1SW4A

Crystal structure of prox from archeoglobus fulgidus in complex with trimethyl ammonium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDYALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the binding of compatible solutes by ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein binding
molecule keywords osmoprotection protein (proX)
total genus 99
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sw4A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 1sw4A02
1RYXA 4DDDA 2W7YA 4RNSA 4NWDA 4ELQA 1XS5A 4IGRA 5TPAA 4OETA 4Q0CA 4LUBA 1D9YA 5ITPA 4RA1A 1B5JA 3L6GA 1GGGA 4G68A 3G3IA 2NXOA 1FTKA 4THIA 1B0HA 1MQIA 2P1SA 1B7ZA 1MQGA 1I6QA 4XKNA 4OEVA 3RPWA 2O7IA 4EQ9A 3KBRA 4ZEDA 2VD3A 1YPNA 2I48A 3TCFA 3FASA 5DEXB 3W15C 1NNPA 2O69A 4X1DA 4FATA 3R7XA 4F18A 1FTMA 4YKIA 3TTLA 5I2NA 3KSJA 3PUWE 1Y20A 5H8SA 1AH5A 2IA4A 3QAXA 1LCTA 4MLVA 4U1ZA 3BFUA 1A8FA 1B6HA 1D4NA 2OWSA 3IO6A 1ZU0A 4O3AA 3KEIA 1TXFA 1R9QA 1MM6A 2H98A 4MF3A 4P0GA 1MXXA 5F7VA 3RTWB 4WEDA 3SKPA 5AA2B 3RUMA 3O29A 3EHSA 4OFJA 4X48A 4DZ1A 2VGQA 1DMBA 2PMSA 2R6GE 5B7DA 2XXXA 3B6QA 3KJTA 3HV1A 5H8QA 1MXWA 4C1TA 4U22A 1JVYA 1UQWA 1ZMGA 3CFXA 1GTKA 3IJOB 2F7CA 3T66A 3TZAA 3HN0A 1NH8A 3HSTA 5TPAB 1D3KA 4QSEA 3E9XA 1P1QA 4H65A 2QRYA 2UVGA 3FXQA 3I3VA 3IOWA 3Q27A 4IO5A 3TUSA 1O63A 1LLSA 3GBAA 1R6ZA 2X26A 2Z8DA 4HCYA 2I4BA 4YB7A 5AA2D 1MQJA 2ZNUA 5DTBA 4R2BA 3E3KA 3ILTB 4I62A 3VXCA 1MY3A 1MS7A 2HZLA 2LAOA 2M8CA 3H6VA 5I58B 4U1OA 3TYHA 2Q89A 1B05A 4GL0A 4F3PA 4UACA 3K6UA 4WKMA 2AL5A 1CE2A 1OIBA 1QUKA 1LAXA 1R9LA 3QXMA 3H3GA 3LSFB 3IB2A 1POY1 2PT1A 4UA8A 4QFOA 4H1XA 4ND9A 3U8QA 3UN6A 2F7AA 2XXYA 4YB5A 5I84A 4C1UA 1PC3A 2XXPA 4RPOA 3TAJA 1EU8A 4QHQA 5AA3A 1A99A 3GBBA 1R1NA 1PB7A 3K1MA 5DVJA 2KLFA 4FIMA 1TFDA 4OXVA 2XHDA 1B0LA 4C0RA 1N7XA 5H8HB 4ESWA 3RGYA 3CR9A 3FJGA 4TLLB 2QS4A 3EQ1A 3IOTA 1OVTA 5M2VA 1LAGE 3V8XB 3FXRA 1LBBA 2REJA 2V25A 3MVWA 1MXUA 1A40A 1PB8A 2QS1A 3KG2A 4GF8A 2F35A 2GHBA 4G8HA 2UYEA 3IK6B 3VLWA 2OLBA 3N6TA 2RC7A 3O9PA 4R75A 2PYYA 1LSTA 4QRZA 3QSLA 1MG1A 4YB6A 4E0WA 4KD5A 4X1BA 4H8JA 1Y9UA 3O6IA 4P11A 3K2DA 4KYEA 3MVZA 3THIA 1B9JA 3U94A 4EDPA 2XXRA 4ZEBA 4U4XA 4H6DA 4OFLA 4R6KA 3MC2A 4TOZA 2UVJA 3LSXA 4JBZA 3MPLA 4R73A 1LAFE 5FTHA 1FQAA 3T9XB 2FA7A 4F3BA 4NF8A 3C9HA 4F31B 3IX1A 2AIXA 3O66A 1OLCA 2Y7PA 2E1SA 3IB0A 1TFAA 4GLIA 1F9BA 5TP9B 4BDOA 1I6AA 3D4CA 4PETA 1WDNA 3LSWA 1P1UA 4KR5A 5TP9A 4IO4A 2XD2A 4ZEKA 4IGTA 5L9SA 3G3FA 2DP8A 1IITA 1AL3A 4EQBA 1KWHA 2ANJA 3TEPA 1OLAA 3FXUA 4XTCQ 3ECRA 4DCYA 1IQ7A 3FVOA 5AA2A 4LQ5A 3WAEA 1MH4A 2DE2A 2F6PA 3KN3A 3M3LA 2O51A 3OMBA 3PPNA 2I3WA 4GWOA 3QUJA 2AYSA 4QFLA 2NVUB 4HS7A 4JWYA 1B4ZA 2GHAA 1RYOA 1GVCA 1TT1A 3TKDA 2HXWA 3PD8A 4MLQA 5CC2A 1MM7A 1B3GA 2E0SA 3K6WA 3OXNA 2F78A 3OOAA 3LUYA 4NTLA 4OYVA 3RTFB 3TFLA 4AB5A 4F1UA 4IY6A 1H43A 4OZ9A 3UORA 5CMCA 3K6VA 4ZS9A 1MQHA 1MY4A 1B1HA 1N3XA 2F97A 1B7UA 4JWXA 2WKYA 3C34A 4GRKA 4KCCA 4QSDA 2PVUA 3TTKA 4BDMA 2R9JA 4MFIA 1WVJA 1FQDA 3I5OA 1ZKBA 3VDFA 1JVXA 3FIRA 4FEBA 4NF6B 3H6TA 4XKRA 4N6PA 5A5XA 1US4A 1NMUA 1VE4A 3O6GA 3PUYE 1SVXB 1JNFA 1DSNA 3EHTA 4H5GA 2XXWA 1IEJA 1NNTA 4ZZAA 4ZE8A 3K1PA 3FATA 5I56B 3GXAA 3RY3A 1PBPA 1QJMA 3Q26A 4F39A 3QYTA 5KZTA 1UIVA 4IO6A 1MXZA 3OENA 4NF4A 3C32A 3LC8A 5I56A 2XX8A 1BTJA 3A3CA 3TELA 2ZYOA 4YMBA 1BIYA 3P7IA 4GD5A 3CRBA 3CFLA 1XOCA 2DVCA 2ZYNA 4G68B 4JB7A 1MPCA 1MY0A 1PB9A 2O84X 2OK2A 2Y7KA 1H76A 4GXAA 2F5XA 5AA1A 5A5XB 1US5A 1OQHA 2O6AA 2FNCA 4XKPA 3TTRA 3V89B 1M5EA 3IOVA 1B3FA 4Q8RA 4NWCA 4HTGA 1MDQA 4I8CA 3AXFA 1L5TA 4BDNA 3K0VA 1FTOA 1FQBA 5CBSA 5CRYA 4EUOA 3MJNA 4IY5A 3TODA 1B40A 2Q2AA 3QIMA 4JDFA 4DXUA 1ZLQA 3W9VA 3N6UA 1D9VA 1B52A 2THIA 4U4SA 4DLDA 1JW5A 5CBRA 3FVNA 4OTEA 4DE8A 5CMMA 5KDTB 5ICTA 4FE8A 3MAMA 4OVJA 1FW0A 3SDFA 2YPNA 1URDA 4G8MA 2BJJX 4YU0A 3TCHA 1AMFA 4XKQA 1DTZA 2VHAA 1JW1A 3C33A 1H44A 4QFKA 3V5AA 3O2AA 5I59A 1I6BA 3CI8A 4R6YA 2OBGA 3PPPA 1N04A 4YKKA 4ZZEA 3WAFA 2B3FA 3SEVA 3VV5A 3MZBA 3W9WA 2GRVA 5I2NB 2ZYMA 1JEVA 3OSQA 2DWHA 3UGWA 4AQ4A 2DXRA 4PFUA 4EXLA 3K00A 1JEUA 4OWDA 2B65A 3FJ7A 4POXA 3FD3A 4JSOA 1P1NA 3TPAA 1Q1KA 4LZ7A 5FHNA 5IAIA 5B70A 4YKJA 1M5FA 1N7WA 5FHOA 3RT8A 2HCAA 4QFPA 1Y1ZA 4GQOA 2HZKA 1SBPA 2CMOA 1DPPA 3RT6B 4R9FA 4ZDMA 3UP9A 3D4GA 5L8DA 3ILUB 1URGA 1OVBA 1SI0A 2ZYKA 3KN7A 3MBPA 3MP1A 1UTBA 4BLAA 4ECFA 5DVIA 5K2XA 2H9BA 2R71A 1IIWA 1MRPA 1BLFA 4GVOA 4MBPA 3S2VA 2V84A 3GZGA 4KCDA 3G3KA 1QUIA 4N13A 3KN8A 3U1OA 2I0CA 1LCFA 2OCUA 5K2YA 4ELPA 3G7WA 5H8FA 4ELRA 3DM0A 1MPDA 2RINA 5AA4B 4F2QA 1H45A 2QSXA 3G3GA 5ELVA 2Q2CA 5AA4A 1B51A 3ONMA 3R26A 3G3JA 4RPNA 4XXUA 3K02A 1M5CA 3QK6A 4H0WA 4LVQA 4ZEFA 3T93B 5DT6A 4PFWA 2I0BA 4ONYA 3S9EA 5BUUA 1H3DA 1IXIA 2DS9A 1LFGA 2I4CA 5H8NA 1SD3A 1DPEA 5TU0A 2CZLA 3T22A 3UK4A 4RK2A 3Q29A 5KCJA 2IEEA 3T9VA 3TTMA 3IL1B 1VR5A 3SEUA 2ZXTA 4U2RA 5H8HA 4BDLA 1LAHE 5L9MA 1M5BA 1ZTYA 3CFZA 5I2KB 2I49A 3H6UA 3MVXA 4OHNA 1MY2A 5EHSA 3M8UA 1GR2A 1IXGA 1SI1A 1VFDA 4Q5TA 3TDJA 4ELOA 5JTYA 1NKXA 2YLNA 2Z22A 2RC8A 3UA8A 3VLUA 4KQPA 4IO3A 3PPOA 1Y3PA 4FJPA 1FQCA 5FHMA 5ICQA 4NF5A 1P99A 3RNNA 1TWYA 1QW0A 1II5A 3FUZA 3CIJA 2XD3A 2HEUA 1S9TA 4I1DA 1AIVA 1PEBA 4H5FA 1IXCA 4RXLA 5I58A 1DTGA 2GH9A 3IAZA 3U92A 4F29A 1PDAA 1FCKA 3B6WA 4NF4B 3VFJA 4KI0E 4FEDA 2ZMBA 4LATA 3ODBA 4E0XA 5LOMA 2X7QA 1QKAA 4M4GA 3U93A 4GIZA 4OQOA 3FJMA 3TMGA 2B3BA 2NOOA 3PPRA 3SEWA 3TQWA 2XXQA 4L17A 1J1NA 4I9DA 3ZS6A 4EF2A 3MWBA 5JEIA 2H25A 3S9NC 2UVHA 3IB1A 4O3CA 5ISUA 3EN3A 4TQUQ 3RQTA 1NFTA 4OERA 3T9UA 4GFRA 3N26A 2G29A 3OO7A 3PUXE 4N07A 3KOSA 3DP8A 2H99A 1MXYA 5IKBA 2XXHA 4PFTA 2V3UA 1SQYA 2OZZA 4YKPA 2A5TA 1N3WA 2VD2A 3GLBA 1EZOA 2O1MA 1SW1A 1P1OA 2A5SA 3CG1A 2UXAA 3HHGA 3K1NA 1FQEA 2D21A 2GFEA 4GXSB 4MH5A 4R9GA 3CVGA 3DP4A 3LSLA 1Y3QA 1EH3A 2V93A 3H6WA 3O28A 3KOTA 1LB8A 2FYIA 2QS3A 2X7PA 3QUFA 2H4IA 3A3UA 5CM6A 2OJTA 5L9OA 4PFYA 2HFBA 3VVDA 3HPIA 1Q35A 4DXBA 2DE3A 3L6HA 1LGBC 2ONSA 5I2KA 2F6GA 1QKBA 1HSEA 5F1QA 1QUJA 4QSCA 4G2ZA 4IB2A 3MP8A 3O6HA 3PMVA 4G4PA 2Q8JA 1ZIUA 2Y7IA 5HPQA 4PQJA 3H06B 2Y7RA 3TQLA 1P1WA 1B1XA 2RCAA 1XC1A 2VOZA 4F2OA 3FZVA 2QL3A 3K6XA 1YAEA 3M3KA 2DVZA 2VP1A 4Z0IA 1WODA 1T0KA 5DYHA 2Q88A 2PT2A 4R2FA 3BFTA 3RN8A 1B3EA 3CSBA 3FVGA 2Z8FA 3FGSA 4LONB 3PPQA 1BKAA 4WXJA 1SDXA 4XIGQ 5H8FB 3EHUA 3EPEA 2PBWA 3PUVE 3FV1A 1ELJA 1JETA 5CMBA 3S9MC 1XHYA 3DELB 3FV2A 2D3IA 3H4ZA 4G8NA 3LBSA 4ISUA 5I59B 2UVIA 2ONRA 1Y4CA 3A09A 1B58A 4R6HA 1PBQA 1N0TA 2DSFA 4PP0A 5EHMA 4O3BA 4R74A 3MZ9A 3PGFA 4X9TA 3OO6A 3V83A 1ZBMA 2DOJA 4LQ2A 2QPQA 1S7YA 2XXIA 1O64A 3JYRA 3MUQA 4OMBA 3PU5A 2F36A 3SEXA 4P0IA 3T9HB 1NNKA 4U21A 4YAHX 1B3HA 3HCQA 1FQFA 3VLVA 4F22A 3K01A 1FTJA 4NEDA 2HAVA 3IORA 1A8EA 1SW4A 3KGCA 4NF8B 4DCXA 4JXIA 1AOVA 1MQDA 4LZ5A 3O97A 1HSLA 4WEPA 4YZZA 1Z7NE 3OD7A 1UTHB 5HM4B 3B6TA 3VXBA 2Z23A 5JK4A 1GV8A 1MY1A 1Z7ME 3OEKA 2DWJA 3R6UA 3I6VA 2DXYA 4RJZA 4ESXA 1B5IA 1I69A 3OSRA 5FTIA 4NMYA 1XVXA 3PD9A 4LP2B 3MP6A 4NE4A 2DWAA 3Q28A 1B32A 2DQVA 2P0SA 2ESNA 2RCBA 1A55A 3TCGA 2D5WA 4F19A 3KZGA 1LFHA 2Y7WA 1S50A 1RKMA 1LBCA 3PMWA 2I3VA 2HAUA 3FVKA 3LR1A 2UYFA 4PE5B 4QF9A 1B3LA 2HQ0A 1OQGA 2XXTA 3KFMA 1N76A 3G3HA 4K3FA 5JTYB 4Z7EA 4U23A 2Y84A 2ALUA 2QMXA 2RC9A 3EF7A 5ITOA 2NWJA 1UTHA 1USYH 4GL8A 4FAJA 4EQ7A 5CMKA 3PV0E 4R72A 3VVFA 3S9LC 1QVSA 4JSDA 1JQFA 3UIFA 4NF6A 2DYXA 4Q30B 4F3GA 3HHFA 5KCJB 1JW4A 2OWTA 4IO7A 4RK9A 4LA9A 1MH3A 4EF1A 4KPTA 5H8NB 1FTLA 3IR1A 3MW0A 1LFIA 1BP5A 2ABHA 3DLNA 1Y4TA 4KYDA 3ZSFA 4G77A 3RLFE 1A7LA 2RF1A 4QFNA 2ZNTA 1ZJLA 1N84A 5CI5A 1VSOA 3PMXA 1O7TA 2PX1A 1A54A 1Y3NA 2H5YA 1HSJA 2QJEA 4FECA 3M3FA 2I6EA 4OENA 4ZEIA 4KHZE 4F1YA 2P2AA 3SETA 4DIGA 1IXHA 2O1LA 1SW5A 3E4RA 3F11A 1B2HA 3ZKLA 4BDRA 2DWIA 2V3TA 1XVYA 1VFEA 3IJXB 4F3SA 2G93A 1OMPA 1UTBB 5J1DA 4HCWA 3T96B 3SERA 4BDQA 4YMAA 4LZ8A 2RKMA 1SW2A 5AE4A 2XXUA 1POTA 4NF5B 2I58A 3OO9A 1USYE 3C31A 4ZE9A 1XT8A 4IO2A 3CG3A 3H7MA 1MXVA 3MZ1A 3KSXA 4OEUA 3E13X 3TTNA 1NL5A 5HBCA 1URSA 3S4UA 3CSGA 2REGA 1YTVA 3SESA 2QS2A 2F34A 3USDA 3K4UA 5DVFA 3Q25A 3SEYA 3ZKKA 5BWJA 2QMWA 3IOUA 4FORA 1SYHA 4OESA 3B7DA 2F7BA 3VE1B 1NNFA 1IUDA 1M5DA 1IZ1A 3PUZE 3VVEA 1MPBA 5EYFA 3JZJA 1DOTA 2XXVA 2DE4A 2NUVA 3OO8A 4H8IA 3BKIB 2Q9TA 4KFQA 4DXCA 2ONKE 4RY1A 1LB9A 4AB6A 3JV9A 1EZPA 3MVYA 2XX7A 2XX9A 2Z8EA 2V3QA 3C4MA 4H67A 4M1VA 1B7HA 1B46A 1SYIA 2AL4A 3KJ7A 4F1VA 3DP6A 5KDTA 2YJPA 1QULA 1UIUA 2ZNSA 3C36A 3HO7A 4EXKA 1B4HA 3OELA 1B5HA 5H8QB 5I57A 5I57B 1ATGA 3MPKA 3MQ9A 4TLMB 4RYAA 5DEXA 4POWA 4OFOA 3IO4A 2O7UA 4G68C 2A5TB 4KYSA 4HW8A 1NH7A 1YCJA 3H03A 1MDP1 2F8DA 1EZ9A 2O68A 1ANFA 1CB6A 3BBRA 3N94A 3C35A 3N5LA 3OEMA 4JWOA 4YICA 4ZECA 4GOTA 1Y1MA 3U72A
