1MH3A

Maltose binding-a1 homeodomain protein chimera, crystal form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
421
structure length
421
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords maltose binding-a1 homeodomain protein chimera
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
total genus 144
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh3A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A01
4XRMA 4UACA 3K01A 1QKAA 4IHYA 2LAOA 1JJ8C 4MF3A 3C33A 3JRFA 3S9LC 4JX5A 1JGGA 1DPPA 1AH5A 2H8RA 5I2KA 1I69A 4DZ1A 1I6HJ 4UUTA 3PV0E 4MH5A 4M4GA 3RN8A 4J19A 5K2YA 5IP6A 2XGDA 1FQFA 4U21A 1JUMA 4HS7A 4YB5A 1II5A 3RUMA 3RPWA 2LD5A 3VLUA 3LUYA 1X58A 3BR1A 5FKNA 3C4MA 3ECRA 4X1EA 2DOJA 4ZZAA 1IUFA 4C3JJ 3A09A 3MAMA 1A8EA 2YU9J 3IB2A 3VVFA 4XRSG 4TLMB 1MY1A 1HSEA 3RKQA 2AL5A 3E3KA 3A3CA 1IXHA 5E3OA 1A40A 1NKXA 4B3AA 4MO7A 3K0VA 4QSHA 3WHCA 3K6XA 1D4NA 3VV5A 3C35A 3QQAA 1R1NA 1QVSA 3C36A 5DTBA 4JSOA 1MBHA 3T9VA 2IEKA 4JSDA 4I6ZA 4RNSA 1BLFA 3FXUA 1WH7A 1FTJA 2XX9A 1B2HA 5TP9B 2HAUA 2O68A 4OHNA 4G77A 3MPLA 5HODA 4GVOA 4XIDA 4H0WA 1LCTA 3A01B 3GBBA 4KYEA 2Z8DA 4EF1A 2ONRA 1U9NA 3CIJA 3KJTA 4A3LJ 4HCWA 3MVXA 1GGGA 3C9HA 1B6HA 2REJA 3K00A 3N5LA 3HSTA 3TW7A 2X7PA 1UTBA 1Z7NE 4OYVA 1SD3A 5I59B 3GLBA 4ZDMA 4F39A 3Q0UA 3LC8A 5I2NA 3TEDA 3IB1A 5F0CA 1ZQ3P 4P0GA 4BBSJ 2Y7PA 3K6VA 2R71A 4PQJA 1B3LA 4I9DA 3S9MC 3PPOA 3SFIA 5EZHA 4TOZA 5IOYA 4NF8A 5GP9A 4U1OA 2XPUA 2ZB9A 3O6GA 4F29A 4GRKA 2XXTA 3UP9A 3KZGA 1LAXA 5IOZA 2DSFA 3FJGA 1IZ1A 1VFEA 2CJJA 5F0HA 1ETKA 4DXUA 2KT0A 3W9WA 4DZJA 3QYTA 4GWOA 4YZZA 2QJEA 3OXNA 3PUXE 5FHOA 1NMUA 2NVYJ 3PPPA 4HCYA 4X1BA 3EQ1A 1QW0A 3TPAA 3BR0A 4C1UA 4BDOA 4GL0A 3CSGA 5EHSA 1X2NA 1IITA 1EU8A 2GRVA 4PFUA 3MVWA 5B70A 4WKMA 5TPAA 1LE8A 4DYQA 4V2GA 2X26A 4YKJA 3U93A 3H03A 3B6TA 4R9GA 4F1YA 1VSOA 3KN3A 4LZ7A 4R6YA 3PUYE 5H8QA 2QMXA 4F3PA 1SVXB 3MP6A 3N6UA 2FYIA 2HFBA 2Q88A 1RYOA 3HB9A 4HNVA 5JTYB 2ESNA 3BTLA 5IYCJ 1Y3QA 3NAUA 3PPRA 2ECCA 2E2IJ 3C31A 3MP1A 2Y7KA 2M8GX 3JRIA 1RPWA 3WHBA 1FTZA 5IYBJ 4IO4A 3EN3A 3OENA 1WGXA 4DDDA 1MM6A 4LZ8A 2YLNA 3V8XB 2B3BA 2X7QA 4YKPA 2OK2A 1JNFA 1S50A 1F9BA 3MKLA 1B3HA 3M8UA 1IGNA 1EH3A 1POGA 1QUIA 4ND9A 1VFDA 4UA8A 4ISUA 4A3JJ 1NK2P 3HN0A 2GBYA 1FTOA 2CQQA 4LP2B 3G3FA 4RDUA 2XXHA 4XK4A 1NL5A 5J1UA 4C3IJ 3IOTA 1JW1A 3H3VK 1F36A 3IH3A 2QRYA 4F2OA 4EXLA 2V25A 4EDPA 4C0RA 1E3OC 3KOTA 3S1NJ 4ZEDA 3ZQHA 3IO4A 2NOOA 3OO8A 1ORKA 2F5XA 2O51A 3ONMA 3HM5A 1B05A 3TP3A 1ETVA 5EF6A 3Q27A 4GFRA 1TT1A 2O6AA 2N8GA 5FHMA 3PMXA 4ELOA 1PB7A 3SJMA 5I58B 3TYHA 5CMKA 4YKKA 3RZOJ 1QPIA 4ECFA 4PETA 3W6VA 3OO6A 3H06B 2O84X 2Q2AA 2XXPA 3JRGA 1P1OA 5M5XJ 5JK4A 5CM6A 3G1MA 3G7WA 3LSLA 3S2DJ 3BG3A 5CRYA 1MPCA 3TTNA 4YKIA 3S16J 3FK6A 2DA5A 4D7NA 1LFIA 2M2EA 2NVTJ 5DEXA 2Q2CA 3SETA 1LAFE 2Y9YA 3BG9A 2RC9A 1CE2A 2I4CA 4NEDA 4NMYA 1LGBC 2DXRA 5B7DA 2R5ZA 2X6OA 1PUFA 1GDTA 4GIZA 3IJOB 1ETQA 3HKZN 1POTA 2AHQA 3S1MJ 2Y2ZA 1JEUA 1DPEA 5EG0A 4F2QA 3S9NC 1AU7A 3HO7A 3OOAA 5EYFA 4EEFG 2XPVA 1B58A 1OVTA 4O3AA 2RCBA 4RY1A 4QHQA 5IP9J 4ELRA 1T0KA 1H76A 1S7EA 1I6QA 1JVXA 1MXXA 1I3QJ 2DYXA 3Q25A 2F97A 5EDNA 1I50J 2UVJA 1UG2A 3O6HA 4ZE9A 1SFOJ 2A5TA 3GXAA 4QFKA 3IORA 3C34A 3BG5A 2UXAA 3TCGA 2H25A 2AL4A 4G68C 5IPAA 1B46A 3ZKLA 4N6PA 1ZJLA 3BTCA 4A3EJ 3OEMA 5FTIA 1US5A 3QK6A 2B65A 5EGOB 3LNQA 3SEYA 3ZS6A 4FEDA 4XKNA 2PVUA 2F7BA 5H8SA 1HSJA 3M4OJ 5H8HA 1DMBA 2A5TB 1BIYA 5M5WJ 3LSRA 1YRNB 3KFMA 5L9OA 4TQUQ 1PC3A 2EBIA 1N3WA 4OEUA 5FHNA 2Y0SN 3KJ7A 3L6GA 3O29A 3T22A 2G0EA 2Y30A 1B1HA 3RTFB 3K2AA 1P7IA 3EPEA 4G8NA 2I10A 4FIMA 3G3KA 2I58A 3G1OA 4JXIA 4IGRA 4NF5B 1N0TA 5CMMA 3HDDA 4LA9A 3ZKKA 5ITPA 4YICA 2ID3A 3KN7A 3K02A 3M3KA 1O7TA 3MVZA 4U23A 4NF6B 2JWTA 2YS9A 2QSXA 2XXQA 5H8FA 1Y1MA 1GT0C 2DA1A 4XICA 4R72A 1JKQC 4XRSA 2OWTA 2ZNTA 3PMVA 3MN2A 2RKMA 4XIGQ 4LONB 2OLBA 2D5VA 1MXVA 4MFDA 4HW8A 3QPLA 2I4BA 1UTHB 2PMZN 4X1DA 5DVJA 4FE8A 5I57A 1MH3A 1D5YA 4EQBA 2H1KA 2YPNA 4POXA 2LY9A 3TW6A 1EZ9A 1GTKA 3SERA 5IYDJ 4DXBA 1ETXA 2QS2A 1ZR2A 2F8DA 1XS9A 1USYE 1BTJA 3E7LA 3JR9A 2Z22A 2OPTA 1R9QA 1XG1A 3I5OA 4OWDA 2WAQN 2D21A 4PFYA 2G93A 1UIUA 4U22A 1JTYA 3SEUA 1B40A 2R9JA 3IOVA 3VDFA 1U8BA 3W9VA 2PX1A 2RF1A 1LB8A 2THIA 1MNMC 1ITYA 3UN6A 3V5AA 4FAJA 1DTGA 4AUXA 5C44J 4M3EA 4EUOA 1ZU0A 2IA4A 1MXZA 3U72A 2L7FP 1MY2A 4I1DA 1JTXA 4GXAA 3KSJA 1JT0A 3IJXB 3IR1A 1SQYA 1ZKBA 4OMBA 4OZ9A 4ESWA 1SDXA 2DWIA 5A5XA 2XGCA 1B7HA 1D9VA 2RC7A 3B6WA 4OFOA 3V89B 1HSLA 5FLVA 4OFLA 3C32A 4QTRA 1B51A 3HGYA 3U8QA 2HXOA 1IV6A 3RGYA 2NUVA 3HOZJ 2JA7J 4M3GA 2X9DA 2M0CA 4E0WA 3UIFA 4I76A 2UVGA 4DCXA 4ELPA 2Q9TA 3MVPA 3ZQLA 2W7YA 2ZYMA 4DIGA 1LFHA 2M34A 4OESA 3JRDA 2F6PA 1LBCA 3KSXA 3IX1A 3FVGA 4A3CJ 5F08A 3MJNA 3G3GA 2BJJX 4ESXA 5K7FA 4ONYA 4IY6A 2QS1A 3TQLA 4KQPA 2LTPA 3CMYA 1P1WA 2DWHA 5AA1A 3FD3A 1ZKGA 5IP7J 4WXJA 1Y3PA 4WEPA 2GHBA 3F11A 2XXXA 4BBRJ 5I2KB 3THIA 4XKPA 2DMTA 2Q8JA 2ANJA 3HOXJ 4ZE8A 4LATA 3TTLA 2KLFA 3T66A 3K2DA 4KI0E 1P7JA 4R2BA 4H8IA 2OF7A 2NVQJ 1JQFA 4Q30B 4RA1A 3G1LA 1NH7A 2DJNA 1MG1A 1URSA 1BW6A 1S9TA 3TEPA 