3TTKA

Crystal structure of apo-spud
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
340
structure length
340
Chain Sequence
DNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyamine transport protein
publication title Structural Basis of Substrate Binding Specificity Revealed by the Crystal Structures of Polyamine Receptors SpuD and SpuE from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 116
structure length 340
sequence length 340
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttkA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ttkA02
1LBCA 3CFLA 3DLNA 2Z23A 2OLBA 3BKIB 3OO8A 1GTKA 1B32A 3TQLA 4GXAA 4R74A 1PBQA 5DVJA 4QF9A 5FTHA 4KYEA 2H98A 4O3BA 4U23A 2DXRA 3SEXA 4OZ9A 5HBCA 1ZLQA 3T9VA 4EXKA 2ZNTA 3CIJA 1A8FA 3E3KA 4M1VA 4IO7A 3OO7A 1MXWA 4EQ7A 3IX1A 1SW4A 2XXPA 1MXXA 3O29A 1PB9A 4ZS9A 1NFTA 5IKBA 5I58B 3SEYA 4FAJA 1LLSA 2AIXA 1HSJA 2ANJA 4NEDA 3RUMA 3L6HA 2VP1A 5DVFA 3EF7A 2ONKE 5AA1A 1ZJLA 1B1XA 1B1HA 2DS9A 1XT8A 5H8HB 5TP9A 3TZAA 1D4NA 1SW5A 3K1PA 2KLFA 2I0BA 1IITA 3GBBA 3R6UA 5L9SA 1Y9UA 1N3XA 3IO6A 3K6VA 2DWJA 4ONYA 3Q26A 3FJ7A 1DSNA 1JW4A 4KQPA 2ZXTA 5CMBA 4FIMA 3OSRA 1UTBA 1R9QA 1FTOA 1NKXA 2OZZA 1B3HA 2A5TA 3O9PA 1IUDA 1LBBA 4F1VA 3ILUB 1MY0A 3U1OA 5I57B 2DVCA 1D9YA 3PU5A 5AA4B 4G68B 3TTNA 4FJPA 1POY1 5DYHA 1N7WA 4Z7EA 1MQHA 3M3LA 3ILTB 1B46A 3M8UA 3HHFA 1Y1ZA 4F1UA 5A5XB 3PUWE 4GFRA 1S9TA 4WKMA 4GD5A 3LSLA 1YPNA 4DLDA 4NF8B 2ZYNA 3GXAA 3FVNA 4XXUA 4HS7A 4HW8A 3LUYA 4GF8A 1SVXB 3VE1B 1LFGA 2QSXA 3K00A 2RF1A 1OLAA 4NWCA 3VVDA 4RNSA 3O66A 1A54A 2F97A 4U4XA 3EN3A 1BIYA 3HCQA 4QFKA 4OETA 4IY6A 4X1DA 3ODBA 1UQWA 4F3PA 4OFJA 2VD3A 2H9BA 5J1DA 3RNNA 2CMOA 1Y3QA 2DE4A 2DXYA 1P99A 1M5CA 1SW2A 2QPQA 2V84A 1B4ZA 1WVJA 3QUJA 3V83A 1FW0A 4DCXA 5EHSA 4G4PA 4BDMA 1XS5A 1ZIUA 3T96B 3SESA 3FZVA 4OWDA 2RC8A 3TCHA 4AB6A 1DPEA 1OVTA 3H6VA 1MXZA 4YKIA 5H8SA 5H8NB 3PD8A 1AL3A 2XXHA 1B5IA 4PQJA 1URGA 1Q35A 2I58A 2AYSA 4YICA 4IGTA 2ZYMA 2PVUA 4ZEIA 1SYHA 3PD9A 4OTEA 3T22A 2NVUB 3IAZA 4KD5A 1QUIA 4OENA 4YMAA 2D21A 3PPPA 3L6GA 2QMWA 2R71A 4THIA 1LAGE 4X1BA 1B6HA 4F22A 4DCYA 5K2XA 4G8HA 4IGRA 1NNPA 1URSA 2UXAA 2UVIA 2O7UA 4U22A 1N04A 1VSOA 1M5EA 5KDTA 2O51A 3B7DA 4R73A 1LAXA 4FECA 1H3DA 4DXBA 4QFLA 4Q8RA 1GVCA 1ZKBA 2A5TB 1UIUA 4EF1A 3TPAA 2XXIA 3CR9A 5DEXA 2XD2A 3V5AA 3VLUA 2VD2A 5FHMA 3CFZA 1AMFA 1QJMA 4R6YA 5FHNA 1MPCA 1US4A 4R2FA 4BDRA 1SDXA 3H4ZA 2QJEA 1NL5A 2DVZA 3H6TA 1UTHB 3C33A 1I6QA 3SEUA 3IOTA 5BWJA 3C9HA 2NOOA 3DM0A 3OENA 1MM6A 1WDNA 3PGFA 1EH3A 1XHYA 4KI0E 4QHQA 4R2BA 3PPRA 1MQDA 4U21A 2UVJA 4Q0CA 1SW1A 1EZOA 2OWTA 1H44A 2I3VA 3PMWA 3UK4A 5I58A 1VFDA 3VLVA 2DSFA 1MXUA 4TLLB 1JEVA 2I3WA 2B3FA 4IO6A 2HZLA 1B3GA 4WEDA 2YJPA 3RT6B 2RKMA 1LB8A 5H8HA 3DP6A 2Q9TA 2HAVA 3O2AA 3ZS6A 5CI5A 1Y1MA 2RC7A 3TODA 2DWAA 4NWDA 1PC3A 3KOSA 1JW5A 2O7IA 4JWYA 1FQDA 2IA4A 2QMXA 2F78A 4OEVA 4TQUQ 3S2VA 3TQWA 2Y7WA 3U92A 3MVXA 3KJ7A 1B05A 4XKPA 3TTMA 1Z7ME 3S9MC 4EUOA 3ONMA 3BFTA 2O84X 1RYOA 2RCBA 3A3UA 4O3AA 3FXQA 4P0IA 5I2KB 4NMYA 4DIGA 3LR1A 3TTRA 4FEBA 5H8FB 4KHZE 3K1NA 4X9TA 5AA4A 4G68A 1H43A 2REJA 4H8IA 3C35A 5FTIA 4R6KA 2Y7IA 4G2ZA 1MQJA 3THIA 2ESNA 3K0VA 2VHAA 4ND9A 4JSDA 3IOUA 5A5XA 3RT8A 4DZ1A 4IO5A 2ZNSA 5AA2B 3TTLA 4NF8A 1XVYA 3B6WA 4FE8A 2HXWA 2P1SA 4ZEDA 5H8QA 2OBGA 3OD7A 3TYHA 3FVOA 2G29A 4GWOA 2E0SA 1Z7NE 2I0CA 1BP5A 3H6WA 2V3QA 2A5SA 3TCFA 2PBWA 2XXXA 1Y4TA 5DEXB 4POWA 4UA8A 5FHOA 2DP8A 1A55A 1N84A 3QAXA 1YTVA 1MY3A 3SEVA 3FATA 3HHGA 5AA2D 2F6PA 5IAIA 3F11A 4H5FA 4F2OA 1DMBA 2H5YA 1IZ1A 3HV1A 4C1TA 1N3WA 3A3CA 3TAJA 1MQGA 4OHNA 3C34A 3LSWA 5ICQA 1OQHA 4AQ4A 4NF4A 4LP2B 1N76A 1P1QA 2UVGA 3UP9A 4ZZEA 4QFNA 2F7CA 5H8NA 2RCAA 3TEPA 1MXVA 3MP6A 5TU0A 1LSTA 3K1MA 2DWHA 3SEWA 2H25A 2Q8JA 3R7XA 1O7TA 2H99A 1VE4A 3IOWA 3KSXA 4KPTA 1EU8A 2NXOA 4YMBA 4ZDMA 3DP8A 1SD3A 4LA9A 4E0XA 2Q89A 3M3KA 4ZEFA 1VR5A 3VVEA 2Z22A 3E13X 1A7LA 1SI0A 4I1DA 1BTJA 1ELJA 1KWHA 1SYIA 1UIVA 3IL1B 3QUFA 4YB6A 3KFMA 4LONB 2DQVA 4BDNA 3I3VA 3B6TA 1B52A 2GHBA 1A99A 1IXCA 4FATA 1B3EA 3TKDA 3FV2A 4I8CA 4LATA 5CBSA 1P1OA 4MLQA 1PB7A 4U2RA 3H03A 3HN0A 1P1UA 4RK2A 2D5WA 4FORA 3FJGA 4EQ9A 5LOMA 3O97A 1WODA 1UTHA 1EZ9A 4K3FA 4XIGQ 3IOVA 3UIFA 1TFAA 4JB7A 3MZ9A 1FQBA 3SETA 4MF3A 1Q1KA 3SDFA 3MC2A 3TDJA 4C1UA 2DE2A 5H8QB 5K2YA 2QL3A 3EPEA 3G7WA 4G8NA 4YB5A 5L9MA 2HEUA 3UORA 4BLAA 2ALUA 4LVQA 2QS1A 1R9LA 4XKQA 2B3BA 4YU0A 2D3IA 4ECFA 4BDLA 1B4HA 5F7VA 3S9EA 1QULA 4ZEBA 1TWYA 3FV1A 3CG1A 3MZBA 5DT6A 3T9XB 4PFUA 3EHUA 5DVIA 5ITOA 1S7YA 3H7MA 2Q2AA 3IB2A 3CVGA 5ITPA 2F5XA 2R6GE 3W9VA 3AXFA 4UACA 3W9WA 2CZLA 2F34A 4ZE8A 4GQOA 4E0WA 5EHMA 1RKMA 4NF4B 1B2HA 1XC1A 1I6BA 3FGSA 2GHAA 2XXRA 4ESXA 1M5BA 3K4UA 3O6HA 3CFXA 2QRYA 3E9XA 4G77A 1A40A 1IXGA 2OJTA 2Z8EA 3A09A 3OELA 3PMXA 5I2KA 5H8FA 4ZZAA 3G3GA 3KJTA 2V25A 2XXUA 1MDQA 4RYAA 1GR2A 3CSBA 4MH5A 2HQ0A 3JZJA 3UGWA 4HCWA 3QYTA 5I2NA 4NF6B 3G3IA 3N5LA 1FTKA 1IEJA 1FQAA 1JEUA 2Z8DA 4EF2A 5ELVA 1ZTYA 1I6AA 2AL4A 1MH3A 5AA2A 3G3KA 1VFEA 2DWIA 2O1LA 1QUJA 3G3HA 4Q30B 4OFOA 1FTLA 1NMUA 2RC9A 3OO9A 2P0SA 4QFPA 1OIBA 1NH8A 3MVZA 3H3GA 3V8XB 2O69A 4P0GA 5F1QA 4R75A 2X26A 3O28A 4DXUA 3T93B 3IB0A 5KCJA 1AH5A 3IB1A 4LQ5A 3G3FA 3DP4A 3FVGA 2XXVA 4R72A 4H6DA 1YCJA 2ZYOA 2QS3A 3LSXA 2LAOA 3C36A 4EQBA 1USYE 4F19A 5ICTA 4LZ7A 4OFLA 3TCGA 3PUYE 3MVWA 4ELOA 3OXNA 1Y4CA 1GV8A 2THIA 2Q2CA 3IJOB 1B7HA 4GRKA 3MPKA 3OEMA 3ZSFA 2GFEA 3OO6A 2DYXA 2IEEA 4PP0A 1MY4A 1OLCA 3KBRA 1JETA 3Q29A 5JEIA 3N6TA 5CMCA 4ZE9A 3S9NC 2HFBA 1FTJA 4ELRA 3S9LC 4PFTA 1EZPA 3C4MA 3VLWA 1ZU0A 3QK6A 4R9FA 5BUUA 3C31A 1P1NA 1LCTA 2RINA 4QSDA 1XVXA 3GBAA 5L8DA 4DDDA 4G8MA 3Q27A 4IO4A 4RJZA 4F3GA 2NWJA 3RTWB 3U93A 3PUVE 1AIVA 4YKKA 1IXHA 1OMPA 4OXVA 3OEKA 1LAFE 1MY1A 3KG2A 3EHSA 4GLIA 4HTGA 4JWXA 1I69A 1OQGA 5I2NB 3VVFA 5JTYA 1R6ZA 4OMBA 4YZZA 1LFIA 1R1NA 4MLVA 2XXYA 3D4GA 1QKBA 2Y7KA 1CE2A 4KFQA 1B5JA 4N6PA 4F31B 4IY5A 1QVSA 1FCKA 2AL5A 4YB7A 1B58A 2M8CA 1NH7A 1AOVA 1DTZA 2HAUA 3PPOA 2PT1A 3MW0A 1MRPA 1SI1A 3TUSA 5L9OA 1FQCA 3T9HB 1GGGA 4F29A 3TELA 1XOCA 1B5HA 4H67A 1FQFA 4FEDA 4L17A 4JBZA 2O6AA 3PPNA 4RA1A 5KCJB 4YAHX 1IXIA 1PB8A 4H8JA 3I5OA 3DELB 1MY2A 3O6GA 4R6HA 3U72A 1A8EA 3MQ9A 4QSEA 3R26A 3RY3A 4U4SA 2XXQA 3PUXE 3QIMA 2GH9A 3IK6B 3C32A 4NTLA 4TOZA 1MDP1 1B7ZA 3MAMA 4JSOA 5I59A 4DXCA 1LFHA 3HPIA 4PETA 2REGA 2WKYA 3P7IA 1YAEA 5I56B 4ZEKA 3WAEA 2I49A 4RPOA 5HPQA 2HCAA 1PEBA 4IB2A 3Q28A 3N6UA 3I6VA 3MP1A 1O64A 3IORA 2P2AA 4H65A 4JDFA 4EDPA 4JWOA 1PBPA 1LAHE 4NF6A 4I62A 2PT2A 2F7BA 4KYSA 3W15C 3K6XA 4Z0IA 2VGQA 2DOJA 4NE4A 2DE3A 3EHTA 4ZECA 2OK2A 3TTKA 3VXCA 4GL0A 1FTMA 4IO3A 5TPAA 3B6QA 2F8DA 1N0TA 1JQFA 4LZ8A 4RY1A 4C0RA 4LQ2A 4O3CA 3CI8A 1HSLA 3SKPA 3KN8A 1SQYA 2QS4A 1Y20A 1QW0A 3MZ1A 4KCDA 1MPBA 1B0HA 3H06B 3ZKLA 5HM4B 3K01A 2Q88A 3N94A 1TT1A 2FNCA 2XXTA 1JW1A 4YKPA 3FJMA 5JTYB 4GL8A 3FIRA 3RN8A 3U8QA 1N7XA 4XKRA 2V3UA 4F3BA 1QUKA 2I6EA 2I4BA 1IQ7A 1Y3NA 4U1ZA 4N13A 2UYFA 1MPDA 1B7UA 3USDA 3N26A 3KOTA 1DOTA 3MBPA 3M3FA 3PUZE 4H5GA 4XKNA 5AA3A 1MXYA 1B3FA 2UVHA 5I84A 3UA8A 1P1WA 2XHDA 4GXSB 1ZMGA 3HSTA 4F18A 2V93A 4WXJA 4NF5A 1D3KA 3RGYA 4GOTA 3OMBA 4I9DA 4TLMB 5DTBA 3FXRA 1II5A 4OVJA 4Q5TA 1D9VA 3FVKA 4PE5B 3T66A 2F7AA 4OERA 1LB9A 3E4RA 1MQIA 2FA7A 2GRVA 5ISUA 2XX7A 2O1MA 3G3JA 3VFJA 5I59B 4F2QA 4YKJA 3SERA 4ELQA 1F9BA 3ECRA 2Y7PA 3OOAA 3Q25A 1HSEA 4HCYA 3GLBA 3WAFA 2G93A 1QKAA 3RQTA 3UN6A 5CBRA 3H6UA 2Y7RA 1LCFA 2YLNA 1DPPA 3FXUA 4ISUA 3LBSA 3MWBA 1NNFA 1NNKA 3KSJA 4RXLA 1H76A 3GZGA 1MG1A 2XX8A 4X48A 1B51A 3PMVA 3MPLA 5TP9B 3D4CA 5JK4A 1RYXA 5TPAB 3LSFB 3O6IA 4R9GA 3MJNA 3BFUA 4U1OA 2Z8FA 3KGCA 3CRBA 4P11A 1S50A 1B0LA 4AB5A 4F1YA 1IIWA 3EQ1A 3OSQA 2XX9A 4N07A 1POTA 1SBPA 3RPWA 1MS7A 2OCUA 1UTBB 1M5FA 5CMKA 5KZTA 3JYRA 2BJJX 2Y84A 3VV5A 3HO7A 3KN3A 4F3SA 3BBRA 3MP8A 2PMSA 3PPQA 4DE8A 3K6UA 3IJXB 4KR5A 4EXLA 4ELPA 1PDAA 4MFIA 2OWSA 1NNTA 2NUVA 4KCCA 2X7PA 4BDOA 1BKAA 4F39A 4IO2A 1B40A 2ABHA 2ZYKA 2ONRA 3PV0E 1US5A 3KN7A 4OEUA 3QSLA 2X7QA 3K02A 5M2VA 2VOZA 1JVXA 2H4IA 4LZ5A 5I56A 4NF5B 5CC2A 5AE4A 4MBPA 1DTGA 4G68C 1USYH 3MVYA 4POXA 3FUZA 1ATGA 2YPNA 2R9JA 2ZNUA 3KZGA 2B65A 5CMMA 2UYEA 3RLFE 1L5TA 1LGBC 2ONSA 4H0WA 1JVYA 4OQOA 3MUQA 3VDFA 3S4UA 4GVOA 3V89B 1T0KA 4GIZA 1BLFA 4H1XA 1MM7A 1CB6A 4QSCA 4WEPA 2O68A 3JV9A 4QRZA 5CRYA 2I4CA 2FYIA 3KEIA 3K2DA 5B70A 1URDA 3VXBA 1ANFA 2QS2A 1B3LA 1B9JA 4PFYA 1J1NA 2W7YA 1OVBA 1MH4A 2ZMBA 1Y3PA 5EYFA 3U94A 2F36A 2F35A 3CSGA 2E1SA 4RK9A 4XTCQ 2HZKA 1ZBMA 4BDQA 2F6GA 5I57A 3IO4A 5CM6A 4PFWA 4OESA 3CG3A 3FD3A 1JNFA 4QFOA 3T9UA 3TMGA 2I48A 1TXFA 3FASA 4KYDA 3K6WA 4JXIA 3RTFB 3TFLA 2XXWA 5B7DA 2V3TA 4OYVA 1O63A 1FQEA 3QXMA 1TFDA 1H45A 5KDTB 1M5DA 4RPNA 2PYYA 4ESWA 3ZKKA 3LC8A 3IR1A 2XD3A 4LUBA 4M4GA 2PX1A
