3TTKA

Crystal structure of apo-spud
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
340
structure length
340
Chain Sequence
DNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Polyamine transport protein
publication title Structural Basis of Substrate Binding Specificity Revealed by the Crystal Structures of Polyamine Receptors SpuD and SpuE from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 116
structure length 340
sequence length 340
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttkA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttkA02
5AA2A 5I58A 4X9TA 3H3GA 4U4XA 4GOTA 3OO7A 1ZLQA 1BP5A 1LAXA 2XX9A 3G3KA 1HSJA 5H8SA 2I3WA 1LB9A 4YB6A 4JBZA 1IQ7A 4KCCA 2GHAA 2O84X 1B9JA 3RTWB 2HQ0A 3SESA 2H5YA 1GGGA 1II5A 3VE1B 2VHAA 3S2VA 3FASA 2XXPA 2O69A 4ZEDA 3OD7A 2NVUB 3V5AA 5TU0A 3CIJA 3PPOA 3BBRA 3EN3A 4OVJA 3G3FA 2NOOA 2F7BA 2DYXA 3MP8A 1D3KA 4RY1A 5AA4A 3HO7A 2DXRA 5CMKA 1MM7A 2Q88A 3EPEA 5AA1A 3T96B 2VD2A 2RF1A 3LSWA 2ZNSA 2F8DA 1M5EA 3KOTA 4GVOA 2OWSA 3FATA 3IORA 1WODA 1MY2A 3KSXA 4F31B 4MBPA 3V8XB 2W7YA 1HSLA 1ZMGA 2WKYA 4DXBA 4GIZA 4RYAA 5FTIA 4YMBA 3TCHA 2PYYA 3KN3A 3TAJA 5H8NA 3TQWA 3T93B 4FEBA 3VFJA 1Y3QA 3D4CA 4TOZA 3KSJA 4H65A 1O64A 1FTKA 3C31A 2M8CA 3MC2A 1A7LA 4H8IA 3IX1A 4RPNA 1NNKA 3MP6A 5I57A 2XX7A 2F7CA 4R9GA 5I2KB 1JNFA 3SEVA 1B1HA 1SYHA 1N7WA 4LQ2A 5H8QB 1MXUA 3KBRA 3M8UA 2Y7PA 1LB8A 4NF6B 3TFLA 4IGTA 1B5IA 1MS7A 3S9MC 2H98A 1IUDA 5AA2B 5I58B 3HSTA 4MH5A 5FTHA 3FVNA 2Q2CA 1ZIUA 5ICTA 1IXIA 5DVJA 5EHSA 5TPAB 1SQYA 3C34A 3Q29A 1TFDA 3FD3A 1XVYA 2P0SA 2Y7WA 4RXLA 2YPNA 1WVJA 5HM4B 3TZAA 2HZLA 1CE2A 1MPCA 3FJMA 4ZZAA 3M3KA 2O7IA 2ZXTA 3C9HA 3OO8A 3FV2A 4DZ1A 4F2OA 2GRVA 4R9FA 2P2AA 2VGQA 4ONYA 4WKMA 3ZKKA 1TWYA 5ITOA 4YMAA 2F34A 2R71A 3G3GA 3O6GA 4AQ4A 4QF9A 3QUJA 5AA4B 1I6BA 1N76A 4O3AA 3H6WA 4WEDA 3O9PA 1A54A 4ELQA 2DWIA 2HCAA 1UTHB 1ATGA 1POY1 1DPEA 4U2RA 3IB1A 1IZ1A 3PUVE 5CMMA 2CMOA 1UTBA 4F3PA 1B3LA 3FGSA 3OOAA 4EQBA 5J1DA 3TODA 1T0KA 1FCKA 3MZ9A 1US4A 4F1UA 4Q30B 1JW1A 3SEXA 4KI0E 2HEUA 1JVYA 5CMCA 3KJTA 4IO6A 1JEUA 2HXWA 4F1VA 4G68C 4LUBA 1LFIA 5H8NB 4C1UA 3MQ9A 3LSLA 3S9EA 5DT6A 1MY3A 1IXHA 3QSLA 3USDA 3VXBA 3VV5A 3K1NA 2GHBA 3VVEA 4ZE9A 2XXTA 1TT1A 5ELVA 3HV1A 3GLBA 4HS7A 1AIVA 4FEDA 1B5HA 4U22A 1MPBA 2B3FA 3N94A 3LUYA 5I57B 2I58A 4JWXA 2G93A 3TQLA 3CFXA 3UK4A 4QFNA 1PDAA 4F3BA 1DPPA 3K00A 5JEIA 4NF8A 2I49A 1OMPA 2RC7A 4ND9A 2HFBA 2IEEA 3CI8A 3G3HA 3K6XA 3MPLA 1B4ZA 3OO9A 4AB6A 1ANFA 2DWAA 3IOWA 1B6HA 3ILUB 3K1PA 3C33A 4JXIA 3Q27A 1D9YA 2RINA 4QFPA 4I62A 1MXYA 3TUSA 3V83A 3R7XA 2AL5A 1RYXA 3O97A 1B51A 5H8HA 4OQOA 2Z22A 1EH3A 4H1XA 1XHYA 1AL3A 2A5TA 4NF4A 3O28A 2ABHA 3SERA 1UIUA 2DE3A 3SETA 2ANJA 1R6ZA 2Y7RA 4FIMA 3Q28A 2O1LA 4O3CA 1MH3A 3MVYA 1MQDA 2PVUA 2XXRA 3L6GA 1FQBA 1P1QA 1LBCA 3H6VA 3WAEA 4YB5A 1B7UA 1NFTA 1UIVA 1Q35A 3UP9A 4GXAA 1IITA 2P1SA 3PUYE 1QVSA 4KHZE 2O51A 5CBSA 1H3DA 4U23A 3W15C 4XKRA 1M5BA 3LSXA 3TTLA 2H99A 3MJNA 3CRBA 5AE4A 2FYIA 1GTKA 3SKPA 1VFEA 4TLLB 1OIBA 4P0IA 4BDLA 5JK4A 4X1BA 2DSFA 2DE4A 3PPPA 3RQTA 3MUQA 1P1NA 4TQUQ 3TYHA 2X26A 1SDXA 1VSOA 2QSXA 4GD5A 4NWDA 1QULA 1BTJA 5L9SA 4OHNA 2I48A 2ZYNA 2I4CA 1NH7A 1IXCA 3PU5A 4KPTA 3HHFA 4GWOA 1MQHA 3Q26A 4KYEA 1POTA 3C36A 5H8QA 3VXCA 3A3UA 4HTGA 3LC8A 4FECA 2UVIA 2XX8A 4R2FA 4IO7A 1I6QA 5JTYA 1LGBC 1R9QA 2Z8FA 4PP0A 1MQJA 3OEKA 3HHGA 2F78A 3OXNA 2RKMA 4OEUA 3DELB 1H45A 4NF8B 2ZNTA 4QFOA 4R72A 3DP4A 5TPAA 2REJA 4ISUA 3IAZA 3IO4A 3FIRA 5AA3A 3K01A 5AA2D 3RNNA 1FTMA 5TP9A 3K1MA 3TEPA 2OZZA 5H8HB 3K2DA 4WEPA 3RY3A 2XXIA 2I4BA 2Y7KA 4PFTA 3CFLA 2A5TB 4QHQA 3DP6A 4NF4B 4N07A 2QPQA 4POWA 3CG3A 2ONKE 3K6WA 1O7TA 5I2NA 4H8JA 3MBPA 3O2AA 3AXFA 1NL5A 3PUZE 3FVKA 4R74A 1A8EA 4YKIA 2B3BA 3O66A 4ELRA 3C32A 1UTHA 3PUWE 4KCDA 3IO6A 1QKBA 3TCGA 4KYSA 3RTFB 5LOMA 4BDQA 2DS9A 2YLNA 1URSA 3VVFA 3HPIA 3A3CA 3MVZA 3WAFA 4PFUA 4ZZEA 1MDP1 3G3JA 2Y7IA 1QW0A 3DM0A 2DVZA 3PPQA 3F11A 3IOTA 4R6YA 4HCYA 3VVDA 1SW2A 3MZBA 1EZOA 3S9NC 3S9LC 1NNFA 5DVIA 1NNTA 2THIA 1NH8A 4U1OA 3RN8A 4H0WA 4DXCA 3K02A 1XC1A 4EXLA 1VFDA 1JVXA 3BFTA 2DVCA 1B1XA 1B2HA 4G4PA 1MG1A 2CZLA 4R6KA 3QIMA 1Y4TA 3BKIB 4BDMA 1URDA 2UVJA 3PD9A 3V89B 4NF5A 5IKBA 1LAGE 4KQPA 5DEXB 4BDRA 4R75A 4BDOA 1QUJA 2Z8EA 1B0LA 4IY6A 1GV8A 5F7VA 3SEWA 2AL4A 2A5SA 5JTYB 1Y3PA 2Q2AA 4RK9A 4G68A 3U93A 1SVXB 1SYIA 4LQ5A 3CVGA 3H4ZA 3KEIA 5L8DA 1QUKA 1B3FA 1VR5A 1N84A 4OMBA 2O6AA 1B46A 1H76A 4DCYA 4MLVA 5L9MA 4EDPA 2ZNUA 5TP9B 4DDDA 2QMXA 1N04A 3IR1A 2XXHA 2RCBA 3L6HA 3OSQA 1B3EA 2ZYOA 1B3HA 1LCTA 3KN7A 1PEBA 4ZEKA 5K2YA 1NMUA 4H67A 3PUXE 4OXVA 3T9XB 5I2NB 4NEDA 2H9BA 3I5OA 1YPNA 3N5LA 1QKAA 4EXKA 4UA8A 1LSTA 2F35A 4LZ7A 2V84A 4G77A 3UN6A 4HCWA 5HPQA 4NMYA 4XTCQ 1MRPA 2E1SA 3PMVA 3T66A 2XXQA 1D9VA 1S7YA 3HCQA 1B5JA 3UIFA 4C0RA 2OLBA 3HN0A 1YAEA 3T22A 4EF2A 1SI1A 3PMWA 4GL0A 3EHSA 4K3FA 1IIWA 1OQGA 5L9OA 2UYEA 4NWCA 1Y3NA 3T9UA 2I0BA 2V3TA 3O6HA 1OVTA 4F22A 2V3QA 4F3GA 4IO3A 1LFHA 3TTRA 3Q25A 3IB2A 1MY1A 1ZKBA 1FQEA 1LBBA 4ZE8A 2HAVA 2H4IA 4NF5B 5IAIA 1SD3A 3ODBA 4FATA 3ONMA 4YICA 2NXOA 3R26A 2DWJA 2PMSA 2QL3A 5DYHA 4ESWA 3TKDA 3E9XA 4JSDA 4G68B 2I6EA 3O29A 5KDTA 4P11A 3N6UA 4JSOA 1BIYA 2ESNA 4QFKA 4C1TA 1SW1A 1M5CA 1MPDA 1SW5A 2QS1A 2UVGA 3H06B 4MLQA 2V93A 4OETA 2XXXA 4PFYA 3M3LA 4N6PA 1FQCA 2AIXA 3JZJA 3U94A 2D21A 4EQ9A 4OZ9A 3DP8A 2QS2A 3TDJA 3FV1A 1CB6A 1UQWA 5EHMA 3KOSA 1Y1ZA 3SDFA 4PE5B 2F7AA 1B0HA 1O63A 5B70A 4RK2A 2R9JA 3RT6B 3KG2A 1JW5A 4ELOA 4LATA 1DMBA 3PMXA 5I56A 1OVBA 3FJ7A 3KZGA 4H6DA 2F6PA 1LCFA 3DLNA 1FQDA 2D3IA 3I3VA 3RT8A 4ESXA 1R1NA 5FHNA 4R2BA 3OENA 2PBWA 4LVQA 2Q9TA 4GRKA 4R6HA 1N0TA 2BJJX 4OFLA 4ELPA 1I6AA 2UVHA 1FQAA 3EQ1A 5CC2A 1XVXA 2QS4A 1Y4CA 2ZYKA 4N13A 3THIA 4X1DA 3BFUA 2AYSA 3R6UA 5DEXA 4XKQA 3EHUA 1JEVA 4KFQA 2UXAA 2Q8JA 4Q8RA 3TTNA 3OO6A 5FHOA 3FJGA 4Z0IA 1B7ZA 1A99A 2E0SA 4OERA 4YB7A 4R73A 3GZGA 3TPAA 5ICQA 3KN8A 1I69A 5K2XA 4G8NA 1Y1MA 4YU0A 1XT8A 4AB5A 1PB7A 4DIGA 5I59A 4LA9A 3B6WA 4DE8A 5I84A 4I9DA 4RPOA 2H25A 1PC3A 3TTMA 3N6TA 2VD3A 1AH5A 4JDFA 3ZKLA 4Q5TA 4MFIA 5DVFA 2NWJA 1SW4A 5KDTB 1N3XA 4F19A 5M2VA 3SEYA 5CI5A 5A5XA 3TELA 4RNSA 4PQJA 1IXGA 2OJTA 3K0VA 5CRYA 3JV9A 1M5FA 1PB9A 2PX1A 1FTLA 1QJMA 3RPWA 3UA8A 2ONRA 2XXUA 3K6UA 4OWDA 5ISUA 1AMFA 3RLFE 2I0CA 2Q89A 1B58A 1SBPA 2Z8DA 4LZ5A 1ELJA 3KFMA 3TTKA 3QK6A 3FUZA 4H5FA 2RC9A 1B3GA 2VOZA 1P1WA 4OTEA 4E0WA 1AOVA 3W9WA 3MVXA 4FAJA 1XS5A 5I56B 2HZKA 3GBAA 4GLIA 2IA4A 4X48A 1RKMA 1LAFE 2KLFA 4H5GA 4EQ7A 1YTVA 3T9VA 3IJXB 1H43A 3VDFA 4DLDA 1OLAA 4MF3A 3CFZA 2F97A 2RC8A 1EU8A 2O1MA 1USYE 1P1OA 2ZMBA 3U1OA 4I8CA 1KWHA 4ZDMA 2ALUA 5CBRA 3E4RA 3GXAA 1YCJA 1MM6A 3PD8A 1MY4A 2OWTA 2R6GE 4I1DA 3PPRA 3I6VA 4RA1A 1XOCA 3VLWA 3P7IA 1FTJA 4LZ8A 3RGYA 4PFWA 5BWJA 2DWHA 1DTZA 3O6IA 1ZU0A 4Z7EA 2XXYA 1FQFA 1DSNA 1MXVA 3FZVA 2V25A 1US5A 4EUOA 4BLAA 3ECRA 5B7DA 1D4NA 4NE4A 1NKXA 3GBBA 1BLFA 1A55A 2XD3A 4YZZA 5I59B 3UORA 4QFLA 4ZECA 3KJ7A 4F18A 4OFJA 3IJOB 3MP1A 4EF1A 3E3KA 1MQIA 3OMBA 3LBSA 3IB0A 4GXSB 1A8FA 4UACA 4XIGQ 3S4UA 4BDNA 4XKPA 2OBGA 3FVOA 4YKJA 3H6UA 1H44A 5HBCA 2LAOA 1P1UA 2OCUA 4FE8A 3C35A 5A5XB 1LFGA 1FTOA 1MY0A 4PETA 3H03A 5KCJA 2GFEA 3OEMA 2XXWA 3W9VA 2D5WA 3OELA 3CSBA 4QSEA 3QUFA 3QYTA 3U8QA 2FNCA 4IO5A 1Z7NE 2GH9A 2RCAA 4QRZA 5FHMA 3UGWA 4TLMB 1OLCA 3MPKA 2HAUA 1Y9UA 3PGFA 1ZBMA 4JWOA 3KGCA 4L17A 1WDNA 1JETA 4KYDA 1NNPA 2DP8A 1MXWA 1B32A 2NUVA 2PT2A 2REGA 1J1NA 3MWBA 1N3WA 1Z7ME 4ZS9A 3SEUA 4ECFA 4M1VA 2DOJA 3C4MA 1RYOA 2X7PA 1MH4A 3N26A 4O3BA 3ZSFA 1JW4A 2XXVA 3RUMA 4YAHX 3CSGA 4OEVA 4IB2A 3IL1B 1URGA 4P0GA 2F5XA 4WXJA 4OENA 3B6TA 1IEJA 3B6QA 1GVCA 3FXQA 1TXFA 2QS3A 5H8FA 4F3SA 2X7QA 4F39A 5KZTA 4IO4A 4F2QA 3ZS6A 2ONSA 1LAHE 1EZPA 3TCFA 3QXMA 5F1QA 4U21A 3IK6B 1N7XA 1MXZA 4M4GA 3JYRA 4KD5A 3U72A 1MQGA 4LP2B 4GQOA 3VLUA 4XKNA 4OFOA 2UYFA 2QMWA 5BUUA 3A09A 3E13X 4POXA 4Q0CA 1QUIA 3PPNA 4F29A 4GL8A 3CR9A 1F9BA 3T9HB 1VE4A 2Y84A 4YKPA 4LONB 4KR5A 2PT1A 5CMBA 1DTGA 1B4HA 4G2ZA 3K4UA 4FORA 4IGRA 1JQFA 1MDQA 1ZTYA 3LSFB 2DE2A 4U4SA 3K6VA 4E0XA 4HW8A 1MXXA 1B7HA 3CG1A 4IO2A 4DXUA 5DTBA 1PB8A 3G3IA 1B52A 4F1YA 3VLVA 2OK2A 2V3UA 1DOTA 5ITPA 2B65A 3QAXA 1LLSA 3LR1A 2VP1A 5KCJB 4DCXA 3TMGA 4OESA 2XD2A 4ZEBA 3MZ1A 1EZ9A 1L5TA 3MVWA 4QSDA 4FJPA 4XXUA 2QRYA 2FA7A 4QSCA 5CM6A 3H7MA 1B05A 3M3FA 2F6GA 3EF7A 4IY5A 4GF8A 2ZYMA 2O7UA 3MAMA 1B40A 4NTLA 1A40A 2G29A 3FVGA 3OSRA 1OQHA 3B7DA 2Z23A 2YJPA 1S9TA 1FW0A 3IOVA 3EHTA 3H6TA 1UTBB 4JWYA 2DQVA 4YKKA 4GFRA 2O68A 1ZJLA 3D4GA 4U1ZA 4ZEFA 4G8HA 3ILTB 2QJEA 1SI0A 1GR2A 2DXYA 3PV0E 4RJZA 3G7WA 2I3VA 4G8MA 4JB7A 1Q1KA 1PBPA 5H8FB 1HSEA 1USYH 1PBQA 5I2KA 5EYFA 1R9LA 2F36A 1TFAA 1M5DA 4ZEIA 3FXRA 3IOUA 1BKAA 1Y20A 3MW0A 3U92A 4NF6A 4OYVA 4THIA 1P99A 1S50A 2XHDA 3FXUA
