1MH3A

Maltose binding-a1 homeodomain protein chimera, crystal form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
421
structure length
421
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose binding-a1 homeodomain protein chimera
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
total genus 144
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh3A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A01
2RCBA 3ZKKA 1LAFE 3MZ9A 3A3CA 2DWJA 1QULA 4WEDA 3PD9A 3G3JA 2RAEA 2X26A 3G7WA 4EEFG 1QRYA 3M3LA 4BDMA 1FQFA 1ZLQA 4AB6A 1U78A 2QF7A 2WV1A 3HM5A 2NVTJ 1H76A 1LLSA 2XXXA 3WHCA 4UUSB 3HOZJ 2M34A 4XTCQ 3OSGA 4ELQA 2ECBA 2XRLA 2F36A 3H03A 1S9TA 2I4CA 2NVQJ 2GHAA 2V84A 3I3VA 3JRDA 3TODA 5FHMA 2DMTA 2ME6A 2OWTA 3KBRA 1Y4CA 2Y9ZA 4M3EA 2B63J 3B6CA 3GTOJ 1O7TA 3M3KA 3FIWA 3HKZN 1MS7A 4R6YA 2OCUA 5EHMA 4NMYA 4JSOA 1B3HA 2DA6A 2DJNA 4LUBA 3OELA 1B7UA 2AHQA 2WAQN 1TFAA 2IAIA 1W0TA 2GHBA 5FKLA 1DSNA 3CCYA 4OVJA 2Z8FA 5EEAA 3KGCA 5BUUA 1OVBA 3W6VA 1DPEA 1EU8A 2XXRA 2F34A 2LD5A 4CYCB 3BBRA 2WB1N 4OEUA 4OZ9A 2R71A 5IPAA 2O69A 1WI3A 5F0HA 5JEIA 3K2DA 2I48A 3GBGA 5AA2B 2H8RA 4I8CA 2LKXA 4M4GA 1BW6A 4QSHA 1DOTA 1PBPA 2DA5A 1BW5A 4U1ZA 4A3KJ 3PU5A 1USYE 4RA1A 4OYVA 2H25A 1RKTA 2RC7A 1UIVA 1MNMC 4IHVA 3UIFA 4YB7A 4XK4A 1AHDP 2DVCA 4KFQA 5F27A 2FJ1A 1IIWA 1ZJLA 2F35A 3TEPA 5DT6A 3TCFA 3ECRA 3H0GJ 4MFDA 3OIOA 1Q1VA 1TC3C 4FEDA 4E0WA 1B40A 2HAVA 5FTIA 1AIVA 3CFLA 4NF8A 3D4GA 3MAMA 3ODBA 3TTRA 2DWHA 2V25A 3M8UA 3U92A 3T9XB 2O1LA 2F6PA 3CRBA 3QAXA 2DTZA 5F7VA 4YMAA 3W15C 3ZOBA 1MM6A 5FKKA 5GP9A 2KT0A 4QHQA 2ID3A 2JN6A 1FIPA 1S7YA 2I3VA 2ZNTA 2H4IA 3K6XA 2R6GE 4JXIA 2THIA 3V8XB 1ORKA 4F29A 3BR3A 3C31A 5FKMA 4N6PA 1N0TA 1JVYA 3BFTA 2O7UA 3K6VA 4QSCA 4F1UA 1UQWA 5AA1A 3OEMA 4GVOA 3VE1B 1OMPA 1WVJA 1NNTA 4GXAA 3H3VK 3SEYA 2Z23A 2EBIA 1ELJA 1UTBB 5KZTA 3K2AA 5DVFA 1A55A 4ECFA 5ELVA 1NMUA 5DVIA 2LP0A 3HHGA 1TFDA 2Z8DA 1RESA 4JYKA 3EHSA 1SW4A 4ELOA 4W97A 1ZQ3P 2I3WA 2Y7IA 5CI5A 5AA2A 2AIXA 2W48A 1JVXA 3LC8A 5KCJA 2UYFA 4C2MJ 1N3XA 4Q0CA 3FZVA 3TFLA 2GFEA 4XRSA 4XKNA 5FLMJ 2HCAA 1PDAA 3VDFA 5DYHA 5TPAB 2XPUA 4NTLA 4BXXJ 5FHNA 2I4BA 3MP1A 5EYFA 2HZKA 3C4MA 1HLVA 1OJLA 4PFUA 1IXHA 1JT0A 3LSFB 1B3LA 2HXIA 4RK9A 2P81A 2UVIA 2DWAA 3CIJA 3S1RJ 2R5YB 1B8IA 1GVCA 2VKVA 2JMWA 3C32A 3MPLA 1U9NA 4OHNA 3N5LA 5DS9A 2MW8A 2DE2A 3CVGA 4X48A 1FIAA 4M6VA 4OWDA 1MQGA 1I6HJ 5FHOA 1HF0A 4GIZA 3D4CA 1HSLA 2WKYA 2FQ4A 2FYIA 2ONKE 2ANJA 2Y7RA 5GPAA 2TCTA 2IEKA 1I3QJ 1URDA 4EF1A 3BQYA 3K0VA 3GTGJ 2XXIA 1FQBA 1NNKA 4NWCA 3HOWJ 3V83A 3VPRA 2XHDA 1QUKA 3VXCA 1EH3A 2YU9J 2PMSA 3CSBA 3SEUA 3ILTB 4JX4A 4M3DA 3GTJJ 1LAXA 3GXAA 4F3SA 3TTKA 2JA8J 3H6UA 1YRNA 1B72B 2M2EA 5DTBA 4FATA 1D5YA 5CRYA 2O9LA 1UTBA 1SI0A 2F7AA 2HDDA 1URGA 5ITPA 5L9SA 4UUTA 2Y7WA 3MBPA 4DZPA 4GD5A 1ZBMA 2Q89A 1LFBA 4LOCA 4QTRA 1M5DA 2Y30A 1EF4A 1H89C 2AO9A 2I0BA 5TPAA 1U9OA 3IH2A 1NK2P 1POTA 4RBOA 1UG2A 2Y9YA 2HFBA 5H8NA 5ICTA 3TKDA 1JTYA 2DMNA 1POGA 3RZDJ 4M1VA 3KOSA 3LSGA 5E3MA 4UA8A 4DCYA 1VI0A 3FJGA 2XGDA 2YS9A 2UVJA 2X6OA 4IGRA 3BTCA 3WAEA 3HGYA 3G3KA 3A3UA 3O9PA 1JKQC 4LP2B 1TXFA 2NVUB 5CMKA 3QYTA 4KR5A 3KEIA 3FK7A 2OF7A 4A3DJ 3U93A 4DE8A 1UTHB 2OZZA 4JBZA 4DZJA 5K2XA 4DYRA 4DXBA 3WAFA 4R2FA 3OO9A 1GGGA 2QJEA 4Q5TA 2QL3A 3SFIA 4I1DA 2LLKA 3T66A 4FTHA 1I50J 4FCYA 1I6BA 3M3YJ 4LZ7A 3CSGA 2DP8A 2XB0X 1MG1A 1JW1A 2Y2ZA 5CBSA 3TELA 1LB9A 1LBCA 2FD5A 4A3FJ 2I58A 3WHBA 2HAUA 3VV5A 3KOTA 2CUEA 1DPPA 3A03A 5JTYB 3GLBA 3IB1A 4IHWA 3JRFA 1YCJA 1MBHA 3LSJA 3JRBA 1B72A 1JEUA 3SEXA 3MPKA 4ZE8A 3TDJA 2JJ7A 4NF6B 2DA7A 4H8JA 5K2YA 4IHYA 3UORA 4OESA 1FCKA 1QVUA 3MP6A 5H8HB 1T0KA 4EQ9A 3S9NC 3PO3J 1LAHE 1USYH 4IO6A 2XD2A 1AL3A 3OENA 4M3FA 4OQOA 2A5TB 1RETA 3ONMA 3KFMA 2XB5A 1WGXA 5GPCA 3GTPJ 3DCFA 3H3GA 3G3HA 1AMFA 4H65A 4K3FA 3CQZJ 1R6ZA 2M8CA 4OERA 1A7LA 4DXUA 5AA3A 1QVTA 2HOTA 4IY6A 2G0EA 2UVHA 1FQEA 1HOMA 3CR9A 3UGWA 1P1NA 4MLVA 5EDNA 5IOYA 3T22A 3MP8A 3Q26A 3BT9A 3BG5A 4RNSA 3RQTA 1MQJA 3Q25A 1BJZA 1DMBA 2F6GA 3BQZA 4Q8RA 3SETA 3SEWA 3HO7A 2LFBA 4FJPA 2I6EA 3FXUA 4ISUA 1UTHA 2Q2CA 1FQCA 4BDLA 2E1OA 3BKIB 4X6AJ 3UA8A 3HOYJ 3FJ7A 2Q9TA 4ONYA 4O3CA 3IAZA 1LAGE 4C0RA 2ZYKA 2Y0SN 2I10A 1Y4TA 3KSXA 1YAEA 3G1LA 4GOTA 1HSEA 5H8QB 2R92J 4D5FA 5JTYA 1LFGA 2GRVA 4IGTA 3VXBA 2GLOA 2XXQA 4N13A 3R7XA 4YKKA 1FTJA 2Q88A 4NF6A 2X7QA 4Y52J 1YPNA 1AU7A 5H8HA 2DXRA 2XX9A 1P7IA 1SQYA 3TZAA 4X1DA 4JWYA 1ATGA 3BFUA 1B1XA 4LA9A 4M3GA 2CUFA 3QXMA 4V2GA 1Y1WJ 1IUFA 4NF8B 1ITYA 2P0SA 3RKQA 3EQ1A 4RY1A 3QUFA 3HCQA 3QUJA 2DMQA 2PMZN 4OETA 5K7ZA 2LK2A 2R5ZB 4BBSJ 3FXQA 4LQ2A 2VP1A 4U4SA 3AXFA 5M5WJ 4X1BA 3NARA 3HOVJ 5DVJA 4BDQA 3VVFA 3VLUA 1SANA 1MY2A 3IOUA 1IEJA 2K9SA 2ESNA 2PT2A 1II5A 1MXVA 1JTXA 5I84A 1MBJA 3IO6A 3RTWB 4MFEA 2QS3A 3MVPA 1UHSA 1X2NA 2OPTA 2D5WA 3A09A 2X9DA 4LATA 4P0GA 5JLXA 3CMYA 2HI3A 1OLCA 1H8AC 4F1YA 3GTLJ 4TLMB 4OTEA 1I69A 1GR2A 3LUYA 4H67A 4FE4A 4R6KA 3H7MA 2GM4A 4G12A 3PUWE 2DMUA 1OFCX 1WPKA 2XSDC 2YUSA 1ZR4A 4R73A 5IP9J 2XXPA 3MWBA 3RNNA 3UN6A 2JA5J 3M4OJ 2ZMBA 3EN3A 4A93J 4IO7A 2NS7A 4ESWA 4A3BJ 