1SW4A

Crystal structure of prox from archeoglobus fulgidus in complex with trimethyl ammonium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDYALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords osmoprotection protein (proX)
publication title Structural basis for the binding of compatible solutes by ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 99
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sw4A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 1sw4A02
3RT6B 4ZZAA 1RKMA 4F22A 4G68A 1R1NA 2OZZA 2NXOA 1A7LA 3IOVA 4YB7A 2DXRA 1LCTA 2O1LA 3GXAA 3PPPA 3H6VA 3D4CA 3U92A 4ELOA 1IIWA 3THIA 4RA1A 4QFPA 1EZOA 1P1NA 4FAJA 2CMOA 4OYVA 5TPAA 4XKQA 4YB6A 3Q25A 1DTZA 4LUBA 3T96B 1B6HA 3ONMA 4QF9A 3H06B 3WAEA 4ESWA 1MXWA 4I9DA 3T22A 4GF8A 4NWDA 2I3WA 3G7WA 4EUOA 3O29A 3CVGA 1FW0A 2GHAA 5DEXA 4BDLA 3TZAA 2PX1A 1YTVA 3A09A 1Y3NA 3F11A 3LUYA 1S9TA 2THIA 1P1OA 5H8SA 5JTYB 1XC1A 4HCYA 2UVJA 5DT6A 1JVXA 1RYXA 4AB5A 4X48A 4BLAA 3Q28A 3TPAA 2NOOA 3H6WA 1M5EA 2XXUA 2B3BA 5DYHA 3MW0A 3CIJA 2HXWA 1FQAA 2I48A 1B2HA 3VXCA 4RJZA 4F1YA 1HSJA 4TQUQ 1SW1A 3HN0A 4ONYA 4ZZEA 1UTHA 1LFIA 1LB8A 4JDFA 4NF6A 4C1UA 4EQ9A 4OHNA 5BWJA 1Y1ZA 2CZLA 5FHOA 3FASA 4LQ5A 3H3GA 2YPNA 5LOMA 2Z8FA 4HCWA 5H8NA 2OJTA 2RC8A 2O7IA 1LGBC 5ITPA 3FVNA 2A5TB 1NMUA 5TP9B 5F7VA 4I62A 4ZE8A 4LZ7A 4I1DA 4M4GA 5L9MA 3MAMA 1ZLQA 4GL8A 4R74A 3RTWB 5I58B 4H5GA 3LC8A 4ZEFA 4M1VA 4ZECA 4RK2A 4WEDA 4XKPA 2QPQA 2XXVA 3OENA 3FATA 1MXXA 3K2DA 3PMVA 1POTA 1HSLA 3QK6A 4NF4B 1QJMA 3Q26A 4ND9A 4BDOA 1PB7A 5H8QB 2FA7A 2W7YA 3KSXA 3H6UA 1LBBA 1NH8A 4F2OA 3TTLA 2H9BA 2O6AA 4N07A 1QUKA 5CI5A 3PV0E 3C33A 3MP8A 3O97A 2QJEA 1I6QA 1FTLA 4I8CA 3RPWA 3FD3A 2HAVA 3W9WA 4N13A 1DOTA 2ZNSA 4NF8B 3FXRA 4DIGA 5ELVA 1N7WA 3B6TA 3EPEA 4F31B 3UK4A 4JSOA 3L6GA 4R6KA 1TFAA 3FXQA 4RY1A 3TEPA 1UIVA 1IXIA 4YMBA 2VD2A 5CMKA 4YZZA 2HZLA 4XXUA 2VP1A 3R26A 4U23A 3OO6A 4LQ2A 3TQLA 1SDXA 3PU5A 1P1QA 4H6DA 1SW2A 1XOCA 5I2KB 4YKKA 3M3KA 4PFTA 1XT8A 4GXSB 3LSLA 5AA4A 1XVXA 1B58A 4F39A 3VFJA 3GLBA 3TYHA 5I58A 4DLDA 4X1DA 3DLNA 1NNKA 3IL1B 2LAOA 4H5FA 4U1ZA 2DS9A 3BFUA 1B0HA 1MM6A 4TLMB 2GH9A 3EHUA 3M8UA 3DM0A 1S50A 5B7DA 3VLVA 3TUSA 4G8HA 1MXUA 2O1MA 4BDNA 1LLSA 2UXAA 4R72A 2Y7PA 1FQFA 5H8HA 1MS7A 4ZEBA 2HZKA 4YU0A 1SI0A 3D4GA 1URDA 2XX7A 4U21A 1VFDA 1D4NA 3QIMA 1MXYA 4DXBA 3V83A 3QXMA 2QMWA 5CMCA 2AL5A 3FGSA 4XKRA 4KCCA 1M5CA 4ZS9A 4KYSA 3N6TA 1XS5A 2I3VA 1ATGA 3MZ9A 5CM6A 1EU8A 3CFZA 2NVUB 1M5DA 4LZ8A 3DELB 2XXXA 1DPEA 4ZEIA 3MVYA 2Q2CA 1A55A 3M3FA 1B1XA 3C4MA 1IXCA 3MVZA 1M5FA 1JQFA 2I58A 3OSQA 4G68B 3DP6A 4Q30B 3FIRA 5I2KA 3KN3A 3PPQA 3HCQA 4FEDA 5H8FA 2ZNTA 4DXUA 2HQ0A 1QULA 3IJOB 1PC3A 2QL3A 3CR9A 4WEPA 1J1NA 3PPNA 3OO8A 4TOZA 2DXYA 4PFYA 3KG2A 1ANFA 3GZGA 3S9NC 3OOAA 3N26A 4G8MA 1Y4TA 4NE4A 4NEDA 2O68A 1H45A 4TLLB 3OELA 4IO2A 3RNNA 4EQBA 4UACA 3ZKLA 4AB6A 1MY2A 1M5BA 2X26A 3CRBA 1ZKBA 5DVJA 5CMBA 3I6VA 1BLFA 4U2RA 3TCHA 1TWYA 5DEXB 4OTEA 4IO6A 3TQWA 2V3TA 1WODA 2B3FA 5I2NA 4FIMA 5L9OA 2D5WA 3K6WA 3K6XA 4AQ4A 3MP6A 1N04A 3R6UA 4RXLA 5BUUA 1XHYA 4Z0IA 3TELA 1P1WA 2F78A 4KHZE 4F3SA 1SYIA 2XXIA 3OO9A 5HM4B 1EZ9A 5KCJA 3OMBA 3H03A 1F9BA 2KLFA 2XXTA 4GWOA 4FE8A 3KGCA 3K0VA 1OIBA 2FNCA 1UTHB 1B4ZA 4ELQA 3PPRA 1US4A 4NF6B 1QUJA 1I6AA 1BIYA 4GLIA 3G3GA 3IORA 4THIA 4QFKA 3QSLA 4IY5A 4IO5A 4DXCA 3LBSA 3L6HA 5H8NB 1MY1A 2E0SA 2ZYOA 4EF2A 1USYE 4EXLA 2XX8A 1FQEA 1WVJA 3B7DA 3TKDA 4OXVA 1Q1KA 4QSCA 2I0CA 4ZEDA 4OQOA 3PUXE 2DOJA 2ZXTA 1L5TA 3S4UA 3MBPA 4YKJA 1O63A 4DZ1A 1B3EA 1A54A 3SDFA 1UQWA 3ZSFA 1Y4CA 2F5XA 2ABHA 2I0BA 3FVGA 1IXGA 4G77A 5CMMA 2UVHA 2ESNA 1RYOA 3K1MA 3V5AA 1B7HA 3C34A 1LFGA 3SEVA 2V93A 4OZ9A 3LSWA 1D9VA 1Z7NE 4IGTA 1B9JA 4KFQA 4QFOA 3S9EA 2F34A 4KPTA 3IO6A 2O51A 3T9VA 4F1UA 1OLCA 1QKBA 4R2BA 1FTKA 1JW4A 4WXJA 5KDTA 1B52A 1MQJA 4DCXA 3EHTA 4H65A 3VLWA 5I84A 1B0LA 1IITA 5JEIA 2Y84A 3IB1A 3O6GA 1QUIA 3MVWA 1FTOA 5B70A 2FYIA 3TTKA 2REJA 5AE4A 3CSGA 4POWA 4LP2B 1NL5A 1B5JA 3WAFA 2R71A 4P0IA 3G3HA 3T93B 1SBPA 3C35A 4RK9A 2QS3A 5FTHA 3KEIA 1GGGA 5AA4B 3CG1A 1BP5A 3I3VA 3KJTA 1MH4A 4RPOA 3VLUA 4JWYA 1HSEA 3RLFE 4LZ5A 2V25A 3FXUA 3PUVE 4OFLA 2F6GA 2ALUA 3A3UA 3MPLA 3CSBA 3C36A 5K2YA 3JYRA 2Y7IA 4E0XA 2ZYMA 2GRVA 3KJ7A 1DMBA 4HTGA 2XX9A 5H8HB 2ONRA 3IB0A 1H76A 1PBPA 5CBRA 3RGYA 3SEXA 4P11A 2IA4A 3K1PA 2ONKE 2DQVA 4Z7EA 3UGWA 2X7QA 3GBAA 1A40A 3ILUB 3MUQA 3HHFA 3P7IA 3E3KA 4BDQA 4LATA 2AL4A 3CI8A 5EYFA 3T9XB 4QSDA 3K02A 2V3QA 2DE3A 2QMXA 5AA1A 4U22A 1MQHA 2Q88A 3KBRA 1MH3A 5ICQA 1JNFA 2Z8EA 4GXAA 2Q89A 1MDP1 2QS1A 2V84A 3VDFA 1AMFA 1NFTA 4C0RA 1LAFE 2DVZA 1JETA 3KN8A 4G4PA 3TTNA 4GIZA 1B4HA 5I59A 1MXZA 4GVOA 3U93A 1TFDA 4POXA 4KD5A 3G3FA 4PETA 1Y3PA 1YAEA 2GFEA 3SESA 3G3IA 3I5OA 1II5A 2Z8DA 5TU0A 2RKMA 1IXHA 3OXNA 4YICA 5H8FB 2DYXA 3FJMA 1DSNA 2P1SA 4IO7A 3TCFA 4QSEA 2UYEA 4HW8A 3RUMA 3CFXA 4OETA 1R9QA 4JSDA 1R9LA 3IOWA 4R2FA 2XXYA 1IUDA 4BDRA 5AA2D 5L8DA 4H8IA 1OVTA 1H44A 1OVBA 3UIFA 3IR1A 4MLVA 4LVQA 1CB6A 2RF1A 2QRYA 5AA3A 3O9PA 2I6EA 2R9JA 2GHBA 3G3KA 2M8CA 5AA2A 1N76A 3LSXA 1CE2A 3B6WA 3PUWE 3JZJA 3EQ1A 5J1DA 3S9MC 1PBQA 1PB8A 3N5LA 2XHDA 1PEBA 1B7ZA 1FCKA 3IK6B 5I2NB 2Q2AA 3K6UA 4U4XA 2E1SA 1JEUA 2H25A 5DTBA 3C32A 2VD3A 4E0WA 5CBSA 3Q29A 1UIUA 5KCJB 1P99A 2F7AA 5FTIA 3IOTA 3U72A 2HCAA 1MM7A 4YKIA 3R7XA 2H5YA 1B40A 3OSRA 4C1TA 3S9LC 2DWJA 1UTBA 2UVIA 4ECFA 1O7TA 4Q5TA 3T9UA 3V89B 2I4CA 4OEUA 4YB5A 1BTJA 3FJGA 4O3BA 2V3UA 4F19A 5F1QA 3U8QA 1MY3A 3OEMA 3K1NA 3N6UA 1JW5A 3KZGA 1YCJA 2O84X 1A8FA 4FEBA 3C9HA 4RPNA 3QUFA 1URGA 4DE8A 5I57A 5ICTA 3PMXA 4ISUA 3AXFA 5FHNA 2VOZA 2O7UA 2VHAA 1JVYA 2Z23A 1B3LA 1MXVA 1Q35A 2UVGA 2Q8JA 3HPIA 1AL3A 1B3GA 4FATA 1SW4A 2YLNA 3Q27A 1SI1A 2DSFA 3QUJA 1N84A 1NH7A 3C31A 1QW0A 2PT1A 5JK4A 3RN8A 4NTLA 3EF7A 3IAZA 2ANJA 3MC2A 3MQ9A 1GR2A 3ODBA 3TODA 1ZIUA 3PD8A 1DPPA 1US5A 3EN3A 3VE1B 4GRKA 2BJJX 2F8DA 1LCFA 2A5SA 1MRPA 2XXWA 1FTMA 2DWIA 5KDTB 5IKBA 4YAHX 2I49A 4FJPA 2P2AA 1ZJLA 1GTKA 2YJPA 1Z7ME 3BFTA 5HBCA 4YMAA 4GD5A 5EHMA 3HHGA 3K01A 3MVXA 2RC7A 1VR5A 4FECA 3IOUA 4IY6A 1OQHA 4EDPA 3SEUA 1A8EA 3O66A 1SYHA 1SW5A 2P0SA 2IEEA 4Q8RA 3E9XA 4QHQA 1N3XA 1YPNA 4N6PA 5I56A 4RYAA 3ECRA 2OWSA 3OEKA 1B32A 2HAUA 1DTGA 2OBGA 1B46A 3PGFA 1MPBA 1VE4A 5ITOA 2REGA 4ELRA 1FTJA 4NF5A 4JB7A 1H3DA 2ZNUA 4EF1A 3VVFA 5L9SA 5A5XA 1BKAA 1QVSA 3N94A 2D21A 3IX1A 3SEWA 4JBZA 3U94A 4ZE9A 2VGQA 3KFMA 3RT8A 2PT2A 1NNPA 1O64A 3TMGA 1IQ7A 5KZTA 1ZU0A 1B7UA 3EHSA 1FQBA 2F7BA 3PUYE 4G68C 2Y7RA 1FQDA 2F6PA 4ZEKA 2ZYNA 1LSTA 2F36A 2UYFA 2XD3A 1MPDA 1EZPA 3PUZE 5I59B 4KCDA 4Q0CA 3E4RA 4JWXA 3CG3A 3ZS6A 3VVDA 2DE4A 1T0KA 3LSFB 4NMYA 1Y20A 3IO4A 1LAXA 3VV5A 4PP0A 4X9TA 1FQCA 4OFOA 4R73A 3MJNA 4L17A 4F18A 2PYYA 1B05A 3FV2A 4IO3A 4EQ7A 3H4ZA 1Y9UA 2PBWA 2NWJA 4ESXA 3UP9A 2AIXA 1SD3A 3T66A 3A3CA 2XD2A 3H7MA 5IAIA 1MQGA 1ZMGA 2Y7KA 1Y3QA 5AA2B 3VXBA 4QRZA 3O2AA 2I4BA 4X1BA 1B5HA 4H67A 1MQDA 3MZ1A 4OWDA 1LAHE 4HS7A 3QYTA 4BDMA 3HO7A 5DVFA 2ZYKA 1OLAA 1IZ1A 4XIGQ 2G93A 2Q9TA 4F3BA 1MY0A 4R9FA 4GFRA 4ZDMA 1SQYA 3B6QA 5M2VA 2HEUA 1USYH 3FZVA 3RTFB 3ILTB 3S2VA 3OO7A 5JTYA 2DWAA 3LR1A 4MLQA 4QFNA 4MBPA 4O3AA 1NNTA 4R6HA 4R9GA 4OERA 1TXFA 4KQPA 1UTBB 2O69A 2Y7WA 1I6BA 3O28A 4H0WA 3FV1A 2H4IA 3TFLA 3V8XB 2PVUA 4OFJA 4F3GA 3KOSA 3RY3A 2NUVA 2R6GE 4R6YA 4H8JA 1R6ZA 1H43A 4PQJA 3SKPA 4JWOA 5EHSA 3W9VA 1POY1 2QS2A 3IB2A 3HSTA 4NWCA 4PFUA 3FUZA 3HV1A 2A5TA 3DP8A 4XKNA 5TP9A 3O6IA 5I57B 1VSOA 4IGRA 2G29A 3PPOA 3PMWA 3SERA 1N3WA 3OD7A 3TAJA 1WDNA 4OMBA 1D9YA 1QKAA 2PMSA 2B65A 3IJXB 5CRYA 4NF4A 3U1OA 1XVYA 3ZKKA 4IB2A 5H8QA 3MP1A 1ELJA 4RNSA 3TTRA 1IEJA 2OWTA 2OK2A 4KYDA 4KI0E 3BBRA 4DDDA 2ZMBA 2DWHA 1LAGE 5DVIA 1GV8A 2QS4A 1MPCA 4QFLA 4UA8A 4KYEA 2H99A 1Y1MA 4F3PA 3VVEA 4OESA 1A99A 3G3JA 4JXIA 2DE2A 1LB9A 3SETA 4LONB 3PD9A 5HPQA 1LBCA 1AOVA 3KN7A 4NF8A 5ISUA 3UN6A 2RC9A 4DCYA 1P1UA 2OCUA 1AH5A 4F1VA 1ZBMA 1URSA 3K6VA 5FHMA 4U4SA 4KR5A 3BKIB 4O3CA 4EXKA 4F29A 3TTMA 2RCAA 2RINA 3MPKA 3T9HB 4MFIA 4YKPA 4PE5B 4OEVA 4PFWA 3JV9A 1ZTYA 4WKMA 1B51A 4OENA 3UA8A 2XXQA 1JW1A 4OVJA 1JEVA 1PB9A 4IO4A 2QSXA 4H1XA 4MH5A 2H98A 3KOTA 4U1OA 2F97A 1MQIA 1NNFA 3FVOA 2HFBA 5I56B 4R75A 5TPAB 1OMPA 1I69A 3FVKA 1B3HA 1N0TA 2XXRA 4LA9A 4ELPA 1VFEA 3O6HA 3DP4A 2RCBA 4F2QA 2F7CA 4NF5B 2OLBA 2XXPA 4G8NA 1B1HA 1MDQA 1B5IA 3H6TA 3TDJA 2Z22A 4GQOA 1PDAA 1S7YA 2D3IA 3UORA 2DVCA 4GL0A 1TT1A 5A5XB 4G2ZA 4XTCQ 3CFLA 3M3LA 4K3FA 1KWHA 2ONSA 3K00A 3USDA 1B3FA 1D3KA 4GOTA 3RQTA 5K2XA 1GVCA 3K4UA 4MF3A 3TCGA 3W15C 3FJ7A 2XXHA 3MZBA 2X7PA 3KSJA 1SVXB 4FORA 1MG1A 5CC2A 1EH3A 1MY4A 1N7XA 3E13X 1NKXA 1OQGA 2F35A 3QAXA 1AIVA 4P0GA 2DP8A 2WKYA 1LFHA 3SEYA 3MWBA 2AYSA 3GBBA