2F78A 3OSRA 1P1UA 5IKBA 4DLDA 3OSFA 4G68A 3VLVA 1B72A 3RZDJ 4NE4A 3QUFA 4KR5A 1VR5A 2VP1A 3TTKA 2R5YA 2V3UA 3G3HA 1OFCX 5ISUA 1ZR4A 5HPQA 4CYCA 3LOCA 3TDJA 3SEXA 4G8HA 5FLMJ 1MQHA 2F7AA 3Q26A 4O3BA 3IL1B 2HAVA 5K2XA 1OCPA 1ELJA 2DQVA 3VXCA 3FK7A 3PPQA 2L7MP 4MLVA 1LCFA 1GV5A 1B3EA 3SESA 1GVDA 1EZOA 2WB1N 4HTGA 2DA4A 3GTGJ 4ZEKA 3QSLA 4PFTA 3BFUA 4X6AJ 3RNNA 4IGTA 3TCHA 1EZPA 1GVCA 5BWJA 1O64A 3A3UA 3CCYA 3PGFA 3B6QA 2ZYNA 4IEJA 1B7ZA 1XVYA 1N84A 3S14J 3IOUA 5J1DA 5F27A 3K6UA 5DTDA 1URDA 3HGGA 5K7HA 2HZLA 1H45A 1UTBB 2VOZA 3OMBA 4BY7J 2F36A 5I2NB 3BR6A 3UK4A 4KD5A 2EZLA 3VVEA 3QUJA 4FATA 2IBDA 3TQWA 2EQRA 3GTQJ 3HEFA 4PE5B 3HHGA 3FVOA 1NNTA 2HEUA 3E4RA 5FKOA 2GFEA 5HM4B 2OBGA 3IAZA 3P7IA 4NF8B 3PMWA 5H8NA 3GTLJ 3GBAA 4XTCQ 2FA7A 3DP4A 2EZKA 1VI0A 2H9BA 3OO9A 3M3FA 3FKIJ 4S0HB 1L5TA 4M3FA 3PM1A 1FIPA 4MBPA 4F19A 2D5WA 2JMWA 5GPCA 2XX8A 3TELA 3OD7A 1FTKA 3HBLA 2HQ0A 4IB2A 4E0XA 5CBSA 3I6VA 4U4SA 4IO7A 1Y4TA 1ZTRA 2R7ZJ 1I6AA 2V3QA 3MW0A 4N13A 5TPAB 3MZ9A 5KDTA 1LE8B 4A3KJ 5JEIA 2F7CA 2R93J 4NF4A 2ID6A 3GTJJ 2CMOA 3KG2A 3Q29A 3U94A 3F0CA 1ENHA 3T96B 3N26A 3HOWJ 3BR2A 3T9UA 1B32A 5EYRA 5H8QB 3ILTB 3FUZA 4XKQA 3OOUA 2O1LA 5AA2D 2F34A 1PDAA 5I84A 4P11A 2DVCA 2RC8A 1PBQA 1Q35A 1AIVA 4DYCA 2I0BA 1T33A 3HCQA 2DMNA 4JWOA 5KDTB 3TTMA 2ALUA 2F6GA 1QRYA 1A7LA 5FJ8J 3B7DA 1VE4A 1R6ZA 2O1MA 3SDFA 2DMUA 2FNCA 2UVIA 3CSBA 1A55A 2W48A 3WAEA 2DE3A 1GV2A 4A3DJ 1FQCA 3TODA 1EF4A 4A93J 4F3GA 1JW5A 3PPNA 5M3MJ 4M1VA 3R6UA 2RAEA 1OLAA 4YAHX 2M8CA 2ZMBA 1POY1 1SW1A 3CG1A 4AC0A 1TWCJ 3JV9A 4ABZA 3MVYA 4Q8RA 1XT8A 1WI3A 1F43A 4JBZA 2IEEA 4JWYA 4L17A 3PO2J 2NWJA 2KDZA 1FIAA 4F31B 2FJ1A 1SI0A 1MBKA 3JRHA 4M6VA 4QF9A 4F18A 2MW8A 4IO6A 1JKPC 3DELB 1Y4CA 3PUWE 3UKGA 3JRBA 5FKKA 4YB6A 1MY3A 3HOYJ 2OCUA 3GTKJ 1MY4A 2QL3A 5AA4A 3LBSA 4BDMA 4DZPA 1OQHA 5AA3A 3S2HJ 2XB5A 5F1JA 1B1XA 5CMBA 1TWAJ 4THIA 3FXQA 2EZHA 3BT9A 3GTPJ 2HZKA 1B5HA 2GHAA 2R0QC 3FISA 2VKEA 2ZYOA 3U92A 2DE2A 2H99A 2XXUA 3KOSA 3HPIA 3GZGA 2AO9A 1HLVA 4QSCA 3RT6B 4Y7NJ 2K9NA 5BNGA 5DEXB 3D4GA 1MBJA 4A3FJ 5BUUA 3CFXA 3TUSA 3TFLA 5EZGA 3B6CA 3MC2A 2E19A 4G2ZA 5FKLA 2R5ZB 5AA2A 2VD3A 4GD5A 2O7IA 5AA4B 1PUFB 3QXMA 1JKOC 4UUSA 3N6TA 1OMPA 3CFLA 1SW4A 4AQ4A 4R74A 5EG0B 1XS5A 1SW5A 3S15J 4TLLB 4WEDA 2E2JJ 2ONKE 4Z0IA 2DWJA 1M5BA 2DA6A 4PP0A 2JA6J 1Y20A 1B7UA 1ZMGA 3IH4A 1MS7A 1WPKA 2NVUB 2MGQA 3GBGA 2WKYA 1MBFA 2P1SA 4ZEIA 1RR7A 4KYDA 2Y31A 4RPNA 3LSGA 1TXFA 3O2AA 1IQ7A 1XVXA 2CUEA 2FD5A 3BTIA 4JP0A 1N7XA 1LFBA 1NH8A 2M9HA 3ZQIA 4QFNA 1Y1ZA 1AOVA 2XXVA 2H4IA 2OZZA 3ZSFA 1FCKA 1PB8A 1R9TJ 3USDA 3KN8A 1MRPA 3PO3J 5KCJA 4KYSA 2ZXTA 4U4XA 2VGQA 5H8HB 1XC1A 2OJTA 1A54A 5E3MA 2UYFA 1LAGE 1D3KA 4LZ5A 1OQGA 1OLCA 3B6AA 5IAIA 3Q3SA 4NWDA 1ZIUA 3BBRA 3TKDA 3D4CA 3TMGA 1TWGJ 3RTWB 5CMCA 1Y1WJ 3S9EA 1JJ6C 4P0IA 4OENA 1QKBA 1QUKA 1MQIA 4GF8A 3PUVE 3OO7A 4H8JA 4YB7A 1MBGA 3MQ9A 1XC5A 4F3BA 1LFUP 3TCFA 3FZVA 4LQ2A 3K4UA 3PD8A 3CG3A 2P81A 1B3GA 4GXSB 2HXIA 2NVXJ 1DU6A 3O9PA 3O66A 2IAIA 4F3SA 4QSDA 3IOWA 5HBCA 4KCDA 4RXLA 2DE4A 5H8FB 4BDQA 2XXWA 3KBRA 3IH2A 1KWHA 1X2MA 2Q89A 4ELQA 1N3XA 3A03A 1JVYA 4KFQA 1FQBA 4EF2A 2UYEA 1UMQA 1GV8A 2L7ZA 2ZNSA 4X48A 4MFEA 4LVQA 2HYJA 5I57B 1H43A 4F1VA 3QAXA 3MPKA 4RK2A 1FW0A 1AMFA 4G4PA 1MY0A 4YMAA 5J1RA 3BR3A 4DE8A 1HDDC 3SEWA 2AIXA 1M5FA 1URGA 1S7YA 5AE4A 2CQXA 1SW2A 2XD2A 4C3HJ 1UQWA 1AKHA 5KZTA 4OQOA 2Z8FA 4AB6A 1WODA 2PMSA 3ZQFA 1FEXA 3SEVA 1BP5A 3OIOA 4G12A 3CQZJ 3QPSA 2DMPA 4FJPA 5FTHA 1O4XA 2PBWA 1BL0A 4B1RA 2FX0A 5EEAA 1LBBA 1ZLQA 2MG4A 2JA8J 1LLSA 3LSJA 3IK6B 4FEBA 2H98A 4H1XA 2TCTA 5F7VA 5JLWA 3R26A 2LK2A 4NDLA 3JYRA 2NS8A 3LSPA 1P99A 5A5XB 5L8DA 3MZ1A 3VE1B 2AYSA 3ZQGA 3L1PA 2GH9A 3BR5A 5GPAA 3EHUA 2K9QA 4NTLA 3SKPA 1JT6A 1MXUA 1OVBA 4R9FA 4AB5A 1G2HA 2I3WA 2DA7A 1LAHE 2XXRA 4I8CA 3S17J 1NNPA 1PEBA 4L5EA 4FE4A 1DOTA 4IO5A 3FASA 3S2VA 2Y7IA 2XHDA 2LFBA 2VKVA 2DWAA 5ICQA 1MDP1 2O9LA 4R73A 3Q0VA 1JW4A 3AXFA 4ZEFA 4BY1J 1IC8A 1SYHA 1MXYA 3K6WA 5TP9A 3HV1A 3GTOJ 1WVJA 2K9SA 4N07A 4LUBA 4NWCA 3D1NI 3LR1A 2WV1A 3UGWA 5J1YA 2ABHA 4RK9A 4POWA 2GM4A 3RY3A 1ETWA 4IHXA 4JDFA 3I4NJ 2QS4A 1W0UA 1K61A 1BJZA 3A01A 3OSQA 3ILUB 3W15C 2XGEA 1SI1A 5DVFA 4EQ7A 4R2FA 3T9HB 3BQZA 1ZTYA 2NXOA 1LFGA 4FCYA 2D3IA 4KPTA 1RYXA 1TWFJ 2JK3A 5I59A 4GOTA 3Q28A 1I6BA 1UHSA 1FTMA 4IHWA 3EHTA 2MSYA 5DT6A 4M3DA 1NNKA 1OIBA 4QFLA 5F04A 5C4XJ 3LSWA 4V2FA 2ME0A 2O8KA 4G68B 1B72B 3TP0A 4U2RA 4OEVA 1FQAA 1B5IA 2L0KA 3MUQA 4JB7A 4GL8A 3OEKA 3TZAA 3E9XA 3VVDA 2R5YB 1U78A 3GTMJ 3EF7A 2ELKA 1APLC 4BDNA 3ZOBA 1QULA 3IV5A 3PUZE 1NK3P 1MQGA 4CYCB 1B8IA 1IG7A 2QS3A 3T9XB 1LSTA 2JN6A 4Q5TA 1A6IA 4H65A 4C1TA 1MXWA 4R6HA 2HOSA 1Q1KA 4FE7A 4IO3A 1HDPA 3A02A 3JRCA 4JWXA 5ELVA 5DS9A 1M5CA 1ZK8A 3JRAA 1IJWC 1QJMA 5JLXA 2R6GE 2GLOA 4ZZEA 3H3GA 4BDLA 1Q1VA 1TFDA 5JTYA 5E3NA 4FTHA 2RINA 1B8IB 2YJPA 1N76A 2XRLA 4BKXA 3HOUJ 1ETOA 1GUUA 3MWBA 2QF7A 1XHYA 3PU5A 4DW6A 1RKWA 3FATA 4BXXJ 3S1QJ 2Y7WA 2I3VA 2VI6A 4D5CA 4I62A 3G3JA 1NFTA 1IDZA 3CFZA 1A5JA 1H3DA 1QVTA 4IO2A 2LKXA 4FECA 2CRGA 3Q0WA 4MFIA 3RT8A 2DP8A 4LQ5A 3BFTA 