5AA1A

Crystal structure of mltf from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
418
structure length
418
Chain Sequence
EGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFTQHLQQRLPRYESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE-BOUND LYTIC MUREIN TRANSGLYCOSYLASE F
publication title Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 137
structure length 418
sequence length 418
chains with identical sequence B, C, D
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5aa1A02
3C9HA 4F18A 1ZU0A 1MDP1 3RT6B 4Z7EA 1B4ZA 2RC7A 4Q8RA 1DTGA 4F1VA 2XXIA 4X1DA 4KHZE 4M4GA 4YKIA 3U92A 3W9WA 3MJNA 3HPIA 3MP6A 3FXQA 4ELPA 2I48A 1D9VA 1FQDA 2I6EA 1NH7A 4X48A 1ZTYA 3IX1A 5L9OA 4PETA 1MPBA 1WDNA 3ECRA 5DVIA 1URDA 4EQ9A 4PE5B 1XC1A 3C33A 3SEVA 4BDMA 1B32A 1NNPA 4HTGA 5JK4A 1GGGA 1PC3A 4BDQA 1VR5A 5KCJB 3MVZA 4OEUA 1QVSA 5I2KA 3LR1A 3H6VA 4IO7A 2O69A 3H6WA 3SERA 1MG1A 3KN8A 4ZE9A 1PBQA 5DTBA 2H25A 3KG2A 3BFUA 3G3IA 2Z8DA 5CI5A 3RUMA 4RJZA 1TFAA 4PQJA 1RKMA 3N94A 2ONRA 4NF6A 3VLUA 4R73A 2CMOA 3R7XA 4OENA 2D5WA 3FJMA 1FTKA 1FQBA 4NE4A 1LBCA 5H8QB 3OXNA 4KD5A 3IO6A 4F3SA 3TKDA 1DTZA 1P1QA 3TZAA 1QKBA 3VVFA 5JTYA 2Y7IA 5I2NB 1M5DA 2XXVA 4QRZA 1LLSA 1MQIA 3MQ9A 3M8UA 1VFDA 1MY2A 2GFEA 4JDFA 3UK4A 4FIMA 2H4IA 3IOUA 1Y20A 1AL3A 1EZOA 1A55A 3G3KA 5K2XA 4LONB 4I9DA 1B0LA 1DOTA 4N07A 2AL4A 2QS2A 3PUVE 3SEUA 3OO7A 3EHUA 4GQOA 4P0IA 3PPOA 3ZKLA 5KDTA 2ANJA 3K02A 3I3VA 3WAEA 3FGSA 2VP1A 4QFPA 3D4CA 4ZDMA 3ILTB 1Y9UA 3IL1B 1US4A 3EQ1A 2F78A 2XXXA 4H8JA 5BUUA 2RCBA 4M1VA 2F7CA 1YAEA 2F36A 1P1UA 1I6QA 1NNFA 2XXRA 1J1NA 4ZZEA 3ZKKA 2F7BA 1QJMA 3FZVA 4EXLA 1AOVA 5H8FA 2Q88A 3K1MA 2RCAA 4H5GA 3O28A 4O3BA 4C1UA 5CMCA 2V3QA 3FVGA 3E13X 1FCKA 1Z7ME 4NF4A 5AA1A 4E0WA 5I56A 2QS4A 4KYSA 4X9TA 3AXFA 2X26A 2XXHA 1A99A 1FQEA 5K2YA 4DDDA 4HCYA 1N3XA 1XS5A 3JZJA 2OK2A 3C32A 4H67A 1MXXA 3VVEA 3KFMA 1Y3QA 2GHAA 1EZPA 3U8QA 2DYXA 4QSEA 1UTBA 4F3BA 3E4RA 3QSLA 3U1OA 1MXVA 2VD2A 2F34A 3QK6A 4YU0A 3DM0A 3T22A 2DOJA 1AMFA 2I0CA 1LAHE 3O97A 5EHSA 1PB9A 1SI0A 3EF7A 2OBGA 3ZS6A 2XX7A 5F7VA 3T9VA 1GR2A 4WEPA 2D3IA 2I0BA 1MY1A 4GIZA 4U2RA 3K01A 3QAXA 4KR5A 2AL5A 5L8DA 3FJ7A 1B05A 3MWBA 4X1BA 1Q35A 1LAFE 3OOAA 3K1PA 4ESXA 4JWYA 4PFWA 3KN7A 1B2HA 3CG3A 4RPOA 3RT8A 3PPNA 2YLNA 3PU5A 4DIGA 3T96B 3OEMA 1D9YA 4H65A 2HQ0A 2OWSA 4PFUA 2R6GE 4OFJA 4IY5A 2E1SA 2F8DA 4O3AA 1XVYA 3HV1A 4R6HA 3IOVA 3O6IA 4U1OA 1SW1A 1QW0A 1B9JA 2DWAA 3FV2A 3UGWA 4MLQA 1PEBA 1NL5A 2G29A 4LUBA 5H8NA 3RNNA 4EUOA 4OESA 3ONMA 1SD3A 2Z8EA 1JQFA 3S4UA 3TQLA 5IKBA 3K00A 3UA8A 3KJTA 3IAZA 4F2OA 3KSXA 1A8EA 1HSEA 4C1TA 3DP6A 5ELVA 1P99A 1OVTA 3PV0E 2H9BA 1OQGA 1LGBC 5AA2A 