3SETA

Ni-mediated dimer of maltose-binding protein a216h/k220h by synthetic symmetrization (form i)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
total genus 122
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3setA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3setA01
1B05A 1B2HA 4OMBA 4YKJA 2ZXTA 1B5HA 3MVWA 4U1ZA 1RYXA 4NWDA 2REJA 1ZKBA 1ZLQA 1EZPA 4FJPA 3TZAA 2Y7PA 2VD2A 3OOAA 3IL1B 3VXBA 1T0KA 1LAHE 2DYXA 1FCKA 3K6VA 4RXLA 1P1OA 1LCTA 2OCUA 3KSXA 3FJGA 3KJTA 4E0XA 2GHAA 3QK6A 4MFIA 1JQFA 3KOSA 3OMBA 4EQ9A 3MWBA 3O66A 1IIWA 4POWA 2DXYA 3KN8A 1H3DA 2XX7A 4RK2A 1UIVA 4THIA 3C36A 2I6EA 1O7TA 4I1DA 4PFTA 3K6UA 4IO3A 5EYFA 4K3FA 5JEIA 4X1BA 1S7YA 2QSXA 4U22A 1IXIA 5B70A 4NF4A 1SW1A 1LFHA 4GOTA 4BDNA 3K01A 2O51A 4MBPA 3CIJA 4UA8A 1P1NA 5AA4A 1N0TA 1QJMA 2AYSA 3UP9A 1AH5A 1F9BA 2B3BA 4G4PA 5I56B 3B7DA 3CFLA 3M8UA 3RT8A 3KBRA 4O3CA 1FTJA 1TT1A 1LGBC 2F6GA 4F19A 2O69A 3L6GA 2DS9A 1NL5A 4BDLA 1BP5A 4NEDA 3TCGA 1B58A 4GLIA 3PUYE 3S9NC 5DVJA 4F22A 4Z0IA 5I58B 3PMVA 2PT1A 3U1OA 4PFYA 4ZDMA 3IOUA 4XKRA 2F7AA 1Q35A 1Y1ZA 1LFIA 1OMPA 1GGGA 4R6YA 3S2VA 1XVYA 1M5BA 1A54A 2X7QA 1XHYA 3D4GA 1DPEA 5EHSA 5I84A 1YTVA 3E3KA 4F29A 2XXYA 3V8XB 3BBRA 4KQPA 1SBPA 3TUSA 4ECFA 4OFOA 3S9EA 2XXHA 5EHMA 1POY1 2Z8EA 3O6HA 2XD2A 4WXJA 3QXMA 1SI1A 2DE2A 3S4UA 1USYE 4M1VA 4R2FA 3IAZA 3M3KA 2NXOA 4RYAA 4YAHX 4BDRA 1BLFA 4FORA 1QKBA 4KYSA 4G2ZA 4KPTA 2F36A 2HEUA 3H7MA 4NF6B 1TFAA 1DTZA 3ODBA 4RNSA 2GFEA 4H67A 1US5A 5I59A 4NE4A 1QKAA 1I6QA 2DP8A 4F3SA 5J1DA 3K2DA 2P2AA 3MW0A 3T93B 2Q2AA 1MXVA 1EH3A 3RPWA 2NOOA 4PP0A 3JZJA 1JEVA 1MY0A 2B3FA 1FW0A 1JW1A 5IAIA 4GL0A 4KR5A 4EQBA 1A8FA 5DT6A 3FASA 2RKMA 4QFLA 4M4GA 3I5OA 4F2QA 4IY6A 3UIFA 1FQEA 1SI0A 3IB0A 1GR2A 5H8HA 3TKDA 1OLCA 4QHQA 5H8SA 1A40A 5JTYB 4DCYA 1N3WA 4TOZA 4DXBA 1PBPA 2PMSA 3E13X 1UQWA 1R9LA 4EXKA 3KZGA 5ELVA 5H8FA 4JWXA 2RC8A 3JYRA 1J1NA 1JETA 4F18A 2HQ0A 1NNPA 1MQDA 1N3XA 1VR5A 1B52A 2UYEA 4POXA 5KZTA 2RC7A 3ZS6A 1Y9UA 2REGA 4KYDA 3PPQA 3P7IA 3G3KA 1US4A 3TCHA 1B0HA 3KFMA 1JVYA 3U8QA 2Y7KA 1FTMA 3UK4A 5DEXA 3HHFA 1FTKA 1QUIA 3T96B 1M5EA 3G3IA 4JB7A 4IO2A 2GRVA 1A99A 4IO7A 1MXZA 2DOJA 2F78A 1MQIA 2XHDA 1MDQA 4JBZA 4LZ5A 4IO6A 4GVOA 2HXWA 4I62A 5DTBA 2Z22A 2ANJA 2PT2A 3N94A 2OWSA 3DM0A 3IOWA 1HSJA 2V25A 4NF5B 3RT6B 4Q0CA 2GH9A 1CE2A 3GZGA 3GBAA 3VE1B 2KLFA 3K02A 4QFPA 1B9JA 1YAEA 4F31B 2V3UA 4GFRA 2XXVA 5TPAA 3UGWA 2DWIA 4QSDA 5TP9B 5AA4B 5F7VA 5L8DA 2E0SA 4PQJA 2P1SA 5AA2B 4YMBA 2A5TB 1D3KA 2Y7RA 4ZEKA 1H76A 5IKBA 1DMBA 4PFWA 2G29A 5DVFA 3PPNA 1IITA 3G3FA 4ESWA 1LLSA 5AA1A 1S9TA 3IR1A 4EF1A 2O68A 3TTKA 4XKNA 1B3GA 3N6TA 2LAOA 2I58A 4X1DA 3LSFB 3FVNA 5L9MA 2XXQA 4U1OA 1SW4A 2F35A 2I4CA 2X26A 4KCCA 2Z8DA 3SEYA 1N76A 3OO9A 3H6UA 3RQTA 1UTBA 1MQHA 1ZU0A 3PUVE 3SKPA 4BLAA 5F1QA 1LAGE 2VGQA 4HTGA 2UVJA 3RTWB 2RF1A 1DTGA 4GQOA 3ILTB 4R73A 1HSLA 3IOVA 4QF9A 2I3WA 3KOTA 1A55A 3TQLA 2DE3A 4OESA 1URGA 3PPOA 1USYH 4R72A 1IEJA 4MF3A 4LUBA 1PB9A 1RYOA 3EHSA 3QUJA 2HAVA 3OO8A 3PGFA 1OVTA 3TEPA 3KN3A 3H6WA 4ISUA 3K1MA 3VLUA 4R9FA 5CC2A 3LC8A 5FTHA 3ZSFA 1AMFA 3SEXA 4PETA 1FTLA 3O2AA 4RPOA 4RA1A 3TDJA 3U94A 4F39A 3ZKLA 2VD3A 5I2NB 4I9DA 4ELRA 4YKKA 2O84X 3ECRA 5CMCA 1PB7A 1EU8A 1P1WA 1UTHA 3QSLA 3EHTA 2R9JA 3A09A 4HCYA 1A7LA 4OYVA 2FA7A 1ZMGA 2UVIA 2HFBA 1MXYA 3FGSA 4C0RA 5I2KB 3Q25A 1WDNA 3JV9A 3PMWA 3T9HB 4OVJA 3G3JA 3KN7A 3PUZE 5CBSA 3OEKA 4LQ5A 1D9VA 4OXVA 4JWYA 4GRKA 3RTFB 5KCJA 5HPQA 4F1YA 3I6VA 1B5IA 3TTMA 1Y3PA 1URDA 1MM7A 2RCAA 1XVXA 1MPCA 2A5SA 4E0WA 3B6WA 1H44A 2W7YA 1JNFA 2G93A 2AL5A 4I8CA 4GXAA 2QS1A 1NNTA 1ELJA 4L17A 2Q89A 4MH5A 3B6TA 4OEVA 3TYHA 2PX1A 3SEVA 2H98A 2IA4A 3A3CA 3LSXA 3MC2A 3LR1A 2NUVA 2XXXA 3T22A 2I3VA 2HZKA 3R26A 5ICTA 4G68C 3VLVA 3C31A 4QRZA 4LP2B 3MP1A 4FATA 4ZZAA 1QUJA 3IO6A 2R71A 5H8QA 2DVZA 3UA8A 1B5JA 1RKMA 1POTA 3PUWE 4F1VA 5B7DA 2HAUA 3ONMA 3THIA 2ABHA 1LAFE 3K00A 3HPIA 2ESNA 1MH4A 1MPBA 1N04A 4U23A 3CVGA 4BDOA 3MVXA 1MXUA 1MY2A 2Q88A 1II5A 5TPAB 3LSWA 3PUXE 1OQHA 4H5FA 4DXUA 3C32A 2F6PA 4AQ4A 3UN6A 5KDTA 3OENA 3W9WA 1LBBA 4QFKA 1Z7ME 2DXRA 3EN3A 3C9HA 2I49A 1MXXA 1MQGA 2PBWA 3TPAA 3WAFA 5BWJA 4OETA 3DP4A 1UIUA 5ITPA 2OZZA 3HHGA 1QULA 3QUFA 2F5XA 4C1UA 3ILUB 1B6HA 4KYEA 4G68A 3FUZA 4YU0A 2F8DA 5A5XA 1EZOA 1IZ1A 2OBGA 4KCDA 4H6DA 3TTRA 4OWDA 3B6QA 3FVKA 3C4MA 2AL4A 4XXUA 3KSJA 4FECA 4DLDA 1SDXA 3GLBA 1XT8A 5I57A 1XC1A 5H8NB 2O1LA 4BDMA 1VSOA 3MPKA 1IUDA 4NF8B 2I0BA 3H03A 3KGCA 4FEBA 3CI8A 2XXTA 1WVJA 5HM4B 4FEDA 2V3TA 3OSRA 3RN8A 3Q28A 4TLLB 4ZEDA 3FVOA 1MRPA 1B7UA 1MPDA 3VFJA 1I6BA 4H8JA 1FQDA 1B32A 2XXUA 2D21A 4OQOA 1CB6A 3TELA 2ALUA 3T9XB 3EPEA 4ESXA 4R6KA 4EXLA 3Q27A 1VFEA 2ZMBA 3MZ9A 1LFGA 3IB1A 3IB2A 4HW8A 3GBBA 5CRYA 2D5WA 4FIMA 4O3BA 1BIYA 1B7HA 1XOCA 3W15C 1AL3A 2P0SA 1PBQA 4AB6A 4OENA 4OEUA 3IJXB 2ONKE 1GV8A 2YPNA 5FHOA 1M5DA 1ANFA 3D4CA 2H5YA 1B40A 4JWOA 4LVQA 1Y20A 3PD8A 3MJNA 1SYHA 4H1XA 5I56A 4Q5TA 1DOTA 4QFNA 2UVGA 1Y1MA 4Q8RA 1ATGA 1Y4CA 3H06B 5ICQA 2H9BA 3DP6A 4IO5A 4F1UA 4JSOA 3M3LA 4OZ9A 1MXWA 3U72A 4KHZE 4U4XA 2UXAA 3LSLA 4NF4B 4KD5A 3OEMA 2ZNTA 3SERA 3QAXA 4UACA 3O6GA 3EQ1A 1JW4A 2V93A 1SD3A 2PVUA 2Z8FA 5AA2D 3SETA 2RINA 1FQCA 3H3GA 1N7XA 1B1XA 4ELPA 5CMBA 2D3IA 3DP8A 3RNNA 3QIMA 1KWHA 1LBCA 1B4ZA 1H43A 3TAJA 3K1PA 4DXCA 2XXWA 3CR9A 3HV1A 3HSTA 4R74A 4LONB 4NF6A 3OXNA 3LBSA 3KG2A 1I6AA 4OFLA 3CG3A 3O9PA 1N84A 3MVZA 3CFZA 1P1QA 3PV0E 3PPPA 3FATA 5DVIA 5CMMA 3R6UA 1GVCA 5HBCA 3K1NA 3N6UA 4EQ7A 1A8EA 4MLVA 1LCFA 4FE8A 1N7WA 1MM6A 4GIZA 4F3GA 1ZTYA 3O97A 1OIBA 3UORA 2RCBA 2THIA 2O6AA 2O7IA 2FYIA 2VHAA 4OFJA 3W9VA 4P11A 2GHBA 4DIGA 5BUUA 4U21A 4LQ2A 2QPQA 4TQUQ 1Z7NE 2F34A 4ELOA 2IEEA 3MZ1A 1B3LA 4LATA 4QSEA 3O29A 1MH3A 4DCXA 4KI0E 3K6WA 4G68B 2ZYOA 1LAXA 2OWTA 5I59B 3LUYA 4XIGQ 2DWHA 1Y3NA 3H6VA 4U2RA 3S9MC 1NNKA 1ZIUA 4BDQA 2V84A 3PPRA 3U92A 2DVCA 3T9VA 1OVBA 1SVXB 2B65A 5TU0A 5CMKA 1DSNA 4DE8A 4JDFA 3M3FA 4G8HA 5AA3A 1TXFA 4OHNA 1QW0A 2Z23A 4QSCA 3SESA 5H8HB 4IB2A 1P99A 2HZLA 3HO7A 3K6XA 3S9LC 4RY1A 4ZZEA 4NMYA 3RLFE 4ELQA 2DWJA 3O28A 3N5LA 4F3BA 3FD3A 5H8FB 3TQWA 4XKQA 3V83A 4X9TA 2F97A 1MDP1 4GXSB 4YB7A 2YJPA 4ZEBA 2ZNUA 2Q2CA 4R9GA 5L9SA 4NF5A 5CM6A 1QUKA 1YCJA 3PMXA 4LZ8A 1SYIA 3RGYA 3EHUA 4ZECA 1LB8A 3OO7A 2QJEA 4GWOA 4YZZA 3A3UA 2DQVA 2XXPA 1MY3A 1Y3QA 3DLNA 1AOVA 4FAJA 1TWYA 5TP9A 5DEXB 3BFUA 2QMWA 3SEWA 1P1UA 3QYTA 5AA2A 4RPNA 2A5TA 1B1HA 1I69A 4C1TA 4HCWA 3U93A 1IQ7A 4ZEFA 5ISUA 1IXCA 1Y4TA 4IO4A 3VV5A 4LZ7A 3IJOB 3KEIA 2WKYA 2QS4A 1D9YA 3TCFA 3E4RA 1SW2A 3OSQA 3KJ7A 3H6TA 2F7BA 2R6GE 3I3VA 2DE4A 4X48A 4N13A 4YB6A 2XXIA 4GL8A 1B0LA 1LSTA 1SW5A 4RK9A 3HN0A 1MS7A 2UVHA 1PC3A 2RC9A 3CSBA 5JK4A 5CBRA 3VXCA 2H25A 2X7PA 3ZKKA 1PEBA 2XD3A 4P0GA 1URSA 4ONYA 4YKIA 2XX8A 3MBPA 2I4BA 2QMXA 2NVUB 1R6ZA 4DZ1A 1B51A 4LA9A 1BTJA 2DSFA 4EUOA 2OK2A 4R6HA 2ZYKA 4EF2A 1MQJA 1VFDA 4IGTA 2H4IA 2Q9TA 2VOZA 3PD9A 3DELB 2Y84A 4HS7A 1UTBB 3PU5A 3CFXA 5I2NA 3FJ7A 1PDAA 3RUMA 2HCAA 1B3HA 4OERA 4ZEIA 3HCQA 4IY5A 2E1SA 1SQYA 3C33A 1MY1A 2QS2A 4O3AA 2ZYNA 2YLNA 2O7UA 3OD7A 1B3EA 5FHMA 3VVDA 4G8MA 3VLWA 3Q29A 1IXHA 1B4HA 4YMAA 3GXAA 4NTLA 2F7CA 2ZYMA 3FIRA 4KFQA 1R9QA 1OQGA 4AB5A 5CI5A 5I2KA 1JVXA 1VE4A 2VP1A 1IXGA 1B7ZA 2UYFA 3F11A 3E9XA 3K0VA 4R75A 4GD5A 1B46A 5M2VA 3TMGA 3IOTA 3T66A 2ONRA 1S50A 3VVFA 3FV2A 2XXRA 3EF7A 3K4UA 3H4ZA 3SDFA 2I48A 2H99A 2ONSA 4NWCA 1LB9A 3MP6A 4Q30B 3BKIB 5K2XA 4WEDA 4JSDA 1UTHB 4XKPA 1YPNA 4N6PA 4DDDA 4Z7EA 4ND9A 2Y7WA 3TODA 3G7WA 3Q26A 3G3GA 5K2YA 3RY3A 3TTNA 2QS3A 2V3QA 3IX1A 4F2OA 3MQ9A 3R7XA 5ITOA 4H0WA 1JEUA 3BFTA 3TFLA 4G77A 4ZE8A 4PE5B 2Q8JA 2NWJA 3SEUA 3FJMA 3T9UA 1ZJLA 4QFOA 2FNCA 2I0CA 5KCJB 1MY4A 5I58A 4RJZA 4WEPA 4YICA 4OTEA 1NH8A 3IORA 3MAMA 1JW5A 1L5TA 1M5FA 2PYYA 3VVEA 3CG1A 3FXRA 4G8NA 1MG1A 2DWAA 1D4NA 3MUQA 1HSEA 4WKMA 4IGRA 1M5CA 1NFTA 1NNFA 4GF8A 1FQAA 4F3PA 5L9OA 5FHNA 1FTOA 3V89B 1BKAA 3OO6A 1GTKA 1OLAA 4TLMB 4P0IA 3MPLA 4XTCQ 3O6IA 4H5GA 5FTIA 4H65A 4N07A 3C35A 3V5AA 3VDFA 3C34A 2QRYA 5H8QB 4ZS9A 4JXIA 2XX9A 2AIXA 1AIVA 3IK6B 3MVYA 4U4SA 4YB5A 3FV1A 1NMUA 2O1MA 2Y7IA 4ZE9A 2ZNSA 1O63A 4R2BA 5AE4A 5LOMA 3AXFA 3G3HA 2M8CA 3FXQA 1QVSA 1PB8A 5H8NA 1ZBMA 3OELA 5DYHA 4NF8A 3TTLA 1FQBA 1O64A 1NKXA 4MLQA 5KDTB 1WODA 3CSGA 1H45A 3L6HA 3IO4A 1FQFA 4PFUA 3WAEA 1R1NA 2CZLA 5JTYA 4YKPA 3MZBA 2BJJX 5A5XB 4H8IA 3USDA 4EDPA 3N26A 3FVGA 3FXUA 1NH7A 2OLBA 1DPPA 1EZ9A 1Q1KA 3FZVA 1TFDA 2OJTA 1B3FA 3CRBA 2QL3A 1XS5A 3MP8A 5I57B 2CMOA
