5AA1A

Crystal structure of mltf from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
418
structure length
418
Chain Sequence
EGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 137
structure length 418
sequence length 418
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa1A02
2DXYA 3G7WA 3O97A 5AA4B 1FTLA 4DLDA 2PVUA 1MXVA 1J1NA 3OMBA 2UYFA 3TMGA 1LBBA 2RC9A 5CI5A 4KCCA 5I58B 3TDJA 4FEBA 4NF4B 2BJJX 1B7ZA 3K6XA 4ELOA 3MPLA 2IA4A 5FTIA 1M5DA 2G29A 4U2RA 3TTMA 4OVJA 5KZTA 4KQPA 2ONKE 5FHNA 2VGQA 1IXHA 2Y7WA 1MQJA 4O3CA 2Z8FA 1URGA 2XX9A 4Q0CA 1B05A 1OLCA 3PMXA 1B32A 3USDA 4JXIA 3K02A 3Q28A 3T9XB 3H6WA 3OO7A 4OENA 1FQDA 5FHOA 5ITPA 2ZYKA 2NOOA 2F34A 1LAHE 3SEWA 5ICTA 4WKMA 1OQGA 4JB7A 4NF6A 1IUDA 4ECFA 4YMAA 4F2OA 1GVCA 2NUVA 3P7IA 4MH5A 1B3LA 1N7WA 3IJXB 1A99A 3BBRA 4DXBA 4G4PA 1CE2A 5KDTA 3VV5A 5I57B 2E0SA 4H1XA 1JNFA 3VLUA 1FTMA 3U8QA 3VVEA 4ZZAA 3TEPA 3C33A 4IY5A 5AA2A 3EN3A 5DTBA 2IEEA 3FJMA 3FXUA 4ZEIA 1B0HA 2THIA 1OMPA 1US5A 2FYIA 3PPOA 1A54A 4JSDA 4HCYA 1NMUA 1MPCA 3O6GA 1UTBA 2O6AA 3LSWA 1FQEA 2PMSA 4FECA 4MLQA 5BWJA 4F1VA 3LSFB 4ND9A 3FVNA 3MZ9A 2QL3A 3QUFA 1XHYA 3BFUA 2ZYOA 3CIJA 2DWJA 2FNCA 3T9VA 4KI0E 4JDFA 5KCJA 1LB8A 3MVWA 4PE5B 1B1HA 3GLBA 4RJZA 4H5GA 2ESNA 4XIGQ 1N04A 2XXIA 1MY2A 2ZYMA 1GTKA 4R74A 2XXTA 3ZKKA 2DWAA 2F78A 4QFNA 2RCBA 5CC2A 2W7YA 3B6TA 3M3FA 3R26A 2V25A 2Z8EA 3U72A 5DVFA 3KSXA 3VFJA 3O28A 4YMBA 5B70A 4U1OA 3L6HA 2V3UA 1US4A 3MVYA 3A09A 3C4MA 5CMKA 2RC7A 1Y1ZA 4R2BA 4F18A 4IO2A 3V8XB 3W9VA 3K00A 1LB9A 4ZEFA 3SEXA 2PT1A 3N26A 3EHUA 4F22A 2UYEA 5I84A 5I56B 3ZKLA 2HZKA 4TLLB 1B6HA 4R73A 1RYOA 4ZE8A 2HAUA 4LUBA 3T96B 3CRBA 5DEXB 1N0TA 2QMXA 5AA3A 3OELA 5J1DA 1UIUA 3VVDA 4GF8A 4U22A 3ZS6A 4F19A 2O69A 2GHAA 4BDLA 2O7UA 4RPNA 3RQTA 4YAHX 1P1OA 4HW8A 1B3EA 4LQ5A 5L9MA 5H8HA 3PPNA 3FUZA 3K0VA 1ELJA 3T93B 4GL0A 1LAGE 1IXCA 3PUZE 4LZ8A 3FVOA 2E1SA 3V5AA 2DE3A 1QVSA 1EH3A 3U93A 1MXYA 2I48A 4LZ7A 1OVBA 3T22A 3VE1B 1Y4TA 1PEBA 2XXHA 4GD5A 1KWHA 4GVOA 2NWJA 3HN0A 2QRYA 5CMCA 3K4UA 1MH4A 2A5SA 3SEYA 3KEIA 1FQAA 4P0IA 3TTLA 3FXQA 4H65A 1LBCA 3FVKA 3E13X 5IKBA 1ANFA 2XXXA 1FW0A 4ZDMA 1I6AA 1NNFA 1FQCA 3QK6A 2I0CA 4PFWA 2O84X 2ONRA 5TPAB 2DE4A 3FJ7A 4FE8A 1F9BA 3RN8A 4QFKA 3MPKA 4TOZA 2H9BA 4POWA 3TTRA 4AQ4A 2O7IA 3IORA 3PMWA 1M5CA 2B65A 1N76A 4O3AA 1ZBMA 3PD8A 4IO6A 1WVJA 2Q88A 1UQWA 1ATGA 3KOTA 5B7DA 3H03A 3QAXA 1POTA 4M1VA 3O6HA 3PD9A 4RNSA 2RCAA 1QKAA 3PUVE 3S2VA 1DTGA 4N13A 3S4UA 1BP5A 3LR1A 4QSCA 2RC8A 4F1YA 1P99A 3WAEA 4BDQA 3C36A 5I2NA 1P1WA 3Q27A 4C1TA 4OWDA 5L8DA 4E0XA 4U21A 3V83A 4YKKA 2A5TA 4F3GA 1MPBA 2XXVA 5DYHA 3H6UA 3EHTA 4RXLA 3C34A 3GBAA 4YU0A 4BDMA 3B7DA 5TP9A 2VOZA 3DELB 4GOTA 1N3WA 4X1BA 3MJNA 2B3BA 2F35A 1B3FA 2F7BA 3A3CA 1FQFA 1MXUA 1MQIA 2ZYNA 2QS3A 3FV2A 4OQOA 4XKQA 4HS7A 3RPWA 3VXBA 4M4GA 4F3BA 3LSXA 2ZNUA 3PMVA 2LAOA 4JWXA 2AL4A 2Z22A 1PBQA 1CB6A 1O63A 4MF3A 3DM0A 4YB7A 4OMBA 1FCKA 1NH8A 4QFLA 4I62A 2M8CA 2F7CA 4LVQA 4LP2B 1WDNA 4F2QA 1B7HA 4GLIA 2XD3A 3HV1A 4KD5A 1B58A 1P1NA 2XHDA 1JVXA 1EZOA 2I3VA 2I4CA 1LAFE 3DP6A 3RGYA 3UORA 2UXAA 2V3TA 4IO4A 1N84A 4ZS9A 1VSOA 5CMBA 1DTZA 2X7PA 4U4SA 3KOSA 2ONSA 3IB1A 4JWOA 3TPAA 3QIMA 3TYHA 1YPNA 3GBBA 3MWBA 2DP8A 1SBPA 1IEJA 1B1XA 1NL5A 1RKMA 4E0WA 4OYVA 1FQBA 1BKAA 1A7LA 1UTHA 3CR9A 4QHQA 2FA7A 3RT8A 3ZSFA 1HSLA 1LLSA 5CBRA 1R1NA 1PB9A 2ABHA 2CMOA 4QSDA 1POY1 1XVYA 5KDTB 4LATA 4IO5A 3OOAA 4BDOA 5K2YA 3T9HB 3RLFE 1D4NA 3OEMA 4QRZA 1I6BA 1MH3A 2F8DA 3HHFA 1MY3A 5AA2B 4Z7EA 3JV9A 3WAFA 4F29A 3TKDA 3C31A 1MDQA 3HCQA 3JYRA 4FORA 3IB2A 2GFEA 3EQ1A 4NF8A 4IGRA 1OIBA 1JVYA 2ANJA 1IQ7A 2HAVA 4FATA 1EU8A 1B40A 3UGWA 3R7XA 2AL5A 4G68A 3N5LA 2QS2A 1MQDA 4KYDA 3R6UA 2YPNA 4OFJA 4NMYA 3OSRA 1LCTA 3CFLA 4GL8A 1ZJLA 3K1NA 3DP8A 3Q25A 2XX8A 5KCJB 3MZ1A 3CG3A 2DYXA 3IOVA 5TU0A 4OFOA 4RK9A 1D9YA 5L9SA 1NNTA 4YKJA 3SKPA 1PB8A 2RF1A 1H45A 3F11A 3OO8A 1BTJA 4H8JA 4L17A 3KZGA 1O7TA 1Y20A 3ILUB 3RTWB 1DOTA 2DS9A 5H8QA 1DPEA 5CMMA 4RYAA 3TQLA 5I59A 5EHMA 4ZECA 3FVGA 3G3HA 4PQJA 5HM4B 4DCYA 1S7YA 5BUUA 4IO7A 1B46A 1II5A 2XD2A 1XS5A 1AIVA 4NF5A 2KLFA 3N6UA 2WKYA 4GWOA 2VP1A 2NVUB 5DVJA 3PUXE 2PBWA 3BFTA 1PB7A 2I6EA 2DVCA 3VLVA 4XTCQ 4YB6A 3MP8A 1NKXA 4NWDA 4WEDA 4X48A 1SW2A 4EXKA 3IO6A 1WODA 5M2VA 3K6VA 5ICQA 3IO4A 3MP1A 3GZGA 1B7UA 2D21A 5CBSA 1ZU0A 2F6PA 3DLNA 4ELRA 3HO7A 3H4ZA 5ITOA 1B5HA 2VHAA 3KGCA 1QJMA 1FTOA 4HCWA 4WXJA 4LONB 2GHBA 3Q26A 2UVIA 3PUWE 1P1UA 4YICA 3TELA 4YB5A 1Y1MA 3H6VA 4DIGA 3TTKA 3OXNA 3U94A 4ELPA 3G3IA 5K2XA 3PV0E 1O64A 1DSNA 1QUIA 4Q5TA 3TCHA 3K1PA 1LFGA 3RTFB 4EQ7A 3O6IA 1NH7A 1URSA 5I2KA 1XT8A 3RNNA 4U4XA 3FXRA 2H98A 4MLVA 4QFOA 1A55A 1OVTA 3T9UA 4G68C 3MUQA 2QS1A 2V3QA 4THIA 1MY0A 3U92A 2V84A 3EF7A 3VLWA 3LUYA 1S9TA 3LSLA 1HSEA 2CZLA 4JSOA 4OFLA 3ONMA 2DE2A 1VE4A 5JTYA 1Z7NE 2Q2CA 2QSXA 5DT6A 3SEUA 1BIYA 3N94A 3S9NC 1MXZA 3O29A 4IY6A 3B6WA 3UN6A 3KBRA 4G8MA 3H7MA 5ISUA 1EZ9A 1YAEA 5I2NB 4LZ5A 1ZLQA 3MQ9A 1SI1A 3FD3A 2XXPA 2OCUA 4Z0IA 2O1LA 2A5TB 4Q30B 4RA1A 4AB6A 1B0LA 4ZEBA 4NWCA 2OZZA 4EF1A 4ESXA 5TP9B 1B2HA 5EHSA 4IO3A 5FTHA 4RY1A 1FTKA 5A5XA 1M5EA 4FEDA 3LC8A 4I9DA 3KJTA 3IOTA 3PPPA 3C35A 1GGGA 1A40A 5AE4A 4F31B 1IXGA 4POXA 3MW0A 3IOUA 2DQVA 1LFHA 2DVZA 4PP0A 4RK2A 1P1QA 3QXMA 5CM6A 5L9OA 4R72A 5H8NA 2DOJA 4TQUQ 4EQBA 1NNPA 1Y3PA 1VR5A 3MP6A 1AOVA 1EZPA 2ZMBA 3K6WA 3KN7A 4XXUA 5H8SA 4XKRA 3K1MA 3LBSA 1FTJA 3H3GA 1A8EA 4KHZE 1PBPA 2AIXA 1Y9UA 4EF2A 3IB0A 1L5TA 2DXRA 3G3GA 3UP9A 1ZIUA 4KFQA 4WEPA 2RINA 4LQ2A 3W15C 4XKPA 3FJGA 1AMFA 3MVXA 1USYE 2R71A 3V89B 4ZEDA 1Z7ME 4R6HA 3HSTA 4EXLA 3BKIB 3KN3A 2HFBA 3G3FA 1H76A 4DZ1A 2O51A 3KN8A 1R9QA 2F6GA 3CI8A 4EDPA 4KPTA 2XXYA 3PGFA 2RKMA 2XXWA 3M3LA 2D3IA 1QUJA 1SW4A 4U1ZA 1H44A 2OK2A 2Y7IA 4JBZA 4JWYA 5HPQA 2P0SA 3HPIA 1UTHB 1B9JA 2HXWA 1SQYA 3I3VA 3FIRA 5H8FA 4TLMB 4ESWA 1MM6A 2H5YA 3IK6B 2Q9TA 3E3KA 4OEUA 3TAJA 2QPQA 4NF6B 5AA4A 1MXXA 3CSBA 5AA1A 1I6QA 4XKNA 3Q29A 1JQFA 5I58A 4PFYA 3L6GA 4NF4A 1SW5A 2Q89A 3OSQA 4R9FA 4F3SA 3S9EA 4G8NA 3MVZA 3OO6A 1SYHA 1GV8A 1JW1A 2XXQA 3M3KA 1NFTA 4BDNA 4ZE9A 3G3JA 4IGTA 3DP4A 4N6PA 4NF8B 1MRPA 4R9GA 3OENA 2DWIA 1N3XA 4NTLA 3IR1A 2HCAA 1LAXA 1JETA 2R9JA 4G68B 3O9PA 1USYH 4PFUA 2OBGA 4R6YA 2UVHA 3KJ7A 2Y84A 1UTBB 2OJTA 3CFZA 4F3PA 1JW4A 1Y4CA 3CSGA 1JEUA 1Q1KA 3FGSA 4DXCA 1MG1A 1MXWA 2ZNTA 3UA8A 3FZVA 4EQ9A 5I57A 4QFPA 3T66A 2ALUA 2HQ0A 1MS7A 3QYTA 1ZKBA 2PX1A 3TZAA 1HSJA 2Y7RA 3RY3A 1N7XA 3FATA 3OO9A 3MBPA 5CRYA 2P2AA 4ZEKA 3JZJA 5H8QB 2QS4A 1ZMGA 3H06B 1OQHA 2XXRA 5I59B 2PYYA 1TFDA 1R6ZA 2XX7A 2X7QA 1XC1A 4C1UA 4UA8A 4P0GA 4NF5B 3ODBA 3EPEA 1R9LA 2GH9A 3SETA 4KYEA 3IOWA 3QSLA 1JW5A 2I3WA 4NEDA 3ILTB 3HHGA 2XXUA 4QSEA 1XOCA 3QUJA 1M5BA 2R6GE 3THIA 1S50A 5HBCA 4R6KA 4IB2A 2Z8DA 3SESA 3H6TA 3KSJA 3S9MC 3RUMA 4Q8RA 1YTVA 4H5FA 1MQHA 3C9HA 1DPPA 4ISUA 3G3KA 1AH5A 2X26A 4AB5A 2AYSA 4I1DA 3O66A 4H8IA 2F7AA 3IAZA 2ZNSA 4N07A 1B51A 4LA9A 3VDFA 4MFIA 3PPQA 4K3FA 2I58A 1A8FA 2B3FA 1NNKA 2QMWA 2O68A 3PU5A 3CVGA 5H8HB 1QKBA 2Z23A 1B3HA 1TFAA 5ELVA 2P1SA 2HEUA 1TT1A 2YJPA 4G77A 1T0KA 1VFEA 5I2KB 1SDXA 1LFIA 1MPDA 3B6QA 2H99A 3I6VA 2DWHA 3D4GA 5JEIA 5I56A 4GXAA 4DE8A 1OLAA 5EYFA 4F1UA 1SD3A 3ECRA 3TCFA 4ZZEA 3MC2A 2V93A 5DEXA 3O2AA 2NXOA 5DVIA 3TODA 2PT2A 4YKIA 3TFLA 4H6DA 2OWTA 4H0WA 1TXFA 5F1QA 4PFTA 4I8CA 2DSFA 2I49A 3SERA 2UVJA 3MZBA 5JTYB 2I0BA 3RT6B 4NE4A 1MM7A 4OTEA 1SI0A 1I69A 4DXUA 2F5XA 1SW1A 4GFRA 3GXAA 3IL1B 4HTGA 2I4BA 4GIZA 4F39A 4R2FA 4OESA 2REJA 3M8UA 3PUYE 3AXFA 3SEVA 4OXVA 1H3DA 1D3KA 1IZ1A 2D5WA 3C32A 1H43A 2YLNA 2O1MA 4DDDA 4OEVA 3SDFA 2QJEA 3IJOB 4BLAA 4KR5A 3EHSA 3W9WA 3K2DA 4RPOA 3PPRA 3I5OA 2Y7KA 3S9LC 1JEVA 2H25A 1B5JA 1Q35A 3OEKA 4GQOA 1D9VA 4U23A 2Q2AA 3N6TA 1IXIA 3CG1A 3IX1A 2VD2A 2REGA 5A5XB 4OETA 1LSTA 1LGBC 1DMBA 1B4ZA 5LOMA 1URDA 1IIWA 1Y3NA 4GRKA 5TPAA 1YCJA 2HZLA 4KCDA 3MAMA 1MDP1 4OZ9A 3UIFA 3E4RA 4EUOA 1Y3QA 1SVXB 5IAIA 1ZTYA 3KG2A 4H67A 3TUSA 2G93A 5H8NB 4BDRA 3D4CA 3K6UA 1QULA 2Q8JA 3U1OA 4G2ZA 3TCGA 2F97A 1XVXA 2H4IA 4QF9A 1SYIA 2ZXTA 3FASA 1MQGA 3CFXA 4X1DA 3K01A 1AL3A 1LCFA 4X9TA 1TWYA 2Y7PA 4OERA 4YZZA 1GR2A 1MY1A 3TQWA 1PC3A 1QUKA 4KYSA 2UVGA 1M5FA 4YKPA 3KFMA 4FJPA 1BLFA 3VVFA 4P11A 2OWSA 1MY4A 4UACA 2F36A 1VFDA 1PDAA 4MBPA 1B3GA 1UIVA 3OD7A 4C0RA 1B5IA 5FHMA 5JK4A 1IITA 4G8HA 3A3UA 3FV1A 4PETA 1RYXA 4FIMA 5F7VA 1QW0A 4ELQA 4DCXA 4ONYA 4O3BA 2VD3A 2OLBA 3TTNA 3UK4A 4FAJA 5H8FB 4OHNA 5AA2D 2GRVA 3VXCA 1B52A 4R75A 3E9XA 4GXSB 1B4HA