chains in the Genus database with same CATH superfamily
5AA2A 5I58A 4X9TA 3H3GA 4NX1A 4U4XA 4O7MA 4GOTA 3OO7A 2R8TA 1ZLQA 1BP5A 1LAXA 1EYIA 2XX9A 3G3KA 1HSJA 1NV5A 5H8SA 5I5PA 2I3WA 1LB9A 4YB6A 4JBZA 1IQ7A 4KCCA 2GHAA 1LBYA 2O84X 1B9JA 3RTWB 2HQ0A 3SESA 2H5YA 1GGGA 1II5A 4OVTA 3VE1B 1FBEA 2VHAA 3S2VA 3FASA 1FBHA 2XXPA 4NG7A 2WX9A 2O69A 4ZEDA 3OD7A 2NVUB 3V5AA 5TU0A 3CIJA 2L5VA 3PPOA 3BBRA 3EN3A 4OVJA 3G3FA 3NOHA 2NOOA 2F7BA 2DYXA 4PFRA 3MP8A 1D3KA 4RY1A 5AA4A 3HO7A 2DXRA 1VDWA 5CMKA 3E78A 1MM7A 2Q88A 3EPEA 5AA1A 3T96B 1AWBA 2VD2A 3ROJA 2RF1A 4MEVA 3LSWA 2ZNSA 4QXDA 2F8DA 4I3EA 1M5EA 3E79A 3KOTA 4GVOA 2OWSA 3FATA 3IORA 1WODA 1MY2A 1FBPA 3KSXA 4F31B 4MBPA 3V8XB 2W7YA 1HSLA 1ZMGA 2WKYA 4DXBA 4GIZA 4RYAA 5FTIA 4YMBA 3TCHA 2PYYA 4XFEA 3KN3A 3TAJA 5H8NA 3TQWA 3T93B 4FEBA 3VFJA 1Y3QA 3D4CA 4GWYA 4GX6A 2P3VA 4TOZA 3KSJA 4H65A 1O64A 1FTKA 3C31A 2M8CA 3MC2A 1A7LA 4AS5A 4H8IA 3IX1A 2MKZA 4RPNA 1NNKA 3MP6A 5I57A 2XX7A 2F7CA 4R9GA 1NV6A 3KC1A 5I2KB 4UABA 1JNFA 4KXPA 3SEVA 1B1HA 3BIHA 1SYHA 1N7WA 4LQ2A 5H8QB 1MXUA 3KBRA 3M8UA 2Y7PA 1LB8A 4NF6B 3TFLA 4IGTA 1B5IA 1MS7A 3S9MC 2H98A 1IMEA 1IUDA 5AA2B 5I58B 4OANA 3HSTA 4MH5A 5FTHA 3FVNA 5EQAA 2B4LA 2Q2CA 1ZIUA 2XWOA 5ESYA 5ICTA 5A5LA 1IXIA 5ET5A 5DVJA 5EHSA 5TPAB 1SQYA 3C34A 3Q29A 1TFDA 3FD3A 1XVYA 2P0SA 2Y7WA 4RXLA 2YPNA 1WVJA 5HM4B 5IZZA 3TZAA 2HZLA 1CE2A 1MPCA 3FJMA 4ZZAA 1FBDA 3M3KA 2O7IA 2ZXTA 3C9HA 3OO8A 2CZKA 3FV2A 4H45A 4DZ1A 4F2OA 1NUXA 2GRVA 4R9FA 2P2AA 2VGQA 4ONYA 4WKMA 3ZKKA 1TWYA 5ITOA 1IMCA 1NI9A 4YMAA 2F34A 2R71A 3G3GA 3O6GA 4AQ4A 4QF9A 5I7IA 3QUJA 5AA4B 1I6BA 1N76A 4P1EA 4O3AA 3H6WA 4WEDA 3O9PA 1A54A 4ELQA 2DWIA 2HCAA 1UTHB 1ATGA 1POY1 1DPEA 4U2RA 3IB1A 1IZ1A 3PUVE 5CMMA 2CMOA 1UTBA 4PTKA 4F3PA 2GQ1A 1B3LA 3FGSA 3OOAA 4EQBA 1LBXA 5J1DA 3TODA 1T0KA 1FCKA 3MZ9A 1US4A 4F1UA 4Q30B 1JW1A 2ZZWA 3SEXA 4KI0E 2HEUA 2XWVA 1JVYA 5CMCA 4PFBA 3KJTA 2PFYA 4IO6A 1JEUA 2HXWA 4F1VA 4O8MA 5ET8A 4G68C 1RDXA 4LUBA 1LFIA 5H8NB 4C1UA 3MQ9A 3LSLA 3S9EA 5DT6A 3A29A 1MY3A 1IXHA 3QSLA 3USDA 3VXBA 3VV5A 3K1NA 2GHBA 3VVEA 4ZE9A 2XXTA 5LTCA 1TT1A 5ELVA 3HV1A 3GLBA 4DI4B 2DDKA 4HS7A 1AIVA 4FEDA 1B5HA 5F24A 4U22A 1MPBA 2B3FA 3N94A 3LUYA 5I57B 2I58A 4JWXA 2G93A 3TQLA 3CFXA 3UK4A 4QFNA 1PDAA 4F3BA 1DPPA 3K00A 5JEIA 4NF8A 2I49A 1OMPA 1FSAA 2RC7A 4PAFA 4ND9A 2HFBA 2IEEA 3CI8A 3G3HA 3K6XA 3MPLA 1B4ZA 3OO9A 4AB6A 1ANFA 2DWAA 3IOWA 4P1LA 2OX3A 3RPLB 1B6HA 3ILUB 3K1PA 3C33A 4JXIA 3Q27A 1D9YA 2RINA 4QFPA 4I62A 1MXYA 3TUSA 3V83A 3D1RA 3R7XA 2AL5A 2QVVA 1RYXA 3O97A 1B51A 5H8HA 4OQOA 2Z22A 1EH3A 2JJKA 4H1XA 4G61A 1XHYA 2QVRA 4JVDA 4MNPA 4GWZA 4MMPA 1AL3A 2A5TA 1FPGA 4NF4A 3O28A 2ABHA 2HHMA 3SERA 1UIUA 2DE3A 3SETA 2ANJA 1R6ZA 2Y7RA 1CNQA 4FIMA 3Q28A 2KQZA 2O1LA 4O3CA 1MH3A 3MVYA 1LBWA 1MQDA 2PVUA 4PC9A 2XXRA 3L6GA 3FBPA 1FQBA 1P1QA 1LBCA 3H6VA 3WAEA 2HXRA 4YB5A 1B7UA 1NFTA 1UIVA 1Q35A 3UP9A 4GXAA 1IITA 2P1SA 4X04A 3PUYE 1QVSA 1FBGA 4KHZE 2O51A 5CBSA 1H3DA 4U23A 4GWWA 3W15C 4XKRA 1M5BA 3LSXA 3TTLA 1QGXA 2H99A 3MJNA 3CRBA 5AE4A 1JP4A 2FYIA 1GTKA 3SKPA 1VFEA 4TLLB 1OIBA 4P0IA 4BDLA 5JK4A 4X1BA 4MNIA 2DSFA 1RDYA 2DE4A 3PPPA 3RQTA 3MUQA 1P1NA 5DW8A 4TQUQ 3TYHA 2X26A 1SDXA 4LN5A 1VSOA 2QSXA 3QMFA 4GD5A 4MJOA 4NWDA 1QULA 1BTJA 1RDZA 5L9SA 2WBBA 2WBDA 4OHNA 4H46A 2I48A 2ZYNA 2I4CA 1NH7A 1IXCA 3PU5A 4KPTA 3HHFA 4GWOA 1MQHA 3Q26A 4O94A 2CZHA 4KYEA 1KA1A 1POTA 3C36A 5H8QA 3VXCA 3A3UA 4HTGA 3LC8A 4FECA 2UVIA 3LV0A 1XI6A 2XX8A 4R2FA 4IO7A 1NUZA 1I6QA 5JTYA 1LGBC 1R9QA 2Z8FA 4PP0A 1MQJA 3OEKA 3HHGA 4PAKA 2F78A 3OXNA 2RKMA 4OEUA 3DELB 2FIEA 1H45A 4NF8B 1FPKA 2ZNTA 5ET7A 4QFOA 4R72A 3DP4A 5TPAA 2REJA 4ISUA 3CHGA 3IAZA 4MCOA 3IO4A 3FIRA 2ZZXA 2FBPA 4IR8A 5AA3A 3K01A 5AA2D 3RNNA 1FTMA 5TP9A 3K1MA 3TEPA 1FTAA 2OZZA 5H8HB 3K2DA 4WEPA 3RY3A 2XXIA 4GX3A 2I4BA 4OA4A 2Y7KA 4PFTA 3CFLA 2A5TB 4QHQA 3DP6A 4NF4B 4N07A 4GBVA 2QPQA 4POWA 3CG3A 2ONKE 3K6WA 1O7TA 5I2NA 4H8JA 3KC0A 3MBPA 3O2AA 4MIJA 3AXFA 1NL5A 3PUZE 3FVKA 4R74A 1EYKA 1A8EA 4YKIA 2B3BA 3O66A 4ELRA 3C32A 1UTHA 3PUWE 4KCDA 3IO6A 1QKBA 3TCGA 4KYSA 3RTFB 5LOMA 4BDQA 2DS9A 2YLNA 1URSA 4MAGA 3VVFA 1IMAA 3GYYA 3HPIA 3A3CA 3MVZA 3WAFA 5ET6A 4PFUA 1YYZA 4ZZEA 1MDP1 3G3JA 2Y7IA 4PF6A 1QW0A 3DM0A 2DVZA 4N15A 3PPQA 3F11A 3IOTA 4R6YA 4HCYA 3VVDA 1FBFA 1SW2A 3MZBA 1EZOA 3S9NC 5EYGA 3S9LC 1NNFA 5DVIA 1NNTA 2THIA 1NH8A 4U1OA 3RN8A 4H0WA 4DXCA 3K02A 2QFLA 1XC1A 4EXLA 1VFDA 1JVXA 3BFTA 2DVCA 1B1XA 1DK4A 1B2HA 4G4PA 4R6KA 1MG1A 2CZLA 4PCDA 1NV2A 3QIMA 1FJ6A 2WEFA 1Y4TA 3BKIB 4BDMA 1URDA 2UVJA 2XXKA 3PD9A 3V89B 4NF5A 5IKBA 1LAGE 4KQPA 5DEXB 4BDRA 4R75A 3B8BA 4BDOA 1QUJA 2Z8EA 3RPLA 1B0LA 4IY6A 1FPDA 1GV8A 5F7VA 3SEWA 2AL4A 2A5SA 1Q9DA 5JTYB 1Y3PA 2Q2AA 4RK9A 4G68A 4OVPA 1SVXB 1FBCA 3U93A 1SYIA 4OVRA 4LQ5A 3CVGA 3H4ZA 3KEIA 5L8DA 1QUKA 2CZIA 1DCUA 1B3FA 5LDZA 1VR5A 2V4CA 1N84A 4OMBA 2O6AA 1B46A 2XWIA 5T3JA 1H76A 4NQ8A 4DCYA 4MLVA 2CEXA 5L9MA 3FXBA 4EDPA 2ZNUA 5TP9B 4DDDA 2QMXA 1N04A 3IR1A 2XXHA 1FPJA 2RCBA 3L6HA 5IZ3A 1KZ8A 3OSQA 1B3EA 2ZYOA 1B3HA 1NUWA 1LCTA 3KN7A 4QBAA 1PEBA 4ZEKA 5K2YA 1NMUA 4H67A 3PUXE 4OXVA 3T9XB 4FBPA 5I2NB 4NEDA 2H9BA 3I5OA 1YPNA 3N5LA 1QKAA 2F3BA 4EXKA 4UA8A 1LSTA 1G0IA 2F35A 4LZ7A 2V84A 4G77A 3UN6A 4HCWA 5HPQA 4NMYA 4XTCQ 4PF8A 1MRPA 2E1SA 3PMVA 3T66A 2XXQA 1D9VA 1S7YA 3HCQA 1B5JA 3UIFA 4C0RA 2OLBA 3HN0A 1YAEA 3T22A 4EF2A 4P47A 1SI1A 3PMWA 4GL0A 3EHSA 4K3FA 1IIWA 1OQGA 4P8BA 5L9OA 2UYEA 4NWCA 1Y3NA 4PGPA 1LBVA 1G0HA 4NAPA 3T9UA 4GWXA 5IM2A 2I0BA 2V3TA 3O6HA 1EYJA 1OVTA 4F22A 4N81A 2V3QA 4F3GA 4IO3A 1LFHA 3TTRA 3Q25A 3IB2A 1MY1A 1ZKBA 1NV3A 1FQEA 1LBBA 4ZE8A 2HAVA 2H4IA 3B50A 4NF5B 5IAIA 2Y5LA 1SD3A 3ODBA 1FPIA 4FATA 3ONMA 4YICA 2NXOA 3R26A 2DWJA 1DBZA 2PFZA 2PMSA 2QL3A 5DYHA 4ESWA 3TKDA 3EKIA 3E9XA 2WYKA 4JSDA 4G68B 2I6EA 3O29A 5KDTA 4P11A 3N6UA 4JSOA 1BIYA 2ESNA 4MX6A 4QFKA 4C1TA 1SW1A 1M5CA 1MPDA 1SW5A 2QS1A 2UVGA 3H06B 4MLQA 4PAIA 1IMFA 2V93A 4P9KA 1INPA 4GWSA 4OETA 2XXXA 4PFYA 3M3LA 4N6PA 4PDDA 4PGNA 1FQCA 2AIXA 3JZJA 5IZ1A 3U94A 2D21A 4EQ9A 4OZ9A 3DP8A 2QVUA 3KBZA 5IZ3B 2QS2A 3TDJA 3FV1A 1CB6A 1UQWA 5EHMA 3KOSA 1NUYA 1Y1ZA 3SDFA 4PE5B 2F7AA 1B0HA 1O63A 5B70A 1IMBA 4RK2A 2R9JA 3RT6B 3KG2A 1JW5A 4ELOA 1FPBA 4LATA 1DMBA 3PMXA 5I56A 1OVBA 3FJ7A 3KZGA 4H6DA 2F6PA 1LCFA 2HPGA 3DLNA 1FQDA 2D3IA 3I3VA 1YZ0A 1SPIA 3RT8A 4ESXA 1R1NA 5FHNA 4R2BA 3BIGA 3OENA 2PBWA 4LVQA 2Q9TA 4GRKA 4R6HA 2FIXA 1N0TA 2BJJX 4OFLA 4ELPA 1I6AA 2UVHA 1FQAA 1FPLA 3EQ1A 5CC2A 1XVXA 2QS4A 1Y4CA 2ZYKA 4N13A 3THIA 4X1DA 3BFUA 2AYSA 3R6UA 5DEXA 4XKQA 3EHUA 1JEVA 4KFQA 2UXAA 2Q8JA 4Q8RA 2ZZVA 3TTNA 3OO6A 5FHOA 3FJGA 4Z0IA 1B7ZA 1A99A 2E0SA 4OERA 4YB7A 4R73A 3GZGA 3TPAA 5ICQA 3KN8A 1I69A 1NV4A 5K2XA 4G8NA 1Y1MA 4YU0A 2FHYA 1XT8A 3T0JA 4AB5A 4N4UA 1PB7A 4DIGA 5I59A 2XA5A 1NV0A 4LA9A 3B6WA 4DE8A 5I84A 4I9DA 4RPOA 2WYPA 2H25A 1PC3A 3TTMA 3N6TA 2VD3A 1AH5A 4JDFA 3PTYA 3ZKLA 4Q5TA 4MFIA 5DVFA 2NWJA 1SW4A 5KDTB 1N3XA 4I3YA 1LEVA 4F19A 5M2VA 3SEYA 4PBQA 2CEYA 5CI5A 5A5XA 3TELA 4RNSA 4PQJA 1IXGA 2OJTA 3K0VA 5CRYA 3JV9A 1M5FA 1PB9A 2PX1A 1FTLA 1QJMA 3RPWA 3UA8A 2Q74A 2ONRA 2XXUA 3K6UA 2FVZA 4OWDA 5EQ8A 5ISUA 1AMFA 2OWZA 3RLFE 2I0CA 2Q89A 1B58A 1SBPA 2Z8DA 4LZ5A 1ELJA 3KFMA 1FRPA 3TTKA 3QK6A 3FUZA 4H5FA 4PDHA 2RC9A 1B3GA 2VOZA 1P1WA 4OTEA 4E0WA 1AOVA 3W9WA 4X8RA 3MVXA 4FAJA 1XS5A 5I56B 2HZKA 3GBAA 4GLIA 2IA4A 4X48A 1RKMA 1LAFE 2KLFA 4H5GA 4EQ7A 1YTVA 4MNCA 4N8YA 3IFAA 3T9VA 3IJXB 3MSTA 1H43A 2KR0A 3VDFA 5I3SA 4DLDA 1OLAA 4MF3A 3CFZA 2F97A 2RC8A 1EU8A 4MHFA 2O1MA 4NF0A 1USYE 1P1OA 2ZMBA 3U1OA 4I8CA 1KWHA 4ZDMA 2ALUA 5CBRA 3E4RA 3GXAA 1YCJA 1MM6A 3PD8A 5FBPA 1MY4A 2BJIA 2OWTA 2R6GE 4I1DA 3PPRA 3I6VA 4RA1A 1XOCA 3VLWA 3P7IA 1LBZA 1FTJA 4LZ8A 3RGYA 4PFWA 5BWJA 1FJ9A 2DWHA 1DTZA 3O6IA 3MYUA 1ZU0A 4Z7EA 2XXYA 1FQFA 1DSNA 1MXVA 3FZVA 3HFUA 2V25A 1US5A 4EUOA 4BLAA 3ECRA 5B7DA 1D4NA 4NE4A 1NKXA 3GBBA 4PFIA 1BLFA 1A55A 2XD3A 4YZZA 5I59B 3UORA 4QFLA 4ZECA 3KJ7A 4F18A 4N6DA 4OFJA 3IJOB 