3VLVA 1FTJA 1S7YA 1USYH 1JEUA 4KYEA 3TTLA 1FTLA 2GHBA 4PFTA 1ANFA 3OSRA 3ILUB 2THIA 4Z0IA 4POXA 3VXBA 4TOZA 5IAIA 4I62A 3O66A 1ZMGA 4MF3A 1LAGE 1R1NA 4DCXA 1MRPA 5DYHA 1B51A 4F2QA 4G2ZA 3CG1A 3MP1A 1SW2A 4IO3A 3M3KA 3VDFA 3PMVA 4TQUQ 4HW8A 2PT2A 4NWDA 4EQBA 2Z23A 1TXFA 3KOTA 4YICA 1MH4A 1AH5A 4LZ7A 5TPAA 4OERA 1IITA 4YB6A 3PMWA 2A5TA 4R74A 2PVUA 5I57A 4O3CA 1EH3A 3FVNA 4QFOA 3K6WA 4OHNA 2UVIA 3PUXE 3FXUA 3FJGA 3VV5A 1B7UA 4JWOA 2I3VA 2DP8A 3O2AA 4G68B 3PPQA 4F19A 3CFXA 4IGTA 3RQTA 3A09A 3TMGA 4IO5A 2I4CA 2PT1A 5H8HB 3RGYA 4KQPA 2HZKA 4KI0E 1RYOA 2XX9A 1IXCA 2G93A 4JSDA 3R6UA 1MY3A 4YB7A 3HHGA 4RNSA 1LFHA 5TP9A 5CBSA 4RXLA 3RTFB 2FNCA 2YJPA 4RA1A 2DXRA 3E9XA 3U93A 2ZNTA 2V84A 4YKKA 5I59A 4AB6A 3OSQA 2XXQA 3BKIB 1OLCA 3RPWA 3W9VA 1B7HA 4ONYA 2HXWA 1DPPA 1L5TA 1B40A 2ABHA 3S9LC 3OEKA 4YKPA 1LFIA 1A54A 3T93B 1ATGA 1IUDA 3QUJA 2XD3A 2DE3A 1LB8A 3HO7A 3OO8A 3FIRA 1QUKA 2OWTA 1M5EA 1VE4A 3M3LA 2QJEA 3MUQA 4GLIA 4RYAA 3TTKA 4LZ8A 1YPNA 3LC8A 4GRKA 3MVWA 2BJJX 4NEDA 4QSDA 4FATA 2UYEA 2HAUA 2YPNA 2W7YA 1B3GA 3GBAA 3GXAA 1QKAA 2O6AA 2O7UA 3A3UA 3PD9A 1A40A 3TCFA 4G4PA 5CRYA 1OIBA 3SETA 3GZGA 1UTHB 3K6XA 2O7IA 2O68A 2VOZA 3HCQA 1BLFA 4QFKA 1URSA 4GF8A 1PB8A 5A5XA 1H44A 4H0WA 1NMUA 2HCAA 2A5TB 4NF5B 2O51A 3K6VA 4GL0A 5FTHA 2HZLA 3HSTA 4NF8A 3MC2A 4OFOA 4F3GA 3OO9A 5DEXB 3DELB 3MVXA 2NUVA 3E3KA 3SDFA 4MLVA 4NWCA 1MPDA 1NNTA 3IB1A 4I1DA 3EHSA 1B52A 5ICTA 5CMKA 4ZEKA 2H99A 1EU8A 2F5XA 2I58A 3H7MA 1ZKBA 2PYYA 5AA4A 4ELRA 2IA4A 3H03A 1FQAA 1MH3A 5I58A 5AA2D 4AB5A 3PMXA 2V3UA 2ZNSA 5F1QA 1IXIA 4N13A 4UA8A 5CC2A 1URGA 4OWDA 4XTCQ 1I6AA 2H98A 3TEPA 1DPEA 2Y7WA 1UIUA 2VD3A 2Q89A 4LQ5A 4R6YA 4OETA 3MAMA 3PUWE 4ZEBA 5EHMA 2ESNA 1ZJLA 3FATA 3B6TA 1T0KA 1US5A 2XXUA 3UORA 1UQWA 1H76A 3CVGA 5ITOA 3K2DA 5I2KB 3Q27A 4DXUA 2REJA 1B5HA 2Q9TA 4AQ4A 1USYE 3TPAA 2XX8A 4DLDA 5TU0A 1FQCA 3H6UA 2Q2CA 1DMBA 3G3GA 1UIVA 4NF6B 3EHTA 1CB6A 3DLNA 3TDJA 4BDRA 4POWA 3PGFA 1MY0A 4TLMB 2AIXA 2NWJA 2ONKE 4Q30B 2F6GA 1JETA 2RINA 1II5A 3KEIA 4PP0A 4U4XA 5FTIA 3V8XB 5JTYB 1NNKA 4P11A 1MXUA 3DP8A 2F6PA 4ELQA 3IJXB 3O6GA 3H3GA 1XT8A 2DQVA 1B5IA 2OLBA 3SEWA 5B70A 3O6HA 4OYVA 1Y4CA 5DVFA 2ZYOA 1B5JA 2QPQA 1YTVA 2F7AA 3C4MA 4U23A 1KWHA 1O63A 1N7WA 1LBBA 4ESWA 4G77A 4DCYA 4YMAA 3V89B 3B6WA 2R71A 5KDTB 4LATA 1LB9A 4RPNA 1ZBMA 1MS7A 3B6QA 1F9BA 2QS3A 3H06B 5KZTA 1H43A 4HCWA 2REGA 4OFLA 3Q28A 1Y3PA 4IGRA 3IB0A 4GFRA 2Z22A 3C34A 2UVJA 1Y4TA 2V93A 3HN0A 3G3HA 1N3WA 5H8FB 3RN8A 4QFLA 5I58B 4FECA 5KCJA 4OTEA 3PPRA 1P1WA 4LP2B 3TQWA 5M2VA 1JEVA 1MXWA 1QUJA 4NF4B 5I56B 3VLWA 2RC8A 2UVHA 3OELA 2LAOA 1JW4A 4RK2A 4U21A 3IORA 2QMWA 4R9FA 1B7ZA 2OCUA 1I69A 2A5SA 4ND9A 1ZLQA 