chains in the Genus database with same CATH superfamily
1FBHA 1LBCA 3CFLA 1K9ZA 3DLNA 2QVVA 2Z23A 2OLBA 3BKIB 3OO8A 1GTKA 1B32A 3TQLA 4GXAA 4NN3A 4R74A 1PBQA 4PGPA 5DVJA 4QF9A 5FTHA 4KYEA 2H98A 4O3BA 2PFZA 1AWBA 4U23A 2DXRA 3SEXA 4DI3D 4OZ9A 5HBCA 1ZLQA 3T9VA 4EXKA 2ZNTA 3CIJA 1A8FA 3E3KA 4M1VA 4IO7A 3OO7A 1MXWA 4EQ7A 3IX1A 4MCOA 1SW4A 4X8RA 2XXPA 3ROJA 1MXXA 3O29A 1PB9A 4ZS9A 1NFTA 4IR8A 5IKBA 4HXVA 1NV2A 5I58B 3SEYA 4FAJA 1LLSA 2AIXA 1HSJA 2ANJA 4N91A 4NEDA 3RUMA 3L6HA 2VP1A 5DVFA 3EF7A 2ONKE 5AA1A 1ZJLA 1B1XA 1B1HA 2DS9A 1XT8A 5H8HB 3KC0A 1YZ0A 5TP9A 3TZAA 2ZZVA 1D4NA 1SW5A 3K1PA 2KLFA 2I0BA 1IITA 3GBBA 5I7IA 1FBDA 3BIHA 3R6UA 5L9SA 2CEYA 1Y9UA 1N3XA 3IO6A 3K6VA 2DWJA 4ONYA 5LTCA 5DW8A 2QVUA 3Q26A 3FJ7A 1DSNA 1JW4A 4KQPA 2ZXTA 1LBZA 5CMBA 4FIMA 3OSRA 4PAKA 1UTBA 1R9QA 1FTOA 1NKXA 2OZZA 5EQ8A 1B3HA 2A5TA 3O9PA 1FRPA 1YXIA 5IZZA 1IUDA 1EYKA 1LBBA 2CZIA 4F1VA 3ILUB 1MY0A 3U1OA 5I57B 2DVCA 1D9YA 3PU5A 5AA4B 4G68B 3TTNA 4FJPA 1POY1 5DYHA 1N7WA 4Z7EA 1MQHA 3M3LA 3ILTB 1B46A 3M8UA 2FBPA 3HHFA 1Y1ZA 4F1UA 1BK4A 5A5XB 3PUWE 4GFRA 1S9TA 4WKMA 5ET5A 3FBPA 4GD5A 3LSLA 1YPNA 4DLDA 4NF8B 2ZYNA 3GXAA 3FVNA 4XXUA 4HS7A 4HW8A 3LUYA 2P3VA 4GF8A 1EYIA 1SVXB 3VE1B 1LFGA 2QSXA 3K00A 2RF1A 1OLAA 4NWCA 3VVDA 4RNSA 3O66A 1A54A 2F97A 4U4XA 2HPGA 3EN3A 1BIYA 3HCQA 4QFKA 3LV0A 4OETA 4IY6A 4X1DA 3ODBA 1UQWA 4F3PA 4OFJA 2VD3A 2H9BA 5J1DA 3RNNA 2CMOA 1Y3QA 2DE4A 1FPGA 2DXYA 1P99A 1M5CA 1SW2A 2QPQA 2B4MA 2V84A 1B4ZA 1WVJA 3QUJA 3V83A 2FIEA 1FW0A 4I40A 4DCXA 5EHSA 4G4PA 4BDMA 2FHYA 4O7MA 4N6DA 1XS5A 1ZIUA 4O7IA 3T96B 3SESA 3FZVA 4OWDA 2RC8A 3TCHA 4AB6A 1DPEA 2WEFA 1OVTA 4MIJA 3H6VA 5ET8A 1MXZA 4YKIA 5H8SA 5H8NB 1RDYA 4MNCA 3PD8A 1AL3A 2XXHA 1B5IA 4PQJA 1URGA 1Q35A 4PTKA 2I58A 2AYSA 4YICA 4IGTA 5F24A 2ZYMA 2PVUA 2OX3A 4MHFA 4ZEIA 1SYHA 3PD9A 2B4LA 4OTEA 3T22A 2NVUB 3IAZA 4KD5A 1QUIA 4OENA 4YMAA 2D21A 3PPPA 3L6GA 5EYGA 2QMWA 2R71A 4THIA 1LAGE 1XI6A 2F3BA 4X1BA 1B6HA 4F22A 4DCYA 5K2XA 4G8HA 4IGRA 1NNPA 1URSA 2UXAA 2UVIA 2O7UA 4U22A 1N04A 1VSOA 1M5EA 5KDTA 2O51A 4OANA 3B7DA 4R73A 1LAXA 4FECA 1H3DA 4DXBA 4QFLA 4Q8RA 1GVCA 1ZKBA 2A5TB 1UIUA 4N6KA 5FBPA 3KC1A 4QXDA 4EF1A 3TPAA 2XXIA 3CR9A 2HXRA 5DEXA 1NV0A 2XD2A 3V5AA 3VLUA 2VD2A 5FHMA 3CFZA 1AMFA 1NV1A 1QJMA 4R6YA 5FHNA 1MPCA 1US4A 4R2FA 4UABA 4BDRA 2XWVA 1SDXA 3H4ZA 4N4UA 2QJEA 1NL5A 2DVZA 3H6TA 4FBPA 4KXPA 1UTHB 3C33A 1I6QA 2XXKA 4PF6A 3SEUA 3IOTA 5BWJA 4JVIA 3C9HA 2NOOA 3DM0A 3OENA 1MM6A 1WDNA 3PGFA 1EH3A 1XHYA 4KI0E 4QHQA 2WYPA 4R2BA 3PPRA 1MQDA 1NUZA 4U21A 2UVJA 4Q0CA 5LDZA 1SW1A 1EZOA 2OWTA 1H44A 4HE2A 2I3VA 3PMWA 3ISPA 3UK4A 5I58A 1VFDA 2XWOA 3VLVA 2DSFA 1MXUA 4TLLB 1JEVA 2I3WA 2B3FA 4IO6A 2HZLA 1B3GA 4NGUA 4WEDA 4I3EA 2YJPA 1LBXA 3RT6B 2RKMA 1LB8A 5H8HA 3DP6A 2Q9TA 2HAVA 3O2AA 3ZS6A 2PCRA 5CI5A 1Y1MA 2RC7A 2ZZWA 3TODA 2DWAA 4NWDA 1PC3A 3KOSA 1JW5A 2O7IA 4JWYA 1FQDA 1CNQA 2IA4A 3RPLB 2QMXA 2F78A 4OEVA 4TQUQ 3S2VA 3TQWA 2Y7WA 3U92A 3MVXA 3KJ7A 1B05A 4XKPA 3TTMA 1Z7ME 3S9MC 1NV7A 4EUOA 3ONMA 3BFTA 2O84X 1RYOA 2RCBA 3A3UA 4O3AA 3FXQA 4P0IA 1FPLA 5I2KB 4NMYA 3LR1A 2VPOA 3TTRA 4DIGA 4FEBA 5H8FB 4KHZE 3K1NA 4X9TA 5AA4A 4G68A 1H43A 2REJA 4H8IA 4P1EA 3C35A 5FTIA 1NUWA 2Y7IA 4P9KA 4HE0A 4R6KA 4G2ZA 1MQJA 3THIA 2ESNA 3K0VA 2VHAA 1IMDA 1NV5A 4ND9A 4JSDA 3SZPA 3IOUA 5A5XA 1K9YA 3RT8A 4DZ1A 4IO5A 2ZNSA 5AA2B 3TTLA 4NF8A 1XVYA 3B6WA 4FE8A 2HXWA 1KA0A 2P1SA 4ZEDA 5H8QA 2OBGA 3OD7A 3TYHA 5ET7A 3FVOA 2G29A 4GWOA 2E0SA 1Z7NE 1G0IA 2I0CA 1BP5A 3H6WA 2V3QA 2A5SA 3TCFA 2Y5LA 3B8BA 2PBWA 2XXXA 1Y4TA 5DEXB 5I5PA 4POWA 4UA8A 4G61A 5FHOA 2DP8A 1A55A 1N84A 3QAXA 4GWUA 1RDZA 1YTVA 1MY3A 3SEVA 3FATA 3HHGA 4O8MA 5AA2D 4P47A 2F6PA 5IAIA 3F11A 4H5FA 4F2OA 1DMBA 2H5YA 1IZ1A 3HV1A 4C1TA 1N3WA 3A3CA 4OVPA 3TAJA 4GX6A 1MQGA 4OHNA 3C34A 3LSWA 5ICQA 1OQHA 4OVSA 3FXBA 4AQ4A 4NF4A 4LP2B 1N76A 1P1QA 4N17A 4OVRA 2UVGA 3UP9A 1RDXA 4ZZEA 4QFNA 2F7CA 5H8NA 2RCAA 2FVZA 1FBEA 3TEPA 1MXVA 3MP6A 5TU0A 1LSTA 3K1MA 2DWHA 3SEWA 2H25A 1NUXA 2Q8JA 3R7XA 1O7TA 2H99A 1VE4A 3IOWA 3KSXA 4PFIA 2FIXA 2Q74A 2P3NA 4KPTA 1EU8A 2NXOA 4YMBA 4ZDMA 3DP8A 1SD3A 4LA9A 4E0XA 2Q89A 3M3KA 4ZEFA 1VR5A 3VVEA 2Z22A 3E79A 3E13X 1A7LA 1SI0A 1LBWA 4I1DA 1BTJA 2GQ1A 1ELJA 1KWHA 1SYIA 2Y5KA 1UIVA 2XA5A 3IL1B 3QUFA 4YB6A 3KFMA 4LONB 2DQVA 3I3VA 4BDNA 3B6TA 1B52A 2GHBA 1A99A 4MMPA 1IXCA 4FATA 1B3EA 3TKDA 3FV2A 4I8CA 1JP4A 4LATA 4PBQA 5CBSA 1P1OA 4MLQA 1PB7A 4U2RA 3H03A 3HN0A 1P1UA 4PAFA 4RK2A 4NAPA 2D5WA 4FORA 2HHMA 3FJGA 4OVQA 4EQ9A 5LOMA 3O97A 1WODA 1UTHA 1EZ9A 4K3FA 4XIGQ 3IOVA 3UIFA 1TFAA 4N8GA 4JB7A 3MZ9A 1FQBA 3SETA 4MF3A 1Q1KA 3NOHA 3SDFA 3MC2A 2R8TA 3TDJA 4C1UA 2DE2A 5H8QB 5K2YA 2CZHA 2QL3A 3EPEA 3G7WA 4MX6A 4G8NA 4YB5A 5L9MA 2HEUA 4PE3A 3UORA 4BLAA 2ALUA 4LVQA 2QS1A 1R9LA 4PF8A 4XKQA 4AS4A 2B3BA 4YU0A 2D3IA 1FJ9A 1FPJA 4ECFA 5IGAA 4BDLA 1B4HA 5F7VA 3S9EA 1QULA 4ZEBA 1TWYA 3FV1A 3CG1A 3MZBA 2QFLA 2DDKA 5DT6A 3T9XB 4PFUA 4PDHA 3EHUA 1FPEA 1NV4A 4O94A 5DVIA 5ITOA 1S7YA 3H7MA 2Q2AA 3IB2A 4N8YA 3CVGA 5ITPA 2F5XA 2R6GE 3W9VA 3AXFA 4UACA 3W9WA 3RPLA 2CZLA 2F34A 4ZE8A 4GQOA 4E0WA 5EHMA 1RKMA 4NF4B 1B2HA 1XC1A 1I6BA 3FGSA 4GWWA 2GHAA 2XXRA 4ESXA 1M5BA 3K4UA 3O6HA 3CFXA 2QRYA 3E9XA 4G77A 1A40A 4GX4A 1IXGA 4PBHA 1INPA 2OJTA 2Z8EA 3EKIA 3A09A 3OELA 3PMXA 5I2KA 5H8FA 4MNIA 4ZZAA 3G3GA 3KJTA 2V25A 2XXUA 1MDQA 4RYAA 1GR2A 3CSBA 4MH5A 5IZ1A 2HQ0A 3JZJA 3UGWA 4HCWA 3QYTA 5I2NA 4NF6B 3G3IA 3N5LA 1FTKA 1IEJA 1FQAA 1LEVA 1JEUA 2Z8DA 3A29A 4EF2A 5ELVA 1ZTYA 1I6AA 2AL4A 1MH3A 5AA2A 3G3KA 2VPNA 1VFEA 1FPIA 2DWIA 2O1LA 1QUJA 1DBZA 3G3HA 4AS5A 4Q30B 4OFOA 1FTLA 2JJKA 3E78A 1NMUA 2RC9A 3OO9A 2P0SA 4QFPA 1OIBA 1NH8A 3MVZA 3H3GA 1NV6A 3V8XB 2O69A 4HE1A 4P0GA 5F1QA 4R75A 2X26A 3O28A 2ZZXA 4DXUA 3T93B 3IB0A 5KCJA 1AH5A 3IB1A 4LQ5A 3G3FA 3DP4A 3FVGA 5T3JA 2XXVA 4R72A 4H6DA 1YCJA 2WBDA 2ZYOA 2QS3A 3LSXA 2LAOA 3C36A 4EQBA 4P8BA 1USYE 4F19A 2VT5A 5ICTA 4LZ7A 4OFLA 3TCGA 3PUYE 1FPDA 3MVWA 4ELOA 3OXNA 1Y4CA 4MAGA 4P1LA 1GV8A 2THIA 2Q2CA 3IJOB 1B7HA 4GRKA 3MYUA 3MPKA 3OEMA 3ZSFA 4H46A 2GFEA 3OO6A 4N81A 2DYXA 2IEEA 4PP0A 1DCUA 1MY4A 1OLCA 3HFUA 3KBRA 1JETA 2BJIA 3Q29A 5JEIA 3N6TA 5CMCA 4ZE9A 3S9NC 2HFBA 1FTJA 4N15A 4PC9A 4ELRA 3S9LC 4PFTA 1EZPA 3C4MA 3VLWA 1KZ8A 1ZU0A 3QK6A 4R9FA 5BUUA 3C31A 1P1NA 1LCTA 2RINA 4QSDA 1XVXA 3GBAA 5L8DA 4DDDA 4G8MA 3Q27A 4IO4A 4RJZA 4F3GA 5ET6A 2NWJA 3RTWB 3U93A 3PUVE 1AIVA 4YKKA 1IXHA 2KR0A 1OMPA 4OXVA 3OEKA 1LAFE 1MY1A 3KG2A 3EHSA 4GLIA 2WBBA 4HTGA 4JWXA 1I69A 1OQGA 5I2NB 3VVFA 5JTYA 1R6ZA 4OMBA 4YZZA 1LFIA 1R1NA 4MLVA 3IFAA 2XXYA 3D4GA 1QKBA 2Y7KA 1CE2A 4KFQA 1B5JA 4N6PA 4F31B 4IY5A 4XEQA 1QVSA 5EQ9A 1FCKA 2AL5A 4YB7A 1B58A 2M8CA 1NH7A 1AOVA 1DTZA 2HAUA 3PPOA 2PT1A 3MW0A 1MRPA 1SI1A 3TUSA 5L9OA 1FQCA 3T9HB 1GGGA 4F29A 3TELA 4PFRA 1XOCA 1B5HA 4H67A 4QBAA 1FQFA 4FEDA 3KBZA 4L17A 4JBZA 4P3LA 2O6AA 3PPNA 4RA1A 1FSAA 5KCJB 4JVDA 4YAHX 1IXIA 1PB8A 4H8JA 3I5OA 3DELB 1MY2A 5J16A 2MKZA 3O6GA 4R6HA 3U72A 1A8EA 3MQ9A 4QSEA 4GBWA 3R26A 3RY3A 4U4SA 2XXQA 3PUXE 3QIMA 2GH9A 3IK6B 3C32A 4NTLA 1VDWA 4TOZA 1MDP1 1B7ZA 3MAMA 4JSOA 5I59A 4DXCA 1LFHA 3D1RA 3HPIA 4PETA 2REGA 2WKYA 3P7IA 1YAEA 5I56B 3MSTA 4ZEKA 3WAEA 2I49A 4RPOA 5HPQA 2HCAA 1PEBA 4IB2A 2CZKA 1FBGA 3Q28A 3N6UA 3I6VA 3MP1A 1O64A 3IORA 2P2AA 4GWXA 4XFEA 5EYHA 4H65A 4JDFA 4EDPA 4JWOA 1PBPA 1FJ6A 1LAHE 4NF6A 2CEXA 4I62A 2PT2A 2F7BA 4KYSA 4NHBA 3W15C 3K6XA 4Z0IA 2VGQA 2DOJA 4NE4A 2DE3A 3QMFA 3EHTA 4ZECA 2OK2A 3TTKA 3VXCA 4GL0A 3U65A 1FTMA 2XWKA 4IO3A 4NQ8A 5TPAA 3B6QA 4DI4B 2F8DA 1N0TA 2WYKA 1JQFA 4RY1A 4LZ8A 4C0RA 4LQ2A 5IZ3A 4O3CA 3CI8A 1HSLA 3SKPA 1IMFA 3KN8A 1SQYA 2QS4A 1NUYA 1Y20A 1QW0A 3MZ1A 4KCDA 1FBFA 1MPBA 1B0HA 2F3DA 3H06B 3ZKLA 5HM4B 3K01A 2Q88A 3N94A 1TT1A 2FNCA 2XXTA 5IM2A 1JW1A 4NG7A 4YKPA 3FJMA 1EYJA 5JTYB 4GL8A 3FIRA 2OWZA 3RN8A 3U8QA 2WX9A 1N7XA 4XKRA 2V3UA 4F3BA 1QUKA 1QGXA 2I6EA 2I4BA 1IQ7A 1Y3NA 4U1ZA 4N13A 2UYFA 1MPDA 1B7UA 1FPFA 3USDA 3N26A 3KOTA 4OA4A 2QVRA 1DOTA 3MBPA 