1UMQA 3S14J 5KCJB 2NWJA 2JA6J 3LSXA 5H8QA 1O4XA 1A99A 5HPQA 3SEVA 3H6TA 1VSOA 3PMVA 3HSTA 3T93B 5IYDJ 5AA2D 4BDOA 2CMOA 3C35A 2K9QA 4ZEKA 2HQ5A 5I58B 2QPQA 1Y9UA 5EYRA 2D3IA 2EZHA 4H1XA 4DDDA 1DU0A 1RR7A 3RPWA 4YKPA 1GV8A 1B8IB 2DS9A 1P1WA 4DZ1A 2XGEA 1P1QA 1SYHA 4G8NA 2O84X 1CE2A 4H5FA 3K01A 5F08A 3RTFB 4XIDA 2VPRA 1B32A 3O29A 4EXLA 2H98A 3G3IA 1IXCA 1BKAA 2QRYA 2R5ZA 2E2JJ 3I4NJ 4ZS9A 3U1OA 4MIMA 1N84A 2E2IJ 1DU6A 3S9MC 3CI8A 2M9HA 5IOZA 3DP4A 3TQLA 2NS8A 2NOGA 3C33A 3TQWA 1MXXA 1MBFA 3I4MJ 1MXWA 2ZYMA 4U22A 3N6UA 1IITA 1G2HA 3S2HJ 1SBPA 2YJPA 5F1QA 5F04A 1YRNB 1OCTC 2DSFA 2R9JA 3B6TA 1QKAA 4Z7EA 1EZPA 1IUDA 4EQ7A 3JR9A 1H88C 4V2FA 2NXOA 1JW5A 3O28A 4PE5B 1A54A 1HSJA 3DM0A 2FX0A 1ZMGA 2HEUA 3TAJA 4QRZA 1T56A 3RT8A 1MQHA 4DIGA 1A40A 3K02A 3SJMA 1GT0C 2L0KA 1K61A 4TLLB 4G8HA 1M5FA 5FLVA 3FXRA 1EZOA 3LSWA 4I9DA 3QIMA 5H8NB 2G93A 1WODA 4NF5B 5IAIA 5I58A 3H6VA 1S7EA 2CRGA 5LOMA 2ONSA 2D21A 4O3AA 2ME0A 4OENA 1MSEC 4QFNA 2DA1A 4NEDA 4IO3A 4RYAA 3CFZA 5L9MA 4ZEFA 3EPEA 3TCGA 3PUXE 4U2RA 3K1NA 4HW8A 3A01A 4ZEIA 2DYXA 1XS5A 1PB7A 3GTKJ 1MM7A 1VFDA 4FISA 1X2MA 5ISUA 2W7YA 3MW0A 2QS1A 3T96B 4KQPA 1X58A 4C1TA 4YKJA 3QK6A 3IB2A 1IZ1A 3GTMJ 4XKPA 4YKIA 2VHAA 3RN8A 2IBDA 1PB9A 1ETWA 2L7FP 3LR1A 2CQQA 1ANFA 2NUVA 2K9NA 5DEXA 1XT8A 1BA5A 1B5HA 3DP6A 4MH5A 4HCWA 4KYDA 4WEPA 3JV9A 5IP7J 3S17J 1Y1MA 1MSFC 3PUYE 1WDNA 1A5JA 1MY3A 4I6ZA 3BTJA 1D3KA 4EF2A 3IJXB 3HN0A 5A5XB 1Y1VJ 4G68A 5CMBA 3EHUA 3Q0VA 2YPNA 1B2HA 3USDA 1VR5A 4YB6A 4RPNA 1JJ6C 1OIBA 1SW2A 3VLVA 2QMXA 3JRAA 4JWXA 4A69C 1PC3A 2XXUA 4C1UA 1H3DA 4A3CJ 2EZLA 4MLOA 5K7HA 1JUPA 2VKEA 4HNVA 2HYJA 3IL1B 4GFRA 5M3MJ 3HBLA 2RC8A 2K40A 3VLWA 1Q35A 5B70A 3IO4A 4AYBN 2OBGA 5K7FA 3O8GA 4NF5A 3QSLA 1ZU0A 1JETA 5CMCA 4IHXA 2X7PA 3SDFA 2HZLA 2ZYNA 2CQXA 4POXA 3O8HA 1POY1 1FQAA 5HM4B 1SW1A 4G8MA 1MBEA 2O8KA 1H45A 2BJJX 3OO8A 3TW7A 5TU0A 2ZXTA 3ZSFA 9ANTA 3DELB 2AYSA 2Y31A 3S2DJ 3MQ9A 4HTGA 1KWHA 2NVYJ 4XRMA 2ZNUA 3HV1A 2Y7KA 3JYRA 3OSQA 1SD3A 1JNFA 4NWDA 4TOZA 2EH3A 4J19A 4F2OA 4FE7A 4GQOA 1ETOA 5J1DA 4NDLA 5EG0B 1LFIA 4EQBA 2H9BA 3OO6A 4D7MA 1IJWC 1Q1KA 1FTTA 1MY4A 3PUZE 1ZKBA 3IORA 2DMPA 5FKNA 2R7ZJ 5M5YJ 3MVYA 3R6UA 4XRSG 4ZE9A 3LSRA 2F7BA 4ND9A 3FVKA 3C2BA 1F36A 1APLC 2LVSA 1OQHA 3Q29A 5BWJA 2DN0A 2HXWA 1XC5A 4G4PA 3TCHA 5H8FA 1O63A 3QPLA 4JP0A 3LNQA 4H5GA 5A5XA 4FECA 3BG3A 1NH8A 4Q30B 5I59B 4ZECA 3I5OA 1HCRA 3O66A 1IC8A 3OD7A 3OMBA 4IEJA 3SERA 3S9EA 2XXYA 3MC2A 1NTCA 3IJOB 3MUQA 2DVZA 5F0CA 3PM1A 2HQ0A 1MXYA 5JK4A 3HHFA 4NF4B 1JT6A 3JRHA 3KN7A 1JJ8C 3LOCA 2V93A 1ETQA 1XVXA 4HCYA 3B7DA 4OFOA 3Q28A 2QSXA 2O6AA 3CG1A 3TTLA 3O2AA 4I76A 2VGQA 4YB5A 5C4XJ 3E9XA 4B1RA 4F18A 4BDRA 1FQDA 1ZK8A 4G68C 4JB7A 4P0IA 3PUVE 5DTDA 4THIA 3TMGA 1JKOC 2B3BA 2R93J 3F11A 3A02A 5EZGA 1EZ9A 1ZR2A 4EXKA 1Y20A 4KCDA 3PMXA 2H1KA 3JRGA 3LBSA 5I2KA 2LTPA 3BR6A 4DYCA 4R2BA 4KI0E 2AL4A 5AA4B 4U21A 1IQ7A 4EUOA 1XS9A 3O97A 3D1NI 2I49A 4B3AA 3ZQHA 5EG0A 3EHTA 2A5SA 1VFEA 2QMWA 4U4XA 5EF6A 1XVYA 1ETYA 2DE4A 1MDQA 3IV5A 3MVXA 1FJLA 1B3FA 4DXCA 4PFYA 3LSLA 3RLFE 2GBYA 1HDPA 1N3WA 3PGFA 4DCXA 3CDLA 2O7OA 2E1SA 1B4ZA 1D9YA 1LSTA 1VFCA 1NL5A 3KJTA 2V3TA 2RC9A 2P2AA 3FATA 4IB2A 2HOAA 2E0SA 5CMMA 1P7JA 5FJ8J 1US5A 4RPOA 1VE4A 3S15J 4O3BA 2Z22A 4QSEA 4GLIA 3BR5A 3QPSA 2VI6A 2F78A 5I59A 1B05A 1MRPA 1OLAA 1P99A 4G77A 4R6HA 1TWCJ 1TWGJ 4MLQA 3TEDA 3T9UA 2PX1A 1JKPC 3MVWA 4MF3A 3S1QJ 4JX6A 4H6DA 2VUMJ 1OVTA 4AB5A 3ZQLA 4KD5A 4D7NA 3KJ7A 4PP0A 5HODA 3PMWA 4YZZA 4NF4A 2JWTA 1Y3NA 2PYYA 5J1YA 3GZGA 4ZZEA 1P1OA 1RKMA 1TWFJ 2ZB9A 3Q0WA 4PETA 1MQIA 4I62A 1PUFB 4FEBA 1ETKA 2RINA 5C3EJ 3ZQGA 3E3KA 2F97A 4RJZA 1MH4A 2LY9A 2ONRA 3I6VA 1H44A 2DE3A 4AC0A 2R0QC 3FUZA 5CM6A 4DW6A 5C44J 2PT1A 3N26A 3PPRA 4QFOA 3UKGA 4L5EA 4ESXA 1F9BA 3FJMA 3O6HA 3IR1A 4R9FA 3FD3A 3THIA 3SESA 2AL5A 3U8QA 3TUSA 3VFJA 3C36A 2LR8A 3E7LA 3PO2J 4QFKA 2Y7PA 3OOAA 1JKRC 4A3MJ 2FNCA 3RGYA 4BLAA 5AA4A 1QVSA 1ZTYA 5J3LA 4F3GA 1R1NA 3OXNA 4JDFA 3M3FA 1NFTA 4F19A 3HOUJ 4FAJA 1QPIA 4XKQA 1CQTA 1XHYA 1FTMA 3H06B 2QS4A 1FTZA 1BL0A 5EHSA 5EGOB 4BDNA 1N04A 3O6IA 1B7HA 3HDDA 5M3FJ 1GUUA 4C3HJ 3S1NJ 1GV2A 5IP6A 4B4CA 2O1MA 3MZ1A 2B3FA 1JGGA 4GWOA 5FTHA 3GBAA 3Q3SA 1IG7A 1B0LA 4U23A 2MSYA 3BTLA 4KCCA 1AH5A 2XXVA 1W0UA 1A8FA 2DWIA 5FKOA 2HOSA 2DXYA 3O6GA 1A6IA 4WXJA 4FIMA 2UVGA 3FVNA 5TP9A 2M0CA 2KLFA 2QS2A 3E4RA 4IO5A 1QUJA 2L7MP 1GDTA 3DEWA 2RF1A 3RY3A 2UXAA 4OFJA 2B65A 3K00A 1DTGA 3Q0UA 1AKHA 1IGNA 1B0HA 1B6HA 1FTLA 4UACA 3JZJA 1ZKGA 4GL8A 3A01B 3HGGA 4XXUA 1PUFA 1MY1A 3MN2A 3GTQJ 1IV6A 2ZYOA 2XX8A 4GRKA 1B9JA 1RYOA 1TWYA 2ID6A 3PPNA 4QFPA 2O51A 3BR0A 1ZGWA 2VD3A 4AUXA 4PQJA 4MFIA 5DEXB 4Z0IA 3OOUA 1B7ZA 4UUSA 4BBRJ 1YTVA 1VNDA 1JEVA 4E0XA 1MPBA 1QKBA 1HDDC 4OMBA 3EF7A 3RQIA 3OSFA 3L6HA 5C4JJ 1LBBA 2COBA 1ZIUA 3PPOA 4IO4A 1NKXA 2YLNA 1ETVA 1B46A 1OCPA 4G68B 3OEKA 3TW6A 1NK3P 5EGOA 1LCFA 4BY1J 3ILUB 1WH5A 4U1OA 4F1VA 2PVUA 4X9TA 4POWA 4QFLA 1IXGA 1H43A 3T9HB 3IOTA 3RT6B 4ZDMA 4CYCA 1B3GA 4YMBA 1TT1A 4WKMA 3BG9A 3IK6B 2PBWA 2M8GX 1LGBC 5E3LA 3FKIJ 2IA4A 2Z8EA 2OWSA 3IB0A 