4IO2A 4FJPA 1B3EA 3Q26A 3I6VA 3MVYA 4C0RA 3N6UA 3MPKA 3MPLA 1UTBB 5H8QA 1MPCA 4U4SA 2ALUA 1LFGA 4EF1A 4R6KA 3CFLA 2H5YA 1XHYA 5I2NA 2VHAA 2XXYA 4HS7A 3C36A 4R72A 3DP4A 3VFJA 3JYRA 2Y7PA 4PFYA 3FXRA 4RY1A 3LSLA 3CSGA 4F31B 3K0VA 3RY3A 4DXCA 1OLAA 1WODA 4H5FA 4KYDA 4XKRA 2WKYA 3PD8A 1LAXA 2B3FA 3N26A 4IO4A 4G68C 4YMBA 4ZEDA 3BBRA 1BKAA 1XOCA 1R9LA 4XXUA 4EQ7A 1JNFA 3UP9A 4OEVA 3HHFA 1A7LA 2XXPA 3LBSA 4R9GA 2B3BA 3RTWB 2UYFA 1IXHA 2ZNUA 5ISUA 2PX1A 1TFDA 1XVXA 5CMMA 2UVGA 1Y1ZA 1A8FA 2ZYMA 2XHDA 4WEDA 4TLLB 2DSFA 3SEXA 4ZEIA 4BDOA 3MZ9A 1SYIA 2O84X 4EDPA 1NKXA 3JV9A 3TCGA 4F3PA 2V25A 3THIA 2P2AA 1M5BA 4OMBA 4LA9A 3UIFA 3O29A 5H8NB 3C31A 4UACA 4IO6A 4F1UA 1B46A 1IXGA 3T66A 1M5FA 5JEIA 3QUFA 3LSWA 1VFEA 2Y84A 5H8SA 4NMYA 1B3LA 4IY6A 1S50A 4NTLA 5I84A 4ZECA 3FV1A 3PPPA 4OZ9A 1POY1 3K1NA 1Q1KA 2I49A 4FE8A 2ZMBA 1CE2A 4WKMA 5AA2B 3F11A 3TTNA 4GXSB 5DT6A 5ICQA 3H6TA 4JB7A 4MH5A 3N5LA 3GBBA 1D4NA 4OQOA 3M3FA 3USDA 3VE1B 3N6TA 1BP5A 3IOTA 1N84A 3CR9A 5AE4A 3CSBA 1Z7NE 1OQHA 1GV8A 1R6ZA 4FORA 1JVXA 2F35A 4LZ5A 4MFIA 2DWJA 4F39A 5HBCA 1TT1A 4JBZA 1VSOA 2Q8JA 1SI1A 5AA3A 2HFBA 2GH9A 3MP8A 1QUIA 4G8MA 3C35A 5TPAB 1O7TA 1YCJA 1S9TA 2Q2AA 5I57B 3Q29A 2QL3A 3T9UA 4F22A 1N7XA 3LUYA 3PUYE 1P1OA 2PBWA 3TELA 1TWYA 4GOTA 1AIVA 3OENA 2R9JA 3H4ZA 4KPTA 1B1HA 2Y7KA 3R26A 1DSNA 4E0XA 3MBPA 4P0GA 1JW1A 2DE4A 5L9SA 5HM4B 1SBPA 3ODBA 1D3KA 3CIJA 3A3CA 4ECFA 3V5AA 1SYHA 2X7QA 2RF1A 1N04A 3QYTA 1B3HA 4ISUA 2P1SA 1OMPA 3WAFA 4LQ2A 4ELOA 3VXCA 3EN3A 2QRYA 5FHMA 3L6HA 5TP9B 2D21A 4YZZA 1QULA 2ZYNA 3I5OA 3PUZE 2OZZA 2CZLA 4OVJA 5FHNA 3L6GA 3O9PA 5I59B 2XXTA 1SDXA 3T9HB 1BTJA 3S2VA 3FVOA 4R2BA 3UN6A 2QS1A 1IEJA 1B0HA 3KOSA 1BIYA 4N6PA 1GVCA 4F1YA 3QIMA 3VVDA 1SQYA 1HSLA 1N0TA 3TTMA 4THIA 4OXVA 3ZSFA 4XKNA 1SW4A 2ONSA 4XKPA 2O1MA 4KCCA 3LSXA 3QXMA 2QMXA 4H6DA 5ITPA 3KGCA 4JWXA 4ZEFA 4GVOA 3FD3A 1R9QA 2VGQA 1MQJA 1LCFA 2PMSA 2ZXTA 3D4GA 3K4UA 1Y1MA 3U72A 1IZ1A 3KN3A 1NH8A 2DWIA 3IO4A 1H3DA 1IIWA 1FTOA 1MXYA 3CFZA 3KJ7A 4QF9A 3S9MC 4ZE8A 4WXJA 3IB2A 4G68A 2E0SA 3OMBA 5HPQA 4KFQA 1IQ7A 4ZZAA 1SVXB 3TAJA 4LVQA 3TFLA 1MM7A 3GLBA 3IOWA 3G3JA 5J1DA 2X7PA 4H1XA 3W15C 1H45A 1MY4A 5A5XB 5H8HA 3TODA 3OD7A 1PDAA 4H8IA 1SW5A 3BFTA 4GWOA 3CRBA 2UXAA 4QFNA 3S9NC 3G7WA 4NF8B 4XKQA 4ZS9A 2M8CA 4U22A 4MBPA 4BLAA 2DWHA 1MDQA 2GRVA 2IEEA 3RLFE 2RC9A 2NVUB 1B3FA 1B58A 2HAVA 2OJTA 4GD5A 5CMBA 3FUZA 3CI8A 3G3FA 3TTRA 2NOOA 2B65A 4QHQA 4QSCA 3TUSA 4G8HA 2HEUA 3FVKA 4BDLA 1OVBA 3B7DA 3KSJA 4FAJA 5AA4B 1N76A 4GL8A 2I4BA 3KBRA 1NFTA 4EXKA 4JXIA 3OO6A 2XXWA 3Q25A 1PBPA 2DVCA 3SESA 3EPEA 2RKMA 2DS9A 3TCHA 3P7IA 2FYIA 3MZ1A 5EYFA 4XIGQ 4L17A 4DE8A 1HSJA 1ZIUA 1GTKA 4R75A 