1MH3A

Maltose binding-a1 homeodomain protein chimera, crystal form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
421
structure length
421
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
molecule keywords maltose binding-a1 homeodomain protein chimera
total genus 144
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh3A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A01
4FECA 3K6VA 4OEVA 1Y3PA 3WAEA 4EDPA 4I6ZA 5CBSA 4U22A 1MXZA 5H8HA 1H76A 2DXYA 2ME0A 4NF6A 5TPAB 1O64A 3MVYA 5I2KA 5IOYA 4WXJA 2RAEA 2X26A 1FIPA 3HDDA 3RKQA 1D9YA 4W97A 3U94A 1SVXB 1B3HA 2HQ0A 3CVGA 4MLOA 4PP0A 2L7FP 3M3KA 4GRKA 3KN8A 2R0QC 2F36A 2E2IJ 1FQEA 3S16J 3IL1B 5IPAA 4X48A 3RZOJ 4KYEA 4ISUA 2R5ZB 2FX0A 3UORA 2UVGA 3VLVA 2GLOA 1OCPA 2CU7A 2XX8A 1WODA 2P81A 3OEKA 1NH7A 2N8GA 2RCBA 4XTCQ 1MDQA 1N84A 1GVCA 3PPOA 5AA2A 1B7UA 4OYVA 2Y9YA 5EHSA 3O6IA 3UIFA 1YAEA 2G29A 1SDXA 4IB2A 3SEUA 3Q0WA 2DTZA 1S9TA 3TELA 1EZ9A 1PB8A 5EHMA 2X9DA 3OSGA 4DCXA 2E1SA 3PMVA 3FISA 1EU8A 1S50A 4GL8A 3K7AJ 2O1MA 3SDFA 3KSXA 5AA1A 4U4SA 4PE5B 4M3DA 3ECRA 3TEDA 2XRLA 3MZ1A 3CSBA 3PV0E 2XPWA 1ANFA 1ETKA 2O69A 3IK6B 1OLAA 1Y4CA 4TLMB 3FVOA 3IB1A 3FV1A 3HV1A 3HOVJ 1CB6A 3W6VA 3HO7A 3V5AA 3LSRA 1CE2A 2V25A 3UP9A 3KEIA 5I58B 5H8FA 1B1HA 4F2QA 1H88C 1AU7A 3M3LA 1A8EA 2OBGA 1SW5A 3SEVA 3TP0A 3Q27A 5EZGA 1A54A 4NF6B 4I76A 3IB0A 3SKPA 1A8FA 2OWTA 3PD9A 1DPEA 1MG1A 2KT0A 3MP1A 3E9XA 2H25A 3TPAA 1FEXA 1VR5A 4AQ4A 2DMQA 2QF7A 2B63J 1UTHA 3UGWA 3T93B 4DDDA 1NNFA 3N26A 2HI3A 4OFOA 3FD3A 5H8QB 2Q8JA 4YU0A 5DVJA 2UVHA 1TWFJ 3HN0A 3PUYE 1PBQA 4F3GA 4QF9A 1IEJA 4R2FA 4OVJA 4U23A 4RY1A 4FJPA 1B52A 5F1JA 4TLLB 3H4ZA 3ZQFA 3B6TA 1N3WA 3MQ9A 4GLIA 1ZR4A 3TUSA 2K9SA 5DTBA 1ZBMA 5ICQA 3RNNA 4LONB 4ZEDA 4BBRJ 1WI3A 1B72B 2OCUA 4FEDA 4MF3A 1K61A 3QYTA 4I1DA 4UUSB 2OZZA 2BJJX 2VOZA 4JBZA 1MY3A 4DE8A 1N76A 3JRBA 3PUZE 3A03A 3IAZA 4ZS9A 1FQAA 3FASA 1B0HA 2D21A 3S9NC 2VD2A 5E3OA 3FK6A 1R9QA 3TEPA 4FEBA 3K6WA 3GZGA 3U8QA 4H8JA 1JGGA 4LZ5A 1LFIA 3S9MC 1I69A 4F1YA 4NTLA 3Q28A 1FQDA 2R92J 3PPRA 4L5EA 3FXQA 5CMMA 3KOSA 2DE3A 4QIWN 2RINA 5FHNA 4IHYA 2LP0A 1N04A 4G68A 3S9EA 2DWHA 1B46A 4OWDA 1WCMJ 4I62A 2PX1A 5H8SA 1B0LA 4F3BA 2HOAA 3H7MA 4ZEIA 3LNQA 2NXOA 3FUZA 4GWOA 1A55A 2DXRA 4Z7EA 2K9QA 1MY0A 3G3IA 2R93J 5AA3A 3WHBA 2L7ZA 1LAHE 5H8QA 1B2HA 4G68B 5TP9B 4QRZA 1EZPA 4IEJA 1ZGWA 3THIA 3MAMA 2QJEA 1QUIA 4ZEKA 4IHWA 3KN3A 5JTYA 2REGA 2M9HA 3IOTA 2H1KA 1NH8A 1BW6A 5F0CA 5A5XB 4G8HA 1JKOC 4JWYA 3KJ7A 3H3GA 3IOUA 4AUXA 4LATA 2TCTA 2M8GX 2GHBA 5EGOA 3SDGA 3HEFA 4IGTA 3A01B 3QSLA 1G2HA 4QTRA 3NAUA 3ZQGA 2E0SA 1IQ7A 5E3NA 3TZAA 3JRIA 4ESXA 3M8UA 3TTLA 3O97A 2I6EA 2WKYA 3VVDA 4R74A 4G68C 1OVBA 1MH3A 1QVTA 2CZLA 2DN0A 1JTXA 1SW1A 4F31B 1LE8A 4N07A 4DZ1A 3MP6A 2ZNTA 2Z22A 4PFWA 4POXA 5EF6A 4CYCA 3G7WA 1K83J 4RJZA 1BTJA 1IXGA 2K9NA 3RUMA 3UK4A 3S4UA 3VVEA 3S17J 3B6CA 1HSJA 2O1LA 5EEAA 2HOSA 5KDTB 1A5JA 2G0EA 4MFEA 3H6UA 1RETA 1IGNA 2G93A 1MM7A 2DVCA 1FW0A 5FKLA 1J1NA 3ZOBA 2UYEA 2MGQA 3AXFA 3O8HA 1B8IA 2LFBA 1DTGA 2ID3A 2O7OA 1SW2A 4GVOA 3S9LC 4GL0A 3LSFB 1BA5A 3S14J 2O9LA 1NK3P 4A93J 2ECBA 5K7HA 1XC1A 3PPQA 4KCDA 1MQGA 4QFOA 5HM4B 1ZTRA 4A3EJ 3BG5A 4MFDA 4KYDA 3HB9A 2NOOA 3QPSA 1UIVA 2V84A 2AL4A 1B3EA 3OIOA 2RCAA 3N6TA 5ITOA 2I48A 1MXXA 4FATA 3A02A 3B6QA 5HBCA 1OJLA 2F7AA 1BW5A 3UKGA 2Q88A 4E0XA 5I2NB 1MY1A 2ZNUA 2GFEA 4N6PA 5F0FA 3G3KA 5I59A 3B7DA 2I4BA 1F43A 3G3HA 3T9HB 1Y1WJ 2X6OA 5H8HB 1ZKBA 1HSLA 2DSFA 2XX9A 2ECCA 4F29A 2IAIA 2PYYA 2PBWA 4DCYA 2NVTJ 1BLFA 3RN8A 3ZS6A 3PD8A 4NE4A 4DYRA 1B58A 2RC9A 5KCJA 4OENA 1AMFA 3NARA 3FJGA 2I49A 1FTOA 3MVXA 2VUMJ 1JJ6C 3CMYA 1IZ1A 5K2YA 1MPCA 4UA8A 4AC0A 1LAXA 2DMUA 4GXAA 2QPQA 2HZLA 2OK2A 2EZKA 2VKVA 4XRSA 3MVZA 3KZGA 4C3IJ 3RQIA 4ZZAA 1GV2A 2DWAA 1AKHA 3OO7A 3IH3A 5HODA 2CRGA 4OFJA 1VSOA 1MQJA 5ITPA 5KCJB 4M4GA 1DU6A 4A3CJ 1JW5A 2DYXA 1MSEC 3I4MJ 3K00A 4DZJA 2P0SA 3MN2A 1IIWA 1Y3QA 5C3EJ 4HS7A 1BKAA 4RPOA 2YLNA 3QXMA 4C0RA 3OD7A 3BTJA 4DYQA 5M3FJ 4WEDA 1XT8A 2WV1A 1HOMA 2R5YA 5DVIA 3VLWA 2KDZA 2HXOA 4W1UA 1MPDA 2LY9A 4NF8B 5I2NA 1POTA 5EDNA 4EF1A 4XIGQ 5F08A 3LBSA 1Y1MA 4OQOA 5TPAA 4KFQA 3MUQA 2Y7WA 4F1UA 2RC8A 1QJMA 4LZ7A 3K6UA 1PDAA 3CQZJ 4YMAA 1PEBA 3L6HA 2VGQA 5AA2D 4R6HA 1TFDA 1OCTC 3H3VK 4HTGA 1JUSA 4FE7A 2EBIA 3K2DA 1JNFA 5TP9A 3QUFA 1QULA 2CUEA 4A3MJ 1GR2A 1WVJA 3VPRA 3K01A 4YKKA 4LZ8A 1POY1 4JX5A 4EEFG 3QIMA 4KD5A 3PO2J 3EHTA 4YMBA 3K4UA 4YB6A 5FHOA 3H03A 2VKEA 1B7ZA 4H67A 2NVQJ 1VE4A 1LCFA 4ELQA 1DU0A 2EH3A 3KJTA 2L0KA 2Y31A 3CFXA 2E2HJ 1I6BA 3RTFB 5KDTA 2DA6A 4WKMA 2XGDA 3MZBA 1QVSA 3C31A 2ALUA 2ID6A 3IJOB 3KFMA 4KPTA 1HF0A 3SFIA 1XHYA 1CQTA 2QCOA 3LSGA 1WH7A 1APLC 3G3JA 2JJ7A 1OFCX 1B5IA 1UTBA 1XC5A 1P1UA 1UMQA 1MQDA 2FYIA 3TODA 2F6PA 3RZDJ 1TWYA 2OWSA 4MO7A 1RESA 2R71A 4POWA 3HKZN 1GV8A 1YRNA 4LUBA 2V3UA 1ETOA 3TAJA 1B72A 1MXUA 4BDOA 3GTMJ 3KBRA 4NF5B 3U1OA 3QQAA 3GXAA 1U78A 2DVZA 4Q0CA 4J19A 1OIBA 1SBPA 2HAVA 5DEXB 1VFEA 2VHAA 4GFRA 4IO7A 3L1PA 2HYJA 2HFBA 1US4A 1Q35A 3S2HJ 2F34A 3USDA 2AIXA 5ELVA 4BDNA 2H9BA 4EXLA 4H5FA 5BUUA 