1MH3A

Maltose binding-a1 homeodomain protein chimera, crystal form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
421
structure length
421
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding, dna binding protein
molecule keywords maltose binding-a1 homeodomain protein chimera
total genus 144
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh3A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A01
1MPDA 1GDTA 1U78A 1TC3C 2AIXA 2ZYMA 4F29A 3BQZA 2DA4A 3KZGA 2X6OA 3GTMJ 4YB7A 3TAJA 4E0WA 3FVNA 1JW4A 4C0RA 4DXBA 2LD5A 1N3XA 1UHSA 3GTOJ 1EZ9A 1PB9A 1GGGA 1HOMA 4DXCA 1BW5A 1B5IA 3MKLA 2I3VA 3U93A 3UA8A 4IEJA 4CYCA 3CFXA 3IX1A 3FISA 3QPSA 3RZDJ 2H5YA 1AKHB 1W0TA 4OERA 3IJXB 1B46A 2QS3A 2Q8JA 4BDRA 1X2NA 1LAXA 1IDYA 5DTBA 3KFMA 4BKXA 2QS4A 3R7XA 4LZ8A 2OZZA 2YUSA 2F7CA 2I0BA 1MQJA 4Y52J 3BTIA 2Y0SN 1USYE 1QVUA 4R72A 2M34A 4X9TA 2HAUA 2F8DA 3MP6A 2DA2A 2REGA 1ETKA 3SJMA 1R6ZA 5KCJB 1ENHA 3EQ1A 3TCHA 1B3EA 1HDPA 4QRZA 4YICA 4D7MA 3WHBA 3ZSFA 4ZEKA 4KQPA 2DMNA 4PETA 1LFHA 4XK4A 4R6HA 1Z7NE 4A3DJ 2I0CA 5FLMJ 4YB5A 4M3GA 3FUZA 2PMZN 2PMSA 4JDFA 4NF5A 3O2AA 4GXSB 1IIWA 4H8JA 5CC2A 3KOTA 5DVFA 1XHYA 1JTXA 4RJZA 1NNFA 4OFOA 2I10A 2UYFA 3FXRA 9ANTA 4GLIA 2IBDA 3QXMA 3Q0WA 2OLBA 2E0SA 4XIGQ 1URGA 1Y4CA 2DS9A 5CRYA 4C1UA 1FTMA 4ZDMA 3T22A 1FQBA 3BKIB 4XKRA 4U4XA 2CUFA 5JTYA 3LSLA 4JXIA 5AA4B 2V3QA 1VE4A 5DTDA 1IEJA 4RNSA 3DP6A 2QL3A 4DYCA 2OK2A 2NWJA 1SFOJ 1RYOA 2P0SA 2UVIA 3IAZA 4MO7A 3M8UA 5AA2B 3VV5A 4M3BA 1MY0A 5H8QA 3TTKA 4BDQA 3HSTA 1MBJA 1JUSA 2O7OA 1RESA 1II5A 2VUMJ 3ZQGA 2RCBA 4M3FA 3S9MC 1N0TA 5B70A 5C44J 5IAIA 1LAHE 3IOVA 5HODA 1TT1A 4QTRA 4A3EJ 1DSNA 3HCQA 4FJPA 1NFTA 3Q26A 2Z8FA 2NUVA 3OSRA 4BDMA 2QS1A 5I59B 1URDA 3KG2A 1JKRC 3U72A 2HXOA 4F31B 3MBPA 3PD8A 1MBEA 4A69C 3K1PA 5M5XJ 5ICQA 4PP0A 3HKZN 1FQDA 4MIMA 4POWA 5JK4A 1UTBB 3TTNA 1LFBA 5F0FA 1DU6A 5J3LA 1A54A 4QFOA 1LAGE 1WDNA 4GRKA 2ONSA 4C3HJ 4S0HB 5DEXB 1HCRA 2EBIA 1H45A 5AE4A 3KN7A 2ESNA 1IQ7A 3HBLA 4NF4A 1PB7A 4R75A 3EHUA 3LSXA 3IOTA 4FAJA 4RYAA 1MBHA 1AIVA 4OMBA 5F08A 3QYTA 2V3TA 3ODBA 4FATA 3FASA 1FQCA 4QSCA 3SEVA 5CM6A 4XRSG 4F3BA 2CMOA 1TFAA 2COBA 4QIWN 3SEUA 2W7YA 1MXXA 2L9RA 3TP0A 2HFBA 5I57A 5DYHA 4W97A 1OQHA 1MBGA 4UUTA 3OIOA 1JVXA 5EYFA 3TQWA 1U8BA 3M3KA 4OQOA 3SERA 1FQFA 4A3IJ 1EZPA 2UXAA 4H65A 1BA5A 4I1DA 4POXA 3SEWA 1MM7A 1HLVA 4ZEFA 3PPPA 1OJLA 4NF4B 2HOTA 1A55A 4ONYA 4C2MJ 1L5TA 4BDLA 2XXVA 3OO6A 5FHOA 1JKOC 3HOVJ 1HF0A 4HCYA 1MXWA 2DMUA 1O7TA 1SANA 1FTZA 4JX5A 4NWCA 2H25A 3GTQJ 5EG0A 1LFUP 4Z7EA 1I69A 5F0CA 3VE1B 3V8XB 2TCTA 3I3VA 2F34A 2XD2A 4YZZA 1T33A 3WAEA 1UTHA 5HPQA 2Y30A 1MY3A 5K7HA 1ORKA 1P1WA 3H6UA 1MBFA 5I84A 3BTJA 4LZ5A 3MQ9A 5EZGA 3EN3A 3JRAA 4OETA 4H8IA 3FVKA 1IXHA 1JW1A 1FQEA 4QFNA 1JJ8C 1Y3QA 2HQ0A 3HB9A 4ZS9A 3U8QA 2XGDA 3S16J 4PFTA 4F1UA 2PYYA 2HOAA 3HEFA 1VSOA 1FTLA 2XXPA 1U9NA 3TCGA 5EGOB 4WEDA 4KFQA 4BDOA 3GLBA 4FORA 3HOZJ 3ZKLA 2I48A 1P7IA 3HHGA 4Q5TA 5C3EJ 5EEAA 5AA3A 2L7MP 4GL0A 4A3LJ 5FKMA 5F04A 2F78A 3GTGJ 3HHFA 1VF9A 4BLAA 1Q1KA 2QS2A 1SD3A 4QFPA 2P1SA 2M8CA 1AU7A 1IG7A 2DVCA 3Q27A 3LSFB 1GV2A 4GF8A 1RPWA 1QVTA 4GXAA 4PFUA 1WODA 1B0LA 2L0KA 4G68B 3ZQIA 1Y1VJ 4JSDA 5EZHA 2NOOA 3VVDA 3Q3SA 1P7JA 1S9TA 2I4BA 3TEDA 2JN6A 1PBPA 5LOMA 3S9LC 2HCAA 2VOZA 3CVGA 2B65A 2ZNTA 4EXLA 4QF9A 2RAEA 3FXUA 5HBCA 4RPOA 2NVTJ 3S1QJ 3H7MA 2ABHA 1B2HA 1OLAA 1A5JA 3SEXA 1P1QA 4LONB 2B3BA 1IXIA 2Q88A 3FK7A 3MZ1A 4TOZA 2E2HJ 4JWOA 1NNPA 3QK6A 5EHSA 1Y1ZA 4F3GA 2E19A 4JWXA 5EHMA 3EPEA 4IB2A 2Z23A 2VKVA 1SBPA 3Q28A 4OENA 3FZVA 1GT0C 4GIZA 1B72B 4KR5A 4RBOA 1FTTA 1ETQA 2E2JJ 3N5LA 2VPRA 1H44A 2Z8EA 3SFIA 3RLFE 1I3QJ 3S9EA 5JLWA 3MVYA 3VXCA 2EZHA 1WH7A 1SQYA 1D4NA 1QRYA 5AA1A 5M2VA 2B63J 4EF1A 4GL8A 3GBGA 3HOXJ 1IV6A 3H6TA 4JX4A 2QSXA 2R0QC 3VPRA 4MFIA 3E9XA 3OXNA 4YKJA 1AMFA 4BBSJ 4YMBA 2JA8J 4OZ9A 4P11A 3TUSA 2JWTA 3A01A 1AKHA 5DT6A 5H8FA 2O7IA 3K1NA 5K2YA 4KYSA 3NARA 3E13X 1VFDA 2IA4A 1APLC 3G3FA 4BY7J 3QQAA 3G1MA 2Y7IA 2ZYKA 1YPNA 2ECBA 1B51A 5E3NA 3OEMA 1P99A 3MUQA 4P0GA 1JNFA 3MVXA 3S4UA 2KLFA 4QSHA 2DE4A 3PUXE 1DTZA 2DA3A 4I9DA 3KSJA 4FEBA 1VNDA 3O8HA 1I6HJ 5H8NB 3VVFA 4AUXA 1XVXA 3QUJA 1QPIA 3RZOJ 2LLKA 4N6PA 3KOSA 4ELPA 3JRFA 1O4XA 5EF6A 2HZKA 2K9NA 3HV1A 3IJOB 2EH3A 2L7FP 3TEPA 2O84X 1MY1A 1DTGA 3DP8A 2X26A 2H4IA 2IEEA 4A3GJ 1O64A 2A5TB 4A3MJ 4A3JJ 2Y7KA 3Q0VA 5EGOA 4F39A 1B05A 5EYRA 3K2AA 4MF3A 1ZTRA 2M0CA 1XVYA 1Y3NA 2CUEA 1ETVA 1B6HA 2LFBA 1EZOA 3TW7A 3NAUA 1LFIA 3A3CA 4MLOA 4HNVA 5I58B 3N26A 2Y9YA 3OO9A 1ZK8A 4ELOA 1POGA 4A3FJ 3PU5A 1UTHB 2R5ZA 1MQDA 3JYRA 3TPAA 1BJZA 1H88C 3B6AA 5IYBJ 1I6AA 3G3KA 4XICA 1JT0A 5IYCJ 2CQXA 1JKQC 3O6IA 1QKAA 3V5AA 5E3OA 4NE4A 3Q29A 3U92A 2H98A 4U22A 2NVXJ 1PBQA 3CI8A 1SW2A 2CRGA 4A93J 4IO5A 1H89C 4NF8B 2D5VA 1E3OC 3O97A 2OWSA 1ANFA 1P1OA 1XC1A 1TWFJ 1S7EA 1ATGA 3FATA 3IORA 4H5GA 1MSFC 1H3DA 1MXUA 4G8HA 1R9QA 2F6PA 2XXHA 1AH5A 4YAHX 2G93A 3IB1A 1OCPA 3WHCA 3KN3A 1A6IA 3H0GJ 4O3AA 2XX9A 3PMVA 5I2NA 5EDNA 4B3AA 2I58A 4E0XA 3O6GA 1IXCA 1Y20A 2K9QA 5JLXA 1LFGA 1MXYA 5H8SA 1ETOA 1T0KA 3T9VA 