5FHOA 1MQGA 4GXAA 4DZ1A 1B4HA 5BWJA 1FQFA 1LSTA 1O64A 1ELJA 3LSFB 1RYXA 1M5CA 3S9EA 5CBRA 2DE2A 2O1LA 3K6UA 4I8CA 1MQHA 2DVZA 4FEBA 4F29A 4EF2A 1WVJA 2AYSA 3IR1A 3KZGA 1MM6A 1B6HA 4YKJA 4FEDA 3MW0A 3MZBA 4IB2A 3IJOB 3IK6B 4YAHX 1UTHA 2P0SA 1POTA 4Q0CA 1B1XA 4RK9A 1Y3NA 1P1NA 4BDNA 4KCDA 4U1ZA 2ZYKA 4R2FA 5LOMA 5L9MA 5CM6A 1LCTA 2KLFA 1JVYA 3SKPA 4JSOA 2FA7A 2XD2A 4K3FA 4NF5A 5DVJA 2QSXA 4Q5TA 1MXZA 2DXYA 1PB7A 2Y7RA 1MQDA 2Z8FA 3V83A 1FTMA 3U94A 5DEXA 1EZ9A 2V3TA 3T9XB 1FW0A 4YB5A 3SEYA 4G8NA 3FASA 1JW5A 2F97A 1I6BA 4DXBA 3TYHA 2NXOA 5B7DA 2I3WA
chains in the Genus database with same CATH superfamily
3C9HA 4F18A 1ZU0A 1RDYA 1MDP1 3RT6B 4Z7EA 4G61A 1B4ZA 2RC7A 4Q8RA 1DTGA 1FPKA 4MNIA 4F1VA 2XXIA 4OVTA 1DBZA 4X1DA 1FBDA 4KHZE 4M4GA 4YKIA 3U92A 5ET5A 3W9WA 3MJNA 2P3NA 3HPIA 3MP6A 3FXQA 4NHBA 4I3YA 2I48A 1D9VA 4ELPA 1FQDA 2I6EA 1NH7A 4X48A 1FPBA 1ZTYA 3IX1A 5L9OA 4PETA 1MPBA 1WDNA 3ECRA 5DVIA 1URDA 4EQ9A 4PE5B 1XC1A 3C33A 3SEVA 4P56A 4BDMA 1B32A 1NNPA 4HTGA 5JK4A 4PC9A 1GGGA 1PC3A 4BDQA 1VR5A 5KCJB 3MVZA 4OEUA 1QVSA 5I2KA 3LR1A 4MAGA 2V4CA 3H6VA 4IO7A 4XF5A 2O69A 3H6WA 3SERA 4MCOA 1MG1A 3KN8A 4ZE9A 4PAKA 1PBQA 5DTBA 2H25A 3KG2A 2HPGA 3BFUA 3G3IA 2Z8DA 5CI5A 3RUMA 4RJZA 1TFAA 4PQJA 1RKMA 3N94A 1CNQA 2ONRA 4NF6A 3VLUA 4R73A 4PFBA 3B8BA 1FPEA 2CMOA 4N8GA 3R7XA 1LBYA 5I3SA 4OENA 2D5WA 3FJMA 1FTKA 4P1LA 3RPLA 2WYKA 1FQBA 4I3EA 4NE4A 1LBCA 5H8QB 3OXNA 4KD5A 3IO6A 4F3SA 3TKDA 1DTZA 1P1QA 3TZAA 1QKBA 3VVFA 5JTYA 2Y7IA 5I2NB 2WBDA 1M5DA 2XXVA 4QRZA 3T0JA 1LLSA 1MQIA 3MQ9A 1XI6A 3M8UA 4O8MA 1NV3A 1VFDA 1MY2A 2GFEA 4HXVA 4JDFA 2MKZA 3UK4A 4OVSA 4FIMA 2H4IA 2XWVA 3IOUA 1Y20A 4QBAA 1AL3A 1EZOA 1A55A 2HHMA 3G3KA 5K2XA 4LONB 4I9DA 1B0LA 1DOTA 4N07A 2AL4A 2QS2A 3PUVE 3SEUA 3OO7A 3EHUA 4GQOA 4P0IA 1NV2A 3PPOA 3ZKLA 5IZ3A 5KDTA 2ANJA 3K02A 3I3VA 3WAEA 3FGSA 5I7IA 2VP1A 4PTKA 4QFPA 3D4CA 4ZDMA 3ILTB 1Y9UA 3IL1B 1US4A 3EQ1A 2F78A 2XXXA 1NV5A 4H8JA 5BUUA 2RCBA 4M1VA 2F7CA 1YAEA 4P47A 2F36A 1NUZA 1P1UA 1Q9DA 4I40A 4OA4A 1I6QA 2ZZWA 3LUZA 1NNFA 1DCUA 2XXRA 3KC0A 1J1NA 4ZZEA 3ZKKA 2QFLA 4PE3A 2F7BA 4HE2A 1QJMA 3FZVA 4EXLA 1AOVA 5H8FA 2Q88A 3K1MA 2RCAA 4H5GA 3O28A 4O3BA 4GWZA 4C1UA 1FPFA 4JVDA 5CMCA 2V3QA 3FVGA 3E13X 1FCKA 1Z7ME 1NV7A 4NF4A 5AA1A 4E0WA 5I56A 2QS4A 4KYSA 4X9TA 3AXFA 3BIHA 4MX6A 2X26A 2XXHA 1A99A 1FQEA 5K2YA 4DDDA 4HCYA 1N3XA 1DK4A 1XS5A 5EQ8A 3JZJA 2OK2A 3C32A 4H67A 1MXXA 3VVEA 3KFMA 1Y3QA 2GHAA 1EZPA 3U8QA 2DYXA 4QSEA 1UTBA 4F3BA 2FVZA 3E4RA 3QSLA 3ISPA 3U1OA 1MXVA 1FTAA 2VD2A 2F34A 3QK6A 4YU0A 3DM0A 3T22A 2DOJA 2Y5LA 2F3DA 1AMFA 2I0CA 1LAHE 3O97A 5EHSA 1PB9A 1SI0A 3EF7A 1RDXA 2OBGA 2VPNA 3ZS6A 2XX7A 5F7VA 3T9VA 1GR2A 