3C35A 2Z8DA 4LQ2A 3PPNA 1FTLA 3O28A 3OEMA 1IDYA 4OZ9A 4YAHX 4M3EA 1GGGA 2XXVA 3Q25A 1IUDA 1XG1A 2ZYKA 4U4XA 2FNCA 2X7QA 4PETA 4ZDMA 2REJA 2DWIA 2GHAA 4O3BA 1Y4TA 1FQCA 3TFLA 1E3OC 1H44A 1JW4A 2NVYJ 3HOZJ 1NFTA 3VDFA 1UTHB 4HW8A 3ZQIA 2PT1A 3K1NA 1US5A 1QPIA 2ZB9A 2QS3A 2XHDA 3HM5A 3JZJA 3BTCA 4JSOA 2VP1A 2DA2A 3I6VA 2LD5A 1EH3A 2XX7A 2R9JA 1MPBA 1IC8A 5F27A 3DP6A 4BDQA 4GFBA 2RF1A 3Q29A 4Q5TA 1MRPA 5I56A 1GUUA 5B70A 3BKIB 4BLAA 4IO5A 4FORA 1IRZA 1SQYA 5AE4A 2JA8J 3O8GA 3RY3A 2Y7PA 5K7ZA 3G1MA 1QW0A 4JP0A 3ZSFA 4XRMA 3K0VA 1Y20A 4LP2B 1RYXA 1GDTA 4B3AA 3LOCA 1MY2A 1HLVA 5H8NA 4A69C 2F8DA 1B7HA 4LA9A 2DA4A 1MQIA 1JQFA 1NNTA 5GPAA 3OSRA 4XKPA 3C9HA 5CMKA 1S7EA 1I6QA 1P99A 4F19A 4DXBA 1LFBA 1PB9A 2ZYNA 1LE8B 1IJWC 3V8XB 4KHZE 1FJLA 1SANA 3LUYA 1LFGA 5IAIA 4YKIA 4O3AA 5L9SA 1FQFA 3E4RA 4Q8RA 3C4MA 1URSA 3SEWA 5FLMJ 3I5OA 5BWJA 3IH2A 3TKDA 5J3LA 3T9XB 4U1OA 4OESA 1O63A 1WDNA 3BR6A 1JT0A 2FJ1A 3BQYA 5FTHA 2LAOA 2R5ZA 4Y7NJ 3HGYA 2F35A 1WGXA 3BR0A 4FISA 3IORA 2IEKA 4XRSG 4RBOA 2P2AA 5CM6A 3PGFA 5IKBA 1EF4A 5K2XA 1LCTA 4TQUQ 1EZOA 2OLBA 4JWOA 4DXCA 1B32A 1OQHA 1ZLQA 3N5LA 3HSTA 4IO6A 3ZKLA 1MBGA 4M3FA 2FA7A 3MC2A 2X7PA 1PC3A 1B5JA 2XXWA 1TFAA 4YKJA 1FTTA 3OO8A 1ORKA 1AIVA 1MM6A 2KLFA 3FKIJ 4RDUA 3S15J 3PPPA 4F22A 5LOMA 2ONKE 4OMBA 4P0IA 3CIJA 1QKBA 5DS9A 2M34A 3IV5A 1QKAA 3L6GA 3VXBA 3WAFA 4ZE8A 1B8IB 3IO4A 5J1YA 2AL5A 3G3GA 4A3LJ 5AA4A 3KN7A 4XK4A 3H6WA 1JJ8C 4IHXA 3BFUA 3IB2A 3GLBA 3DP8A 3SETA 5IYBJ 3S1NJ 5IP9J 3SESA 3JRHA 4JXIA 2ZNSA 1D3KA 3MWBA 3LSWA 3JRDA 2ABHA 3O9PA 2W48A 1I6HJ 2DS9A 4RK9A 4DYCA 4R72A 5J1UA 4IY6A 2MW8A 4ZZEA 1H45A 1R6ZA 2DE2A 4QFLA 3Q26A 3IOWA 2F97A 1PUFA 4FE4A 4OETA 2GH9A 2XXHA 2O6AA 2I0BA 1LFUP 4ONYA 2H5YA 2L7MP 3TTKA 2Y0SN 2LTPA 1RKWA 3A01A 2JMWA 1AOVA 1MBFA 2DA3A 1B40A 2D5VA 1U9NA 4F3PA 1DPPA 3KOTA 5H8NB 2I10A 2MSYA 1XVXA 2OF7A 3A3CA 5IOZA 3K1PA 3KGCA 3KSJA 1MXWA 4L17A 5FJ8J 2QS2A 4LOCA 1ETWA 2O84X 4THIA 3HHFA 1MDP1 4H65A 1IXIA 1N7XA 3B6AA 3E7LA 2JK3A 4BY1J 1Q1VA 3PUVE 4MBPA 1B6HA 9ANTA 1MNMC 3CCYA 4BXXJ 5FKOA 1FCKA 2QS4A 2DWJA 1I3QJ 1FIAA 3I4NJ 3UN6A 4RXLA 4YKPA 3SEYA 3TW7A 1SYHA 3MJNA 1PBPA 4MLQA 1H3DA 3GTKJ 2LK2A 4FE8A 3TYHA 2EZHA 1X58A 1ZTYA 2XB0X 3GBAA 4AB6A 1ETQA 2XPUA 4FTHA 4H1XA 4P0GA 4H5GA 3TTMA 4TOZA 3BBRA 2QMWA 3IJXB 3HCQA 3RPWA 1Z7NE 2O51A 2ZMBA 3M3FA 4OHNA 1FTKA 2UYFA 5J1DA 1P1QA 4C3JJ 3RT6B 1PUFB 2V3TA 4F3SA 1ZU0A 2K40A 2DMPA 4M3GA 4IGRA 3DM0A 3ODBA 2DA1A 4FIMA 2XD2A 2Y9ZA 1FQBA 5DYHA 4D5CA 3PUXE 1Z0XA 4DXUA 1LSTA 3S1RJ 4H0WA 2B65A 1NMUA 1OLCA 4AB5A 3CRBA 2LLKA 1TC3C 3DEWA 2ANJA 2VPRA 2X48A 5J1RA 2ME6A 3HOWJ 3OSFA 1B05A 1JUPA 2Q9TA 3QUJA 4X9TA 1YRNB 5TU0A 1VF9A 1DMBA 2EQRA 4G12A 3Q3SA 2B3BA 2VD3A 3PU5A 4A3FJ 2WAQN 3V83A 2XPVA 1MY4A 3DELB 4JX4A 4IHVA 3H6TA 3IOVA 4K3FA 3TCFA 3OMBA 3W9VA 2HQ5A 4QSCA 1XS9A 1DOTA 4GD5A 3OOAA 3QPLA 1VFCA 2QMXA 3GTQJ 1F9BA 1P1WA 4B4CA 5I59B 2CUFA 2F6GA 3S2VA 3FIRA 3FVGA 4OTEA 3EF7A 4EF2A 1GTKA 3IO6A 1B3GA 3BR1A 3SJMA 1D5YA 1VI0A 2ESNA 1FTMA 2JA6J 3E13X 3FGSA 4M6VA 4HNVA 1Y3NA 2F7BA 1S7YA 3BR5A 4V2FA 2IA4A 5FTIA 4E0WA 4EQ7A 3IX1A 2RKMA 1U8BA 3QK6A 4NF4A 3OSQA 2IBDA 3RGYA 1MBJA 1JKRC 4QSHA 1II5A 3PMWA 2DMNA 2IEEA 2NUVA 4R9FA 2VI6A 4JB7A 1FTJA 2XXIA 1MS7A 3HOXJ 4ZECA 1RPWA 1O4XA 2Y7KA 1URDA 1B9JA 2XSDC 3EHSA 3WHCA 5IP7J 3CG1A 3FVKA 3MVWA 1UG2A 3FATA 3MW0A 3T9UA 1JEVA 3TTNA 1MBEA 1NNPA 3IR1A 5EYRA 1LAFE 3CDLA 5FKKA 4H8IA 2AO9A 4D5FA 3TMGA 4NF5A 4OFLA 3JYRA 5C4JJ 1ZQ3P 2HOTA 4I9DA 3JRCA 4UUTA 4ZE9A 2Q2CA 4NMYA 4FCYA 1YCJA 5C44J 2UVJA 1M5DA 4C1TA 2CJJA 2CMOA 5EGOB 3ILTB 4A3JJ 1MXVA 4DIGA 3VV5A 1TWAJ 1W0UA 3N6UA 1BL0A 3K6XA 1M5CA 1YTVA 1T0KA 1F36A 5CMCA 2Z8FA 1VNDA 5EG0A 3C33A 5FKMA 1JVXA 2DP8A 4M1VA 3TQWA 2L9RA 2YJPA 1WPKA 4G4PA 5M3MJ 3K1MA 3G1LA 5JEIA 1ELJA 3HGGA 4IO3A 1IDZA 3EHUA 5DTDA 1IV6A 2HZKA 2QSXA 3VLUA 2YPNA 4XKQA 3TQLA 1USYH 2W7YA 4JDFA 4Z0IA 2GM4A 5EYFA 1RKTA 4IO4A 1JUMA 2JA7J 4ELOA 2I58A 4U2RA 4BY7J 4C1UA 2DQVA 1P7IA 2JA5J 1H8AC 3VVFA 5JLWA 5FLVA 4LVQA 4NEDA 3P7IA 3UA8A 2I4CA 3MPKA 3O2AA 3W9WA 4ELPA 4JSDA 2XXQA 3G1OA 3O66A 4RPNA 1LB8A 1HDDC 4A3GJ 3H06B 1AH5A 5EG0B 2HDDA 4V2GA 2XGEA 1P7JA 3BG9A 3BT9A 4BBSJ 3ILUB 3A09A 1JTYA 3R7XA 2CQXA 5L9OA 4JYKA 1UIUA 3A3UA 4XXUA 1A40A 4DW6A 5ICTA 4MIMA 4N13A 1MQHA 3T22A 1GVDA 4NF8A 1WH5A 5DVFA 2JWTA 1R9LA 4RNSA 1LBBA 1SD3A 1SFOJ 2I3WA 3OELA 1B51A 2Q2AA 5GPCA 3ONMA 5F0HA 3MBPA 1USYE 2FD5A 3Q0UA 3U72A 1OVTA 1IITA 1I6AA 3RT8A 1MH4A 1IG7A 2XXTA 2DA7A 4JX6A 3GTPJ 2NWJA 2F7CA 3OO6A 3BQZA 3LSXA 1VFDA 4R6YA 3ZQCA 3IH4A 1L5TA 4GOTA 2HXIA 2Z23A 5M2VA 1PB7A 4QSEA 2ONRA 4HCYA 2M8CA 4MLVA 1ATGA 1MBHA 2WB1N 4QFKA 1ZR2A 1T56A 3JV9A 4ZEBA 2XD3A 4KCCA 3LSJA 2QS1A 1XOCA 3CR9A 4NF4B 4OEUA 1JKPC 4C2MJ 3F0CA 1Y1ZA 1URGA 1LB9A 5I56B 1D4NA 5BNGA 5IYDJ 3S1MJ 2MG4A 5KZTA 3BG3A 1JKQC 4QFPA 3RTWB 3H6VA 4WEPA 3PM1A 1OMPA 2H98A 1B4HA 2EZIA 1DTZA 2ZXTA 4YICA 2AHQA 2JN6A 2OPTA 1MXYA 2XXYA 1MBKA 4H6DA 2PMZN 4EXKA 1JVYA 3TW6A 1X2NA 4PQJA 4BDLA 2YU9J 3BTLA 5E3MA 3HOUJ 3OXNA 4QFNA 3U92A 3CFZA 4ECFA 4C3HJ 3FIWA 2QL3A 4U21A 1HSEA 3JREA 3HHGA 