chains in the Genus database with same CATH superfamily
2DXYA 1DCUA 3G7WA 3O97A 2PFZA 5AA4B 1FTLA 4DLDA 2PVUA 1MXVA 1J1NA 4PDDA 3OMBA 2UYFA 3MYUA 3TMGA 1LBBA 2RC9A 5CI5A 4KCCA 5I58B 3TDJA 4FEBA 4NF4B 2BJJX 1B7ZA 3K6XA 4ELOA 3MPLA 2IA4A 5FTIA 1M5DA 2KQZA 2G29A 2QVUA 4U2RA 3TTMA 4OVJA 5KZTA 1FSAA 4P8BA 4KQPA 5ET8A 4PFIA 4O7IA 2ONKE 5FHNA 2VGQA 4PTKA 1IXHA 2Y7WA 1MQJA 4O3CA 2Z8FA 1URGA 2XX9A 4Q0CA 1B05A 1OLCA 3PMXA 1B32A 3USDA 2WYPA 3K02A 4JXIA 2KR0A 3Q28A 3H6WA 3T9XB 3OO7A 4OENA 1FQDA 5FHOA 5ITPA 2ZYKA 1NV2A 2NOOA 2F34A 1LAHE 3SEWA 5ICTA 4AS4A 4WKMA 1OQGA 4I40A 1NV1A 4QBAA 4JB7A 4NF6A 1IUDA 4ECFA 4YMAA 4F2OA 1GVCA 2NUVA 3P7IA 4MH5A 1B3LA 1N7WA 3IJXB 1A99A 3BBRA 4P56A 4DXBA 4G4PA 4H45A 1CE2A 5KDTA 3VV5A 5I57B 2BJIA 2E0SA 4H1XA 1JNFA 3VLUA 1FTMA 3U8QA 3VVEA 4ZZAA 2XWVA 3TEPA 3C33A 4IY5A 5AA2A 3EN3A 5DTBA 2IEEA 3FJMA 3FXUA 4ZEIA 1B0HA 4MHFA 2THIA 1OMPA 1US5A 2FYIA 3PPOA 1A54A 4JSDA 2XXKA 4HCYA 1NMUA 4NG7A 1MPCA 3O6GA 2VPNA 1UTBA 4GBVA 2O6AA 3LSWA 1FQEA 2PMSA 4FECA 4MLQA 5BWJA 4F1VA 3LSFB 4ND9A 3FVNA 3MZ9A 2QL3A 4PE3A 3QUFA 1XHYA 3BFUA 2ZYOA 3CIJA 2DWJA 2FNCA 3T9VA 4KI0E 1LEVA 4JDFA 5KCJA 1LB8A 3MVWA 2QFLA 4PE5B 1B1HA 3GLBA 4RJZA 4PBQA 4XF5A 4H5GA 2ESNA 4XIGQ 1N04A 1EYIA 2XXIA 1MY2A 1LBWA 2ZYMA 1GTKA 4R74A 2XXTA 3ZKKA 2DWAA 2F78A 4QFNA 2RCBA 5CC2A 2W7YA 3B6TA 3M3FA 3R26A 4PFBA 2V25A 2Z8EA 3U72A 5DVFA 3KSXA 4PFRA 3VFJA 3O28A 4YMBA 5B70A 5IGAA 4U1OA 3L6HA 2V3UA 1US4A 3MVYA 3A09A 3C4MA 1EYKA 5CMKA 4G61A 2RC7A 1Y1ZA 4R2BA 4F18A 4IO2A 3V8XB 3W9VA 3K00A 1LB9A 4ZEFA 3SEXA 2PT1A 3N26A 3EHUA 4F22A 2UYEA 1FJ9A 5I84A 3FXBA 5I56B 3ZKLA 2HZKA 4TLLB 1B6HA 4R73A 1RYOA 4ZE8A 2HAUA 4LUBA 3T96B 3CRBA 2HPGA 4PF8A 5DEXB 2R8TA 1N0TA 2QMXA 3OELA 5AA3A 5J1DA 1UIUA 3VVDA 4GF8A 4U22A 3ZS6A 4F19A 2O69A 2GHAA 2PCRA 4BDLA 4HE2A 1NV3A 2O7UA 4RPNA 3RQTA 2JJKA 4YAHX 1P1OA 4HW8A 1B3EA 4LQ5A 5L9MA 5DW8A 5H8HA 3PPNA 3FUZA 4GBWA 3K0VA 1ELJA 1NUXA 4MNPA 3T93B 4GL0A 4PCDA 1LAGE 1IXCA 4GX6A 3PUZE 4LZ8A 3FVOA 2E1SA 3V5AA 2DE3A 4NN3A 1QVSA 5LDZA 1EH3A 3U93A 1MXYA 2I48A 4LZ7A 1OVBA 1SPIA 4O94A 3T22A 3VE1B 1Y4TA 1PEBA 2XXHA 4GD5A 1KWHA 4GVOA 4JVDA 2NWJA 3HN0A 4PF6A 3U65A 2QRYA 5CMCA 3K4UA 1MH4A 2A5SA 2Q8MA 3SEYA 3KEIA 1FQAA 4P0IA 3TTLA 3FXQA 4H65A 1IMCA 1LBCA 3FVKA 3D1RA 4O8MA 3E13X 5IKBA 4DI3D 2FIEA 1ANFA 1FBCA 2XXXA 1FW0A 4ZDMA 4MJOA 1NV7A 4MNIA 1EYJA 1I6AA 1NNFA 1FQCA 3QK6A 2I0CA 4PFWA 2O84X 2ONRA 5TPAB 2DE4A 3FJ7A 3BIHA 4FE8A 1F9BA 3RN8A 4QFKA 3MPKA 4TOZA 2H9BA 1NUWA 4POWA 3TTRA 4AQ4A 2O7IA 3IORA 3PMWA 1M5CA 2B65A 1N76A 4O3AA 1ZBMA 4IR8A 2F3DA 3PD8A 4IO6A 1WVJA 2Q88A 5IZZA 1UQWA 1ATGA 3KOTA 5B7DA 3H03A 1FBDA 3QAXA 1POTA 4M1VA 3O6HA 3PD9A 4LN5A 4RNSA 2RCAA 1QKAA 3PUVE 1LBZA 1DTGA 3S2VA 4N13A 4QXDA 3S4UA 1BP5A 3LR1A 4QSCA 2RC8A 4F1YA 1P99A 3WAEA 4BDQA 1FPGA 3C36A 5I2NA 1P1WA 3B8BA 3Q27A 4C1TA 4OWDA 5L8DA 4E0XA 4U21A 3V83A 4YKKA 2A5TA 4F3GA 1MPBA 2XXVA 5DYHA 3H6UA 3EHTA 4RXLA 3C34A 4GWWA 3GBAA 4YU0A 4BDMA 3B7DA 5TP9A 2VOZA 2XWIA 4N4UA 3DELB 3ISPA 4GOTA 4PAFA 1N3WA 4FBPA 3IFCA 4X1BA 3MJNA 2B3BA 2F35A 1B3FA 2F7BA 3A3CA 1FQFA 2Y5LA 1MXUA 1MQIA 4UABA 2ZYNA 2QS3A 3FV2A 4OQOA 4XKQA 4HS7A 3RPWA 3VXBA 4P47A 4M4GA 4F3BA 4HE0A 3LSXA 2ZNUA 3PMVA 2LAOA 1K9ZA 4JWXA 2AL4A 2CEXA 2Z22A 1PBQA 1CB6A 2DDKA 1O63A 4MF3A 3DM0A 4YB7A 4OMBA 1FCKA 1NH8A 4QFLA 4I62A 2M8CA 2F7CA 4LVQA 4LP2B 1WDNA 4F2QA 1B7HA 3LV0A 4GLIA 2XD3A 3HV1A 4KD5A 1B58A 4N15A 4HE1A 1P1NA 2XHDA 1JVXA 1FBEA 1YZ0A 5ESYA 3KC0A 1EZOA 4N6DA 2I3VA 2I4CA 1LAFE 1FPFA 3DP6A 3RGYA 3UORA 2Q74A 2UXAA 1YYZA 2V3TA 4IO4A 1N84A 4ZS9A 2ZZXA 1VSOA 5CMBA 1DTZA 2X7PA 4U4SA 3KOSA 2ONSA 3IB1A 4JWOA 3TPAA 3QIMA 3TYHA 1YPNA 3GBBA 4HXVA 3MWBA 2DP8A 1SBPA 1IEJA 1B1XA 1NL5A 1RKMA 4E0WA 4OYVA 2XWKA 1FQBA 1BKAA 1A7LA 1VDWA 1UTHA 3CR9A 4QHQA 2FA7A 2ZZVA 3RT8A 3ZSFA 1HSLA 1LLSA 5CBRA 1R1NA 1PB9A 2ABHA 2CMOA 4QSDA 1POY1 1XVYA 5KDTB 4LATA 4IO5A 3OOAA 4BDOA 5EQ8A 5K2YA 3T9HB 5EQ9A 3RLFE 2WBBA 1D4NA 3OEMA 4QRZA 1I6BA 1MH3A 2F8DA 3HHFA 1MY3A 2VT5A 5AA2B 4OVQA 4Z7EA 3JV9A 3WAFA 3PTYA 4F29A 3RYDA 3TKDA 3C31A 1MDQA 5I5PA 1G0HA 4GX3A 5I7IA 1AWBA 3HCQA 3JYRA 4FORA 1IMAA 3IB2A 2GFEA 3IFAA 3EQ1A 4NF8A 4IGRA 1OIBA 1JVYA 2ANJA 1IQ7A 2HAVA 4FATA 1EU8A 1B40A 1JP4A 3UGWA 3R7XA 2AL5A 4G68A 1FPJA 1FPBA 3N5LA 2QS2A 2CZKA 1MQDA 4KYDA 1DBZA 3R6UA 2YPNA 4OFJA 4NMYA 3OSRA 1LCTA 3CFLA 4N81A 4GL8A 1ZJLA 3K1NA 3DP8A 3Q25A 2XX8A 5KCJB 3MZ1A 3CG3A 2DYXA 3IOVA 5TU0A 4OFOA 4RK9A 1D9YA 1FPIA 5L9SA 1NNTA 4YKJA 3SKPA 4MEVA 1PB8A 2RF1A 1H45A 3F11A 3OO8A 1BTJA 4H8JA 4OVPA 1NV4A 4PAKA 4L17A 3KZGA 1O7TA 1Y20A 3ILUB 3RTWB 1DOTA 2DS9A 5H8QA 1DPEA 5CMMA 4N17A 4RYAA 3TQLA 5I59A 5EHMA 4ZECA 3FVGA 3G3HA 4PQJA 5HM4B 4DCYA 1S7YA 5BUUA 4IO7A 1B46A 1II5A 2XD2A 1KZ8A 1XS5A 1AIVA 2V4CA 4NF5A 2KLFA 3N6UA 2WKYA 4GWOA 4P1EA 2VP1A 2NVUB 5DVJA 3PUXE 2PBWA 3BFTA 1PB7A 2I6EA 2DVCA 3VLVA 4XTCQ 4YB6A 3MP8A 1NKXA 4NWDA 4WEDA 4X48A 1SW2A 2P3NA 4EXKA 2FHYA 3IO6A 1WODA 5M2VA 3K6VA 1BK4A 1DK4A 5ICQA 3IO4A 3MP1A 3GZGA 1B7UA 2D21A 5CBSA 1ZU0A 2F6PA 3DLNA 4JVCA 3HO7A 4ELRA 3H4ZA 5ITOA 1B5HA 4H46A 2VHAA 3KGCA 1QJMA 1FTOA 4HCWA 4WXJA 4LONB 2GHBA 4JVIA 3Q26A 2UVIA 3PUWE 1P1UA 4YICA 3TELA 1RDXA 4XFEA 4YB5A 1Y1MA 3H6VA 4MAGA 4DIGA 3TTKA 3OXNA 3U94A 4ELPA 3G3IA 5K2XA 5EYHA 3PV0E 1O64A 1DSNA 1QUIA 4Q5TA 4OVTA 3TCHA 3K1PA 1LFGA 3RTFB 4EQ7A 1FPLA 3KC1A 3O6IA 1NH7A 1URSA 5I2KA 1XT8A 3RNNA 4U4XA 4NX1A 1XI6A 3FXRA 2H98A 4MLVA 4GWZA 1A55A 4QFOA 1OVTA 1NV5A 1KA0A 3T9UA 2WBDA 4G68C 3MUQA 2QS1A 2V3QA 4THIA 1MY0A 3U92A 1LBYA 2V84A 2FIXA 2XWOA 3EF7A 3VLWA 3LUYA 1S9TA 3LSLA 1HSEA 4OVSA 2CZLA 1LBVA 4JSOA 4GWSA 4OA4A 4OFLA 3ONMA 2DE2A 1QGXA 1VE4A 5JTYA 1Z7NE 2Q2CA 2QSXA 5DT6A 3SEUA 4N8YA 1BIYA 3N94A 3S9NC 1MXZA 2QVVA 3O29A 4IY6A 3B6WA 2GQ1A 3UN6A 3KBRA 4G8MA 1NUZA 3H7MA 5ISUA 1EZ9A 1RDZA 1YAEA 5I2NB 4LZ5A 1ZLQA 3MQ9A 1SI1A 3FD3A 1IMEA 1NI9A 2XXPA 2OCUA 4Z0IA 2O1LA 2A5TB 4Q30B 4RA1A 4X8RA 4AB6A 1B0LA 4ZEBA 4NWCA 2OZZA 4EF1A 4PC9A 4ESXA 1NV0A 5TP9B 1B2HA 5EHSA 4IO3A 5FTHA 4RY1A 1FTKA 5A5XA 1M5EA 4FEDA 3LC8A 1RDYA 4I9DA 3KJTA 3IOTA 3E78A 5IZ3A 3PPPA 3C35A 1GGGA 1A40A 5AE4A 4F31B 1IXGA 4POXA 3MW0A 3IOUA 2DQVA 1LFHA 2DVZA 4PP0A 4RK2A 1P1QA 3QXMA 5CM6A 5L9OA 4R72A 5H8NA 2DOJA 3T0JA 1IMBA 1D9QA 4TQUQ 4EQBA 1NNPA 1Y3PA 1VR5A 3MP6A 1AOVA 1EZPA 2ZMBA 3K6WA 3KN7A 4XXUA 5H8SA 3RPLA 4XKRA 3K1MA 3LBSA 1FTJA 3H3GA 1A8EA 4KHZE 1PBPA 2WEFA 3HFUA 2AIXA 1Y9UA 4EF2A 3IB0A 1L5TA 4N91A 2DXRA 3G3GA 3UP9A 1ZIUA 4KFQA 4WEPA 2RINA 4LQ2A 3W15C 4XKPA 3FJGA 1AMFA 3MVXA 1USYE 2R71A 3EKIA 3V89B 4ZEDA 1Z7ME 4R6HA 2FVZA 3HSTA 4EXLA 3BKIB 3KN3A 2HFBA 3G3FA 1H76A 4DZ1A 2B4MA 2O51A 3KN8A 1R9QA 2F6GA 3CI8A 5IZ1A 4EDPA 1G0IA 4KPTA 2XXYA 3PGFA 2RKMA 2XXWA 3M3LA 4P9KA 2D3IA 1QUJA 1SW4A 3QMFA 4U1ZA 1H44A 2OK2A 2Y7IA 4JBZA 4JWYA 5HPQA 2P0SA 3HPIA 1UTHB 1B9JA 2HXWA 1SQYA 3I3VA 4GX4A 3FIRA 5H8FA 4TLMB 4ESWA 1MM6A 2H5YA 3IK6B 2F3BA 2L5VA 2Q9TA 3E3KA 4OEUA 3TAJA 2QPQA 4NF6B 5AA4A 1MXXA 3CSBA 3KBZA 2VPOA 5AA1A 1I6QA 4XKNA 3Q29A 1JQFA 4N6KA 4N8GA 5I58A 2CZHA 4PFYA 3L6GA 4NF4A 1SW5A 2Q89A 3OSQA 4R9FA 4F3SA 3S9EA 4G8NA 3MVZA 3OO6A 1SYHA 1GV8A 1FPKA 1JW1A 2XXQA 3M3KA 5EQAA 1NFTA 4BDNA 4ZE9A 3G3JA 4IGTA 3DP4A 2ZZWA 4N6PA 4NF8B 1MRPA 4R9GA 3OENA 2DWIA 1N3XA 4NTLA 3IR1A 2HCAA 5FBPA 1LAXA 1JETA 4NAPA 2R9JA 4G68B 3O9PA 1USYH 4PFUA 5J16A 2OBGA 4R6YA 1INPA 2UVHA 3KJ7A 2Y84A 1UTBB 2OJTA 3CFZA 4PAIA 4F3PA 5ET6A 1JW4A 1Y4CA 3CSGA 4NGUA 2CEYA 1JEUA 1Q1KA 3FGSA 4DXCA 1FPEA 1MG1A 4O7MA 1MXWA 4MMPA 2ZNTA 1FBPA 3UA8A 3FZVA 4EQ9A 5I57A 4QFPA 3T66A 2ALUA 2HQ0A 1MS7A 4MNCA 3QYTA 3A29A 1ZKBA 2PX1A 4PGNA 3TZAA 1HSJA 2Y7RA 3RY3A 1N7XA 3FATA 3OO9A 3MBPA 5CRYA 2P2AA 4ZEKA 3JZJA 5H8QB 2QS4A 1ZMGA 2B4LA 3H06B 1OQHA 2XXRA 5I59B 2PYYA 1TFDA 1R6ZA 2XX7A 2FBPA 4MX6A 2X7QA 2XA5A 1XC1A 4C1UA 4UA8A 4P0GA 4NF5B 1FTAA 3EPEA 3ODBA 1R9LA 2GH9A 3SETA 4KYEA 3IOWA 3QSLA 1JW5A 3SZPA 2I3WA 4NEDA 3ILTB 4KXPA 2HXRA 4PDHA 3HHGA 2XXUA 4QSEA 1KA1A 1Q9DA 1XOCA 3QUJA 1M5BA 2R6GE 3THIA 1S50A 5HBCA 4R6KA 5EYGA 2PFYA 4IB2A 2Z8DA 3SESA 3H6TA 3KSJA 3S9MC 3RUMA 5ET7A 4Q8RA 1YTVA 4H5FA 1MQHA 3C9HA 4NQ8A 1DPPA 4ISUA 3G3KA 1AH5A 2X26A 2OX3A 3E79A 4AB5A 2AYSA 4I1DA 3O66A 4H8IA 2F7AA 3IAZA 4P1LA 2ZNSA 4N07A 