4WEPA 2D3IA 4HE0A 2I0BA 1MY1A 4GIZA 4U2RA 3K01A 3QAXA 5IGAA 4KR5A 2AL5A 5L8DA 1RDZA 3FJ7A 1B05A 3MWBA 4X1BA 1Q35A 1LAFE 3OOAA 3K1PA 4ESXA 4JWYA 4PFWA 3KN7A 1B2HA 3CG3A 4RPOA 3RT8A 3PPNA 2YLNA 3EKIA 3PU5A 4DIGA 3T96B 3OEMA 1D9YA 4H65A 2HQ0A 2OWSA 4PFUA 2R6GE 4OFJA 4IY5A 2E1SA 2F8DA 4O3AA 5ET8A 1XVYA 3HV1A 4R6HA 4AS5A 3IOVA 4P9KA 3O6IA 4U1OA 1SW1A 1QW0A 1B9JA 4N8YA 2FHYA 2DWAA 3FV2A 3UGWA 4MLQA 1PEBA 1NL5A 2G29A 2XWKA 4LUBA 3T1BA 5H8NA 3RNNA 4EUOA 4OESA 3ONMA 1SD3A 2Z8EA 1JQFA 3S4UA 3TQLA 5IKBA 3K00A 3UA8A 3KJTA 3IAZA 4F2OA 2HXRA 4N4UA 3KSXA 4GWXA 1A8EA 1FPGA 4DI4B 4GX3A 1HSEA 4QXDA 4C1TA 3DP6A 5ELVA 1P99A 1OVTA 3PV0E 2H9BA 1OQGA 1LGBC 5AA2A 1EYJA 3VLVA 3FXBA 1FPDA 1FTJA 1S7YA 1USYH 1JEUA 4PBQA 3MYUA 4JVIA 4KYEA 2XWIA 3TTLA 1FTLA 2GHBA 4PFTA 1ANFA 3OSRA 3ILUB 2THIA 4Z0IA 4POXA 3VXBA 4TOZA 5IAIA 3MSTA 4I62A 3O66A 1ZMGA 4MF3A 1LAGE 1R1NA 4DCXA 1MRPA 2OX3A 5DYHA 1B51A 4F2QA 4G2ZA 3CG1A 3MP1A 1SW2A 4IO3A 3M3KA 3VDFA 3PMVA 4TQUQ 4HW8A 2PT2A 4NWDA 5FBPA 4EQBA 2Z23A 1TXFA 3KOTA 4YICA 1MH4A 1AH5A 4LZ7A 5TPAA 4OERA 2ZZVA 1IITA 4YB6A 3PMWA 4N81A 2A5TA 4R74A 2PVUA 5I57A 4MJOA 4O3CA 1EH3A 3FVNA 4QFOA 3K6WA 4OHNA 2UVIA 3PUXE 3FXUA 3FJGA 3LV0A 3VV5A 1B7UA 4JWOA 2I3VA 2DP8A 4N91A 3O2AA 4G68B 3PPQA 1YZ0A 4F19A 3CFXA 4IGTA 3RQTA 3A09A 3TMGA 4IO5A 2I4CA 1YYZA 2PT1A 5H8HB 3RGYA 4KQPA 2HZKA 4KI0E 1RYOA 2BJIA 5LTCA 2XX9A 1IXCA 4OVPA 2G93A 4JSDA 1IMAA 3R6UA 1MY3A 4YB7A 3HHGA 4RNSA 1LFHA 5TP9A 5CBSA 4RXLA 3RTFB 2FNCA 4GBWA 2YJPA 4RA1A 2DXRA 3E9XA 3U93A 2CEYA 2ZNTA 2V84A 4PGNA 4YKKA 1IMFA 5I59A 4AB6A 3OSQA 2XXQA 3BKIB 1OLCA 3RPWA 3W9VA 4ONYA 1B7HA 3HFUA 2HXWA 1DPPA 4OVRA 1L5TA 1B40A 2ABHA 3S9LC 3OEKA 4YKPA 1LFIA 1A54A 3PTYA 3T93B 1ATGA 2WX9A 1IUDA 3QUJA 2PFZA 1JP4A 1FBFA 2XD3A 2DE3A 1LB8A 3HO7A 3OO8A 4AS4A 3FIRA 3KBZA 2L5VA 1QUKA 2OWTA 1M5EA 1VE4A 4PGPA 3M3LA 2QJEA 3MUQA 4GLIA 3IFCA 4RYAA 3TTKA 4LZ8A 1YPNA 1IMCA 3LC8A 4GRKA 3MVWA 2BJJX 4GWSA 4NEDA 4QSDA 4FATA 2UYEA 2HAUA 2YPNA 2W7YA 1B3GA 3GBAA 3GXAA 1QKAA 2O6AA 2O7UA 3A3UA 4MNCA 3PD9A 1A40A 3TCFA 4G4PA 5CRYA 1IMDA 1OIBA 3SETA 4H45A 3GZGA 1UTHB 2WBBA 3K6XA 2O7IA 2O68A 2VOZA 4O94A 3HCQA 1BLFA 4QFKA 1FJ9A 1URSA 4GF8A 3IFAA 1PB8A 5A5XA 1H44A 4H0WA 2PCRA 4H46A 1NMUA 2HCAA 2A5TB 4NF5B 2O51A 3K6VA 4GL0A 5FTHA 1LBWA 2HZLA 3HSTA 4NF8A 5ET6A 3MC2A 4OFOA 4GX6A 4F3GA 3OO9A 5DEXB 3DELB 3MVXA 2NUVA 3E3KA 3SDFA 4NX1A 4MLVA 4NWCA 1MPDA 1NNTA 3IB1A 2DDKA 1SPIA 4I1DA 3EHSA 1B52A 4GX4A 5ICTA 5CMKA 4ZEKA 2H99A 4MEVA 1EU8A 2F5XA 1QGXA 2I58A 3H7MA 1ZKBA 2PYYA 5AA4A 4ELRA 2IA4A 3H03A 4FBPA 1FQAA 1MH3A 5I58A 5AA2D 4AB5A 5F24A 3PMXA 2V3UA 2ZNSA 5F1QA 4MNPA 1IXIA 4N13A 4UA8A 5CC2A 4NN3A 1URGA 4OWDA 4XTCQ 