3MP1A 4EF1A 3E3KA 1MQIA 3OMBA 4OVSA 3LBSA 1FPFA 3IB0A 4GXSB 1A8FA 2VPOA 4UACA 4XIGQ 4GBWA 3S4UA 4BDNA 4XKPA 2OBGA 3FVOA 3SZPA 1YXIA 4YKJA 3H6UA 1H44A 3ISPA 5HBCA 2LAOA 1P1UA 2OCUA 2VPNA 4FE8A 4JVCA 3C35A 5A5XB 1LFGA 1FTOA 1MY0A 4PETA 3H03A 5KCJA 1K9ZA 2GFEA 3OEMA 2XXWA 3W9VA 4P3LA 2D5WA 3OELA 3CSBA 4QSEA 3QUFA 3QYTA 3U8QA 2FNCA 4IO5A 5IGAA 1Z7NE 2GH9A 2RCAA 4QRZA 2PCRA 5FHMA 3UGWA 4XF5A 4TLMB 1OLCA 3MPKA 2HAUA 1Y9UA 3PGFA 1ZBMA 4JWOA 3KGCA 4L17A 1WDNA 1JETA 4KYDA 1NNPA 2DP8A 4OVQA 1MXWA 1B32A 2NUVA 4XEQA 2PT2A 2REGA 1J1NA 3MWBA 1N3WA 1Z7ME 4ZS9A 3SEUA 4ECFA 4M1VA 2DOJA 2F3DA 3C4MA 1RYOA 2X7PA 1MH4A 3N26A 4O3BA 3ZSFA 4N91A 1JW4A 2XXVA 3IFCA 3RUMA 2Y5KA 4YAHX 3CSGA 4OEVA 4IB2A 4HXVA 3IL1B 1URGA 4P0GA 4GWUA 2F5XA 4WXJA 4OENA 3B6TA 1IEJA 3B6QA 1GVCA 3FXQA 1TXFA 4NHBA 2QS3A 5H8FA 4F3SA 2X7QA 4F39A 4N8GA 5KZTA 4IO4A 4F2QA 3ZS6A 2ONSA 1LAHE 1EZPA 3TCFA 3QXMA 5F1QA 4U21A 3IK6B 1N7XA 1MXZA 4M4GA 3JYRA 4KD5A 4I40A 3U72A 1MQGA 4LP2B 4GQOA 3VLUA 4XKNA 5EYHA 4OFOA 2UYFA 2B4MA 2QMWA 5BUUA 3A09A 3E13X 4POXA 4Q0CA 1QUIA 3PPNA 4F29A 4GL8A 3CR9A 1F9BA 3T9HB 1VE4A 2Y84A 4YKPA 4LONB 4KR5A 2PT1A 5CMBA 1DTGA 1B4HA 4G2ZA 3K4UA 1NV7A 4FORA 4IGRA 1JQFA 1MDQA 1ZTYA 3LSFB 2DE2A 4U4SA 3U65A 3K6VA 4E0XA 1K9YA 4HW8A 1MXXA 1B7HA 3CG1A 4IO2A 4DXUA 5DTBA 1PB8A 4HE1A 3G3IA 1B52A 2VT5A 4F1YA 3VLVA 2OK2A 2V3UA 1DOTA 4PE3A 5ITPA 2B65A 1NV1A 3QAXA 1LLSA 3LR1A 4JVIA 2VP1A 5KCJB 4DCXA 3TMGA 4OESA 2XD2A 4P56A 4ZEBA 3MZ1A 1EZ9A 1L5TA 1BK4A 3MVWA 4QSDA 4FJPA 4XXUA 4HE0A 2QRYA 1KA0A 2FA7A 2Q8MA 4QSCA 5CM6A 3H7MA 1B05A 3M3FA 2F6GA 3EF7A 4IY5A 4GF8A 2ZYMA 2O7UA 3MAMA 1B40A 4O7IA 4NTLA 5J16A 1A40A 2P3NA 2G29A 3FVGA 3OSRA 3T1BA 4NN3A 1OQHA 3B7DA 2Z23A 2YJPA 1S9TA 1FW0A 3IOVA 3EHTA 3H6TA 4NGUA 1UTBB 4JWYA 3RYDA 2DQVA 4YKKA 4GFRA 2O68A 5EQ7A 1ZJLA 3D4GA 5EQ9A 2XWKA 4U1ZA 1D9QA 4ZEFA 4G8HA 3ILTB 2QJEA 1SI0A 1GR2A 2DXYA 3PV0E 4HE2A 4RJZA 1IMDA 3G7WA 4AS4A 4JB7A 2I3VA 4G8MA 1Q1KA 1PBPA 5H8FB 1HSEA 1USYH 1PBQA 1FPEA 5I2KA 5EYFA 1R9LA 4N6KA 2F36A 4GX4A 4N17A 1TFAA 1M5DA 4ZEIA 3FXRA 3IOUA 4PBHA 1BKAA 1Y20A 4DI3D 3MW0A 3U92A 3LUZA 4NF6A 4OYVA 4THIA 1P99A 1S50A 2XHDA 3FXUA
chains in the Genus database with same CATH topology
5AA2A 5I58A 4X9TA 3H3GA 4U4XA 4GOTA 3OO7A 1ZLQA 1BP5A 1LAXA 2XX9A 3G3KA 1HSJA 5H8SA 2I3WA 1LB9A 4YB6A 4JBZA 1IQ7A 4KCCA 2GHAA 2O84X 1B9JA 3RTWB 2HQ0A 3SESA 2H5YA 1GGGA 1II5A 3VE1B 2VHAA 3S2VA 3FASA 2XXPA 2O69A 4ZEDA 3OD7A 2NVUB 3V5AA 5TU0A 3CIJA 3PPOA 3BBRA 3EN3A 4OVJA 3G3FA 2NOOA 2F7BA 2DYXA 3MP8A 1D3KA 4RY1A 5AA4A 3HO7A 2DXRA 5CMKA 1MM7A 2Q88A 3EPEA 5AA1A 3T96B 2VD2A 2RF1A 3LSWA 2ZNSA 2F8DA 1M5EA 3KOTA 4GVOA 2OWSA 3FATA 3IORA 1WODA 1MY2A 3KSXA 4F31B 4MBPA 3V8XB 2W7YA 1HSLA 1ZMGA 2WKYA 4DXBA 4GIZA 4RYAA 5FTIA 4YMBA 3TCHA 2PYYA 3KN3A 3TAJA 5H8NA 3TQWA 3T93B 4FEBA 3VFJA 1Y3QA 3D4CA 4TOZA 3KSJA 4H65A 1O64A 1FTKA 3C31A 2M8CA 3MC2A 1A7LA 4H8IA 3IX1A 4RPNA 1NNKA 3MP6A 5I57A 2XX7A 2F7CA 4R9GA 5I2KB 1JNFA 3SEVA 1B1HA 1SYHA 1N7WA 4LQ2A 5H8QB 1MXUA 3KBRA 3M8UA 2Y7PA 1LB8A 4NF6B 3TFLA 4IGTA 1B5IA 1MS7A 3S9MC 2H98A 1IUDA 5AA2B 5I58B 3HSTA 4MH5A 5FTHA 3FVNA 2Q2CA 1ZIUA 5ICTA 1IXIA 5DVJA 5EHSA 5TPAB 1SQYA 3C34A 3Q29A 1TFDA 3FD3A 1XVYA 2P0SA 2Y7WA 4RXLA 2YPNA 1WVJA 5HM4B 3TZAA 2HZLA 1CE2A 1MPCA 3FJMA 4ZZAA 3M3KA 2O7IA 2ZXTA 3C9HA 3OO8A 3FV2A 4DZ1A 4F2OA 2GRVA 4R9FA 2P2AA 2VGQA 4ONYA 4WKMA 3ZKKA 1TWYA 5ITOA 4YMAA 2F34A 2R71A 3G3GA 3O6GA 4AQ4A 4QF9A 3QUJA 5AA4B 1I6BA 1N76A 4O3AA 3H6WA 4WEDA 3O9PA 1A54A 4ELQA 2DWIA 2HCAA 1UTHB 1ATGA 1POY1 1DPEA 4U2RA 3IB1A 1IZ1A 3PUVE 5CMMA 2CMOA 1UTBA 4F3PA 1B3LA 3FGSA 3OOAA 4EQBA 5J1DA 3TODA 1T0KA 1FCKA 3MZ9A 1US4A 4F1UA 4Q30B 1JW1A 3SEXA 4KI0E 2HEUA 1JVYA 5CMCA 3KJTA 4IO6A 1JEUA 2HXWA 4F1VA 4G68C 4LUBA 1LFIA 5H8NB 4C1UA 3MQ9A 3LSLA 3S9EA 5DT6A 1MY3A 1IXHA 3QSLA 3USDA 3VXBA 3VV5A 3K1NA 2GHBA 3VVEA 4ZE9A 2XXTA 1TT1A 5ELVA 3HV1A 3GLBA 4HS7A 1AIVA 4FEDA 1B5HA 4U22A 1MPBA 2B3FA 3N94A 3LUYA 5I57B 2I58A 4JWXA 2G93A 3TQLA 3CFXA 3UK4A 4QFNA 1PDAA 4F3BA 1DPPA 3K00A 5JEIA 4NF8A 2I49A 1OMPA 2RC7A 4ND9A 2HFBA 2IEEA 3CI8A 3G3HA 3K6XA 3MPLA 1B4ZA 3OO9A 4AB6A 1ANFA 2DWAA 3IOWA 1B6HA 3ILUB 3K1PA 3C33A 4JXIA 3Q27A 1D9YA 2RINA 4QFPA 4I62A 1MXYA 3TUSA 3V83A 3R7XA 2AL5A 1RYXA 3O97A 1B51A 5H8HA 4OQOA 2Z22A 1EH3A 4H1XA 1XHYA 1AL3A 2A5TA 4NF4A 3O28A 2ABHA 3SERA 1UIUA 2DE3A 3SETA 2ANJA 1R6ZA 2Y7RA 4FIMA 3Q28A 2O1LA 4O3CA 1MH3A 3MVYA 1MQDA 2PVUA 2XXRA 3L6GA 1FQBA 1P1QA 1LBCA 3H6VA 3WAEA 4YB5A 1B7UA 1NFTA 1UIVA 1Q35A 3UP9A 4GXAA 1IITA 2P1SA 3PUYE 1QVSA 4KHZE 2O51A 5CBSA 1H3DA 4U23A 3W15C 4XKRA 1M5BA 3LSXA 3TTLA 2H99A 3MJNA 3CRBA 5AE4A 2FYIA 1GTKA 3SKPA 1VFEA 4TLLB 1OIBA 4P0IA 4BDLA 5JK4A 4X1BA 2DSFA 2DE4A 3PPPA 3RQTA 3MUQA 1P1NA 4TQUQ 3TYHA 2X26A 1SDXA 1VSOA 2QSXA 4GD5A 4NWDA 1QULA 1BTJA 5L9SA 4OHNA 2I48A 2ZYNA 2I4CA 1NH7A 1IXCA 3PU5A 4KPTA 3HHFA 4GWOA 1MQHA 3Q26A 4KYEA 1POTA 3C36A 5H8QA 3VXCA 3A3UA 4HTGA 3LC8A 4FECA 2UVIA 2XX8A 4R2FA 4IO7A 1I6QA 5JTYA 1LGBC 1R9QA 2Z8FA 4PP0A 1MQJA 3OEKA 3HHGA 2F78A 3OXNA 2RKMA 4OEUA 3DELB 1H45A 4NF8B 2ZNTA 4QFOA 4R72A 3DP4A 5TPAA 2REJA 4ISUA 3IAZA 3IO4A 3FIRA 5AA3A 3K01A 5AA2D 3RNNA 1FTMA 5TP9A 3K1MA 3TEPA 2OZZA 5H8HB 3K2DA 4WEPA 3RY3A 2XXIA 2I4BA 2Y7KA 4PFTA 3CFLA 2A5TB 4QHQA 3DP6A 4NF4B 4N07A 2QPQA 4POWA 3CG3A 2ONKE 3K6WA 1O7TA 5I2NA 4H8JA 3MBPA 3O2AA 3AXFA 1NL5A 3PUZE 3FVKA 4R74A 1A8EA 4YKIA 2B3BA 3O66A 4ELRA 3C32A 1UTHA 3PUWE 4KCDA 3IO6A 1QKBA 3TCGA 4KYSA 3RTFB 5LOMA 4BDQA 2DS9A 2YLNA 1URSA 3VVFA 3HPIA 3A3CA 3MVZA 3WAFA 4PFUA 4ZZEA 1MDP1 3G3JA 2Y7IA 1QW0A 3DM0A 2DVZA 3PPQA 3F11A 3IOTA 4R6YA 4HCYA 3VVDA 1SW2A 3MZBA 1EZOA 3S9NC 3S9LC 1NNFA 5DVIA 1NNTA 2THIA 1NH8A 4U1OA 3RN8A 4H0WA 4DXCA 3K02A 1XC1A 4EXLA 1VFDA 1JVXA 3BFTA 2DVCA 1B1XA 1B2HA 4G4PA 1MG1A 2CZLA 4R6KA 3QIMA 1Y4TA 3BKIB 4BDMA 1URDA 2UVJA 3PD9A 3V89B 4NF5A 5IKBA 1LAGE 4KQPA 5DEXB 4BDRA 4R75A 4BDOA 1QUJA 2Z8EA 1B0LA 4IY6A 1GV8A 5F7VA 3SEWA 2AL4A 2A5SA 5JTYB 1Y3PA 2Q2AA 4RK9A 4G68A 3U93A 1SVXB 1SYIA 4LQ5A 3CVGA 3H4ZA 3KEIA 5L8DA 1QUKA 1B3FA 1VR5A 1N84A 4OMBA 2O6AA 1B46A 1H76A 4DCYA 4MLVA 5L9MA 4EDPA 2ZNUA 5TP9B 4DDDA 2QMXA 1N04A 3IR1A 2XXHA 2RCBA 3L6HA 3OSQA 1B3EA 2ZYOA 1B3HA 1LCTA 3KN7A 1PEBA 4ZEKA 5K2YA 1NMUA 4H67A 3PUXE 4OXVA 3T9XB 5I2NB 4NEDA 2H9BA 3I5OA 1YPNA 3N5LA 1QKAA 4EXKA 4UA8A 1LSTA 2F35A 4LZ7A 2V84A 4G77A 3UN6A 4HCWA 5HPQA 4NMYA 4XTCQ 1MRPA 2E1SA 3PMVA 3T66A 2XXQA 1D9VA 1S7YA 3HCQA 1B5JA 3UIFA 4C0RA 2OLBA 3HN0A 1YAEA 3T22A 4EF2A 1SI1A 3PMWA 4GL0A 3EHSA 4K3FA 1IIWA 1OQGA 5L9OA 2UYEA 4NWCA 1Y3NA 3T9UA 2I0BA 2V3TA 3O6HA 1OVTA 4F22A 2V3QA 4F3GA 4IO3A 1LFHA 3TTRA 3Q25A 3IB2A 1MY1A 1ZKBA 1FQEA 1LBBA 4ZE8A 2HAVA 2H4IA 4NF5B 5IAIA 1SD3A 3ODBA 4FATA 3ONMA 4YICA 2NXOA 3R26A 2DWJA 2PMSA 2QL3A 5DYHA 4ESWA 3TKDA 3E9XA 4JSDA 4G68B 2I6EA 3O29A 5KDTA 4P11A 3N6UA 4JSOA 1BIYA 2ESNA 4QFKA 4C1TA 1SW1A 1M5CA 1MPDA 1SW5A 2QS1A 2UVGA 3H06B 4MLQA 2V93A 4OETA 2XXXA 4PFYA 3M3LA 4N6PA 1FQCA 2AIXA 3JZJA 3U94A 2D21A 4EQ9A 4OZ9A 3DP8A 2QS2A 3TDJA 3FV1A 1CB6A 1UQWA 5EHMA 3KOSA 1Y1ZA 3SDFA 4PE5B 2F7AA 1B0HA 1O63A 5B70A 4RK2A 2R9JA 3RT6B 3KG2A 1JW5A 4ELOA 4LATA 1DMBA 3PMXA 5I56A 1OVBA 3FJ7A 3KZGA 4H6DA 2F6PA 1LCFA 3DLNA 1FQDA 2D3IA 3I3VA 3RT8A 4ESXA 1R1NA 5FHNA 4R2BA 3OENA 2PBWA 4LVQA 2Q9TA 4GRKA 4R6HA 1N0TA 2BJJX 4OFLA 4ELPA 1I6AA 2UVHA 1FQAA 3EQ1A 5CC2A 1XVXA 2QS4A 1Y4CA 2ZYKA 4N13A 3THIA 4X1DA 3BFUA 2AYSA 3R6UA 5DEXA 4XKQA 3EHUA 1JEVA 4KFQA 2UXAA 2Q8JA 4Q8RA 3TTNA 3OO6A 5FHOA 3FJGA 4Z0IA 1B7ZA 1A99A 2E0SA 4OERA 4YB7A 4R73A 3GZGA 3TPAA 5ICQA 3KN8A 1I69A 5K2XA 4G8NA 1Y1MA 4YU0A 1XT8A 4AB5A 1PB7A 4DIGA 5I59A 4LA9A 3B6WA 4DE8A 5I84A 4I9DA 4RPOA 2H25A 1PC3A 3TTMA 3N6TA 2VD3A 1AH5A 4JDFA 3ZKLA 4Q5TA 4MFIA 5DVFA 2NWJA 1SW4A 5KDTB 1N3XA 4F19A 5M2VA 3SEYA 5CI5A 5A5XA 3TELA 4RNSA 4PQJA 1IXGA 2OJTA 3K0VA 5CRYA 3JV9A 1M5FA 1PB9A 2PX1A 1FTLA 1QJMA 3RPWA 3UA8A 2ONRA 2XXUA 3K6UA 4OWDA 5ISUA 1AMFA 3RLFE 2I0CA 2Q89A 1B58A 1SBPA 2Z8DA 4LZ5A 1ELJA 3KFMA 3TTKA 3QK6A 3FUZA 4H5FA 2RC9A 1B3GA 2VOZA 1P1WA 4OTEA 4E0WA 1AOVA 3W9WA 3MVXA 4FAJA 1XS5A 5I56B 2HZKA 3GBAA 4GLIA 2IA4A 4X48A 1RKMA 1LAFE 2KLFA 4H5GA 4EQ7A 1YTVA 3T9VA 3IJXB 1H43A 3VDFA 4DLDA 1OLAA 4MF3A 3CFZA 2F97A 2RC8A 1EU8A 2O1MA 1USYE 1P1OA 2ZMBA 3U1OA 4I8CA 1KWHA 4ZDMA 2ALUA 5CBRA 3E4RA 3GXAA 1YCJA 1MM6A 3PD8A 1MY4A 2OWTA 2R6GE 4I1DA 3PPRA 3I6VA 4RA1A 1XOCA 3VLWA 3P7IA 1FTJA 