chains in the Genus database with same CATH superfamily
3RT6B 4ZZAA 1RKMA 4F22A 4G68A 1R1NA 2OZZA 2ZZXA 2NXOA 1A7LA 3IOVA 4YB7A 2QVUA 2DXRA 1LCTA 2O1LA 3GXAA 3PPPA 3H6VA 3D4CA 3U92A 4UABA 4ELOA 1IIWA 5LDZA 3THIA 4RA1A 4QFPA 1EZOA 1P1NA 4FAJA 4HE0A 2CMOA 4OYVA 5TPAA 1FBGA 4XKQA 4YB6A 3Q25A 1DTZA 4LUBA 3T96B 1B6HA 3ONMA 4QF9A 3H06B 5T3JA 3WAEA 4ESWA 4I40A 1MXWA 4I9DA 4PAFA 3T22A 4GF8A 4NWDA 2I3WA 3G7WA 4EUOA 1BK4A 3O29A 3CVGA 4MAGA 1FW0A 2GHAA 5DEXA 4BDLA 3TZAA 2PX1A 1YTVA 3A09A 1Y3NA 3F11A 2Y5LA 4X8RA 4P56A 3LUYA 1S9TA 2THIA 1P1OA 5H8SA 5JTYB 1XC1A 2CEXA 4HCYA 4O8MA 2UVJA 4NGUA 5DT6A 1JVXA 1RYXA 4AB5A 5ET7A 4X48A 4BLAA 3Q28A 4NX1A 3TPAA 4MIJA 2NOOA 3H6WA 1M5EA 2XXUA 2B3BA 5DYHA 3MW0A 3CIJA 2HXWA 1FQAA 4PTKA 2I48A 1B2HA 3VXCA 4RJZA 4F1YA 1HSJA 4TQUQ 1SW1A 3HN0A 3RYDA 4ONYA 4ZZEA 3MYUA 1UTHA 1LFIA 1LB8A 4JDFA 4PCDA 4NF6A 4C1UA 4EQ9A 4OHNA 5BWJA 1Y1ZA 2CZLA 1YXIA 5FHOA 3FASA 4LQ5A 3H3GA 2YPNA 5LOMA 5DW8A 2Z8FA 4HCWA 5H8NA 2OJTA 2RC8A 2O7IA 3HFUA 1LGBC 5ITPA 3FVNA 2A5TB 2DDKA 4MEVA 1NMUA 5TP9B 5F7VA 4I62A 3NOHA 5EQ7A 4ZE8A 1EYJA 4LZ7A 4I1DA 4M4GA 5L9MA 3MAMA 1ZLQA 4GL8A 4R74A 3RTWB 5I58B 4H5GA 3LC8A 4GWYA 4ZEFA 4M1VA 2BJIA 4ZECA 4RK2A 4WEDA 1NUWA 4XKPA 5ESYA 2QPQA 2XXVA 3OENA 3FATA 1MXXA 1XI6A 3K2DA 2ZZVA 3PMVA 1POTA 1HSLA 3QK6A 4NF4B 1QJMA 3Q26A 4ND9A 1JP4A 4PF6A 5IZZA 4BDOA 2P3VA 1PB7A 5H8QB 4O7MA 2FA7A 2W7YA 3E78A 3KSXA 1IMDA 3H6UA 1LBBA 1NH8A 4MNCA 4F2OA 3TTLA 2H9BA 2O6AA 4N07A 1QUKA 5CI5A 2F3BA 3PV0E 3C33A 1DBZA 3MP8A 3O97A 2QJEA 1I6QA 1FTLA 4I8CA 3RPWA 3FD3A 2HAVA 2L5VA 4PBQA 3W9WA 4N13A 1DOTA 2ZNSA 4NF8B 3FXRA 4DIGA 3ROJA 1KA0A 3QMFA 5ELVA 5ET8A 1N7WA 3B6TA 3EPEA 4F31B 3UK4A 4JSOA 2HHMA 3L6GA 4R6KA 1TFAA 3FXQA 4RY1A 3TEPA 4HE1A 1IMAA 1UIVA 1IXIA 4YMBA 2VD2A 5CMKA 4YZZA 2HZLA 4XXUA 2VP1A 3R26A 4U23A 3OO6A 4LQ2A 3TQLA 1SDXA 3PU5A 1P1QA 1FBHA 4H6DA 1SW2A 5IZ3B 1XOCA 4P1EA 5I2KB 4YKKA 3M3KA 4NAPA 4PFTA 1XT8A 4GXSB 2HXRA 3LSLA 5AA4A 1LBXA 1XVXA 1B58A 4F39A 3VFJA 3GLBA 3TYHA 5I58A 2CEYA 4DLDA 4X1DA 3DLNA 1NNKA 5EYHA 4MX6A 3IL1B 2LAOA 4H5FA 4U1ZA 2DS9A 3BFUA 1FPDA 1B0HA 1LBZA 1MM6A 4TLMB 2GH9A 3EHUA 4P8BA 3M8UA 3DM0A 1S50A 3VLVA 5B7DA 3TUSA 4G8HA 3LV0A 1MXUA 2O1MA 4BDNA 1LLSA 2UXAA 4R72A 2Y7PA 1FQFA 5H8HA 1MS7A 4ZEBA 2HZKA 4YU0A 1SI0A 3D4GA 1URDA 2XX7A 4U21A 1G0IA 1FBFA 1RDZA 4N4UA 1VFDA 1D4NA 3QIMA 3RPLA 1MXYA 4DXBA 3V83A 3QXMA 2QMWA 5CMCA 2AL5A 3FGSA 4XKRA 4KCCA 1M5CA 4ZS9A 4KYSA 3N6TA 1XS5A 2I3VA 1ATGA 3MZ9A 5CM6A 2XWVA 4N6DA 1EU8A 3CFZA 2NVUB 1M5DA 2Q8MA 4LZ8A 3DELB 2XXXA 1DPEA 4ZEIA 3MVYA 1KA1A 2Q2CA 1A55A 2WX9A 3M3FA 1B1XA 1NV5A 1IXCA 3C4MA 3MVZA 1M5FA 1JQFA 2I58A 3OSQA 4GX6A 4G68B 2WYKA 3DP6A 4GWWA 4Q30B 3FIRA 5I2KA 2PFYA 3KN3A 3PPQA 3HCQA 4FEDA 2WEFA 5H8FA 1DCUA 2ZNTA 4DXUA 2HQ0A 1QULA 3IJOB 1PC3A 2QL3A 4OVSA 3CR9A 4WEPA 1J1NA 4OA4A 3PPNA 3OO8A 4TOZA 2DXYA 4PFYA 3KG2A 1ANFA 3GZGA 3S9NC 3OOAA 3N26A 4G8MA 1IMCA 1Y4TA 4NE4A 4NEDA 2WBBA 2O68A 3LUZA 1LBVA 1H45A 4TLLB 3OELA 4IO2A 3RNNA 4EQBA 4UACA 3ZKLA 4AB6A 1MY2A 1M5BA 2X26A 4N6KA 3CRBA 1ZKBA 5DVJA 5CMBA 3I6VA 1BLFA 4U2RA 1FJ6A 3TCHA 5I3SA 1TWYA 4OVTA 5DEXB 4OTEA 4IO6A 3TQWA 2V3TA 1WODA 2CZHA 2B3FA 5I2NA 4FIMA 4PFRA 5L9OA 3EKIA 2D5WA 3K6WA 3K6XA 1G0HA 4AQ4A 2FHYA 3MP6A 1N04A 3R6UA 4RXLA 5BUUA 1XHYA 4Z0IA 3TELA 1P1WA 2F78A 4KHZE 4F3SA 1SYIA 2XXIA 3OO9A 5HM4B 4P3LA 1EZ9A 5KCJA 3OMBA 3H03A 4LN5A 1F9BA 3IFCA 2KLFA 2XXTA 4GWOA 4FE8A 5I5PA 3KGCA 3K0VA 1OIBA 2FNCA 1UTHB 1RDXA 1B4ZA 4ELQA 3PPRA 1US4A 4NF6B 1QUJA 1I6AA 1BIYA 4GLIA 3G3GA 3IORA 1LBWA 4THIA 4QFKA 3QSLA 4IY5A 4IO5A 4DXCA 3LBSA 3L6HA 5H8NB 1MY1A 2E0SA 2ZYOA 4EF2A 1USYE 4EXLA 2XX8A 1FQEA 1NV7A 1WVJA 1FBEA 3B7DA 3TKDA 4OXVA 1Q1KA 4QSCA 2I0CA 4ZEDA 4OQOA 3PUXE 2DOJA 2ZXTA 1L5TA 3FXBA 3S4UA 3MBPA 4YKJA 1LEVA 1O63A 4DZ1A 1B3EA 3T0JA 1A54A 3SDFA 1UQWA 3ZSFA 1Y4CA 2F5XA 2KQZA 2ABHA 2I0BA 2VPNA 3FVGA 1IXGA 4G77A 5CMMA 2UVHA 1FTAA 2ESNA 1RYOA 4DI4B 1DK4A 3K1MA 2FVZA 3V5AA 1B7HA 3C34A 1LFGA 3SEVA 2V93A 4OZ9A 4FBPA 3LSWA 1D9VA 4PGNA 1Z7NE 5IZ1A 1FBCA 4H46A 4IGTA 4OVRA 1B9JA 4KFQA 4GX4A 4QFOA 3S9EA 2F34A 2PFZA 4KPTA 4P1LA 3IO6A 2O51A 3T9VA 4F1UA 4N8YA 1OLCA 1QKBA 4R2BA 1FTKA 1JW4A 4WXJA 5KDTA 1B52A 1MQJA 4DCXA 3EHTA 4H65A 3VLWA 5I84A 1B0LA 1IITA 5JEIA 2Y84A 3IB1A 3O6GA 1QUIA 3MVWA 1FTOA 1VDWA 5B70A 2FYIA 3TTKA 2REJA 5AE4A 1RDYA 3CSGA 4POWA 4LP2B 1NL5A 1B5JA 3WAFA 4MCOA 2R71A 4P0IA 4DI3D 3G3HA 3T93B 1SBPA 1FPKA 3C35A 4RK9A 5EQAA 2QS3A 2B4MA 5FTHA 3KEIA 1GGGA 5AA4B 3CG1A 1BP5A 3I3VA 1INPA 3SZPA 3ISPA 4NHBA 3KJTA 1MH4A 2FBPA 4RPOA 1FPJA 3VLUA 4JWYA 1HSEA 1YYZA 2OX3A 3RLFE 1IMBA 2VT5A 4LZ5A 2V25A 3FXUA 3PUVE 4OFLA 2F6GA 3KC0A 2ALUA 3A3UA 3MPLA 3CSBA 4P9KA 2MKZA 3C36A 5K2YA 3JYRA 1NV2A 2Y7IA 4E0XA 2ZYMA 2GRVA 3KJ7A 1DMBA 4HTGA 2XX9A 5H8HB 2ONRA 1FPLA 3IB0A 1H76A 1PBPA 5CBRA 1NV3A 3RGYA 3SEXA 4P11A 2IA4A 3K1PA 2ONKE 1NV0A 2DQVA 4Z7EA 3UGWA 2X7QA 4PC9A 3GBAA 3RPLB 1A40A 3ILUB 3MUQA 3HHFA 3P7IA 3E3KA 4BDQA 4LATA 2AL4A 3CI8A 1EYKA 2XWOA 5EYFA 3T9XB 4QSDA 3K02A 2V3QA 2DE3A 2QMXA 5AA1A 4U22A 3B50A 1MQHA 2JJKA 2Q88A 1KZ8A 3KBRA 1MH3A 5ICQA 1JNFA 2Z8EA 4GXAA 2Q89A 1MDP1 2QS1A 2V84A 2PCRA 1AMFA 3VDFA 1NFTA 4C0RA 1LAFE 5LTCA 2DVZA 1JETA 2XXKA 3KN8A 4G4PA 3MSTA 3TTNA 4GIZA 1B4HA 5I59A 1MXZA 4GVOA 3U93A 1TFDA 4POXA 4KD5A 3G3FA 4PETA 1Y3PA 1YAEA 2GFEA 3GYYA 3SESA 3G3IA 3I5OA 1AWBA 1II5A 2Z8DA 5TU0A 2RKMA 1IXHA 3OXNA 4YICA 5H8FB 2DYXA 3FJMA 1DSNA 2P1SA 4IO7A 3TCFA 4QSEA 2UYEA 4AS4A 4HW8A 3RUMA 3CFXA 4OETA 1R9QA 4JSDA 1R9LA 3IOWA 4PF8A 4R2FA 4GBVA 2XXYA 1IUDA 4BDRA 5AA2D 4O7IA 5L8DA 4H8IA 1OVTA 1H44A 1OVBA 4IR8A 3UIFA 3IR1A 4MLVA 4LVQA 1CB6A 2RF1A 2QRYA 5AA3A 3O9PA 2I6EA 2R9JA 2GHBA 3G3KA 2M8CA 5AA2A 4HE2A 4N81A 5ET5A 1N76A 3LSXA 1CE2A 3B6WA 4N8GA 2OWZA 3PUWE 3JZJA 3EQ1A 5J1DA 3S9MC 1PBQA 1PB8A 3N5LA 4PAKA 2XHDA 1PEBA 1B7ZA 1FCKA 1NV1A 1FRPA 3IK6B 5I2NB 2Q2AA 2FIXA 3K6UA 4U4XA 2E1SA 1JEUA 2H25A 5DTBA 3C32A 2VD3A 4E0WA 2F3DA 5CBSA 1FPGA 3Q29A 1UIUA 5KCJB 1P99A 2F7AA 5FTIA 3IOTA 3U72A 2HCAA 1MM7A 3CHGA 4YKIA 5F24A 3R7XA 2H5YA 4PGPA 1B40A 3OSRA 4GWXA 4C1TA 3S9LC 2DWJA 1UTBA 2UVIA 4ECFA 5J16A 1O7TA 3T1BA 4Q5TA 3T9UA 3V89B 2I4CA 4OEUA 4YB5A 1BTJA 3FJGA 4O3BA 1FBPA 2V3UA 4F19A 5F1QA 3U8QA 4G61A 2VPOA 4JVCA 1MY3A 1FSAA 3OEMA 3K1NA 3N6UA 1JW5A 3KZGA 1YCJA 2O84X 1A8FA 4FEBA 3C9HA 4RPNA 3QUFA 1URGA 4DE8A 5I57A 5IGAA 5ICTA 3PMXA 4ISUA 3KC1A 3AXFA 4PAIA 5FHNA 2VOZA 3PTYA 2O7UA 2VHAA 1SPIA 1JVYA 2Z23A 2B4LA 1B3LA 1MXVA 1Q35A 2UVGA 2Q8JA 3HPIA 4JVDA 1AL3A 1B3GA 4FATA 1SW4A 2YLNA 3Q27A 1SI1A 2DSFA 3QUJA 1N84A 1NH7A 3C31A 1QW0A 2PT1A 5JK4A 3RN8A 4NTLA 3EF7A 3IAZA 2ANJA 3MC2A 3MQ9A 1GR2A 3ODBA 3TODA 1ZIUA 3PD8A 1DPPA 1US5A 3EN3A 4MMPA 3VE1B 4HXVA 4GRKA 2BJJX 2F8DA 1LCFA 1EYIA 2A5SA 1MRPA 3E79A 2XXWA 1FTMA 2DWIA 5KDTB 5IKBA 4YAHX 2I49A 4FJPA 2P2AA 1ZJLA 1GTKA 2YJPA 1Z7ME 3BFTA 5HBCA 4YMAA 4GD5A 4PBHA 5EHMA 4XFEA 3U65A 4GBWA 3HHGA 3K01A 3MVXA 2WBDA 2RC7A 1VR5A 4FECA 3IOUA 4IY6A 1OQHA 4EDPA 3SEUA 1A8EA 2XWIA 3O66A 1SYHA 1SW5A 2P0SA 2IEEA 4Q8RA 3E9XA 2Q74A 4QHQA 4MHFA 1N3XA 1YPNA 4N6PA 1D9QA 5I56A 4RYAA 3ECRA 2V4CA 2OWSA 3OEKA 1B32A 2HAUA 1DTGA 2OBGA 1B46A 5EQ9A 5IM2A 3PGFA 1MPBA 1VE4A 5ITOA 2REGA 5A5LA 4ELRA 1FTJA 4NF5A 1YZ0A 4JB7A 1H3DA 2ZNUA 4EF1A 3VVFA 5L9SA 5A5XA 1BKAA 1QVSA 3N94A 2D21A 3IX1A 3SEWA 4JBZA 3U94A 1IMFA 4ZE9A 2VGQA 3KFMA 3RT8A 2PT2A 1NNPA 1O64A 2KR0A 3TMGA 1IQ7A 5KZTA 1ZU0A 4JVIA 1B7UA 3EHSA 1FQBA 2F7BA 3PUYE 4G68C 2Y7RA 1FQDA 2F6PA 4ZEKA 2ZYNA 1LSTA 2F36A 2UYFA 2XD3A 1MPDA 1EZPA 3PUZE 5I59B 4KCDA 4Q0CA 3E4RA 4JWXA 2CZKA 3CG3A 4OVPA 3ZS6A 3VVDA 3FBPA 2DE4A 1T0KA 3LSFB 4H45A 4NMYA 1Y20A 3IO4A 1LAXA 3VV5A 4PP0A 4X9TA 4QBAA 1FQCA 4OFOA 4R73A 3MJNA 4L17A 2WYPA 4F18A 4MJOA 2PYYA 1B05A 3FV2A 4IO3A 4EQ7A 3H4ZA 4N17A 1Y9UA 1FJ9A 2PBWA 2NWJA 4ESXA 3UP9A 2AIXA 1SD3A 1NI9A 4NQ8A 3T66A 3A3CA 2XD2A 3H7MA 5IAIA 1MQGA 1ZMGA 2Y7KA 1Y3QA 5AA2B 3VXBA 4QRZA 3O2AA 2I4BA 1FPBA 4X1BA 1NV4A 4OVQA 1B5HA 4H67A 1MQDA 1NUZA 3MZ1A 4OWDA 4NG7A 1LAHE 4PE3A 4HS7A 3QYTA 4BDMA 3HO7A 5DVFA 2ZYKA 1OLAA 