1MH3A

Maltose binding-a1 homeodomain protein chimera, crystal form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
421
structure length
421
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
molecule keywords maltose binding-a1 homeodomain protein chimera
total genus 144
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh3A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A01
2P1SA 4YB5A 5CM6A 2GH9A 3ZQFA 1NNPA 3JV9A 1RR7A 3HHGA 4G8MA 4U1ZA 3T96B 3VLWA 3N94A 5CMKA 4RDUA 1ELJA 3ZOBA 4TLMB 1GDTA 1FQAA 3N6TA 2QSXA 4NWCA 1CB6A 4HCWA 1NTCA 1QPIA 3R7XA 1FQBA 2GFEA 2NXOA 2ABHA 3IL1B 5K7FA 4HS7A 5I58A 3K0VA 3ZQLA 5JLWA 1NK3P 1HDPA 3BR6A 4H8IA 2EZIA 3KSJA 4NF6B 3WHCA 4Q5TA 1AOVA 1A7LA 2DTZA 3HOYJ 1D4NA 3FIRA 1IUDA 1URGA 5AA1A 4NMYA 3SFIA 1IZ1A 4POXA 4YMBA 2ELKA 3CFLA 3IX1A 1DU6A 3Q29A 5DYHA 4EF2A 1M5FA 2JA7J 2F7BA 2JWTA 1MBJA 3TP0A 1SYHA 1QKAA 2HEUA 1UHSA 3HOXJ 3Q3SA 4KYSA 4F2OA 2V3QA 3C32A 5L8DA 1IXHA 4H8JA 5EHMA 2JMWA 1Q1VA 4AC0A 5M5YJ 3TCGA 3U93A 4R2FA 3QQAA 1JETA 1H43A 1MM6A 3H3VK 1WPKA 2N8GA 1E3OC 2O1LA 1Z7NE 2XXVA 2DXRA 3MJNA 3JRHA 1D9YA 3EPEA 1ZR4A 3E4RA 3L1PA 3ONMA 3RUMA 5F1JA 2OLBA 4G68A 1UTHB 4ZEDA 1HOMA 1XVXA 1HF0A 3CVGA 4FAJA 2I48A 1BIYA 4ZE8A 1DPEA 2X26A 2DQVA 3C33A 5C4XJ 4PFUA 4DYRA 3MC2A 1A8EA 3TTMA 5TP9A 4OEVA 1PUFB 1US4A 1LBBA 2OCUA 3VDFA 2TRTA 2HXOA 4QFPA 3CG3A 2ECBA 2OF7A 2F8DA 3GXAA 1VFDA 3V8XB 4AB6A 2HXIA 4QSHA 2X7PA 4NF8A 3IH2A 4OZ9A 3P7IA 4E0WA 2H1KA 4JB7A 4J19A 4M4GA 3PUVE 3GTQJ 1B7ZA 2LD5A 4A3GJ 3E13X 4KR5A 5IP9J 4QFNA 2X7QA 1MXXA 2XPWA 5DEXA 2HAUA 4OERA 1FCKA 5I2NA 3MVYA 3TTKA 1H8AC 3OELA 2MW8A 3PUWE 1TWGJ 1SDXA 4X48A 3RT8A 1URDA 2DP8A 4QSEA 4AQ4A 1B2HA 3ILUB 3EHTA 2VUMJ 4IHWA 1MBHA 2NVXJ 4I76A 1A5JA 4R6HA 4JSOA 2Z22A 4B1RA 1P7IA 1OLCA 4M1VA 1YCJA 2Q8JA 4F3GA 3VE1B 1RESA 3JRFA 3SKPA 3TELA 3QUFA 4NF6A 3OSFA 1RKWA 1B4ZA 2B3BA 4PFWA 4NF8B 4FTHA 5KZTA 2RINA 4XIGQ 5KCJB 4ZEIA 1HCRA 1B7UA 3KOSA 2CQQA 1QUIA 4OWDA 3B6WA 2UYEA 1MQJA 3KOTA 3LSXA 2W48A 2RKMA 1LBCA 5EGOA 4DIGA 1QUJA 3S9MC 4N07A 3RLFE 2WB1N 2ZB9A 2EZHA 4JX6A 2WAQN 5B7DA 1FTTA 1VE4A 4F1UA 1SBPA 1SW2A 2ME0A 3CG1A 1ANFA 2NVUB 2ALUA 3NAUA 4CYCB 5HM4B 2XXIA 2Y9ZA 4NWDA 3SJMA 3PD9A 3TEDA 2HOTA 2RC8A 2B65A 5I84A 1TWCJ 4XRSG 4QHQA 1ETQA 4F3BA 4DZ1A 2I3VA 4XRMA 3C36A 1MPDA 3Q26A 3B6QA 1N04A 3GTGJ 3EQ1A 3S9NC 2Y7IA 4GXSB 2CJJA 2B63J 3A01B 4G4PA 3BFUA 5H8FA 3LSWA 1I6HJ 5H8FB 3GZGA 3PV0E 5CMBA 4FEDA 3RN8A 1QRYA 3Q25A 1MPCA 1N7XA 1MPBA 4EQBA 3PMVA 5TP9B 1S7YA 3LC8A 2V25A 3UGWA 4M3EA 3SESA 4JX5A 1Y4TA 3SDFA 1SI0A 1FTKA 2ZYMA 4GXAA 5EEAA 2XXXA 4MFIA 2M9HA 3Q0VA 3U92A 2R5YA 5FKMA 1FEXA 2VKEA 3RPWA 3BFTA 4R2BA 5K2XA 2NS7A 2BJJX 2R5ZA 3PGFA 4IO7A 5EHSA 4DXUA 2ID3A 2O7IA 3KBRA 3R26A 5H8HB 3S17J 2ECCA 1F36A 1P1UA 3E7LA 3BG5A 1MXVA 1MBKA 4A3JJ 1B46A 1F9BA 4GIZA 4EEFG 4U21A 3CDLA 1YRNB 4LZ7A 2V3UA 3HM5A 3HOZJ 2JN6A 3F0CA 2CMOA 5H8HA 1PUFA 3VVFA 1PBPA 4ZZEA 3FGSA 3C2BA 2D21A 1OMPA 1JQFA 1SYIA 2I10A 2WKYA 2XXWA 1MDQA 3EHSA 1IQ7A 4F2QA 2Y7RA 2H98A 3MPLA 4EQ7A 4GFRA 4FE4A 1JGGA 4XK4A 4F1YA 2NS8A 1B40A 4ECFA 4FE7A 2MG4A 4UA8A 2NOOA 1SW1A 1NMUA 3MWBA 1OLAA 2V93A 1LCTA 5IP7J 5FJ8J 3TZAA 1ETOA 5CC2A 3OO7A 1LCFA 3G7WA 3G3GA 4H0WA 2XGEA 1T33A 1B0LA 3TAJA 3I4MJ 2LKXA 1U8BA 2GRVA 1HSEA 5AA2B 3S1RJ 2DMPA 4F3PA 1JTXA 2OWSA 1MNMC 3LSPA 4AB5A 4ZDMA 3MZ9A 3SEUA 3MUQA 3D4CA 1IJWC 4YICA 3O97A 4DLDA 4IO5A 2HOSA 3UIFA 4YKKA 1FTLA 2XXYA 3ZQGA 2CQXA 3C4MA 1MS7A 3ILTB 3E3KA 1FQEA 1LFIA 5DVIA 3IO4A 3O28A 3FVKA 3B6CA 1WVJA 2PYYA 4GL8A 2I4CA 2Q88A 3B6TA 1EU8A 4A3DJ 3DM0A 3FASA 2XD3A 2XPVA 1QVUA 3H6VA 1TT1A 4GQOA 4ZE9A 5KDTB 4GRKA 2Y0SN 3FZVA 3K6WA 3PPOA 4IO2A 1HSLA 4R9FA 2RF1A 2CU7A 4OESA 4LQ2A 2QPQA 1MXYA 4UACA 1VNDA 1DMBA 3G3IA 3K02A 1S9TA 4P11A 4U2RA 3CR9A 3M3FA 2Z8FA 2CRGA 2E2JJ 5H8NB 1IGNA 2F97A 2M2EA 1A40A 4B3AA 5K2YA 1RYXA 2ZNTA 2I3WA 3OOAA 1A54A 5HBCA 3RZOJ 2GHBA 3RT6B 1B51A 1DU0A 3H7MA 2XGCA 1GR2A 5C44J 1P7JA 2NUVA 1S50A 4MLOA 4GOTA 1B52A 3QAXA 3RNNA 3CQZJ 3CSGA 4X1BA 4LATA 2W7YA 3FK6A 5ITOA 2ZNUA 3JRBA 5H8QB 4DZPA 3OMBA 4MLVA 4ONYA 2FJ1A 1IEJA 1L5TA 1TWHJ 4ELOA 4ESXA 1B7HA 5TPAA 4RY1A 2VHAA 2JA8J 5EG0A 5CBRA 1DPPA 1MY0A 2E0SA 5M3FJ 4L5EA 5EF6A 1CE2A 3GBAA 3TCHA 2DYXA 2GBYA 1MRPA 3W9VA 3TDJA 1B72A 2E2HJ 4QFLA 1BTJA 3CIJA 1JNFA 1H45A 5IP6A 3A09A 3E9XA 4FIMA 4XKPA 2PMSA 4H6DA 1JT0A 4BBRJ 3JREA 1K61A 1QJMA 1II5A 5B70A 1N76A 3SEYA 3BTJA 1BLFA 5I59B 1OCTC 1P1OA 1JKOC 3MP8A 3ODBA 3VXBA 3RTFB 4OFOA 3BR1A 3FVGA 3ZQHA 3SDGA 2R6GE 1Y1VJ 2F5XA 3G1MA 4YB7A 3GTOJ 3T9VA 3BR0A 3K1NA 2L7FP 5F0CA 3G3KA 2DA6A 3A03A 2EZLA 5GPAA 1JUSA 2XPUA 2HQ5A 4X1DA 3G3FA 4RBOA 5J1YA 1B3FA 4C3JJ 1FTMA 3USDA 2M8GX 2YS9A 4NEDA 4OXVA 3OSQA 4BLAA 1ZMGA 5ISUA 5JTYA 3IH4A 1D9VA 4IGTA 4GLIA 1B3EA 2ZYNA 2Z8DA 2H4IA 3MP6A 2DMTA 4HTGA 4FCYA 1B3GA 5L9MA 2PT2A 5CMCA 2QCOA 2H9BA 3K01A 4G68B 5BWJA 1UTHA 3N5LA 4U23A 5C3EJ 3RTWB 2D5WA 4I6ZA 2DSFA 1US5A 1VI0A 1SD3A 2LP0A 3KJTA 3JR9A 1B3LA 1MQIA 4I8CA 4ZEKA 3CFZA 2DE3A 4V2FA 3MP1A 3R6UA 4YKJA 4MH5A 2DN0A 1QVSA 5ICTA 4Q0CA 4ELRA 2B3FA 1H44A 2GHAA 2D5VA 2VPRA 