A;  4NGU A;  4Q30 B;  2RKM A;  2Q8M A;  3VDF A;  4ONY A;  1MH3 A;  2V3U A;  5EQ7 A;  2O7I A;  5FTI A;  3CHG A;  3IOR A;  2RC9 A;  2R8T A;  4POW A;  3PMW A;  3Q29 A;  2HXR A;  2Q2A A;  1OMP A;  2F7C A;  1IEJ A;  3RTF B;  2VP1 A;  4I8C A;  2F3D A;  2XXQ A;  3T0J A;  4YMB A;  3QAX A;  3PD8 A;  1D9Y A;  4PDH A;  2F34 A;  1KA1 A;  4MLV A;  1URG A;  2QJE A;  3DP8 A;  1IIT A;  3MC2 A;  2ANJ A;  2XXH A;  1ZKB A;  4XKQ A;  4QHQ A;  4X1D A;  4OA4 A;  4HE1 A;  4BDR A;  2B4L A;  4H5G A;  1SBP A;  4C0R A;  4F22 A;  1B2H A;  1BKA A;  2A5S A;  3N94 A;  3FD3 A;  1BK4 A;  1B7H A;  3KN7 A;  4UA8 A;  1VSO A;  3LC8 A;  3VVD A;  4ECF A;  3LUZ A;  4WEP A;  1NUY A;  1B7Z A;  1K9Z A;  3MZ1 A;  1M5F A;  3RUM A;  3QSL A;  2D5W A;  1EZO A;  5TPA A;  4GWU A;  3OXN A;  3OEN A;  3SEV A;  3LV0 A;  2XWO A;  3KSJ A;  4P0G A;  4LUB A;  2HFB A;  1H44 A;  2HEU A;  3THI A;  5LOM A;  1O7T A;  3I5O A;  2O1M A;  3BBR A;  3VV5 A;  1N7W A;  3T9V A;  1FBF A;  3IJO B;  4RPN A;  3BFT A;  4HCY A;  1MQD A;  1N04 A;  4PBH A;  4RK2 A;  4PAI A;  4OVJ A;  4P8B A;  3IB1 A;  2QMX A;  3H3G A;  3C9H A;  3EHU A;  5L9M A;  3TQL A;  1A8F A;  1YAE A;  3K00 A;  2H9B A;  3HN0 A;  5I58 B;  3FAT A;  1IXH A;  3K6W A;  1A40 A;  4NF5 A;  1A7L A;  1WOD A;  3KOT A;  5CC2 A;  3RY3 A;  1HSE A;  5DW8 A;  4JWY A;  4NF4 A;  2THI A;  3GXA A;  3CR9 A;  1MQJ A;  4EQB A;  3O6G A;  5AA4 A;  3O28 A;  3SKP A;  1I6A A;  3TTR A;  1B4Z A;  1SI1 A;  4JSD A;  3R7X A;  4ZED A;  4DI4 B;  4PET A;  5CI5 A;  2ONR A;  2VD3 A;  4P1L A;  1ZBM A;  4U22 A;  2QMW A;  1FJ9 A;  1IXI A;  3K1N A;  4BLA A;  2PT2 A;  3IR1 A;  2P3N A;  3N26 A;  5L8D A;  1QUL A;  1SW4 A;  2BJI A;  2QFL A;  1SW1 A;  1NUX A;  4U4X A;  1UTB B;  1ZJL A;  4O3B A;  3PUV E;  2R71 A;  3OSR A;  1LBB A;  4YIC A;  4X9T A;  4X04 A;  3IB0 A;  4MMP A;  3C33 A;  3ILU B;  4P9K A;  1Y1M A;  1Y1Z A;  2REJ A;  4BDN A;  3PGF A;  2I0C A;  3M8U A;  3BKI B;  1MS7 A;  4PFB A;  3RNN A;  4PTK A;  2OWT A;  2OWS A;  1F9B A;  2B3B A;  1MPB A;  1OLA A;  3OD7 A;  2UVJ A;  5ISU A;  1MDQ A;  4F3G A;  3SET A;  1LAX A;  5TU0 A;  3IAZ A;  1OVB A;  3RT6 B;  4DI3 D;  2Q8J A;  4KYD A;  5I59 A;  1DCU A;  1FBE A;  2ONS A;  2ZYO A;  