chains in the Genus database with same CATH superfamily
4RNSA 1XS5A 5TPAA 4LUBA 1GGGA 1RDYA 3KBRA 1YPNA 4GWYA 3TCFA 5DEXB 1NNPA 4X1DA 3R7XA 3PUWE 1AH5A 3QAXA 4MLVA 3BFUA 1A8FA 2OWSA 1TXFA 4MF3A 5F7VA 4WEDA 1FRPA 2VT5A 5B7DA 3B6QA 3KJTA 1UQWA 1NH8A 3HSTA 2Z8DA 2I4BA 1FJ6A 3QMFA 5DTBA 2ZNUA 4FBPA 3VXCA 1MY3A 2HZLA 5I58B 4PAIA 4U1OA 4GL0A 4UACA 5ESYA 1CE2A 4MEVA 2PT1A 4QFOA 3UN6A 1FJ9A 1EYIA 1NV3A 2KLFA 4FIMA 4OXVA 4ESWA 3RGYA 3CR9A 3FJGA 4TLLB 1LBBA 4O3CA 1MXUA 4GF8A 2F35A 2OLBA 2RC7A 4OVPA 1LSTA 3T1BA 4X1BA 4H8JA 1Y9UA 4KYEA 3MVZA 1D9QA 5FTHA 3C9HA 4XF5A 3IB0A 2E1SA 1FPGA 1F9BA 4OANA 1I6AA 1NUWA 1WDNA 3LSWA 1P1UA 4EQBA 4OVSA 4N8YA 4XTCQ 4MNPA 1IQ7A 5AA2A 5BUUA 1FPFA 4LQ5A 3PPNA 3WAEA 5I7IA 2O51A 2NVUB 2GHAA 2HXWA 3PD8A 1B3GA 3RTFB 3OOAA 4F1UA 2WKYA 3C34A 1FPBA 1WVJA 3I5OA 1ZKBA 4FEBA 1US4A 3FXBA 1NMUA 1SVXB 4H5GA 1DSNA 2XXWA 3K1PA 4QBAA 5I56A 4GD5A 2DVCA 4JB7A 1MPCA 5AA1A 1OQHA 4MAGA 4NF0A 1M5EA 4NWCA 1MDQA 1FQBA 4DXUA 4PDDA 2Q2AA 1ZLQA 1B52A 5CBRA 5CMMA 5ICTA 2YPNA 4G8MA 2BJJX 2PFZA 1DTZA 1H44A 3O2AA 3CI8A 4YKKA 4ZZEA 3W9WA 1FBGA 1JEVA 2DXRA 1EZPA 4JSOA 2F3BA 5FHNA 2HCAA 4QFPA 3RPLA 2ZYKA 1UTBA 4BDMA 3S2VA 1MRPA 1BLFA 2V84A 2WX9A 3G3KA 1QUIA 4GBVA 3KN8A 1LCFA 2OCUA 1MPDA 2RINA 1H45A 3E79A 2Q2CA 1B51A 1NV7A 3T93B 3GYYA 4ZEFA 4PFWA 4XEQA 5H8NA 1LFGA 2CZLA 1AWBA 2IEEA 4I3YA 1M5BA 3CFZA 3MVXA 3M8UA 3TDJA 1SI1A 4IR8A 1NUXA 1NKXA 2Z22A 4IO3A 1Y3PA 5ET7A 5FHMA 1FTAA 5ICQA 4NF5A 1TWYA 1S9TA 1IXCA 1FSAA 2FIXA 4LATA 3ODBA 2Y5KA 3TQWA 2XXQA 1J1NA 1NUYA 4I9DA 2H25A 3S9NC 3IB1A 3LUZA 3ISPA 1NFTA 4OERA 3OO7A 1FPDA 4PFTA 4PTKA 4YKPA 2A5TA 2VD2A 3GLBA 1P1OA 3MSTA 4XKQA 2UXAA 4GXSB 3CVGA 1Y3QA 2FYIA 2QS3A 2OJTA 2F6GA 1IMCA 4QSCA 4IB2A 3MP8A 1LBVA 3TQLA 2Y7RA 1NV0A 2RCAA 2WBDA 1XC1A 2VOZA 4F2OA 3FZVA 2QL3A 3K6XA 2DVZA 4XFEA 5DYHA 2Q88A 2PT2A 3BFTA 2B4MA 1SDXA 3EPEA 3PUVE 1ELJA 3S9MC 3FV2A 2D3IA 1N0TA 2DSFA 1FBPA 4R74A 2QPQA 1NV5A 1IMDA 3EKIA 4JXIA 1AOVA 5JK4A 1GV8A 1Z7ME 2DXYA 1I69A 5FTIA 4NMYA 3PD9A 3MP6A 4NE4A 3Q28A 4NAPA 1A55A 2P3NA 2I3VA 3FVKA 4GX4A 1B3LA 2HQ0A 4K3FA 2XXTA 3KFMA 1N76A 3G3HA 4U23A 3EF7A 5ITOA 4GL8A 3UIFA 5EQ9A 3HHFA 4IO7A 1MH3A 4KPTA 4JVCA 3IR1A 2PFYA 3ZSFA 1ZJLA 1N84A 5CI5A 2KQZA 4ZEIA 2I6EA 4MX6A 3E4RA 4O7IA 2DWIA 1XVYA 3HFUA 3IJXB 2G93A 1OMPA 4N6KA 4BDQA 3SERA 2RKMA 1SW2A 2XXUA 4NQ8A 1XT8A 1MXVA 3MZ1A 3KSXA 3TTNA 1NL5A 3S4UA 5DVFA 3B7DA 2F7BA 1NNFA 1IZ1A 3PUZE 2XXVA 3OO8A 5F24A 2Q9TA 4AB6A 2XX7A 1B7HA 1SYIA 3DP6A 5KDTA 1B5HA 4OFOA 4G68C 2A5TB 1NH7A 2F8DA 3N94A 4ZECA 4GOTA 2XWIA 4O94A 2W7YA 1BK4A 4NWDA 4OETA 1D9YA 5ITPA 4RA1A 1B5JA 3G3IA 2P1SA 1B7ZA 4XKNA 4ZEDA 3RPWA 5EQAA 2VD3A 2I48A 4FATA 1LBZA 1FTMA 1LCTA 1D4NA 4O3AA 4OVRA 4I3EA 1LEVA 3EHSA 2VGQA 2PMSA 2KR0A 5H8QA 4C1TA 1FBCA 4U22A 3IJOB 2F7CA 1D3KA 2QRYA 4AS5A 3FXQA 3I3VA 3Q27A 4YB7A 3KC1A 1KA1A 3ILTB 5FBPA 1B05A 4F3PA 4WKMA 1OIBA 1LAXA 3LSFB 4UA8A 4AS4A 4ND9A 3U8QA 2F7AA 5I3SA 4RPOA 4QHQA 5AA3A 2XHDA 1B0LA 4C0RA 1N7XA 4HXVA 2QS4A 1DK4A 1OVTA 4GWSA 4G8HA 5T3JA 3O9PA 4R75A 2QVUA 4KD5A 3O6IA 4EDPA 2XXRA 4ZEBA 4R6KA 3LSXA 3MPLA 1LAFE 1FQAA 3T0JA 4NF8A 3IX1A 2Y7PA 4GLIA 3MYUA 1IMEA 4KR5A 4IO4A 2XD2A 3G3FA 1AL3A 2HPGA 1KWHA 2ANJA 3FXUA 3ECRA 2XWKA 4MHFA 2DE2A 4QFLA 3QUJA 2AYSA 1B4ZA 1RYOA 2BJIA 1GVCA 4MNCA 4OYVA 1MM7A 2E0SA 3K6WA 3OXNA 3TFLA 4GWUA 4AB5A 4OZ9A 4MIJA 5H8QB 5LOMA 4JWXA 4PAKA 1B7UA 4QSDA 3BIGA 2GQ1A 3VDFA 4NF6B 3FIRA 4GWWA 4N6PA 1VE4A 4ZE8A 1NNTA 3FATA 3GXAA 3RY3A 1PBPA 2XXKA 3QYTA 5KZTA 1MXZA 4X04A 3LC8A 2XX8A 4YMBA 2ZYOA 1BIYA 2QFLA 5EYHA 3CRBA 3CFLA 2ZYNA 3W9VA 1MY0A 5A5XB 1H76A 1US5A 3V89B 3IOVA 5ET6A 4Q8RA 4HTGA 3AXFA 4N81A 1L5TA 4BDNA 4IY5A 3TODA 3QIMA 4JDFA 3N6UA 1D9VA 2THIA 1JW5A 4FE8A 4OVJA 3SDFA 4YU0A 2ZZWA 2VHAA 1JW1A 5I59A 1I6BA 3PPPA 2B3FA 3VV5A 2GRVA 2DWHA 1Q9DA 4PFUA 2B65A 3FJ7A 5IAIA 3FD3A 1M5FA 1N7WA 5FHOA 1Y1ZA 1DPPA 3UP9A 5L8DA 4DXBA 3MP1A 3MBPA 4BLAA 4GX6A 5DVIA 5K2XA 2R71A 1IIWA 3GZGA 4H45A 2Y5LA 1DCUA 3R26A 3G3JA 4RPNA 1M5CA 3IFCA 1H3DA 4F22A 1SD3A 1DPEA 3T22A 4HE2A 4RK2A 3Q29A 5DW8A 1VR5A 1LAHE 2CZIA 3B50A 1MY2A 1IXGA 4Q5TA 1IMBA 4MJOA 2YLNA 4PGPA 2VPOA 1FQCA 3RNNA 4I1DA 2HEUA 1AIVA 4RXLA 4O8MA 3IAZA 4KI0E 4H46A 1QKAA 4OQOA 2B3BA 4L17A 5ISUA 2WYPA 3RQTA 3T9UA 3N26A 4P9KA 2WYKA 2XXHA 1NV1A 2V3UA 1EZOA 2A5SA 3CG1A 1FQEA 2D21A 1LB8A 3QUFA 5L9OA 1Q35A 3FBPA 1LGBC 5I2KA 1HSEA 5F1QA 4G2ZA 4G4PA 2Q8JA 4PQJA 1B1XA 2VP1A 4Z0IA 4WXJA 1BKAA 3EHUA 2PBWA 1XHYA 2FHYA 2UVIA 2ONRA 1Y4CA 3A09A 4R6HA 3LV0A 3MZ9A 3OO6A 1FBEA 2R8TA 4LQ2A 2XXIA 1S7YA 4OMBA 1O64A 2F36A 4YAHX 4DCXA 1SW4A 3KGCA 1NV4A 1HSLA 1UTHB 1KA0A 2Z23A 4GBWA 3OEKA 4ESXA 3OSRA 4GX3A 1B32A 1INPA 2RCBA 3TCGA 3KZGA 1LFHA 5AA2B 1S50A 4X48A 1LBCA 2HAUA 4PE5B 2ALUA 3PV0E 4R72A 3A29A 4P1LA 5KCJB 1JW4A 2OWTA 1FTLA 1LFIA 1BP5A 2ABHA 4KYDA 4NG7A 3RLFE 5LDZA 4QFNA 5IM2A 4FECA 1O7TA 2QJEA 1Y3NA 1HSJA 1FPLA 1SW5A 3ZKLA 1VFEA 4HCWA 5AE4A 1VDWA 3H7MA 1JP4A 3E13X 1URSA 4X8RA 3USDA 2QS2A 2F34A 3ZKKA 2QMWA 1M5DA 5EYFA 1DOTA 2NUVA 4KFQA 4H8IA 4DXCA 4RY1A 1LB9A 3JV9A 3MVYA 2XX9A 3C4MA 4M1VA 2AL4A 3KJ7A 2YJPA 1QULA 4EXKA 3C36A 1B4HA 3MPKA 5DEXA 3IO4A 1YCJA 1EZ9A 2O68A 3OEMA 1CB6A 3BBRA 3C35A 3U72A 4MMPA 1RYXA 3IFAA 4Q0CA 4PGNA 4G68A 1FTKA 1B0HA 1MQGA 4OEVA 4F18A 3U65A 4YKIA 4PE3A 4PF8A 3TTLA 5I2NA 5H8SA 3IO6A 1ZU0A 1R9QA 1MM6A 1MXXA 3RUMA 2XWVA 4OFJA 2QVVA 1MXWA 1JVYA 1GTKA 5ET5A 4N17A 4H65A 4QSEA 3IOWA 4IO5A 1O63A 1LLSA 3GBAA 2X26A 4R2BA 3E3KA 4I62A 1MS7A 2LAOA 3TYHA 2Q89A 3K6UA 2AL5A 1FPKA 3QXMA 3H3GA 1POY1 4H1XA 1QGXA 4YB5A 5I84A 4MCOA 1PC3A 1EU8A 1A99A 3GBBA 1R1NA 5DVJA 1TFDA 3EQ1A 5M2VA 3MVWA 2V25A 1A40A 2QS1A 2GHBA 5IZ1A 4QRZA 3QSLA 4YB6A 5IZZA 1FPEA 4JVIA 4OFLA 3MC2A 4R73A 3T9XB 4F31B 1OLCA 1TFAA 4BDOA 1OLAA 3FVOA 5EYGA 2F6PA 3KN3A 3M3LA 4HS7A 4JWYA 5CC2A 1TT1A 4MLQA 2B4LA 4N8GA 4IY6A 1H43A 1MQHA 1MY4A 1B1HA 1N3XA 2F97A 4GRKA 3TTKA 2PVUA 4MFIA 1FQDA 3H6TA 5A5XA 3O6GA 3EHTA 1IEJA 4F39A 1UIVA 3OENA 4NF4A 3C32A 3TELA 1BTJA 3A3CA 1DBZA 4P8BA 3P7IA 4G68B 2FVZA 2F5XA 1FBFA 2FNCA 4XKPA 2XA5A 4I8CA 2OWZA 3K0VA 5CBSA 2CEYA 5CRYA 4EUOA 4DLDA 1YYZA 4DE8A 1URDA 3TCHA 1AMFA 3C33A 4QFKA 4PF6A 3BIHA 1EYKA 1N04A 3WAFA 3SZPA 5I2NB 4AQ4A 3K00A 1P1NA 1Q1KA 4LZ7A 5B70A 4YKJA 4GQOA 2HZKA 3D4GA 5TPAB 3ILUB 1SI0A 5LTCA 4NHBA 3NOHA 3TAJA 4GVOA 4MBPA 3U1OA 2FBPA 4ELRA 2ZZXA 2QSXA 3G3GA 5ELVA 5AA4A 3K02A 3QK6A 2WBBA 5DT6A 3RTWB 1IXIA 5TU0A 5KCJA 3T9VA 3TTMA 3IL1B 4BDLA 3SEUA 2ZXTA 5H8HA 5L9MA 2I49A 3H6UA 5JTYA 1VFDA 4ELOA 2RC8A 4KQPA 4FJPA 1YZ0A 1P99A 1QW0A 1II5A 1NI9A 1PEBA 4H5FA 4F29A 1PDAA 1FCKA 4DI4B 4NF4B 4FEDA 2ZMBA 4E0XA 4M4GA 3U93A 3D1RA 3FJMA 3TMGA 4JVDA 2NOOA 1NV2A 3ZS6A 2PCRA 3MWBA 4GWZA 2UVHA 4TQUQ 4GFRA 4I40A 3PUXE 4N07A 3KOSA 3DP8A 1SQYA 2OZZA 4PFIA 2O1MA 3HHGA 2GFEA 4MH5A 3DP4A 3LSLA 1EH3A 2V93A 3KOTA 2X7PA 2H4IA 3A3UA 2CEXA 4PFYA 2HFBA 3VVDA 5ET8A 3L6HA 1QKBA 3ROJA 1QUJA 3O6HA 4PCDA 3H06B 4N4UA 4NX1A 1YAEA 1WODA 1T0KA 4R2FA 3RN8A 1B3EA 3CSBA 3FVGA 3PPQA 3FV1A 3DELB 5I59B 4G8NA 3H4ZA 3LBSA 1PBQA 5EHMA 1LBYA 4O3BA 3PGFA 3V83A 2DOJA 3JYRA 3PU5A 3SEXA 4P0IA 3T9HB 1NNKA 4U21A 5IZ3A 1B3HA 3HCQA 3VLVA 3K01A 4NF8B 1A8EA 4YZZA 3OD7A 3B6TA 3VXBA 1G0HA 4RJZA 2DWJA 3I6VA 4LP2B 4PDHA 2DQVA 2D5WA 1RKMA 3LR1A 4QF9A 1OQGA 2QMXA 2XWOA 4P56A 4EQ7A 5CMKA 3VVFA 4NF6A 4Q30B 2VPNA 4RK9A 4LA9A 4EF1A 3MW0A 1Y4TA 4G77A 2RF1A 4N15A 2ZNTA 4N91A 1VSOA 2Q74A 2H5YA 4OENA 5J16A 4F1YA 2P2AA 2O1LA 3F11A 1B2HA 1IMFA 4BDRA 2V3TA 1POTA 4ZE9A 2I58A 4IO2A 1IMAA 3CG3A 3CSGA 2REGA 1YTVA 3Q25A 5BWJA 3IOUA 1SYHA 4OESA 1KZ8A 1IUDA 3VVEA 3JZJA 3BKIB 2Z8EA 2QVRA 1B46A 4F1VA 1UIUA 2ZNSA 2JJKA 3OELA 5I57B 1ATGA 4TLMB 4RYAA 4KYSA 3RYDA 2HHMA 1ANFA 4JWOA 1LBXA 1Y1MA 4DDDA 4G61A 4ELQA 4IGRA 4QXDA 3L6GA 4THIA 2NXOA 4P1EA 1MQIA 1I6QA 4EQ9A 2O7IA 4PC9A 3FASA 2O69A 3KSJA 1Y20A 3KC0A 2IA4A 1XI6A 4U1ZA 1B6HA 3KEIA 4P0GA 2H98A 2F3DA 3SKPA 1NUZA 3O29A 4DZ1A 1DMBA 2R6GE 2XXXA 3HV1A 1ZMGA 3CFXA 3T66A 3HN0A 2MKZA 3E9XA 1P1QA 2UVGA 4P47A 1R6ZA 4HCYA 5EQ8A 5AA2D 1MQJA 1CNQA 2M8CA 3H6VA 