2CU7A 2E2IJ 2V3UA 3GBBA 3KJTA 2DVZA 4B1RA 1CB6A 2FNCA 5M5WJ 1RETA 2Y7WA 4N07A 3S1RJ 1N3WA 3W15C 3ZQCA 3IH2A 1MH3A 1TFDA 3H6VA 4EUOA 4DCYA 3RTWB 4MLVA 3OD7A 2D3IA 4UACA 5DEXA 1ETXA 5KDTB 3FIRA 3AXFA 3JV9A 3MWBA 3BTLA 1AOVA 1YTVA 3R26A 1GV8A 3K7AJ 4DE8A 2ALUA 4MLQA 3CQZJ 3PGFA 5FLVA 4NMYA 4YKIA 1MM6A 1OIBA 4DZJA 1CQTA 1WGXA 2RF1A 3HOWJ 2E1SA 5I59A 1LGBC 3CFZA 2RC9A 1JW5A 4V2GA 4FTHA 1Y3PA 3JR9A 2QMWA 2KT0A 3U94A 4DZPA 1UQWA 2W48A 2EZKA 1GVCA 2WB1N 3KGCA 2O51A 1JJ6C 1FIAA 2X7PA 1ZKGA 4U1ZA 3IB0A 1QUKA 4ZEIA 1IGNA 4WXJA 3TZAA 1US4A 5IP7J 3PPOA 4EDPA 2FJ1A 2NS8A 2XXWA 5ELVA 1POTA 5IP6A 1SW1A 4R9FA 1ZKBA 5IPAA 2LP0A 2O8KA 1QW0A 4ZZAA 5AA2A 1PUFA 5L9OA 2GRVA 2PX1A 4LQ5A 3G7WA 2AHQA 4IHVA 4KHZE 3GZGA 2HXWA 2MW8A 1TWHJ 3M3LA 3JZJA 5J1UA 2K9SA 5M5YJ 4RY1A 4NF8A 4F1VA 1B3FA 3UIFA 2F7BA 1GUUA 3RUMA 3MVZA 5AA4A 3EHTA 1YAEA 2UVHA 1EU8A 4OFJA 1OFCX 4QSDA 1DPPA 2RINA 3IL1B 1ZR2A 1M5CA 2XXQA 1LBCA 4OFLA 3ZQLA 2JA7J 4WEPA 2R5ZB 4ELRA 4OTEA 1MXZA 5L9SA 1N76A 5L8DA 4NTLA 5I58A 2GH9A 4KCCA 3UP9A 5FKOA 1Q35A 1ZBMA 1D3KA 1PDAA 3C31A 3K00A 2R6GE 1MY4A 5ISUA 3TELA 1RKTA 4IGRA 5IOZA 3TCFA 1URSA 4RA1A 4PE5B 4F3PA 5M3MJ 3B6TA 3MP8A 4OXVA 4F19A 3PUWE 1QUJA 4X1EA 4H0WA 4DXUA 3TP3A 4TQUQ 4I8CA 3M4OJ 4FE7A 3FJ7A 3GXAA 3VXBA 2ZNUA 1I50J 1F43A 1ZTYA 3K0VA 3C33A 2HDDA 4IHWA 4KD5A 4B4CA 4ECFA 2NVYJ 4ZE9A 4GD5A 3BT9A 1NK3P 4D5CA 3OSFA 4IY6A 3Q25A 2AYSA 3USDA 3K6VA 2QJEA 2QF7A 2DTZA 3I4MJ 5ICTA 5JEIA 3E3KA 4O3CA 2LVSA 1G2HA 4Q8RA 3T93B 4CYCB 3H3VK 3H03A 3VFJA 3HM5A 1Q1VA 4ND9A 1LCTA 1PC3A 2IEKA 4GWOA 1B58A 4LOCA 1NH7A 1X2MA 4I76A 3FVOA 3A01B 4ESWA 5B7DA 3QAXA 4THIA 3CSGA 1GTKA 4JBZA 1ZR4A 4AYBN 5F1JA 1B32A 1MBKA 2ONRA 3M3YJ 3ILTB 4M4GA 5AA2D 3HOUJ 4X48A 3C4MA 3N6UA 4C3JJ 1H8AC 3PPQA 1SYIA 4G2ZA 1CE2A 1LB8A 3JRHA 3KBRA 3LSPA 2N8GA 4G8MA 4BDNA 5J1DA 1S50A 2ONKE 4L5EA 1LE8B 1TWGJ 4IY5A 1JUPA 2FQ4A 3T9UA 3JRGA 3S15J 1LLSA 3VLWA 4AB6A 3PO3J 1UG2A 5J1YA 3MP1A 1JETA 4IO2A 3K02A 1ZQ3P 1IITA 1BIYA 4A3CJ 1B52A 3LOCA 1MNMC 2RKMA 1MG1A 1YCJA 1LB9A 1SDXA 1JVYA 2XB0X 2F5XA 3FD3A 4G8NA 5IP9J 4RDUA 1GR2A 1B5HA 2DA5A 1J1NA 3MPKA 3UN6A 3S2VA 4Q30B 4X6AJ 3S14J 3IOWA 2Q2CA 3FKIJ 1ZGWA 2DXYA 2R92J 5IOYA 2R5YB 1VR5A 2F7AA 2DN0A 2OBGA 4TLMB 3THIA 4AC0A 1FEXA 1MQHA 1SYHA 4ZE8A 4FE8A 1B3LA 3TTMA 4ZEBA 3KSXA 1WPKA 3OOUA 1EF4A 3TODA 4EF2A 4H6DA 3SDFA 3LNQA 3K4UA 3PM1A 1PUFB 4XIDA 5FHMA 2XXTA 3ECRA 1Z0XA 1IUFA 2VKEA 3VLUA 1HDDC 2B3FA 5FTIA 2CZLA 1TWAJ 2CJJA 2KDZA 3RGYA 3I4NJ 4JP0A 1B9JA 2YLNA 5CBRA 2OPTA 3FGSA 5F0HA 4D5FA 3DELB 2R71A 3EHSA 1ZIUA 4NWDA 2E1OA 4ZECA 4OVJA 2EZIA 3ZQHA 2O1MA 4NF6B 3PUVE 2REJA 4U1OA 1MQIA 1A7LA 4F18A 1H43A 1ZMGA 4HW8A 4JSOA 1M5EA 1LAFE 3C35A 5E3MA 1AL3A 2QRYA 4KI0E 2LR8A 4IHYA 3CG3A 3OENA 1IXGA 2GHAA 2O9LA 2O6AA 4DZ1A 2G29A 2GBYA 3QSLA 3IOUA 1OQGA 3QUFA 2M2EA 2F6GA 2EZLA 1MQGA 4FCYA 3W9WA 2DWIA 3IO4A 1FTJA 4HS7A 4A3BJ 2VD2A 3TMGA 1B7UA 1DPEA 3F11A 1U9OA 3S1MJ 5K7FA 3O28A 5KDTA 4ZEDA 2MG4A 1JGGA 4RPNA 3H06B 2HXIA 4EQBA 3RKQA 2Q9TA 3H4ZA 2V25A 5H8HB 2H99A 2Y9ZA 3G3GA 3O66A 3FV2A 1UIVA 1MSEC 4PQJA 4R74A 3PD9A 3B6CA 1FTKA 3SEYA 1T56A 5TPAA 5BWJA 1N7XA 1M5DA 4M1VA 4QFKA 1HSLA 2GFEA 2XPWA 1ZU0A 1LBBA 2M8GX 5I56B 3O9PA 3OO7A 3DCFA 3CDLA 4IO7A 3PV0E 2NS7A 5I57B 3EF7A 1ELJA 3BG9A 5I2NB 2P81A 2DP8A 2DXRA 1NTCA 4M3EA 1RYXA 5DVJA 2XXIA 3N6TA 4Q0CA 1QKBA 5DVIA 5K7ZA 3MN2A 4MH5A 3ZQFA 3LSRA 2OF7A 3CG1A 3TFLA 3T9XB 1IDZA 1RKMA 1WVJA 5L9MA 3TTRA 1MS7A 4O3BA 3FK6A 2R7ZJ 2A5SA 4UUSB 2DOJA 3S2DJ 4EEFG 1D5YA 1GV5A 1XS5A 3RQIA 4NDLA 3JRCA 3CRBA 3BG3A 1F9BA 3B6QA 3RTFB 2DMQA 1R1NA 2ZYNA 3TDJA 2DWJA 2ID6A 4I6ZA 1D9YA 3FV1A 2ZB9A 1JKPC 1UTBA 3HGYA 1B0HA 1SVXB 3V89B 1A99A 1SW4A 1N04A 3FJGA 2XXXA 1PEBA 3V83A 2DA7A 2WV1A 1ITYA 2O1LA 1VI0A 3IH3A 2X9DA 3DP4A 4LUBA 3HGGA 2VGQA 4ELQA 5KZTA 1NKXA 1BLFA 3MW0A 1RKWA 1POY1 2X7QA 1UMQA 2ZMBA 3RY3A 1NH8A 2NVQJ 3IV5A 2DJNA 3K1MA 1P1NA 1M5FA 1NK2P 3D4CA 1BW6A 3GTLJ 4PFWA 1QUIA 4D7NA 1R9LA 1ZJLA 1I6QA 3LSJA 1Y1MA 2F35A 2PVUA 2XXUA 4F22A 2A5TA 2BJJX 5FKLA 1XT8A 4RXLA 5H8QB 3BG5A 4XRMA 4F1YA 3A02A 2GLOA 5TP9B 2HOSA 5CBSA 3BFUA 2RC8A 2DA6A 1LSTA 1A8FA 2ELKA 4LATA 1YRNB 4OEUA 3OELA 3S1NJ 2XB5A 3CIJA 3MZ9A 3S9NC 3OSGA 5BUUA 2V93A 1PB8A 3D4GA 3UKGA 4JYKA 4K3FA 4R9GA 2ME0A 2R5YA 3C36A 2ID3A 3A03A 3LR1A 4JWYA 3BBRA 4OWDA 4LA9A 4YB6A 5CMBA 1JT6A 1S7YA 4QSEA 3UGWA 3W6VA 1ETYA 2YU9J 3BR5A 3DEWA 3OEKA 2FYIA 5FJ8J 2THIA 1XG1A 1HSJA 1US5A 4DDDA 2LTPA 2XHDA 5H8FB 4FE4A 1IJWC 2JA5J 3LSWA 2F97A 3JRIA 5BNGA 2DWHA 3QPLA 1OCTC 1JEVA 2QCOA 1MY2A 3BR3A 1LE8A 2LAOA 4GOTA 1MDQA 2CQQA 2Y31A 4G4PA 2LK2A 4OEVA 4I62A 5KCJA 1NL5A 4XKPA 1B7ZA 2HYJA 4U21A 1B5JA 2Z22A 5IYDJ 5CMCA 3C34A 3LUYA 3HN0A 4XKNA 4EXKA 4LQ2A 1B40A 3D1NI 1VFEA 2HEUA 4LZ7A 3DLNA 4R6KA 3U1OA 5ITOA 1B72A 5C4XJ 3BR2A 3IO6A 3F0CA 2P2AA 2HQ5A 2ZXTA 3MAMA 1OLCA 4GFRA 3JRBA 4BBRJ 3SESA 4X1BA 2HI3A 4Z0IA 3G3JA 1OVTA 3GTJJ 1DMBA 3LBSA 2XXYA 3BTCA 2M9HA 2VHAA 3KN8A 1B1XA 1XC5A 3K01A 3RQTA 3FVGA 3M3FA 1N7WA 1SW5A 4PFYA 5J1RA 5FKKA 2GHBA 5TU0A 3S17J 3FIWA 1XS9A 1USYH 4FEDA 3K6WA 3E4RA 1FIPA 2ANJA 1IRZA 