1MH3A

Maltose binding-a1 homeodomain protein chimera, crystal form i
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
421
structure length
421
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTAAAAAISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding, dna binding protein
molecule keywords maltose binding-a1 homeodomain protein chimera
publication title Insights into binding cooperativity of MATa1/MATalpha2 from the crystal structure of a MATa1 homeodomain-maltose binding protein chimera
pubmed doi rcsb
source organism Escherichia coli
total genus 144
structure length 421
sequence length 421
ec nomenclature
pdb deposition date 2002-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mh3A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mh3A01
2O1LA 1N3WA 4ZEKA 2O7UA 4I1DA 1SVXB 3M3LA 3VV5A 4A3FJ 1NK2P 4YKJA 4G77A 4FECA 2EZKA 1Y4CA 3VDFA 2Z8DA 3IH3A 1DMBA 2F6PA 1I6BA 5DVFA 2A5TB 1SANA 4XTCQ 3PM1A 4MLVA 4U1OA 5EHSA 1H88C 4XKQA 1Z0XA 1CE2A 4OEVA 3TEDA 1SYIA 1FTJA 2OBGA 1IC8A 2A5SA 1P99A 4RPNA 5A5XA 4I76A 5M5XJ 3M4OJ 1WVJA 5H8NB 3KFMA 4F3BA 3OO9A 4ELOA 3KN3A 2O7IA 3TZAA 1ZJLA 4V2GA 1SW2A 2UVGA 4BXXJ 3IR1A 4XRSG 1YTVA 3TDJA 1LAFE 2DP8A 1Y1VJ 3A3CA 2RCAA 1POGA 1Y1MA 2I4CA 1BLFA 3QXMA 1UTHA 4H5GA 1NH8A 4O3BA 1IJWC 2IAIA 1Y1WJ 1UIVA 3L6HA 1GV8A 1IXHA 5L9OA 2Y7PA 4F29A 4NDLA 1URSA 4F1YA 3M3KA 1FJLA 4RA1A 4ZECA 3RZOJ 4AB5A 2DE4A 3E9XA 3BTCA 5I84A 5EZGA 1MS7A 4H8IA 4PETA 1TWFJ 3QUJA 1RKMA 3O6IA 4XKPA 1LAGE 4WEPA 5HM4B 2ZYOA 5CMBA 4DZJA 3C34A 2V93A 1BA5A 1B51A 1UTHB 4QTRA 5L9MA 1OIBA 5J1UA 1VF9A 1ETVA 1DU6A 4G8NA 3IX1A 3LSJA 1I69A 1WPKA 3THIA 4MH5A 1Q1VA 4FJPA 3MVWA 3ZQFA 2LP0A 2DXRA 5JLXA 4HTGA 2XGDA 3SDFA 4POWA 3C31A 2QL3A 1ETXA 4GRKA 3QPSA 1BTJA 1FIAA 1LFUP 4ZDMA 5BWJA 5DVIA 1JW1A 3H6WA 1ENHA 5GP9A 1B0HA 4NF8A 5AA2A 3K2AA 3ECRA 3MVZA 1RETA 4F31B 4IO5A 2KDZA 2YS9A 2H99A 4XKNA 5DEXA 1TFDA 4R72A 1F43A 2ONSA 2DMTA 1IV6A 3QK6A 3G1MA 2QS2A 3S9MC 3MZ9A 1XVYA 1XS5A 1YRNA 3TCGA 2Q88A 1S50A 2XX8A 3O2AA 4YMAA 1USYH 3HGYA 4J19A 3DELB 1S9TA 2O68A 2RC7A 3ZQLA 4W97A 5AA2B 5FHOA 2IBDA 5M5YJ 1MSEC 3S1MJ 3BG9A 1WDNA 4LZ5A 3U92A 3PGFA 5E3MA 3S16J 5DEXB 2VUMJ 4UUSA 1H8AC 5EHMA 4P11A 4THIA 3MJNA 1OCTC 4PP0A 1HCRA 4MFDA 1YRNB 2QS1A 3EHUA 4AQ4A 5E3LA 1NK3P 1T33A 1HLVA 5F0CA 1B3GA 5L9SA 3K6UA 2VP1A 3SERA 4YICA 3CFLA 3RGYA 4H6DA 4Q30B 3TTNA 2LAOA 3ZQCA 4LVQA 2XSDC 1H3DA 4IO7A 2NS7A 4DCYA 4IO4A 5JEIA 3IO6A 3BBRA 3TTKA 4QIWN 3JRHA 2HCAA 2EH3A 3C4MA 4C3IJ 4YZZA 1MNMC 5FKNA 1MG1A 2ZYKA 4QFNA 5ELVA 1FQFA 1YPNA 3MN2A 2O8KA 3MPLA 2V3UA 3RLFE 2FX0A 1B1XA 1A7LA 1EZOA 4ESXA 1PB8A 3ZKLA 2QRYA 2L9RA 2WB1N 2M34A 1QVTA 2VKVA 1D9VA 3EHTA 1IXGA 2AYSA 4WXJA 2H1KA 5M3FJ 2B3BA 3C36A 1DPPA 5TU0A 1JTXA 1CB6A 2Z23A 4MFEA 3H0GJ 3SDGA 4D7MA 4ZEDA 4R2BA 2IA4A 5KZTA 3QIMA 1SD3A 2V25A 1US5A 5DTDA 3RTWB 1P1QA 4JWOA 1Y20A 2I4BA 2NVUB 2D5WA 4DXUA 1DTZA 3MW0A 1LFGA 1SW4A 3KOTA 3S14J 1XS9A 3QQAA 5CBRA 1DSNA 4EQ7A 2EZLA 1I6QA 4JDFA 3DP6A 3IH2A 3IH4A 4I62A 2DE3A 3F11A 3W6VA 3W9VA 1LFBA 4QSEA 1SI1A 4DLDA 3UORA 1PC3A 2TCTA 4U4XA 3CRBA 1MPDA 4Z0IA 3BG5A 4B1RA 3EF7A 2CJJA 1NNPA 2REJA 2M9HA 1B4ZA 4QFOA 3S9EA 2B3FA 1MPBA 3LNQA 2DS9A 1NKXA 1IG7A 2HZLA 3HHFA 2WV1A 1IXIA 4ABZA 3FVOA 3O28A 3G3KA 3SEYA 5EZHA 1MXWA 3U8QA 4QF9A 4NWCA 2LKXA 3S1RJ 1IRZA 1P1NA 4C1TA 1B3LA 3E4RA 4XIGQ 1FTLA 1A8EA 4KCDA 1B7ZA 5TP9A 1PBQA 3IK6B 1QJMA 4O3AA 4A3KJ 3GTJJ 3ONMA 4RJZA 5CRYA 4QSCA 4BY1J 1MY2A 4I6ZA 4QRZA 4C3JJ 3OO7A 2QPQA 4OEUA 1HSLA 2I3WA 3N94A 3L1PA 3UN6A 2TRTA 4A3JJ 2XB0X 2P0SA 5LOMA 3WAEA 1DTGA 3EPEA 4YKPA 4X48A 2XGCA 5TP9B 4R9FA 3S1NJ 1D9YA 3VLWA 1JT6A 2UVJA 4MLOA 3FK7A 2L7FP 3FJMA 2RC8A 4KI0E 2V84A 1RKWA 5FJ8J 2GH9A 3IOVA 1OQHA 3RUMA 4OYVA 3ILUB 3M3FA 2NVQJ 3UIFA 3JV9A 4Z7EA 1NTCA 5H8FA 2ME0A 1OCPA 4GIZA 4YMBA 2OF7A 4X9TA 1JJ8C 2XRLA 4OQOA 1ZQ3P 2GLOA 2NOOA 3FJ7A 3T9VA 3U72A 2O7OA 3DLNA 2ONKE 1VE4A 4XRMA 2QF7A 5I2NA 3BR2A 4YB6A 2PVUA 4JYKA 2E2JJ 3CIJA 3PUZE 1W0TA 4JX4A 3IOUA 1SYHA 3TEPA 4XICA 3M8UA 4LQ2A 3B6CA 5DVJA 3BTIA 3FZVA 2DA7A 3H03A 2R9JA 5H8FB 4DXCA 2ANJA 3LSPA 3RTFB 3BR0A 2H25A 1JJ6C 3TW7A 3Q0WA 4KYSA 2H8RA 2QSXA 1LFHA 1VI0A 1KWHA 3BR5A 3IORA 4JXIA 3ZSFA 1Z7NE 2I0BA 4BBRJ 5I2NB 5CMCA 1P1WA 4A3DJ 3JRGA 4OFLA 4ZZAA 4RXLA 4DIGA 1MBKA 1B40A 2R5ZA 2D21A 4G68B 4OFJA 4QSDA 3OO6A 4KYDA 5DYHA 4M3DA 4A3EJ 4B4CA 5B70A 3OD7A 4YB5A 3D4GA 4A93J 3BR1A 1LSTA 1B6HA 3HBLA 1XG1A 1JT0A 4DYRA 3IAZA 4QFKA 1VNDA 3OSGA 4XK4A 5EGOA 1EZPA 4U1ZA 2K40A 1RKTA 3K02A 2Z22A 1FTKA 4F2OA 2XXHA 1FQEA 1PBPA 2Y7IA 2R5ZB 3K1MA 2REGA 4KD5A 1M5CA 3S9NC 3HOVJ 2PT1A 3TQLA 3SETA 4A3CJ 1P7IA 4JBZA 2LK2A 4DCXA 4BKXA 4MBPA 4EQ9A 2JA6J 2HEUA 4I8CA 1MXVA 4OENA 3FK6A 3HM5A 3VLVA 1Z77A 1U78A 3U1OA 2NOGA 4IO6A 5F1JA 5EGOB 2JWTA 4EXLA 1OVBA 3MC2A 3IL1B 4DDDA 3N6TA 3MVYA 5M5WJ 3K00A 5DTBA 1ANFA 2Q2AA 1Y1ZA 4NF5A 4UACA 3G1LA 1WI3A 5CI5A 5FKKA 4M3BA 3HDDA 2N8GA 4NWDA 1MY1A 1F36A 1FEXA 1MM6A 3H3VK 1XHYA 2I10A 5IP7J 3GXAA 4OMBA 3KBRA 1LAXA 2ZMBA 1SQYA 1VFDA 2XXPA 2OZZA 4IGRA 2XD2A 3GTOJ 2RINA 3MZBA 4KQPA 5I59A 1ITYA 3H4ZA 3LSRA 4F1VA 4C2MJ 5BNGA 4E0WA 1MRPA 4H65A 