chains in the Genus database with same CATH superfamily
2XXKA 1IMCA 1B05A 5ET8A 1B2HA 4OMBA 4YKJA 2ZXTA 1B5HA 3MVWA 4U1ZA 1RYXA 4MHFA 4NWDA 2REJA 1ZKBA 1ZLQA 1EZPA 4FJPA 3TZAA 2Y7PA 2VD2A 3OOAA 4OVQA 3IL1B 3VXBA 1T0KA 1LAHE 2DYXA 1FCKA 3K6VA 4RXLA 1P1OA 1LCTA 2OCUA 3KSXA 3FJGA 3KJTA 4E0XA 2GHAA 3QK6A 4MFIA 1JQFA 2MKZA 3KOSA 2WYKA 3OMBA 4GBWA 4EQ9A 3MWBA 3O66A 1IIWA 4POWA 2DXYA 4NGUA 3KN8A 1H3DA 2XX7A 4RK2A 1UIVA 4THIA 3C36A 2I6EA 1O7TA 4I1DA 4PFTA 4IO3A 3K6UA 4NAPA 5EYFA 4K3FA 5JEIA 4X1BA 1S7YA 3FXBA 2QSXA 4U22A 1IXIA 2P3VA 5B70A 4NF4A 4PF6A 1SW1A 1LFHA 4GOTA 3E79A 4BDNA 3K01A 2O51A 4HE2A 4MBPA 1EYIA 3CIJA 4UA8A 1P1NA 5AA4A 1N0TA 1QJMA 2AYSA 1NV3A 3UP9A 1AH5A 4P1LA 1F9BA 2B3BA 4G4PA 5I56B 1NI9A 3B7DA 3CFLA 3M8UA 3RT8A 3KBRA 4PC9A 4O3CA 1FTJA 1TT1A 4I3EA 1LGBC 2F6GA 4F19A 2O69A 3L6GA 2DS9A 5I7IA 1NL5A 4BDLA 1BP5A 4NEDA 3TCGA 1B58A 2HXRA 4MCOA 4PTKA 4GLIA 3PUYE 3S9NC 5DVJA 4F22A 4Z0IA 5I58B 3PMVA 2PT1A 4PAFA 3U1OA 4PFYA 4XFEA 4ZDMA 3IOUA 4XKRA 2F7AA 1NUXA 1Q35A 1Y1ZA 1LFIA 1OMPA 1G0HA 1GGGA 4R6YA 3S2VA 3B8BA 1XVYA 1M5BA 1A54A 2X7QA 1IMBA 1XHYA 3D4GA 1DPEA 5EHSA 5I84A 3KBZA 1YTVA 3E3KA 4F29A 2XXYA 3V8XB 3BBRA 4KQPA 1SBPA 3TUSA 4N6DA 4ECFA 3BIGA 3IFCA 4OFOA 3S9EA 2XXHA 5EHMA 1POY1 2Z8EA 4OVPA 3O6HA 2XD2A 4WXJA 3QXMA 1SI1A 2DE2A 5EQ8A 3S4UA 1USYE 4M1VA 4R2FA 3IAZA 3M3KA 2NXOA 4RYAA 4YAHX 4BDRA 1BLFA 4FORA 1QKBA 4NG7A 4KYSA 4JVCA 4G2ZA 4KPTA 2F36A 2HEUA 3H7MA 4NF6B 1TFAA 4GWSA 1DTZA 4LN5A 4GX3A 3ODBA 1K9ZA 4RNSA 2GFEA 5FBPA 4H67A 1US5A 5I59A 2PCRA 1NV0A 4NE4A 1QKAA 1I6QA 2DP8A 4F3SA 5J1DA 3K2DA 2P2AA 3MW0A 3T93B 3NOHA 1FJ6A 1MXVA 2Q2AA 1EH3A 3RPWA 4MX6A 2NOOA 4PP0A 3JZJA 1JEVA 1MY0A 2B3FA 1FW0A 1JW1A 5IAIA 4GL0A 5A5LA 4KR5A 4EQBA 1A8FA 1DK4A 5DT6A 3FASA 2RKMA 4QFLA 4M4GA 3I5OA 4F2QA 4IY6A 3UIFA 1FQEA 1SI0A 3IB0A 1GR2A 5H8HA 3LUZA 4JVIA 3TKDA 1OLCA 4QHQA 2CEYA 1A40A 5H8SA 5JTYB 4DCYA 1N3WA 2PFYA 4TOZA 4DXBA 1PBPA 4PCDA 2PMSA 5EQAA 3E13X 2HPGA 1UQWA 1R9LA 4EXKA 3KZGA 5ELVA 2VT5A 4X04A 5H8FA 4JWXA 2RC8A 2B4MA 3JYRA 1J1NA 1JETA 4F18A 4PBQA 2HQ0A 1NNPA 2VPOA 1MQDA 1N3XA 1VR5A 1B52A 2UYEA 4JVDA 4POXA 5KZTA 2RC7A 3ZS6A 1Y9UA 2REGA 4KYDA 3PPQA 3P7IA 1FBDA 3G3KA 1US4A 3TCHA 1NV5A 1B0HA 3KFMA 3ISPA 1JVYA 3U8QA 3KC0A 2Y7KA 1FTMA 3UK4A 5DEXA 3HHFA 4PFBA 4GX4A 1FTKA 1QUIA 3T96B 1M5EA 3G3IA 2WEFA 4JB7A 4IO2A 2GRVA 1A99A 4IO7A 1MXZA 2DOJA 1BK4A 2F78A 4P1EA 5I3SA 1MQIA 2XWKA 2XHDA 1MDQA 4JBZA 4LZ5A 4IO6A 4GVOA 2HXWA 4I62A 5DTBA 2Z22A 2ANJA 2PT2A 3N94A 2OWSA 3DM0A 3IOWA 1HSJA 2V25A 4NF5B 3RT6B 4Q0CA 2GH9A 1CE2A 3GZGA 3GBAA 3VE1B 2KLFA 3K02A 4QFPA 1B9JA 1YAEA 4PGPA 4F31B 2V3UA 4GFRA 2XXVA 5TPAA 3UGWA 2DWIA 4QSDA 5TP9B 5AA4B 5F7VA 5L8DA 2E0SA 2KR0A 4PQJA 2P1SA 5AA2B 4YMBA 2A5TB 1D3KA 2Y7RA 3T0JA 4ZEKA 1H76A 1NUYA 5IKBA 1DMBA 4PFWA 2G29A 5DVFA 3PPNA 1IITA 3G3FA 4O7IA 4ESWA 1LLSA 5AA1A 1FPLA 1S9TA 3IR1A 5ET7A 2Y5KA 4EF1A 2O68A 3TTKA 4XKNA 5EQ7A 4QXDA 1B3GA 5LTCA 1FBCA 3N6TA 1AWBA 2LAOA 2I58A 4PFIA 4X1DA 3LSFB 3FVNA 4PE3A 5L9MA 2WX9A 2XXQA 4U1OA 1KZ8A 1SW4A 2F35A 2I4CA 2X26A 4KCCA 2Z8DA 3SEYA 1N76A 3OO9A 3H6UA 3RQTA 1FTAA 1UTBA 1MQHA 1ZU0A 3PUVE 3SKPA 4BLAA 5F1QA 1LAGE 2VGQA 4HTGA 2UVJA 3RTWB 2RF1A 1DTGA 2VPNA 4GQOA 3ILTB 4R73A 1HSLA 3IOVA 4QF9A 2I3WA 3KOTA 1A55A 3TQLA 2DE3A 4OESA 1URGA 3PPOA 1USYH 4R72A 1IEJA 4MF3A 1LBYA 2HHMA 4LUBA 1FPBA 1PB9A 1RYOA 3EHSA 3QUJA 2HAVA 3OO8A 4O94A 3PGFA 1OVTA 3TEPA 3KN3A 4NN3A 3H6WA 4ISUA 3K1MA 3VLUA 4R9FA 5CC2A 3U65A 1KA1A 3LC8A 1IMDA 1FBHA 5FTHA 3ZSFA 1AMFA 3SEXA 2CZKA 4PETA 1FTLA 3O2AA 4RPOA 4RA1A 3TDJA 3U94A 4F39A 3ZKLA 2VD3A 5I2NB 4I9DA 4ELRA 4YKKA 2O84X 3ECRA 5CMCA 1PB7A 1EU8A 4MIJA 1P1WA 1UTHA 3QSLA 3EHTA 2R9JA 3A09A 4HCYA 4PGNA 1A7LA 4OYVA 2WYPA 2FA7A 1NUWA 1ZMGA 2ZZVA 2UVIA 2HFBA 1MXYA 3FGSA 4C0RA 5I2KB 3Q25A 1WDNA 1G0IA 3JV9A 5EYGA 3PMWA 4N15A 2BJIA 3T9HB 4OVJA 3G3JA 3KN7A 3PUZE 5CBSA 3OEKA 4LQ5A 1D9VA 1IMFA 1INPA 4OXVA 4JWYA 4GRKA 3RTFB 5KCJA 5HPQA 4F1YA 3I6VA 1B5IA 3TTMA 1NV1A 1Y3PA 1URDA 5IZ3A 1MM7A 2RCAA 1XVXA 1MPCA 2A5SA 4QBAA 4E0WA 3B6WA 1H44A 2W7YA 1JNFA 2XA5A 2G93A 2AL5A 4I8CA 4GXAA 2QS1A 1NNTA 1ELJA 4L17A 2Q89A 4MH5A 3B6TA 4OEVA 3TYHA 2PX1A 3SEVA 2H98A 2IA4A 3A3CA 3LSXA 3MC2A 4MEVA 3LR1A 2NUVA 2XXXA 3T22A 2I3VA 2HZKA 4GWZA 1D9QA 3R26A 5ICTA 4G68C 3VLVA 3C31A 4QRZA 4LP2B 1FPIA 3MP1A 4FATA 4ZZAA 3IFAA 1QUJA 3IO6A 2R71A 5H8QA 4DI3D 2DVZA 3UA8A 1B5JA 1RKMA 1POTA 3PUWE 4F1VA 4KXPA 5B7DA 4O7MA 2HAUA 3ONMA 3THIA 2ABHA 1LAFE 3K00A 3HPIA 2ESNA 1MH4A 3D1RA 1MPBA 1N04A 4U23A 2Q8MA 3CVGA 4BDOA 3MVXA 1MXUA 1MY2A 2Q88A 1II5A 5TPAB 3LSWA 3PUXE 1OQHA 2PFZA 4H5FA 4DXUA 3C32A 4N8GA 2F6PA 4AQ4A 3UN6A 5KDTA 3OENA 5EQ9A 3W9WA 1LBBA 4QFKA 1Z7ME 2DXRA 3EN3A 3C9HA 2I49A 1MXXA 1FSAA 3A29A 1MQGA 1LBVA 2DDKA 2PBWA 3TPAA 2F3DA 3WAFA 5BWJA 4OETA 3DP4A 1UIUA 5ITPA 2OZZA 3HHGA 1QULA 3QUFA 2F5XA 4C1UA 3ILUB 5EYHA 1B6HA 4KYEA 2L5VA 4G68A 3FUZA 4YU0A 2F8DA 5A5XA 1EZOA 1IZ1A 2OBGA 4KCDA 4H6DA 3TTRA 4OWDA 3B6QA 3FVKA 1FPGA 3C4MA 1RDYA 2AL4A 2QVVA 4XXUA 3KSJA 4FECA 4DLDA 1SDXA 3GLBA 1XT8A 5I57A 1XC1A 5H8NB 2O1LA 4BDMA 1VSOA 3MPKA 1KA0A 3HFUA 1IUDA 4NF8B 2ZZWA 2I0BA 3H03A 3KGCA 4FEBA 3CI8A 2XXTA 1WVJA 5HM4B 4FEDA 2V3TA 3OSRA 3RN8A 3Q28A 4TLLB 4ZEDA 3FVOA 4OA4A 2FIEA 1MRPA 1B7UA 4UABA 4O8MA 3BIHA 1MPDA 3VFJA 1I6BA 4H8JA 2QVUA 1FQDA 2XWVA 1B32A 5DW8A 1IMAA 2XXUA 2D21A 4OQOA 1CB6A 3TELA 1JP4A 2ALUA 3T9XB 3EPEA 4ESXA 4R6KA 4EXLA 3Q27A 1VFEA 2ZMBA 3SZPA 3MZ9A 1LFGA 3IB1A 3IB2A 5ESYA 4HW8A 3GBBA 2XWIA 5CRYA 5ET6A 2D5WA 4FIMA 3E78A 4OANA 4GWUA 4O3BA 1BIYA 1B7HA 1XOCA 4PFRA 3W15C 1YYZA 1AL3A 2P0SA 1PBQA 4AB6A 4OENA 1FPJA 4OEUA 4H45A 3IJXB 2ONKE 1GV8A 2YPNA 5FHOA 1M5DA 1ANFA 3D4CA 2H5YA 1B40A 4JWOA 4OVSA 4LVQA 2QFLA 1Y20A 3PD8A 3MJNA 5F24A 1SYHA 4H1XA 5I56A 4Q5TA 1DOTA 4MJOA 4P8BA 4QFNA 2UVGA 1Y1MA 4Q8RA 2WBDA 1ATGA 1Y4CA 3H06B 3RPLA 5ICQA 2H9BA 3DP6A 4IO5A 4F1UA 5IGAA 1EYJA 2WBBA 5IZ1A 4JSOA 5J16A 3M3LA 4OZ9A 1MXWA 3GYYA 3U72A 4PF8A 4U4XA 4KHZE 2UXAA 3LSLA 4NF4B 1NV2A 2FBPA 4KD5A 3LV0A 3OEMA 2ZNTA 3SERA 3QAXA 4UACA 1FRPA 3O6GA 3EQ1A 1JW4A 2V93A 1SD3A 2PVUA 2Z8FA 5AA2D 3SETA 1RDZA 2RINA 1FQCA 3H3GA 4P56A 4GWXA 4OVTA 1N7XA 1B1XA 4ELPA 5CMBA 4GX6A 2D3IA 3DP8A 3RNNA 4N81A 3QIMA 1KWHA 1LBCA 1B4ZA 1H43A 3TAJA 3K1PA 4DXCA 4AS5A 1NV6A 2FIXA 2XXWA 3CR9A 3HV1A 3HSTA 4R74A 4LONB 4NF6A 3OXNA 3LBSA 3KG2A 4AS4A 1I6AA 5T3JA 4OFLA 3CG3A 3O9PA 1N84A 3MVZA 3CFZA 1P1QA 3PV0E 3PPPA 3FATA 5DVIA 2GQ1A 4DI4B 4N6KA 5CMMA 2ZZXA 3R6UA 3KC1A 1GVCA 5HBCA 3K1NA 3N6UA 4EQ7A 1A8EA 4MLVA 1LCFA 4FE8A 4NF0A 4MAGA 1N7WA 1MM6A 3QMFA 4GIZA 4GWWA 4F3GA 1ZTYA 3O97A 1OIBA 3UORA 2RCBA 2THIA 2O6AA 2O7IA 2FYIA 2VHAA 4OFJA 3W9VA 4P11A 1Q9DA 2GHBA 4DIGA 5BUUA 4U21A 4LQ2A 4I40A 2QPQA 4TQUQ 1Z7NE 2F34A 4ELOA 2IEEA 3MZ1A 1B3LA 4LATA 4QSEA 1LBZA 3O29A 1MH3A 4DCXA 4KI0E 3K6WA 4G68B 2ZYOA 1LAXA 2OWTA 5I59B 2R8TA 3LUYA 4XIGQ 2DWHA 1Y3NA 3H6VA 4U2RA 3S9MC 1NNKA 1ZIUA 4BDQA 2V84A 3PPRA 3U92A 2DVCA 3T9VA 1OVBA 1SVXB 2B65A 1VDWA 5TU0A 5CMKA 1DSNA 4DE8A 4JDFA 4PBHA 3M3FA 4G8HA 5AA3A 1TXFA 4OHNA 1QW0A 2Z23A 4QSCA 3SESA 5H8HB 4IB2A 4NX1A 1P99A 5LDZA 2HZLA 3HO7A 3K6XA 1IMEA 1LBXA 1QGXA 4RY1A 3S9LC 1NUZA 4ZZEA 4NMYA 3RLFE 4ELQA 2DWJA 3O28A 3N5LA 4F3BA 3FD3A 4PAIA 5H8FB 3TQWA 3T1BA 4XKQA 3V83A 4X9TA 2F97A 1MDP1 4GXSB 4YB7A 2YJPA 4ZEBA 2ZNUA 2Q2CA 4R9GA 5L9SA 4NF5A 5CM6A 1QUKA 1YCJA 3PMXA 4LZ8A 1SYIA 3RGYA 3EHUA 4ZECA 1LB8A 3OO7A 2QJEA 4IR8A 4GWOA 4YZZA 3A3UA 1FPKA 3EKIA 2DQVA 2XXPA 1MY3A 1Y3QA 3DLNA 1AOVA 4FAJA 1TWYA 1YXIA 5TP9A 5DEXB 3BFUA 2QMWA 1FBEA 3SEWA 1P1UA 3QYTA 5AA2A 4RPNA 2A5TA 1B1HA 5IM2A 1NV7A 1I69A 4H46A 4C1TA 4HCWA 3U93A 1IQ7A 3MSTA 4ZEFA 5ISUA 3RPLB 1IXCA 1LEVA 1Y4TA 4IO4A 3VV5A 2P3NA 4LZ7A 3IJOB 4OVRA 4MNCA 3KEIA 2WKYA 2QS4A 2Y5LA 1D9YA 3TCFA 3E4RA 4GWYA 1SW2A 3OSQA 3KJ7A 3H6TA 2F7BA 2R6GE 3I3VA 2DE4A 3B50A 4X48A 4N13A 4YB6A 2XXIA 4GL8A 1B0LA 1LSTA 1SW5A 1RDXA 4RK9A 3HN0A 1XI6A 1MS7A 2UVHA 1PC3A 2RC9A 3CSBA 2F3BA 2B4LA 5ET5A 5JK4A 4P9KA 5CBRA 3VXCA 2H25A 2X7PA 3ZKKA 4N17A 1PEBA 2XD3A 4P0GA 1URSA 4ONYA 2Q74A 4YKIA 2XX8A 1FBGA 3MBPA 2I4BA 4N8YA 4XEQA 4P47A 2QMXA 2NVUB 1R6ZA 4DZ1A 1B51A 4LA9A 1BTJA 2DSFA 2FHYA 4EUOA 2OK2A 4R6HA 5IZZA 2ZYKA 4EF2A 3PTYA 