3MVY A;  5KCJ B;  4OER A;  3JV9 A;  2DVZ A;  1FPD A;  4OVT A;  3W9W A;  3MVZ A;  1FTO A;  3CI8 A;  4YKK A;  1UTH A;  5I57 B;  3ZSF A;  2F7B A;  1B3G A;  4YZZ A;  4G68 B;  2XWK A;  1NV5 A;  2F97 A;  3LSW A;  4PFW A;  4G77 A;  4AS4 A;  3FXQ A;  1TFA A;  1IQ7 A;  5T3J A;  1OQG A;  3K6U A;  3VLU A;  2DWJ A;  2Q2C A;  2QVR A;  1JET A;  4JDF A;  3S9L C;  2GQ1 A;  2W7Y A;  1MDP 1;  1FPB A;  1UIV A;  2PBW A;  2V84 A;  1RKM A;  1YYZ A;  3CSB A;  4R75 A;  4NED A;  4O7M A;  4NF6 A;  3RPW A;  3HFU A;  2ZYK A;  4XFE A;  4KHZ E;  2G93 A;  1D4N A;  4ZE8 A;  2QSX A;  2XA5 A;  1NI9 A;  4NE4 A;  4WXJ A;  2O51 A;  3FGS A;  1YCJ A;  2CZI A;  4ZZE A;  1TT1 A;  1FBH A;  4P47 A;  1ATG A;  2REG A;  3KEI A;  4LP2 B;  3VVE A;  1B32 A;  3MQ9 A;  4DIG A;  4XXU A;  4QSE A;  2V3Q A;  1B46 A;  1B1X A;  3V83 A;  4QFP A;  1QUI A;  1MPD A;  2BJJ X;  2CEX A;  2HAU A;  1NNF A;  2ZNS A;  1XT8 A;  1QW0 A;  3ECR A;  5IAI A;  3L6G A;  5IGA A;  4KQP A;  3TCH A;  2B65 A;  4BDQ A;  3CFL A;  5ET5 A;  5I2N B;  5CMC A;  5DVI A;  2DQV A;  3HPI A; 
#chains in the Genus database with same CATH homology
 3O97 A;  1Y9U A;  2GRV A;  3PPO A;  3LUY A;  4IO4 A;  5H8N A;  2G29 A;  2QL3 A;  1EU8 A;  1MQG A;  4C1U A;  3K01 A;  1UQW A;  1FQD A;  2Z23 A;  1GGG A;  2D21 A;  3FVO A;  1O63 A;  5CBS A;  5CMM A;  3H6U A;  3A3C A;  1IXG A;  2V25 A;  5A5X A;  2I3V A;  2CZL A;  3UN6 A;  3A09 A;  5AE4 A;  1OIB A;  3QIM A;  3V5A A;  4EDP A;  3N6U A;  4BDL A;  1MXX A;  4O3C A;  4FEC A;  2XX9 A;  1DOT A;  2M8C A;  2RCB A;  2I58 A;  5EYF A;  1B3H A;  2R9J A;  3K2D A;  5DTB A;  4PP0 A;  3U92 A;  2FA7 A;  3MUQ A;  3MZ9 A;  2AL4 A;  4EXL A;  2XXW A;  4U21 A;  1GVC A;  3O9P A;  1DPE A;  3RTW B;  1QJM A;  3BFU A;  2CMO A;  2GFE A;  1PB9 A;  2NOO A;  1D3K A;  1SW5 A;  1OQH A;  3CIJ A;  4R9F A;  4LZ7 A;  2XXP A;  4E0W A;  1LCF A;  1LB9 A;  3SER A;  1ELJ A;  5TP9 A;  4YKI A;  4KCD A;  3OO7 A;  4ZEB A;  4DLD A;  3C36 A;  1MXW A;  4HS7 A;  2YLN A;  2OK2 A;  3IO4 A;  4ZE9 A;  2YJP A;  4POX A;  3KJ7 A;  1QUK A;  3MP6 A;  1BTJ A;  4PQJ A;  3WAE A;  5ICT A;  3VLV A;  3ZS6 A;  3VFJ A;  1MQH A;  1AIV A;  2H98 A;  4LAT A;  2O68 A;  2X26 A;  5M2V A;  3C34 A;  4DZ1 