3I3VA 2DXYA 5H8NB 2DS9A 3K7AJ 2ME6A 1MDQA 1ATGA 4BLAA 1HCRA 2DN0A 1B3FA 2PYYA 3JZJA 3ZQCA 1QUJA 1VF9A 1RESA 2HOAA 1SYIA 1CB6A 3BKIB 3U1OA 2ZYKA 2A5SA 3FJMA 1PB9A 2XX7A 2ONSA 3O6IA 1H8AC 4IY5A 4EXKA 2LVSA 3H6VA 4O3CA 4OETA 2LLKA 2V84A 2Y84A 1DU0A 4NF4B 5DYHA 4QFPA 1Z77A 2P0SA 2UVHA 3HOVJ 1H88C 2G29A 1Z0XA 5M3FJ 3H6TA 1BKAA 3L6HA 3H4ZA 1B5JA 4QRZA 2DMQA 5ITOA 5I58A 1JUPA 2O7UA 4MLOA 1IXGA 4D7MA 4H5FA 1TWHJ 2I0CA 5J3LA 3T93B 1FTLA 4QSEA 2VUMJ 2RCAA 3BTJA 5F1QA 1PBPA 4W1UA 4DCYA 1JKRC 2VHAA 2VPRA 1JUSA 3LSXA 1MPDA 4ZECA 3O28A 1Y3NA 1JEVA 1A8FA 1SBPA 3O8HA 4JYKA 3DM0A 3NARA 1J1NA 4F1UA 2JA5J 2HXWA 4OXVA 3UA8A 3VLWA 2Y9ZA 5CBRA 2CU7A 4Q0CA 4XXUA 1XOCA 3K1PA 4C2MJ 2CZLA 5CI5A 2DA3A 1YTVA 4Y52J 1P1NA 3M3YJ 3EHSA 2XB0X 2R92J 1MSFC 3RQIA 4OVJA 1MPBA 2LP0A 1USYH 3KEIA 4A3BJ 4OERA 3CDLA 1IUDA 1W0TA 1NNFA 4ZS9A 3WAFA 2B3FA 1IRZA 1MQJA 3TAJA 5L9SA 1AL3A 3DEWA 2I6EA 2HDDA 4H5GA 3H6UA 3FGSA 5TU0A 5EHMA 2I49A 1Y9UA 4A3GJ 3IO6A 1OJLA 1YAEA 2X48A 2H5YA 4OFJA 3DP6A 1OCTC 4PFWA 2I48A 2XPWA 4GFBA 2QMWA 1MSEC 2V3TA 3H7MA 2V93A 5EGOA 1AHDP 3N94A 4M3BA 2XXIA 1FJLA 1RKMA 1MQDA 1DTZA 1N7WA 5DVIA 5C3EJ 1YRNA 5LOMA 2HCAA 4MLQA 5F0FA 4RBOA 4KCCA 2E1SA 1WCMJ 2DTZA 5AA2B 4F22A 1B0LA 3E13X 3PD9A 2Z23A 3S4UA 5I56A 1U9OA 4K3FA 1A99A 3G3IA 1UIVA 2EZIA 4RYAA 4UUSB 1MH4A 1ANFA 1TC3C 2XSDC 3VXBA 3TTRA 1BW5A 4D5FA 4H67A 1Z7ME 3M3LA 4FORA 1QVUA 4NF5A 3MZBA 2O69A 1T56A 5L9MA 2XD3A 4G8MA 2QPQA 1ZBMA 3KGCA 2P2AA 1RETA 4LOCA 1FTTA 1GR2A 4JX4A 4X9TA 1R9LA 4DYRA 3O8GA 1O63A 3FVKA 2HOTA 4YMBA 4NF6A 3CI8A 1NTCA 4ZEBA 4AYBN 2E1OA 5I56B 2REGA 4XKRA 1ZGWA 1IEJA 4RJZA 2F35A 3MBPA 3LSFB 1FQEA 1K83J 3MP8A 4DXCA 2COBA 5ICTA 3S1RJ 1UTHA 3SDGA 4R75A 1LB9A 2B63J 3OSGA 4RPOA 4W97A 5KCJB 1CQTA 3HHFA 2O7OA 4YU0A 1B0HA 2QCOA 1SANA 1IDYA 4EQ9A 4IHVA 3V83A 2L9RA 4A3MJ 1TWYA 9ANTA 2ZNUA 2HI3A 1Y1VJ 1H89C 4U1ZA 1B52A 3CR9A 1JETA 1RKTA 1HF0A 3C2BA 3H6WA 2E0SA 3R7XA 3K1MA 2NOGA 3BQYA 3I4MJ 3VPRA 3CVGA 2LR8A 2OWSA 1N04A 3DCFA 3RQTA 3JREA 2VD2A 3FV2A 2PT2A 2CUFA 3FVNA 4R6KA 3DP8A 4JX6A 1TFAA 2PT1A 4KHZE 2YUSA 2XXYA 3DLNA 1DSNA 1P1QA 4FISA 5M5YJ 2JJ7A 3FXRA 1D9YA 4GLIA 3FV1A 5K7ZA 1VNDA 1H44A 1US4A 5E3LA 2ECBA 4OTEA 1IIWA 4QIWN 4GQOA 1BA5A 1YPNA 1M5EA 3OELA 4A69C 3RLFE 2DVZA 1YCJA 3IB0A 4Z7EA 3H0GJ 3UORA 5FKMA 3FJ7A 2TRTA 1IXCA 4A3IJ 2Y7RA 3FIWA 1WH5A 1IXIA 4H6DA 4B4CA 2EH3A 1MBEA 4BDRA 3VFJA 2NS7A 3QIMA 2Z8EA 3O97A 1M5DA 1MM7A 3ODBA 1HOMA 1B4HA 5CC2A 1FQDA 1B9JA 1ETYA 3CRBA 2DA2A 2FQ4A 2HQ5A 4MIMA 4QFOA 1AKHB 3K1NA 1B4ZA 1WDNA 1VFCA 2K40A 5C4JJ 5M2VA 2E2HJ 3FIRA
chains in the Genus database with same CATH superfamily
4XRMA 4UACA 3K01A 4OAZA 2R7FA 1QKAA 4IHYA 2LAOA 2EK5A 1JJ8C 2GIZA 2OQGA 4MF3A 3C33A 3VEPA 3JRFA 3S9LC 2P7CB 2EJRA 4JX5A 1JGGA 2X6WA 3WTUC 1J59A 2Y69H 1DPPA 4BQOA 1AH5A 3K4LA 1V4RA 2H8RA 5ESYA 1I69A 5I2KA 4O8MA 3VVDA 1LQ1A 1DPUA 1A35A 4DZ1A 2IS2A 1I6HJ 2WV0A 4UUTA 3AAFA 3PV0E 4MH5A 2GAUA 1K4TA 1ON2A 4I3EA 4M4GA 2HZTA 4XL9A 2DJIA 2LY1A 3RN8A 4J19A 1Z21A 5K2YA 1IN8A 3E5UA 1H0MA 3KZIC 5IP6A 3T96B 2XGDA 1FQFA 2PFYA 4U21A 1JUMA 1FBQA 4HS7A 4YB5A 2PQ8A 1II5A 3I59A 4G2ZA 3E6DA 2HVRA 3U65A 1G6NA 3F21A 3RUMA 3BJ6A 3DXJF 3RPWA 2LD5A 3VLUA 3LUYA 1X58A 3BR1A 4HAMA 5FKNA 5TRDA 4U0YA 3C4MA 4X1EA 3ECRA 2DOJA 1R5HA 4ZZAA 4L9TA 2WAFA 4HQEA 1IUFA 4C3JJ 2VT3A 3A09A 4OINF 3MAMA 5L3BA 4LIUA 1JHFA 3OOPA 4M71A 1G4DA 1A8EA 2YU9J 1USSA 4ZYHA 3IB2A 1KGSA 3VVFA 5KHDA 4XRSG 4TLMB 1MY1A 4PJMA 1HSEA 4ZDLA 3RKQA 5CQGA 5ET8A 2AL5A 3E3KA 3A3CA 2MYSA 1BK4A 1IXHA 5E3OA 1KA8A 1A40A 5CYVA 1NKXA 4B3AA 4MO7A 2KQZA 4NQWB 1NG7A 3K0VA 4QSHA 3PTYA 2IA1A 3ULQB 2GOMA 2HDWA 5HVQC 1A6QA 3WHCA 3QP5A 4BH9A 2BW3B 3WU1B 1D4NA 1NUXA 1IMFA 3K6XA 3QQAA 1R1NA 3C35A 4XOTA 4RM2A 4ENKA 1QVSA 4JVIA 3C36A 5DTBA 2BE5F 2V79A 3DKWA 3KX2A 4LFUA 4JSOA 2X0LA 2VE8A 1MBHA 2XF6A 4HF0A 3T9VA 1ZRDA 1FPJA 2IEKA 1SD7A 1DP3A 3RPQA 4JSDA 4I6ZA 1VQPI 1BLFA 4RNSA 3FXUA 1WH7A 1FTJA 3PSIA 3E5XA 1B2HA 2XX9A 1WHUA 4QLCU 1IMDA 1K9YA 5TP9B 4F93B 2F5FA 5JVGF 2RN7A 2HAUA 4E7LA 2O68A 4OHNA 1HKSA 4G77A 5I5PA 1YIOA 1EH8A 3MPLA 2MD5A 1X4OA 5HS9A 3NQOA 4IVNA 5HODA 1FTAA 4GVOA 4XIDA 1N77A 1A04A 4L9NA 4NN3A 2I5UA 1CF7B 5JHUA 5IT3A 3WE3A 2DPDA 4H0WA 1LCTA 2P0WA 2VL8A 3CLOA 3A01B 3GBBA 4MHGA 2Z8DA 4KYEA 2WB1A 4EF1A 3WG9A 2ONRA 1U9NA 4HX4A 4YFXF 1HKQA 2QZ8A 3CIJA 2VBZA 3KJTA 3FHNA 1KZHA 3TO6A 4A3LJ 2OD5A 2HEOA 4HCWA 4PE3A 3MVXA 1GGGA 3C9HA 4GYIA 3M8EA 1TNSA 1B6HA 2OWZA 2REJA 3BOQA 3HSTA 3TW7A 3K00A 3N5LA 2XWIA 2D2WA 1Q9DA 4LG3A 2X7PA 1P92A 1UTBA 1Z7NE 4OYVA 1XCBA 1SD3A 1I3AA 5I59B 3GLBA 2IRFG 4ZDMA 3J7ZI 4F39A 3Q0UA 3LC8A 5I2NA 3TEDA 2XUBA 3OYAA 2D1HA 2AQFA 5F0CA 3IB1A 1XGOA 2E35A 5ED4A 1LUJB 2FUG2 3C18A 1ZQ3P 4P0GA 2LY2A 4YIRX 1KYZA 2VBYA 4BBSJ 1X4PA 4LLLA 1TBXA 2Y7PA 5HDGA 4YKIA 3K6VA 2PJRA 2R71A 2FA5A 3J81K 4PQJA 3KEYA 5E1ZB 2BYVE 2E5ZA 1B3LA 4I9DA 3S9MC 5TISC 4XQFA 3PPOA 3WGHA 2XDVA 2E1NA 3OMYA 4Y15A 5EZHA 3SFIA 3ZR8X 4DIQA 5IOYA 1XCVA 1S72I 4NF8A 5GP9A 2HYFA 4D0PA 4TOZA 1EYIA 1OCOH 4U1OA 1O7LA 2XPUA 3F72A 2ZB9A 3O6GA 4F29A 4MQ9F 4AIDA 5B1BH 5HNFA 4KIGA 