1IG7A 4POWA 1B1XA 2OPTA 4A3MJ 3TP3A 1A8FA 4X6AJ 2OBGA 1UG2A 3HO7A 1MXZA 2KT0A 4IEJA 3CRBA 4OMBA 5AA2D 3OEMA 4OYVA 5TPAB 4ISUA 1Y3QA 5IKBA 4MF3A 4O3AA 3M4OJ 1SQYA 2XD2A 3PD8A 4KYDA 4C3HJ 4TLLB 1R1NA 1LLSA 2Z23A 4LVQA 2Y7PA 2NVYJ 3HV1A 1W0UA 3MPKA 4A3EJ 1MQGA 4KCCA 3M3KA 3MVWA 1YRNA 4BDQA 1VF9A 5A5XA 1Y3PA 2VOZA 4G8NA 4LOCA 1BA5A 1B9JA 3K7AJ 3O6IA 3CFXA 5FHNA 3VV5A 1AKHB 2OJTA 5EYRA 1WH7A 1RKTA 5I57A 2TCTA 1IXCA 5E3MA 5JLXA 4WEDA 2H25A 3BTLA 3MQ9A 2XXUA 4LUBA 3TTLA 1X58A 1Y3NA 5DTDA 1IXIA 3PO3J 1LGBC 3IOTA 3TW6A 3OXNA 5M3MJ 1AKHA 1USYE 3DEWA 1ITYA 2HFBA 4M3BA 2OK2A 2DJNA 4XKRA 2IEEA 4KCDA 3LSGA 2I4BA 1ETYA 5GP9A 4YMAA 3TQLA 2O84X 3I4NJ 5CRYA 1ETXA 1N3WA 1CQTA 1NFTA 3OIOA 2G93A 4RK9A 2NWJA 4BKXA 4YB6A 2R92J 4C3IJ 2QJEA 2HDDA 3G1OA 5AA2A 2X48A 1VFCA 1MQDA 4LQ5A 1B05A 2XX7A 4WKMA 1Q35A 4H5FA 5CMMA 3H03A 1TWYA 2NVQJ 3A02A 2A5TA 2DE4A 4H67A 5JTYB 5F7VA 2HYJA 3S2HJ 1B1HA 3M8UA 1SW5A 3EF7A 4OHNA 2QMWA 1A55A 1B0HA 1GUUA 4KQPA 2Y2ZA 2ONKE 1Z77A 4EF1A 2JK3A 2K9QA 4P0GA 2CUFA 3HOUJ 1MY4A 2Y84A 2UVIA 1AU7A 3QPSA 5CBSA 1WODA 3THIA 4X1EA 3HCQA 5IYCJ 4NTLA 3PMWA 5J1DA 5I2NB 1WH5A 1Y4CA 3IOUA 5HPQA 3TCFA 2X6OA 1M5DA 3MAMA 4IHYA 4G2ZA 1NH8A 4JP0A 4ZZAA 1R9LA 1JUPA 4NDLA 1O7TA 1MXWA 3N26A 2QMXA 3LR1A 3VLUA 1XVYA 3T9UA 4YKIA 4WEPA 5F0FA 5M5XJ 2H99A 2M8CA 3S2VA 1D5YA 2F78A 3JRIA 4NF4B 4LZ5A 1XS9A 3TUSA 1DSNA 1QUKA 1PDAA 4B4CA 4R72A 1ZBMA 2D3IA 4HW8A 2Y7KA 4NE4A 1P1WA 1GV5A 2O51A 4E0XA 2P81A 4MBPA 3QPLA 4BBSJ 3HHFA 1FQCA 4A69C 2AL4A 1MBEA 2HZKA 2RC7A 1H3DA 3DP8A 2QRYA 1FTZA 1OVBA 1TWFJ 1OQHA 2FX0A 2LLKA 1IV6A 1JTYA 1MDP1 1R9QA 4DZJA 2F36A 5EG0B 5DEXB 1PB8A 1FW0A 3LSRA 2E1OA 2THIA 4C0RA 1AH5A 4DXCA 4F31B 1LAGE 1NNTA 4R6KA 4CYCA 4WXJA 3DCFA 1H76A 3TODA 3CSBA 2DMUA 2XXQA 2DA3A 1MBFA 2GM4A 1APLC 3U1OA 4A3KJ 1WDNA 2Z8EA 1GGGA 2AO9A 1FIPA 4P0IA 4Y52J 4OTEA 4GFBA 3FK7A 4EUOA 1M5CA 1ZTYA 2JA5J 1EZPA 1POGA 4TOZA 1IITA 1UIVA 3JRAA 1OJLA 4D7NA 3UP9A 4XTCQ 3F11A 5ICQA 5AA3A 4MFDA 1B8IB 1LSTA 5F1QA 2Y9YA 1JKRC 3HB9A 3S2DJ 1PEBA 3KFMA 3PPNA 4O3BA 1LAHE 1ENHA 4XRSA 1JJ6C 4G8HA 2DA4A 2QS1A 1I3QJ 1VR5A 3JZJA 3K00A 1IUFA 1BW5A 1ZJLA 3HGGA 3FXQA 2FD5A 3RY3A 1B8IA 3V83A 5EYFA 2M34A 3EN3A 2Q2CA 3T9XB 3GBGA 1JW4A 5AE4A 2XB0X 4G77A 3K2AA 2KLFA 4QTRA 1SVXB 4C1TA 2MGQA 1LAXA 2GLOA 1PB7A 2O7OA 1GVCA 4UUTA 3PU5A 5DS9A 1A6IA 4M6VA 2PT1A 1G2HA 3U94A 2CUEA 1TFDA 2DVZA 3ZQIA 4X9TA 2WV1A 4JWOA 1TC3C 4XIDA 4HNVA 1LFGA 1SFOJ 3H3GA 4H65A 3UA8A 3TFLA 1I6BA 2YUSA 1F43A 4F19A 2AIXA 3ZKKA 4H5GA 2VKVA 2MSYA 1OCPA 1MY3A 3M3YJ 1Y1ZA 1ZR2A 1LE8B 1UTBB 2HI3A 1MH3A 2EZKA 1BL0A 4QFKA 2FA7A 4W97A 4RNSA 1R6ZA 1ZKBA 3O8GA 1LE8A 1NNKA 5I2KA 4IO6A 3BT9A 1ETVA 4UUSB 4M3DA 4LONB 3HPIA 4GWOA 2XRLA 3I6VA 2FQ4A 4PFTA 2LVSA 1VSOA 3IB1A 4ESWA 5HODA 4BDLA 3S4UA 1HSJA 2XXTA 4A3CJ 3FATA 2HQ0A 3FJGA 2K9SA 1MQHA 4OEUA 2XGDA 1QW0A 3IK6B 3I5OA 2F35A 1YAEA 1XS5A 1RYOA 2QF7A 3HKZN 1J1NA 1AHDP 5F27A 3A3UA 1ETKA 4IO4A 2R71A 5K7ZA 1FIAA 5FKNA 4K3FA 5DTBA 2DOJA 3DELB 3K2DA 1MH4A 1YTVA 1WI3A 4C2MJ 1JT6A 4JDFA 4F1VA 5FKLA 4O3CA 3IH3A 2VD2A 4RPOA 3OO8A 2XX8A 4ZEFA 4W1UA 5J1RA 5I2KB 5FHOA 3QSLA 1NK2P 1TXFA 3DLNA 3UORA 1GV2A 2CZLA 3MZBA 1EF4A 4NF5B 3BR2A 3H4ZA 2I0CA 3BQZA 2HAVA 3EHUA 2PMZN 4D7MA 3KN8A 3BTIA 2AL5A 3K1MA 2I49A 1WCMJ 3IR1A 3GTKJ 2COBA 4TQUQ 4LP2B 2V84A 3PUYE 4I62A 4QFOA 3O66A 2L7MP 1MY1A 1EZOA 1LFBA 4M3GA 2DS9A 4FISA 1IC8A 3TKDA 1A99A 3LSLA 3H6UA 4I1DA 2XX9A 1JJ8C 2HXWA 1OQGA 4Q30B 3UN6A 5IOZA 3KSXA 1GVDA 4EQ9A 1DOTA 4R74A 3H6WA 2VD3A 3MVPA 2RAEA 4JXIA 1IDZA 1O64A 4GL0A 2E19A 5IYBJ 3TEPA 2X9DA 3K6UA 5IYDJ 4JSDA 1ZIUA 4JWXA 4EXLA 2DA7A 5DT6A 2A5SA 2Q9TA 3KN3A 2ZXTA 3ZKLA 3WAEA 3RQIA 4QF9A 3IO6A 4F22A 2IAIA 2O9LA 1K83J 3B7DA 4UUSA 4EDPA 1RETA 4D5FA 1UTBA 4QRZA 4DCXA 1M5BA 5E3NA 5DVFA 3W15C 3KZGA 4A3FJ 2JJ7A 1EH3A 2P2AA 2Q89A 4OVJA 3RKQA 4OENA 1U78A 4THIA 3C31A 1T56A 3CCYA 1TWAJ 3ECRA 2ME6A 4YU0A 4KD5A 3UKGA 3OSGA 2LFBA 1JVXA 3SETA 1ETWA 3Q28A 3FUZA 1YPNA 1SANA 1B6HA 2DWHA 4GF8A 1LAFE 2DXYA 5KDTA 4AUXA 4DYCA 2L0KA 4XICA 3G3HA 2I6EA 1MXUA 1JKPC 1Y20A 3OD7A 5I56B 1ZGWA 1NL5A 4NF5A 3T93B 1I6QA 4DDDA 2HZLA 5I56A 4ZS9A 4MFEA 1JW1A 4DE8A 3S9LC 4KFQA 1XOCA 4I9DA 4D5CA 2EQRA 2REJA 2Q2AA 3CMYA 3TTNA 1ZK8A 3IAZA 4IO3A 5LOMA 3QXMA 1U9OA 1IIWA 4IY6A 2DWAA 3HEFA 3MN2A 3DP6A 5EGOB 3H06B 3S1NJ 3MKLA 1MSFC 1P99A 1HLVA 4R73A 5FLVA 3KN7A 3NARA 4QSCA 3V89B 3TW7A 2ZNSA 1N7WA 4IHVA 3S14J 1FQFA 3KEIA 2R7ZJ 1EZ9A 4EXKA 3BR5A 2EBIA 3PPPA 4G68C 2LK2A 4AYBN 2R0QC 2AYSA 2LY9A 3T9HB 4OFJA 2L9RA 1GT0C 1ORKA 5M2VA 5FHMA 2QL3A 2ZMBA 2R5YB 4IB2A 2I0BA 5BUUA 2QS2A 2IA4A 2F6PA 3HOVJ 3FJMA 1NNFA 2ONRA 3QYTA 3GTPJ 3BQYA 3GTJJ 1USYH 2KDZA 4N13A 4FECA 2EH3A 2VI6A 1NH7A 3TYHA 5EZGA 1OFCX 2OZZA 3SEWA 3MVXA 3A01A 2YU9J 4KPTA 1O63A 1B5HA 3U72A 3FV1A 3JRCA 2DMNA 3HBLA 4JX4A 2JA6J 3I3VA 4F18A 3LSFB 1URSA 4PP0A 1RKMA 3LUYA 3KGCA 2DA5A 2FYIA 1POY1 2K40A 3PPQA 2ESNA 3OSRA 3JRDA 3GTMJ 5DVJA 5JK4A 1T0KA 4BDNA 4DW6A 1MY2A 3V5AA 5M5WJ 4RXLA 3BG9A 3IOVA 3QIMA 3VVEA 1FTJA 2UYFA 1JEUA 3A3CA 2DWJA 2R93J 1Z7ME 2Y7WA 3C9HA 3VXCA 3S15J 3PM1A 2F7AA 