4NF5B 4YAHX 2H4IA 5F27A 2DMQA 4A3MJ 3HO7A 2I6EA 2F7AA 1EF4A 4IY5A 1WH5A 2I48A 1B0LA 1LB9A 3T66A 3PPPA 4OXVA 3H06B 3ODBA 3O8HA 1URDA 1M5DA 3IB2A 5F04A 1FQDA 3HOWJ 2L0KA 2CQXA 1HDPA 2XPVA 4ELPA 1BKAA 2Z8FA 5I59B 3C32A 2Y7RA 1ZKBA 1TWHJ 3T9XB 2HI3A 3BTJA 1IITA 4FE7A 1SFOJ 5AA4B 4IHXA 5EF6A 3B6TA 1MY0A 4FISA 1N04A 3MVXA 3TCFA 1AU7A 3RQTA 1B46A 1ETWA 2JMWA 1IZ1A 3MZ1A 3HKZN 4RK9A 3HHGA 4HCWA 1MY3A 2ZYMA 1A5JA 4N07A 4ZE8A 3PPRA 2O9LA 1I6AA 5J1RA 1QUJA 4B3AA 2XXYA 2DMPA 3DCFA 2PT2A 4TOZA 2HXIA 2CUFA 1X2NA 2ECCA 4PQJA 5ITPA 1ZTRA 2DJNA 2Q8JA 3HB9A 1JQFA 3TMGA 1O7TA 3BQZA 1ZR4A 3MBPA 2DWHA 2NVTJ 2UYFA 3SESA 4BBSJ 4XKRA 1H89C 5KCJA 2UVIA 4FEDA 1Y3PA 2DE2A 3OENA 2OWSA 3B6QA 1GVCA 3KGCA 3JYRA 4WKMA 3A09A 2MG4A 2OK2A 4ONYA 2DA6A 1LLSA 4G12A 3G7WA 5FTHA 3CCYA 1A55A 1T0KA 4L17A 4ZS9A 3ZOBA 3MAMA 3TTLA 4XXUA 4F3GA 3DP4A 4HNVA 2M8CA 3LSLA 5KCJB 5IOYA 1I6HJ 2KT0A 3S4UA 1A54A 2O51A 3N6UA 4LZ7A 3BT9A 2JJ7A 3KEIA 3RY3A 5ISUA 1R1NA 2HAUA 1URGA 3I4NJ 4PFYA 1QKBA 1XC5A 1JETA 2FYIA 2VKEA 3SJMA 3E3KA 3FISA 1WGXA 2K9SA 2YJPA 2DMNA 4JSDA 4ND9A 1MSFC 1MXUA 1GR2A 2JA7J 4KYEA 1B5IA 2JK3A 4N6PA 2X7PA 4OETA 2L7ZA 1A40A 1QUKA 3PUYE 1B2HA 2CMOA 4POXA 4PFTA 2R0QC 1JKPC 2HOTA 1U8BA 3VXBA 1ELJA 1OJLA 5H8QA 3MPKA 1B5HA 1MQDA 2DSFA 1TFAA 3FVGA 1IUDA 1S7YA 4X1DA 1PB7A 5I56A 5E3NA 3HOZJ 3VLUA 5IOZA 1TWGJ 2LR8A 1FQCA 3T93B 1BP5A 3CI8A 2GHBA 4ELQA 2I58A 2F36A 1NMUA 4G2ZA 5H8QB 5JTYB 1SBPA 2OCUA 2XX7A 3Q0UA 5K2XA 5K7HA 3PMXA 2Y9ZA 4A3BJ 4BLAA 1MXZA 2H9BA 5I56B 1MQGA 5J3LA 3RZDJ 2DWJA 2I49A 5FLMJ 4R9GA 3R7XA 4YKKA 1Q35A 5IP9J 4OESA 5I57A 3G3HA 2QS3A 2M8GX 2E0SA 1MPCA 2Y84A 3R26A 3FV1A 3TP3A 3FGSA 2PX1A 3TUSA 2Y0SN 4GD5A 4LA9A 3IOWA 3S2VA 1IDZA 2O84X 3K6XA 3PPOA 3C33A 2O1MA 3E7LA 1B72A 2DOJA 2CRGA 3TODA 3R6UA 2RC9A 2P81A 3NARA 3O29A 2DN0A 1WH7A 3HEFA 2G93A 2LY9A 4HW8A 1UHSA 2F34A 5I57B 1SW5A 4LONB 3PUVE 2I3VA 2EZIA 1MH4A 1SW1A 3UK4A 3Q29A 1YCJA 3SEXA 1QW0A 1T56A 4X1BA 3W15C 2K9QA 3KJTA 1O4XA 3OXNA 3Q27A 3PD9A 2H98A 1B72B 1JTYA 1JW5A 2ECBA 2R71A 2Y30A 2XXVA 3K4UA 3FIWA 3HOUJ 1JNFA 2X26A 1A6IA 1GUUA 2QMXA 3SKPA 2XXWA 3K1PA 2XXRA 2YLNA 4FCYA 3MP8A 2THIA 3OEKA 2KLFA 4R6YA 2FD5A 2AL4A 1PUFA 4IO3A 4F19A 3GZGA 4ELRA 1B3EA 1ZMGA 4DW6A 3MP6A 1Q1KA 5E3OA 1M5EA 1IGNA 3FUZA 3EQ1A 2FNCA 3BFUA 3RQIA 1BL0A 3D4CA 1JKOC 2HAVA 4GL0A 2NUVA 4MFIA 3VVDA 1F9BA 2XXTA 4H0WA 4A3IJ 2EQRA 3V83A 1JKQC 3H6VA 1ZR2A 1PUFB 3QUFA 2Z8EA 4M3FA 3CDLA 3K7AJ 1MQJA 1LAHE 4QSHA 1HSEA 4D7NA 4DYCA 1JUMA 2CU7A 3OOAA 3TKDA 5FHNA 2AL5A 2ESNA 2PBWA 2VD3A 1N7XA 2F7CA 1TWCJ 4XRSA 4OWDA 4UA8A 4PE5B 3T9HB 1ZBMA 4MO7A 3H6UA 1J1NA 1SI0A 4OHNA 3KN7A 3C2BA 4A69C 1O63A 3K1NA 5H8HA 3I4MJ 1LE8B 3I3VA 3TTRA 2G0EA 1B4HA 2Y7KA 1WODA 1B32A 1IDYA 4NF4A 2VI6A 5IYCJ 2COBA 3QAXA 2M2EA 4HCYA 1GV5A 2JA5J 4GFBA 1X58A 2GFEA 4LZ8A 4EF1A 2ZNUA 1H44A 1TT1A 2HFBA 1MBJA 3KOSA 3MKLA 2AIXA 3GBBA 1LBBA 2ABHA 2HYJA 2I0CA 4GLIA 3WHCA 5CC2A 1B3HA 1RYXA 2Q9TA 5H8HB 4G68A 1B5JA 1AH5A 1N7WA 2HZKA 2RAEA 1TC3C 3KN8A 3U94A 3FATA 3W9WA 2YPNA 4NF4B 4QHQA 4U2RA 1JGGA 5IPAA 2NS8A 2X6OA 1MXXA 5FKLA 1Z7ME 1JW4A 2W48A 5M3MJ 2XXXA 3H3GA 2AHQA 2FQ4A 2F78A 4IHYA 3GTPJ 1H76A 4EDPA 4LUBA 1LB8A 5AA3A 1OFCX 1QULA 1EU8A 2F97A 3PPNA 2HQ0A 4RNSA 2UVHA 1B1HA 4GOTA 2ME6A 1JEUA 4AYBN 3LSGA 1AHDP 4OZ9A 3Q25A 3TYHA 2ID6A 3PD8A 3MVPA 2XB5A 2VD2A 4U21A 4AB6A 3N26A 4S0HB 5IYDJ 4JX6A 3QSLA 3VE1B 4MIMA 5IP6A 4FEBA 1B8IA 4TLMB 4X6AJ 4RYAA 3O6GA 4E0XA 5CMKA 3FVKA 3CSGA 2H5YA 1N0TA 3O97A 4FE4A 4NEDA 4FTHA 2XX9A 2L7MP 4R73A 1LFIA 4DYQA 1GVDA 2OWTA 2VHAA 3RKQA 2BJJX 4JP0A 3C35A 3S15J 2ZXTA 1QRYA 4M3EA 4JB7A 2IEEA 4R6HA 5H8SA 3KG2A 3LSWA 2NVYJ 4FIMA 3SFIA 3GLBA 3O9PA 3JRAA 1B8IB 1P1OA 2B63J 4JSOA 2E19A 1QVSA 1D3KA 3FD3A 3VFJA 4K3FA 1WCMJ 1AIVA 1VR5A 4GXAA 5HPQA 3CG3A 4GF8A 5FLVA 2OJTA 2NVXJ 1NNKA 3PUXE 3HOYJ 2DA2A 3MUQA 1NH7A 3KSJA 1JEVA 4G4PA 3FV2A 2ZYNA 3FXUA 1POTA 4H5FA 4BDRA 2HXOA 3LC8A 4Y7NJ 3JRDA 1S7EA 1N84A 1P1UA 3GBAA 2HDDA 1PEBA 4G68C 3BFTA 2PMSA 5CM6A 5AA4A 1IQ7A 4W1UA 3OMBA 1MDP1 5J1DA 3HV1A 2DA3A 4F1UA 2B65A 4DE8A 4ZEIA 1OMPA 4Y52J 1NFTA 1BIYA 1MBFA 2HOSA 4OFOA 1D5YA 1UMQA 2XPWA 3PU5A 3FKIJ 1JUPA 2XXQA 3PV0E 5F7VA 1N76A 2QCOA 4OVJA 1MQIA 1K83J 1MDQA 1G2HA 4M6VA 1EH3A 1FQAA 4IHVA 3PMVA 1FTOA 4U22A 3S17J 3BR6A 2XGEA 2EBIA 2O69A 3O66A 1H45A 1UG2A 5C44J 2HQ5A 1M5FA 3PO2J 4YKIA 3C9HA 1JKRC 3RN8A 1ETYA 4LOCA 2YU9J 3SEUA 5IKBA 5ITOA 1ZGWA 2MW8A 5EG0A 2X9DA 1NNTA 1Y3NA 4WEDA 2W7YA 2CZLA 3V89B 1Y4TA 3TCHA 2K9NA 1D4NA 2Q89A 3ZKKA 3IB1A 2DA1A 2DA4A 5C4JJ 4C3HJ 2GHAA 3I5OA 4DZPA 3G3IA 3OELA 1LCFA 5GPCA 5A5XB 2Y31A 4IEJA 5CBSA 1LCTA 1XC1A 4G8MA 4M3GA 3WHBA 1H43A 1BW5A 3BQYA 4ECFA 3ZQHA 5EG0B 5EDNA 3QPLA 3PMWA 3IV5A 1U9OA 5I2KA 3GBGA 3CMYA 3A01A 1LGBC 2VOZA 1SDXA 3RNNA 3FXQA 1HOMA 3A3UA 4EXKA 4FAJA 4FATA 1UIUA 1YAEA 3DM0A 3M3YJ 1VSOA 4IHWA 1IXCA 2PMZN 2MSYA 3FIRA 2F8DA 2DYXA 2QJEA 4OERA 1W0UA 5I2KB 3ZQIA 3PPQA 4Q5TA 3OIOA 3UKGA 1IEJA 3UGWA 1FW0A 4GXSB 4DZ1A 2R92J 3A01B 3OO8A 1IUFA 1R9LA 3A03A 4BDMA 1VFCA 5M2VA 4A3LJ 3PO3J 4R2FA 1ZK8A 1POY1 5IYBJ 4QFPA 1XVXA 1R9QA 1FTMA 4C1UA 1PDAA 3HPIA 5EEAA 4U4SA 2ZB9A 1X2MA 2RCBA 