3H4ZA 4YICA 1GTKA 2ELKA 3IH3A 3QQAA 3OO7A 4FORA 2DQVA 1FTKA 3DLNA 3ZS6A 1WCMJ 2E19A 3C9HA 4MBPA 5I57B 1GVDA 2ZNSA 1WH7A 4JSDA 5KDTB 1US4A 4F3BA 1S50A 4P11A 4FE8A 3HEFA 2CU7A 4YAHX 5I56B 1URSA 4C3IJ 2GH9A 3BR1A 2OK2A 5CC2A 1SFOJ 5E3OA 1ETXA 3MJNA 4DYQA 1B1HA 4S0HB 3LSPA 3ZQIA 4ZEDA 2REJA 2TRTA 3IOVA 4NE4A 1MBGA 2XXWA 3G3FA 3PPQA 1MH3A 4KYSA 4DLDA 3HOXJ 1Z77A 2Q8JA 1ZTRA 4QSDA 3S4UA 3B6WA 4M3BA 1GV5A 4OFLA 1MPCA 2RCAA 3SKPA 3L1PA 5M2VA 5JLWA 3PV0E 2H99A 3TP0A 3FVOA 1K83J 2DA2A 1IRZA 2OJTA 3K7AJ 3SDGA 2DA4A 4ABZA 1JUMA 3IOWA 1Y3QA 5IKBA 5H8FB 1XC1A 3H6WA 2H5YA 4R75A 3G3GA 1BIYA 2XX7A 2CZLA 3R26A 1NNPA 2EZKA 2XPWA 3KG2A 4F3PA 4A3EJ 4KPTA 2ECCA 1QW0A 2RKMA 1B51A 1R9QA 5ICQA 3N6TA 1PEBA 4KHZE 3UP9A 1LE8B 5B7DA 1M5CA 3MZBA 2HXOA 1Y3PA 1B5IA 1N7XA 4LVQA 3K1MA 1IDYA 3V89B 1CB6A 4C3JJ 4H8IA 3IH4A 3P7IA 4R74A 1PBQA 5F1JA 4HS7A 5ITOA 3TTNA 4A3JJ 5J1UA 3FASA 4ELPA 4F22A 5I57A 3JRIA 4QF9A 5KDTA 4ELRA 5IYBJ 1QJMA 2LAOA 4KYEA 3W9VA 2D5VA 4X1EA 4ZZAA 1MQDA 5I56A 5I2KB 5L8DA 1IXIA 4BY7J 3BTIA 4TQUQ 5CBRA 2MG4A 2R5YA 4A3LJ 2I0CA 5I2NB 5F0FA 1Z7ME 5IYCJ 4RK2A 2L9RA 3B6QA 5HBCA 5M5XJ 1MBKA 4A3IJ 4F2QA 4N07A 3HPIA 3IX1A 2XGCA 4RXLA 4MO7A 2FA7A 1B4HA 3W9WA 3TP3A 3MKLA 1RKWA 2OLBA 1MPDA 4PFTA 3RUMA 2KDZA 1A8EA 3HB9A 2V3UA 3ZKLA 1FTOA 1FW0A 3FVGA 2IEEA 1DTZA 1MXZA 4ZEBA 3PPPA 2DA3A 2O68A 4OXVA 1XG1A 3MVZA 3C34A 3DP8A 3FK6A 2ABHA 3GBBA 1NNFA 2EQRA 3KN3A 1E3OC 1P1UA 4F39A 2F8DA 2EZIA 1SVXB 1R9TJ 1MY0A 1I6QA 3UK4A 4GF8A 3FISA 2XD3A 2VD2A 3JRCA 3OSRA 3JREA 1LE8A 5H8SA 3G1MA 2N8GA 1Z0XA 2NOOA 1VF9A 5E3NA 2L7ZA 3G1OA 1Y1ZA 4XIGQ 3FV1A 2G29A 4AQ4A 4QIWN 4A3GJ 1SYIA 3E13X 3KSJA 1B52A 3F0CA 4GFBA 3PD8A 2QCOA 1TWHJ 2P1SA 1LFHA 2ALUA 3KZGA 3TTMA 1B5JA 4PFWA 3L6GA 1BTJA 1RYXA 2Y84A 1F43A 2XXTA 2O7IA 3Q27A 3FGSA 4XICA 2JA7J 4EDPA 3KN8A 1LB8A 1MDP1 4JX5A 1LCTA 1U8BA 3VVDA 1Z7NE 3B6AA 3ZQCA 2XXHA 4LZ8A 5I2NA 1AOVA 3TPAA 3CFXA 2XPVA 4F31B 2E2HJ 4H0WA 3FV2A 3S16J 4BKXA 1J1NA 4G2ZA 2DOJA 3RZOJ 1R9LA 2X48A 1BLFA 3CG3A 3N94A 2F7CA 1SW5A 5AE4A 1D9VA 4OEVA 2MGQA 2REGA 1QUIA 3V5AA 4LQ5A 3NAUA 4GXSB 4JWOA 4R72A 3TYHA 1SI1A 1UIUA 1N76A 1IDZA 4LZ5A 4Y7NJ 1NH7A 5EZHA 2UYEA 3K1PA 3K6UA 1N7WA 1XOCA 4GL0A 3S1MJ 4XKRA 1LFUP 1B3EA 1JUSA 1FEXA 1O64A 2VOZA 1JW4A 1ENHA 5TP9B 1TWAJ 1OQGA 4L17A 3U72A 3FIRA 4LONB 4YU0A 4RDUA 5J1RA 4D5CA 1L5TA 3U94A 5L9OA 1M5EA 2V3QA 2JK3A 1JQFA 2F5XA 2NVXJ 3S9LC 3BR2A 3S2VA 1B58A 3T9VA 3K6WA 2CJJA 1AKHB 1MXUA 5BNGA 3ZQFA 1SDXA 3VVEA 1PB8A 1RPWA 3K4UA 4R9GA 1M5BA 1D4NA 4W1UA 4IO2A 1BP5A 2A5TA 1I6AA 2Q2AA 1T33A 4IY5A
chains in the Genus database with same CATH superfamily
2RCBA 3ZKKA 3M7GA 1FPLA 1LAFE 2AQFA 2R3SA 3QOPA 4I01A 3E78A 3NEUA 3MZ9A 2GQQA 2HVSA 3A3CA 3F23A 2DWJA 1QULA 4WEDA 4LGWA 3PD9A 5E79C 3G3JA 3M07A 1ZRFA 2RAEA 2X26A 2BW3B 1XSXA 3KP7A 4NB5A 3G7WA 4EEFG 5IZ1A 1QRYA 2LKSA 2K4BA 4ZDOA 3M3LA 4BDMA 5LDZA 5LFAA 1FQFA 1MIJA 1ZLQA 4ANJA 1U78A 2QF7A 4AB6A 2WV1A 3HM5A 3IC7A 2NVTJ 1H76A 1LLSA 2XXXA 3WHCA 4UUSB 3HOZJ 2M34A 1RRJA 1MJBA 4XTCQ 3OSGA 4EJVA 3DLAA 4L0YB 2X1CA 4ELQA 2ECBA 2XRLA 2F36A 2UYEA 3H03A 3PFYA 1S9TA 2I4CA 2NVQJ 1ODDA 2GHAA 2V84A 3I3VA 3JRDA 3TODA 1PJRA 2ZFUA 3VSKA 5FHMA 4BGDA 2DMTA 2ME6A 2OWTA 5CVRA 1Y4CA 3H6UA 2WA0A 4M3EA 2Y9ZA 3B6CA 2Q2EA 4CDGA 2B63J 3GTOJ 4BEHA 5LD2C 1O7TA 3DKXA 3M3KA 5FRNA 3FIWA 3HKZN 1MS7A 4R6YA 1W5SA 4XONA 4C9YA 1CF7B 2OCUA 5EHMA 4NMYA 4JSOA 4YFNF 1B3HA 2DA6A 1WJDA 2DJNA 2XWKA 3P9CA 4PJ0C 3OELA 4LUBA 1B7UA 4PJJA 5CQEA 4PC9A 1OISA 2AHQA 2V6CA 2WAQN 4D9JA 2RNGA 3H3UA 1TFAA 2IAIA 1W0TA 2GHBA 4WF2A 2M4GA 3HRTA 5FKLA 3G6EI 1DSNA 3CCYA 2MH2A 4OVJA 3BZKA 5KAFC 2Z8FA 3DV8A 5EEAA 3KGCA 4CYDA 4QXDA 1P92A 3BJOA 5BUUA 1L3LA 2DCEA 1OVBA 3W6VA 1DPEA 1EU8A 1KA0A 2W85A 1FPJA 2XXRA 2QWWA 4E7HA 2F34A 2LD5A 4CYCB 1YJ9I 3L2QA 3BBRA 4YB6A 2DDAA 2WB1N 4PJNA 1B9MA 3BWGA 1X1AA 3ZP5A 4Y13A 3DTIA 1YFHA 4OEUA 4OZ9A 1QPMA 2JPCA 5IPAA 2R71A 2O69A 1WI3A 2BXYA 5F0HA 3K2DA 4P1WA 4AS4A 1XD7A 5JEIA 2FXAA 2GA1A 2NRAC 1VQ6I 2I48A 1FZPB 3GBGA 5AA2B 2L9NA 2H8RA 1UJ8A 5D6EA 4U87A 4I8CA 4OMZA 3CUQB 1MNDA 2LKXA 2OQGA 4ENJA 1OLCA 5EYGA 4M4GA 4NC6A 4A5MA 4BNCA 3LUZA 1BW6A 4XLAA 4QSHA 1DOTA 2IGKA 1PBPA 2DA5A 2DOFA 1BW5A 4U1ZA 4PJLA 3KCCA 4A3KJ 3PU5A 1USYE 3FV1A 4RA1A 1OLTA 4EJOA 2XA5A 4PJMA 1USTA 3BPXA 4OYVA 2PMUA 2H25A 1RKTA 2VQLA 2RC7A 4RAFA 1UIVA 2XAGA 1MNMC 4IHVA 1EYJA 3UIFA 1BI0A 4YB7A 5JFRA 4XK4A 5TISC 1AHDP 1PUEE 2X6YA 4M6YA 3P9IA 4IJAA 3FX3A 4OVRA 2DVCA 4KFQA 1WJCA 2O0YA 5F27A 4EVIA 2FJ1A 1IIWA 3GWZA 1ZJLA 3KYLA 2F35A 3TEPA 3I0TA 5DT6A 3TCFA 3ECRA 2HQAA 1XCBA 2H94A 1QQIA 3BJAA 4CCOA 3H0GJ 4MFDA 3OIOA 1Q1VA 1TC3C 4FEDA 4E0WA 2ETHA 3MEXA 3BZCA 3QYEA 1J59A 1B40A 4MQVA 2HAVA 5FTIA 2R7UA 3TFLA 1AIVA 2VJJA 2WY7Q 2EFOA 3CFLA 1QU3A 1XB4A 3ABTA 1P4XA 4NF8A 4NC7A 1SAUA 3D4GA 3S3MA 3MAMA 3ODBA 4N81A 3RYDA 3TTRA 1F9NA 3DQVC 1JXSA 3AL0C 4LFUA 2P3NA 2DWHA 2V25A 4JBAA 4HZFA 2BW3A 3T5XA 4BAYA 4NF0A 2E1MB 3K69A 2EB7A 1YJNI 3IAM2 3M8UA 3U92A 2X1EA 5E18F 3KYDB 4G7ZF 2F6PA 2MKZA 1R1TA 4FETA 4JOMA 2O1LA 3CRBA 3QAXA 1UFMA 2DTZA 2QQ9A 5F7VA 1FP1D 5LTCA 