3M3FA 2KQZA 3PUZE 4H5GA 4XKNA 5AA3A 1MXYA 1B3FA 2UVHA 5I84A 3UA8A 1P1WA 1FTAA 1DK4A 2XHDA 4GXSB 1ZMGA 3HSTA 4F18A 2V93A 4WXJA 4NF5A 3LUZA 1D3KA 4P56A 3RGYA 4GOTA 3BIGA 4MJOA 1NI9A 3OMBA 4NF0A 4I9DA 4TLMB 5DTBA 1FBCA 3FXRA 1II5A 4OVJA 4MNPA 2XWIA 4Q5TA 1D9VA 3FVKA 1Q9DA 4PE5B 1D9QA 4LN5A 3T66A 2F7AA 4PGNA 3RYDA 4OERA 1LB9A 3E4RA 1MQIA 2FA7A 2GRVA 5ISUA 2XX7A 2O1MA 3G3JA 1IMCA 3VFJA 5I59B 4F2QA 1SPIA 1IMBA 4YKJA 3SERA 4ELQA 4XF5A 1F9BA 3ECRA 4PFBA 1G0HA 2Y7PA 3OOAA 3Q25A 1HSEA 4HCYA 3GLBA 3WAFA 4OVTA 2G93A 1QKAA 3RQTA 3UN6A 5CBRA 3H6UA 2Y7RA 1LCFA 2YLNA 1DPPA 3FXUA 4ISUA 3LBSA 5I3SA 3MWBA 1NNFA 1NNKA 3KSJA 1FBPA 4JVCA 4RXLA 1H76A 3GZGA 1KA1A 1LBVA 1MG1A 1B51A 2XX8A 4X48A 2PFYA 3PMVA 3MPLA 1FPBA 5TP9B 3D4CA 5JK4A 1RYXA 5TPAB 3LSFB 3O6IA 4R9GA 4GBVA 3MJNA 3BFUA 5A5LA 4U1OA 5IZ3B 2Z8FA 3KGCA 3CRBA 4P11A 1S50A 1B0LA 4AB5A 4F1YA 1IIWA 3IFCA 3EQ1A 3OSQA 2XX9A 4N07A 1POTA 1SBPA 3RPWA 1MS7A 2OCUA 1UTBB 1M5FA 5CMKA 2L5VA 5KZTA 3JYRA 2BJJX 4GWSA 2Y84A 3VV5A 3HO7A 3KN3A 4F3SA 3BBRA 3MP8A 2PMSA 3PPQA 4DE8A 3K6UA 5EQ7A 3IJXB 4KR5A 4EXLA 4ELPA 1PDAA 4MFIA 2OWSA 1NNTA 2NUVA 4KCCA 2X7PA 4BDOA 1BKAA 4F39A 4IO2A 1B40A 2ABHA 2ZYKA 2ONRA 3PV0E 1US5A 3KN7A 4OEUA 3QSLA 3T0JA 2X7QA 3K02A 5M2VA 4I3YA 1YYZA 2VOZA 1JVXA 2H4IA 4LZ5A 5I56A 1IMAA 1LBYA 4NF5B 5CC2A 5AE4A 5ESYA 4GWZA 4MBPA 1DTGA 4G68C 1USYH 3MVYA 4POXA 3FUZA 1ATGA 2YPNA 2R9JA 2ZNUA 3KZGA 2B65A 5CMMA 2UYEA 3RLFE 3T1BA 1L5TA 1LGBC 2ONSA 4H0WA 1JVYA 3CHGA 4X04A 4OQOA 3MUQA 3VDFA 3S4UA 4GVOA 2Q8MA 5EQAA 4MEVA 3V89B 1T0KA 4GIZA 1BLFA 4H1XA 1MM7A 1CB6A 4QSCA 4WEPA 2O68A 3JV9A 4QRZA 5CRYA 2I4CA 2FYIA 3KEIA 3K2DA 5B70A 1URDA 3VXBA 4GX3A 1ANFA 2QS2A 1B3LA 1B9JA 4PFYA 1IMEA 1J1NA 2W7YA 1OVBA 1MH4A 2ZMBA 1Y3PA 3B50A 5EYFA 3GYYA 4PCDA 3U94A 2F36A 2F35A 3CSGA 2E1SA 4RK9A 4XTCQ 2HZKA 1ZBMA 4BDQA 2F6GA 5I57A 1NV3A 3IO4A 5CM6A 4PFWA 4PAIA 4OESA 3CG3A 3FD3A 1JNFA 4QFOA 2V4CA 3T9UA 3TMGA 2I48A 1FPKA 4GWYA 1TXFA 3FASA 4KYDA 4H45A 3K6WA 4JXIA 3RTFB 4NX1A 3TFLA 2XXWA 3PTYA 2V3TA 5B7DA 4OYVA 4PDDA 1O63A 1FQEA 3QXMA 1TFDA 1H45A 5KDTB 1M5DA 4RPNA 2PYYA 4ESWA 3ZKKA 3LC8A 3IR1A 2XD3A 4LUBA 4M4GA 2PX1A
chains in the Genus database with same CATH topology
1LBCA 3CFLA 3DLNA 2Z23A 2OLBA 3BKIB 3OO8A 1GTKA 1B32A 3TQLA 4GXAA 4R74A 1PBQA 5DVJA 4QF9A 5FTHA 4KYEA 2H98A 4O3BA 4U23A 2DXRA 3SEXA 4OZ9A 5HBCA 1ZLQA 3T9VA 4EXKA 2ZNTA 3CIJA 1A8FA 3E3KA 4M1VA 4IO7A 3OO7A 1MXWA 4EQ7A 3IX1A 1SW4A 2XXPA 1MXXA 3O29A 1PB9A 4ZS9A 1NFTA 5IKBA 5I58B 3SEYA 4FAJA 1LLSA 2AIXA 1HSJA 2ANJA 4NEDA 3RUMA 3L6HA 2VP1A 5DVFA 3EF7A 2ONKE 5AA1A 1ZJLA 1B1XA 1B1HA 2DS9A 1XT8A 5H8HB 5TP9A 3TZAA 1D4NA 1SW5A 3K1PA 2KLFA 2I0BA 1IITA 3GBBA 3R6UA 5L9SA 1Y9UA 1N3XA 3IO6A 3K6VA 2DWJA 4ONYA 3Q26A 3FJ7A 1DSNA 1JW4A 4KQPA 2ZXTA 5CMBA 4FIMA 3OSRA 1UTBA 1R9QA 1FTOA 1NKXA 2OZZA 1B3HA 2A5TA 3O9PA 1IUDA 1LBBA 4F1VA 3ILUB 1MY0A 3U1OA 5I57B 2DVCA 1D9YA 3PU5A 5AA4B 4G68B 3TTNA 4FJPA 1POY1 5DYHA 1N7WA 4Z7EA 1MQHA 3M3LA 3ILTB 1B46A 3M8UA 3HHFA 1Y1ZA 4F1UA 5A5XB 3PUWE 4GFRA 1S9TA 4WKMA 4GD5A 3LSLA 1YPNA 4DLDA 4NF8B 2ZYNA 3GXAA 3FVNA 4XXUA 4HS7A 4HW8A 3LUYA 4GF8A 1SVXB 3VE1B 1LFGA 2QSXA 3K00A 2RF1A 1OLAA 4NWCA 3VVDA 4RNSA 3O66A 1A54A 2F97A 4U4XA 3EN3A 1BIYA 3HCQA 4QFKA 4OETA 4IY6A 4X1DA 3ODBA 1UQWA 4F3PA 4OFJA 2VD3A 2H9BA 5J1DA 3RNNA 2CMOA 1Y3QA 2DE4A 2DXYA 1P99A 1M5CA 1SW2A 2QPQA 2V84A 1B4ZA 1WVJA 3QUJA 3V83A 1FW0A 4DCXA 5EHSA 4G4PA 4BDMA 1XS5A 1ZIUA 3T96B 3SESA 3FZVA 4OWDA 2RC8A 3TCHA 4AB6A 1DPEA 1OVTA 3H6VA 1MXZA 4YKIA 5H8SA 5H8NB 3PD8A 1AL3A 2XXHA 1B5IA 4PQJA 1URGA 1Q35A 2I58A 2AYSA 4YICA 4IGTA 2ZYMA 2PVUA 4ZEIA 1SYHA 3PD9A 4OTEA 3T22A 2NVUB 3IAZA 4KD5A 1QUIA 4OENA 4YMAA 2D21A 3PPPA 3L6GA 2QMWA 2R71A 4THIA 1LAGE 4X1BA 1B6HA 4F22A 4DCYA 5K2XA 4G8HA 4IGRA 1NNPA 1URSA 2UXAA 2UVIA 2O7UA 4U22A 1N04A 1VSOA 1M5EA 5KDTA 2O51A 3B7DA 4R73A 1LAXA 4FECA 1H3DA 4DXBA 4QFLA 4Q8RA 1GVCA 1ZKBA 2A5TB 1UIUA 4EF1A 3TPAA 2XXIA 3CR9A 5DEXA 2XD2A 3V5AA 3VLUA 2VD2A 5FHMA 3CFZA 1AMFA 1QJMA 4R6YA 5FHNA 1MPCA 1US4A 4R2FA 4BDRA 1SDXA 3H4ZA 2QJEA 1NL5A 2DVZA 3H6TA 1UTHB 3C33A 1I6QA 3SEUA 3IOTA 5BWJA 3C9HA 2NOOA 3DM0A 3OENA 1MM6A 1WDNA 3PGFA 1EH3A 1XHYA 4KI0E 4QHQA 4R2BA 3PPRA 1MQDA 4U21A 2UVJA 4Q0CA 1SW1A 1EZOA 2OWTA 1H44A 2I3VA 3PMWA 3UK4A 5I58A 1VFDA 3VLVA 2DSFA 1MXUA 4TLLB 1JEVA 2I3WA 2B3FA 4IO6A 2HZLA 1B3GA 4WEDA 2YJPA 3RT6B 2RKMA 1LB8A 5H8HA 3DP6A 2Q9TA 2HAVA 3O2AA 3ZS6A 5CI5A 1Y1MA 2RC7A 3TODA 2DWAA 4NWDA 1PC3A 3KOSA 1JW5A 2O7IA 4JWYA 1FQDA 2IA4A 2QMXA 2F78A 4OEVA 4TQUQ 3S2VA 3TQWA 2Y7WA 3U92A 3MVXA 3KJ7A 1B05A 4XKPA 3TTMA 1Z7ME 3S9MC 4EUOA 3ONMA 3BFTA 2O84X 1RYOA 2RCBA 3A3UA 4O3AA 3FXQA 4P0IA 5I2KB 4NMYA 4DIGA 3LR1A 3TTRA 4FEBA 5H8FB 4KHZE 3K1NA 4X9TA 5AA4A 4G68A 1H43A 2REJA 4H8IA 3C35A 5FTIA 4R6KA 2Y7IA 4G2ZA 1MQJA 3THIA 2ESNA 3K0VA 2VHAA 4ND9A 4JSDA 3IOUA 5A5XA 3RT8A 4DZ1A 4IO5A 2ZNSA 5AA2B 3TTLA 4NF8A 1XVYA 3B6WA 4FE8A 2HXWA 2P1SA 4ZEDA 5H8QA 2OBGA 3OD7A 3TYHA 3FVOA 2G29A 4GWOA 2E0SA 1Z7NE 2I0CA 1BP5A 3H6WA 2V3QA 2A5SA 3TCFA 2PBWA 2XXXA 1Y4TA 5DEXB 4POWA 4UA8A 5FHOA 2DP8A 1A55A 1N84A 3QAXA 1YTVA 1MY3A 3SEVA 3FATA 3HHGA 5AA2D 2F6PA 5IAIA 3F11A 4H5FA 4F2OA 1DMBA 2H5YA 1IZ1A 3HV1A 4C1TA 1N3WA 3A3CA 3TAJA 1MQGA 4OHNA 3C34A 3LSWA 5ICQA 1OQHA 4AQ4A 4NF4A 4LP2B 1N76A 1P1QA 2UVGA 3UP9A 4ZZEA 4QFNA 2F7CA 5H8NA 2RCAA 3TEPA 1MXVA 3MP6A 5TU0A 1LSTA 3K1MA 2DWHA 3SEWA 2H25A 2Q8JA 3R7XA 1O7TA 2H99A 1VE4A 3IOWA 3KSXA 4KPTA 1EU8A 2NXOA 4YMBA 4ZDMA 3DP8A 1SD3A 4LA9A 4E0XA 2Q89A 3M3KA 4ZEFA 1VR5A 3VVEA 2Z22A 3E13X 1A7LA 1SI0A 4I1DA 1BTJA 1ELJA 1KWHA 1SYIA 1UIVA 3IL1B 3QUFA 4YB6A 3KFMA 4LONB 2DQVA 4BDNA 3I3VA 3B6TA 1B52A 2GHBA 1A99A 1IXCA 4FATA 1B3EA 3TKDA 3FV2A 4I8CA 4LATA 5CBSA 1P1OA 4MLQA 1PB7A 4U2RA 3H03A 3HN0A 1P1UA 4RK2A 2D5WA 4FORA 3FJGA 4EQ9A 5LOMA 3O97A 1WODA 1UTHA 1EZ9A 4K3FA 4XIGQ 3IOVA 3UIFA 1TFAA 4JB7A 3MZ9A 1FQBA 3SETA 4MF3A 1Q1KA 3SDFA 3MC2A 3TDJA 4C1UA 2DE2A 5H8QB 5K2YA 2QL3A 3EPEA 3G7WA 4G8NA 4YB5A 5L9MA 2HEUA 3UORA 4BLAA 2ALUA 4LVQA 2QS1A 1R9LA 4XKQA 2B3BA 4YU0A 2D3IA 4ECFA 4BDLA 1B4HA 5F7VA 3S9EA 1QULA 4ZEBA 1TWYA 3FV1A 3CG1A 3MZBA 5DT6A 3T9XB 4PFUA 3EHUA 5DVIA 5ITOA 1S7YA 3H7MA 2Q2AA 3IB2A 3CVGA 5ITPA 2F5XA 2R6GE 3W9VA 3AXFA 4UACA 3W9WA 2CZLA 2F34A 4ZE8A 4GQOA 4E0WA 5EHMA 1RKMA 4NF4B 1B2HA 1XC1A 1I6BA 3FGSA 2GHAA 2XXRA 4ESXA 1M5BA 3K4UA 3O6HA 3CFXA 2QRYA 3E9XA 4G77A 1A40A 1IXGA 2OJTA 2Z8EA 3A09A 3OELA 3PMXA 5I2KA 5H8FA 4ZZAA 3G3GA 3KJTA 2V25A 2XXUA 1MDQA 4RYAA 1GR2A 3CSBA 4MH5A 2HQ0A 3JZJA 3UGWA 4HCWA 3QYTA 5I2NA 4NF6B 3G3IA 3N5LA 1FTKA 1IEJA 1FQAA 1JEUA 2Z8DA 4EF2A 5ELVA 1ZTYA 1I6AA 2AL4A 1MH3A 5AA2A 3G3KA 1VFEA 2DWIA 2O1LA 1QUJA 3G3HA 4Q30B 4OFOA 1FTLA 1NMUA 2RC9A 3OO9A 2P0SA 4QFPA 1OIBA 1NH8A 3MVZA 3H3GA 3V8XB 2O69A 4P0GA 5F1QA 4R75A 2X26A 3O28A 4DXUA 3T93B 3IB0A 5KCJA 1AH5A 3IB1A 4LQ5A 3G3FA 3DP4A 3FVGA 2XXVA 4R72A 4H6DA 1YCJA 2ZYOA 2QS3A 3LSXA 2LAOA 3C36A 4EQBA 1USYE 4F19A 5ICTA 4LZ7A 4OFLA 3TCGA 3PUYE 3MVWA 4ELOA 3OXNA 1Y4CA 1GV8A 2THIA 2Q2CA 3IJOB 1B7HA 4GRKA 3MPKA 3OEMA 3ZSFA 2GFEA 3OO6A 2DYXA 2IEEA 4PP0A 1MY4A 1OLCA 3KBRA 1JETA 3Q29A 5JEIA 3N6TA 5CMCA 4ZE9A 3S9NC 2HFBA 1FTJA 4ELRA 3S9LC 4PFTA 1EZPA 3C4MA 3VLWA 1ZU0A 3QK6A 4R9FA 5BUUA 3C31A 1P1NA 1LCTA 2RINA 4QSDA 1XVXA 3GBAA 5L8DA 4DDDA 4G8MA 3Q27A 4IO4A 4RJZA 4F3GA 2NWJA 3RTWB 3U93A 3PUVE 1AIVA 4YKKA 1IXHA 1OMPA 4OXVA 3OEKA 1LAFE 1MY1A 3KG2A 3EHSA 4GLIA 4HTGA 4JWXA 1I69A 1OQGA 5I2NB 3VVFA 5JTYA 1R6ZA 4OMBA 4YZZA 1LFIA 1R1NA 4MLVA 2XXYA 3D4GA 1QKBA 2Y7KA 1CE2A 4KFQA 1B5JA 4N6PA 4F31B 4IY5A 1QVSA 1FCKA 2AL5A 4YB7A 1B58A 2M8CA 1NH7A 1AOVA 1DTZA 2HAUA 3PPOA 2PT1A 3MW0A 1MRPA 1SI1A 3TUSA 5L9OA 1FQCA 3T9HB 1GGGA 4F29A 3TELA 1XOCA 1B5HA 4H67A 1FQFA 4FEDA 4L17A 4JBZA 2O6AA 3PPNA 4RA1A 5KCJB 4YAHX 1IXIA 1PB8A 4H8JA 3I5OA 3DELB 1MY2A 3O6GA 4R6HA 3U72A 1A8EA 3MQ9A 4QSEA 3R26A 3RY3A 4U4SA 2XXQA 3PUXE 3QIMA 2GH9A 3IK6B 3C32A 4NTLA 4TOZA 1MDP1 1B7ZA 3MAMA 4JSOA 5I59A 4DXCA 1LFHA 3HPIA 4PETA 2REGA 2WKYA 3P7IA 1YAEA 5I56B 4ZEKA 3WAEA 2I49A 4RPOA 5HPQA 2HCAA 1PEBA 4IB2A 3Q28A 3N6UA 3I6VA 3MP1A 1O64A 3IORA 2P2AA 4H65A 4JDFA 4EDPA 4JWOA 1PBPA 1LAHE 4NF6A 4I62A 2PT2A 2F7BA 4KYSA 3W15C 3K6XA 4Z0IA 2VGQA 2DOJA 4NE4A 2DE3A 3EHTA 4ZECA 2OK2A 3TTKA 3VXCA 4GL0A 1FTMA 4IO3A 5TPAA 3B6QA 2F8DA 1N0TA 1JQFA 4LZ8A 4RY1A 4C0RA 4LQ2A 4O3CA 3CI8A 1HSLA 3SKPA 3KN8A 1SQYA 2QS4A 1Y20A 