4Z7EA 5J1UA 5H8QA 1B5IA 2QS4A 1PB9A 2DMQA 1P1QA 2RCAA 3U8QA 4JBZA 4M3FA 4U1OA 3GBBA 5I59A 2LR8A 3D4GA 1JW5A 5L9OA 4YZZA 1BJZA 3C35A 4BDMA 2H5YA 3O8HA 2V3TA 3HN0A 3G1LA 3DP4A 3TTRA 1S7EA 5F04A 4R75A 2ANJA 3O6HA 5C4JJ 2UVGA 5K7HA 1PC3A 1N84A 3LNQA 4QIWN 5ITPA 5E3OA 5F0HA 5FTIA 2UVJA 2Y30A 4DYQA 4FJPA 4F39A 9ANTA 4GD5A 2XSDC 4KHZE 4PE5B 4Z0IA 2XXRA 2ID6A 2M0CA 2O6AA 3MZ1A 3O9PA 2DWIA 3TPAA 3QUJA 3LBSA 4FEBA 4BDOA 3FISA 2PX1A 5CI5A 3BKIB 1UMQA 2IEKA 2LTPA 3BTCA 4HCYA 1LFHA 1DTGA 1XC1A 3FKIJ 3Q27A 1OIBA 2RCBA 3PMXA 4V2GA 3PUZE 3K4UA 4FORA 4RYAA 5F08A 2G0EA 4R9GA 1QKBA 2I58A 1Y9UA 2PVUA 2O1MA 2YPNA 1N3XA 1FJLA 4C1UA 1H88C 5EDNA 3JYRA 3IOWA 2XB5A 1IDYA 1M5EA 4A3BJ 2P0SA 2XXPA 2DE2A 1LB9A 5E3LA 2O7UA 3WAFA 5H8SA 3RQTA 4JWYA 1DTZA 1QVTA 3MBPA 2E2IJ 2XXHA 3FD3A 3PUXE 5A5XB 1IXGA 4A3IJ 3T66A 1U9NA 3VLVA 4BXXJ 3TMGA 3O29A 1OVTA 1QULA 3BR3A 1X2NA 1P1NA 1TFAA 3M3LA 1ZLQA 2NVTJ 1N0TA 3C34A 2Y31A 3JRGA 1R9TJ 3K1PA 4RK2A 1B4HA 2R9JA 4Q8RA 1ATGA 3D1NI 3HOWJ 1VFEA 3FXUA 4LA9A 4ELPA 2DVCA 5FTHA 4N6PA 3QK6A 1B5JA 4RA1A 2PBWA 3S16J 4YAHX 1XC5A 2L7ZA 3IV5A 1ZQ3P 2OWTA 1FQDA 2ONSA 4IY5A 1UIUA 5IOYA 1MBGA 2O69A 4BDRA 1POTA 2ZYKA 5FKKA 1Q1KA 3FVNA 3BBRA 3PPRA 1Y1MA 2ZYOA 1JKQC 2YLNA 5GPCA 2O8KA 4OFLA 3SERA 1WGXA 5FLMJ 1AL3A 5I58B 1GTKA 5H8NA 5I57B 1SI1A 3WHBA 3HGYA 4KI0E 3B6AA 4R6YA 2UXAA 4ELQA 3LOCA 1NKXA 2F6GA 4F3SA 3BG3A 3IB2A 1GV8A 1SW4A 4DCYA 4S0HB 3S1QJ 3GTLJ 3FVOA 3FIWA 1MM7A 5IAIA 4F29A 4A93J 1MSEC 2REGA 5KCJA 4Y7NJ 3CI8A 1X2MA 2VGQA 2HCAA 1JVYA 1B58A 1XHYA 1ZTRA 3LSJA 3OO9A 4ZEBA 5TU0A 3GLBA 2E1SA 5L9SA 1B72B 3VVDA 3OENA 2NOGA 2F34A 3W9WA 4IGRA 2VP1A 5ELVA 3HDDA 4G12A 4XXUA 5AA4B 4BY7J 1ZU0A 4RJZA 4BY1J 1JUMA 5AA4A 4U22A 1H89C 3HSTA 3H6TA 1ZKGA 3FJ7A 3VFJA 3Q0UA 2G29A 4MIMA 2UVHA 4U4XA 3SEVA 4PETA 2H8RA 4A3LJ 4MO7A 1B32A 3K6VA 2DA2A 4IHXA 1HDDC 4FATA 1PBQA 4OETA 1AIVA 2K9NA 4FE8A 4GVOA 1O4XA 1UQWA 3K6XA 4H1XA 3VPRA 4XKNA 1I69A 4MLQA 3O6GA 5J3LA 1LB8A 3OEKA 3MW0A 4OQOA 4DXBA 2O68A 3RGYA 3S9EA 3IJXB 3H0GJ 1I50J 2HOAA 5BNGA 3ZQCA 1Z0XA 4JYKA 3L6HA 2A5TB 2R5ZB 3O2AA 3FV2A 3IB0A 2YJPA 3N6UA 3G3JA 1BP5A 4KYEA 2IBDA 3PO2J 5IPAA 1LFUP 4PQJA 4YKPA 3KJ7A 1IRZA 1MG1A 3ZSFA 2AHQA 1I6AA 5JEIA 1Y1WJ 3TQWA 2LAOA 3L6GA 3OO6A 3AXFA 4QSDA 5EZHA 3UK4A 2FNCA 1B3HA 4U4SA 3FXRA 3IORA 3W6VA 1AMFA 1XT8A 2F7CA 4PFYA 3S1MJ 3T22A 1BW6A 1XG1A 4ND9A 3MVZA 4LZ8A 3ZS6A 1JEVA 3OOUA 4NF4A 1BKAA 2QS3A 3SEXA 3KG2A 5FKOA 4ZECA 1W0TA 2DA1A 1D3KA 1KWHA 2XHDA 2RC9A 4ABZA 1FTOA 3RZDJ 3Q0WA 1RPWA 4L17A 4XKQA 4RPNA 3IJOB
chains in the Genus database with same CATH superfamily
2P1SA 4YB5A 3V7RA 5CM6A 2Z99A 4OMZA 3ZQFA 2GH9A 3ZQ7A 3HL2A 1NNPA 1RR7A 3JV9A 3HHGA 4G8MA 4U1ZA 3T96B 3VLWA 3N94A 4G94A 1DK4A 4L9VA 2Z3YA 3BC8A 4RDUA 5CMKA 2ADUA 4XSZF 1MW7A 1YE9A 4ZYDA 1ELJA 1Y39A 2IA1A 3ZOBA 2L9SA 4TLMB 1GDTA 2OC6A 1X4PA 1YQAA 1FQAA 1FRPA 2QSXA 3N6TA 4NWCA 1CB6A 4HCWA 1NTCA 1QPIA 4XOTA 3LSKA 3LQQA 1O3TA 1EYIA 3R7XA 1FQBA 2GFEA 3KE2A 4HNUA 2ABHA 2NXOA 3IL1B 5K7FA 4HS7A 5I58A 3KP7A 4IX7A 3ZQLA 3K0VA 5JLWA 1NK3P 2CQNA 4FBPA 1HDPA 3BR6A 4I09A 4XL9A 4H8IA 4FAJA 3K4MA 4EM1A 4ENJA 4N81A 3TDUC 3MQ0A 2EZIA 2FHYA 3KSJA 3P9CA 3WHCA 3MKZA 4NF6B 4Q5TA 1A7LA 1AOVA 2DTZA 2IS6A 2BZTA 3HOYJ 1D4NA 1SVMA 3FIRA 2LNBA 1IUDA 1URGA 5AA1A 5GTIC 4NMYA 3SFIA 1IZ1A 5D5VB 2FOKA 1C0WA 2P7CB 1B4AA 4POXA 4GX4A 4YMBA 1OQYA 2ELKA 1LB2A 2XXKA 2R7WA 2OX3A 1I6XA 4HEA2 1I3AA 3CFLA 3IX1A 4HLYA 3MCZA 2STWA 1DU6A 3Q29A 2AQFA 4Z2YA 3RYRA 2OAZA 5DYHA 5EQAA 4EF2A 3KEOA 1GVJA 4RB0A 3V8KA 2WAFA 2JA7J 1M5FA 3OYAA 4N4NB 2F7BA 2JWTA 4IR8A 4IQ4A 2M4KA 4CA0A 3TO7A 1CF7A 1MBJA 3TP0A 4CCOA 3LAJA 1QKAA 1SYHA 5LRRA 2JUCA 1UHSA 2HEUA 2EK5A 3HOXJ 3Q3SA 2ZZWA 4KYSA 4F2OA 3JCUC 2V3QA 3C32A 3OY9A 3Q9VA 3CO6C 2K85A 4PFOA 5HNFA 2AS5F 1W5CC 1O7FA 3VEPA 5L8DA 1KYZA 3DWLE 1IXHA 4H8JA 5EHMA 2JMWA 1Q1VA 4AC0A 1RUOA 5M5YJ 1SPIA 3TCGA 3U93A 4R2FA 2XC7A 3E5XA 3QQAA 4UVCA 1FSAA 1JETA 1H43A 4NGUA 1MM6A 3H3VK 2Z1DA 1WPKA 2N8GA 1E3OC 2O1LA 3DTKA 4N17A 5D8LB 1FPDA 1Z7NE 3WGHA 2B9SA 2JA2A 2XXVA 2DXRA 4UY8I 4RS8A 3MJNA 3ABTA 2X6WA 3JRHA 1ZR4A 1D9YA 3EPEA 2DT5A 1DDNA 3L1PA 5DCFA 3E4RA 5F1JA 2OLBA 2KLOA 3ONMA 3RUMA 1VQ5I 2ZMEC 1VDWA 3CDHA 1QZZA 5BPDA 3SFZA 1WZ2A 1EYJA 4G68A 4ZDOA 1UTHB 4ZEDA 2H27A 1V5FA 6PAXA 3H9QA 1HOMA 3F8FA 4HX7A 4DBRA 4P9UA 1HF0A 5DDGA 4OIOF 2FRHA 4F3QA 3E3VA 1BIYA 2CEYA 2I48A 4HE2A 1DPEA 4ZE8A 4GWZA 3A0BC 2X26A 2DQVA 3C33A 1GXPA 5C4XJ 2XWKA 3TOBA 4B8XA 3UNGC 4DYRA 3CMEI 2F48A 1PUEE 1A8EA 2BW3A 1KA1A 1VQ6I 5TP9A 4KFCA 4OEVA 1BC7C 4B48A 1PUFB 1US4A 2L5QA 5HLIA 5ILSA 1LBBA 2OCUA 3QAHA 3VDFA 2ELJA 3B50A 2TRTA 2GIVA 2HXOA 4QFPA 3CG3A 1J2XA 2ECBA 2OF7A 3HKZA 2F8DA 1VFDA 3GXAA 3V8XB 4AB6A 3VODA 3MC2A 2HXIA 4QSHA 1IAWA 2X7PA 4IRGA 4NF8A 5IGAA 3IH2A 4OZ9A 4YIIA 3P7IA 4E0WA 2H1KA 5KNLA 2QYOA 4J19A 4JB7A 4M4GA 1TQIA 1ZARA 2X0LA 3FXOA 1T2KA 3GTQJ 3PUVE 2P8TA 1WI9A 1B7ZA 3KP6A 1KA8A 3LA3A 4GYGA 2LD5A 4A3GJ 2LDUA 3A4CA 3E13X 4KR5A 5IP9J 2OJED 4I0BA 2M8EA 5GTHC 2KFDA 5E1XA 1HW2A 2FBHA 2P5LC 1YJWI 2TDXA 3L00A 2OZUA 2PMZA 4QFNA 2X7QA 2L3DA 1MXXA 