A;  4NF8 A;  2D3I A;  2F5X A;  1IXC A;  3O66 A;  2QRY A;  1Q35 A;  4YU0 A;  1JW5 A;  1SW2 A;  3IOT A;  4GFR A;  3U72 A;  2XXR A;  4F31 B;  2AIX A;  4NWC A;  3CFZ A;  1SD3 A;  3UA8 A;  2H25 A;  3KOS A;  3FVG A;  4HCW A;  4GIZ A;  1H3D A;  2DP8 A;  2WKY A;  3C4M A;  3CG3 A;  4FE8 A;  4I62 A;  1NNT A;  1B7U A;  1MXY A;  2XXV A;  1A99 A;  2GHA A;  1B0L A;  1MRP A;  1P1O A;  3MZB A;  5FHN A;  1XC1 A;  3FJM A;  5H8S A;  1NH7 A;  2DWH A;  1LGB C;  4GD5 A;  1ZIU A;  2XX7 A;  1LFI A;  1BIY A;  1S9T A;  3U8Q A;  4ISU A;  3TEL A;  1M5B A;  1BLF A;  2Y7K A;  3SEW A;  1LB8 A;  2Z8D A;  3TKD A;  3TEP A;  1WDN A;  4DXC A;  2F78 A;  4IO3 A;  2F7A A;  1AMF A;  5I2K B;  1DMB A;  1MY0 A;  3M3F A;  3H6W A;  1SI0 A;  4ELO A;  4KR5 A;  1NMU A;  1P1N A;  3HHG A;  3N6T A;  2ZXT A;  4EQ9 A;  2VGQ A;  1LAF E;  3B6Q A;  4EXK A;  3LR1 A;  4GOT A;  4OES A;  5AA2 D;  1I6Q A;  4YKP A;  1B58 A;  4H65 A;  1JNF A;  4LVQ A;  2P2A A;  2OZZ A;  3U93 A;  3AXF A;  3FAS A;  2I4C A;  4EUO A;  3Q26 A;  4NF5 B;  2DSF A;  1MY4 A;  2XXI A;  2GH9 A;  4RNS A;  2LAO A;  4NF4 B;  2E1S A;  4TLM B;  5AA4 B;  1D9V A;  3OO9 A;  3V89 B;  4R2F A;  4BDO A;  5EHS A;  3PUY E;  3VXC A;  3ONM A;  4FOR A;  1M5D A;  3PMV A;  3UK4 A;  4TLL B;  3G3G A;  3SEX A;  2Q88 A;  3T22 A;  1EH3 A;  3VLW A;  3L6H A;  3I3V A;  1UTB A;  1MQI A;  5ITP A;  2Z8F A;  2VHA A;  1A55 A;  1US5 A;  3B6T A;  3OEL A;  3K02 A;  3IB2 A;  1FCK A;  1VFE A;  4LQ2 A;  1MY2 A;  3KN8 A;  4LA9 A;  3G7W A;  4RY1 A;  1ANF A;  5L9O A;  1EZP A;  4E0X A;  1B5H A;  1UIU A;  1USY E;  4FAJ A;  1Y4T A;  3FXR A;  4IO6 A;  2HCA A;  3KJT A;  3PPP A;  1Y3N A;  1ZMG A;  3P7I A;  1IUD A;  3PD9 A;  1LAG E;  3KZG A;  2I0B A;  3K6X A;  2Q9T A;  4ELR A;  2B3F A;  5F7V A;  2ZYN A;  4U23 A;  4JXI A;  1LAH E;  3MJN A;  2RCA A;  3IJX B;  1AL3 A;  4RXL A;  2V3T A;  3TFL A;  3EQ1 A;  5H8Q A;  5I59 B;  4YKJ A;  4ZDM A;  1LBC A;  5I57 A;  4IY5 A;  3O6H A;  1P99 A;  4G68 A;  4DDD A;  3QUF A;  1AH5 A;  1TWY A;  4F29 A;  4U2R A;  5AA1 A;  4BDM A;  1JEV A;  4KPT A;  1FQC A;  2E0S A;  5KDT A;  4F3P A;  2DXR A;  4AQ4 A;  4F18 A;  4MH5 A;  4F2Q A;  1QKA A;  2DE4 A;  4IO7 A;  3HO7 A;  1FQB A;  4QFO