1B51A 4LA9A 3VDFA 4MFIA 4XEQA 1FBHA 3PPQA 4K3FA 2I58A 1A8FA 2B3FA 1NNKA 2QMWA 2O68A 3PU5A 3CVGA 5H8HB 1QKBA 1YXIA 2Z23A 1B3HA 5IM2A 4GWXA 1K9YA 1TFAA 5ELVA 2P1SA 4PGPA 2HEUA 1TT1A 2YJPA 4G77A 1T0KA 1VFEA 5ET5A 5I2KB 1SDXA 1LFIA 1MPDA 3B6QA 2H99A 3I6VA 2DWHA 1FBGA 3D4GA 5JEIA 5I56A 4GXAA 3LUZA 4DE8A 1OLAA 5EYFA 4F1UA 1SD3A 3ECRA 3TCFA 5EQ7A 4ZZEA 3MC2A 2V93A 5DEXA 4P3LA 3O2AA 3T1BA 2NXOA 5DVIA 3TODA 2PT2A 4YKIA 3TFLA 4H6DA 2OWTA 4H0WA 1TXFA 5F1QA 4PFTA 4I8CA 2DSFA 2I49A 3SERA 2UVJA 4GWYA 5A5LA 3MZBA 3GYYA 5JTYB 2I0BA 3RT6B 4NE4A 1MM7A 4OTEA 5T3JA 1SI0A 1I69A 4X04A 4DXUA 2F5XA 1SW1A 4GFRA 3GXAA 3IL1B 4HTGA 2I4BA 4GIZA 4F39A 4R2FA 4OESA 2REJA 3M8UA 1IMDA 4I3EA 3PUYE 4I3YA 3AXFA 3SEVA 4OXVA 1H3DA 1D3KA 1IZ1A 2D5WA 3C32A 2WX9A 1H43A 2YLNA 2O1MA 4DDDA 4OEVA 3SDFA 2QJEA 3IJOB 4BLAA 4KR5A 3EHSA 3W9WA 3K2DA 4RPOA 3PPRA 3I5OA 2Y7KA 3S9LC 1JEVA 2H25A 2MKZA 2WYKA 1B5JA 1FRPA 1Q35A 3OEKA 1FJ6A 5F24A 4GQOA 1D9VA 4U23A 2Q2AA 3N6TA 1IXIA 3CG1A 4MIJA 3IX1A 3B50A 2OWZA 2P3VA 2VD2A 2REGA 3FBPA 5A5XB 2QVRA 4OETA 1LSTA 1LGBC 1DMBA 1B4ZA 5LOMA 1URDA 1IIWA 1Y3NA 4GRKA 5TPAA 1YCJA 4NHBA 2HZLA 4KCDA 3MAMA 5IZ3B 1MDP1 4OZ9A 2Y5KA 3UIFA 3BIGA 3E4RA 4EUOA 1Y3QA 1SVXB 5IAIA 1NV6A 1ZTYA 3KG2A 1CNQA 4H67A 3TUSA 2G93A 5H8NB 4BDRA 3D4CA 3K6UA 1QULA 2Q8JA 3U1OA 1NUYA 3MSTA 4G2ZA 2CZIA 3TCGA 2F97A 1XVXA 2H4IA 4QF9A 1SYIA 2ZXTA 3FASA 1MQGA 3RPLB 3CFXA 4X1DA 3K01A 4NF0A 1FPDA 1AL3A 1LCFA 4OANA 4X9TA 1TWYA 2Y7PA 4OERA 5LTCA 1LBXA 4OVRA 4YZZA 3ROJA 1GR2A 1MY1A 3TQWA 1PC3A 1QUKA 4GWUA 4KYSA 2UVGA 4MCOA 1M5FA 4PBHA 4YKPA 3KFMA 4FJPA 1BLFA 5I3SA 3VVFA 4P11A 2OWSA 4DI4B 1MY4A 4UACA 2F36A 1VFDA 1PDAA 4MBPA 1B3GA 3CHGA 1UIVA 3OD7A 3NOHA 4C0RA 1B5IA 5FHMA 5JK4A 2HHMA 1IITA 4G8HA 3A3UA 3FV1A 4PETA 1RYXA 4FIMA 5F7VA 1QW0A 1FBFA 4ELQA 4DCXA 4ONYA 4O3BA 2VD3A 2OLBA 3TTNA 3UK4A 4FAJA 4AS5A 5H8FB 4OHNA 5AA2D 2GRVA 3VXCA 1B52A 4R75A 1IMFA 3E9XA 4GXSB 1B4HA
chains in the Genus database with same CATH topology
2DXYA 3G7WA 3O97A 5AA4B 1FTLA 4DLDA 2PVUA 1MXVA 1J1NA 3OMBA 2UYFA 3TMGA 1LBBA 2RC9A 5CI5A 4KCCA 5I58B 3TDJA 4FEBA 4NF4B 2BJJX 1B7ZA 3K6XA 4ELOA 3MPLA 2IA4A 5FTIA 1M5DA 2G29A 4U2RA 3TTMA 4OVJA 5KZTA 4KQPA 2ONKE 5FHNA 2VGQA 1IXHA 2Y7WA 1MQJA 4O3CA 2Z8FA 1URGA 2XX9A 4Q0CA 1B05A 1OLCA 3PMXA 1B32A 3USDA 4JXIA 3K02A 3Q28A 3T9XB 3H6WA 3OO7A 4OENA 1FQDA 5FHOA 5ITPA 2ZYKA 2NOOA 2F34A 1LAHE 3SEWA 5ICTA 4WKMA 1OQGA 4JB7A 4NF6A 1IUDA 4ECFA 4YMAA 4F2OA 1GVCA 2NUVA 3P7IA 4MH5A 1B3LA 1N7WA 3IJXB 1A99A 3BBRA 4DXBA 4G4PA 1CE2A 5KDTA 3VV5A 5I57B 2E0SA 4H1XA 1JNFA 3VLUA 1FTMA 3U8QA 3VVEA 4ZZAA 3TEPA 3C33A 4IY5A 5AA2A 3EN3A 5DTBA 2IEEA 3FJMA 3FXUA 4ZEIA 1B0HA 2THIA 1OMPA 1US5A 2FYIA 3PPOA 1A54A 4JSDA 4HCYA 1NMUA 1MPCA 3O6GA 1UTBA 2O6AA 3LSWA 1FQEA 2PMSA 4FECA 4MLQA 5BWJA 4F1VA 3LSFB 4ND9A 3FVNA 3MZ9A 2QL3A 3QUFA 1XHYA 3BFUA 2ZYOA 3CIJA 2DWJA 2FNCA 3T9VA 4KI0E 4JDFA 5KCJA 1LB8A 3MVWA 4PE5B 1B1HA 3GLBA 4RJZA 4H5GA 2ESNA 4XIGQ 1N04A 2XXIA 1MY2A 2ZYMA 1GTKA 4R74A 2XXTA 3ZKKA 2DWAA 2F78A 4QFNA 2RCBA 5CC2A 2W7YA 3B6TA 3M3FA 3R26A 2V25A 2Z8EA 3U72A 5DVFA 3KSXA 3VFJA 3O28A 4YMBA 5B70A 4U1OA 3L6HA 2V3UA 1US4A 3MVYA 3A09A 3C4MA 5CMKA 2RC7A 1Y1ZA 4R2BA 4F18A 4IO2A 3V8XB 3W9VA 3K00A 1LB9A 4ZEFA 3SEXA 2PT1A 3N26A 3EHUA 4F22A 2UYEA 5I84A 5I56B 3ZKLA 2HZKA 4TLLB 1B6HA 4R73A 1RYOA 4ZE8A 2HAUA 4LUBA 3T96B 3CRBA 5DEXB 1N0TA 2QMXA 5AA3A 3OELA 5J1DA 1UIUA 3VVDA 4GF8A 4U22A 3ZS6A 4F19A 2O69A 2GHAA 4BDLA 2O7UA 4RPNA 3RQTA 4YAHX 1P1OA 4HW8A 1B3EA 4LQ5A 5L9MA 5H8HA 3PPNA 3FUZA 3K0VA 1ELJA 3T93B 4GL0A 1LAGE 1IXCA 3PUZE 4LZ8A 3FVOA 2E1SA 3V5AA 2DE3A 1QVSA 1EH3A 3U93A 1MXYA 2I48A 4LZ7A 1OVBA 3T22A 3VE1B 1Y4TA 1PEBA 2XXHA 4GD5A 1KWHA 4GVOA 2NWJA 3HN0A 2QRYA 5CMCA 3K4UA 1MH4A 2A5SA 3SEYA 3KEIA 1FQAA 4P0IA 3TTLA 3FXQA 4H65A 1LBCA 3FVKA 3E13X 5IKBA 1ANFA 2XXXA 1FW0A 4ZDMA 1I6AA 1NNFA 1FQCA 3QK6A 2I0CA 4PFWA 2O84X 2ONRA 5TPAB 2DE4A 3FJ7A 4FE8A 1F9BA 3RN8A 4QFKA 3MPKA 4TOZA 2H9BA 4POWA 3TTRA 4AQ4A 2O7IA 3IORA 3PMWA 1M5CA 2B65A 1N76A 4O3AA 1ZBMA 3PD8A 4IO6A 1WVJA 2Q88A 1UQWA 1ATGA 3KOTA 5B7DA 3H03A 3QAXA 1POTA 4M1VA 3O6HA 3PD9A 4RNSA 2RCAA 1QKAA 3PUVE 3S2VA 1DTGA 4N13A 3S4UA 1BP5A 3LR1A 4QSCA 2RC8A 4F1YA 1P99A 3WAEA 4BDQA 3C36A 5I2NA 1P1WA 3Q27A 4C1TA 4OWDA 5L8DA 4E0XA 4U21A 3V83A 4YKKA 2A5TA 4F3GA 1MPBA 2XXVA 5DYHA 3H6UA 3EHTA 4RXLA 3C34A 3GBAA 4YU0A 4BDMA 3B7DA 5TP9A 2VOZA 3DELB 4GOTA 1N3WA 4X1BA 3MJNA 2B3BA 2F35A 1B3FA 2F7BA 3A3CA 1FQFA 1MXUA 1MQIA 2ZYNA 2QS3A 3FV2A 4OQOA 4XKQA 4HS7A 3RPWA 3VXBA 4M4GA 4F3BA 3LSXA 2ZNUA 3PMVA 2LAOA 4JWXA 2AL4A 2Z22A 1PBQA 1CB6A 1O63A 4MF3A 3DM0A 4YB7A 4OMBA 1FCKA 1NH8A 4QFLA 4I62A 2M8CA 2F7CA 4LVQA 4LP2B 1WDNA 4F2QA 1B7HA 4GLIA 2XD3A 3HV1A 4KD5A 1B58A 1P1NA 2XHDA 1JVXA 1EZOA 2I3VA 2I4CA 1LAFE 3DP6A 3RGYA 3UORA 2UXAA 2V3TA 4IO4A 1N84A 4ZS9A 1VSOA 5CMBA 1DTZA 2X7PA 4U4SA 3KOSA 2ONSA 3IB1A 4JWOA 3TPAA 3QIMA 3TYHA 1YPNA 3GBBA 3MWBA 2DP8A 1SBPA 1IEJA 1B1XA 1NL5A 1RKMA 4E0WA 4OYVA 1FQBA 1BKAA 1A7LA 1UTHA 3CR9A 4QHQA 2FA7A 3RT8A 3ZSFA 1HSLA 1LLSA 5CBRA 1R1NA 1PB9A 2ABHA 2CMOA 4QSDA 1POY1 1XVYA 5KDTB 4LATA 4IO5A 3OOAA 4BDOA 5K2YA 3T9HB 3RLFE 1D4NA 3OEMA 4QRZA 1I6BA 1MH3A 2F8DA 3HHFA 1MY3A 5AA2B 4Z7EA 3JV9A 3WAFA 4F29A 3TKDA 3C31A 1MDQA 3HCQA 3JYRA 4FORA 3IB2A 2GFEA 3EQ1A 4NF8A 4IGRA 1OIBA 1JVYA 2ANJA 1IQ7A 2HAVA 4FATA 1EU8A 1B40A 3UGWA 3R7XA 2AL5A 4G68A 3N5LA 2QS2A 1MQDA 4KYDA 3R6UA 2YPNA 4OFJA 4NMYA 3OSRA 1LCTA 3CFLA 4GL8A 1ZJLA 3K1NA 3DP8A 3Q25A 2XX8A 5KCJB 3MZ1A 3CG3A 2DYXA 3IOVA 5TU0A 4OFOA 4RK9A 1D9YA 5L9SA 1NNTA 4YKJA 3SKPA 1PB8A 2RF1A 1H45A 3F11A 3OO8A 1BTJA 4H8JA 4L17A 3KZGA 1O7TA 1Y20A 3ILUB 3RTWB 1DOTA 2DS9A 5H8QA 1DPEA 5CMMA 4RYAA 3TQLA 5I59A 5EHMA 4ZECA 3FVGA 3G3HA 4PQJA 5HM4B 4DCYA 1S7YA 5BUUA 4IO7A 1B46A 1II5A 2XD2A 1XS5A 1AIVA 4NF5A 2KLFA 3N6UA 2WKYA 4GWOA 2VP1A 2NVUB 5DVJA 3PUXE 2PBWA 3BFTA 1PB7A 2I6EA 2DVCA 3VLVA 4XTCQ 4YB6A 3MP8A 1NKXA 4NWDA 4WEDA 4X48A 1SW2A 4EXKA 3IO6A 1WODA 5M2VA 3K6VA 5ICQA 3IO4A 3MP1A 3GZGA 1B7UA 2D21A 5CBSA 1ZU0A 2F6PA 3DLNA 4ELRA 3HO7A 3H4ZA 5ITOA 1B5HA 2VHAA 3KGCA 1QJMA 1FTOA 4HCWA 4WXJA 4LONB 2GHBA 3Q26A 2UVIA 3PUWE 1P1UA 4YICA 3TELA 4YB5A 1Y1MA 3H6VA 4DIGA 3TTKA 3OXNA 3U94A 4ELPA 3G3IA 5K2XA 3PV0E 1O64A 1DSNA 1QUIA 4Q5TA 3TCHA 3K1PA 1LFGA 3RTFB 4EQ7A 3O6IA 1NH7A 1URSA 5I2KA 1XT8A 3RNNA 4U4XA 3FXRA 2H98A 4MLVA 4QFOA 1A55A 1OVTA 3T9UA 4G68C 3MUQA 2QS1A 2V3QA 4THIA 1MY0A 3U92A 2V84A 3EF7A 3VLWA 3LUYA 1S9TA 3LSLA 1HSEA 2CZLA 4JSOA 4OFLA 3ONMA 2DE2A 1VE4A 5JTYA 1Z7NE 2Q2CA 2QSXA 5DT6A 3SEUA 1BIYA 3N94A 3S9NC 1MXZA 3O29A 4IY6A 3B6WA 3UN6A 3KBRA 4G8MA 3H7MA 5ISUA 1EZ9A 1YAEA 5I2NB 4LZ5A 1ZLQA 3MQ9A 1SI1A 3FD3A 2XXPA 2OCUA 4Z0IA 2O1LA 2A5TB 4Q30B 4RA1A 4AB6A 1B0LA 4ZEBA 4NWCA 2OZZA 4EF1A 4ESXA 5TP9B 1B2HA 5EHSA 4IO3A 5FTHA 4RY1A 1FTKA 5A5XA 1M5EA 4FEDA 3LC8A 4I9DA 3KJTA 3IOTA 3PPPA 3C35A 1GGGA 1A40A 5AE4A 4F31B 1IXGA 4POXA 3MW0A 3IOUA 2DQVA 1LFHA 2DVZA 4PP0A 4RK2A 1P1QA 3QXMA 5CM6A 5L9OA 4R72A 5H8NA 2DOJA 4TQUQ 4EQBA 1NNPA 1Y3PA 1VR5A 3MP6A 1AOVA 1EZPA 2ZMBA 3K6WA 3KN7A 4XXUA 5H8SA 4XKRA 3K1MA 3LBSA 1FTJA 3H3GA 1A8EA 4KHZE 1PBPA 2AIXA 1Y9UA 4EF2A 3IB0A 1L5TA 2DXRA 3G3GA 3UP9A 1ZIUA 4KFQA 4WEPA 2RINA 4LQ2A 3W15C 4XKPA 3FJGA 1AMFA 3MVXA 1USYE 2R71A 3V89B 4ZEDA 1Z7ME 4R6HA 3HSTA 4EXLA 3BKIB 3KN3A 2HFBA 3G3FA 1H76A 4DZ1A 2O51A 3KN8A 1R9QA 2F6GA 3CI8A 4EDPA 4KPTA 2XXYA 3PGFA 2RKMA 2XXWA 3M3LA 2D3IA 1QUJA 1SW4A 4U1ZA 1H44A 2OK2A 2Y7IA 4JBZA 4JWYA 5HPQA 2P0SA 3HPIA 1UTHB 1B9JA 2HXWA 1SQYA 3I3VA 3FIRA 5H8FA 4TLMB 4ESWA 1MM6A 2H5YA 3IK6B 2Q9TA 3E3KA 4OEUA 3TAJA 2QPQA 4NF6B 5AA4A 1MXXA 3CSBA 5AA1A 1I6QA 4XKNA 3Q29A 1JQFA 5I58A 4PFYA 3L6GA 4NF4A 1SW5A 2Q89A 3OSQA 4R9FA 4F3SA 3S9EA 4G8NA 3MVZA 3OO6A 1SYHA 1GV8A 1JW1A 2XXQA 3M3KA 1NFTA 4BDNA 4ZE9A 3G3JA 4IGTA 3DP4A 4N6PA 4NF8B 1MRPA 4R9GA 3OENA 2DWIA 1N3XA 4NTLA 3IR1A 2HCAA 1LAXA 1JETA 2R9JA 4G68B 3O9PA 1USYH 4PFUA 2OBGA 4R6YA 2UVHA 3KJ7A 2Y84A 1UTBB 2OJTA 3CFZA 4F3PA 1JW4A 1Y4CA 3CSGA 1JEUA 1Q1KA 3FGSA 4DXCA 1MG1A 1MXWA 2ZNTA 3UA8A 3FZVA 4EQ9A 5I57A 4QFPA 3T66A 2ALUA 2HQ0A 1MS7A 3QYTA 1ZKBA 2PX1A 3TZAA 1HSJA 2Y7RA 3RY3A 1N7XA 3FATA 3OO9A 3MBPA 5CRYA 2P2AA 4ZEKA 3JZJA 5H8QB 2QS4A 1ZMGA 3H06B 1OQHA 2XXRA 5I59B 2PYYA 1TFDA 1R6ZA 2XX7A 2X7QA 1XC1A 4C1UA 4UA8A 4P0GA 4NF5B 3ODBA 3EPEA 1R9LA 2GH9A 3SETA 4KYEA 