4LZ8A 3RGYA 4PFWA 5BWJA 2DWHA 1DTZA 3O6IA 1ZU0A 4Z7EA 2XXYA 1FQFA 1DSNA 1MXVA 3FZVA 2V25A 1US5A 4EUOA 4BLAA 3ECRA 5B7DA 1D4NA 4NE4A 1NKXA 3GBBA 1BLFA 1A55A 2XD3A 4YZZA 5I59B 3UORA 4QFLA 4ZECA 3KJ7A 4F18A 4OFJA 3IJOB 3MP1A 4EF1A 3E3KA 1MQIA 3OMBA 3LBSA 3IB0A 4GXSB 1A8FA 4UACA 4XIGQ 3S4UA 4BDNA 4XKPA 2OBGA 3FVOA 4YKJA 3H6UA 1H44A 5HBCA 2LAOA 1P1UA 2OCUA 4FE8A 3C35A 5A5XB 1LFGA 1FTOA 1MY0A 4PETA 3H03A 5KCJA 2GFEA 3OEMA 2XXWA 3W9VA 2D5WA 3OELA 3CSBA 4QSEA 3QUFA 3QYTA 3U8QA 2FNCA 4IO5A 1Z7NE 2GH9A 2RCAA 4QRZA 5FHMA 3UGWA 4TLMB 1OLCA 3MPKA 2HAUA 1Y9UA 3PGFA 1ZBMA 4JWOA 3KGCA 4L17A 1WDNA 1JETA 4KYDA 1NNPA 2DP8A 1MXWA 1B32A 2NUVA 2PT2A 2REGA 1J1NA 3MWBA 1N3WA 1Z7ME 4ZS9A 3SEUA 4ECFA 4M1VA 2DOJA 3C4MA 1RYOA 2X7PA 1MH4A 3N26A 4O3BA 3ZSFA 1JW4A 2XXVA 3RUMA 4YAHX 3CSGA 4OEVA 4IB2A 3IL1B 1URGA 4P0GA 2F5XA 4WXJA 4OENA 3B6TA 1IEJA 3B6QA 1GVCA 3FXQA 1TXFA 2QS3A 5H8FA 4F3SA 2X7QA 4F39A 5KZTA 4IO4A 4F2QA 3ZS6A 2ONSA 1LAHE 1EZPA 3TCFA 3QXMA 5F1QA 4U21A 3IK6B 1N7XA 1MXZA 4M4GA 3JYRA 4KD5A 3U72A 1MQGA 4LP2B 4GQOA 3VLUA 4XKNA 4OFOA 2UYFA 2QMWA 5BUUA 3A09A 3E13X 4POXA 4Q0CA 1QUIA 3PPNA 4F29A 4GL8A 3CR9A 1F9BA 3T9HB 1VE4A 2Y84A 4YKPA 4LONB 4KR5A 2PT1A 5CMBA 1DTGA 1B4HA 4G2ZA 3K4UA 4FORA 4IGRA 1JQFA 1MDQA 1ZTYA 3LSFB 2DE2A 4U4SA 3K6VA 4E0XA 4HW8A 1MXXA 1B7HA 3CG1A 4IO2A 4DXUA 5DTBA 1PB8A 3G3IA 1B52A 4F1YA 3VLVA 2OK2A 2V3UA 1DOTA 5ITPA 2B65A 3QAXA 1LLSA 3LR1A 2VP1A 5KCJB 4DCXA 3TMGA 4OESA 2XD2A 4ZEBA 3MZ1A 1EZ9A 1L5TA 3MVWA 4QSDA 4FJPA 4XXUA 2QRYA 2FA7A 4QSCA 5CM6A 3H7MA 1B05A 3M3FA 2F6GA 3EF7A 4IY5A 4GF8A 2ZYMA 2O7UA 3MAMA 1B40A 4NTLA 1A40A 2G29A 3FVGA 3OSRA 1OQHA 3B7DA 2Z23A 2YJPA 1S9TA 1FW0A 3IOVA 3EHTA 3H6TA 1UTBB 4JWYA 2DQVA 4YKKA 4GFRA 2O68A 1ZJLA 3D4GA 4U1ZA 4ZEFA 4G8HA 3ILTB 2QJEA 1SI0A 1GR2A 2DXYA 3PV0E 4RJZA 3G7WA 2I3VA 4G8MA 4JB7A 1Q1KA 1PBPA 5H8FB 1HSEA 1USYH 1PBQA 5I2KA 5EYFA 1R9LA 2F36A 1TFAA 1M5DA 4ZEIA 3FXRA 3IOUA 1BKAA 1Y20A 3MW0A 3U92A 4NF6A 4OYVA 4THIA 1P99A 1S50A 2XHDA 3FXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AA2 A;  5I58 A;  4X9T A;  3H3G A;  4U4X A;  4GOT A;  3OO7 A;  1ZLQ A;  1BP5 A;  1LAX A;  2XX9 A;  3G3K A;  1HSJ A;  5H8S A;  2I3W A;  1LB9 A;  4YB6 A;  4JBZ A;  1IQ7 A;  4KCC A;  2GHA A;  2O84 X;  1B9J A;  3RTW B;  2HQ0 A;  3SES A;  2H5Y A;  1GGG A;  1II5 A;  3VE1 B;  2VHA A;  3S2V A;  3FAS A;  2XXP A;  2O69 A;  4ZED A;  3OD7 A;  2NVU B;  3V5A A;  5TU0 A;  3CIJ A;  3PPO A;  3BBR A;  3EN3 A;  4OVJ A;  3G3F A;  2NOO A;  2F7B A;  2DYX A;  3MP8 A;  1D3K A;  4RY1 A;  5AA4 A;  3HO7 A;  2DXR A;  5CMK A;  1MM7 A;  2Q88 A;  3EPE A;  5AA1 A;  3T96 B;  2VD2 A;  2RF1 A;  3LSW A;  2ZNS A;  2F8D A;  1M5E A;  3KOT A;  4GVO A;  2OWS A;  3FAT A;  3IOR A;  1WOD A;  1MY2 A;  3KSX A;  4F31 B;  4MBP A;  3V8X B;  2W7Y A;  1HSL A;  1ZMG A;  2WKY A;  4DXB A;  4GIZ A;  4RYA A;  5FTI A;  4YMB A;  3TCH A;  2PYY A;  3KN3 A;  3TAJ A;  5H8N A;  3TQW A;  3T93 B;  4FEB A;  3VFJ A;  1Y3Q A;  3D4C A;  4TOZ A;  3KSJ A;  4H65 A;  1O64 A;  1FTK A;  3C31 A;  2M8C A;  3MC2 A;  1A7L A;  4H8I A;  3IX1 A;  4RPN A;  1NNK A;  3MP6 A;  5I57 A;  2XX7 A;  2F7C A;  4R9G A;  5I2K B;  1JNF A;  3SEV A;  1B1H A;  1SYH A;  1N7W A;  4LQ2 A;  5H8Q B;  1MXU A;  3KBR A;  3M8U A;  2Y7P A;  1LB8 A;  4NF6 B;  3TFL A;  4IGT A;  1B5I A;  1MS7 A;  3S9M C;  2H98 A;  1IUD A;  5AA2 B;  5I58 B;  3HST A;  4MH5 A;  5FTH A;  3FVN A;  2Q2C A;  1ZIU A;  5ICT A;  1IXI A;  5DVJ A;  5EHS A;  5TPA B;  1SQY A;  3C34 A;  3Q29 A;  1TFD A;  3FD3 A;  1XVY A;  2P0S A;  2Y7W A;  4RXL A;  2YPN A;  1WVJ A;  5HM4 B;  3TZA A;  2HZL A;  1CE2 A;  1MPC A;  3FJM A;  4ZZA A;  3M3K A;  2O7I A;  2ZXT A;  3C9H A;  3OO8 A;  3FV2 A;  4DZ1 A;  4F2O A;  2GRV A;  4R9F A;  2P2A A;  2VGQ A;  4ONY A;  4WKM A;  3ZKK A;  1TWY A;  5ITO A;  4YMA A;  2F34 A;  2R71 A;  3G3G A;  3O6G A;  4AQ4 A;  4QF9 A;  3QUJ A;  5AA4 B;  1I6B A;  1N76 A;  4O3A A;  3H6W A;  4WED A;  3O9P A;  1A54 A;  4ELQ A;  2DWI A;  2HCA A;  1UTH B;  1ATG A;  1POY 1;  1DPE A;  4U2R A;  3IB1 A;  1IZ1 A;  3PUV E;  5CMM A;  2CMO A;  1UTB A;  4F3P A;  1B3L A;  3FGS A;  3OOA A;  4EQB A;  5J1D A;  3TOD A;  1T0K A;  1FCK A;  3MZ9 A;  1US4 A;  4F1U A;  4Q30 B;  1JW1 A;  3SEX A;  4KI0 E;  2HEU A;  1JVY A;  5CMC A;  3KJT A;  4IO6 A;  1JEU A;  2HXW A;  4F1V A;  4G68 C;  4LUB A;  1LFI A;  5H8N B;  4C1U A;  3MQ9 A;  3LSL A;  3S9E A;  5DT6 A;  1MY3 A;  1IXH A;  3QSL A;  3USD A;  3VXB A;  3VV5 A;  3K1N A;  2GHB A;  3VVE A;  4ZE9 A;  2XXT A;  1TT1 A;  5ELV A;  3HV1 A;  3GLB A;  4HS7 A;  1AIV A;  4FED A;  1B5H A;  4U22 A;  1MPB A;  2B3F A;  3N94 A;  3LUY A;  5I57 B;  2I58 A;  4JWX A;  2G93 A;  3TQL A;  3CFX A;  3UK4 A;  4QFN A;  1PDA A;  4F3B A;  1DPP A;  3K00 A;  5JEI A;  4NF8 A;  2I49 A;  1OMP A;  2RC7 A;  4ND9 A;  2HFB A;  2IEE A;  3CI8 A;  3G3H A;  3K6X A;  3MPL A;  1B4Z A;  3OO9 A;  4AB6 A;  1ANF A;  2DWA A;  3IOW A;  1B6H A;  3ILU B;  3K1P A;  3C33 A;  4JXI A;  3Q27 A;  1D9Y A;  2RIN A;  4QFP A;  4I62 A;  1MXY A;  3TUS A;  3V83 A;  3R7X A;  2AL5 A;  1RYX A;  3O97 A;  1B51 A;  5H8H A;  4OQO A;  2Z22 A;  1EH3 A;  4H1X A;  1XHY A;  1AL3 A;  2A5T A;  4NF4 A;  3O28 A;  2ABH A;  3SER A;  1UIU A;  2DE3 A;  3SET A;  2ANJ A;  1R6Z A;  2Y7R A;  4FIM A;  3Q28 A;  2O1L A;  4O3C A;  1MH3 A;  3MVY A;  1MQD A;  2PVU A;  2XXR A;  3L6G A;  1FQB A;  1P1Q A;  1LBC A;  3H6V A;  3WAE A;  4YB5 A;  1B7U A;  1NFT A;  1UIV A;  1Q35 A;  3UP9 A;  4GXA A;  1IIT A;  2P1S A;  3PUY E;  1QVS A;  4KHZ E;  2O51 A;  5CBS A;  1H3D A;  4U23 A;  3W15 C;  4XKR A;  1M5B A;  3LSX A;  3TTL A;  2H99 A;  3MJN A;  3CRB A;  5AE4 A;  2FYI A;  1GTK A;  3SKP A;  1VFE A;  4TLL B;  1OIB A;  4P0I A;  4BDL A;  5JK4 A;  4X1B A;  2DSF A;  2DE4 A;  3PPP A;  3RQT A;  3MUQ A;  1P1N A;  4TQU Q;  3TYH A;  2X26 A;  1SDX A;  1VSO A;  2QSX A;  4GD5 A;  4NWD A;  1QUL A;  1BTJ A;  5L9S A;  4OHN A;  2I48 A;  2ZYN A;  2I4C A;  1NH7 A;  1IXC A;  3PU5 A;  4KPT A;  3HHF A;  4GWO A;  1MQH A;  3Q26 A;  4KYE A;  1POT A;  3C36 A;  5H8Q A;  3VXC A;  3A3U A;  4HTG A;  3LC8 A;  4FEC A;  2UVI A;  2XX8 A;  4R2F A;  4IO7 A;  1I6Q A;  5JTY A;  1LGB C;  1R9Q A;  2Z8F A;  4PP0 A;  1MQJ A;  3OEK A;  3HHG A;  2F78 A;  3OXN A;  2RKM A;  4OEU A;  3DEL B;  1H45 A;  4NF8 B;  2ZNT A;  4QFO A;  4R72 A;  3DP4 A;  5TPA A;  2REJ A;  4ISU A;  3IAZ A;  3IO4 A;  3FIR A;  5AA3 A;  3K01 A;  5AA2 D;  3RNN A;  1FTM A;  5TP9 A;  3K1M A;  3TEP A;  2OZZ A;  5H8H B;  3K2D A;  4WEP A;  3RY3 A;  2XXI A;  2I4B A;  2Y7K A;  4PFT A;  3CFL A;  2A5T B;  4QHQ A;  3DP6 A;  4NF4 B;  4N07 A;  2QPQ A;  4POW A;  3CG3 A;  2ONK E;  3K6W A;  1O7T A;  5I2N A;  4H8J A;  3MBP A;  3O2A A;  3AXF A;  1NL5 A;  3PUZ E;  3FVK A;  4R74 A;  1A8E A;  4YKI A;  2B3B A;  3O66 A;  4ELR A;  3C32 A;  1UTH A;  3PUW E;  4KCD A;  3IO6 A;  1QKB A;  3TCG A;  4KYS A;  3RTF B;  5LOM A;  4BDQ A;  2DS9 A;  2YLN A;  1URS A;  3VVF A;  3HPI A;  3A3C A;  3MVZ A;  3WAF A;  4PFU A;  4ZZE A;  1MDP 1;  3G3J A;  2Y7I A;  1QW0 A;  3DM0 A;  2DVZ A;  3PPQ A;  3F11 A;  3IOT A;  4R6Y A;  4HCY A;  3VVD A;  1SW2 A;  3MZB A;  1EZO A;  3S9N C;  3S9L C;  1NNF A;  5DVI A;  1NNT A;  2THI A;  1NH8 A;  4U1O A;  3RN8 A;  4H0W A;  4DXC A;  3K02 A;  1XC1 A;  4EXL A;  1VFD A;  1JVX A;  3BFT A;  2DVC A;  1B1X A;  1B2H A;  4G4P A;  1MG1 A;  2CZL A;  4R6K A;  3QIM A;  1Y4T A;  3BKI B;  4BDM A;  1URD A;  2UVJ A;  3PD9 A;  3V89 B;  4NF5 A;  5IKB A;  1LAG E;  4KQP A;  5DEX B;  4BDR A;  4R75 A;  4BDO A;  1QUJ A;  2Z8E A;  1B0L A;  4IY6 A;  1GV8 A;  5F7V A;  3SEW A;  2AL4 A;  2A5S A;  5JTY B;  1Y3P A;  2Q2A A;  4RK9 A;  4G68 A;  3U93 A;  1SVX B;  1SYI A;  4LQ5 A;  3CVG A;  3H4Z A;  3KEI A;  5L8D A;  1QUK A;  1B3F A;  1VR5 A;  1N84 A;  4OMB A;  2O6A A;  1B46 A;  1H76 A;  4DCY A;  4MLV A;  5L9M A;  4EDP A;  2ZNU A;  5TP9 B;  4DDD A;  2QMX A;  1N04 A;  3IR1 A;  2XXH A;  2RCB A;  3L6H A;  3OSQ A;  1B3E A;  2ZYO A;  1B3H A;  1LCT A;  3KN7 A;  1PEB A;  4ZEK A;  5K2Y A;  1NMU A;  4H67 A;  3PUX E;  4OXV A;  3T9X B;  5I2N B;  4NED A;  2H9B A;  3I5O A;  1YPN A;  3N5L A;  1QKA A;  4EXK A;  4UA8 A;  1LST A;  2F35 A;  4LZ7 A;  2V84 A;  4G77 A;  3UN6 A;  4HCW A;  5HPQ A;  4NMY A;  4XTC Q;  1MRP A;  2E1S A;  3PMV A;  3T66 A;  2XXQ A;  1D9V A;  1S7Y A;  3HCQ A;  1B5J