1I6AA 2WYPA 1AWBA 2H98A 3TEPA 1DPEA 2Y7WA 1UIUA 2VD3A 2XXKA 2Q89A 4LQ5A 4R6YA 4OETA 3MAMA 3PUWE 4ZEBA 5EHMA 2ESNA 4PF6A 4PFRA 1ZJLA 3FATA 3B6TA 1T0KA 1US5A 2XXUA 3UORA 1UQWA 1H76A 4MIJA 3CVGA 5ITOA 3K2DA 5I2KB 3Q27A 4DXUA 2REJA 1B5HA 5I5PA 2Q9TA 4AQ4A 1NV4A 1USYE 2ZZXA 3TPAA 2XX8A 4LN5A 4DLDA 5TU0A 1FQCA 3H6UA 2Q2CA 4PAIA 1DMBA 3G3GA 1UIVA 4NF6B 3EHTA 1NUXA 1CB6A 3DLNA 4PDHA 3TDJA 4BDRA 4POWA 3PGFA 1MY0A 4TLMB 2AIXA 2NWJA 2ONKE 3RPLB 4Q30B 2F6GA 1JETA 2RINA 1II5A 1FSAA 3KEIA 4PP0A 4U4XA 5FTIA 4KXPA 4X8RA 3V8XB 5JTYB 1NNKA 4P11A 1MXUA 3DP8A 2F6PA 4ELQA 3E78A 3IJXB 3O6GA 3H3GA 1XT8A 4DI3D 2DQVA 1B5IA 2OLBA 2P3VA 3SEWA 3BIGA 1FPJA 5B70A 3O6HA 4OYVA 1Y4CA 5DVFA 2ZYOA 1B5JA 2CZIA 2QPQA 1YTVA 1KA0A 2F7AA 3C4MA 4U23A 3B50A 1KWHA 4GWWA 4PF8A 1O63A 1N7WA 1LBBA 4ESWA 4G77A 1BK4A 4DCYA 4YMAA 3V89B 2PFYA 3B6WA 2R71A 5IZ3B 5KDTB 4LATA 1LB9A 4RPNA 1LBVA 1ZBMA 1MS7A 2KQZA 3B6QA 1F9BA 1VDWA 2QS3A 3H06B 5KZTA 1H43A 4HCWA 2REGA 4OFLA 3Q28A 1Y3PA 4IGRA 3IB0A 3D1RA 4GFRA 2Z22A 3C34A 2UVJA 1Y4TA 1FPLA 2V93A 3HN0A 3G3HA 1N3WA 5H8FB 3RN8A 4QFLA 5I58B 4FECA 5KCJA 4OTEA 3PPRA 1P1WA 4LP2B 3TQWA 5M2VA 1JEVA 1MXWA 1QUJA 4NF4B 5I56B 2B4LA 3VLWA 2RC8A 2UVHA 3OELA 2LAOA 1JW4A 4RK2A 4U21A 3IORA 2QMWA 4R9FA 1B7ZA 2OCUA 1I69A 2FIXA 2A5SA 4ND9A 1ZLQA 4IO2A 4FJPA 1B3EA 3Q26A 3I6VA 2FIEA 3MVYA 3N6UA 4C0RA 3MPKA 3MPLA 1FBCA 1UTBB 5H8QA 1MPCA 4U4SA 2ALUA 1LFGA 4EF1A 4MMPA 4R6KA 3CFLA 4NG7A 2H5YA 1XHYA 4PDDA 5I2NA 2VHAA 2XXYA 4HS7A 3C36A 4R72A 3DP4A 3VFJA 3JYRA 2Y7PA 4PFYA 1KA1A 3FXRA 4RY1A 3LSLA 2B4MA 3CSGA 5EQ9A 4F31B 3K0VA 1EYIA 3RY3A 4DXCA 1OLAA 1WODA 4H5FA 4KYDA 4XKRA 2WKYA 3PD8A 1LAXA 2B3FA 3N26A 4IO4A 4G68C 4PAFA 4YMBA 4ZEDA 3BBRA 5ET7A 1BKAA 1XOCA 1R9LA 4XXUA 4EQ7A 1JNFA 3UP9A 4OEVA 3HHFA 1A7LA 2XXPA 3LBSA 4R9GA 2B3BA 5EYGA 3RTWB 2UYFA 1IXHA 2ZNUA 3U65A 4OANA 4UABA 5ISUA 2PX1A 3RYDA 1TFDA 1XVXA 1EYKA 5CMMA 2UVGA 1Y1ZA 1A8FA 2ZYMA 2QVRA 2XHDA 3NOHA 4WEDA 4TLLB 2DSFA 1G0IA 3SEXA 4ZEIA 4BDOA 3MZ9A 5EYHA 1SYIA 4NGUA 2O84X 4EDPA 1NKXA 3JV9A 3TCGA 4F3PA 2V25A 3THIA 1YXIA 1NUYA 3GYYA 2P2AA 1M5BA 3CHGA 3FBPA 4OMBA 4LA9A 3UIFA 3O29A 1FRPA 5H8NB 4NF0A 3C31A 4UACA 4IO6A 4F1UA 1B46A 1IXGA 3T66A 2OWZA 1M5FA 5JEIA 3QUFA 3LSWA 1VFEA 2F3BA 2Y84A 2XWOA 4IR8A 5H8SA 4NMYA 1B3LA 4IY6A 1S50A 4P8BA 4NTLA 1NUWA 5I84A 1FBPA 4ZECA 3FV1A 3PPPA 4OZ9A 4O7MA 1POY1 3K1NA 1Q1KA 2I49A 4FE8A 2ZMBA 1CE2A 3KC1A 4WKMA 5AA2B 3F11A 3TTNA 4GXSB 5DT6A 5ICQA 3H6TA 4JB7A 2R8TA 3N5LA 3GBBA 4MH5A 2CZKA 4NAPA 4P1EA 1D4NA 4OQOA 3M3FA 2JJKA 3USDA 4PFIA 3VE1B 3N6TA 1BP5A 4O7IA 3IOTA 1N84A 3CR9A 5AE4A 3CSBA 1Z7NE 1OQHA 1GV8A 2VPOA 1R6ZA 4FORA 1JVXA 2F35A 4LZ5A 1G0HA 2CEXA 4MFIA 4NQ8A 