3H0GJ 2H4IA 4KQPA 3K02A 4YB7A 4IO2A 3QAXA 4XKNA 1BJZA 3BTIA 2NVUB 2Y84A 1KWHA 3DP4A 1NK2P 1NTCA 4UUSA 3I3VA 5B7DA 3K2AA 1TT1A 3ZQLA 2O8KA 1ETXA 2H99A 5DEXA 5F1QA 3PUWE 3C34A 3BR3A 2EZLA 2Y2ZA 1I50J 5CBRA 2Y7IA 3KG2A 1Z77A 4X6AJ 4EQ9A 5IYCJ 2OJTA 2DJNA 1A6IA 2F5XA 3W15C 2DE4A 5EZHA 2XXRA 4CYCB 1H89C 2H8RA 3O6GA 4GIZA 2R6GE 2F78A 5JK4A 3OENA 2NS7A 4OERA 2RC7A 1U9OA 1TWHJ 3HBLA 1SI1A 1HDPA 2YS9A 1P1OA 4XIDA 3GBBA 2UVIA 3MVPA 3LR1A 3RQTA 1QVUA 1B1XA 1R1NA 4GQOA 4RA1A 4QHQA 5M5WJ 1LGBC 1POGA 2YUSA 1NKXA 1ITYA 3ZKKA 4YZZA 1YPNA 2V3QA 2ELKA 2DOJA 3D4GA 1SI0A 4EUOA 1IUFA 2D3IA 2QRYA 2M0CA 1JW1A 4GXSB 1ZK8A 4FAJA 4EQBA 3T9VA 4R9GA 2ZYMA 4KI0E 4I8CA 1SW4A 5I2KB 5A5XA 2HCAA 4ZEFA 4R75A 4M3BA 5E3LA 3JRAA 3S2DJ 2LVSA 5CC2A 1ETYA 5DT6A 3D4CA 5FHMA 2I3VA 3CI8A 2DA5A 1LFHA 3GTJJ 2Z8EA 4XKRA 1TWGJ 1P1NA 4F1VA 3F11A 4MFIA 1ZIUA 1B3FA 4HCWA 1QUJA 3TCGA 1AHDP 1M5EA 3TTRA 4Y52J 4ESWA 2NOGA 2PT2A 2DMTA 2V93A 4S0HB 1UQWA 3TCHA 3FXUA 4F39A 1XS5A 2E2JJ 4G2ZA 2LKXA 1A7LA 5ISUA 3T96B 4X1DA 4R6KA 2XGCA 3HPIA 2LR8A 5I57B 4GF8A 2E1OA 1Y9UA 4BDRA 3T66A 5H8FB 1JT6A 1LAGE 3LC8A 2HXWA 3LSPA 3GTOJ 1GT0C 3LSLA 5F7VA 2XXXA 2E19A 4F2OA 2XXUA 4PFYA 1GV5A 3M4OJ 4BDMA 1IXHA 1R9TJ 4PFTA 4BKXA 4QSDA 1TWCJ 1T33A 2HEUA 3VE1B 2Y30A 5M5YJ 1AKHB 5FKNA 4ABZA 4R73A 3GTGJ 3O29A 4U1ZA 3S1QJ 1DSNA 1UTBB 1ZMGA 3FJMA 1A99A 3JRFA 1N7WA 1B5HA 4B1RA 1AL3A 1HCRA 1M5FA 3E3KA 3BFTA 4NWCA 4XICA 4JWXA 3MPLA 4RYAA 5JTYB 2O68A 5I84A 1Y1VJ 5C4XJ 5IP6A 2THIA 5I57A 2R7ZJ 5AA2B 2D5WA 3MZ9A 2XXPA 4G8MA 4A3IJ 1JEUA 5M5XJ 4D7MA 3EQ1A 3CFLA 4IY5A 3EN3A 1BP5A 3EPEA 3FVNA 2ZYOA 3D1NI 5CI5A 5K7FA 1Z7ME 3JR9A 2PVUA 4DZPA 4MH5A 3FJ7A 2P1SA 1O7TA 4G77A 4NWDA 4A3BJ 4RK2A 1JETA 3DLNA 4YB5A 1RKMA 4Q30B 5HPQA 4NDLA 4X1EA 2O7UA 4LQ5A 4OXVA 1FTZA 3TDJA 3FZVA 3HOYJ 2Y7RA 3JRGA 3R26A 1LBCA 4KR5A 5L9MA 4ELRA 3FK7A 3M3YJ 5JLXA 3VXCA 3U93A 2I0CA 2TRTA 2A5TA 1N0TA 3ZQHA 2UXAA 3MP8A 3G3FA 4P11A 1D9VA 2A5SA 3B6WA 3DCFA 4F18A 1ETVA 5F04A 4X1BA 3VFJA 1B4ZA 5I58A 3C2BA 2R5YB 2CQQA 1BIYA 2ONSA 3C32A 3R6UA 1OQGA 2GBYA 2GRVA 2HAUA 3O6HA 4O3CA 1W0TA 1IXCA 1Q1KA 3BR2A 3C36A 2COBA 3PMXA 3PO3J 1UHSA 3FV2A 2NS8A 1SYIA 1X2MA 3TP3A 1LLSA 4A3DJ 1NNKA 2FQ4A 4KYSA 1TXFA 1B3LA 4DLDA 1QUKA 2PMSA 4UACA 1NL5A 1XVYA 3MKLA 1H43A 1RYOA 2B3FA 4A3KJ 4PFUA 3GTLJ 3FXRA 3SERA 3SEXA 3RLFE 1RR7A 4R2BA 2Q89A 2AYSA 3V89B 2A5TB 3N94A 2M2EA 5AA4B 5L8DA 1ZJLA 1ENHA 3Q0VA 3OO9A 1MSFC 4AYBN 2NVXJ 1M5BA 3CSGA 5CRYA 4D7NA 3GBGA 1ZKGA 3CG3A 4ND9A 5GP9A 1N3XA 5CMBA 1QRYA 2O7IA 2XB5A 3OOUA 4G8NA
chains in the Genus database with same CATH superfamily
2QVOA 4FECA 3E6BA 3K6VA 4OEVA 2HZTA 3VFZA 1Y3PA 3WAEA 4EDPA 3EUKL 3PNVA 4I6ZA 5CBSA 4U22A 2UZKA 4NAPA 2HXRA 1X4OA 3I9V2 1MXZA 3HUGA 3PUBA 1PYVA 1H76A 5H8HA 1FBFA 2IT0A 2WB1A 2DXYA 2ME0A 5L3DA 5BQTA 4NF6A 5TPAB 3GCMA 1EYIA 1O64A 3MVYA 4QBAA 5I2KA 4E7SA 4LD5A 2IW5A 5IOYA 4WXJA 2RAEA 3SXYA 2VOOA 1FIPA 3HDDA 3RKQA 1D9YA 1NV2A 2X26A 4PAKA 1UELB 3I59B 3K69A 3QPTA 4W97A 1MKMA 3U94A 2OAZA 2VE9A 1SVXB 4X04A 1B3HA 5HLHA 3ABKH 2HQ0A 3CVGA 3CCQI 3RPLB 3A0BC 3GVAA 1NH3A 4IRIA 4MLOA 3GMEA 2FXAA 4PP0A 1SFUA 5ET6A 4CSWA 1TQIA 2L7FP 5J8CA 4HSTA 3M3KA 1LNWA 4GRKA 4FETA 2HVSA 3KN8A 2W25A 2R0QC 2E2IJ 2F36A 1FQEA 3S16J 4P9FA 3IL1B 5IPAA 4X48A 3RZOJ 4KYEA 4ISUA 2R5ZB 2FX0A 1RIOH 3UORA 2UVGA 3L9FA 3VLVA 2DFEA 2CO5A 4M6YA 2GLOA 4FBPA 5B5EC 4PFBA 1OCPA 2CQ7A 2CU7A 2XX8A 4N17A 1WODA 4IKFA 1R1UA 2P81A 3OEKA 1NH7A 4IXAA 2HFHA 3DLAA 1O7FA 4YFNF 5D4RA 2N8GA 3KZYA 4KIFA 1V54H 2RCBA 4PK4A 4XTCQ 1MDQA 2K5CA 1N84A 1GVCA 3PPOA 5AA2A 1XCBA 2VC0A 3RDIA 3AG4H 1B7UA 4OYVA 5I7IA 2Y9YA 3NEUA 4O5VA 4WF2A 3O6IA 5EHSA 3KP2A 1YAEA 3Q5FA 1SDXA 2G29A 4IB2A 3UIFA 4F92B 2K27A 3SEUA 2ZXJA 3GFIA 4G6TB 3Q0WA 5EQ9A 1NV0A 5LFAA 2DTZA 3M1EA 1S9TA 3TELA 1EZ9A 1PB8A 5EHMA 4RGXA 2X9DA 3OSGA 4DCXA 2E1SA 5J16A 2P6SA 5JR3A 2OA4A 3PMVA 4U0WA 3FISA 2LY2A 2QQAA 3DFGA 3K4BA 4HF0A 1EU8A 2QVVA 1YX5A 1S50A 4PE3A 4GL8A 3K7AJ 2O1MA 3SDFA 1R5ID 3WE3A 4ZZDA 3KSXA 5AA1A 2MA3A 2EPFA 4U4SA 4PE5B 3CCJI 4M3DA 2R7XA 3ECRA 3TEDA 2XRLA 5BPIA 3MZ1A 2GAUA 4UHTA 4U1ZA 4EVIA 1AWCA 1NV1A 3CSBA 3DV8A 3PV0E 2K9LA 2XPWA 3ZCOA 2GA2A 1ETKA 4QPQA 1ANFA 2O69A 3IK6B 4OVRA 1OLAA 1Y4CA 4TLMB 3FVOA 1I3AA 2HYFA 3IB1A 1NV6A 3FV1A 3HV1A 3HOVJ 2DQRA 3HKZA 1CB6A 2VKHA 4XLAA 1Q1HA 3CJRB 3W6VA 3HO7A 5ILSA 3VYSB 3CUQB 3V5AA 3LSRA 1YJ9I 5CVVA 2F3BA 4NQWA 2GWRA 2XAFA 3K4NA 2DT6A 3L09A 3F8NA 1WWXA 1CE2A 2V25A 2A05A 2EIMH 4D0PA 4ZC3A 3HTSB 3UP9A 1W5SA 2Z16A 4RLQA 4ENMA 2MKZA 3KEIA 4LJZF 4GWWA 5I58B 4M74A 5H8FA 2ZXWH 1B1HA 4GYIA 1S5LC 3ABMH 4F2QA 3IKTA 1H88C 1HA8A 1P6RA 5H20A 2KISA 2KIMA 1AU7A 2F5VA 3M3LA 1FSHA 3HSFA 1A8EA 1Z9CA 1SW5A 2OBGA 2UV1A 1LEBA 3R61A 3SEVA 2I8DA 3HSRA 2JRTA 1EH6A 3TP0A 3U9GA 5EZGA 4BEHA 3Q27A 1A54A 3WTTC 4NF6B 3E79A 3GZNB 4AYBA 4GX3A 1K4TA 4I76A 3IB0A 2CS3A 2E1CA 4PDKA 3SKPA 4JVDA 2K7LA 1WRJA 1A8FA 2OWTA 4HW0A 3KZZA 2D2WA 2Z99A 3PD9A 1DPEA 1MG1A 2KT0A 3E9XA 3MP1A 2R7UA 2H25A 1I1GA 3TPAA 5FD6A 1FEXA 3E5UA 1VR5A 2WEFA 4AQ4A 2DMQA 2QF7A 2B63J 1UTHA 3EKIA 3CJNA 4HG2A 3UGWA 3T93B 