3IOWA 3QSLA 1JW5A 2I3WA 4NEDA 3ILTB 3HHGA 2XXUA 4QSEA 1XOCA 3QUJA 1M5BA 2R6GE 3THIA 1S50A 5HBCA 4R6KA 4IB2A 2Z8DA 3SESA 3H6TA 3KSJA 3S9MC 3RUMA 4Q8RA 1YTVA 4H5FA 1MQHA 3C9HA 1DPPA 4ISUA 3G3KA 1AH5A 2X26A 4AB5A 2AYSA 4I1DA 3O66A 4H8IA 2F7AA 3IAZA 2ZNSA 4N07A 1B51A 4LA9A 3VDFA 4MFIA 3PPQA 4K3FA 2I58A 1A8FA 2B3FA 1NNKA 2QMWA 2O68A 3PU5A 3CVGA 5H8HB 1QKBA 2Z23A 1B3HA 1TFAA 5ELVA 2P1SA 2HEUA 1TT1A 2YJPA 4G77A 1T0KA 1VFEA 5I2KB 1SDXA 1LFIA 1MPDA 3B6QA 2H99A 3I6VA 2DWHA 3D4GA 5JEIA 5I56A 4GXAA 4DE8A 1OLAA 5EYFA 4F1UA 1SD3A 3ECRA 3TCFA 4ZZEA 3MC2A 2V93A 5DEXA 3O2AA 2NXOA 5DVIA 3TODA 2PT2A 4YKIA 3TFLA 4H6DA 2OWTA 4H0WA 1TXFA 5F1QA 4PFTA 4I8CA 2DSFA 2I49A 3SERA 2UVJA 3MZBA 5JTYB 2I0BA 3RT6B 4NE4A 1MM7A 4OTEA 1SI0A 1I69A 4DXUA 2F5XA 1SW1A 4GFRA 3GXAA 3IL1B 4HTGA 2I4BA 4GIZA 4F39A 4R2FA 4OESA 2REJA 3M8UA 3PUYE 3AXFA 3SEVA 4OXVA 1H3DA 1D3KA 1IZ1A 2D5WA 3C32A 1H43A 2YLNA 2O1MA 4DDDA 4OEVA 3SDFA 2QJEA 3IJOB 4BLAA 4KR5A 3EHSA 3W9WA 3K2DA 4RPOA 3PPRA 3I5OA 2Y7KA 3S9LC 1JEVA 2H25A 1B5JA 1Q35A 3OEKA 4GQOA 1D9VA 4U23A 2Q2AA 3N6TA 1IXIA 3CG1A 3IX1A 2VD2A 2REGA 5A5XB 4OETA 1LSTA 1LGBC 1DMBA 1B4ZA 5LOMA 1URDA 1IIWA 1Y3NA 4GRKA 5TPAA 1YCJA 2HZLA 4KCDA 3MAMA 1MDP1 4OZ9A 3UIFA 3E4RA 4EUOA 1Y3QA 1SVXB 5IAIA 1ZTYA 3KG2A 4H67A 3TUSA 2G93A 5H8NB 4BDRA 3D4CA 3K6UA 1QULA 2Q8JA 3U1OA 4G2ZA 3TCGA 2F97A 1XVXA 2H4IA 4QF9A 1SYIA 2ZXTA 3FASA 1MQGA 3CFXA 4X1DA 3K01A 1AL3A 1LCFA 4X9TA 1TWYA 2Y7PA 4OERA 4YZZA 1GR2A 1MY1A 3TQWA 1PC3A 1QUKA 4KYSA 2UVGA 1M5FA 4YKPA 3KFMA 4FJPA 1BLFA 3VVFA 4P11A 2OWSA 1MY4A 4UACA 2F36A 1VFDA 1PDAA 4MBPA 1B3GA 1UIVA 3OD7A 4C0RA 1B5IA 5FHMA 5JK4A 1IITA 4G8HA 3A3UA 3FV1A 4PETA 1RYXA 4FIMA 5F7VA 1QW0A 4ELQA 4DCXA 4ONYA 4O3BA 2VD3A 2OLBA 3TTNA 3UK4A 4FAJA 5H8FB 4OHNA 5AA2D 2GRVA 3VXCA 1B52A 4R75A 3E9XA 4GXSB 1B4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXY A;  3G7W A;  3O97 A;  5AA4 B;  1FTL A;  4DLD A;  2PVU A;  1MXV A;  1J1N A;  3OMB A;  2UYF A;  3TMG A;  1LBB A;  2RC9 A;  5CI5 A;  4KCC A;  5I58 B;  3TDJ A;  4FEB A;  4NF4 B;  2BJJ X;  1B7Z A;  3K6X A;  4ELO A;  3MPL A;  2IA4 A;  5FTI A;  1M5D A;  2G29 A;  4U2R A;  3TTM A;  4OVJ A;  5KZT A;  4KQP A;  2ONK E;  5FHN A;  2VGQ A;  1IXH A;  2Y7W A;  1MQJ A;  4O3C A;  2Z8F A;  1URG A;  2XX9 A;  4Q0C A;  1B05 A;  1OLC A;  3PMX A;  1B32 A;  3USD A;  4JXI A;  3K02 A;  3Q28 A;  3T9X B;  3H6W A;  3OO7 A;  4OEN A;  1FQD A;  5FHO A;  5ITP A;  2ZYK A;  2NOO A;  2F34 A;  1LAH E;  3SEW A;  5ICT A;  4WKM A;  1OQG A;  4JB7 A;  4NF6 A;  1IUD A;  4ECF A;  4YMA A;  4F2O A;  1GVC A;  2NUV A;  3P7I A;  4MH5 A;  1B3L A;  1N7W A;  3IJX B;  1A99 A;  3BBR A;  4DXB A;  4G4P A;  1CE2 A;  5KDT A;  3VV5 A;  5I57 B;  2E0S A;  4H1X A;  1JNF A;  3VLU A;  1FTM A;  3U8Q A;  3VVE A;  4ZZA A;  3TEP A;  3C33 A;  4IY5 A;  5AA2 A;  3EN3 A;  5DTB A;  2IEE A;  3FJM A;  3FXU A;  4ZEI A;  1B0H A;  2THI A;  1OMP A;  1US5 A;  2FYI A;  3PPO A;  1A54 A;  4JSD A;  4HCY A;  1NMU A;  1MPC A;  3O6G A;  1UTB A;  2O6A A;  3LSW A;  1FQE A;  2PMS A;  4FEC A;  4MLQ A;  5BWJ A;  4F1V A;  3LSF B;  4ND9 A;  3FVN A;  3MZ9 A;  2QL3 A;  3QUF A;  1XHY A;  3BFU A;  2ZYO A;  3CIJ A;  2DWJ A;  2FNC A;  3T9V A;  4KI0 E;  4JDF A;  5KCJ A;  1LB8 A;  3MVW A;  4PE5 B;  1B1H A;  3GLB A;  4RJZ A;  4H5G A;  2ESN A;  4XIG Q;  1N04 A;  2XXI A;  1MY2 A;  2ZYM A;  1GTK A;  4R74 A;  2XXT A;  3ZKK A;  2DWA A;  2F78 A;  4QFN A;  2RCB A;  5CC2 A;  2W7Y A;  3B6T A;  3M3F A;  3R26 A;  2V25 A;  2Z8E A;  3U72 A;  5DVF A;  3KSX A;  3VFJ A;  3O28 A;  4YMB A;  5B70 A;  4U1O A;  3L6H A;  2V3U A;  1US4 A;  3MVY A;  3A09 A;  3C4M A;  5CMK A;  2RC7 A;  1Y1Z A;  4R2B A;  4F18 A;  4IO2 A;  3V8X B;  3W9V A;  3K00 A;  1LB9 A;  4ZEF A;  3SEX A;  2PT1 A;  3N26 A;  3EHU A;  4F22 A;  2UYE A;  5I84 A;  5I56 B;  3ZKL A;  2HZK A;  4TLL B;  1B6H A;  4R73 A;  1RYO A;  4ZE8 A;  2HAU A;  4LUB A;  3T96 B;  3CRB A;  5DEX B;  1N0T A;  2QMX A;  5AA3 A;  3OEL A;  5J1D A;  1UIU A;  3VVD A;  4GF8 A;  4U22 A;  3ZS6 A;  4F19 A;  2O69 A;  2GHA A;  4BDL A;  2O7U A;  4RPN A;  3RQT A;  4YAH X;  1P1O A;  4HW8 A;  1B3E A;  4LQ5 A;  5L9M A;  5H8H A;  3PPN A;  3FUZ A;  3K0V A;  1ELJ A;  3T93 B;  4GL0 A;  1LAG E;  1IXC A;  3PUZ E;  4LZ8 A;  3FVO A;  2E1S A;  3V5A A;  2DE3 A;  1QVS A;  1EH3 A;  3U93 A;  1MXY A;  2I48 A;  4LZ7 A;  1OVB A;  3T22 A;  3VE1 B;  1Y4T A;  1PEB A;  2XXH A;  4GD5 A;  1KWH A;  4GVO A;  2NWJ A;  3HN0 A;  2QRY A;  5CMC A;  3K4U A;  1MH4 A;  2A5S A;  3SEY A;  3KEI A;  1FQA A;  4P0I A;  3TTL A;  3FXQ A;  4H65 A;  1LBC A;  3FVK A;  3E13 X;  5IKB A;  1ANF A;  2XXX A;  1FW0 A;  4ZDM A;  1I6A A;  1NNF A;  1FQC A;  3QK6 A;  2I0C A;  4PFW A;  2O84 X;  2ONR A;  5TPA B;  2DE4 A;  3FJ7 A;  4FE8 A;  1F9B A;  3RN8 A;  4QFK A;  3MPK A;  4TOZ A;  2H9B A;  4POW A;  3TTR A;  4AQ4 A;  2O7I A;  3IOR A;  3PMW A;  1M5C A;  2B65 A;  1N76 A;  4O3A A;  1ZBM A;  3PD8 A;  4IO6 A;  1WVJ A;  2Q88 A;  1UQW A;  1ATG A;  3KOT A;  5B7D A;  3H03 A;  3QAX A;  1POT A;  4M1V A;  3O6H A;  3PD9 A;  4RNS A;  2RCA A;  1QKA A;  3PUV E;  3S2V A;  1DTG A;  4N13 A;  3S4U A;  1BP5 A;  3LR1 A;  4QSC A;  2RC8 A;  4F1Y A;  1P99 A;  3WAE A;  4BDQ A;  3C36 A;  5I2N A;  1P1W A;  3Q27 A;  4C1T A;  4OWD A;  5L8D A;  4E0X A;  4U21 A;  3V83 A;  4YKK A;  2A5T A;  4F3G A;  1MPB A;  2XXV A;  5DYH A;  3H6U A;  3EHT A;  4RXL A;  3C34 A;  3GBA A;  4YU0 A;  4BDM A;  3B7D A;  5TP9 A;  2VOZ A;  3DEL B;  4GOT A;  1N3W A;  4X1B A;  3MJN A;  2B3B A;  2F35 A;  1B3F A;  2F7B A;  3A3C A;  1FQF A;  1MXU A;  1MQI A;  2ZYN A;  2QS3 A;  3FV2 A;  4OQO A;  4XKQ A;  4HS7 A;  3RPW A;  3VXB A;  4M4G A;  4F3B A;  3LSX A;  2ZNU A;  3PMV A;  2LAO A;  4JWX A;  2AL4 A;  2Z22 A;  1PBQ A;  1CB6 A;  1O63 A;  4MF3 A;  3DM0 A;  4YB7 A;  4OMB A;  1FCK A;  1NH8 A;  4QFL A;  4I62 A;  2M8C A;  2F7C A;  4LVQ A;  4LP2 B;  1WDN A;  4F2Q A;  1B7H A;  4GLI A;  2XD3 A;  3HV1 A;  4KD5 A;  1B58 A;  1P1N A;  2XHD A;  1JVX A;  1EZO A;  2I3V A;  2I4C A;  1LAF E;  3DP6 A;  3RGY A;  3UOR A;  2UXA A;  2V3T A;  4IO4 A;  1N84 A;  4ZS9 A;  1VSO A;  5CMB A;  1DTZ A;  2X7P A;  4U4S A;  3KOS A;  2ONS A;  3IB1 A;  4JWO A;  3TPA A;  3QIM A;  3TYH A;  1YPN A;  3GBB A;  3MWB A;  2DP8 A;  1SBP A;  1IEJ A;  1B1X A;  1NL5 A;  1RKM A;  4E0W A;  4OYV A;  1FQB A;  1BKA A;  1A7L A;  1UTH A;  3CR9 A;  4QHQ A;  2FA7 A;  3RT8 A;  3ZSF A;  1HSL A;  1LLS A;  5CBR A;  1R1N A;  1PB9 A;  2ABH A;  2CMO A;  4QSD A;  1POY 1;  1XVY A;  5KDT B;  4LAT A;  4IO5 A;  3OOA A;  4BDO A;  5K2Y A;  3T9H B;  3RLF E;  1D4N A;  3OEM A;  4QRZ A;  1I6B A;  1MH3 A;  2F8D A;  3HHF A;  1MY3 A;  5AA2 B;  4Z7E A;  3JV9 A;  3WAF A;  4F29 A;  3TKD A;  3C31 A;  1MDQ A;  3HCQ A;  3JYR A;  4FOR A;  3IB2 A;  2GFE A;  3EQ1 A;  4NF8 A;  4IGR A;  1OIB A;  1JVY A;  2ANJ A;  1IQ7 A;  2HAV A;  4FAT A;  1EU8 A;  1B40 A;  3UGW A;  3R7X A;  2AL5 A;  4G68 A;  3N5L A;  2QS2 A;  1MQD A;  4KYD A;  3R6U A;  2YPN A;  4OFJ A;  4NMY A;  3OSR A;  1LCT A;  3CFL A;  4GL8 A;  1ZJL A;  3K1N A;  3DP8 A;  3Q25 A;  2XX8 A;  5KCJ B;  3MZ1 A;  3CG3 A;  2DYX A;  3IOV A;  5TU0 A;  4OFO A;  4RK9 A;  1D9Y A;  5L9S A;  1NNT A;  4YKJ A;  3SKP A;  1PB8 A;  2RF1 A;  1H45 A;  3F11 A;  3OO8 A;  1BTJ A;  4H8J A;  4L17 A;  3KZG A;  1O7T A;  1Y20 A;  3ILU B;  3RTW B;  1DOT A;  2DS9 A;  5H8Q A;  1DPE A;  5CMM A;  4RYA A;  3TQL A;  5I59 A;  5EHM A;  4ZEC A;  3FVG A;  3G3H A;  4PQJ A;  5HM4 B;  4DCY A;  1S7Y A;  5BUU A;  4IO7 A;  1B46 A;  1II5 A;  2XD2 A;  1XS5 A;  1AIV A;  4NF5 A;  2KLF A;  3N6U A;  2WKY A;  4GWO A;  2VP1 A;  2NVU B;  5DVJ A;  3PUX E;  2PBW A;  3BFT A;  1PB7 A;  2I6E A;  2DVC A;  3VLV A;  4XTC Q;  4YB6 A;  3MP8 A;  1NKX A;  4NWD A;  4WED A;  4X48 A;  1SW2 A;  4EXK A;  3IO6 A;  1WOD A;  5M2V A;  3K6V A;  5ICQ A;  3IO4 A;  3MP1 A;  3GZG A;  1B7U A;  2D21 A;  5CBS A;  1ZU0 A;  2F6P A;  3DLN A;  4ELR A;  3HO7 A;  3H4Z A;  5ITO A;  1B5H A;  2VHA A;  3KGC A;  1QJM A;  1FTO A;  4HCW A;  4WXJ A;  4LON B;  2GHB A;  3Q26 A;  2UVI A;  3PUW E;  1P1U A;  4YIC A;  3TEL A;  4YB5 A;  1Y1M A;  3H6V A;  4DIG A;  3TTK A;  3OXN A;  3U94 A;  4ELP A;  3G3I A;  5K2X A;  3PV0 E;  1O64 A;  1DSN A;  1QUI A;  4Q5T A;  3TCH A;  3K1P A;  1LFG A;  3RTF B;  4EQ7 A;  3O6I A;  1NH7 