3MZYA 4YMAA 2OTLI 3W15C 1YW9A 3TKYA 3ZOBA 4PSWA 1MM6A 3PIOF 3RCOA 5FKKA 5GP9A 4AM3A 4OU0A 2HPMA 2KT0A 4QHQA 1T38A 2ID3A 2JN6A 1FIPA 3IHUA 1S7YA 4GWXA 2I3VA 2GIZA 2ZNTA 2H4IA 1G3SA 1TQMA 3K6XA 2R6GE 2HHMA 4JXIA 2THIA 2DK8A 1CF7A 1ORKA 3V8XB 4F29A 3BR3A 2IW5A 3C31A 2RC4A 5FKMA 5HNFA 3O6BB 3OL4A 4UVBA 1KQ8A 4N6PA 1N0TA 1JVYA 2JSCA 1KA1A 1BM9A 3BFTA 2O7UA 4KIBA 3K6VA 4QSCA 3CCUI 3NWTA 4RGXA 1Z9CA 4F1UA 4MAGA 1AA7A 1FY7A 2L01A 3CJQB 3CESA 1VQNI 1UQWA 3OEMA 5AA1A 3K4KA 4GVOA 1OPCA 1SVMA 2E35A 5HDKA 3VE1B 1OMPA 1WVJA 4TV7A 1NNTA 1VQ7I 4GXAA 3H3VK 4R1HA 3N97A 2DDKA 3SEYA 3MKZA 4BQOA 1HW2A 2EBIA 1ELJA 2Z23A 1S72I 1UTBB 4GBVA 2B4MA 3K2AA 3DKWA 4E6KG 4S04A 5DVFA 1MMNA 2MBFA 5ET8A 5KZTA 1A55A 4ECFA 5K1YA 3F72A 5ELVA 1G3YA 1NMUA 5DVIA 2LP0A 3HHGA 1TFDA 2Z8DA 1RESA 4JYKA 3GZNB 1FOKA 1SW4A 4HX8A 2K3FA 2VXZA 4W97A 1ZQ3P 2I3WA 2Y7IA 5CI5A 5AA2A 3T9XB 2AIXA 2W48A 1JVXA 3LC8A 3CUQA 5ESYA 5KCJA 1AOYA 4HNUA 1WQ2A 4C2MJ 2UYFA 3TO9A 5DYMA 1N3XA 1OYYA 2XF5A 4RAGA 2DI3A 2W1OA 3BJ6A 4Q0CA 1WFXA 1W5TA 2E5NA 3FZVA 4NQWB 3B02A 4RGUA 2LYCA 3WTTC 3K4JA 4XRSA 1DQUA 3EKIA 4XKNA 5FLMJ 2HCAA 1S7AA 2VPOA 3KEQA 1ZH5A 1PDAA 4OOIA 3VDFA 5DYHA 5TPAB 1QZEA 3GZ5A 2XPUA 2CYYA 3RPUD 2L5VA 4PZJA 4UUVA 3MCZA 3GZ6A 4BXXJ 4NTLA 5FHNA 2I4BA 3MP1A 3E79A 2HZKA 1LPQA 5JR3A 2WBBA 3C4MA 5EYFA 4JVIA 3FHNA 1HLVA 4A5NA 2K5CA 2DFIA 1OJLA 4PFUA 3CDIA 3ECOA 1IXHA 1HKTA 4DI4B 1DCUA 3O3KA 3JTGA 1JT0A 2V1XA 3LSFB 1B3LA 1HQCA 2HXIA 2MLGA 2P81A 5CVVA 2UVIA 1E2XA 3FBNB 2DWAA 4RK9A 2GFEA 2CV2A 2NS0A 2V6EA 1LUJB 1OCCH 2XKOA 2BY1A 3CIJA 3S1RJ 4JQFA 3CZ6A 5LHHA 2R5YB 1B8IA 1B6AA 2WY8Q 3J81Z 1GVCA 2VKVA 2JMWA 3IRRA 3C32A 3MPLA 2K27A 1U9NA 1AWCA 4OHNA 3DBLB 3J7YJ 3N5LA 5DS9A 3IL2A 2MW8A 4UHTA 2DK5A 2DE2A 3CVGA 3GW2A 4HXVA 4X48A 4GGGA 4PAKA 4HNTA 1X1DA 1FIAA 4M6VA 4WXCA 3OR2C 5CVUA 4U7BA 4KJZA 1MQGA 4OWDA 1I6HJ 5FHOA 3FBIB 1FBGA 1YS7A 1RZ4A 1HF0A 2HVQA 5HDNA 4GIZA 1Y8RB 1R5ID 3D4CA 2STWA 1HSLA 2H09A 2WKYA 2Z33A 1YZ0A 1MD0A 2FQ4A 3J81K 2FYIA 2ONKE 3SHFA 2ANJA 4E7ZA 1FC3A 3V8LA 3ZMUA 3KPHA 1V5EA 4AVZA 2Y7RA 3OYHA 1BOAA 5GPAA 2TCTA 4HE2A 4Y17A 5FGMA 2OX3A 2GIVA 1Z6TA 2IEKA 1I3QJ 2H6CA 1URDA 1IF1A 1X3ZB 4EF1A 3BQYA 3K0VA 3DEEA 5I5PA 1OMIA 2KRFA 5E1XA 3K6GA 5DV5A 3GTGJ 3ZMSA 1FQBA 2XXIA 1S3JA 1SD6A 1NNKA 1FNNA 4NWCA 3HOWJ 3V83A 2P7CB 3OV8A 1ZGAA 2DYSH 3DWLE 4NUBA 3VPRA 3RI4A 2XHDA 2KR0A 1J7KA 1QUKA 3VXCA 1EH3A 1ZYRF 3K70D 3N4MA 2YU9J 2IS2A 2PMSA 3ZMZA 3CSBA 3SEUA 3NWSA 4N6KA 2A61A 1FBPA 3F22A 3ILTB 3PNTA 4I0BA 3CTAA 3DEUA 4JX4A 4M3DA 3GTJJ 2IT0A 3DU5A 1LAXA 3GXAA 3TTKA 4F3SA 2Z16A 3ELKA 2EFPA 3QPHA 2HR3A 1YRNA 4CZZA 2M2EA 4BDZA 1B72B 2JA8J 2ZSIB 4XFEA 5DTBA 3MKYB 4FATA 3VYUB 4OMYA 3EETA 1D5YA 1Z7UA 1LVKA 2NOJB 5H6RA 5CRYA 1ZRCA 1W7PB 4GCVA 4Q48A 2O9LA 5CMMA 3FMSA 1UTBA 3RQ4A 1WHUA 1SI0A 4PUSA 3QYFA 2F7AA 2HDDA 3GYYA 3HYIA 1URGA 2E60A 2P3VA 3WTUC 2DPUA 5ITPA 1SAXA 2M3AA 3BPVA 4UUTA 5L9SA 2R7WA 2Y7WA 2F5EA 3RPUA 4DZPA 3MBPA 4GD5A 1ZBMA 1MMDA 3I59B 3GO5A 2Q89A 2XAQA 4R72A 3QODA 5F24A 1LFBA 4ETSA 1SFKA 3I71A 4LOCA 1W7PD 4QTRA 1M5DA 4MX6A 3T1BA 1BC8C 2Y30A 4NQWA 4EJWA 2VLAA 2VC1A 3C3WA 1FTAA 1EF4A 4J01A 1R6RA 1D0YA 1PVEA 1H89C 4BXUA 2AO9A 1X1BA 1QBJA 2I0BA 3F8BA 5TPAA 3LA7A 1U9OA 3IH2A 4FASD 5KNLA 3OYBA 4RBOA 3SZPA 1T0FA 1QZYA 1NK2P 1POTA 1UG2A 3I58A 2MA3A 3GX4X 3EPZA 4XN3A 3ZPLA 1P6RA 2KIMA 2Y9YA 4RAYA 3U2RA 4XKWA 5LRRA 1YITI 2HFBA 4HE1A 5H8NA 5ICTA 2GQ1A 2E5ZA 4AU7A 3I55I 3TKDA 1JTYA 2DMNA 1K6OA 2MH9A 1POGA 3RZDJ 4M1VA 4Q5SF 3KOSA 3LSGA 3K9TA 3MWMA 2KPMA 1FPGA 1FSEA 2XAFA 2R7XA 5E3MA 4UA8A 4DCYA 2LG4A 1VI0A 2OBPA 1AWBA 2OAZA 3FJGA 5L3EA 1N25A 2XGDA 3A0HC 1JHFA 2YS9A 2UVJA 2X6OA 3MD2A 5JHUA 2FA5A 3OYIA 4IGRA 3E97A 3BTCA 2HDWA 4HX7A 4XSXF 1XMXA 4I02A 3WAEA 1VQLI 3CLOA 4IL6C 3HGYA 3X2QH 5ET5A 3G3KA 2HYFA 4Q4ZF 3WE3A 2CWEA 3OS1A 3A3UA 1XGSA 4IXAA 1CGPA 2QBYB 2Z2SB 2FOWA 3CP2A 3O9PA 2WTEA 1A04A 2XHKA 4OINF 1GVJA 2NVUB 3H1CA 3CCRI 1JKQC 1TXFA 5DEQA 4LP2B 5T3JA 5CMKA 3QYTA 3LQRA 1NI9A 2QQBA 5H6QA 4KR5A 2M7BA 2Q74A 3KEIA 3FK7A 2OF7A 4A3DJ 3U93A 2OU2A 4PAFA 4DE8A 1UTHB 2VT2A 1BIBA 1XSDA 1ZRDA 4F52A 2OZZA 1LDJA 4JBZA 4DZJA 5K2XA 2DTRA 4DYRA 4DXBA 2M30A 3WAFA 4Y33A 4R2FA 1DPUA 3OO9A 1WSUA 1LB2A 1FBFA 1GGGA 3OIPA 1UCRA 2QJEA 3L2UA 4Q5TA 4XKCA 4Z6YA 2AS5F 3SFIA 4C2UA 3A2KA 2QL3A 2LLKA 4I1DA 2ZO4A 4P56A 1IN8A 3KZIC 3T66A 4FTHA 1I50J 3H9GA 4FCYA 1I6BA 2LH9A 3M3YJ 4LZ7A 1RDZA 3CSGA 2DP8A 2XB0X 2XDVA 2KZGA 1MG1A 1JW1A 2Y2ZA 5CBSA 2PFBA 3DFGA 4U0YA 2HOEA 4M9XA 2OC6A 2WC2A 1H9TA 2FD5A 4A3FJ 1LB9A 1LBCA 3U1KA 3RYPA 3WHBA 4AIHA 2HAUA 2I58A 3VV5A 4IOAF 2CUEA 3KOTA 3AG2H 1JHHA 1DPPA 3ONQA 5L3BA 3HRMA 4F1YA 3A03A 5JTYB 3GLBA 1MDMA 2FF4A 4QLCU 1HW1A 3HKZA 1SD4A 2XF6A 4IHWA 3AL0B 3JRFA 3IB1A 1YCJA 4RM3A 1MBHA 3HRUA 3LSJA 3JRBA 3HSEA 4NNJA 3VDXA 1B72A 2EJRA 2DPDA 2K85A 2M8EA 3GCMA 1JEUA 3ZN1A 3ROJA 3SEXA 4ITVA 2WAQA 2KIUA 1WWXA 2L4AA 2RDPA 2COMA 3ABUA 3MPKA 4ZE8A 3TDJA 2UXXA 1FPBA 2JJ7A 5LRSA 1W7PA 2DA7A 1T8IA 4H8JA 3RKYA 4NF6B 5K2YA 1I1GA 4IHYA 2BHYA 3QAHA 4UB6C 2KDOA 3LSHA 3EYIA 3UORA 4OESA 1FCKA 1QVUA 3MP6A 3NRVA 