4DDDA 1NNFA 3N26A 2HI3A 4OFOA 3FD3A 4EM2A 3WTWC 5H8QB 5A2QZ 2JQ7A 2Q8JA 5J4VA 4YU0A 5DVJA 2VC1A 2GXAA 1XDSA 2UVHA 1BOAA 1TWFJ 4F55A 2KZGA 3RPQA 3HN0A 3PUYE 3HSEA 3SEQA 1PBQA 1B1BA 3BPVA 5GAEJ 4PGPA 4F3GA 4QF9A 2QQ9A 2VQCA 1IEJA 2FE3A 3JCUC 4R2FA 4OVJA 2V6CA 1LEAA 1FT9A 1ZYRF 3NWSA 4U23A 1UHMA 4RY1A 4FJPA 1B52A 5F1JA 4MHFA 4TLLB 1S7AA 3E1SA 3H4ZA 2M5WA 3OWTA 4L9VA 3V7RA 3ZQFA 2DYXA 3B6TA 2R8TA 1BR4A 2M1BA 1N3WA 4KN4X 3SZPA 2HR3A 1F4KA 3DTEA 1R5GA 3O3KA 2XDVA 4A2UA 3MQ9A 4GLIA 2VQLA 1V5FA 1ZR4A 1T0FA 2PFZA 3TUSA 2V1XA 2FUG2 3C2GA 2P8TA 3CUQC 3I0TA 2K9SA 5DTBA 3CJTB 2IGOA 3FXKA 2VODA 1NUXA 1ZBMA 5ICQA 2O0YA 4PZJA 3RNNA 1T39A 2QSHX 4XLFA 4ZYDA 3DPLC 4LONB 4CYDA 4ZEDA 4BBRJ 1TZLA 1WI3A 4GWYA 5TRDA 1FBDA 2O3FA 1B72B 2OCUA 4OVPA 2FF4A 2FBIA 4FEDA 3QYFA 2EV5A 3GX4X 4MF3A 1K61A 5F64A 3L7WA 3QYTA 3HHHA 2LH9A 2E71A 4I1DA 4UUSB 3DLLF 2OZZA 4YMBA 2BJJX 2OBPA 2R7DA 1LUJB 2LKSA 3QAHA 4HXVA 4PCDA 3BDDA 5ET8A 2VOZA 4JBZA 1BBYA 2P6TA 1VQMI 1G0HA 1MY3A 2W1OA 5CQEA 4CZZA 3CCRI 4DE8A 1SVMA 1N76A 3S2WA 3JRBA 3EDPA 2PI0A 3PUZE 2QEXI 3A03A 2KMUA 1P4WA 2GQ1A 1OYYA 3IAZA 4M72A 4ZS9A 1YO5C 1VQKI 2IGNA 3J80Z 5B3SH 2CV2A 1XN7A 1FQAA 2L01A 4I98B 5EQAA 1OLTA 4MJOA 3FASA 5LLQA 1U6GA 4J01A 1B0HA 1D0XA 2D21A 3S9NC 1FP2A 3GXOA 3FK6A 4G6DA 4MEYF 4XKBA 5E3OA 1E0EA 1R9QA 2VD2A 3GZGA 3K6WA 4FEBA 4H8JA 1JGGA 4O94A 3U8QA 4LZ5A 4KMFA 2IP2A 1LFIA 1I69A 3S9MC 4F1YA 3RPLA 3PNYA 2ACJA 3Q28A 1FQDA 2Z5UA 2R92J 1SFKA 2P3VA 4NTLA 3X2QH 5JHFA 3PPRA 3BROA 3FXQA 4L5EA 5CMMA 4E7HA 2DE3A 3KOSA 2A07F 4QIWN 1EH8A 2FMYA 2RINA 5FHNA 4IHYA 2LP0A 2ZMEB 1N04A 4G68A 3S9EA 3OS2A 1VQ7I 2DWHA 2XF6A 1B46A 1BIAA 4OWDA 1WCMJ 2ISZA 2HGCA 4I62A 2PX1A 5H8SA 1HKSA 1B0LA 4F3BA 2HOAA 3H7MA 2OX3A 1K9YA 3EETA 3LNQA 5DD4A 2NXOA 4ZEIA 3FUZA 4GWOA 2LF8A 3ELKA 5LGUA 1A55A 5HLIA 2DXRA 4Z7EA 1OKRA 1YYVA 1XSVA 2K9QA 1MY0A 3G3IA 2R93J 2LNBA 3WHBA 2L7ZA 3BOQA 1LAHE 5H8QA 5AA3A 1B2HA 3GYHX 4G68B 5TP9B 2VE8A 1KU9A 1AOYA 3NOHA 1GXPA 4QRZA 4Q4ZF 2R7TA 4E6KG 4FASD 2PJRB 2NNNA 1EZPA 1IRXA 4IEJA 1ZGWA 1IN8A 2W82A 3THIA 4H45A 1LBWA 3MAMA 2QJEA 4F52A 1Z3XA 2X1EA 3EUAA 4I02A 1I1SA 4IHWA 2DK5A 4PSWA 2HPMA 1QUIA 3KN3A 4ZEKA 1KZ8A 5JTYA 3GEZA 2REGA 2QVRA 1LB2A 1TLHB 2M9HA 5D6FA 2R7RA 2IS6A 3IOTA 4BL0B 2JSCA 2ZFWA 2H1KA 1NH8A 1BW6A 5A5LA 5D5WB 5F0CA 5A5XB 1NG6A 4G8HA 1JKOC 4JWYA 3G3ZA 1FOYA 1T6SA 2M30A 3H3GA 3KJ7A 4XNFA 2BOLA 3IOUA 1QA6A 4AUXA 3U1DA 3U21A 4LATA 2A6HF 2L4MA 2TCTA 2M8GX 3E0JB 3GLLA 1KQ0A 2OU2A 5L3CA 5EGOA 3AKZA 3ABUA 3HOTA 2KRCA 3EQLF 3HEFA 3SDGA 3A01B 4IGTA 4XN3A 2Q1ZB 4AD9A 3QSLA 1G2HA 4QTRA 3NAUA 4YFXF 3ZQGA 2E0SA 1IQ7A 5E3NA 3TZAA 3JRIA 4JOMA 4ESXA 3M8UA 3TTLA 3O97A 1HXDA 1LVKA 2I6EA 2YX7A 2WKYA 2V9PA 2V6EA 1L3LA 4G68C 2QWWA 3J81K 1YW9A 4R74A 1OVBA 4NQWB 2QENA 4U88A 3IFAA 2L54A 1MH3A 2DODA 1QVTA 3LFUA 4ON0A 5KAFC 3K70D 2ZZVA 2CZLA 3IHUA 3H9JA 2DN0A 4N0BA 1JTXA 3CC4I 1SW1A 4ZDOA 4IR8A 4F31B 3TL4X 2CG4A 1LE8A 2HQNA 4N07A 4DZ1A 3MP6A 5IZ3A 2L9SA 3PIOF 2ZNTA 4E7ZA 2Z22A 4PFWA 1AWBA 4POXA 5EF6A 4CYCA 1JXSA 4ESFA 1K83J 3CCUI 3G7WA 4RJZA 1BTJA 3J7AO 2K9NA 1IXGA 1FPQA 2JPCA 1KYZA 3K70C 4XF5A 3RUMA 3UK4A 3S4UA 3VVEA 3S17J 2CYYA 5L3EA 2DDKA 2RREA 5HS8A 3B6CA 3WG9A 3F6OA 1LEVA 1HSJA 1LJ9A 2O1LA 2XF5A 5EEAA 3S3MA 2HOSA 1A5JA 5KDTB 2G0EA 5CYVA 4MFEA 3KYDB 2FSWA 2W4SA 2JT1A 4M9SA 3H6UA 1F5TA 4R8HA 1RETA 3BJOA 2QA4I 1IGNA 1FTAA 2G93A 1MM7A 2VB6A 3K10A 4I3YA 1X4PA 3S9LC 2DVCA 1FW0A 5FKLA 3S3NA 3H9GA 1BI0A 1J1NA 2XROA 2EV6A 2FMLA 3ZOBA 4U0VA 5JVGF 2UYEA 4EATA 2ZZWA 2MGQA 4OIQF 3O8HA 1IN4A 3OYIA 4E7KA 3DWLE 2LFBA 1B8IA 2ID3A 2O7OA 4AIHA 3WTXC 1IUYA 1DTGA 2CQKA 2RN7A 2VBZA 1BA5A 1SW2A 3LSFB 4GL0A 3S14J 2O9LA 2AS5F 1LBXA 1NK3P 4A93J 3OELA 2ECBA 1IAWA 1NV7A 5K7HA 1XC1A 5EQ7A 3TBIA 3PPQA 4KCDA 4IX7A 1HC8A 5L3FA 2KIFA 2P4WA 1X1BA 1S6LA 2R3SA 1MQGA 2A5YB 4QFOA 5HM4B 1ZTRA 4A3EJ 5I3SA 2ELJA 4AS4A 3TDZC 3BG5A 4MFDA 4CCOA 3CMAI 2LYCA 4CHUA 4KYDA 3HB9A 3D5LA 2NOOA 3QPSA 3AAFA 1UIVA 4GWZA 2PCRA 3KCCA 2IA0A 3R0AA 4RM2A 5ED4A 2WTEA 2V84A 3PNTA 4KN7X 2AL4A 1V4RA 1B3EA 3OIOA 2Q74A 2RCAA 2VJIA 5E18F 1INPA 1R4MB 1SD5A 4RB0A 3N6TA 5ITOA 1JE8A 2I48A 1MXXA 4FATA 3RIRA 3A02A 3I58A 5CVIA 4CXFA 1YHQI 3B6QA 1OJLA 2F7AA 5HBCA 4E4HA 1BW5A 1SMYF 3UKGA 2Q88A 2HQRA 4E0XA 3HOSA 2RDPA 1T8IA 5I2NB 3I59A 4DBQA 4OMZA 2LSOA 1MY1A 2ZNUA 3T1BA 2GFEA 4N6PA 5F0FA 2EFOA 4II3A 3G3KA 5I59A 2K02A 3B7DA 2I4BA 1F43A 3G3HA 3T9HB 1WZ2A 1XGMA 1Y1WJ 5E1XA 2X6OA 3HUGB 1ZKBA 5H8HB 1HSLA 2DSFA 2XX9A 2ECCA 4F29A 2IAIA 2OTJI 2PYYA 3LSIA 3TO7A 2BJIA 6PAXA 1J0RA 4HBLA 3ZP5A 2PBWA 4DCYA 3L2RA 2NVTJ 4GO1A 5E17F 4Y4RA 1BLFA 2E1MC 1J75A 1FOWA 1WFXA 2H8WA 3RN8A 3IP4B 3J80K 1Y8RB 4XRFA 4IOCF 3PD8A 4NE4A 2OCCH 3QYEA 4DYRA 4YG2F 4RS8A 3GW2A 3IRQA 3N97A 1B58A 2RC9A 1W7PA 5KCJA 4OENA 2OZ6A 3KYCB 1AMFA 4N15A 3NARA 3KP5A 3J81Z 3FJGA 4QWQA 2FVZA 2I49A 2HNHA 2STTA 4BHPA 1FTOA 4WXDA 3MVXA 4PBQA 2VUMJ 3E78A 2E1NA 2QYOA 1A36A 5JVTA 1JJ6C 2WX9A 2BHYA 3CMYA 2BV6A 2A68F 1IZ1A 2V7FA 4MQ9F 2HVQA 5K2YA 1MPCA 3E5QA 5LEJA 1N78A 2QVUA 3BPXA 3F23A 2FOKA 5E8GA 2Q8KA 2KLOA 4AC0A 