1MQJA 1VFDA 4IGTA 2H4IA 2Q9TA 1LBWA 2VOZA 3PD9A 3DELB 2Y84A 4HS7A 1UTBB 3PU5A 3CFXA 4N4UA 4I3YA 5I2NA 3FJ7A 1PDAA 3RUMA 2HCAA 1B3HA 4OERA 2XWOA 4ZEIA 3HCQA 4IY5A 4HXVA 2E1SA 1SQYA 3C33A 1MY1A 2QS2A 4O3AA 2ZYNA 2YLNA 2O7UA 3OD7A 1B3EA 5FHMA 3VVDA 4G8MA 3VLWA 2OX3A 3Q29A 1IXHA 1B4HA 4YMAA 3GXAA 4NTLA 2F7CA 4NQ8A 2ZYMA 2V4CA 3FIRA 4KFQA 1R9QA 1OQGA 4AB5A 5CI5A 5I2KA 1JVXA 1VE4A 2VP1A 1IXGA 3MYUA 1B7ZA 2UYFA 2CEXA 3F11A 3E9XA 3K0VA 4R75A 4GD5A 1B46A 5M2VA 3TMGA 3IOTA 3T66A 2ONRA 1S50A 3VVFA 3FV2A 2XXRA 3EF7A 3K4UA 3H4ZA 3SDFA 2I48A 2H99A 2ONSA 4NWCA 1LB9A 3MP6A 4Q30B 3BKIB 5K2XA 4WEDA 4JSDA 1UTHB 4XKPA 1YPNA 4N6PA 4DDDA 4Z7EA 4ND9A 2Y7WA 3TODA 3G7WA 1FPEA 3Q26A 3G3GA 5K2YA 4X8RA 3RY3A 3TTNA 2QS3A 2V3QA 3IX1A 4F2OA 3MQ9A 3R7XA 5ITOA 4H0WA 1FPFA 1JEUA 3BFTA 3TFLA 4G77A 4ZE8A 4G61A 4PE5B 2Q8JA 2NWJA 4GBVA 5I5PA 2CZIA 3SEUA 1FBFA 3FJMA 3T9UA 4PDDA 1ZJLA 4QFOA 2FNCA 2I0CA 5KCJB 1MY4A 3FBPA 4MMPA 5I58A 4PDHA 4RJZA 4WEPA 4YICA 4OTEA 1NH8A 3IORA 3MAMA 1JW5A 4NHBA 1L5TA 1M5FA 2PYYA 3VVEA 5IZ3B 3CG1A 3FXRA 4G8NA 1MG1A 2DWAA 1D4NA 1NV4A 3MUQA 1HSEA 2KQZA 4XF5A 4WKMA 4IGRA 1FBPA 1M5CA 1NFTA 1NNFA 4GF8A 1FQAA 1FPDA 3ROJA 4F3PA 5L9OA 5FHNA 1FTOA 3V89B 1BKAA 3OO6A 2CZHA 2JJKA 1GTKA 1OLAA 4TLMB 4FBPA 1EYKA 4P0IA 1K9YA 4N91A 3MPLA 4XTCQ 3O6IA 4H5GA 5FTIA 4H65A 4N07A 2FVZA 3C35A 3V5AA 3VDFA 1YZ0A 4HE1A 3C34A 2QRYA 5H8QB 4ZS9A 4JXIA 2XX9A 2AIXA 1CNQA 1AIVA 3IK6B 3MVYA 4U4SA 4YB5A 3FV1A 1NMUA 2O1MA 2Y7IA 2QVRA 2OWZA 4ZE9A 2ZNSA 1FJ9A 1O63A 1DCUA 4P3LA 4R2BA 5AE4A 5LOMA 3AXFA 3G3HA 2M8CA 3FXQA 1QVSA 4MNPA 3RYDA 1PB8A 5H8NA 1ZBMA 3OELA 5DYHA 4NF8A 3TTLA 1FQBA 1O64A 1NKXA 4MLQA 5KDTB 1WODA 3CSGA 1H45A 3L6HA 3IO4A 4PAKA 1FQFA 4PFUA 3WAEA 1R1NA 2CZLA 5JTYA 4YKPA 3MZBA 2BJJX 5A5XB 4H8IA 3USDA 4EDPA 3N26A 3FVGA 3FXUA 1NH7A 2OLBA 3CHGA 1DPPA 1EZ9A 1Q1KA 3FZVA 1DBZA 4MNIA 1SPIA 1TFDA 2OJTA 1B3FA 4HE0A 3CRBA 2QL3A 1XS5A 3MP8A 5I57B 2CMOA
chains in the Genus database with same CATH topology
1B05A 1B2HA 4OMBA 4YKJA 2ZXTA 1B5HA 3MVWA 4U1ZA 1RYXA 4NWDA 2REJA 1ZKBA 1ZLQA 1EZPA 4FJPA 3TZAA 2Y7PA 2VD2A 3OOAA 3IL1B 3VXBA 1T0KA 1LAHE 2DYXA 1FCKA 3K6VA 4RXLA 1P1OA 1LCTA 2OCUA 3KSXA 3FJGA 3KJTA 4E0XA 2GHAA 3QK6A 4MFIA 1JQFA 3KOSA 3OMBA 4EQ9A 3MWBA 3O66A 1IIWA 4POWA 2DXYA 3KN8A 1H3DA 2XX7A 4RK2A 1UIVA 4THIA 3C36A 2I6EA 1O7TA 4I1DA 4PFTA 3K6UA 4IO3A 5EYFA 4K3FA 5JEIA 4X1BA 1S7YA 2QSXA 4U22A 1IXIA 5B70A 4NF4A 1SW1A 1LFHA 4GOTA 4BDNA 3K01A 2O51A 4MBPA 3CIJA 4UA8A 1P1NA 5AA4A 1N0TA 1QJMA 2AYSA 3UP9A 1AH5A 1F9BA 2B3BA 4G4PA 5I56B 3B7DA 3CFLA 3M8UA 3RT8A 3KBRA 4O3CA 1FTJA 1TT1A 1LGBC 2F6GA 4F19A 2O69A 3L6GA 2DS9A 1NL5A 4BDLA 1BP5A 4NEDA 3TCGA 1B58A 4GLIA 3PUYE 3S9NC 5DVJA 4F22A 4Z0IA 5I58B 3PMVA 2PT1A 3U1OA 4PFYA 4ZDMA 3IOUA 4XKRA 2F7AA 1Q35A 1Y1ZA 1LFIA 1OMPA 1GGGA 4R6YA 3S2VA 1XVYA 1M5BA 1A54A 2X7QA 1XHYA 3D4GA 1DPEA 5EHSA 5I84A 1YTVA 3E3KA 4F29A 2XXYA 3V8XB 3BBRA 4KQPA 1SBPA 3TUSA 4ECFA 4OFOA 3S9EA 2XXHA 5EHMA 1POY1 2Z8EA 3O6HA 2XD2A 4WXJA 3QXMA 1SI1A 2DE2A 3S4UA 1USYE 4M1VA 4R2FA 3IAZA 3M3KA 2NXOA 4RYAA 4YAHX 4BDRA 1BLFA 4FORA 1QKBA 4KYSA 4G2ZA 4KPTA 2F36A 2HEUA 3H7MA 4NF6B 1TFAA 1DTZA 3ODBA 4RNSA 2GFEA 4H67A 1US5A 5I59A 4NE4A 1QKAA 1I6QA 2DP8A 4F3SA 5J1DA 3K2DA 2P2AA 3MW0A 3T93B 2Q2AA 1MXVA 1EH3A 3RPWA 2NOOA 4PP0A 3JZJA 1JEVA 1MY0A 2B3FA 1FW0A 1JW1A 5IAIA 4GL0A 4KR5A 4EQBA 1A8FA 5DT6A 3FASA 2RKMA 4QFLA 4M4GA 3I5OA 4F2QA 4IY6A 3UIFA 1FQEA 1SI0A 3IB0A 1GR2A 5H8HA 3TKDA 1OLCA 4QHQA 5H8SA 1A40A 5JTYB 4DCYA 1N3WA 4TOZA 4DXBA 1PBPA 2PMSA 3E13X 1UQWA 1R9LA 4EXKA 3KZGA 5ELVA 5H8FA 4JWXA 2RC8A 3JYRA 1J1NA 1JETA 4F18A 2HQ0A 1NNPA 1MQDA 1N3XA 1VR5A 1B52A 2UYEA 4POXA 5KZTA 2RC7A 3ZS6A 1Y9UA 2REGA 4KYDA 3PPQA 3P7IA 3G3KA 1US4A 3TCHA 1B0HA 3KFMA 1JVYA 3U8QA 2Y7KA 1FTMA 3UK4A 5DEXA 3HHFA 1FTKA 1QUIA 3T96B 1M5EA 3G3IA 4JB7A 4IO2A 2GRVA 1A99A 4IO7A 1MXZA 2DOJA 2F78A 1MQIA 2XHDA 1MDQA 4JBZA 4LZ5A 4IO6A 4GVOA 2HXWA 4I62A 5DTBA 2Z22A 2ANJA 2PT2A 3N94A 2OWSA 3DM0A 3IOWA 1HSJA 2V25A 4NF5B 3RT6B 4Q0CA 2GH9A 1CE2A 3GZGA 3GBAA 3VE1B 2KLFA 3K02A 4QFPA 1B9JA 1YAEA 4F31B 2V3UA 4GFRA 2XXVA 5TPAA 3UGWA 2DWIA 4QSDA 5TP9B 5AA4B 5F7VA 5L8DA 2E0SA 4PQJA 2P1SA 5AA2B 4YMBA 2A5TB 1D3KA 2Y7RA 4ZEKA 1H76A 5IKBA 1DMBA 4PFWA 2G29A 5DVFA 3PPNA 1IITA 3G3FA 4ESWA 1LLSA 5AA1A 1S9TA 3IR1A 4EF1A 2O68A 3TTKA 4XKNA 1B3GA 3N6TA 2LAOA 2I58A 4X1DA 3LSFB 3FVNA 5L9MA 2XXQA 4U1OA 1SW4A 2F35A 2I4CA 2X26A 4KCCA 2Z8DA 3SEYA 1N76A 3OO9A 3H6UA 3RQTA 1UTBA 1MQHA 1ZU0A 3PUVE 3SKPA 4BLAA 5F1QA 1LAGE 2VGQA 4HTGA 2UVJA 3RTWB 2RF1A 1DTGA 4GQOA 3ILTB 4R73A 1HSLA 3IOVA 4QF9A 2I3WA 3KOTA 1A55A 3TQLA 2DE3A 4OESA 1URGA 3PPOA 1USYH 4R72A 1IEJA 4MF3A 4LUBA 1PB9A 1RYOA 3EHSA 3QUJA 2HAVA 3OO8A 3PGFA 1OVTA 3TEPA 3KN3A 3H6WA 4ISUA 3K1MA 3VLUA 4R9FA 5CC2A 3LC8A 5FTHA 3ZSFA 1AMFA 3SEXA 4PETA 1FTLA 3O2AA 4RPOA 4RA1A 3TDJA 3U94A 4F39A 3ZKLA 2VD3A 5I2NB 4I9DA 4ELRA 4YKKA 2O84X 3ECRA 5CMCA 1PB7A 1EU8A 1P1WA 1UTHA 3QSLA 3EHTA 2R9JA 3A09A 4HCYA 1A7LA 4OYVA 2FA7A 1ZMGA 2UVIA 2HFBA 1MXYA 3FGSA 4C0RA 5I2KB 3Q25A 1WDNA 3JV9A 3PMWA 3T9HB 4OVJA 3G3JA 3KN7A 3PUZE 5CBSA 3OEKA 4LQ5A 1D9VA 4OXVA 4JWYA 4GRKA 3RTFB 5KCJA 5HPQA 4F1YA 3I6VA 1B5IA 3TTMA 1Y3PA 1URDA 1MM7A 2RCAA 1XVXA 1MPCA 2A5SA 4E0WA 3B6WA 1H44A 2W7YA 1JNFA 2G93A 2AL5A 4I8CA 4GXAA 2QS1A 1NNTA 1ELJA 4L17A 2Q89A 4MH5A 3B6TA 4OEVA 3TYHA 2PX1A 3SEVA 2H98A 2IA4A 3A3CA 3LSXA 3MC2A 3LR1A 2NUVA 2XXXA 3T22A 2I3VA 2HZKA 3R26A 5ICTA 4G68C 3VLVA 3C31A 4QRZA 4LP2B 3MP1A 4FATA 4ZZAA 1QUJA 3IO6A 2R71A 5H8QA 2DVZA 3UA8A 1B5JA 1RKMA 1POTA 3PUWE 4F1VA 5B7DA 2HAUA 3ONMA 3THIA 2ABHA 1LAFE 3K00A 3HPIA 2ESNA 1MH4A 1MPBA 1N04A 4U23A 3CVGA 4BDOA 3MVXA 1MXUA 1MY2A 2Q88A 1II5A 5TPAB 3LSWA 3PUXE 1OQHA 4H5FA 4DXUA 3C32A 2F6PA 4AQ4A 3UN6A 5KDTA 3OENA 3W9WA 1LBBA 4QFKA 1Z7ME 2DXRA 3EN3A 3C9HA 2I49A 1MXXA 1MQGA 2PBWA 3TPAA 3WAFA 5BWJA 4OETA 3DP4A 1UIUA 5ITPA 2OZZA 3HHGA 1QULA 3QUFA 2F5XA 4C1UA 3ILUB 1B6HA 4KYEA 4G68A 3FUZA 4YU0A 2F8DA 5A5XA 1EZOA 1IZ1A 2OBGA 4KCDA 4H6DA 3TTRA 4OWDA 3B6QA 3FVKA 3C4MA 2AL4A 4XXUA 3KSJA 4FECA 4DLDA 1SDXA 3GLBA 1XT8A 5I57A 1XC1A 5H8NB 2O1LA 4BDMA 1VSOA 3MPKA 1IUDA 4NF8B 2I0BA 3H03A 3KGCA 4FEBA 3CI8A 2XXTA 1WVJA 5HM4B 4FEDA 2V3TA 3OSRA 3RN8A 3Q28A 4TLLB 4ZEDA 3FVOA 1MRPA 1B7UA 1MPDA 3VFJA 1I6BA 4H8JA 1FQDA 1B32A 2XXUA 2D21A 4OQOA 1CB6A 3TELA 2ALUA 3T9XB 3EPEA 4ESXA 4R6KA 4EXLA 3Q27A 1VFEA 2ZMBA 3MZ9A 1LFGA 3IB1A 3IB2A 4HW8A 3GBBA 5CRYA 2D5WA 4FIMA 4O3BA 1BIYA 1B7HA 1XOCA 3W15C 1AL3A 2P0SA 1PBQA 4AB6A 4OENA 4OEUA 3IJXB 2ONKE 1GV8A 2YPNA 5FHOA 1M5DA 1ANFA 3D4CA 2H5YA 1B40A 4JWOA 4LVQA 1Y20A 3PD8A 3MJNA 1SYHA 4H1XA 5I56A 4Q5TA 1DOTA 4QFNA 2UVGA 1Y1MA 4Q8RA 1ATGA 1Y4CA 3H06B 5ICQA 2H9BA 3DP6A 4IO5A 4F1UA 4JSOA 3M3LA 4OZ9A 1MXWA 3U72A 4KHZE 4U4XA 2UXAA 3LSLA 4NF4B 4KD5A 3OEMA 2ZNTA 3SERA 3QAXA 4UACA 3O6GA 3EQ1A 1JW4A 2V93A 1SD3A 2PVUA 2Z8FA 5AA2D 3SETA 2RINA 1FQCA 3H3GA 1N7XA 1B1XA 4ELPA 5CMBA 2D3IA 3DP8A 3RNNA 3QIMA 1KWHA 1LBCA 1B4ZA 1H43A 3TAJA 3K1PA 4DXCA 2XXWA 3CR9A 3HV1A 3HSTA 4R74A 4LONB 4NF6A 3OXNA 3LBSA 3KG2A 1I6AA 4OFLA 3CG3A 3O9PA 1N84A 3MVZA 3CFZA 1P1QA 3PV0E 3PPPA 3FATA 5DVIA 5CMMA 3R6UA 1GVCA 5HBCA 3K1NA 3N6UA 4EQ7A 1A8EA 4MLVA 1LCFA 4FE8A 1N7WA 1MM6A 4GIZA 4F3GA 1ZTYA 3O97A 1OIBA 3UORA 2RCBA 2THIA 2O6AA 2O7IA 2FYIA 2VHAA 4OFJA 3W9VA 4P11A 2GHBA 4DIGA 5BUUA 4U21A 4LQ2A 2QPQA 4TQUQ 1Z7NE 2F34A 4ELOA 2IEEA 3MZ1A 1B3LA 4LATA 4QSEA 3O29A 1MH3A 4DCXA 4KI0E 3K6WA 4G68B 2ZYOA 1LAXA 2OWTA 5I59B 3LUYA 4XIGQ 2DWHA 1Y3NA 3H6VA 4U2RA 3S9MC 1NNKA 1ZIUA 4BDQA 2V84A 3PPRA 3U92A 2DVCA 3T9VA 1OVBA 1SVXB 2B65A 5TU0A 5CMKA 1DSNA 4DE8A 4JDFA 3M3FA 4G8HA 5AA3A 1TXFA 4OHNA 1QW0A 2Z23A 4QSCA 3SESA 5H8HB 4IB2A 1P99A 2HZLA 3HO7A 3K6XA 3S9LC 4RY1A 4ZZEA 4NMYA 3RLFE 4ELQA 2DWJA 3O28A 3N5LA 4F3BA 3FD3A 5H8FB 3TQWA 4XKQA 3V83A 4X9TA 2F97A 1MDP1 4GXSB 4YB7A 2YJPA 4ZEBA 2ZNUA 2Q2CA 4R9GA 5L9SA 4NF5A 5CM6A 1QUKA 1YCJA 3PMXA 4LZ8A 1SYIA 3RGYA 3EHUA 4ZECA 1LB8A 3OO7A 2QJEA 4GWOA 4YZZA 3A3UA 2DQVA 2XXPA 1MY3A 1Y3QA 3DLNA 1AOVA 4FAJA 1TWYA 5TP9A 5DEXB 3BFUA 2QMWA 3SEWA 1P1UA 3QYTA 5AA2A 4RPNA 2A5TA 1B1HA 1I69A 4C1TA 4HCWA 3U93A 1IQ7A 4ZEFA 5ISUA 1IXCA 1Y4TA 4IO4A 3VV5A 4LZ7A 3IJOB 3KEIA 2WKYA 2QS4A 1D9YA 3TCFA 3E4RA 1SW2A 3OSQA 3KJ7A 3H6TA 2F7BA 2R6GE 3I3VA 2DE4A 4X48A 4N13A 4YB6A 2XXIA 4GL8A 1B0LA 1LSTA 1SW5A 