1QW0A 3MZ1A 4KCDA 1MPBA 1B0HA 3H06B 3ZKLA 5HM4B 3K01A 2Q88A 3N94A 1TT1A 2FNCA 2XXTA 1JW1A 4YKPA 3FJMA 5JTYB 4GL8A 3FIRA 3RN8A 3U8QA 1N7XA 4XKRA 2V3UA 4F3BA 1QUKA 2I6EA 2I4BA 1IQ7A 1Y3NA 4U1ZA 4N13A 2UYFA 1MPDA 1B7UA 3USDA 3N26A 3KOTA 1DOTA 3MBPA 3M3FA 3PUZE 4H5GA 4XKNA 5AA3A 1MXYA 1B3FA 2UVHA 5I84A 3UA8A 1P1WA 2XHDA 4GXSB 1ZMGA 3HSTA 4F18A 2V93A 4WXJA 4NF5A 1D3KA 3RGYA 4GOTA 3OMBA 4I9DA 4TLMB 5DTBA 3FXRA 1II5A 4OVJA 4Q5TA 1D9VA 3FVKA 4PE5B 3T66A 2F7AA 4OERA 1LB9A 3E4RA 1MQIA 2FA7A 2GRVA 5ISUA 2XX7A 2O1MA 3G3JA 3VFJA 5I59B 4F2QA 4YKJA 3SERA 4ELQA 1F9BA 3ECRA 2Y7PA 3OOAA 3Q25A 1HSEA 4HCYA 3GLBA 3WAFA 2G93A 1QKAA 3RQTA 3UN6A 5CBRA 3H6UA 2Y7RA 1LCFA 2YLNA 1DPPA 3FXUA 4ISUA 3LBSA 3MWBA 1NNFA 1NNKA 3KSJA 4RXLA 1H76A 3GZGA 1MG1A 2XX8A 4X48A 1B51A 3PMVA 3MPLA 5TP9B 3D4CA 5JK4A 1RYXA 5TPAB 3LSFB 3O6IA 4R9GA 3MJNA 3BFUA 4U1OA 2Z8FA 3KGCA 3CRBA 4P11A 1S50A 1B0LA 4AB5A 4F1YA 1IIWA 3EQ1A 3OSQA 2XX9A 4N07A 1POTA 1SBPA 3RPWA 1MS7A 2OCUA 1UTBB 1M5FA 5CMKA 5KZTA 3JYRA 2BJJX 2Y84A 3VV5A 3HO7A 3KN3A 4F3SA 3BBRA 3MP8A 2PMSA 3PPQA 4DE8A 3K6UA 3IJXB 4KR5A 4EXLA 4ELPA 1PDAA 4MFIA 2OWSA 1NNTA 2NUVA 4KCCA 2X7PA 4BDOA 1BKAA 4F39A 4IO2A 1B40A 2ABHA 2ZYKA 2ONRA 3PV0E 1US5A 3KN7A 4OEUA 3QSLA 2X7QA 3K02A 5M2VA 2VOZA 1JVXA 2H4IA 4LZ5A 5I56A 4NF5B 5CC2A 5AE4A 4MBPA 1DTGA 4G68C 1USYH 3MVYA 4POXA 3FUZA 1ATGA 2YPNA 2R9JA 2ZNUA 3KZGA 2B65A 5CMMA 2UYEA 3RLFE 1L5TA 1LGBC 2ONSA 4H0WA 1JVYA 4OQOA 3MUQA 3VDFA 3S4UA 4GVOA 3V89B 1T0KA 4GIZA 1BLFA 4H1XA 1MM7A 1CB6A 4QSCA 4WEPA 2O68A 3JV9A 4QRZA 5CRYA 2I4CA 2FYIA 3KEIA 3K2DA 5B70A 1URDA 3VXBA 1ANFA 2QS2A 1B3LA 1B9JA 4PFYA 1J1NA 2W7YA 1OVBA 1MH4A 2ZMBA 1Y3PA 5EYFA 3U94A 2F36A 2F35A 3CSGA 2E1SA 4RK9A 4XTCQ 2HZKA 1ZBMA 4BDQA 2F6GA 5I57A 3IO4A 5CM6A 4PFWA 4OESA 3CG3A 3FD3A 1JNFA 4QFOA 3T9UA 3TMGA 2I48A 1TXFA 3FASA 4KYDA 3K6WA 4JXIA 3RTFB 3TFLA 2XXWA 5B7DA 2V3TA 4OYVA 1O63A 1FQEA 3QXMA 1TFDA 1H45A 5KDTB 1M5DA 4RPNA 2PYYA 4ESWA 3ZKKA 3LC8A 3IR1A 2XD3A 4LUBA 4M4GA 2PX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBC A;  3CFL A;  3DLN A;  2Z23 A;  2OLB A;  3BKI B;  3OO8 A;  1GTK A;  1B32 A;  3TQL A;  4GXA A;  4R74 A;  1PBQ A;  5DVJ A;  4QF9 A;  5FTH A;  4KYE A;  2H98 A;  4O3B A;  4U23 A;  2DXR A;  3SEX A;  4OZ9 A;  5HBC A;  1ZLQ A;  3T9V A;  4EXK A;  2ZNT A;  3CIJ A;  1A8F A;  3E3K A;  4M1V A;  4IO7 A;  3OO7 A;  1MXW A;  4EQ7 A;  3IX1 A;  1SW4 A;  2XXP A;  1MXX A;  3O29 A;  1PB9 A;  4ZS9 A;  1NFT A;  5IKB A;  5I58 B;  3SEY A;  4FAJ A;  1LLS A;  2AIX A;  1HSJ A;  2ANJ A;  4NED A;  3RUM A;  3L6H A;  2VP1 A;  5DVF A;  3EF7 A;  2ONK E;  5AA1 A;  1ZJL A;  1B1X A;  1B1H A;  2DS9 A;  1XT8 A;  5H8H B;  5TP9 A;  3TZA A;  1D4N A;  1SW5 A;  3K1P A;  2KLF A;  2I0B A;  1IIT A;  3GBB A;  3R6U A;  5L9S A;  1Y9U A;  1N3X A;  3IO6 A;  3K6V A;  2DWJ A;  4ONY A;  3Q26 A;  3FJ7 A;  1DSN A;  1JW4 A;  4KQP A;  2ZXT A;  5CMB A;  4FIM A;  3OSR A;  1UTB A;  1R9Q A;  1FTO A;  1NKX A;  2OZZ A;  1B3H A;  2A5T A;  3O9P A;  1IUD A;  1LBB A;  4F1V A;  3ILU B;  1MY0 A;  3U1O A;  5I57 B;  2DVC A;  1D9Y A;  3PU5 A;  5AA4 B;  4G68 B;  3TTN A;  4FJP A;  1POY 1;  5DYH A;  1N7W A;  4Z7E A;  1MQH A;  3M3L A;  3ILT B;  1B46 A;  3M8U A;  3HHF A;  1Y1Z A;  4F1U A;  5A5X B;  3PUW E;  4GFR A;  1S9T A;  4WKM A;  4GD5 A;  3LSL A;  1YPN A;  4DLD A;  4NF8 B;  2ZYN A;  3GXA A;  3FVN A;  4XXU A;  4HS7 A;  4HW8 A;  3LUY A;  4GF8 A;  1SVX B;  3VE1 B;  1LFG A;  2QSX A;  3K00 A;  2RF1 A;  1OLA A;  4NWC A;  3VVD A;  4RNS A;  3O66 A;  1A54 A;  2F97 A;  4U4X A;  3EN3 A;  1BIY A;  3HCQ A;  4QFK A;  4OET A;  4IY6 A;  4X1D A;  3ODB A;  1UQW A;  4F3P A;  4OFJ A;  2VD3 A;  2H9B A;  5J1D A;  3RNN A;  2CMO A;  1Y3Q A;  2DE4 A;  2DXY A;  1P99 A;  1M5C A;  1SW2 A;  2QPQ A;  2V84 A;  1B4Z A;  1WVJ A;  3QUJ A;  3V83 A;  1FW0 A;  4DCX A;  5EHS A;  4G4P A;  4BDM A;  1XS5 A;  1ZIU A;  3T96 B;  3SES A;  3FZV A;  4OWD A;  2RC8 A;  3TCH A;  4AB6 A;  1DPE A;  1OVT A;  3H6V A;  1MXZ A;  4YKI A;  5H8S A;  5H8N B;  3PD8 A;  1AL3 A;  2XXH A;  1B5I A;  4PQJ A;  1URG A;  1Q35 A;  2I58 A;  2AYS A;  4YIC A;  4IGT A;  2ZYM A;  2PVU A;  4ZEI A;  1SYH A;  3PD9 A;  4OTE A;  3T22 A;  2NVU B;  3IAZ A;  4KD5 A;  1QUI A;  4OEN A;  4YMA A;  2D21 A;  3PPP A;  3L6G A;  2QMW A;  2R71 A;  4THI A;  1LAG E;  4X1B A;  1B6H A;  4F22 A;  4DCY A;  5K2X A;  4G8H A;  4IGR A;  1NNP A;  1URS A;  2UXA A;  2UVI A;  2O7U A;  4U22 A;  1N04 A;  1VSO A;  1M5E A;  5KDT A;  2O51 A;  3B7D A;  4R73 A;  1LAX A;  4FEC A;  1H3D A;  4DXB A;  4QFL A;  4Q8R A;  1GVC A;  1ZKB A;  2A5T B;  1UIU A;  4EF1 A;  3TPA A;  2XXI A;  3CR9 A;  5DEX A;  2XD2 A;  3V5A A;  3VLU A;  2VD2 A;  5FHM A;  3CFZ A;  1AMF A;  1QJM A;  4R6Y A;  5FHN A;  1MPC A;  1US4 A;  4R2F A;  4BDR A;  1SDX A;  3H4Z A;  2QJE A;  1NL5 A;  2DVZ A;  3H6T A;  1UTH B;  3C33 A;  1I6Q A;  3SEU A;  3IOT A;  5BWJ A;  3C9H A;  2NOO A;  3DM0 A;  3OEN A;  1MM6 A;  1WDN A;  3PGF A;  1EH3 A;  1XHY A;  4KI0 E;  4QHQ A;  4R2B A;  3PPR A;  1MQD A;  4U21 A;  2UVJ A;  4Q0C A;  1SW1 A;  1EZO A;  2OWT A;  1H44 A;  2I3V A;  3PMW A;  3UK4 A;  5I58 A;  1VFD A;  3VLV A;  2DSF A;  1MXU A;  4TLL B;  1JEV A;  2I3W A;  2B3F A;  4IO6 A;  2HZL A;  1B3G A;  4WED A;  2YJP A;  3RT6 B;  2RKM A;  1LB8 A;  5H8H A;  3DP6 A;  2Q9T A;  2HAV A;  3O2A A;  3ZS6 A;  5CI5 A;  1Y1M A;  2RC7 A;  3TOD A;  2DWA A;  4NWD A;  1PC3 A;  3KOS A;  1JW5 A;  2O7I A;  4JWY A;  1FQD A;  2IA4 A;  2QMX A;  2F78 A;  4OEV A;  4TQU Q;  3S2V A;  3TQW A;  2Y7W A;  3U92 A;  3MVX A;  3KJ7 A;  1B05 A;  4XKP A;  3TTM A;  1Z7M E;  3S9M C;  4EUO A;  3ONM A;  3BFT A;  2O84 X;  1RYO A;  2RCB A;  3A3U A;  4O3A A;  3FXQ A;  4P0I A;  5I2K B;  4NMY A;  4DIG A;  3LR1 A;  3TTR A;  4FEB A;  5H8F B;  4KHZ E;  3K1N A;  4X9T A;  5AA4 A;  4G68 A;  1H43 A;  2REJ A;  4H8I A;  3C35 A;  5FTI A;  4R6K A;  2Y7I A;  4G2Z A;  1MQJ A;  3THI A;  2ESN A;  3K0V A;  2VHA A;  4ND9 A;  4JSD A;  3IOU A;  5A5X A;  3RT8 A;  4DZ1 A;  4IO5 A;  2ZNS A;  5AA2 B;  3TTL A;  4NF8 A;  1XVY A;  3B6W A;  4FE8 A;  2HXW A;  2P1S A;  4ZED A;  5H8Q A;  2OBG A;  3OD7 A;  3TYH A;  3FVO A;  2G29 A;  4GWO A;  2E0S A;  1Z7N E;  2I0C A;  1BP5 A;  3H6W A;  2V3Q A;  2A5S A;  3TCF A;  2PBW A;  2XXX A;  1Y4T A;  5DEX B;  4POW A;  4UA8 A;  5FHO A;  2DP8 A;  1A55 A;  1N84 A;  3QAX A;  1YTV A;  1MY3 A;  3SEV A;  3FAT A;  3HHG A;  5AA2 D;  2F6P A;  5IAI A;  3F11 A;  4H5F A;  4F2O A;  1DMB A;  2H5Y A;  1IZ1 A;  3HV1 A;  4C1T A;  1N3W A;  3A3C A;  3TAJ A;  1MQG A;  4OHN A;  3C34 A;  3LSW A;  5ICQ A;  1OQH A;  4AQ4 A;  4NF4 A;  4LP2 B;  1N76 A;  1P1Q A;  2UVG A;  3UP9 A;  4ZZE A;  4QFN A;  2F7C A;  5H8N A;  2RCA A;  3TEP A;  1MXV A;  3MP6 A;  5TU0 A;  1LST A;  3K1M A;  2DWH A;  3SEW A;  2H25 A;  2Q8J A;  3R7X A;  1O7T A;  2H99 A;  1VE4 A;  3IOW A;  3KSX A;  4KPT A;  1EU8 A;  2NXO A;  4YMB A;  4ZDM A;  3DP8 A;  1SD3 A;  4LA9 A;  4E0X A;  2Q89 A;  3M3K A;  4ZEF A;  1VR5 A;  3VVE A;  2Z22 A;  3E13 X;  1A7L A;  1SI0 A;  4I1D A;  1BTJ A;  1ELJ A;  1KWH A;  1SYI A;  1UIV A;  3IL1 B;  3QUF A;  4YB6 A;  3KFM A;  4LON B;  2DQV A;  4BDN A;  3I3V A;  3B6T A;  1B52 A;  2GHB A;  1A99 A;  1IXC A;  4FAT A;  1B3E A;  3TKD A;  3FV2 A;  4I8C A;  4LAT A;  5CBS A;  1P1O A;  4MLQ A;  1PB7 A;  4U2R A;  3H03 A;  3HN0 A;  1P1U A;  4RK2 A;  2D5W A;  4FOR A;  3FJG A;  4EQ9 A;  5LOM A;  3O97 A;  1WOD A;  1UTH A;  1EZ9 A;  4K3F A;  4XIG Q;  3IOV A;  3UIF A;  1TFA A;  4JB7 A;  3MZ9 A;  1FQB A;  3SET A;  4MF3 A;  1Q1K A;  3SDF A;  3MC2 A;  3TDJ A;  4C1U A;  2DE2 A;  5H8Q B;  5K2Y A;  2QL3 A;  3EPE A;  3G7W A;  4G8N A;  4YB5 A;  5L9M A;  2HEU A;  3UOR A;  4BLA A;  2ALU A;  4LVQ A;  2QS1 A;  1R9L A;  4XKQ A;  2B3B A;  4YU0 A;  2D3I A;  4ECF A;  4BDL A;  1B4H A;  5F7V A;  3S9E A;  1QUL A;  4ZEB A;  1TWY A;  3FV1 A;  3CG1 A;  3MZB A;  5DT6 A;  3T9X B;  4PFU A;  3EHU A;  5DVI A;  5ITO A;  1S7Y A;  3H7M A;  2Q2A A;  3IB2 A;  3CVG A;  5ITP A;  2F5X A;  2R6G E;  3W9V A;  3AXF A;  4UAC A;  3W9W A;  2CZL A;  2F34 A;  4ZE8 A;  4GQO A;  4E0W A;  5EHM A;  1RKM A;  4NF4 B;  1B2H A;  1XC1 A;  1I6B A;  3FGS A;  2GHA A;  2XXR A;  4ESX A;  1M5B A;  3K4U A;  3O6H A;  3CFX A;  2QRY A;  3E9X A;  4G77 A;  1A40 A;  1IXG A;  2OJT A;  2Z8E A;  3A09 A;  3OEL A;  3PMX A;  5I2K A;  