2VASA 4GRKA 4OVTA 4ONYA 2XXTA 3UP9A 2KRFA 3KZGA 1D9QA 5EQAA 3ROJA 1LAXA 5IOZA 3DP7A 3W3CA 3GCMA 2DSFA 2WBMA 1IZ1A 2FBKA 2CJJA 4LMYA 5F0HA 1ETKA 1VFEA 2Y5KA 3FJGA 1D0YA 2KT0A 4DXUA 3W9WA 4DZJA 3QYTA 4GWOA 4YZZA 2QJEA 3OXNA 3PUXE 5FHOA 1NMUA 2NVYJ 3PPPA 4HCYA 4X1BA 2L9VA 2KIQA 1QPMA 3N05A 2DT6A 3EQ1A 1QW0A 3I0TA 4P55A 3T0JA 3L2CA 2O6GE 2ZJ2A 3TPAA 3BR0A 4BE1A 3VV5A 4C1UA 2RKHA 2Z2SB 2IXSA 4GL0A 1Z9CA 3CSGA 4BDOA 2VC0A 5EHSA 1X2NA 3K9TA 4FX0A 1IITA 1EU8A 4PSXA 3SYTA 1YJWI 5LEKA 2VJJA 2GRVA 3PNYA 3MVWA 4PFUA 3LA7A 5B70A 1W5CC 4WKMA 1N25A 5TPAA 3COAC 4Y13A 1LE8A 3KIOA 2DI3A 4DYQA 4V2GA 4N6DA 2X26A 3GZ5A 2P5LC 4YKJA 3U93A 3PNTA 1PUEE 1OLTA 4PBQA 3H03A 3B6TA 2P8TA 2IA2A 4R9GA 4F1YA 1VSOA 2DDAA 2E7WA 4NC8A 3KN3A 4LZ7A 4R6YA 2WY8Q 3PUYE 5H8QA 2QMXA 4F3PA 1SVXB 3MP6A 3N6UA 2XV4S 3L2UA 3GZNB 1ZG1A 2FYIA 2JUCA 2QFLA 2HFBA 3ZN0A 2Q88A 1RYOA 1V55H 3HB9A 4HNVA 5JTYB 2ESNA 2Q0OA 3EETA 3BTLA 1R4NB 4N4UA 5IYCJ 1ZGAA 1Y3QA 2X85A 4G6DA 3ECOA 2W7NA 3NAUA 4HOBA 3KFWX 3PPRA 1BC8C 2ECCA 4MTEA 2W84A 3RSNA 2E2IJ 3C31A 3TKYA 4OMZA 5GADJ 2Y7KA 3MP1A 2M8GX 3JRIA 4JVCA 1RPWA 4N9IA 2A07F 1LDDA 2X1CA 4O94A 3WHBA 4AS4A 3MKWB 2FHYA 4WK8F 5HS8A 1FTZA 2H09A 4CGZA 2V1XA 5IYBJ 4LK0F 3OYMA 4IO4A 3CJTB 4B09A 4HLYA 3NWSA 2QQ9A 3EN3A 3OENA 5A2QK 5CKTA 1WGXA 4DDDA 1MM6A 4LZ8A 2YLNA 3V8XB 4HLXA 4RLFA 2H6CA 2B3BA 2X7QA 4YKPA 3HZJA 4P1WA 2LF8A 4B8XA 1B1BA 2Q1ZB 1LNWA 3OYHA 2OK2A 4C2TA 2VPNA 1JNFA 1S50A 2VC1A 4ESFA 1XGSA 2RV8A 2W1OA 1VQ7I 3MZHA 1F9BA 3MKLA 3CF2A 4NF0A 5FRNA 4GXOA 3VSLA 1B3HA 4XRFA 3M8UA 1LBVA 1IGNA 3QPHA 2VOPA 4MNCA 1EH3A 1POGA 1QUIA 4ND9A 1VFDA 4UA8A 2UV1A 2MLGA 2G9WA 4ISUA 4A3JJ 4P1LA 4E7SA 3MCZA 1NK2P 2GBYA 3AL0C 3HN0A 1FTOA 2CQQA 3F22A 4LP2B 3G3FA 3T1BA 4RDUA 2E1CA 3OYBA 3V7CA 4XK4A 1T2KA 5J1UA 1NL5A 4C3IJ 2XXHA 1BIBA 4U7DA 3IOTA 1JW1A 2FVZA 5K1YA 2DDBA 3H3VK 1F36A 3IH3A 1FBPA 2QRYA 3BDDA 1OQYA 3L00A 3LSHA 2PG4A 3HPHA 3L2VA 4F2OA 4EXLA 2V25A 4EDPA 1G3YA 1G3TA 4EGZA 1E3OC 4C0RA 3KOTA 3S1NJ 2F3BA 4EGYA 4ZEDA 3ZQHA 3UR3C 2F6CA 2ZSIB 2NOOA 1XI6A 3IO4A 5AONA 4RA2A 4ASNA 1YHQI 3OO8A 2LBFB 1ORKA 4IF4A 3WU2C 1SEUA 2OV7A 3ZQQA 2F5XA 1VQMI 2O51A 3ONMA 3HM5A 1B05A 5CVIA 3ROUA 4LLNA 3TP3A 1ETVA 5EF6A 3OYIA 3RKYA 3QU3A 1FBCA 3Q27A 3HUGA 4Y17A 1TT1A 2O6AA 2N8GA 4GFRA 2VPOA 3PMXA 5FHMA 4ELOA 3ZMDA 2F4IA 1PB7A 1T0FC 3VYUB 2PFZA 4P47A 1WJEA 1MJAA 1U5TA 3SJMA 4OIPF 5I58B 2P5KA 2QQBA 3TYHA 5E18F 2IS6A 2LC2A 2Q2EA 3SZGA 3RZOJ 4YKKA 5CMKA 1QPIA 2V1NA 4DQ2A 2FEZA 4ECFA 4PETA 4PCQA 3W6VA 3OO6A 3H06B 3T9UA 3OYCA 4H4KC 3T8RA 2O84X 2Q2AA 2XXPA 3JRGA 1BIAA 4L0ZB 1P1OA 5M5XJ 5JK4A 3ZMVA 5CM6A 3G1MA 3G7WA 3LSLA 3S2DJ 3BG3A 2DDKA 1MPCA 5CRYA 3TTNA 2F5VA 1FT9A 1FBSA 3SEQA 4IKFA 2K3FA 3S16J 3C7JA 2DA5A 3FK6A 4D7NA 3OYGA 3GFLA 1LBYA 3OYFA 1SAUA 3ONQA 2YU3A 3I9V2 1MNEA 5DEQA 4YRVA 1LEBA 1B6AA 1LFIA 3LSIA 4IB2A 2M2EA 2KRHA 2NVTJ 2M87A 3LV0A 3WODF 5DEXA 2Q2CA 1RI7A 3SETA 3OIQA 4JK1X 4PFPA 1LAFE 4I40A 2Y9YA 1LJ9A 1GHCA 3BG9A 2RC9A 1CE2A 4NC7A 2I4CA 4IRIA 4JVDA 1LDJA 4NEDA 1LGBC 4NMYA 2BGCA 2A6TA 2LSOA 2UXXA 1I5ZA 4YG2F 2DXRA 5B7DA 2R5ZA 4QPOA 2KIUA 2X6OA 4KN4X 5KCJA 2M3AA 2VODA 1D5VA 1PUFA 4Y3OA 1GDTA 4GIZA 3IJOB 2IGMA 1ETQA 1BI2A 1LBWA 3HKZN 3ISPA 1POTA 4EMSA 2AHQA 3S1MJ 1YFHA 2Y2ZA 5J47A 1JEUA 1P2FA 1Y8QB 3QPTA 2FNAA 1DPEA 5EG0A 4F2QA 3S9NC 3IRRA 1AU7A 3HO7A 3OOAA 5EYFA 4EEFG 1O7FA 2PX9A 4DOZA 2XPVA 2GQQA 2M0MA 5LRRA 1B58A 1FPFA 1ONVA 2QGUA 1OVTA 4O3AA 2RCBA 3EQLF 3VB2A 4QHQA 4Q48A 5IP9J 4RY1A 5FFZA 1IRGA 3BP8A 3ZMSA 2MKZA 4PFOA 4ELRA 1T0KA 1H76A 1S7EA 1I6QA 1JVXA 1MXXA 3W2WA 1I3QJ 4O6JA 2DYXA 3F8CA 2LNBA 1Z7LA 5EDNA 2NXNB 1J75A 2VOOA 2F97A 1I50J 3Q25A 4HNUA 2R8TA 2RC4A 5FB2A 1YITI 2UVJA 3KEQA 1UG2A 3GYYA 2FOKA 3FBPA 4ZTJA 3O6HA 4ZE9A 1SFOJ 1K6YA 2A5TA 1U8RA 1R7JA 5ICEA 1IUYA 1R23A 3GXAA 3OYDA 5LHGA 2Z33A 4QFKA 2JSCA 3V4GA 3C34A 3IORA 4L18B 1QGXA 2VBXA 2QA4I 2ZMEC 4E6KG 4U87A 1FZPB 3BG5A 2CV2A 2KISA 3AG3H 3BIHA 2UXAA 3TCGA 1QNTA 1NV4A 2H25A 4A0ZA 2AL4A 2GWRA 2HQRA 2DTRA 1SD6A 1ZRFA 4KN7X 4G68C 2OBPA 5IPAA 1B46A 3ZKLA 4L0YB 4N6PA 4CCOA 1ZJLA 3BTCA 1PDNC 4NAPA 2BHZA 2ACJA 4A3EJ 3OEMA 2OA4A 3L2WA 5FTIA 1FPKA 1US5A 1JGSA 2K3PA 4MNIA 1WJ5A 3I3LA 1LDKB 3GFMA 2HPMA 2IS1A 1RDYA 2B65A 3QK6A 5EGOB 3LNQA 3SEYA 1XDUA 3RPUD 2BY2A 1VDWA 3ZS6A 3V8KA 1OCRH 1LVAA 2B9SA 4FEDA 4XKNA 2PVUA 2F7BA 3RKXA 5H8SA 1YO5C 1HSJA 3DPLC 5FO5A 5L3EA 3M4OJ 3BPXA 3CHGA 1DMBA 2A5TB 5H8HA 1BIYA 5B1AH 5M5WJ 2DAOA 3LSRA 4OEVA 1YRNB 3KFMA 4M6XA 1G0HA 4LK1F 4TQUQ 1PC3A 2XAUA 1XDSA 5L9OA 2EBIA 1N3WA 4S05A 3A2KA 4OEUA 5FHNA 1R22A 2Y0SN 3KJ7A 1MDMA 5J8FA 3L6GA 5F24A 2CW8A 4TV7A 3O29A 4YFKF 1SAXA 1XB4A 4IQ4A 2WY7Q 2G0EA 3T22A 4I0BA 4RM3A 4Q47A 5LLQA 3ABTA 2Y30A 1B1HA 3FHZA 3A4CA 2R7WA 1IV8A 3FXBA 1SD4A 2BY3A 3RTFB 3K2AA 2QVVA 1P7IA 4P3LA 2X1EA 2JVGA 4ZDOA 3EPEA 4G8NA 2I10A 4FIMA 4ETSA 2I58A 3G1OA 3G3KA 1NUYA 4JXIA 5CPRB 4IGRA 2G7UA 2YX4A 4NF5B 1N0TA 5CMMA 1Y6IA 1WWXA 3HDDA 4LA9A 5GTHC 3ZKKA 4KIFA 1Z05A 4UVBA 1IN4A 5ITPA 5J6XA 4YICA 2ID3A 3KN7A 3K02A 3RDIA 2L2OA 2LG4A 1O7TA 3FM3A 4LG0A 3M3KA 2XASA 2KLOA 3MVZA 2IPQX 