A;  4KCC A;  3OEM A;  1LST A;  1FTL A;  3EN3 A;  2Y84 A;  3SEY A;  2Y7I A;  4NF6 B;  1B51 A;  4X1B A;  4OXV A;  4XTC Q;  2H99 A;  3QUJ A;  4LZ8 A;  2IA4 A;  1M5E A;  2ZNT A;  3K0V A;  4YAH X;  3LSX A;  1B4H A;  4GF8 A;  2OCU A;  1FTM A;  1PB7 A;  4EF1 A;  3OO8 A;  3MP1 A;  5CBR A;  2XD2 A;  1T0K A;  1IZ1 A;  3IK6 B;  3O2A A;  3MBP A;  5BUU A;  2PMS A;  3FJG A;  1GTK A;  1CB6 A;  3E3K A;  5AA3 A;  2PVU A;  3R6U A;  5CMB A;  3ZKK A;  2XXU A;  3PUZ E;  5L9S A;  4OQO A;  4M4G A;  1VE4 A;  1B40 A;  3HV1 A;  4IO5 A;  3C35 A;  3PPN A;  4DCX A;  1MXZ A;  1GV8 A;  2OBG A;  5I56 B;  2FNC A;  1B9J A;  5K2Y A;  3MPK A;  4G8H A;  4GWO A;  5CM6 A;  1JW1 A;  3EF7 A;  4F39 A;  2ABH A;  1R9L A;  1URD A;  4ZZA A;  3C31 A;  3JYR A;  3HHF A;  1PDA A;  1MY1 A;  4AB5 A;  3U94 A;  4ELQ A;  5H8N B;  1XS5 A;  5DVF A;  3MWB A;  3E13 X;  1O64 A;  3FV1 A;  4N07 A;  2I6E A;  4TQU Q;  3SDF A;  3IOU A;  3OSQ A;  3H4Z A;  4JBZ A;  3QK6 A;  4OEV A;  2PYY A;  3OMB A;  2UVH A;  5AA2 B;  2A5T B;  1N7X A;  1XHY A;  4OMB A;  5JTY A;  1YTV A;  3H7M A;  2F8D A;  4XKN A;  1A8E A;  1JW4 A;  1KWH A;  1B3E A;  5DEX B;  1WVJ A;  2UYE A;  3PPQ A;  4GXS B;  1MY3 A;  3T66 A;  1DTG A;  1Q1K A;  3JZJ A;  3N5L A;  4OFJ A;  4NTL A;  1CE2 A;  3DP6 A;  3H6T A;  4FJP A;  3G3K A;  4IY6 A;  5DT6 A;  4OWD A;  1II5 A;  1XOC A;  3H03 A;  2GHB A;  4GLI A;  4RPO A;  2XHD A;  2F35 A;  1HSJ A;  1B0H A;  1PB8 A;  3KSX A;  5H8H A;  3B7D A;  2ESN A;  2DWI A;  2XXX A;  5H8F A;  3O29 A;  3W15 C;  2I3W A;  1I6B A;  1FQF A;  3S9N C;  4G68 C;  1NKX A;  3FJ7 A;  4OFO A;  4OFL A;  5FHM A;  1QVS A;  3DP4 A;  3F11 A;  1USY H;  2HZL A;  3CVG A;  1FW0 A;  3RN8 A;  1N3W A;  4IGR A;  1DPP A;  1JQF A;  2RIN A;  1XVY A;  3TTL A;  3PUW E;  3V8X B;  3VE1 B;  3DM0 A;  3MVW A;  4NMY A;  4YB7 A;  4LZ5 A;  3D4C A;  2DWA A;  1VFD A;  3SEU A;  3K6V A;  3KG2 A;  3KFM A;  3TTM A;  4F3S A;  4YMA A;  3T9U A;  3TOD A;  4NF8 B;  3UOR A;  2QPQ A;  4G4P A;  1NL5 A;  2UXA A;  4FED A;  3FUZ A;  3K1P A;  2XD3 A;  3TPA A;  2PX1 A;  2NUV A;  2ZNU A;  1R1N A;  4G8N A;  3S2V A;  4H0W A;  2H4I A;  3H6V A;  4QFL A;  2NVU B;  4K3F A;  1PEB A;  3CRB A;  1B5J A;  2F6G A;  4GVO A;  