1IZ1A 4XIGQ 2G93A 2Q9TA 4F3BA 4GWZA 1MY0A 4R9FA 4GFRA 4ZDMA 1SQYA 3B6QA 5M2VA 2HEUA 1USYH 3FZVA 3RTFB 3ILTB 3S2VA 3OO7A 5JTYA 2DWAA 3LR1A 1FPIA 4MLQA 4QFNA 4MBPA 4O3AA 1NNTA 4R6HA 1LBYA 4N91A 4R9GA 1K9YA 3KBZA 4OERA 1TXFA 4KQPA 5I7IA 1UTBB 2O69A 3D1RA 2Y7WA 1I6BA 3O28A 4PFIA 4H0WA 3FV1A 2H4IA 3TFLA 3V8XB 4XF5A 2PVUA 4OFJA 4NF0A 4F3GA 3KOSA 3RY3A 2NUVA 2R6GE 4R6YA 4H8JA 1R6ZA 1H43A 4PQJA 3SKPA 4JWOA 5EHSA 3BIHA 3W9VA 1POY1 2QS2A 2P3NA 2QVVA 3IB2A 4QXDA 3HSTA 4NWCA 4PFUA 3FUZA 3HV1A 2XA5A 2A5TA 3DP8A 4MNPA 4XKNA 5TP9A 1IMEA 3O6IA 5I57B 1VSOA 2QVRA 4PDHA 4IGRA 2G29A 3PPOA 2FIEA 3PMWA 3SERA 1N3WA 3OD7A 3TAJA 1WDNA 4OMBA 1D9YA 4AS5A 1QKAA 2PMSA 2B65A 3IJXB 5CRYA 4NF4A 3U1OA 1XVYA 3ZKKA 4IB2A 5H8QA 4GWUA 3MP1A 3BIGA 1ELJA 4RNSA 3TTRA 5FBPA 1IEJA 2OWTA 2OK2A 4KYDA 4KI0E 3BBRA 4DDDA 2ZMBA 4MNIA 2DWHA 1LAGE 5DVIA 4XEQA 1GV8A 2QS4A 1MPCA 4N15A 4QFLA 4UA8A 4KYEA 2H99A 1Y1MA 4F3PA 3VVEA 4OESA 1CNQA 3A29A 1A99A 3G3JA 4I3EA 4JXIA 2DE2A 2GQ1A 1LB9A 3SETA 4LONB 3PD9A 4KXPA 5HPQA 1LBCA 1AOVA 3KN7A 2HPGA 4NF8A 3B8BA 5ISUA 3UN6A 4NN3A 2RC9A 4DCYA 4PFBA 1P1UA 2OCUA 1AH5A 4F1VA 1ZBMA 1URSA 3K6VA 5EYGA 5FHMA 4U4SA 4KR5A 3BKIB 4O3CA 4EXKA 4F29A 3TTMA 2RCAA 2RINA 3MPKA 3T9HB 1FPFA 1K9ZA 4MFIA 4YKPA 4PE5B 4OEVA 4PFWA 3JV9A 1ZTYA 4WKMA 1B51A 4OENA 3UA8A 2XXQA 5IZ3A 1JW1A 4OVJA 2Y5KA 4I3YA 2XWKA 4PDDA 1JEVA 4GX3A 1PB9A 4IO4A 2QSXA 4H1XA 3IFAA 4MH5A 2H98A 3KOTA 4U1OA 2F97A 1MQIA 2QFLA 1QGXA 1NNFA 1NUXA 4X04A 3FVOA 2HFBA 5I56B 4R75A 5TPAB 1OMPA 1I69A 3FVKA 1B3HA 1N0TA 2XXRA 4LA9A 4ELPA 1VFEA 3O6HA 1NUYA 3DP4A 2RCBA 1FBDA 4F2QA 2F7CA 4OANA 4NF5B 2OLBA 2XXPA 4G8NA 2R8TA 1B1HA 1MDQA 1B5IA 3H6TA 3TDJA 2Z22A 4GQOA 1PDAA 1S7YA 2D3IA 3UORA 4O94A 2DVCA 4GL0A 1TT1A 5A5XB 1Q9DA 4G2ZA 4XTCQ 3CFLA 3M3LA 4K3FA 1KWHA 2ONSA 1FPEA 5ET6A 3K00A 4P47A 3USDA 1B3FA 1D3KA 4GOTA 5EQ8A 3RQTA 5K2XA 1GVCA 3K4UA 4MF3A 3TCGA 3W15C 3FJ7A 2XXHA 3MZBA 2X7PA 3KSJA 1SVXB 4FORA 1MG1A 5CC2A 1EH3A 2ZZWA 1MY4A 1N7XA 4GWSA 3E13X 1NKXA 1OQGA 2F35A 3QAXA 1AIVA 1NV6A 4P0GA 2DP8A 2WKYA 1LFHA 2CZIA 3SEYA 3MWBA 2AYSA 3GBBA
chains in the Genus database with same CATH topology
3RT6B 4ZZAA 1RKMA 4F22A 4G68A 1R1NA 2OZZA 2NXOA 1A7LA 3IOVA 4YB7A 2DXRA 1LCTA 2O1LA 3GXAA 3PPPA 3H6VA 3D4CA 3U92A 4ELOA 1IIWA 3THIA 4RA1A 4QFPA 1EZOA 1P1NA 4FAJA 2CMOA 4OYVA 5TPAA 4XKQA 4YB6A 3Q25A 1DTZA 4LUBA 3T96B 1B6HA 3ONMA 4QF9A 3H06B 3WAEA 4ESWA 1MXWA 4I9DA 3T22A 4GF8A 4NWDA 2I3WA 3G7WA 4EUOA 3O29A 3CVGA 1FW0A 2GHAA 5DEXA 4BDLA 3TZAA 2PX1A 1YTVA 3A09A 1Y3NA 3F11A 3LUYA 1S9TA 2THIA 1P1OA 5H8SA 5JTYB 1XC1A 4HCYA 2UVJA 5DT6A 1JVXA 1RYXA 4AB5A 4X48A 4BLAA 3Q28A 3TPAA 2NOOA 3H6WA 1M5EA 2XXUA 2B3BA 5DYHA 3MW0A 3CIJA 2HXWA 1FQAA 2I48A 1B2HA 3VXCA 4RJZA 4F1YA 1HSJA 4TQUQ 1SW1A 3HN0A 4ONYA 4ZZEA 1UTHA 1LFIA 1LB8A 4JDFA 4NF6A 4C1UA 4EQ9A 4OHNA 5BWJA 1Y1ZA 2CZLA 5FHOA 3FASA 4LQ5A 3H3GA 2YPNA 5LOMA 2Z8FA 4HCWA 5H8NA 2OJTA 2RC8A 2O7IA 1LGBC 5ITPA 3FVNA 2A5TB 1NMUA 5TP9B 5F7VA 4I62A 4ZE8A 4LZ7A 4I1DA 4M4GA 5L9MA 3MAMA 1ZLQA 4GL8A 4R74A 3RTWB 5I58B 4H5GA 3LC8A 4ZEFA 4M1VA 4ZECA 4RK2A 4WEDA 4XKPA 2QPQA 2XXVA 3OENA 3FATA 1MXXA 3K2DA 3PMVA 1POTA 1HSLA 3QK6A 4NF4B 1QJMA 3Q26A 4ND9A 4BDOA 1PB7A 5H8QB 2FA7A 2W7YA 3KSXA 3H6UA 1LBBA 1NH8A 4F2OA 3TTLA 2H9BA 2O6AA 4N07A 1QUKA 5CI5A 3PV0E 3C33A 3MP8A 3O97A 2QJEA 1I6QA 1FTLA 4I8CA 3RPWA 3FD3A 2HAVA 3W9WA 4N13A 1DOTA 2ZNSA 4NF8B 3FXRA 4DIGA 5ELVA 1N7WA 3B6TA 3EPEA 4F31B 3UK4A 4JSOA 3L6GA 4R6KA 1TFAA 3FXQA 4RY1A 3TEPA 1UIVA 1IXIA 4YMBA 2VD2A 5CMKA 4YZZA 2HZLA 4XXUA 2VP1A 3R26A 4U23A 3OO6A 4LQ2A 3TQLA 1SDXA 3PU5A 1P1QA 4H6DA 1SW2A 1XOCA 5I2KB 4YKKA 3M3KA 4PFTA 1XT8A 4GXSB 3LSLA 5AA4A 1XVXA 1B58A 4F39A 3VFJA 3GLBA 3TYHA 5I58A 4DLDA 4X1DA 3DLNA 1NNKA 3IL1B 2LAOA 4H5FA 4U1ZA 2DS9A 3BFUA 1B0HA 1MM6A 4TLMB 2GH9A 3EHUA 3M8UA 3DM0A 1S50A 5B7DA 3VLVA 3TUSA 4G8HA 1MXUA 2O1MA 4BDNA 1LLSA 2UXAA 4R72A 2Y7PA 1FQFA 5H8HA 1MS7A 4ZEBA 2HZKA 4YU0A 1SI0A 3D4GA 1URDA 2XX7A 4U21A 1VFDA 1D4NA 3QIMA 1MXYA 4DXBA 3V83A 3QXMA 2QMWA 5CMCA 2AL5A 3FGSA 4XKRA 4KCCA 1M5CA 4ZS9A 4KYSA 3N6TA 1XS5A 2I3VA 1ATGA 3MZ9A 5CM6A 1EU8A 3CFZA 2NVUB 1M5DA 4LZ8A 3DELB 2XXXA 1DPEA 4ZEIA 3MVYA 2Q2CA 1A55A 3M3FA 1B1XA 3C4MA 1IXCA 3MVZA 1M5FA 1JQFA 2I58A 3OSQA 4G68B 3DP6A 4Q30B 3FIRA 5I2KA 3KN3A 3PPQA 3HCQA 4FEDA 5H8FA 2ZNTA 4DXUA 2HQ0A 1QULA 3IJOB 1PC3A 2QL3A 3CR9A 4WEPA 1J1NA 3PPNA 3OO8A 4TOZA 2DXYA 4PFYA 3KG2A 1ANFA 3GZGA 3S9NC 3OOAA 3N26A 4G8MA 1Y4TA 4NE4A 4NEDA 2O68A 1H45A 4TLLB 3OELA 4IO2A 3RNNA 4EQBA 4UACA 3ZKLA 4AB6A 1MY2A 1M5BA 2X26A 3CRBA 1ZKBA 5DVJA 5CMBA 3I6VA 1BLFA 4U2RA 3TCHA 1TWYA 5DEXB 4OTEA 4IO6A 3TQWA 2V3TA 1WODA 2B3FA 5I2NA 4FIMA 5L9OA 2D5WA 3K6WA 3K6XA 4AQ4A 3MP6A 1N04A 3R6UA 4RXLA 5BUUA 1XHYA 4Z0IA 3TELA 1P1WA 2F78A 4KHZE 4F3SA 1SYIA 2XXIA 3OO9A 5HM4B 1EZ9A 5KCJA 3OMBA 3H03A 1F9BA 2KLFA 2XXTA 4GWOA 4FE8A 3KGCA 3K0VA 1OIBA 2FNCA 1UTHB 1B4ZA 4ELQA 3PPRA 1US4A 4NF6B 1QUJA 1I6AA 1BIYA 4GLIA 3G3GA 3IORA 4THIA 4QFKA 3QSLA 4IY5A 4IO5A 4DXCA 3LBSA 3L6HA 5H8NB 1MY1A 2E0SA 2ZYOA 4EF2A 1USYE 4EXLA 2XX8A 1FQEA 1WVJA 3B7DA 3TKDA 4OXVA 1Q1KA 4QSCA 2I0CA 4ZEDA 4OQOA 3PUXE 2DOJA 2ZXTA 1L5TA 3S4UA 3MBPA 4YKJA 1O63A 4DZ1A 1B3EA 1A54A 3SDFA 1UQWA 3ZSFA 1Y4CA 2F5XA 2ABHA 2I0BA 3FVGA 1IXGA 4G77A 5CMMA 2UVHA 2ESNA 1RYOA 3K1MA 3V5AA 1B7HA 3C34A 1LFGA 3SEVA 2V93A 4OZ9A 3LSWA 1D9VA 1Z7NE 4IGTA 1B9JA 4KFQA 4QFOA 3S9EA 2F34A 4KPTA 3IO6A 2O51A 3T9VA 4F1UA 1OLCA 1QKBA 4R2BA 1FTKA 1JW4A 4WXJA 5KDTA 1B52A 1MQJA 4DCXA 3EHTA 4H65A 3VLWA 5I84A 1B0LA 1IITA 5JEIA 2Y84A 3IB1A 3O6GA 1QUIA 3MVWA 1FTOA 5B70A 2FYIA 3TTKA 2REJA 5AE4A 3CSGA 4POWA 4LP2B 1NL5A 1B5JA 3WAFA 2R71A 4P0IA 3G3HA 3T93B 1SBPA 3C35A 4RK9A 2QS3A 5FTHA 3KEIA 1GGGA 5AA4B 3CG1A 1BP5A 3I3VA 3KJTA 1MH4A 4RPOA 3VLUA 4JWYA 1HSEA 3RLFE 4LZ5A 2V25A 3FXUA 3PUVE 4OFLA 2F6GA 2ALUA 3A3UA 3MPLA 3CSBA 3C36A 5K2YA 3JYRA 2Y7IA 4E0XA 2ZYMA 2GRVA 3KJ7A 1DMBA 4HTGA 2XX9A 5H8HB 2ONRA 3IB0A 1H76A 1PBPA 5CBRA 3RGYA 3SEXA 4P11A 2IA4A 3K1PA 2ONKE 2DQVA 4Z7EA 3UGWA 2X7QA 3GBAA 1A40A 3ILUB 3MUQA 3HHFA 3P7IA 3E3KA 4BDQA 4LATA 2AL4A 3CI8A 5EYFA 3T9XB 4QSDA 3K02A 2V3QA 2DE3A 2QMXA 5AA1A 4U22A 1MQHA 2Q88A 3KBRA 1MH3A 5ICQA 1JNFA 2Z8EA 4GXAA 2Q89A 1MDP1 2QS1A 2V84A 3VDFA 1AMFA 1NFTA 4C0RA 1LAFE 2DVZA 1JETA 3KN8A 4G4PA 3TTNA 4GIZA 1B4HA 5I59A 1MXZA 4GVOA 3U93A 1TFDA 4POXA 4KD5A 3G3FA 4PETA 1Y3PA 1YAEA 2GFEA 3SESA 3G3IA 3I5OA 1II5A 2Z8DA 5TU0A 2RKMA 1IXHA 3OXNA 4YICA 5H8FB 2DYXA 3FJMA 1DSNA 2P1SA 4IO7A 3TCFA 4QSEA 2UYEA 4HW8A 3RUMA 3CFXA 4OETA 1R9QA 4JSDA 1R9LA 3IOWA 4R2FA 2XXYA 1IUDA 4BDRA 5AA2D 5L8DA 4H8IA 1OVTA 1H44A 1OVBA 3UIFA 3IR1A 4MLVA 4LVQA 1CB6A 2RF1A 2QRYA 5AA3A 3O9PA 2I6EA 2R9JA 2GHBA 3G3KA 2M8CA 5AA2A 1N76A 3LSXA 1CE2A 3B6WA 3PUWE 3JZJA 3EQ1A 5J1DA 3S9MC 1PBQA 1PB8A 3N5LA 2XHDA 1PEBA 1B7ZA 1FCKA 3IK6B 5I2NB 2Q2AA 3K6UA 4U4XA 2E1SA 1JEUA 2H25A 5DTBA 3C32A 2VD3A 4E0WA 5CBSA 3Q29A 1UIUA 5KCJB 1P99A 2F7AA 5FTIA 3IOTA 3U72A 2HCAA 1MM7A 4YKIA 3R7XA 2H5YA 1B40A 3OSRA 4C1TA 3S9LC 2DWJA 1UTBA 2UVIA 4ECFA 1O7TA 4Q5TA 3T9UA 3V89B 2I4CA 4OEUA 4YB5A 1BTJA 3FJGA 4O3BA 2V3UA 4F19A 5F1QA 3U8QA 1MY3A 3OEMA 3K1NA 3N6UA 1JW5A 3KZGA 1YCJA 2O84X 1A8FA 4FEBA 3C9HA 4RPNA 3QUFA 1URGA 4DE8A 5I57A 5ICTA 3PMXA 4ISUA 3AXFA 5FHNA 2VOZA 2O7UA 2VHAA 1JVYA 2Z23A 1B3LA 1MXVA 1Q35A 2UVGA 2Q8JA 3HPIA 1AL3A 1B3GA 4FATA 1SW4A 2YLNA 3Q27A 1SI1A 2DSFA 3QUJA 1N84A 1NH7A 3C31A 1QW0A 2PT1A 5JK4A 3RN8A 4NTLA 3EF7A 3IAZA 2ANJA 3MC2A 3MQ9A 1GR2A 3ODBA 3TODA 1ZIUA 3PD8A 1DPPA 1US5A 3EN3A 3VE1B 4GRKA 2BJJX 2F8DA 1LCFA 2A5SA 1MRPA 2XXWA 1FTMA 2DWIA 5KDTB 5IKBA 4YAHX 2I49A 4FJPA 2P2AA 1ZJLA 1GTKA 2YJPA 1Z7ME 3BFTA 5HBCA 4YMAA 4GD5A 5EHMA 3HHGA 3K01A 3MVXA 2RC7A 1VR5A 4FECA 3IOUA 4IY6A 1OQHA 4EDPA 3SEUA 1A8EA 3O66A 1SYHA 1SW5A 2P0SA 2IEEA 4Q8RA 3E9XA 4QHQA 1N3XA 1YPNA 4N6PA 5I56A 4RYAA 3ECRA 2OWSA 3OEKA 1B32A 2HAUA 1DTGA 2OBGA 1B46A 3PGFA 1MPBA 1VE4A 5ITOA 2REGA 4ELRA 1FTJA 4NF5A 4JB7A 1H3DA 2ZNUA 4EF1A 3VVFA 5L9SA 5A5XA 1BKAA 1QVSA 3N94A 2D21A 3IX1A 3SEWA 4JBZA 3U94A 4ZE9A 2VGQA 3KFMA 3RT8A 2PT2A 1NNPA 1O64A 3TMGA 1IQ7A 5KZTA 1ZU0A 1B7UA 3EHSA 1FQBA 2F7BA 3PUYE 4G68C 2Y7RA 1FQDA 2F6PA 4ZEKA 2ZYNA 1LSTA 2F36A 2UYFA 2XD3A 1MPDA 1EZPA 3PUZE 5I59B 4KCDA 4Q0CA 3E4RA 4JWXA 3CG3A 3ZS6A 3VVDA 2DE4A 1T0KA 3LSFB 4NMYA 1Y20A 3IO4A 1LAXA 3VV5A 4PP0A 4X9TA 1FQCA 4OFOA 4R73A 3MJNA 