1SI1A 3SDGA 3PUYE 2R93J 1B1HA 4G68A 3TQLA 2NVUB 3IB2A 1FTOA 3C9HA 1Y1WJ 2PT1A 1RR7A 1Y4TA 4H67A 5I2KB 1WH5A 3IR1A 2DMPA 5E3LA 2QMXA 3VVEA 3MVPA 1YRNA 3T9HB 4F3SA 4U2RA 2MGQA 1GVDA 4GVOA 4F2OA 5M3FJ 2VP1A 1D9VA 1FCKA 2PBWA 5TP9A 4MBPA 3VDFA 4ABZA 1WI3A 3PPRA 1LCFA 2Y7RA 1MH4A 4WKMA 5GPAA 4KCDA 5A5XB 2EQRA 1FW0A 2O69A 1A8EA 2Y84A 5GP9A 4XKQA 3PO2J 1Y9UA 3MVWA 2G0EA 2DMTA 2Z8DA 5FTHA 4MFDA 3R6UA 3UORA 1MPBA 4NEDA 1MRPA 5F27A 1Z77A 2JK3A 2DYXA 1BP5A 1ZLQA 4FECA 4LP2B 3B6WA 3K6XA 1NMUA 4JX6A 4OESA 2WKYA 3KEIA 2LKXA 3C2BA 4R2FA 4IHXA 2YPNA 1W0UA 3JREA 3N94A 4X1DA 2PT2A 2RC7A 3L6GA 2XPVA 5EG0B 1K61A 5CI5A 2H1KA 3ILUB 5FKNA 4KYDA 1B8IB 3BFTA 4F2QA 1WCMJ 3T66A 4RK9A 1JTYA 4DLDA 3TYHA 1BKAA 3MC2A 2OJTA 3ONMA 4DYQA 3T96B 1QJMA 4UUSA 4H5FA 2JMWA 4C1TA 3OOAA 1M5BA 3PMWA 1B4HA 2DSFA 1TXFA 3FJMA 3K2DA 1OMPA 4V2FA 1BL0A 3ZKKA 3RT6B 3OSQA 1VFCA 2XPUA 5K2XA 2GM4A 3CCYA 2VD3A 3SKPA 4DYRA 4EQ9A 3FXQA 3CSBA 2LY9A 2OWTA 2TRTA 1B7HA 3K6UA 3VLVA 2XX7A 5I56A 2RCAA 4YMAA 4G68C 4GFBA 5HM4B 3S2HJ 1I6BA 1QULA 2AO9A 2K40A 5TPAB 2DWAA 2HZLA 4FIMA 3O8GA 1XOCA 2NXOA 4Y7NJ 5F1QA 3HO7A 3G3HA 4EQ7A 3L1PA 3OMBA 3CR9A 5H8HA 2I3WA 4H1XA 4LVQA 2H8RA 3A09A 3IK6B 2IAIA 2YJPA 4BXXJ 3G3IA 2ECCA 1IZ1A 1JQFA 2H9BA 4GQOA 4P0IA 3PPNA 3L6HA 4IO3A 4UA8A 3GTKJ 1QVSA 1JUMA 2O68A 4YKPA 2D21A 3P7IA 4IO6A 4ZZEA 3ZOBA 5FHNA 1TWCJ 2HAVA 3IH4A 2JA6J 1MDP1 1Z7ME 1IUDA 3DM0A 1P1UA 3G1OA 4M3DA 3G1LA 2DA1A 1OVBA 2OCUA 4IO4A 5F7VA 4MFEA 4XXUA 1BTJA 1IC8A 3WAFA 4YU0A 4NF6A 3H3GA 3PMXA 2WAQN 3A3UA 3OO8A 2MSYA 3H6WA 4R6YA 3TW6A 4HTGA 1UIUA 3TTLA 4M6VA 3KJ7A 3BR0A 2XGEA 3B7DA 3RN8A 2XRLA 1B3GA 1NNTA 2UVJA 4AQ4A 2F36A 4OYVA 4RK2A 3MJNA 1AHDP 2DE2A 3BR1A 4N13A 3W9VA 1MXVA 2UVGA 5C4JJ 4G12A 1F36A 3TKDA 1B3HA 2X48A 2O7UA 1X58A 1MPCA 2JJ7A 3MPLA 4G77A 4ISUA 4QFLA 2UYEA 4W1UA 5GPCA 5CMMA 4DCXA 3PUZE 4ESXA 3SETA 2ZNSA 3CFLA 3BQYA 4YKKA 2ME6A 2Y2ZA 2NOGA 1O63A 2R9JA 2D5WA 4L17A 1B8IA 2FD5A 5JTYB 1KWHA 1SI0A 3ZS6A 2XD3A 3E7LA 1A40A 4JB7A 4FISA 2I49A 3RNNA 2FX0A 3GTPJ 3MZBA 1DU0A 4KPTA 3LSGA 1FQAA 1R9TJ 2AL4A 3HDDA 5ITPA 3CMYA 1ETWA 4QHQA 2I4CA 2I6EA 3HOYJ 1TWYA 2XXRA 4DW6A 2YS9A 3RPWA 1N84A 4TLLB 2XSDC 1H76A 4NF5B 4C3IJ 4AB5A 2Q89A 2Q2AA 3O29A 4R2BA 5DS9A 3QIMA 3O6HA 4XRSA 3I6VA 4DIGA 4J19A 2QPQA 4OHNA 5A5XA 2XGCA 3LC8A 4U23A 3BR6A 3Q0UA 3RT8A 4U4SA 4BY1J 1EH3A 2FA7A 3GBAA 5IKBA 3I5OA 4HCWA 4KYEA 2AL5A 2DE3A 2VI6A 1NNKA 4IGTA 1K83J 4R73A 3UK4A 1FJLA 4XTCQ 2ZYOA 2DQVA 1JEUA 2V84A 2XX8A 4A3KJ 1B4ZA 5H8NA 2Y7PA 1DOTA 3C32A 3JRDA 3HPIA 2L7ZA 1HSEA 5I2KA 5CMKA
chains in the Genus database with same CATH superfamily
4MMPA 1MPDA 1X4PA 3E79A 4FQGA 2IPQX 1GDTA 1OYYA 2XAUA 1U78A 1TC3C 1B1BA 4Z2YA 2EK5A 2Z1DA 2AIXA 4PCDA 2ZYMA 4F29A 1V5GA 3BQZA 2V1NA 2DA4A 2F4MB 2F3BA 3KZGA 2X6OA 5JVGF 3GTMJ 4YB7A 3TAJA 4E0WA 1LBZA 3FVNA 1IN8A 4PFRA 3H0DA 4GYIA 4A6EA 1STZA 1JW4A 4R79A 2H27A 4C0RA 2XDVA 4DXBA 3IRQA 2LD5A 3MEXA 1UHSA 3ECOA 1N3XA 1ERDA 3GTOJ 1EZ9A 1PB9A 2BY2A 3M7GA 1GGGA 3V42A 4GWSA 1HOMA 3M8FA 4RLQA 4DXCA 1BW5A 1B5IA 3MKLA 2I3VA 3U93A 3UA8A 4IEJA 3IWFA 4NQWB 4CYCA 1YXIA 3CFXA 3IX1A 3VXCA 2FU4A 3FISA 4N6KA 4J01A 3QPSA 2OV7A 3RZDJ 2H5YA 1AKHB 1W0TA 3KP4A 4OERA 2O61A 3IJXB 3G3ZA 3OYAA 4N0BA 1B46A 2VPNA 4KMUX 1YX3A 3T0YA 3CCQI 2QS3A 2VJIA 2VBXA 1UFMA 2Q8JA 2EFOA 4BDRA 2Y75A 4BQQA 1X2NA 2HVQA 2KMUA 1IDYA 4BXUA 1LAXA 5DTBA 3K4CA 3K4JA 3JW4A 1D8JA 1H9GA 1YIJI 4BKXA 2QS4A 5EJCA 5HS9A 3KFMA 2B9SA 3R7XA 2DPUA 1XN7A 1P4WA 4LZ8A 5DD8A 2OZZA 2YUSA 2Z33A 2F7CA 4PGPA 4L18B 4EJTA 1D0ZA 1FPGA 2I0BA 4LFUA 1MQJA 3EKIA 1RZ4A 4Y52J 4GX3A 3BTIA 2Y0SN 3RKYA 1USYE 3EETA 1QVUA 4R72A 3WGGA 4MNIA 4K2EA 2M34A 3WU0A 4AIKA 1FPJA 3BIHA 4X9TA 2HAUA 2BOLA 1K9ZA 1UJ8A 4OIQF 2RQPA 2F8DA 3MP6A 2DA2A 1KQ9A 2CW7A 2MFZA 3CDIA 2REGA 1ETKA 1OR7A 3SJMA 1F4KA 4OMYA 1ENHA 4ENKA 1R6ZA 5KCJB 3EQ1A 1K78A 2HEOA 1B3EA 3TCHA 1HDPA 4QRZA 2DK5A 2VXZA 4YICA 4D7MA 2Z5UA 3SZGA 3WHBA 3ABUA 1FRPA 4ZEKA 3ZSFA 4KQPA 1FZPB 2DMNA 4PETA 2B0LA 2QQBA 3OR2C 4E70A 3CO6C 4XK4A 1YTYA 1FPKA 1O64A 1LFHA 4R6HA 1Z7NE 2X6XA 4A3DJ 2I0CA 4U0YA 5FLMJ 3V7RA 3OWTA 4YB5A 4M3GA 3LV0A 3FUZA 4BE1A 4NF0A 2PMZN 1Z6RA 3HPGA 3N97A 1NG7A 2PMSA 4JDFA 4NF5A 3O2AA 3K10A 2BV6A 4GXSB 3Q9VA 1SFEA 4P1LA 3E6CC 3W2AA 2DW4A 1IIWA 4UHTA 1NH3A 2XIGA 4H8JA 5CC2A 4Q47A 2HNHA 3KOTA 5DVFA 2KIUA 1XHYA 1JTXA 4RJZA 1NNFA 1DUXC 3LSTA 1Z3YA 2I10A 4ZYDA 4OFOA 4RLFA 3W3CA 3E97A 2LMDA 3FXRA 4XOPA 2UYFA 2YSRA 9ANTA 4GLIA 2HPIA 2IBDA 2K9LA 3CJRB 3QXMA 3Q0WA 3A4CA 2OLBA 3OYIA 2ELJA 3WE3A 2IP2A 3GLLA 3ABKH 1HKTA 2E0SA 2DDBA 4CXFA 2ACJA 4XIGQ 1URGA 1Y4CA 2DS9A 4U0VA 1GLNA 1IN7A 1XB4A 2JVHA 2XF5A 4BACA 3MKYB 4FX0A 2HR3A 2ZSHB 5DYMA 5CRYA 4C1UA 2OC6A 4KA4A 1FPIA 1USTA 1FBFA 2K4JA 1FTMA 4EGYA 1BI2A 1QZEA 1XX5A 3SEQA 4ZDMA 3T22A 1FQBA 3BKIB 4XKRA 4U4XA 2CUFA 4XLPF 3HRUA 3TGNA 3B50A 3LSLA 4JXIA 5JTYA 2CWEA 2R7TA 5AA4B 2V3QA 3E0JB 2A68F 1YJ9I 1VE4A 5DTDA 3KP3A 2Z9OA 3EPZA 3KPHA 1XDSA 1S72I 1IEJA 2V1DA 1VQ6I 4RNSA 2FNAA 3DP6A 3HRTA 2A5YB 2QL3A 4LIVA 4DYCA 2OK2A 4KDPA 2NWJA 1SFOJ 3HUGB 2CGPA 2VT3A 5B1AH 1RYOA 4PAFA 