4GQO A;  5KZT A;  4EQ7 A;  4PE5 B;  3RQT A;  1HSL A;  3HST A;  4R9G A;  5K2X A;  5J1D A;  3IO6 A;  3TCG A;  3T9H B;  4XIG Q;  5F1Q A;  1B3F A;  2FYI A;  4X48 A;  1B5I A;  4WED A;  4GL8 A;  1R9Q A;  2PT1 A;  3TZA A;  4XKP A;  4F1V A;  5TPA B;  4H1X A;  4U4S A;  1DSN A;  3TTN A;  3FXU A;  4Z0I A;  3KBR A;  1B3L A;  3B6W A;  1MXV A;  4IB2 A;  5I2K A;  2QS1 A;  2DE2 A;  2X7Q A;  5DVJ A;  3M3K A;  3H06 B;  2QS3 A;  4ESX A;  2YPN A;  3PMX A;  3S9M C;  3FIR A;  4ZEC A;  5I58 A;  1LCT A;  3MP8 A;  3GZG A;  4MBP A;  1Z7N E;  1NNK A;  2ZMB A;  2HZK A;  3TTK A;  3I6V A;  2XX8 A;  4KFQ A;  4KYS A;  1PBP A;  1I69 A;  1YPN A;  4KD5 A;  4JWO A;  4EF2 A;  1R6Z A;  5HPQ A;  4PFU A;  4NWD A;  4LON B;  1P1U A;  2DE3 A;  2X7P A;  4LQ5 A;  1H43 A;  4ELP A;  4QFK A;  3C32 A;  3GBA A;  2O84 X;  5HM4 B;  3O6I A;  1MPC A;  4ZEK A;  5FHO A;  3RT8 A;  1LFG A;  4F1U A;  1OVT A;  4Z7E A;  4P11 A;  4XKR A;  1VR5 A;  2V93 A;  3CFX A;  5ELV A;  1FTK A;  3IOW A;  1Z7M E;  2HXW A;  3EHS A;  4ZEI A;  2XXT A;  4M1V A;  2QS4 A;  3UGW A;  2DXY A;  1P1W A;  2OLB A;  3D4G A;  1B1H A;  3TMG A;  3LSF B;  4R74 A;  1Y4C A;  1MG1 A;  1P1Q A;  3A3U A;  4GRK A;  4JWX A;  1N84 A;  1SVX B;  5JEI A;  4MLQ A;  3SES A;  1QUJ A;  2RC8 A;  2P0S A;  3E4R A;  4I9D A;  1QKB A;  2Z8E A;  4YB5 A;  3T93 B;  4DCY A;  4RA1 A;  1H76 A;  2O6A A;  4F1Y A;  2IEE A;  4F3B A;  3MW0 A;  3CSG A;  3IL1 B;  1NFT A;  5KCJ A;  2VOZ A;  3FV2 A;  5CRY A;  2DVC A;  1TFD A;  1URS A;  2F36 A;  3FZV A;  1N76 A;  4H8J A;  2DYX A;  1MH4 A;  3Q27 A;  5JK4 A;  2AL5 A;  2I49 A;  4Q8R A;  3Q25 A;  5H8Q B;  4Q0C A;  3ILT B;  1UTH B;  3RGY A;  1S50 A;  2HQ0 A;  4FEB A;  2F6P A;  5I84 A;  4N6P A;  4PFY A;  4QSD A;  4OHN A;  4O3A A;  4L17 A;  3IX1 A;  3RLF E;  1RYX A;  3DEL B;  4R6K A;  5ICQ A;  2ONK E;  1L5T A;  2ALU A;  3PV0 E;  5KDT B;  1B6H A;  1SYH A;  4RJZ A;  4OTE A;  3G3F A;  4YB6 A;  4F2O A;  4OET A;  3ZKL A;  1NH8 A;  3MPL A;  1POY 1;  4ZS9 A;  1SDX A;  1GR2 A;  4AB6 A;  1JEU A;  4R6Y A;  4HTG A;  4MF3 A;  4JSO A;  4ZEF A;  1EZ9 A;  1FTJ A;  3TQW A;  1PBQ A;  3EPE A;  1MXU A;  2OJT A;  4DXU A;  3WAF A;  3ODB A;  1MM6 A;  1IIW A;  3FVN A;  3OEK A;  4H8I