4PBHA 5H8HB 1N77A 4EQ9A 3S9NC 1T0KA 1C0WA 2CS3A 3PO3J 3VODA 1LAHE 1USYH 3LV0A 4IO6A 4RLQA 2WADA 3TMOA 2XD2A 1AL3A 4PCDA 3OENA 5DUIA 4CZCA 4KMFA 4M3FA 2HKXA 2UXNA 3S3NA 3EUHC 2UWMA 2WB1A 4IQ4A 2BY0A 4L5JA 4CXFA 1NV3A 2A5TB 3FKJA 2IS6A 2R7VA 1RETA 3ONMA 5IZ3A 3KFMA 4PTKA 2R7DA 2IP2A 2XB5A 1WGXA 2ADUA 3AG4H 3DCFA 4RM2A 5GPCA 3GTPJ 1F1ZA 1WJ5A 4H4KC 4XL9A 3H3GA 5ICGA 2EIMH 4X0GA 1AMFA 3G3HA 3L7WA 4H65A 3BG6A 2ZJRF 4K3FA 3CQZJ 3PQJA 1NV2A 4GX4A 1R6ZA 2M8CA 5IT3A 2HNHA 4OERA 4RB2C 2PN6A 1A7LA 4DXUA 4KDPA 5B7DA 1FOYA 4ZDLA 3KP2A 2XVCA 1HXDA 2K9LA 2V26A 5AA3A 1QVTA 5BQTA 1XX5A 2VPNA 3H3ZA 2HOTA 2RNJA 1NV0A 4IY6A 2G0EA 1K9ZA 2UVHA 4FX4A 1FYMA 5ICEA 4I3EA 4ASNA 1FQEA 2DAOA 1HOMA 3CR9A 3UGWA 5CPRB 5J6XA 4Z2YA 1P1NA 4GDFA 1EJ9A 4MLVA 2A07F 1KGSA 2W7NA 5EDNA 3QU3A 5IOYA 3HPGA 1RIOH 2I5UA 3MP8A 3T22A 4B43A 2Q2EB 4IRGA 4A6EA 3Q26A 3DPLC 1WVRA 3BT9A 3BG5A 4RNSA 3RQTA 1MQJA 4M9ZA 4PGGA 3Q25A 1U8RA 4IX7A 4EM0B 5IM2A 3ERED 4GWUA 4N4NB 1BJZA 1DMBA 2F6GA 3BQZA 4Q8RA 1BI1A 2BHZA 3SETA 3SEWA 2R7RA 3HO7A 2XIGA 2LFBA 1XN7A 4FJPA 3FXUA 3IKTA 1XPXA 2I6EA 2Q8MA 4ISUA 4BJ5C 1UTHA 2Q2CA 2DLLA 3L09A 1FQCA 2V9PA 1LBYA 2V4CA 2CZKA 4XMYA 4BDLA 2E1OA 1FBCA 4XORA 5LGTA 1R7JA 3BKIB 3H0DA 4X6AJ 2MC3A 2FU4A 3UA8A 1MJAA 4KHZE 4P1LA 4ZDPA 3HOYJ 2TDXA 3FJ7A 2Q9TA 2IGOA 4ONYA 3M8EA 1IN6A 4KIGA 1Q1HA 4O3CA 1B9NA 4Y3OA 4EJTA 3IAZA 4GO1A 1LAGE 4C0RA 2ZYKA 2Y0SN 2I10A 1Y4TA 1BI3A 4U0VA 3KEYA 3KSXA 1R71A 1YAEA 3G1LA 1R1UA 3ESWB 3EUAA 3E6CC 2IGNA 4GOTA 1HSEA 5H8QB 5BPIA 2R92J 4D5FA 5JTYA 3W3CA 1FPQA 4ESBA 3U9GA 1LFGA 4U7DA 3FHZA 2X1DA 2GRVA 4U88A 1BR2A 3OS2A 4IGTA 4RMNA 2LNBA 3VXBA 2GLOA 3KFWX 4A6DA 2XXQA 4N13A 3R7XA 4AWXB 2FOKA 4YKKA 3A4CA 3KP3A 4GWZA 1FTJA 2Q88A 4NF6A 4GX3A 2X7QA 4IHTA 3ZQ7A 3PIPF 4Y52J 5HLGA 1AU7A 1YPNA 5E17F 4KT5C 5H8HA 2DXRA 4BE0A 2XX9A 1P7IA 1SQYA 3TZAA 4X1DA 4N8GA 4JWYA 1ATGA 1V5GA 3BFUA 4MTDA 2F4MB 4WCGA 3U1DA 1X4OA 3MKWB 1PEBA 1B1XA 2IS4A 4LA9A 4M3GA 2H8WA 2CUFA 5ILVA 3QXMA 5A5LA 4V2GA 1DK4A 2JVHA 1OYWA 4GRIA 4A12A 1Y1WJ 4IRHA 2Y5LA 2F3DA 1IUFA 2HPIA 4NF8B 4HV5A 1ITYA 3I3LA 2P0SA 2P4WA 3RKQA 1XMAA 4GBWA 3MZHA 3Q5FA 3EQ1A 2VASA 4RY1A 3QUFA 2KIQA 3HCQA 3IWFA 3QUJA 2DMQA 2PMZN 4BJTA 1FSAA 4OETA 1REPC 2E34A 5K7ZA 2CW7A 2LK2A 2R5ZB 2GOXB 4BBSJ 3FXQA 2L02A 4LQ2A 4G94A 4XNFA 1ZREA 2JQ7A 2VP1A 4U4SA 3AXFA 5M5WJ 4X1BA 1R00A 2YU3A 5J4VA 3NARA 4D1QA 3HOVJ 5DVJA 4BDQA 1BJAA 1KZ8A 3VVFA 3VLUA 1SANA 1MY2A 4KMUX 1Z1DA 1IEJA 3IOUA 2K9SA 5K5RA 4ZH4F 1MJ9A 5EQ8A 2R7QA 1FX7A 2ESNA 3CHGA 2PT2A 2Z5UA 1D1CA 1II5A 1MXVA 2OZ6A 1JTXA 5I84A 1MBJA 2ZMEA 4LMYA 1YO5C 2XKPA 3IO6A 2EINH 2P5KA 3CF5F 2K9MA 3RTWB 4N8YA 4PFPA 4MFEA 2QS3A 2A6HF 1UHSA 1L0OC 1X2NA 2OPTA 3MVPA 2QEXI 2D5WA 3MQ0A 3WGIA 3FM3A 3A09A 2X9DA 3FXKA 4LATA 1FT9A 2PG4A 4P0GA 5JLXA 3HC7A 2HI3A 3PSIA 3TOAA 4ZZLA 3CMYA 4XRFA 1H8AC 2ZC2A 2HEOA 3GTLJ 3PTYA 3N05A 3OYLA 5BPDA 3TDZC 5JHFA 1I69A 1GR2A 3LUYA 4H67A 4OTEA 1KA8A 2IGMA 2UZKA 3M8JA 4FE4A 1HSTA 3H7MA 1KU7A 4R6KA 1LJ9A 3GLLA 3L2WA 2GM4A 1NUZA 3Q9SA 2RVCA 3QP6A 4G12A 2PEXA 1UAAA 3PUWE 1ZLJA 1OFCX 2DMUA 2Q8KA 3I54A 1WPKA 2XSDC 2RQQA 3KIOA 2M45A 2YUSA 1ZR4A 1DDNA 3HJEA 4R73A 2LF8A 2CQKA 5IP9J 2XXPA 3MWBA 3RNNA 3V5AA 3UN6A 2JA5J 3M4OJ 2ZMBA 2M5WA 3EN3A 4A93J 1V55H 4IO7A 2NS7A 3S3OA 5ET6A 4ESWA 1TQIA 3WTSC 4A3BJ 2HU9A 3H5AA 4UVAA 1ON1A 3V8KA 4EM1A 1FWZA 2IA1A 3M1EA 4M73A 1UMQA 4U0WA 3RTRA 3S14J 2VJ5A 3FMRA 5KCJB 2NWJA 1Z6RA 2JA6J 3LSXA 5H8QA 5HNHA 4KN7X 2P6TA 1TBXA 1O4XA 2HYGD 1A99A 5HPQA 4IPAA 2YSRA 3SEVA 2KQZA 4HQMA 3H6TA 1PP8F 1U6GA 2AXLA 1BK4A 1VSOA 3PMVA 3HSTA 3T93B 4PDDA 5IYDJ 4NHJA 2EWNA 3E0JB 1V5FA 1J9IA 2BJIA 5AA2D 4BDOA 2LDUA 2DDBA 3E5QA 2P5VA 2G7UA 2Y75A 2CMOA 3C35A 3AAFA 2KZVA 2K9QA 3OS0A 3RKWA 4ZEKA 2HQ5A 5I58B 2QPQA 1OQYA 2OA4A 1Y9UA 1XGOA 5EYRA 2EZHA 2XV4S 2D3IA 3C18A 4H1XA 5CLSA 1DU0A 1RNLA 2CFXA 3TO7A 5DDGA 2B9SA 1TNTA 1EH6A 1RR7A 3RPWA 4YKPA 1GV8A 1B8IB 2DS9A 2D45A 1P1WA 4DZ1A 2F3BA 1XTAA 2XGEA 1CNQA 1FJ6A 1P1QA 2WV0A 1X1CA 1IV8A 1SYHA 4G8NA 2O84X 3COAC 2BZTA 3OMYA 3WGGA 1CE2A 4H5FA 3K01A 5F08A 3RTFB 1TNSA 1WKMA 1LEBA 4XIDA 2VPRA 3DPTA 1B32A 1Q9DA 3O29A 1RC9A 4EXLA 3FXJA 2H98A 3G3IA 4E4HA 1HC8A 1IXCA 3BDDA 3OYGA 1BKAA 4CCMA 2R5ZA 2E2JJ 4BS9A 3TQNA 3I4NJ 2QRYA 4XEQA 4LITA 4ZS9A 3U1OA 4MIMA 1N84A 2E2IJ 5LLQA 2OTJI 4E70A 1DU6A 2XF7A 3OYMA 1FRPA 3S9MC 3K4CA 5E1WA 2Z9OA 2R7OA 3CI8A 1QGPA 2QENA 2PMHA 2RREA 3BCAA 4XOTA 4CCLA 4DBRA 2XUBA 2M9HA 3Q9VA 5IOZA 4YFKF 1A6QA 3DP4A 3TQLA 4KT6A 2NS8A 4P9KA 3SXYA 4MIJA 3E5UA 3KC0A 2NOGA 3TDUC 2V1NA 2PLYA 2P8TA 3C33A 2R4GA 4LLNA 1LBXA 3TQWA 2B7EA 1MXXA 1FLIA 1MBFA 4JVDA 3I4MJ 1S9HA 4RGRA 2O5RA 1LDKB 1NV7A 3R4KA 2BGCA 2BY2A 3ERMA 1MXWA 3WTWC 2ZYMA 1FBEA 3CJRB 3F6OA 3RYRA 2QZ8A 3MAJA 4U22A 2DT7B 3N6UA 1IITA 1G2HA 3S2HJ 1SBPA 3JTHA 2E7WA 1TW2A 3KP4A 4EV0A 2A05A 2YJPA 5F1QA 1FBQA 2X6WA 5ERIA 1N75A 5F04A 3C1DA 1YRNB 4BU2A 3L2RA 2VBXA 3H36A 1OCTC 3S93A 3PNYA 3K4NA 2E71A 5J8CA 1XGNA 4MEYF 2LC2A 1FOWA 3F9KA 3V7SA 4IQJA 2DSFA 2R9JA 3KBZA 4CA0A 2JUCA 4MHGA 1QKAA 2GXGA 3B6TA 3TOBA 1R1VA 3HOTA 4A0XA 4Z7EA 1EZPA 