2RKMA 3LSFB 1LBCA 5GPAA 2HXWA 2WKYA 4GFRA 5IAIA 4RPOA 1M5BA 2QMWA 2UYEA 5JTYA 5K2YA 5C4XJ 2YUSA 1O64A 3BR3A 1RPWA 3K6VA 2F7BA 3KJ7A 4NF8B 4KCCA 2XPUA 2ALUA 4X1EA 3SEWA 1E3OC 5JK4A 4BDQA 3V8XB 2F35A 4A3GJ 1CQTA 2XD3A 2HOAA 3U93A 2R6GE 4RK2A 2DQVA 3UA8A 4M4GA 1QVUA 1B9JA 3JREA 1HSJA 3LOCA 4KR5A 4KPTA 9ANTA 1USYE 4H67A 5TPAA 1I3QJ 5K7FA 1ZLQA 3CFXA 4Q8RA 2IEKA 3TELA 3FVNA 4EF2A 4R6KA 1RR7A 5CMMA 4GQOA 2LVSA 1N3XA 4PFUA 3P7IA 3HCQA 3TAJA 3AXFA 5DT6A 4ZEFA 4UUSB 3IB0A 3OSQA 2VGQA 2F5XA 3JRIA 1GDTA 3JR9A 1ORKA 2OPTA 5K7ZA 1PB9A 2V3TA 3S2DJ 3LUYA 3T22A 1MM7A 4JWYA 2DTZA 5ICTA 1RYOA 3RPWA 5TPAB 2Q2CA 1B7HA 3H7MA 3G3GA 3IJXB 3ILTB 3CR9A 1ZKGA 5HBCA 5DS9A 1JVXA 4M1VA 4F3PA 2UXAA 1HDDC 2Y9YA 4F3SA 1K61A 3VPRA 4CYCA 4BDOA 2RF1A 2OLBA 4OTEA 1FIPA 2VPRA 1TXFA 3G3FA 4MLQA 2E1SA 1QPIA 2D5VA 4AUXA 4N13A 4QFLA 3MWBA 5FKOA 3TFLA 3PUWE 2V3QA 3SEVA 4O3CA 4HS7A 4ZEBA 3S9LC 1IIWA 4U23A 4YU0A 1DU0A 1FTTA 1MY4A 5C3EJ 2R7ZJ 1U9NA 4YB7A 3TW6A 4CYCB 3O6HA 4H8JA 4BDLA 2WAQN 4RDUA 3JRBA 4F2QA 3OOUA 4IGTA 1EZ9A 3HGGA 1P7JA 5KDTA 4F22A 3GTMJ 4D5FA 5B7DA 2FA7A 1FTZA 3FXRA 3TPAA 5HODA 5ICQA 2DWAA 3VXCA 2Y7WA 3G1OA 3KZGA 2P2AA 2DVCA 4ZZEA 1ETQA 4UUTA 1NL5A 2XXUA 5F0HA 1LE8A 2LTPA 3Q0VA 4FORA 2E2IJ 1AOVA 2ZNSA 2X48A 5KDTB 3H6TA 4LP2B 4F18A 3RT6B 4EUOA 3G3JA 4FE8A 2DA5A 2FJ1A 1HF0A 1FQBA 4C0RA 2E1OA 2GBYA 3K01A 1AKHA 4PFWA 3ZS6A 4R75A 2NWJA 4NF6A 5JLWA 3BKIB 3B7DA 5I58A 2AO9A 2LFBA 3D1NI 1A8FA 2CUEA 4TLLB 2R93J 4ZE9A 4EEFG 3A02A 1JUSA 3O8GA 2M0CA 2PYYA 4ESWA 3MQ9A 1TWAJ 4JX5A 1GV2A 4MF3A 4Q0CA 4TQUQ 3LSXA 4IB2A 3HN0A 1XT8A 3T96B 2QS4A 3QYTA 1AKHB 1MH3A 4NTLA 1XOCA 1R6ZA 3OEMA 4AC0A 3B6WA 1AMFA 3Q3SA 4NF6B 1OVTA 4ISUA 4IO2A 1MBEA 1B3FA 3IOTA 1MXYA 5I58B 4R74A 4I9DA 3MP1A 3DP8A 1B58A 1FCKA 4H1XA 3OSRA 3N5LA 3UP9A 3TQWA 1BJZA 2LD5A 2D3IA 3JRCA 4XIDA 2JN6A 4P0GA 1APLC 3K2DA 1MBHA 1ATGA 1BW6A 3V5AA 2DXYA 3VVEA 3HSTA 2O6AA 1OLCA 1B52A 3GTGJ 3RT8A 3LR1A 4F39A 3Q28A 3FJGA 1GGGA 4D5CA 2ZNTA 3LBSA 4GWOA 3KSXA 3DEWA 1TWYA 3EHSA 2MGQA 3CSBA 3CFZA 5J1YA 1II5A 1GTKA 3USDA 4NMYA 4L5EA 2DMUA 3EN3A 3T9UA 4DXBA 5L8DA 1I50J 2XHDA 3K6WA 4GL8A 1Y3QA 3NAUA 1NNFA 4NE4A 1JVYA 3IO4A 5FKMA 5AE4A 4RBOA 2CQQA 3GTQJ 2GM4A 1B05A 4KFQA 1A99A 3S2HJ 1Y9UA 3CQZJ 4RY1A 2ELKA 3B6AA 3ZQGA 1QKAA 3Q26A 5EYRA 2LLKA 3OSFA 3F0CA 1DOTA 3CG1A 3FASA 1ETKA 1GT0C 1VFEA 1L5TA 3JRFA 1US4A 2X7QA 4LATA 1AL3A 1UQWA 1UTBA 3S1QJ 1DPEA 2P1SA 4G8HA 3VVFA 1OQGA 2NXOA 3BTLA 2ONRA 1ZTYA 2EZHA 3BG3A 1MQHA 1ZIUA 5F0FA 2R5YA 1B7UA 3TP0A 3HOXJ 4KHZE 4BDNA 4EQBA 4IY6A 2E2HJ 5FTIA 2DVZA 3L6GA 2G29A 5EYFA 1RESA 3TTMA 5AA2D 1ZU0A 2DWIA 3CVGA 3IJOB 3GTLJ 5AA1A 2XXIA 1UTBB 3E13X 3JZJA 2F6GA 2ID3A 1MBGA 2A5TA 3I6VA 1QUIA 2R5YB 1OLAA 4BY7J 3GTKJ 5F1QA 2Y2ZA 4LQ5A 3WAFA 1ETOA 5F08A 4V2FA 4JWXA 3K0VA 5H8NA 4GVOA 5BUUA 1R9TJ 4P0IA 2GRVA 5FHMA 2JA8J
chains in the Genus database with same CATH superfamily
2O1LA 1N3WA 4ZEKA 4L9NA 4P9UA 4ZTJA 1KA1A 2O7UA 4I1DA 1SVXB 1K4TA 3M3LA 3VV5A 1FX7A 2DK5A 4WWCA 2O3FA 4A3FJ 1NK2P 3LSMA 4HOBA 4XNFA 5LRSA 4G77A 4FECA 1X1CA 2CWEA 4YKJA 1OR7C 1UB9A 2ETHA 2EZKA 3DPUA 1Y4CA 2UXXA 3BC8A 3VDFA 3OWTA 1RUNA 2Z8DA 3IH3A 3QP6A 1DMBA 2F6PA 1I6BA 1FJ6A 5DVFA 2XASA 3K4MA 4KXPA 2Z16A 4RLQA 2A5TB 5DUIA 5DW8A 1KQ9A 2KJBA 1SANA 2LMDA 3PM1A 4IF4A 5H20A 3RCOA 4MLVA 4U1OA 4XTCQ 5EHSA 1H88C 4XKQA 1TQPA 3B02A 1Z0XA 1CE2A 4OEVA 3TEDA 1SYIA 4BE1A 1FTJA 3OS2A 1IC8A 2EV0A 2DFFA 1P99A 2A5SA 4I76A 5M5XJ 3M4OJ 3GWZA 1WVJA 1W5SA 4GXOA 5H8NB 2KLOA 2VJ4A 5EQAA 1B6AA 4EJVA 3KFMA 1K79A 3OO9A 4ELOA 4F3BA 4AS5A 2QQ8A 3KN3A 2W4SA 2O7IA 3CCJI 1ZJLA 3TZAA 3TQNA 1ZRFA 2FQ3A 4V2GA 4UY8I 1SW2A 1D0YA 2UVGA 1T0FA 4GYIA 4BXXJ 3IR1A 4NHBA 2L4MA 4RB0A 1U8RA 3KCCA 4XRSG 1YTVA 2GXBA 4E4HA 3CMAI 3CG1A 1YFHA 3TDJA 4HA8A 1LAFE 2PMZA 4EMSA 3DWLE 2DP8A 1Y1VJ 2M1BA 3A3CA 2FA5A 1IMBA 2RCAA 1POGA 3JW4A 3FWEA 1Y1MA 4MAGA 4FETA 2I4CA 3QAHA 3LA7A 1BLFA 2KP6A 1UTHA 5DD8A 3QXMA 3L2UA 3IHUA 1D9QA 2F5DA 1NV7A 1LPQA 1V5GA 3RPUD 4H5GA 4KHZE 1Y0UA 4BDNA 2L9SA 1LBZA 4E7IA 1NH8A 1D1CA 4O3BA 4HF2A 4G7OF 2HKOA 1IJWC 1FWZA 2D1HA 2HDWA 2IAIA 1Y1WJ 1UIVA 1XMXA 2LSOA 3L6HA 1GV8A 1IXHA 2XROA 5L9OA 2Y7PA 1WJFA 2X4HA 4F29A 4NDLA 1URSA 3F21A 4F1YA 4I02A 1FJLA 5CQGA 3M3KA 4RA1A 4U0VA 4ZECA 3RZOJ 4AB5A 2DE4A 5IZ3B 1BJAA 5DCMA 3BTCA 5KVRA 1TTYA 3D5LA 5EZGA 3CCLI 3E9XA 1X4OA 5I84A 1MS7A 5L3CA 2ZC2A 4H8IA 1R71A 4PBHA 4PETA 1TWFJ 3QUJA 1RKMA 3HPGA 3O6IA 4XKPA 1LAGE 3E78A 3I58A 5L3FA 4WEPA 5HS7A 2ZYOA 2L5QA 5CMBA 2A05A 4DZJA 1WSUA 4YG2F 2VT5A 2OZUA 3C34A 4BXFA 3IWZA 4XR6A 2V93A 1BA5A 4MNCA 4P5OA 4Z6YA 1B51A 3HSFA 1DCUA 4HG2A 1UTHB 1S3JA 2GIVA 4QTRA 3DTKA 5L9MA 3E97A 3AL0C 2QQAA 1OIBA 2V4CA 5J1UA 1MMDA 3E3VA 4KITB 2K85A 1O3RA 1EH7A 1F4KA 1ZN2A 3RPWA 5HS9A 2RN7A 4CYDA 1VF9A 2CGPA 1ETVA 1DU6A 3CCRI 2DQLA 3LFUA 4XLFA 1GHCA 3IX1A 4G8NA 2LG4A 4PAIA 1HW5A 3LSJA 1I69A 1WPKA 1Z7LA 3BPXA 3BZCA 2XAQA 1BK4A 3THIA 4XOTA 4MH5A 2KIUA 1Q1VA 4FJPA 3H35A 3MVWA 3ZQFA 1BBYA 4MEYF 2LP0A 5DCMB 3BLYA 4OIPF 2DXRA 5JLXA 4E7LA 1FOYA 1I1GA 1SC7A 2LH9A 4NAPA 2V9KA 4B8XA 4HTGA 3L2CA 2XGDA 2F2EA 3SDFA 4POWA 1K9ZA 3C31A 2QL3A 1ETXA 2VQLA 