2XPWA 5DEXA 4PF6A 4HBLA 2CG4A 2DYSH 1LFPA 4E4HA 2HAUA 1V4RA 2CV0A 4OERA 1FCKA 1FPEA 5I2NA 3WG9A 3MVYA 3TTKA 1H8AC 3OELA 2VOOA 2MW8A 1FC3A 4RGUA 2FBIA 2G7UA 3PUWE 1TWGJ 2PG4A 4HPQA 4YRVA 3CJRB 4E70A 1SDXA 4HV5A 4X48A 3RT8A 3DU6A 1XGMA 4B47A 1URDA 2DP8A 4QSEA 2W4SA 4AQ4A 3MAJA 1B2HA 3ILUB 2XWVA 4LIUA 1G0HA 3EHTA 5GAEJ 4OVTA 2VUMJ 1A35A 4IHWA 1MBHA 2ZO4A 4K2EA 4I76A 1K6OA 1A5JA 1FPQA 4JSOA 3L7WA 4R6HA 2Z22A 1UB9A 3VB2A 4G8XA 4B1RA 3CUOA 1P7IA 1OLCA 2W24A 4M1VA 1YCJA 4O7MA 3J7AY 1P9QC 2Q8JA 4AS5A 4F3GA 3VE1B 2P0WA 1FYKA 1RESA 3JRFA 3F3XA 3LMMA 4XKBA 2ZCWA 3COAC 2GQ1A 1HKSA 3EETA 5LHGA 3QUFA 4NF6A 3BJAA 3F8NA 3FX3A 4ZZLA 1RKWA 3OSFA 1B4ZA 3BZKA 1NUXA 2RC4A 1LQ1A 2B3BA 4PFWA 3K4BA 4BU2A 4NF8B 4FTHA 4N8YA 4D9JA 3WTZA 2RINA 5KZTA 3K2ZA 2XAGA 3KZYA 4XIGQ 4PJ0C 4ZEIA 5KCJB 1HCRA 1B7UA 5D4SA 2A6EF 2CQQA 1QUIA 3KOSA 4OWDA 3B6WA 3SEQA 1MQJA 2UYEA 4KISA 2W48A 2Z2SB 2MLGA 1LBCA 2RKMA 5EGOA 3KOTA 4LG3A 1QUJA 1V3FA 4DIGA 3S9MC 4QXDA 3H5NA 4N07A 3RLFE 2WB1N 4O6JA 5GADJ 2K5CA 2EZHA 2ZB9A 4JX6A 4BQOA 2WAQN 5B7DA 3KIOA 3PL8A 4QPOA 4KT5C 1EJ9A 1LDJA 3J81K 1FTTA 1VE4A 1VQOI 4F1UA 4H46A 1SBPA 5IT9K 3L9FA 2COMA 2RQPA 1B9MA 1W5SA 3WU1B 1VQNI 1SW2A 2ME0A 1MMAA 3CG1A 1DCUA 2NVUB 1ANFA 4NB5A 2ALUA 4ZC3A 3NAUA 3J80K 4S04A 4CYCB 5HM4B 2W84A 4A6EA 1S8NA 2XXIA 3K69A 2K02A 3HRMA 4MQ9F 1R58A 4IL6C 4GRIA 2Y9ZA 4NWDA 1O7LA 3RSNA 2MYSA 1D1AA 1QZEA 1OMIA 1Y56A 3K10A 3SJMA 3TEDA 2HOTA 2B65A 2RC8A 3PD9A 5I84A 2VB6A 1TWCJ 3QPTA 4XRSG 2CZHA 4EJTA 4QHQA 2FE3A 3ABLH 3D5LA 3LSXA 4XKCA 1ACIA 3DPTA 1ETQA 4F3BA 1TT5B 4DZ1A 2M0MA 3CD6I 4OVSA 2O8XA 2FBKA 5K5OA 3RPLB 4II3A 2QVOA 2L4AA 3I59A 4RB1A 1IMBA 3OV8A 4MX6A 2HGCA 2YSRA 2AXTC 1V5EA 2I3VA 2ISZA 4XRMA 3C36A 4KXPA 4X0GA 4C30A 1MPDA 3Q26A 3WE2A 1N04A 3B6QA 3ABUA 4M71A 1G3TA 3H0DA 3GTGJ 1NUYA 1ZELA 4YEJA 4IQJA 3EQ1A 3KCCA 3S9NC 2Y7IA 4GXSB 2CJJA 3Q5FA 3IP4B 2B63J 2EA4A 3A01B 3BFUA 3FDYA 4G4PA 5H8FA 5BQTA 3LSWA 1XSDA 3S93A 1I6HJ 2WAQA 3QOPA 4A0XA 1CF7B 1LBWA 3GZGA 5H8FB 4PDHA 2WWYA 4L9JA 5HDKA 3PV0E 5I2KA 1RC9A 5J4VA 5CMBA 3I71A 2BHZA 4FEDA 3RN8A 4Y13A 1ZGJA 1AWCA 2EA2A 2DPDA 2O6GE 1QRYA 4PSXA 3QYEA 1K7AA 1UZCA 3Q25A 5LEJA 1MPCA 3QU6A 1MPBA 1N7XA 3PMVA 4EQBA 2PFBA 5TP9B 1S7YA 2LF8A 3LC8A 2ELHA 5TISC 4ZYGA 2V25A 3UGWA 1ZRFA 4PFPA 4HDVA 4DJAA 2P3NA 4M3EA 4UB8C 1FBPA 4KUMA 1ZN2A 3GZ5A 3SESA 4JX5A 3ZP5A 1W36C 1K9ZA 1ZREA 1Y4TA 1UAAA 3SDFA 3ZRGA 5LHIA 1J9IA 1SI0A 1FTKA 4PFUA 2E34A 2ZYMA 2GXGA 5EEAA 4GXAA 2XXXA 4JVDA 4MFIA 4N6KA 2M9HA 3Q0VA 1XMAA 4LK1F 1HKTA 1PVEA 2ICWG 2NXNB 3U92A 2R5YA 5FKMA 3JW4A 1FEXA 2VKEA 3RPWA 3BFTA 1ODDA 2HVRA 1QO0D 2X1CA 4R2BA 5HDNA 5LGUA 5K2XA 2NS7A 1D1CA 2P6SA 2BJJX 2MLKA 3HIFA 2R5ZA 3PGFA 4IO7A 2E71A 2HNHA 5EHSA 1HXDA 5IZ3A 4DXUA 2ID3A 2O7IA 2RKHA 1WJAA 4N9IA 3KBRA 4GDFA 3PSFA 3C3WA 3R26A 5H8HB 3A29A 1LKXA 3S17J 2ECCA 1IO2A 1F36A 4LGWA 1P1UA 1GXQA 3E7LA 1Y8RB 1U2WA 2RNGA 2VKHA 3BG5A 1MBKA 2Y48A 3PNYA 2Q8KA 1F9NA 4A3JJ 3H5AA 1B46A 1F9BA 3P9IA 3TBIA 4KIBA 1FBEA 2FSWA 4HXVA 4GIZA 4PCDA 3WODF 4EEFG 4U21A 3CDLA 2M87A 1DP7P 1EA3A 1MZBA 3ZMVA 1YRNB 5CKTA 4LZ7A 3DPLC 3HTUA 4DQ2A 2V3UA 2KJBA 4HQEA 1N75A 2RN7A 3HM5A 1KA0A 4QWQA 3HOZJ 3IUOA 2JN6A 2FNAA 2IVMA 3F0CA 3ZN0A 2CMOA 5ESYA 4CCNA 5H8HA 4Q48A 3FXBA 1XD7A 3NEUA 4XBFA 2E36A 4XLCA 1FBUA 1PUFA 1PBPA 4ZZEA 3WU0A 2UZKA 3VVFA 1USSA 3C2BA 3FGSA 2D21A 2K86A 1FPIA 2W7NA 1OMPA 3F6VA 1JQFA 1SYIA 2OWZA 2I10A 4XEQA 2IGKA 2WKYA 2XXWA 1MDQA 3S32A 5KHDA 2B0LA 3EHSA 1S6LA 4LK0F 3F8CA 3RQ4A 3OYKA 4MIJA 3JSOA 1IQ7A 4F2QA 1FNNA 2P5VA 4I0AA 2A3SA 2Y7RA 3J7YJ 2H98A 3MPLA 4EQ7A 4GFRA 3OIQA 4FE4A 1JGGA 4XK4A 3ROJA 2V6EA 3EDPA 3T0YA 3SZTA 1W1WE 2STTA 4F1YA 2NS8A 1B40A 2YPRA 2VONA 4ECFA 4FE7A 5L3CA 2DDBA 2MG4A 3OS0A 2LH9A 2O3FA 4XMYA 4PSWA 4CO8A 4BH9A 5JHUA 1YITI 1SW1A 2NOOA 3MD2A 4UA8A 3S8PA 4UB6C 1NMUA 1OLAA 3LA7A 2V93A 1LCTA 5IP7J 5FJ8J 4OU0A 3MWBA 3TZAA 1ETOA 3GFMA 5CC2A 2HS5A 4UHTA 3TOAA 3OO7A 1LCFA 3G7WA 5I5PA 3G3GA 4H0WA 3IWFA 3CJTB 4G6QA 2XGEA 3FWEA 5B1BH 2QM3A 2ZKZA 1YJ9I 4KIFA 1GHCA 4MNUA 1T33A 4NQWB 2VPOA 2IJLA 2R7DA 4LD5A 2WYKA 1B0LA 1M1EB 2BOLA 3MKYB 2JT1A 3I4MJ 3TAJA 1F4KA 2P4WA 4BE0A 1X3ZB 5DM6F 1LBVA 2LKXA 3WE3A 2PFYA 3L2WA 2MH2A 1ZLKA 1U8BA 3TGNA 2GRVA 4AS4A 1HSEA 5AA2B 4HSTA 2HQRA 2HFHA 3S1RJ 2DMPA 3U65A 4NF0A 1JTXA 4F3PA 2OWSA 1I5ZA 4HW0A 2H8WA 3OYJA 4L5JA 4IF4A 3LSPA 1MNMC 3FBIB 4AB5A 4LFUA 1OCRH 2PJPA 4ZDMA 3MZ9A 2UXXA 4A0YA 3SEUA 3L2CA 3D4CA 2D2WA 1IJWC 4ESJA 5EEGA 3MUQA 1UELB 3BZCA 1PP8F 3FHZA 1MMSA 3O97A 1OCZH 1LEVA 4P47A 4YICA 1I1GA 4DLDA 4IO5A 4FX0A 4UABA 1W4MA 2HOSA 3CLQA 3UIFA 2DCEA 4YKKA 5KAFC 4UUVA 3DKYA 1FTLA 2LBFA 3BLYA 3ZQGA 2XXYA 2CQXA 5JVTA 2WC2A 2VC0A 3C4MA 3D5SC 1MS7A 3CHGA 5ICFA 3ILTB 3E3KA 2VT5A 1Z1DA 4B43A 4OOIA 5K1YA 3I55I 2IGOA 3GLXA 1LFIA 1FQEA 4OMYA 5DVIA 3CCQI 3IO4A 1R71A 4H0EA 3O28A 3FVKA 1H0MA 2WV0A 3B6CA 5ICCA 1P4XA 1WVJA 2FIEA 2BHYA 2DOAA 1I39A 2ZFUA 2PYYA 4BUPA 1QQIA 3DXJF 4GL8A 2I4CA 1FOYA 2Q88A 4ZJZA 3B6TA 1EU8A 1JHFA 4Q5SF 4A3DJ 3WGGA 4RAZA 3DM0A 3FASA 2XD3A 2XPVA 1QVUA 1LEBA 1P4WA 1TT1A 3H6VA 4GQOA 4ZE9A 