4RK9A 3HN0A 1MS7A 2UVHA 1PC3A 2RC9A 3CSBA 5JK4A 5CBRA 3VXCA 2H25A 2X7PA 3ZKKA 1PEBA 2XD3A 4P0GA 1URSA 4ONYA 4YKIA 2XX8A 3MBPA 2I4BA 2QMXA 2NVUB 1R6ZA 4DZ1A 1B51A 4LA9A 1BTJA 2DSFA 4EUOA 2OK2A 4R6HA 2ZYKA 4EF2A 1MQJA 1VFDA 4IGTA 2H4IA 2Q9TA 2VOZA 3PD9A 3DELB 2Y84A 4HS7A 1UTBB 3PU5A 3CFXA 5I2NA 3FJ7A 1PDAA 3RUMA 2HCAA 1B3HA 4OERA 4ZEIA 3HCQA 4IY5A 2E1SA 1SQYA 3C33A 1MY1A 2QS2A 4O3AA 2ZYNA 2YLNA 2O7UA 3OD7A 1B3EA 5FHMA 3VVDA 4G8MA 3VLWA 3Q29A 1IXHA 1B4HA 4YMAA 3GXAA 4NTLA 2F7CA 2ZYMA 3FIRA 4KFQA 1R9QA 1OQGA 4AB5A 5CI5A 5I2KA 1JVXA 1VE4A 2VP1A 1IXGA 1B7ZA 2UYFA 3F11A 3E9XA 3K0VA 4R75A 4GD5A 1B46A 5M2VA 3TMGA 3IOTA 3T66A 2ONRA 1S50A 3VVFA 3FV2A 2XXRA 3EF7A 3K4UA 3H4ZA 3SDFA 2I48A 2H99A 2ONSA 4NWCA 1LB9A 3MP6A 4Q30B 3BKIB 5K2XA 4WEDA 4JSDA 1UTHB 4XKPA 1YPNA 4N6PA 4DDDA 4Z7EA 4ND9A 2Y7WA 3TODA 3G7WA 3Q26A 3G3GA 5K2YA 3RY3A 3TTNA 2QS3A 2V3QA 3IX1A 4F2OA 3MQ9A 3R7XA 5ITOA 4H0WA 1JEUA 3BFTA 3TFLA 4G77A 4ZE8A 4PE5B 2Q8JA 2NWJA 3SEUA 3FJMA 3T9UA 1ZJLA 4QFOA 2FNCA 2I0CA 5KCJB 1MY4A 5I58A 4RJZA 4WEPA 4YICA 4OTEA 1NH8A 3IORA 3MAMA 1JW5A 1L5TA 1M5FA 2PYYA 3VVEA 3CG1A 3FXRA 4G8NA 1MG1A 2DWAA 1D4NA 3MUQA 1HSEA 4WKMA 4IGRA 1M5CA 1NFTA 1NNFA 4GF8A 1FQAA 4F3PA 5L9OA 5FHNA 1FTOA 3V89B 1BKAA 3OO6A 1GTKA 1OLAA 4TLMB 4P0IA 3MPLA 4XTCQ 3O6IA 4H5GA 5FTIA 4H65A 4N07A 3C35A 3V5AA 3VDFA 3C34A 2QRYA 5H8QB 4ZS9A 4JXIA 2XX9A 2AIXA 1AIVA 3IK6B 3MVYA 4U4SA 4YB5A 3FV1A 1NMUA 2O1MA 2Y7IA 4ZE9A 2ZNSA 1O63A 4R2BA 5AE4A 5LOMA 3AXFA 3G3HA 2M8CA 3FXQA 1QVSA 1PB8A 5H8NA 1ZBMA 3OELA 5DYHA 4NF8A 3TTLA 1FQBA 1O64A 1NKXA 4MLQA 5KDTB 1WODA 3CSGA 1H45A 3L6HA 3IO4A 1FQFA 4PFUA 3WAEA 1R1NA 2CZLA 5JTYA 4YKPA 3MZBA 2BJJX 5A5XB 4H8IA 3USDA 4EDPA 3N26A 3FVGA 3FXUA 1NH7A 2OLBA 1DPPA 1EZ9A 1Q1KA 3FZVA 1TFDA 2OJTA 1B3FA 3CRBA 2QL3A 1XS5A 3MP8A 5I57B 2CMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B05 A;  1B2H A;  4OMB A;  4YKJ A;  2ZXT A;  1B5H A;  3MVW A;  4U1Z A;  1RYX A;  4NWD A;  2REJ A;  1ZKB A;  1ZLQ A;  1EZP A;  4FJP A;  3TZA A;  2Y7P A;  2VD2 A;  3OOA A;  3IL1 B;  3VXB A;  1T0K A;  1LAH E;  2DYX A;  1FCK A;  3K6V A;  4RXL A;  1P1O A;  1LCT A;  2OCU A;  3KSX A;  3FJG A;  3KJT A;  4E0X A;  2GHA A;  3QK6 A;  4MFI A;  1JQF A;  3KOS A;  3OMB A;  4EQ9 A;  3MWB A;  3O66 A;  1IIW A;  4POW A;  2DXY A;  3KN8 A;  1H3D A;  2XX7 A;  4RK2 A;  1UIV A;  4THI A;  3C36 A;  2I6E A;  1O7T A;  4I1D A;  4PFT A;  3K6U A;  4IO3 A;  5EYF A;  4K3F A;  5JEI A;  4X1B A;  1S7Y A;  2QSX A;  4U22 A;  1IXI A;  5B70 A;  4NF4 A;  1SW1 A;  1LFH A;  4GOT A;  4BDN A;  3K01 A;  2O51 A;  4MBP A;  3CIJ A;  4UA8 A;  1P1N A;  5AA4 A;  1N0T A;  1QJM A;  2AYS A;  3UP9 A;  1AH5 A;  1F9B A;  2B3B A;  4G4P A;  5I56 B;  3B7D A;  3CFL A;  3M8U A;  3RT8 A;  3KBR A;  4O3C A;  1FTJ A;  1TT1 A;  1LGB C;  2F6G A;  4F19 A;  2O69 A;  3L6G A;  2DS9 A;  1NL5 A;  4BDL A;  1BP5 A;  4NED A;  3TCG A;  1B58 A;  4GLI A;  3PUY E;  3S9N C;  5DVJ A;  4F22 A;  4Z0I A;  5I58 B;  3PMV A;  2PT1 A;  3U1O A;  4PFY A;  4ZDM A;  3IOU A;  4XKR A;  2F7A A;  1Q35 A;  1Y1Z A;  1LFI A;  1OMP A;  1GGG A;  4R6Y A;  3S2V A;  1XVY A;  1M5B A;  1A54 A;  2X7Q A;  1XHY A;  3D4G A;  1DPE A;  5EHS A;  5I84 A;  1YTV A;  3E3K A;  4F29 A;  2XXY A;  3V8X B;  3BBR A;  4KQP A;  1SBP A;  3TUS A;  4ECF A;  4OFO A;  3S9E A;  2XXH A;  5EHM A;  1POY 1;  2Z8E A;  3O6H A;  2XD2 A;  4WXJ A;  3QXM A;  1SI1 A;  2DE2 A;  3S4U A;  1USY E;  4M1V A;  4R2F A;  3IAZ A;  3M3K A;  2NXO A;  4RYA A;  4YAH X;  4BDR A;  1BLF A;  4FOR A;  1QKB A;  4KYS A;  4G2Z A;  4KPT A;  2F36 A;  2HEU A;  3H7M A;  4NF6 B;  1TFA A;  1DTZ A;  3ODB A;  4RNS A;  2GFE A;  4H67 A;  1US5 A;  5I59 A;  4NE4 A;  1QKA A;  1I6Q A;  2DP8 A;  4F3S A;  5J1D A;  3K2D A;  2P2A A;  3MW0 A;  3T93 B;  2Q2A A;  1MXV A;  1EH3 A;  3RPW A;  2NOO A;  4PP0 A;  3JZJ A;  1JEV A;  1MY0 A;  2B3F A;  1FW0 A;  1JW1 A;  5IAI A;  4GL0 A;  4KR5 A;  4EQB A;  1A8F A;  5DT6 A;  3FAS A;  2RKM A;  4QFL A;  4M4G A;  3I5O A;  4F2Q A;  4IY6 A;  3UIF A;  1FQE A;  1SI0 A;  3IB0 A;  1GR2 A;  5H8H A;  3TKD A;  1OLC A;  4QHQ A;  5H8S A;  1A40 A;  5JTY B;  4DCY A;  1N3W A;  4TOZ A;  4DXB A;  1PBP A;  2PMS A;  3E13 X;  1UQW A;  1R9L A;  4EXK A;  3KZG A;  5ELV A;  5H8F A;  4JWX A;  2RC8 A;  3JYR A;  1J1N A;  1JET A;  4F18 A;  2HQ0 A;  1NNP A;  1MQD A;  1N3X A;  1VR5 A;  1B52 A;  2UYE A;  4POX A;  5KZT A;  2RC7 A;  3ZS6 A;  1Y9U A;  2REG A;  4KYD A;  3PPQ A;  3P7I A;  3G3K A;  1US4 A;  3TCH A;  1B0H A;  3KFM A;  1JVY A;  3U8Q A;  2Y7K A;  1FTM A;  3UK4 A;  5DEX A;  3HHF A;  1FTK A;  1QUI A;  3T96 B;  1M5E A;  3G3I A;  4JB7 A;  4IO2 A;  2GRV A;  1A99 A;  4IO7 A;  1MXZ A;  2DOJ A;  2F78 A;  1MQI A;  2XHD A;  1MDQ A;  4JBZ A;  4LZ5 A;  4IO6 A;  4GVO A;  2HXW A;  4I62 A;  5DTB A;  2Z22 A;  2ANJ A;  2PT2 A;  3N94 A;  2OWS A;  3DM0 A;  3IOW A;  1HSJ A;  2V25 A;  4NF5 B;  3RT6 B;  4Q0C A;  2GH9 A;  1CE2 A;  3GZG A;  3GBA A;  3VE1 B;  2KLF A;  3K02 A;  4QFP A;  1B9J A;  1YAE A;  4F31 B;  2V3U A;  4GFR A;  2XXV A;  5TPA A;  3UGW A;  2DWI A;  4QSD A;  5TP9 B;  5AA4 B;  5F7V A;  5L8D A;  2E0S A;  4PQJ A;  2P1S A;  5AA2 B;  4YMB A;  2A5T B;  1D3K A;  2Y7R A;  4ZEK A;  1H76 A;  5IKB A;  1DMB A;  4PFW A;  2G29 A;  5DVF A;  3PPN A;  1IIT A;  3G3F A;  4ESW A;  1LLS A;  5AA1 A;  1S9T A;  3IR1 A;  4EF1 A;  2O68 A;  3TTK A;  4XKN A;  1B3G A;  3N6T A;  2LAO A;  2I58 A;  4X1D A;  3LSF B;  3FVN A;  5L9M A;  2XXQ A;  4U1O A;  1SW4 A;  2F35 A;  2I4C A;  2X26 A;  4KCC A;  2Z8D A;  3SEY A;  1N76 A;  3OO9 A;  3H6U A;  3RQT A;  1UTB A;  1MQH A;  1ZU0 A;  3PUV E;  3SKP A;  4BLA A;  5F1Q A;  1LAG E;  2VGQ A;  4HTG A;  2UVJ A;  3RTW B;  2RF1 A;  1DTG A;  4GQO A;  3ILT B;  4R73 A;  1HSL A;  3IOV A;  4QF9 A;  2I3W A;  3KOT A;  1A55 A;  3TQL A;  2DE3 A;  4OES A;  1URG A;  3PPO A;  1USY H;  4R72 A;  1IEJ A;  4MF3 A;  4LUB A;  1PB9 A;  1RYO A;  3EHS A;  3QUJ A;  2HAV A;  3OO8 A;  3PGF A;  1OVT A;  3TEP A;  3KN3 A;  3H6W A;  4ISU A;  3K1M A;  3VLU A;  4R9F A;  5CC2 A;  3LC8 A;  5FTH A;  3ZSF A;  1AMF A;  3SEX A;  4PET A;  1FTL A;  3O2A A;  4RPO A;  4RA1 A;  3TDJ A;  3U94 A;  4F39 A;  3ZKL A;  2VD3 A;  5I2N B;  4I9D A;  4ELR A;  4YKK A;  2O84 X;  3ECR A;  5CMC A;  1PB7 A;  1EU8 A;  1P1W A;  1UTH A;  3QSL A;  3EHT A;  2R9J A;  3A09 A;  4HCY A;  1A7L A;  4OYV A;  2FA7 A;  1ZMG A;  2UVI A;  2HFB A;  1MXY A;  3FGS A;  4C0R A;  5I2K B;  3Q25 A;  1WDN A;  3JV9 A;  3PMW A;  3T9H B;  4OVJ A;  3G3J A;  3KN7 A;  3PUZ E;  5CBS A;  3OEK A;  4LQ5 A;  1D9V A;  4OXV A;  4JWY A;  4GRK A;  3RTF B;  5KCJ A;  5HPQ A;  4F1Y A;  3I6V A;  1B5I A;  3TTM A;  1Y3P A;  1URD A;  1MM7 A;  2RCA A;  1XVX A;  1MPC A;  2A5S A;  4E0W A;  3B6W A;  1H44 A;  2W7Y A;  1JNF A;  2G93 A;  2AL5 A;  4I8C A;  4GXA A;  2QS1 A;  1NNT A;  1ELJ A;  4L17 A;  2Q89 A;  4MH5 A;  3B6T A;  4OEV A;  3TYH A;  2PX1 A;  3SEV A;  2H98 A;  2IA4 A;  3A3C A;  3LSX A;  3MC2 A;  3LR1 A;  2NUV A;  2XXX A;  3T22 A;  2I3V A;  2HZK A;  3R26 A;  5ICT A;  4G68 C;  3VLV A;  3C31 A;  4QRZ A;  4LP2 B;  3MP1 A;  4FAT A;  4ZZA A;  1QUJ A;  3IO6 A;  2R71 A;  5H8Q A;  2DVZ A;  3UA8 A;  1B5J A;  1RKM A;  1POT A;  3PUW E;  4F1V A;  5B7D A;  2HAU A;  3ONM A;  3THI A;  2ABH A;  1LAF E;  3K00 A;  3HPI A;  2ESN A;  1MH4 A;  1MPB A;  1N04 A;  4U23 A;  3CVG A;  4BDO A;  3MVX A;  1MXU A;  1MY2 A;  2Q88 A;  1II5 A;  5TPA B;  3LSW A;  3PUX E;  1OQH A;  4H5F A;  4DXU A;  3C32 A;  2F6P A;  4AQ4 A;  3UN6 A;  5KDT A;  3OEN A;  3W9W A;  1LBB A;  4QFK A;  1Z7M E;  2DXR A;  3EN3 A;  3C9H A;  2I49 A;  1MXX A;  1MQG A;  2PBW A;  3TPA A;  3WAF A;  5BWJ A;  4OET A;  3DP4 A;  1UIU A;  5ITP A;  2OZZ A;  3HHG A;  1QUL A;  3QUF A;  2F5X A;  4C1U A;  3ILU B;  1B6H A;  4KYE A;  4G68 A;  3FUZ A;  4YU0 A;  2F8D A;  5A5X A;  1EZO A;  1IZ1 A;  2OBG A;  4KCD A;  4H6D A;  3TTR A;  4OWD A;  3B6Q A;  3FVK A;  3C4M A;  2AL4 A;  4XXU A;  3KSJ A;  4FEC A;  4DLD A;  1SDX A;  3GLB A;  1XT8 A;  5I57 A;  1XC1 A;  5H8N B;  2O1L A;  4BDM A;  1VSO A;  3MPK A;  1IUD A;  4NF8 B;  2I0B A;  3H03 A;  3KGC A;  4FEB A;  3CI8 A;  2XXT A;  1WVJ A;  5HM4 B;  4FED A;  2V3T A;  3OSR A;  3RN8 A;  3Q28 A;  4TLL B;  4ZED A;  3FVO A;  1MRP A;  1B7U A;  1MPD A;  3VFJ A;  1I6B A;  4H8J A;  1FQD A;  1B32 