4U23A 4XKBA 2QKLB 4NF6B 2K27A 3LAPA 2JWTA 1LBZA 4U88A 1XGNA 2YS9A 2QSXA 2NS0A 2WTEA 4CCMA 2FRHA 3HTSB 2XXQA 5H8FA 4EJVA 1Y1MA 5IZ1A 2EFQA 4X04A 1GT0C 2DA1A 2WWYA 2KIFA 4XR6A 1UB9A 1W7PD 4XICA 4R72A 2ZNZA 1JKQC 4XRSA 4RGSA 1G0IA 1DPRA 2OWTA 2ZNTA 2E36A 4A6DA 2QSGX 1WJDA 3MN2A 4L9JA 4RAFA 3PMVA 2RKMA 3GMEA 3CC2I 4XIGQ 4LONB 4GO1A 1W5TA 2JVHA 2D5VA 1MXVA 2OLBA 1FC3A 2GOXB 4MFDA 4HW8A 5FLXK 3BZ6A 3DBHB 3QPLA 1WZ2A 2VONA 1S7AA 2I4BA 2V6EA 1JE8A 1UTHB 4A5NA 2PMZN 5FD5A 4X1DA 5DVJA 3CP2A 1IW7F 2MH2A 4FE8A 5I57A 1MH3A 1J7KA 4JQFA 1D5YA 1KZ8A 2H1KA 2YPNA 4EQBA 4POXA 1X3UA 2LY9A 1SVMA 4H45A 3TW6A 4CICA 1EZ9A 1GTKA 5IYDJ 3SERA 1ETXA 4DXBA 2L02A 2QS2A 1ZR2A 2F8DA 1XS9A 4MEXF 4G94A 1USYE 4BDYA 1BTJA 4RLQA 3G6EI 1KA1A 5IT9K 3GFIA 1IRFA 3E7LA 3JR9A 2Z22A 1YX5A 4E70A 1AOYA 2OPTA 1R9QA 1XG1A 2O0YA 3I5OA 4OWDA 5LTCA 1SPIA 2WAQN 4HSRA 2D21A 4PFYA 1MKMA 2G93A 3GLXA 2PEXA 3S93A 2W57A 1UIUA 4U22A 2D1VA 1JTYA 2WYKA 3SEUA 1B40A 2CZIA 2R9JA 2PFBA 4N4OB 5HOOA 3IOVA 3VDFA 3DKXA 1U8BA 1ZHFA 3W9VA 3I54A 2PX1A 3GF2A 2RF1A 1S3JA 2HVQA 3OS2A 4HZFA 2V26A 4BXUA 3WTYC 1LB8A 2THIA 1MNMC 2E7XA 3C3WA 5ILSA 1ITYA 3UN6A 3V5AA 4BQNA 4FAJA 3A0HC 1DTGA 2ZFWA 4AUXA 3V7RA 2BXZA 2GIVA 4AD9A 1MMGA 5D5WB 4HXVA 4GX4A 3H92A 5C44J 3PJRA 1I39A 1SFXA 4M3EA 4EUOA 4NHBA 4PJLA 1ZU0A 2IA4A 4HQMA 1MXZA 3U72A 1FOWA 2L7FP 1MY2A 4I1DA 5DCMB 1P4XA 5DM6F 1JTXA 1IRXA 1OR7C 1XPXA 4GXAA 2NRAC 4YFNF 1BR1A 3K0LA 1QBJA 4HNTA 4C9YA 3KSJA 1JT0A 5BQTA 3IJXB 5ET7A 1FBGA 3IR1A 5EYHA 3TMOA 2GA2A 3ASOH 5D5UB 1DK4A 4DBQA 1SQYA 1ZKBA 4OMBA 2K85A 1WI9A 2COMA 4DJAA 4OZ9A 4UUVA 2E71A 1SDXA 1ZREA 2DWIA 4ESWA 5A5XA 2XGCA 4PJ0C 2JJKA 4JOMA 1B7HA 3HRUA 1D9VA 2ZJRF 2C6YA 2RC7A 3B6WA 4OFOA 1FMWA 2R7OA 3V89B 1HSLA 5FLVA 1T0FA 3C32A 4OFLA 4QTRA 1B51A 4OVRA 3E6MA 2XGXA 3HGYA 3U8QA 2HXOA 4A0YA 1IV6A 3RGYA 2NUVA 1MGTA 2A6HF 3HOZJ 1YTYA 2JA7J 1ZG3A 4M3GA 2KZVA 2X9DA 2CEXA 3K10A 3HL2A 3CUQC 4ZYEA 5E8IA 4RB1A 2M0CA 2ZXJA 5HS7A 1OISA 4E0WA 2O3FA 4I76A 4IXAA 2UVGA 3EUHC 4EJTA 3TOBA 2V9VA 2HPGA 3UIFA 4DCXA 2Q9TA 4ELPA 5A5LA 1HQCA 2XAFA 3MVPA 3E97A 3ZQLA 2W7YA 2ZYMA 2B7EA 4P1EA 4DIGA 1LFHA 1FBHA 1YS6A 4IRHA 3S8PA 2M34A 3NOHA 1JP4A 4OESA 3JRDA 2F6PA 2HPIA 3R0JA 1IMEA 1LBCA 2BVLA 3KSXA 3IX1A 3FVGA 2WC2A 4A3CJ 5F08A 2BY0A 2E1MC 3QOPA 3MJNA 2DLLA 2KQRA 3LSTA 4NB5A 1IN5A 3MKYB 1W7PA 3IRQA 1DP7P 2CUZA 2BJJX 3G3GA 4ESXA 4R79A 5K7FA 1RR8C 2QS1A 3B50A 4UXNA 2FOWA 4BHBA 4IY6A 4KQPA 4OVSA 3TQLA 2LTPA 3CMYA 4B44A 4B43A 1P1WA 2DWHA 3HXLA 5H6QA 5AA1A 3J81Z 2ZXHA 4HX8A 3FD3A 1ZKGA 2LKPA 1I27A 1BI1A 5IP7J 4U7BA 2B4MA 2XXKA 4WXJA 1Y3PA 3MMYB 2VIXA 4KIBA 4WEPA 1K78A 2GHBA 2P5VA 4WCGA 1YYVA 3ELKA 2PN6A 3F11A 4OWRB 2XXXA 4QBAA 1OCCH 4UV8A 4BBRJ 2FBHA 1WJCA 2OZUA 5KNLA 5I2KB 3THIA 4XKPA 1PVEA 2DMTA 2O61A 2Q8JA 4Q5SF 4XBFA 1MJBA 2ANJA 3HOXJ 2IT0A 4ZE8A 4LATA 4N4NB 2KLFA 3T66A 1YYZA 3K2DA 3TTLA 4ZYDA 4KI0E 3ABLH 1P7JA 2IP2A 4WXDA 2ETHA 2YSRA 4O3MA 2STWA 2OX3A 4R2BA 4H8IA 2OF7A 2NVQJ 1JQFA 3HRTA 3PFIA 4AM3A 4Q30B 1KU2A 1RZ4A 3I59B 4RA1A 4HW0A 4MQVA 3G1LA 1GLNA 3NEUA 1NH7A 2DJNA 4OIRF 1MG1A 4FQGA 2ZMEA 3H5AA 1YJ9I 1URSA 1BW6A 4RB2C 2OTJI 1S9TA 3TEPA 2F78A 3OSRA 1R1VA 5BS6A 1M1EB 2ICWG 1P1UA 4WX9A 5IKBA 4DLDA 3OSFA 3OV8A 3FMSA 1YQAA 2R7RA 1FPDA 1K78B 4G68A 4DI4B 3VLVA 2GXGA 2RVCA 2FF4A 4AWXB 1BOAA 2KJBA 5K5RA 1B72A 1R49A 3RZDJ 4NE4A 3QUFA 5T3JA 1E17A 3QMFA 2K02A 3ERED 4KR5A 5L3FA 1VR5A 5KVRA 1F4KA 2VP1A 2ZZVA 4DNCA 2XHKA 3TTKA 3BG7A 1ZGJA 2R5YA 4MHFA 2V3UA 1BR4A 1D8JA 3G3HA 2EPFA 2NAZA 1OFCX 3K69A 1K6OA 4CCLA 2ELJA 3FMRA 4L9VA 5ISUA 3HJEA 4NQ8A 3N4MA 1ZR4A 4MX6A 4KFCA 1PP7U 5HPQA 3DBLB 1FPLA 4EATA 4CYCA 3R4KA 3LOCA 2W00A 3TDJA 1KQ0A 4HE2A 2PJPA 3SEXA 1FNNA 4G8HA 5FLMJ 3CCUI 1FSHA 1MQHA 2F7AA 2FIEA 1LFPA 3Q26A 4PJNA 2EIKH 3QRFF 3RCOA 4O3BA 3DV8A 4ZZDA 1OKRA 3IL1B 3DPUA 2HAVA 5K2XA 4NC6A 2EA2A 2EB7A 1OCPA 2A05A 1ELJA 2DQVA 3VXCA 3CUOA 3FK7A 3KP6A 1X1PA 2KZGA 1FPBA 3F8BA 3PPQA 1ZAOA 2L7MP 4U0WA 3FXOA 2GZWA 1O3RA 4MLVA 1LCFA 1GV5A 5A2QZ 2QKMB 3H3UA 1B3EA 1GVDA 3SESA 1EZOA 2WB1N 4GWSA 4HTGA 2DA4A 2FNPA 3GTGJ 4ZEKA 3QSLA 4PFTA 3BFUA 2HQAA 4X6AJ 5IGAA 4LD5A 3RNNA 2KFDA 1O57A 3H3ZA 3VSKA 4IGTA 1GVCA 3TCHA 5D6FA 1O3SA 3FX3A 1QGPA 5E8GA 2XWKA 1BOBA 5BWJA 3ZRGA 1O64A 3A3UA 3CCYA 5HLHA 1T08B 2V1DA 3PGFA 3B6QA 1VQ6I 4RGUA 3IUOA 3WTZA 1SD5A 1D1AA 2ZYNA 1P4WA 4IEJA 1B7ZA 1XVYA 1N84A 3M1EA 3S14J 1QA6A 4P9KA 3IOUA 4AIJA 5HDNA 2M4GA 5J1DA 5F27A 3K6UA 4XN3A 5DTDA 5AA2A 1URDA 3HGGA 2RNJA 5K7HA 2HZLA 1H45A 2GXAA 1UTBB 2VOZA 3OMBA 3FM5A 3PFYA 4CZZA 4BY7J 4CXFA 2HKXA 2HU9A 2F36A 5I2NB 3BR6A 3UK4A 1YS7A 3Q9SA 4KD5A 2HS5A 2VE9A 2EZLA 3HRSA 5FRMA 4GCVA 3VVEA 1VZ0A 2CG4A 1K9ZA 3QUJA 4FATA 2X51A 2IBDA 2L4MA 2J5OA 3RTRA 1STZA 2J5PA 2Z99A 3TDZC 4BGDA 3TQWA 1FBDA 2EQRA 2PJRB 3GTQJ 4HG2A 3HEFA 2ZJPF 2CEYA 4MNPA 3HHGA 1XX5A 5L3CA 4XLHA 3FVOA 4PE5B 1NNTA 1MMNA 2HEUA 5TJJA 2QQ8A 1GVJA 4GYGA 5FKOA 2GFEA 3CCVI 3E4RA 5HM4B 1J0RA 3M8FA 4IO9F 1TTYA 2OBGA 3IAZA 3P7IA 4P8BA 4NF8B 3PMWA 5H8NA 2E5NA 3GTLJ 1WJBA 3L2RA 5DUKA 2LREA 3GBAA 4XTCQ 3AKZA 4II2A 3VODA 2FA7A 4KMUX 5E20A 