4UA8A 3S3OA 3IRRA 3LA7A 1SD4A 1LAXA 2DMUA 3G4SI 4GXAA 1FJ6A 2XWIA 2DFIA 1BOBA 4BJ6C 2HZLA 2QPQA 2OK2A 2OZUA 1U8RA 2M87A 2EZKA 4LFUA 2VKVA 1Z6TA 5LHHA 4XRSA 1S72I 3KZGA 3MVZA 4P55A 4C3IJ 3RQIA 4ZZAA 1GV2A 3ZN0A 2DWAA 4PAFA 4G7ZF 1AKHA 3IAS2 4PJMA 2KDOA 3IH3A 3AG1H 1KA0A 3OO7A 5HODA 2CRGA 4OFJA 1TT0A 3K0LA 1HBXG 1VSOA 1MQJA 5ITPA 5KCJB 4M4GA 4XOPA 1DU6A 1BN5A 4A3CJ 1JW5A 4O8MA 1BIBA 1Y6IA 3KP7A 3QU6A 2BBYA 4DZJA 4HAMA 3FF5A 1OYIA 3WTYC 1MSEC 3I4MJ 2COMA 5DM6F 1G3TA 2P0SA 2KKOA 3MN2A 5D5UB 1IIWA 2BE5F 2L4AA 1Y3QA 5C3EJ 1USSA 1YLFA 4CCKA 1ZHFA 4HS7A 1BKAA 3A0HC 4RPOA 2YLNA 4XEQA 3HRSA 2EK5A 3QXMA 2V79A 1A35A 4C0RA 4B43A 4LIUA 2D1VA 3OD7A 2F6CA 3BTJA 2DT5A 2XC7A 1KQ9A 1P9QC 2WV0A 4LLLA 4DYQA 5F1RA 2KRFA 5M3FJ 1O3QA 4WEDA 1ZLKA 5CKTA 4EJOA 2WV1A 1XT8A 1HOMA 2R5YA 3VSLA 5DVIA 2XV4S 2RNJA 2A6EF 4HE0A 3VLWA 2KDZA 3RTRA 2HXOA 3HRTA 4W1UA 4L9TA 1MPDA 2RV8A 2LY9A 2YSRA 4I7HA 1BJAA 4UY8I 5LBQA 4NF8B 4KT5C 5I2NA 2B9SA 4WX9A 1HW2A 4Y33A 1POTA 5EDNA 4EF1A 2NAZA 4XIGQ 5IT3A 2R7OA 3FHNA 4XLNF 2C6YA 3P7NA 3BZ6A 5F08A 3LBSA 1Y1MA 4OQOA 5TPAA 4KFQA 3MUQA 3W3CA 4P9UA 2Y7WA 1TW2A 4HV5A 2RC8A 1QJMA 4F1UA 2BY3A 3GZ5A 2BY2A 3VDXA 5ILVA 4OINF 4LZ7A 3K6UA 3OO8A 1PDAA 3Q9VA 1T95A 2WBBA 3HYIA 2HKXA 3CQZJ 1ULYA 4YMAA 1PEBA 2ZSIB 3ECOA 1MDMB 3L6HA 2BW3B 2VGQA 5AA2D 2PJRA 4R6HA 4Y17A 1FOKA 1OCTC 3H3VK 1TFDA 3E3VA 1JUSA 4FE7A 2EBIA 3K2DA 4HTGA 4XLPF 1JNFA 5TP9A 1R22A 3QUFA 1Z1DA 2XAUA 1MMAA 2CUEA 1QULA 1IO2A 4A3MJ 3C7JA 4NC8A 1F1ZA 1GR2A 1WVJA 3H5RA 1N25A 1BR2A 2M45A 4DGWB 2OWZA 2JPBA 3VPRA 3K01A 4YKKA 4LZ8A 1POY1 1YJNI 3CCMI 1P2FA 4JX5A 4EEFG 3QIMA 3O2PE 3ZMDA 3PO2J 4BQQA 4KD5A 4E7LA 1IN7A 1HKQA 5CVJA 3EHTA 3K4UA 4YB6A 2EB7A 4C9YA 5J8FA 3H03A 5FHOA 2VKEA 1B7ZA 5ET7A 4H67A 3OMYA 1J59A 4N6DA 3EUHA 1D1BA 2NVQJ 2DJIA 2XHKA 1LCFA 1VE4A 4ELQA 2DO7A 2EH3A 3RKYA 1UJ8A 1DU0A 2FIXA 1KGSA 3DKYA 2CH0A 3SHFA 3KJTA 2L0KA 1P92A 4WXHA 2Y31A 3CFXA 2LDUA 3QOEA 4RGSA 2E2HJ 2F4MB 4G7HF 1I6BA 3ILUB 1DPUA 3RTFB 5KDTA 5FO5A 2X85A 2DA6A 2XIGA 4MEVA 4WKMA 2XGDA 3MZBA 2FNAA 1K4SA 1QVSA 1NUZA 2FRHA 3CP2A 2H1LA 3OYFA 3C31A 4WXCA 3D5RC 2X6YA 1YW7A 2K86A 2R7QA 2ID6A 5LHGA 1FPIA 2ALUA 4QLCU 3W2VA 3IJOB 3KFMA 2JUGA 1AIVA 4I99C 2VQHA 3UR3C 3SFIA 1HF0A 4KPTA 3J7AY 4PJ0C 3RPUD 5ICGA 1K78A 2XAJA 1XHYA 1CQTA 1SFEA 1Z6RA 2QCOA 2KP6A 3LSGA 4FQGA 4UNOA 1WH7A 1APLC 1SAXA 2JJ7A 4D1QA 2H27A 3G3JA 1YZ0A 1OFCX 4HLYA 1B5IA 2BHZA 2GIZA 2F5FA 3MAJA 1UTBA 1FJ9A 2XWVA 3FBPA 1XC5A 4RLFA 1P1UA 1J09A 1UMQA 4R1HA 1MQDA 2FYIA 5IT9K 3BG6A 5GTIC 1D9QA 1QO0D 2DPDA 2F6PA 3RZDJ 1YE9A 2CW0F 3FWEA 1TWYA 3TODA 5L3BA 2OWSA 3LUZA 3DP7A 3CCEI 3DU5A 1RESA 4MO7A 3MEXA 2R71A 1GXQA 4HX4A 4L18B 4S04A 2EV0A 5GADJ 4POWA 3JTGA 1SPIA 2QSFX 3HKZN 5FFXA 5LHIA 1GV8A 2KQZA 4OIPF 3KYLA 1YRNA 4LUBA 4NGUA 2V3UA 1ETOA 3TAJA 1B72A 4QXDA 3I3LA 1MXUA 4YIFA 4BDOA 3GTMJ 3KBRA 4NF5B 3HRUA 4F3QA 3U1OA 3QQAA 4LK1F 3GXAA 3ULQB 1U78A 2DVZA 3GYYA 2MD0A 1D8KA 3ISPA 4Q0CA 2EILH 4J19A 1OIBA 2WC2A 1SBPA 4M71A 4PCQA 2HAVA 2X6WA 3L2WA 1IMBA 1VFEA 5DEXB 2VHAA 4YELA 5TJJA 4GFRA 3RPUA 3BLYA 4BQOA 4IO7A 3WGIA 4LG0A 2HYJA 4BUPA 3L1PA 3U2RA 4KITB 2MFZA 3H3UA 3A29A 3LQQA 2DYSH 2HS5A 2HFBA 1US4A 2EWNA 3KE2A 1Q35A 3S2HJ 4P1LA 1IMCA 2F34A 3USDA 5TGTA 1K7AA 2AIXA 5ELVA 4BDNA 4MNPA 4OU0A 1VTNC 2H9BA 4B8XA 4H5FA 4KMUX 4ANJA 3BJAA 3C35A 4EXLA 5BUUA 4JVCA 5CPRB 2Z8DA 4LQ2A 3PPNA 2XVCA 1FTLA 4OAYA 2V1UA 1IDYA 2NS0A 3O28A 3OEMA 4OVTA 4KXPA 4OZ9A 3RYRA 2MH9A 1REPC 2HVRA 3R4KA 2WAEA 3OV8A 4M3EA 1YI2I 1GGGA 4YAHX 1SD7A 3RKXA 2XXVA 3Q25A 1IUDA 1XG1A 2LRDA 2ZYKA 4U4XA 3I56I 2FNCA 2IXSA 2X7QA 1U5TB 4PETA 4ZDMA 2REJA 2DWIA 2GHAA 2E1MB 4O3BA 3MKYB 1Y4TA 3OY9A 4IHSA 1J7KA 1FQCA 4MNCA 1MMGA 3TFLA 1UFMA 1E3OC 1H44A 2HDWA 1UG0A 2QQ8A 2F4OB 2NVYJ 1JW4A 1R5HA 1TQMA 3HOZJ 1NFTA 3VDFA 1UTHB 4N6KA 1VQ9I 4HW8A 4A0XA 5FGMA 4RB3C 1XSDA 2CEYA 3ZQIA 2PT1A 3K1NA 1US5A 1DDNA 2HWVA 4ZTFA 1E3HA 2ZB9A 1QPIA 1S3JA 4P3LA 2QS3A 2XHDA 4IOAF 3CUOA 3HM5A 3BTCA 3JZJA 1MNDA 4JSOA 2GZWA 5CQGA 2VP1A 2DA2A 3I6VA 3V8JA 2LD5A 4G7OF 1EH3A 1I6XA 1NI9A 2XX7A 1FBUA 2PFBA 3J7ZI 1MPBA 2R9JA 4BXFA 2DAOA 1IC8A 3FMSA 3L2VA 3DKWA 5F27A 4CICA 3DP6A 4OVQA 3K4KA 1D0ZA 1WSUA 4BDQA 2WADA 4GFBA 1MMNA 2VL8A 2RF1A 5B66C 4XOTA 2CFXA 1VQLI 2XKOA 3Q29A 3VYUB 2IGKA 2K3FA 4Q5TA 1MRPA 1NUWA 5I56A 3RJPA 1GUUA 1FLIA 5B70A 1YIJI 3WU1B 3OR2C 3BKIB 4BLAA 4IO5A 4FORA 3CCSI 1U5TA 3DEUA 4EGZA 4KICA 1IRZA 2VONA 3A4CA 1SQYA 5AE4A 2ZJQF 1ONVA 2JA8J 3O8GA 4XN0A 5HDGA 5DM7F 2QBYB 4UVBA 2KZVA 4MIJA 1FMWA 3HFUA 3ZMTA 4PGHA 1I39A 2Y7PA 3GUDA 5K7ZA 3RY3A 1B9NA 4MAGA 3G1MA 1QW0A 4JP0A 2F5CA 4RMNA 4XRMA 2VJJA 1YJWI 2GA1A 1Y20A 3K0VA 4LP2B 2VXZA 4ENJA 1RYXA 4I09A 2DDBA 3RCOA 1GDTA 1XX5A 3OR1C 3P9KA 3LOCA 4B3AA 3VYRB 2FBPA 4RM3A 4GWSA 2A3SA 1MY2A 4A5NA 3K2ZA 4A5MA 1HLVA 2WBDA 4A69C 5H8NA 4A6DA 2LKPA 3IFCA 3WTSC 2F8DA 4KA4A 4C2UA 1B7HA 1BI3A 1U3EM 4LA9A 1D1CA 2DA4A 3TMOA 1MQIA 1JQFA 2LY1A 1NNTA 5GPAA 4GYGA 4LG0B 3DKXA 4EJVA 3OSRA 2WWYA 1MJBA 4XKPA 3C9HA 3I71A 4HA8A 1S7EA 1QHGA 4OOIA 5B1BH 5CMKA 1A6QA 2MC4A 1I6QA 3PJRA 1P99A 2LMDA 4F19A 