A;  2XXU A;  2D21 A;  4OQO A;  1CB6 A;  3TEL A;  2ALU A;  3T9X B;  3EPE A;  4ESX A;  4R6K A;  4EXL A;  3Q27 A;  1VFE A;  2ZMB A;  3MZ9 A;  1LFG A;  3IB1 A;  3IB2 A;  4HW8 A;  3GBB A;  5CRY A;  2D5W A;  4FIM A;  4O3B A;  1BIY A;  1B7H A;  1XOC A;  3W15 C;  1AL3 A;  2P0S A;  1PBQ A;  4AB6 A;  4OEN A;  4OEU A;  3IJX B;  2ONK E;  1GV8 A;  2YPN A;  5FHO A;  1M5D A;  1ANF A;  3D4C A;  2H5Y A;  1B40 A;  4JWO A;  4LVQ A;  1Y20 A;  3PD8 A;  3MJN A;  1SYH A;  4H1X A;  5I56 A;  4Q5T A;  1DOT A;  4QFN A;  2UVG A;  1Y1M A;  4Q8R A;  1ATG A;  1Y4C A;  3H06 B;  5ICQ A;  2H9B A;  3DP6 A;  4IO5 A;  4F1U A;  4JSO A;  3M3L A;  4OZ9 A;  1MXW A;  3U72 A;  4KHZ E;  4U4X A;  2UXA A;  3LSL A;  4NF4 B;  4KD5 A;  3OEM A;  2ZNT A;  3SER A;  3QAX A;  4UAC A;  3O6G A;  3EQ1 A;  1JW4 A;  2V93 A;  1SD3 A;  2PVU A;  2Z8F A;  5AA2 D;  3SET A;  2RIN A;  1FQC A;  3H3G A;  1N7X A;  1B1X A;  4ELP A;  5CMB A;  2D3I A;  3DP8 A;  3RNN A;  3QIM A;  1KWH A;  1LBC A;  1B4Z A;  1H43 A;  3TAJ A;  3K1P A;  4DXC A;  2XXW A;  3CR9 A;  3HV1 A;  3HST A;  4R74 A;  4LON B;  4NF6 A;  3OXN A;  3LBS A;  3KG2 A;  1I6A A;  4OFL A;  3CG3 A;  3O9P A;  1N84 A;  3MVZ A;  3CFZ A;  1P1Q A;  3PV0 E;  3PPP A;  3FAT A;  5DVI A;  5CMM A;  3R6U A;  1GVC A;  5HBC A;  3K1N A;  3N6U A;  4EQ7 A;  1A8E A;  4MLV A;  1LCF A;  4FE8 A;  1N7W A;  1MM6 A;  4GIZ A;  4F3G A;  1ZTY A;  3O97 A;  1OIB A;  3UOR A;  2RCB A;  2THI A;  2O6A A;  2O7I A;  2FYI A;  2VHA A;  4OFJ A;  3W9V A;  4P11 A;  2GHB A;  4DIG A;  5BUU A;  4U21 A;  4LQ2 A;  2QPQ A;  4TQU Q;  1Z7N E;  2F34 A;  4ELO A;  2IEE A;  3MZ1 A;  1B3L A;  4LAT A;  4QSE A;  3O29 A;  1MH3 A;  4DCX A;  4KI0 E;  3K6W A;  4G68 B;  2ZYO A;  1LAX A;  2OWT A;  5I59 B;  3LUY A;  4XIG Q;  2DWH A;  1Y3N A;  3H6V A;  4U2R A;  3S9M C;  1NNK A;  1ZIU A;  4BDQ A;  2V84 A;  3PPR A;  3U92 A;  2DVC A;  3T9V A;  1OVB A;  1SVX B;  2B65 A;  5TU0 A;  5CMK A;  1DSN A;  4DE8 A;  4JDF A;  3M3F A;  4G8H A;  5AA3 A;  1TXF A;  4OHN A;  1QW0 A;  2Z23 A;  4QSC A;  3SES A;  5H8H B;  4IB2 A;  1P99 A;  2HZL A;  3HO7 A;  3K6X A;  3S9L C;  4RY1 A;  4ZZE A;  4NMY A;  3RLF E;  4ELQ A;  2DWJ A;  3O28 A;  3N5L A;  4F3B A;  3FD3 A;  5H8F B;  3TQW A;  4XKQ A;  3V83 A;  4X9T A;  2F97 A;  1MDP 1;  4GXS B;  4YB7 A;  2YJP A;  4ZEB A;  2ZNU A;  2Q2C A;  4R9G A;  5L9S A;  4NF5 A;  5CM6 A;  1QUK A;  1YCJ A;  3PMX A;  4LZ8 A;  1SYI A;  3RGY A;  3EHU A;  4ZEC A;  1LB8 A;  3OO7 A;  2QJE A;  4GWO A;  4YZZ A;  3A3U A;  2DQV A;  2XXP A;  1MY3 A;  1Y3Q A;  3DLN A;  1AOV A;  4FAJ A;  1TWY A;  5TP9 A;  5DEX B;  3BFU A;  2QMW A;  3SEW A;  1P1U A;  3QYT A;  5AA2 A;  4RPN A;  2A5T A;  1B1H A;  1I69 A;  4C1T A;  4HCW A;  3U93 A;  1IQ7 A;  4ZEF A;  5ISU A;  1IXC A;  1Y4T A;  4IO4 A;  3VV5 A;  4LZ7 A;  3IJO B;  3KEI A;  2WKY A;  2QS4 A;  1D9Y A;  3TCF A;  3E4R A;  1SW2 A;  3OSQ A;  3KJ7 A;  3H6T A;  2F7B A;  2R6G E;  3I3V A;  2DE4 A;  4X48 A;  4N13 A;  4YB6 A;  2XXI A;  4GL8 A;  1B0L A;  1LST A;  1SW5 A;  4RK9 A;  3HN0 A;  1MS7 A;  2UVH A;  1PC3 A;  2RC9 A;  3CSB A;  5JK4 A;  5CBR A;  3VXC A;  2H25 A;  2X7P A;  3ZKK A;  1PEB A;  2XD3 A;  4P0G A;  1URS A;  4ONY A;  4YKI A;  2XX8 A;  3MBP A;  2I4B A;  2QMX A;  2NVU B;  1R6Z A;  4DZ1 A;  1B51 A;  4LA9 A;  1BTJ A;  2DSF A;  4EUO A;  2OK2 A;  4R6H A;  2ZYK A;  4EF2 A;  1MQJ A;  1VFD A;  4IGT A;  2H4I A;  2Q9T A;  2VOZ A;  3PD9 A;  3DEL B;  2Y84 A;  4HS7 A;  1UTB B;  3PU5 A;  3CFX A;  5I2N A;  3FJ7 A;  1PDA A;  3RUM A;  2HCA A;  1B3H A;  4OER A;  4ZEI A;  3HCQ A;  4IY5 A;  2E1S A;  1SQY A;  3C33 A;  1MY1 A;  2QS2 A;  4O3A A;  2ZYN A;  2YLN A;  2O7U A;  3OD7 A;  1B3E A;  5FHM A;  3VVD A;  4G8M A;  3VLW A;  3Q29 A;  1IXH A;  1B4H A;  4YMA A;  3GXA A;  4NTL A;  2F7C A;  2ZYM A;  3FIR A;  4KFQ A;  1R9Q A;  1OQG A;  4AB5 A;  5CI5 A;  5I2K A;  1JVX A;  1VE4 A;  2VP1 A;  1IXG A;  1B7Z A;  2UYF A;  3F11 A;  3E9X A;  3K0V A;  4R75 A;  4GD5 A;  1B46 A;  5M2V A;  3TMG A;  3IOT A;  3T66 A;  2ONR A;  1S50 A;  3VVF A;  3FV2 A;  2XXR A;  3EF7 A;  3K4U A;  3H4Z A;  3SDF A;  2I48 A;  2H99 A;  2ONS A;  4NWC A;  1LB9 A;  3MP6 A;  4Q30 B;  3BKI B;  5K2X A;  4WED A;  4JSD A;  1UTH B;  4XKP A;  1YPN A;  4N6P A;  4DDD A;  4Z7E A;  4ND9 A;  2Y7W A;  3TOD A;  3G7W A;  3Q26 A;  3G3G A;  5K2Y A;  3RY3 A;  3TTN A;  2QS3 A;  2V3Q A;  3IX1 A;  4F2O A;  3MQ9 A;  3R7X A;  5ITO A;  4H0W A;  1JEU A;  3BFT A;  3TFL A;  4G77 A;  4ZE8 A;  4PE5 B;  2Q8J A;  2NWJ A;  3SEU A;  3FJM A;  3T9U A;  1ZJL A;  4QFO A;  2FNC A;  2I0C A;  5KCJ B;  1MY4 A;  5I58 A;  4RJZ A;  4WEP A;  4YIC A;  4OTE A;  1NH8 A;  3IOR A;  3MAM A;  1JW5 A;  1L5T A;  1M5F A;  2PYY A;  3VVE A;  3CG1 A;  3FXR A;  4G8N A;  1MG1 A;  2DWA A;  1D4N A;  3MUQ A;  1HSE A;  4WKM A;  4IGR A;  1M5C A;  1NFT A;  1NNF A;  4GF8 A;  1FQA A;  4F3P A;  5L9O A;  5FHN A;  1FTO A;  3V89 B;  1BKA A;  3OO6 A;  1GTK A;  1OLA A;  4TLM B;  4P0I A;  3MPL A;  4XTC Q;  3O6I A;  4H5G A;  5FTI A;  4H65 A;  4N07 A;  3C35 A;  3V5A A;  3VDF A;  3C34 A;  2QRY A;  5H8Q B;  4ZS9 A;  4JXI A;  2XX9 A;  2AIX A;  1AIV A;  3IK6 B;  3MVY A;  4U4S A;  4YB5 A;  3FV1 A;  1NMU A;  2O1M A;  2Y7I A;  4ZE9 A;  2ZNS A;  1O63 A;  4R2B A;  5AE4 A;  5LOM A;  3AXF A;  3G3H A;  2M8C A;  3FXQ A;  1QVS A;  1PB8 A;  5H8N A;  1ZBM A;  3OEL A;  5DYH A;  4NF8 A;  3TTL A;  1FQB A;  1O64 A;  1NKX A;  4MLQ A;  5KDT B;  1WOD A;  3CSG A;  1H45 A;  3L6H A;  3IO4 A;  1FQF A;  4PFU A;  3WAE A;  1R1N A;  2CZL A;  5JTY A;  4YKP A;  3MZB A;  2BJJ X;  5A5X B;  4H8I A;  3USD A;  4EDP A;  3N26 A;  3FVG A;  3FXU A;  1NH7 A;  2OLB A;  1DPP A;  1EZ9 A;  1Q1K A;  3FZV A;  1TFD A;  2OJT A;  1B3F A;  3CRB A;  2QL3 A;  1XS5 A;  3MP8 A;  5I57 B;  2CMO A; 
#chains in the Genus database with same CATH topology
 2XXK A;  1IMC A;  1B05 A;  5ET8 A;  1B2H A;  4OMB A;  4YKJ A;  2ZXT A;  1B5H A;  3MVW A;  4U1Z A;  1RYX A;  4MHF A;  4NWD A;  2REJ A;  1ZKB A;  1ZLQ A;  1EZP A;  4FJP A;  3TZA A;  2Y7P A;  2VD2 A;  3OOA A;  4OVQ A;  3IL1 B;  3VXB A;  1T0K A;  1LAH E;  2DYX A;  1FCK A;  3K6V A;  4RXL A;  1P1O A;  1LCT A;  2OCU A;  3KSX A;  3FJG A;  3KJT A;  4E0X A;  2GHA A;  3QK6 A;  4MFI A;  1JQF A;  2MKZ A;  3KOS A;  2WYK A;  3OMB A;  4GBW A;  4EQ9 A;  3MWB A;  3O66 A;  1IIW A;  4POW A;  2DXY A;  4NGU A;  3KN8 A;  1H3D A;  2XX7 A;  4RK2 A;  1UIV A;  4THI A;  3C36 A;  2I6E A;  1O7T A;  4I1D A;  4PFT A;  4IO3 A;  3K6U A;  4NAP A;  5EYF A;  4K3F A;  5JEI A;  4X1B A;  1S7Y A;  3FXB A;  2QSX A;  4U22 A;  1IXI A;  2P3V A;  5B70 A;  4NF4 A;  4PF6 A;  1SW1 A;  1LFH A;  4GOT A;  3E79 A;  4BDN A;  3K01 A;  2O51 A;  4HE2 A;  4MBP A;  1EYI A;  3CIJ A;  4UA8 A;  1P1N A;  5AA4 A;  1N0T A;  1QJM A;  2AYS A;  1NV3 A;  3UP9 A;  1AH5 A;  4P1L A;  1F9B A;  2B3B A;  4G4P A;  5I56 B;  1NI9 A;  3B7D A;  3CFL A;  3M8U A;  3RT8 A;  3KBR A;  4PC9 A;  4O3C A;  1FTJ A;  1TT1 A;  4I3E A;  1LGB C;  2F6G A;  4F19 A;  2O69 A;  3L6G A;  2DS9 A;  5I7I A;  1NL5 A;  4BDL A;  1BP5 A;  4NED A;  3TCG A;  1B58 A;  2HXR A;  4MCO A;  4PTK A;  4GLI A;  3PUY E;  3S9N C;  5DVJ A;  4F22 A;  4Z0I A;  5I58 B;  3PMV A;  2PT1 A;  4PAF A;  3U1O A;  4PFY A;  4XFE A;  4ZDM A;  3IOU A;  4XKR A;  2F7A A;  1NUX A;  1Q35 A;  1Y1Z A;  1LFI A;  1OMP A;  1G0H A;  1GGG A;  4R6Y A;  3S2V A;  3B8B A;  1XVY A;  1M5B A;  1A54 A;  2X7Q A;  1IMB A;  1XHY A;  3D4G A;  1DPE A;  5EHS A;  5I84 A;  3KBZ A;  1YTV A;  3E3K A;  4F29 A;  2XXY A;  3V8X B;  3BBR A;  4KQP A;  1SBP A;  3TUS A;  4N6D A;  4ECF A;  3BIG A;  3IFC A;  4OFO A;  3S9E A;  2XXH A;  5EHM A;  1POY 1;  2Z8E A;  4OVP A;  3O6H A;  2XD2 A;  4WXJ A;  3QXM A;  1SI1 A;  2DE2 A;  5EQ8 A;  3S4U A;  1USY E;  4M1V A;  4R2F A;  3IAZ A;  3M3K A;  2NXO A;  4RYA A;  4YAH X;  4BDR A;  1BLF A;  4FOR A;  1QKB A;  4NG7 A;  4KYS A;  4JVC A;  4G2Z A;  4KPT A;  2F36 A;  2HEU A;  3H7M A;  4NF6 B;  1TFA A;  4GWS A;  1DTZ A;  4LN5 A;  4GX3 A;  3ODB A;  1K9Z A;  4RNS A;  2GFE A;  5FBP A;  4H67 A;  1US5 A;  5I59 A;  2PCR A;  1NV0 A;  4NE4 A;  1QKA A;  1I6Q A;  2DP8 A;  4F3S A;  5J1D A;  3K2D A;  2P2A A;  3MW0 A;  3T93 B;  3NOH A;  1FJ6 A;  1MXV A;  2Q2A A;  1EH3 A;  3RPW A;  4MX6 A;  2NOO A;  4PP0 A;  3JZJ A;  1JEV A;  1MY0 A;  2B3F A;  1FW0 A;  