A;  3UIF A;  4C0R A;  2OLB A;  3HN0 A;  1YAE A;  3T22 A;  4EF2 A;  1SI1 A;  3PMW A;  4GL0 A;  3EHS A;  4K3F A;  1IIW A;  1OQG A;  5L9O A;  2UYE A;  4NWC A;  1Y3N A;  3T9U A;  2I0B A;  2V3T A;  3O6H A;  1OVT A;  4F22 A;  2V3Q A;  4F3G A;  4IO3 A;  1LFH A;  3TTR A;  3Q25 A;  3IB2 A;  1MY1 A;  1ZKB A;  1FQE A;  1LBB A;  4ZE8 A;  2HAV A;  2H4I A;  4NF5 B;  5IAI A;  1SD3 A;  3ODB A;  4FAT A;  3ONM A;  4YIC A;  2NXO A;  3R26 A;  2DWJ A;  2PMS A;  2QL3 A;  5DYH A;  4ESW A;  3TKD A;  3E9X A;  4JSD A;  4G68 B;  2I6E A;  3O29 A;  5KDT A;  4P11 A;  3N6U A;  4JSO A;  1BIY A;  2ESN A;  4QFK A;  4C1T A;  1SW1 A;  1M5C A;  1MPD A;  1SW5 A;  2QS1 A;  2UVG A;  3H06 B;  4MLQ A;  2V93 A;  4OET A;  2XXX A;  4PFY A;  3M3L A;  4N6P A;  1FQC A;  2AIX A;  3JZJ A;  3U94 A;  2D21 A;  4EQ9 A;  4OZ9 A;  3DP8 A;  2QS2 A;  3TDJ A;  3FV1 A;  1CB6 A;  1UQW A;  5EHM A;  3KOS A;  1Y1Z A;  3SDF A;  4PE5 B;  2F7A A;  1B0H A;  1O63 A;  5B70 A;  4RK2 A;  2R9J A;  3RT6 B;  3KG2 A;  1JW5 A;  4ELO A;  4LAT A;  1DMB A;  3PMX A;  5I56 A;  1OVB A;  3FJ7 A;  3KZG A;  4H6D A;  2F6P A;  1LCF A;  3DLN A;  1FQD A;  2D3I A;  3I3V A;  3RT8 A;  4ESX A;  1R1N A;  5FHN A;  4R2B A;  3OEN A;  2PBW A;  4LVQ A;  2Q9T A;  4GRK A;  4R6H A;  1N0T A;  2BJJ X;  4OFL A;  4ELP A;  1I6A A;  2UVH A;  1FQA A;  3EQ1 A;  5CC2 A;  1XVX A;  2QS4 A;  1Y4C A;  2ZYK A;  4N13 A;  3THI A;  4X1D A;  3BFU A;  2AYS A;  3R6U A;  5DEX A;  4XKQ A;  3EHU A;  1JEV A;  4KFQ A;  2UXA A;  2Q8J A;  4Q8R A;  3TTN A;  3OO6 A;  5FHO A;  3FJG A;  4Z0I A;  1B7Z A;  1A99 A;  2E0S A;  4OER A;  4YB7 A;  4R73 A;  3GZG A;  3TPA A;  5ICQ A;  3KN8 A;  1I69 A;  5K2X A;  4G8N A;  1Y1M A;  4YU0 A;  1XT8 A;  4AB5 A;  1PB7 A;  4DIG A;  5I59 A;  4LA9 A;  3B6W A;  4DE8 A;  5I84 A;  4I9D A;  4RPO A;  2H25 A;  1PC3 A;  3TTM A;  3N6T A;  2VD3 A;  1AH5 A;  4JDF A;  3ZKL A;  4Q5T A;  4MFI A;  5DVF A;  2NWJ A;  1SW4 A;  5KDT B;  1N3X A;  4F19 A;  5M2V A;  3SEY A;  5CI5 A;  5A5X A;  3TEL A;  4RNS A;  4PQJ A;  1IXG A;  2OJT A;  3K0V A;  5CRY A;  3JV9 A;  1M5F A;  1PB9 A;  2PX1 A;  1FTL A;  1QJM A;  3RPW A;  3UA8 A;  2ONR A;  2XXU A;  3K6U A;  4OWD A;  5ISU A;  1AMF A;  3RLF E;  2I0C A;  2Q89 A;  1B58 A;  1SBP A;  2Z8D A;  4LZ5 A;  1ELJ A;  3KFM A;  3TTK A;  3QK6 A;  3FUZ A;  4H5F A;  2RC9 A;  1B3G A;  2VOZ A;  1P1W A;  4OTE A;  4E0W A;  1AOV A;  3W9W A;  3MVX A;  4FAJ A;  1XS5 A;  5I56 B;  2HZK A;  3GBA A;  4GLI A;  2IA4 A;  4X48 A;  1RKM A;  1LAF E;  2KLF A;  4H5G A;  4EQ7 A;  1YTV A;  3T9V A;  3IJX B;  1H43 A;  3VDF A;  4DLD A;  1OLA A;  4MF3 A;  3CFZ A;  2F97 A;  2RC8 A;  1EU8 A;  2O1M A;  1USY E;  1P1O A;  2ZMB A;  3U1O A;  4I8C A;  1KWH A;  4ZDM A;  2ALU A;  5CBR A;  3E4R A;  3GXA A;  1YCJ A;  1MM6 A;  3PD8 A;  1MY4 A;  2OWT A;  2R6G E;  4I1D A;  3PPR A;  3I6V A;  4RA1 A;  1XOC A;  3VLW A;  3P7I A;  1FTJ A;  4LZ8 A;  3RGY A;  4PFW A;  5BWJ A;  2DWH A;  1DTZ A;  3O6I A;  1ZU0 A;  4Z7E A;  2XXY A;  1FQF A;  1DSN A;  1MXV A;  3FZV A;  2V25 A;  1US5 A;  4EUO A;  4BLA A;  3ECR A;  5B7D A;  1D4N A;  4NE4 A;  1NKX A;  3GBB A;  1BLF A;  1A55 A;  2XD3 A;  4YZZ A;  5I59 B;  3UOR A;  4QFL A;  4ZEC A;  3KJ7 A;  4F18 A;  4OFJ A;  3IJO B;  3MP1 A;  4EF1 A;  3E3K A;  1MQI A;  3OMB A;  3LBS A;  3IB0 A;  4GXS B;  1A8F A;  4UAC A;  4XIG Q;  3S4U A;  4BDN A;  4XKP A;  2OBG A;  3FVO A;  4YKJ A;  3H6U A;  1H44 A;  5HBC A;  2LAO A;  1P1U A;  2OCU A;  4FE8 A;  3C35 A;  5A5X B;  1LFG A;  1FTO A;  1MY0 A;  4PET A;  3H03 A;  5KCJ A;  2GFE A;  3OEM A;  2XXW A;  3W9V A;  2D5W A;  3OEL A;  3CSB A;  4QSE A;  3QUF A;  3QYT A;  3U8Q A;  2FNC A;  4IO5 A;  1Z7N E;  2GH9 A;  2RCA A;  4QRZ A;  5FHM A;  3UGW A;  4TLM B;  1OLC A;  3MPK A;  2HAU A;  1Y9U A;  3PGF A;  1ZBM A;  4JWO A;  3KGC A;  4L17 A;  1WDN A;  1JET A;  4KYD A;  1NNP A;  2DP8 A;  1MXW A;  1B32 A;  2NUV A;  2PT2 A;  2REG A;  1J1N A;  3MWB A;  1N3W A;  1Z7M E;  4ZS9 A;  3SEU A;  4ECF A;  4M1V A;  2DOJ A;  3C4M A;  1RYO A;  2X7P A;  1MH4 A;  3N26 A;  4O3B A;  3ZSF A;  1JW4 A;  2XXV A;  3RUM A;  4YAH X;  3CSG A;  4OEV A;  4IB2 A;  3IL1 B;  1URG A;  4P0G A;  2F5X A;  4WXJ A;  4OEN A;  3B6T A;  1IEJ A;  3B6Q A;  1GVC A;  3FXQ A;  1TXF A;  2QS3 A;  5H8F A;  4F3S A;  2X7Q A;  4F39 A;  5KZT A;  4IO4 A;  4F2Q A;  3ZS6 A;  2ONS A;  1LAH E;  1EZP A;  3TCF A;  3QXM A;  5F1Q A;  4U21 A;  3IK6 B;  1N7X A;  1MXZ A;  4M4G A;  3JYR A;  4KD5 A;  3U72 A;  1MQG A;  4LP2 B;  4GQO A;  3VLU A;  4XKN A;  4OFO A;  2UYF A;  2QMW A;  5BUU A;  3A09 A;  3E13 X;  4POX A;  4Q0C A;  1QUI A;  3PPN A;  4F29 A;  4GL8 A;  3CR9 A;  1F9B A;  3T9H B;  1VE4 A;  2Y84 A;  4YKP A;  4LON B;  4KR5 A;  2PT1 A;  5CMB A;  1DTG A;  1B4H A;  4G2Z A;  3K4U A;  4FOR A;  4IGR A;  1JQF A;  1MDQ A;  1ZTY A;  3LSF B;  2DE2 A;  4U4S A;  3K6V A;  4E0X A;  4HW8 A;  1MXX A;  1B7H A;  3CG1 A;  4IO2 A;  4DXU A;  5DTB A;  1PB8 A;  3G3I A;  1B52 A;  4F1Y A;  3VLV A;  2OK2 A;  2V3U A;  1DOT A;  5ITP A;  2B65 A;  3QAX A;  1LLS A;  3LR1 A;  2VP1 A;  5KCJ B;  4DCX A;  3TMG A;  4OES A;  2XD2 A;  4ZEB A;  3MZ1 A;  1EZ9 A;  1L5T A;  3MVW A;  4QSD A;  4FJP A;  4XXU A;  2QRY A;  2FA7 A;  4QSC A;  5CM6 A;  3H7M A;  1B05 A;  3M3F A;  2F6G A;  3EF7 A;  4IY5 A;  4GF8 A;  2ZYM A;  2O7U A;  3MAM A;  1B40 A;  4NTL A;  1A40 A;  2G29 A;  3FVG A;  3OSR A;  1OQH A;  3B7D A;  2Z23 A;  2YJP A;  1S9T A;  1FW0 A;  3IOV A;  3EHT A;  3H6T A;  1UTB B;  4JWY A;  2DQV A;  4YKK A;  4GFR A;  2O68 A;  1ZJL A;  3D4G A;  4U1Z A;  4ZEF A;  4G8H A;  3ILT B;  2QJE A;  1SI0 A;  1GR2 A;  2DXY A;  3PV0 E;  4RJZ A;  3G7W A;  2I3V A;  4G8M A;  4JB7 A;  1Q1K A;  1PBP A;  5H8F B;  1HSE A;  1USY H;  1PBQ A;  5I2K A;  5EYF A;  1R9L A;  2F36 A;  1TFA A;  1M5D A;  4ZEI A;  3FXR A;  3IOU A;  1BKA A;  1Y20 A;  3MW0 A;  3U92 A;  4NF6 A;  4OYV A;  4THI A;  1P99 A;  1S50 A;  2XHD A;  3FXU A; 
#chains in the Genus database with same CATH topology
 5AA2 A;  5I58 A;  4X9T A;  3H3G A;  4NX1 A;  4U4X A;  4O7M A;  4GOT A;  3OO7 A;  2R8T A;  1ZLQ A;  1BP5 A;  1LAX A;  1EYI A;  2XX9 A;  3G3K A;  1HSJ A;  1NV5 A;  5H8S A;  5I5P A;  2I3W A;  1LB9 A;  4YB6 A;  4JBZ A;  1IQ7 A;  4KCC A;  2GHA A;  1LBY A;  2O84 X;  1B9J A;  3RTW B;  2HQ0 A;  3SES A;  2H5Y A;  1GGG A;  1II5 A;  4OVT A;  3VE1 B;  1FBE A;  2VHA A;  3S2V A;  3FAS A;  1FBH A;  2XXP A;  4NG7 A;  2WX9 A;  2O69 A;  4ZED A;  3OD7 A;  2NVU B;  3V5A A;  5TU0 A;  3CIJ A;  2L5V A;  3PPO A;  3BBR A;  3EN3 A;  4OVJ A;  3G3F A;  3NOH A;  2NOO A;  2F7B A;  2DYX A;  4PFR A;  3MP8 A;  1D3K A;  4RY1 A;  5AA4 A;  3HO7 A;  2DXR A;  1VDW A;  5CMK A;  3E78 A;  1MM7 A;  2Q88 A;  3EPE A;  5AA1 A;  3T96 B;  1AWB A;  2VD2 A;  3ROJ A;  2RF1 A;  4MEV A;  3LSW A;  2ZNS A;  4QXD A;  2F8D A;  4I3E A;  1M5E A;  3E79 A;  3KOT A;  4GVO A;  2OWS A;  3FAT A;  3IOR A;  1WOD A;  1MY2 A;  1FBP A;  3KSX A;  4F31 B;  4MBP A;  3V8X B;  2W7Y A;  1HSL A;  1ZMG A;  2WKY A;  4DXB A;  4GIZ A;  4RYA A;  5FTI A;  4YMB A;  3TCH A;  2PYY A;  4XFE A;  3KN3 A;  3TAJ A;  5H8N A;  3TQW A;  3T93 B;  4FEB A;  3VFJ A;  1Y3Q A;  3D4C A;  4GWY A;  4GX6 A;  2P3V A;  4TOZ A;  3KSJ A;  4H65 A;  1O64 A;  1FTK A;  3C31 A;  2M8C A;  3MC2 A;  1A7L A;  4AS5 A;  4H8I A;  3IX1 A;  2MKZ A;  4RPN A;  1NNK A;  3MP6 A;  5I57 A;  2XX7 A;  2F7C A;  4R9G A;  1NV6 A;  3KC1 A;  5I2K B;  4UAB A;  1JNF A;  4KXP A;  3SEV A;  1B1H A;  3BIH A;  1SYH A;  1N7W A;  4LQ2 A;  5H8Q B;  1MXU A;  3KBR A;  3M8U A;  2Y7P A;  1LB8 A;  4NF6 B;  3TFL A;  4IGT A;  1B5I A;  1MS7 A;  3S9M C;  2H98 A;  1IME A;  1IUD A;  5AA2 B;  5I58 B;  4OAN A;  3HST A;  4MH5 A;  5FTH A;  3FVN A;  5EQA A;  2B4L A;  2Q2C A;  1ZIU A;  2XWO A;  5ESY A;  5ICT A;  5A5L A;  1IXI A;  5ET5 A;  5DVJ A;  5EHS A;  5TPA B;  1SQY A;  3C34 A;  3Q29 A;  1TFD A;  3FD3 A;  1XVY A;  2P0S A;  2Y7W A;  4RXL A;  2YPN A;  1WVJ A;  5HM4 B;  5IZZ A;  3TZA A;  2HZL A;  1CE2 A;  1MPC A;  3FJM A;  4ZZA A;  1FBD A;  3M3K A;  2O7I A;  2ZXT A;  3C9H A;  3OO8 A;  2CZK A;  3FV2 A;  4H45 A;  4DZ1 A;  4F2O A;  1NUX A;  2GRV A;  4R9F A;  2P2A A;  2VGQ A;  4ONY A;  4WKM A;  3ZKK A;  1TWY A;  5ITO A;  1IMC A;  1NI9 A;  4YMA A;  2F34 A;  2R71 A;  3G3G A;  3O6G A;  4AQ4 A;  4QF9 A;  5I7I A;  3QUJ A;  5AA4 B;  1I6B A;  1N76 A;  4P1E A;  4O3A