4GRKA 3M8FA 1ZG1A 2ZJRF 4I99C 1FBUA 3ABKH 2EWNA 4LGWA 1BC7C 3QPSA 1BTJA 1FIAA 3SDBA 4B47A 4ESBA 4L0ZB 4MNIA 1LFUP 4ZDMA 5BWJA 1TT5B 3GLXA 1JW1A 3H6WA 3DKYA 4GWXA 4GX6A 1ENHA 2H8WA 5GP9A 2EFOA 2K9MA 4CCLA 4EJWA 3CF5F 1B0HA 4NF8A 5AA2A 3JAMK 1KQ0A 3K2AA 3ECRA 3MVZA 1RETA 3JTGA 3VWBA 1BI3A 4F31B 1FYKA 3MKZA 4IO5A 2EJRA 2DO7A 2KDZA 4ESJA 2L02A 3JCUC 2YS9A 1NV6A 1X3WB 1DBZA 2H99A 4XKNA 4ITVA 5DEXA 1TFDA 4R72A 2Q0OA 1F43A 4R79A 2ONSA 1A36A 2DMTA 2DLLA 1IV6A 3QK6A 3G1MA 5E79C 2QS2A 4ZYAA 3S9MC 2DJIA 4V19K 1P2FA 3MZ9A 3H9GA 1Y39A 1YRNA 1XS5A 1XVYA 2YSRA 1ZTYA 1S50A 2Q88A 3TCGA 1ZELA 3EDPA 1AWCA 2XX8A 1G0HA 3O2AA 4M73A 3RDIA 3W2AA 4YMAA 1USYH 3HGYA 4J19A 3KP6A 3LAPA 2UZKA 5LTCA 2XAUA 3ML6A 1FBQA 4DNCA 4PJNA 4X04A 4ZZDA 1BI0A 1XMAA 3DELB 4PDHA 1S9TA 2O68A 5LDZA 4XF5A 1C0WA 2RC7A 4NBQA 3ZQLA 4W97A 5AA2B 1WVRA 2EFPA 3I5UA 4HE2A 1T0FC 5FHOA 2IBDA 2PX9A 5ICFA 5M5YJ 1MSEC 3SZGA 3BG9A 3VYUB 3S1MJ 3A4CA 4ZJZA 5LGTA 1WDNA 3PGFA 5E3MA 3FBNB 3S16J 4LZ5A 3U92A 5DEXB 2VUMJ 4UUSA 1H8AC 1CGPA 3F8BA 1NUZA 3KC0A 5EHMA 5T3JA 1FPJA 4BL0B 4P11A 4THIA 3MJNA 1OCTC 4PP0A 2VASA 4HF1A 1HCRA 4UNOA 4MFDA 1YRNB 2CV1A 5D4RA 2QS1A 3EHUA 2FNAA 5CVJA 1D8JA 4AQ4A 5E3LA 1E2XA 3K4CA 1ZRCA 3CF2A 1NK3P 4GYGA 1ZH5A 1T33A 1KA8A 1HLVA 2PFYA 3OL4A 2IA2A 3K4JA 3P5JA 4LN5A 1S29A 3ECOA 3HSRA 5H2FC 5F0CA 2FF4A 4BU2A 1B3GA 3K6UA 5L9SA 2VP1A 3SERA 4YICA 3CFLA 3RGYA 2UUZA 4H6DA 4KNYA 4WCGA 3QU3A 4Q30B 4N6KA 3TTNA 2LAOA 3ZQCA 3DTIA 4LVQA 2XSDC 1H3DA 2QYOA 4IO7A 4OVRA 2NS7A 4GX4A 4IO4A 4DCYA 1ZYRF 2WWYA 3K9TA 5JEIA 3IO6A 4MTEA 3BBRA 2HNHA 1WI9A 1OCOH 3TTKA 2Z2SB 5D5WB 4QIWN 3JRHA 3BG6A 1JGSA 2KISA 2HCAA 3GZ6A 2EH3A 1S72I 3C4MA 3WE3A 4C3IJ 3PIPF 2DTRA 1SD7A 2LYCA 1OLTA 3IC7A 1MNMC 4YZZA 3TO9A 5FKNA 4BJTA 1MG1A 2ZYKA 2L7KA 1YJ9I 1FQFA 4L9TA 1HA8A 3MD2A 4QFNA 5ELVA 1YPNA 1VQ8I 4NN3A 3MN2A 2O8KA 3MPLA 2V3UA 3RLFE 2FX0A 4N9HA 1B1XA 1A7LA 2DCEA 4LITA 1EZOA 4ASNA 4ESXA 3CZ6A 3WE2A 1SFXA 1PB8A 2QRYA 2L9RA 2WB1N 2M34A 2W1OA 4AM3A 3ZKLA 1QVTA 3ABTA 2QWWA 2VKVA 2XSJC 1HW2A 1D9VA 3EHTA 2W57A 1GVJA 2OU2A 1IXGA 3GW2A 2AYSA 4WXJA 4UVBA 5B1BH 2H1KA 5M3FJ 2R7XA 2B3BA 3C36A 3K0LA 1DPPA 5TU0A 2OV7A 5ESYA 3QYEA 4LIVA 1MMSA 1JTXA 2STWA 5KK1A 3S8PA 5HS8A 3RPQA 1CB6A 2Z23A 1HSTA 1QA6A 4MFEA 3H0GJ 2HHMA 3SDGA 4D7MA 3KC1A 2ZJPF 4ZEDA 5ED4A 2IA4A 4R2BA 1V5FA 2XVCA 3QIMA 5KZTA 1SD3A 4BE2A 2KJCA 4KUMA 2V25A 2QBYA 2J5OA 5DTDA 4BAYA 1US5A 1P1QA 2FIXA 4JWOA 3RTWB 1QQIA 4IZZA 2E7XA 4XN3A 3CLOA 3LV0A 1LBXA 2X1DA 4G6QA 3OY9A 1Y20A 2I4BA 2NVUB 2D5WA 4DXUA 1DTZA 3MW0A 3ECHA 2G7UA 4HEA2 1LFGA 4CSWA 1SW4A 1IN5A 1FBHA 3KOTA 2DFHA 3S14J 3CC2I 2P7VB 1FC3A 4Q5SF 2AXLA 1Z67A 2HTSA 3QQAA 2VC1A 1XS9A 1DSNA 5CBRA 3CCVI 1E17A 5DDGA 4P47A 1E0EA 4EQ7A 5ERIA 4FBPA 2EZLA 3ZMTA 1I6QA 4JDFA 3DP6A 3GVAA 1SAXA 3IH2A 1NH3A 2XAFA 3IH4A 4EM0B 4I62A 2DE3A 1R5HA 3F11A 2P6TA 3W6VA 1ZAOA 2KZGA 3KETA 4MHFA 3W9VA 1LFBA 1R6RA 2WADA 1YLFA 1SI1A 4QSEA 1YOVB 3UORA 4DLDA 2QBYB 3TGNA 5FB2A 4CCJA 1PC3A 2TCTA 5D6EA 5AONA 2LRDA 1SVOA 4U4XA 4HAMA 3CRBA 1MPDA 4Z0IA 1WWXA 3BG5A 3DQVC 4B1RA 3EF7A 2CJJA 4PZJA 1NNPA 2M9HA 1B4ZA 1TQMA 2ZFWA 3TOBA 2REJA 4IOCF 2R7DA 3NQOA 3QP5A 3S9EA 5GADJ 3J7YJ 2DPDA 2B3FA 5L3BA 1KYZA 3LNQA 1MPBA 2DS9A 1NKXA 1IG7A 3W6JB 2HZLA 3SEZA 4NC7A 4WXHA 3HHFA 2WV1A 4N0BA 3S2WA 1VQ9I 5JR3A 1IXIA 3CC4I 4ABZA 3FVOA 3O28A 4FQGA 3G3KA 3BJ6A 4NB5A 5EZHA 3SEYA 1MXWA 1O7LA 2DFEA 3U8QA 4QF9A 1I39A 3T8TA 5TJJA 4XOPA 4NWCA 3IAM2 2XDVA 1UHMA 5ICGA 2LKXA 3S1RJ 1PP7U 1IRZA 1P1NA 4O6JA 5FLXK 1B3LA 3E4RA 4C1TA 3F8MA 4ZH4F 4KN4X 2EFWA 4PFBA 4B43A 4XIGQ 1FTLA 1A8EA 4KCDA 1X19A 2QQ9A 1IMAA 1B7ZA 5TP9A 4XKVA 1PBQA 3C7JA 2VJIA 3IK6B 1QZYA 1R4NB 1QJMA 3ISPA 4O3AA 4A3KJ 3GTJJ 1KU7A 1B9NA 1OLAA 1ULYA 3ONMA 1RIOH 4RJZA 2MLKA 5CRYA 2EPFA 4QSCA 4PGGA 4FX0A 4BY1J 1MY2A 4I6ZA 4QRZA 1YE9A 2W00A 4C3JJ 4IO9F 3OO7A 2QPQA 1BI1A 2ESHA 4L9VA 2VOPA 5D6FA 1W5CC 3UR3C 3I0TA 4OEUA 3TKYA 1SFKA 1X1DA 1H9TA 2HQAA 2RNGA 3OR2C 1HSLA 5TISC 1K7AA 2I3WA 3N94A 3L1PA 1MW7A 3UN6A 2TRTA 4A3JJ 3K4LA 4XONA 2XB0X 1LNWA 2L54A 2X6WA 4PAKA 2P0SA 3FASA 5LOMA 3WAEA 3NWTA 1DTGA 2XWOA 3EPEA 4YKPA 4UV8A 1J0RA 2YU3A 4G6DA 3DP7A 2XGCA 4HYEA 4X48A 5TP9B 4MCOA 4R9FA 2GA2A 1N25A 3S1NJ 3L2WA 1D9YA 4GWYA 4NX1A 3VLWA 3ZQ7A 3HC7A 2LF7A 3WTSC 1XGOA 2GZWA 1X1AA 1JT6A 2UVJA 4MLOA 3FK7A 2L7FP 3FJMA 2RC8A 4KI0E 4WX9A 3IL2A 1LJ9A 3BZKA 1RKWA 5FJ8J 3J80Z 3H36A 2B4LA 2GH9A 2V84A 4M9SA 1OQHA 3IOVA 1T39A 4OYVA 3RUMA 2LNBA 5HDNA 3ILUB 3M3FA 2QGUA 2NVQJ 3UIFA 3E6CC 3JV9A 4Z7EA 3KEQA 1NTCA 4BQOA 2ME0A 3N97A 5H8FA 1OCPA 4GIZA 4WK8F 4YMBA 2OF7A 1IRXA 4X9TA 1JJ8C 4RAGA 2JZYA 2XRLA 2DYRH 2QQBA 4OQOA 2WA0A 1ZQ3P 2GLOA 2NOOA 3FJ7A 5A5XA 1Y8QB 3T9VA 3VSLA 1LBVA 3U72A 1Z21A 4LK0F 2O7OA 3DLNA 1FRPA 2ONKE 1VE4A 1UELB 3BZ6A 1E3PA 1YQAA 5A2QZ 2P0WA 4N15A 4GX3A 4ZYHA 2QF7A 2V26A 3BR2A 3L7WA 4XRMA 4PFIA 3DLAA 4YB6A 2PVUA 5I2NA 4JYKA 2E2JJ 3CIJA 3PUZE 1W0TA 1M1EB 4JX4A 3G4SI 1P4WA 3IOUA 2VBZA 2VKDA 1SYHA 4GRIA 3TEPA 3S32A 4XICA 3M8UA 1Z7UA 4LQ2A 3B6CA 5DVJA 3BTIA 3FZVA 3CO6C 1OCZH 2DA7A 2BHYA 3H03A 1KQ8A 2R9JA 1TL8A 3DPTA 3CDHA 5H8FB 4DXCA 2ANJA 5K1YA 1XTAA 3LSPA 