1QUKA 1R9LA 3IB2A 2XXYA 4C1UA 2XXPA 1EYJA 1PB7A 3K1MA 4OA4A 5H8HB 4UABA 3IOTA 1LAGE 3V8XB 4PFRA 3FXRA 2REJA 1PB8A 2ZZVA 3KG2A 2UYEA 3IK6B 3VLWA 3N6TA 2PYYA 4O7MA 1MG1A 4E0WA 4P11A 3K2DA 3THIA 3U94A 1B9JA 2L5VA 4U4XA 4H6DA 4TOZA 2UVJA 4JBZA 2FA7A 1LBWA 5A5LA 4F3BA 2AIXA 3O66A 5TP9B 3D4CA 4PETA 5TP9A 4ZEKA 4IGTA 5L9SA 2DP8A 1IITA 3TEPA 2Q8MA 1MH4A 3OMBA 4GWOA 2I3WA 3TKDA 2F78A 3LUYA 4NTLA 2HXRA 3UORA 3CHGA 5CMCA 4PBHA 3K6VA 4ZS9A 4KCCA 2R9JA 1JVXA 1FBDA 4XKRA 5IZ3B 4P3LA 3PUYE 3T96B 1JNFA 4ZZAA 5I56B 1QJMA 3Q26A 2OX3A 4PBQA 4IO6A 1XOCA 3TZAA 2CZKA 1PB9A 2O84X 2OK2A 2Y7KA 4PFBA 4GXAA 4HE1A 2O6AA 3TTRA 2FIEA 1B3FA 3PTYA 1FTOA 3MJNA 1B40A 4U4SA 4OVTA 3FVNA 4OTEA 5KDTB 2DDKA 3MAMA 1FW0A 3V5AA 4R6YA 2OBGA 3SEVA 3MZBA 2ZYMA 3OSQA 3UGWA 4EXLA 1JEUA 4OWDA 4EF2A 4POXA 3TPAA 2V4CA 3RT8A 1SBPA 2CMOA 3RT6B 4R9FA 4ZDMA 1URGA 1OVBA 3KN7A 4ECFA 2H9BA 3SESA 4KCDA 4N13A 2I0CA 4ELPA 5K2YA 3G7WA 5H8FA 3DM0A 5AA4B 4F2QA 3ONMA 4XXUA 4OVQA 4H0WA 4LVQA 2I0BA 4ONYA 3S9EA 2I4CA 3TUSA 2DS9A 3UK4A 3RPLB 4U2RA 1ZTYA 5I2KB 4OHNA 5EHSA 1GR2A 3UA8A 3VLUA 2CZHA 4N6DA 3PPOA 3FUZA 3CIJA 2XD3A 5I58A 1DTGA 2GH9A 3U92A 3B6WA 3VFJA 2X7QA 4NGUA 4GIZA 3PPRA 3SEWA 5JEIA 3EN3A 4MNIA 2G29A 5IGAA 2H99A 1MXYA 5IKBA 5EQ7A 1N3WA 3K1NA 1SW1A 3SETA 4R9GA 3O28A 3H6WA 5CM6A 1K9YA 3HPIA 2DE3A 1SPIA 2ONSA 3KBZA 3B8BA 3PMVA 1ZIUA 2Y7IA 5HPQA 3E78A 1P1WA 3M3KA 4HE0A 2Z8FA 3FGSA 4LONB 5H8FB 4XIGQ 5CMBA 1JETA 4ISUA 1B58A 4PP0A 4X9TA 4NN3A 1ZBMA 3MUQA 1FQFA 1FTJA 4NEDA 2P3VA 2HAVA 3IORA 1MQDA 4LZ5A 3O97A 4WEPA 1Z7NE 1MY1A 3R6UA 1YXIA 1B5IA 1XVXA 2DWAA 1K9ZA 2P0SA 2ESNA 4PAFA 4F19A 1FBHA 2Y7WA 3PMWA 2UYFA 5JTYB 4Z7EA 2Y84A 2RC9A 2NWJA 1UTHA 1USYH 4FAJA 1NV6A 1QVSA 4JSDA 1JQFA 3S9LC 2DYXA 4F3GA 5H8NB 3DLNA 1A7LA 1FPJA 1RDZA 4DCYA 3W15C 3PMXA 4GWXA 2PX1A 1A54A 4LN5A 3M3FA 4KHZE 4DIGA 1IXHA 4DI3D 4F3SA 1UTBB 5J1DA 4YMAA 4LZ8A 5HM4B 4NF5B 3OO9A 1USYE 1FPIA 3C31A 2WEFA 4OEUA 5HBCA 3K4UA 3SEYA 4FORA 3VE1B 5I5PA 1MPBA 2DE4A 2ONKE 2V3QA 4H67A 3HO7A 5I57A 3MQ9A 4KXPA 4POWA 2O7UA 1RDXA 4HW8A 3H03A 1MDP1 4YICA 3N5LA 1G0IA
chains in the Genus database with same CATH topology
1RYXA 4DDDA 2W7YA 4RNSA 4NWDA 4ELQA 1XS5A 4IGRA 5TPAA 4OETA 4Q0CA 4LUBA 1D9YA 5ITPA 4RA1A 1B5JA 3L6GA 1GGGA 4G68A 3G3IA 2NXOA 1FTKA 4THIA 1B0HA 1MQIA 2P1SA 1B7ZA 1MQGA 1I6QA 4XKNA 4OEVA 3RPWA 2O7IA 4EQ9A 3KBRA 4ZEDA 2VD3A 1YPNA 2I48A 3TCFA 3FASA 5DEXB 3W15C 1NNPA 2O69A 4X1DA 4FATA 3R7XA 4F18A 1FTMA 4YKIA 3TTLA 5I2NA 3KSJA 3PUWE 1Y20A 5H8SA 1AH5A 2IA4A 3QAXA 1LCTA 4MLVA 4U1ZA 3BFUA 1A8FA 1B6HA 1D4NA 2OWSA 3IO6A 1ZU0A 4O3AA 3KEIA 1TXFA 1R9QA 1MM6A 2H98A 4MF3A 4P0GA 1MXXA 5F7VA 3RTWB 4WEDA 3SKPA 5AA2B 3RUMA 3O29A 3EHSA 4OFJA 4X48A 4DZ1A 2VGQA 1DMBA 2PMSA 2R6GE 5B7DA 2XXXA 3B6QA 3KJTA 3HV1A 5H8QA 1MXWA 4C1TA 4U22A 1JVYA 1UQWA 1ZMGA 3CFXA 1GTKA 3IJOB 2F7CA 3T66A 3TZAA 3HN0A 1NH8A 3HSTA 5TPAB 1D3KA 4QSEA 3E9XA 1P1QA 4H65A 2QRYA 2UVGA 3FXQA 3I3VA 3IOWA 3Q27A 4IO5A 3TUSA 1O63A 1LLSA 3GBAA 1R6ZA 2X26A 2Z8DA 4HCYA 2I4BA 4YB7A 5AA2D 1MQJA 2ZNUA 5DTBA 4R2BA 3E3KA 3ILTB 4I62A 3VXCA 1MY3A 1MS7A 2HZLA 2LAOA 2M8CA 3H6VA 5I58B 4U1OA 3TYHA 2Q89A 1B05A 4GL0A 4F3PA 4UACA 3K6UA 4WKMA 2AL5A 1CE2A 1OIBA 1QUKA 1LAXA 1R9LA 3QXMA 3H3GA 3LSFB 3IB2A 1POY1 2PT1A 4UA8A 4QFOA 4H1XA 4ND9A 3U8QA 3UN6A 2F7AA 2XXYA 4YB5A 5I84A 4C1UA 1PC3A 2XXPA 4RPOA 3TAJA 1EU8A 4QHQA 5AA3A 1A99A 3GBBA 1R1NA 1PB7A 3K1MA 5DVJA 2KLFA 4FIMA 1TFDA 4OXVA 2XHDA 1B0LA 4C0RA 1N7XA 5H8HB 4ESWA 3RGYA 3CR9A 3FJGA 4TLLB 2QS4A 3EQ1A 3IOTA 1OVTA 5M2VA 1LAGE 3V8XB 3FXRA 1LBBA 2REJA 2V25A 3MVWA 1MXUA 1A40A 1PB8A 2QS1A 3KG2A 4GF8A 2F35A 2GHBA 4G8HA 2UYEA 3IK6B 3VLWA 2OLBA 3N6TA 2RC7A 3O9PA 4R75A 2PYYA 1LSTA 4QRZA 3QSLA 1MG1A 4YB6A 4E0WA 4KD5A 4X1BA 4H8JA 1Y9UA 3O6IA 4P11A 3K2DA 4KYEA 3MVZA 3THIA 1B9JA 3U94A 4EDPA 2XXRA 4ZEBA 4U4XA 4H6DA 4OFLA 4R6KA 3MC2A 4TOZA 2UVJA 3LSXA 4JBZA 3MPLA 4R73A 1LAFE 5FTHA 1FQAA 3T9XB 2FA7A 4F3BA 4NF8A 3C9HA 4F31B 3IX1A 2AIXA 3O66A 1OLCA 2Y7PA 2E1SA 3IB0A 1TFAA 4GLIA 1F9BA 5TP9B 4BDOA 1I6AA 3D4CA 4PETA 1WDNA 3LSWA 1P1UA 4KR5A 5TP9A 4IO4A 2XD2A 4ZEKA 4IGTA 5L9SA 3G3FA 2DP8A 1IITA 1AL3A 4EQBA 1KWHA 2ANJA 3TEPA 1OLAA 3FXUA 4XTCQ 3ECRA 4DCYA 1IQ7A 3FVOA 5AA2A 4LQ5A 3WAEA 1MH4A 2DE2A 2F6PA 3KN3A 3M3LA 2O51A 3OMBA 3PPNA 2I3WA 4GWOA 3QUJA 2AYSA 4QFLA 2NVUB 4HS7A 4JWYA 1B4ZA 2GHAA 1RYOA 1GVCA 1TT1A 3TKDA 2HXWA 3PD8A 4MLQA 5CC2A 1MM7A 1B3GA 2E0SA 3K6WA 3OXNA 2F78A 3OOAA 3LUYA 4NTLA 4OYVA 3RTFB 3TFLA 4AB5A 4F1UA 4IY6A 1H43A 4OZ9A 3UORA 5CMCA 3K6VA 4ZS9A 1MQHA 1MY4A 1B1HA 1N3XA 2F97A 1B7UA 4JWXA 2WKYA 3C34A 4GRKA 4KCCA 4QSDA 2PVUA 3TTKA 4BDMA 2R9JA 4MFIA 1WVJA 1FQDA 3I5OA 1ZKBA 3VDFA 1JVXA 3FIRA 4FEBA 4NF6B 3H6TA 4XKRA 4N6PA 5A5XA 1US4A 1NMUA 1VE4A 3O6GA 3PUYE 1SVXB 1JNFA 1DSNA 3EHTA 4H5GA 2XXWA 1IEJA 1NNTA 4ZZAA 4ZE8A 3K1PA 3FATA 5I56B 3GXAA 3RY3A 1PBPA 1QJMA 3Q26A 4F39A 3QYTA 5KZTA 1UIVA 4IO6A 1MXZA 3OENA 4NF4A 3C32A 3LC8A 5I56A 2XX8A 1BTJA 3A3CA 3TELA 2ZYOA 4YMBA 1BIYA 3P7IA 4GD5A 3CRBA 3CFLA 1XOCA 2DVCA 2ZYNA 4G68B 4JB7A 1MPCA 1MY0A 1PB9A 2O84X 2OK2A 2Y7KA 1H76A 4GXAA 2F5XA 5AA1A 5A5XB 1US5A 1OQHA 2O6AA 2FNCA 4XKPA 3TTRA 3V89B 1M5EA 3IOVA 1B3FA 4Q8RA 4NWCA 4HTGA 1MDQA 4I8CA 3AXFA 1L5TA 4BDNA 3K0VA 1FTOA 1FQBA 5CBSA 5CRYA 4EUOA 3MJNA 4IY5A 3TODA 1B40A 2Q2AA 3QIMA 4JDFA 4DXUA 1ZLQA 3W9VA 3N6UA 1D9VA 1B52A 2THIA 4U4SA 4DLDA 1JW5A 5CBRA 3FVNA 4OTEA 4DE8A 5CMMA 5KDTB 5ICTA 4FE8A 3MAMA 4OVJA 1FW0A 3SDFA 2YPNA 1URDA 4G8MA 2BJJX 4YU0A 3TCHA 1AMFA 4XKQA 1DTZA 2VHAA 1JW1A 3C33A 1H44A 4QFKA 3V5AA 3O2AA 5I59A 1I6BA 3CI8A 4R6YA 2OBGA 3PPPA 1N04A 4YKKA 4ZZEA 3WAFA 2B3FA 3SEVA 3VV5A 3MZBA 3W9WA 2GRVA 5I2NB 2ZYMA 1JEVA 3OSQA 2DWHA 3UGWA 4AQ4A 2DXRA 4PFUA 4EXLA 3K00A 1JEUA 4OWDA 2B65A 3FJ7A 4POXA 3FD3A 4JSOA 1P1NA 3TPAA 1Q1KA 4LZ7A 5FHNA 5IAIA 5B70A 4YKJA 1M5FA 1N7WA 5FHOA 3RT8A 2HCAA 4QFPA 1Y1ZA 4GQOA 2HZKA 1SBPA 2CMOA 1DPPA 3RT6B 4R9FA 4ZDMA 3UP9A 3D4GA 5L8DA 3ILUB 1URGA 1OVBA 1SI0A 2ZYKA 3KN7A 3MBPA 3MP1A 1UTBA 4BLAA 4ECFA 5DVIA 5K2XA 2H9BA 2R71A 1IIWA 1MRPA 1BLFA 4GVOA 4MBPA 3S2VA 2V84A 3GZGA 4KCDA 3G3KA 1QUIA 4N13A 3KN8A 3U1OA 2I0CA 1LCFA 2OCUA 5K2YA 4ELPA 3G7WA 5H8FA 4ELRA 3DM0A 1MPDA 2RINA 5AA4B 4F2QA 1H45A 2QSXA 3G3GA 5ELVA 2Q2CA 5AA4A 1B51A 3ONMA 3R26A 3G3JA 4RPNA 4XXUA 3K02A 1M5CA 3QK6A 4H0WA 4LVQA 4ZEFA 3T93B 5DT6A 4PFWA 2I0BA 4ONYA 3S9EA 5BUUA 1H3DA 1IXIA 2DS9A 1LFGA 2I4CA 5H8NA 1SD3A 1DPEA 5TU0A 2CZLA 3T22A 3UK4A 4RK2A 3Q29A 5KCJA 2IEEA 3T9VA 3TTMA 3IL1B 1VR5A 3SEUA 2ZXTA 4U2RA 5H8HA 4BDLA 1LAHE 5L9MA 1M5BA 1ZTYA 3CFZA 5I2KB 2I49A 3H6UA 3MVXA 4OHNA 1MY2A 5EHSA 3M8UA 1GR2A 1IXGA 1SI1A 1VFDA 4Q5TA 3TDJA 4ELOA 5JTYA 1NKXA 2YLNA 2Z22A 2RC8A 3UA8A 3VLUA 4KQPA 4IO3A 3PPOA 1Y3PA 4FJPA 1FQCA 5FHMA 5ICQA 4NF5A 1P99A 3RNNA 1TWYA 1QW0A 1II5A 3FUZA 3CIJA 2XD3A 2HEUA 1S9TA 4I1DA 1AIVA 1PEBA 4H5FA 1IXCA 4RXLA 5I58A 1DTGA 2GH9A 3IAZA 3U92A 4F29A 1PDAA 1FCKA 3B6WA 4NF4B 3VFJA 4KI0E 4FEDA 2ZMBA 4LATA 3ODBA 4E0XA 5LOMA 2X7QA 1QKAA 4M4GA 3U93A 4GIZA 4OQOA 3FJMA 3TMGA 2B3BA 2NOOA 3PPRA 3SEWA 3TQWA 2XXQA 4L17A 1J1NA 4I9DA 3ZS6A 4EF2A 3MWBA 5JEIA 2H25A 3S9NC 2UVHA 3IB1A 4O3CA 5ISUA 3EN3A 4TQUQ 3RQTA 1NFTA 4OERA 3T9UA 4GFRA 3N26A 2G29A 3OO7A 3PUXE 4N07A 3KOSA 3DP8A 2H99A 1MXYA 5IKBA 2XXHA 4PFTA 2V3UA 1SQYA 2OZZA 4YKPA 2A5TA 1N3WA 2VD2A 3GLBA 1EZOA 2O1MA 1SW1A 1P1OA 2A5SA 3CG1A 2UXAA 3HHGA 3K1NA 1FQEA 2D21A 2GFEA 4GXSB 4MH5A 4R9GA 3CVGA 3DP4A 3LSLA 1Y3QA 1EH3A 2V93A 3H6WA 3O28A 3KOTA 1LB8A 2FYIA 2QS3A 2X7PA 3QUFA 2H4IA 3A3UA 5CM6A 2OJTA 5L9OA 4PFYA 2HFBA 3VVDA 3HPIA 1Q35A 4DXBA 2DE3A 3L6HA 1LGBC 2ONSA 5I2KA 2F6GA 1QKBA 1HSEA 5F1QA 1QUJA 4QSCA 4G2ZA 4IB2A 3MP8A 3O6HA 3PMVA 4G4PA 2Q8JA 1ZIUA 2Y7IA 5HPQA 4PQJA 3H06B 2Y7RA 3TQLA 1P1WA 1B1XA 2RCAA 1XC1A 2VOZA 4F2OA 3FZVA 2QL3A 3K6XA 1YAEA 3M3KA 2DVZA 2VP1A 4Z0IA 1WODA 1T0KA 5DYHA 2Q88A 2PT2A 4R2FA 3BFTA 3RN8A 1B3EA 3CSBA 3FVGA 2Z8FA 3FGSA 4LONB 3PPQA 1BKAA 4WXJA 1SDXA 4XIGQ 5H8FB 3EHUA 3EPEA 2PBWA 3PUVE 3FV1A 1ELJA 1JETA 5CMBA 3S9MC 1XHYA 3DELB 3FV2A 2D3IA 3H4ZA 4G8NA 3LBSA 4ISUA 5I59B 2UVIA 2ONRA 1Y4CA 3A09A 1B58A 4R6HA 1PBQA 1N0TA 2DSFA 4PP0A 5EHMA 4O3BA 4R74A 3MZ9A 3PGFA 4X9TA 3OO6A 3V83A 1ZBMA 2DOJA 4LQ2A 2QPQA 1S7YA 2XXIA 1O64A 3JYRA 3MUQA 4OMBA 3PU5A 2F36A 3SEXA 4P0IA 3T9HB 1NNKA 4U21A 4YAHX 1B3HA 3HCQA 1FQFA 3VLVA 4F22A 3K01A 1FTJA 4NEDA 2HAVA 3IORA 1A8EA 