2DWJA 4F39A 5HBCA 1TT1A 4JBZA 1VSOA 2Q8JA 2GQ1A 1SI1A 5AA3A 2HFBA 2GH9A 3MP8A 1QUIA 4G8MA 3C35A 5TPAB 3QMFA 1O7TA 1D9QA 5EQ7A 1YCJA 1S9TA 2Q2AA 5I57B 3Q29A 2QL3A 3T9UA 4F22A 4PCDA 1N7XA 5IM2A 2QVVA 3LUYA 3PUYE 4N6KA 1P1OA 2PBWA 3TELA 1TWYA 4GOTA 1AIVA 3OENA 1NV0A 2R9JA 1FJ6A 3H4ZA 4KPTA 1B1HA 2Y7KA 3R26A 3ROJA 1DSNA 4E0XA 5T3JA 3MBPA 4P0GA 1JW1A 2DE4A 5L9SA 5HM4B 5J16A 1SBPA 3ODBA 1D3KA 3CIJA 3A3CA 4N17A 4ECFA 3V5AA 1SYHA 2X7QA 2RF1A 1N04A 3QYTA 1B3HA 4ISUA 2P1SA 1IMBA 1OMPA 3WAFA 4LQ2A 4ELOA 3VXCA 4JVCA 3EN3A 2QRYA 5FHMA 3L6HA 5TP9B 2D21A 4YZZA 1QULA 2ZYNA 3I5OA 3PUZE 2OZZA 2CZLA 4OVJA 5FHNA 4GWUA 3L6GA 3O9PA 5I59B 2XXTA 1SDXA 2XA5A 3T9HB 1BTJA 3S2VA 3FVOA 4R2BA 3UN6A 2QS1A 1IEJA 1B0HA 3KOSA 1BIYA 4N6PA 1GVCA 4F1YA 3QIMA 3VVDA 1SQYA 1HSLA 1N0TA 3TTMA 4THIA 4X04A 4OXVA 3ZSFA 5A5LA 4XKNA 5IZZA 1SW4A 2ONSA 4XKPA 2O1MA 4KCCA 3LSXA 3QXMA 2QMXA 4H6DA 5ITPA 1NI9A 2WEFA 3KGCA 1KZ8A 1FPIA 4JWXA 1NV1A 4ZEFA 4HE1A 4GVOA 2Q74A 3FD3A 1R9QA 2VGQA 1MQJA 1LCFA 2PMSA 2ZXTA 3D4GA 3K4UA 1Y1MA 3U72A 1IZ1A 2Y5KA 3KN3A 1NH8A 2DWIA 3IO4A 1H3DA 1IIWA 4N6DA 1FTOA 1MXYA 3CFZA 2FBPA 3KJ7A 4QF9A 3S9MC 4ZE8A 4WXJA 3IB2A 4P3LA 3SZPA 4G68A 2E0SA 3OMBA 5HPQA 4KFQA 1IQ7A 4ZZAA 1SVXB 3TAJA 4LVQA 3TFLA 1MM7A 3GLBA 3IOWA 3G3JA 5J1DA 2X7PA 4H1XA 5IZ1A 3W15C 1H45A 1MY4A 5A5XB 5H8HA 3TODA 3OD7A 1PDAA 1LEVA 4H8IA 1SW5A 3BFTA 4GWOA 3CRBA 2UXAA 4QFNA 3S9NC 3G7WA 4NF8B 4XKQA 4ZS9A 2M8CA 4U22A 4MBPA 4XEQA 4BLAA 2DWHA 1NV6A 1MDQA 2GRVA 2IEEA 3E79A 3RLFE 2RC9A 4GBVA 2NVUB 1B3FA 1B58A 2QVUA 2HAVA 2OJTA 4GD5A 2Q8MA 5CMBA 3FUZA 3CI8A 3G3FA 3TTRA 2NOOA 1K9YA 4MHFA 2B65A 4QHQA 4QSCA 3TUSA 4G8HA 5ESYA 2HEUA 3FVKA 4BDLA 1OVBA 3B7DA 3KSJA 4FAJA 5AA4B 1N76A 4GL8A 1FBEA 5EQAA 5LDZA 2I4BA 3KBRA 1NFTA 4EXKA 4PBHA 1LBZA 4JXIA 3A29A 3OO6A 2XXWA 3Q25A 1PBPA 2DVCA 3SESA 1FBHA 3EPEA 2RKMA 2DS9A 2KR0A 3TCHA 3P7IA 2FYIA 3MZ1A 1IMEA 5EYFA 4XIGQ 4L17A 4DE8A 1HSJA 1ZIUA 1GTKA 4R75A 5FHOA 1MQGA 4GXAA 4DZ1A 1B4HA 5BWJA 1FQFA 1LSTA 1K9ZA 1O64A 1ELJA 4OVQA 3LSFB 1RYXA 1M5CA 3S9EA 5CBRA 2DE2A 2O1LA 3K6UA 4I8CA 1MQHA 2DVZA 4FEBA 4F29A 4EF2A 1WVJA 2AYSA 3IR1A 3KZGA 1MM6A 1B6HA 4YKJA 4FEDA 3MW0A 5DW8A 3MZBA 4IB2A 3IJOB 3IK6B 4YAHX 1UTHA 2P0SA 1POTA 4Q0CA 1B1XA 4RK9A 1Y3NA 1P1NA 4BDNA 4KCDA 4U1ZA 2ZYKA 4R2FA 5LOMA 5L9MA 5CM6A 1LCTA 2KLFA 1JVYA 3SKPA 4JSOA 2FA7A 1LBXA 2XD2A 4K3FA 4NF5A 5DVJA 2QSXA 4Q5TA 1MXZA 2VT5A 4GWYA 2DXYA 1PB7A 2Y7RA 1MQDA 2Z8FA 3V83A 1FTMA 3U94A 5DEXA 1EZ9A 2V3TA 3T9XB 1FW0A 4YB5A 1FBGA 3SEYA 4XFEA 4G8NA 3FASA 4N15A 1JW5A 2F97A 2CZHA 1I6BA 4DXBA 3TYHA 2NXOA 5B7DA 1INPA 2I3WA
chains in the Genus database with same CATH topology