A;  3H6W A;  4WED A;  3O9P A;  1A54 A;  4ELQ A;  2DWI A;  2HCA A;  1UTH B;  1ATG A;  1POY 1;  1DPE A;  4U2R A;  3IB1 A;  1IZ1 A;  3PUV E;  5CMM A;  2CMO A;  1UTB A;  4PTK A;  4F3P A;  2GQ1 A;  1B3L A;  3FGS A;  3OOA A;  4EQB A;  1LBX A;  5J1D A;  3TOD A;  1T0K A;  1FCK A;  3MZ9 A;  1US4 A;  4F1U A;  4Q30 B;  1JW1 A;  2ZZW A;  3SEX A;  4KI0 E;  2HEU A;  2XWV A;  1JVY A;  5CMC A;  4PFB A;  3KJT A;  2PFY A;  4IO6 A;  1JEU A;  2HXW A;  4F1V A;  4O8M A;  5ET8 A;  4G68 C;  1RDX A;  4LUB A;  1LFI A;  5H8N B;  4C1U A;  3MQ9 A;  3LSL A;  3S9E A;  5DT6 A;  3A29 A;  1MY3 A;  1IXH A;  3QSL A;  3USD A;  3VXB A;  3VV5 A;  3K1N A;  2GHB A;  3VVE A;  4ZE9 A;  2XXT A;  5LTC A;  1TT1 A;  5ELV A;  3HV1 A;  3GLB A;  4DI4 B;  2DDK A;  4HS7 A;  1AIV A;  4FED A;  1B5H A;  5F24 A;  4U22 A;  1MPB A;  2B3F A;  3N94 A;  3LUY A;  5I57 B;  2I58 A;  4JWX A;  2G93 A;  3TQL A;  3CFX A;  3UK4 A;  4QFN A;  1PDA A;  4F3B A;  1DPP A;  3K00 A;  5JEI A;  4NF8 A;  2I49 A;  1OMP A;  1FSA A;  2RC7 A;  4PAF A;  4ND9 A;  2HFB A;  2IEE A;  3CI8 A;  3G3H A;  3K6X A;  3MPL A;  1B4Z A;  3OO9 A;  4AB6 A;  1ANF A;  2DWA A;  3IOW A;  4P1L A;  2OX3 A;  3RPL B;  1B6H A;  3ILU B;  3K1P A;  3C33 A;  4JXI A;  3Q27 A;  1D9Y A;  2RIN A;  4QFP A;  4I62 A;  1MXY A;  3TUS A;  3V83 A;  3D1R A;  3R7X A;  2AL5 A;  2QVV A;  1RYX A;  3O97 A;  1B51 A;  5H8H A;  4OQO A;  2Z22 A;  1EH3 A;  2JJK A;  4H1X A;  4G61 A;  1XHY A;  2QVR A;  4JVD A;  4MNP A;  4GWZ A;  4MMP A;  1AL3 A;  2A5T A;  1FPG A;  4NF4 A;  3O28 A;  2ABH A;  2HHM A;  3SER A;  1UIU A;  2DE3 A;  3SET A;  2ANJ A;  1R6Z A;  2Y7R A;  1CNQ A;  4FIM A;  3Q28 A;  2KQZ A;  2O1L A;  4O3C A;  1MH3 A;  3MVY A;  1LBW A;  1MQD A;  2PVU A;  4PC9 A;  2XXR A;  3L6G A;  3FBP A;  1FQB A;  1P1Q A;  1LBC A;  3H6V A;  3WAE A;  2HXR A;  4YB5 A;  1B7U A;  1NFT A;  1UIV A;  1Q35 A;  3UP9 A;  4GXA A;  1IIT A;  2P1S A;  4X04 A;  3PUY E;  1QVS A;  1FBG A;  4KHZ E;  2O51 A;  5CBS A;  1H3D A;  4U23 A;  4GWW A;  3W15 C;  4XKR A;  1M5B A;  3LSX A;  3TTL A;  1QGX A;  2H99 A;  3MJN A;  3CRB A;  5AE4 A;  1JP4 A;  2FYI A;  1GTK A;  3SKP A;  1VFE A;  4TLL B;  1OIB A;  4P0I A;  4BDL A;  5JK4 A;  4X1B A;  4MNI A;  2DSF A;  1RDY A;  2DE4 A;  3PPP A;  3RQT A;  3MUQ A;  1P1N A;  5DW8 A;  4TQU Q;  3TYH A;  2X26 A;  1SDX A;  4LN5 A;  1VSO A;  2QSX A;  3QMF A;  4GD5 A;  4MJO A;  4NWD A;  1QUL A;  1BTJ A;  1RDZ A;  5L9S A;  2WBB A;  2WBD A;  4OHN A;  4H46 A;  2I48 A;  2ZYN A;  2I4C A;  1NH7 A;  1IXC A;  3PU5 A;  4KPT A;  3HHF A;  4GWO A;  1MQH A;  3Q26 A;  4O94 A;  2CZH A;  4KYE A;  1KA1 A;  1POT A;  3C36 A;  5H8Q A;  3VXC A;  3A3U A;  4HTG A;  3LC8 A;  4FEC A;  2UVI A;  3LV0 A;  1XI6 A;  2XX8 A;  4R2F A;  4IO7 A;  1NUZ A;  1I6Q A;  5JTY A;  1LGB C;  1R9Q A;  2Z8F A;  4PP0 A;  1MQJ A;  3OEK A;  3HHG A;  4PAK A;  2F78 A;  3OXN A;  2RKM A;  4OEU A;  3DEL B;  2FIE A;  1H45 A;  4NF8 B;  1FPK A;  2ZNT A;  5ET7 A;  4QFO A;  4R72 A;  3DP4 A;  5TPA A;  2REJ A;  4ISU A;  3CHG A;  3IAZ A;  4MCO A;  3IO4 A;  3FIR A;  2ZZX A;  2FBP A;  4IR8 A;  5AA3 A;  3K01 A;  5AA2 D;  3RNN A;  1FTM A;  5TP9 A;  3K1M A;  3TEP A;  1FTA A;  2OZZ A;  5H8H B;  3K2D A;  4WEP A;  3RY3 A;  2XXI A;  4GX3 A;  2I4B A;  4OA4 A;  2Y7K A;  4PFT A;  3CFL A;  2A5T B;  4QHQ A;  3DP6 A;  4NF4 B;  4N07 A;  4GBV A;  2QPQ A;  4POW A;  3CG3 A;  2ONK E;  3K6W A;  1O7T A;  5I2N A;  4H8J A;  3KC0 A;  3MBP A;  3O2A A;  4MIJ A;  3AXF A;  1NL5 A;  3PUZ E;  3FVK A;  4R74 A;  1EYK A;  1A8E A;  4YKI A;  2B3B A;  3O66 A;  4ELR A;  3C32 A;  1UTH A;  3PUW E;  4KCD A;  3IO6 A;  1QKB A;  3TCG A;  4KYS A;  3RTF B;  5LOM A;  4BDQ A;  2DS9 A;  2YLN A;  1URS A;  4MAG A;  3VVF A;  1IMA A;  3GYY A;  3HPI A;  3A3C A;  3MVZ A;  3WAF A;  5ET6 A;  4PFU A;  1YYZ A;  4ZZE A;  1MDP 1;  3G3J A;  2Y7I A;  4PF6 A;  1QW0 A;  3DM0 A;  2DVZ A;  4N15 A;  3PPQ A;  3F11 A;  3IOT A;  4R6Y A;  4HCY A;  3VVD A;  1FBF A;  1SW2 A;  3MZB A;  1EZO A;  3S9N C;  5EYG A;  3S9L C;  1NNF A;  5DVI A;  1NNT A;  2THI A;  1NH8 A;  4U1O A;  3RN8 A;  4H0W A;  4DXC A;  3K02 A;  2QFL A;  1XC1 A;  4EXL A;  1VFD A;  1JVX A;  3BFT A;  2DVC A;  1B1X A;  1DK4 A;  1B2H A;  4G4P A;  4R6K A;  1MG1 A;  2CZL A;  4PCD A;  1NV2 A;  3QIM A;  1FJ6 A;  2WEF A;  1Y4T A;  3BKI B;  4BDM A;  1URD A;  2UVJ A;  2XXK A;  3PD9 A;  3V89 B;  4NF5 A;  5IKB A;  1LAG E;  4KQP A;  5DEX B;  4BDR A;  4R75 A;  3B8B A;  4BDO A;  1QUJ A;  2Z8E A;  3RPL A;  1B0L A;  4IY6 A;  1FPD A;  1GV8 A;  5F7V A;  3SEW A;  2AL4 A;  2A5S A;  1Q9D A;  5JTY B;  1Y3P A;  2Q2A A;  4RK9 A;  4G68 A;  4OVP A;  1SVX B;  1FBC A;  3U93 A;  1SYI A;  4OVR A;  4LQ5 A;  3CVG A;  3H4Z A;  3KEI A;  5L8D A;  1QUK A;  2CZI A;  1DCU A;  1B3F A;  5LDZ A;  1VR5 A;  2V4C A;  1N84 A;  4OMB A;  2O6A A;  1B46 A;  2XWI A;  5T3J A;  1H76 A;  4NQ8 A;  4DCY A;  4MLV A;  2CEX A;  5L9M A;  3FXB A;  4EDP A;  2ZNU A;  5TP9 B;  4DDD A;  2QMX A;  1N04 A;  3IR1 A;  2XXH A;  1FPJ A;  2RCB A;  3L6H A;  5IZ3 A;  1KZ8 A;  3OSQ A;  1B3E A;  2ZYO A;  1B3H A;  1NUW A;  1LCT A;  3KN7 A;  4QBA A;  1PEB A;  4ZEK A;  5K2Y A;  1NMU A;  4H67 A;  3PUX E;  4OXV A;  3T9X B;  4FBP A;  5I2N B;  4NED A;  2H9B A;  3I5O A;  1YPN A;  3N5L A;  1QKA A;  2F3B A;  4EXK A;  4UA8 A;  1LST A;  1G0I A;  2F35 A;  4LZ7 A;  2V84 A;  4G77 A;  3UN6 A;  4HCW A;  5HPQ A;  4NMY A;  4XTC Q;  4PF8 A;  1MRP A;  2E1S A;  3PMV A;  3T66 A;  2XXQ A;  1D9V A;  1S7Y A;  3HCQ A;  1B5J A;  3UIF A;  4C0R A;  2OLB A;  3HN0 A;  1YAE A;  3T22 A;  4EF2 A;  4P47 A;  1SI1 A;  3PMW A;  4GL0 A;  3EHS A;  4K3F A;  1IIW A;  1OQG A;  4P8B A;  5L9O A;  2UYE A;  4NWC A;  1Y3N A;  4PGP A;  1LBV A;  1G0H A;  4NAP A;  3T9U A;  4GWX A;  5IM2 A;  2I0B A;  2V3T A;  3O6H A;  1EYJ A;  1OVT A;  4F22 A;  4N81 A;  2V3Q A;  4F3G A;  4IO3 A;  1LFH A;  3TTR A;  3Q25 A;  3IB2 A;  1MY1 A;  1ZKB A;  1NV3 A;  1FQE A;  1LBB A;  4ZE8 A;  2HAV A;  2H4I A;  3B50 A;  4NF5 B;  5IAI A;  2Y5L A;  1SD3 A;  3ODB A;  1FPI A;  4FAT A;  3ONM A;  4YIC A;  2NXO A;  3R26 A;  2DWJ A;  1DBZ A;  2PFZ A;  2PMS A;  2QL3 A;  5DYH A;  4ESW A;  3TKD A;  3EKI A;  3E9X A;  2WYK A;  4JSD A;  4G68 B;  2I6E A;  3O29 A;  5KDT A;  4P11 A;  3N6U A;  4JSO A;  1BIY A;  2ESN A;  4MX6 A;  4QFK A;  4C1T A;  1SW1 A;  1M5C A;  1MPD A;  1SW5 A;  2QS1 A;  2UVG A;  3H06 B;  4MLQ A;  4PAI A;  1IMF A;  2V93 A;  4P9K A;  1INP A;  4GWS A;  4OET A;  2XXX A;  4PFY A;  3M3L A;  4N6P A;  4PDD A;  4PGN A;  1FQC A;  2AIX A;  3JZJ A;  5IZ1 A;  3U94 A;  2D21 A;  4EQ9 A;  4OZ9 A;  3DP8 A;  2QVU A;  3KBZ A;  5IZ3 B;  2QS2 A;  3TDJ A;  3FV1 A;  1CB6 A;  1UQW A;  5EHM A;  3KOS A;  1NUY A;  1Y1Z A;  3SDF A;  4PE5 B;  2F7A A;  1B0H A;  1O63 A;  5B70 A;  1IMB A;  4RK2 A;  2R9J A;  3RT6 B;  3KG2 A;  1JW5 A;  4ELO A;  1FPB A;  4LAT A;  1DMB A;  3PMX A;  5I56 A;  1OVB A;  3FJ7 A;  3KZG A;  4H6D A;  2F6P A;  1LCF A;  2HPG A;  3DLN A;  1FQD A;  2D3I A;  3I3V A;  1YZ0 A;  1SPI A;  3RT8 A;  4ESX A;  1R1N A;  5FHN A;  4R2B A;  3BIG A;  3OEN A;  2PBW A;  4LVQ A;  2Q9T A;  4GRK A;  4R6H A;  2FIX A;  1N0T A;  2BJJ X;  4OFL A;  4ELP A;  1I6A A;  2UVH A;  1FQA A;  1FPL A;  3EQ1 A;  5CC2 A;  1XVX A;  2QS4 A;  1Y4C A;  2ZYK A;  4N13 A;  3THI A;  4X1D A;  3BFU A;  2AYS A;  3R6U A;  5DEX A;  4XKQ A;  3EHU A;  1JEV A;  4KFQ A;  2UXA A;  2Q8J A;  4Q8R A;  2ZZV A;  3TTN A;  3OO6 A;  5FHO A;  3FJG A;  4Z0I A;  1B7Z A;  1A99 A;  2E0S A;  4OER A;  4YB7 A;  4R73 A;  3GZG A;  3TPA A;  5ICQ A;  3KN8 A;  1I69 A;  1NV4 A;  5K2X A;  4G8N A;  1Y1M A;  4YU0 A;  2FHY A;  1XT8 A;  3T0J A;  4AB5 A;  4N4U A;  1PB7 A;  4DIG A;  5I59 A;  2XA5 A;  1NV0 A;  4LA9 A;  3B6W A;  4DE8 A;  5I84 A;  4I9D A;  4RPO A;  2WYP A;  2H25 A;  1PC3 A;  3TTM A;  3N6T A;  2VD3 A;  1AH5 A;  4JDF A;  3PTY A;  3ZKL A;  4Q5T A;  4MFI A;  5DVF A;  2NWJ A;  1SW4 A;  5KDT B;  1N3X A;  4I3Y A;  1LEV A;  4F19 A;  5M2V A;  3SEY A;  4PBQ A;  2CEY A;  5CI5 A;  5A5X A;  3TEL A;  4RNS A;  4PQJ A;  1IXG A;  2OJT A;  3K0V A;  5CRY A;  3JV9 A;  1M5F A;  1PB9 A;  2PX1 A;  1FTL A;  1QJM A;  3RPW A;  3UA8 A;  2Q74 A;  2ONR A;  2XXU A;  3K6U A;  2FVZ A;  4OWD A;  5EQ8 A;  5ISU A;  1AMF A;  2OWZ A;  3RLF E;  2I0C A;  2Q89 A;  1B58 A;  1SBP A;  2Z8D A;  4LZ5 A;  1ELJ A;  3KFM A;  1FRP A;  