1WJ5A 2F6CA 3RTFB 2PI0A 1YXIA 3BR0A 3GYHX 2H25A 1JJ6C 2CZIA 1VQ6I 2PN6A 3CC7I 3TW7A 3Q0WA 3SXYA 3F8NA 2VPNA 2H8RA 4KPTA 4KYSA 2K4JA 2QSXA 1LFHA 2V9PA 1VI0A 2QSHX 4M74A 1KWHA 1G8XA 4Y3OA 5FRNA 3PUBA 1J9IA 4IQJA 5HLTA 1MGTA 3BR5A 4C9YA 3IORA 4JXIA 5DV5A 3K70D 1Z7NE 3V4GA 3ZSFA 2I0BA 4BBRJ 5I2NB 4P3LA 2ZZVA 2CEYA 5CMCA 2FBKA 5F6FA 1NV1A 1P1WA 3K4KA 2V6CA 2M30A 4LD5A 3JRGA 3AKZA 4A3DJ 1FY7A 4OFLA 3FX3A 3MKYB 2IA0A 2XC7A 3EUHC 3KPHA 3OL3A 4RXLA 4ZZAA 4DIGA 4G94A 3U9GA 2ZJ2A 5EEHA 1MBKA 1NUWA 1B40A 2QSFX 5J8CA 1FNNA 2R5ZA 2D21A 4G68B 5FO5A 4OFJA 4QSDA 5EQ9A 1FP2A 3OO6A 3HOSA 1X4PA 4KYDA 5DYHA 4M3DA 4A3EJ 4B4CA 5B70A 2XWIA 2BE5F 3WODF 1Y0NA 3MZ8A 3OD7A 1RZ4A 3I56I 1P4XA 3D4GA 4YB5A 2IVMA 4A93J 3BR1A 2GA1A 4G61A 2HWVA 1LSTA 3R61A 3MQ0A 2X85A 4RGRA 1B6HA 3HBLA 3R4KA 4EQQA 2OUMA 4BJ6C 4PAFA 1P6RA 3ROUA 3IRRA 1GXPA 1XG1A 3CCEI 5LHIA 1JT0A 4DYRA 4YIFA 3IAZA 4QFKA 2DFIA 1VNDA 3OSGA 2L9NA 4XK4A 5EGOA 1EZPA 3A2KA 4U1ZA 5ET8A 5H6QA 2K40A 1RKTA 3FM5A 3K02A 3V7RA 2Z22A 1FTKA 2XA5A 3H5AA 1IN7A 3ABMH 3BCAA 1I5ZA 4F2OA 2XXHA 1FPEA 4A5MA 1FQEA 1EH8A 3EQLF 3RQ4A 3WU0A 2QEXI 4F7ZA 1PBPA 2PQ8A 3K1MA 2EV6A 2R5ZB 2Y7IA 1UAAA 2REGA 4KD5A 1M5CA 4E7JA 3S9NC 3SEQA 3HOVJ 2ZSIB 5D5UB 2PT1A 2GOMA 3TQLA 3P9IA 3OYHA 3SETA 4A3CJ 1P7IA 1EYKA 2LK2A 2LREA 2VT3A 1Q9DA 4JBZA 4DCXA 3F6VA 4BKXA 4MGRA 3MZHA 4MBPA 4EQ9A 2JA6J 4N6DA 2HEUA 4I8CA 1MXVA 4OENA 1H9GA 1K6YA 3FK6A 3HM5A 4UVCA 4JVDA 1R5GA 1Z77A 3VLVA 1MDMB 3W3CA 1U78A 4YIIA 3GFMA 2M7BA 2NOGA 4IO6A 5F1JA 3U1OA 4WXCA 3ZMVA 2PBIA 5EGOB 1DP7P 1JE8A 2JWTA 3GEZA 3KE2A 4X8RA 3FXOA 5JVGF 3SYTA 2O6GE 1OVBA 4EXLA 3MC2A 3IL1B 5IT9K 3AG4H 4DDDA 3N6TA 1OKRA 5M5WJ 3ZCOA 3MVYA 2JRTA 2KIMA 3K00A 4I09A 5DTBA 1FBGA 5JHUA 3CUQA 1T98A 1ANFA 2Q2AA 4PJJA 3RYPA 1Y1ZA 1FYMA 4NF5A 4UACA 3G1LA 1LB2A 2QKMB 1WI3A 1WJAA 5CI5A 1U0JA 5FKKA 2A5WA 4M3BA 2N8GA 2FRHA 3BCBA 3HDDA 4NWDA 1MY1A 1YG2A 3MMYB 2OWZA 1F36A 2M45A 3G71I 1FEXA 1MM6A 5CLSA 5J40A 3OYCA 3H3VK 2FXAA 1XHYA 2I10A 5IP7J 4O94A 3GXAA 4OMBA 3BIHA 3KBRA 3UNGC 1LAXA 2ZMBA 2CZKA 1VTNC 2HKXA 1OISA 1FJ9A 3LWFA 1SQYA 1VFDA 2XXPA 4C2TA 3E6MA 2OZZA 4IGRA 2XD2A 3GTOJ 2RINA 1U3EM 3MZBA 3FDYA 1XSDA 4HNTA 1F5TA 3OYIA 1RUOA 4KQPA 5I59A 1ITYA 2UV1A 1D5VA 3H4ZA 3LSRA 4BDZA 1PJRA 4F1VA 2AS5F 4C2MJ 2QLZA 3SQNA 5EQ7A 5BNGA 3CUQB 4E0WA 2X6XA 1MRPA 4H65A 2X51A 4NF5B 2L4AA 4KMFA 4YAHX 2H4IA 2KKOA 5F27A 2YPRA 2CYYA 2DMQA 4A3MJ 3HO7A 2I6EA 3OYDA 3J81Z 2JT1A 2F7AA 3WTYC 3E5QA 4I40A 4CCKA 3OMYA 1EF4A 4IY5A 2ELJA 4KA4A 1WH5A 4Q48A 2I48A 1B0LA 2HVQA 1LB9A 1WJBA 3PPPA 4OXVA 1P9QC 3T66A 3H06B 3ODBA 3O8HA 3VYTB 1URDA 1M5DA 2NYXA 4Y17A 3IB2A 5F04A 4I0AA 1FQDA 3HOWJ 2L0KA 2CQXA 1BOAA 1YIOA 1S5LC 1HDPA 2E36A 2L9VA 1ONVA 2XPVA 4ELPA 2JTVA 1BKAA 2HXRA 3E6BA 2Z8FA 2QUFA 4BUPA 5I59B 3C32A 3DKWA 3BJAA 3WU2C 3GZNB 5J8FA 2Y7RA 4XQFA 1ZKBA 4AIJA 1Y8RB 1TWHJ 5ILSA 3T9XB 4XFEA 2HI3A 3BTJA 2EFQA 4FE7A 1MMGA 1SFOJ 1IITA 5AA4B 3ZXSA 4IHXA 5EF6A 5IZ3A 1RDXA 4HLYA 3B6TA 1D0XA 1MY0A 1I3AA 4FISA 1N04A 3MVXA 2HZTA 4E7HA 3TCFA 3OYNA 1AU7A 1J7KA 3RQTA 1B46A 4I01A 1ETWA 2Y48A 2FHYA 2BVLA 3OYGA 3B50A 2UXNA 2JMWA 1IZ1A 3V8LA 5JHFA 3DBRB 3MZ1A 1WFXA 4A0XA 4BQNA 3HKZN 4QLCU 4RK9A 3HHGA 4HCWA 1MY3A 4KT5C 4MX6A 2ZYMA 4D0PA 2BVMA 5GAGJ 1FBDA 3GXOA 3DXJF 1A5JA 4N07A 3RTRA 4ZE8A 1B9MA 2IGMA 4BDYA 1Z9CA 3PPRA 2O9LA 1I6AA 4OA4A 4NC6A 5E8GA 5J1RA 1QUJA 2MC4A 5E8IA 4B3AA 3OR1C 4IX7A 2XXYA 3I9V2 1XGMA 2DMPA 2IGKA 3DCFA 1XDUA 4J00A 2PT2A 4TOZA 2HXIA 4GWZA 1R00A 2CUFA 1X2NA 4S04A 1DGWY 3RKXA 2ECCA 4PQJA 5ITPA 1AOYA 1ZTRA 1VQNI 2DJNA 2Q8JA 3HB9A 1JQFA 3TMGA 3ZGKA 1O7TA 3BQZA 2JVGA 4UHTA 2F4IA 1ZR4A 2DWHA 3MBPA 1FT9A 2NVTJ 2UYFA 3SESA 1QZZA 2VE9A 4BBSJ 4XKRA 4I2OA 1H89C 2WBDA 2UVIA 4FEDA 5KCJA 3JAMZ 1Y3PA 2DE2A 3JSPA 1VQ5I 3OYKA 2CUZA 2WEFA 3FBPA 3CUQC 3U1KA 1MJ9A 3OENA 2OWSA 5I7IA 3B6QA 1GVCA 2A3SA 3Q9VA 2BYVE 3KGCA 4QFOA 3JYRA 5LGNA 4WKMA 1DQUA 1Y56A 2MYSA 3V42A 4CCNA 1W1WE 2JSPA 3L2VA 1O3SA 5IY5H 2QVUA 4NUBA 3A09A 1A6QA 3OYJA 2MG4A 2YX4A 4D1QA 2OK2A 4ONYA 2DA6A 2F5FA 4IJAA 1LLSA 3NOHA 4G12A 2IW5A 3ERMA 4PJMA 3G7WA 4N17A 4CUGA 1EJ9A 4PBQA 5FTHA 1YTYA 3CCYA 1A55A 3G3ZA 3S93A 2DODA 1FZPB 4L17A 1T0KA 4ZS9A 3ZOBA 4ZDPA 2PJPA 3MAMA 1J2XA 3TTLA 4NGUA 2D45A 3BPVA 3ASNH 5DCFA 4AD9A 3I3LA 2Z1DA 3DP4A 2KIFA 5B66C 4RGUA 1R5ID 4HNVA 1K9YA 2M8CA 5CKTA 5LGUA 2XWVA 1IRGA 1OCCH 3LSLA 5KCJB 2E1NA 5IOYA 1I6HJ 2JUCA 1HXDA 2KT0A 2P8TA 1A04A 1GLNA 2DDBA 3S4UA 1A54A 4HE1A 2O51A 2Z33A 1D1AA 3L2RA 3N6UA 4LZ7A 3BT9A 2V1XA 3CJTB 2DAOA 4ENMA 2CSOA 2JJ7A 3KEIA 3RY3A 5ISUA 1R1NA 5D8KB 3M8JA 1XI6A 2WYPA 2JQ7A 2E35A 2HAUA 1QHHD 1QPMA 2VE8A 4FX4A 3I4NJ 1URGA 1QKBA 1IXSB 4PFYA 1S7OA 4PUSA 4F92B 5LHGA 2IXSA 3IFCA 1XC5A 5BMZA 1JETA 2R8TA 4GO1A 2FYIA 2VKEA 4ENKA 2LKSA 3SJMA 2PMHA 1REPC 3E3KA 3FISA 3GFLA 1WGXA 2OBGA 2P3NA 4CGZA 2IS4A 2K9SA 2YJPA 2B0LA 2DMNA 2QVOA 3EETA 1VQMI 4JSDA 4ND9A 3ERED 2XWKA 4GBWA 1UCRA 4OU0A 1MSFC 1QBJA 4IRGA 1MXUA 4QWQA 1GR2A 2JA7J 4KYEA 1B5IA 2JK3A 4NC8A 3HTUA 2X7PA 2L7ZA 5DEQA 4N6PA 4OETA 1A40A 3FXMA 2PFZA 3QPHA 1QUKA 1F1ZA 3PUYE 1B2HA 5EEGA 2CMOA 5CJ9A 4PFRA 4POXA 4DI3D 2O8XA 4PFTA 