4L17A 4F18A 2PYYA 1B05A 3FV2A 4IO3A 4EQ7A 3H4ZA 1Y9UA 2PBWA 2NWJA 4ESXA 3UP9A 2AIXA 1SD3A 3T66A 3A3CA 2XD2A 3H7MA 5IAIA 1MQGA 1ZMGA 2Y7KA 1Y3QA 5AA2B 3VXBA 4QRZA 3O2AA 2I4BA 4X1BA 1B5HA 4H67A 1MQDA 3MZ1A 4OWDA 1LAHE 4HS7A 3QYTA 4BDMA 3HO7A 5DVFA 2ZYKA 1OLAA 1IZ1A 4XIGQ 2G93A 2Q9TA 4F3BA 1MY0A 4R9FA 4GFRA 4ZDMA 1SQYA 3B6QA 5M2VA 2HEUA 1USYH 3FZVA 3RTFB 3ILTB 3S2VA 3OO7A 5JTYA 2DWAA 3LR1A 4MLQA 4QFNA 4MBPA 4O3AA 1NNTA 4R6HA 4R9GA 4OERA 1TXFA 4KQPA 1UTBB 2O69A 2Y7WA 1I6BA 3O28A 4H0WA 3FV1A 2H4IA 3TFLA 3V8XB 2PVUA 4OFJA 4F3GA 3KOSA 3RY3A 2NUVA 2R6GE 4R6YA 4H8JA 1R6ZA 1H43A 4PQJA 3SKPA 4JWOA 5EHSA 3W9VA 1POY1 2QS2A 3IB2A 3HSTA 4NWCA 4PFUA 3FUZA 3HV1A 2A5TA 3DP8A 4XKNA 5TP9A 3O6IA 5I57B 1VSOA 4IGRA 2G29A 3PPOA 3PMWA 3SERA 1N3WA 3OD7A 3TAJA 1WDNA 4OMBA 1D9YA 1QKAA 2PMSA 2B65A 3IJXB 5CRYA 4NF4A 3U1OA 1XVYA 3ZKKA 4IB2A 5H8QA 3MP1A 1ELJA 4RNSA 3TTRA 1IEJA 2OWTA 2OK2A 4KYDA 4KI0E 3BBRA 4DDDA 2ZMBA 2DWHA 1LAGE 5DVIA 1GV8A 2QS4A 1MPCA 4QFLA 4UA8A 4KYEA 2H99A 1Y1MA 4F3PA 3VVEA 4OESA 1A99A 3G3JA 4JXIA 2DE2A 1LB9A 3SETA 4LONB 3PD9A 5HPQA 1LBCA 1AOVA 3KN7A 4NF8A 5ISUA 3UN6A 2RC9A 4DCYA 1P1UA 2OCUA 1AH5A 4F1VA 1ZBMA 1URSA 3K6VA 5FHMA 4U4SA 4KR5A 3BKIB 4O3CA 4EXKA 4F29A 3TTMA 2RCAA 2RINA 3MPKA 3T9HB 4MFIA 4YKPA 4PE5B 4OEVA 4PFWA 3JV9A 1ZTYA 4WKMA 1B51A 4OENA 3UA8A 2XXQA 1JW1A 4OVJA 1JEVA 1PB9A 4IO4A 2QSXA 4H1XA 4MH5A 2H98A 3KOTA 4U1OA 2F97A 1MQIA 1NNFA 3FVOA 2HFBA 5I56B 4R75A 5TPAB 1OMPA 1I69A 3FVKA 1B3HA 1N0TA 2XXRA 4LA9A 4ELPA 1VFEA 3O6HA 3DP4A 2RCBA 4F2QA 2F7CA 4NF5B 2OLBA 2XXPA 4G8NA 1B1HA 1MDQA 1B5IA 3H6TA 3TDJA 2Z22A 4GQOA 1PDAA 1S7YA 2D3IA 3UORA 2DVCA 4GL0A 1TT1A 5A5XB 4G2ZA 4XTCQ 3CFLA 3M3LA 4K3FA 1KWHA 2ONSA 3K00A 3USDA 1B3FA 1D3KA 4GOTA 3RQTA 5K2XA 1GVCA 3K4UA 4MF3A 3TCGA 3W15C 3FJ7A 2XXHA 3MZBA 2X7PA 3KSJA 1SVXB 4FORA 1MG1A 5CC2A 1EH3A 1MY4A 1N7XA 3E13X 1NKXA 1OQGA 2F35A 3QAXA 1AIVA 4P0GA 2DP8A 2WKYA 1LFHA 3SEYA 3MWBA 2AYSA 3GBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT6 B;  4ZZA A;  1RKM A;  4F22 A;  4G68 A;  1R1N A;  2OZZ A;  2NXO A;  1A7L A;  3IOV A;  4YB7 A;  2DXR A;  1LCT A;  2O1L A;  3GXA A;  3PPP A;  3H6V A;  3D4C A;  3U92 A;  4ELO A;  1IIW A;  3THI A;  4RA1 A;  4QFP A;  1EZO A;  1P1N A;  4FAJ A;  2CMO A;  4OYV A;  5TPA A;  4XKQ A;  4YB6 A;  3Q25 A;  1DTZ A;  4LUB A;  3T96 B;  1B6H A;  3ONM A;  4QF9 A;  3H06 B;  3WAE A;  4ESW A;  1MXW A;  4I9D A;  3T22 A;  4GF8 A;  4NWD A;  2I3W A;  3G7W A;  4EUO A;  3O29 A;  3CVG A;  1FW0 A;  2GHA A;  5DEX A;  4BDL A;  3TZA A;  2PX1 A;  1YTV A;  3A09 A;  1Y3N A;  3F11 A;  3LUY A;  1S9T A;  2THI A;  1P1O A;  5H8S A;  5JTY B;  1XC1 A;  4HCY A;  2UVJ A;  5DT6 A;  1JVX A;  1RYX A;  4AB5 A;  4X48 A;  4BLA A;  3Q28 A;  3TPA A;  2NOO A;  3H6W A;  1M5E A;  2XXU A;  2B3B A;  5DYH A;  3MW0 A;  3CIJ A;  2HXW A;  1FQA A;  2I48 A;  1B2H A;  3VXC A;  4RJZ A;  4F1Y A;  1HSJ A;  4TQU Q;  1SW1 A;  3HN0 A;  4ONY A;  4ZZE A;  1UTH A;  1LFI A;  1LB8 A;  4JDF A;  4NF6 A;  4C1U A;  4EQ9 A;  4OHN A;  5BWJ A;  1Y1Z A;  2CZL A;  5FHO A;  3FAS A;  4LQ5 A;  3H3G A;  2YPN A;  5LOM A;  2Z8F A;  4HCW A;  5H8N A;  2OJT A;  2RC8 A;  2O7I A;  1LGB C;  5ITP A;  3FVN A;  2A5T B;  1NMU A;  5TP9 B;  5F7V A;  4I62 A;  4ZE8 A;  4LZ7 A;  4I1D A;  4M4G A;  5L9M A;  3MAM A;  1ZLQ A;  4GL8 A;  4R74 A;  3RTW B;  5I58 B;  4H5G A;  3LC8 A;  4ZEF A;  4M1V A;  4ZEC A;  4RK2 A;  4WED A;  4XKP A;  2QPQ A;  2XXV A;  3OEN A;  3FAT A;  1MXX A;  3K2D A;  3PMV A;  1POT A;  1HSL A;  3QK6 A;  4NF4 B;  1QJM A;  3Q26 A;  4ND9 A;  4BDO A;  1PB7 A;  5H8Q B;  2FA7 A;  2W7Y A;  3KSX A;  3H6U A;  1LBB A;  1NH8 A;  4F2O A;  3TTL A;  2H9B A;  2O6A A;  4N07 A;  1QUK A;  5CI5 A;  3PV0 E;  3C33 A;  3MP8 A;  3O97 A;  2QJE A;  1I6Q A;  1FTL A;  4I8C A;  3RPW A;  3FD3 A;  2HAV A;  3W9W A;  4N13 A;  1DOT A;  2ZNS A;  4NF8 B;  3FXR A;  4DIG A;  5ELV A;  1N7W A;  3B6T A;  3EPE A;  4F31 B;  3UK4 A;  4JSO A;  3L6G A;  4R6K A;  1TFA A;  3FXQ A;  4RY1 A;  3TEP A;  1UIV A;  1IXI A;  4YMB A;  2VD2 A;  5CMK A;  4YZZ A;  2HZL A;  4XXU A;  2VP1 A;  3R26 A;  4U23 A;  3OO6 A;  4LQ2 A;  3TQL A;  1SDX A;  3PU5 A;  1P1Q A;  4H6D A;  1SW2 A;  1XOC A;  5I2K B;  4YKK A;  3M3K A;  4PFT A;  1XT8 A;  4GXS B;  3LSL A;  5AA4 A;  1XVX A;  1B58 A;  4F39 A;  3VFJ A;  3GLB A;  3TYH A;  5I58 A;  4DLD A;  4X1D A;  3DLN A;  1NNK A;  3IL1 B;  2LAO A;  4H5F A;  4U1Z A;  2DS9 A;  3BFU A;  1B0H A;  1MM6 A;  4TLM B;  2GH9 A;  3EHU A;  3M8U A;  3DM0 A;  1S50 A;  5B7D A;  3VLV A;  3TUS A;  4G8H A;  1MXU A;  2O1M A;  4BDN A;  1LLS A;  2UXA A;  4R72 A;  2Y7P A;  1FQF A;  5H8H A;  1MS7 A;  4ZEB A;  2HZK A;  4YU0 A;  1SI0 A;  3D4G A;  1URD A;  2XX7 A;  4U21 A;  1VFD A;  1D4N A;  3QIM A;  1MXY A;  4DXB A;  3V83 A;  3QXM A;  2QMW A;  5CMC A;  2AL5 A;  3FGS A;  4XKR A;  4KCC A;  1M5C A;  4ZS9 A;  4KYS A;  3N6T A;  1XS5 A;  2I3V A;  1ATG A;  3MZ9 A;  5CM6 A;  1EU8 A;  3CFZ A;  2NVU B;  1M5D A;  4LZ8 A;  3DEL B;  2XXX A;  1DPE A;  4ZEI A;  3MVY A;  2Q2C A;  1A55 A;  3M3F A;  1B1X A;  3C4M A;  1IXC A;  3MVZ A;  1M5F A;  1JQF A;  2I58 A;  3OSQ A;  4G68 B;  3DP6 A;  4Q30 B;  3FIR A;  5I2K A;  3KN3 A;  3PPQ A;  3HCQ A;  4FED A;  5H8F A;  2ZNT A;  4DXU A;  2HQ0 A;  1QUL A;  3IJO B;  1PC3 A;  2QL3 A;  3CR9 A;  4WEP A;  1J1N A;  3PPN A;  3OO8 A;  4TOZ A;  2DXY A;  4PFY A;  3KG2 A;  1ANF A;  3GZG A;  3S9N C;  3OOA A;  3N26 A;  4G8M A;  1Y4T A;  4NE4 A;  4NED A;  2O68 A;  1H45 A;  4TLL B;  3OEL A;  4IO2 A;  3RNN A;  4EQB A;  4UAC A;  3ZKL A;  4AB6 A;  1MY2 A;  1M5B A;  2X26 A;  3CRB A;  1ZKB A;  5DVJ A;  5CMB A;  3I6V A;  1BLF A;  4U2R A;  3TCH A;  1TWY A;  5DEX B;  4OTE A;  4IO6 A;  3TQW A;  2V3T A;  1WOD A;  2B3F A;  5I2N A;  4FIM A;  5L9O A;  2D5W A;  3K6W A;  3K6X A;  4AQ4 A;  3MP6 A;  1N04 A;  3R6U A;  4RXL A;  5BUU A;  1XHY A;  4Z0I A;  3TEL A;  1P1W A;  2F78 A;  4KHZ E;  4F3S A;  1SYI A;  2XXI A;  3OO9 A;  5HM4 B;  1EZ9 A;  5KCJ A;  3OMB A;  3H03 A;  1F9B A;  2KLF A;  2XXT A;  4GWO A;  4FE8 A;  3KGC A;  3K0V A;  1OIB A;  2FNC A;  1UTH B;  1B4Z A;  4ELQ A;  3PPR A;  1US4 A;  4NF6 B;  1QUJ A;  1I6A A;  1BIY A;  4GLI A;  3G3G A;  3IOR A;  4THI A;  4QFK A;  3QSL A;  4IY5 A;  4IO5 A;  4DXC A;  3LBS A;  3L6H A;  5H8N B;  1MY1 A;  2E0S A;  2ZYO A;  4EF2 A;  1USY E;  4EXL A;  2XX8 A;  1FQE A;  1WVJ A;  3B7D A;  3TKD A;  4OXV A;  1Q1K A;  4QSC A;  2I0C A;  4ZED A;  4OQO A;  3PUX E;  2DOJ A;  2ZXT A;  1L5T A;  3S4U A;  3MBP A;  4YKJ A;  1O63 A;  4DZ1 A;  1B3E A;  1A54 A;  3SDF A;  1UQW A;  3ZSF A;  1Y4C A;  2F5X A;  2ABH A;  2I0B A;  3FVG A;  1IXG A;  4G77 A;  5CMM A;  2UVH A;  2ESN A;  1RYO A;  3K1M A;  3V5A A;  1B7H A;  3C34 A;  1LFG A;  3SEV A;  2V93 A;  4OZ9 A;  3LSW A;  1D9V A;  1Z7N E;  4IGT A;  1B9J A;  4KFQ A;  4QFO A;  3S9E A;  2F34 A;  4KPT A;  3IO6 A;  2O51 A;  3T9V A;  4F1U A;  1OLC A;  1QKB A;  4R2B A;  1FTK A;  1JW4 A;  4WXJ A;  5KDT A;  1B52 A;  1MQJ A;  4DCX A;  3EHT A;  4H65 A;  3VLW A;  5I84 A;  1B0L A;  1IIT A;  5JEI A;  2Y84 A;  3IB1 A;  3O6G A;  1QUI A;  3MVW A;  1FTO A;  5B70 A;  2FYI A;  3TTK A;  2REJ A;  5AE4 A;  3CSG A;  4POW A;  4LP2 B;  1NL5 A;  1B5J A;  3WAF A;  2R71 A;  4P0I A;  3G3H A;  3T93 B;  1SBP A;  3C35 A;  4RK9 A;  2QS3 A;  5FTH A;  3KEI A;  1GGG A;  5AA4 B;  3CG1 A;  1BP5 A;  3I3V A;  3KJT A;  1MH4 A;  4RPO A;  3VLU A;  4JWY A;  1HSE A;  3RLF E;  4LZ5 A;  2V25 A;  3FXU A;  3PUV E;  4OFL A;  2F6G A;  2ALU A;  3A3U A;  3MPL A;  3CSB A;  3C36 A;  5K2Y A;  3JYR A;  2Y7I A;  4E0X A;  2ZYM A;  2GRV A;  3KJ7 A;  1DMB A;  4HTG A;  2XX9 A;  5H8H B;  2ONR A;  3IB0 A;  1H76 A;  1PBP A;  5CBR A;  3RGY A;  3SEX A;  4P11 A;  2IA4 A;  3K1P A;  2ONK E;  2DQV A;  4Z7E A;  3UGW A;  2X7Q A;  3GBA A;  1A40 A;  3ILU B;  3MUQ A;  3HHF A;  3P7I A;  3E3K A;  4BDQ A;  4LAT A;  2AL4 A;  3CI8 A;  5EYF A;  3T9X B;  4QSD A;  3K02 A;  2V3Q A;  2DE3 A;  2QMX A;  5AA1 A;  4U22 A;  1MQH A;  2Q88 A;  3KBR A;  1MH3 A;  5ICQ A;  1JNF A;  2Z8E A;  4GXA A;  2Q89 A;  1MDP 1;  2QS1 A;  2V84 A;  3VDF A;  1AMF A;  1NFT A;  4C0R A;  1LAF E;  2DVZ A;  1JET A;  3KN8 A;  4G4P A;  3TTN A;  4GIZ A;  1B4H A;  5I59 A;  1MXZ A;  4GVO A;  3U93 A;  1TFD A;  4POX A;  4KD5 A;  3G3F A;  4PET A;  1Y3P A;  1YAE A;  2GFE A;  3SES A;  3G3I