4IQJA 2P0SA 2QVOA 3OYGA 2UVIA 1G8XA 2BZTA 4HEA2 3MKZA 2V4CA 3IAZA 1S6LA 4MO7A 4NNJA 4XQFA 3M8UA 5AA2B 3VV5A 4M3BA 1MY0A 4O94A 3EUHA 4F52A 4NQ8A 4RAFA 5H8QA 1Y0UA 3TTKA 3HSTA 4BDQA 4XEQA 1MBJA 3CZ6A 4AIHA 1JUSA 2O7OA 4CCMA 1RESA 2KL4A 1II5A 4YIIA 2VUMJ 3H9QA 1KU7A 2KLOA 1B4AA 3ZQGA 3ZMZA 1WJDA 2RCBA 4M3FA 1XGMA 5IGAA 1N0TA 3S9MC 3R0JA 1P9QC 4ZC3A 1VTNC 5C44J 5B70A 5IAIA 1LAHE 5I7IA 2VC0A 5HODA 1D3YA 2ZXWH 2L02A 2R7SA 1TT1A 3IOVA 4OINF 4QTRA 2LY1A 4HF0A 4G7HF 5J8CA 1LPQA 3ZQQA 4A3EJ 4PJNA 3OYBA 3WTXC 3QMFA 4MHGA 3P7NA 4PFBA 3LSHA 3KZZA 2VQCA 1DSNA 1U5TC 5EEHA 3HCQA 4FJPA 1NFTA 2M5WA 3Q26A 4PSXA 2Z8FA 3KZYA 2NUVA 3OSRA 4BDMA 1VQKI 4BHCA 2QS1A 5I59B 5D4SA 1URDA 3KG2A 1JKRC 3U72A 1G4DA 3BCBA 2HXOA 4EJVA 4F31B 4WXCA 3V8LA 3MBPA 3PD8A 1MBEA 3K1PA 4A69C 2OZUA 5M5XJ 1FLIA 1INPA 4PP0A 2ETHA 3BOQA 5ICQA 1YW7A 2CQ7A 2F2EA 3SQNA 3HKZN 2L01A 1ZHFA 3WU2C 3QPHA 1FQDA 1MMAA 2MC3A 2Q2EB 4MIMA 4CYDA 4POWA 2A61A 5JK4A 4IJAA 1UTBB 4I3EA 2ZBKA 1E3PA 1R1TA 2ZZWA 1XPXA 1LFBA 1R00A 1J59A 1LDJA 3TTNA 5F0FA 5FRMA 1DU6A 2KIMA 5F6FA 5J3LA 3W2VA 4A5NA 1A54A 4QFOA 1LAGE 1JW1A 4HOBA 2YPRA 1WDNA 4GRKA 2DYSH 2LDUA 3TDZC 3I56I 1EA3A 1LDKB 4N4OB 5BPDA 4C3HJ 2ONSA 4S0HB 1TQIA 2Y48A 1HCRA 2EBIA 1H45A 5DEXB 5AE4A 2ELHA 3IFCA 3KN7A 3RPLA 2ESNA 2L3DA 1IQ7A 3NWSA 5HLTA 3Q5FA 3LWFA 3HBLA 4NF4A 5H20A 3TKYA 1PB7A 4R75A 1G3SA 5DV5A 1BIAA 3EHUA 2MA3A 3GMEA 2FVZA 3IOTA 3LSXA 4RYAA 4NUBA 4FAJA 4JVDA 1H9TA 2JSPA 4PGNA 5ILVA 1MBHA 1AIVA 4OMBA 5IZ3A 3LSKA 5F08A 3QYTA 4HRIA 2JUGA 3R6SA 3S32A 2XA5A 2V3TA 2E7XA 3ODBA 4FATA 2CV1A 3MSTA 3FASA 5L3FA 4UABA 1FQCA 4QSCA 3QP6A 4BJTA 3SEVA 5CM6A 4XRSG 1JGSA 2CO5A 4F3BA 1QZYA 5D6EA 5B5EC 2CMOA 1TBXA 1TFAA 2COBA 1KYZA 2OA4A 4QIWN 1FYLA 4BUPA 3SEUA 2W7YA 4CCOA 1MXXA 3KEOA 2L9RA 3TP0A 2HFBA 4MEVA 5I57A 5DYHA 4XLHA 2FSWA 1ZN2A 4W97A 4OAYA 1MBGA 1PYVA 3HIFA 3LSIA 4UUTA 3OIOA 1OQHA 3FBPA 4MTDA 2NXNB 1JVXA 4UV8A 5EYFA 1T8IA 4XN0A 2AXTC 3FBNB 3TQWA 2QSGX 2GXGA 2VLAA 1U8BA 4GWZA 3JSPA 3M3KA 1OKRA 5ED4A 5LHGA 1REPC 3ZXSA 4C9YA 3A29A 4CZZA 4OQOA 3SERA 1FQFA 5LTCA 3PJRA 4NBQA 4A3IJ 3VWBA 4L0YB 1EZPA 2IJLA 1HW1A 2UXAA 4PAKA 3LFUA 4H65A 1BA5A 4BHPA 1TW2A 4GO1A 4I1DA 4POXA 4O7IA 3SEWA 5IZ3B 1MM7A 2VBYA 1R49A 1HLVA 3WE2A 4I99C 1YITI 4RA2A 4ZEFA 5LHHA 2R7WA 3PPPA 3OR1C 1E2XA 3GZ6A 3TO7A 2HU9A 4UB8C 1OJLA 4NF4B 2HOTA 1A55A 1Q1HA 4ONYA 4C2MJ 4PTKA 1L5TA 3RPLB 2XXVA 4BDLA 3H92A 1O7FA 3OO6A 5FHOA 3U1DA 1JKOC 2AS5F 5E18F 3HOVJ 3GYYA 3K4LA 1HF0A 3ESWB 4DBRA 4G6TB 3VB2A 4S05A 2V1UA 4HCYA 1MXWA 2DMUA 3EYYA 1O7TA 1SANA 1MMDA 1FTZA 4L9JA 1VQ4I 2F3DA 3T5XA 4JX5A 3HOTA 4NWCA 2H25A 1FC3A 1SVOA 3OL4A 3GTQJ 2HQNA 5EG0A 5BS6A 1LFUP 4Z7EA 1I69A 2F5FA 3CLOA 3J80Z 3DBLB 4ITVA 4PJJA 5F0CA 4RB3C 2M45A 3VE1B 2RGVA 3V8XB 3HTSB 4IL6C 1FPBA 2ZC2A 2TCTA 3I3VA 1T6SA 2OTJI 3DBRB 2F34A 2XD2A 2HVRA 3MAJA 3MMYB 1T33A 4YZZA 3WAEA 1UTHA 1S29A 3G73A 3E1SA 5HPQA 3MZHA 2MH9A 2Y30A 1MY3A 2H8WA 5K7HA 1P4XA 2Y5KA 3GF2A 3KP2A 3QWLA 3F6OA 3LUZA 4X0GA 3NOHA 1ORKA 2A69F 1Y8RB 3BY6A 1P1WA 4HX7A 3H6UA 1MBFA 5I84A 2CH0A 3CCMI 1IXSB 2OUMA 3BTJA 4BEHB 4LZ5A 1TW3A 2LKPA 5IY5H 3MQ9A 5EZGA 1D5VA 2D1VA 3JRAA 3EN3A 4OETA 4H8IA 5D5WB 2R7VA 1IXHA 4KN7X 2KJBA 4B8XA 4DQ2A 1V55H 2LG4A 1JJ8C 2OQGA 1FQEA 3HB9A 1Y3QA 3HTUA 2HQ0A 4ZS9A 3U8QA 2XGDA 5E1ZB 3UR3C 3S16J 4PFTA 4IOAF 2PYYA 2HOAA 1VDWA 4F1UA 4HG2A 3HEFA 3IAM2 1VSOA 2BJIA 3FM5A 1FTLA 4U87A 2XXPA 1U9NA 3TCGA 5EGOB 1NV5A 4WEDA 2CS3A 3ONQA 1GVJA 2QKMB 5J4YA 4KFQA 4BDOA 3CMAI 1FWZA 3FDYA 3GLBA 1KU2A 2WV0A 4FORA 4MTEA 3HOZJ 3ZKLA 2I48A 4BU2A 1D1CA 1P7IA 3CJNA 2QFLA 3HHGA 4Q5TA 2Q1ZB 5J40A 1OYWA 2VE8A 5C3EJ 2O03A 3PUBA 2PMZA 2BE5F 4GWXA 5EEAA 5AA3A 2JA2A 2CFOA 3AG2H 1VQOI 1IW7F 4IX7A 1QPMA 4HE1A 2L7MP 3RYRA 4GL0A 4A3LJ 2HKOA 5FKMA 5F04A 2NS0A 2F78A 2D45A 3GTGJ 3HHFA 1VF9A 3DLAA 3PFIA 3GEZA 1VQLI 4BLAA 1MMGA 2E5NA 1Q1KA 2QS2A 2XAHA 1SD3A 2MD5A 2QVVA 3A0HC 4QFPA 1MW7A 3O2PE 2P1SA 1JHFA 3F6VA 2M8CA 1AU7A 5CLSA 2GIVA 2ZNZA 3QYEA 1IG7A 2DVCA 1FMVA 3E5QA 4I09A 3Q27A 3LSFB 1GV2A 4GF8A 1HXDA 1RPWA 1G3YA 3AAFA 1QVTA 3G6EI 4CZCA 1MJ9A 4I01A 4GXAA 3ULQB 4N91A 3KLOA 1FPDA 4PFUA 1R6RA 2KJCA 1WODA 4NGUA 2E1MB 1S5LC 1B0LA 4OVTA 2L0KA 4G68B 3ZQIA 2K85A 1Y1VJ 4JSDA 5EZHA 1TT0A 1RDYA 4DBQA 2NOOA 1B6AA 4KI0E 2V7FA 1WKMA 3W6KB 3VVDA 2COMA 3Q3SA 1P7JA 4I02A 2IGKA 1KZ8A 3TEDA 1S9TA 2I4BA 2HQAA 2JN6A 1PBPA 5LOMA 3S9LC 2HCAA 2VOZA 3VEPA 3CVGA 2B65A 1R7JA 2ZNTA 1SFXA 4CHUA 4EXLA 4QF9A 1W7PA 2RAEA 3FXUA 1UB9A 5HBCA 4RPOA 2DCEA 2A6HF 3PNVA 4IRIA 2NVTJ 3S1QJ 3H7MA 2D1HA 2L5QA 5JHUA 2ABHA 5I5PA 1LBXA 1Y0NA 1B2HA 3ZPLA 1OLAA 4ZDOA 3K70C 1A5JA 3SEXA 5L3DA 3KX2A 1DDNA 1P1QA 2CV0A 3SFZA 3LAPA 1IXIA 2B3BA 4LONB 2Q88A 3FK7A 3RKXA 3MZ1A 4TOZA 4LLNA 2E2HJ 4RAYA 2VPLA 1S8NA 4JWOA 4BXFA 1NNPA 3QK6A 5EHSA 1Y1ZA 4F3GA 2E19A 4JWXA 5EHMA 3EPEA 4IB2A 2Z23A 2VJJA 2VKVA 4G8XA 1RUOA 2BVLA 1SBPA 3Q28A 4OENA 3FZVA 2QKLB 1GT0C 5D6FA 2F5EA 1WVRA 4I98B 1TZLA 1B72B 4GIZA 3J7YJ 4KR5A 2DQLA 2H6BA 2FHYA 3DKXA 4UY8I 1ONVA 4RBOA 1FTTA 1ETQA 2LF7A 2M1BA 3ML6A 2VPRA 4UB6C 2E2JJ 1H44A 3N5LA 3M8JA 2Z8EA 