A;  1URS A;  5I2K A;  1XT8 A;  3RNN A;  4U4X A;  3FXR A;  2H98 A;  4MLV A;  4QFO A;  1A55 A;  1OVT A;  3T9U A;  4G68 C;  3MUQ A;  2QS1 A;  2V3Q A;  4THI A;  1MY0 A;  3U92 A;  2V84 A;  3EF7 A;  3VLW A;  3LUY A;  1S9T A;  3LSL A;  1HSE A;  2CZL A;  4JSO A;  4OFL A;  3ONM A;  2DE2 A;  1VE4 A;  5JTY A;  1Z7N E;  2Q2C A;  2QSX A;  5DT6 A;  3SEU A;  1BIY A;  3N94 A;  3S9N C;  1MXZ A;  3O29 A;  4IY6 A;  3B6W A;  3UN6 A;  3KBR A;  4G8M A;  3H7M A;  5ISU A;  1EZ9 A;  1YAE A;  5I2N B;  4LZ5 A;  1ZLQ A;  3MQ9 A;  1SI1 A;  3FD3 A;  2XXP A;  2OCU A;  4Z0I A;  2O1L A;  2A5T B;  4Q30 B;  4RA1 A;  4AB6 A;  1B0L A;  4ZEB A;  4NWC A;  2OZZ A;  4EF1 A;  4ESX A;  5TP9 B;  1B2H A;  5EHS A;  4IO3 A;  5FTH A;  4RY1 A;  1FTK A;  5A5X A;  1M5E A;  4FED A;  3LC8 A;  4I9D A;  3KJT A;  3IOT A;  3PPP A;  3C35 A;  1GGG A;  1A40 A;  5AE4 A;  4F31 B;  1IXG A;  4POX A;  3MW0 A;  3IOU A;  2DQV A;  1LFH A;  2DVZ A;  4PP0 A;  4RK2 A;  1P1Q A;  3QXM A;  5CM6 A;  5L9O A;  4R72 A;  5H8N A;  2DOJ A;  4TQU Q;  4EQB A;  1NNP A;  1Y3P A;  1VR5 A;  3MP6 A;  1AOV A;  1EZP A;  2ZMB A;  3K6W A;  3KN7 A;  4XXU A;  5H8S A;  4XKR A;  3K1M A;  3LBS A;  1FTJ A;  3H3G A;  1A8E A;  4KHZ E;  1PBP A;  2AIX A;  1Y9U A;  4EF2 A;  3IB0 A;  1L5T A;  2DXR A;  3G3G A;  3UP9 A;  1ZIU A;  4KFQ A;  4WEP A;  2RIN A;  4LQ2 A;  3W15 C;  4XKP A;  3FJG A;  1AMF A;  3MVX A;  1USY E;  2R71 A;  3V89 B;  4ZED A;  1Z7M E;  4R6H A;  3HST A;  4EXL A;  3BKI B;  3KN3 A;  2HFB A;  3G3F A;  1H76 A;  4DZ1 A;  2O51 A;  3KN8 A;  1R9Q A;  2F6G A;  3CI8 A;  4EDP A;  4KPT A;  2XXY A;  3PGF A;  2RKM A;  2XXW A;  3M3L A;  2D3I A;  1QUJ A;  1SW4 A;  4U1Z A;  1H44 A;  2OK2 A;  2Y7I A;  4JBZ A;  4JWY A;  5HPQ A;  2P0S A;  3HPI A;  1UTH B;  1B9J A;  2HXW A;  1SQY A;  3I3V A;  3FIR A;  5H8F A;  4TLM B;  4ESW A;  1MM6 A;  2H5Y A;  3IK6 B;  2Q9T A;  3E3K A;  4OEU A;  3TAJ A;  2QPQ A;  4NF6 B;  5AA4 A;  1MXX A;  3CSB A;  5AA1 A;  1I6Q A;  4XKN A;  3Q29 A;  1JQF A;  5I58 A;  4PFY A;  3L6G A;  4NF4 A;  1SW5 A;  2Q89 A;  3OSQ A;  4R9F A;  4F3S A;  3S9E A;  4G8N A;  3MVZ A;  3OO6 A;  1SYH A;  1GV8 A;  1JW1 A;  2XXQ A;  3M3K A;  1NFT A;  4BDN A;  4ZE9 A;  3G3J A;  4IGT A;  3DP4 A;  4N6P A;  4NF8 B;  1MRP A;  4R9G A;  3OEN A;  2DWI A;  1N3X A;  4NTL A;  3IR1 A;  2HCA A;  1LAX A;  1JET A;  2R9J A;  4G68 B;  3O9P A;  1USY H;  4PFU A;  2OBG A;  4R6Y A;  2UVH A;  3KJ7 A;  2Y84 A;  1UTB B;  2OJT A;  3CFZ A;  4F3P A;  1JW4 A;  1Y4C A;  3CSG A;  1JEU A;  1Q1K A;  3FGS A;  4DXC A;  1MG1 A;  1MXW A;  2ZNT A;  3UA8 A;  3FZV A;  4EQ9 A;  5I57 A;  4QFP A;  3T66 A;  2ALU A;  2HQ0 A;  1MS7 A;  3QYT A;  1ZKB A;  2PX1 A;  3TZA A;  1HSJ A;  2Y7R A;  3RY3 A;  1N7X A;  3FAT A;  3OO9 A;  3MBP A;  5CRY A;  2P2A A;  4ZEK A;  3JZJ A;  5H8Q B;  2QS4 A;  1ZMG A;  3H06 B;  1OQH A;  2XXR A;  5I59 B;  2PYY A;  1TFD A;  1R6Z A;  2XX7 A;  2X7Q A;  1XC1 A;  4C1U A;  4UA8 A;  4P0G A;  4NF5 B;  3ODB A;  3EPE A;  1R9L A;  2GH9 A;  3SET A;  4KYE A;  3IOW A;  3QSL A;  1JW5 A;  2I3W A;  4NED A;  3ILT B;  3HHG A;  2XXU A;  4QSE A;  1XOC A;  3QUJ A;  1M5B A;  2R6G E;  3THI A;  1S50 A;  5HBC A;  4R6K A;  4IB2 A;  2Z8D A;  3SES A;  3H6T A;  3KSJ A;  3S9M C;  3RUM A;  4Q8R A;  1YTV A;  4H5F A;  1MQH A;  3C9H A;  1DPP A;  4ISU A;  3G3K A;  1AH5 A;  2X26 A;  4AB5 A;  2AYS A;  4I1D A;  3O66 A;  4H8I A;  2F7A A;  3IAZ A;  2ZNS A;  4N07 A;  1B51 A;  4LA9 A;  3VDF A;  4MFI A;  3PPQ A;  4K3F A;  2I58 A;  1A8F A;  2B3F A;  1NNK A;  2QMW A;  2O68 A;  3PU5 A;  3CVG A;  5H8H B;  1QKB A;  2Z23 A;  1B3H A;  1TFA A;  5ELV A;  2P1S A;  2HEU A;  1TT1 A;  2YJP A;  4G77 A;  1T0K A;  1VFE A;  5I2K B;  1SDX A;  1LFI A;  1MPD A;  3B6Q A;  2H99 A;  3I6V A;  2DWH A;  3D4G A;  5JEI A;  5I56 A;  4GXA A;  4DE8 A;  1OLA A;  5EYF A;  4F1U A;  1SD3 A;  3ECR A;  3TCF A;  4ZZE A;  3MC2 A;  2V93 A;  5DEX A;  3O2A A;  2NXO A;  5DVI A;  3TOD A;  2PT2 A;  4YKI A;  3TFL A;  4H6D A;  2OWT A;  4H0W A;  1TXF A;  5F1Q A;  4PFT A;  4I8C A;  2DSF A;  2I49 A;  3SER A;  2UVJ A;  3MZB A;  5JTY B;  2I0B A;  3RT6 B;  4NE4 A;  1MM7 A;  4OTE A;  1SI0 A;  1I69 A;  4DXU A;  2F5X A;  1SW1 A;  4GFR A;  3GXA A;  3IL1 B;  4HTG A;  2I4B A;  4GIZ A;  4F39 A;  4R2F A;  4OES A;  2REJ A;  3M8U A;  3PUY E;  3AXF A;  3SEV A;  4OXV A;  1H3D A;  1D3K A;  1IZ1 A;  2D5W A;  3C32 A;  1H43 A;  2YLN A;  2O1M A;  4DDD A;  4OEV A;  3SDF A;  2QJE A;  3IJO B;  4BLA A;  4KR5 A;  3EHS A;  3W9W A;  3K2D A;  4RPO A;  3PPR A;  3I5O A;  2Y7K A;  3S9L C;  1JEV A;  2H25 A;  1B5J A;  1Q35 A;  3OEK A;  4GQO A;  1D9V A;  4U23 A;  2Q2A A;  3N6T A;  1IXI A;  3CG1 A;  3IX1 A;  2VD2 A;  2REG A;  5A5X B;  4OET A;  1LST A;  1LGB C;  1DMB A;  1B4Z A;  5LOM A;  1URD A;  1IIW A;  1Y3N A;  4GRK A;  5TPA A;  1YCJ A;  2HZL A;  4KCD A;  3MAM A;  1MDP 1;  4OZ9 A;  3UIF A;  3E4R A;  4EUO A;  1Y3Q A;  1SVX B;  5IAI A;  1ZTY A;  3KG2 A;  4H67 A;  3TUS A;  2G93 A;  5H8N B;  4BDR A;  3D4C A;  3K6U A;  1QUL A;  2Q8J A;  3U1O A;  4G2Z A;  3TCG A;  2F97 A;  1XVX A;  2H4I A;  4QF9 A;  1SYI A;  2ZXT A;  3FAS A;  1MQG A;  3CFX A;  4X1D A;  3K01 A;  1AL3 A;  1LCF A;  4X9T A;  1TWY A;  2Y7P A;  4OER A;  4YZZ A;  1GR2 A;  1MY1 A;  3TQW A;  1PC3 A;  1QUK A;  4KYS A;  2UVG A;  1M5F A;  4YKP A;  3KFM A;  4FJP A;  1BLF A;  3VVF A;  4P11 A;  2OWS A;  1MY4 A;  4UAC A;  2F36 A;  1VFD A;  1PDA A;  4MBP A;  1B3G A;  1UIV A;  3OD7 A;  4C0R A;  1B5I A;  5FHM A;  5JK4 A;  1IIT A;  4G8H A;  3A3U A;  3FV1 A;  4PET A;  1RYX A;  4FIM A;  5F7V A;  1QW0 A;  4ELQ A;  4DCX A;  4ONY A;  4O3B A;  2VD3 A;  2OLB A;  3TTN A;  3UK4 A;  4FAJ A;  5H8F B;  4OHN A;  5AA2 D;  2GRV A;  3VXC A;  1B52 A;  4R75 A;  3E9X A;  4GXS B;  1B4H A; 
#chains in the Genus database with same CATH topology
 2DXY A;  1DCU A;  3G7W A;  3O97 A;  2PFZ A;  5AA4 B;  1FTL A;  4DLD A;  2PVU A;  1MXV A;  1J1N A;  4PDD A;  3OMB A;  2UYF A;  3MYU A;  3TMG A;  1LBB A;  2RC9 A;  5CI5 A;  4KCC A;  5I58 B;  3TDJ A;  4FEB A;  4NF4 B;  2BJJ X;  1B7Z A;  3K6X A;  4ELO A;  3MPL A;  2IA4 A;  5FTI A;  1M5D A;  2KQZ A;  2G29 A;  2QVU A;  4U2R A;  3TTM A;  4OVJ A;  5KZT A;  1FSA A;  4P8B A;  4KQP A;  5ET8 A;  4PFI A;  4O7I A;  2ONK E;  5FHN A;  2VGQ A;  4PTK A;  1IXH A;  2Y7W A;  1MQJ A;  4O3C A;  2Z8F A;  1URG A;  2XX9 A;  4Q0C A;  1B05 A;  1OLC A;  3PMX A;  1B32 A;  3USD A;  2WYP A;  3K02 A;  4JXI A;  2KR0 A;  3Q28 A;  3H6W A;  3T9X B;  3OO7 A;  4OEN A;  1FQD A;  5FHO A;  5ITP A;  2ZYK A;  1NV2 A;  2NOO A;  2F34 A;  1LAH E;  3SEW A;  5ICT A;  4AS4 A;  4WKM A;  1OQG A;  4I40 A;  1NV1 A;  4QBA A;  4JB7 A;  4NF6 A;  1IUD A;  4ECF A;  4YMA A;  4F2O A;  1GVC A;  2NUV A;  3P7I A;  4MH5 A;  1B3L A;  1N7W A;  3IJX B;  1A99 A;  3BBR A;  4P56 A;  4DXB A;  4G4P A;  4H45 A;  1CE2 A;  5KDT A;  3VV5 A;  5I57 B;  2BJI A;  2E0S A;  4H1X A;  1JNF A;  3VLU A;  1FTM A;  3U8Q A;  3VVE A;  4ZZA A;  2XWV A;  3TEP A;  3C33 A;  4IY5 A;  5AA2 A;  3EN3 A;  5DTB A;  2IEE A;  3FJM A;  3FXU A;  4ZEI A;  1B0H A;  4MHF A;  2THI A;  1OMP A;  1US5 A;  2FYI A;  3PPO A;  1A54 A;  4JSD A;  2XXK A;  4HCY A;  1NMU A;  4NG7 A;  1MPC A;  3O6G A;  2VPN A;  1UTB A;  4GBV A;  2O6A A;  3LSW A;  1FQE A;  2PMS A;  4FEC A;  4MLQ A;  5BWJ A;  4F1V A;  3LSF B;  4ND9 A;  3FVN A;  3MZ9 A;  2QL3 A;  4PE3 A;  3QUF A;  1XHY A;  3BFU A;  2ZYO A;  3CIJ A;  2DWJ A;  2FNC A;  3T9V A;  4KI0 E;  1LEV A;  4JDF A;  5KCJ A;  1LB8 A;  3MVW A;  2QFL A;  4PE5 B;  1B1H A;  3GLB A;  4RJZ A;  4PBQ A;  4XF5 A;  4H5G A;  2ESN A;  4XIG Q;  1N04 A;  1EYI A;  2XXI A;  1MY2 A;  1LBW A;  2ZYM A;  1GTK A;  4R74 A;  2XXT A;  3ZKK A;  2DWA A;  2F78 A;  4QFN A;  2RCB A;  5CC2 A;  2W7Y A;  3B6T A;  3M3F A;  3R26 A;  4PFB A;  2V25 A;  2Z8E A;  3U72 A;  5DVF A;  3KSX A;  4PFR A;  3VFJ A;  3O28 A;  4YMB A;  5B70 A;  5IGA A;  4U1O A;  3L6H A;  2V3U A;  1US4 A;  3MVY A;  3A09 A;  3C4M A;  1EYK A;  5CMK A;  4G61 A;  2RC7 A;  1Y1Z A;  4R2B A;  4F18 A;  4IO2 A;  3V8X B;  3W9V A;  3K00 A;  1LB9 A;  4ZEF A;  3SEX A;  2PT1 A;  3N26 A;  3EHU A;  4F22 A;  2UYE A;  1FJ9 A;  5I84 A;  3FXB A;  5I56 B;  3ZKL A;  2HZK A;  4TLL B;  1B6H A;  4R73 A;  1RYO A;  4ZE8 A;  2HAU A;  4LUB A;  3T96 B;  3CRB A;  2HPG A;  4PF8 A;  