1SW4A 3KGCA 4NF8B 4DCXA 4JXIA 1AOVA 1MQDA 4LZ5A 3O97A 1HSLA 4WEPA 4YZZA 1Z7NE 3OD7A 1UTHB 5HM4B 3B6TA 3VXBA 2Z23A 5JK4A 1GV8A 1MY1A 1Z7ME 3OEKA 2DWJA 3R6UA 3I6VA 2DXYA 4RJZA 4ESXA 1B5IA 1I69A 3OSRA 5FTIA 4NMYA 1XVXA 3PD9A 4LP2B 3MP6A 4NE4A 2DWAA 3Q28A 1B32A 2DQVA 2P0SA 2ESNA 2RCBA 1A55A 3TCGA 2D5WA 4F19A 3KZGA 1LFHA 2Y7WA 1S50A 1RKMA 1LBCA 3PMWA 2I3VA 2HAUA 3FVKA 3LR1A 2UYFA 4PE5B 4QF9A 1B3LA 2HQ0A 1OQGA 2XXTA 3KFMA 1N76A 3G3HA 4K3FA 5JTYB 4Z7EA 4U23A 2Y84A 2ALUA 2QMXA 2RC9A 3EF7A 5ITOA 2NWJA 1UTHA 1USYH 4GL8A 4FAJA 4EQ7A 5CMKA 3PV0E 4R72A 3VVFA 3S9LC 1QVSA 4JSDA 1JQFA 3UIFA 4NF6A 2DYXA 4Q30B 4F3GA 3HHFA 5KCJB 1JW4A 2OWTA 4IO7A 4RK9A 4LA9A 1MH3A 4EF1A 4KPTA 5H8NB 1FTLA 3IR1A 3MW0A 1LFIA 1BP5A 2ABHA 3DLNA 1Y4TA 4KYDA 3ZSFA 4G77A 3RLFE 1A7LA 2RF1A 4QFNA 2ZNTA 1ZJLA 1N84A 5CI5A 1VSOA 3PMXA 1O7TA 2PX1A 1A54A 1Y3NA 2H5YA 1HSJA 2QJEA 4FECA 3M3FA 2I6EA 4OENA 4ZEIA 4KHZE 4F1YA 2P2AA 3SETA 4DIGA 1IXHA 2O1LA 1SW5A 3E4RA 3F11A 1B2HA 3ZKLA 4BDRA 2DWIA 2V3TA 1XVYA 1VFEA 3IJXB 4F3SA 2G93A 1OMPA 1UTBB 5J1DA 4HCWA 3T96B 3SERA 4BDQA 4YMAA 4LZ8A 2RKMA 1SW2A 5AE4A 2XXUA 1POTA 4NF5B 2I58A 3OO9A 1USYE 3C31A 4ZE9A 1XT8A 4IO2A 3CG3A 3H7MA 1MXVA 3MZ1A 3KSXA 4OEUA 3E13X 3TTNA 1NL5A 5HBCA 1URSA 3S4UA 3CSGA 2REGA 1YTVA 3SESA 2QS2A 2F34A 3USDA 3K4UA 5DVFA 3Q25A 3SEYA 3ZKKA 5BWJA 2QMWA 3IOUA 4FORA 1SYHA 4OESA 3B7DA 2F7BA 3VE1B 1NNFA 1IUDA 1M5DA 1IZ1A 3PUZE 3VVEA 1MPBA 5EYFA 3JZJA 1DOTA 2XXVA 2DE4A 2NUVA 3OO8A 4H8IA 3BKIB 2Q9TA 4KFQA 4DXCA 2ONKE 4RY1A 1LB9A 4AB6A 3JV9A 1EZPA 3MVYA 2XX7A 2XX9A 2Z8EA 2V3QA 3C4MA 4H67A 4M1VA 1B7HA 1B46A 1SYIA 2AL4A 3KJ7A 4F1VA 3DP6A 5KDTA 2YJPA 1QULA 1UIUA 2ZNSA 3C36A 3HO7A 4EXKA 1B4HA 3OELA 1B5HA 5H8QB 5I57A 5I57B 1ATGA 3MPKA 3MQ9A 4TLMB 4RYAA 5DEXA 4POWA 4OFOA 3IO4A 2O7UA 4G68C 2A5TB 4KYSA 4HW8A 1NH7A 1YCJA 3H03A 1MDP1 2F8DA 1EZ9A 2O68A 1ANFA 1CB6A 3BBRA 3N94A 3C35A 3N5LA 3OEMA 4JWOA 4YICA 4ZECA 4GOTA 1Y1MA 3U72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYX A;  4DDD A;  2W7Y A;  4RNS A;  4NWD A;  4ELQ A;  1XS5 A;  4IGR A;  5TPA A;  4OET A;  4Q0C A;  4LUB A;  1D9Y A;  5ITP A;  4RA1 A;  1B5J A;  3L6G A;  1GGG A;  4G68 A;  3G3I A;  2NXO A;  1FTK A;  4THI A;  1B0H A;  1MQI A;  2P1S A;  1B7Z A;  1MQG A;  1I6Q A;  4XKN A;  4OEV A;  3RPW A;  2O7I A;  4EQ9 A;  3KBR A;  4ZED A;  2VD3 A;  1YPN A;  2I48 A;  3TCF A;  3FAS A;  5DEX B;  3W15 C;  1NNP A;  2O69 A;  4X1D A;  4FAT A;  3R7X A;  4F18 A;  1FTM A;  4YKI A;  3TTL A;  5I2N A;  3KSJ A;  3PUW E;  1Y20 A;  5H8S A;  1AH5 A;  2IA4 A;  3QAX A;  1LCT A;  4MLV A;  4U1Z A;  3BFU A;  1A8F A;  1B6H A;  1D4N A;  2OWS A;  3IO6 A;  1ZU0 A;  4O3A A;  3KEI A;  1TXF A;  1R9Q A;  1MM6 A;  2H98 A;  4MF3 A;  4P0G A;  1MXX A;  5F7V A;  3RTW B;  4WED A;  3SKP A;  5AA2 B;  3RUM A;  3O29 A;  3EHS A;  4OFJ A;  4X48 A;  4DZ1 A;  2VGQ A;  1DMB A;  2PMS A;  2R6G E;  5B7D A;  2XXX A;  3B6Q A;  3KJT A;  3HV1 A;  5H8Q A;  1MXW A;  4C1T A;  4U22 A;  1JVY A;  1UQW A;  1ZMG A;  3CFX A;  1GTK A;  3IJO B;  2F7C A;  3T66 A;  3TZA A;  3HN0 A;  1NH8 A;  3HST A;  5TPA B;  1D3K A;  4QSE A;  3E9X A;  1P1Q A;  4H65 A;  2QRY A;  2UVG A;  3FXQ A;  3I3V A;  3IOW A;  3Q27 A;  4IO5 A;  3TUS A;  1O63 A;  1LLS A;  3GBA A;  1R6Z A;  2X26 A;  2Z8D A;  4HCY A;  2I4B A;  4YB7 A;  5AA2 D;  1MQJ A;  2ZNU A;  5DTB A;  4R2B A;  3E3K A;  3ILT B;  4I62 A;  3VXC A;  1MY3 A;  1MS7 A;  2HZL A;  2LAO A;  2M8C A;  3H6V A;  5I58 B;  4U1O A;  3TYH A;  2Q89 A;  1B05 A;  4GL0 A;  4F3P A;  4UAC A;  3K6U A;  4WKM A;  2AL5 A;  1CE2 A;  1OIB A;  1QUK A;  1LAX A;  1R9L A;  3QXM A;  3H3G A;  3LSF B;  3IB2 A;  1POY 1;  2PT1 A;  4UA8 A;  4QFO A;  4H1X A;  4ND9 A;  3U8Q A;  3UN6 A;  2F7A A;  2XXY A;  4YB5 A;  5I84 A;  4C1U A;  1PC3 A;  2XXP A;  4RPO A;  3TAJ A;  1EU8 A;  4QHQ A;  5AA3 A;  1A99 A;  3GBB A;  1R1N A;  1PB7 A;  3K1M A;  5DVJ A;  2KLF A;  4FIM A;  1TFD A;  4OXV A;  2XHD A;  1B0L A;  4C0R A;  1N7X A;  5H8H B;  4ESW A;  3RGY A;  3CR9 A;  3FJG A;  4TLL B;  2QS4 A;  3EQ1 A;  3IOT A;  1OVT A;  5M2V A;  1LAG E;  3V8X B;  3FXR A;  1LBB A;  2REJ A;  2V25 A;  3MVW A;  1MXU A;  1A40 A;  1PB8 A;  2QS1 A;  3KG2 A;  4GF8 A;  2F35 A;  2GHB A;  4G8H A;  2UYE A;  3IK6 B;  3VLW A;  2OLB A;  3N6T A;  2RC7 A;  3O9P A;  4R75 A;  2PYY A;  1LST A;  4QRZ A;  3QSL A;  1MG1 A;  4YB6 A;  4E0W A;  4KD5 A;  4X1B A;  4H8J A;  1Y9U A;  3O6I A;  4P11 A;  3K2D A;  4KYE A;  3MVZ A;  3THI A;  1B9J A;  3U94 A;  4EDP A;  2XXR A;  4ZEB A;  4U4X A;  4H6D A;  4OFL A;  4R6K A;  3MC2 A;  4TOZ A;  2UVJ A;  3LSX A;  4JBZ A;  3MPL A;  4R73 A;  1LAF E;  5FTH A;  1FQA A;  3T9X B;  2FA7 A;  4F3B A;  4NF8 A;  3C9H A;  4F31 B;  3IX1 A;  2AIX A;  3O66 A;  1OLC A;  2Y7P A;  2E1S A;  3IB0 A;  1TFA A;  4GLI A;  1F9B A;  5TP9 B;  4BDO A;  1I6A A;  3D4C A;  4PET A;  1WDN A;  3LSW A;  1P1U A;  4KR5 A;  5TP9 A;  4IO4 A;  2XD2 A;  4ZEK A;  4IGT A;  5L9S A;  3G3F A;  2DP8 A;  1IIT A;  1AL3 A;  4EQB A;  1KWH A;  2ANJ A;  3TEP A;  1OLA A;  3FXU A;  4XTC Q;  3ECR A;  4DCY A;  1IQ7 A;  3FVO A;  5AA2 A;  4LQ5 A;  3WAE A;  1MH4 A;  2DE2 A;  2F6P A;  3KN3 A;  3M3L A;  2O51 A;  3OMB A;  3PPN A;  2I3W A;  4GWO A;  3QUJ A;  2AYS A;  4QFL A;  2NVU B;  4HS7 A;  4JWY A;  1B4Z A;  2GHA A;  1RYO A;  1GVC A;  1TT1 A;  3TKD A;  2HXW A;  3PD8 A;  4MLQ A;  5CC2 A;  1MM7 A;  1B3G A;  2E0S A;  3K6W A;  3OXN A;  2F78 A;  3OOA A;  3LUY A;  4NTL A;  4OYV A;  3RTF B;  3TFL A;  4AB5 A;  4F1U A;  4IY6 A;  1H43 A;  4OZ9 A;  3UOR A;  5CMC A;  3K6V A;  4ZS9 A;  1MQH A;  1MY4 A;  1B1H A;  1N3X A;  2F97 A;  1B7U A;  4JWX A;  2WKY A;  3C34 A;  4GRK A;  4KCC A;  4QSD A;  2PVU A;  3TTK A;  4BDM A;  2R9J A;  4MFI A;  1WVJ A;  1FQD A;  3I5O A;  1ZKB A;  3VDF A;  1JVX A;  3FIR A;  4FEB A;  4NF6 B;  3H6T A;  4XKR A;  4N6P A;  5A5X A;  1US4 A;  1NMU A;  1VE4 A;  3O6G A;  3PUY E;  1SVX B;  1JNF A;  1DSN A;  3EHT A;  4H5G A;  2XXW A;  1IEJ A;  1NNT A;  4ZZA A;  4ZE8 A;  3K1P A;  3FAT A;  5I56 B;  3GXA A;  3RY3 A;  1PBP A;  1QJM A;  3Q26 A;  4F39 A;  3QYT A;  5KZT A;  1UIV A;  4IO6 A;  1MXZ A;  3OEN A;  4NF4 A;  3C32 A;  3LC8 A;  5I56 A;  2XX8 A;  1BTJ A;  3A3C A;  3TEL A;  2ZYO A;  4YMB A;  1BIY A;  3P7I A;  4GD5 A;  3CRB A;  3CFL A;  1XOC A;  2DVC A;  2ZYN A;  4G68 B;  4JB7 A;  1MPC A;  1MY0 A;  1PB9 A;  2O84 X;  2OK2 A;  2Y7K A;  1H76 A;  4GXA A;  2F5X A;  5AA1 A;  5A5X B;  1US5 A;  1OQH A;  2O6A A;  2FNC A;  4XKP A;  3TTR A;  3V89 B;  1M5E A;  3IOV A;  1B3F A;  4Q8R A;  4NWC A;  4HTG A;  1MDQ A;  4I8C A;  3AXF A;  1L5T A;  4BDN A;  3K0V A;  1FTO A;  1FQB A;  5CBS A;  5CRY A;  4EUO A;  3MJN A;  4IY5 A;  3TOD A;  1B40 A;  2Q2A A;  3QIM A;  4JDF A;  4DXU A;  1ZLQ A;  3W9V A;  3N6U A;  1D9V A;  1B52 A;  2THI A;  4U4S A;  4DLD A;  1JW5 A;  5CBR A;  3FVN A;  4OTE A;  4DE8 A;  5CMM A;  5KDT B;  5ICT A;  4FE8 A;  3MAM A;  4OVJ A;  1FW0 A;  3SDF A;  2YPN A;  1URD A;  4G8M A;  2BJJ X;  4YU0 A;  3TCH A;  1AMF A;  4XKQ A;  1DTZ A;  2VHA A;  1JW1 A;  3C33 A;  1H44 A;  4QFK A;  3V5A A;  3O2A A;  5I59 A;  1I6B A;  3CI8 A;  4R6Y A;  2OBG A;  3PPP A;  1N04 A;  4YKK A;  4ZZE A;  3WAF A;  2B3F A;  3SEV A;  3VV5 A;  3MZB A;  3W9W A;  2GRV A;  5I2N B;  2ZYM A;  1JEV A;  3OSQ A;  2DWH A;  3UGW A;  4AQ4 A;  2DXR A;  4PFU A;  4EXL A;  3K00 A;  1JEU A;  4OWD A;  2B65 A;  3FJ7 A;  4POX A;  3FD3 A;  4JSO A;  1P1N A;  3TPA A;  1Q1K A;  4LZ7 A;  5FHN A;  5IAI A;  5B70 A;  4YKJ A;  1M5F A;  1N7W A;  5FHO A;  3RT8 A;  2HCA A;  4QFP A;  1Y1Z A;  4GQO A;  2HZK A;  1SBP A;  2CMO A;  1DPP A;  3RT6 B;  4R9F A;  4ZDM A;  3UP9 A;  3D4G A;  5L8D A;  3ILU B;  1URG A;  1OVB A;  1SI0 A;  2ZYK A;  3KN7 A;  3MBP A;  3MP1 A;  1UTB A;  4BLA A;  4ECF A;  5DVI A;  5K2X A;  2H9B A;  2R71 A;  1IIW A;  1MRP A;  1BLF A;  4GVO A;  4MBP A;  3S2V A;  2V84 A;  3GZG A;  4KCD A;  3G3K A;  1QUI A;  4N13 A;  3KN8 A;  3U1O A;  2I0C A;  1LCF A;  2OCU A;  5K2Y A;  4ELP A;  3G7W A;  5H8F A;  4ELR A;  3DM0 A;  1MPD A;  2RIN A;  5AA4 B;  4F2Q A;  1H45 A;  2QSX A;  3G3G A;  5ELV A;  2Q2C A;  5AA4 A;  1B51 A;  3ONM A;  3R26 A;  3G3J A;  4RPN A;  4XXU A;  3K02 A;  1M5C A;  3QK6 A;  4H0W A;  4LVQ A;  4ZEF A;  3T93 B;  5DT6 A;  4PFW A;  2I0B A;  4ONY A;  3S9E A;  5BUU A;  1H3D A;  1IXI A;  2DS9 A;  1LFG