3PNTA 3OY9A 3SFIA 4E7IA 3RLFE 1P4AA 1I3QJ 1LBVA 2WA0A 2VC1A 1WHUA 1TQPA 3S9EA 2WB1A 1DGRM 2P5LC 4XSXF 4B3XA 4B44A 3H5AA 1ZAOA 1X3UA 2EZHA 5JLWA 1V5EA 4R8HA 1WH7A 3BWGA 5FGMA 2IS1A 1SQYA 1D4NA 3BIGA 1QRYA 2R7RA 5AA1A 5M2VA 2B63J 2VT5A 3C2GA 2M4GA 5D5UB 4PC9A 4EF1A 2ADUA 5JHFA 3GBGA 2ICWG 1F5TA 1KA1A 2MKZA 4GL8A 3HOXJ 1IV6A 3H6TA 1MKMA 2DOAA 4JX4A 1ZLJA 2RNJA 1VQ7I 2OBPA 1I1SA 1FX7A 2E71A 2QSXA 3VYSB 2LKSA 4G7OF 2R0QC 2BY3A 1PP7U 4H46A 3VPRA 4MFIA 5DW8A 3E9XA 2PI0A 3OXNA 3E5UA 4YKJA 1NG6A 4ESBA 1AMFA 2DQRA 4BBSJ 1I39A 4YMBA 4I0BA 2JA8J 1R71A 2Q0OA 2QWWA 4JQFA 3H9JA 3M1CA 4OZ9A 2VB6A 4P11A 3PUFA 3TUSA 2JWTA 3ROUA 4XONA 3A01A 1K6OA 2KIQA 3ZR8X 1AKHA 5DT6A 5H8FA 5E8GA 2O7IA 3K1NA 4V19K 5K2YA 4KYSA 2QQ9A 1WJBA 3NARA 1A04A 3E13X 2QA4I 4XLCA 1VFDA 2IA4A 4NQWA 1FP2A 3OYJA 4DJAA 2PLYA 1APLC 3FXOA 1ZELA 3S8PA 1WSUA 2FEZA 1VQ9I 1YX5A 4BY7J 2BXZA 3DBHB 2JPBA 3QQAA 3G3FA 2OAZA 3I71A 3BPVA 2Q74A 4O6JA 2ISZA 1AOYA 3T0JA 2YX7A 3G1MA 2Y7IA 4YEJA 4WXHA 2ZYKA 1IN6A 3SYTA 1Y6IA 1YPNA 4KNYA 5D4RA 1ZRCA 5K1YA 2ECBA 1B51A 5E3NA 5K5QA 3OEMA 4M73A 5CVVA 5JFRA 4S04A 1P99A 3MUQA 4P0GA 1JNFA 4XRFA 1B59A 3MVXA 3OENA 1ZG3A 5CYVA 2KLFA 3S4UA 2MD0A 5KAIC 4QSHA 1EH8A 2DE4A 3PUXE 4AYBA 1P92A 1DTZA 5LEKA 3RDIA 2DA3A 4I9DA 4G61A 1W7PD 2VOOA 4U7BA 1LVAA 3KSJA 2V9VA 4FEBA 3PIPF 1VNDA 2JZYA 3BC8A 1XMXA 3O8HA 4IZZA 1I6HJ 5H8NB 3VVFA 5IT3A 4AUXA 2O8XA 1XVXA 1QPIA 3RZOJ 2LLKA 3LQRA 3QUJA 2GQ1A 3KOSA 4OMZA 3JRFA 4N6PA 4ELPA 4N9IA 1G0IA 3T8TA 5EF6A 1O4XA 2HZKA 2K9NA 1AWBA 3HV1A 1ODDA 4WX9A 3PFYA 3IJOB 2EH3A 2L7FP 3SZPA 1LJ9A 3DPTA 3TEPA 2H09A 1MY1A 1DTGA 3TO9A 2O84X 4M71A 3DP8A 2A6TA 4HSTA 2UZKA 1RUNA 3G4SI 2H4IA 2IEEA 2X26A 2BW3A 4A0XA 1ULYA 4A3GJ 4G94A 4A3MJ 4P9FA 3SZTA 1XMAA 2ZXIA 4HX4A 4A3JJ 1T0FC 2PJRA 3HJEA 4BYYA 3IFAA 2MABA 2Y7KA 1N75A 4OANA 3Q0VA 2BEOA 5EGOA 2CEXA 4F39A 1Z05A 1YHQI 1O3SA 1B05A 5EYRA 4I2OA 4MAGA 3K2AA 2JVGA 1ON2A 4CA0A 4MF3A 1ZTRA 2M0CA 1XVYA 1Y3NA 4DIQA 2IT0A 2CUEA 1ETVA 1B6HA 2LFBA 4H4KC 2JRTA 5CVRA 2EINH 1EZOA 4IHTA 3TW7A 3NAUA 5CQGA 4BQOA 1Z3XA 3CCSI 1LFIA 2X1DA 3A3CA 2JPCA 4GX6A 4MLOA 3ZMDA 4HNVA 5I58B 3N26A 2Y9YA 2XVCA 2DODA 4HF1A 1R36A 3OO9A 1ZK8A 4KMFA 2HXRA 4ELOA 2RKHA 4HDUA 1POGA 1DQUA 4A3FJ 1RR8C 3PU5A 5DUKA 1UTHB 4B48A 2R5ZA 2R7XA 2XASA 1MQDA 3JYRA 2K5CA 3TPAA 2RVCA 1BJZA 4RAGA 3B6AA 5DDGA 1H88C 5IYBJ 3RYDA 4QFNA 1I6AA 3G3KA 1WJCA 2L54A 3A2KA 4XICA 1JT0A 4PDHA 1Z21A 2LYCA 3OYCA 5IYCJ 5IM2A 1L0OC 2CQXA 1T38A 1UELB 3FMQA 3HXLA 4Y3OA 1JKQC 2W24A 1VQNI 1QKAA 3V5AA 2BGCA 2FOKA 1HC8A 5E3OA 4MNPA 4NE4A 2WAFA 3Q29A 1HA8A 3U92A 4RS8A 3OYHA 3M1EA 3RSNA 2E36A 3QPTA 2H98A 2NVXJ 4L9NA 3KN8A 2PMHA 4UVCA 4U22A 3FKJA 1PBQA 2P5VA 3CI8A 1S7OA 1SW2A 1BOBA 2CRGA 2DOEA 2F6CA 5D8KB 3FWEA 2LBFA 4A93J 1R5HA 4IO5A 1H89C 1EYIA 1QZZA 1LEVA 4NF8B 1R5GA 5CVJA 5K5RA 1MGTA 1OCZH 2KRCA 4CCJA 2D5VA 3OV8A 2JQ7A 3LAJA 3B8BA 1E3OC 2STWA 3O97A 2OWSA 1R5ID 2KIFA 1ANFA 3CTAA 1K7AA 3GFIA 1P1OA 4PSWA 4XORA 4LG0A 1XC1A 2EB7A 1TWFJ 1CNQA 3DXJF 4CCKA 1KQ0A 3DU6A 1S7EA 1ATGA 4N4UA 1MJBA 5BQTA 3FATA 3IORA 4H5GA 3LA7A 1MSFC 1H3DA 1MXUA 4G8HA 1R9QA 2F6PA 2XXHA 3HFUA 1WJEA 3QP5A 1AH5A 2L5VA 4YAHX 2G93A 5CVIA 3IB1A 1OCPA 3WHCA 3KETA 3QYFA 3KN3A 4YFXF 1A6IA 5L3EA 1SFUA 1DGWY 3H0GJ 2QSFX 2ZJQF 3WG7H 5KHDA 4O3AA 2XX9A 3PMVA 5CJ9A 5I2NA 3ABLH 5EDNA 4PBHA 3AL0C 4B3AA 1XI6A 2I58A 1FBUA 4E0XA 3MZYA 5A5LA 4AVZA 3O6GA 1IXCA 1Y20A 4OVPA 1YS7A 2K9QA 5JLXA 1IRGA 1LFGA 3OYEA 2JJKA 3QAHA 5HLGA 1U8RA 1MXYA 1ZGJA 5H8SA 4IO9F 1ETOA 2G9WA 4N8YA 3T9VA 1T0KA 3I4PA 5TJJA 4LITA 2CU7A 2DT6A 5ICCA 1KGSA 2JTVA 3L2QA 2E2IJ 4ENJA 2V3UA 3GBBA 2VPOA 4XLEA 3KJTA 1ZREA 4B1RA 4BQNA 1CB6A 2DVZA 3ZGKA 2FNCA 5M5WJ 1RETA 2Y7WA 4N07A 3S1RJ 1M1EB 4OIPF 3RJPA 1N3WA 3ZQCA 3W15C 1WI9A 3IH2A 1SEUA 3HRMA 1MH3A 4Y4RA 4EGZA 1TFDA 3H6VA 1FSEA 2A5TB 3RTRA 4DCYA 4EUOA 3RTWB 2OQRA 5JR3A 4MLVA 3OD7A 4LB6B 4JK1X 4BAYA 2HTSA 3DTKA 4IRGA 2D3IA 2ZMEC 4UACA 5J6XA 3KC1A 2DJIA 5D5XB 5DEXA 1ETXA 5KDTB 4Y33A 1LEBA 3KCCA 3FIRA 3AXFA 4M9XA 3JV9A 2F48A 3BTLA 3MWBA 1AOVA 1OCRH 4HW0A 3W6JB 2TDXA 3OYKA 4OWRB 2PN6A 4EM2A 1YTVA 3PSIA 3R26A 1GV8A 4YG2F 2L2OA 3K7AJ 4DE8A 2EFNA 2ALUA 2HDWA 1R4MB 4MLQA 2VN2A 2HKXA 1BR4A 1J09A 5IT9K 1X3WB 3CQZJ 4II2A 3PGFA 2IS2A 5FLVA 4NMYA 3ZMVA 1EH7A 2EIMH 4YKIA 1MM6A 1OIBA 1F1ZA 1SVLA 3K70D 4DZJA 1CQTA 5LGNA 2Z99A 1IMFA 2A5WA 2IXSA 4F3PA 2NYXA 4XN3A 2WYPA 1WGXA 3AKZA 3QU6A 2ZXHA 3U65A 1S9HA 1IF1A 2RF1A 2XXKA 4GX4A 3HOWJ 4EM1A 4F92B 2E1SA 5I59A 2X6YA 1EYJA 2HYFA 1LGBC 3CFZA 2HFHA 4D0PA 2RC9A 4Y17A 1JW5A 4L5IA 2GQQA 1SD5A 4V2GA 2LY2A 4FTHA 1Y3PA 5DM6F 4PFPA 3JR9A 2KT0A 2QMWA 4ZDPA 2W25A 2HZTA 3KBZA 2CZIA 4AD9A 4KFCA 3U94A 4DZPA 1SFKA 1BI1A 5DUIA 1UQWA 2W48A 2EZKA 4NC7A 5TGTA 1IRFA 3BCAA 2XWVA 2WB1N 1WJAA 4MNUA 1GVCA 4LGWA 3KGCA 1U6GA 4KITB 3DLLF 2O51A 1JJ6C 3MWMA 1FIAA 2X7PA 1ZKGA 4JVCA 1NV2A 4U1ZA 3IB0A 5LRRA 2RC4A 2IGMA 1UHWA 4WWCA 4E7HA 1IGNA 1QUKA 3I59A 1ZYRF 2IA1A 1W36D 3CLQA 4WXJA 5CI5A 3TZAA 2P5KA 4HPQA 3KP5A 5IP7J 1US4A 2RDPA 2W4SA 3PPOA 4EDPA 2P6SA 4GBVA 4MGRA 3K4BA 1KA8A 2FJ1A 2CEYA 2L4MA 2W57A 