5DEX B;  2R8T A;  1N0T A;  2QMX A;  3OEL A;  5AA3 A;  5J1D A;  1UIU A;  3VVD A;  4GF8 A;  4U22 A;  3ZS6 A;  4F19 A;  2O69 A;  2GHA A;  2PCR A;  4BDL A;  4HE2 A;  1NV3 A;  2O7U A;  4RPN A;  3RQT A;  2JJK A;  4YAH X;  1P1O A;  4HW8 A;  1B3E A;  4LQ5 A;  5L9M A;  5DW8 A;  5H8H A;  3PPN A;  3FUZ A;  4GBW A;  3K0V A;  1ELJ A;  1NUX A;  4MNP A;  3T93 B;  4GL0 A;  4PCD A;  1LAG E;  1IXC A;  4GX6 A;  3PUZ E;  4LZ8 A;  3FVO A;  2E1S A;  3V5A A;  2DE3 A;  4NN3 A;  1QVS A;  5LDZ A;  1EH3 A;  3U93 A;  1MXY A;  2I48 A;  4LZ7 A;  1OVB A;  1SPI A;  4O94 A;  3T22 A;  3VE1 B;  1Y4T A;  1PEB A;  2XXH A;  4GD5 A;  1KWH A;  4GVO A;  4JVD A;  2NWJ A;  3HN0 A;  4PF6 A;  3U65 A;  2QRY A;  5CMC A;  3K4U A;  1MH4 A;  2A5S A;  2Q8M A;  3SEY A;  3KEI A;  1FQA A;  4P0I A;  3TTL A;  3FXQ A;  4H65 A;  1IMC A;  1LBC A;  3FVK A;  3D1R A;  4O8M A;  3E13 X;  5IKB A;  4DI3 D;  2FIE A;  1ANF A;  1FBC A;  2XXX A;  1FW0 A;  4ZDM A;  4MJO A;  1NV7 A;  4MNI A;  1EYJ A;  1I6A A;  1NNF A;  1FQC A;  3QK6 A;  2I0C A;  4PFW A;  2O84 X;  2ONR A;  5TPA B;  2DE4 A;  3FJ7 A;  3BIH A;  4FE8 A;  1F9B A;  3RN8 A;  4QFK A;  3MPK A;  4TOZ A;  2H9B A;  1NUW A;  4POW A;  3TTR A;  4AQ4 A;  2O7I A;  3IOR A;  3PMW A;  1M5C A;  2B65 A;  1N76 A;  4O3A A;  1ZBM A;  4IR8 A;  2F3D A;  3PD8 A;  4IO6 A;  1WVJ A;  2Q88 A;  5IZZ A;  1UQW A;  1ATG A;  3KOT A;  5B7D A;  3H03 A;  1FBD A;  3QAX A;  1POT A;  4M1V A;  3O6H A;  3PD9 A;  4LN5 A;  4RNS A;  2RCA A;  1QKA A;  3PUV E;  1LBZ A;  1DTG A;  3S2V A;  4N13 A;  4QXD A;  3S4U A;  1BP5 A;  3LR1 A;  4QSC A;  2RC8 A;  4F1Y A;  1P99 A;  3WAE A;  4BDQ A;  1FPG A;  3C36 A;  5I2N A;  1P1W A;  3B8B A;  3Q27 A;  4C1T A;  4OWD A;  5L8D A;  4E0X A;  4U21 A;  3V83 A;  4YKK A;  2A5T A;  4F3G A;  1MPB A;  2XXV A;  5DYH A;  3H6U A;  3EHT A;  4RXL A;  3C34 A;  4GWW A;  3GBA A;  4YU0 A;  4BDM A;  3B7D A;  5TP9 A;  2VOZ A;  2XWI A;  4N4U A;  3DEL B;  3ISP A;  4GOT A;  4PAF A;  1N3W A;  4FBP A;  3IFC A;  4X1B A;  3MJN A;  2B3B A;  2F35 A;  1B3F A;  2F7B A;  3A3C A;  1FQF A;  2Y5L A;  1MXU A;  1MQI A;  4UAB A;  2ZYN A;  2QS3 A;  3FV2 A;  4OQO A;  4XKQ A;  4HS7 A;  3RPW A;  3VXB A;  4P47 A;  4M4G A;  4F3B A;  4HE0 A;  3LSX A;  2ZNU A;  3PMV A;  2LAO A;  1K9Z A;  4JWX A;  2AL4 A;  2CEX A;  2Z22 A;  1PBQ A;  1CB6 A;  2DDK A;  1O63 A;  4MF3 A;  3DM0 A;  4YB7 A;  4OMB A;  1FCK A;  1NH8 A;  4QFL A;  4I62 A;  2M8C A;  2F7C A;  4LVQ A;  4LP2 B;  1WDN A;  4F2Q A;  1B7H A;  3LV0 A;  4GLI A;  2XD3 A;  3HV1 A;  4KD5 A;  1B58 A;  4N15 A;  4HE1 A;  1P1N A;  2XHD A;  1JVX A;  1FBE A;  1YZ0 A;  5ESY A;  3KC0 A;  1EZO A;  4N6D A;  2I3V A;  2I4C A;  1LAF E;  1FPF A;  3DP6 A;  3RGY A;  3UOR A;  2Q74 A;  2UXA A;  1YYZ A;  2V3T A;  4IO4 A;  1N84 A;  4ZS9 A;  2ZZX A;  1VSO A;  5CMB A;  1DTZ A;  2X7P A;  4U4S A;  3KOS A;  2ONS A;  3IB1 A;  4JWO A;  3TPA A;  3QIM A;  3TYH A;  1YPN A;  3GBB A;  4HXV A;  3MWB A;  2DP8 A;  1SBP A;  1IEJ A;  1B1X A;  1NL5 A;  1RKM A;  4E0W A;  4OYV A;  2XWK A;  1FQB A;  1BKA A;  1A7L A;  1VDW A;  1UTH A;  3CR9 A;  4QHQ A;  2FA7 A;  2ZZV A;  3RT8 A;  3ZSF A;  1HSL A;  1LLS A;  5CBR A;  1R1N A;  1PB9 A;  2ABH A;  2CMO A;  4QSD A;  1POY 1;  1XVY A;  5KDT B;  4LAT A;  4IO5 A;  3OOA A;  4BDO A;  5EQ8 A;  5K2Y A;  3T9H B;  5EQ9 A;  3RLF E;  2WBB A;  1D4N A;  3OEM A;  4QRZ A;  1I6B A;  1MH3 A;  2F8D A;  3HHF A;  1MY3 A;  2VT5 A;  5AA2 B;  4OVQ A;  4Z7E A;  3JV9 A;  3WAF A;  3PTY A;  4F29 A;  3RYD A;  3TKD A;  3C31 A;  1MDQ A;  5I5P A;  1G0H A;  4GX3 A;  5I7I A;  1AWB A;  3HCQ A;  3JYR A;  4FOR A;  1IMA A;  3IB2 A;  2GFE A;  3IFA A;  3EQ1 A;  4NF8 A;  4IGR A;  1OIB A;  1JVY A;  2ANJ A;  1IQ7 A;  2HAV A;  4FAT A;  1EU8 A;  1B40 A;  1JP4 A;  3UGW A;  3R7X A;  2AL5 A;  4G68 A;  1FPJ A;  1FPB A;  3N5L A;  2QS2 A;  2CZK A;  1MQD A;  4KYD A;  1DBZ A;  3R6U A;  2YPN A;  4OFJ A;  4NMY A;  3OSR A;  1LCT A;  3CFL A;  4N81 A;  4GL8 A;  1ZJL A;  3K1N A;  3DP8 A;  3Q25 A;  2XX8 A;  5KCJ B;  3MZ1 A;  3CG3 A;  2DYX A;  3IOV A;  5TU0 A;  4OFO A;  4RK9 A;  1D9Y A;  1FPI A;  5L9S A;  1NNT A;  4YKJ A;  3SKP A;  4MEV A;  1PB8 A;  2RF1 A;  1H45 A;  3F11 A;  3OO8 A;  1BTJ A;  4H8J A;  4OVP A;  1NV4 A;  4PAK A;  4L17 A;  3KZG A;  1O7T A;  1Y20 A;  3ILU B;  3RTW B;  1DOT A;  2DS9 A;  5H8Q A;  1DPE A;  5CMM A;  4N17 A;  4RYA A;  3TQL A;  5I59 A;  5EHM A;  4ZEC A;  3FVG A;  3G3H A;  4PQJ A;  5HM4 B;  4DCY A;  1S7Y A;  5BUU A;  4IO7 A;  1B46 A;  1II5 A;  2XD2 A;  1KZ8 A;  1XS5 A;  1AIV A;  2V4C A;  4NF5 A;  2KLF A;  3N6U A;  2WKY A;  4GWO A;  4P1E A;  2VP1 A;  2NVU B;  5DVJ A;  3PUX E;  2PBW A;  3BFT A;  1PB7 A;  2I6E A;  2DVC A;  3VLV A;  4XTC Q;  4YB6 A;  3MP8 A;  1NKX A;  4NWD A;  4WED A;  4X48 A;  1SW2 A;  2P3N A;  4EXK A;  2FHY A;  3IO6 A;  1WOD A;  5M2V A;  3K6V A;  1BK4 A;  1DK4 A;  5ICQ A;  3IO4 A;  3MP1 A;  3GZG A;  1B7U A;  2D21 A;  5CBS A;  1ZU0 A;  2F6P A;  3DLN A;  4JVC A;  3HO7 A;  4ELR A;  3H4Z A;  5ITO A;  1B5H A;  4H46 A;  2VHA A;  3KGC A;  1QJM A;  1FTO A;  4HCW A;  4WXJ A;  4LON B;  2GHB A;  4JVI A;  3Q26 A;  2UVI A;  3PUW E;  1P1U A;  4YIC A;  3TEL A;  1RDX A;  4XFE A;  4YB5 A;  1Y1M A;  3H6V A;  4MAG A;  4DIG A;  3TTK A;  3OXN A;  3U94 A;  4ELP A;  3G3I A;  5K2X A;  5EYH A;  3PV0 E;  1O64 A;  1DSN A;  1QUI A;  4Q5T A;  4OVT A;  3TCH A;  3K1P A;  1LFG A;  3RTF B;  4EQ7 A;  1FPL A;  3KC1 A;  3O6I A;  1NH7 A;  1URS A;  5I2K A;  1XT8 A;  3RNN A;  4U4X A;  4NX1 A;  1XI6 A;  3FXR A;  2H98 A;  4MLV A;  4GWZ A;  1A55 A;  4QFO A;  1OVT A;  1NV5 A;  1KA0 A;  3T9U A;  2WBD A;  4G68 C;  3MUQ A;  2QS1 A;  2V3Q A;  4THI A;  1MY0 A;  3U92 A;  1LBY A;  2V84 A;  2FIX A;  2XWO A;  3EF7 A;  3VLW A;  3LUY A;  1S9T A;  3LSL A;  1HSE A;  4OVS A;  2CZL A;  1LBV A;  4JSO A;  4GWS A;  4OA4 A;  4OFL A;  3ONM A;  2DE2 A;  1QGX A;  1VE4 A;  5JTY A;  1Z7N E;  2Q2C A;  2QSX A;  5DT6 A;  3SEU A;  4N8Y A;  1BIY A;  3N94 A;  3S9N C;  1MXZ A;  2QVV A;  3O29 A;  4IY6 A;  3B6W A;  2GQ1 A;  3UN6 A;  3KBR A;  4G8M A;  1NUZ A;  3H7M A;  5ISU A;  1EZ9 A;  1RDZ A;  1YAE A;  5I2N B;  4LZ5 A;  1ZLQ A;  3MQ9 A;  1SI1 A;  3FD3 A;  1IME A;  1NI9 A;  2XXP A;  2OCU A;  4Z0I A;  2O1L A;  2A5T B;  4Q30 B;  4RA1 A;  4X8R A;  4AB6 A;  1B0L A;  4ZEB A;  4NWC A;  2OZZ A;  4EF1 A;  4PC9 A;  4ESX A;  1NV0 A;  5TP9 B;  1B2H A;  5EHS A;  4IO3 A;  5FTH A;  4RY1 A;  1FTK A;  5A5X A;  1M5E A;  4FED A;  3LC8 A;  1RDY A;  4I9D A;  3KJT A;  3IOT A;  3E78 A;  5IZ3 A;  3PPP A;  3C35 A;  1GGG A;  1A40 A;  5AE4 A;  4F31 B;  1IXG A;  4POX A;  3MW0 A;  3IOU A;  2DQV A;  1LFH A;  2DVZ A;  4PP0 A;  4RK2 A;  1P1Q A;  3QXM A;  5CM6 A;  5L9O A;  4R72 A;  5H8N A;  2DOJ A;  3T0J A;  1IMB A;  1D9Q A;  4TQU Q;  4EQB A;  1NNP A;  1Y3P A;  1VR5 A;  3MP6 A;  1AOV A;  1EZP A;  2ZMB A;  3K6W A;  3KN7 A;  4XXU A;  5H8S A;  3RPL A;  4XKR A;  3K1M A;  3LBS A;  1FTJ A;  3H3G A;  1A8E A;  4KHZ E;  1PBP A;  2WEF A;  3HFU A;  2AIX A;  1Y9U A;  4EF2 A;  3IB0 A;  1L5T A;  4N91 A;  2DXR A;  3G3G A;  3UP9 A;  1ZIU A;  4KFQ A;  4WEP A;  2RIN A;  4LQ2 A;  3W15 C;  4XKP A;  3FJG A;  1AMF A;  3MVX A;  1USY E;  2R71 A;  3EKI A;  3V89 B;  4ZED A;  1Z7M E;  4R6H A;  2FVZ A;  3HST A;  4EXL A;  3BKI B;  3KN3 A;  2HFB A;  3G3F A;  1H76 A;  4DZ1 A;  2B4M A;  2O51 A;  3KN8 A;  1R9Q A;  2F6G A;  3CI8 A;  5IZ1 A;  4EDP A;  1G0I A;  4KPT A;  2XXY A;  3PGF A;  2RKM A;  2XXW A;  3M3L A;  4P9K A;  2D3I A;  1QUJ A;  1SW4 A;  3QMF A;  4U1Z A;  1H44 A;  2OK2 A;  2Y7I A;  4JBZ A;  4JWY A;  5HPQ A;  2P0S A;  3HPI A;  1UTH B;  1B9J A;  2HXW A;  1SQY A;  3I3V A;  4GX4 A;  3FIR A;  5H8F A;  4TLM B;  4ESW A;  1MM6 A;  2H5Y A;  3IK6 B;  2F3B A;  2L5V A;  2Q9T A;  3E3K A;  4OEU A;  3TAJ A;  2QPQ A;  4NF6 B;  5AA4 A;  1MXX A;  3CSB A;  3KBZ A;  2VPO A;  5AA1 A;  1I6Q A;  4XKN A;  3Q29 A;  1JQF A;  4N6K A;  4N8G A;  5I58 A;  2CZH A;  4PFY A;  3L6G A;  4NF4 A;  1SW5 A;  2Q89 A;  3OSQ A;  4R9F A;  4F3S A;  3S9E A;  4G8N A;  3MVZ A;  3OO6 A;  1SYH A;  1GV8 A;  1FPK A;  1JW1 A;  2XXQ A;  3M3K A;  5EQA A;  1NFT A;  4BDN A;  4ZE9 A;  3G3J A;  4IGT A;  3DP4 A;  2ZZW A;  4N6P A;  4NF8 B;  1MRP A;  4R9G A;  3OEN A;  2DWI A;  1N3X A;  4NTL A;  3IR1 A;  2HCA A;  5FBP A;  1LAX A;  1JET A;  