2CUZA 1KQ9A 3M9AA 2QYOA 1IUDA 4EQ7A 3JR9A 1D9QA 1H88C 4V2FA 4ENMA 3CCVI 4M9SA 2NXOA 1JW5A 3O28A 4PE5B 1DBZA 1A54A 4BUPA 1LEVA 1HSJA 2ZMEC 4MEVA 3DM0A 2BV6A 3WGHA 2FX0A 1RR8C 1ZMGA 2HEUA 3TAJA 1FP2A 2RKHA 4QRZA 2BYVE 1LDDA 1T56A 2YR2A 2QQAA 4BL0B 1MQHA 4A2UA 3RT8A 4DIGA 1A40A 3K02A 2YPRA 3VYRB 3SJMA 1GT0C 2L0KA 1FMVA 1K61A 2JTVA 1E17A 4TLLB 5AA4A 2RGVA 4ENKA 4G8HA 1M5FA 5FLVA 3FXRA 1EZOA 3GXOA 2VKHA 3EHSA 1IMDA 3LSWA 1EYIA 1D8KA 4I9DA 3QIMA 4HRIA 5H8NB 3E6BA 4L5IA 4ZC3A 3J7AY 1KYZA 2G93A 1WODA 2EIKH 3VYTB 1QHGA 2ESHA 4HDUA 4NF5B 5I58A 4O3MA 5IAIA 4L0ZB 4LD5A 4M6XA 3H6VA 2VKDA 1S7EA 1W1WE 2CRGA 4PFOA 2CV1A 2CEXA 5LOMA 4ESFA 4QPOA 3D5RC 2ONSA 5DCMB 2HTJA 2D21A 4O3AA 2ME0A 3JSOA 4OENA 4I7HA 1MSEC 3CP8A 4QFNA 2DA1A 4NEDA 5IZZA 4IO3A 2CG4A 1QHHD 4RYAA 3CFZA 1X19A 3HOSA 5L9MA 4MEXF 4ZEFA 4HEA2 3B73A 4JK1X 4PE3A 3EPEA 4DDDA 4N4UA 3TCGA 4P47A 5GAEJ 3PUXE 4U2RA 3K1NA 4NGUA 4HW8A 4ELOA 2EPFA 1WJEA 2FE3A 3A01A 4ZEIA 2DYXA 1D1AA 4IZZA 1XS5A 1FPEA 4AIDA 1PB7A 3GTKJ 1MM7A 1VFDA 4PAIA 2W4SA 3HL2A 4FISA 1X2MA 4N4OB 5J4YA 3CC4I 1NV4A 1RDXA 5ISUA 4GWYA 1R22A 2Z1DA 3OYKA 2W7YA 5CYVA 1X3UA 3MW0A 3S32A 2QS1A 5H2FC 4Q47A 4D0PA 1ONVA 1Z7LA 4KQPA 1G4DA 3T96B 1X58A 3SFZA 3DU6A 4C1TA 3JAMZ 3HTUA 2DOAA 2FRHA 3I53A 3PL8A 3LSMA 3CCJI 4N91A 5F64A 2PJPA 4YKJA 4GYGA 3QK6A 4A0ZA 4NBQA 5EEHA 1SEUA 1IZ1A 3IB2A 1SFXA 3GTMJ 2WX9A 4XKPA 5BOXA 2H1LA 3OIQA 2VHAA 4YKIA 2IBDA 1PB9A 1W4MA 3RJPA 3RN8A 1ETWA 2L7FP 3LR1A 4P8BA 2CQQA 4UV9A 1ANFA 2L9SA 3EUHA 2NUVA 2M4KA 2L4MA 3RPLA 1WJFA 3CCQI 2K9NA 3KETA 1R4MB 4F93B 5DEXA 2V9VA 1O57A 1V4RA 2ZJ2A 4DOZA 1XT8A 3I5UA 2JRTA 5ICFA 1BA5A 2HQRA 1B5HA 3DP6A 4HCWA 4MH5A 4KYDA 4N15A 4BXFA 3JAMK 1KU9A 3JV9A 5IP7J 1MDMB 4OVTA 4WEPA 3S17J 2E1CA 2DQLA 3QP5A 4CH7A 1BN5A 1Y1MA 3BIHA 1MSFC 2PFYA 3L00A 3PUYE 1WDNA 4O94A 1A5JA 1MY3A 4I6ZA 3BTJA 4WXDA 4BQNA 1D3KA 3KZYA 4EF2A 3IJXB 1BOBA 4DI3D 3LA2A 3TGNA 4FX0A 1R58A 4BQAA 2FIXA 2M1BA 1NUYA 3HN0A 5A5XB 3BZ6A 1Y1VJ 4ESJA 3OYNA 4G68A 5CMBA 5FB2A 3EHUA 2PJRB 3Q0VA 2YPNA 4LK0F 1JI8A 2F2EA 4Y15A 3MYUA 4C2TA 1B2HA 1OCRH 3USDA 1VR5A 1SD7A 5L3FA 2F5CA 3FXLA 1JJ6C 2IXSA 1OIBA 1SW2A 2V7FA 3D1RA 4RPNA 3GYHX 2QMXA 3VLVA 3K4LA 3JRAA 4V19K 2ZXWH 4JWXA 4A69C 1D0ZA 1PC3A 1IN4A 2XXUA 1S29A 4C1UA 1KZHA 5IZ3B 1H3DA 1G8XA 2A3SA 4A3CJ 1XDSA 3D0SA 2H27A 2EZLA 4MLOA 5K7HA 1JUPA 2VKEA 3HXLA 2Y0SA 2VBWA 2IPQX 4HNVA 2HYJA 3IL1B 5HS9A 5F6FA 4GFRA 5M3MJ 1XGMA 3HBLA 4MTEA 1JGSA 2RC8A 4G9YA 2O6GE 2K40A 2XRNA 3VLWA 1LKXA 3RSNA 1Q35A 5B70A 4ZYEA 1VQ8I 4GXOA 3D5SC 1WJAA 3IO4A 1MZBA 2W57A 3TBIA 2GZWA 4AYBN 2OBGA 2EILH 2PI0A 2VQGA 3O8GA 5K7FA 3QPTA 2WAEA 3WE2A 4L18B 1JETA 1ZU0A 3QSLA 4FBPA 5CMCA 4IHXA 4KUMA 2X7PA 2HZLA 3QU6A 1IO2A 2ZYNA 1STZA 2CQXA 3SDFA 3H9JA 2L9VA 1FBSA 3BCBA 1QGXA 5FD6A 2AQEA 3ZGKA 1X1PA 5IT9Z 5DCMA 4N17A 3OYCA 5L3CA 3O8HA 5D8KB 5KVRA 1FQAA 1POY1 4POXA 5CKTA 4U4XA 1SW1A 4UABA 4AS5A 5HM4B 4OA4A 4G8MA 1MBEA 2O8KA 1H45A 2BJJX 3OO8A 3TW7A 5TU0A 3LAJA 2ZXTA 1R5HA 3ZSFA 9ANTA 3HUGB 3DELB 5JVGF 2AYSA 2Y31A 4DBQA 1K4SA 3J80Z 3EDPA 4FT8A 3S2DJ 4M74A 3ASNH 3MQ9A 4HTGA 2VJIA 1KWHA 4E7KA 2NVYJ 2CUJA 3E5XA 4XRMA 4LB6B 1E0EA 2HWVA 2Y7KA 2ZNUA 3HV1A 3CDHA 2LKPA 3JYRA 3A0BC 3OSQA 1SD3A 1O3RA 2KP6A 1JNFA 4NWDA 4TOZA 2EH3A 2FMLA 2PBIA 4J19A 5EQ7A 3C2HA 5IT9K 2FSWA 4FE7A 3F21A 4F2OA 4GQOA 2P6SA 1J2XA 1ETOA 1MMAA 3ZRGA 2L3DA 3G73A 5J1DA 4NDLA 5EG0B 3CJTB 4BH9A 4KIFA 1LFIA 1UELB 3F8NA 1XMKA 4EQBA 3IFAA 1R23A 2JRMA 2PMZA 4RB0A 3GFIA 4D7MA 1IJWC 2H9BA 3OO6A 2X4HA 2KQRA 1ZHFA 1Q1KA 1FTTA 3PQKA 3J80K 1PP7U 3SYTA 1MY4A 2ZZXA 3PUZE 5D5UB 4GWSA 1ZKBA 1NV5A 4ZTFA 5CQGA 1I6XA 5F1RA 3ZQQA 3IORA 1GXPA 2DMPA 1T2KA 2VT3A 5FKNA 2WWYA 2P5LC 2R7ZJ 1J0RA 2HPGA 5M5YJ 3MVYA 2WAFA 2QGUA 3R6UA 2DT6A 4XRSG 3LSRA 4OQOA 4ZE9A 2DBBA 3FXOA 5HS7A 4PF8A 4PSXA 4C30A 2LBFA 4HV6A 2F7BA 4ND9A 3FVKA 3CMMA 3C2BA 1EKEA 3V42A 2BOLA 1F36A 1APLC 1MGTA 1WI9A 2LVSA 3H92A 5CVIA 4L9JA 1OQHA 2HVRA 3Q29A 5BWJA 2DN0A 2HXWA 1BBYA 2KRCA 1XC5A 5GTHC 4G4PA 4NX1A 3TCHA 2MC4A 4QPQA 5H8FA 4ENNA 2VT5A 3OWTA 3QPLA 4JP0A 2C6YA 1O63A 3T0JA 2AXTC 2V9KA 3LNQA 2EFWA 4H5GA 5A5XA 4MNUA 5DW8A 2WYPA 4FECA 3BG3A 1NH8A 4Q30B 5D5XB 2I8DA 2PJRA 2QVRA 5I59B 3LA3A 2A5WA 1R49A 1IMBA 3IKVA 4ZECA 1SVLA 3I5OA 1HCRA 2YX7A 3KX2A 3CF2A 4WWCA 3O66A 3LFKA 1IC8A 2QA4I 1V3FA 4IVNA 2W82A 2F48A 3OD7A 3VOEA 3OMBA 3OYFA 4MNCA 2K4JA 4IEJA 5J40A 3G3ZA 4OWRB 4II3A 2STTA 3SERA 3P5JA 2ISYA 2XXYA 3MC2A 3S9EA 1NTCA 3IJOB 1ZN2A 2DVZA 2OD5A 3MUQA 5F0CA 2VONA 3PM1A 5LBQA 3H5RA 1T39A 1MXYA 2PQ8A 2HQ0A 5JK4A 2EIJH 4F3QA 5I7IA 5TGTA 3HHFA 2HS5A 3HSFA 4NF4B 2A5YB 1M1EB 1JT6A 2OCEA 1XI6A 2W24A 3G71I 3JRHA 4AVPA 2VOOA 3KN7A 1JJ8C 3LOCA 5GAGJ 3PJRA 5HDGA 2V93A 1ETQA 4MMPA 1XVXA 1YLFA 4HCYA 1Z05A 3B7DA 4OFOA 2J5OA 3Q28A 2QSXA 3FWEA 2O6AA 2VN2A 4UXNA 1INPA 3CG1A 3O2AA 4I76A 2VGQA 3TTLA 4CUGA 2LF7A 4PCQA 5C4XJ 4YB5A 4J00A 3E9XA 4B1RA 4F18A 4OIPF 4BDRA 3CCSI 1ZK8A 2DU9A 1FQDA 1I3AA 4G68C 4JB7A 4ZTJA 3FDYA 4P0IA 2ZXIA 3PUVE 2BBYA 3DP7A 5DTDA 1LNWA 2X51A 4G61A 3K0LA 3B50A 3AG1H 2E7XA 4XKBA 4THIA 3TMGA 4GYIA 3UR3C 1JKOC 