1JW1 A;  5IAI A;  4GL0 A;  5A5L A;  4KR5 A;  4EQB A;  1A8F A;  1DK4 A;  5DT6 A;  3FAS A;  2RKM A;  4QFL A;  4M4G A;  3I5O A;  4F2Q A;  4IY6 A;  3UIF A;  1FQE A;  1SI0 A;  3IB0 A;  1GR2 A;  5H8H A;  3LUZ A;  4JVI A;  3TKD A;  1OLC A;  4QHQ A;  2CEY A;  1A40 A;  5H8S A;  5JTY B;  4DCY A;  1N3W A;  2PFY A;  4TOZ A;  4DXB A;  1PBP A;  4PCD A;  2PMS A;  5EQA A;  3E13 X;  2HPG A;  1UQW A;  1R9L A;  4EXK A;  3KZG A;  5ELV A;  2VT5 A;  4X04 A;  5H8F A;  4JWX A;  2RC8 A;  2B4M A;  3JYR A;  1J1N A;  1JET A;  4F18 A;  4PBQ A;  2HQ0 A;  1NNP A;  2VPO A;  1MQD A;  1N3X A;  1VR5 A;  1B52 A;  2UYE A;  4JVD A;  4POX A;  5KZT A;  2RC7 A;  3ZS6 A;  1Y9U A;  2REG A;  4KYD A;  3PPQ A;  3P7I A;  1FBD A;  3G3K A;  1US4 A;  3TCH A;  1NV5 A;  1B0H A;  3KFM A;  3ISP A;  1JVY A;  3U8Q A;  3KC0 A;  2Y7K A;  1FTM A;  3UK4 A;  5DEX A;  3HHF A;  4PFB A;  4GX4 A;  1FTK A;  1QUI A;  3T96 B;  1M5E A;  3G3I A;  2WEF A;  4JB7 A;  4IO2 A;  2GRV A;  1A99 A;  4IO7 A;  1MXZ A;  2DOJ A;  1BK4 A;  2F78 A;  4P1E A;  5I3S A;  1MQI A;  2XWK A;  2XHD A;  1MDQ A;  4JBZ A;  4LZ5 A;  4IO6 A;  4GVO A;  2HXW A;  4I62 A;  5DTB A;  2Z22 A;  2ANJ A;  2PT2 A;  3N94 A;  2OWS A;  3DM0 A;  3IOW A;  1HSJ A;  2V25 A;  4NF5 B;  3RT6 B;  4Q0C A;  2GH9 A;  1CE2 A;  3GZG A;  3GBA A;  3VE1 B;  2KLF A;  3K02 A;  4QFP A;  1B9J A;  1YAE A;  4PGP A;  4F31 B;  2V3U A;  4GFR A;  2XXV A;  5TPA A;  3UGW A;  2DWI A;  4QSD A;  5TP9 B;  5AA4 B;  5F7V A;  5L8D A;  2E0S A;  2KR0 A;  4PQJ A;  2P1S A;  5AA2 B;  4YMB A;  2A5T B;  1D3K A;  2Y7R A;  3T0J A;  4ZEK A;  1H76 A;  1NUY A;  5IKB A;  1DMB A;  4PFW A;  2G29 A;  5DVF A;  3PPN A;  1IIT A;  3G3F A;  4O7I A;  4ESW A;  1LLS A;  5AA1 A;  1FPL A;  1S9T A;  3IR1 A;  5ET7 A;  2Y5K A;  4EF1 A;  2O68 A;  3TTK A;  4XKN A;  5EQ7 A;  4QXD A;  1B3G A;  5LTC A;  1FBC A;  3N6T A;  1AWB A;  2LAO A;  2I58 A;  4PFI A;  4X1D A;  3LSF B;  3FVN A;  4PE3 A;  5L9M A;  2WX9 A;  2XXQ A;  4U1O A;  1KZ8 A;  1SW4 A;  2F35 A;  2I4C A;  2X26 A;  4KCC A;  2Z8D A;  3SEY A;  1N76 A;  3OO9 A;  3H6U A;  3RQT A;  1FTA A;  1UTB A;  1MQH A;  1ZU0 A;  3PUV E;  3SKP A;  4BLA A;  5F1Q A;  1LAG E;  2VGQ A;  4HTG A;  2UVJ A;  3RTW B;  2RF1 A;  1DTG A;  2VPN A;  4GQO A;  3ILT B;  4R73 A;  1HSL A;  3IOV A;  4QF9 A;  2I3W A;  3KOT A;  1A55 A;  3TQL A;  2DE3 A;  4OES A;  1URG A;  3PPO A;  1USY H;  4R72 A;  1IEJ A;  4MF3 A;  1LBY A;  2HHM A;  4LUB A;  1FPB A;  1PB9 A;  1RYO A;  3EHS A;  3QUJ A;  2HAV A;  3OO8 A;  4O94 A;  3PGF A;  1OVT A;  3TEP A;  3KN3 A;  4NN3 A;  3H6W A;  4ISU A;  3K1M A;  3VLU A;  4R9F A;  5CC2 A;  3U65 A;  1KA1 A;  3LC8 A;  1IMD A;  1FBH A;  5FTH A;  3ZSF A;  1AMF A;  3SEX A;  2CZK A;  4PET A;  1FTL A;  3O2A A;  4RPO A;  4RA1 A;  3TDJ A;  3U94 A;  4F39 A;  3ZKL A;  2VD3 A;  5I2N B;  4I9D A;  4ELR A;  4YKK A;  2O84 X;  3ECR A;  5CMC A;  1PB7 A;  1EU8 A;  4MIJ A;  1P1W A;  1UTH A;  3QSL A;  3EHT A;  2R9J A;  3A09 A;  4HCY A;  4PGN A;  1A7L A;  4OYV A;  2WYP A;  2FA7 A;  1NUW A;  1ZMG A;  2ZZV A;  2UVI A;  2HFB A;  1MXY A;  3FGS A;  4C0R A;  5I2K B;  3Q25 A;  1WDN A;  1G0I A;  3JV9 A;  5EYG A;  3PMW A;  4N15 A;  2BJI A;  3T9H B;  4OVJ A;  3G3J A;  3KN7 A;  3PUZ E;  5CBS A;  3OEK A;  4LQ5 A;  1D9V A;  1IMF A;  1INP A;  4OXV A;  4JWY A;  4GRK A;  3RTF B;  5KCJ A;  5HPQ A;  4F1Y A;  3I6V A;  1B5I A;  3TTM A;  1NV1 A;  1Y3P A;  1URD A;  5IZ3 A;  1MM7 A;  2RCA A;  1XVX A;  1MPC A;  2A5S A;  4QBA A;  4E0W A;  3B6W A;  1H44 A;  2W7Y A;  1JNF A;  2XA5 A;  2G93 A;  2AL5 A;  4I8C A;  4GXA A;  2QS1 A;  1NNT A;  1ELJ A;  4L17 A;  2Q89 A;  4MH5 A;  3B6T A;  4OEV A;  3TYH A;  2PX1 A;  3SEV A;  2H98 A;  2IA4 A;  3A3C A;  3LSX A;  3MC2 A;  4MEV A;  3LR1 A;  2NUV A;  2XXX A;  3T22 A;  2I3V A;  2HZK A;  4GWZ A;  1D9Q A;  3R26 A;  5ICT A;  4G68 C;  3VLV A;  3C31 A;  4QRZ A;  4LP2 B;  1FPI A;  3MP1 A;  4FAT A;  4ZZA A;  3IFA A;  1QUJ A;  3IO6 A;  2R71 A;  5H8Q A;  4DI3 D;  2DVZ A;  3UA8 A;  1B5J A;  1RKM A;  1POT A;  3PUW E;  4F1V A;  4KXP A;  5B7D A;  4O7M A;  2HAU A;  3ONM A;  3THI A;  2ABH A;  1LAF E;  3K00 A;  3HPI A;  2ESN A;  1MH4 A;  3D1R A;  1MPB A;  1N04 A;  4U23 A;  2Q8M A;  3CVG A;  4BDO A;  3MVX A;  1MXU A;  1MY2 A;  2Q88 A;  1II5 A;  5TPA B;  3LSW A;  3PUX E;  1OQH A;  2PFZ A;  4H5F A;  4DXU A;  3C32 A;  4N8G A;  2F6P A;  4AQ4 A;  3UN6 A;  5KDT A;  3OEN A;  5EQ9 A;  3W9W A;  1LBB A;  4QFK A;  1Z7M E;  2DXR A;  3EN3 A;  3C9H A;  2I49 A;  1MXX A;  1FSA A;  3A29 A;  1MQG A;  1LBV A;  2DDK A;  2PBW A;  3TPA A;  2F3D A;  3WAF A;  5BWJ A;  4OET A;  3DP4 A;  1UIU A;  5ITP A;  2OZZ A;  3HHG A;  1QUL A;  3QUF A;  2F5X A;  4C1U A;  3ILU B;  5EYH A;  1B6H A;  4KYE A;  2L5V A;  4G68 A;  3FUZ A;  4YU0 A;  2F8D A;  5A5X A;  1EZO A;  1IZ1 A;  2OBG A;  4KCD A;  4H6D A;  3TTR A;  4OWD A;  3B6Q A;  3FVK A;  1FPG A;  3C4M A;  1RDY A;  2AL4 A;  2QVV A;  4XXU A;  3KSJ A;  4FEC A;  4DLD A;  1SDX A;  3GLB A;  1XT8 A;  5I57 A;  1XC1 A;  5H8N B;  2O1L A;  4BDM A;  1VSO A;  3MPK A;  1KA0 A;  3HFU A;  1IUD A;  4NF8 B;  2ZZW A;  2I0B A;  3H03 A;  3KGC A;  4FEB A;  3CI8 A;  2XXT A;  1WVJ A;  5HM4 B;  4FED A;  2V3T A;  3OSR A;  3RN8 A;  3Q28 A;  4TLL B;  4ZED A;  3FVO A;  4OA4 A;  2FIE A;  1MRP A;  1B7U A;  4UAB A;  4O8M A;  3BIH A;  1MPD A;  3VFJ A;  1I6B A;  4H8J A;  2QVU A;  1FQD A;  2XWV A;  1B32 A;  5DW8 A;  1IMA A;  2XXU A;  2D21 A;  4OQO A;  1CB6 A;  3TEL A;  1JP4 A;  2ALU A;  3T9X B;  3EPE A;  4ESX A;  4R6K A;  4EXL A;  3Q27 A;  1VFE A;  2ZMB A;  3SZP A;  3MZ9 A;  1LFG A;  3IB1 A;  3IB2 A;  5ESY A;  4HW8 A;  3GBB A;  2XWI A;  5CRY A;  5ET6 A;  2D5W A;  4FIM A;  3E78 A;  4OAN A;  4GWU A;  4O3B A;  1BIY A;  1B7H A;  1XOC A;  4PFR A;  3W15 C;  1YYZ A;  1AL3 A;  2P0S A;  1PBQ A;  4AB6 A;  4OEN A;  1FPJ A;  4OEU A;  4H45 A;  3IJX B;  2ONK E;  1GV8 A;  2YPN A;  5FHO A;  1M5D A;  1ANF A;  3D4C A;  2H5Y A;  1B40 A;  4JWO A;  4OVS A;  4LVQ A;  2QFL A;  1Y20 A;  3PD8 A;  3MJN A;  5F24 A;  1SYH A;  4H1X A;  5I56 A;  4Q5T A;  1DOT A;  4MJO A;  4P8B A;  4QFN A;  2UVG A;  1Y1M A;  4Q8R A;  2WBD A;  1ATG A;  1Y4C A;  3H06 B;  3RPL A;  5ICQ A;  2H9B A;  3DP6 A;  4IO5 A;  4F1U A;  5IGA A;  1EYJ A;  2WBB A;  5IZ1 A;  4JSO A;  5J16 A;  3M3L A;  4OZ9 A;  1MXW A;  3GYY A;  3U72 A;  4PF8 A;  4U4X A;  4KHZ E;  2UXA A;  3LSL A;  4NF4 B;  1NV2 A;  2FBP A;  4KD5 A;  3LV0 A;  3OEM A;  2ZNT A;  3SER A;  3QAX A;  4UAC A;  1FRP A;  3O6G A;  3EQ1 A;  1JW4 A;  2V93 A;  1SD3 A;  2PVU A;  2Z8F A;  5AA2 D;  3SET A;  1RDZ A;  2RIN A;  1FQC A;  3H3G A;  4P56 A;  4GWX A;  4OVT A;  1N7X A;  1B1X A;  4ELP A;  5CMB A;  4GX6 A;  2D3I A;  3DP8 A;  3RNN A;  4N81 A;  3QIM A;  1KWH A;  1LBC A;  1B4Z A;  1H43 A;  3TAJ A;  3K1P A;  4DXC A;  4AS5 A;  1NV6 A;  2FIX A;  2XXW A;  3CR9 A;  3HV1 A;  3HST A;  4R74 A;  4LON B;  4NF6 A;  3OXN A;  3LBS A;  3KG2 A;  4AS4 A;  1I6A A;  5T3J A;  4OFL A;  3CG3 A;  3O9P A;  1N84 A;  3MVZ A;  3CFZ A;  1P1Q A;  3PV0 E;  3PPP A;  3FAT A;  5DVI A;  2GQ1 A;  4DI4 B;  4N6K A;  5CMM A;  2ZZX A;  3R6U A;  3KC1 A;  1GVC A;  5HBC A;  3K1N A;  3N6U A;  4EQ7 A;  1A8E A;  4MLV A;  1LCF A;  4FE8 A;  4NF0 A;  4MAG A;  1N7W A;  1MM6 A;  3QMF A;  4GIZ A;  4GWW A;  4F3G A;  1ZTY A;  3O97 A;  1OIB A;  3UOR A;  2RCB A;  2THI A;  2O6A A;  2O7I A;  2FYI A;  2VHA A;  4OFJ A;  3W9V A;  4P11 A;  1Q9D A;  2GHB A;  4DIG A;  5BUU A;  4U21 A;  4LQ2 A;  4I40 A;  2QPQ A;  4TQU Q;  1Z7N E;  2F34 A;  4ELO A;  2IEE A;  3MZ1 A;  1B3L A;  4LAT A;  4QSE A;  1LBZ A;  3O29 A;  1MH3 A;  4DCX A;  4KI0 E;  3K6W A;  4G68 B;  2ZYO A;  1LAX A;  2OWT A;  5I59 B;  2R8T A;  3LUY A;  4XIG Q;  2DWH A;  1Y3N A;  3H6V A;  4U2R A;  3S9M C;  1NNK A;  1ZIU A;  4BDQ A;  2V84 A;  3PPR A;  3U92 A;  2DVC A;  3T9V A;  1OVB A;  1SVX B;  2B65 A;  1VDW A;  5TU0 A;  5CMK A;  1DSN A;  4DE8 A;  4JDF A;  4PBH A;  3M3F A;  4G8H A;  5AA3 A;  1TXF A;  4OHN A;  1QW0 A;  2Z23 A;  4QSC A;  3SES A;  5H8H B;  4IB2 A;  4NX1 A;  1P99 A;  5LDZ A;  2HZL A;  3HO7 A;  3K6X A;  1IME A;  1LBX A;  1QGX A;  4RY1 A;  3S9L C;  1NUZ A;  4ZZE A;  4NMY A;  3RLF E;  4ELQ A;  2DWJ A;  3O28 A;  3N5L A;  4F3B A;  3FD3 A;  4PAI A;  5H8F B;  3TQW A;  3T1B A;  4XKQ A;  3V83 A;  4X9T A;  2F97 A;  