2NS8A 1EJ9A 4OIOF 2XXWA 5ELVA 4ZYGA 2HGCA 5H6QA 1TNTA 5LBQA 3O6BB 3L2UA 1POTA 5IP6A 1SW1A 4R9FA 2E5ZA 1BJAA 2VL8A 3KZIC 1FSHA 5IPAA 1ZKBA 2XAFA 3C2HA 3GVAA 2LP0A 5DCMB 3F21A 5TRDA 2O8KA 1QW0A 2EA4A 4ZZAA 5AA2A 5EQ8A 1PUFA 5L9OA 2GRVA 2PX1A 2NRAC 4LQ5A 3S2WA 3G7WA 2AHQA 4IHVA 4KHZE 3GZGA 2HXWA 4LIUA 2MW8A 1TWHJ 3J7AY 3M3LA 3JZJA 5J1UA 2K9SA 4WK8F 2M7AA 5M5YJ 4XOTA 3GUDA 3HC7A 3KYCB 3I3LA 4NF8A 3E3VA 4RY1A 4F1VA 2ZCWA 1VZ0A 4FHTA 1B3FA 3TDUC 3FM3A 3UIFA 2F7BA 1GUUA 3DKWA 3DF8A 1V4RA 3MKWB 2XC7A 3RUMA 3P9KA 1YYVA 3MVZA 5AA4A 3DV8A 3EHTA 1YAEA 2UVHA 3HKZA 1EU8A 4OFJA 1OFCX 3R4KA 4QSDA 4IR8A 1DPPA 2RINA 1W36C 2CG4A 2R7DA 3IL1B 1ZR2A 2FNPA 4AWXB 4B47A 1M5CA 2XXQA 1LBCA 4OFLA 4EQQA 1W4MA 2BHYA 3ZQLA 1NV6A 2V1XA 2ZJRF 5TISC 2JA7J 4WEPA 4D9JA 5BOXA 2IA0A 4LK1F 2R5ZB 1FBEA 4ELRA 1PDNC 2BHZA 4LG3A 4OTEA 2EIJH 4M72A 5ICFA 1MXZA 5L9SA 3BDDA 1N76A 4GGGA 5L3BA 4O3MA 1O3TA 4ZTFA 5L8DA 4OOIA 2QBYA 4NTLA 5I58A 3G2BA 1C0WA 2VXDA 3AG1H 4TV7A 3CCEI 1SMTA 2XF6A 5ERIA 2GH9A 1R4NB 4KCCA 3SDBA 2M87A 3UP9A 2DT7B 1N78A 4RMNA 5FKOA 1Q35A 2QQ8A 2PBIA 1ZBMA 1D3KA 1PDAA 3C31A 1FYMA 4UXNA 1V3FA 3GW2A 4HAMA 4ZYAA 3K00A 1D0XA 1BI0A 3IUOA 2R6GE 1MY4A 3CP2A 4ZH4F 3TELA 5ISUA 2E1NA 1YS6A 1U2WA 1RKTA 4IGRA 4RGRA 5IOZA 5FO5A 3TCFA 1URSA 4RA1A 4A0YA 2CW0F 4PE5B 4OAZA 3VYUB 2KPMA 2M4KA 4G6QA 3TMOA 3HG9A 4LLGF 3EUAA 4FASD 5M3MJ 1O3RA 3B6TA 3MP8A 3QODA 4OXVA 4CICA 4F19A 2P7VB 1CGPA 2LF8A 2FBIA 2PQ8A 3FHZA 1NI9A 3PUWE 2FBPA 4XMYA 1QUJA 4P96A 4X1EA 4H0WA 4DXUA 1OCOH 3TP3A 3CC7I 4I8CA 4TQUQ 3M4OJ 4FE7A 3WTYC 2DFIA 2HS5A 3MQ0A 2J5OA 3FJ7A 3GXAA 4BE0A 3VXBA 2ZNUA 1I50J 3WTTC 1F43A 1ZTYA 1K4SA 3K0VA 2DFHA 3CF2A 1Z1DA 5KVRA 3OYNA 3OYFA 1ZG1A 3C33A 2HDDA 4IHWA 4KD5A 4B4CA 1LEAA 2KQRA 4A6DA 1XTAA 4DI4B 4ECFA 4NC6A 2NVYJ 3DFGA 4XBFA 3CO7C 4GD5A 4OVQA 2ZFWA 4ZE9A 3WTSC 3BT9A 3CC2I 3RKWA 4KIGA 2MYSA 1NK3P 4D5CA 3PSFA 2CUJA 3OSFA 3Q25A 4IY6A 3OS2A 3CJTB 1PP8F 2AYSA 3USDA 3K6VA 3JAMK 2QJEA 4OA4A 2QF7A 3WG9A 4N15A 2VBWA 3GWZA 4RB2C 2EWNA 2DTZA 2VKHA 2CV2A 3I4MJ 1YE9A 1P6RA 5ICTA 4NHBA 4IKFA 3FXMA 5JEIA 1ON1A 3E3KA 4O3CA 2K3PA 5H6RA 2LVSA 1O3QA 3D5RC 2MH2A 1G2HA 3LA3A 2OCEA 3RI4A 4Q8RA 3EDPA 3T93B 1R58A 2HWVA 4CYCB 5ICEA 4CGZA 3H3VK 3H03A 4ESJA 5HNFA 3F8MA 5BMZA 3VFJA 2M3AA 4GDFA 4GWYA 3HM5A 1Q1VA 1YJWI 4ND9A 1LCTA 4LN5A 2DFEA 2IEKA 3S3NA 1PC3A 4O8MA 4GWOA 1B58A 4E7JA 4LOCA 1YQAA 1NH7A 1W1WE 1X2MA 4I76A 1WFXA 1B9NA 3FVOA 4CDGA 1HW5A 3CMEI 3A01B 4ZTJA 4ESWA 5EQ9A 1G3WA 3QAXA 5ET5A 2Z16A 1X1BA 5B7DA 2VKDA 4THIA 3C7JA 1JE8A 3CSGA 1IV8A 2Z2SB 1H0MA 1EKEA 4MQ9F 1GTKA 3KYDB 4JOMA 3HL2A 4JBZA 4WXDA 1ZR4A 4AYBN 1BOAA 1RRJA 4X04A 4G6DA 5F1JA 3JAMZ 1B32A 3L2VA 1MBKA 2QVUA 2DT5A 2ONRA 5EQAA 3M3YJ 1HKQA 1I3AA 1J2XA 2K27A 3ILTB 4M4GA 2FOWA 3RQ4A 3RIRA 2QUFA 1YJNI 5AA2D 3HOUJ 4X48A 3C4MA 4PZJA 4C3JJ 3N6UA 2NNNA 1H8AC 1QNTA 1XGNA 3ASOH 1SYIA 3PPQA 2O5RA 2EFWA 1TT5B 4G2ZA 1CE2A 1LB8A 5FFZA 3JRHA 3I9V2 2E34A 3ISPA 3ECHA 4G77A 3U21A 3KBRA 1D1AA 2N8GA 4A2UA 3LSPA 4G8MA 4BDNA 2ZO4A 5J1DA 1S50A 2RNGA 3DPLC 1T0FA 4ZJZA 2ONKE 2CQNA 4L5EA 4FBPA 1LE8B 3H35A 3ZMTA 2OD5A 1TWGJ 3ZMSA 4IY5A 1K4TA 4U88A 1LNWA 1JUPA 2ISYA 3GFMA 2IS4A 2FQ4A 3T9UA 3KP7A 3JRGA 1IO2A 3S15J 1LLSA 3TOBA 3VLWA 4AB6A 3IP4B 4Q4ZF 1UG2A 4UUVA 5J1YA 3PO3J 5J47A 3MP1A 5CVUA 2X4HA 1JETA 2HQRA 2IVMA 4IO2A 3K02A 1FT9A 4R1HA 1ZQ3P 1IITA 3JTHA 2VOPA 2XF7A 1BIYA 4A3CJ 5ESYA 1B52A 2W84A 4P9UA 3LOCA 1MNMC 2RKMA 3FXBA 1MG1A 4IVNA 1YCJA 4XLNF 3ZRGA 4KIBA 5AIPA 1FPFA 1LB9A 1G59A 4BDYA 1SDXA 2KR0A 2EJRA 4AU7A 2QVRA 5FRNA 2FQ3A 1JVYA 1W7PB 2XB0X 4XL9A 2F5XA 3FD3A 4MNCA 2RQQA 4G8NA 5IP9J 1E3HA 3P9CA 4RDUA 2QBYB 5FLXZ 4HZFA 1EYKA 3SEZA 4FT8A 1GR2A 3M8EA 1B5HA 1X1PA 3BROA 2DA5A 2X1CA 4F91B 1J1NA 3MPKA 3UN6A 1ACIA 2X85A 1IXRC 4AVPA 4HDVA 3S2VA 4Q30B 4X6AJ 3S14J 3IOWA 1V5FA 3L7WA 4KN4X 2Q2CA 3FKIJ 2MLKA 1ZGWA 5CQEA 2DXYA 2R92J 5IOYA 2I5UA 3K6GA 2R5YB 1VR5A 3CMMA 1VQ8I 3HYIA 2DN0A 2F7AA 2OBGA 3LFKA 4TLMB 3THIA 4AC0A 1ZG5A 1FEXA 1MQHA 4KJZA 2DLLA 1SYHA 4N17A 4PAIA 4ZE8A 3BG7A 4FE8A 1B3LA 4RGSA 3E5XA 3TTMA 3AG4H 4BJ6C 3CF5F 4LJZF 2R3SA 3E6BA 2H94A 2V26A 4ZEBA 4G9YA 3KSXA 5FD5A 1WPKA 3OOUA 3BZKA 1EF4A 4XKCA 3KEQA 3TODA 2KISA 3KLNA 5FLXK 4EF2A 4H6DA 3SDFA 3DU5A 3LNQA 3K4UA 1DK4A 3L00A 3PM1A 5GAEJ 1PUFB 4XIDA 5FHMA 3F8FA 2XXTA 1Z0XA 3ECRA 1IUFA 2VKEA 4PJ0C 2JUCA 1BM9A 1RC9A 2P0WA 3VLUA 1B9MA 3TL4X 3CCVI 1HDDC 2B3FA 2CZLA 5FTIA 1TWAJ 2CJJA 2KDZA 4UNOA 3RGYA 3BJ6A 3I4NJ 1SPIA 3EUKL 2FA5A 2VONA 2QLZA 4YFKF 3FVKA 4JP0A 3UNGC 1B9JA 2YLNA 4Q48A 5CBRA 1IMDA 3R60A 2R7QA 2OPTA 4GOTA 1IMEA 3HSRA 4BE2A 3FGSA 3C1DA 5F0HA 1XSXA 4D5FA 5LGTA 3DELB 3TQNA 5LHIA 3I59B 2R71A 1J7KA 3EHSA 3HPHA 4UVAA 1ZIUA 4NWDA 2FUG2 2HZDA 3KFWX 4BS9A 3IKVA 2E1OA 3K0LA 4ZECA 3L2RA 3WGHA 5AIQA 2F4OB 4YRVA 4Y13A 2PJPA 4OVJA 2EZIA 3ZQHA 2O1MA 4NF6B 3PUVE 1QHGA 4FETA 1FJ6A 4A12A 3FF5A 5DCFA 2AQFA 3AG3H 5HDNA 2DAOA 4BEHA 4GYGA 4HBLA 1MQIA 1A7LA 2REJA 4U1OA 3CUQA 5IZ1A 1H43A 4F18A 2HHMA 2XUBA 1ZMGA 2LH9A 3FXJA 3D1RA 4JSOA 2VQHA 1LAFE 1M5EA 4HW8A 3C35A 5GTIC 5E3MA 1AL3A 2FIXA 2QRYA 2LR8A 