5H8F A;  4ZZA A;  3G3G A;  3KJT A;  2V25 A;  2XXU A;  1MDQ A;  4RYA A;  1GR2 A;  3CSB A;  4MH5 A;  2HQ0 A;  3JZJ A;  3UGW A;  4HCW A;  3QYT A;  5I2N A;  4NF6 B;  3G3I A;  3N5L A;  1FTK A;  1IEJ A;  1FQA A;  1JEU A;  2Z8D A;  4EF2 A;  5ELV A;  1ZTY A;  1I6A A;  2AL4 A;  1MH3 A;  5AA2 A;  3G3K A;  1VFE A;  2DWI A;  2O1L A;  1QUJ A;  3G3H A;  4Q30 B;  4OFO A;  1FTL A;  1NMU A;  2RC9 A;  3OO9 A;  2P0S A;  4QFP A;  1OIB A;  1NH8 A;  3MVZ A;  3H3G A;  3V8X B;  2O69 A;  4P0G A;  5F1Q A;  4R75 A;  2X26 A;  3O28 A;  4DXU A;  3T93 B;  3IB0 A;  5KCJ A;  1AH5 A;  3IB1 A;  4LQ5 A;  3G3F A;  3DP4 A;  3FVG A;  2XXV A;  4R72 A;  4H6D A;  1YCJ A;  2ZYO A;  2QS3 A;  3LSX A;  2LAO A;  3C36 A;  4EQB A;  1USY E;  4F19 A;  5ICT A;  4LZ7 A;  4OFL A;  3TCG A;  3PUY E;  3MVW A;  4ELO A;  3OXN A;  1Y4C A;  1GV8 A;  2THI A;  2Q2C A;  3IJO B;  1B7H A;  4GRK A;  3MPK A;  3OEM A;  3ZSF A;  2GFE A;  3OO6 A;  2DYX A;  2IEE A;  4PP0 A;  1MY4 A;  1OLC A;  3KBR A;  1JET A;  3Q29 A;  5JEI A;  3N6T A;  5CMC A;  4ZE9 A;  3S9N C;  2HFB A;  1FTJ A;  4ELR A;  3S9L C;  4PFT A;  1EZP A;  3C4M A;  3VLW A;  1ZU0 A;  3QK6 A;  4R9F A;  5BUU A;  3C31 A;  1P1N A;  1LCT A;  2RIN A;  4QSD A;  1XVX A;  3GBA A;  5L8D A;  4DDD A;  4G8M A;  3Q27 A;  4IO4 A;  4RJZ A;  4F3G A;  2NWJ A;  3RTW B;  3U93 A;  3PUV E;  1AIV A;  4YKK A;  1IXH A;  1OMP A;  4OXV A;  3OEK A;  1LAF E;  1MY1 A;  3KG2 A;  3EHS A;  4GLI A;  4HTG A;  4JWX A;  1I69 A;  1OQG A;  5I2N B;  3VVF A;  5JTY A;  1R6Z A;  4OMB A;  4YZZ A;  1LFI A;  1R1N A;  4MLV A;  2XXY A;  3D4G A;  1QKB A;  2Y7K A;  1CE2 A;  4KFQ A;  1B5J A;  4N6P A;  4F31 B;  4IY5 A;  1QVS A;  1FCK A;  2AL5 A;  4YB7 A;  1B58 A;  2M8C A;  1NH7 A;  1AOV A;  1DTZ A;  2HAU A;  3PPO A;  2PT1 A;  3MW0 A;  1MRP A;  1SI1 A;  3TUS A;  5L9O A;  1FQC A;  3T9H B;  1GGG A;  4F29 A;  3TEL A;  1XOC A;  1B5H A;  4H67 A;  1FQF A;  4FED A;  4L17 A;  4JBZ A;  2O6A A;  3PPN A;  4RA1 A;  5KCJ B;  4YAH X;  1IXI A;  1PB8 A;  4H8J A;  3I5O A;  3DEL B;  1MY2 A;  3O6G A;  4R6H A;  3U72 A;  1A8E A;  3MQ9 A;  4QSE A;  3R26 A;  3RY3 A;  4U4S A;  2XXQ A;  3PUX E;  3QIM A;  2GH9 A;  3IK6 B;  3C32 A;  4NTL A;  4TOZ A;  1MDP 1;  1B7Z A;  3MAM A;  4JSO A;  5I59 A;  4DXC A;  1LFH A;  3HPI A;  4PET A;  2REG A;  2WKY A;  3P7I A;  1YAE A;  5I56 B;  4ZEK A;  3WAE A;  2I49 A;  4RPO A;  5HPQ A;  2HCA A;  1PEB A;  4IB2 A;  3Q28 A;  3N6U A;  3I6V A;  3MP1 A;  1O64 A;  3IOR A;  2P2A A;  4H65 A;  4JDF A;  4EDP A;  4JWO A;  1PBP A;  1LAH E;  4NF6 A;  4I62 A;  2PT2 A;  2F7B A;  4KYS A;  3W15 C;  3K6X A;  4Z0I A;  2VGQ A;  2DOJ A;  4NE4 A;  2DE3 A;  3EHT A;  4ZEC A;  2OK2 A;  3TTK A;  3VXC A;  4GL0 A;  1FTM A;  4IO3 A;  5TPA A;  3B6Q A;  2F8D A;  1N0T A;  1JQF A;  4LZ8 A;  4RY1 A;  4C0R A;  4LQ2 A;  4O3C A;  3CI8 A;  1HSL A;  3SKP A;  3KN8 A;  1SQY A;  2QS4 A;  1Y20 A;  1QW0 A;  3MZ1 A;  4KCD A;  1MPB A;  1B0H A;  3H06 B;  3ZKL A;  5HM4 B;  3K01 A;  2Q88 A;  3N94 A;  1TT1 A;  2FNC A;  2XXT A;  1JW1 A;  4YKP A;  3FJM A;  5JTY B;  4GL8 A;  3FIR A;  3RN8 A;  3U8Q A;  1N7X A;  4XKR A;  2V3U A;  4F3B A;  1QUK A;  2I6E A;  2I4B A;  1IQ7 A;  1Y3N A;  4U1Z A;  4N13 A;  2UYF A;  1MPD A;  1B7U A;  3USD A;  3N26 A;  3KOT A;  1DOT A;  3MBP A;  3M3F A;  3PUZ E;  4H5G A;  4XKN A;  5AA3 A;  1MXY A;  1B3F A;  2UVH A;  5I84 A;  3UA8 A;  1P1W A;  2XHD A;  4GXS B;  1ZMG A;  3HST A;  4F18 A;  2V93 A;  4WXJ A;  4NF5 A;  1D3K A;  3RGY A;  4GOT A;  3OMB A;  4I9D A;  4TLM B;  5DTB A;  3FXR A;  1II5 A;  4OVJ A;  4Q5T A;  1D9V A;  3FVK A;  4PE5 B;  3T66 A;  2F7A A;  4OER A;  1LB9 A;  3E4R A;  1MQI A;  2FA7 A;  2GRV A;  5ISU A;  2XX7 A;  2O1M A;  3G3J A;  3VFJ A;  5I59 B;  4F2Q A;  4YKJ A;  3SER A;  4ELQ A;  1F9B A;  3ECR A;  2Y7P A;  3OOA A;  3Q25 A;  1HSE A;  4HCY A;  3GLB A;  3WAF A;  2G93 A;  1QKA A;  3RQT A;  3UN6 A;  5CBR A;  3H6U A;  2Y7R A;  1LCF A;  2YLN A;  1DPP A;  3FXU A;  4ISU A;  3LBS A;  3MWB A;  1NNF A;  1NNK A;  3KSJ A;  4RXL A;  1H76 A;  3GZG A;  1MG1 A;  2XX8 A;  4X48 A;  1B51 A;  3PMV A;  3MPL A;  5TP9 B;  3D4C A;  5JK4 A;  1RYX A;  5TPA B;  3LSF B;  3O6I A;  4R9G A;  3MJN A;  3BFU A;  4U1O A;  2Z8F A;  3KGC A;  3CRB A;  4P11 A;  1S50 A;  1B0L A;  4AB5 A;  4F1Y A;  1IIW A;  3EQ1 A;  3OSQ A;  2XX9 A;  4N07 A;  1POT A;  1SBP A;  3RPW A;  1MS7 A;  2OCU A;  1UTB B;  1M5F A;  5CMK A;  5KZT A;  3JYR A;  2BJJ X;  2Y84 A;  3VV5 A;  3HO7 A;  3KN3 A;  4F3S A;  3BBR A;  3MP8 A;  2PMS A;  3PPQ A;  4DE8 A;  3K6U A;  3IJX B;  4KR5 A;  4EXL A;  4ELP A;  1PDA A;  4MFI A;  2OWS A;  1NNT A;  2NUV A;  4KCC A;  2X7P A;  4BDO A;  1BKA A;  4F39 A;  4IO2 A;  1B40 A;  2ABH A;  2ZYK A;  2ONR A;  3PV0 E;  1US5 A;  3KN7 A;  4OEU A;  3QSL A;  2X7Q A;  3K02 A;  5M2V A;  2VOZ A;  1JVX A;  2H4I A;  4LZ5 A;  5I56 A;  4NF5 B;  5CC2 A;  5AE4 A;  4MBP A;  1DTG A;  4G68 C;  1USY H;  3MVY A;  4POX A;  3FUZ A;  1ATG A;  2YPN A;  2R9J A;  2ZNU A;  3KZG A;  2B65 A;  5CMM A;  2UYE A;  3RLF E;  1L5T A;  1LGB C;  2ONS A;  4H0W A;  1JVY A;  4OQO A;  3MUQ A;  3VDF A;  3S4U A;  4GVO A;  3V89 B;  1T0K A;  4GIZ A;  1BLF A;  4H1X A;  1MM7 A;  1CB6 A;  4QSC A;  4WEP A;  2O68 A;  3JV9 A;  4QRZ A;  5CRY A;  2I4C A;  2FYI A;  3KEI A;  3K2D A;  5B70 A;  1URD A;  3VXB A;  1ANF A;  2QS2 A;  1B3L A;  1B9J A;  4PFY A;  1J1N A;  2W7Y A;  1OVB A;  1MH4 A;  2ZMB A;  1Y3P A;  5EYF A;  3U94 A;  2F36 A;  2F35 A;  3CSG A;  2E1S A;  4RK9 A;  4XTC Q;  2HZK A;  1ZBM A;  4BDQ A;  2F6G A;  5I57 A;  3IO4 A;  5CM6 A;  4PFW A;  4OES A;  3CG3 A;  3FD3 A;  1JNF A;  4QFO A;  3T9U A;  3TMG A;  2I48 A;  1TXF A;  3FAS A;  4KYD A;  3K6W A;  4JXI A;  3RTF B;  3TFL A;  2XXW A;  5B7D A;  2V3T A;  4OYV A;  1O63 A;  1FQE A;  3QXM A;  1TFD A;  1H45 A;  5KDT B;  1M5D A;  4RPN A;  2PYY A;  4ESW A;  3ZKK A;  3LC8 A;  3IR1 A;  2XD3 A;  4LUB A;  4M4G A;  2PX1 A; 
#chains in the Genus database with same CATH topology
 1FBH A;  1LBC A;  3CFL A;  1K9Z A;  3DLN A;  2QVV A;  2Z23 A;  2OLB A;  3BKI B;  3OO8 A;  1GTK A;  1B32 A;  3TQL A;  4GXA A;  4NN3 A;  4R74 A;  1PBQ A;  4PGP A;  5DVJ A;  4QF9 A;  5FTH A;  4KYE A;  2H98 A;  4O3B A;  2PFZ A;  1AWB A;  4U23 A;  2DXR A;  3SEX A;  4DI3 D;  4OZ9 A;  5HBC A;  1ZLQ A;  3T9V A;  4EXK A;  2ZNT A;  3CIJ A;  1A8F A;  3E3K A;  4M1V A;  4IO7 A;  3OO7 A;  1MXW A;  4EQ7 A;  3IX1 A;  4MCO A;  1SW4 A;  4X8R A;  2XXP A;  3ROJ A;  1MXX A;  3O29 A;  1PB9 A;  4ZS9 A;  1NFT A;  4IR8 A;  5IKB A;  4HXV A;  1NV2 A;  5I58 B;  3SEY A;  4FAJ A;  1LLS A;  2AIX A;  1HSJ A;  2ANJ A;  4N91 A;  4NED A;  3RUM A;  3L6H A;  2VP1 A;  5DVF A;  3EF7 A;  2ONK E;  5AA1 A;  1ZJL A;  1B1X A;  1B1H A;  2DS9 A;  1XT8 A;  5H8H B;  3KC0 A;  1YZ0 A;  5TP9 A;  3TZA A;  2ZZV A;  1D4N A;  1SW5 A;  3K1P A;  2KLF A;  2I0B A;  1IIT A;  3GBB A;  5I7I A;  1FBD A;  3BIH A;  3R6U A;  5L9S A;  2CEY A;  1Y9U A;  1N3X A;  3IO6 A;  3K6V A;  2DWJ A;  4ONY A;  5LTC A;  5DW8 A;  2QVU A;  3Q26 A;  3FJ7 A;  1DSN A;  1JW4 A;  4KQP A;  2ZXT A;  1LBZ A;  5CMB A;  4FIM A;  3OSR A;  4PAK A;  1UTB A;  1R9Q A;  1FTO A;  1NKX A;  2OZZ A;  5EQ8 A;  1B3H A;  2A5T A;  3O9P A;  1FRP A;  1YXI A;  5IZZ A;  1IUD A;  1EYK A;  1LBB A;  2CZI A;  4F1V A;  3ILU B;  1MY0 A;  3U1O A;  5I57 B;  2DVC A;  1D9Y A;  3PU5 A;  5AA4 B;  4G68 B;  3TTN A;  4FJP A;  1POY 1;  5DYH A;  1N7W A;  4Z7E A;  1MQH A;  3M3L A;  3ILT B;  1B46 A;  3M8U A;  2FBP A;  3HHF A;  1Y1Z A;  4F1U A;  1BK4 A;  5A5X B;  3PUW E;  4GFR A;  1S9T A;  4WKM A;  5ET5 A;  3FBP A;  4GD5 A;  3LSL A;  1YPN A;  4DLD A;  4NF8 B;  2ZYN A;  3GXA A;  3FVN A;  4XXU A;  4HS7 A;  4HW8 A;  3LUY A;  2P3V A;  4GF8 A;  1EYI A;  1SVX B;  3VE1 B;  1LFG A;  2QSX A;  3K00 A;  2RF1 A;  1OLA A;  4NWC A;  3VVD A;  4RNS A;  3O66 A;  1A54 A;  2F97 A;  4U4X A;  2HPG A;  3EN3 A;  1BIY A;  3HCQ A;  4QFK A;  3LV0 A;  4OET A;  4IY6 A;  4X1D A;  3ODB A;  1UQW A;  4F3P A;  4OFJ A;  2VD3 A;  2H9B A;  5J1D A;  3RNN A;  2CMO A;  1Y3Q A;  2DE4 A;  1FPG A;  2DXY A;  1P99 A;  1M5C A;  1SW2 A;  2QPQ A;  2B4M A;  2V84 A;  1B4Z A;  1WVJ A;  3QUJ A;  3V83 A;  2FIE A;  1FW0 A;  4I40 A;  4DCX A;  5EHS A;  4G4P A;  4BDM A;  2FHY A;  4O7M A;  4N6D A;  1XS5 A;  1ZIU A;  4O7I A;  3T96 B;  3SES A;  3FZV A;  4OWD A;  2RC8 A;  3TCH A;  4AB6 