3EUHC 5J8CA 3G4SI 4GRKA 5KDTB 2Y0SN 3FZVA 4GO1A 1RUNA 3K6WA 1HSLA 3PPOA 4IO2A 4R9FA 2K27A 2RF1A 2CU7A 1TW2A 5HOOA 4OESA 1R23A 3TMOA 4LQ2A 3H1CA 2QPQA 1TT0A 3REOA 1K79A 1VNDA 4ANJA 4HDUA 1T38A 1MXYA 1NV6A 4UACA 5HLGA 1DMBA 3DV8A 1PJRA 3E79A 3G3IA 3K02A 1YYVA 1NG7A 4V19K 1FP2A 1S9TA 4P11A 5AIQA 4G7ZF 4U2RA 2BYVE 3G71I 3CR9A 3ERED 2QKMB 1V55H 4DOZA 3M3FA 4F7ZA 1D9QA 4KN7X 3CC7I 2Z8FA 2BE5F 2HTJA 2CRGA 2LSOA 3QP6A 4PJNA 3VYTB 2I8DA 2E2JJ 2XSJC 3ECHA 5H8NB 1MMNA 3K4KA 2JQ7A 1MNDA 1JHHA 2EILH 3U2RA 1IGNA 2XF5A 4N8GA 2JZYA 1XSXA 2F97A 4N15A 2M2EA 1A40A 4B3AA 1DPUA 5K2YA 2M7AA 1DP3A 2V4CA 1RYXA 2ZNTA 2I3WA 2WEFA 3OOAA 1A54A 5HBCA 4IOAF 3I5UA 2E5ZA 2CSOA 5H2FC 1SVOA 3RZOJ 2K3PA 2GHBA 3GXOA 1JXSA 4RAYA 1P92A 1BIBA 4G7HF 3TQNA 3RT6B 4BEHA 3ULQB 1W36D 1B51A 5E8GA 3OYNA 1DU0A 3H7MA 2XGCA 1GR2A 1OKRA 5C44J 1EH7A 3CCLI 2F4IA 1T8IA 1P7JA 2NUVA 1S50A 2P3VA 3KEYA 1HW5A 4MLOA 4GOTA 2LY2A 4IO9F 2EFWA 1B52A 4PAKA 4E7LA 1RI7A 3QAXA 4GBWA 3VFZA 3WTTC 3CQZJ 3CSGA 3I58A 3BPXA 3HOTA 4IHSA 3RNNA 4X1BA 3C7JA 4I99C 4LATA 2XASA 4JBAA 1SMYF 4CDGA 4ENKA 4IRHA 4B44A 3A2KA 2W7YA 1BOBA 3DF8A 3FK6A 1F5TA 5ITOA 2ZNUA 1IF1A 5JR3A 3JRBA 3E97A 5IAIA 4FHTA 4KITB 4DZPA 3OMBA 4MLVA 4ONYA 2FJ1A 1IEJA 5H8QB 1L5TA 1TWHJ 4ELOA 1SD5A 1XMXA 3MFKA 4LG0B 1G8XA 1B7HA 5TPAA 4AYBA 4ESXA 2EFQA 2VHAA 4RY1A 1Y8QB 3FMQA 2JA8J 5EG0A 5IY5H 4OVQA 1DPPA 2ACJA 1MY0A 5CBRA 3CCEI 5ERIA 2E0SA 5M3FJ 4L5EA 5EF6A 1LJ9A 1CE2A 3GBAA 3TCHA 1HW1A 2DYXA 2GBYA 2VT3A 2XAHA 4WWCA 4PJLA 5KCMA 1MRPA 1XSVA 2PQ8A 2ZJRF 1OR7A 3TDJA 1B72A 2E2HJ 3W9VA 4QFLA 1BTJA 3CIJA 2X51A 1JNFA 1H45A 1IN6A 1X1CA 5IP6A 3A09A 3OWTA 4X8RA 4RGSA 3E9XA 1BC8C 4FIMA 2A6TA 2FF4A 3GVAA 4IOCF 2PBIA 1QHHD 4XKPA 4BQQA 2KIQA 2V26A 2HEOA 2PMSA 4H6DA 5EQ7A 5HVQC 3T8RA 1JT0A 2ZJ2A 2F5EA 3NQOA 2XAUA 2HTSA 2LKSA 2OUMA 4A5NA 1VQ7I 5JFRA 1XPXA 1ZRCA 4BBRJ 2QSGX 3JREA 1K61A 1QJMA 1II5A 5B70A 3DTIA 2ETHA 1N76A 4YFNF 3SEYA 3BTJA 1BLFA 5I59B 4EV0A 1OCTC 3MSTA 2H1LA 1P1OA 1JKOC 2CZKA 3MP8A 3ODBA 3VXBA 1KGSA 3RTFB 4OFOA 3BR1A 3MMYB 2V9KA 3FVGA 3RTRA 3I3LA 3ZQHA 5F6FA 3IKTA 3SDGA 4Z6YA 3MYUA 5LLQA 2OCCH 2R6GE 2RDPA 1Y1VJ 2F5XA 3G1MA 1TQPA 2HKOA 4L0YB 4GX3A 4YB7A 5DCMB 1IMDA 1NG6A 1KONA 2AQEA 3GTOJ 2XKOA 3T9VA 3BR0A 3K1NA 4NQ8A 1Z7UA 1JI8A 2L7FP 1MGTA 5F0CA 3G3KA 2DA6A 3A03A 2EZLA 5GPAA 1JUSA 2MC3A 4II2A 2XPUA 3D5RC 2DOEA 5DEQA 2HQ5A 2WB1A 4M74A 4X1DA 3EKIA 4NX1A 2PJRA 2VC1A 4E7ZA 1INPA 4MTEA 3CCJI 4EJOA 3G3FA 4YELA 4RBOA 4OIQF 5J1YA 4FQGA 1B3FA 4C3JJ 3I59B 4ZYAA 1FTMA 1YXIA 3USDA 2QKLB 1TNTA 4MCOA 3OS1A 1YHQI 2M8GX 4PZJA 2YS9A 3R61A 3JTGA 4NEDA 2DTRA 3CMAI 3OSQA 4OXVA 3QP5A 3IAM2 4BLAA 1ZMGA 1ON2A 5ISUA 1FBHA 5JTYA 3IH4A 1D9VA 2DQRA 4GLIA 4IGTA 3I9V2 5EEHA 5BS6A 4BE2A 3U1KA 1B3EA 2BVMA 3BJ6A 4RLFA 3NWTA 2ZYNA 4O8MA 2Z8DA 5LDZA 3BOQA 4ASNA 1SAXA 4P1WA 2H4IA 3BIHA 2DMTA 3MP6A 2DLLA 4FCYA 4HTGA 4XLFA 1B3GA 5L9MA 4XONA 4BL0B 1VQKI 3V7CA 2QCOA 5HS8A 2PT2A 5CMCA 2VJJA 1D8JA 2VJIA 2H9BA 3K01A 1IXRC 1HA8A 2HQAA 4G68B 1UTHA 2NNNA 3N5LA 3HC7A 5BWJA 2UV1A 4R79A 5C3EJ 4U23A 3IFCA 4EGZA 2D5WA 5IM2A 1UHWA 4I6ZA 2DSFA 1FBCA 1US5A 3RTWB 1AWBA 1VI0A 4F91B 1SD3A 2LP0A 2WYPA 3KJTA 3JR9A 2F5CA 2HPGA 2M5WA 1B3LA 4GX6A 1G3SA 2RREA 1K4SA 4E6KG 1MQIA 2R3SA 4CICA 1R4MB 4I8CA 2DFFA 3HSEA 3CFZA 5J40A 4ZEKA 4RMNA 2DE3A 2Y5LA 5JI6A 4HV6A 4V2FA 3CDIA 3MP1A 3R6UA 4YKJA 3SEZA 4MH5A 3MKWB 1S72I 3K9TA 2DDAA 4DI3D 4E7JA 2DN0A 1QVSA 5AONA 5ICTA 4Q0CA 1VQPI 2B3FA 4ELRA 1H44A 2GHAA 2D5VA 2CUZA 2DYRH 3I54A 2VPRA 1IG7A 2IGMA 1B1XA 2OPTA 3F21A 4PC9A 4A3MJ 4POWA 3DKXA 4DBQA 4Y3OA 2Y69H 1D8KA 5HDGA 4BHBA 3TP3A 3FXKA 2JSCA 4X6AJ 1A8FA 2OBGA 1UG2A 3HO7A 4MNIA 1MXZA 2KT0A 4M6XA 1FJ9A 5FRMA 2QQBA 2CH0A 4IEJA 3CO7C 1PDNC 3CRBA 4OMBA 4EJWA 5AA2D 3OEMA 4YFXF 4OYVA 5TPAB 1WRJA 4ISUA 2IGNA 1Y3QA 5IKBA 4MF3A 3IHUA 4O3AA 3M4OJ 2MD0A 3CZ6A 1LPQA 2WBDA 1SQYA 2XD2A 3PD8A 4KYDA 4C3HJ 1OYWA 1LBYA 5CYVA 4QBAA 4TLLB 2B7EA 2VOPA 3H3ZA 1R1NA 3F72A 1LLSA 2ISYA 1OPCA 4CHUA 3HTSB 2Y7PA 2Z23A 2CQKA 2NVYJ 3HV1A 4LVQA 5E1ZB 2IPQX 3OL4A 1N25A 1W0UA 4PK4A 3MPKA 4A3EJ 1MQGA 4KCCA 2XWOA 5FROA 3M3KA 1X4OA 2DK5A 2LOOA 1FPFA 1YRNA 3MVWA 4I2OA 2VBWA 4BDQA 1VF9A 3CUQA 5A5XA 1Y3PA 2VOZA 4G8NA 4LOCA 1BA5A 2MD5A 4CYDA 1SMTA 3GZ6A 1D0XA 3PQKA 1IN8A 2J5PA 4XQFA 3K7AJ 1B9JA 3O6IA 1A31A 2LF7A 3CFXA 5FHNA 3VV5A 1AKHB 2QQAA 2OJTA 4GYIA 1Z6TA 1OYYA 1Z67A 2LY1A 4NBQA 4XRFA 5EYRA 1WH7A 3RCOA 1RKTA 1U8RA 1L0OC 5I57A 3FXMA 1IXCA 2TCTA 3ESWB 4HZFA 1IMCA 2EV6A 3C1DA 5E3MA 1FPLA 4RAFA 5JLXA 4WEDA 3BCBA 2H25A 2C6YA 3BTLA 2E1CA 2R7XA 3MQ9A 1D0ZA 2XXUA 2HKXA 4LUBA 3TTLA 1X58A 1Y3NA 3HG9A 4PGHA 5DTDA 3LAPA 1IXIA 2WBBA 3M7GA 3PO3J 1LGBC 5IZ1A 4OIRF 3IOTA 3TW6A 3OXNA 4BJ6C 4MTDA 3KPHA 5J6XA 1MXVA 5M3MJ 1X1AA 1AKHA 2CW0F 3EPZA 1WQ2A 3DEWA 1USYE 3R60A 3IC7A 2Q0OA 1YLFA 1ITYA 2KMUA 1IMFA 2HFBA 5DW8A 4M3BA 4BDYA 2DJNA 2OK2A 4XKRA 2IEEA 4KCDA 3LSGA 3ZN1A 2VE8A 2I4BA 4H4KC 3QYFA 1R1UA 1ETYA 5GP9A 4PJJA 4RB2C 4YMAA 3KZIC 3TQLA 2O84X 1B59A 2R7OA 3I4NJ 1V5GA 5CRYA 1ETXA 1N3WA 1CQTA 1O3QA 1KU7A 2E7XA 4ZZDA 1WSUA 3U9GA 2JRMA 4CUGA 1J75A 