3ASNH 5CKTA 1PUEE 4C2UA 2DU9A 2QM3A 4IHYA 4QWQA 2XKOA 1IXGA 3DP7A 1T95A 2Z3YA 3E78A 2LOOA 2GHAA 2G7HA 3CESA 4L9VA 3EUHC 2O9LA 2X1EA 2O6AA 4DZ1A 2G29A 5LD2C 2GBYA 2EFQA 3QSLA 2ZMEB 1XMKA 3IOUA 2L7KA 1DP7P 1OQGA 2LSOA 3EYIA 1KYWA 2XGXA 1J5YA 2M2EA 2M30A 3QUFA 3F8NA 2EZLA 3QYBA 1MQGA 4FCYA 1XD7A 2F6GA 2DWIA 3IO4A 1FTJA 3ZN0A 1BR2A 4HS7A 3W9WA 4F3QA 4A3BJ 4HA8A 2VD2A 3TMGA 3Q9SA 1B7UA 5ET6A 1DPEA 2GWRA 3F11A 2PMUA 2QEXI 1U9OA 4KIFA 2R4GA 3S1MJ 4BL0B 5I3SA 2ZSIB 2CFXA 5K7FA 2Q8KA 1A31A 2XWOA 2NOJB 2F4IA 4AS5A 3O28A 2D2WA 4ZEDA 2MG4A 5KDTA 3NWTA 4IPAA 2YU3A 4HV5A 1JGGA 2PFYA 4RPNA 4XF5A 4IRHA 3FMRA 3H06B 2HXIA 2L9SA 4EQBA 3RKQA 3MD2A 2Q9TA 3H4ZA 2V25A 5H8HB 4I3YA 4NAPA 5KAFC 1YFHA 4LLLA 2H99A 2IGNA 2Y9ZA 3G3GA 3OS1A 3G71I 3O66A 1IUYA 2GOMA 1MSEC 1UIVA 2WEFA 3FV2A 4PQJA 3PD9A 3B6CA 1FTKA 4R74A 1T56A 3SEYA 4O5VA 4M9SA 5TPAA 2ZXJA 3H3UA 5D5VB 3OYLA 1N7XA 5BWJA 5GAHJ 1M5DA 4M1VA 4AM3A 4QFKA 1HSLA 2GFEA 2XPWA 3DEEA 2PG4A 2VE9A 1ZU0A 4EJOA 1LBBA 2M8GX 3BZ6A 5I56B 3O9PA 1LDDA 3J7AO 3OO7A 4GWWA 2W7NA 3DCFA 3CDLA 3VFZA 2DXIA 4IO7A 3V8KA 1QO0D 3PV0E 5FBPA 2NS7A 1FJ9A 4QLCU 5I57B 3IC7A 5A2QK 3AL0B 3EF7A 1ELJA 3BG9A 3H36A 2DDAA 1TQMA 2CW8A 2P81A 4KUMA 1HBXG 5I2NB 5ET8A 2DP8A 2M7BA 3LA2A 2DXRA 5DD4A 1NTCA 4JVIA 2QYOA 1NUZA 4M3EA 3I55I 2UXNA 1RYXA 5DVJA 1QQIA 2P8TA 1SVMA 2QENA 2XXIA 1R1VA 3N6TA 2UUZA 3N4MA 4E6KG 1QKBA 4I7HA 1N77A 4I40A 4Q0CA 5DVIA 5K7ZA 3ABMH 3MN2A 4MH5A 2GXAA 2DBBA 3ZQFA 3LSRA 3COAC 1LVKA 4J00A 2OF7A 3CG1A 3LSMA 3TFLA 1J75A 3T9XB 2A3SA 1IDZA 1RKMA 1WVJA 5L9MA 3TTRA 1MS7A 4O3BA 3FK6A 1Z9CA 2R7ZJ 2A5SA 2OX3A 4UUSB 1FBQA 4PF6A 2DOJA 3OMYA 4DI3D 4XSZF 3S2DJ 3P9IA 1MMSA 2XAJA 4EEFG 1D5YA 3QU3A 1GV5A 3C18A 1XS5A 2GA2A 4NDLA 3RQIA 3JRCA 2VQLA 2LBFB 4X8RA 3CRBA 3V7SA 2XAQA 4NB5A 3BG3A 5K5OA 1F9BA 2GZWA 3B6QA 3RTFB 1X4OA 2DMQA 1Q9DA 1R1NA 2ZYNA 3TDJA 2KQZA 4KICA 5LDZA 2DWJA 2ID6A 4M6YA 2PX9A 2W82A 5A2QZ 3OS0A 4I6ZA 1D9YA 3FV1A 2UWMA 2ZB9A 3OIPA 3C3WA 1JKPC 1UTBA 3PQKA 4QPOA 3HGYA 4PJLA 1QBJA 1B0HA 1SVXB 4PFIA 3B73A 1OQYA 3V89B 1E0EA 3G3IA 4PDKA 2LNBA 2H6CA 1A99A 1S3JA 3JSOA 2IA2A 4C2TA 1T98A 2IW5A 1SW4A 1N04A 3FJGA 2W1OA 2XXXA 1PEBA 1Z7LA 1FBHA 4C30A 2KFDA 3V83A 4RGUA 2DA7A 1RIOH 2WV1A 1ITYA 2O1LA 1FY7A 1VI0A 3IH3A 2X9DA 4LMYA 2V9PA 3DP4A 3MFKA 4MHFA 4ZYHA 4ZDLA 2X0LA 4LUBA 3HGGA 2VGQA 5HVQC 3M07A 1TLHB 2WTEA 3CUQB 4MJOA 4ELQA 5KZTA 1UG0A 1NKXA 2K9MA 1BLFA 1RKWA 1POY1 3CCLI 1FSAA 2X7QA 2XWKA 1U0JA 1UMQA 3MW0A 2ZMBA 1LUJB 5EYGA 3RY3A 1NH8A 1LKXA 3IV5A 2NVQJ 4EV0A 3K4KA 2DJNA 3TO6A 3K1MA 5BPIA 4ZZLA 3F8CA 1P1NA 1M5FA 1K79A 3SXYA 1NK2P 3D4CA 1BW6A 1RNLA 3GTLJ 2FMLA 1X3ZB 3I54A 3ZN1A 4HLXA 4M9ZA 5JI6A 4PFWA 1QUIA 3NEUA 4D7NA 2FBHA 1FPLA 4KT5C 3GLXA 1TNSA 3J80K 1I6QA 1K9YA 1R9LA 3FMSA 3LSJA 1ZJLA 1Y1MA 2F35A 2PVUA 2XKPA 3CUQC 2A5TA 2BJJX 2CZKA 5F1RA 2XXUA 4F22A 1MD0A 5FKLA 4QPQA 1XT8A 3BG5A 4RXLA 5H8QB 4GRIA 4XRMA 4MIJA 4CCNA 3A02A 3BJAA 2GLOA 2HOSA 5TP9B 4F1YA 2XSJC 4HF2A 5D8LB 5CBSA 2L9VA 2F5VA 3ZCOA 5ILUA 2O6GE 3BFUA 2RC8A 2DA6A 1LSTA 1A8FA 3OYMA 2ELKA 1U5TB 3HOSA 1GXPA 2EFPA 3IWZA 4LATA 2MLGA 1YRNB 3FXLA 1MNDA 4OEUA 3OELA 2NAZA 3VYTB 4P1WA 5J8FA 1LFPA 3S1NJ 2EPFA 2XB5A 3CIJA 3MZ9A 3S9NC 3OSGA 2VODA 1KA0A 1IN5A 2V93A 4HE2A 5BUUA 1PB8A 3D4GA 3CUOA 1FBGA 3UKGA 1NUXA 1UCRA 1TTYA 4JYKA 4K3FA 4R9GA 3L9FA 1OPCA 2EV5A 2VJ5A 1NV3A 2ME0A 2R5YA 3CD6I 2XV4S 1MZBA 1DPUA 4OU0A 2HPMA 3C36A 3ZP5A 2ID3A 3A03A 3GFJA 3A0BC 3GO5A 3LR1A 3ZMUA 4KYWA 2ESHA 1ZLKA 4Q5SF 2VBZA 2E7WA 3BBRA 3IRRA 4JWYA 4LA9A 4OWDA 4YB6A 5CMBA 1JT6A 4NHJA 1JXSA 1BI3A 1HSTA 1S7YA 4QSEA 5KNLA 3UGWA 3BG6A 3W6VA 2XAGA 1ETYA 3JTGA 2YU9J 3BR5A 4EJUA 3DEWA 3OEKA 2EV0A 2FYIA 4IF4A 4OVRA 5FJ8J 4NX1A 3CJQB 3I64A 2THIA 1XG1A 2V79A 3E6MA 1G6NA 1HSJA 1US5A 3RPUA 2STTA 1SAUA 4DDDA 1FPQA 2L4AA 2LTPA 2XHDA 4HV6A 5H8FB 4Z6YA 4ZZDA 3HRSA 2WBDA 2GAUA 4PE3A 4FE4A 1ZRFA 1IJWC 1D0YA 1EH6A 3O6IA 2E1MC 5F64A 4ZEIA 2JA5J 3LSWA 2F97A 1BR1A 3OOPA 4BJ5C 3JRIA 5BNGA 2DWHA 3QPLA 1MDMA 2DTRA 1OCTC 1JEVA 4ENNA 4N8GA 1V54H 3CCUI 2O0YA 1JP4A 3GX4X 2QCOA 3H5NA 3ABTA 1FTAA 1MY2A 3BR3A 1OCCH 1LE8A 2LAOA 1MDQA 2CQQA 2Y31A 4YIFA 2LK2A 4G4PA 1AA7A 1MJAA 2FF4A 4I62A 1K78B 4OEVA 2WAQA 1A6QA 5KCJA 2UXXA 1NL5A 4XKPA 1B7ZA 2HYJA 4WF2A 4KXPA 4U21A 2DO7A 1B5JA 4RM3A 1JI8A 2Z22A 5IYDJ 5CMCA 3C34A 3I53A 3HN0A 3LUYA 4XKNA 3EQLF 4EXKA 4LQ2A 2OU2A 3LL7A 1B40A 1OISA 3D1NI 5EYHA 4HQMA 1VFEA 3KE2A 2ZJPF 2HEUA 4LZ7A 4XKWA 3DLNA 1YW8A 2QGUA 2DPDA 2QZ8A 1FMWA 4R6KA 2K4BA 1RDXA 3U1OA 1NUYA 4PFOA 5ITOA 1B72A 1GXQA 5C4XJ 2OWZA 2ZKZA 3BR2A 3IO6A 3GZNB 3F0CA 2P2AA 2HQ5A 2ZXTA 3MAMA 2KHMA 1OLCA 4GFRA 2QQAA 3JRBA 2Y5LA 3KP6A 5B3SH 4XLAA 2RV8A 1MDMB 4E7LA 4BBRJ 2GIZA 5B1BH 3SESA 3N05A 2HI3A 5DM7F 4GBWA 4X1BA 3G3JA 3FHNA 4Z0IA 3HHHA 2J5PA 1XDUA 1OVTA 3GTJJ 1NV1A 1DMBA 3LBSA 2XXYA 3BTCA 2G7UA 2M9HA 3DWLE 3DEUA 4P55A 3GYHX 2VHAA 1B1XA 3LQQA 2JT1A 2IRFG 1XC5A 1Y56A 3K01A 1YO5C 3RQTA 3FVGA 2KP6A 2VIXA 1W5SA 3M3FA 4ZYEA 4RB1A 1N7WA 1SW5A 4PFYA 1UZCA 1G3TA 2KRFA 3DKYA 5FKKA 5J1RA 4GWUA 5E79C 2GHBA 5TU0A 1X1DA 3S17J 3FIWA 4UV9A 3CCJI 