1Q1HA 2R0QC 4XL9A 4U87A 1JKPC 1D3YA 2HOTA 4F93B 2WB1A 1OYYA 3PNYA 1U8BA 3VXBA 1ELJA 1OJLA 4DJAA 4IPAA 2R4GA 4DI4B 4U0YA 5H8QA 3CUOA 3K70C 3MPKA 3F6OA 1B5HA 3D5SC 2BBYA 3H0DA 5I5PA 1MQDA 3L9FA 1MMAA 3A1YA 2DSFA 1TFAA 3FVGA 1IUDA 4IKFA 2HYGD 2VL8A 1S7YA 4X1DA 2KHMA 1PB7A 5I56A 5E3NA 3HOZJ 4EATA 3VLUA 5IOZA 2FU4A 1TWGJ 2CW0F 5HDKA 2OC6A 2MH2A 2KL4A 2LR8A 3FHNA 4CCOA 4BNCA 2VN2A 1FQCA 3T93B 1WJCA 3OS1A 1BP5A 3CI8A 3J7ZI 1IXRC 4A6EA 2P4WA 3H92A 1SD4A 1G4DA 2GHBA 4RPNA 3VSKA 4F91B 3WU1B 3SHFA 1TZLA 4YELA 2KR0A 4ELQA 2I58A 2F36A 1NUXA 1OYWA 1O7FA 1NMUA 4G2ZA 3LSTA 3TO6A 2M4KA 4PK4A 5L3GA 3ZPLA 1W5TA 3HHHA 5H8QB 2O5RA 2ZKZA 4KIGA 1SBPA 5JTYB 2OCUA 2BY0A 2XX7A 3Q0UA 5K2XA 2D1VA 5K7HA 1X3UA 2R7RA 1YYVA 5KNLA 3PMXA 2Y9ZA 1CF7B 4HLXA 1G6NA 2MA3A 4A3BJ 4OANA 4BLAA 4DBRA 3C3WA 1MXZA 2H9BA 5I56B 2VBYA 1MQGA 5J3LA 3RZDJ 2DWJA 1MKMA 1MQHA 2I49A 5FLMJ 3HFUA 5J4YA 4R9GA 3R7XA 4YKKA 2V7FA 1Q35A 5D5VB 5IP9J 1BR4A 4OESA 3G3HA 2DOEA 5I57A 2QS3A 3HUGA 4RB2C 2M8GX 5ET7A 1NI9A 2E0SA 1MPCA 4WXDA 3ZMDA 4KYWA 2Y84A 4MNUA 1QHGA 3R26A 2V79A 3BG7A 4GWUA 2H27A 3FV1A 3TP3A 3FGSA 4YRVA 2PX1A 2D2WA 3AG1H 3TUSA 2Y0SN 4KMUX 4LB6B 1XMKA 3R0JA 4YFKF 4GD5A 4LA9A 4AS4A 4KFCA 5HDGA 2UWMA 5HNHA 3IOWA 3S2VA 1IDZA 1TBXA 1VQ4I 2O84X 3K6XA 2CO5A 1D8KA 2O1MA 2STTA 3C33A 3PPOA 2DW4A 3E7LA 1B72A 1TP4A 2DOJA 1WJEA 2CRGA 3TODA 1KYWA 3R6UA 1ZARA 4CZZA 1H0MA 3CJRB 2RC9A 2P81A 1FTAA 3NARA 3O29A 2I8DA 2DN0A 1JHHA 4G9YA 1WH7A 4OVTA 3HEFA 2G93A 2LY9A 4HW8A 4GGGA 1FOKA 3LSHA 1XGSA 1UHSA 2F34A 4YEJA 4OIRF 4LLNA 5I57B 5JVTA 1SW5A 3HUGB 3ZMUA 4LONB 3PUVE 2I3VA 1QGPA 2EZIA 5B3SH 4M9XA 2HDCA 1MH4A 3DPLC 1SW1A 3RYRA 3BOQA 3UK4A 4PDKA 3B8BA 3Q29A 1YW9A 1YCJA 2CZHA 3SEXA 3MAJA 1T56A 1QW0A 2FIEA 4X1BA 3W15C 2K9QA 3KJTA 4E7SA 3F3XA 1O4XA 2P7CB 2R7TA 3OXNA 4BEHA 3Q27A 2DBBA 3PD9A 1JTYA 1B72B 5FFZA 1JW5A 2ECBA 1USSA 2FBPA 2H98A 2Y30A 2GXAA 2HQNA 2BV6A 2R71A 2XXVA 3E79A 3FIWA 3HOUJ 1JP4A 3K4UA 4X0GA 4OVQA 1JNFA 2IPQX 2ZO4A 2X26A 2KQZA 4UV9A 2FE3A 1A6IA 1GUUA 2VPOA 2QMXA 3SKPA 3EYYA 4AIHA 3LUZA 2XXWA 3K1PA 4RMNA 4HBLA 3LMMA 2XXRA 2YLNA 3FMSA 5CVIA 4FCYA 3MP8A 3CCMI 2THIA 2ZMEA 3OEKA 3K10A 2KLFA 2Q74A 4XLHA 4R6YA 2FD5A 1LEBA 5ET6A 2Y75A 4AIKA 2VONA 2LKPA 2AL4A 2VJ5A 1PUFA 4IO3A 4F19A 4N4OB 3GZGA 4ELRA 4HQEA 4HDVA 3CMMA 3EUHA 3KEOA 4NF0A 2LC2A 1B3EA 4Y33A 1ZMGA 3KX2A 4DW6A 3MP6A 2KRCA 1Q1KA 2LY1A 5E3OA 1M5EA 2OQGA 3HG9A 4BEHB 5JI6A 1IGNA 4P9FA 3FUZA 4RLFA 3EQ1A 2FNCA 3BFUA 3RQIA 1BL0A 3D4CA 2J5PA 3O3KA 2HQRA 4ETSA 5CVVA 1JKOC 1P4AA 2HAVA 4GL0A 2CMPA 1ZGAA 2NUVA 2WY8Q 3E6DA 4MFIA 5LBQA 3CP8A 1F9BA 3VVDA 2XXTA 4HRIA 4OIQF 2ZXHA 4H0WA 1HKSA 3F9KA 2F4MB 4IRIA 4A3IJ 2EQRA 3V83A 2ZMEB 3E5UA 3GF2A 1JKQC 1ZLJA 1FMVA 2BEOA 3QU6A 3RI4A 2NXNB 3H6VA 3WTTC 1ZR2A 3TBIA 2FOKA 2OJED 1PUFB 4LLGF 2PJRA 2Z8EA 3QUFA 2MD0A 3NEUA 2KRHA 3ROJA 4M3FA 3S3NA 3CDLA 4EJOA 3K7AJ 4Y4RA 1YYZA 2O03A 1MQJA 1LAHE 4QSHA 1HSEA 4IQ4A 2GIZA 3KYDB 2GXGA 1YITI 2ZFUA 4D7NA 4DYCA 4NHJA 1JUMA 2DXIA 1J59A 2CU7A 1EV7A 2LDUA 4P55A 3OOAA 1ZHFA 4BHPA 3TKDA 3V8JA 5FHNA 5HVQC 2AL5A 3R0AA 3BY6A 2ESNA 2Y5LA 3I54A 2PBWA 4N8YA 2VD3A 2A6EF 1N7XA 3TDUC 4CICA 2F7CA 1TWCJ 5E17F 4XRSA 1BR1A 2CW8A 1W4MA 4DQ2A 1ZLKA 4OWDA 4UA8A 4GDFA 4PE5B 2RC4A 1ZBMA 4MO7A 2BY2A 3H6UA 3T9HB 4XSXF 3U65A 1IMFA 1J1NA 1SI0A 4OHNA 3HXLA 2O0YA 3KN7A 2VT2A 4CCMA 3C2BA 4A69C 1O63A 3K1NA 2XRNA 1RC9A 5H8HA 3I4MJ 1MNDA 2OX3A 2Y69H 4U7DA 2PJRB 4MNPA 1LE8B 5LHHA 3I3VA 3TTRA 2ZXJA 2G0EA 1B4HA 2E71A 2Y7KA 1WODA 2HTJA 4AYBA 1B32A 1IDYA 2BJIA 3WGHA 1FSEA 3BDDA 2CQNA 4KIBA 4NF4A 2VI6A 5IYCJ 2COBA 2M5WA 4OAZA 3QAXA 2XF6A 2GAUA 2E7WA 2M2EA 4HCYA 1GV5A 2R7OA 5F64A 5BPIA 1X58A 2JA5J 5L3DA 1YJNI 4GFBA 2GFEA 4LZ8A 4EF1A 2VC0A 2ZNUA 1H44A 1TT1A 2HFBA 1MBJA 1QU3A 1FBFA 3KOSA 2IS6A 2V4JC 3MKLA 4UXNA 3KZZA 2F5EA 2XGXA 3HIFA 5CQEA 2AIXA 3QWLA 3GBBA 1LBBA 2ABHA 2HYJA 2I0CA 4GLIA 2HGCA 3HRSA 3WHCA 3D1RA 5CC2A 1B3HA 1RYXA 4AWXB 2Q9TA 5H8HB 4G68A 1B5JA 1AH5A 1N7WA 2CS3A 3GO5A 2BOLA 4PGHA 4RGSA 2RAEA 3MFKA 1T8IA 3EYIA 2HZKA 2Q8KA 1YHQI 2IA1A 4E7KA 1TC3C 1LKXA 3FMRA 3KN8A 3U94A 3FATA 3W9WA 2DYSH 3WG9A 4JQFA 4B44A 4P1EA 1MZBA 3PSFA 2YPNA 4NF4B 4ENJA 2BW3B 4QHQA 1JGGA 5IPAA 4NQ8A 3FM3A 4U2RA 3KLOA 2NS8A 2X6OA 1MXXA 2XKOA 5FKLA 1Z7ME 4OWRB 1JW4A 3KIOA 3G73A 2W48A 1IN6A 2ZMEC 5M3MJ 2XXXA 3H3GA 2AHQA 2FQ4A 5IM2A 2HPIA 2F78A 2RNJA 4IHYA 3GTPJ 1H76A 4PTKA 1FYLA 2XV4S 1SD5A 1VZ0A 4LUBA 3M9AA 1LB8A 4EDPA 2DOFA 5DVIA 1ON1A 5AA3A 1OFCX 2QM3A 1EU8A 1G0IA 2X1CA 2XAJA 1K78A 2KZVA 3L09A 1QULA 1IW7F 2F97A 3PPNA 2HQ0A 4GWWA 4N8GA 4RNSA 4FT8A 4CDGA 2VQGA 1B1HA 2UVHA 4GOTA 1XDSA 2ME6A 1JEUA 2CFOA 4AYBN 3LSGA 1AHDP 4OZ9A 2DQRA 3IWFA 3Q25A 3VEPA 3TYHA 1YZ0A 3F22A 2ID6A 2QSGX 1WQ2A 2O61A 3PD8A 2ZBKA 1B1BA 1OCRH 3MVPA 3AFHA 5DM6F 1NUYA 2GQ1A 2XB5A 3KYCB 2VD2A 4U21A 4AB6A 1ZG5A 5KCMA 1NV4A 3N26A 4IRHA 1T2KA 4S0HB 1S9HA 4JX6A 5IYDJ 3QSLA 1W7PA 5GAHJ 2PCRA 3VE1B 4MIMA 4FHTA 5D5XB 5IP6A 1MDMA 2WBBA 4FEBA 1B8IA 4OAYA 4TLMB 4HPQA 1DP3A 4X6AJ 3K2ZA 2IT0A 5DYMA 4RYAA 3O6GA 4E0XA 3RPLA 4KIFA 5CMKA 2H6BA 1K78B 3CSGA 3FVKA 3OS0A 2ADUA 2H5YA 1N0TA 4N9IA 3QMFA 3O97A 2F5VA 