3DP4A 2EZKA 1Y56A 3D1RA 1VI0A 4OMYA 2H9BA 2IVMA 3OO9A 3M3FA 3FKIJ 3DU5A 1MMDA 2OAZA 4KT5C 4S0HB 2DW4A 1Y8RB 5D6EA 1L5TA 4M3FA 3PM1A 1FIPA 1NH3A 4MBPA 4F19A 4PF8A 2D5WA 2JMWA 3H1CA 2BZTA 4UABA 3OYEA 2EINH 2IGOA 5HLIA 5GPCA 2XX8A 2CW0F 1FWZA 3TELA 1TNTA 3OD7A 2W25A 3HBLA 1ZLJA 3QYEA 1FTKA 5BMZA 1U6GA 2Y75A 3HOSA 2HQ0A 3I6VA 4IO7A 4U4SA 1Y4TA 1ZTRA 4E0XA 2R3SA 4BEHA 2R7ZJ 1I6AA 2V3QA 3MW0A 2A61A 5ERIA 4OVQA 3LA3A 4G7HF 3ZMZA 4N13A 5TPAB 5LGUA 3CD6I 3CF5F 3MZ9A 5KDTA 1JHHA 1LE8B 4A3KJ 5JEIA 3OR1C 2F7CA 2R93J 3K4MA 2EFWA 4NF4A 2ID6A 3GTJJ 5B3SH 3ERMA 4BYYA 2CMOA 4UB6C 3KG2A 4BNCA 3Q29A 3U94A 2BY1A 3MSTA 3F0CA 1ENHA 2BXYA 5HLTA 2MFZA 3N26A 3HOWJ 3BR2A 1NV2A 3S3OA 1DUXC 1B32A 5EYRA 4BJ6C 5GTIC 3ILTB 5H8QB 3FUZA 3VFZA 2CUJA 4XKQA 1NV6A 2KL4A 2B4LA 4MEVA 3OOUA 3RIRA 2O1LA 5ET6A 5AA2D 1R5GA 3F9KA 1OR7A 2HTSA 2CYYA 1MIJA 3F8NA 3H36A 4LIVA 2F34A 3NRVA 1PDAA 5CJ9A 3RPLA 5I84A 2M1BA 4P11A 2EIJH 2DVCA 2RC8A 3EDPA 3J7AO 1NUWA 1PBQA 1Q35A 4DI3D 2AXTC 4S04A 1DDNA 2ZKZA 1AIVA 4DYCA 4I01A 2V4JC 2I0BA 3OS1A 3H35A 5LEJA 1T33A 3HCQA 2DMNA 4JWOA 5KDTB 4GWXA 3TTMA 1F9NA 4PDHA 2ALUA 3OIPA 2F6GA 2K5CA 5CLSA 3EKIA 2A69F 5IZZA 3LFKA 5I7IA 2CQ7A 1QRYA 4WWCA 1A7LA 2M5WA 4B3XA 5AIPA 1QZEA 5FJ8J 3G71I 3BJOA 2QBYA 3B7DA 2P6TA 3DLAA 1VE4A 3FBIB 2JPCA 4CUGA 2R7UA 5IY5H 1R6ZA 1IO2A 4F3QA 1U2WA 2Z9OA 2O1MA 3SDFA 2DMUA 2FNCA 1XMKA 2UVIA 5BPDA 3CSBA 2CH0A 3CUQA 4ENJA 1BN5A 1A55A 2W48A 3WAEA 1V3FA 2DE3A 1GV2A 2GXBA 4B48A 5ET5A 3EUHA 4A3DJ 1FQCA 3TODA 2ZNYA 1FMVA 2OJED 1EF4A 2P7VB 3JSPA 4A93J 4F3GA 1JW5A 2DOEA 2WBBA 3D5RC 2QQAA 3H9GA 3QU6A 3EPZA 1O3QA 5M3MJ 3FKJA 3PPNA 3R6UA 4M1VA 3CCQI 2LYCA 2RAEA 1BI0A 2XF5A 3BZKA 3MZYA 5FFXA 4XLCA 1OLAA 4HE1A 4OANA 4YAHX 2JT1A 2M8CA 2ZMBA 4M9ZA 1POY1 2ISZA 1SW1A 3CG1A 4AC0A 1R1UA 1TWCJ 3JV9A 1EH7A 4ABZA 3MVYA 2Q8KA 4RB3C 4Q8RA 3T0YA 3OYNA 4CYDA 4N8GA 1QZYA 1XT8A 3B8BA 1WI3A 1F43A 3MQ0A 4WF2A 4A2UA 4IX7A 4JBZA 2R7DA 2IEEA 4JWYA 4HBLA 4L17A 4PAIA 5DUIA 3PO2J 3I5UA 2HHMA 1W36C 2NWJA 2KDZA 3M9AA 4P5OA 1FIAA 1TW3A 1B9MA 4F31B 1OCZH 1S8NA 2FJ1A 1SI0A 1MBKA 1ZARA 3JRHA 1O3TA 2MA3A 3FWEA 4M6VA 2FMLA 1IXSB 4G6TB 2WYPA 4QF9A 4F18A 4OA4A 2MW8A 2YX7A 4IO6A 2VXDA 1JKPC 3E5QA 2O03A 3DELB 3TQNA 4A6EA 4FX4A 2ZCWA 1Y4CA 4XKCA 3PUWE 1UZCA 3UKGA 3HUGB 3RYPA 1TT5B 3JRBA 5FKKA 4YB6A 3W6JB 1MY3A 3HOYJ 2OCUA 1U5TB 3GTKJ 1MY4A 1D3YA 2QL3A 5AA4A 5JFRA 2Q2EB 4MEYF 3LBSA 4BDMA 4DZPA 2WADA 2W85A 1OQHA 3S2HJ 5AA3A 2XB5A 3GWZA 4PJJA 5F1JA 1TWAJ 2BOLA 2DK5A 1B1XA 3FXQA 1FPIA 2EZHA 4THIA 5LHHA 4IL6C 4HYEA 1DBZA 3BT9A 1IXRC 3GTPJ 2OQRA 2HZKA 1YZ0A 2VBWA 1KONA 4E7KA 2R0QC 1B5HA 2GHAA 1HKTA 5DYMA 2XA5A 4GX6A 3FISA 2VKEA 3MWMA 2ZYOA 3U92A 2DE2A 2AS5F 2H99A 2XXUA 3KOSA 4I98B 2PLYA 3HPIA 5DT6A 2ZSHB 4C2UA 3GZGA 2AO9A 1HLVA 1NV0A 4QSCA 2CV1A 4Y7NJ 3FMQA 3RT6B 4EM1A 3G73A 3T5XA 2VJIA 2K9NA 5BNGA 3MEXA 3F3XA 5DEXB 1G59A 1FPGA 3D4GA 1MBJA 4UY8I 4IZZA 1VQ5I 4A3FJ 3DKYA 5CVJA 5BUUA 1R6RA 2IA0A 5LGNA 3CFXA 3TUSA 2ESHA 4IQJA 3ZN1A 3TFLA 5GAHJ 5EZGA 3B6CA 3MC2A 1WKMA 1P9QC 2A3SA 2E19A 4N0BA 4OAYA 2EV0A 5FKLA 2R5ZB 1T39A 2VD3A 4GD5A 2O7IA 4BE2A 5AA4B 1PUFB 4MIJA 3QXMA 4PFIA 1HSTA 2PMUA 1T38A 4UUSA 1JKOC 1TL8A 3N6TA 3L2QA 2STTA 1OMPA 3BCAA 3CFLA 1SW4A 4AQ4A 2H27A 4R74A 4GBWA 5EG0B 1XS5A 1FSEA 3DPTA 3BROA 2FQ3A 4N9HA 1SW5A 3KLOA 3S15J 3ZP5A 2EWNA 1QZZA 2AXLA 3H9JA 5FLXZ 4TLLB 4WEDA 2E2JJ 2ONKE 4Z0IA 3CESA 2LMDA 4EVIA 4XNFA 2OCEA 3HHHA 2DWJA 2QLZA 1M5BA 2DA6A 4PP0A 3ZCOA 1T95A 2JA6J 2VT5A 1EJ9A 2G7HA 1NV5A 5D5XB 3F23A 4ANJA 1Y20A 3HC7A 1QU3A 5EJCA 3ZXSA 3P9IA 3WTWC 1B7UA 1ZMGA 3IH4A 4WXCA 5KAIC 1MS7A 3DTIA 5HDKA 1QQIA 1WPKA 4C30A 2NVUB 3LFUA 1QO0D 2MGQA 3GBGA 3CCEI 5DW8A 2CWEA 2WKYA 1GXQA 5J16A 1X1CA 5IT9Z 4MJOA 3I56I 2EFNA 1I1GA 5LDZA 3SHFA 1MBFA 2P1SA 3GO5A 4ZEIA 1RR7A 2VXZA 1T6SA 1LB2A 2Y31A 3X2QH 4KYDA 4RPNA 3LSGA 3BIGA 1N75A 1TXFA 3O2AA 4OVPA 1IQ7A 4AYBA 1XVXA 2CUEA 2FD5A 4J00A 3EUAA 3BTIA 4JP0A 1E0EA 4P56A 1HC8A 1LFBA 1N7XA 1NH8A 1TW2A 1VQKI 3I4PA 2L3DA 3HOTA 2M9HA 3ZQIA 4I3YA 1YIJI 4QFNA 1Y1ZA 4EJUA 5FROA 1AOVA 3QOEA 2XXVA 3ABMH 2NOJB 2H4IA 2OZZA 1CGPA 2F4OB 4NUBA 3ZSFA 2KDOA 3ESWB 1FCKA 4PC9A 1PB8A 1K4SA 2VQCA 2Z1DA 1R9TJ 1NG6A 3USDA 1DCUA 5F6FA 4A12A 1MRPA 2QVUA 3PO3J 3KN8A 1S9HA 4IRGA 4BHPA 4P9UA 4E7IA 2ZXTA 4KYSA 4P96A 4U4XA 5EYGA 5IM2A 2XVCA 2VGQA 4L5IA 3OY9A 4F91B 2CMPA 4BACA 1W36D 4A5MA 5H8HB 4KXPA 1XC1A 2OJTA 1A54A 4BHCA 3ZPLA 2KR0A 1T8IA 5E3MA 2UYFA 4MCOA 1LAGE 4MNUA 3O3KA 1ULYA 1D3KA 4LZ5A 1OQGA 1OLCA 1R36A 3B6AA 5IAIA 3Q3SA 1MDMB 1IMAA 3LL7A 5BOXA 4NWDA 2CGPA 3R60A 1ZIUA 1W1WE 3BBRA 4ZYAA 4GGGA 3TKDA 3D4CA 3TMGA 4AS5A 1TWGJ 2M45A 3ECHA 3KCCA 1R71A 2P6SA 2Z3YA 4RAZA 2V4CA 4HSTA 3RTWB 5CMCA 1E2XA 1Y1WJ 1C0WA 4QPQA 1BBYA 1JJ6C 4P0IA 3S9EA 3DWLE 4KA4A 2DQRA 1L3LA 2CQKA 3E1SA 4OENA 3C2HA 1IF1A 1QKBA 1QUKA 1MQIA 4GF8A 1EA3A 3OO7A 3HSFA 3PUVE 4H8JA 4YB7A 1MBGA 2OC6A 4Q4ZF 3MQ9A 1XC5A 3K4BA 2PMZA 4RGRA 4II3A 4F3BA 2JUGA 3SXYA 3SEZA 1LFUP 3TCFA 2DFIA 3VYSB 4RGXA 5H2FC 3FZVA 3B73A 4LQ2A 3CDHA 3K4UA 3PD8A 2FMYA 1MW7A 3CG3A 2P81A 3L09A 1LEAA 1B3GA 2R7QA 