A;  2I4C A;  5H8N A;  1SD3 A;  1DPE A;  5TU0 A;  2CZL A;  3T22 A;  3UK4 A;  4RK2 A;  3Q29 A;  5KCJ A;  2IEE A;  3T9V A;  3TTM A;  3IL1 B;  1VR5 A;  3SEU A;  2ZXT A;  4U2R A;  5H8H A;  4BDL A;  1LAH E;  5L9M A;  1M5B A;  1ZTY A;  3CFZ A;  5I2K B;  2I49 A;  3H6U A;  3MVX A;  4OHN A;  1MY2 A;  5EHS A;  3M8U A;  1GR2 A;  1IXG A;  1SI1 A;  1VFD A;  4Q5T A;  3TDJ A;  4ELO A;  5JTY A;  1NKX A;  2YLN A;  2Z22 A;  2RC8 A;  3UA8 A;  3VLU A;  4KQP A;  4IO3 A;  3PPO A;  1Y3P A;  4FJP A;  1FQC A;  5FHM A;  5ICQ A;  4NF5 A;  1P99 A;  3RNN A;  1TWY A;  1QW0 A;  1II5 A;  3FUZ A;  3CIJ A;  2XD3 A;  2HEU A;  1S9T A;  4I1D A;  1AIV A;  1PEB A;  4H5F A;  1IXC A;  4RXL A;  5I58 A;  1DTG A;  2GH9 A;  3IAZ A;  3U92 A;  4F29 A;  1PDA A;  1FCK A;  3B6W A;  4NF4 B;  3VFJ A;  4KI0 E;  4FED A;  2ZMB A;  4LAT A;  3ODB A;  4E0X A;  5LOM A;  2X7Q A;  1QKA A;  4M4G A;  3U93 A;  4GIZ A;  4OQO A;  3FJM A;  3TMG A;  2B3B A;  2NOO A;  3PPR A;  3SEW A;  3TQW A;  2XXQ A;  4L17 A;  1J1N A;  4I9D A;  3ZS6 A;  4EF2 A;  3MWB A;  5JEI A;  2H25 A;  3S9N C;  2UVH A;  3IB1 A;  4O3C A;  5ISU A;  3EN3 A;  4TQU Q;  3RQT A;  1NFT A;  4OER A;  3T9U A;  4GFR A;  3N26 A;  2G29 A;  3OO7 A;  3PUX E;  4N07 A;  3KOS A;  3DP8 A;  2H99 A;  1MXY A;  5IKB A;  2XXH A;  4PFT A;  2V3U A;  1SQY A;  2OZZ A;  4YKP A;  2A5T A;  1N3W A;  2VD2 A;  3GLB A;  1EZO A;  2O1M A;  1SW1 A;  1P1O A;  2A5S A;  3CG1 A;  2UXA A;  3HHG A;  3K1N A;  1FQE A;  2D21 A;  2GFE A;  4GXS B;  4MH5 A;  4R9G A;  3CVG A;  3DP4 A;  3LSL A;  1Y3Q A;  1EH3 A;  2V93 A;  3H6W A;  3O28 A;  3KOT A;  1LB8 A;  2FYI A;  2QS3 A;  2X7P A;  3QUF A;  2H4I A;  3A3U A;  5CM6 A;  2OJT A;  5L9O A;  4PFY A;  2HFB A;  3VVD A;  3HPI A;  1Q35 A;  4DXB A;  2DE3 A;  3L6H A;  1LGB C;  2ONS A;  5I2K A;  2F6G A;  1QKB A;  1HSE A;  5F1Q A;  1QUJ A;  4QSC A;  4G2Z A;  4IB2 A;  3MP8 A;  3O6H A;  3PMV A;  4G4P A;  2Q8J A;  1ZIU A;  2Y7I A;  5HPQ A;  4PQJ A;  3H06 B;  2Y7R A;  3TQL A;  1P1W A;  1B1X A;  2RCA A;  1XC1 A;  2VOZ A;  4F2O A;  3FZV A;  2QL3 A;  3K6X A;  1YAE A;  3M3K A;  2DVZ A;  2VP1 A;  4Z0I A;  1WOD A;  1T0K A;  5DYH A;  2Q88 A;  2PT2 A;  4R2F A;  3BFT A;  3RN8 A;  1B3E A;  3CSB A;  3FVG A;  2Z8F A;  3FGS A;  4LON B;  3PPQ A;  1BKA A;  4WXJ A;  1SDX A;  4XIG Q;  5H8F B;  3EHU A;  3EPE A;  2PBW A;  3PUV E;  3FV1 A;  1ELJ A;  1JET A;  5CMB A;  3S9M C;  1XHY A;  3DEL B;  3FV2 A;  2D3I A;  3H4Z A;  4G8N A;  3LBS A;  4ISU A;  5I59 B;  2UVI A;  2ONR A;  1Y4C A;  3A09 A;  1B58 A;  4R6H A;  1PBQ A;  1N0T A;  2DSF A;  4PP0 A;  5EHM A;  4O3B A;  4R74 A;  3MZ9 A;  3PGF A;  4X9T A;  3OO6 A;  3V83 A;  1ZBM A;  2DOJ A;  4LQ2 A;  2QPQ A;  1S7Y A;  2XXI A;  1O64 A;  3JYR A;  3MUQ A;  4OMB A;  3PU5 A;  2F36 A;  3SEX A;  4P0I A;  3T9H B;  1NNK A;  4U21 A;  4YAH X;  1B3H A;  3HCQ A;  1FQF A;  3VLV A;  4F22 A;  3K01 A;  1FTJ A;  4NED A;  2HAV A;  3IOR A;  1A8E A;  1SW4 A;  3KGC A;  4NF8 B;  4DCX A;  4JXI A;  1AOV A;  1MQD A;  4LZ5 A;  3O97 A;  1HSL A;  4WEP A;  4YZZ A;  1Z7N E;  3OD7 A;  1UTH B;  5HM4 B;  3B6T A;  3VXB A;  2Z23 A;  5JK4 A;  1GV8 A;  1MY1 A;  1Z7M E;  3OEK A;  2DWJ A;  3R6U A;  3I6V A;  2DXY A;  4RJZ A;  4ESX A;  1B5I A;  1I69 A;  3OSR A;  5FTI A;  4NMY A;  1XVX A;  3PD9 A;  4LP2 B;  3MP6 A;  4NE4 A;  2DWA A;  3Q28 A;  1B32 A;  2DQV A;  2P0S A;  2ESN A;  2RCB A;  1A55 A;  3TCG A;  2D5W A;  4F19 A;  3KZG A;  1LFH A;  2Y7W A;  1S50 A;  1RKM A;  1LBC A;  3PMW A;  2I3V A;  2HAU A;  3FVK A;  3LR1 A;  2UYF A;  4PE5 B;  4QF9 A;  1B3L A;  2HQ0 A;  1OQG A;  2XXT A;  3KFM A;  1N76 A;  3G3H A;  4K3F A;  5JTY B;  4Z7E A;  4U23 A;  2Y84 A;  2ALU A;  2QMX A;  2RC9 A;  3EF7 A;  5ITO A;  2NWJ A;  1UTH A;  1USY H;  4GL8 A;  4FAJ A;  4EQ7 A;  5CMK A;  3PV0 E;  4R72 A;  3VVF A;  3S9L C;  1QVS A;  4JSD A;  1JQF A;  3UIF A;  4NF6 A;  2DYX A;  4Q30 B;  4F3G A;  3HHF A;  5KCJ B;  1JW4 A;  2OWT A;  4IO7 A;  4RK9 A;  4LA9 A;  1MH3 A;  4EF1 A;  4KPT A;  5H8N B;  1FTL A;  3IR1 A;  3MW0 A;  1LFI A;  1BP5 A;  2ABH A;  3DLN A;  1Y4T A;  4KYD A;  3ZSF A;  4G77 A;  3RLF E;  1A7L A;  2RF1 A;  4QFN A;  2ZNT A;  1ZJL A;  1N84 A;  5CI5 A;  1VSO A;  3PMX A;  1O7T A;  2PX1 A;  1A54 A;  1Y3N A;  2H5Y A;  1HSJ A;  2QJE A;  4FEC A;  3M3F A;  2I6E A;  4OEN A;  4ZEI A;  4KHZ E;  4F1Y A;  2P2A A;  3SET A;  4DIG A;  1IXH A;  2O1L A;  1SW5 A;  3E4R A;  3F11 A;  1B2H A;  3ZKL A;  4BDR A;  2DWI A;  2V3T A;  1XVY A;  1VFE A;  3IJX B;  4F3S A;  2G93 A;  1OMP A;  1UTB B;  5J1D A;  4HCW A;  3T96 B;  3SER A;  4BDQ A;  4YMA A;  4LZ8 A;  2RKM A;  1SW2 A;  5AE4 A;  2XXU A;  1POT A;  4NF5 B;  2I58 A;  3OO9 A;  1USY E;  3C31 A;  4ZE9 A;  1XT8 A;  4IO2 A;  3CG3 A;  3H7M A;  1MXV A;  3MZ1 A;  3KSX A;  4OEU A;  3E13 X;  3TTN A;  1NL5 A;  5HBC A;  1URS A;  3S4U A;  3CSG A;  2REG A;  1YTV A;  3SES A;  2QS2 A;  2F34 A;  3USD A;  3K4U A;  5DVF A;  3Q25 A;  3SEY A;  3ZKK A;  5BWJ A;  2QMW A;  3IOU A;  4FOR A;  1SYH A;  4OES A;  3B7D A;  2F7B A;  3VE1 B;  1NNF A;  1IUD A;  1M5D A;  1IZ1 A;  3PUZ E;  3VVE A;  1MPB A;  5EYF A;  3JZJ A;  1DOT A;  2XXV A;  2DE4 A;  2NUV A;  3OO8 A;  4H8I A;  3BKI B;  2Q9T A;  4KFQ A;  4DXC A;  2ONK E;  4RY1 A;  1LB9 A;  4AB6 A;  3JV9 A;  1EZP A;  3MVY A;  2XX7 A;  2XX9 A;  2Z8E A;  2V3Q A;  3C4M A;  4H67 A;  4M1V A;  1B7H A;  1B46 A;  1SYI A;  2AL4 A;  3KJ7 A;  4F1V A;  3DP6 A;  5KDT A;  2YJP A;  1QUL A;  1UIU A;  2ZNS A;  3C36 A;  3HO7 A;  4EXK A;  1B4H A;  3OEL A;  1B5H A;  5H8Q B;  5I57 A;  5I57 B;  1ATG A;  3MPK A;  3MQ9 A;  4TLM B;  4RYA A;  5DEX A;  4POW A;  4OFO A;  3IO4 A;  2O7U A;  4G68 C;  2A5T B;  4KYS A;  4HW8 A;  1NH7 A;  1YCJ A;  3H03 A;  1MDP 1;  2F8D A;  1EZ9 A;  2O68 A;  1ANF A;  1CB6 A;  3BBR A;  3N94 A;  3C35 A;  3N5L A;  3OEM A;  4JWO A;  4YIC A;  4ZEC A;  4GOT A;  1Y1M A;  3U72 A; 
#chains in the Genus database with same CATH topology
 4RNS A;  1XS5 A;  5TPA A;  4LUB A;  1GGG A;  1RDY A;  3KBR A;  1YPN A;  4GWY A;  3TCF A;  5DEX B;  1NNP A;  4X1D A;  3R7X A;  3PUW E;  1AH5 A;  3QAX A;  4MLV A;  3BFU A;  1A8F A;  2OWS A;  1TXF A;  4MF3 A;  5F7V A;  4WED A;  1FRP A;  2VT5 A;  5B7D A;  3B6Q A;  3KJT A;  1UQW A;  1NH8 A;  3HST A;  2Z8D A;  2I4B A;  1FJ6 A;  3QMF A;  5DTB A;  2ZNU A;  4FBP A;  3VXC A;  1MY3 A;  2HZL A;  5I58 B;  4PAI A;  4U1O A;  4GL0 A;  4UAC A;  5ESY A;  1CE2 A;  4MEV A;  2PT1 A;  4QFO A;  3UN6 A;  1FJ9 A;  1EYI A;  1NV3 A;  2KLF A;  4FIM A;  4OXV A;  4ESW A;  3RGY A;  3CR9 A;  3FJG A;  4TLL B;  1LBB A;  4O3C A;  1MXU A;  4GF8 A;  2F35 A;  2OLB A;  2RC7 A;  4OVP A;  1LST A;  3T1B A;  4X1B A;  4H8J A;  1Y9U A;  4KYE A;  3MVZ A;  1D9Q A;  5FTH A;  3C9H A;  4XF5 A;  3IB0 A;  2E1S A;  1FPG A;  1F9B A;  4OAN A;  1I6A A;  1NUW A;  1WDN A;  3LSW A;  1P1U A;  4EQB A;  4OVS A;  4N8Y A;  4XTC Q;  4MNP A;  1IQ7 A;  5AA2 A;  5BUU A;  1FPF A;  4LQ5 A;  3PPN A;  3WAE A;  5I7I A;  2O51 A;  2NVU B;  2GHA A;  2HXW A;  3PD8 A;  1B3G A;  3RTF B;  3OOA A;  4F1U A;  2WKY A;  3C34 A;  1FPB A;  1WVJ A;  3I5O A;  1ZKB A;  4FEB A;  1US4 A;  3FXB A;  1NMU A;  1SVX B;  4H5G A;  1DSN A;  2XXW A;  3K1P A;  4QBA A;  5I56 A;  4GD5 A;  2DVC A;  4JB7 A;  1MPC A;  5AA1 A;  1OQH A;  4MAG A;  4NF0 A;  1M5E A;  4NWC A;  1MDQ A;  1FQB A;  4DXU A;  4PDD A;  2Q2A A;  1ZLQ A;  1B52 A;  5CBR A;  5CMM A;  5ICT A;  2YPN A;  4G8M A;  2BJJ X;  2PFZ A;  1DTZ A;  1H44 A;  3O2A A;  3CI8 A;  4YKK A;  4ZZE A;  3W9W A;  1FBG A;  1JEV A;  2DXR A;  1EZP A;  4JSO A;  2F3B A;  5FHN A;  2HCA A;  4QFP A;  3RPL A;  2ZYK A;  1UTB A;  4BDM A;  3S2V A;  1MRP A;  1BLF A;  2V84 A;  2WX9 A;  3G3K A;  1QUI A;  4GBV A;  3KN8 A;  1LCF A;  2OCU A;  1MPD A;  2RIN A;  1H45 A;  3E79 A;  2Q2C A;  1B51 A;  1NV7 A;  3T93 B;  3GYY A;  4ZEF A;  4PFW A;  4XEQ A;  5H8N A;  1LFG A;  2CZL A;  1AWB A;  2IEE A;  4I3Y A;  1M5B A;  3CFZ A;  3MVX A;  3M8U A;  3TDJ A;  1SI1 A;  4IR8 A;  1NUX A;  1NKX A;  2Z22 A;  4IO3 A;  1Y3P A;  5ET7 A;  5FHM A;  1FTA A;  5ICQ A;  4NF5 A;  1TWY A;  1S9T A;  1IXC A;  1FSA A;  2FIX A;  4LAT A;  3ODB A;  2Y5K A;  3TQW A;  2XXQ A;  1J1N A;  1NUY A;  4I9D A;  2H25 A;  3S9N C;  3IB1 A;  3LUZ A;  3ISP A;  1NFT A;  4OER A;  3OO7 A;  1FPD A;  4PFT A;  4PTK A;  4YKP A;  2A5T A;  2VD2 A;  3GLB A;  1P1O A;  