3TTK A;  3QK6 A;  3FUZ A;  4H5F A;  4PDH A;  2RC9 A;  1B3G A;  2VOZ A;  1P1W A;  4OTE A;  4E0W A;  1AOV A;  3W9W A;  4X8R A;  3MVX A;  4FAJ A;  1XS5 A;  5I56 B;  2HZK A;  3GBA A;  4GLI A;  2IA4 A;  4X48 A;  1RKM A;  1LAF E;  2KLF A;  4H5G A;  4EQ7 A;  1YTV A;  4MNC A;  4N8Y A;  3IFA A;  3T9V A;  3IJX B;  3MST A;  1H43 A;  2KR0 A;  3VDF A;  5I3S A;  4DLD A;  1OLA A;  4MF3 A;  3CFZ A;  2F97 A;  2RC8 A;  1EU8 A;  4MHF A;  2O1M A;  4NF0 A;  1USY E;  1P1O A;  2ZMB A;  3U1O A;  4I8C A;  1KWH A;  4ZDM A;  2ALU A;  5CBR A;  3E4R A;  3GXA A;  1YCJ A;  1MM6 A;  3PD8 A;  5FBP A;  1MY4 A;  2BJI A;  2OWT A;  2R6G E;  4I1D A;  3PPR A;  3I6V A;  4RA1 A;  1XOC A;  3VLW A;  3P7I A;  1LBZ A;  1FTJ A;  4LZ8 A;  3RGY A;  4PFW A;  5BWJ A;  1FJ9 A;  2DWH A;  1DTZ A;  3O6I A;  3MYU A;  1ZU0 A;  4Z7E A;  2XXY A;  1FQF A;  1DSN A;  1MXV A;  3FZV A;  3HFU A;  2V25 A;  1US5 A;  4EUO A;  4BLA A;  3ECR A;  5B7D A;  1D4N A;  4NE4 A;  1NKX A;  3GBB A;  4PFI A;  1BLF A;  1A55 A;  2XD3 A;  4YZZ A;  5I59 B;  3UOR A;  4QFL A;  4ZEC A;  3KJ7 A;  4F18 A;  4N6D A;  4OFJ A;  3IJO B;  3MP1 A;  4EF1 A;  3E3K A;  1MQI A;  3OMB A;  4OVS A;  3LBS A;  1FPF A;  3IB0 A;  4GXS B;  1A8F A;  2VPO A;  4UAC A;  4XIG Q;  4GBW A;  3S4U A;  4BDN A;  4XKP A;  2OBG A;  3FVO A;  3SZP A;  1YXI A;  4YKJ A;  3H6U A;  1H44 A;  3ISP A;  5HBC A;  2LAO A;  1P1U A;  2OCU A;  2VPN A;  4FE8 A;  4JVC A;  3C35 A;  5A5X B;  1LFG A;  1FTO A;  1MY0 A;  4PET A;  3H03 A;  5KCJ A;  1K9Z A;  2GFE A;  3OEM A;  2XXW A;  3W9V A;  4P3L A;  2D5W A;  3OEL A;  3CSB A;  4QSE A;  3QUF A;  3QYT A;  3U8Q A;  2FNC A;  4IO5 A;  5IGA A;  1Z7N E;  2GH9 A;  2RCA A;  4QRZ A;  2PCR A;  5FHM A;  3UGW A;  4XF5 A;  4TLM B;  1OLC A;  3MPK A;  2HAU A;  1Y9U A;  3PGF A;  1ZBM A;  4JWO A;  3KGC A;  4L17 A;  1WDN A;  1JET A;  4KYD A;  1NNP A;  2DP8 A;  4OVQ A;  1MXW A;  1B32 A;  2NUV A;  4XEQ A;  2PT2 A;  2REG A;  1J1N A;  3MWB A;  1N3W A;  1Z7M E;  4ZS9 A;  3SEU A;  4ECF A;  4M1V A;  2DOJ A;  2F3D A;  3C4M A;  1RYO A;  2X7P A;  1MH4 A;  3N26 A;  4O3B A;  3ZSF A;  4N91 A;  1JW4 A;  2XXV A;  3IFC A;  3RUM A;  2Y5K A;  4YAH X;  3CSG A;  4OEV A;  4IB2 A;  4HXV A;  3IL1 B;  1URG A;  4P0G A;  4GWU A;  2F5X A;  4WXJ A;  4OEN A;  3B6T A;  1IEJ A;  3B6Q A;  1GVC A;  3FXQ A;  1TXF A;  4NHB A;  2QS3 A;  5H8F A;  4F3S A;  2X7Q A;  4F39 A;  4N8G A;  5KZT A;  4IO4 A;  4F2Q A;  3ZS6 A;  2ONS A;  1LAH E;  1EZP A;  3TCF A;  3QXM A;  5F1Q A;  4U21 A;  3IK6 B;  1N7X A;  1MXZ A;  4M4G A;  3JYR A;  4KD5 A;  4I40 A;  3U72 A;  1MQG A;  4LP2 B;  4GQO A;  3VLU A;  4XKN A;  5EYH A;  4OFO A;  2UYF A;  2B4M A;  2QMW A;  5BUU A;  3A09 A;  3E13 X;  4POX A;  4Q0C A;  1QUI A;  3PPN A;  4F29 A;  4GL8 A;  3CR9 A;  1F9B A;  3T9H B;  1VE4 A;  2Y84 A;  4YKP A;  4LON B;  4KR5 A;  2PT1 A;  5CMB A;  1DTG A;  1B4H A;  4G2Z A;  3K4U A;  1NV7 A;  4FOR A;  4IGR A;  1JQF A;  1MDQ A;  1ZTY A;  3LSF B;  2DE2 A;  4U4S A;  3U65 A;  3K6V A;  4E0X A;  1K9Y A;  4HW8 A;  1MXX A;  1B7H A;  3CG1 A;  4IO2 A;  4DXU A;  5DTB A;  1PB8 A;  4HE1 A;  3G3I A;  1B52 A;  2VT5 A;  4F1Y A;  3VLV A;  2OK2 A;  2V3U A;  1DOT A;  4PE3 A;  5ITP A;  2B65 A;  1NV1 A;  3QAX A;  1LLS A;  3LR1 A;  4JVI A;  2VP1 A;  5KCJ B;  4DCX A;  3TMG A;  4OES A;  2XD2 A;  4P56 A;  4ZEB A;  3MZ1 A;  1EZ9 A;  1L5T A;  1BK4 A;  3MVW A;  4QSD A;  4FJP A;  4XXU A;  4HE0 A;  2QRY A;  1KA0 A;  2FA7 A;  2Q8M A;  4QSC A;  5CM6 A;  3H7M A;  1B05 A;  3M3F A;  2F6G A;  3EF7 A;  4IY5 A;  4GF8 A;  2ZYM A;  2O7U A;  3MAM A;  1B40 A;  4O7I A;  4NTL A;  5J16 A;  1A40 A;  2P3N A;  2G29 A;  3FVG A;  3OSR A;  3T1B A;  4NN3 A;  1OQH A;  3B7D A;  2Z23 A;  2YJP A;  1S9T A;  1FW0 A;  3IOV A;  3EHT A;  3H6T A;  4NGU A;  1UTB B;  4JWY A;  3RYD A;  2DQV A;  4YKK A;  4GFR A;  2O68 A;  5EQ7 A;  1ZJL A;  3D4G A;  5EQ9 A;  2XWK A;  4U1Z A;  1D9Q A;  4ZEF A;  4G8H A;  3ILT B;  2QJE A;  1SI0 A;  1GR2 A;  2DXY A;  3PV0 E;  4HE2 A;  4RJZ A;  1IMD A;  3G7W A;  4AS4 A;  4JB7 A;  2I3V A;  4G8M A;  1Q1K A;  1PBP A;  5H8F B;  1HSE A;  1USY H;  1PBQ A;  1FPE A;  5I2K A;  5EYF A;  1R9L A;  4N6K A;  2F36 A;  4GX4 A;  4N17 A;  1TFA A;  1M5D A;  4ZEI A;  3FXR A;  3IOU A;  4PBH A;  1BKA A;  1Y20 A;  4DI3 D;  3MW0 A;  3U92 A;  3LUZ A;  4NF6 A;  4OYV A;  4THI A;  1P99 A;  1S50 A;  2XHD A;  3FXU A; 
#chains in the Genus database with same CATH homology
 5AA2 A;  5I58 A;  4X9T A;  3H3G A;  4U4X A;  4GOT A;  3OO7 A;  1ZLQ A;  1BP5 A;  1LAX A;  2XX9 A;  3G3K A;  1HSJ A;  5H8S A;  2I3W A;  1LB9 A;  4YB6 A;  4JBZ A;  1IQ7 A;  4KCC A;  2GHA A;  2O84 X;  1B9J A;  3RTW B;  2HQ0 A;  3SES A;  2H5Y A;  1GGG A;  1II5 A;  3VE1 B;  2VHA A;  3S2V A;  3FAS A;  2XXP A;  2O69 A;  4ZED A;  3OD7 A;  2NVU B;  3V5A A;  5TU0 A;  3CIJ A;  3PPO A;  3BBR A;  3EN3 A;  4OVJ A;  3G3F A;  2NOO A;  2F7B A;  2DYX A;  3MP8 A;  1D3K A;  4RY1 A;  5AA4 A;  3HO7 A;  2DXR A;  5CMK A;  1MM7 A;  2Q88 A;  3EPE A;  5AA1 A;  3T96 B;  2VD2 A;  2RF1 A;  3LSW A;  2ZNS A;  2F8D A;  1M5E A;  3KOT A;  4GVO A;  2OWS A;  3FAT A;  3IOR A;  1WOD A;  1MY2 A;  3KSX A;  4F31 B;  4MBP A;  3V8X B;  2W7Y A;  1HSL A;  1ZMG A;  2WKY A;  4DXB A;  4GIZ A;  4RYA A;  5FTI A;  4YMB A;  3TCH A;  2PYY A;  3KN3 A;  3TAJ A;  5H8N A;  3TQW A;  3T93 B;  4FEB A;  3VFJ A;  1Y3Q A;  3D4C A;  4TOZ A;  3KSJ A;  4H65 A;  1O64 A;  1FTK A;  3C31 A;  2M8C A;  3MC2 A;  1A7L A;  4H8I A;  3IX1 A;  4RPN A;  1NNK A;  3MP6 A;  5I57 A;  2XX7 A;  2F7C A;  4R9G A;  5I2K B;  1JNF A;  3SEV A;  1B1H A;  1SYH A;  1N7W A;  4LQ2 A;  5H8Q B;  1MXU A;  3KBR A;  3M8U A;  2Y7P A;  1LB8 A;  4NF6 B;  3TFL A;  4IGT A;  1B5I A;  1MS7 A;  3S9M C;  2H98 A;  1IUD A;  5AA2 B;  5I58 B;  3HST A;  4MH5 A;  5FTH A;  3FVN A;  2Q2C A;  1ZIU A;  5ICT A;  1IXI A;  5DVJ A;  5EHS A;  5TPA B;  1SQY A;  3C34 A;  3Q29 A;  1TFD A;  3FD3 A;  1XVY A;  2P0S A;  2Y7W A;  4RXL A;  2YPN A;  1WVJ A;  5HM4 B;  3TZA A;  2HZL A;  1CE2 A;  1MPC A;  3FJM A;  4ZZA A;  3M3K A;  2O7I A;  2ZXT A;  3C9H A;  3OO8 A;  3FV2 A;  4DZ1 A;  4F2O A;  2GRV A;  4R9F A;  2P2A A;  2VGQ A;  4ONY A;  4WKM A;  3ZKK A;  1TWY A;  5ITO A;  4YMA A;  2F34 A;  2R71 A;  3G3G A;  3O6G A;  4AQ4 A;  4QF9 A;  3QUJ A;  5AA4 B;  1I6B A;  1N76 A;  4O3A A;  3H6W A;  4WED A;  3O9P A;  1A54 A;  4ELQ A;  2DWI A;  2HCA A;  1UTH B;  1ATG A;  1POY 1;  1DPE A;  4U2R A;  3IB1 A;  1IZ1 A;  3PUV E;  5CMM A;  2CMO A;  1UTB A;  4F3P A;  1B3L A;  3FGS A;  3OOA A;  4EQB A;  5J1D A;  3TOD A;  1T0K A;  1FCK A;  3MZ9 A;  1US4 A;  4F1U A;  4Q30 B;  1JW1 A;  3SEX A;  4KI0 E;  2HEU A;  1JVY A;  5CMC A;  3KJT A;  4IO6 A;  1JEU A;  2HXW A;  4F1V A;  4G68 C;  4LUB A;  1LFI A;  5H8N B;  4C1U A;  3MQ9 A;  3LSL A;  3S9E A;  5DT6 A;  1MY3 A;  1IXH A;  3QSL A;  3USD A;  3VXB A;  3VV5 A;  3K1N A;  2GHB A;  3VVE A;  4ZE9 A;  2XXT A;  1TT1 A;  5ELV A;  3HV1 A;  3GLB A;  4HS7 A;  1AIV A;  4FED A;  1B5H A;  4U22 A;  1MPB A;  2B3F A;  3N94 A;  3LUY A;  5I57 B;  2I58 A;  4JWX A;  2G93 A;  3TQL A;  3CFX A;  3UK4 A;  4QFN A;  1PDA A;  4F3B A;  1DPP A;  3K00 A;  5JEI A;  4NF8 A;  2I49 A;  1OMP A;  2RC7 A;  4ND9 A;  2HFB A;  2IEE A;  3CI8 A;  3G3H A;  3K6X A;  3MPL A;  1B4Z A;  3OO9 A;  4AB6 A;  1ANF A;  2DWA A;  3IOW A;  1B6H A;  3ILU B;  3K1P A;  3C33 A;  4JXI A;  3Q27 A;  1D9Y A;  2RIN A;  4QFP A;  4I62 A;  1MXY A;  3TUS A;  3V83 A;  3R7X A;  2AL5 A;  1RYX A;  3O97 A;  1B51 A;  5H8H A;  4OQO A;  2Z22 A;  1EH3 A;  4H1X A;  1XHY A;  1AL3 A;  2A5T A;  4NF4 A;  3O28 A;  2ABH A;  3SER A;  1UIU A;  2DE3 A;  3SET A;  2ANJ A;  1R6Z A;  2Y7R A;  4FIM A;  3Q28 A;  2O1L A;  4O3C A;  1MH3 A;  3MVY A;  1MQD A;  2PVU A;  2XXR A;  3L6G A;  1FQB A;  1P1Q A;  1LBC A;  3H6V A;  3WAE A;  4YB5 A;  1B7U A;  1NFT A;  1UIV A;  1Q35 A;  3UP9 A;  4GXA A;  1IIT A;  2P1S A;  3PUY E;  1QVS A;  4KHZ E;  2O51 A;  5CBS A;  1H3D A;  4U23 A;  3W15 C;  4XKR A;  1M5B A;  3LSX A;  3TTL A;  2H99 A;  3MJN A;  3CRB A;  5AE4 A;  2FYI A;  1GTK A;  3SKP A;  1VFE A;  4TLL B;  1OIB A;  4P0I A;  4BDL A;  5JK4 A;  4X1B A;  2DSF A;  2DE4 A;  3PPP A;  3RQT A;  3MUQ A;  1P1N A;  4TQU Q;  3TYH A;  2X26 A;  1SDX A;  1VSO A;  2QSX A;  4GD5 A;  4NWD A;  1QUL A;  1BTJ A;  5L9S A;  4OHN A;  2I48 A;  2ZYN A;  2I4C A;  1NH7 A;  1IXC A;  