2I5UA 2XF5A 2VXZA 3E0JB 3NRVA 4FE4A 4NEDA 4UB8C 3CDIA 1YW8A 4FTHA 2XX9A 4HF0A 2L7MP 4R73A 3QOEA 1USTA 4HX4A 4HSTA 1LFIA 3KBZA 4DYQA 1GVDA 5K5OA 2X0LA 2VJJA 2EK5A 4LLLA 1LFPA 2DOAA 2HZDA 1HQCA 2RQQA 3RKQA 4JP0A 3W2VA 3COAC 2BJJX 2FMYA 2VHAA 1V55H 1G3WA 3S15J 2ZXTA 3C35A 1QRYA 4M3EA 4JB7A 2IEEA 4R6HA 2A61A 2CG4A 1EA3A 2K86A 3KG2A 3LSWA 5H8SA 2NVYJ 4QPOA 2A6HF 3FHZA 4FIMA 3SFIA 3OYFA 3GLBA 3TMOA 2X1EA 3T5XA 4CH7A 1W7PB 3O9PA 1LDJA 3JRAA 1UZCA 1B8IB 1P1OA 2B63J 4JSOA 1FBSA 2E19A 1QVSA 1ZG3A 3RYDA 1D3KA 3FD3A 2ICWG 3VFJA 2G7HA 4K3FA 1WCMJ 3RPLB 1AIVA 2K4BA 1KU9A 1YS6A 1VR5A 4GXAA 3DU6A 2PEXA 4M72A 2VIXA 2OTLI 2CUJA 2E5ZA 5GAEJ 2DI3A 5HPQA 3CG3A 2PG4A 2EA2A 2CQKA 1IN8A 3PQKA 5D4SA 4FASD 4WF2A 3ABUA 3DV8A 4N81A 1IO2A 3ZN1A 4GF8A 2X6YA 5FLVA 2NNYA 1DPUA 4PSWA 2NVXJ 1NNKA 2OJTA 3HOYJ 3PUXE 4HDUA 4IHTA 4AVPA 1MJAA 2DA2A 3MUQA 1NH7A 4R1HA 3KSJA 1SEUA 4PGNA 2B9SA 1A31A 1JEVA 1BIAA 3KP2A 1YX3A 1O3QA 3FV2A 4G4PA 3WGIA 4MJOA 2ZYNA 3DEUA 3FXUA 4PGPA 1LUJB 1Z6RA 1EYIA 1POTA 3SZTA 4H5FA 4BDRA 2HXOA 2F3DA 3LC8A 1IRFA 4Y7NJ 1P92A 1HC8A 3JRDA 5J47A 1S7EA 1N84A 4RAZA 3DTEA 1P1UA 3GBAA 2HDDA 3Q5FA 1PEBA 2CFXA 2KPMA 3BFTA 2PMSA 4XKWA 5LLQA 4G68C 3HKZA 1XX5A 1MJBA 4HNUA 1JHFA 4EJTA 4O7MA 4LB5A 1E3HA 5CM6A 4BHCA 5IGAA 5AA4A 1IQ7A 3F23A 1ZGJA 4W1UA 3OMBA 4P96A 1MDP1 3HV1A 2DA3A 3PNTA 3BROA 4ZDLA 2HVRA 1RDYA 5J1DA 1R4MB 2B65A 4IXAA 4F1UA 3P9KA 4DE8A 3CCUI 4ZEIA 2OBPA 1FPGA 3K6GA 2HS5A 3CO7C 1OMPA 4Y52J 1HKQA 3AG3H 1NFTA 1BIYA 4EVIA 1MBFA 2HOSA 3KZIC 4UB6C 4KN7X 1D5YA 1KU2A 3MCZA 4UUVA 1UMQA 2BGCA 2XPWA 4OFOA 5E20A 1ODDA 4PE3A 2PLYA 3PU5A 5FROA 3FKIJ 4OMZA 1JUPA 2XXQA 3PV0E 5F7VA 1N76A 1XCVA 2QCOA 5IZZA 4PF6A 4OVJA 1MQIA 1K83J 4MIJA 1MDQA 1DGRM 1G2HA 4U0WA 4M6VA 1EH3A 1DUXC 5J16A 1FQAA 3Q9SA 4IHVA 4D9JA 3PMVA 4PFPA 2NNNA 1FTOA 2FVZA 4U22A 2FBIA 3FXLA 1VQKI 3D5RC 4XORA 3S17J 3BR6A 3A0BC 1TLHB 5TGTA 1RR8C 2XGEA 3RSNA 2EBIA 4ZDOA 1S8NA 5K5RA 2O69A 3GZ5A 2JPBA 3SFZA 1J09A 3H9JA 4EJUA 1LVKA 4KISA 1H45A 3HRUA 3O66A 4XEQA 2CQ7A 1UG2A 4F3QA 2HQ5A 2M8EA 4MHGA 5GTHC 5C44J 1VQPI 3PO2J 1V3FA 1M5FA 3BWGA 4YKIA 3F8FA 2JA8J 3C9HA 1JKRC 1MNEA 5LEKA 5CVRA 1RNLA 3OYMA 3RN8A 1ETYA 1TW2A 4XKCA 2R7VA 4LOCA 3VODA 3VFZA 2YU9J 4IR8A 5CYVA 3VOEA 3SEUA 1OPCA 5EYGA 2R7WA 4LFUA 3LA2A 5IKBA 5ITOA 1KONA 1D1BA 3FXKA 1ZGWA 1PDNC 2MW8A 3O2PE 5EG0A 5E1XA 3RKYA 4ESFA 4A2UA 2X9DA 3JSOA 1NNTA 1Y3NA 4WEDA 1LEAA 2W7YA 2CZLA 3V89B 1Y4TA 3TCHA 3KLNA 3J81K 2K9NA 1D4NA 2Q89A 4O7IA 3ZKKA 2W85A 4C30A 3IB1A 2DA1A 2DA4A 2F48A 5C4JJ 5FGMA 4C3HJ 2GHAA 3I5OA 1YO5C 4DZPA 3JTHA 3H5RA 3V8KA 3G3IA 1LCFA 5HLHA 3OELA 2Z99A 4ZTFA 1TQIA 1SFEA 2R7FA 5GPCA 5ICCA 2A69F 1U6GA 4Z2YA 2W84A 3V7CA 3ZRGA 5A5XB 2Y31A 4IEJA 5CBSA 1LCTA 1R1TA 2W24A 1XC1A 2NAZA 2RV8A 4G8MA 3MEXA 4M3GA 3WHBA 1H43A 1NV2A 1R1UA 2NS0A 2WYKA 5LRRA 4BQAA 1BW5A 2L3DA 3BQYA 1L3LA 1BI2A 3ZQHA 5EG0B 2B4MA 4DGWB 3IFAA 4PDDA 4ECFA 2XHKA 2JPCA 1N75A 2M3AA 2PFBA 5EDNA 3QPLA 1NV3A 3PMWA 2WAEA 1BOBA 3IV5A 4F3GA 1U9OA 4B3XA 5B1AH 5I2KA 3GBGA 1WZ2A 3CMYA 3ASOH 3L2QA 1FLIA 3U2RA 4NQWA 3A01A 1DDNA 2MKZA 1LGBC 3NWSA 1SDXA 2VOZA 3RNNA 3O6BB 2E60A 1ZRDA 4RA2A 4U88A 1WKMA 3CLQA 3DBLB 1FBPA 2V1DA 3FXQA 1KZ8A 4GBVA 4IVNA 1HOMA 2Z9OA 3A3UA 4EXKA 4PC9A 2K3PA 4FAJA 4EM1A 4PF8A 4DIQA 1QGXA 4FATA 1UIUA 1YAEA 3LAJA 3M3YJ 2A6TA 1I27A 3DM0A 4JVIA 1VSOA 2IRFG 1EH6A 4E7ZA 2P5VA 3HL2A 5DUKA 4BJ5C 1IXCA 1XB4A 4IHWA 2PMZN 2MSYA 1Z05A 1KA0A 1XSVA 1ZREA 3FIRA 2F8DA 4QXDA 3FKJA 2DYXA 4F55A 2QJEA 4OERA 2BXYA 2Q2EA 1W0UA 5HM4B 3PJRA 5I2KB 3ZQIA 3PPQA 3G2BA 3CMEI 4Q5TA 3OIOA 3UKGA 1IEJA 3UGWA 1FSHA 4PJ0C 1FW0A 4LMYA 4GXSB 4DZ1A 4NQWB 4QPQA 3A01B 2R92J 3OO8A 1IUFA 1R9LA 3A03A 2TDXA 4DBQA 4BDMA 5D8LB 3OYBA 4CXFA 3CTAA 1ZIUA 2H09A 1VFCA 1FPFA 5M2VA 4A3LJ 3PO3J 3WG7H 5GTIC 1HBXG 2H6CA 5E1ZB 2IJLA 4R2FA 2FNPA 2EFNA 1ZK8A 1POY1 1BN5A 4MQVA 5IYBJ 4QFPA 2OAZA 1TNTA 1XVXA 1QNTA 1S7AA 1R9QA 3KP3A 1FTMA 1R22A 2JJKA 3VDXA 1PVEA 4C1UA 2A5YB 4KDPA 2M4GA 1R36A 4C2UA 1TW3A 3RJPA 1PDAA 2VPLA 1Y6IA 2MBFA 2H1LA 3HPIA 4EM2A 1BR2A 3HJEA 5EEAA 4U4SA 2XUBA 2ZB9A 1X2MA 3OYLA 3V7SA 2Q2EB 2RCBA 3W6KB 2RKMA 3LSFB 1SAUA 2QZ8A 5GPAA 1LBCA 2L2OA 4G7HF 2OTJI 2CW7A 2ZXIA 2BY1A 1KZHA 4L5JA 1S6LA 4I98B 2HXWA 3X2QH 2CEXA 2WKYA 4GFRA 1F9NA 4XKBA 4HXVA 5IAIA 4RPOA 1NHAA 1M5BA 2QMWA 2UYEA 1LDKB 2LBFA 3BP8A 4XN0A 2DPUA 5K2YA 5JTYA 5C4XJ 3T0JA 3G6EI 4M6XA 2YUSA 5HLGA 3BR3A 1RPWA 1IV8A 1O64A 2HYFA 2Y0SA 1CF7A 1INPA 3K6VA 2AXTC 1OMIA 3QOPA 2F7BA 2IGNA 3KJ7A 4NF8B 4KCCA 2XPUA 2ALUA 4X1EA 2K7LA 3SEWA 1E3OC 5JK4A 1BC8C 4BDQA 2RVCA 3H3ZA 3V8XB 2F35A 2COMA 2EB7A 5A5LA 4A3GJ 1CQTA 1XSXA 3MSTA 5BQTA 2XD3A 2HOAA 2EILH 3ZMZA 3U93A 1TT0A 1EKEA 2R6GE 4I0BA 4II2A 4RK2A 2ZNYA 2DQVA 1D0ZA 4ZC3A 2MD5A 3EKIA 2RDPA 4YFXF 1R1VA 4M9ZA 2FSWA 2YX7A 3UA8A 3EUKL 1QVUA 2HOEA 4M4GA 5ET5A 5JFRA 1B9JA 1Z91A 2H94A 1GXQA 3HRTA 3U1DA 2V9VA 1HSJA 2XKPA 3LOCA 4HV5A 3JREA 2HVSA 1IMEA 4KR5A 3K4NA 2LY2A 2LBFB 1HW1A 9ANTA 1USYE 1YS7A 4H67A 5DM7F 2ZCWA 5H6RA 4PCQA 1DPRA 2AQEA 1FPQA 1I3QJ 5K7FA 1ZLQA 5TPAA 1V54H 2QVRA 3CFXA 4Q8RA 2F4OB 5ILVA 2DDKA 2IEKA 1W36C 1VQLI 4L18B 2WX9A 3TELA 3FVNA 