3MST A;  4XKQ A;  2UXA A;  4GXS B;  3CVG A;  1Y3Q A;  2FYI A;  2QS3 A;  2OJT A;  2F6G A;  1IMC A;  4QSC A;  4IB2 A;  3MP8 A;  1LBV A;  3TQL A;  2Y7R A;  1NV0 A;  2RCA A;  2WBD A;  1XC1 A;  2VOZ A;  4F2O A;  3FZV A;  2QL3 A;  3K6X A;  2DVZ A;  4XFE A;  5DYH A;  2Q88 A;  2PT2 A;  3BFT A;  2B4M A;  1SDX A;  3EPE A;  3PUV E;  1ELJ A;  3S9M C;  3FV2 A;  2D3I A;  1N0T A;  2DSF A;  1FBP A;  4R74 A;  2QPQ A;  1NV5 A;  1IMD A;  3EKI A;  4JXI A;  1AOV A;  5JK4 A;  1GV8 A;  1Z7M E;  2DXY A;  1I69 A;  5FTI A;  4NMY A;  3PD9 A;  3MP6 A;  4NE4 A;  3Q28 A;  4NAP A;  1A55 A;  2P3N A;  2I3V A;  3FVK A;  4GX4 A;  1B3L A;  2HQ0 A;  4K3F A;  2XXT A;  3KFM A;  1N76 A;  3G3H A;  4U23 A;  3EF7 A;  5ITO A;  4GL8 A;  3UIF A;  5EQ9 A;  3HHF A;  4IO7 A;  1MH3 A;  4KPT A;  4JVC A;  3IR1 A;  2PFY A;  3ZSF A;  1ZJL A;  1N84 A;  5CI5 A;  2KQZ A;  4ZEI A;  2I6E A;  4MX6 A;  3E4R A;  4O7I A;  2DWI A;  1XVY A;  3HFU A;  3IJX B;  2G93 A;  1OMP A;  4N6K A;  4BDQ A;  3SER A;  2RKM A;  1SW2 A;  2XXU A;  4NQ8 A;  1XT8 A;  1MXV A;  3MZ1 A;  3KSX A;  3TTN A;  1NL5 A;  3S4U A;  5DVF A;  3B7D A;  2F7B A;  1NNF A;  1IZ1 A;  3PUZ E;  2XXV A;  3OO8 A;  5F24 A;  2Q9T A;  4AB6 A;  2XX7 A;  1B7H A;  1SYI A;  3DP6 A;  5KDT A;  1B5H A;  4OFO A;  4G68 C;  2A5T B;  1NH7 A;  2F8D A;  3N94 A;  4ZEC A;  4GOT A;  2XWI A;  4O94 A;  2W7Y A;  1BK4 A;  4NWD A;  4OET A;  1D9Y A;  5ITP A;  4RA1 A;  1B5J A;  3G3I A;  2P1S A;  1B7Z A;  4XKN A;  4ZED A;  3RPW A;  5EQA A;  2VD3 A;  2I48 A;  4FAT A;  1LBZ A;  1FTM A;  1LCT A;  1D4N A;  4O3A A;  4OVR A;  4I3E A;  1LEV A;  3EHS A;  2VGQ A;  2PMS A;  2KR0 A;  5H8Q A;  4C1T A;  1FBC A;  4U22 A;  3IJO B;  2F7C A;  1D3K A;  2QRY A;  4AS5 A;  3FXQ A;  3I3V A;  3Q27 A;  4YB7 A;  3KC1 A;  1KA1 A;  3ILT B;  5FBP A;  1B05 A;  4F3P A;  4WKM A;  1OIB A;  1LAX A;  3LSF B;  4UA8 A;  4AS4 A;  4ND9 A;  3U8Q A;  2F7A A;  5I3S A;  4RPO A;  4QHQ A;  5AA3 A;  2XHD A;  1B0L A;  4C0R A;  1N7X A;  4HXV A;  2QS4 A;  1DK4 A;  1OVT A;  4GWS A;  4G8H A;  5T3J A;  3O9P A;  4R75 A;  2QVU A;  4KD5 A;  3O6I A;  4EDP A;  2XXR A;  4ZEB A;  4R6K A;  3LSX A;  3MPL A;  1LAF E;  1FQA A;  3T0J A;  4NF8 A;  3IX1 A;  2Y7P A;  4GLI A;  3MYU A;  1IME A;  4KR5 A;  4IO4 A;  2XD2 A;  3G3F A;  1AL3 A;  2HPG A;  1KWH A;  2ANJ A;  3FXU A;  3ECR A;  2XWK A;  4MHF A;  2DE2 A;  4QFL A;  3QUJ A;  2AYS A;  1B4Z A;  1RYO A;  2BJI A;  1GVC A;  4MNC A;  4OYV A;  1MM7 A;  2E0S A;  3K6W A;  3OXN A;  3TFL A;  4GWU A;  4AB5 A;  4OZ9 A;  4MIJ A;  5H8Q B;  5LOM A;  4JWX A;  4PAK A;  1B7U A;  4QSD A;  3BIG A;  2GQ1 A;  3VDF A;  4NF6 B;  3FIR A;  4GWW A;  4N6P A;  1VE4 A;  4ZE8 A;  1NNT A;  3FAT A;  3GXA A;  3RY3 A;  1PBP A;  2XXK A;  3QYT A;  5KZT A;  1MXZ A;  4X04 A;  3LC8 A;  2XX8 A;  4YMB A;  2ZYO A;  1BIY A;  2QFL A;  5EYH A;  3CRB A;  3CFL A;  2ZYN A;  3W9V A;  1MY0 A;  5A5X B;  1H76 A;  1US5 A;  3V89 B;  3IOV A;  5ET6 A;  4Q8R A;  4HTG A;  3AXF A;  4N81 A;  1L5T A;  4BDN A;  4IY5 A;  3TOD A;  3QIM A;  4JDF A;  3N6U A;  1D9V A;  2THI A;  1JW5 A;  4FE8 A;  4OVJ A;  3SDF A;  4YU0 A;  2ZZW A;  2VHA A;  1JW1 A;  5I59 A;  1I6B A;  3PPP A;  2B3F A;  3VV5 A;  2GRV A;  2DWH A;  1Q9D A;  4PFU A;  2B65 A;  3FJ7 A;  5IAI A;  3FD3 A;  1M5F A;  1N7W A;  5FHO A;  1Y1Z A;  1DPP A;  3UP9 A;  5L8D A;  4DXB A;  3MP1 A;  3MBP A;  4BLA A;  4GX6 A;  5DVI A;  5K2X A;  2R71 A;  1IIW A;  3GZG A;  4H45 A;  2Y5L A;  1DCU A;  3R26 A;  3G3J A;  4RPN A;  1M5C A;  3IFC A;  1H3D A;  4F22 A;  1SD3 A;  1DPE A;  3T22 A;  4HE2 A;  4RK2 A;  3Q29 A;  5DW8 A;  1VR5 A;  1LAH E;  2CZI A;  3B50 A;  1MY2 A;  1IXG A;  4Q5T A;  1IMB A;  4MJO A;  2YLN A;  4PGP A;  2VPO A;  1FQC A;  3RNN A;  4I1D A;  2HEU A;  1AIV A;  4RXL A;  4O8M A;  3IAZ A;  4KI0 E;  4H46 A;  1QKA A;  4OQO A;  2B3B A;  4L17 A;  5ISU A;  2WYP A;  3RQT A;  3T9U A;  3N26 A;  4P9K A;  2WYK A;  2XXH A;  1NV1 A;  2V3U A;  1EZO A;  2A5S A;  3CG1 A;  1FQE A;  2D21 A;  1LB8 A;  3QUF A;  5L9O A;  1Q35 A;  3FBP A;  1LGB C;  5I2K A;  1HSE A;  5F1Q A;  4G2Z A;  4G4P A;  2Q8J A;  4PQJ A;  1B1X A;  2VP1 A;  4Z0I A;  4WXJ A;  1BKA A;  3EHU A;  2PBW A;  1XHY A;  2FHY A;  2UVI A;  2ONR A;  1Y4C A;  3A09 A;  4R6H A;  3LV0 A;  3MZ9 A;  3OO6 A;  1FBE A;  2R8T A;  4LQ2 A;  2XXI A;  1S7Y A;  4OMB A;  1O64 A;  2F36 A;  4YAH X;  4DCX A;  1SW4 A;  3KGC A;  1NV4 A;  1HSL A;  1UTH B;  1KA0 A;  2Z23 A;  4GBW A;  3OEK A;  4ESX A;  3OSR A;  4GX3 A;  1B32 A;  1INP A;  2RCB A;  3TCG A;  3KZG A;  1LFH A;  5AA2 B;  1S50 A;  4X48 A;  1LBC A;  2HAU A;  4PE5 B;  2ALU A;  3PV0 E;  4R72 A;  3A29 A;  4P1L A;  5KCJ B;  1JW4 A;  2OWT A;  1FTL A;  1LFI A;  1BP5 A;  2ABH A;  4KYD A;  4NG7 A;  3RLF E;  5LDZ A;  4QFN A;  5IM2 A;  4FEC A;  1O7T A;  2QJE A;  1Y3N A;  1HSJ A;  1FPL A;  1SW5 A;  3ZKL A;  1VFE A;  4HCW A;  5AE4 A;  1VDW A;  3H7M A;  1JP4 A;  3E13 X;  1URS A;  4X8R A;  3USD A;  2QS2 A;  2F34 A;  3ZKK A;  2QMW A;  1M5D A;  5EYF A;  1DOT A;  2NUV A;  4KFQ A;  4H8I A;  4DXC A;  4RY1 A;  1LB9 A;  3JV9 A;  3MVY A;  2XX9 A;  3C4M A;  4M1V A;  2AL4 A;  3KJ7 A;  2YJP A;  1QUL A;  4EXK A;  3C36 A;  1B4H A;  3MPK A;  5DEX A;  3IO4 A;  1YCJ A;  1EZ9 A;  2O68 A;  3OEM A;  1CB6 A;  3BBR A;  3C35 A;  3U72 A;  4MMP A;  1RYX A;  3IFA A;  4Q0C A;  4PGN A;  4G68 A;  1FTK A;  1B0H A;  1MQG A;  4OEV A;  4F18 A;  3U65 A;  4YKI A;  4PE3 A;  4PF8 A;  3TTL A;  5I2N A;  5H8S A;  3IO6 A;  1ZU0 A;  1R9Q A;  1MM6 A;  1MXX A;  3RUM A;  2XWV A;  4OFJ A;  2QVV A;  1MXW A;  1JVY A;  1GTK A;  5ET5 A;  4N17 A;  4H65 A;  4QSE A;  3IOW A;  4IO5 A;  1O63 A;  1LLS A;  3GBA A;  2X26 A;  4R2B A;  3E3K A;  4I62 A;  1MS7 A;  2LAO A;  3TYH A;  2Q89 A;  3K6U A;  2AL5 A;  1FPK A;  3QXM A;  3H3G A;  1POY 1;  4H1X A;  1QGX A;  4YB5 A;  5I84 A;  4MCO A;  1PC3 A;  1EU8 A;  1A99 A;  3GBB A;  1R1N A;  5DVJ A;  1TFD A;  3EQ1 A;  5M2V A;  3MVW A;  2V25 A;  1A40 A;  2QS1 A;  2GHB A;  5IZ1 A;  4QRZ A;  3QSL A;  4YB6 A;  5IZZ A;  1FPE A;  4JVI A;  4OFL A;  3MC2 A;  4R73 A;  3T9X B;  4F31 B;  1OLC A;  1TFA A;  4BDO A;  1OLA A;  3FVO A;  5EYG A;  2F6P A;  3KN3 A;  3M3L A;  4HS7 A;  4JWY A;  5CC2 A;  1TT1 A;  4MLQ A;  2B4L A;  4N8G A;  4IY6 A;  1H43 A;  1MQH A;  1MY4 A;  1B1H A;  1N3X A;  2F97 A;  4GRK A;  3TTK A;  2PVU A;  4MFI A;  1FQD A;  3H6T A;  5A5X A;  3O6G A;  3EHT A;  1IEJ A;  4F39 A;  1UIV A;  3OEN A;  4NF4 A;  3C32 A;  3TEL A;  1BTJ A;  3A3C A;  1DBZ A;  4P8B A;  3P7I A;  4G68 B;  2FVZ A;  2F5X A;  1FBF A;  2FNC A;  4XKP A;  2XA5 A;  4I8C A;  2OWZ A;  3K0V A;  5CBS A;  2CEY A;  5CRY A;  4EUO A;  4DLD A;  1YYZ A;  4DE8 A;  1URD A;  3TCH A;  1AMF A;  3C33 A;  4QFK A;  4PF6 A;  3BIH A;  1EYK A;  1N04 A;  3WAF A;  3SZP A;  5I2N B;  4AQ4 A;  3K00 A;  1P1N A;  1Q1K A;  4LZ7 A;  5B70 A;  4YKJ A;  4GQO A;  2HZK A;  3D4G A;  5TPA B;  3ILU B;  1SI0 A;  5LTC A;  4NHB A;  3NOH A;  3TAJ A;  4GVO A;  4MBP A;  3U1O A;  2FBP A;  4ELR A;  2ZZX A;  2QSX A;  3G3G A;  5ELV A;  5AA4 A;  3K02 A;  3QK6 A;  2WBB A;  5DT6 A;  3RTW B;  1IXI A;  5TU0 A;  5KCJ A;  3T9V A;  3TTM A;  3IL1 B;  4BDL A;  3SEU A;  2ZXT A;  5H8H A;  5L9M A;  2I49 A;  3H6U A;  5JTY A;  1VFD A;  4ELO A;  2RC8 A;  4KQP A;  4FJP A;  1YZ0 A;  1P99 A;  1QW0 A;  1II5 A;  1NI9 A;  1PEB A;  4H5F A;  4F29 A;  1PDA A;  1FCK A;  4DI4 B;  4NF4 B;  4FED A;  2ZMB A;  4E0X A;  4M4G A;  3U93 A;  3D1R A;  3FJM A;  3TMG A;  4JVD A;  2NOO A;  1NV2 A;  3ZS6 A;  2PCR A;  3MWB A;  4GWZ A;  2UVH A;  4TQU Q;  4GFR A;  4I40 A;  3PUX E;  4N07 A;  3KOS A;  3DP8 A;  1SQY A;  2OZZ A;  4PFI A;  2O1M A;  3HHG A;  2GFE A;  4MH5 A;  3DP4 A;  3LSL A;  1EH3 A;  2V93 A;  3KOT A;  2X7P A;  2H4I A;  3A3U A;  2CEX A;  4PFY A;  2HFB A;  3VVD A;  5ET8 A;  3L6H A;  1QKB A;  3ROJ A;  1QUJ A;  3O6H A;  4PCD A;  3H06 B;  4N4U A;  4NX1 A;  1YAE A;  1WOD A;  1T0K A;  4R2F A;  3RN8 A;  1B3E A;  3CSB A;  3FVG A;  3PPQ A;  3FV1 A;  3DEL B;  5I59 B;  4G8N A;  3H4Z A;  3LBS A;  1PBQ A;  5EHM A;  1LBY A;  4O3B A;  3PGF A;  3V83 A;  2DOJ A;  3JYR A;  3PU5 A;  3SEX A;  4P0I A;  3T9H B;  1NNK A;  4U21 A;  5IZ3 A;  1B3H A;  3HCQ A;  3VLV A;  3K01 A;  4NF8 B;  1A8E A;  4YZZ A;  3OD7 A;  3B6T A;  3VXB A;  1G0H A;  4RJZ A;  2DWJ A;  3I6V A;  4LP2 B;  4PDH A;  2DQV A;  2D5W