1J7KA 1NFTA 3OIOA 2G93A 4RK9A 2NWJA 4BKXA 4LG0A 4YB6A 1R49A 4L0ZB 2R92J 4C3IJ 2EFPA 3FKJA 4BJ5C 2FXAA 3S3NA 2HDDA 3G1OA 2QJEA 4HYEA 2X48A 5AA2A 3HXLA 5D5XB 4B09A 3GFLA 1VFCA 5ET6A 1MQDA 4LQ5A 1YFHA 1B05A 2XX7A 1WJDA 4WKMA 1BI3A 1Q35A 4H5FA 5CMMA 3H03A 1TWYA 2NVQJ 3BZ6A 3A02A 4WXHA 2A5TA 2DE4A 4H67A 1E17A 1BR2A 1TW3A 4HE1A 1LBXA 2HXRA 5JTYB 3FF5A 3GF2A 2IRFG 5F7VA 3IKVA 2HYJA 3S2HJ 1B1HA 4AIKA 3HSRA 1FPBA 1NI9A 1SW5A 3M8UA 4JVCA 3T0JA 3OYGA 3E6BA 1R00A 2XF6A 3M1CA 3EF7A 2L7KA 2M4GA 3MZHA 4M9XA 3SZGA 1HSTA 2QMWA 4OHNA 2BBYA 1MJAA 1A55A 1K9YA 4CZCA 1TQMA 3T1BA 2Z33A 1USTA 1B0HA 1G3WA 2OTLI 1U5TB 1GUUA 4E7SA 2VQGA 4KQPA 2Y2ZA 4IZZA 2ONKE 4ENMA 1WFXA 1KU9A 1Z77A 3I64A 5DYMA 3DBLB 5HLHA 1SFUA 4EF1A 2JK3A 2MC4A 2K9QA 4P0GA 4MEYF 4C9YA 2CUFA 5CPRB 2R7UA 3HOUJ 1KQ8A 1MY4A 3GZNB 3WTWC 1BK4A 2Y84A 1AA7A 1XVXA 2UVIA 2DFHA 1AU7A 5H8QA 3LA2A 3QPSA 1S7OA 5CBSA 1WODA 3O6BB 5LBQA 4CXFA 1MDMA 2HPMA 4X1EA 3HCQA 3THIA 5IYCJ 4PAIA 1HKQA 4NTLA 4L18B 3PMWA 5J1DA 5I2NB 1WH5A 1FPGA 2XGXA 2D45A 2CV2A 2GA2A 1Y4CA 3IOUA 5HPQA 4Y15A 1CGPA 3TCFA 2X6OA 1M5DA 2H6CA 4MAGA 1OYIA 3MAMA 1RDZA 2D1HA 3PIOF 4IHYA 2IXSA 4G2ZA 3J7AO 1PYVA 4OANA 1I1SA 5FD5A 1SFEA 5A2QZ 1NH8A 2DJIA 4JP0A 1LBZA 4ZZAA 4CSWA 1R9LA 3VYUB 1FBDA 5DM7F 1JUPA 2QLZA 4NDLA 1O7TA 4HQMA 1MXWA 1W7PA 3N26A 2QMXA 2BW3B 1DBZA 2O5RA 2HZDA 2R7QA 3LR1A 3VLUA 1T08B 1GLNA 2PLYA 1XVYA 3T9UA 5A2QK 4YKIA 4WEPA 2A5WA 5HS7A 5F0FA 2Z16A 5M5XJ 4A6DA 1BR1A 3KZZA 4XOPA 3GWZA 2H99A 2M8CA 1FPKA 3S2VA 1D5YA 2F78A 3JRIA 5TGTA 4MJOA 4NF4B 3C2HA 3GYYA 1MMDA 4LZ5A 5ET8A 1XS9A 4G7OF 2Y5KA 3BY6A 4U0YA 2NAZA 4IPAA 4WK8F 1VQ9I 1DSNA 2PI0A 1PDAA 1QUKA 3TUSA 4B4CA 1K6YA 3E0JB 2BJIA 2Q8MA 4R72A 3RPQA 1R5ID 1ZBMA 2D3IA 4PFRA 5EQ8A 1DGWY 4DNCA 2DFEA 1Y0UA 1FBSA 4UV8A 4HW8A 2Y7KA 4NE4A 1RNLA 1CNQA 2QENA 1P1WA 1GV5A 1REPC 2O51A 4OAZA 4E0XA 2P81A 4MBPA 4IJAA 4Y4RA 3QPLA 4BBSJ 3HHFA 1FQCA 4A69C 2V7FA 4HLXA 1MBEA 3CJQB 3VYSB 2AL4A 2HZKA 2R7SA 1H3DA 2RC7A 3DP8A 2F3BA 1O3RA 3ZGKA 3P9KA 2QRYA 1FTZA 1OVBA 3E5QA 1TWFJ 1LUJB 4NC6A 1OQHA 2FX0A 3CCVI 1S9HA 2LLKA 4XLNF 3ZMSA 4P9FA 1JTYA 1IV6A 1MDP1 1R9QA 2GA1A 2CEXA 4RLQA 2E35A 4DZJA 4KDPA 3RKYA 2F36A 1ON1A 3B02A 5EG0B 5DEXB 1PB8A 2IP2A 2KRHA 1FW0A 2XWIA 3J7ZI 3LSRA 2E1OA 2VQLA 4WXCA 2THIA 3TTMA 3NOHA 4C0RA 1AH5A 2DPUA 4DXCA 1OLTA 2W82A 4YFKF 3TO6A 2Y75A 2QFLA 1LAGE 4F31B 2E5NA 2XA5A 1FOXA 2LRDA 1NNTA 4KNYA 4R6KA 2JSPA 3HUGB 4CCKA 3NWSA 3W3CA 1FSHA 1N77A 4CYCA 4WXJA 3E6DA 3DCFA 2WAEA 4XM3A 2ZZXA 2OQRA 4F55A 2WA0A 1H76A 3TODA 3A1YA 3KP3A 3CSBA 2DMUA 1MJ9A 2XXQA 3VYRB 2DA3A 2K9MA 2HDWA 1MBFA 2GM4A 4XLHA 4I3EA 1APLC 3F8MA 3U1OA 4O5VA 1F1ZA 5FO5A 3RYPA 1XN7A 4A3KJ 1WDNA 3CF2A 4GBVA 2J5OA 3IAS2 2Z8EA 1VQ4I 2CGPA 1QGPA 4PCQA 2AO9A 1GGGA 1FIPA 4P0IA 4Y52J 4OTEA 1YJNI 4U88A 3FK7A 5K5RA 3QPHA 4GFBA 4EUOA 1M5CA 1ZTYA 4P96A 2JA5J 5D5UB 4H45A 1EZPA 1E2XA 1POGA 2GAUA 4TOZA 4P5OA 1IITA 1UIVA 3JRAA 1OJLA 3FHNA 5FFZA 4D7NA 1O3SA 1S5LC 3M8EA 5CQGA 3UP9A 3HRTA 4XTCQ 3CC2I 3F11A 1YIOA 1H9TA 5AA3A 5ICQA 3B73A 3ERMA 4MFDA 4XORA 1KZHA 1B8IB 1LSTA 5F1QA 2Y9YA 2VBXA 1LDKB 3HB9A 4EQQA 1JKRC 3S2DJ 1PEBA 2YR2A 5E17F 3KFMA 3VXCA 4BQAA 4KICA 1MKMA 3F22A 3PPNA 4O3BA 2XHKA 1LEAA 3SZPA 2W25A 4KJZA 1LAHE 1ENHA 2R7FA 4XRSA 1JJ6C 4G8HA 2DA4A 2KL4A 2QS1A 1U3EM 1I3QJ 1VR5A 3OYDA 3JZJA 3K00A 2XAQA 3BP8A 4ESFA 4C2UA 1IUFA 1BW5A 1ZJLA 4HE0A 1Y0NA 2FU4A 1T98A 4RM3A 1D0YA 1DGRM 3RPUD 3HGGA 4XKWA 1K78B 3FXQA 2JJKA 2FD5A 2CMPA 2FNPA 3RY3A 1B8IA 1G59A 3V83A 3GUDA 5EYFA 2ZFWA 4PBQA 1J59A 3OYBA 3P5JA 2WBMA 2BVLA 5B66C 4LJZF 2K7LA 2M34A 3EN3A 4MHFA 4BJTA 2V1NA 2Q2CA 3T9XB 3GBGA 3ROUA 3F6OA 1JW4A 5AE4A 2A5YB 2XB0X 2WY7Q 1ERDA 1FMVA 2P6TA 3K0LA 4G77A 4NUBA 2NRAC 5FLXZ 1XTAA 2Q1ZB 3K2AA 2KLFA 4QTRA 3OIPA 2DT6A 3KX2A 3GO5A 4BS9A 1SVXB 1R5GA 2EIMH 4CZZA 4C1TA 4ZTJA 5J8FA 2KIFA 2MGQA 1ZG3A 2KZVA 1LAXA 3ZR8X 2GLOA 1PB7A 2O7OA 1R5HA 3WTUC 1GVCA 4UUTA 3PU5A 3P7NA 1A6IA 5DS9A 4M6VA 2ZNZA 2PT1A 3KYDB 4XLEA 1G2HA 3U94A 2CUEA 3DLLF 1NV3A 4G6DA 3VSLA 3ELKA 4PUSA 1TFDA 3HPHA 1UG0A 1Q1HA 2R7TA 2DVZA 3ZQIA 1BJAA 5CVUA 4HA8A 4QPQA 5FRNA 4X9TA 1IN4A 3KEQA 2WV1A 4JWOA 1TC3C 2L9NA 4PAFA 4XIDA 4HNVA 3BG6A 4KYWA 1SFOJ 1LFGA 3H3GA 4H65A 3UA8A 3TFLA 4NG7A 3K4LA 1I6BA 2HYGD 5CVVA 2YUSA 1MIJA 5JHFA 3K4NA 5FBPA 4N9HA 1F43A 4F19A 2AIXA 2OV7A 3WTSC 1A36A 3ZKKA 2DU9A 1T0FA 4H5GA 2VKVA 2MSYA 4CCMA 1K78A 5B3SH 1NUWA 1OCPA 3FXJA 1MY3A 1SVLA 3M3YJ 1ZR2A 4LLLA 4WCGA 1Y1ZA 2JTVA 1LE8B 1UTBB 4A5MA 3OYFA 2BV6A 2CUJA 4EATA 4GWXA 2HI3A 2L9VA 1FOWA 1MH3A 5BOXA 2VQHA 3M8JA 2EZKA 4KT6A 1Z7LA 2HDCA 2DXIA 4X04A 1T6SA 1BL0A 4QFKA 5L3DA 3V7SA 1QGXA 1DPRA 3OR2C 3AG4H 2BY3A 2KRFA 2FA7A 4W97A 2VLAA 4LLGF 4RNSA 4IHTA 3RPUA 1R6ZA 1ZKBA 2V6CA 1WJBA 2FIXA 2CW8A 1T0FC 1EV7A 3O8GA 1BBYA 3SDBA 1LE8A 5BMZA 1N78A 1Z05A 1NNKA 1XDSA 4IO6A 3BT9A 1ETVA 4N0BA 4M3DA 4UUSB 3HPIA 4LONB 3BDDA 3LFKA 4GWOA 1A04A 2XRLA 3I6VA 3G3ZA 2FQ4A 2M3AA 4PFTA 2LVSA 3HUGA 3PIPF 4MEVA 1VSOA 3IB1A 4P8BA 2LREA 5B1AH 4ESWA 5HODA 5FD6A 4UNOA 4BDLA 1LVKA 3S4UA 2NOJB 3DPUA 4HAMA 1HSJA 2XXTA 4A3CJ 2FVZA 4EJUA 