1IAWA 3BIGA 2B3BA 2ZMEB 2R93J 2A6TA 3HUGA 3KP6A 3F11A 2X85A 2GOMA 2B0LA 2V79A 3WU0A 2ZNZA 1SMTA 3A02A 5EZGA 1EZ9A 2WEFA 1ZR2A 4EXKA 3L2CA 1Y20A 4KCDA 3PMXA 2H1KA 3JRGA 1ZG3A 2DXIA 3LBSA 5I2KA 1YTYA 1LBWA 2LTPA 3BR6A 4DYCA 2K7LA 3HPHA 3PFIA 3ML6A 1BC7C 4KI0E 4R2BA 2AL4A 5AA4B 2MLKA 5FD5A 5LGNA 4U21A 1IQ7A 4EUOA 1KU3A 1XS9A 1QZZA 2OQRA 1UHMA 4CGZA 3KC1A 3O97A 5KCMA 3D1NI 2F5VA 2I49A 1SD5A 4B3AA 3OR1C 3ZQHA 5EG0A 2A5SA 3EHTA 2BE5F 1VFEA 3CD6I 4OAYA 1R36A 4HLYA 2QMWA 4I3YA 5EF6A 1XVYA 1EA3A 1ETYA 2DE4A 4ON0A 3PUFA 3IV5A 1XSVA 1MDQA 4FQGA 3MVXA 1FJLA 1B3FA 1K78B 4DXCA 4PFYA 1YS6A 3OYEA 2LY1A 3LSLA 4E7JA 3EYYA 3RLFE 2GBYA 3KE2A 2K3PA 1BIAA 2V4JC 1HDPA 1BR4A 1N3WA 4LB5A 3CC2I 3PGFA 4DCXA 3DKYA 4EJUA 3CDLA 2Y69H 2O7OA 2E1SA 2ZNYA 4CHUA 1B4ZA 2BVLA 4O7IA 1D9YA 1LSTA 2G9WA 1VFCA 1U5TC 1NL5A 4DIQA 5CVJA 5J8FA 4HW0A 5GADJ 3KJTA 3AKZA 2V3TA 1SMYF 2RC9A 2P2AA 3CMEI 1VZ0A 3FATA 2HOAA 2IA2A 2E0SA 1P7JA 3HHHA 5FJ8J 1US5A 4IB2A 4RPOA 3ULQB 1VE4A 3S15J 4O3BA 2Z22A 4QSEA 2LOOA 3CUOA 3BR5A 2JA2A 3QPSA 4BYYA 1ACIA 4GLIA 4MHFA 2VI6A 1FYLA 2F78A 5I59A 1B05A 2W00A 3W2AA 1MRPA 1OLAA 1P99A 4I98B 4G77A 1TWCJ 4R6HA 1TWGJ 2BY3A 4MLQA 3TEDA 3T9UA 2PX1A 1JKPC 1UB9A 4G8XA 3LFUA 4IHSA 3MVWA 4H46A 4MF3A 3S1QJ 4JX6A 2R7SA 4H6DA 2VUMJ 1OVTA 4AB5A 5EEGA 5FFXA 1I27A 4O6JA 2OWZA 2VB6A 2W84A 3GUDA 3I64A 2EK5A 3ZQLA 4KD5A 4D7NA 3E6DA 4AIJA 3HZJA 3KJ7A 2GAUA 4LG3A 4HYEA 4PP0A 1TW3A 5HODA 3PMWA 2DW4A 2L5QA 3IUOA 2QVUA 4YZZA 4NF4A 2JWTA 3K70C 1KU2A 5DCFA 1Y3NA 2PYYA 5J1YA 4FIMA 1IN7A 4MGRA 3GZGA 4ZZEA 5E8GA 1SFUA 1P1OA 3KEOA 1VQMI 1RKMA 4P1EA 1TWFJ 1KONA 2ZB9A 1LVAA 3Q0WA 5D5WB 1NH3A 4NF5A 4PETA 1MQIA 4I62A 1PUFB 4H45A 3JCUC 2CH0A 2MYSA 2Q1ZB 4FEBA 1YOVB 1OCZH 2KIFA 3LQQA 2QVVA 1ETKA 2RINA 4N9IA 5C3EJ 3ZQGA 2DYRH 3E3KA 2F97A 4RJZA 2XWVA 1MH4A 2LY9A 2ONRA 3UP9A 5B66C 1TP4A 1H44A 1DPRA 2HGCA 3I6VA 1VQKI 2DE3A 4AC0A 2ELHA 3GFMA 2R0QC 3FUZA 5CM6A 2XXKA 2EFQA 4LJZF 1GHCA 3J7ZI 4DW6A 5C44J 2PT1A 1Z21A 2OJED 5LHGA 4B44A 2XGXA 1FPDA 3N26A 3PPRA 4HX4A 2VXDA 2DFFA 4L5EA 3UKGA 2F5DA 4QFOA 1NG6A 4ESXA 1F9BA 5GTIC 3K2ZA 3FJMA 1G3WA 2MFZA 1O3TA 3O6HA 3BOQA 3DPUA 5CJ9A 2FBPA 3IR1A 3FD3A 2B4LA 4R9FA 3THIA 3SESA 3V7RA 1VQOI 2AL5A 4M72A 4AD9A 3H35A 5B5EC 5TRDA 3LL7A 1P4AA 4L9TA 4R8HA 3U8QA 4X04A 2CV0A 1ON2A 3FM5A 3TUSA 3ROUA 3C36A 2LR8A 3VFJA 3E7LA 4RGSA 3PO2J 2Y7PA 2IVMA 1D3YA 1JKRC 4N9HA 2DO7A 4A3MJ 2FNCA 3OOAA 4CCKA 3RGYA 4BLAA 3LWFA 1QVSA 1I39A 1ZTYA 5J3LA 2VC0A 2M0MA 4HAMA 4KITB 4F3GA 1R1NA 3OXNA 4JDFA 3M3FA 4WK8F 1K6YA 3AG3H 4IO9F 1NFTA 4XF5A 4F19A 3HOUJ 4FAJA 1QPIA 2RQPA 4XKQA 4CO8A 5HLHA 1CQTA 1XHYA 1PYVA 1VQPI 1FTMA 2CW8A 1W36C 4XLFA 1K78A 3HFUA 3H06B 3DBRB 2QS4A 1FTZA 4JVCA 1BL0A 5EHSA 1D1BA 5EGOB 3ZCOA 4BDNA 3W6JB 1N04A 5IGAA 3O6IA 1B7HA 1PDNC 4LLLA 3HDDA 1TL8A 1IXRC 1MMSA 5M3FJ 5TJJA 4PGNA 4UV8A 3TELA 1GUUA 4C3HJ 1G0HA 1G0IA 1YHQI 3S1NJ 1GV2A 2QLZA 5IP6A 4B4CA 1P2FA 4DQ2A 2NYXA 2O1MA 3MSTA 4S05A 2B3FA 1JGGA 1GXQA 3GLXA 3MZ1A 4GWOA 5FTHA 4G6DA 1K4TA 3JW4A 3P7NA 2VQHA 3GBAA 3Q3SA 1IG7A 1B0LA 4F92B 2ZJPF 4GWWA 4U23A 2KL4A 2MSYA 3BTLA 4E7LA 4KCCA 1AH5A 3R60A 2PX9A 2OUMA 1W0UA 2A6EF 2QKMB 2XXVA 4IRIA 1A8FA 5FKOA 2DWIA 2HOSA 2DXYA 3O6GA 1A6IA 2V1UA 4BHBA 2JZYA 2D2WA 4OVQA 4WXJA 1G59A 2Y0MA 4KISA 2UVGA 4Y4RA 2DFHA 4ZZDA 3FVNA 2UUZA 2NXNB 4H0EA 5TP9A 3VSLA 2M0CA 2KLFA 2OV7A 2CSOA 2QS2A 2MD0A 2JSPA 3MZ8A 1J75A 3E4RA 1RUNA 1HKSA 1B4AA 4IO5A 4QWQA 1QUJA 4HDVA 1D5VA 2F5FA 2L7MP 4RA2A 2QM3A 3ABMH 4B3XA 1GDTA 2XWOA 2EFNA 1HKQA 1S8NA 4EQQA 3DEWA 4I99C 2RF1A 3RY3A 1YIJI 2UXAA 1T98A 4OFJA 1V54H 4CSWA 4XLEA 2P0WA 2B65A 2CO5A 4ZYAA 3U21A 2D1VA 3K00A 1DTGA 1I5ZA 1OYIA 2FNAA 3CCMI 3Q0UA 4YELA 3QWLA 2VJ4A 3VEPA 1AKHA 1A36A 4KYWA 3AFHA 1IGNA 3I9V2 1B0HA 1YG2A 1B6HA 4R79A 1KYWA 2D1HA 4RAZA 1F4KA 1FTLA 1IXSB 2CZIA 4UACA 4DJAA 1VQ5I 4OIOF 2RV8A 3JZJA 3F8MA 2F4OB 1ZKGA 3C2GA 4HG2A 2VBZA 3OY9A 4G7OF 4GL8A 3A01B 2EA4A 3HGGA 3W2VA 4XXUA 3FBPA 1PUFA 1YXIA 4BQQA 1MY1A 4LN5A 3MN2A 3GTQJ 4MNPA 5IY5H 1IV6A 3WTXC 2WBDA 2R8TA 5FLXZ 4KFCA 4BHPA 4EM2A 3QOEA 2Z3YA 2FUG2 4IOCF 2ZYOA 2H6BA 2XX8A 4XLPF 4GRKA 2O61A 4G6TB 1B9JA 1RYOA 1Y8QB 3A1YA 1JP4A 1TWYA 4AYBA 1IUYA 2XAUA 2OZUA 2ID6A 3DXJF 3PPNA 3WG9A 4QFPA 2O51A 1UHWA 3BR0A 5GAHJ 4P9FA 2E1NA 2NNYA 1ZGWA 3RPLB 2VD3A 2ZXHA 4BJ6C 4AUXA 4WXHA 1IW7F 1P9QC 3HRSA 2CEYA 4PQJA 1B59A 3ZMDA 1H9GA 4MFIA 3IWZA 5DEXB 4Z0IA 3OOUA 2VIXA 1IMEA 5K5QA 4F55A 5FLXK 4UUSA 1B7ZA 4HSRA 4BBRJ 4M71A 1YTVA 1GLNA 2EV0A 1VNDA 3VFZA 4MQ9F 1OR7C 4EATA 1JEVA 3GVAA 1ERDA 4E0XA 3FMQA 1MPBA 1QKBA 3OYDA 1HDDC 4OMBA 4EGZA 4QFKA 3EF7A 3RQIA 3OSFA 3L6HA 5C4JJ 3PUBA 1LBBA 3QMFA 4PGPA 4YRVA 3V4GA 4P55A 1Y39A 1MNEA 2QSHX 4B09A 2COBA 4B48A 2KLOA 2GWRA 2K86A 3EQLF 1ZIUA 3PPOA 4B8XA 4IO4A 2RN7A 1F5TA 1NKXA 2YLNA 1RDYA 1ETVA 4CCJA 1ZARA 2M87A 3MMYB 1OCPA 2LMDA 1B46A 2CZHA 2CGPA 3OEKA 4G68B 3TW6A 1NK3P 1NV6A 5EGOA 2NAZA 2KRHA 1LCFA 4BY1J 2KJCA 4RB3C 3ILUB 1WH5A 1U3EM 4U1OA 3WG7H 4F1VA 2IJLA 4ZYGA 1YJWI 2PVUA 4PFRA 1OCOH 2LSOA 1T08B 2HKOA 3IAS2 4RB1A 4POWA 4QFLA 4X9TA 2HZTA 3HTSB 1IXGA 2O03A 