4NAP A;  2R9J A;  4G68 B;  3O9P A;  1USY H;  4PFU A;  5J16 A;  2OBG A;  4R6Y A;  1INP A;  2UVH A;  3KJ7 A;  2Y84 A;  1UTB B;  2OJT A;  3CFZ A;  4PAI A;  4F3P A;  5ET6 A;  1JW4 A;  1Y4C A;  3CSG A;  4NGU A;  2CEY A;  1JEU A;  1Q1K A;  3FGS A;  4DXC A;  1FPE A;  1MG1 A;  4O7M A;  1MXW A;  4MMP A;  2ZNT A;  1FBP A;  3UA8 A;  3FZV A;  4EQ9 A;  5I57 A;  4QFP A;  3T66 A;  2ALU A;  2HQ0 A;  1MS7 A;  4MNC A;  3QYT A;  3A29 A;  1ZKB A;  2PX1 A;  4PGN A;  3TZA A;  1HSJ A;  2Y7R A;  3RY3 A;  1N7X A;  3FAT A;  3OO9 A;  3MBP A;  5CRY A;  2P2A A;  4ZEK A;  3JZJ A;  5H8Q B;  2QS4 A;  1ZMG A;  2B4L A;  3H06 B;  1OQH A;  2XXR A;  5I59 B;  2PYY A;  1TFD A;  1R6Z A;  2XX7 A;  2FBP A;  4MX6 A;  2X7Q A;  2XA5 A;  1XC1 A;  4C1U A;  4UA8 A;  4P0G A;  4NF5 B;  1FTA A;  3EPE A;  3ODB A;  1R9L A;  2GH9 A;  3SET A;  4KYE A;  3IOW A;  3QSL A;  1JW5 A;  3SZP A;  2I3W A;  4NED A;  3ILT B;  4KXP A;  2HXR A;  4PDH A;  3HHG A;  2XXU A;  4QSE A;  1KA1 A;  1Q9D A;  1XOC A;  3QUJ A;  1M5B A;  2R6G E;  3THI A;  1S50 A;  5HBC A;  4R6K A;  5EYG A;  2PFY A;  4IB2 A;  2Z8D A;  3SES A;  3H6T A;  3KSJ A;  3S9M C;  3RUM A;  5ET7 A;  4Q8R A;  1YTV A;  4H5F A;  1MQH A;  3C9H A;  4NQ8 A;  1DPP A;  4ISU A;  3G3K A;  1AH5 A;  2X26 A;  2OX3 A;  3E79 A;  4AB5 A;  2AYS A;  4I1D A;  3O66 A;  4H8I A;  2F7A A;  3IAZ A;  4P1L A;  2ZNS A;  4N07 A;  1B51 A;  4LA9 A;  3VDF A;  4MFI A;  4XEQ A;  1FBH A;  3PPQ A;  4K3F A;  2I58 A;  1A8F A;  2B3F A;  1NNK A;  2QMW A;  2O68 A;  3PU5 A;  3CVG A;  5H8H B;  1QKB A;  1YXI A;  2Z23 A;  1B3H A;  5IM2 A;  4GWX A;  1K9Y A;  1TFA A;  5ELV A;  2P1S A;  4PGP A;  2HEU A;  1TT1 A;  2YJP A;  4G77 A;  1T0K A;  1VFE A;  5ET5 A;  5I2K B;  1SDX A;  1LFI A;  1MPD A;  3B6Q A;  2H99 A;  3I6V A;  2DWH A;  1FBG A;  3D4G A;  5JEI A;  5I56 A;  4GXA A;  3LUZ A;  4DE8 A;  1OLA A;  5EYF A;  4F1U A;  1SD3 A;  3ECR A;  3TCF A;  5EQ7 A;  4ZZE A;  3MC2 A;  2V93 A;  5DEX A;  4P3L A;  3O2A A;  3T1B A;  2NXO A;  5DVI A;  3TOD A;  2PT2 A;  4YKI A;  3TFL A;  4H6D A;  2OWT A;  4H0W A;  1TXF A;  5F1Q A;  4PFT A;  4I8C A;  2DSF A;  2I49 A;  3SER A;  2UVJ A;  4GWY A;  5A5L A;  3MZB A;  3GYY A;  5JTY B;  2I0B A;  3RT6 B;  4NE4 A;  1MM7 A;  4OTE A;  5T3J A;  1SI0 A;  1I69 A;  4X04 A;  4DXU A;  2F5X A;  1SW1 A;  4GFR A;  3GXA A;  3IL1 B;  4HTG A;  2I4B A;  4GIZ A;  4F39 A;  4R2F A;  4OES A;  2REJ A;  3M8U A;  1IMD A;  4I3E A;  3PUY E;  4I3Y A;  3AXF A;  3SEV A;  4OXV A;  1H3D A;  1D3K A;  1IZ1 A;  2D5W A;  3C32 A;  2WX9 A;  1H43 A;  2YLN A;  2O1M A;  4DDD A;  4OEV A;  3SDF A;  2QJE A;  3IJO B;  4BLA A;  4KR5 A;  3EHS A;  3W9W A;  3K2D A;  4RPO A;  3PPR A;  3I5O A;  2Y7K A;  3S9L C;  1JEV A;  2H25 A;  2MKZ A;  2WYK A;  1B5J A;  1FRP A;  1Q35 A;  3OEK A;  1FJ6 A;  5F24 A;  4GQO A;  1D9V A;  4U23 A;  2Q2A A;  3N6T A;  1IXI A;  3CG1 A;  4MIJ A;  3IX1 A;  3B50 A;  2OWZ A;  2P3V A;  2VD2 A;  2REG A;  3FBP A;  5A5X B;  2QVR A;  4OET A;  1LST A;  1LGB C;  1DMB A;  1B4Z A;  5LOM A;  1URD A;  1IIW A;  1Y3N A;  4GRK A;  5TPA A;  1YCJ A;  4NHB A;  2HZL A;  4KCD A;  3MAM A;  5IZ3 B;  1MDP 1;  4OZ9 A;  2Y5K A;  3UIF A;  3BIG A;  3E4R A;  4EUO A;  1Y3Q A;  1SVX B;  5IAI A;  1NV6 A;  1ZTY A;  3KG2 A;  1CNQ A;  4H67 A;  3TUS A;  2G93 A;  5H8N B;  4BDR A;  3D4C A;  3K6U A;  1QUL A;  2Q8J A;  3U1O A;  1NUY A;  3MST A;  4G2Z A;  2CZI A;  3TCG A;  2F97 A;  1XVX A;  2H4I A;  4QF9 A;  1SYI A;  2ZXT A;  3FAS A;  1MQG A;  3RPL B;  3CFX A;  4X1D A;  3K01 A;  4NF0 A;  1FPD A;  1AL3 A;  1LCF A;  4OAN A;  4X9T A;  1TWY A;  2Y7P A;  4OER A;  5LTC A;  1LBX A;  4OVR A;  4YZZ A;  3ROJ A;  1GR2 A;  1MY1 A;  3TQW A;  1PC3 A;  1QUK A;  4GWU A;  4KYS A;  2UVG A;  4MCO A;  1M5F A;  4PBH A;  4YKP A;  3KFM A;  4FJP A;  1BLF A;  5I3S A;  3VVF A;  4P11 A;  2OWS A;  4DI4 B;  1MY4 A;  4UAC A;  2F36 A;  1VFD A;  1PDA A;  4MBP A;  1B3G A;  3CHG A;  1UIV A;  3OD7 A;  3NOH A;  4C0R A;  1B5I A;  5FHM A;  5JK4 A;  2HHM A;  1IIT A;  4G8H A;  3A3U A;  3FV1 A;  4PET A;  1RYX A;  4FIM A;  5F7V A;  1QW0 A;  1FBF A;  4ELQ A;  4DCX A;  4ONY A;  4O3B A;  2VD3 A;  2OLB A;  3TTN A;  3UK4 A;  4FAJ A;  4AS5 A;  5H8F B;  4OHN A;  5AA2 D;  2GRV A;  3VXC A;  1B52 A;  4R75 A;  1IMF A;  3E9X A;  4GXS B;  1B4H A; 
#chains in the Genus database with same CATH homology
 2DXY A;  3G7W A;  3O97 A;  5AA4 B;  1FTL A;  4DLD A;  2PVU A;  1MXV A;  1J1N A;  3OMB A;  2UYF A;  3TMG A;  1LBB A;  2RC9 A;  5CI5 A;  4KCC A;  5I58 B;  3TDJ A;  4FEB A;  4NF4 B;  2BJJ X;  1B7Z A;  3K6X A;  4ELO A;  3MPL A;  2IA4 A;  5FTI A;  1M5D A;  2G29 A;  4U2R A;  3TTM A;  4OVJ A;  5KZT A;  4KQP A;  2ONK E;  5FHN A;  2VGQ A;  1IXH A;  2Y7W A;  1MQJ A;  4O3C A;  2Z8F A;  1URG A;  2XX9 A;  4Q0C A;  1B05 A;  1OLC A;  3PMX A;  1B32 A;  3USD A;  4JXI A;  3K02 A;  3Q28 A;  3T9X B;  3H6W A;  3OO7 A;  4OEN A;  1FQD A;  5FHO A;  5ITP A;  2ZYK A;  2NOO A;  2F34 A;  1LAH E;  3SEW A;  5ICT A;  4WKM A;  1OQG A;  4JB7 A;  4NF6 A;  1IUD A;  4ECF A;  4YMA A;  4F2O A;  1GVC A;  2NUV A;  3P7I A;  4MH5 A;  1B3L A;  1N7W A;  3IJX B;  1A99 A;  3BBR A;  4DXB A;  4G4P A;  1CE2 A;  5KDT A;  3VV5 A;  5I57 B;  2E0S A;  4H1X A;  1JNF A;  3VLU A;  1FTM A;  3U8Q A;  3VVE A;  4ZZA A;  3TEP A;  3C33 A;  4IY5 A;  5AA2 A;  3EN3 A;  5DTB A;  2IEE A;  3FJM A;  3FXU A;  4ZEI A;  1B0H A;  2THI A;  1OMP A;  1US5 A;  2FYI A;  3PPO A;  1A54 A;  4JSD A;  4HCY A;  1NMU A;  1MPC A;  3O6G A;  1UTB A;  2O6A A;  3LSW A;  1FQE A;  2PMS A;  4FEC A;  4MLQ A;  5BWJ A;  4F1V A;  3LSF B;  4ND9 A;  3FVN A;  3MZ9 A;  2QL3 A;  3QUF A;  1XHY A;  3BFU A;  2ZYO A;  3CIJ A;  2DWJ A;  2FNC A;  3T9V A;  4KI0 E;  4JDF A;  5KCJ A;  1LB8 A;  3MVW A;  4PE5 B;  1B1H A;  3GLB A;  4RJZ A;  4H5G A;  2ESN A;  4XIG Q;  1N04 A;  2XXI A;  1MY2 A;  2ZYM A;  1GTK A;  4R74 A;  2XXT A;  3ZKK A;  2DWA A;  2F78 A;  4QFN A;  2RCB A;  5CC2 A;  2W7Y A;  3B6T A;  3M3F A;  3R26 A;  2V25 A;  2Z8E A;  3U72 A;  5DVF A;  3KSX A;  3VFJ A;  3O28 A;  4YMB A;  5B70 A;  4U1O A;  3L6H A;  2V3U A;  1US4 A;  3MVY A;  3A09 A;  3C4M A;  5CMK A;  2RC7 A;  1Y1Z A;  4R2B A;  4F18 A;  4IO2 A;  3V8X B;  3W9V A;  3K00 A;  1LB9 A;  4ZEF A;  3SEX A;  2PT1 A;  3N26 A;  3EHU A;  4F22 A;  2UYE A;  5I84 A;  5I56 B;  3ZKL A;  2HZK A;  4TLL B;  1B6H A;  4R73 A;  1RYO A;  4ZE8 A;  2HAU A;  4LUB A;  3T96 B;  3CRB A;  5DEX B;  1N0T A;  2QMX A;  5AA3 A;  3OEL A;  5J1D A;  1UIU A;  3VVD A;  4GF8 A;  4U22 A;  3ZS6 A;  4F19 A;  2O69 A;  2GHA A;  4BDL A;  2O7U A;  4RPN A;  3RQT A;  4YAH X;  1P1O A;  4HW8 A;  1B3E A;  4LQ5 A;  5L9M A;  5H8H A;  3PPN A;  3FUZ A;  3K0V A;  1ELJ A;  3T93 B;  4GL0 A;  1LAG E;  1IXC A;  3PUZ E;  4LZ8 A;  3FVO A;  2E1S A;  3V5A A;  2DE3 A;  1QVS A;  1EH3 A;  3U93 A;  1MXY A;  2I48 A;  4LZ7 A;  1OVB A;  3T22 A;  3VE1 B;  1Y4T A;  1PEB A;  2XXH A;  4GD5 A;  1KWH A;  4GVO A;  2NWJ A;  3HN0 A;  2QRY A;  5CMC A;  3K4U A;  1MH4 A;  2A5S A;  3SEY A;  3KEI A;  1FQA A;  4P0I A;  3TTL A;  3FXQ A;  4H65 A;  1LBC A;  3FVK A;  3E13 X;  5IKB A;  1ANF A;  2XXX A;  1FW0 A;  4ZDM A;  1I6A A;  1NNF A;  1FQC A;  3QK6 A;  2I0C A;  4PFW A;  2O84 X;  2ONR A;  5TPA B;  2DE4 A;  3FJ7 A;  4FE8 A;  1F9B A;  3RN8 A;  4QFK A;  3MPK A;  4TOZ A;  2H9B A;  4POW A;  3TTR A;  4AQ4 A;  2O7I A;  3IOR A;  3PMW A;  1M5C A;  2B65 A;  1N76 A;  4O3A A;  1ZBM A;  3PD8 A;  4IO6 A;  1WVJ A;  2Q88 A;  1UQW A;  1ATG A;  3KOT A;  5B7D A;  3H03 A;  3QAX A;  1POT A;  4M1V A;  3O6H A;  3PD9 A;  4RNS A;  2RCA A;  1QKA A;  3PUV E;  3S2V A;  1DTG A;  4N13 A;  3S4U A;  1BP5 A;  3LR1 A;  4QSC A;  2RC8 A;  4F1Y A;  1P99 A;  3WAE A;  4BDQ A;  3C36 A;  5I2N A;  1P1W A;  3Q27 A;  4C1T A;  4OWD A;  5L8D A;  4E0X A;  4U21 A;  3V83 A;  4YKK A;  2A5T A;  4F3G A;  1MPB A;  2XXV A;  5DYH A;  3H6U A;  3EHT A;  4RXL A;  3C34 A;  3GBA A;  4YU0 A;  4BDM A;  3B7D A;  5TP9 A;  2VOZ A;  3DEL B;  4GOT A;  1N3W A;  4X1B A;  3MJN A;  2B3B A;  2F35 A;  1B3F A;  2F7B A;  3A3C A;  1FQF A;  1MXU A;  1MQI A;  2ZYN A;  2QS3 A;  3FV2 A;  4OQO A;  4XKQ A;  4HS7 A;  3RPW A;  3VXB A;  4M4G A;  4F3B A;  3LSX A;  2ZNU A;  3PMV A;  2LAO A;  4JWX A;  2AL4 A;  2Z22 A;  1PBQ A;  1CB6 A;  1O63 A;  4MF3 A;  3DM0 A;  4YB7 A;  4OMB A;  1FCK