A;  3I5O A;  1II5 A;  2Z8D A;  5TU0 A;  2RKM A;  1IXH A;  3OXN A;  4YIC A;  5H8F B;  2DYX A;  3FJM A;  1DSN A;  2P1S A;  4IO7 A;  3TCF A;  4QSE A;  2UYE A;  4HW8 A;  3RUM A;  3CFX A;  4OET A;  1R9Q A;  4JSD A;  1R9L A;  3IOW A;  4R2F A;  2XXY A;  1IUD A;  4BDR A;  5AA2 D;  5L8D A;  4H8I A;  1OVT A;  1H44 A;  1OVB A;  3UIF A;  3IR1 A;  4MLV A;  4LVQ A;  1CB6 A;  2RF1 A;  2QRY A;  5AA3 A;  3O9P A;  2I6E A;  2R9J A;  2GHB A;  3G3K A;  2M8C A;  5AA2 A;  1N76 A;  3LSX A;  1CE2 A;  3B6W A;  3PUW E;  3JZJ A;  3EQ1 A;  5J1D A;  3S9M C;  1PBQ A;  1PB8 A;  3N5L A;  2XHD A;  1PEB A;  1B7Z A;  1FCK A;  3IK6 B;  5I2N B;  2Q2A A;  3K6U A;  4U4X A;  2E1S A;  1JEU A;  2H25 A;  5DTB A;  3C32 A;  2VD3 A;  4E0W A;  5CBS A;  3Q29 A;  1UIU A;  5KCJ B;  1P99 A;  2F7A A;  5FTI A;  3IOT A;  3U72 A;  2HCA A;  1MM7 A;  4YKI A;  3R7X A;  2H5Y A;  1B40 A;  3OSR A;  4C1T A;  3S9L C;  2DWJ A;  1UTB A;  2UVI A;  4ECF A;  1O7T A;  4Q5T A;  3T9U A;  3V89 B;  2I4C A;  4OEU A;  4YB5 A;  1BTJ A;  3FJG A;  4O3B A;  2V3U A;  4F19 A;  5F1Q A;  3U8Q A;  1MY3 A;  3OEM A;  3K1N A;  3N6U A;  1JW5 A;  3KZG A;  1YCJ A;  2O84 X;  1A8F A;  4FEB A;  3C9H A;  4RPN A;  3QUF A;  1URG A;  4DE8 A;  5I57 A;  5ICT A;  3PMX A;  4ISU A;  3AXF A;  5FHN A;  2VOZ A;  2O7U A;  2VHA A;  1JVY A;  2Z23 A;  1B3L A;  1MXV A;  1Q35 A;  2UVG A;  2Q8J A;  3HPI A;  1AL3 A;  1B3G A;  4FAT A;  1SW4 A;  2YLN A;  3Q27 A;  1SI1 A;  2DSF A;  3QUJ A;  1N84 A;  1NH7 A;  3C31 A;  1QW0 A;  2PT1 A;  5JK4 A;  3RN8 A;  4NTL A;  3EF7 A;  3IAZ A;  2ANJ A;  3MC2 A;  3MQ9 A;  1GR2 A;  3ODB A;  3TOD A;  1ZIU A;  3PD8 A;  1DPP A;  1US5 A;  3EN3 A;  3VE1 B;  4GRK A;  2BJJ X;  2F8D A;  1LCF A;  2A5S A;  1MRP A;  2XXW A;  1FTM A;  2DWI A;  5KDT B;  5IKB A;  4YAH X;  2I49 A;  4FJP A;  2P2A A;  1ZJL A;  1GTK A;  2YJP A;  1Z7M E;  3BFT A;  5HBC A;  4YMA A;  4GD5 A;  5EHM A;  3HHG A;  3K01 A;  3MVX A;  2RC7 A;  1VR5 A;  4FEC A;  3IOU A;  4IY6 A;  1OQH A;  4EDP A;  3SEU A;  1A8E A;  3O66 A;  1SYH A;  1SW5 A;  2P0S A;  2IEE A;  4Q8R A;  3E9X A;  4QHQ A;  1N3X A;  1YPN A;  4N6P A;  5I56 A;  4RYA A;  3ECR A;  2OWS A;  3OEK A;  1B32 A;  2HAU A;  1DTG A;  2OBG A;  1B46 A;  3PGF A;  1MPB A;  1VE4 A;  5ITO A;  2REG A;  4ELR A;  1FTJ A;  4NF5 A;  4JB7 A;  1H3D A;  2ZNU A;  4EF1 A;  3VVF A;  5L9S A;  5A5X A;  1BKA A;  1QVS A;  3N94 A;  2D21 A;  3IX1 A;  3SEW A;  4JBZ A;  3U94 A;  4ZE9 A;  2VGQ A;  3KFM A;  3RT8 A;  2PT2 A;  1NNP A;  1O64 A;  3TMG A;  1IQ7 A;  5KZT A;  1ZU0 A;  1B7U A;  3EHS A;  1FQB A;  2F7B A;  3PUY E;  4G68 C;  2Y7R A;  1FQD A;  2F6P A;  4ZEK A;  2ZYN A;  1LST A;  2F36 A;  2UYF A;  2XD3 A;  1MPD A;  1EZP A;  3PUZ E;  5I59 B;  4KCD A;  4Q0C A;  3E4R A;  4JWX A;  3CG3 A;  3ZS6 A;  3VVD A;  2DE4 A;  1T0K A;  3LSF B;  4NMY A;  1Y20 A;  3IO4 A;  1LAX A;  3VV5 A;  4PP0 A;  4X9T A;  1FQC A;  4OFO A;  4R73 A;  3MJN A;  4L17 A;  4F18 A;  2PYY A;  1B05 A;  3FV2 A;  4IO3 A;  4EQ7 A;  3H4Z A;  1Y9U A;  2PBW A;  2NWJ A;  4ESX A;  3UP9 A;  2AIX A;  1SD3 A;  3T66 A;  3A3C A;  2XD2 A;  3H7M A;  5IAI A;  1MQG A;  1ZMG A;  2Y7K A;  1Y3Q A;  5AA2 B;  3VXB A;  4QRZ A;  3O2A A;  2I4B A;  4X1B A;  1B5H A;  4H67 A;  1MQD A;  3MZ1 A;  4OWD A;  1LAH E;  4HS7 A;  3QYT A;  4BDM A;  3HO7 A;  5DVF A;  2ZYK A;  1OLA A;  1IZ1 A;  4XIG Q;  2G93 A;  2Q9T A;  4F3B A;  1MY0 A;  4R9F A;  4GFR A;  4ZDM A;  1SQY A;  3B6Q A;  5M2V A;  2HEU A;  1USY H;  3FZV A;  3RTF B;  3ILT B;  3S2V A;  3OO7 A;  5JTY A;  2DWA A;  3LR1 A;  4MLQ A;  4QFN A;  4MBP A;  4O3A A;  1NNT A;  4R6H A;  4R9G A;  4OER A;  1TXF A;  4KQP A;  1UTB B;  2O69 A;  2Y7W A;  1I6B A;  3O28 A;  4H0W A;  3FV1 A;  2H4I A;  3TFL A;  3V8X B;  2PVU A;  4OFJ A;  4F3G A;  3KOS A;  3RY3 A;  2NUV A;  2R6G E;  4R6Y A;  4H8J A;  1R6Z A;  1H43 A;  4PQJ A;  3SKP A;  4JWO A;  5EHS A;  3W9V A;  1POY 1;  2QS2 A;  3IB2 A;  3HST A;  4NWC A;  4PFU A;  3FUZ A;  3HV1 A;  2A5T A;  3DP8 A;  4XKN A;  5TP9 A;  3O6I A;  5I57 B;  1VSO A;  4IGR A;  2G29 A;  3PPO A;  3PMW A;  3SER A;  1N3W A;  3OD7 A;  3TAJ A;  1WDN A;  4OMB A;  1D9Y A;  1QKA A;  2PMS A;  2B65 A;  3IJX B;  5CRY A;  4NF4 A;  3U1O A;  1XVY A;  3ZKK A;  4IB2 A;  5H8Q A;  3MP1 A;  1ELJ A;  4RNS A;  3TTR A;  1IEJ A;  2OWT A;  2OK2 A;  4KYD A;  4KI0 E;  3BBR A;  4DDD A;  2ZMB A;  2DWH A;  1LAG E;  5DVI A;  1GV8 A;  2QS4 A;  1MPC A;  4QFL A;  4UA8 A;  4KYE A;  2H99 A;  1Y1M A;  4F3P A;  3VVE A;  4OES A;  1A99 A;  3G3J A;  4JXI A;  2DE2 A;  1LB9 A;  3SET A;  4LON B;  3PD9 A;  5HPQ A;  1LBC A;  1AOV A;  3KN7 A;  4NF8 A;  5ISU A;  3UN6 A;  2RC9 A;  4DCY A;  1P1U A;  2OCU A;  1AH5 A;  4F1V A;  1ZBM A;  1URS A;  3K6V A;  5FHM A;  4U4S A;  4KR5 A;  3BKI B;  4O3C A;  4EXK A;  4F29 A;  3TTM A;  2RCA A;  2RIN A;  3MPK A;  3T9H B;  4MFI A;  4YKP A;  4PE5 B;  4OEV A;  4PFW A;  3JV9 A;  1ZTY A;  4WKM A;  1B51 A;  4OEN A;  3UA8 A;  2XXQ A;  1JW1 A;  4OVJ A;  1JEV A;  1PB9 A;  4IO4 A;  2QSX A;  4H1X A;  4MH5 A;  2H98 A;  3KOT A;  4U1O A;  2F97 A;  1MQI A;  1NNF A;  3FVO A;  2HFB A;  5I56 B;  4R75 A;  5TPA B;  1OMP A;  1I69 A;  3FVK A;  1B3H A;  1N0T A;  2XXR A;  4LA9 A;  4ELP A;  1VFE A;  3O6H A;  3DP4 A;  2RCB A;  4F2Q A;  2F7C A;  4NF5 B;  2OLB A;  2XXP A;  4G8N A;  1B1H A;  1MDQ A;  1B5I A;  3H6T A;  3TDJ A;  2Z22 A;  4GQO A;  1PDA A;  1S7Y A;  2D3I A;  3UOR A;  2DVC A;  4GL0 A;  1TT1 A;  5A5X B;  4G2Z A;  4XTC Q;  3CFL A;  3M3L A;  4K3F A;  1KWH A;  2ONS A;  3K00 A;  3USD A;  1B3F A;  1D3K A;  4GOT A;  3RQT A;  5K2X A;  1GVC A;  3K4U A;  4MF3 A;  3TCG A;  3W15 C;  3FJ7 A;  2XXH A;  3MZB A;  2X7P A;  3KSJ A;  1SVX B;  4FOR A;  1MG1 A;  5CC2 A;  1EH3 A;  1MY4 A;  1N7X A;  3E13 X;  1NKX A;  1OQG A;  2F35 A;  3QAX A;  1AIV A;  4P0G A;  2DP8 A;  2WKY A;  1LFH A;  3SEY A;  3MWB A;  2AYS A;  3GBB A; 
#chains in the Genus database with same CATH topology
 3RT6 B;  4ZZA A;  1RKM A;  4F22 A;  4G68 A;  1R1N A;  2OZZ A;  2ZZX A;  2NXO A;  1A7L A;  3IOV A;  4YB7 A;  2QVU A;  2DXR A;  1LCT A;  2O1L A;  3GXA A;  3PPP A;  3H6V A;  3D4C A;  3U92 A;  4UAB A;  4ELO A;  1IIW A;  5LDZ A;  3THI A;  4RA1 A;  4QFP A;  1EZO A;  1P1N A;  4FAJ A;  4HE0 A;  2CMO A;  4OYV A;  5TPA A;  1FBG A;  4XKQ A;  4YB6 A;  3Q25 A;  1DTZ A;  4LUB A;  3T96 B;  1B6H A;  3ONM A;  4QF9 A;  3H06 B;  5T3J A;  3WAE A;  4ESW A;  4I40 A;  1MXW A;  4I9D A;  4PAF A;  3T22 A;  4GF8 A;  4NWD A;  2I3W A;  3G7W A;  4EUO A;  1BK4 A;  3O29 A;  3CVG A;  4MAG A;  1FW0 A;  2GHA A;  5DEX A;  4BDL A;  3TZA A;  2PX1 A;  1YTV A;  3A09 A;  1Y3N A;  3F11 A;  2Y5L A;  4X8R A;  4P56 A;  3LUY A;  1S9T A;  2THI A;  1P1O A;  5H8S A;  5JTY B;  1XC1 A;  2CEX A;  4HCY A;  4O8M A;  2UVJ A;  4NGU A;  5DT6 A;  1JVX A;  1RYX A;  4AB5 A;  5ET7 A;  4X48 A;  4BLA A;  3Q28 A;  4NX1 A;  3TPA A;  4MIJ A;  2NOO A;  3H6W A;  1M5E A;  2XXU A;  2B3B A;  5DYH A;  3MW0 A;  3CIJ A;  2HXW A;  1FQA A;  4PTK A;  2I48 A;  1B2H A;  3VXC A;  4RJZ A;  4F1Y A;  1HSJ A;  4TQU Q;  1SW1 A;  3HN0 A;  3RYD A;  4ONY A;  4ZZE A;  3MYU A;  1UTH A;  1LFI A;  1LB8 A;  4JDF A;  4PCD A;  4NF6 A;  4C1U A;  4EQ9 A;  4OHN A;  5BWJ A;  1Y1Z A;  2CZL A;  1YXI A;  5FHO A;  3FAS A;  4LQ5 A;  3H3G A;  2YPN A;  5LOM A;  5DW8 A;  2Z8F A;  4HCW A;  5H8N A;  2OJT A;  2RC8 A;  2O7I A;  3HFU A;  1LGB C;  5ITP A;  3FVN A;  2A5T B;  2DDK A;  4MEV A;  1NMU A;  5TP9 B;  5F7V A;  4I62 A;  3NOH A;  5EQ7 A;  4ZE8 A;  1EYJ A;  4LZ7 A;  4I1D A;  4M4G A;  5L9M A;  3MAM A;  1ZLQ A;  4GL8 A;  4R74 A;  3RTW B;  5I58 B;  4H5G A;  3LC8 A;  4GWY A;  4ZEF A;  4M1V A;  2BJI A;  4ZEC A;  4RK2 A;  4WED A;  1NUW A;  4XKP A;  5ESY A;  2QPQ A;  2XXV A;  3OEN A;  3FAT A;  1MXX A;  1XI6 A;  3K2D A;  2ZZV A;  3PMV A;  1POT A;  1HSL A;  3QK6 A;  4NF4 B;  1QJM A;  3Q26 A;  4ND9 A;  1JP4 A;  4PF6 A;  5IZZ A;  4BDO A;  2P3V A;  1PB7 A;  5H8Q B;  4O7M A;  2FA7 A;  2W7Y A;  3E78 A;  3KSX A;  1IMD A;  3H6U A;  1LBB A;  1NH8 A;  4MNC A;  4F2O A;  3TTL A;  2H9B A;  2O6A A;  4N07 A;  1QUK A;  5CI5 A;  2F3B A;  3PV0 E;  3C33 A;  1DBZ A;  3MP8 A;  3O97 A;  2QJE A;  1I6Q A;  1FTL A;  4I8C A;  3RPW A;  3FD3 A;  2HAV A;  2L5V A;  4PBQ A;  3W9W A;  4N13 A;  1DOT A;  2ZNS A;  4NF8 B;  3FXR A;  4DIG A;  3ROJ A;  1KA0 A;  3QMF A;  5ELV A;  