1MDP 1;  4GXS B;  4YB7 A;  2YJP A;  4ZEB A;  2ZNU A;  2Q2C A;  4R9G A;  5L9S A;  4NF5 A;  5CM6 A;  1QUK A;  1YCJ A;  3PMX A;  4LZ8 A;  1SYI A;  3RGY A;  3EHU A;  4ZEC A;  1LB8 A;  3OO7 A;  2QJE A;  4IR8 A;  4GWO A;  4YZZ A;  3A3U A;  1FPK A;  3EKI A;  2DQV A;  2XXP A;  1MY3 A;  1Y3Q A;  3DLN A;  1AOV A;  4FAJ A;  1TWY A;  1YXI A;  5TP9 A;  5DEX B;  3BFU A;  2QMW A;  1FBE A;  3SEW A;  1P1U A;  3QYT A;  5AA2 A;  4RPN A;  2A5T A;  1B1H A;  5IM2 A;  1NV7 A;  1I69 A;  4H46 A;  4C1T A;  4HCW A;  3U93 A;  1IQ7 A;  3MST A;  4ZEF A;  5ISU A;  3RPL B;  1IXC A;  1LEV A;  1Y4T A;  4IO4 A;  3VV5 A;  2P3N A;  4LZ7 A;  3IJO B;  4OVR A;  4MNC A;  3KEI A;  2WKY A;  2QS4 A;  2Y5L A;  1D9Y A;  3TCF A;  3E4R A;  4GWY A;  1SW2 A;  3OSQ A;  3KJ7 A;  3H6T A;  2F7B A;  2R6G E;  3I3V A;  2DE4 A;  3B50 A;  4X48 A;  4N13 A;  4YB6 A;  2XXI A;  4GL8 A;  1B0L A;  1LST A;  1SW5 A;  1RDX A;  4RK9 A;  3HN0 A;  1XI6 A;  1MS7 A;  2UVH A;  1PC3 A;  2RC9 A;  3CSB A;  2F3B A;  2B4L A;  5ET5 A;  5JK4 A;  4P9K A;  5CBR A;  3VXC A;  2H25 A;  2X7P A;  3ZKK A;  4N17 A;  1PEB A;  2XD3 A;  4P0G A;  1URS A;  4ONY A;  2Q74 A;  4YKI A;  2XX8 A;  1FBG A;  3MBP A;  2I4B A;  4N8Y A;  4XEQ A;  4P47 A;  2QMX A;  2NVU B;  1R6Z A;  4DZ1 A;  1B51 A;  4LA9 A;  1BTJ A;  2DSF A;  2FHY A;  4EUO A;  2OK2 A;  4R6H A;  5IZZ A;  2ZYK A;  4EF2 A;  3PTY A;  1MQJ A;  1VFD A;  4IGT A;  2H4I A;  2Q9T A;  1LBW A;  2VOZ A;  3PD9 A;  3DEL B;  2Y84 A;  4HS7 A;  1UTB B;  3PU5 A;  3CFX A;  4N4U A;  4I3Y A;  5I2N A;  3FJ7 A;  1PDA A;  3RUM A;  2HCA A;  1B3H A;  4OER A;  2XWO A;  4ZEI A;  3HCQ A;  4IY5 A;  4HXV A;  2E1S A;  1SQY A;  3C33 A;  1MY1 A;  2QS2 A;  4O3A A;  2ZYN A;  2YLN A;  2O7U A;  3OD7 A;  1B3E A;  5FHM A;  3VVD A;  4G8M A;  3VLW A;  2OX3 A;  3Q29 A;  1IXH A;  1B4H A;  4YMA A;  3GXA A;  4NTL A;  2F7C A;  4NQ8 A;  2ZYM A;  2V4C A;  3FIR A;  4KFQ A;  1R9Q A;  1OQG A;  4AB5 A;  5CI5 A;  5I2K A;  1JVX A;  1VE4 A;  2VP1 A;  1IXG A;  3MYU A;  1B7Z A;  2UYF A;  2CEX A;  3F11 A;  3E9X A;  3K0V A;  4R75 A;  4GD5 A;  1B46 A;  5M2V A;  3TMG A;  3IOT A;  3T66 A;  2ONR A;  1S50 A;  3VVF A;  3FV2 A;  2XXR A;  3EF7 A;  3K4U A;  3H4Z A;  3SDF A;  2I48 A;  2H99 A;  2ONS A;  4NWC A;  1LB9 A;  3MP6 A;  4Q30 B;  3BKI B;  5K2X A;  4WED A;  4JSD A;  1UTH B;  4XKP A;  1YPN A;  4N6P A;  4DDD A;  4Z7E A;  4ND9 A;  2Y7W A;  3TOD A;  3G7W A;  1FPE A;  3Q26 A;  3G3G A;  5K2Y A;  4X8R A;  3RY3 A;  3TTN A;  2QS3 A;  2V3Q A;  3IX1 A;  4F2O A;  3MQ9 A;  3R7X A;  5ITO A;  4H0W A;  1FPF A;  1JEU A;  3BFT A;  3TFL A;  4G77 A;  4ZE8 A;  4G61 A;  4PE5 B;  2Q8J A;  2NWJ A;  4GBV A;  5I5P A;  2CZI A;  3SEU A;  1FBF A;  3FJM A;  3T9U A;  4PDD A;  1ZJL A;  4QFO A;  2FNC A;  2I0C A;  5KCJ B;  1MY4 A;  3FBP A;  4MMP A;  5I58 A;  4PDH A;  4RJZ A;  4WEP A;  4YIC A;  4OTE A;  1NH8 A;  3IOR A;  3MAM A;  1JW5 A;  4NHB A;  1L5T A;  1M5F A;  2PYY A;  3VVE A;  5IZ3 B;  3CG1 A;  3FXR A;  4G8N A;  1MG1 A;  2DWA A;  1D4N A;  1NV4 A;  3MUQ A;  1HSE A;  2KQZ A;  4XF5 A;  4WKM A;  4IGR A;  1FBP A;  1M5C A;  1NFT A;  1NNF A;  4GF8 A;  1FQA A;  1FPD A;  3ROJ A;  4F3P A;  5L9O A;  5FHN A;  1FTO A;  3V89 B;  1BKA A;  3OO6 A;  2CZH A;  2JJK A;  1GTK A;  1OLA A;  4TLM B;  4FBP A;  1EYK A;  4P0I A;  1K9Y A;  4N91 A;  3MPL A;  4XTC Q;  3O6I A;  4H5G A;  5FTI A;  4H65 A;  4N07 A;  2FVZ A;  3C35 A;  3V5A A;  3VDF A;  1YZ0 A;  4HE1 A;  3C34 A;  2QRY A;  5H8Q B;  4ZS9 A;  4JXI A;  2XX9 A;  2AIX A;  1CNQ A;  1AIV A;  3IK6 B;  3MVY A;  4U4S A;  4YB5 A;  3FV1 A;  1NMU A;  2O1M A;  2Y7I A;  2QVR A;  2OWZ A;  4ZE9 A;  2ZNS A;  1FJ9 A;  1O63 A;  1DCU A;  4P3L A;  4R2B A;  5AE4 A;  5LOM A;  3AXF A;  3G3H A;  2M8C A;  3FXQ A;  1QVS A;  4MNP A;  3RYD A;  1PB8 A;  5H8N A;  1ZBM A;  3OEL A;  5DYH A;  4NF8 A;  3TTL A;  1FQB A;  1O64 A;  1NKX A;  4MLQ A;  5KDT B;  1WOD A;  3CSG A;  1H45 A;  3L6H A;  3IO4 A;  4PAK A;  1FQF A;  4PFU A;  3WAE A;  1R1N A;  2CZL A;  5JTY A;  4YKP A;  3MZB A;  2BJJ X;  5A5X B;  4H8I A;  3USD A;  4EDP A;  3N26 A;  3FVG A;  3FXU A;  1NH7 A;  2OLB A;  3CHG A;  1DPP A;  1EZ9 A;  1Q1K A;  3FZV A;  1DBZ A;  4MNI A;  1SPI A;  1TFD A;  2OJT A;  1B3F A;  4HE0 A;  3CRB A;  2QL3 A;  1XS5 A;  3MP8 A;  5I57 B;  2CMO A; 
#chains in the Genus database with same CATH homology
 1B05 A;  1B2H A;  4OMB A;  4YKJ A;  2ZXT A;  1B5H A;  3MVW A;  4U1Z A;  1RYX A;  4NWD A;  2REJ A;  1ZKB A;  1ZLQ A;  1EZP A;  4FJP A;  3TZA A;  2Y7P A;  2VD2 A;  3OOA A;  3IL1 B;  3VXB A;  1T0K A;  1LAH E;  2DYX A;  1FCK A;  3K6V A;  4RXL A;  1P1O A;  1LCT A;  2OCU A;  3KSX A;  3FJG A;  3KJT A;  4E0X A;  2GHA A;  3QK6 A;  4MFI A;  1JQF A;  3KOS A;  3OMB A;  4EQ9 A;  3MWB A;  3O66 A;  1IIW A;  4POW A;  2DXY A;  3KN8 A;  1H3D A;  2XX7 A;  4RK2 A;  1UIV A;  4THI A;  3C36 A;  2I6E A;  1O7T A;  4I1D A;  4PFT A;  3K6U A;  4IO3 A;  5EYF A;  4K3F A;  5JEI A;  4X1B A;  1S7Y A;  2QSX A;  4U22 A;  1IXI A;  5B70 A;  4NF4 A;  1SW1 A;  1LFH A;  4GOT A;  4BDN A;  3K01 A;  2O51 A;  4MBP A;  3CIJ A;  4UA8 A;  1P1N A;  5AA4 A;  1N0T A;  1QJM A;  2AYS A;  3UP9 A;  1AH5 A;  1F9B A;  2B3B A;  4G4P A;  5I56 B;  3B7D A;  3CFL A;  3M8U A;  3RT8 A;  3KBR A;  4O3C A;  1FTJ A;  1TT1 A;  1LGB C;  2F6G A;  4F19 A;  2O69 A;  3L6G A;  2DS9 A;  1NL5 A;  4BDL A;  1BP5 A;  4NED A;  3TCG A;  1B58 A;  4GLI A;  3PUY E;  3S9N C;  5DVJ A;  4F22 A;  4Z0I A;  5I58 B;  3PMV A;  2PT1 A;  3U1O A;  4PFY A;  4ZDM A;  3IOU A;  4XKR A;  2F7A A;  1Q35 A;  1Y1Z A;  1LFI A;  1OMP A;  1GGG A;  4R6Y A;  3S2V A;  1XVY A;  1M5B A;  1A54 A;  2X7Q A;  1XHY A;  3D4G A;  1DPE A;  5EHS A;  5I84 A;  1YTV A;  3E3K A;  4F29 A;  2XXY A;  3V8X B;  3BBR A;  4KQP A;  1SBP A;  3TUS A;  4ECF A;  4OFO A;  3S9E A;  2XXH A;  5EHM A;  1POY 1;  2Z8E A;  3O6H A;  2XD2 A;  4WXJ A;  3QXM A;  1SI1 A;  2DE2 A;  3S4U A;  1USY E;  4M1V A;  4R2F A;  3IAZ A;  3M3K A;  2NXO A;  4RYA A;  4YAH X;  4BDR A;  1BLF A;  4FOR A;  1QKB A;  4KYS A;  4G2Z A;  4KPT A;  2F36 A;  2HEU A;  3H7M A;  4NF6 B;  1TFA A;  1DTZ A;  3ODB A;  4RNS A;  2GFE A;  4H67 A;  1US5 A;  5I59 A;  4NE4 A;  1QKA A;  1I6Q A;  2DP8 A;  4F3S A;  5J1D A;  3K2D A;  2P2A A;  3MW0 A;  3T93 B;  2Q2A A;  1MXV A;  1EH3 A;  3RPW A;  2NOO A;  4PP0 A;  3JZJ A;  1JEV A;  1MY0 A;  2B3F A;  1FW0 A;  1JW1 A;  5IAI A;  4GL0 A;  4KR5 A;  4EQB A;  1A8F A;  5DT6 A;  3FAS A;  2RKM A;  4QFL A;  4M4G A;  3I5O A;  4F2Q A;  4IY6 A;  3UIF A;  1FQE A;  1SI0 A;  3IB0 A;  1GR2 A;  5H8H A;  3TKD A;  1OLC A;  4QHQ A;  5H8S A;  1A40 A;  5JTY B;  4DCY A;  1N3W A;  4TOZ A;  4DXB A;  1PBP A;  2PMS A;  3E13 X;  1UQW A;  1R9L A;  4EXK A;  3KZG A;  5ELV A;  5H8F A;  4JWX A;  2RC8 A;  3JYR A;  1J1N A;  1JET A;  4F18 A;  2HQ0 A;  1NNP A;  1MQD A;  1N3X A;  1VR5 A;  1B52 A;  2UYE A;  4POX A;  5KZT A;  2RC7 A;  3ZS6 A;  1Y9U A;  2REG A;  4KYD A;  3PPQ A;  3P7I A;  3G3K A;  1US4 A;  3TCH A;  1B0H A;  3KFM A;  1JVY A;  3U8Q A;  2Y7K A;  1FTM A;  3UK4 A;  5DEX A;  3HHF A;  1FTK A;  1QUI A;  3T96 B;  1M5E A;  3G3I A;  4JB7 A;  4IO2 A;  2GRV A;  1A99 A;  4IO7 A;  1MXZ A;  2DOJ A;  2F78 A;  1MQI A;  2XHD A;  1MDQ A;  4JBZ A;  4LZ5 A;  4IO6 A;  4GVO A;  2HXW A;  4I62 A;  5DTB A;  2Z22 A;  2ANJ A;  2PT2 A;  3N94 A;  2OWS A;  3DM0 A;  3IOW A;  1HSJ A;  2V25 A;  4NF5 B;  3RT6 B;  4Q0C A;  2GH9 A;  1CE2 A;  3GZG A;  3GBA A;  3VE1 B;  2KLF A;  3K02 A;  4QFP A;  1B9J A;  1YAE A;  4F31 B;  2V3U A;  4GFR A;  2XXV A;  5TPA A;  3UGW A;  2DWI A;  4QSD A;  5TP9 B;  5AA4 B;  5F7V A;  5L8D A;  2E0S A;  4PQJ A;  2P1S A;  5AA2 B;  4YMB A;  2A5T B;  1D3K A;  2Y7R A;  4ZEK A;  1H76 A;  5IKB A;  1DMB A;  4PFW A;  2G29 A;  5DVF A;  3PPN A;  1IIT A;  3G3F A;  4ESW A;  1LLS A;  5AA1 A;  1S9T A;  3IR1 A;  4EF1 A;  2O68 A;  3TTK A;  4XKN A;  1B3G A;  3N6T A;  2LAO A;  2I58 A;  4X1D A;  3LSF B;  3FVN A;  5L9M A;  2XXQ A;  4U1O A;  1SW4 A;  2F35 A;  2I4C A;  2X26 A;  4KCC A;  2Z8D A;  3SEY A;  1N76 A;  3OO9 A;  3H6U A;  3RQT A;  1UTB A;  1MQH A;  1ZU0 A;  3PUV E;  3SKP A;  4BLA A;  5F1Q A;  1LAG E;  2VGQ A;  4HTG A;  2UVJ A;  3RTW B;  2RF1 A;  1DTG A;  4GQO A;  3ILT B;  4R73 A;  1HSL A;  3IOV A;  4QF9 A;  2I3W A;  3KOT A;  1A55 A;  3TQL A;  2DE3 A;  4OES