A;  3S9E A;  4N13 A;  4U1O A;  4U1Z A;  3T9X B;  3UIF A;  1JVX A;  4HW8 A;  2RF1 A;  4QSC A;  3IOV A;  1FQE A;  1BP5 A;  5DYH A;  3U1O A;  2KLF A;  4P0I A;  2XXY A;  2ZYM A;  2UYF A;  3OO6 A;  1FQA A;  3LBS A;  4UAC A;  5EHM A;  2QS2 A;  2UVI A;  3QXM A;  3R26 A;  1MM7 A;  1A54 A;  4Q5T A;  5I2N A;  4DE8 A;  4OEN A;  3E9X A;  1ZTY A;  1DTZ A;  5I56 A;  4G8M A;  3PUX E;  2R6G E;  4GXA A;  1Y3P A;  4QRZ A;  3VVF A;  4DXB A;  5CMK A;  1Y20 A;  1N3X A;  4H67 A;  3MAM A;  1SQY A;  2RC7 A;  3G3H A;  2O7U A;  4C1T A;  2NWJ A;  3PU5 A;  3W9V A;  3QYT A;  3TCF A;  4OEU A;  4QFN A;  4OYV A;  3G3I A;  3KGC A;  3PPR A;  5A5X B;  1H45 A;  4RYA A;  4PFT A;  5FTH A;  4R73 A;  4R6H A;  4RK9 A;  1US4 A;  5IKB A;  4G2Z A;  5B7D A;  3FVK A;  5AA2 A;  1XVX A;  2A5T A;  2DS9 A;  4F19 A;  1LFH A;  2HAV A;  4MFI A;  1B05 A;  1POT A;  1B52 A;  2VD2 A;  3K1M A;  3DLN A;  4WKM A;  3G3J A;  4QF9 A;  5JTY B;  4OZ9 A;  3LSL A;  5DEX A;  3KN3 A;  3M3L A;  1AOV A;  1NNP A;  3T96 B;  4THI A;  2H5Y A;  1N0T A;  3S4U A;  1TXF A;  2O1L A;  3OOA A;  3CG1 A;  2I48 A;  4R2B A;  4IO2 A;  3GLB A;  1Y3Q A;  4H5F A;  1OLC A;  4KI0 E;  3TUS A;  2AYS A;  1LLS A;  4R72 A;  5BWJ A;  3TDJ A;  4FAT A;  2O69 A;  3Q28 A;  5B70 A;  2NXO A;  3TYH A;  4IGT A;  4KYE A;  2Z22 A;  4ND9 A;  2Y7W A;  4I1D A;  5ITO A;  4GL0 A;  2Y7P A;  2Q89 A;  4ESW A;  3HCQ A;  2UVG A;  5TP9 B;  3VXB A;  5H8H B;  2DOJ A;  5HBC A;  1J1N A;  2Y7R A;  5H8F B;  2I4B A;  3UP9 A;  3EHT A;  1RYO A;  1SYI A;  4JB7 A;  1PC3 A;  4FIM A;  3MVX A;  2P1S A;  4TOZ A;  4H6D A;  3USD A;  1M5C A;  3TAJ A;  1ZLQ A;  3K4U A;  1JVY A;  1ZU0 A;  1S7Y A;  3GBB A;  4Q30 B;  2RKM A;  3VDF A;  4ONY A;  1MH3 A;  2V3U A;  2O7I A;  5FTI A;  3IOR A;  2RC9 A;  4POW A;  3PMW A;  3Q29 A;  2Q2A A;  1OMP A;  2F7C A;  1IEJ A;  3RTF B;  2VP1 A;  4I8C A;  2XXQ A;  4YMB A;  3QAX A;  3PD8 A;  1D9Y A;  2F34 A;  4MLV A;  1URG A;  2QJE A;  3DP8 A;  1IIT A;  3MC2 A;  2ANJ A;  2XXH A;  1ZKB A;  4XKQ A;  4QHQ A;  4X1D A;  4BDR A;  4H5G A;  1SBP A;  4C0R A;  4F22 A;  1B2H A;  1BKA A;  2A5S A;  3N94 A;  3FD3 A;  1B7H A;  3KN7 A;  4UA8 A;  1VSO A;  3LC8 A;  3VVD A;  4ECF A;  4WEP A;  1B7Z A;  