3CESA 4EF2A 1VDWA 4R6KA 1I1SA 1RR7A 5CMMA 4LIUA 2R7UA 4GQOA 2LVSA 1N3XA 4PFUA 4Q47A 3HCQA 3P7IA 2WTEA 3TAJA 3AXFA 5DT6A 4ZEFA 3CHGA 4OMYA 4XLNF 4UUSB 3IB0A 1L0OC 4RB1A 3WTWC 3OSQA 2VGQA 2F5XA 2F5CA 2RKHA 3JRIA 1GDTA 2F3BA 3JR9A 3GLLA 1UFMA 1ORKA 2OPTA 1DK4A 3HSEA 5K7ZA 2FEZA 2FOWA 1BM9A 1PB9A 4N4UA 3DU5A 2GWRA 2V3TA 3S2DJ 2BZTA 3LUYA 4MMPA 4CA0A 4A0YA 3N4MA 4IL6C 3FBIB 4JOMA 2OA4A 3REOA 1SVLA 3C1DA 3T22A 4NG7A 4XLCA 1N78A 1K4SA 1MM7A 4JWYA 1YX5A 3W2WA 2DTZA 5ICTA 2WAQA 3F72A 1RYOA 3IAS2 2XAGA 1V5EA 3K69A 4G8XA 4I7HA 4MQ9F 3RPUA 5TRDA 1V4RA 5TPAB 4LG3A 3M1EA 4PJLA 2Q2CA 2FBHA 1XPXA 1B7HA 4KICA 3H7MA 2HPMA 1NV5A 3G3GA 3IJXB 1TNSA 1NG6A 3ILTB 3CR9A 1ZKGA 5HBCA 5DS9A 4XM3A 1JVXA 4ZYDA 3AG2H 1FBCA 2Z3YA 4U7BA 1R7JA 4M1VA 4F3PA 1B59A 4I3YA 2UXAA 1HDDC 3QODA 2Y9YA 4F3SA 3K4BA 1K61A 2P5KA 4EQBA 4XMYA 3LL7A 3TOAA 3PUFA 5K5QA 3VPRA 2GOXB 2VODA 4CYCA 1U2WA 2BY3A 1QO0D 1FBEA 2RQPA 4B48A 2EIJH 2JSCA 4BDOA 3GFIA 1QUIA 5LFAA 3BIGA 4PFOA 4HX8A 1EYJA 2Y0MA 2RF1A 2OLBA 2E1MB 4L5IA 4XSZF 5FLXZ 3ONQA 4AIDA 4OTEA 1FIPA 4P8BA 4IOAF 2VPRA 1FPLA 1TXFA 4HV6A 3H1CA 1QPIA 4YFNF 2D5VA 1FOXA 1J5YA 4TV7A 2E1SA 4MLQA 2IS2A 3HOTA 4AUXA 2FMLA 3WTVC 1JI8A 1AWBA 4N13A 4QFLA 1BIBA 3MWBA 5FKOA 3RKWA 1IN4A 3ESWB 3TFLA 3PUWE 5HNFA 3L00A 1K6OA 4P9KA 2V3QA 1T38A 1W7PD 2HPGA 1FOWA 2P3VA 3SEVA 4O3CA 3GCMA 1G3YA 2OD5A 4HS7A 2QA4I 2EV5A 4ZEBA 1IIWA 3LSIA 4U23A 3S9LC 4YU0A 3M8EA 3IUOA 5AIPA 4GCVA 3GFJA 1DU0A 1FTTA 1MY4A 5C3EJ 2R7ZJ 1U9NA 2ZJQF 2RGVA 1LQ1A 4CZCA 3TW6A 4YB7A 4ZZLA 2HR3A 2MFZA 4CYCB 1AA7A 3O6HA 2JA2A 1NV0A 4H8JA 4BDLA 3ZP5A 3G3FA 2WAQN 3KEYA 4RDUA 2CV2A 3T1BA 4HQMA 4Y15A 1FMWA 3JRBA 2ZZXA 4F2QA 2VXDA 3OOUA 5E18F 4IHSA 5CPRB 2HEOA 4IGTA 1LBYA 1EZ9A 3FXJA 3HGGA 3C18A 3J7AY 4S05A 1P7JA 5KDTA 3QYBA 2MABA 1B4AA 1FPIA 2MLGA 4F22A 3GTMJ 4D5FA 2VQCA 3OOPA 2FA7A 3ABLH 5B7DA 5HOOA 3F8CA 1Z3XA 1FTZA 5J6XA 2ZXWH 3LQQA 3FXRA 3P9CA 3U21A 3ZMSA 3TPAA 1KGSA 5HODA 2XIGA 4O8MA 3BJOA 3KP5A 4HZFA 5ICQA 4F52A 3HZJA 3LQRA 2DWAA 2M87A 3VXCA 1G3SA 4BHBA 3CD6I 5FD6A 2Y7WA 4P1LA 3G1OA 3HYIA 5ICEA 5HLIA 3KYLA 3KZGA 3SZPA 2P2AA 5BPDA 2IP2A 1FPKA 2LOOA 2DT5A 2DVCA 4XBFA 4ZZEA 1ETQA 2K27A 4UUTA 4ZYGA 1NL5A 2XXUA 5F0HA 3KP4A 2LTPA 1LE8A 3Q0VA 4FORA 2E2IJ 1AOVA 3S3MA 4Y13A 2ZNSA 2X48A 3MZYA 3R6SA 5KDTB 3H6TA 1ERDA 3EPZA 3GUDA 4LP2B 4L9JA 2Q1ZB 2OCCH 3PSIA 3T0YA 1N77A 1FPBA 4F18A 3RT6B 5EJCA 3VB2A 2WAFA 2R7SA 4EUOA 2VBXA 2VKHA 2R3SA 2OWTA 3QPTA 3G3JA 3LSKA 1SD6A 4FE8A 2DA5A 3KZYA 4LK1F 2FJ1A 1RRJA 1HF0A 2V6EA 1FQBA 4C0RA 5B5EC 2E1OA 4BGDA 2W82A 4BACA 2GBYA 2RREA 3K01A 1AKHA 4PFWA 3ZS6A 2KIQA 4OVSA 4R75A 2V1NA 2NWJA 3OYEA 2E1MC 4RM2A 2HFHA 1R58A 2DT6A 4NF6A 5JLWA 3KP7A 3BKIB 3B7DA 5I58A 3A0HC 2AO9A 2LFBA 3CJNA 2A07F 4O3MA 3D1NI 1A8FA 2CUEA 2ZSHB 2R93J 1XGNA 4PCDA 4TLLB 2PMUA 3IP4B 4ZE9A 3PNVA 4M71A 3OYAA 3J7AO 4OINF 1XN7A 5FD5A 4EEFG 2P5LC 3A02A 3H5NA 1JUSA 2VBWA 2NRAC 1T08B 2M0MA 3O8GA 4AU7A 2M0CA 2OQRA 2PYYA 4ESWA 2XAHA 3M7GA 1TWAJ 3E1SA 4HSRA 1YIJI 2EA4A 5KAFC 4JX5A 1RDZA 3MQ9A 1GV2A 2BW3A 4MF3A 4Q0CA 2K3FA 5IZ1A 4TQUQ 1X1PA 1G59A 3LSXA 2GQQA 3QRFF 2K02A 3D0SA 3DEEA 4LJZF 1RI7A 4IB2A 3HN0A 4HE0A 1XT8A 3T96B 1O57A 2QS4A 4RM3A 1ACIA 4XLPF 1IAWA 3QYTA 1AKHB 3OIPA 3IKTA 1MH3A 2QENA 1X1BA 1XOCA 1R6ZA 3OEMA 4NTLA 1IMDA 2K5CA 4AC0A 1VQOI 3B6WA 1AMFA 3Q3SA 1VFEA 1LVAA 1IF1A 1WJDA 3HRMA 4H4KC 2OCEA 1OVTA 4IO2A 4ISUA 4NF6B 1MBEA 4OIOF 1B3FA 4BXUA 1MXYA 3IOTA 3PTYA 5I58B 4H0EA 3T8RA 4R74A 2KQRA 1WHUA 4G6TB 4I9DA 3MP1A 2KDOA 3DP8A 1MMNA 2E5NA 5KHDA 1SFUA 1B58A 1FCKA 4R8HA 3I71A 2K9LA 1VQ7I 1U5TA 2ISYA 3CJQB 2JRMA 3OSRA 1IMCA 4H1XA 4HW0A 2LF8A 2JVHA 2ELHA 2XF7A 3QYFA 4I3EA 2V1UA 3ZR8X 3N5LA 3UP9A 3CCQI 4BYYA 2QKLB 3TQWA 1BJZA 2LD5A 2D3IA 2DK8A 3C2HA 3JRCA 4XIDA 2JN6A 4J01A 4A12A 1YJWI 1APLC 4P0GA 1LDDA 3K2DA 3J80K 5DD4A 4OVPA 4YIRX 3MKWB 1MBHA 2FUG2 1ATGA 1BW6A 1WRJA 1Z6TA 1FSAA 4QBAA 3A29A 3V5AA 3ELKA 3I55I 2DXYA 3VVEA 3HSTA 3ULQB 2R7QA 2O6AA 1OLCA 1B52A 3TL4X 3GTGJ 3RT8A 3I4PA 2ZNZA 1UG0A 4A6DA 4EV0A 3LR1A 4F39A 3Q28A 2ZZWA 1XCBA 3FJGA 4XLAA 4BE0A 1Z3YA 5BS6A 1GGGA 4D5CA 1FP1D 2ZNTA 3M07A 3LBSA 3FF5A 3HPHA 3ZN0A 4GWOA 4UABA 2WBMA 3P7NA 1OR7A 1U5TB 4MTDA 5AIQA 3KSXA 1LBWA 3DEWA 1TWYA 2Z5UA 2HU9A 2OZ6A 5A2QK 3EHSA 5I3SA 3ZQQA 2MGQA 3CSBA 1PP8F 3CFZA 5J1YA 4N4NB 1GTKA 1II5A 3USDA 4NMYA 4L5EA 1G3TA 2DMUA 4BQQA 4M6YA 3EN3A 4XXUA 2CH0A 3T9UA 1SMYF 2ISZA 3GX4X 4Q4ZF 5IT9Z 1X3ZB 2Y5KA 4DXBA 3FXBA 4NNJA 1NG7A 2B7EA 2MC3A 3LFKA 4CO8A 1W36D 2W7NA 1J75A 3IRQA 4JVCA 4RS8A 1I50J 5L8DA 5L3EA 1LEVA 2XHDA 2G9WA 3K6WA 3MYUA 1Y3QA 4GL8A 3NAUA 1NNFA 3I64A 4NE4A 3R60A 3IKVA 4RB3C 1R23A 4LG0A 1JVYA 3IO4A 5FBPA 4KJZA 5CVUA 5FKMA 5AE4A 4RBOA 2AQFA 1XD7A 3B73A 2MH9A 2CV0A 6PAXA 4H46A 2CQQA 3GTQJ 2GM4A 3H3UA 4CHUA 3I59A 3H9QA 4PSXA 1B05A 3VYRB 4KFQA 2YR2A 1A99A 3S2HJ 1PYVA 3PIOF 5E1WA 1Y9UA 3CQZJ 4RY1A 2ELKA 2A68F 1OQYA 3B6AA 3TO7A 4ON0A 3ZQGA 4HX7A 1QKAA 3Q26A 5BOXA 4ENNA 5EYRA 2Q8MA 1T95A 5EQ8A 2LLKA 2QFLA 1I6XA 3DBHB 3EUAA 3F0CA 3OSFA 3S3OA 1DOTA 1ETKA 2BHZA 3C2GA 3OV8A 3DLLF 2JUGA 3WTZA 2WY7Q 1GT0C 3JRFA 2E1CA 1FPDA 1US4A 1L5TA 2IGOA 4H45A 2KFD