3RYRA 4GXSB 2M30A 2HXIA 1VQLI 2NVXJ 2DFEA 3V42A 4G7ZF 1DU6A 1TQPA 3O9PA 1RUNA 4LG0B 3O66A 2IAIA 2K9MA 3KP2A 4F3SA 4QSDA 5HLGA 3IOWA 1J9IA 2F2EA 5HBCA 4KCDA 3E0JB 4RXLA 2DE4A 2JSPA 4DBRA 5H8FB 4BDQA 1KA0A 4IHTA 1R58A 3OL4A 1ODDA 2XXWA 5LD2C 4N6KA 3KBRA 3IH2A 3TDUC 1KWHA 1X2MA 2Q89A 4ELQA 1N3XA 3A03A 1JVYA 2BVMA 5CQEA 2Z5UA 1Z7UA 3FXLA 1MMSA 4KFQA 4IOAF 2BEOA 3BG6A 3HTUA 1FQBA 4G61A 4EF2A 2R7VA 2FXAA 2UYEA 1UMQA 2R7TA 1IAWA 4E4HA 1GV8A 4EQQA 2L7ZA 3F8MA 2ZNSA 4X48A 4PZJA 2P3NA 3CLQA 4MFEA 4LVQA 1X1DA 1XN7A 2HYJA 5DV5A 1UFMA 1D8KA 5I57B 2BV6A 1J2XA 1H43A 4PFRA 3QAXA 1BR2A 2VT2A 4F1VA 3MPKA 4RK2A 1FW0A 2BHYA 1AMFA 1HBXG 4GRIA 3AG4H 1MY0A 4G4PA 4YMAA 3RPUA 5J1RA 3BR3A 3KP5A 4DE8A 3WTVC 1HDDC 2LH9A 3HSEA 3DLLF 4LLGF 3SEWA 3CJQB 4HV6A 2AIXA 2DOAA 4AIKA 1M5FA 3CMAI 1URGA 1S7YA 2L5QA 5AE4A 2CQXA 1VQ4I 1SW2A 1S5LC 3BLYA 4C3HJ 2XD2A 1UQWA 1Z67A 2NNYA 2GQ1A 1AKHA 1OYWA 2DOFA 3PL8A 5D4RA 4OQOA 5KZTA 2Z8FA 4AB6A 1WODA 2CZHA 2HR3A 2DFHA 2CS3A 4XN0A 4KYWA 2PMSA 3ZQFA 4AU7A 1FEXA 4PAFA 3SEVA 1BP5A 3OIOA 4LB6B 3I64A 2CSOA 4G12A 3CQZJ 3QPSA 2VKHA 2DMPA 3E6BA 3AL0B 4FJPA 5FTHA 3J7YJ 1O4XA 2VN2A 3G2BA 3SQNA 2PBWA 1BL0A 1YJNI 2HXRA 1UHWA 4YEJA 4B1RA 2FX0A 5EEAA 1BC7C 2XAQA 2BBYA 3E6CC 1LBBA 1ZLQA 1FBUA 2MG4A 2JA8J 1LLSA 3R61A 1GXPA 3LSJA 4G7OF 3IK6B 4FEBA 2XROA 2W82A 2H98A 4H1XA 2OTLI 3S2WA 4O7IA 1S29A 2TCTA 1ERDA 5F7VA 3CO6C 2HZDA 3DEEA 1XMXA 5JLWA 2R7SA 2XAHA 3D0SA 3IC7A 3R26A 4YIFA 2EFOA 2LK2A 4NDLA 3JYRA 3MYUA 2NS8A 2Y48A 3LSPA 1P99A 2HFHA 1Z3XA 3RI4A 1XGMA 1F1ZA 4KICA 3CMEI 5A5XB 5L8DA 1D1BA 3MZ1A 4QWQA 1YI2I 3VE1B 1I1SA 3N97A 3CMMA 2NYXA 4YELA 2AYSA 3DF8A 3ZQGA 2KRCA 3L1PA 3I55I 2GH9A 1XTAA 3BR5A 4XLAA 4GWZA 5GPAA 3EHUA 3U9GA 5ICFA 1ON1A 2K9QA 4PGHA 2RDPA 1WFXA 4NTLA 3SKPA 1HW1A 1JT6A 1MXUA 2M7BA 3CZ6A 1OVBA 4R9FA 4AB5A 1G2HA 1T98A 2I3WA 3BPVA 4BE0A 1EYKA 2DA7A 2IGNA 1LAHE 2Y5LA 2D45A 2XXRA 4I8CA 1SMYF 3I71A 4CCKA 2HYGD 4GDFA 3S17J 1NNPA 3LQRA 1LVKA 1PEBA 4L5EA 1D1CA 4CSWA 3CCLI 1U5TC 4FE4A 4LITA 1DOTA 4IO5A 3FASA 3S2VA 4P9FA 1REPC 4NQWA 4AIHA 2Y7IA 4M74A 2XHDA 1S6LA 2LFBA 2VKVA 1TQIA 2DWAA 2DXIA 5ICQA 3GXOA 5CVVA 1MDP1 2QYOA 2O9LA 5IZ3A 1YW9A 2BW3A 3RQ4A 4R73A 3Q0VA 1JW4A 1FY7A 4M6YA 2XWVA 2ISYA 4PGGA 3AXFA 4ZEFA 4BY1J 2RREA 1IC8A 4XORA 4KISA 5DCFA 3MD2A 1SYHA 2CW7A 1SFEA 5ILUA 4GX3A 1MXYA 3K6WA 1X3WB 4NG7A 4UVCA 4BS9A 3J80K 2EV6A 2IS4A 5TP9A 3HV1A 4PSWA 4LB5A 1W7PB 3QWLA 3GTOJ 1WVJA 3GLLA 2UZKA 2K9SA 1P6RA 3FBNB 4N07A 4LUBA 4NWCA 3C1DA 3D1NI 2R4GA 3H5RA 3LR1A 4XLEA 2WV1A 1NI9A 3UGWA 5J1YA 2ABHA 1EZPA 4RK9A 1CNQA 4POWA 2GM4A 3RY3A 1ETWA 4IHXA 3A29A 1XMAA 2VB6A 4BXFA 1CF7A 3I4NJ 4JDFA 2V9KA 2MC3A 2QS4A 4N17A 1W0UA 1PP8F 1K61A 1BJZA 3A01A 3OSQA 3ILUB 3W15C 4XONA 4ESJA 4BQAA 2XGEA 4ENMA 2HQNA 1SI1A 5DVFA 1FX7A 3V8JA 4EQ7A 2KJCA 2OU2A 4CDGA 4R2FA 1WQ2A 3T9HB 3I53A 3P7NA 3BQZA 4MAGA 4XM3A 1TT0A 1ZTYA 2NXOA 4EM2A 1X3ZB 1LFGA 4FCYA 1Y0UA 2K9LA 2D3IA 2JRTA 4R8HA 3UNGC 1RYXA 1TWFJ 2JK3A 5E1XA 4KPTA 2QSHX 3JW4A 5I59A 4GOTA 3Q28A 4Z6YA 3IP4B 3Q9VA 1I6BA 1UHSA 3WTSC 2F5CA 4CCJA 1UELB 1AWBA 1FTMA 4IHWA 3EHTA 4PGNA 2K86A 1DQUA 2WAEA 4IJAA 4RMNA 3KEOA 3W2VA 2MSYA 2ZMEB 3PUBA 4K2EA 4M3DA 2DQLA 4KUMA 4AVPA 1NNKA 1OIBA 2P3VA 4QFLA 3SDBA 5F04A 3U1DA 5C4XJ 3LSWA 5LRSA 2V7FA 5DD8A 3IAS2 4V2FA 2ME0A 5GAGJ 3EUKL 1AA7A 2O8KA 3M1CA 4G68B 4GWWA 3MKZA 4XLNF 2KPMA 1IMBA 1B72B 1J5YA 3TP0A 4U2RA 1TP4A 4M72A 5DD4A 3W6KB 4CO8A 1B5IA 1FQAA 2L0KA 1FP2A 4RAGA 2JA2A 2I8DA 4HEA2 1Z3YA 3MUQA 4JB7A 1UHMA 2V9PA 4GL8A 3OEKA 4G9YA 4MTDA 3CCJI 3TZAA 2BJIA 3WTTC 3P9CA 3E9XA 2EFPA 1J09A 2WA0A 2DO7A 3K4JA 3CCMI 2R5YB 1U78A 3GTMJ 2LOOA 1K79A 3EF7A 2CFOA 2HOEA 2ELKA 4RAYA 2DCEA 1APLC 4XKWA 4BDNA 4EJOA 3DBRB 1FRPA 3CTAA 1UJ8A 3VYRB 3ZOBA 3IV5A 4E7JA 1EYJA 1QULA 3PUZE 1NK3P 1MQGA 2QWWA 4CYCB 1B8IA 1IG7A 3SFZA 1MNDA 2QS3A 4E7HA 3T9XB 1LSTA 2JN6A 1ZLKA 4Q5TA 1A6IA 4H65A 3LSKA 4C1TA 2E34A 3LAJA 2H1LA 1MXWA 4R6HA 4NNJA 3O2PE 2PI0A 1YXIA 2HOSA 1Q1KA 2A6EF 4FE7A 4IO3A 2EV5A 1HDPA 1FP1D 2XAJA 3A02A 3JRCA 3KZYA 4I99C 1JXSA 4JWXA 1L0OC 2LDUA 5DS9A 3OYJA 5ELVA 3F6OA 1M5CA 1FPQA 3FF5A 4IR8A 3OYKA 1ZK8A 3JRAA 1IJWC 1QJMA 5DM7F 1LKXA 1OMIA 5JLXA 4FASD 4ZZLA 1Z6TA 2UUZA 4BDZA 1NV3A 2R6GE 2KKOA 4PFBA 3PIPF 2GLOA 4ZZEA 4LGWA 3GX4X 3V8LA 3CDIA 3M8JA 5B66C 4ZTFA 3H3GA 3R6SA 1W5SA 4X8RA 2K4JA 5TGTA 5EQ8A 1X1BA 2CQNA 4BDLA 1Q1VA 4ENNA 1TFDA 4BUPA 3ZQ7A 5FD6A 2Q8MA 5JTYA 2FE3A 5E3NA 2HVSA 4FTHA 2RINA 1B8IB 5DDGA 4I02A 2YJPA 1N76A 2XRLA 4GWUA 4PTKA 4BKXA 3HOUJ 3K4NA 1IMCA 1RDZA 1ETOA 1GUUA 3MWBA 2QF7A 3IFAA 4L5JA 1XHYA 3PU5A 1EV7A 1RKWA 4DW6A 3FATA 3K6GA 3KYDB 4BXXJ 3S1QJ 3JSOA 2I3VA 2VI6A 2Y7WA 2RGVA 2DPUA 4D5CA 4I62A 3WGGA 1IN7A 1NFTA 1IDZA 3G3JA 1I6XA 3CP8A 3CFZA 2HTJA 3W2AA 3PUFA 4HDUA 2OCCH 4NHJA 1A5JA 5J4VA 2LF7A 1QVTA 1H3DA 4IO2A 3S32A 1ZN2A 2LKXA 5H20A 3IAM2 3K70C 4FECA 2CRGA 4MMPA 3RKWA 4PCDA 3Q0WA 4MFIA 3RT8A 3DEUA 3KPHA 2DP8A 1P4AA 5CVRA 1Y39A 4FT8A 4LQ5A 1UCRA 5ILVA 3BFTA 4BQQA 3I3VA 2DXYA 5H8NB 2IJLA 2DS9A 3DFGA 5JHFA 3K7AJ 2ME6A 2EIMH 4KJZA 5F64A 2V1UA 1MDQA 1ATGA 2ZXWH 4BLAA 1HCRA 