4DXBA 2W57A 1LFBA 3QWLA 1PB9A 2A61A 2ZYNA 1LE8B 1IJWC 3V8XB 4KHZE 1JHHA 1FJLA 1SANA 3LUYA 1LFGA 3CC7I 4RAFA 3IWFA 5IAIA 4YKIA 4O3AA 4BH9A 5L9SA 1XMKA 1FQFA 2O5RA 1PUEE 3E4RA 1XGNA 4RAGA 2QFLA 4Q8RA 1N75A 3SFZA 3C4MA 1URSA 5HS9A 3SEWA 5FLMJ 4O7MA 3PFYA 3I5OA 5JFRA 2EFPA 4IQ4A 4MGRA 4I9DA 2ZSHB 3TDUC 5BWJA 3IH2A 3TKDA 4BHBA 5J3LA 2Q2EB 4E7JA 3T9XB 1QZEA 4HQEA 3B73A 4OESA 4U1OA 1BI1A 3H35A 1LKXA 2VT3A 3FX3A 3KEQA 3KIOA 5J4YA 1O63A 2VIXA 1WDNA 3BR6A 1JT0A 3L00A 2FJ1A 2XGXA 3BQYA 2XASA 5FLXK 5FTHA 3OYAA 2LAOA 2R5ZA 4Y7NJ 3HGYA 2F35A 2H09A 1WGXA 3BR0A 3KC1A 4PAIA 4FISA 4CH7A 4CCNA 1S8NA 1LQ1A 3IORA 2IEKA 2A6TA 4G6QA 4XRSG 4AU7A 4RBOA 1Y0UA 2P2AA 5CM6A 3PGFA 3IKVA 1K78B 2FHYA 5IKBA 4XORA 1EF4A 5K2XA 1LCTA 4TQUQ 2KPMA 3SQNA 4WCGA 4H4KC 1TQPA 3DQVC 1EZOA 2OLBA 4L9NA 1FSAA 4JWOA 2XWKA 2L7KA 4HNUA 4DXCA 3FHZA 3BZCA 2F4IA 3W2AA 1B32A 2XF7A 1OQHA 2E7XA 3U1KA 4Z2YA 5GTHC 4PF8A 2EFNA 3TOAA 2AXTC 1ZLQA 4UB8C 3HSTA 3N5LA 1X1AA 2BVMA 3FXLA 4GWXA 4IO6A 1FNNA 1UHWA 4OA4A 2KJBA 3F8BA 1DP3A 1YXIA 3ZKLA 1MBGA 4M3FA 5H2FC 3HL2A 3T0YA 3F22A 1DPRA 4DJAA 2FA7A 3ZQ7A 2DOFA 4NHBA 1R7JA 4Q47A 3OS1A 2X7PA 1IMDA 4LIVA 3MC2A 2F2EA 2G7HA 1PC3A 4CCLA 1B5JA 2WA0A 2NNYA 2XXWA 4JBAA 1TFAA 4YKJA 3C1DA 1FTTA 1ORKA 3FKJA 3CC2I 2QKMB 3MZYA 3PFIA 3M9AA 4FX0A 4PUSA 2P5KA 5J47A 5FRMA 1MM6A 2KLFA 3DTIA 3FKIJ 3D1RA 4RDUA 4RGUA 3S15J 3B8BA 3V8LA 3PPPA 4N8YA 4F22A 2ONKE 5LOMA 2V9VA 2E34A 4OMBA 4P0IA 2EJRA 2ZMEA 3CIJA 1QKBA 5DS9A 3LSKA 2M34A 3RQ4A 2EFWA 3IV5A 1IW7F 1QKAA 4BXUA 3L6GA 3VXBA 3WAFA 1JP4A 2VXDA 4ZE8A 2OV7A 1B8IB 1OCOH 3IO4A 2VPLA 3AXFA 5EYHA 1KONA 5J1YA 2OJED 2AL5A 4NF0A 1R4NB 1YOVB 3ZMVA 2K4BA 3RYPA 3G3GA 3OYKA 2ZNZA 1CGPA 4A3LJ 5AA4A 3KN7A 4I0BA 3BWGA 4XK4A 3H6WA 4XM3A 1EYJA 4KISA 1Y8QB 1R6RA 3CZ6A 3FXJA 1JJ8C 4IHXA 4GVOA 4DQ2A 5D5VB 3LA2A 3BFUA 3IB2A 3GLBA 5KVRA 3DP8A 5EQ8A 3SETA 3ECHA 3OYMA 2CV1A 5CLSA 5IYBJ 2P7CB 3S1NJ 5IP9J 3SESA 5AIQA 3JRHA 1KYWA 1BR1A 4JXIA 2ZNSA 1D3KA 3MWBA 1FY7A 3R60A 3BIGA 3LSWA 1MJ9A 3JRDA 1JHFA 2XRNA 1FPJA 2ABHA 4HYEA 3QPHA 4UXNA 2RNGA 3O9PA 2W48A 1I6HJ 2DS9A 3DPUA 4DYCA 4R72A 5J1UA 4IY6A 4RK9A 3CP8A 1ZARA 4P5OA 1RR8C 2MW8A 1Y56A 5D8LB 2RC7A 4Q48A 4WWCA 4ZZEA 1H45A 5FFZA 1D5VA 1R6ZA 2DE2A 3HC7A 4QFLA 3Q26A 3IOWA 2EA2A 4NC6A 2F97A 1J9IA 2KQRA 4GGGA 5DYMA 1PUFA 2BVLA 4FE4A 4CO8A 2V9KA 1YS7A 3QMFA 4OETA 4P8BA 5DCMA 4H0EA 2GH9A 5DDGA 2O6AA 2XXHA 5ILUA 4KIGA 1D1AA 2I0BA 1UZCA 4ENKA 1LFUP 4ONYA 2H5YA 4UV9A 2L7MP 1R00A 3MSTA 2ZKZA 4NC7A 3TTKA 2FBKA 2Y0SN 4M9XA 5F24A 2LTPA 2Y5LA 1RKWA 5HVQC 3A01A 2JMWA 1AOVA 1MBFA 2DA3A 4ITVA 3HPHA 3KP3A 1YS6A 2D5VA 1B40A 1U2WA 1U9NA 4F3PA 3DBLB 3MWMA 1YTYA 1DPPA 3N05A 3J7YJ 3KOTA 5H8NB 3T0JA 2I10A 2MSYA 1XVXA 3GWZA 2OF7A 3OYNA 4V19K 1FBCA 2MH2A 2W85A 1EH7A 2BY0A 1X3WB 3K1PA 5IOZA 3A3CA 3KGCA 4OANA 3KSJA 5DW8A 1ZRDA 1MXWA 3C3WA 5T3JA 3C18A 4L17A 4TV7A 5FJ8J 3FXOA 2QS2A 4O7IA 4LOCA 1ETWA 4EJTA 2O84X 4THIA 3HHFA 5K5OA 5JK4A 5AONA 1MDP1 4H65A 1FZPB 1IXIA 3LSTA 4OAZA 1N7XA 3B6AA 3E7LA 2K85A 1WI9A 2JK3A 4OERA 1Z7UA 1WVRA 4BY1J 1Q1VA 2XWOA 3PUVE 4MBPA 1B9MA 1Y0NA 2AXLA 4Y15A 5GAHJ 2QLZA 3CESA 3NWTA 9ANTA 5IY5H 3BC8A 1B6HA 2CZIA 1MNMC 2G7UA 3CCYA 4BXXJ 2DPUA 3CCVI 5FKOA 3I54A 1FCKA 1FYLA 4DI4B 4MQVA 2QS4A 5HS7A 2DWJA 5EJCA 1FIAA 1I3QJ 3G2BA 3I4NJ 3UN6A 4RXLA 3Q9SA 4YKPA 2QM3A 4N81A 2ZFUA 3SEYA 2XSJC 3FM5A 4MNUA 4XLHA 4HZFA 2E5ZA 3TW7A 3ERED 4XLCA 4U0YA 1SYHA 2JSPA 2WY8Q 1MW7A 1T98A 3MZHA 2HEOA 2VPNA 3MJNA 1PBPA 4MLQA 4N91A 1SD6A 1H3DA 3GTKJ 2P5VA 2LK2A 5FD5A 4FE8A 4N4OB 5KAIC 3TYHA 2EZHA 1EYKA 1PVEA 1X58A 1XDUA 2ZXHA 1E3PA 3VYTB 2YU3A 1ZTYA 2XB0X 4HSRA 3GBAA 4RPNA 3PUFA 4AB6A 1ETQA 1ZLJA 2XPUA 1ZAOA 4FTHA 4H1XA 4P0GA 1ZGAA 1U5TC 4H5GA 4PJNA 3OOPA 4ZH4F 3H3ZA 1FPDA 4TOZA 2CZHA 3BBRA 3TTMA 2QMWA 1S7OA 3QYBA 3IJXB 2LOOA 3HCQA 3NRVA 4KUMA 2Z33A 1MMSA 3RPWA 2P3NA 1Z7NE 2O51A 2ZMBA 4U7DA 1KU7A 3M3FA 1BC8C 4RB1A 4JQFA 1C0WA 4ENNA 2MLKA 4LITA 3JSOA 4OHNA 2CWEA 5DCMB 1FTKA 1MMDA 1VZ0A 1P1QA 2HPGA 2UYFA 2OUMA 3IC7A 5J1DA 4C3JJ 3RT6B 1W36C 2GOMA 1PUFB 3UNGC 2DQLA 4OWRB 2V3TA 4IO9F 4F3SA 2VJ5A 1ZU0A 2M4KA 3BCBA 2K40A 2DMPA 4M3GA 2WBMA 1FPGA 4IGRA 1PDNC 3DM0A 1Z91A 3S8PA 3ODBA 1YQAA 4I01A 5JHUA 2DA1A 1IMEA 4FIMA 2XD2A 3OYJA 3CDIA 2Y9ZA 2DOEA 1FQBA 3B50A 5DYHA 5ESYA 3FMQA 1W4MA 4D5CA 2O6GE 2PEXA 3PUXE 3F3XA 1Z0XA 4FHTA 3H1CA 2HHMA 2J5PA 1LSTA 4DXUA 4B48A 3S1RJ 4H0WA 3V8KA 4XL9A 4ZYHA 1NMUA 2B65A 1LFPA 5FBPA 1OLCA 1SC7A 4AB5A 1FP1D 3CRBA 2IA2A 1UAAA 4O3MA 2LLKA 1TC3C 1JGSA 3DEWA 2ANJA 3CHGA 2VPRA 2X48A 3KZIC 2ME6A 4ZYGA 3H92A 5J1RA 5FLXZ 4KYWA 3HG9A 3HOWJ 3OSFA 1STZA 3QODA 1B05A 3W6JB 3DF8A 2ESHA 5HLTA 3FDYA 2LG4A 1JUPA 3F9KA 1N77A 2Q9TA 3QUJA 1YRNB 4X9TA 5TU0A 2DW4A 3HJEA 2L9NA 1VF9A 1EA3A 3ZXSA 1DMBA 3WGGA 2DFHA 2EQRA 2L5QA 3CF2A 4RAYA 2P0WA 1WJFA 3COAC 4GDFA 4G12A 3Q3SA 1ZGJA 4ESBA 5E79C 1K79A 2B3BA 1KU3A 2F5EA 1W7PD 1YG2A 2VD3A 2I5UA 4KFCA 3E97A 3GFMA 3PSIA 1J5YA 1UB9A 4A3FJ 3PU5A 2WAQN 3WE2A 3VVDA 2PN6A 3V83A 2BGCA 2XPVA 1MY4A 4OMYA 3DELB 3GFLA 1G4DA 3B02A 3NQOA 4JX4A 2ADUA 4IHVA 1FMVA 1G3WA 4XQFA 1RI7A 