3MZ1 A;  1M5F A;  3RUM A;  3QSL A;  2D5W A;  1EZO A;  5TPA A;  3OXN A;  3OEN A;  3SEV A;  3KSJ A;  4P0G A;  4LUB A;  2HFB A;  1H44 A;  2HEU A;  3THI A;  5LOM A;  1O7T A;  3I5O A;  2O1M A;  3BBR A;  3VV5 A;  1N7W A;  3T9V A;  3IJO B;  4RPN A;  3BFT A;  4HCY A;  1MQD A;  1N04 A;  4RK2 A;  4OVJ A;  3IB1 A;  2QMX A;  3H3G A;  3C9H A;  3EHU A;  5L9M A;  3TQL A;  1A8F A;  1YAE A;  3K00 A;  2H9B A;  3HN0 A;  5I58 B;  3FAT A;  1IXH A;  3K6W A;  1A40 A;  4NF5 A;  1A7L A;  1WOD A;  3KOT A;  5CC2 A;  3RY3 A;  1HSE A;  4JWY A;  4NF4 A;  2THI A;  3GXA A;  3CR9 A;  1MQJ A;  4EQB A;  3O6G A;  5AA4 A;  3O28 A;  3SKP A;  1I6A A;  3TTR A;  1B4Z A;  1SI1 A;  4JSD A;  3R7X A;  4ZED A;  4PET A;  5CI5 A;  2ONR A;  2VD3 A;  1ZBM A;  4U22 A;  2QMW A;  1IXI A;  3K1N A;  4BLA A;  2PT2 A;  3IR1 A;  3N26 A;  5L8D A;  1QUL A;  1SW4 A;  1SW1 A;  4U4X A;  1UTB B;  1ZJL A;  4O3B A;  3PUV E;  2R71 A;  3OSR A;  1LBB A;  4YIC A;  4X9T A;  3IB0 A;  3C33 A;  3ILU B;  1Y1M A;  1Y1Z A;  2REJ A;  4BDN A;  3PGF A;  2I0C A;  3M8U A;  3BKI B;  1MS7 A;  3RNN A;  2OWT A;  2OWS A;  1F9B A;  2B3B A;  1MPB A;  1OLA A;  3OD7 A;  2UVJ A;  5ISU A;  1MDQ A;  4F3G A;  3SET A;  1LAX A;  5TU0 A;  3IAZ A;  1OVB A;  3RT6 B;  2Q8J A;  4KYD A;  5I59 A;  2ZYO A;  2ONS A;  3MVY A;  5KCJ B;  4OER A;  3JV9 A;  2DVZ A;  3W9W A;  3MVZ A;  1FTO A;  3CI8 A;  4YKK A;  1UTH A;  5I57 B;  3ZSF A;  2F7B A;  1B3G A;  4YZZ A;  4G68 B;  2F97 A;  3LSW A;  4PFW A;  4G77 A;  3FXQ A;  1TFA A;  1IQ7 A;  1OQG A;  3K6U A;  3VLU A;  2DWJ A;  2Q2C A;  1JET A;  4JDF A;  3S9L C;  2W7Y A;  1MDP 1;  1UIV A;  2PBW A;  2V84 A;  1RKM A;  3CSB A;  4R75 A;  4NED A;  4NF6 A;  3RPW A;  2ZYK A;  4KHZ E;  2G93 A;  1D4N A;  4ZE8 A;  2QSX A;  4NE4 A;  4WXJ A;  2O51 A;  3FGS A;  1YCJ A;  4ZZE A;  1TT1 A;  1ATG A;  2REG A;  3KEI A;  4LP2 B;  3VVE A;  1B32 A;  3MQ9 A;  4DIG A;  4XXU A;  4QSE A;  2V3Q A;  1B46 A;  1B1X A;  3V83 A;  4QFP A;  1QUI A;  1MPD A;  2BJJ X;  2HAU A;  1NNF A;  2ZNS A;  1XT8 A;  1QW0 A;  3ECR A;  5IAI A;  3L6G A;  4KQP A;  3TCH A;  2B65 A;  4BDQ A;  3CFL A;  5I2N B;  5CMC A;  5DVI A;  2DQV A;  3HPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...