A;  1RKM A;  3LR1 A;  4QF9 A;  1OQG A;  2QMX A;  2XWO A;  4P56 A;  4EQ7 A;  5CMK A;  3VVF A;  4NF6 A;  4Q30 B;  2VPN A;  4RK9 A;  4LA9 A;  4EF1 A;  3MW0 A;  1Y4T A;  4G77 A;  2RF1 A;  4N15 A;  2ZNT A;  4N91 A;  1VSO A;  2Q74 A;  2H5Y A;  4OEN A;  5J16 A;  4F1Y A;  2P2A A;  2O1L A;  3F11 A;  1B2H A;  1IMF A;  4BDR A;  2V3T A;  1POT A;  4ZE9 A;  2I58 A;  4IO2 A;  1IMA A;  3CG3 A;  3CSG A;  2REG A;  1YTV A;  3Q25 A;  5BWJ A;  3IOU A;  1SYH A;  4OES A;  1KZ8 A;  1IUD A;  3VVE A;  3JZJ A;  3BKI B;  2Z8E A;  2QVR A;  1B46 A;  4F1V A;  1UIU A;  2ZNS A;  2JJK A;  3OEL A;  5I57 B;  1ATG A;  4TLM B;  4RYA A;  4KYS A;  3RYD A;  2HHM A;  1ANF A;  4JWO A;  1LBX A;  1Y1M A;  4DDD A;  4G61 A;  4ELQ A;  4IGR A;  4QXD A;  3L6G A;  4THI A;  2NXO A;  4P1E A;  1MQI A;  1I6Q A;  4EQ9 A;  2O7I A;  4PC9 A;  3FAS A;  2O69 A;  3KSJ A;  1Y20 A;  3KC0 A;  2IA4 A;  1XI6 A;  4U1Z A;  1B6H A;  3KEI A;  4P0G A;  2H98 A;  2F3D A;  3SKP A;  1NUZ A;  3O29 A;  4DZ1 A;  1DMB A;  2R6G E;  2XXX A;  3HV1 A;  1ZMG A;  3CFX A;  3T66 A;  3HN0 A;  2MKZ A;  3E9X A;  1P1Q A;  2UVG A;  4P47 A;  1R6Z A;  4HCY A;  5EQ8 A;  5AA2 D;  1MQJ A;  1CNQ A;  2M8C A;  3H6V A;  1QUK A;  1R9L A;  3IB2 A;  2XXY A;  4C1U A;  2XXP A;  1EYJ A;  1PB7 A;  3K1M A;  4OA4 A;  5H8H B;  4UAB A;  3IOT A;  1LAG E;  3V8X B;  4PFR A;  3FXR A;  2REJ A;  1PB8 A;  2ZZV A;  3KG2 A;  2UYE A;  3IK6 B;  3VLW A;  3N6T A;  2PYY A;  4O7M A;  1MG1 A;  4E0W A;  4P11 A;  3K2D A;  3THI A;  3U94 A;  1B9J A;  2L5V A;  4U4X A;  4H6D A;  4TOZ A;  2UVJ A;  4JBZ A;  2FA7 A;  1LBW A;  5A5L A;  4F3B A;  2AIX A;  3O66 A;  5TP9 B;  3D4C A;  4PET A;  5TP9 A;  4ZEK A;  4IGT A;  5L9S A;  2DP8 A;  1IIT A;  3TEP A;  2Q8M A;  1MH4 A;  3OMB A;  4GWO A;  2I3W A;  3TKD A;  2F78 A;  3LUY A;  4NTL A;  2HXR A;  3UOR A;  3CHG A;  5CMC A;  4PBH A;  3K6V A;  4ZS9 A;  4KCC A;  2R9J A;  1JVX A;  1FBD A;  4XKR A;  5IZ3 B;  4P3L A;  3PUY E;  3T96 B;  1JNF A;  4ZZA A;  5I56 B;  1QJM A;  3Q26 A;  2OX3 A;  4PBQ A;  4IO6 A;  1XOC A;  3TZA A;  2CZK A;  1PB9 A;  2O84 X;  2OK2 A;  2Y7K A;  4PFB A;  4GXA A;  4HE1 A;  2O6A A;  3TTR A;  2FIE A;  1B3F A;  3PTY A;  1FTO A;  3MJN A;  1B40 A;  4U4S A;  4OVT A;  3FVN A;  4OTE A;  5KDT B;  2DDK A;  3MAM A;  1FW0 A;  3V5A A;  4R6Y A;  2OBG A;  3SEV A;  3MZB A;  2ZYM A;  3OSQ A;  3UGW A;  4EXL A;  1JEU A;  4OWD A;  4EF2 A;  4POX A;  3TPA A;  2V4C A;  3RT8 A;  1SBP A;  2CMO A;  3RT6 B;  4R9F A;  4ZDM A;  1URG A;  1OVB A;  3KN7 A;  4ECF A;  2H9B A;  3SES A;  4KCD A;  4N13 A;  2I0C A;  4ELP A;  5K2Y A;  3G7W A;  5H8F A;  3DM0 A;  5AA4 B;  4F2Q A;  3ONM A;  4XXU A;  4OVQ A;  4H0W A;  4LVQ A;  2I0B A;  4ONY A;  3S9E A;  2I4C A;  3TUS A;  2DS9 A;  3UK4 A;  3RPL B;  4U2R A;  1ZTY A;  5I2K B;  4OHN A;  5EHS A;  1GR2 A;  3UA8 A;  3VLU A;  2CZH A;  4N6D A;  3PPO A;  3FUZ A;  3CIJ A;  2XD3 A;  5I58 A;  1DTG A;  2GH9 A;  3U92 A;  3B6W A;  3VFJ A;  2X7Q A;  4NGU A;  4GIZ A;  3PPR A;  3SEW A;  5JEI A;  3EN3 A;  4MNI A;  2G29 A;  5IGA A;  2H99 A;  1MXY A;  5IKB A;  5EQ7 A;  1N3W A;  3K1N A;  1SW1 A;  3SET A;  4R9G A;  3O28 A;  3H6W A;  5CM6 A;  1K9Y A;  3HPI A;  2DE3 A;  1SPI A;  2ONS A;  3KBZ A;  3B8B A;  3PMV A;  1ZIU A;  2Y7I A;  5HPQ A;  3E78 A;  1P1W A;  3M3K A;  4HE0 A;  2Z8F A;  3FGS A;  4LON B;  5H8F B;  4XIG Q;  5CMB A;  1JET A;  4ISU A;  1B58 A;  4PP0 A;  4X9T A;  4NN3 A;  1ZBM A;  3MUQ A;  1FQF A;  1FTJ A;  4NED A;  2P3V A;  2HAV A;  3IOR A;  1MQD A;  4LZ5 A;  3O97 A;  4WEP A;  1Z7N E;  1MY1 A;  3R6U A;  1YXI A;  1B5I A;  1XVX A;  2DWA A;  1K9Z A;  2P0S A;  2ESN A;  4PAF A;  4F19 A;  1FBH A;  2Y7W A;  3PMW A;  2UYF A;  5JTY B;  4Z7E A;  2Y84 A;  2RC9 A;  2NWJ A;  1UTH A;  1USY H;  4FAJ A;  1NV6 A;  1QVS A;  4JSD A;  1JQF A;  3S9L C;  2DYX A;  4F3G A;  5H8N B;  3DLN A;  1A7L A;  1FPJ A;  1RDZ A;  4DCY A;  3W15 C;  3PMX A;  4GWX A;  2PX1 A;  1A54 A;  4LN5 A;  3M3F A;  4KHZ E;  4DIG A;  1IXH A;  4DI3 D;  4F3S A;  1UTB B;  5J1D A;  4YMA A;  4LZ8 A;  5HM4 B;  4NF5 B;  3OO9 A;  1USY E;  1FPI A;  3C31 A;  2WEF A;  4OEU A;  5HBC A;  3K4U A;  3SEY A;  4FOR A;  3VE1 B;  5I5P A;  1MPB A;  2DE4 A;  2ONK E;  2V3Q A;  4H67 A;  3HO7 A;  5I57 A;  3MQ9 A;  4KXP A;  4POW A;  2O7U A;  1RDX A;  4HW8 A;  3H03 A;  1MDP 1;  4YIC A;  3N5L A;  1G0I A; 
#chains in the Genus database with same CATH homology
 1RYX A;  4DDD A;  2W7Y A;  4RNS A;  4NWD A;  4ELQ A;  1XS5 A;  4IGR A;  5TPA A;  4OET A;  4Q0C A;  4LUB A;  1D9Y A;  5ITP A;  4RA1 A;  1B5J A;  3L6G A;  1GGG A;  4G68 A;  3G3I A;  2NXO A;  1FTK A;  4THI A;  1B0H A;  1MQI A;  2P1S A;  1B7Z A;  1MQG A;  1I6Q A;  4XKN A;  4OEV A;  3RPW A;  2O7I A;  4EQ9 A;  3KBR A;  4ZED A;  2VD3 A;  1YPN A;  2I48 A;  3TCF A;  3FAS A;  5DEX B;  3W15 C;  1NNP A;  2O69 A;  4X1D A;  4FAT A;  3R7X A;  4F18 A;  1FTM A;  4YKI A;  3TTL A;  5I2N A;  3KSJ A;  3PUW E;  1Y20 A;  5H8S A;  1AH5 A;  2IA4 A;  3QAX A;  1LCT A;  4MLV A;  4U1Z A;  3BFU A;  1A8F A;  1B6H A;  1D4N A;  2OWS A;  3IO6 A;  1ZU0 A;  4O3A A;  3KEI A;  1TXF A;  1R9Q A;  1MM6 A;  2H98 A;  4MF3 A;  4P0G A;  1MXX A;  5F7V A;  3RTW B;  4WED A;  3SKP A;  5AA2 B;  3RUM A;  3O29 A;  3EHS A;  4OFJ A;  4X48 A;  4DZ1 A;  2VGQ A;  1DMB A;  2PMS A;  2R6G E;  5B7D A;  2XXX A;  3B6Q A;  3KJT A;  3HV1 A;  5H8Q A;  1MXW A;  4C1T A;  4U22 A;  1JVY A;  1UQW A;  1ZMG A;  3CFX A;  1GTK A;  3IJO B;  2F7C A;  3T66 A;  3TZA A;  3HN0 A;  1NH8 A;  3HST A;  5TPA B;  1D3K A;  4QSE A;  3E9X A;  1P1Q A;  4H65 A;  2QRY A;  2UVG A;  3FXQ A;  3I3V A;  3IOW A;  3Q27 A;  4IO5 A;  3TUS A;  1O63 A;  1LLS A;  3GBA A;  1R6Z A;  2X26 A;  2Z8D A;  4HCY A;  2I4B A;  4YB7 A;  5AA2 D;  1MQJ A;  2ZNU A;  5DTB A;  4R2B A;  3E3K A;  3ILT B;  4I62 A;  3VXC A;  1MY3 A;  1MS7 A;  2HZL A;  2LAO A;  2M8C A;  3H6V A;  5I58 B;  4U1O A;  3TYH A;  2Q89 A;  1B05 A;  4GL0 A;  4F3P A;  4UAC A;  3K6U A;  4WKM A;  2AL5 A;  1CE2 A;  1OIB A;  1QUK A;  1LAX A;  1R9L A;  3QXM A;  3H3G A;  3LSF B;  3IB2 A;  1POY 1;  2PT1 A;  4UA8 A;  4QFO A;  4H1X A;  4ND9 A;  3U8Q A;  3UN6 A;  2F7A A;  2XXY A;  4YB5 A;  5I84 A;  4C1U A;  1PC3 A;  2XXP A;  4RPO A;  3TAJ A;  1EU8 A;  4QHQ A;  5AA3 A;  1A99 A;  3GBB A;  1R1N A;  1PB7 A;  3K1M A;  5DVJ A;  2KLF A;  4FIM A;  1TFD A;  4OXV A;  2XHD A;  1B0L A;  4C0R A;  1N7X A;  5H8H B;  4ESW A;  3RGY A;  3CR9 A;  3FJG A;  4TLL B;  2QS4 A;  3EQ1 A;  3IOT A;  1OVT A;  5M2V A;  1LAG E;  3V8X B;  3FXR A;  1LBB A;  2REJ A;  2V25 A;  3MVW A;  1MXU A;  1A40 A;  1PB8 A;  2QS1 A;  3KG2 A;  4GF8 A;  2F35 A;  2GHB A;  4G8H A;  2UYE A;  3IK6 B;  3VLW A;  2OLB A;  3N6T A;  2RC7 A;  3O9P A;  4R75 A;  2PYY A;  1LST A;  4QRZ A;  3QSL A;  1MG1 A;  4YB6 A;  4E0W A;  4KD5 A;  4X1B A;  4H8J A;  1Y9U A;  3O6I A;  4P11 A;  3K2D A;  4KYE A;  3MVZ A;  3THI A;  1B9J A;  3U94 A;  4EDP A;  2XXR A;  4ZEB A;  4U4X A;  4H6D A;  4OFL A;  4R6K A;  3MC2 A;  4TOZ A;  2UVJ A;  3LSX A;  4JBZ A;  3MPL A;  4R73 A;  1LAF E;  5FTH A;  1FQA A;  3T9X B;  2FA7 A;  4F3B A;  4NF8 A;  3C9H A;  4F31 B;  3IX1 A;  2AIX A;  3O66 A;  1OLC A;  2Y7P A;  2E1S A;  3IB0 A;  1TFA A;  4GLI A;  1F9B A;  5TP9 B;  4BDO A;  1I6A A;  3D4C A;  4PET A;  1WDN A;  3LSW A;  1P1U A;  4KR5 A;  5TP9 A;  4IO4 A;  2XD2 A;  4ZEK A;  4IGT A;  5L9S A;  3G3F A;  2DP8 A;  1IIT A;  1AL3 A;  4EQB A;  1KWH A;  2ANJ A;  3TEP A;  1OLA A;  3FXU A;  4XTC Q;  3ECR A;  4DCY A;  1IQ7 A;  3FVO A;  5AA2 A;  4LQ5 A;  3WAE A;  1MH4 A;  2DE2 A;  2F6P A;  3KN3 A;  3M3L A;  2O51 A;  3OMB A;  3PPN A;  2I3W A;  4GWO A;  3QUJ A;  2AYS A;  4QFL A;  2NVU B;  4HS7 A;  4JWY A;  1B4Z A;  2GHA A;  1RYO A;  1GVC A;  1TT1 A;  3TKD A;  2HXW A;  3PD8 A;  4MLQ A;  5CC2 A;  1MM7 A;  1B3G A;  2E0S A;  3K6W A;  3OXN A;  2F78 A;  3OOA A;  3LUY A;  4NTL A;  4OYV A;  3RTF B;  3TFL A;  4AB5 A;  4F1U A;  4IY6 A;  1H43 A;  4OZ9 A;  3UOR A;  5CMC A;  3K6V A;  4ZS9 A;  1MQH A;  1MY4 A;  1B1H A;  1N3X A;  2F97 A;  1B7U A;  4JWX A;  2WKY A;  3C34 A;  4GRK A;  4KCC A;  4QSD A;  2PVU A;  3TTK A;  4BDM A;  2R9J A;  4MFI A;  1WVJ A;  1FQD A;  3I5O A;  1ZKB A;  3VDF A;  1JVX A;  3FIR A;  4FEB A;  4NF6 B;  3H6T A;  4XKR A;  4N6P A;  5A5X A;  1US4 A;  1NMU A;  1VE4 A;  3O6G A;  3PUY E;  1SVX B;  1JNF A;  1DSN A;  