2IS1A 3CO7C 1NV5A 3H6TA 3IOVA 4K3FA 4BACA 1XMAA 3TCFA 4IJAA 3OMBA 1USTA 1OMIA 3W9VA 1WJEA 2PMHA 2HQ5A 4ZYEA 1GHCA 4QSCA 3E5XA 1DP7P 4ZDLA 1XS9A 2HU9A 3CTAA 3OL3A 2VBWA 1D0YA 1DOTA 4GD5A 3D5SC 3OOAA 2A5WA 2D1HA 1BM9A 3QPLA 1VFCA 2QMXA 3GTQJ 5FRNA 1S29A 1F9BA 1P1WA 4B4CA 2F48A 5I59B 1I5ZA 3AG2H 1ZG3A 2CUFA 2FOWA 4Q5SF 2F6GA 3S2VA 3DXJF 1QZYA 2F5DA 1VQ8I 3VOEA 3FIRA 3E6DA 3FVGA 4MCOA 1U0JA 4B47A 3KC0A 4OTEA 5BOXA 1G3SA 3EF7A 4EF2A 1GTKA 4AIJA 3IO6A 3TO6A 1B3GA 1B6AA 4PTKA 3CDHA 3BR1A 3F72A 3HTUA 1VI0A 4FT8A 3SJMA 1R58A 1D5YA 2UWMA 1FPBA 2M0MA 2XAHA 2ESNA 3H5NA 1MZBA 2QSGX 1DCUA 1FTMA 2M7AA 4AIDA 2JA6J 1T0FC 3E13X 4AIKA 3FGSA 4N9HA 4BS9A 4M6VA 1FPLA 1RC9A 4CUGA 3BZKA 1WKMA 3V7SA 4C30A 4HNVA 1Y3NA 2F7BA 1EKEA 2XKPA 2FNPA 1S7YA 2RC4A 3BR5A 4HF2A 4V2FA 5H6QA 2HTSA 4D9JA 1DGRM 1V55H 2E36A 1YYZA 2IA4A 2ZCWA 4P11A 4EJWA 5FTIA 1Z3YA 3EUHC 4NUBA 4E0WA 4EQ7A 1W5CC 3GFJA 2RKMA 3IX1A 4HEA2 1U8BA 3QK6A 2B7EA 2UXNA 1R49A 4NF4A 3OSQA 2HZDA 2IBDA 2LBFB 3RGYA 1MBJA 2JA2A 1YITI 1JKRC 2B4LA 4QSHA 1XMXA 4HNTA 2DI3A 2UUZA 2EA4A 3I55I 2X1DA 1II5A 5KHDA 2FQ3A 4BE1A 3PMWA 3M8EA 1S9HA 2DMNA 2IEEA 2NUVA 4R9FA 2VI6A 2QZ8A 4JB7A 3IL2A 2X6XA 1CF7B 2PLYA 1FTJA 3PTYA 5ET5A 2HYGD 3VEPA 5HDKA 2XXIA 3LL7A 1MS7A 3OYHA 3K6GA 3HOXJ 1T38A 3HRMA 2EIJH 2DDAA 4ZECA 1RPWA 1WJAA 1O4XA 1YIOA 3M7GA 1URDA 2Y7KA 2XAGA 3REOA 1B9JA 2XSDC 1D3YA 4BAYA 3WHCA 5IP7J 3CG1A 2KFDA 4RAZA 3EHSA 3FVKA 3MVWA 1UG2A 3FATA 2Z3YA 3MW0A 1KU2A 3T9UA 1JEVA 2IGMA 5IGAA 3TTNA 1MBEA 1X1DA 1NNPA 4HE1A 2NRAC 1BK4A 3IR1A 5EYRA 1LAFE 3CDLA 1OYWA 5FKKA 3R6SA 2AO9A 3KPHA 4D5FA 1ERDA 4H8IA 3TMGA 4NF5A 1YW8A 3LSMA 1OR7C 4OFLA 1FBHA 3JYRA 2V1DA 5H6RA 5C4JJ 4BDYA 5EYGA 3I5UA 3MZ8A 1ZQ3P 2HOTA 2PG4A 3S32A 3SZGA 3JRCA 3N4MA 1OQYA 3OIPA 2QBYA 3QP6A 4UUTA 4ZE9A 2LBFA 2ZC2A 2IPQX 5E1ZB 2Q2CA 5DV5A 4NMYA 1VQOI 2Z1DA 4FCYA 2CW8A 1YCJA 5C44J 1IMAA 2GXBA 3ASNH 3LFKA 2UVJA 1M5DA 1W1WE 3OYEA 3ZSFA 4F7ZA 4C1TA 2CJJA 4IF4A 4CCJA 2CMOA 5EGOB 2WAQA 3ILTB 4A3JJ 1JI8A 1MXVA 3WGHA 4DIGA 3VV5A 1TWAJ 4A0ZA 2FU4A 1W0UA 3OYDA 4YIIA 4CDGA 4YFKF 2ZJ2A 1BL0A 3JAMZ 3N6UA 2XXKA 5BMZA 2OQRA 3K6XA 1P4AA 5ICTA 2K3PA 4HE2A 1M5CA 1XGOA 3BY6A 4U87A 4M73A 1RDXA 1YTVA 1T0KA 1F36A 5FB2A 4H46A 4J00A 2GQQA 2A69F 2Q8MA 5CMCA 1SVLA 1T2KA 3E6MA 3KLNA 2Z8FA 2M3AA 3GLXA 1GVJA 1VNDA 4JVIA 4NB5A 5EG0A 2YPRA 4G94A 4BJTA 3C33A 1IRFA 1NHAA 1XTAA 1YX3A 1H0MA 5FKMA 1JVXA 2DP8A 4M1VA 2K9MA 3TQWA 2PX9A 5E8IA 1K6OA 4N8GA 2L9RA 3TOBA 3CD6I 2YJPA 1WPKA 2B4MA 4GXOA 4G4PA 5DD8A 1VQ6I 5M3MJ 3K1MA 3QU3A 4L5JA 3G1LA 2IS2A 4F93B 1ELJA 5JEIA 3HGGA 2VBYA 2M7BA 1IDZA 3K00A 3EHUA 4IO3A 3L2CA 5DTDA 5HLGA 1MIJA 1IV6A 2HZKA 2QSXA 4MTDA 2PQ8A 2R7FA 4PFPA 1YFHA 3O29A 3VLUA 2YPNA 4XKQA 3TQLA 1USYH 5ICEA 1O3TA 2W7YA 4JDFA 4Z0IA 2GM4A 5EYFA 3QP5A 1RKTA 2V1NA 2PMZA 4HPQA 5CVRA 2BEOA 4IO4A 5LRRA 1JUMA 1FPEA 2L5VA 3MQ0A 2JA7J 2I58A 4ELOA 1X1PA 3JAMK 4U2RA 4BY7J 4C1UA 2DQVA 1P7IA 4XSZF 1LDDA 2JA5J 4BE0A 1H8AC 3VVFA 5JLWA 2Q2EA 3DEEA 2IRFG 5FLVA 4LVQA 1HKTA 1FPKA 2DCEA 2VPOA 2KL4A 3P7IA 4NEDA 3PIPF 3H36A 1HW5A 1ZG1A 4PFRA 4UVCA 3UA8A 3OS0A 2I4CA 3MPKA 2OQGA 3O2AA 3W9WA 4ELPA 4JSDA 2XXQA 3G1OA 4N4NB 4Y13A 3ABTA 2VN2A 3ZGKA 1MDMA 1FOXA 1LB8A 2PBIA 3O66A 1HDDC 2XAQA 4A3GJ 2RKHA 1V5GA 1ACIA 3H06B 1AH5A 5EG0B 2W00A 2HDDA 2ZMEC 4KIBA 3KFWX 4PC9A 5IM2A 3P5JA 4V2GA 2XGEA 1P7JA 3BG9A 3BT9A 4L9JA 1R71A 2O8XA 4BBSJ 1JTYA 1MGTA 1OR7A 3A09A 4GBVA 3R7XA 1DUXC 2BY1A 2GOXB 2CQXA 3CMEI 3ZMSA 3ZPLA 5L9OA 3K4LA 2QGUA 2CGPA 4OIRF 4JYKA 1IV8A 1UIUA 2VJ4A 4WK8F 3A3UA 4XXUA 1A40A 4P47A 4DW6A 5HNHA 4MIMA 4N13A 2ZO4A 1MQHA 2JVGA 1TT5B 2JJKA 1GVDA 3QOPA 5KCMA 4NF8A 3T22A 1Y39A 5EEGA 2OC6A 3MYUA 1WH5A 5LEKA 3G71I 1K6YA 5DVFA 2JWTA 2H6CA 2G9WA 1R9LA 2CW7A 4PGGA 4RNSA 1LBBA 1X1CA 4HF1A 2HQAA 1SD3A 3FXBA 4PDDA 1PJRA 1SFOJ 2I3WA 4XKVA 2MLGA 2H6BA 5TISC 2DT7B 4BE2A 1B51A 2Q2AA 4HV6A 5GPCA 3K4CA 1IMFA 1ZG5A 5F0HA 3ONMA 4II2A 3MBPA 3BIHA 4PDHA 1USYE 2FD5A 5DUKA 1NUYA 2DLLA 3M8FA 3Q0UA 2DK8A 2MYSA 1CNQA 1OVTA 1FSEA 3U72A 3T8RA 3AG3H 4E7IA 1IITA 4KDPA 1I6AA 3RT8A 1MH4A 2JVHA 5L3GA 4F91B 1IG7A 3ASOH 4C2TA 2XXTA 2DA7A 4JX6A 2BXZA 3GTPJ 1QGXA 4LG3A 2NWJA 1LBYA 1Q9DA 3GF2A 3GO5A 2F7CA 2E7WA 1FYKA 3ZR8X 5IZ1A 3OO6A 5J40A 3BQZA 5F6FA 3LSXA 1VFDA 4R6YA 4NX1A 2P5LC 3ZQCA 3IH4A 1L5TA 4EV0A 2GIVA 1LBVA 4GOTA 3MKZA 1LDJA 3ROUA 2KIQA 2X1CA 3I64A 3TEPA 2ZXIA 2HXIA 2ZNYA 2Z23A 2LREA 4CZCA 5M2VA 1PB7A 4QSEA 2ONRA 4RB2C 3LWFA 4L0YB 4UB6C 2M8CA 1VQ4I 4HCYA 5IZ3B 4MLVA 1OPCA 4L5IA 1CF7A 1ATGA 1MBHA 1BC7C 1HW1A 2WB1N 4QFKA 4HOBA 1ZR2A 1T56A 3P9CA 3JV9A 4ZEBA 3OL4A 3WU0A 1XI6A 5FROA 2XD3A 2R7SA 4XMYA 4KCCA 3LSJA 2VT5A 4BQAA 2XA5A 2QQBA 2L3DA 2CSOA 4ETSA 3L2QA 4HDVA 2QS1A 1XOCA 2VLAA 3CR9A 4NF4B 2O03A 4OEUA 5EEHA 1JKPC 2VQGA 3SZTA 1IXSB 4C2MJ 3WTVC 4PBHA 3F0CA 1Y1ZA 5ICFA 2V4JC 2L02A 2W24A 1URGA 1OISA 1IXRC 1LB9A 3EPZA 5I56B 1D4NA 1EV7A 5BNGA 5IYDJ 4BU2A 3S1MJ 2MG4A 2NOJB 4NBQA 3KEOA 5KZTA 2YR2A 4KJZA 4LB5A 2Y69H 4N4UA 2X4HA 4YEJA 5HDNA 2PJPA 3BG3A 1WHUA 5ERIA 1JKQC 4QFPA 3ESWB 3EYYA 3K9TA 1VQPI 3A2KA 5KNLA 4DBRA 3RTWB 