A;  1DPE A;  2WEF A;  1OVT A;  4MIJ A;  3H6V A;  5ET8 A;  1MXZ A;  4YKI A;  5H8S A;  5H8N B;  1RDY A;  4MNC A;  3PD8 A;  1AL3 A;  2XXH A;  1B5I A;  4PQJ A;  1URG A;  1Q35 A;  4PTK A;  2I58 A;  2AYS A;  4YIC A;  4IGT A;  5F24 A;  2ZYM A;  2PVU A;  2OX3 A;  4MHF A;  4ZEI A;  1SYH A;  3PD9 A;  2B4L A;  4OTE A;  3T22 A;  2NVU B;  3IAZ A;  4KD5 A;  1QUI A;  4OEN A;  4YMA A;  2D21 A;  3PPP A;  3L6G A;  5EYG A;  2QMW A;  2R71 A;  4THI A;  1LAG E;  1XI6 A;  2F3B A;  4X1B A;  1B6H A;  4F22 A;  4DCY A;  5K2X A;  4G8H A;  4IGR A;  1NNP A;  1URS A;  2UXA A;  2UVI A;  2O7U A;  4U22 A;  1N04 A;  1VSO A;  1M5E A;  5KDT A;  2O51 A;  4OAN A;  3B7D A;  4R73 A;  1LAX A;  4FEC A;  1H3D A;  4DXB A;  4QFL A;  4Q8R A;  1GVC A;  1ZKB A;  2A5T B;  1UIU A;  4N6K A;  5FBP A;  3KC1 A;  4QXD A;  4EF1 A;  3TPA A;  2XXI A;  3CR9 A;  2HXR A;  5DEX A;  1NV0 A;  2XD2 A;  3V5A A;  3VLU A;  2VD2 A;  5FHM A;  3CFZ A;  1AMF A;  1NV1 A;  1QJM A;  4R6Y A;  5FHN A;  1MPC A;  1US4 A;  4R2F A;  4UAB A;  4BDR A;  2XWV A;  1SDX A;  3H4Z A;  4N4U A;  2QJE A;  1NL5 A;  2DVZ A;  3H6T A;  4FBP A;  4KXP A;  1UTH B;  3C33 A;  1I6Q A;  2XXK A;  4PF6 A;  3SEU A;  3IOT A;  5BWJ A;  4JVI A;  3C9H A;  2NOO A;  3DM0 A;  3OEN A;  1MM6 A;  1WDN A;  3PGF A;  1EH3 A;  1XHY A;  4KI0 E;  4QHQ A;  2WYP A;  4R2B A;  3PPR A;  1MQD A;  1NUZ A;  4U21 A;  2UVJ A;  4Q0C A;  5LDZ A;  1SW1 A;  1EZO A;  2OWT A;  1H44 A;  4HE2 A;  2I3V A;  3PMW A;  3ISP A;  3UK4 A;  5I58 A;  1VFD A;  2XWO A;  3VLV A;  2DSF A;  1MXU A;  4TLL B;  1JEV A;  2I3W A;  2B3F A;  4IO6 A;  2HZL A;  1B3G A;  4NGU A;  4WED A;  4I3E A;  2YJP A;  1LBX A;  3RT6 B;  2RKM A;  1LB8 A;  5H8H A;  3DP6 A;  2Q9T A;  2HAV A;  3O2A A;  3ZS6 A;  2PCR A;  5CI5 A;  1Y1M A;  2RC7 A;  2ZZW A;  3TOD A;  2DWA A;  4NWD A;  1PC3 A;  3KOS A;  1JW5 A;  2O7I A;  4JWY A;  1FQD A;  1CNQ A;  2IA4 A;  3RPL B;  2QMX A;  2F78 A;  4OEV A;  4TQU Q;  3S2V A;  3TQW A;  2Y7W A;  3U92 A;  3MVX A;  3KJ7 A;  1B05 A;  4XKP A;  3TTM A;  1Z7M E;  3S9M C;  1NV7 A;  4EUO A;  3ONM A;  3BFT A;  2O84 X;  1RYO A;  2RCB A;  3A3U A;  4O3A A;  3FXQ A;  4P0I A;  1FPL A;  5I2K B;  4NMY A;  3LR1 A;  2VPO A;  3TTR A;  4DIG A;  4FEB A;  5H8F B;  4KHZ E;  3K1N A;  4X9T A;  5AA4 A;  4G68 A;  1H43 A;  2REJ A;  4H8I A;  4P1E A;  3C35 A;  5FTI A;  1NUW A;  2Y7I A;  4P9K A;  4HE0 A;  4R6K A;  4G2Z A;  1MQJ A;  3THI A;  2ESN A;  3K0V A;  2VHA A;  1IMD A;  1NV5 A;  4ND9 A;  4JSD A;  3SZP A;  3IOU A;  5A5X A;  1K9Y A;  3RT8 A;  4DZ1 A;  4IO5 A;  2ZNS A;  5AA2 B;  3TTL A;  4NF8 A;  1XVY A;  3B6W A;  4FE8 A;  2HXW A;  1KA0 A;  2P1S A;  4ZED A;  5H8Q A;  2OBG A;  3OD7 A;  3TYH A;  5ET7 A;  3FVO A;  2G29 A;  4GWO A;  2E0S A;  1Z7N E;  1G0I A;  2I0C A;  1BP5 A;  3H6W A;  2V3Q A;  2A5S A;  3TCF A;  2Y5L A;  3B8B A;  2PBW A;  2XXX A;  1Y4T A;  5DEX B;  5I5P A;  4POW A;  4UA8 A;  4G61 A;  5FHO A;  2DP8 A;  1A55 A;  1N84 A;  3QAX A;  4GWU A;  1RDZ A;  1YTV A;  1MY3 A;  3SEV A;  3FAT A;  3HHG A;  4O8M A;  5AA2 D;  4P47 A;  2F6P A;  5IAI A;  3F11 A;  4H5F A;  4F2O A;  1DMB A;  2H5Y A;  1IZ1 A;  3HV1 A;  4C1T A;  1N3W A;  3A3C A;  4OVP A;  3TAJ A;  4GX6 A;  1MQG A;  4OHN A;  3C34 A;  3LSW A;  5ICQ A;  1OQH A;  4OVS A;  3FXB A;  4AQ4 A;  4NF4 A;  4LP2 B;  1N76 A;  1P1Q A;  4N17 A;  4OVR A;  2UVG A;  3UP9 A;  1RDX A;  4ZZE A;  4QFN A;  2F7C A;  5H8N A;  2RCA A;  2FVZ A;  1FBE A;  3TEP A;  1MXV A;  3MP6 A;  5TU0 A;  1LST A;  3K1M A;  2DWH A;  3SEW A;  2H25 A;  1NUX A;  2Q8J A;  3R7X A;  1O7T A;  2H99 A;  1VE4 A;  3IOW A;  3KSX A;  4PFI A;  2FIX A;  2Q74 A;  2P3N A;  4KPT A;  1EU8 A;  2NXO A;  4YMB A;  4ZDM A;  3DP8 A;  1SD3 A;  4LA9 A;  4E0X A;  2Q89 A;  3M3K A;  4ZEF A;  1VR5 A;  3VVE A;  2Z22 A;  3E79 A;  3E13 X;  1A7L A;  1SI0 A;  1LBW A;  4I1D A;  1BTJ A;  2GQ1 A;  1ELJ A;  1KWH A;  1SYI A;  2Y5K A;  1UIV A;  2XA5 A;  3IL1 B;  3QUF A;  4YB6 A;  3KFM A;  4LON B;  2DQV A;  3I3V A;  4BDN A;  3B6T A;  1B52 A;  2GHB A;  1A99 A;  4MMP A;  1IXC A;  4FAT A;  1B3E A;  3TKD A;  3FV2 A;  4I8C A;  1JP4 A;  4LAT A;  4PBQ A;  5CBS A;  1P1O A;  4MLQ A;  1PB7 A;  4U2R A;  3H03 A;  3HN0 A;  1P1U A;  4PAF A;  4RK2 A;  4NAP A;  2D5W A;  4FOR A;  2HHM A;  3FJG A;  4OVQ A;  4EQ9 A;  5LOM A;  3O97 A;  1WOD A;  1UTH A;  1EZ9 A;  4K3F A;  4XIG Q;  3IOV A;  3UIF A;  1TFA A;  4N8G A;  4JB7 A;  3MZ9 A;  1FQB A;  3SET A;  4MF3 A;  1Q1K A;  3NOH A;  3SDF A;  3MC2 A;  2R8T A;  3TDJ A;  4C1U A;  2DE2 A;  5H8Q B;  5K2Y A;  2CZH A;  2QL3 A;  3EPE A;  3G7W A;  4MX6 A;  4G8N A;  4YB5 A;  5L9M A;  2HEU A;  4PE3 A;  3UOR A;  4BLA A;  2ALU A;  4LVQ A;  2QS1 A;  1R9L A;  4PF8 A;  4XKQ A;  4AS4 A;  2B3B A;  4YU0 A;  2D3I A;  1FJ9 A;  1FPJ A;  4ECF A;  5IGA A;  4BDL A;  1B4H A;  5F7V A;  3S9E A;  1QUL A;  4ZEB A;  1TWY A;  3FV1 A;  3CG1 A;  3MZB A;  2QFL A;  2DDK A;  5DT6 A;  3T9X B;  4PFU A;  4PDH A;  3EHU A;  1FPE A;  1NV4 A;  4O94 A;  5DVI A;  5ITO A;  1S7Y A;  3H7M A;  2Q2A A;  3IB2 A;  4N8Y A;  3CVG A;  5ITP A;  2F5X A;  2R6G E;  3W9V A;  3AXF A;  4UAC A;  3W9W A;  3RPL A;  2CZL A;  2F34 A;  4ZE8 A;  4GQO A;  4E0W A;  5EHM A;  1RKM A;  4NF4 B;  1B2H A;  1XC1 A;  1I6B A;  3FGS A;  4GWW A;  2GHA A;  2XXR A;  4ESX A;  1M5B A;  3K4U A;  3O6H A;  3CFX A;  2QRY A;  3E9X A;  4G77 A;  1A40 A;  4GX4 A;  1IXG A;  4PBH A;  1INP A;  2OJT A;  2Z8E A;  3EKI A;  3A09 A;  3OEL A;  3PMX A;  5I2K A;  5H8F A;  4MNI A;  4ZZA A;  3G3G A;  3KJT A;  2V25 A;  2XXU A;  1MDQ A;  4RYA A;  1GR2 A;  3CSB A;  4MH5 A;  5IZ1 A;  2HQ0 A;  3JZJ A;  3UGW A;  4HCW A;  3QYT A;  5I2N A;  4NF6 B;  3G3I A;  3N5L A;  1FTK A;  1IEJ A;  1FQA A;  1LEV A;  1JEU A;  2Z8D A;  3A29 A;  4EF2 A;  5ELV A;  1ZTY A;  1I6A A;  2AL4 A;  1MH3 A;  5AA2 A;  3G3K A;  2VPN A;  1VFE A;  1FPI A;  2DWI A;  2O1L A;  1QUJ A;  1DBZ A;  3G3H A;  4AS5 A;  4Q30 B;  4OFO A;  1FTL A;  2JJK A;  3E78 A;  1NMU A;  2RC9 A;  3OO9 A;  2P0S A;  4QFP A;  1OIB A;  1NH8 A;  3MVZ A;  3H3G A;  1NV6 A;  3V8X B;  2O69 A;  4HE1 A;  4P0G A;  5F1Q A;  4R75 A;  2X26 A;  3O28 A;  2ZZX A;  4DXU A;  3T93 B;  3IB0 A;  5KCJ A;  1AH5 A;  3IB1 A;  4LQ5 A;  3G3F A;  3DP4 A;  3FVG A;  5T3J A;  2XXV A;  4R72 A;  4H6D A;  1YCJ A;  2WBD A;  2ZYO A;  2QS3 A;  3LSX A;  2LAO A;  3C36 A;  4EQB A;  4P8B A;  1USY E;  4F19 A;  2VT5 A;  5ICT A;  4LZ7 A;  4OFL A;  3TCG A;  3PUY E;  1FPD A;  3MVW A;  4ELO A;  3OXN A;  1Y4C A;  4MAG A;  4P1L A;  1GV8 A;  2THI A;  2Q2C A;  3IJO B;  1B7H A;  4GRK A;  3MYU A;  3MPK A;  3OEM A;  3ZSF A;  4H46 A;  2GFE A;  3OO6 A;  4N81 A;  2DYX A;  2IEE A;  4PP0 A;  1DCU A;  1MY4 A;  1OLC A;  3HFU A;  3KBR A;  1JET A;  2BJI A;  3Q29 A;  5JEI A;  3N6T A;  5CMC A;  4ZE9 A;  3S9N C;  2HFB A;  1FTJ A;  4N15 A;  4PC9 A;  4ELR A;  3S9L C;  4PFT A;  1EZP A;  3C4M A;  3VLW A;  1KZ8 A;  1ZU0 A;  3QK6 A;  4R9F A;  5BUU A;  3C31 A;  1P1N A;  1LCT A;  2RIN A;  4QSD A;  1XVX A;  3GBA A;  5L8D A;  4DDD A;  4G8M A;  3Q27 A;  4IO4 A;  4RJZ A;  4F3G A;  5ET6 A;  2NWJ A;  3RTW B;  3U93 A;  3PUV E;  1AIV A;  4YKK A;  1IXH A;  2KR0 A;  1OMP A;  4OXV A;  3OEK A;  1LAF E;  1MY1 A;  3KG2 A;  3EHS A;  4GLI A;  2WBB A;  4HTG A;  4JWX A;  1I69 A;  1OQG A;  5I2N B;  3VVF A;  5JTY A;  1R6Z A;  4OMB A;  4YZZ A;  1LFI A;  1R1N A;  4MLV A;  3IFA A;  2XXY A;  3D4G A;  1QKB A;  2Y7K A;  1CE2 A;  4KFQ A;  1B5J A;  4N6P A;  4F31 B;  4IY5 A;  4XEQ A;  1QVS A;  5EQ9 A;  1FCK A;  2AL5 A;  4YB7 A;  1B58 A;  2M8C A;  1NH7 A;  1AOV A;  1DTZ A;  2HAU A;  3PPO A;  2PT1 A;  3MW0 A;  1MRP A;  1SI1 A;  3TUS A;  5L9O A;  1FQC A;  3T9H B;  1GGG A;  4F29 A;  3TEL A;  4PFR A;  1XOC A;  1B5H A;  4H67 A;  4QBA A;  1FQF A;  4FED A;  3KBZ A;  4L17 A;  4JBZ A;  4P3L A;  2O6A A;  3PPN A;  4RA1 A;  1FSA A;  5KCJ B;  4JVD A;  4YAH X;  1IXI A;  1PB8 A;  4H8J A;  3I5O A;  3DEL B;  1MY2 A;  5J16 A;  2MKZ A;  3O6G A;  4R6H A;  3U72 A;  1A8E A;  3MQ9 A;  4QSE A;  4GBW A;  3R26 A;  3RY3 A;  4U4S A;  2XXQ A;  3PUX E;  3QIM A;  2GH9 A;  3IK6 B;  3C32 A;  4NTL A;  1VDW A;  4TOZ A;  1MDP 1;  1B7Z A;  3MAM A;  4JSO A;  5I59 A;  4DXC A;  1LFH A;  3D1R A;  3HPI A;  4PET A;  2REG A;  2WKY A;  3P7I A;  1YAE A;  5I56 B;  3MST A;  4ZEK A;  3WAE A;  2I49 A;  4RPO A;  5HPQ A;  2HCA A;  1PEB A;  4IB2 A;  