2DN0A 2ZC2A 1B3FA 2PYYA 3JZJA 2DODA 4I7HA 3ZQCA 4N91A 1QUJA 3TOAA 1VF9A 1RESA 4UHTA 1FYKA 4OU0A 2HOAA 4PUSA 1SYIA 1CB6A 4H0EA 1LPQA 4HX7A 4XSZF 1RIOH 3BKIB 3U1OA 5J8CA 1K7AA 3H5NA 2ZYKA 2A5SA 3FJMA 4HPQA 1ZH5A 2L7KA 4FHTA 4CZCA 3S3MA 2F48A 4ZH4F 1PB9A 5LBQA 2K4BA 2OUMA 1FSAA 3L9FA 3CCRI 2XX7A 2XRNA 2XC7A 3KP7A 2ONSA 2K7LA 4BJTA 3O6IA 5JR3A 1Q1HA 1H8AC 4IY5A 4X0GA 4BL0B 4CA0A 4EXKA 4BEHB 2LVSA 3H6VA 1ACIA 4O3CA 4OETA 3JCUC 3GEZA 5D5VB 2LLKA 2V84A 3DU6A 1YOVB 2Y84A 2PCRA 3L7WA 4BAYA 1QHGA 1DU0A 4NF4B 3K2ZA 5DYHA 2HDCA 1YLFA 4CH7A 5D8LB 4KNYA 2LBFA 3TO7A 4PK4A 2WX9A 2A5YB 1RNLA 4QFPA 1Z77A 4ON0A 3WU0A 2P0SA 1XSXA 3LUZA 1PYVA 2UVHA 4WXHA 4XKVA 3GW2A 4R1HA 1H88C 3HOVJ 2G29A 1Z0XA 5M3FJ 4HV5A 3FDYA 2E60A 3H6TA 4BU2A 1BKAA 3L6HA 3JAMZ 3ABUA 3H4ZA 1B5JA 3CO7C 3RPLB 4QRZA 3BZCA 1WRJA 2DMQA 5ITOA 5I58A 4F92B 1JUPA 5D8KB 4CHUA 3MZ8A 1MJ9A 4Y33A 2NNNA 2O7UA 2M4KA 4MLOA 2HWVA 1IXGA 4D7MA 4H46A 4H5FA 5BPIA 1TWHJ 3HPGA 1SVLA 2I0CA 3DQVC 5J3LA 3T93B 1U0JA 2XAGA 3KZZA 1FTLA 2VUMJ 4QSEA 3WG7H 2QENA 2TDXA 2LRDA 3BTJA 1ZRCA 1HA8A 2RCAA 4HE0A 1PBPA 4XF5A 5F1QA 4W1UA 4DCYA 1JKRC 2F5DA 3OR2C 2VHAA 2VPRA 3BCBA 3T8TA 1JUSA 4KMFA 2H94A 3LSXA 1N78A 3A1YA 3TO9A 3BY6A 1MPDA 4IOCF 4ZECA 3O28A 1Y3NA 1BI3A 1JEVA 2JPBA 4EM0B 1A8FA 1SBPA 3O8HA 3PQJA 4JYKA 2QBYB 3DM0A 5CMBA 3HG9A 3NARA 3K4CA 1J1NA 4F1UA 2O8XA 3CUQB 2JA5J 1A31A 2HXWA 2XWOA 2F4MB 3K4KA 2L9SA 1WJFA 4OXVA 5D4SA 3UA8A 3VLWA 2Y9ZA 3ASNH 1B9NA 3BC8A 4FETA 5J4YA 2CZKA 5CBRA 2CU7A 5AIQA 4DGWB 4Q0CA 1MD0A 4XXUA 2X4HA 2VQHA 3Q5FA 4I2OA 1XOCA 3K1PA 4PDDA 4D9JA 1OYYA 1R1TA 3KP3A 4C2MJ 4E7ZA 5K5QA 4Z2YA 2CZLA 1RUOA 5L3DA 5CI5A 2YR2A 2DA3A 1A36A 4PDKA 1YTVA 1XSDA 4Y52J 3HKZA 1YX3A 1P1NA 1FYMA 3M3YJ 3EHSA 3JTHA 2XB0X 2E1MB 2R92J 2VJ4A 1TLHB 3MFKA 2ADUA 3OS0A 1MSFC 2ZJQF 3QAHA 3RQIA 4OVJA 1S7OA 1MPBA 2LP0A 2JTVA 1USYH 3J7AY 3PSFA 3KEIA 4A3BJ 2L4AA 4OERA 1IN6A 2A68F 3QP6A 4OIQF 3CDLA 3ZGKA 4PBHA 3K70D 2X6YA 1IUDA 1W0TA 1LEVA 1NNFA 4ZS9A 3KBZA 3GUDA 3WAFA 2B3FA 1IRZA 4XLPF 3G3ZA 1MQJA 3A0BC 3TAJA 2ZZXA 3DTEA 5L9SA 2DK8A 3PNVA 1AL3A 4G6QA 2IW5A 2F3DA 4UB8C 2KMUA 3DEWA 2I6EA 3F8FA 4YIIA 2HGCA 2HDDA 4N81A 4M73A 2HKOA 3H6UA 1FJ9A 3QODA 2UXNA 3VYTB 3FGSA 4H5GA 3IL2A 4O7MA 1SFUA 2CV0A 5TU0A 2PMHA 3JAMK 5EHMA 2I49A 2DFFA 1Y9UA 2DT7B 4A3GJ 1OJLA 3U21A 1LBXA 3PIOF 1YAEA 3IO6A 2QM3A 2VQGA 2X48A 3FXKA 4UV9A 2H5YA 3R0AA 3KLNA 1FJ6A 3IKVA 3M07A 5LGTA 3QYBA 1ZG5A 4OFJA 3DP6A 4M9XA 1OCTC 4PGPA 2I48A 4PFWA 2XPWA 4GFBA 2QMWA 3GVAA 2M7AA 1MSEC 2XF7A 2V3TA 1JI8A 1R4MB 5KK1A 4LJZF 4NBQA 2V93A 3H7MA 2X1DA 5EGOA 2MH9A 3IWZA 5J40A 1AHDP 2JRMA 2KHMA 3N94A 3LSMA 4M3BA 2XXIA 4QXDA 1FJLA 1RKMA 1MQDA 1DTZA 1N7WA 3OWTA 5DVIA 5C3EJ 1YRNA 5LOMA 2M8EA 2HCAA 2YPRA 4OIOF 1INPA 1NV7A 4MLQA 4UNOA 5F0FA 4RBOA 3JTGA 4KCCA 2CFXA 5FGMA 2MC4A 3AG1H 2E1SA 4MGRA 2W4SA 1WCMJ 3LQQA 3IHUA 1V54H 2DBBA 2DTZA 1VTNC 5AA2B 1VQ9I 1FOXA 4F22A 1B0LA 4I0AA 2Y0SA 3E13X 3C2GA 3PD9A 2Z23A 1OYIA 3S4UA 1U9OA 2EILH 4ZYGA 3IFCA 5I56A 1E3HA 3BWGA 4K3FA 1A99A 3HIFA 2XSJC 1UIVA 3G3IA 1R5ID 1B4AA 2EZIA 5FBPA 2O5RA 1YE9A 3WE2A 4UUSB 3VWBA 1MH4A 4RYAA 5E79C 3MAJA 1ANFA 3OL3A 2DYSH 1TC3C 4B47A 2WBDA 1HW5A 2XSDC 3VXBA 2F5EA 4G8XA 5K5OA 3TTRA 5EQ7A 4XEQA 1BW5A 4ESBA 4D5FA 4H67A 3V7SA 1RRJA 1Z7ME 1FBEA 4KT6A 1SVOA 3M3LA 3KC0A 1HXDA 1QVUA 1BM9A 2XKPA 4O5VA 4V19K 3MZBA 4FORA 3VDXA 2O69A 1T56A 2PBIA 2KP6A 2XD3A 1MMAA 1W4MA 1UG0A 4XMYA 4G8MA 2QPQA 5L9MA 1ZYRF 1ZBMA 3KGCA 2P2AA 5IZ3B 1RETA 4LOCA 1FTTA 4F52A 1H9GA 4IPAA 3P5JA 1AWCA 3REOA 5EQ9A 2L01A 4NX1A 1GR2A 4JX4A 4X9TA 2ZBKA 1R9LA 4DYRA 3SZPA 3O8GA 1Z91A 1O63A 2JZYA 4I09A 3HSRA 5LHIA 2HOTA 3FVKA 4NF6A 4YMBA 3CI8A 1NTCA 4ITVA 4LN5A 4ZEBA 1H9TA 1G8XA 2HNHA 2W24A 4AYBN 2E1OA 4ZJZA 4HF1A 5I56B 3IKTA 2REGA 2QSFX 1NUZA 5KCMA 1WSUA 3OYLA 4XKRA 3E3VA 5JI6A 3RJPA 1PJRA 3LWFA 2VKDA 4BJ5C 5LFAA 1ZGWA 2H6BA 1IEJA 2FIXA 4RJZA 2L9NA 2F35A 2L54A 2OZ6A 4M9SA 3LSFB 3MBPA 3KYLA 3H9QA 3ML6A 2XKOA 3GFJA 3G4SI 1FQEA 1K83J 3MP8A 2MABA 1KU9A 2COBA 3HRMA 3LMMA 1KYWA 1HW2A 4DXCA 1RC9A 5ICTA 2DT5A 5HNHA 3S1RJ 2ELHA 3HFUA 5EEGA 3GYHX 3SZTA 4ZC3A 2DU9A 3S3NA 1UTHA 2MLKA 3SDGA 5EEHA 1V5EA 1LB9A 4R75A 2P4WA 5GAEJ 4RS8A 4F7ZA 1FOKA 2B63J 3CC7I 3FXMA 3OSGA 3WTXC 4RPOA 4W97A 3FXJA 5KCJB 4HA8A 1CQTA 3IWFA 3HHFA 1DGRM 1WJAA 1G3WA 2FBPA 5H6RA 2FBIA 2O7OA 4HDVA 1KU7A 1B0HA 4A0XA 2VPLA 4YU0A 1EKEA 1SANA 2QCOA 4XSXF 1IDYA 1Z6RA 3M7GA 5CVUA 3KE2A 2MD0A 2EA4A 3B02A 5JVTA 2MBFA 4IHVA 4EQ9A 5CBSA 3V83A 2L9RA 4A3MJ 1TWYA 9ANTA 4GBVA 4NGUA 2CO5A 2Z16A 4RB0A 4IHSA 2ZNUA 4PF6A 2HI3A 1Y1VJ 2RQPA 1H89C 2VQLA 4U1ZA 1B52A 3F6VA 1VQ8I 3CR9A 1JETA 1RKTA 4NF5A 1USTA 3KC1A 3CCSI 2WAQA 3C2BA 1HF0A 4N15A 3H0DA 1YG2A 3H6WA 2E0SA 3R7XA 2B0LA 2NOGA 3BQYA 2ZFUA 3K1MA 4U0VA 3GZ6A 1X1AA 3I4MJ 1E3PA 3VPRA 3CVGA 4KITB 2LR8A 2OWSA 4AVZA 1N04A 3DCFA 3RQTA 3JREA 1XD7A 2VD2A 3FV2A 2ZXIA 5ICGA 2L5VA 1DGWY 3ZMTA 3CC4I 2PT2A 2CUFA 3FVNA 4R6KA 2VJ5A 1TQMA 3P9KA 1WVRA 3HYIA 2X6XA 2FSWA 5DCMA 2R7XA 3DP8A 1TZLA 1D0ZA 3I58A 4JX6A 4JBAA 1ZELA 1TFAA 2PT1A 4J01A 2UWMA 4KHZE 2YUSA 3E78A 2XXYA 3KYCB