1FYKA 1H43A 2XWIA 1FOXA 4YG2F 1G6NA 3T9HB 5FO5A 3IOTA 3RT6B 3WU1B 2GXBA 1MW7A 2F6CA 4GXSB 4ZDMA 4CYCA 1B3GA 4YMBA 4HLXA 4P9UA 2ZFWA 1FBUA 3S8PA 1TT1A 4WKMA 2GA2A 2QKLB 3BG9A 3REOA 4RLFA 1YW8A 5KAIC 2FEZA 3RIRA 3IK6B 2PBWA 2M8GX 2PCRA 1LGBC 2OCCH 4KNYA 3DF8A 5E3LA 5ED4A 4YEJA 2ICWG 3FKIJ 5HVQC 4BACA 2V1DA 4L9VA 1VQ9I 2IA4A 2Z8EA 5B3SH 2OWSA 3IB0A 2PFZA 3H4ZA 4YICA 4PFIA 1GTKA 2JJKA 2ELKA 3IH3A 3QQAA 3OO7A 4G6QA 4FORA 2DQVA 1FTKA 3DLNA 4I40A 3ZS6A 1TLHB 5HS8A 1ZLKA 1WCMJ 2E19A 3C9HA 4MBPA 3E6MA 5I57B 3I56I 1GVDA 2ZNSA 1WH7A 4BHCA 4JSDA 5KDTB 2KFDA 2A68F 3TO6A 4HQEA 4BE2A 1SFEA 1S50A 1US4A 4P11A 5J47A 4F3BA 1IMAA 4HPQA 3GFLA 1DGRM 4FE8A 4K2EA 2HTSA 2CU7A 3HEFA 2LRDA 4YAHX 1S6LA 3ABKH 3F3XA 3T8RA 2VOPA 5I56B 1U5TB 1SC7A 1URSA 4C3IJ 2GH9A 3BR1A 3M8FA 2OK2A 1EH8A 5CC2A 4XQFA 2KISA 1SFOJ 1ULYA 5E3OA 4LLGF 3F8FA 1ETXA 4OIRF 4X8RA 5HLTA 3WTYC 3OOPA 5D5VB 3MJNA 3IRQA 4DYQA 1B1HA 4S0HB 3LSPA 3ZQIA 4ZEDA 4II2A 2TRTA 2REJA 3IOVA 4NE4A 1MBGA 2XASA 2XXWA 3BROA 3G3FA 1LFPA 4WX9A 4P5OA 1B1BA 2DT5A 1E3PA 1MH3A 2MABA 3R6SA 2LY2A 2QFLA 3PPQA 4KYSA 4DLDA 2KMUA 3HOXJ 4XSZF 1Z77A 2Q8JA 3C7JA 1ZTRA 4CICA 4QSDA 1R4NB 3S4UA 2BEOA 3B6WA 5EQAA 2BXZA 4M3BA 3UNGC 1GV5A 1YX5A 4OFLA 1MPCA 2XAJA 3F8CA 1X3WB 2RCAA 3T0YA 2IRFG 1IN5A 3M1CA 3L1PA 3SKPA 3OYAA 5M2VA 2XSJC 2LBFB 3DLLF 4IF4A 5JLWA 2H99A 3TP0A 3PV0E 5I3SA 2ELJA 1A35A 1MMGA 3FVOA 2VE8A 2UV1A 3JSPA 1K83J 2DA2A 2L54A 5LEJA 1IRZA 2OJTA 2ISZA 2QQ8A 3K7AJ 3SDGA 5DM7F 5KK1A 3CO7C 1EV7A 2DA4A 4ABZA 1JUMA 1VQ4I 1Y3QA 3IOWA 3ZMVA 1ZG5A 1ZGJA 1NV1A 5IKBA 5H8FB 1XC1A 1J09A 3H6WA 2H5YA 4R75A 3QRFF 3G3GA 4E7SA 1BIYA 2XX7A 2W25A 3NQOA 3KYCB 5FFZA 1BI2A 4E7IA 2CZLA 1S7OA 2ZBKA 3R26A 1JE8A 1NNPA 2VL8A 2EZKA 4OIQF 1TQPA 2XPWA 1DGWY 2QSFX 4YIFA 1QA6A 3KG2A 1YI2I 4A3EJ 1WZ2A 2ECCA 1QW0A 4KPTA 2E36A 4F3PA 4PBQA 3KP5A 2RKMA 1B51A 4KA4A 1R9QA 5ICQA 3N6TA 1D8JA 4HBLA 2MD5A 2P7VB 5DD4A 4BE1A 1LE8B 4HF2A 1U0JA 2X0LA 1M5CA 2ZZVA 3MZBA 2HXOA 4O8MA 3WTVC 1K7AA 1Y3PA 1J5YA 3V7CA 1B5IA 2M7AA 1N7XA 4LVQA 3K1MA 1IDYA 3SEQA 3PSFA 3V89B 3ECHA 3CMAI 2FMYA 4HF1A 1CB6A 1U2WA 3K4MA 3ISPA 3L9FA 1Y0NA 1Y6IA 2A69F 4P96A 4C3JJ 2JUGA 1O7LA 4ZYDA 4H8IA 4MCOA 3IH4A 3P7IA 4R74A 1PBQA 5F1JA 4HS7A 3MFKA 5HLIA 3H5NA 1LEAA 1VDWA 1E3HA 5ITOA 1FPKA 3TTNA 2Z99A 4A3JJ 1T6SA 1I1SA 4UB8C 5J1UA 2VQCA 3FASA 4TLMB 4ELPA 4F22A 5I57A 2QUFA 3FXMA 3K10A 3JRIA 4QF9A 4AQ4A 4XKVA 5KDTA 4YIRX 5E8IA 3R61A 1NHAA 3TL4X 5BMZA 4ELRA 4IR8A 4I0AA 5IYBJ 1QJMA 4DNCA 3BY6A 2LAOA 4KYEA 3L2VA 1W36D 3W9VA 2D5VA 4X1EA 1T95A 3KLNA 4I2OA 1UG0A 4ZZAA 1MQDA 5I56A 1U5TA 1TZLA 5I2KB 1IXIA 4BY7J 5L8DA 5LGUA 4LG0B 4NG7A 5J16A 3BTIA 4LK1F 4TQUQ 1W5CC 2MG4A 3LSKA 5FRMA 1NG7A 2R5YA 5CBRA 4A3LJ 2I0CA 5I2NB 2J5PA 5F0FA 1Z7ME 3BLYA 1O7FA 3LSIA 5FROA 5B1AH 5IYCJ 4RK2A 4NQ8A 5HOOA 2FBHA 4PDKA 3DTKA 2L9RA 3B6QA 1LQ1A 5ET7A 5HBCA 3CUQC 4PF6A 5M5XJ 3U65A 1TTYA 5DM6F 3SZGA 4IKFA 1MBKA 4A3IJ 3ZXSA 1YQAA 3BC8A 4F2QA 3GMEA 4N07A 2CQ7A 3ABLH 4EMSA 3HPIA 3IX1A 2XAHA 2DQRA 2ZKZA 2XGCA 4LZ5A 4RXLA 4OAZA 5DD8A 2VODA 1ZG1A 4MO7A 2FA7A 1B4HA 2CQNA 2K02A 3MKLA 3TP3A 5JVTA 3W9WA 1RKWA 3RDIA 3O2PE 2OLBA 2ZJQF 1MPDA 3BP8A 3CLQA 2BVMA 2FBIA 4XBFA 4PFTA 3CO6C 3RUMA 2KDZA 1A8EA 2YX4A 3HB9A 1Z67A 2JT1A 4XLNF 2VBYA 1NUXA 2V3UA 1KQ0A 3ZKLA 1FTOA 3BG7A 1FW0A 4N6DA 3FXBA 3FVGA 2IEEA 1UZCA 2XC7A 3R0AA 1FMWA 4O5VA 1LBVA 1DTZA 1YYVA 1MXZA 4ZEBA 3PPPA 2DA3A 2O68A 1K79A 4P3LA 2GXAA 4OANA 2Y5KA 4OXVA 1ZELA 1Z3YA 1XG1A 3G4SI 3IFCA 5E1ZB 3C34A 3MVZA 4GX6A 4AIKA 4A0YA 4PDHA 2DOEA 3DP8A 3HSRA 2FVZA 1TT5B 3ZN0A 3FK6A 3KZZA 3VWBA 2ABHA 2O3FA 3EUKL 2Y48A 5AONA 1HW5A 2ZCWA 1NNFA 2FIEA 3GBBA 2EQRA 2KKOA 1N78A 3KN3A 1YX3A 1E3OC 1P1UA 4F39A 2F8DA 2LREA 2HDCA 2E1MC 2EZIA 1SVXB 2Q0OA 1R9TJ 2EV6A 2KJBA 4FHTA 4KN4X 2ACJA 1I6QA 4HF0A 3FISA 1MY0A 4GF8A 3UK4A 2XD3A 4F7ZA 1YE9A 3JRCA 2VD2A 3OSRA 5A2QZ 3JREA 1LE8A 5H8SA 3G1MA 4HOBA 2N8GA 1Z0XA 1YIOA 4NN3A 4G7HF 2NOOA 1VF9A 1FBDA 2R7TA 5E3NA 2QVOA 2L7ZA 3G1OA 5D6FA 1Y1ZA 4XIGQ 5L3DA 1O3QA 3FF5A 3RPQA 4QIWN 4A3GJ 1SYIA 2G29A 1WJBA 1FPFA 4PFBA 2CMPA 3I59A 3H9QA 4YFXF 1XDUA 4LIUA 2JPBA 2WYKA 3E13X 3KSJA 1B52A 5EJCA 4KICA 3F0CA 5H20A 5EYHA 1IMFA 4GFBA 5BS6A 1HBXG 3PD8A 2QCOA 1TWHJ 2L2OA 5L3GA 3CC7I 1IRGA 2P1SA 1IRXA 1LFHA 2ALUA 4UNOA 2FBKA 3KZGA 3TTMA 2FQ3A 1B5JA 3VYSB 5A2QK 3L6GA 4PFWA 4XLCA 1BTJA 2DODA 3S2WA 1WRJA 1LBZA 1RYXA 3R0JA 5D4SA 2Y84A 2FHYA 2DJIA 1YW7A 1F43A 2XXTA 4B47A 2WBMA 3SEZA 2X6XA 5DUKA 4BDYA 3W6KB 4MNIA 2O7IA 1HA8A 3ZMTA 3Q27A 1RUOA 3FGSA 4XICA 3B8BA 2G7HA 5K5OA 1EH7A 1NUWA 2JA7J 4EDPA 4EGYA 1LB8A 1MDP1 3KN8A 1Z3XA 2CFOA 4JX5A 1U8BA 3CCEI 2HFHA 1FSHA 1LCTA 3VVDA 2ZXJA 3E1SA 1Z7NE 1Y56A 4XN0A 1EYKA 2F4IA 3B6AA 4LG0A 3ZQCA 4UVCA 4NAPA 3NOHA 4HE0A 4XR6A 2XXHA 3OYJA 3LAPA 3QYBA 3SDBA 3VB2A 1A31A 3HG9A 4OVSA 3LSTA 2JVGA 3P9KA 2IS1A 4LZ8A 4RS8A 2NNNA 3TPAA 5I2NA 1AOVA 3CFXA 2VE9A 2XPVA 1QO0D 4F31B 2E2HJ 4BEHB 1R5GA 4H0WA 3FV2A 3S16J 1FPIA 4BKXA 1J1NA 1IMCA 3ASOH 3WODF 4DGWB 1S5LC 2DOJA 4G2ZA 5ILSA 1SVOA 1DUXC 3RZOJ 1R9LA 2O8XA 2X48A 2QBYA 1BLFA 3CG3A 5E20A 3N94A 4CCNA 3GFJA