A;  1NH8 A;  4QFL A;  4I62 A;  2M8C A;  2F7C A;  4LVQ A;  4LP2 B;  1WDN A;  4F2Q A;  1B7H A;  4GLI A;  2XD3 A;  3HV1 A;  4KD5 A;  1B58 A;  1P1N A;  2XHD A;  1JVX A;  1EZO A;  2I3V A;  2I4C A;  1LAF E;  3DP6 A;  3RGY A;  3UOR A;  2UXA A;  2V3T A;  4IO4 A;  1N84 A;  4ZS9 A;  1VSO A;  5CMB A;  1DTZ A;  2X7P A;  4U4S A;  3KOS A;  2ONS A;  3IB1 A;  4JWO A;  3TPA A;  3QIM A;  3TYH A;  1YPN A;  3GBB A;  3MWB A;  2DP8 A;  1SBP A;  1IEJ A;  1B1X A;  1NL5 A;  1RKM A;  4E0W A;  4OYV A;  1FQB A;  1BKA A;  1A7L A;  1UTH A;  3CR9 A;  4QHQ A;  2FA7 A;  3RT8 A;  3ZSF A;  1HSL A;  1LLS A;  5CBR A;  1R1N A;  1PB9 A;  2ABH A;  2CMO A;  4QSD A;  1POY 1;  1XVY A;  5KDT B;  4LAT A;  4IO5 A;  3OOA A;  4BDO A;  5K2Y A;  3T9H B;  3RLF E;  1D4N A;  3OEM A;  4QRZ A;  1I6B A;  1MH3 A;  2F8D A;  3HHF A;  1MY3 A;  5AA2 B;  4Z7E A;  3JV9 A;  3WAF A;  4F29 A;  3TKD A;  3C31 A;  1MDQ A;  3HCQ A;  3JYR A;  4FOR A;  3IB2 A;  2GFE A;  3EQ1 A;  4NF8 A;  4IGR A;  1OIB A;  1JVY A;  2ANJ A;  1IQ7 A;  2HAV A;  4FAT A;  1EU8 A;  1B40 A;  3UGW A;  3R7X A;  2AL5 A;  4G68 A;  3N5L A;  2QS2 A;  1MQD A;  4KYD A;  3R6U A;  2YPN A;  4OFJ A;  4NMY A;  3OSR A;  1LCT A;  3CFL A;  4GL8 A;  1ZJL A;  3K1N A;  3DP8 A;  3Q25 A;  2XX8 A;  5KCJ B;  3MZ1 A;  3CG3 A;  2DYX A;  3IOV A;  5TU0 A;  4OFO A;  4RK9 A;  1D9Y A;  5L9S A;  1NNT A;  4YKJ A;  3SKP A;  1PB8 A;  2RF1 A;  1H45 A;  3F11 A;  3OO8 A;  1BTJ A;  4H8J A;  4L17 A;  3KZG A;  1O7T A;  1Y20 A;  3ILU B;  3RTW B;  1DOT A;  2DS9 A;  5H8Q A;  1DPE A;  5CMM A;  4RYA A;  3TQL A;  5I59 A;  5EHM A;  4ZEC A;  3FVG A;  3G3H A;  4PQJ A;  5HM4 B;  4DCY A;  1S7Y A;  5BUU A;  4IO7 A;  1B46 A;  1II5 A;  2XD2 A;  1XS5 A;  1AIV A;  4NF5 A;  2KLF A;  3N6U A;  2WKY A;  4GWO A;  2VP1 A;  2NVU B;  5DVJ A;  3PUX E;  2PBW A;  3BFT A;  1PB7 A;  2I6E A;  2DVC A;  3VLV A;  4XTC Q;  4YB6 A;  3MP8 A;  1NKX A;  4NWD A;  4WED A;  4X48 A;  1SW2 A;  4EXK A;  3IO6 A;  1WOD A;  5M2V A;  3K6V A;  5ICQ A;  3IO4 A;  3MP1 A;  3GZG A;  1B7U A;  2D21 A;  5CBS A;  1ZU0 A;  2F6P A;  3DLN A;  4ELR A;  3HO7 A;  3H4Z A;  5ITO A;  1B5H A;  2VHA A;  3KGC A;  1QJM A;  1FTO A;  4HCW A;  4WXJ A;  4LON B;  2GHB A;  3Q26 A;  2UVI A;  3PUW E;  1P1U A;  4YIC A;  3TEL A;  4YB5 A;  1Y1M A;  3H6V A;  4DIG A;  3TTK A;  3OXN A;  3U94 A;  4ELP A;  3G3I A;  5K2X A;  3PV0 E;  1O64 A;  1DSN A;  1QUI A;  4Q5T A;  3TCH A;  3K1P A;  1LFG A;  3RTF B;  4EQ7 A;  3O6I A;  1NH7 A;  1URS A;  5I2K A;  1XT8 A;  3RNN A;  4U4X A;  3FXR A;  2H98 A;  4MLV A;  4QFO A;  1A55 A;  1OVT A;  3T9U A;  4G68 C;  3MUQ A;  2QS1 A;  2V3Q A;  4THI A;  1MY0 A;  3U92 A;  2V84 A;  3EF7 A;  3VLW A;  3LUY A;  1S9T A;  3LSL A;  1HSE A;  2CZL A;  4JSO A;  4OFL A;  3ONM A;  2DE2 A;  1VE4 A;  5JTY A;  1Z7N E;  2Q2C A;  2QSX A;  5DT6 A;  3SEU A;  1BIY A;  3N94 A;  3S9N C;  1MXZ A;  3O29 A;  4IY6 A;  3B6W A;  3UN6 A;  3KBR A;  4G8M A;  3H7M A;  5ISU A;  1EZ9 A;  1YAE A;  5I2N B;  4LZ5 A;  1ZLQ A;  3MQ9 A;  1SI1 A;  3FD3 A;  2XXP A;  2OCU A;  4Z0I A;  2O1L A;  2A5T B;  4Q30 B;  4RA1 A;  4AB6 A;  1B0L A;  4ZEB A;  4NWC A;  2OZZ A;  4EF1 A;  4ESX A;  5TP9 B;  1B2H A;  5EHS A;  4IO3 A;  5FTH A;  4RY1 A;  1FTK A;  5A5X A;  1M5E A;  4FED A;  3LC8 A;  4I9D A;  3KJT A;  3IOT A;  3PPP A;  3C35 A;  1GGG A;  1A40 A;  5AE4 A;  4F31 B;  1IXG A;  4POX A;  3MW0 A;  3IOU A;  2DQV A;  1LFH A;  2DVZ A;  4PP0 A;  4RK2 A;  1P1Q A;  3QXM A;  5CM6 A;  5L9O A;  4R72 A;  5H8N A;  2DOJ A;  4TQU Q;  4EQB A;  1NNP A;  1Y3P A;  1VR5 A;  3MP6 A;  1AOV A;  1EZP A;  2ZMB A;  3K6W A;  3KN7 A;  4XXU A;  5H8S A;  4XKR A;  3K1M A;  3LBS A;  1FTJ A;  3H3G A;  1A8E A;  4KHZ E;  1PBP A;  2AIX A;  1Y9U A;  4EF2 A;  3IB0 A;  1L5T A;  2DXR A;  3G3G A;  3UP9 A;  1ZIU A;  4KFQ A;  4WEP A;  2RIN A;  4LQ2 A;  3W15 C;  4XKP A;  3FJG A;  1AMF A;  3MVX A;  1USY E;  2R71 A;  3V89 B;  4ZED A;  1Z7M E;  4R6H A;  3HST A;  4EXL A;  3BKI B;  3KN3 A;  2HFB A;  3G3F A;  1H76 A;  4DZ1 A;  2O51 A;  3KN8 A;  1R9Q A;  2F6G A;  3CI8 A;  4EDP A;  4KPT A;  2XXY A;  3PGF A;  2RKM A;  2XXW A;  3M3L A;  2D3I A;  1QUJ A;  1SW4 A;  4U1Z A;  1H44 A;  2OK2 A;  2Y7I A;  4JBZ A;  4JWY A;  5HPQ A;  2P0S A;  3HPI A;  1UTH B;  1B9J A;  2HXW A;  1SQY A;  3I3V A;  3FIR A;  5H8F A;  4TLM B;  4ESW A;  1MM6 A;  2H5Y A;  3IK6 B;  2Q9T A;  3E3K A;  4OEU A;  3TAJ A;  2QPQ A;  4NF6 B;  5AA4 A;  1MXX A;  3CSB A;  5AA1 A;  1I6Q A;  4XKN A;  3Q29 A;  1JQF A;  5I58 A;  4PFY A;  3L6G A;  4NF4 A;  1SW5 A;  2Q89 A;  3OSQ A;  4R9F A;  4F3S A;  3S9E A;  4G8N A;  3MVZ A;  3OO6 A;  1SYH A;  1GV8 A;  1JW1 A;  2XXQ A;  3M3K A;  1NFT A;  4BDN A;  4ZE9 A;  3G3J A;  4IGT A;  3DP4 A;  4N6P A;  4NF8 B;  1MRP A;  4R9G A;  3OEN A;  2DWI A;  1N3X A;  4NTL A;  3IR1 A;  2HCA A;  1LAX A;  1JET A;  2R9J A;  4G68 B;  3O9P A;  1USY H;  4PFU A;  2OBG A;  4R6Y A;  2UVH A;  3KJ7 A;  2Y84 A;  1UTB B;  2OJT A;  3CFZ A;  4F3P A;  1JW4 A;  1Y4C A;  3CSG A;  1JEU A;  1Q1K A;  3FGS A;  4DXC A;  1MG1 A;  1MXW A;  2ZNT A;  3UA8 A;  3FZV A;  4EQ9 A;  5I57 A;  4QFP A;  3T66 A;  2ALU A;  2HQ0 A;  1MS7 A;  3QYT A;  1ZKB A;  2PX1 A;  3TZA A;  1HSJ A;  2Y7R A;  3RY3 A;  1N7X A;  3FAT A;  3OO9 A;  3MBP A;  5CRY A;  2P2A A;  4ZEK A;  3JZJ A;  5H8Q B;  2QS4 A;  1ZMG A;  3H06 B;  1OQH A;  2XXR A;  5I59 B;  2PYY A;  1TFD A;  1R6Z A;  2XX7 A;  2X7Q A;  1XC1 A;  4C1U A;  4UA8 A;  4P0G A;  4NF5 B;  3ODB A;  3EPE A;  1R9L A;  2GH9 A;  3SET A;  4KYE A;  3IOW A;  3QSL A;  1JW5 A;  2I3W A;  4NED A;  3ILT B;  3HHG A;  2XXU A;  4QSE A;  1XOC A;  3QUJ A;  1M5B A;  2R6G E;  3THI A;  1S50 A;  5HBC A;  4R6K A;  4IB2 A;  2Z8D A;  3SES A;  3H6T A;  3KSJ A;  3S9M C;  3RUM A;  4Q8R A;  1YTV A;  4H5F A;  1MQH A;  3C9H A;  1DPP A;  4ISU A;  3G3K A;  1AH5 A;  2X26 A;  4AB5 A;  2AYS A;  4I1D A;  3O66 A;  4H8I A;  2F7A A;  3IAZ A;  2ZNS A;  4N07 A;  1B51 A;  4LA9 A;  3VDF A;  4MFI A;  3PPQ A;  4K3F A;  2I58 A;  1A8F A;  2B3F A;  1NNK A;  2QMW A;  2O68 A;  3PU5 A;  3CVG A;  5H8H B;  1QKB A;  2Z23 A;  1B3H A;  1TFA A;  5ELV A;  2P1S A;  2HEU A;  1TT1 A;  2YJP A;  4G77 A;  1T0K A;  1VFE A;  5I2K B;  1SDX A;  1LFI A;  1MPD A;  3B6Q A;  2H99 A;  3I6V A;  2DWH A;  3D4G A;  5JEI A;  5I56 A;  4GXA A;  4DE8 A;  1OLA A;  5EYF A;  4F1U A;  1SD3 A;  3ECR A;  3TCF A;  4ZZE A;  3MC2 A;  2V93 A;  5DEX A;  3O2A A;  2NXO A;  5DVI A;  3TOD A;  2PT2 A;  4YKI A;  3TFL A;  4H6D A;  2OWT A;  4H0W A;  1TXF A;  5F1Q A;  4PFT A;  4I8C A;  2DSF A;  2I49 A;  3SER A;  2UVJ A;  3MZB A;  5JTY B;  2I0B A;  3RT6 B;  4NE4 A;  1MM7 A;  4OTE A;  1SI0 A;  1I69 A;  4DXU A;  2F5X A;  1SW1 A;  4GFR A;  3GXA A;  3IL1 B;  4HTG A;  2I4B A;  4GIZ A;  4F39 A;  4R2F A;  4OES A;  2REJ A;  3M8U A;  3PUY E;  3AXF A;  3SEV A;  4OXV A;  1H3D A;  1D3K A;  1IZ1 A;  2D5W A;  3C32 A;  1H43 A;  2YLN A;  2O1M A;  4DDD A;  4OEV A;  3SDF A;  2QJE A;  3IJO B;  4BLA A;  4KR5 A;  3EHS A;  3W9W A;  3K2D A;  4RPO A;  3PPR A;  3I5O A;  2Y7K A;  3S9L C;  1JEV A;  2H25 A;  1B5J A;  1Q35 A;  3OEK A;  4GQO A;  1D9V A;  4U23 A;  2Q2A A;  3N6T A;  1IXI A;  3CG1 A;  3IX1 A;  2VD2 A;  2REG A;  5A5X B;  4OET A;  1LST A;  1LGB C;  1DMB A;  1B4Z A;  5LOM A;  1URD A;  1IIW A;  1Y3N A;  4GRK A;  5TPA A;  1YCJ A;  2HZL A;  4KCD A;  3MAM A;  1MDP 1;  4OZ9 A;  3UIF A;  3E4R A;  4EUO A;  1Y3Q A;  1SVX B;  5IAI A;  1ZTY A;  3KG2 A;  4H67 A;  3TUS A;  2G93 A;  5H8N B;  4BDR A;  3D4C A;  3K6U A;  1QUL A;  2Q8J A;  3U1O A;  4G2Z A;  3TCG A;  2F97 A;  1XVX A;  2H4I A;  4QF9 A;  1SYI A;  2ZXT A;  3FAS A;  1MQG A;  3CFX A;  4X1D A;  3K01 A;  1AL3 A;  1LCF A;  4X9T A;  1TWY A;  2Y7P A;  4OER A;  4YZZ A;  1GR2 A;  1MY1 A;  3TQW A;  1PC3 A;  1QUK A;  4KYS A;  2UVG A;  1M5F A;  4YKP A;  3KFM A;  4FJP A;  1BLF A;  3VVF A;  4P11 A;  2OWS A;  1MY4 A;  4UAC A;  2F36 A;  1VFD A;  1PDA A;  4MBP A;  1B3G A;  1UIV A;  3OD7 A;  4C0R A;  1B5I A;  5FHM A;  5JK4 A;  1IIT A;  4G8H A;  3A3U A;  3FV1 A;  4PET A;  1RYX A;  4FIM A;  5F7V A;  1QW0 A;  4ELQ A;  4DCX A;  4ONY A;  4O3B A;  2VD3 A;  2OLB A;  3TTN A;  3UK4 A;  4FAJ A;  5H8F B;  4OHN A;  5AA2 D;  2GRV A;  3VXC A;  1B52 A;  4R75 A;  3E9X A;  4GXS B;  1B4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...