5ET8 A;  1N7W A;  3B6T A;  3EPE A;  4F31 B;  3UK4 A;  4JSO A;  2HHM A;  3L6G A;  4R6K A;  1TFA A;  3FXQ A;  4RY1 A;  3TEP A;  4HE1 A;  1IMA A;  1UIV A;  1IXI A;  4YMB A;  2VD2 A;  5CMK A;  4YZZ A;  2HZL A;  4XXU A;  2VP1 A;  3R26 A;  4U23 A;  3OO6 A;  4LQ2 A;  3TQL A;  1SDX A;  3PU5 A;  1P1Q A;  1FBH A;  4H6D A;  1SW2 A;  5IZ3 B;  1XOC A;  4P1E A;  5I2K B;  4YKK A;  3M3K A;  4NAP A;  4PFT A;  1XT8 A;  4GXS B;  2HXR A;  3LSL A;  5AA4 A;  1LBX A;  1XVX A;  1B58 A;  4F39 A;  3VFJ A;  3GLB A;  3TYH A;  5I58 A;  2CEY A;  4DLD A;  4X1D A;  3DLN A;  1NNK A;  5EYH A;  4MX6 A;  3IL1 B;  2LAO A;  4H5F A;  4U1Z A;  2DS9 A;  3BFU A;  1FPD A;  1B0H A;  1LBZ A;  1MM6 A;  4TLM B;  2GH9 A;  3EHU A;  4P8B A;  3M8U A;  3DM0 A;  1S50 A;  3VLV A;  5B7D A;  3TUS A;  4G8H A;  3LV0 A;  1MXU A;  2O1M A;  4BDN A;  1LLS A;  2UXA A;  4R72 A;  2Y7P A;  1FQF A;  5H8H A;  1MS7 A;  4ZEB A;  2HZK A;  4YU0 A;  1SI0 A;  3D4G A;  1URD A;  2XX7 A;  4U21 A;  1G0I A;  1FBF A;  1RDZ A;  4N4U A;  1VFD A;  1D4N A;  3QIM A;  3RPL A;  1MXY A;  4DXB A;  3V83 A;  3QXM A;  2QMW A;  5CMC A;  2AL5 A;  3FGS A;  4XKR A;  4KCC A;  1M5C A;  4ZS9 A;  4KYS A;  3N6T A;  1XS5 A;  2I3V A;  1ATG A;  3MZ9 A;  5CM6 A;  2XWV A;  4N6D A;  1EU8 A;  3CFZ A;  2NVU B;  1M5D A;  2Q8M A;  4LZ8 A;  3DEL B;  2XXX A;  1DPE A;  4ZEI A;  3MVY A;  1KA1 A;  2Q2C A;  1A55 A;  2WX9 A;  3M3F A;  1B1X A;  1NV5 A;  1IXC A;  3C4M A;  3MVZ A;  1M5F A;  1JQF A;  2I58 A;  3OSQ A;  4GX6 A;  4G68 B;  2WYK A;  3DP6 A;  4GWW A;  4Q30 B;  3FIR A;  5I2K A;  2PFY A;  3KN3 A;  3PPQ A;  3HCQ A;  4FED A;  2WEF A;  5H8F A;  1DCU A;  2ZNT A;  4DXU A;  2HQ0 A;  1QUL A;  3IJO B;  1PC3 A;  2QL3 A;  4OVS A;  3CR9 A;  4WEP A;  1J1N A;  4OA4 A;  3PPN A;  3OO8 A;  4TOZ A;  2DXY A;  4PFY A;  3KG2 A;  1ANF A;  3GZG A;  3S9N C;  3OOA A;  3N26 A;  4G8M A;  1IMC A;  1Y4T A;  4NE4 A;  4NED A;  2WBB A;  2O68 A;  3LUZ A;  1LBV A;  1H45 A;  4TLL B;  3OEL A;  4IO2 A;  3RNN A;  4EQB A;  4UAC A;  3ZKL A;  4AB6 A;  1MY2 A;  1M5B A;  2X26 A;  4N6K A;  3CRB A;  1ZKB A;  5DVJ A;  5CMB A;  3I6V A;  1BLF A;  4U2R A;  1FJ6 A;  3TCH A;  5I3S A;  1TWY A;  4OVT A;  5DEX B;  4OTE A;  4IO6 A;  3TQW A;  2V3T A;  1WOD A;  2CZH A;  2B3F A;  5I2N A;  4FIM A;  4PFR A;  5L9O A;  3EKI A;  2D5W A;  3K6W A;  3K6X A;  1G0H A;  4AQ4 A;  2FHY A;  3MP6 A;  1N04 A;  3R6U A;  4RXL A;  5BUU A;  1XHY A;  4Z0I A;  3TEL A;  1P1W A;  2F78 A;  4KHZ E;  4F3S A;  1SYI A;  2XXI A;  3OO9 A;  5HM4 B;  4P3L A;  1EZ9 A;  5KCJ A;  3OMB A;  3H03 A;  4LN5 A;  1F9B A;  3IFC A;  2KLF A;  2XXT A;  4GWO A;  4FE8 A;  5I5P A;  3KGC A;  3K0V A;  1OIB A;  2FNC A;  1UTH B;  1RDX A;  1B4Z A;  4ELQ A;  3PPR A;  1US4 A;  4NF6 B;  1QUJ A;  1I6A A;  1BIY A;  4GLI A;  3G3G A;  3IOR A;  1LBW A;  4THI A;  4QFK A;  3QSL A;  4IY5 A;  4IO5 A;  4DXC A;  3LBS A;  3L6H A;  5H8N B;  1MY1 A;  2E0S A;  2ZYO A;  4EF2 A;  1USY E;  4EXL A;  2XX8 A;  1FQE A;  1NV7 A;  1WVJ A;  1FBE A;  3B7D A;  3TKD A;  4OXV A;  1Q1K A;  4QSC A;  2I0C A;  4ZED A;  4OQO A;  3PUX E;  2DOJ A;  2ZXT A;  1L5T A;  3FXB A;  3S4U A;  3MBP A;  4YKJ A;  1LEV A;  1O63 A;  4DZ1 A;  1B3E A;  3T0J A;  1A54 A;  3SDF A;  1UQW A;  3ZSF A;  1Y4C A;  2F5X A;  2KQZ A;  2ABH A;  2I0B A;  2VPN A;  3FVG A;  1IXG A;  4G77 A;  5CMM A;  2UVH A;  1FTA A;  2ESN A;  1RYO A;  4DI4 B;  1DK4 A;  3K1M A;  2FVZ A;  3V5A A;  1B7H A;  3C34 A;  1LFG A;  3SEV A;  2V93 A;  4OZ9 A;  4FBP A;  3LSW A;  1D9V A;  4PGN A;  1Z7N E;  5IZ1 A;  1FBC A;  4H46 A;  4IGT A;  4OVR A;  1B9J A;  4KFQ A;  4GX4 A;  4QFO A;  3S9E A;  2F34 A;  2PFZ A;  4KPT A;  4P1L A;  3IO6 A;  2O51 A;  3T9V A;  4F1U A;  4N8Y A;  1OLC A;  1QKB A;  4R2B A;  1FTK A;  1JW4 A;  4WXJ A;  5KDT A;  1B52 A;  1MQJ A;  4DCX A;  3EHT A;  4H65 A;  3VLW A;  5I84 A;  1B0L A;  1IIT A;  5JEI A;  2Y84 A;  3IB1 A;  3O6G A;  1QUI A;  3MVW A;  1FTO A;  1VDW A;  5B70 A;  2FYI A;  3TTK A;  2REJ A;  5AE4 A;  1RDY A;  3CSG A;  4POW A;  4LP2 B;  1NL5 A;  1B5J A;  3WAF A;  4MCO A;  2R71 A;  4P0I A;  4DI3 D;  3G3H A;  3T93 B;  1SBP A;  1FPK A;  3C35 A;  4RK9 A;  5EQA A;  2QS3 A;  2B4M A;  5FTH A;  3KEI A;  1GGG A;  5AA4 B;  3CG1 A;  1BP5 A;  3I3V A;  1INP A;  3SZP A;  3ISP A;  4NHB A;  3KJT A;  1MH4 A;  2FBP A;  4RPO A;  1FPJ A;  3VLU A;  4JWY A;  1HSE A;  1YYZ A;  2OX3 A;  3RLF E;  1IMB A;  2VT5 A;  4LZ5 A;  2V25 A;  3FXU A;  3PUV E;  4OFL A;  2F6G A;  3KC0 A;  2ALU A;  3A3U A;  3MPL A;  3CSB A;  4P9K A;  2MKZ A;  3C36 A;  5K2Y A;  3JYR A;  1NV2 A;  2Y7I A;  4E0X A;  2ZYM A;  2GRV A;  3KJ7 A;  1DMB A;  4HTG A;  2XX9 A;  5H8H B;  2ONR A;  1FPL A;  3IB0 A;  1H76 A;  1PBP A;  5CBR A;  1NV3 A;  3RGY A;  3SEX A;  4P11 A;  2IA4 A;  3K1P A;  2ONK E;  1NV0 A;  2DQV A;  4Z7E A;  3UGW A;  2X7Q A;  4PC9 A;  3GBA A;  3RPL B;  1A40 A;  3ILU B;  3MUQ A;  3HHF A;  3P7I A;  3E3K A;  4BDQ A;  4LAT A;  2AL4 A;  3CI8 A;  1EYK A;  2XWO A;  5EYF A;  3T9X B;  4QSD A;  3K02 A;  2V3Q A;  2DE3 A;  2QMX A;  5AA1 A;  4U22 A;  3B50 A;  1MQH A;  2JJK A;  2Q88 A;  1KZ8 A;  3KBR A;  1MH3 A;  5ICQ A;  1JNF A;  2Z8E A;  4GXA A;  2Q89 A;  1MDP 1;  2QS1 A;  2V84 A;  2PCR A;  1AMF A;  3VDF A;  1NFT A;  4C0R A;  1LAF E;  5LTC A;  2DVZ A;  1JET A;  2XXK A;  3KN8 A;  4G4P A;  3MST A;  3TTN A;  4GIZ A;  1B4H A;  5I59 A;  1MXZ A;  4GVO A;  3U93 A;  1TFD A;  4POX A;  4KD5 A;  3G3F A;  4PET A;  1Y3P A;  1YAE A;  2GFE A;  3GYY A;  3SES A;  3G3I A;  3I5O A;  1AWB A;  1II5 A;  2Z8D A;  5TU0 A;  2RKM A;  1IXH A;  3OXN A;  4YIC A;  5H8F B;  2DYX A;  3FJM A;  1DSN A;  2P1S A;  4IO7 A;  3TCF A;  4QSE A;  2UYE A;  4AS4 A;  4HW8 A;  3RUM A;  3CFX A;  4OET A;  1R9Q A;  4JSD A;  1R9L A;  3IOW A;  4PF8 A;  4R2F A;  4GBV A;  2XXY A;  1IUD A;  4BDR A;  5AA2 D;  4O7I A;  5L8D A;  4H8I A;  1OVT A;  1H44 A;  1OVB A;  4IR8 A;  3UIF A;  3IR1 A;  4MLV A;  4LVQ A;  1CB6 A;  2RF1 A;  2QRY A;  5AA3 A;  3O9P A;  2I6E A;  2R9J A;  2GHB A;  3G3K A;  2M8C A;  5AA2 A;  4HE2 A;  4N81 A;  5ET5 A;  1N76 A;  3LSX A;  1CE2 A;  3B6W A;  4N8G A;  2OWZ A;  3PUW E;  3JZJ A;  3EQ1 A;  5J1D A;  3S9M C;  1PBQ A;  1PB8 A;  3N5L A;  4PAK A;  2XHD A;  1PEB A;  1B7Z A;  1FCK A;  1NV1 A;  1FRP A;  3IK6 B;  5I2N B;  2Q2A A;  2FIX A;  3K6U A;  4U4X A;  2E1S A;  1JEU A;  2H25 A;  5DTB A;  3C32 A;  2VD3 A;  4E0W A;  2F3D A;  5CBS A;  1FPG A;  3Q29 A;  1UIU A;  5KCJ B;  1P99 A;  2F7A A;  5FTI A;  3IOT A;  3U72 A;  2HCA A;  1MM7 A;  3CHG A;  4YKI A;  5F24 A;  3R7X A;  2H5Y A;  4PGP A;  1B40 A;  3OSR A;  4GWX A;  4C1T A;  3S9L C;  2DWJ A;  1UTB A;  2UVI A;  4ECF A;  5J16 A;  1O7T A;  3T1B A;  4Q5T A;  3T9U A;  3V89 B;  2I4C A;  4OEU A;  4YB5 A;  1BTJ A;  3FJG A;  4O3B A;  1FBP A;  2V3U A;  4F19 A;  5F1Q A;  3U8Q A;  4G61 A;  2VPO A;  4JVC A;  1MY3 A;  1FSA A;  3OEM A;  3K1N A;  3N6U A;  1JW5 A;  3KZG A;  1YCJ A;  2O84 X;  1A8F A;  4FEB A;  3C9H A;  4RPN A;  3QUF A;  1URG A;  4DE8 A;  5I57 A;  5IGA A;  5ICT A;  3PMX A;  4ISU A;  3KC1 A;  3AXF A;  4PAI A;  5FHN A;  2VOZ A;  3PTY A;  2O7U A;  2VHA A;  1SPI A;  1JVY A;  2Z23 A;  2B4L A;  1B3L A;  1MXV A;  1Q35 A;  2UVG A;  2Q8J A;  3HPI A;  4JVD A;  1AL3 A;  1B3G A;  4FAT A;  1SW4 A;  2YLN A;  3Q27 A;  1SI1 A;  2DSF A;  3QUJ A;  1N84 A;  1NH7 A;  3C31 A;  1QW0 A;  2PT1 A;  5JK4 A;  3RN8 A;  4NTL A;  3EF7 A;  3IAZ A;  2ANJ A;  3MC2 A;  3MQ9 A;  1GR2 A;  3ODB A;  3TOD A;  1ZIU A;  3PD8 A;  1DPP A;  1US5 A;  3EN3 A;  4MMP A;  3VE1 B;  4HXV A;  4GRK A;  2BJJ X;  2F8D A;  1LCF A;  1EYI A;  2A5S A;  1MRP A;  3E79 A;  2XXW A;  1FTM A;  2DWI A;  5KDT B;  5IKB A;  4YAH X;  2I49 A;  4FJP A;  2P2A A;  1ZJL A;  1GTK A;  2YJP A;  1Z7M E;  3BFT A;  5HBC A;  4YMA A;  4GD5 A;  4PBH A;  5EHM A;  4XFE A;  3U65 A;  4GBW A;  3HHG A;  3K01 A;  3MVX A;  2WBD A;  2RC7 A;  1VR5 A;  4FEC A;  3IOU A;  4IY6 A;  1OQH A;  4EDP A;  3SEU A;  1A8E A;  2XWI A;  3O66 A;  1SYH A;  1SW5 A;  2P0S A;  2IEE A;  4Q8R A;  3E9X A;  2Q74 A;  4QHQ A;  4MHF A;  1N3X A;  1YPN A;  4N6P A;  1D9Q A;  5I56 A;  4RYA A;  3ECR A;  2V4C A;  2OWS A;  3OEK A;  1B32 A;  2HAU A;  1DTG A;  2OBG A;  1B46 A;  5EQ9 A;  5IM2 A;  3PGF A;  1MPB A;  1VE4 A;  5ITO A;  2REG A;  5A5L A;  4ELR A;  1FTJ A;  4NF5 A;  1YZ0 A;  4JB7 A;  1H3D A;  2ZNU