3CLQA 3H6VA 4WEPA 3TQNA 3PM1A 2D45A 5HNFA 1OMPA 2H98A 3HZJA 1FWZA 1ZN2A 1QNTA 2R4GA 3W2WA 1B4HA 2EZIA 1DTZA 3VB2A 4OIOF 5BPDA 4GCVA 2ZXTA 4MX6A 1HQCA 3KP6A 2DFFA 2M8EA 2RQQA 4YICA 2AHQA 4PGNA 2JN6A 3ERMA 2OPTA 2PMUA 2RQPA 1MXYA 2XXYA 1MBKA 4H6DA 3AFHA 3PSFA 4UVAA 1E17A 2PMZN 4EXKA 2ETHA 5D4SA 3TW6A 1JVYA 2FEZA 1X2NA 2FBHA 1NV3A 4PQJA 4BDLA 2YU9J 3BTLA 5E3MA 3HOUJ 1NV4A 3OXNA 4QFNA 3U92A 3CFZA 1G3YA 4C3HJ 3FIWA 4ZYAA 5K1YA 1O3RA 2QL3A 2FA5A 1XSXA 3T8TA 3TGNA 4B3XA 4U21A 1HSEA 5A2QK 1AA7A 1B59A 3ROJA 5HOOA 2ZJRF 3JREA 3HHGA 4S05A 1BI2A 4EQQA 3H0GJ 2H4IA 2R7VA 2CV0A 3K02A 4KQPA 4YB7A 4IO2A 3QAXA 4XKNA 1BJZA 4P1EA 3DU6A 3BTIA 2NVUB 3VSKA 1QBJA 4NN3A 2MC3A 4DOZA 4RA2A 1LVAA 2ZBKA 2STWA 2Y84A 4HDUA 3AL0C 4GBWA 5D8KB 3V7CA 1KWHA 3DP4A 1NK2P 1KA1A 3ML6A 1NTCA 4UUSA 3I3VA 4U7BA 5B7DA 2LF7A 3K2AA 1TT1A 1J2XA 3LSHA 1XCVA 4A0YA 3ZQLA 2O8KA 1ETXA 2H99A 1RZ4A 5DEXA 5F1QA 3PUWE 4AM3A 3RSNA 1PP7U 3PQJA 3C34A 1QGPA 3BR3A 5DUIA 3ZS6A 3L2UA 2EZLA 4YRVA 5I5PA 2Y2ZA 1I50J 5CBRA 1G59A 2K4JA 2Y7IA 3KG2A 3HIFA 1Z77A 4X6AJ 2XUBA 2VT2A 5IYCJ 4EQ9A 2OJTA 3MFKA 2DJNA 3LV0A 1MJAA 3FBIB 1ZH5A 4HQMA 4E70A 1A6IA 4RGRA 2F5XA 3W15C 1TTYA 4CA0A 2MABA 2EFQA 2DE4A 4I40A 4I3EA 5EZHA 2BYVE 4LLNA 2Y48A 2XXRA 4CYCB 3IWZA 1H89C 2CQNA 2H8RA 4PJLA 3O6GA 3WODF 2MBFA 2F78A 2R6GE 3OENA 2NS7A 2Q0OA 3SYTA 5D6EA 1TBXA 1X19A 1U9OA 1TWHJ 2H94A 3HBLA 3LA3A 3OIQA 3V4GA 4ZTJA 1SI1A 1HDPA 1G8XA 1IN6A 2YS9A 2R7WA 1P1OA 4XIDA 2OD5A 3GBBA 2UVIA 1OCRH 3MVPA 3M1CA 3LR1A 5E1WA 1QVUA 2ELHA 1B1XA 3RQTA 1R1NA 2VKDA 1WQ2A 4EJUA 4GQOA 4RA1A 4QHQA 5M5WJ 1LGBC 1POGA 1XGSA 2ICWG 2YUSA 4ZDPA 2B0LA 2YX4A 4M6XA 1NKXA 3ZQQA 4ZZLA 2VOPA 2Y75A 3LAJA 1ITYA 3ZKKA 4YZZA 1MD0A 1W5TA 2ELKA 1YPNA 2DOJA 2KR0A 2V3QA 3D4GA 1SI0A 4MTEA 4EUOA 3ZMUA 4HRIA 3KETA 1IUFA 1FBPA 2GHBA 2WYKA 4BGDA 2D3IA 2M0CA 3H0DA 2QRYA 1JW1A 4GXSB 1ZK8A 1FBEA 4MNIA 2OTLI 5B1AH 4FAJA 4EQBA 2P7VB 2BW3A 4EMSA 1LPQA 1RUNA 3T9VA 4R9GA 1R23A 2ZYMA 2VASA 4KI0E 4G9YA 5KK1A 1I27A 1SW4A 4I8CA 1G0IA 3M8JA 1SAUA 3ZRGA 2HCAA 2QUFA 4R75A 3KEYA 4ZEFA 4M3BA 1ON2A 5E3LA 3JRAA 3S2DJ 2LVSA 3JTHA 2AQEA 4G61A 2JTVA 4O6JA 2CMPA 5DEQA 5CC2A 3DBHB 3OYBA 2KIUA 4I0AA 1ETYA 4BEHB 1ZRFA 1VDWA 2F3DA 3D4CA 5DT6A 4MMPA 1KA8A 5FHMA 2DU9A 2I3VA 1E2XA 3KLOA 1RDZA 2M4GA 1ON1A 5LTCA 1QZZA 1TW3A 3CI8A 4CGZA 3I53A 2DA5A 4QPOA 2L2OA 3ONQA 2DBBA 2DXIA 1LFHA 3GTJJ 2DTRA 2IA1A 3E6CC 1IF1A 1QHHD 2Z8EA 4XKRA 3CLOA 5I2KB 1TWGJ 3D0SA 4A12A 1P1NA 3KBZA 1O3SA 1DK4A 2V4CA 1SVOA 5A5XA 3FXMA 4F1VA 3F11A 4MFIA 1ZIUA 1B3FA 4HCWA 3CJQB 4PF6A 1QUJA 3TCGA 1O57A 1R36A 1AHDP 4K2EA 4KNYA 1M5EA 3MMYB 2Z2SB 3TTRA 5LRSA 4Y52J 4ESWA 2NOGA 2PT2A 2E60A 2DMTA 5LGNA 2V93A 3F8CA 3PL8A 4S0HB 1UQWA 3TCHA 4GRIA 1T08B 3FXUA 4F39A 1XS5A 4IZZA 4JK1X 1IN5A 5CVUA 2E2JJ 4G2ZA 2LKXA 1A31A 1A7LA 4EGYA 5ISUA 3T96B 1PP8F 4R6KA 3RI4A 2XGCA 3HPIA 4X1DA 4AS5A 3M07A 1V5EA 4LK0F 3OYGA 4B44A 2LR8A 4A6EA 5I57B 4GF8A 2IVMA 2E1OA 1VQ5I 2IS4A 1DQUA 2W7NA 1Y9UA 3T66A 4BDRA 5H8FB 1XPXA 1JT6A 1TNSA 1LAGE 1ZELA 5IZZA 2MD5A 3CMMA 1QU3A 3LC8A 4BDZA 2HXWA 5LGTA 3MD2A 2QKLB 2KJCA 3LSPA 1HSTA 3GTOJ 4CCMA 3WTUC 3QRFF 1GT0C 2VBXA 1RUOA 1DGWY 3LSLA 3CF5F 5CJ9A 2XXXA 5F7VA 1GLNA 3DBRB 4DIQA 3MCZA 2E19A 3T5XA 2EIKH 4LGWA 4F2OA 2NYXA 3S93A 1LBZA 3G73A 1M1EB 2XXUA 4PFYA 1GV5A 4NHJA 3M4OJ 4BDMA 1K9ZA 1IXHA 2Y0SA 3LAPA 2TDXA 1R9TJ 3C2HA 4PFTA 4BKXA 3IAM2 4QSDA 2E5NA 5GAGJ 4NQ8A 1TWCJ 1WJDA 1T33A 2HEUA 3VE1B 2Y30A 5M5YJ 2HTJA 1AKHB 4IVNA 5FKNA 1DBZA 4XKCA 3MKWB 2EINH 2IJLA 2JUCA 4G8XA 4ABZA 4R73A 3W6KB 3GTGJ 4KT6A 4IRGA 2BZTA 4XSXF 4P96A 3F6VA 2ZJPF 3S1QJ 1Z05A 1DSNA 2DOAA 3CCLI 1UTBB 1ZMGA 3FJMA 3G6EI 4GX4A 1A99A 3JRFA 1N7WA 1V3FA 1B5HA 4ECFA 3HXLA 4B1RA 1AL3A 5ICCA 1HCRA 2L9VA 3H5AA 1M5FA 3E3KA 3BFTA 3RYDA 4NWCA 4EM1A 1XB4A 4AVPA 3CO6C 4XICA 4JWXA 2WY7Q 4IHTA 4P1WA 2LC2A 3MPLA 2ZZXA 4RYAA 3KP4A 5JTYB 1SFXA 3KX2A 3A1YA 2BXYA 2O68A 1WJ5A 4LB6B 5I84A 1Y1VJ 5C4XJ 5IP6A 2THIA 5I57A 2R7ZJ 3WG7H 3GZ6A 5AA2B 2KRHA 1FBGA 2D5WA 3MZ9A 4Z6YA 1Z21A 2XXPA 4G8MA 5J6XA 3OYLA 3DTKA 1SMTA 4A3IJ 4HX8A 1JEUA 5M5XJ 4D7MA 1UCRA 3EQ1A 2W84A 3U65A 3CFLA 4IY5A 3TO9A 4L0ZB 3EN3A 4R79A 1BP5A 3EPEA 3FBNB 3FVNA 1MNEA 1TL8A 4BYYA 1XD7A 3D1NI 2ZYOA 4EM0B 5K7FA 3JSPA 1Z7ME 5CI5A 2CUJA 3BP8A 2Y0MA 3JR9A 2HOEA 3WTZA 2PVUA 4DZPA 1RRJA 4LMYA 4MH5A 3FJ7A 3OYCA 4HLXA 2P1SA 4X8RA 1VQNI 1O7TA 4G77A 1RDYA 4ZJZA 3F8MA 4NWDA 4A3BJ 4IRHA 3SDBA 4RK2A 1OCZH 1JETA 1R1VA 3FMRA 3DLNA 4UABA 2RGVA 3ABLH 5DCFA 4YB5A 1RKMA 4FX4A 4Y3OA 4MEXF 4AVZA 4Q30B 5HPQA 2X51A 2JZYA 4NDLA 4YIRX 4X1EA 2O7UA 4LQ5A 4OXVA 5K5QA 1FTZA 3TDJA 1FRPA 4NG7A 3FZVA 3HOYJ 2Y7RA 1WJBA 3JRGA 3R26A 1A04A 1W36D 1LBCA 4KR5A 5L9MA 3DPTA 4PSXA 4M9ZA 1FYMA 1FPFA 3FK7A 4ELRA 3M3YJ 5IT9Z 3I4PA 2CUZA 4PJJA 5JLXA 3VXCA 2X0LA 2OCEA 4BNCA 2FIEA 1X3ZB 3TKYA 2TRTA 2O61A 2A5TA 1D8JA 1N0TA 2I0CA 3U93A 3BJ6A 3ZQHA 1TNTA 4N9IA 3VODA 4BJ5C 1WJCA 2UXAA 3MP8A 4X0GA 4P9KA 1B4AA 3G3FA 1X3UA 3V42A 1O7LA 4IPAA 1OCCH 1H9TA 3AL0B 3VWBA 4IQJA 3DCFA 1Z67A 4BHCA 1D9VA 2A5SA 3B6WA 1ODDA 1ZRCA 2Y5KA 4AWXB 4F18A 2KHMA 2CEXA 1QPMA