2CZK A;  1FBG A;  3Q28 A;  3N6U A;  3I6V A;  3MP1 A;  1O64 A;  3IOR A;  2P2A A;  4GWX A;  4XFE A;  5EYH A;  4H65 A;  4JDF A;  4EDP A;  4JWO A;  1PBP A;  1FJ6 A;  1LAH E;  4NF6 A;  2CEX A;  4I62 A;  2PT2 A;  2F7B A;  4KYS A;  4NHB A;  3W15 C;  3K6X A;  4Z0I A;  2VGQ A;  2DOJ A;  4NE4 A;  2DE3 A;  3QMF A;  3EHT A;  4ZEC A;  2OK2 A;  3TTK A;  3VXC A;  4GL0 A;  3U65 A;  1FTM A;  2XWK A;  4IO3 A;  4NQ8 A;  5TPA A;  3B6Q A;  4DI4 B;  2F8D A;  1N0T A;  2WYK A;  1JQF A;  4RY1 A;  4LZ8 A;  4C0R A;  4LQ2 A;  5IZ3 A;  4O3C A;  3CI8 A;  1HSL A;  3SKP A;  1IMF A;  3KN8 A;  1SQY A;  2QS4 A;  1NUY A;  1Y20 A;  1QW0 A;  3MZ1 A;  4KCD A;  1FBF A;  1MPB A;  1B0H A;  2F3D A;  3H06 B;  3ZKL A;  5HM4 B;  3K01 A;  2Q88 A;  3N94 A;  1TT1 A;  2FNC A;  2XXT A;  5IM2 A;  1JW1 A;  4NG7 A;  4YKP A;  3FJM A;  1EYJ A;  5JTY B;  4GL8 A;  3FIR A;  2OWZ A;  3RN8 A;  3U8Q A;  2WX9 A;  1N7X A;  4XKR A;  2V3U A;  4F3B A;  1QUK A;  1QGX A;  2I6E A;  2I4B A;  1IQ7 A;  1Y3N A;  4U1Z A;  4N13 A;  2UYF A;  1MPD A;  1B7U A;  1FPF A;  3USD A;  3N26 A;  3KOT A;  4OA4 A;  2QVR A;  1DOT A;  3MBP A;  3M3F A;  2KQZ A;  3PUZ E;  4H5G A;  4XKN A;  5AA3 A;  1MXY A;  1B3F A;  2UVH A;  5I84 A;  3UA8 A;  1P1W A;  1FTA A;  1DK4 A;  2XHD A;  4GXS B;  1ZMG A;  3HST A;  4F18 A;  2V93 A;  4WXJ A;  4NF5 A;  3LUZ A;  1D3K A;  4P56 A;  3RGY A;  4GOT A;  3BIG A;  4MJO A;  1NI9 A;  3OMB A;  4NF0 A;  4I9D A;  4TLM B;  5DTB A;  1FBC A;  3FXR A;  1II5 A;  4OVJ A;  4MNP A;  2XWI A;  4Q5T A;  1D9V A;  3FVK A;  1Q9D A;  4PE5 B;  1D9Q A;  4LN5 A;  3T66 A;  2F7A A;  4PGN A;  3RYD A;  4OER A;  1LB9 A;  3E4R A;  1MQI A;  2FA7 A;  2GRV A;  5ISU A;  2XX7 A;  2O1M A;  3G3J A;  1IMC A;  3VFJ A;  5I59 B;  4F2Q A;  1SPI A;  1IMB A;  4YKJ A;  3SER A;  4ELQ A;  4XF5 A;  1F9B A;  3ECR A;  4PFB A;  1G0H A;  2Y7P A;  3OOA A;  3Q25 A;  1HSE A;  4HCY A;  3GLB A;  3WAF A;  4OVT A;  2G93 A;  1QKA A;  3RQT A;  3UN6 A;  5CBR A;  3H6U A;  2Y7R A;  1LCF A;  2YLN A;  1DPP A;  3FXU A;  4ISU A;  3LBS A;  5I3S A;  3MWB A;  1NNF A;  1NNK A;  3KSJ A;  1FBP A;  4JVC A;  4RXL A;  1H76 A;  3GZG A;  1KA1 A;  1LBV A;  1MG1 A;  1B51 A;  2XX8 A;  4X48 A;  2PFY A;  3PMV A;  3MPL A;  1FPB A;  5TP9 B;  3D4C A;  5JK4 A;  1RYX A;  5TPA B;  3LSF B;  3O6I A;  4R9G A;  4GBV A;  3MJN A;  3BFU A;  5A5L A;  4U1O A;  5IZ3 B;  2Z8F A;  3KGC A;  3CRB A;  4P11 A;  1S50 A;  1B0L A;  4AB5 A;  4F1Y A;  1IIW A;  3IFC A;  3EQ1 A;  3OSQ A;  2XX9 A;  4N07 A;  1POT A;  1SBP A;  3RPW A;  1MS7 A;  2OCU A;  1UTB B;  1M5F A;  5CMK A;  2L5V A;  5KZT A;  3JYR A;  2BJJ X;  4GWS A;  2Y84 A;  3VV5 A;  3HO7 A;  3KN3 A;  4F3S A;  3BBR A;  3MP8 A;  2PMS A;  3PPQ A;  4DE8 A;  3K6U A;  5EQ7 A;  3IJX B;  4KR5 A;  4EXL A;  4ELP A;  1PDA A;  4MFI A;  2OWS A;  1NNT A;  2NUV A;  4KCC A;  2X7P A;  4BDO A;  1BKA A;  4F39 A;  4IO2 A;  1B40 A;  2ABH A;  2ZYK A;  2ONR A;  3PV0 E;  1US5 A;  3KN7 A;  4OEU A;  3QSL A;  3T0J A;  2X7Q A;  3K02 A;  5M2V A;  4I3Y A;  1YYZ A;  2VOZ A;  1JVX A;  2H4I A;  4LZ5 A;  5I56 A;  1IMA A;  1LBY A;  4NF5 B;  5CC2 A;  5AE4 A;  5ESY A;  4GWZ A;  4MBP A;  1DTG A;  4G68 C;  1USY H;  3MVY A;  4POX A;  3FUZ A;  1ATG A;  2YPN A;  2R9J A;  2ZNU A;  3KZG A;  2B65 A;  5CMM A;  2UYE A;  3RLF E;  3T1B A;  1L5T A;  1LGB C;  2ONS A;  4H0W A;  1JVY A;  3CHG A;  4X04 A;  4OQO A;  3MUQ A;  3VDF A;  3S4U A;  4GVO A;  2Q8M A;  5EQA A;  4MEV A;  3V89 B;  1T0K A;  4GIZ A;  1BLF A;  4H1X A;  1MM7 A;  1CB6 A;  4QSC A;  4WEP A;  2O68 A;  3JV9 A;  4QRZ A;  5CRY A;  2I4C A;  2FYI A;  3KEI A;  3K2D A;  5B70 A;  1URD A;  3VXB A;  4GX3 A;  1ANF A;  2QS2 A;  1B3L A;  1B9J A;  4PFY A;  1IME A;  1J1N A;  2W7Y A;  1OVB A;  1MH4 A;  2ZMB A;  1Y3P A;  3B50 A;  5EYF A;  3GYY A;  4PCD A;  3U94 A;  2F36 A;  2F35 A;  3CSG A;  2E1S A;  4RK9 A;  4XTC Q;  2HZK A;  1ZBM A;  4BDQ A;  2F6G A;  5I57 A;  1NV3 A;  3IO4 A;  5CM6 A;  4PFW A;  4PAI A;  4OES A;  3CG3 A;  3FD3 A;  1JNF A;  4QFO A;  2V4C A;  3T9U A;  3TMG A;  2I48 A;  1FPK A;  4GWY A;  1TXF A;  3FAS A;  4KYD A;  4H45 A;  3K6W A;  4JXI A;  3RTF B;  4NX1 A;  3TFL A;  2XXW A;  3PTY A;  2V3T A;  5B7D A;  4OYV A;  4PDD A;  1O63 A;  1FQE A;  3QXM A;  1TFD A;  1H45 A;  5KDT B;  1M5D A;  4RPN A;  2PYY A;  4ESW A;  3ZKK A;  3LC8 A;  3IR1 A;  2XD3 A;  4LUB A;  4M4G A;  2PX1 A; 
#chains in the Genus database with same CATH homology
 1LBC A;  3CFL A;  3DLN A;  2Z23 A;  2OLB A;  3BKI B;  3OO8 A;  1GTK A;  1B32 A;  3TQL A;  4GXA A;  4R74 A;  1PBQ A;  5DVJ A;  4QF9 A;  5FTH A;  4KYE A;  2H98 A;  4O3B A;  4U23 A;  2DXR A;  3SEX A;  4OZ9 A;  5HBC A;  1ZLQ A;  3T9V A;  4EXK A;  2ZNT A;  3CIJ A;  1A8F A;  3E3K A;  4M1V A;  4IO7 A;  3OO7 A;  1MXW A;  4EQ7 A;  3IX1 A;  1SW4 A;  2XXP A;  1MXX A;  3O29 A;  1PB9 A;  4ZS9 A;  1NFT A;  5IKB A;  5I58 B;  3SEY A;  4FAJ A;  1LLS A;  2AIX A;  1HSJ A;  2ANJ A;  4NED A;  3RUM A;  3L6H A;  2VP1 A;  5DVF A;  3EF7 A;  2ONK E;  5AA1 A;  1ZJL A;  1B1X A;  1B1H A;  2DS9 A;  1XT8 A;  5H8H B;  5TP9 A;  3TZA A;  1D4N A;  1SW5 A;  3K1P A;  2KLF A;  2I0B A;  1IIT A;  3GBB A;  3R6U A;  5L9S A;  1Y9U A;  1N3X A;  3IO6 A;  3K6V A;  2DWJ A;  4ONY A;  3Q26 A;  3FJ7 A;  1DSN A;  1JW4 A;  4KQP A;  2ZXT A;  5CMB A;  4FIM A;  3OSR A;  1UTB A;  1R9Q A;  1FTO A;  1NKX A;  2OZZ A;  1B3H A;  2A5T A;  3O9P A;  1IUD A;  1LBB A;  4F1V A;  3ILU B;  1MY0 A;  3U1O A;  5I57 B;  2DVC A;  1D9Y A;  3PU5 A;  5AA4 B;  4G68 B;  3TTN A;  4FJP A;  1POY 1;  5DYH A;  1N7W A;  4Z7E A;  1MQH A;  3M3L A;  3ILT B;  1B46 A;  3M8U A;  3HHF A;  1Y1Z A;  4F1U A;  5A5X B;  3PUW E;  4GFR A;  1S9T A;  4WKM A;  4GD5 A;  3LSL A;  1YPN A;  4DLD A;  4NF8 B;  2ZYN A;  3GXA A;  3FVN A;  4XXU A;  4HS7 A;  4HW8 A;  3LUY A;  4GF8 A;  1SVX B;  3VE1 B;  1LFG A;  2QSX A;  3K00 A;  2RF1 A;  1OLA A;  4NWC A;  3VVD A;  4RNS A;  3O66 A;  1A54 A;  2F97 A;  4U4X A;  3EN3 A;  1BIY A;  3HCQ A;  4QFK A;  4OET A;  4IY6 A;  4X1D A;  3ODB A;  1UQW A;  4F3P A;  4OFJ A;  2VD3 A;  2H9B A;  5J1D A;  3RNN A;  2CMO A;  1Y3Q A;  2DE4 A;  2DXY A;  1P99 A;  1M5C A;  1SW2 A;  2QPQ A;  2V84 A;  1B4Z A;  1WVJ A;  3QUJ A;  3V83 A;  1FW0 A;  4DCX A;  5EHS A;  4G4P A;  4BDM A;  1XS5 A;  1ZIU A;  3T96 B;  3SES A;  3FZV A;  4OWD A;  2RC8 A;  3TCH A;  4AB6 A;  1DPE A;  1OVT A;  3H6V A;  1MXZ A;  4YKI A;  5H8S A;  5H8N B;  3PD8 A;  1AL3 A;  2XXH A;  1B5I A;  4PQJ A;  1URG A;  1Q35 A;  2I58 A;  2AYS A;  4YIC A;  4IGT A;  2ZYM A;  2PVU A;  4ZEI A;  1SYH A;  3PD9 A;  4OTE A;  3T22 A;  2NVU B;  3IAZ A;  4KD5 A;  1QUI A;  4OEN A;  4YMA A;  2D21 A;  3PPP A;  3L6G A;  2QMW A;  2R71 A;  4THI A;  1LAG E;  4X1B A;  1B6H A;  4F22 A;  4DCY A;  5K2X A;  4G8H A;  4IGR A;  1NNP A;  1URS A;  2UXA A;  2UVI A;  2O7U A;  4U22 A;  1N04 A;  1VSO A;  1M5E A;  5KDT A;  2O51 A;  3B7D A;  4R73 A;  1LAX A;  4FEC A;  1H3D A;  4DXB A;  4QFL A;  4Q8R A;  1GVC A;  1ZKB A;  2A5T B;  1UIU A;  4EF1 A;  3TPA A;  2XXI A;  3CR9 A;  5DEX A;  2XD2 A;  3V5A A;  3VLU A;  2VD2 A;  5FHM A;  3CFZ A;  1AMF A;  1QJM A;  4R6Y A;  5FHN A;  1MPC A;  1US4 A;  4R2F A;  4BDR A;  1SDX A;  3H4Z A;  2QJE A;  1NL5 A;  2DVZ A;  3H6T A;  1UTH B;  3C33 A;  1I6Q A;  3SEU A;  3IOT A;  5BWJ A;  3C9H A;  2NOO A;  3DM0 A;  3OEN A;  1MM6 A;  1WDN A;  3PGF A;  1EH3 A;  1XHY A;  4KI0 E;  4QHQ A;  4R2B A;  3PPR A;  1MQD A;  4U21 A;  2UVJ A;  4Q0C A;  1SW1 A;  1EZO A;  2OWT A;  1H44 A;  2I3V A;  3PMW A;  3UK4 A;  5I58 A;  1VFD A;  3VLV A;  2DSF A;  1MXU A;  4TLL B;  1JEV A;  2I3W A;  2B3F A;  4IO6 A;  2HZL A;  1B3G A;  4WED A;  2YJP A;  3RT6 B;  2RKM A;  1LB8 A;  5H8H A;  3DP6 A;  2Q9T A;  2HAV A;  3O2A A;  3ZS6 A;  5CI5 A;  1Y1M A;  2RC7 A;  3TOD A;  2DWA A;  4NWD A;  1PC3 A;  3KOS A;  1JW5 A;  2O7I A;  4JWY A;  1FQD A;  2IA4 A;  2QMX A;  2F78 A;  4OEV A;  4TQU Q;  3S2V A;  3TQW A;  2Y7W A;  3U92 A;  3MVX A;  3KJ7 A;  1B05 A;  4XKP A;  3TTM A;  1Z7M E;  3S9M C;  4EUO A;  3ONM A;  3BFT A;  2O84 X;  1RYO A;  2RCB A;  3A3U A;  4O3A A;  3FXQ A;  4P0I A;  5I2K B;  4NMY A;  4DIG A;  3LR1 A;  3TTR A;  4FEB A;  5H8F B;  4KHZ E;  3K1N A;  4X9T A;  5AA4 A;  4G68 A;  1H43 A;  2REJ A;  4H8I A;  3C35 A;  5FTI A;  4R6K A;  2Y7I A;  4G2Z A;  1MQJ A;  3THI A;  2ESN A;  3K0V A;  2VHA A;  4ND9 A;  4JSD A;  