A;  4EF1 A;  3VVF A;  5L9S A;  5A5X A;  1BKA A;  1QVS A;  3N94 A;  2D21 A;  3IX1 A;  3SEW A;  4JBZ A;  3U94 A;  1IMF A;  4ZE9 A;  2VGQ A;  3KFM A;  3RT8 A;  2PT2 A;  1NNP A;  1O64 A;  2KR0 A;  3TMG A;  1IQ7 A;  5KZT A;  1ZU0 A;  4JVI A;  1B7U A;  3EHS A;  1FQB A;  2F7B A;  3PUY E;  4G68 C;  2Y7R A;  1FQD A;  2F6P A;  4ZEK A;  2ZYN A;  1LST A;  2F36 A;  2UYF A;  2XD3 A;  1MPD A;  1EZP A;  3PUZ E;  5I59 B;  4KCD A;  4Q0C A;  3E4R A;  4JWX A;  2CZK A;  3CG3 A;  4OVP A;  3ZS6 A;  3VVD A;  3FBP A;  2DE4 A;  1T0K A;  3LSF B;  4H45 A;  4NMY A;  1Y20 A;  3IO4 A;  1LAX A;  3VV5 A;  4PP0 A;  4X9T A;  4QBA A;  1FQC A;  4OFO A;  4R73 A;  3MJN A;  4L17 A;  2WYP A;  4F18 A;  4MJO A;  2PYY A;  1B05 A;  3FV2 A;  4IO3 A;  4EQ7 A;  3H4Z A;  4N17 A;  1Y9U A;  1FJ9 A;  2PBW A;  2NWJ A;  4ESX A;  3UP9 A;  2AIX A;  1SD3 A;  1NI9 A;  4NQ8 A;  3T66 A;  3A3C A;  2XD2 A;  3H7M A;  5IAI A;  1MQG A;  1ZMG A;  2Y7K A;  1Y3Q A;  5AA2 B;  3VXB A;  4QRZ A;  3O2A A;  2I4B A;  1FPB A;  4X1B A;  1NV4 A;  4OVQ A;  1B5H A;  4H67 A;  1MQD A;  1NUZ A;  3MZ1 A;  4OWD A;  4NG7 A;  1LAH E;  4PE3 A;  4HS7 A;  3QYT A;  4BDM A;  3HO7 A;  5DVF A;  2ZYK A;  1OLA A;  1IZ1 A;  4XIG Q;  2G93 A;  2Q9T A;  4F3B A;  4GWZ A;  1MY0 A;  4R9F A;  4GFR A;  4ZDM A;  1SQY A;  3B6Q A;  5M2V A;  2HEU A;  1USY H;  3FZV A;  3RTF B;  3ILT B;  3S2V A;  3OO7 A;  5JTY A;  2DWA A;  3LR1 A;  1FPI A;  4MLQ A;  4QFN A;  4MBP A;  4O3A A;  1NNT A;  4R6H A;  1LBY A;  4N91 A;  4R9G A;  1K9Y A;  3KBZ A;  4OER A;  1TXF A;  4KQP A;  5I7I A;  1UTB B;  2O69 A;  3D1R A;  2Y7W A;  1I6B A;  3O28 A;  4PFI A;  4H0W A;  3FV1 A;  2H4I A;  3TFL A;  3V8X B;  4XF5 A;  2PVU A;  4OFJ A;  4NF0 A;  4F3G A;  3KOS A;  3RY3 A;  2NUV A;  2R6G E;  4R6Y A;  4H8J A;  1R6Z A;  1H43 A;  4PQJ A;  3SKP A;  4JWO A;  5EHS A;  3BIH A;  3W9V A;  1POY 1;  2QS2 A;  2P3N A;  2QVV A;  3IB2 A;  4QXD A;  3HST A;  4NWC A;  4PFU A;  3FUZ A;  3HV1 A;  2XA5 A;  2A5T A;  3DP8 A;  4MNP A;  4XKN A;  5TP9 A;  1IME A;  3O6I A;  5I57 B;  1VSO A;  2QVR A;  4PDH A;  4IGR A;  2G29 A;  3PPO A;  2FIE A;  3PMW A;  3SER A;  1N3W A;  3OD7 A;  3TAJ A;  1WDN A;  4OMB A;  1D9Y A;  4AS5 A;  1QKA A;  2PMS A;  2B65 A;  3IJX B;  5CRY A;  4NF4 A;  3U1O A;  1XVY A;  3ZKK A;  4IB2 A;  5H8Q A;  4GWU A;  3MP1 A;  3BIG A;  1ELJ A;  4RNS A;  3TTR A;  5FBP A;  1IEJ A;  2OWT A;  2OK2 A;  4KYD A;  4KI0 E;  3BBR A;  4DDD A;  2ZMB A;  4MNI A;  2DWH A;  1LAG E;  5DVI A;  4XEQ A;  1GV8 A;  2QS4 A;  1MPC A;  4N15 A;  4QFL A;  4UA8 A;  4KYE A;  2H99 A;  1Y1M A;  4F3P A;  3VVE A;  4OES A;  1CNQ A;  3A29 A;  1A99 A;  3G3J A;  4I3E A;  4JXI A;  2DE2 A;  2GQ1 A;  1LB9 A;  3SET A;  4LON B;  3PD9 A;  4KXP A;  5HPQ A;  1LBC A;  1AOV A;  3KN7 A;  2HPG A;  4NF8 A;  3B8B A;  5ISU A;  3UN6 A;  4NN3 A;  2RC9 A;  4DCY A;  4PFB A;  1P1U A;  2OCU A;  1AH5 A;  4F1V A;  1ZBM A;  1URS A;  3K6V A;  5EYG A;  5FHM A;  4U4S A;  4KR5 A;  3BKI B;  4O3C A;  4EXK A;  4F29 A;  3TTM A;  2RCA A;  2RIN A;  3MPK A;  3T9H B;  1FPF A;  1K9Z A;  4MFI A;  4YKP A;  4PE5 B;  4OEV A;  4PFW A;  3JV9 A;  1ZTY A;  4WKM A;  1B51 A;  4OEN A;  3UA8 A;  2XXQ A;  5IZ3 A;  1JW1 A;  4OVJ A;  2Y5K A;  4I3Y A;  2XWK A;  4PDD A;  1JEV A;  4GX3 A;  1PB9 A;  4IO4 A;  2QSX A;  4H1X A;  3IFA A;  4MH5 A;  2H98 A;  3KOT A;  4U1O A;  2F97 A;  1MQI A;  2QFL A;  1QGX A;  1NNF A;  1NUX A;  4X04 A;  3FVO A;  2HFB A;  5I56 B;  4R75 A;  5TPA B;  1OMP A;  1I69 A;  3FVK A;  1B3H A;  1N0T A;  2XXR A;  4LA9 A;  4ELP A;  1VFE A;  3O6H A;  1NUY A;  3DP4 A;  2RCB A;  1FBD A;  4F2Q A;  2F7C A;  4OAN A;  4NF5 B;  2OLB A;  2XXP A;  4G8N A;  2R8T A;  1B1H A;  1MDQ A;  1B5I A;  3H6T A;  3TDJ A;  2Z22 A;  4GQO A;  1PDA A;  1S7Y A;  2D3I A;  3UOR A;  4O94 A;  2DVC A;  4GL0 A;  1TT1 A;  5A5X B;  1Q9D A;  4G2Z A;  4XTC Q;  3CFL A;  3M3L A;  4K3F A;  1KWH A;  2ONS A;  1FPE A;  5ET6 A;  3K00 A;  4P47 A;  3USD A;  1B3F A;  1D3K A;  4GOT A;  5EQ8 A;  3RQT A;  5K2X A;  1GVC A;  3K4U A;  4MF3 A;  3TCG A;  3W15 C;  3FJ7 A;  2XXH A;  3MZB A;  2X7P A;  3KSJ A;  1SVX B;  4FOR A;  1MG1 A;  5CC2 A;  1EH3 A;  2ZZW A;  1MY4 A;  1N7X A;  4GWS A;  3E13 X;  1NKX A;  1OQG A;  2F35 A;  3QAX A;  1AIV A;  1NV6 A;  4P0G A;  2DP8 A;  2WKY A;  1LFH A;  2CZI A;  3SEY A;  3MWB A;  2AYS A;  3GBB A; 
#chains in the Genus database with same CATH homology
 3RT6 B;  4ZZA A;  1RKM A;  4F22 A;  4G68 A;  1R1N A;  2OZZ A;  2NXO A;  1A7L A;  3IOV A;  4YB7 A;  2DXR A;  1LCT A;  2O1L A;  3GXA A;  3PPP A;  3H6V A;  3D4C A;  3U92 A;  4ELO A;  1IIW A;  3THI A;  4RA1 A;  4QFP A;  1EZO A;  1P1N A;  4FAJ A;  2CMO A;  4OYV A;  5TPA A;  4XKQ A;  4YB6 A;  3Q25 A;  1DTZ A;  4LUB A;  3T96 B;  1B6H A;  3ONM A;  4QF9 A;  3H06 B;  3WAE A;  4ESW A;  1MXW A;  4I9D A;  3T22 A;  4GF8 A;  4NWD A;  2I3W A;  3G7W A;  4EUO A;  3O29 A;  3CVG A;  1FW0 A;  2GHA A;  5DEX A;  4BDL A;  3TZA A;  2PX1 A;  1YTV A;  3A09 A;  1Y3N A;  3F11 A;  3LUY A;  1S9T A;  2THI A;  1P1O A;  5H8S A;  5JTY B;  1XC1 A;  4HCY A;  2UVJ A;  5DT6 A;  1JVX A;  1RYX A;  4AB5 A;  4X48 A;  4BLA A;  3Q28 A;  3TPA A;  2NOO A;  3H6W A;  1M5E A;  2XXU A;  2B3B A;  5DYH A;  3MW0 A;  3CIJ A;  2HXW A;  1FQA A;  2I48 A;  1B2H A;  3VXC A;  4RJZ A;  4F1Y A;  1HSJ A;  4TQU Q;  1SW1 A;  3HN0 A;  4ONY A;  4ZZE A;  1UTH A;  1LFI A;  1LB8 A;  4JDF A;  4NF6 A;  4C1U A;  4EQ9 A;  4OHN A;  5BWJ A;  1Y1Z A;  2CZL A;  5FHO A;  3FAS A;  4LQ5 A;  3H3G A;  2YPN A;  5LOM A;  2Z8F A;  4HCW A;  5H8N A;  2OJT A;  2RC8 A;  2O7I A;  1LGB C;  5ITP A;  3FVN A;  2A5T B;  1NMU A;  5TP9 B;  5F7V A;  4I62 A;  4ZE8 A;  4LZ7 A;  4I1D A;  4M4G A;  5L9M A;  3MAM A;  1ZLQ A;  4GL8 A;  4R74 A;  3RTW B;  5I58 B;  4H5G A;  3LC8 A;  4ZEF A;  4M1V A;  4ZEC A;  4RK2 A;  4WED A;  4XKP A;  2QPQ A;  2XXV A;  3OEN A;  3FAT A;  1MXX A;  3K2D A;  3PMV A;  1POT A;  1HSL A;  3QK6 A;  4NF4 B;  1QJM A;  3Q26 A;  4ND9 A;  4BDO A;  1PB7 A;  5H8Q B;  2FA7 A;  2W7Y A;  3KSX A;  3H6U A;  1LBB A;  1NH8 A;  4F2O A;  3TTL A;  2H9B A;  2O6A A;  4N07 A;  1QUK A;  5CI5 A;  3PV0 E;  3C33 A;  3MP8 A;  3O97 A;  2QJE A;  1I6Q A;  1FTL A;  4I8C A;  3RPW A;  3FD3 A;  2HAV A;  3W9W A;  4N13 A;  1DOT A;  2ZNS A;  4NF8 B;  3FXR A;  4DIG A;  5ELV A;  1N7W A;  3B6T A;  3EPE A;  4F31 B;  3UK4 A;  4JSO A;  3L6G A;  4R6K A;  1TFA A;  3FXQ A;  4RY1 A;  3TEP A;  1UIV A;  1IXI A;  4YMB A;  2VD2 A;  5CMK A;  4YZZ A;  2HZL A;  4XXU A;  2VP1 A;  3R26 A;  4U23 A;  3OO6 A;  4LQ2 A;  3TQL A;  1SDX A;  3PU5 A;  1P1Q A;  4H6D A;  1SW2 A;  1XOC A;  5I2K B;  4YKK A;  3M3K A;  4PFT A;  1XT8 A;  4GXS B;  3LSL A;  5AA4 A;  1XVX A;  1B58 A;  4F39 A;  3VFJ A;  3GLB A;  3TYH A;  5I58 A;  4DLD A;  4X1D A;  3DLN A;  1NNK A;  3IL1 B;  2LAO A;  4H5F A;  4U1Z A;  2DS9 A;  3BFU A;  1B0H A;  1MM6 A;  4TLM B;  2GH9 A;  3EHU A;  3M8U A;  3DM0 A;  1S50 A;  5B7D A;  3VLV A;  3TUS A;  4G8H A;  1MXU A;  2O1M A;  4BDN A;  1LLS A;  2UXA A;  4R72 A;  2Y7P A;  1FQF A;  5H8H A;  1MS7 A;  4ZEB A;  2HZK A;  4YU0 A;  1SI0 A;  3D4G A;  1URD A;  2XX7 A;  4U21 A;  1VFD A;  1D4N A;  3QIM A;  1MXY A;  4DXB A;  3V83 A;  3QXM A;  2QMW A;  5CMC A;  2AL5 A;  3FGS A;  4XKR A;  4KCC A;  1M5C A;  4ZS9 A;  4KYS A;  3N6T A;  1XS5 A;  2I3V A;  1ATG A;  3MZ9 A;  5CM6 A;  1EU8 A;  3CFZ A;  2NVU B;  1M5D A;  4LZ8 A;  3DEL B;  2XXX A;  1DPE A;  4ZEI A;  3MVY A;  2Q2C A;  1A55 A;  3M3F A;  1B1X A;  3C4M A;  1IXC A;  3MVZ A;  1M5F A;  1JQF A;  2I58 A;  3OSQ A;  4G68 B;  3DP6 A;  4Q30 B;  3FIR A;  5I2K A;  3KN3 A;  3PPQ A;  3HCQ A;  4FED A;  5H8F A;  2ZNT A;  4DXU A;  2HQ0 A;  1QUL A;  3IJO B;  1PC3 A;  2QL3 A;  3CR9 A;  4WEP A;  1J1N A;  3PPN A;  3OO8 A;  4TOZ A;  2DXY A;  4PFY A;  3KG2 A;  1ANF A;  3GZG A;  3S9N C;  3OOA A;  3N26 A;  4G8M A;  1Y4T A;  4NE4 A;  4NED A;  2O68 A;  1H45 A;  4TLL B;  3OEL A;  4IO2 A;  3RNN A;  4EQB A;  4UAC A;  3ZKL A;  4AB6 A;  1MY2 A;  1M5B A;  2X26 A;  3CRB A;  1ZKB A;  5DVJ A;  5CMB A;  3I6V A;  1BLF A;  4U2R A;  3TCH A;  1TWY A;  5DEX B;  4OTE A;  4IO6 A;  3TQW A;  2V3T A;  1WOD A;  2B3F A;  5I2N A;  4FIM A;  5L9O A;  2D5W A;  3K6W A;  3K6X A;  4AQ4 A;  3MP6 A;  1N04 A;  3R6U A;  4RXL A;  5BUU A;  1XHY A;  4Z0I A;  3TEL A;  1P1W A;  2F78 A;  4KHZ E;  4F3S A;  