3LSMA 3ONQA 1P4AA 3FATA 5H6RA 2KDOA 3Q9SA 2HQ0A 3R4KA 5E18F 3FJGA 2K9SA 1YX3A 2OA4A 4OWRB 3AG1H 2DODA 4UV9A 1ZYRF 1MQHA 1NV4A 2XGDA 4ZDPA 4OEUA 4ZYEA 4RYAA 2ZSIB 1QW0A 1R1TA 3IK6B 3I5OA 3DEUA 2F35A 1YAEA 3IRQA 3GYHX 1RYOA 2YX7A 2QF7A 1XS5A 2F2EA 3HKZN 3E1SA 1J1NA 4LIVA 1AHDP 5F27A 3A3UA 1ETKA 4IO4A 2R71A 2BY1A 5CVIA 5K7ZA 1FIAA 1XGOA 5FKNA 4K3FA 5DTBA 3CESA 3RYDA 1LDDA 2DOJA 3S3MA 3DELB 4CCLA 3K2DA 4MHGA 2QBYB 1YS6A 4XKVA 5JVGF 1MH4A 1YTVA 3MZYA 4YIFA 3IL2A 1WI3A 4C2MJ 4P1EA 4BE1A 1NV0A 1TTYA 1JT6A 4JDFA 4NQWA 4BQNA 4F1VA 5FKLA 2F3DA 4J01A 4O3CA 3RKXA 2Q2EB 3IH3A 4ON0A 1NV7A 2VD2A 3VWBA 4RPOA 3L09A 4AD9A 2F4OB 5F1RA 1R7JA 3C18A 3IWZA 4GGGA 2XX8A 3OO8A 2KRCA 1IUYA 4W1UA 4KA4A 4ZEFA 5J1RA 5I2KB 4XN0A 3ZCOA 2QQ8A 2L2OA 3W2AA 2MKZA 4PGPA 4ENNA 3ZMUA 4AWXB 5FHOA 3QSLA 1NK2P 1TXFA 3PFYA 3DLNA 3UORA 2F5FA 2EIKH 3EUKL 5L3EA 3MEXA 2EIJH 1HBXG 2IA2A 1QPMA 4OIPF 1GV2A 2DW4A 2CZLA 1IRFA 5E8IA 4U0WA 2KR0A 2O03A 3MZBA 1I27A 1QHGA 2JRTA 1EF4A 4D0PA 4NF5B 3WTXC 1YW8A 3BR2A 4HX4A 2MH9A 5FGMA 3H4ZA 3SKPA 3KP5A 2Z9OA 4JVIA 1FX7A 3BJOA 2EFOA 2I0CA 3BQZA 2K4JA 2RV8A 2HAVA 1NV2A 3EHUA 4OVRA 2PMZN 3JTHA 4D7MA 4MQVA 3KN8A 1B6AA 3BTIA 2ZXWH 3KC1A 2AL5A 2HYFA 1R36A 2ZMEA 3K1MA 3QU3A 2P7VB 3D1RA 2I49A 3N97A 1WCMJ 3OL3A 1NUZA 3IR1A 4Q47A 4R8HA 3GTKJ 3ZPLA 2COBA 4TQUQ 4LP2B 4E7KA 1D1BA 2V84A 1UHMA 2LYCA 4UVAA 2DO7A 2K3FA 3E6MA 4NHBA 3ML6A 3PUYE 4I62A 2JPCA 2B4LA 4QFOA 4PFBA 3UR3C 1QU3A 3S2WA 2DK8A 3O66A 2L7MP 3LFUA 1MY1A 1LFBA 4M3GA 2DS9A 4FISA 3IJOB 1EZOA 1IC8A 5I7IA 1U6GA 3PUBA 2Q2EA 1ZG1A 1FBQA 3TKDA 2GOMA 2OZ6A 4Y17A 1A99A 3LSLA 2DAOA 4XNFA 4AU7A 3H6UA 2D1VA 4I1DA 4LITA 2XX9A 1JJ8C 2HXWA 1OQGA 5J16A 3C2GA 2X1DA 4Q30B 3UN6A 2BXYA 4JK1X 2GOXB 5IOZA 1XB4A 5LHHA 3KSXA 1GVDA 4BYYA 4EQ9A 3B8BA 3LWFA 4BEHB 1DOTA 4R74A 3H6WA 5ILUA 1EH8A 4U7DA 1FYMA 1FTAA 2VD3A 5I3SA 1J0RA 3MVPA 2RAEA 2X6YA 2W57A 4JXIA 3I0TA 2DI3A 2EJRA 1T95A 4BGDA 1RIOH 1IDZA 4GWYA 1O64A 4GL0A 1BR4A 3BPVA 2E19A 5IYBJ 1Z91A 1LNWA 3TEPA 2ZJPF 1E3HA 2X9DA 4ZYHA 4LN5A 3K6UA 5IYDJ 4JSDA 1ZIUA 2V1UA 4JWXA 4EXLA 2DA7A 4F92B 4PGGA 5DT6A 2A5SA 2Q9TA 3KN3A 2ZXTA 3ZKLA 1X1DA 3RQIA 3WAEA 1XMKA 3OYHA 4QF9A 3IO6A 2MABA 2M30A 4P3LA 1S7AA 3GW2A 4NHJA 2CV1A 2VPNA 4F22A 3FBNB 5DUIA 2IAIA 2O9LA 1K83J 5H6QA 1G4DA 3B7DA 3CP8A 2PCRA 2WX9A 2EPFA 3BROA 5D6FA 1XX5A 5HNHA 4UUSA 4I01A 3CTAA 4EDPA 1RETA 5CVRA 4GXOA 1IMEA 4AM3A 4D5FA 2A61A 1ZAOA 1KYWA 1UTBA 3RJPA 4A12A 4QRZA 4DCXA 5DUKA 2WADA 5E3NA 1M5BA 5DVFA 3F9KA 3AKZA 1RDYA 3HFUA 3W15C 2KQZA 3VSKA 3KZGA 2LBFB 4A3FJ 2JJ7A 1EH3A 2P2AA 2Q89A 4G6TB 1ULYA 3RKQA 4OVJA 2KIMA 2MFZA 5GAHJ 4M9SA 4OENA 1R1VA 2CO5A 1U78A 1UJ8A 4THIA 3C31A 5J4YA 1BI1A 2G9WA 1MD0A 3CCSI 1T56A 3CCYA 1TWAJ 3ECRA 3HRSA 2QQ9A 1TLHB 1W7PD 2CQ7A 2ME6A 4YU0A 4KD5A 3UKGA 4CCJA 3SQNA 3OSGA 3FBPA 2LFBA 3PNTA 4XR6A 1JVXA 3SETA 3CCUI 4O7IA 3PFIA 1ETWA 2YU3A 3Q28A 3FUZA 1WWXA 2XV4S 5DCMA 1YPNA 1SANA 1B6HA 4GWSA 5LFAA 2DWHA 4GF8A 3FXLA 1LAFE 2L02A 1KQ0A 2DXYA 5KDTA 2KISA 5AIPA 4AUXA 3LQRA 1U5TC 2NYXA 4DYCA 4RGRA 2L0KA 4XICA 2PX9A 1FOKA 1JP4A 5HS9A 3G3HA 2I6EA 1MXUA 3GLLA 1JKPC 1Y20A 3OD7A 4NC8A 5I56B 1ZGWA 1NL5A 4NF5A 3T93B 1I6QA 4OA4A 4DDDA 3MWMA 3ZMDA 2HZLA 5I56A 3HJEA 3M9AA 4ZS9A 4MFEA 1JW1A 2L01A 5CVJA 4IKFA 4DE8A 3S9LC 4KFQA 2E1MB 1XOCA 4I9DA 3FMRA 4D5CA 2LG4A 1UFMA 2M7BA 2EQRA 1KU2A 2REJA 2Q2AA 3CMYA 3DQVC 3H9JA 3DU5A 3TTNA 1A6QA 4M6YA 4IRIA 1ZK8A 2OCEA 2X1EA 3IAZA 1BI0A 4IO3A 5LOMA 1RZ4A 2H94A 4UXNA 3QXMA 4XLPF 1U9OA 4QLCU 2QVVA 1XCVA 3MZ8A 1IIWA 2NNYA 4BNCA 3CJNA 3AFHA 2V9VA 3FM3A 3H35A 3HSFA 4IY6A 2DWAA 3OYMA 1VZ0A 3DP7A 3HEFA 3MN2A 4DGWB 1JE8A 2GXAA 2L4MA 3KLOA 3OMYA 3M8FA 1HQCA 2HZTA 1YO5C 3DP6A 2IA0A 4M72A 5EGOB 3H06B 5EYGA 2ZMEB 3S1NJ 4BHCA 3MKLA 2MBFA 1MSFC 2IS2A 1P99A 1HLVA 2L54A 4R73A 5FLVA 1MNEA 3KN7A 4BXFA 3VDXA 3NARA 1VQ8I 4QSCA 2QSFX 3TW7A 2ZNSA 3V89B 1N7WA 4IHVA 3S14J 1FQFA 1OR7C 4DI4B 3KEIA 1IW7F 2R7ZJ 1EZ9A 3ABKH 1FY7A 3BR5A 2EBIA 2KHMA 4A0ZA 5ICGA 3PPPA 4EXKA 2QBYA 2ZZVA 4G68C 4F93B 3T8TA 4MEXF 2LK2A 3SYTA 1TNSA 4AYBN 3ZMZA 3SXYA 2R0QC 5E79C 1VTNC 1XDUA 2LY9A 2XIGA 3OR1C 2AYSA 2XDVA 4OFJA 2L9RA 3T9HB 2BEOA 4ZH4F 1NV1A 4I02A 1GT0C 1ORKA 5M2VA 2VQCA 2QL3A 5FHMA 2ZMBA 4FX4A 1L3LA 3X2QH 2HR3A 1ZGAA 2R5YB 4IB2A 2I0BA 5BUUA 2QS2A 4GWUA 3RIRA 2IA4A 1G3YA 3QWLA 3EUAA 3CC4I 3HOVJ 2F6PA 3FJMA 1NNFA 2ONRA 2ZXHA 3QYTA 3ISPA 3W6KB 3GTPJ 1SD6A 3BQYA 3GTJJ 5T3JA 1USYH 2KDZA 4N13A 3JAMK 1YS7A 2XROA 5IT3A 4FECA 2EH3A 3TKYA 2ZXJA 1KU3A 3AL0C 2VI6A 3PNVA 3I56I 1NH7A 3TYHA 2MA3A 3V8LA 5EZGA 1OFCX 2OZZA 1V54H 2EFNA 3SEWA 1SFKA 5ICEA 3JSPA 3MVXA 2XAFA 3A01A 4HF0A 1SEUA 2YU9J 1WHUA 3DKWA 2ZJQF 1B5HA 1O63A 4G61A 4KPTA 2HOEA 3U72A 3FV1A 2DOFA 1J09A 3JRCA 2DMNA 1IN7A 4FT8A 1WJEA 3EYYA 3HBLA 4JX4A 2JA6J 2ZBKA 1NHAA 5J47A 3WTYC 3I3VA 4F18A 2EWNA 3LSFB 5TRDA 1URSA 2BXZA 3LV0A 4PP0A 2R8TA 3EUHA 4RGXA 1X19A 3NRVA 1RKMA 5K5QA 3KGCA 3LUYA 2DA5A 2FYIA 1POY1 2K40A 1X3WB 3ZQQA 3PPQA 2ESNA 2PMUA 3F23A 3OSRA 2ZXIA 3JRDA 3GTMJ 5DVJA 2VBZA 3KP4A 5JK4A 1T0KA 2XUBA 5KVRA 4BDNA 4DW6A 1MY2A 5IZ3B 4HG2A 3V5AA 