1XS9A 1USYH 4FEDA 4XM3A 2BVMA 3K6WA 3GCMA 3E4RA 1FIPA 2ANJA 1VQMI 1IRZA 1SI1A 4NG7A 3SDGA 3PUYE 2R93J 1B1HA 4G68A 3TQLA 4N4NB 2NVUB 3WU1B 5HDKA 3IB2A 4PK4A 4PUSA 1FTOA 2WWYA 3VODA 3C9HA 2KRHA 1ZRDA 4OIRF 2R7UA 2DDKA 4XFEA 1Y1WJ 2LC2A 1RR7A 3ERMA 1NV7A 1Y4TA 1HKSA 2PT1A 4H67A 5I2KB 4YELA 4DIGA 3ROJA 4RGXA 1WH5A 2RREA 3IR1A 2DMPA 5E3LA 2QMXA 3VVEA 3MVPA 3WODF 4P47A 1YRNA 2KZVA 3T9HB 4F3SA 4U2RA 2MGQA 3SHFA 2XROA 1GVDA 3R0AA 4GVOA 1U5TA 4ETSA 2WY8Q 2F5CA 4F2OA 2V4JC 4ENMA 4BNCA 4HXVA 5M3FJ 5B66C 2MBFA 1W5TA 4XNFA 2VP1A 4MX6A 3K4MA 1X19A 2KZGA 1CF7A 1D9VA 3T8RA 4N9HA 1BK4A 4E4HA 2HDCA 1FCKA 2PBWA 1X1AA 2XWIA 5TP9A 2CYYA 4MBPA 3VDFA 3L2WA 1W5CC 4PF8A 4ABZA 1WI3A 3PPRA 3U9GA 3WTWC 2XRNA 1LCFA 2AXLA 1MH4A 1O7LA 4IOCF 1YI2I 5GPAA 2Y7RA 4KCDA 4MCOA 4WKMA 5A5XB 1HQCA 2UV1A 5J16A 4HX8A 1FBSA 1YOVB 2EQRA 2Y0MA 3H5RA 4NC8A 3QRFF 1FW0A 2HPGA 1A8EA 2O69A 2Y84A 1I5ZA 5L3GA 5HOOA 3VSLA 2BY1A 5GP9A 5JVTA 2F5DA 4XKQA 2FE3A 1DCUA 3PO2J 2R8TA 1Y9UA 3MVWA 1FOYA 2G0EA 1FOWA 1VQPI 2DMTA 4F93B 1SC7A 2Z8DA 1K6YA 1OYIA 5FTHA 4MFDA 3R6UA 4KISA 3UORA 1LBYA 1MPBA 4IXAA 4NEDA 1NUWA 3CDHA 5F27A 1MRPA 2B7EA 2B4MA 1BBYA 3H9GA 4PDDA 2P4WA 1Z77A 2JK3A 5HDGA 1OMIA 4YIRX 1FBCA 2DYXA 1IMAA 3RPUD 1J0RA 1BP5A 1ZLQA 4RAZA 2CSOA 3S3OA 2MC4A 3WTUC 4FECA 4LP2B 3B6WA 2VJ4A 1WZ2A 3K6XA 1R1UA 4II3A 1NMUA 4JX6A 1YLFA 2WKYA 2DFFA 1P2FA 3KEIA 4OESA 3AFHA 1O57A 5LEJA 5ILSA 3C2BA 2LKXA 4R2FA 3PNYA 4IHXA 3F23A 1QA6A 4BGDA 1W0UA 2YPNA 3JREA 3L2CA 3N94A 4X1DA 2WY7Q 1KZHA 2PT2A 2CZHA 1I6XA 3FXKA 2RC7A 3L6GA 2CMPA 2XPVA 2CQKA 4H0EA 2KDOA 2O3FA 5EG0B 4Y15A 2CUZA 3D5LA 5GAGJ 1K61A 2H1KA 5FKNA 3GFLA 3ILUB 1B8IB 1DBZA 4KYDA 4XKBA 5F24A 4I0AA 3BFTA 2P7CB 4F2QA 1WCMJ 3B02A 3VSKA 1T39A 3T66A 3PQJA 3H3ZA 4RK9A 4B09A 1JTYA 2HYGD 4DLDA 2X6WA 2WBBA 3FX3A 3TYHA 1BKAA 2ZZXA 4ESFA 3MC2A 2OJTA 2ZJ2A 4WCGA 1XGSA 3ONMA 4DYQA 3K9TA 3T96B 1QJMA 4UUSA 3MVYA 4CSWA 4P9KA 1KQ8A 4H5FA 4LB5A 4UVBA 2JMWA 3HSFA 3M9AA 4C1TA 1AWCA 3OOAA 3OIQA 1A35A 1M5BA 2GA1A 6PAXA 3HZJA 5DCMA 4A5MA 2PCRA 3PMWA 1D9QA 1F9NA 1B4HA 2OJED 5KK1A 2DSFA 1ZGAA 5FFXA 1TXFA 3FJMA 1S7AA 4O7MA 2V9KA 3K69A 1USSA 3K2DA 2DYRH 3VDXA 5E17F 1OMPA 3FBIB 1IMCA 4V2FA 3GZ5A 1BL0A 3DTEA 3ZKKA 2FIEA 3RT6B 3MZ8A 3CHGA 2L9NA 4IQ4A 2K7LA 3TOAA 2HVSA 3OSQA 1WJFA 1TP4A 3BZCA 1VFCA 2XPUA 2ZNYA 2GM4A 3K4NA 5K2XA 3CCYA 2VD3A 3SKPA 2WC2A 4PJMA 1BN5A 3DPUA 4DYRA 4HNTA 2A6EF 4EQ9A 3FXQA 4E7SA 3CSBA 5E20A 3I0TA 2YR2A 2LY9A 3CC4I 4BH9A 2OWTA 2TRTA 1B7HA 2V6CA 3K6UA 3VLVA 3RPQA 4XKVA 2E1CA 1SD4A 2XX7A 5ET7A 1D1BA 5I56A 3GXOA 3IHUA 1J9IA 1FYKA 2RCAA 2GXBA 4YMAA 2K3FA 4G68C 4U0WA 4HYEA 4GFBA 5IT9Z 3MYUA 5HM4B 1L3LA 2JSCA 4PBQA 3KYLA 5E8IA 4DGWB 3S2HJ 1I6BA 1QHHD 3REOA 3F3XA 1QULA 2AO9A 5E1WA 5HNHA 2K40A 5TPAB 1OR7C 2DWAA 4BQAA 2HZLA 4FIMA 2VASA 4CH7A 3O8GA 1XOCA 5LRSA 4XR6A 2NXOA 1XSDA 4P1EA 4MEYF 1YW9A 3PL8A 4Y7NJ 5F1QA 4JBAA 4DOZA 3HO7A 3G3HA 4EQ7A 3L1PA 3QOEA 4YFNF 4PGGA 1FOKA 3CR9A 3OMBA 5H8HA 3H1CA 4H45A 1KONA 5EQ7A 1FOXA 4LK0F 3RYPA 4RM2A 5FD6A 4AIJA 3HSEA 4ASNA 1IAWA 2B4LA 2I3WA 4H1XA 2H8RA 4LVQA 3A09A 2FBKA 2R7OA 1G0HA 1YYZA 3IK6B 5FB2A 4QXDA 2IAIA 3IL2A 4BXXJ 1FBDA 4L0ZB 2ECCA 4E7ZA 2WYKA 1IZ1A 4CCLA 2RN7A 1JQFA 2H9BA 1Z91A 2JRMA 5H2FC 4GQOA 5ICGA 1MMNA 2M8EA 3QOPA 3V8JA 4P0IA 2OTLI 3A1YA 4F7ZA 4L9TA 3V4GA 2H1LA 4EVIA 3PPNA 3L6HA 2IGOA 4P5OA 1U3EM 4IO3A 4UA8A 3GTKJ 3J81K 1RDZA 3VOEA 3J7ZI 1Z7UA 1QVSA 2C6YA 4P3LA 2Q2EA 5CPRB 1JUMA 4ANJA 2O68A 3F8BA 3OYDA 2BXYA 2NNYA 4YKPA 1IRXA 2D21A 3P7IA 4IO6A 4XLFA 1SAXA 2ZMEA 3ZOBA 4ZZEA 2I8DA 2LREA 2QSHX 5FHNA 1TWCJ 3L09A 4AIDA 3V7CA 2HAVA 2X51A 1VQ5I 3IH4A 5E1XA 2JA6J 1MDP1 1Z7ME 1LB2A 4B43A 1IUDA 1QU3A 3DM0A 1P1UA 1Y8QB 2V6EA 3G1OA 1T08B 3G1LA 2DA1A 3MCZA 4M3DA 5HLIA 3T1BA 1OVBA 2OCUA 4IO4A 5F7VA 4L5JA 4MFEA 4HQEA 3BJOA 4XXUA 1QGPA 1OLTA 2PFBA 1ZARA 3JCUC 3BLYA 1BTJA 1IC8A 2W00A 3F72A 3CCRI 1EV7A 2M0MA 2YX4A 3WAFA 4YU0A 1FP1D 1R23A 1Z67A 1LBWA 4NF6A 3D5SC 3K2ZA 4D1QA 1Y39A 1PVEA 3H3GA 3PMXA 2WAQN 3D0SA 4LD5A 3A3UA 3NRVA 3OO8A 3PTYA 2EA2A 2ZZVA 2MSYA 1DP3A 2DK8A 3RCOA 3H6WA 4R6YA 4U7DA 3TW6A 3J81Z 2BYVE 5HS8A 4HTGA 1UIUA 3TTLA 4M6VA 4ON0A 4A0ZA 3KJ7A 2YJPA 3BR0A 1NHAA 4CUGA 2XGEA 1NV0A 1I27A 2A05A 1XGOA 3BP8A 5L3CA 2WX9A 3B7DA 3I58A 3ZQ7A 1Z6TA 4BHBA 1NV4A 5T3JA 3RN8A 5DEQA 2XRLA 4DNCA 2W85A 2HTJA 4HSRA 1E17A 1B3GA 2FRHA 1NNTA 2WAEA 2UVJA 4LG0B 2F36A 4AQ4A 2IS6A 4OYVA 1MNEA 4RK2A 5LLQA 3MJNA 2WADA 2VQGA 1AHDP 4IHSA 2DE2A 5IZZA 3BR1A 3S3MA 4N13A 3W9VA 2R7FA 5EEGA 1MXVA 5C4JJ 4G12A 2UVGA 1F36A 1FBPA 3TKDA 1B3HA 2X48A 2Y0SA 3HUGA 1X58A 3LMMA 2JJ7A 1MPCA 2O7UA 3TBIA 1LQ1A 3R61A 3MPLA 2UYEA 4W1UA 4ISUA 4QFLA 3O3KA 1XCVA 5GPCA 3U2RA 5CMMA 4DCXA 1TL8A 3PUZE 4OVSA 4M74A 4ESXA 1ZH5A 3SETA 3S93A 2P3VA 2ZNSA 3ERED 3CFLA 4QBAA 2Y69H 3BQYA 4CO8A 4YKKA 3WTVC 2ME6A 2Y2ZA 1WQ2A 2NOGA 4N6DA 1O63A 3WTZA 2P3NA 2R9JA 2E35A 1YZ0A 2D5WA 4L17A 1B8IA 2FD5A 5JTYB 1KWHA 1SI0A 5HS7A 3ZS6A 4M6XA 4EJWA 2HOEA 2XD3A 3IKTA 4P56A 1BC8C 1SD6A 2EV6A 3E7LA 3PIOF 1A40A 3CG3A 3ELKA 4JB7A 1WWXA 3P5JA 4FISA 2OZ6A 2I49A 3RNNA 4FX4A 2FX0A 1XSVA