A;  1URG A;  3PPO A;  1USY H;  4R72 A;  1IEJ A;  4MF3 A;  4LUB A;  1PB9 A;  1RYO A;  3EHS A;  3QUJ A;  2HAV A;  3OO8 A;  3PGF A;  1OVT A;  3TEP A;  3KN3 A;  3H6W A;  4ISU A;  3K1M A;  3VLU A;  4R9F A;  5CC2 A;  3LC8 A;  5FTH A;  3ZSF A;  1AMF A;  3SEX A;  4PET A;  1FTL A;  3O2A A;  4RPO A;  4RA1 A;  3TDJ A;  3U94 A;  4F39 A;  3ZKL A;  2VD3 A;  5I2N B;  4I9D A;  4ELR A;  4YKK A;  2O84 X;  3ECR A;  5CMC A;  1PB7 A;  1EU8 A;  1P1W A;  1UTH A;  3QSL A;  3EHT A;  2R9J A;  3A09 A;  4HCY A;  1A7L A;  4OYV A;  2FA7 A;  1ZMG A;  2UVI A;  2HFB A;  1MXY A;  3FGS A;  4C0R A;  5I2K B;  3Q25 A;  1WDN A;  3JV9 A;  3PMW A;  3T9H B;  4OVJ A;  3G3J A;  3KN7 A;  3PUZ E;  5CBS A;  3OEK A;  4LQ5 A;  1D9V A;  4OXV A;  4JWY A;  4GRK A;  3RTF B;  5KCJ A;  5HPQ A;  4F1Y A;  3I6V A;  1B5I A;  3TTM A;  1Y3P A;  1URD A;  1MM7 A;  2RCA A;  1XVX A;  1MPC A;  2A5S A;  4E0W A;  3B6W A;  1H44 A;  2W7Y A;  1JNF A;  2G93 A;  2AL5 A;  4I8C A;  4GXA A;  2QS1 A;  1NNT A;  1ELJ A;  4L17 A;  2Q89 A;  4MH5 A;  3B6T A;  4OEV A;  3TYH A;  2PX1 A;  3SEV A;  2H98 A;  2IA4 A;  3A3C A;  3LSX A;  3MC2 A;  3LR1 A;  2NUV A;  2XXX A;  3T22 A;  2I3V A;  2HZK A;  3R26 A;  5ICT A;  4G68 C;  3VLV A;  3C31 A;  4QRZ A;  4LP2 B;  3MP1 A;  4FAT A;  4ZZA A;  1QUJ A;  3IO6 A;  2R71 A;  5H8Q A;  2DVZ A;  3UA8 A;  1B5J A;  1RKM A;  1POT A;  3PUW E;  4F1V A;  5B7D A;  2HAU A;  3ONM A;  3THI A;  2ABH A;  1LAF E;  3K00 A;  3HPI A;  2ESN A;  1MH4 A;  1MPB A;  1N04 A;  4U23 A;  3CVG A;  4BDO A;  3MVX A;  1MXU A;  1MY2 A;  2Q88 A;  1II5 A;  5TPA B;  3LSW A;  3PUX E;  1OQH A;  4H5F A;  4DXU A;  3C32 A;  2F6P A;  4AQ4 A;  3UN6 A;  5KDT A;  3OEN A;  3W9W A;  1LBB A;  4QFK A;  1Z7M E;  2DXR A;  3EN3 A;  3C9H A;  2I49 A;  1MXX A;  1MQG A;  2PBW A;  3TPA A;  3WAF A;  5BWJ A;  4OET A;  3DP4 A;  1UIU A;  5ITP A;  2OZZ A;  3HHG A;  1QUL A;  3QUF A;  2F5X A;  4C1U A;  3ILU B;  1B6H A;  4KYE A;  4G68 A;  3FUZ A;  4YU0 A;  2F8D A;  5A5X A;  1EZO A;  1IZ1 A;  2OBG A;  4KCD A;  4H6D A;  3TTR A;  4OWD A;  3B6Q A;  3FVK A;  3C4M A;  2AL4 A;  4XXU A;  3KSJ A;  4FEC A;  4DLD A;  1SDX A;  3GLB A;  1XT8 A;  5I57 A;  1XC1 A;  5H8N B;  2O1L A;  4BDM A;  1VSO A;  3MPK A;  1IUD A;  4NF8 B;  2I0B A;  3H03 A;  3KGC A;  4FEB A;  3CI8 A;  2XXT A;  1WVJ A;  5HM4 B;  4FED A;  2V3T A;  3OSR A;  3RN8 A;  3Q28 A;  4TLL B;  4ZED A;  3FVO A;  1MRP A;  1B7U A;  1MPD A;  3VFJ A;  1I6B A;  4H8J A;  1FQD A;  1B32 A;  2XXU A;  2D21 A;  4OQO A;  1CB6 A;  3TEL A;  2ALU A;  3T9X B;  3EPE A;  4ESX A;  4R6K A;  4EXL A;  3Q27 A;  1VFE A;  2ZMB A;  3MZ9 A;  1LFG A;  3IB1 A;  3IB2 A;  4HW8 A;  3GBB A;  5CRY A;  2D5W A;  4FIM A;  4O3B A;  1BIY A;  1B7H A;  1XOC A;  3W15 C;  1AL3 A;  2P0S A;  1PBQ A;  4AB6 A;  4OEN A;  4OEU A;  3IJX B;  2ONK E;  1GV8 A;  2YPN A;  5FHO A;  1M5D A;  1ANF A;  3D4C A;  2H5Y A;  1B40 A;  4JWO A;  4LVQ A;  1Y20 A;  3PD8 A;  3MJN A;  1SYH A;  4H1X A;  5I56 A;  4Q5T A;  1DOT A;  4QFN A;  2UVG A;  1Y1M A;  4Q8R A;  1ATG A;  1Y4C A;  3H06 B;  5ICQ A;  2H9B A;  3DP6 A;  4IO5 A;  4F1U A;  4JSO A;  3M3L A;  4OZ9 A;  1MXW A;  3U72 A;  4KHZ E;  4U4X A;  2UXA A;  3LSL A;  4NF4 B;  4KD5 A;  3OEM A;  2ZNT A;  3SER A;  3QAX A;  4UAC A;  3O6G A;  3EQ1 A;  1JW4 A;  2V93 A;  1SD3 A;  2PVU A;  2Z8F A;  5AA2 D;  3SET A;  2RIN A;  1FQC A;  3H3G A;  1N7X A;  1B1X A;  4ELP A;  5CMB A;  2D3I A;  3DP8 A;  3RNN A;  3QIM A;  1KWH A;  1LBC A;  1B4Z A;  1H43 A;  3TAJ A;  3K1P A;  4DXC A;  2XXW A;  3CR9 A;  3HV1 A;  3HST A;  4R74 A;  4LON B;  4NF6 A;  3OXN A;  3LBS A;  3KG2 A;  1I6A A;  4OFL A;  3CG3 A;  3O9P A;  1N84 A;  3MVZ A;  3CFZ A;  1P1Q A;  3PV0 E;  3PPP A;  3FAT A;  5DVI A;  5CMM A;  3R6U A;  1GVC A;  5HBC A;  3K1N A;  3N6U A;  4EQ7 A;  1A8E A;  4MLV A;  1LCF A;  4FE8 A;  1N7W A;  1MM6 A;  4GIZ A;  4F3G A;  1ZTY A;  3O97 A;  1OIB A;  3UOR A;  2RCB A;  2THI A;  2O6A A;  2O7I A;  2FYI A;  2VHA A;  4OFJ A;  3W9V A;  4P11 A;  2GHB A;  4DIG A;  5BUU A;  4U21 A;  4LQ2 A;  2QPQ A;  4TQU Q;  1Z7N E;  2F34 A;  4ELO A;  2IEE A;  3MZ1 A;  1B3L A;  4LAT A;  4QSE A;  3O29 A;  1MH3 A;  4DCX A;  4KI0 E;  3K6W A;  4G68 B;  2ZYO A;  1LAX A;  2OWT A;  5I59 B;  3LUY A;  4XIG Q;  2DWH A;  1Y3N A;  3H6V A;  4U2R A;  3S9M C;  1NNK A;  1ZIU A;  4BDQ A;  2V84 A;  3PPR A;  3U92 A;  2DVC A;  3T9V A;  1OVB A;  1SVX B;  2B65 A;  5TU0 A;  5CMK A;  1DSN A;  4DE8 A;  4JDF A;  3M3F A;  4G8H A;  5AA3 A;  1TXF A;  4OHN A;  1QW0 A;  2Z23 A;  4QSC A;  3SES A;  5H8H B;  4IB2 A;  1P99 A;  2HZL A;  3HO7 A;  3K6X A;  3S9L C;  4RY1 A;  4ZZE A;  4NMY A;  3RLF E;  4ELQ A;  2DWJ A;  3O28 A;  3N5L A;  4F3B A;  3FD3 A;  5H8F B;  3TQW A;  4XKQ A;  3V83 A;  4X9T A;  2F97 A;  1MDP 1;  4GXS B;  4YB7 A;  2YJP A;  4ZEB A;  2ZNU A;  2Q2C A;  4R9G A;  5L9S A;  4NF5 A;  5CM6 A;  1QUK A;  1YCJ A;  3PMX A;  4LZ8 A;  1SYI A;  3RGY A;  3EHU A;  4ZEC A;  1LB8 A;  3OO7 A;  2QJE A;  4GWO A;  4YZZ A;  3A3U A;  2DQV A;  2XXP A;  1MY3 A;  1Y3Q A;  3DLN A;  1AOV A;  4FAJ A;  1TWY A;  5TP9 A;  5DEX B;  3BFU A;  2QMW A;  3SEW A;  1P1U A;  3QYT A;  5AA2 A;  4RPN A;  2A5T A;  1B1H A;  1I69 A;  4C1T A;  4HCW A;  3U93 A;  1IQ7 A;  4ZEF A;  5ISU A;  1IXC A;  1Y4T A;  4IO4 A;  3VV5 A;  4LZ7 A;  3IJO B;  3KEI A;  2WKY A;  2QS4 A;  1D9Y A;  3TCF A;  3E4R A;  1SW2 A;  3OSQ A;  3KJ7 A;  3H6T A;  2F7B A;  2R6G E;  3I3V A;  2DE4 A;  4X48 A;  4N13 A;  4YB6 A;  2XXI A;  4GL8 A;  1B0L A;  1LST A;  1SW5 A;  4RK9 A;  3HN0 A;  1MS7 A;  2UVH A;  1PC3 A;  2RC9 A;  3CSB A;  5JK4 A;  5CBR A;  3VXC A;  2H25 A;  2X7P A;  3ZKK A;  1PEB A;  2XD3 A;  4P0G A;  1URS A;  4ONY A;  4YKI A;  2XX8 A;  3MBP A;  2I4B A;  2QMX A;  2NVU B;  1R6Z A;  4DZ1 A;  1B51 A;  4LA9 A;  1BTJ A;  2DSF A;  4EUO A;  2OK2 A;  4R6H A;  2ZYK A;  4EF2 A;  1MQJ A;  1VFD A;  4IGT A;  2H4I A;  2Q9T A;  2VOZ A;  3PD9 A;  3DEL B;  2Y84 A;  4HS7 A;  1UTB B;  3PU5 A;  3CFX A;  5I2N A;  3FJ7 A;  1PDA A;  3RUM A;  2HCA A;  1B3H A;  4OER A;  4ZEI A;  3HCQ A;  4IY5 A;  2E1S A;  1SQY A;  3C33 A;  1MY1 A;  2QS2 A;  4O3A A;  2ZYN A;  2YLN A;  2O7U A;  3OD7 A;  1B3E A;  5FHM A;  3VVD A;  4G8M A;  3VLW A;  3Q29 A;  1IXH A;  1B4H A;  4YMA A;  3GXA A;  4NTL A;  2F7C A;  2ZYM A;  3FIR A;  4KFQ A;  1R9Q A;  1OQG A;  4AB5 A;  5CI5 A;  5I2K A;  1JVX A;  1VE4 A;  2VP1 A;  1IXG A;  1B7Z A;  2UYF A;  3F11 A;  3E9X A;  3K0V A;  4R75 A;  4GD5 A;  1B46 A;  5M2V A;  3TMG A;  3IOT A;  3T66 A;  2ONR A;  1S50 A;  3VVF A;  3FV2 A;  2XXR A;  3EF7 A;  3K4U A;  3H4Z A;  3SDF A;  2I48 A;  2H99 A;  2ONS A;  4NWC A;  1LB9 A;  3MP6 A;  4Q30 B;  3BKI B;  5K2X A;  4WED A;  4JSD A;  1UTH B;  4XKP A;  1YPN A;  4N6P A;  4DDD A;  4Z7E A;  4ND9 A;  2Y7W A;  3TOD A;  3G7W A;  3Q26 A;  3G3G A;  5K2Y A;  3RY3 A;  3TTN A;  2QS3 A;  2V3Q A;  3IX1 A;  4F2O A;  3MQ9 A;  3R7X A;  5ITO A;  4H0W A;  1JEU A;  3BFT A;  3TFL A;  4G77 A;  4ZE8 A;  4PE5 B;  2Q8J A;  2NWJ A;  3SEU A;  3FJM A;  3T9U A;  1ZJL A;  4QFO A;  2FNC A;  2I0C A;  5KCJ B;  1MY4 A;  5I58 A;  4RJZ A;  4WEP A;  4YIC A;  4OTE A;  1NH8 A;  3IOR A;  3MAM A;  1JW5 A;  1L5T A;  1M5F A;  2PYY A;  3VVE A;  3CG1 A;  3FXR A;  4G8N A;  1MG1 A;  2DWA A;  1D4N A;  3MUQ A;  1HSE A;  4WKM A;  4IGR A;  1M5C A;  1NFT A;  1NNF A;  4GF8 A;  1FQA A;  4F3P A;  5L9O A;  5FHN A;  1FTO A;  3V89 B;  1BKA A;  3OO6 A;  1GTK A;  1OLA A;  4TLM B;  4P0I A;  3MPL A;  4XTC Q;  3O6I A;  4H5G A;  5FTI A;  4H65 A;  4N07 A;  3C35 A;  3V5A A;  3VDF A;  3C34 A;  2QRY A;  5H8Q B;  4ZS9 A;  4JXI A;  2XX9 A;  2AIX A;  1AIV A;  3IK6 B;  3MVY A;  4U4S A;  4YB5 A;  3FV1 A;  1NMU A;  2O1M A;  2Y7I A;  4ZE9 A;  2ZNS A;  1O63 A;  4R2B A;  5AE4 A;  5LOM A;  3AXF A;  3G3H A;  2M8C A;  3FXQ A;  1QVS A;  1PB8 A;  5H8N A;  1ZBM A;  3OEL A;  5DYH A;  4NF8 A;  3TTL A;  1FQB A;  1O64 A;  1NKX A;  4MLQ A;  5KDT B;  1WOD A;  3CSG A;  1H45 A;  3L6H A;  3IO4 A;  1FQF A;  4PFU A;  3WAE A;  1R1N A;  2CZL A;  5JTY A;  4YKP A;  3MZB A;  2BJJ X;  5A5X B;  4H8I A;  3USD A;  4EDP A;  3N26 A;  3FVG A;  3FXU A;  1NH7 A;  2OLB A;  1DPP A;  1EZ9 A;  1Q1K A;  3FZV A;  1TFD A;  2OJT A;  1B3F A;  3CRB A;  2QL3 A;  1XS5 A;  3MP8 A;  5I57 B;  2CMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...