3EHT A;  4H5G A;  2XXW A;  1IEJ A;  1NNT A;  4ZZA A;  4ZE8 A;  3K1P A;  3FAT A;  5I56 B;  3GXA A;  3RY3 A;  1PBP A;  1QJM A;  3Q26 A;  4F39 A;  3QYT A;  5KZT A;  1UIV A;  4IO6 A;  1MXZ A;  3OEN A;  4NF4 A;  3C32 A;  3LC8 A;  5I56 A;  2XX8 A;  1BTJ A;  3A3C A;  3TEL A;  2ZYO A;  4YMB A;  1BIY A;  3P7I A;  4GD5 A;  3CRB A;  3CFL A;  1XOC A;  2DVC A;  2ZYN A;  4G68 B;  4JB7 A;  1MPC A;  1MY0 A;  1PB9 A;  2O84 X;  2OK2 A;  2Y7K A;  1H76 A;  4GXA A;  2F5X A;  5AA1 A;  5A5X B;  1US5 A;  1OQH A;  2O6A A;  2FNC A;  4XKP A;  3TTR A;  3V89 B;  1M5E A;  3IOV A;  1B3F A;  4Q8R A;  4NWC A;  4HTG A;  1MDQ A;  4I8C A;  3AXF A;  1L5T A;  4BDN A;  3K0V A;  1FTO A;  1FQB A;  5CBS A;  5CRY A;  4EUO A;  3MJN A;  4IY5 A;  3TOD A;  1B40 A;  2Q2A A;  3QIM A;  4JDF A;  4DXU A;  1ZLQ A;  3W9V A;  3N6U A;  1D9V A;  1B52 A;  2THI A;  4U4S A;  4DLD A;  1JW5 A;  5CBR A;  3FVN A;  4OTE A;  4DE8 A;  5CMM A;  5KDT B;  5ICT A;  4FE8 A;  3MAM A;  4OVJ A;  1FW0 A;  3SDF A;  2YPN A;  1URD A;  4G8M A;  2BJJ X;  4YU0 A;  3TCH A;  1AMF A;  4XKQ A;  1DTZ A;  2VHA A;  1JW1 A;  3C33 A;  1H44 A;  4QFK A;  3V5A A;  3O2A A;  5I59 A;  1I6B A;  3CI8 A;  4R6Y A;  2OBG A;  3PPP A;  1N04 A;  4YKK A;  4ZZE A;  3WAF A;  2B3F A;  3SEV A;  3VV5 A;  3MZB A;  3W9W A;  2GRV A;  5I2N B;  2ZYM A;  1JEV A;  3OSQ A;  2DWH A;  3UGW A;  4AQ4 A;  2DXR A;  4PFU A;  4EXL A;  3K00 A;  1JEU A;  4OWD A;  2B65 A;  3FJ7 A;  4POX A;  3FD3 A;  4JSO A;  1P1N A;  3TPA A;  1Q1K A;  4LZ7 A;  5FHN A;  5IAI A;  5B70 A;  4YKJ A;  1M5F A;  1N7W A;  5FHO A;  3RT8 A;  2HCA A;  4QFP A;  1Y1Z A;  4GQO A;  2HZK A;  1SBP A;  2CMO A;  1DPP A;  3RT6 B;  4R9F A;  4ZDM A;  3UP9 A;  3D4G A;  5L8D A;  3ILU B;  1URG A;  1OVB A;  1SI0 A;  2ZYK A;  3KN7 A;  3MBP A;  3MP1 A;  1UTB A;  4BLA A;  4ECF A;  5DVI A;  5K2X A;  2H9B A;  2R71 A;  1IIW A;  1MRP A;  1BLF A;  4GVO A;  4MBP A;  3S2V A;  2V84 A;  3GZG A;  4KCD A;  3G3K A;  1QUI A;  4N13 A;  3KN8 A;  3U1O A;  2I0C A;  1LCF A;  2OCU A;  5K2Y A;  4ELP A;  3G7W A;  5H8F A;  4ELR A;  3DM0 A;  1MPD A;  2RIN A;  5AA4 B;  4F2Q A;  1H45 A;  2QSX A;  3G3G A;  5ELV A;  2Q2C A;  5AA4 A;  1B51 A;  3ONM A;  3R26 A;  3G3J A;  4RPN A;  4XXU A;  3K02 A;  1M5C A;  3QK6 A;  4H0W A;  4LVQ A;  4ZEF A;  3T93 B;  5DT6 A;  4PFW A;  2I0B A;  4ONY A;  3S9E A;  5BUU A;  1H3D A;  1IXI A;  2DS9 A;  1LFG A;  2I4C A;  5H8N A;  1SD3 A;  1DPE A;  5TU0 A;  2CZL A;  3T22 A;  3UK4 A;  4RK2 A;  3Q29 A;  5KCJ A;  2IEE A;  3T9V A;  3TTM A;  3IL1 B;  1VR5 A;  3SEU A;  2ZXT A;  4U2R A;  5H8H A;  4BDL A;  1LAH E;  5L9M A;  1M5B A;  1ZTY A;  3CFZ A;  5I2K B;  2I49 A;  3H6U A;  3MVX A;  4OHN A;  1MY2 A;  5EHS A;  3M8U A;  1GR2 A;  1IXG A;  1SI1 A;  1VFD A;  4Q5T A;  3TDJ A;  4ELO A;  5JTY A;  1NKX A;  2YLN A;  2Z22 A;  2RC8 A;  3UA8 A;  3VLU A;  4KQP A;  4IO3 A;  3PPO A;  1Y3P A;  4FJP A;  1FQC A;  5FHM A;  5ICQ A;  4NF5 A;  1P99 A;  3RNN A;  1TWY A;  1QW0 A;  1II5 A;  3FUZ A;  3CIJ A;  2XD3 A;  2HEU A;  1S9T A;  4I1D A;  1AIV A;  1PEB A;  4H5F A;  1IXC A;  4RXL A;  5I58 A;  1DTG A;  2GH9 A;  3IAZ A;  3U92 A;  4F29 A;  1PDA A;  1FCK A;  3B6W A;  4NF4 B;  3VFJ A;  4KI0 E;  4FED A;  2ZMB A;  4LAT A;  3ODB A;  4E0X A;  5LOM A;  2X7Q A;  1QKA A;  4M4G A;  3U93 A;  4GIZ A;  4OQO A;  3FJM A;  3TMG A;  2B3B A;  2NOO A;  3PPR A;  3SEW A;  3TQW A;  2XXQ A;  4L17 A;  1J1N A;  4I9D A;  3ZS6 A;  4EF2 A;  3MWB A;  5JEI A;  2H25 A;  3S9N C;  2UVH A;  3IB1 A;  4O3C A;  5ISU A;  3EN3 A;  4TQU Q;  3RQT A;  1NFT A;  4OER A;  3T9U A;  4GFR A;  3N26 A;  2G29 A;  3OO7 A;  3PUX E;  4N07 A;  3KOS A;  3DP8 A;  2H99 A;  1MXY A;  5IKB A;  2XXH A;  4PFT A;  2V3U A;  1SQY A;  2OZZ A;  4YKP A;  2A5T A;  1N3W A;  2VD2 A;  3GLB A;  1EZO A;  2O1M A;  1SW1 A;  1P1O A;  2A5S A;  3CG1 A;  2UXA A;  3HHG A;  3K1N A;  1FQE A;  2D21 A;  2GFE A;  4GXS B;  4MH5 A;  4R9G A;  3CVG A;  3DP4 A;  3LSL A;  1Y3Q A;  1EH3 A;  2V93 A;  3H6W A;  3O28 A;  3KOT A;  1LB8 A;  2FYI A;  2QS3 A;  2X7P A;  3QUF A;  2H4I A;  3A3U A;  5CM6 A;  2OJT A;  5L9O A;  4PFY A;  2HFB A;  3VVD A;  3HPI A;  1Q35 A;  4DXB A;  2DE3 A;  3L6H A;  1LGB C;  2ONS A;  5I2K A;  2F6G A;  1QKB A;  1HSE A;  5F1Q A;  1QUJ A;  4QSC A;  4G2Z A;  4IB2 A;  3MP8 A;  3O6H A;  3PMV A;  4G4P A;  2Q8J A;  1ZIU A;  2Y7I A;  5HPQ A;  4PQJ A;  3H06 B;  2Y7R A;  3TQL A;  1P1W A;  1B1X A;  2RCA A;  1XC1 A;  2VOZ A;  4F2O A;  3FZV A;  2QL3 A;  3K6X A;  1YAE A;  3M3K A;  2DVZ A;  2VP1 A;  4Z0I A;  1WOD A;  1T0K A;  5DYH A;  2Q88 A;  2PT2 A;  4R2F A;  3BFT A;  3RN8 A;  1B3E A;  3CSB A;  3FVG A;  2Z8F A;  3FGS A;  4LON B;  3PPQ A;  1BKA A;  4WXJ A;  1SDX A;  4XIG Q;  5H8F B;  3EHU A;  3EPE A;  2PBW A;  3PUV E;  3FV1 A;  1ELJ A;  1JET A;  5CMB A;  3S9M C;  1XHY A;  3DEL B;  3FV2 A;  2D3I A;  3H4Z A;  4G8N A;  3LBS A;  4ISU A;  5I59 B;  2UVI A;  2ONR A;  1Y4C A;  3A09 A;  1B58 A;  4R6H A;  1PBQ A;  1N0T A;  2DSF A;  4PP0 A;  5EHM A;  4O3B A;  4R74 A;  3MZ9 A;  3PGF A;  4X9T A;  3OO6 A;  3V83 A;  1ZBM A;  2DOJ A;  4LQ2 A;  2QPQ A;  1S7Y A;  2XXI A;  1O64 A;  3JYR A;  3MUQ A;  4OMB A;  3PU5 A;  2F36 A;  3SEX A;  4P0I A;  3T9H B;  1NNK A;  4U21 A;  4YAH X;  1B3H A;  3HCQ A;  1FQF A;  3VLV A;  4F22 A;  3K01 A;  1FTJ A;  4NED A;  2HAV A;  3IOR A;  1A8E A;  1SW4 A;  3KGC A;  4NF8 B;  4DCX A;  4JXI A;  1AOV A;  1MQD A;  4LZ5 A;  3O97 A;  1HSL A;  4WEP A;  4YZZ A;  1Z7N E;  3OD7 A;  1UTH B;  5HM4 B;  3B6T A;  3VXB A;  2Z23 A;  5JK4 A;  1GV8 A;  1MY1 A;  1Z7M E;  3OEK A;  2DWJ A;  3R6U A;  3I6V A;  2DXY A;  4RJZ A;  4ESX A;  1B5I A;  1I69 A;  3OSR A;  5FTI A;  4NMY A;  1XVX A;  3PD9 A;  4LP2 B;  3MP6 A;  4NE4 A;  2DWA A;  3Q28 A;  1B32 A;  2DQV A;  2P0S A;  2ESN A;  2RCB A;  1A55 A;  3TCG A;  2D5W A;  4F19 A;  3KZG A;  1LFH A;  2Y7W A;  1S50 A;  1RKM A;  1LBC A;  3PMW A;  2I3V A;  2HAU A;  3FVK A;  3LR1 A;  2UYF A;  4PE5 B;  4QF9 A;  1B3L A;  2HQ0 A;  1OQG A;  2XXT A;  3KFM A;  1N76 A;  3G3H A;  4K3F A;  5JTY B;  4Z7E A;  4U23 A;  2Y84 A;  2ALU A;  2QMX A;  2RC9 A;  3EF7 A;  5ITO A;  2NWJ A;  1UTH A;  1USY H;  4GL8 A;  4FAJ A;  4EQ7 A;  5CMK A;  3PV0 E;  4R72 A;  3VVF A;  3S9L C;  1QVS A;  4JSD A;  1JQF A;  3UIF A;  4NF6 A;  2DYX A;  4Q30 B;  4F3G A;  3HHF A;  5KCJ B;  1JW4 A;  2OWT A;  4IO7 A;  4RK9 A;  4LA9 A;  1MH3 A;  4EF1 A;  4KPT A;  5H8N B;  1FTL A;  3IR1 A;  3MW0 A;  1LFI A;  1BP5 A;  2ABH A;  3DLN A;  1Y4T A;  4KYD A;  3ZSF A;  4G77 A;  3RLF E;  1A7L A;  2RF1 A;  4QFN A;  2ZNT A;  1ZJL A;  1N84 A;  5CI5 A;  1VSO A;  3PMX A;  1O7T A;  2PX1 A;  1A54 A;  1Y3N A;  2H5Y A;  1HSJ A;  2QJE A;  4FEC A;  3M3F A;  2I6E A;  4OEN A;  4ZEI A;  4KHZ E;  4F1Y A;  2P2A A;  3SET A;  4DIG A;  1IXH A;  2O1L A;  1SW5 A;  3E4R A;  3F11 A;  1B2H A;  3ZKL A;  4BDR A;  2DWI A;  2V3T A;  1XVY A;  1VFE A;  3IJX B;  4F3S A;  2G93 A;  1OMP A;  1UTB B;  5J1D A;  4HCW A;  3T96 B;  3SER A;  4BDQ A;  4YMA A;  4LZ8 A;  2RKM A;  1SW2 A;  5AE4 A;  2XXU A;  1POT A;  4NF5 B;  2I58 A;  3OO9 A;  1USY E;  3C31 A;  4ZE9 A;  1XT8 A;  4IO2 A;  3CG3 A;  3H7M A;  1MXV A;  3MZ1 A;  3KSX A;  4OEU A;  3E13 X;  3TTN A;  1NL5 A;  5HBC A;  1URS A;  3S4U A;  3CSG A;  2REG A;  1YTV A;  3SES A;  2QS2 A;  2F34 A;  3USD A;  3K4U A;  5DVF A;  3Q25 A;  3SEY A;  3ZKK A;  5BWJ A;  2QMW A;  3IOU A;  4FOR A;  1SYH A;  4OES A;  3B7D A;  2F7B A;  3VE1 B;  1NNF A;  1IUD A;  1M5D A;  1IZ1 A;  3PUZ E;  3VVE A;  1MPB A;  5EYF A;  3JZJ A;  1DOT A;  2XXV A;  2DE4 A;  2NUV A;  3OO8 A;  4H8I A;  3BKI B;  2Q9T A;  4KFQ A;  4DXC A;  2ONK E;  4RY1 A;  1LB9 A;  4AB6 A;  3JV9 A;  1EZP A;  3MVY A;  2XX7 A;  2XX9 A;  2Z8E A;  2V3Q A;  3C4M A;  4H67 A;  4M1V A;  1B7H A;  1B46 A;  1SYI A;  2AL4 A;  3KJ7 A;  4F1V A;  3DP6 A;  5KDT A;  2YJP A;  1QUL A;  1UIU A;  2ZNS A;  3C36 A;  3HO7 A;  4EXK A;  1B4H A;  3OEL A;  1B5H A;  5H8Q B;  5I57 A;  5I57 B;  1ATG A;  3MPK A;  3MQ9 A;  4TLM B;  4RYA A;  5DEX A;  4POW A;  4OFO A;  3IO4 A;  2O7U A;  4G68 C;  2A5T B;  4KYS A;  4HW8 A;  1NH7 A;  1YCJ A;  3H03 A;  1MDP 1;  2F8D A;  1EZ9 A;  2O68 A;  1ANF A;  1CB6 A;  3BBR A;  3N94 A;  3C35 A;  3N5L A;  3OEM A;  4JWO A;  4YIC A;  4ZEC A;  4GOT A;  1Y1M A;  3U72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...