1SYI A;  2XXI A;  3OO9 A;  5HM4 B;  1EZ9 A;  5KCJ A;  3OMB A;  3H03 A;  1F9B A;  2KLF A;  2XXT A;  4GWO A;  4FE8 A;  3KGC A;  3K0V A;  1OIB A;  2FNC A;  1UTH B;  1B4Z A;  4ELQ A;  3PPR A;  1US4 A;  4NF6 B;  1QUJ A;  1I6A A;  1BIY A;  4GLI A;  3G3G A;  3IOR A;  4THI A;  4QFK A;  3QSL A;  4IY5 A;  4IO5 A;  4DXC A;  3LBS A;  3L6H A;  5H8N B;  1MY1 A;  2E0S A;  2ZYO A;  4EF2 A;  1USY E;  4EXL A;  2XX8 A;  1FQE A;  1WVJ A;  3B7D A;  3TKD A;  4OXV A;  1Q1K A;  4QSC A;  2I0C A;  4ZED A;  4OQO A;  3PUX E;  2DOJ A;  2ZXT A;  1L5T A;  3S4U A;  3MBP A;  4YKJ A;  1O63 A;  4DZ1 A;  1B3E A;  1A54 A;  3SDF A;  1UQW A;  3ZSF A;  1Y4C A;  2F5X A;  2ABH A;  2I0B A;  3FVG A;  1IXG A;  4G77 A;  5CMM A;  2UVH A;  2ESN A;  1RYO A;  3K1M A;  3V5A A;  1B7H A;  3C34 A;  1LFG A;  3SEV A;  2V93 A;  4OZ9 A;  3LSW A;  1D9V A;  1Z7N E;  4IGT A;  1B9J A;  4KFQ A;  4QFO A;  3S9E A;  2F34 A;  4KPT A;  3IO6 A;  2O51 A;  3T9V A;  4F1U A;  1OLC A;  1QKB A;  4R2B A;  1FTK A;  1JW4 A;  4WXJ A;  5KDT A;  1B52 A;  1MQJ A;  4DCX A;  3EHT A;  4H65 A;  3VLW A;  5I84 A;  1B0L A;  1IIT A;  5JEI A;  2Y84 A;  3IB1 A;  3O6G A;  1QUI A;  3MVW A;  1FTO A;  5B70 A;  2FYI A;  3TTK A;  2REJ A;  5AE4 A;  3CSG A;  4POW A;  4LP2 B;  1NL5 A;  1B5J A;  3WAF A;  2R71 A;  4P0I A;  3G3H A;  3T93 B;  1SBP A;  3C35 A;  4RK9 A;  2QS3 A;  5FTH A;  3KEI A;  1GGG A;  5AA4 B;  3CG1 A;  1BP5 A;  3I3V A;  3KJT A;  1MH4 A;  4RPO A;  3VLU A;  4JWY A;  1HSE A;  3RLF E;  4LZ5 A;  2V25 A;  3FXU A;  3PUV E;  4OFL A;  2F6G A;  2ALU A;  3A3U A;  3MPL A;  3CSB A;  3C36 A;  5K2Y A;  3JYR A;  2Y7I A;  4E0X A;  2ZYM A;  2GRV A;  3KJ7 A;  1DMB A;  4HTG A;  2XX9 A;  5H8H B;  2ONR A;  3IB0 A;  1H76 A;  1PBP A;  5CBR A;  3RGY A;  3SEX A;  4P11 A;  2IA4 A;  3K1P A;  2ONK E;  2DQV A;  4Z7E A;  3UGW A;  2X7Q A;  3GBA A;  1A40 A;  3ILU B;  3MUQ A;  3HHF A;  3P7I A;  3E3K A;  4BDQ A;  4LAT A;  2AL4 A;  3CI8 A;  5EYF A;  3T9X B;  4QSD A;  3K02 A;  2V3Q A;  2DE3 A;  2QMX A;  5AA1 A;  4U22 A;  1MQH A;  2Q88 A;  3KBR A;  1MH3 A;  5ICQ A;  1JNF A;  2Z8E A;  4GXA A;  2Q89 A;  1MDP 1;  2QS1 A;  2V84 A;  3VDF A;  1AMF A;  1NFT A;  4C0R A;  1LAF E;  2DVZ A;  1JET A;  3KN8 A;  4G4P A;  3TTN A;  4GIZ A;  1B4H A;  5I59 A;  1MXZ A;  4GVO A;  3U93 A;  1TFD A;  4POX A;  4KD5 A;  3G3F A;  4PET A;  1Y3P A;  1YAE A;  2GFE A;  3SES A;  3G3I A;  3I5O A;  1II5 A;  2Z8D A;  5TU0 A;  2RKM A;  1IXH A;  3OXN A;  4YIC A;  5H8F B;  2DYX A;  3FJM A;  1DSN A;  2P1S A;  4IO7 A;  3TCF A;  4QSE A;  2UYE A;  4HW8 A;  3RUM A;  3CFX A;  4OET A;  1R9Q A;  4JSD A;  1R9L A;  3IOW A;  4R2F A;  2XXY A;  1IUD A;  4BDR A;  5AA2 D;  5L8D A;  4H8I A;  1OVT A;  1H44 A;  1OVB A;  3UIF A;  3IR1 A;  4MLV A;  4LVQ A;  1CB6 A;  2RF1 A;  2QRY A;  5AA3 A;  3O9P A;  2I6E A;  2R9J A;  2GHB A;  3G3K A;  2M8C A;  5AA2 A;  1N76 A;  3LSX A;  1CE2 A;  3B6W A;  3PUW E;  3JZJ A;  3EQ1 A;  5J1D A;  3S9M C;  1PBQ A;  1PB8 A;  3N5L A;  2XHD A;  1PEB A;  1B7Z A;  1FCK A;  3IK6 B;  5I2N B;  2Q2A A;  3K6U A;  4U4X A;  2E1S A;  1JEU A;  2H25 A;  5DTB A;  3C32 A;  2VD3 A;  4E0W A;  5CBS A;  3Q29 A;  1UIU A;  5KCJ B;  1P99 A;  2F7A A;  5FTI A;  3IOT A;  3U72 A;  2HCA A;  1MM7 A;  4YKI A;  3R7X A;  2H5Y A;  1B40 A;  3OSR A;  4C1T A;  3S9L C;  2DWJ A;  1UTB A;  2UVI A;  4ECF A;  1O7T A;  4Q5T A;  3T9U A;  3V89 B;  2I4C A;  4OEU A;  4YB5 A;  1BTJ A;  3FJG A;  4O3B A;  2V3U A;  4F19 A;  5F1Q A;  3U8Q A;  1MY3 A;  3OEM A;  3K1N A;  3N6U A;  1JW5 A;  3KZG A;  1YCJ A;  2O84 X;  1A8F A;  4FEB A;  3C9H A;  4RPN A;  3QUF A;  1URG A;  4DE8 A;  5I57 A;  5ICT A;  3PMX A;  4ISU A;  3AXF A;  5FHN A;  2VOZ A;  2O7U A;  2VHA A;  1JVY A;  2Z23 A;  1B3L A;  1MXV A;  1Q35 A;  2UVG A;  2Q8J A;  3HPI A;  1AL3 A;  1B3G A;  4FAT A;  1SW4 A;  2YLN A;  3Q27 A;  1SI1 A;  2DSF A;  3QUJ A;  1N84 A;  1NH7 A;  3C31 A;  1QW0 A;  2PT1 A;  5JK4 A;  3RN8 A;  4NTL A;  3EF7 A;  3IAZ A;  2ANJ A;  3MC2 A;  3MQ9 A;  1GR2 A;  3ODB A;  3TOD A;  1ZIU A;  3PD8 A;  1DPP A;  1US5 A;  3EN3 A;  3VE1 B;  4GRK A;  2BJJ X;  2F8D A;  1LCF A;  2A5S A;  1MRP A;  2XXW A;  1FTM A;  2DWI A;  5KDT B;  5IKB A;  4YAH X;  2I49 A;  4FJP A;  2P2A A;  1ZJL A;  1GTK A;  2YJP A;  1Z7M E;  3BFT A;  5HBC A;  4YMA A;  4GD5 A;  5EHM A;  3HHG A;  3K01 A;  3MVX A;  2RC7 A;  1VR5 A;  4FEC A;  3IOU A;  4IY6 A;  1OQH A;  4EDP A;  3SEU A;  1A8E A;  3O66 A;  1SYH A;  1SW5 A;  2P0S A;  2IEE A;  4Q8R A;  3E9X A;  4QHQ A;  1N3X A;  1YPN A;  4N6P A;  5I56 A;  4RYA A;  3ECR A;  2OWS A;  3OEK A;  1B32 A;  2HAU A;  1DTG A;  2OBG A;  1B46 A;  3PGF A;  1MPB A;  1VE4 A;  5ITO A;  2REG A;  4ELR A;  1FTJ A;  4NF5 A;  4JB7 A;  1H3D A;  2ZNU A;  4EF1 A;  3VVF A;  5L9S A;  5A5X A;  1BKA A;  1QVS A;  3N94 A;  2D21 A;  3IX1 A;  3SEW A;  4JBZ A;  3U94 A;  4ZE9 A;  2VGQ A;  3KFM A;  3RT8 A;  2PT2 A;  1NNP A;  1O64 A;  3TMG A;  1IQ7 A;  5KZT A;  1ZU0 A;  1B7U A;  3EHS A;  1FQB A;  2F7B A;  3PUY E;  4G68 C;  2Y7R A;  1FQD A;  2F6P A;  4ZEK A;  2ZYN A;  1LST A;  2F36 A;  2UYF A;  2XD3 A;  1MPD A;  1EZP A;  3PUZ E;  5I59 B;  4KCD A;  4Q0C A;  3E4R A;  4JWX A;  3CG3 A;  3ZS6 A;  3VVD A;  2DE4 A;  1T0K A;  3LSF B;  4NMY A;  1Y20 A;  3IO4 A;  1LAX A;  3VV5 A;  4PP0 A;  4X9T A;  1FQC A;  4OFO A;  4R73 A;  3MJN A;  4L17 A;  4F18 A;  2PYY A;  1B05 A;  3FV2 A;  4IO3 A;  4EQ7 A;  3H4Z A;  1Y9U A;  2PBW A;  2NWJ A;  4ESX A;  3UP9 A;  2AIX A;  1SD3 A;  3T66 A;  3A3C A;  2XD2 A;  3H7M A;  5IAI A;  1MQG A;  1ZMG A;  2Y7K A;  1Y3Q A;  5AA2 B;  3VXB A;  4QRZ A;  3O2A A;  2I4B A;  4X1B A;  1B5H A;  4H67 A;  1MQD A;  3MZ1 A;  4OWD A;  1LAH E;  4HS7 A;  3QYT A;  4BDM A;  3HO7 A;  5DVF A;  2ZYK A;  1OLA A;  1IZ1 A;  4XIG Q;  2G93 A;  2Q9T A;  4F3B A;  1MY0 A;  4R9F A;  4GFR A;  4ZDM A;  1SQY A;  3B6Q A;  5M2V A;  2HEU A;  1USY H;  3FZV A;  3RTF B;  3ILT B;  3S2V A;  3OO7 A;  5JTY A;  2DWA A;  3LR1 A;  4MLQ A;  4QFN A;  4MBP A;  4O3A A;  1NNT A;  4R6H A;  4R9G A;  4OER A;  1TXF A;  4KQP A;  1UTB B;  2O69 A;  2Y7W A;  1I6B A;  3O28 A;  4H0W A;  3FV1 A;  2H4I A;  3TFL A;  3V8X B;  2PVU A;  4OFJ A;  4F3G A;  3KOS A;  3RY3 A;  2NUV A;  2R6G E;  4R6Y A;  4H8J A;  1R6Z A;  1H43 A;  4PQJ A;  3SKP A;  4JWO A;  5EHS A;  3W9V A;  1POY 1;  2QS2 A;  3IB2 A;  3HST A;  4NWC A;  4PFU A;  3FUZ A;  3HV1 A;  2A5T A;  3DP8 A;  4XKN A;  5TP9 A;  3O6I A;  5I57 B;  1VSO A;  4IGR A;  2G29 A;  3PPO A;  3PMW A;  3SER A;  1N3W A;  3OD7 A;  3TAJ A;  1WDN A;  4OMB A;  1D9Y A;  1QKA A;  2PMS A;  2B65 A;  3IJX B;  5CRY A;  4NF4 A;  3U1O A;  1XVY A;  3ZKK A;  4IB2 A;  5H8Q A;  3MP1 A;  1ELJ A;  4RNS A;  3TTR A;  1IEJ A;  2OWT A;  2OK2 A;  4KYD A;  4KI0 E;  3BBR A;  4DDD A;  2ZMB A;  2DWH A;  1LAG E;  5DVI A;  1GV8 A;  2QS4 A;  1MPC A;  4QFL A;  4UA8 A;  4KYE A;  2H99 A;  1Y1M A;  4F3P A;  3VVE A;  4OES A;  1A99 A;  3G3J A;  4JXI A;  2DE2 A;  1LB9 A;  3SET A;  4LON B;  3PD9 A;  5HPQ A;  1LBC A;  1AOV A;  3KN7 A;  4NF8 A;  5ISU A;  3UN6 A;  2RC9 A;  4DCY A;  1P1U A;  2OCU A;  1AH5 A;  4F1V A;  1ZBM A;  1URS A;  3K6V A;  5FHM A;  4U4S A;  4KR5 A;  3BKI B;  4O3C A;  4EXK A;  4F29 A;  3TTM A;  2RCA A;  2RIN A;  3MPK A;  3T9H B;  4MFI A;  4YKP A;  4PE5 B;  4OEV A;  4PFW A;  3JV9 A;  1ZTY A;  4WKM A;  1B51 A;  4OEN A;  3UA8 A;  2XXQ A;  1JW1 A;  4OVJ A;  1JEV A;  1PB9 A;  4IO4 A;  2QSX A;  4H1X A;  4MH5 A;  2H98 A;  3KOT A;  4U1O A;  2F97 A;  1MQI A;  1NNF A;  3FVO A;  2HFB A;  5I56 B;  4R75 A;  5TPA B;  1OMP A;  1I69 A;  3FVK A;  1B3H A;  1N0T A;  2XXR A;  4LA9 A;  4ELP A;  1VFE A;  3O6H A;  3DP4 A;  2RCB A;  4F2Q A;  2F7C A;  4NF5 B;  2OLB A;  2XXP A;  4G8N A;  1B1H A;  1MDQ A;  1B5I A;  3H6T A;  3TDJ A;  2Z22 A;  4GQO A;  1PDA A;  1S7Y A;  2D3I A;  3UOR A;  2DVC A;  4GL0 A;  1TT1 A;  5A5X B;  4G2Z A;  4XTC Q;  3CFL A;  3M3L A;  4K3F A;  1KWH A;  2ONS A;  3K00 A;  3USD A;  1B3F A;  1D3K A;  4GOT A;  3RQT A;  5K2X A;  1GVC A;  3K4U A;  4MF3 A;  3TCG A;  3W15 C;  3FJ7 A;  2XXH A;  3MZB A;  2X7P A;  3KSJ A;  1SVX B;  4FOR A;  1MG1 A;  5CC2 A;  1EH3 A;  1MY4 A;  1N7X A;  3E13 X;  1NKX A;  1OQG A;  2F35 A;  3QAX A;  1AIV A;  4P0G A;  2DP8 A;  2WKY A;  1LFH A;  3SEY A;  3MWB A;  2AYS A;  3GBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...