3PU5 A;  4KPT A;  3HHF A;  4GWO A;  1MQH A;  3Q26 A;  4KYE A;  1POT A;  3C36 A;  5H8Q A;  3VXC A;  3A3U A;  4HTG A;  3LC8 A;  4FEC A;  2UVI A;  2XX8 A;  4R2F A;  4IO7 A;  1I6Q A;  5JTY A;  1LGB C;  1R9Q A;  2Z8F A;  4PP0 A;  1MQJ A;  3OEK A;  3HHG A;  2F78 A;  3OXN A;  2RKM A;  4OEU A;  3DEL B;  1H45 A;  4NF8 B;  2ZNT A;  4QFO A;  4R72 A;  3DP4 A;  5TPA A;  2REJ A;  4ISU A;  3IAZ A;  3IO4 A;  3FIR A;  5AA3 A;  3K01 A;  5AA2 D;  3RNN A;  1FTM A;  5TP9 A;  3K1M A;  3TEP A;  2OZZ A;  5H8H B;  3K2D A;  4WEP A;  3RY3 A;  2XXI A;  2I4B A;  2Y7K A;  4PFT A;  3CFL A;  2A5T B;  4QHQ A;  3DP6 A;  4NF4 B;  4N07 A;  2QPQ A;  4POW A;  3CG3 A;  2ONK E;  3K6W A;  1O7T A;  5I2N A;  4H8J A;  3MBP A;  3O2A A;  3AXF A;  1NL5 A;  3PUZ E;  3FVK A;  4R74 A;  1A8E A;  4YKI A;  2B3B A;  3O66 A;  4ELR A;  3C32 A;  1UTH A;  3PUW E;  4KCD A;  3IO6 A;  1QKB A;  3TCG A;  4KYS A;  3RTF B;  5LOM A;  4BDQ A;  2DS9 A;  2YLN A;  1URS A;  3VVF A;  3HPI A;  3A3C A;  3MVZ A;  3WAF A;  4PFU A;  4ZZE A;  1MDP 1;  3G3J A;  2Y7I A;  1QW0 A;  3DM0 A;  2DVZ A;  3PPQ A;  3F11 A;  3IOT A;  4R6Y A;  4HCY A;  3VVD A;  1SW2 A;  3MZB A;  1EZO A;  3S9N C;  3S9L C;  1NNF A;  5DVI A;  1NNT A;  2THI A;  1NH8 A;  4U1O A;  3RN8 A;  4H0W A;  4DXC A;  3K02 A;  1XC1 A;  4EXL A;  1VFD A;  1JVX A;  3BFT A;  2DVC A;  1B1X A;  1B2H A;  4G4P A;  1MG1 A;  2CZL A;  4R6K A;  3QIM A;  1Y4T A;  3BKI B;  4BDM A;  1URD A;  2UVJ A;  3PD9 A;  3V89 B;  4NF5 A;  5IKB A;  1LAG E;  4KQP A;  5DEX B;  4BDR A;  4R75 A;  4BDO A;  1QUJ A;  2Z8E A;  1B0L A;  4IY6 A;  1GV8 A;  5F7V A;  3SEW A;  2AL4 A;  2A5S A;  5JTY B;  1Y3P A;  2Q2A A;  4RK9 A;  4G68 A;  3U93 A;  1SVX B;  1SYI A;  4LQ5 A;  3CVG A;  3H4Z A;  3KEI A;  5L8D A;  1QUK A;  1B3F A;  1VR5 A;  1N84 A;  4OMB A;  2O6A A;  1B46 A;  1H76 A;  4DCY A;  4MLV A;  5L9M A;  4EDP A;  2ZNU A;  5TP9 B;  4DDD A;  2QMX A;  1N04 A;  3IR1 A;  2XXH A;  2RCB A;  3L6H A;  3OSQ A;  1B3E A;  2ZYO A;  1B3H A;  1LCT A;  3KN7 A;  1PEB A;  4ZEK A;  5K2Y A;  1NMU A;  4H67 A;  3PUX E;  4OXV A;  3T9X B;  5I2N B;  4NED A;  2H9B A;  3I5O A;  1YPN A;  3N5L A;  1QKA A;  4EXK A;  4UA8 A;  1LST A;  2F35 A;  4LZ7 A;  2V84 A;  4G77 A;  3UN6 A;  4HCW A;  5HPQ A;  4NMY A;  4XTC Q;  1MRP A;  2E1S A;  3PMV A;  3T66 A;  2XXQ A;  1D9V A;  1S7Y A;  3HCQ A;  1B5J A;  3UIF A;  4C0R A;  2OLB A;  3HN0 A;  1YAE A;  3T22 A;  4EF2 A;  1SI1 A;  3PMW A;  4GL0 A;  3EHS A;  4K3F A;  1IIW A;  1OQG A;  5L9O A;  2UYE A;  4NWC A;  1Y3N A;  3T9U A;  2I0B A;  2V3T A;  3O6H A;  1OVT A;  4F22 A;  2V3Q A;  4F3G A;  4IO3 A;  1LFH A;  3TTR A;  3Q25 A;  3IB2 A;  1MY1 A;  1ZKB A;  1FQE A;  1LBB A;  4ZE8 A;  2HAV A;  2H4I A;  4NF5 B;  5IAI A;  1SD3 A;  3ODB A;  4FAT A;  3ONM A;  4YIC A;  2NXO A;  3R26 A;  2DWJ A;  2PMS A;  2QL3 A;  5DYH A;  4ESW A;  3TKD A;  3E9X A;  4JSD A;  4G68 B;  2I6E A;  3O29 A;  5KDT A;  4P11 A;  3N6U A;  4JSO A;  1BIY A;  2ESN A;  4QFK A;  4C1T A;  1SW1 A;  1M5C A;  1MPD A;  1SW5 A;  2QS1 A;  2UVG A;  3H06 B;  4MLQ A;  2V93 A;  4OET A;  2XXX A;  4PFY A;  3M3L A;  4N6P A;  1FQC A;  2AIX A;  3JZJ A;  3U94 A;  2D21 A;  4EQ9 A;  4OZ9 A;  3DP8 A;  2QS2 A;  3TDJ A;  3FV1 A;  1CB6 A;  1UQW A;  5EHM A;  3KOS A;  1Y1Z A;  3SDF A;  4PE5 B;  2F7A A;  1B0H A;  1O63 A;  5B70 A;  4RK2 A;  2R9J A;  3RT6 B;  3KG2 A;  1JW5 A;  4ELO A;  4LAT A;  1DMB A;  3PMX A;  5I56 A;  1OVB A;  3FJ7 A;  3KZG A;  4H6D A;  2F6P A;  1LCF A;  3DLN A;  1FQD A;  2D3I A;  3I3V A;  3RT8 A;  4ESX A;  1R1N A;  5FHN A;  4R2B A;  3OEN A;  2PBW A;  4LVQ A;  2Q9T A;  4GRK A;  4R6H A;  1N0T A;  2BJJ X;  4OFL A;  4ELP A;  1I6A A;  2UVH A;  1FQA A;  3EQ1 A;  5CC2 A;  1XVX A;  2QS4 A;  1Y4C A;  2ZYK A;  4N13 A;  3THI A;  4X1D A;  3BFU A;  2AYS A;  3R6U A;  5DEX A;  4XKQ A;  3EHU A;  1JEV A;  4KFQ A;  2UXA A;  2Q8J A;  4Q8R A;  3TTN A;  3OO6 A;  5FHO A;  3FJG A;  4Z0I A;  1B7Z A;  1A99 A;  2E0S A;  4OER A;  4YB7 A;  4R73 A;  3GZG A;  3TPA A;  5ICQ A;  3KN8 A;  1I69 A;  5K2X A;  4G8N A;  1Y1M A;  4YU0 A;  1XT8 A;  4AB5 A;  1PB7 A;  4DIG A;  5I59 A;  4LA9 A;  3B6W A;  4DE8 A;  5I84 A;  4I9D A;  4RPO A;  2H25 A;  1PC3 A;  3TTM A;  3N6T A;  2VD3 A;  1AH5 A;  4JDF A;  3ZKL A;  4Q5T A;  4MFI A;  5DVF A;  2NWJ A;  1SW4 A;  5KDT B;  1N3X A;  4F19 A;  5M2V A;  3SEY A;  5CI5 A;  5A5X A;  3TEL A;  4RNS A;  4PQJ A;  1IXG A;  2OJT A;  3K0V A;  5CRY A;  3JV9 A;  1M5F A;  1PB9 A;  2PX1 A;  1FTL A;  1QJM A;  3RPW A;  3UA8 A;  2ONR A;  2XXU A;  3K6U A;  4OWD A;  5ISU A;  1AMF A;  3RLF E;  2I0C A;  2Q89 A;  1B58 A;  1SBP A;  2Z8D A;  4LZ5 A;  1ELJ A;  3KFM A;  3TTK A;  3QK6 A;  3FUZ A;  4H5F A;  2RC9 A;  1B3G A;  2VOZ A;  1P1W A;  4OTE A;  4E0W A;  1AOV A;  3W9W A;  3MVX A;  4FAJ A;  1XS5 A;  5I56 B;  2HZK A;  3GBA A;  4GLI A;  2IA4 A;  4X48 A;  1RKM A;  1LAF E;  2KLF A;  4H5G A;  4EQ7 A;  1YTV A;  3T9V A;  3IJX B;  1H43 A;  3VDF A;  4DLD A;  1OLA A;  4MF3 A;  3CFZ A;  2F97 A;  2RC8 A;  1EU8 A;  2O1M A;  1USY E;  1P1O A;  2ZMB A;  3U1O A;  4I8C A;  1KWH A;  4ZDM A;  2ALU A;  5CBR A;  3E4R A;  3GXA A;  1YCJ A;  1MM6 A;  3PD8 A;  1MY4 A;  2OWT A;  2R6G E;  4I1D A;  3PPR A;  3I6V A;  4RA1 A;  1XOC A;  3VLW A;  3P7I A;  1FTJ A;  4LZ8 A;  3RGY A;  4PFW A;  5BWJ A;  2DWH A;  1DTZ A;  3O6I A;  1ZU0 A;  4Z7E A;  2XXY A;  1FQF A;  1DSN A;  1MXV A;  3FZV A;  2V25 A;  1US5 A;  4EUO A;  4BLA A;  3ECR A;  5B7D A;  1D4N A;  4NE4 A;  1NKX A;  3GBB A;  1BLF A;  1A55 A;  2XD3 A;  4YZZ A;  5I59 B;  3UOR A;  4QFL A;  4ZEC A;  3KJ7 A;  4F18 A;  4OFJ A;  3IJO B;  3MP1 A;  4EF1 A;  3E3K A;  1MQI A;  3OMB A;  3LBS A;  3IB0 A;  4GXS B;  1A8F A;  4UAC A;  4XIG Q;  3S4U A;  4BDN A;  4XKP A;  2OBG A;  3FVO A;  4YKJ A;  3H6U A;  1H44 A;  5HBC A;  2LAO A;  1P1U A;  2OCU A;  4FE8 A;  3C35 A;  5A5X B;  1LFG A;  1FTO A;  1MY0 A;  4PET A;  3H03 A;  5KCJ A;  2GFE A;  3OEM A;  2XXW A;  3W9V A;  2D5W A;  3OEL A;  3CSB A;  4QSE A;  3QUF A;  3QYT A;  3U8Q A;  2FNC A;  4IO5 A;  1Z7N E;  2GH9 A;  2RCA A;  4QRZ A;  5FHM A;  3UGW A;  4TLM B;  1OLC A;  3MPK A;  2HAU A;  1Y9U A;  3PGF A;  1ZBM A;  4JWO A;  3KGC A;  4L17 A;  1WDN A;  1JET A;  4KYD A;  1NNP A;  2DP8 A;  1MXW A;  1B32 A;  2NUV A;  2PT2 A;  2REG A;  1J1N A;  3MWB A;  1N3W A;  1Z7M E;  4ZS9 A;  3SEU A;  4ECF A;  4M1V A;  2DOJ A;  3C4M A;  1RYO A;  2X7P A;  1MH4 A;  3N26 A;  4O3B A;  3ZSF A;  1JW4 A;  2XXV A;  3RUM A;  4YAH X;  3CSG A;  4OEV A;  4IB2 A;  3IL1 B;  1URG A;  4P0G A;  2F5X A;  4WXJ A;  4OEN A;  3B6T A;  1IEJ A;  3B6Q A;  1GVC A;  3FXQ A;  1TXF A;  2QS3 A;  5H8F A;  4F3S A;  2X7Q A;  4F39 A;  5KZT A;  4IO4 A;  4F2Q A;  3ZS6 A;  2ONS A;  1LAH E;  1EZP A;  3TCF A;  3QXM A;  5F1Q A;  4U21 A;  3IK6 B;  1N7X A;  1MXZ A;  4M4G A;  3JYR A;  4KD5 A;  3U72 A;  1MQG A;  4LP2 B;  4GQO A;  3VLU A;  4XKN A;  4OFO A;  2UYF A;  2QMW A;  5BUU A;  3A09 A;  3E13 X;  4POX A;  4Q0C A;  1QUI A;  3PPN A;  4F29 A;  4GL8 A;  3CR9 A;  1F9B A;  3T9H B;  1VE4 A;  2Y84 A;  4YKP A;  4LON B;  4KR5 A;  2PT1 A;  5CMB A;  1DTG A;  1B4H A;  4G2Z A;  3K4U A;  4FOR A;  4IGR A;  1JQF A;  1MDQ A;  1ZTY A;  3LSF B;  2DE2 A;  4U4S A;  3K6V A;  4E0X A;  4HW8 A;  1MXX A;  1B7H A;  3CG1 A;  4IO2 A;  4DXU A;  5DTB A;  1PB8 A;  3G3I A;  1B52 A;  4F1Y A;  3VLV A;  2OK2 A;  2V3U A;  1DOT A;  5ITP A;  2B65 A;  3QAX A;  1LLS A;  3LR1 A;  2VP1 A;  5KCJ B;  4DCX A;  3TMG A;  4OES A;  2XD2 A;  4ZEB A;  3MZ1 A;  1EZ9 A;  1L5T A;  3MVW A;  4QSD A;  4FJP A;  4XXU A;  2QRY A;  2FA7 A;  4QSC A;  5CM6 A;  3H7M A;  1B05 A;  3M3F A;  2F6G A;  3EF7 A;  4IY5 A;  4GF8 A;  2ZYM A;  2O7U A;  3MAM A;  1B40 A;  4NTL A;  1A40 A;  2G29 A;  3FVG A;  3OSR A;  1OQH A;  3B7D A;  2Z23 A;  2YJP A;  1S9T A;  1FW0 A;  3IOV A;  3EHT A;  3H6T A;  1UTB B;  4JWY A;  2DQV A;  4YKK A;  4GFR A;  2O68 A;  1ZJL A;  3D4G A;  4U1Z A;  4ZEF A;  4G8H A;  3ILT B;  2QJE A;  1SI0 A;  1GR2 A;  2DXY A;  3PV0 E;  4RJZ A;  3G7W A;  2I3V A;  4G8M A;  4JB7 A;  1Q1K A;  1PBP A;  5H8F B;  1HSE A;  1USY H;  1PBQ A;  5I2K A;  5EYF A;  1R9L A;  2F36 A;  1TFA A;  1M5D A;  4ZEI A;  3FXR A;  3IOU A;  1BKA A;  1Y20 A;  3MW0 A;  3U92 A;  4NF6 A;  4OYV A;  4THI A;  1P99 A;  1S50 A;  2XHD A;  3FXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...