3IOU A;  5A5X A;  3RT8 A;  4DZ1 A;  4IO5 A;  2ZNS A;  5AA2 B;  3TTL A;  4NF8 A;  1XVY A;  3B6W A;  4FE8 A;  2HXW A;  2P1S A;  4ZED A;  5H8Q A;  2OBG A;  3OD7 A;  3TYH A;  3FVO A;  2G29 A;  4GWO A;  2E0S A;  1Z7N E;  2I0C A;  1BP5 A;  3H6W A;  2V3Q A;  2A5S A;  3TCF A;  2PBW A;  2XXX A;  1Y4T A;  5DEX B;  4POW A;  4UA8 A;  5FHO A;  2DP8 A;  1A55 A;  1N84 A;  3QAX A;  1YTV A;  1MY3 A;  3SEV A;  3FAT A;  3HHG A;  5AA2 D;  2F6P A;  5IAI A;  3F11 A;  4H5F A;  4F2O A;  1DMB A;  2H5Y A;  1IZ1 A;  3HV1 A;  4C1T A;  1N3W A;  3A3C A;  3TAJ A;  1MQG A;  4OHN A;  3C34 A;  3LSW A;  5ICQ A;  1OQH A;  4AQ4 A;  4NF4 A;  4LP2 B;  1N76 A;  1P1Q A;  2UVG A;  3UP9 A;  4ZZE A;  4QFN A;  2F7C A;  5H8N A;  2RCA A;  3TEP A;  1MXV A;  3MP6 A;  5TU0 A;  1LST A;  3K1M A;  2DWH A;  3SEW A;  2H25 A;  2Q8J A;  3R7X A;  1O7T A;  2H99 A;  1VE4 A;  3IOW A;  3KSX A;  4KPT A;  1EU8 A;  2NXO A;  4YMB A;  4ZDM A;  3DP8 A;  1SD3 A;  4LA9 A;  4E0X A;  2Q89 A;  3M3K A;  4ZEF A;  1VR5 A;  3VVE A;  2Z22 A;  3E13 X;  1A7L A;  1SI0 A;  4I1D A;  1BTJ A;  1ELJ A;  1KWH A;  1SYI A;  1UIV A;  3IL1 B;  3QUF A;  4YB6 A;  3KFM A;  4LON B;  2DQV A;  4BDN A;  3I3V A;  3B6T A;  1B52 A;  2GHB A;  1A99 A;  1IXC A;  4FAT A;  1B3E A;  3TKD A;  3FV2 A;  4I8C A;  4LAT A;  5CBS A;  1P1O A;  4MLQ A;  1PB7 A;  4U2R A;  3H03 A;  3HN0 A;  1P1U A;  4RK2 A;  2D5W A;  4FOR A;  3FJG A;  4EQ9 A;  5LOM A;  3O97 A;  1WOD A;  1UTH A;  1EZ9 A;  4K3F A;  4XIG Q;  3IOV A;  3UIF A;  1TFA A;  4JB7 A;  3MZ9 A;  1FQB A;  3SET A;  4MF3 A;  1Q1K A;  3SDF A;  3MC2 A;  3TDJ A;  4C1U A;  2DE2 A;  5H8Q B;  5K2Y A;  2QL3 A;  3EPE A;  3G7W A;  4G8N A;  4YB5 A;  5L9M A;  2HEU A;  3UOR A;  4BLA A;  2ALU A;  4LVQ A;  2QS1 A;  1R9L A;  4XKQ A;  2B3B A;  4YU0 A;  2D3I A;  4ECF A;  4BDL A;  1B4H A;  5F7V A;  3S9E A;  1QUL A;  4ZEB A;  1TWY A;  3FV1 A;  3CG1 A;  3MZB A;  5DT6 A;  3T9X B;  4PFU A;  3EHU A;  5DVI A;  5ITO A;  1S7Y A;  3H7M A;  2Q2A A;  3IB2 A;  3CVG A;  5ITP A;  2F5X A;  2R6G E;  3W9V A;  3AXF A;  4UAC A;  3W9W A;  2CZL A;  2F34 A;  4ZE8 A;  4GQO A;  4E0W A;  5EHM A;  1RKM A;  4NF4 B;  1B2H A;  1XC1 A;  1I6B A;  3FGS A;  2GHA A;  2XXR A;  4ESX A;  1M5B A;  3K4U A;  3O6H A;  3CFX A;  2QRY A;  3E9X A;  4G77 A;  1A40 A;  1IXG A;  2OJT A;  2Z8E A;  3A09 A;  3OEL A;  3PMX A;  5I2K A;  5H8F A;  4ZZA A;  3G3G A;  3KJT A;  2V25 A;  2XXU A;  1MDQ A;  4RYA A;  1GR2 A;  3CSB A;  4MH5 A;  2HQ0 A;  3JZJ A;  3UGW A;  4HCW A;  3QYT A;  5I2N A;  4NF6 B;  3G3I A;  3N5L A;  1FTK A;  1IEJ A;  1FQA A;  1JEU A;  2Z8D A;  4EF2 A;  5ELV A;  1ZTY A;  1I6A A;  2AL4 A;  1MH3 A;  5AA2 A;  3G3K A;  1VFE A;  2DWI A;  2O1L A;  1QUJ A;  3G3H A;  4Q30 B;  4OFO A;  1FTL A;  1NMU A;  2RC9 A;  3OO9 A;  2P0S A;  4QFP A;  1OIB A;  1NH8 A;  3MVZ A;  3H3G A;  3V8X B;  2O69 A;  4P0G A;  5F1Q A;  4R75 A;  2X26 A;  3O28 A;  4DXU A;  3T93 B;  3IB0 A;  5KCJ A;  1AH5 A;  3IB1 A;  4LQ5 A;  3G3F A;  3DP4 A;  3FVG A;  2XXV A;  4R72 A;  4H6D A;  1YCJ A;  2ZYO A;  2QS3 A;  3LSX A;  2LAO A;  3C36 A;  4EQB A;  1USY E;  4F19 A;  5ICT A;  4LZ7 A;  4OFL A;  3TCG A;  3PUY E;  3MVW A;  4ELO A;  3OXN A;  1Y4C A;  1GV8 A;  2THI A;  2Q2C A;  3IJO B;  1B7H A;  4GRK A;  3MPK A;  3OEM A;  3ZSF A;  2GFE A;  3OO6 A;  2DYX A;  2IEE A;  4PP0 A;  1MY4 A;  1OLC A;  3KBR A;  1JET A;  3Q29 A;  5JEI A;  3N6T A;  5CMC A;  4ZE9 A;  3S9N C;  2HFB A;  1FTJ A;  4ELR A;  3S9L C;  4PFT A;  1EZP A;  3C4M A;  3VLW A;  1ZU0 A;  3QK6 A;  4R9F A;  5BUU A;  3C31 A;  1P1N A;  1LCT A;  2RIN A;  4QSD A;  1XVX A;  3GBA A;  5L8D A;  4DDD A;  4G8M A;  3Q27 A;  4IO4 A;  4RJZ A;  4F3G A;  2NWJ A;  3RTW B;  3U93 A;  3PUV E;  1AIV A;  4YKK A;  1IXH A;  1OMP A;  4OXV A;  3OEK A;  1LAF E;  1MY1 A;  3KG2 A;  3EHS A;  4GLI A;  4HTG A;  4JWX A;  1I69 A;  1OQG A;  5I2N B;  3VVF A;  5JTY A;  1R6Z A;  4OMB A;  4YZZ A;  1LFI A;  1R1N A;  4MLV A;  2XXY A;  3D4G A;  1QKB A;  2Y7K A;  1CE2 A;  4KFQ A;  1B5J A;  4N6P A;  4F31 B;  4IY5 A;  1QVS A;  1FCK A;  2AL5 A;  4YB7 A;  1B58 A;  2M8C A;  1NH7 A;  1AOV A;  1DTZ A;  2HAU A;  3PPO A;  2PT1 A;  3MW0 A;  1MRP A;  1SI1 A;  3TUS A;  5L9O A;  1FQC A;  3T9H B;  1GGG A;  4F29 A;  3TEL A;  1XOC A;  1B5H A;  4H67 A;  1FQF A;  4FED A;  4L17 A;  4JBZ A;  2O6A A;  3PPN A;  4RA1 A;  5KCJ B;  4YAH X;  1IXI A;  1PB8 A;  4H8J A;  3I5O A;  3DEL B;  1MY2 A;  3O6G A;  4R6H A;  3U72 A;  1A8E A;  3MQ9 A;  4QSE A;  3R26 A;  3RY3 A;  4U4S A;  2XXQ A;  3PUX E;  3QIM A;  2GH9 A;  3IK6 B;  3C32 A;  4NTL A;  4TOZ A;  1MDP 1;  1B7Z A;  3MAM A;  4JSO A;  5I59 A;  4DXC A;  1LFH A;  3HPI A;  4PET A;  2REG A;  2WKY A;  3P7I A;  1YAE A;  5I56 B;  4ZEK A;  3WAE A;  2I49 A;  4RPO A;  5HPQ A;  2HCA A;  1PEB A;  4IB2 A;  3Q28 A;  3N6U A;  3I6V A;  3MP1 A;  1O64 A;  3IOR A;  2P2A A;  4H65 A;  4JDF A;  4EDP A;  4JWO A;  1PBP A;  1LAH E;  4NF6 A;  4I62 A;  2PT2 A;  2F7B A;  4KYS A;  3W15 C;  3K6X A;  4Z0I A;  2VGQ A;  2DOJ A;  4NE4 A;  2DE3 A;  3EHT A;  4ZEC A;  2OK2 A;  3TTK A;  3VXC A;  4GL0 A;  1FTM A;  4IO3 A;  5TPA A;  3B6Q A;  2F8D A;  1N0T A;  1JQF A;  4LZ8 A;  4RY1 A;  4C0R A;  4LQ2 A;  4O3C A;  3CI8 A;  1HSL A;  3SKP A;  3KN8 A;  1SQY A;  2QS4 A;  1Y20 A;  1QW0 A;  3MZ1 A;  4KCD A;  1MPB A;  1B0H A;  3H06 B;  3ZKL A;  5HM4 B;  3K01 A;  2Q88 A;  3N94 A;  1TT1 A;  2FNC A;  2XXT A;  1JW1 A;  4YKP A;  3FJM A;  5JTY B;  4GL8 A;  3FIR A;  3RN8 A;  3U8Q A;  1N7X A;  4XKR A;  2V3U A;  4F3B A;  1QUK A;  2I6E A;  2I4B A;  1IQ7 A;  1Y3N A;  4U1Z A;  4N13 A;  2UYF A;  1MPD A;  1B7U A;  3USD A;  3N26 A;  3KOT A;  1DOT A;  3MBP A;  3M3F A;  3PUZ E;  4H5G A;  4XKN A;  5AA3 A;  1MXY A;  1B3F A;  2UVH A;  5I84 A;  3UA8 A;  1P1W A;  2XHD A;  4GXS B;  1ZMG A;  3HST A;  4F18 A;  2V93 A;  4WXJ A;  4NF5 A;  1D3K A;  3RGY A;  4GOT A;  3OMB A;  4I9D A;  4TLM B;  5DTB A;  3FXR A;  1II5 A;  4OVJ A;  4Q5T A;  1D9V A;  3FVK A;  4PE5 B;  3T66 A;  2F7A A;  4OER A;  1LB9 A;  3E4R A;  1MQI A;  2FA7 A;  2GRV A;  5ISU A;  2XX7 A;  2O1M A;  3G3J A;  3VFJ A;  5I59 B;  4F2Q A;  4YKJ A;  3SER A;  4ELQ A;  1F9B A;  3ECR A;  2Y7P A;  3OOA A;  3Q25 A;  1HSE A;  4HCY A;  3GLB A;  3WAF A;  2G93 A;  1QKA A;  3RQT A;  3UN6 A;  5CBR A;  3H6U A;  2Y7R A;  1LCF A;  2YLN A;  1DPP A;  3FXU A;  4ISU A;  3LBS A;  3MWB A;  1NNF A;  1NNK A;  3KSJ A;  4RXL A;  1H76 A;  3GZG A;  1MG1 A;  2XX8 A;  4X48 A;  1B51 A;  3PMV A;  3MPL A;  5TP9 B;  3D4C A;  5JK4 A;  1RYX A;  5TPA B;  3LSF B;  3O6I A;  4R9G A;  3MJN A;  3BFU A;  4U1O A;  2Z8F A;  3KGC A;  3CRB A;  4P11 A;  1S50 A;  1B0L A;  4AB5 A;  4F1Y A;  1IIW A;  3EQ1 A;  3OSQ A;  2XX9 A;  4N07 A;  1POT A;  1SBP A;  3RPW A;  1MS7 A;  2OCU A;  1UTB B;  1M5F A;  5CMK A;  5KZT A;  3JYR A;  2BJJ X;  2Y84 A;  3VV5 A;  3HO7 A;  3KN3 A;  4F3S A;  3BBR A;  3MP8 A;  2PMS A;  3PPQ A;  4DE8 A;  3K6U A;  3IJX B;  4KR5 A;  4EXL A;  4ELP A;  1PDA A;  4MFI A;  2OWS A;  1NNT A;  2NUV A;  4KCC A;  2X7P A;  4BDO A;  1BKA A;  4F39 A;  4IO2 A;  1B40 A;  2ABH A;  2ZYK A;  2ONR A;  3PV0 E;  1US5 A;  3KN7 A;  4OEU A;  3QSL A;  2X7Q A;  3K02 A;  5M2V A;  2VOZ A;  1JVX A;  2H4I A;  4LZ5 A;  5I56 A;  4NF5 B;  5CC2 A;  5AE4 A;  4MBP A;  1DTG A;  4G68 C;  1USY H;  3MVY A;  4POX A;  3FUZ A;  1ATG A;  2YPN A;  2R9J A;  2ZNU A;  3KZG A;  2B65 A;  5CMM A;  2UYE A;  3RLF E;  1L5T A;  1LGB C;  2ONS A;  4H0W A;  1JVY A;  4OQO A;  3MUQ A;  3VDF A;  3S4U A;  4GVO A;  3V89 B;  1T0K A;  4GIZ A;  1BLF A;  4H1X A;  1MM7 A;  1CB6 A;  4QSC A;  4WEP A;  2O68 A;  3JV9 A;  4QRZ A;  5CRY A;  2I4C A;  2FYI A;  3KEI A;  3K2D A;  5B70 A;  1URD A;  3VXB A;  1ANF A;  2QS2 A;  1B3L A;  1B9J A;  4PFY A;  1J1N A;  2W7Y A;  1OVB A;  1MH4 A;  2ZMB A;  1Y3P A;  5EYF A;  3U94 A;  2F36 A;  2F35 A;  3CSG A;  2E1S A;  4RK9 A;  4XTC Q;  2HZK A;  1ZBM A;  4BDQ A;  2F6G A;  5I57 A;  3IO4 A;  5CM6 A;  4PFW A;  4OES A;  3CG3 A;  3FD3 A;  1JNF A;  4QFO A;  3T9U A;  3TMG A;  2I48 A;  1TXF A;  3FAS A;  4KYD A;  3K6W A;  4JXI A;  3RTF B;  3TFL A;  2XXW A;  5B7D A;  2V3T A;  4OYV A;  1O63 A;  1FQE A;  3QXM A;  1TFD A;  1H45 A;  5KDT B;  1M5D A;  4RPN A;  2PYY A;  4ESW A;  3ZKK A;  3LC8 A;  3IR1 A;  2XD3 A;  4LUB A;  4M4G A;  2PX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...