5M5WJ 2VIXA 4RXLA 3BG9A 3ZMTA 3E6CC 2PN6A 3IOVA 3QIMA 4D1QA 3VVEA 2HVSA 1FTJA 3HHHA 3J81Z 2UYFA 1FT9A 2G7HA 1JEUA 4YG2F 1NV5A 4BACA 3EYIA 3A3CA 5LRSA 3E78A 2DWJA 2OTJI 4PE3A 5HLTA 2R93J 1Z7ME 2Y7WA 2EV5A 2KIUA 3C9HA 2W00A 1ZHFA 2K9LA 2OBPA 5TJJA 3PM1A 1FZPB 1SFXA 3S15J 2O61A 4P56A 3V8JA 4I98B 4FORA 2VL8A 4BDZA 1Z6RA 2PEXA 1WJCA 5J1UA 4CGZA 1B5IA 1R6RA 2DMQA 2Y0SA 1PB9A 4E7IA 1P1QA 2QS4A 4I40A 5IT9Z 3W6JB 1YI2I 1ZH5A 2RCAA 3U8QA 1H9GA 4JBZA 4M3FA 5LTCA 2VJ4A 2PJRB 2XKPA 2X85A 3GBBA 3W2VA 4U1OA 1J5YA 4KMFA 4LLNA 2Y0MA 4HOBA 2H6BA 3IFAA 2LR8A 4P55A 3D4GA 1JW5A 5I59A 5L9OA 4YZZA 1BJZA 3C35A 4BDMA 2IW5A 5FB2A 2H5YA 1O57A 4HRIA 3O8HA 3GX4X 2GXBA 1WVRA 2QUFA 2RGVA 2HPIA 2V3TA 3HN0A 2YX4A 1G0IA 5EQ9A 1BIAA 2XVCA 1VQMI 1IRGA 2KJCA 2W1OA 3G1LA 4LMYA 3H5RA 4RAGA 1R4NB 3CP2A 2DDKA 1XGSA 1S7EA 4ETSA 5F04A 3DP4A 2QGUA 4R75A 3TTRA 2ANJA 3O6HA 3H3UA 5C4JJ 1P6RA 2EINH 3WG7H 3QYBA 4EM2A 4M73A 3K70D 4RA2A 1XI6A 2UVGA 1B9NA 5K7HA 1PC3A 1XCBA 2FMLA 1FYLA 3M1EA 3LNQA 1N84A 3H36A 1S29A 4QIWN 4MGRA 4NN3A 4HF1A 2Q74A 5ITPA 1DQUA 4FASD 5E3OA 3OYCA 3GFIA 5F0HA 5ET7A 5FTIA 2UVJA 3KETA 2VJ5A 2Y30A 3QOEA 4DYQA 4U0VA 4FJPA 1ZRDA 4F39A 5ED4A 9ANTA 2XSDC 4GD5A 4KHZE 4PE5B 1FBFA 2FOWA 4Z0IA 2XXRA 2JVHA 2ID6A 3KC0A 4LB5A 2NS0A 4GWWA 2M0CA 2O6AA 4EGYA 3MZ1A 3O9PA 3LSTA 5B5EC 2OQGA 4J00A 2DWIA 3TPAA 3QUJA 3LBSA 4FEBA 4BDOA 3K6GA 3FISA 1BOAA 1D5VA 2PX1A 5CI5A 3BKIB 1UMQA 1P2FA 3U1DA 2IEKA 4AIJA 2LTPA 1TZLA 3BTCA 1Z3YA 4HCYA 1LFHA 2QA4I 1Z21A 3O2PE 1U5TA 3OYLA 2GQQA 2EB7A 3HOSA 1DTGA 1XC1A 2QVUA 1OISA 2JUGA 2FBPA 2QVRA 3FKIJ 1YIJI 3VOEA 5LGTA 3Q27A 1RR8C 2V9PA 3RPLA 1OIBA 2RCBA 4P9KA 3WGIA 3PMXA 4V2GA 3PUZE 3K4UA 1SC7A 2R7VA 1TL8A 5F08A 2G0EA 2CFXA 1DUXC 3TL4X 1QKBA 4R9GA 2I58A 1Y9UA 1Z3XA 2O1MA 2PVUA 2CS3A 1N3XA 2YPNA 1FJLA 3SHFA 4C1UA 1H88C 2JPBA 5EDNA 4NAPA 5BPIA 3JYRA 3IOWA 2F6CA 4O3MA 2XB5A 3R0AA 4WX9A 2R7RA 1IDYA 1M5EA 3K70C 4A3BJ 3HYIA 2DT7B 1RRJA 3R6SA 2IS1A 2P0SA 2BGCA 2XXPA 2DE2A 1LB9A 5E3LA 2O7UA 2KKOA 3K4CA 4XFEA 4A2UA 4HF2A 4HX8A 3QMFA 3L2UA 1XGNA 3WAFA 5H8SA 5EYHA 3WU2C 3RQTA 4JWYA 1DTZA 1YYZA 3KFWX 1X1BA 1YW9A 1QVTA 3MBPA 2E2IJ 2XXHA 3FD3A 3PUXE 5A5XB 5D8KB 1KQ9A 3PUFA 1IXGA 1U0JA 4A3IJ 3T66A 1NH3A 1U9NA 3VLVA 4BXXJ 5L3BA 3TMGA 3O29A 3K4JA 1OVTA 2BY0A 2VXDA 1QULA 3BR3A 4IVNA 1X2NA 3ABMH 1P1NA 1TFAA 3M3LA 4OVPA 1ZLQA 2NVTJ 1N0TA 3C34A 3DBHB 2Y31A 2ZC2A 3J80Z 3CVGA 4HSRA 2DFIA 3JRGA 2FMYA 1R9TJ 3I4PA 3N05A 4OINF 1SD7A 2KPMA 3K1PA 2VN2A 3QODA 1B4HA 3LSHA 2L5VA 2R9JA 4RK2A 4Q8RA 4GCVA 2LMDA 3I53A 1ATGA 4PDDA 3OS2A 2K4BA 5DD8A 3D1NI 3HOWJ 1SAUA 1YOVB 1VFEA 3G73A 3ECOA 3OYEA 2AXLA 3FXUA 3OYIA 2FQ3A 4LA9A 4ELPA 2DVCA 2WTEA 1W5TA 4N6PA 3QK6A 5FTHA 1S3JA 4M9ZA 4XLAA 2O0YA 2B4MA 1B5JA 4MMPA 4RA1A 1G6NA 2X4HA 1FP1D 3S16J 2PBWA 1IRXA 4YAHX 1XC5A 2L7ZA 4L9NA 5KK1A 3IV5A 1ZQ3P 1WKMA 4C2TA 2OWTA 4BAYA 2UWMA 1FQDA 2ONSA 2XF7A 4IY5A 1UIUA 5IOYA 3KBZA 1PP7U 4N91A 5CJ9A 1MBGA 4O94A 2O69A 2QWWA 3H92A 4BDRA 2XRNA 1POTA 3CLOA 2DBBA 2GIZA 2GZWA 2F5DA 2ZYKA 5FKKA 1YX5A 1YW7A 4BHPA 1X1PA 2ESHA 2VKDA 1AOYA 1Q1KA 3FVNA 2UXNA 4AIHA 3E5UA 3BBRA 3HRUA 5LGNA 3PPRA 1Y1MA 2ZYOA 1JKQC 2YLNA 2FA5A 5CLSA 3CF5F 5GPCA 2O8KA 2M1BA 4OFLA 5E1WA 3SERA 4JOMA 1WGXA 1OCCH 5FLMJ 1AL3A 1VQLI 5I58B 2HU9A 4N4OB 2FEZA 4RM2A 3CCMI 1GTKA 5H8NA 5I57B 3GCMA 1SI1A 3WHBA 3HGYA 1FJ6A 4N6DA 4KI0E 4PF8A 3B6AA 4OAYA 3TELA 4R6YA 2UXAA 4ELQA 3LOCA 4P1LA 5D5WB 4Y33A 3ASNH 4U7BA 1NKXA 2F6GA 4F3SA 3BG3A 2VE9A 3IB2A 1GV8A 1SW4A 4DCYA 5KAIC 1OCOH 4S0HB 3S1QJ 3GTLJ 3PSIA 3FIWA 1MM7A 2VT2A 5DV5A 4ITVA 1QBJA 4A93J 3FVOA 4I3YA 4F29A 1MSEC 4NC7A 2REGA 3DBRB 5KCJA 4U87A 3CUQB 3D0SA 4Y7NJ 3CI8A 4UVBA 1X2MA 2VGQA 2HHMA 2KQRA 2HCAA 2HVQA 1JVYA 1B58A 1XHYA 1ZTRA 1YTYA 4Q4ZF 1K4TA 2P5KA 3LSJA 4KN4X 3HPGA 2EV0A 3OO9A 2E1MC 4ZEBA 3CUQC 4PTKA 3EQLF 2XAJA 5TU0A 4KMUX 3GLBA 2HWVA 2E1SA 3G2BA 5L9SA 2X6XA 3M07A 4PGNA 4L9TA 1B72B 3VVDA 4B3XA 1MJBA 3CMMA 3GEZA 3OENA 5E20A 3GMEA 3DTEA 2NOGA 2F34A 4RB3C 4XN3A 4YIRX 1X3UA 1Y6IA 4IGRA 3W9WA 3T5XA 3LUZA 1TBXA 2V79A 2F7AA 4Z7EA 3RKWA 2LKPA 2VP1A 5ELVA 2W85A 3HDDA 4G12A 2ZNYA 4I7HA 4XXUA 5AA4B 4E7HA 4BY7J 2VBYA 1ZU0A 4RJZA 4BY1J 5F64A 1JUMA 5AA4A 4XSXF 4U22A 5L3GA 1IMAA 1YZ0A 3FMSA 2A05A 2CZIA 1H89C 5F24A 3H6TA 3HSTA 3QRFF 1ZKGA 2IS4A 5GAGJ 3GFJA 2A07F 4LB6B 1WJ5A 3FJ7A 4JQFA 4EJVA 3VFJA 1YG2A 3Q0UA 2G29A 4MIMA 3FM5A 4EMSA 2DQLA 2UVHA 4U4XA 2I5UA 3SEVA 1W7PB 4EM0B 4PETA 3TO9A 4L5IA 1QA6A 5DD4A 1TP4A 2H8RA 4A3LJ 4PFIA 4MO7A 1MMGA 1B32A 3O3KA 5LD2C 3KYLA 2DA2A 4IHXA 3K6VA 2CYYA 5ILVA 3V42A 1HDDC 2GWRA 5EJCA 1QZYA 2A69F 4PDKA 3G6EI 2PMHA 4FATA 1PBQA 4OETA 1AIVA 2H09A 3BCAA 2K9NA 2PFZA 4FE8A 4GVOA 5H20A 3AAFA 1FSEA 1O4XA 3DFGA 1UQWA 3AG2H 2QZ8A 3K6XA 2A6HF 2VPLA 1RDXA 2UUZA 4H1XA 3VPRA 3H9GA 4XKNA 1I69A 1BN5A 4MLQA 1UCRA 3O6GA 5J3LA 1LB8A 4PBHA 4G9YA 1FBGA 3MW0A 3OEKA 1EKEA 5L3FA 1MDMB 3DEEA 2E60A 3LSIA 1T39A 4ZDLA 4OQOA 1WJFA 4S05A 3AL0B 5FFXA 3RI4A 2RVCA 2Z5UA 4DXBA 2V4JC 2O68A 3RGYA 4F52A 1STZA 4HNTA 1E0EA 2R4GA 2CW7A 3V4GA 4IXAA 3BIGA 3BWGA 1ONVA 2BY2A 1ZLJA 3JAMZ 5IZZA