3C9HA 4F18A 1ZU0A 1MDP1 3RT6B 4Z7EA 1B4ZA 2RC7A 4Q8RA 1DTGA 4F1VA 2XXIA 4X1DA 4KHZE 4M4GA 4YKIA 3U92A 3W9WA 3MJNA 3HPIA 3MP6A 3FXQA 4ELPA 2I48A 1D9VA 1FQDA 2I6EA 1NH7A 4X48A 1ZTYA 3IX1A 5L9OA 4PETA 1MPBA 1WDNA 3ECRA 5DVIA 1URDA 4EQ9A 4PE5B 1XC1A 3C33A 3SEVA 4BDMA 1B32A 1NNPA 4HTGA 5JK4A 1GGGA 1PC3A 4BDQA 1VR5A 5KCJB 3MVZA 4OEUA 1QVSA 5I2KA 3LR1A 3H6VA 4IO7A 2O69A 3H6WA 3SERA 1MG1A 3KN8A 4ZE9A 1PBQA 5DTBA 2H25A 3KG2A 3BFUA 3G3IA 2Z8DA 5CI5A 3RUMA 4RJZA 1TFAA 4PQJA 1RKMA 3N94A 2ONRA 4NF6A 3VLUA 4R73A 2CMOA 3R7XA 4OENA 2D5WA 3FJMA 1FTKA 1FQBA 4NE4A 1LBCA 5H8QB 3OXNA 4KD5A 3IO6A 4F3SA 3TKDA 1DTZA 1P1QA 3TZAA 1QKBA 3VVFA 5JTYA 2Y7IA 5I2NB 1M5DA 2XXVA 4QRZA 1LLSA 1MQIA 3MQ9A 3M8UA 1VFDA 1MY2A 2GFEA 4JDFA 3UK4A 4FIMA 2H4IA 3IOUA 1Y20A 1AL3A 1EZOA 1A55A 3G3KA 5K2XA 4LONB 4I9DA 1B0LA 1DOTA 4N07A 2AL4A 2QS2A 3PUVE 3SEUA 3OO7A 3EHUA 4GQOA 4P0IA 3PPOA 3ZKLA 5KDTA 2ANJA 3K02A 3I3VA 3WAEA 3FGSA 2VP1A 4QFPA 3D4CA 4ZDMA 3ILTB 1Y9UA 3IL1B 1US4A 3EQ1A 2F78A 2XXXA 4H8JA 5BUUA 2RCBA 4M1VA 2F7CA 1YAEA 2F36A 1P1UA 1I6QA 1NNFA 2XXRA 1J1NA 4ZZEA 3ZKKA 2F7BA 1QJMA 3FZVA 4EXLA 1AOVA 5H8FA 2Q88A 3K1MA 2RCAA 4H5GA 3O28A 4O3BA 4C1UA 5CMCA 2V3QA 3FVGA 3E13X 1FCKA 1Z7ME 4NF4A 5AA1A 4E0WA 5I56A 2QS4A 4KYSA 4X9TA 3AXFA 2X26A 2XXHA 1A99A 1FQEA 5K2YA 4DDDA 4HCYA 1N3XA 1XS5A 3JZJA 2OK2A 3C32A 4H67A 1MXXA 3VVEA 3KFMA 1Y3QA 2GHAA 1EZPA 3U8QA 2DYXA 4QSEA 1UTBA 4F3BA 3E4RA 3QSLA 3U1OA 1MXVA 2VD2A 2F34A 3QK6A 4YU0A 3DM0A 3T22A 2DOJA 1AMFA 2I0CA 1LAHE 3O97A 5EHSA 1PB9A 1SI0A 3EF7A 2OBGA 3ZS6A 2XX7A 5F7VA 3T9VA 1GR2A 4WEPA 2D3IA 2I0BA 1MY1A 4GIZA 4U2RA 3K01A 3QAXA 4KR5A 2AL5A 5L8DA 3FJ7A 1B05A 3MWBA 4X1BA 1Q35A 1LAFE 3OOAA 3K1PA 4ESXA 4JWYA 4PFWA 3KN7A 1B2HA 3CG3A 4RPOA 3RT8A 3PPNA 2YLNA 3PU5A 4DIGA 3T96B 3OEMA 1D9YA 4H65A 2HQ0A 2OWSA 4PFUA 2R6GE 4OFJA 4IY5A 2E1SA 2F8DA 4O3AA 1XVYA 3HV1A 4R6HA 3IOVA 3O6IA 4U1OA 1SW1A 1QW0A 1B9JA 2DWAA 3FV2A 3UGWA 4MLQA 1PEBA 1NL5A 2G29A 4LUBA 5H8NA 3RNNA 4EUOA 4OESA 3ONMA 1SD3A 2Z8EA 1JQFA 3S4UA 3TQLA 5IKBA 3K00A 3UA8A 3KJTA 3IAZA 4F2OA 3KSXA 1A8EA 1HSEA 4C1TA 3DP6A 5ELVA 1P99A 1OVTA 3PV0E 2H9BA 1OQGA 1LGBC 5AA2A 3VLVA 1FTJA 1S7YA 1USYH 1JEUA 4KYEA 3TTLA 1FTLA 2GHBA 4PFTA 1ANFA 3OSRA 3ILUB 2THIA 4Z0IA 4POXA 3VXBA 4TOZA 5IAIA 4I62A 3O66A 1ZMGA 4MF3A 1LAGE 1R1NA 4DCXA 1MRPA 5DYHA 1B51A 4F2QA 4G2ZA 3CG1A 3MP1A 1SW2A 4IO3A 3M3KA 3VDFA 3PMVA 4TQUQ 4HW8A 2PT2A 4NWDA 4EQBA 2Z23A 1TXFA 3KOTA 4YICA 1MH4A 1AH5A 4LZ7A 5TPAA 4OERA 1IITA 4YB6A 3PMWA 2A5TA 4R74A 2PVUA 5I57A 4O3CA 1EH3A 3FVNA 4QFOA 3K6WA 4OHNA 2UVIA 3PUXE 3FXUA 3FJGA 3VV5A 1B7UA 4JWOA 2I3VA 2DP8A 3O2AA 4G68B 3PPQA 4F19A 3CFXA 4IGTA 3RQTA 3A09A 3TMGA 4IO5A 2I4CA 2PT1A 5H8HB 3RGYA 4KQPA 2HZKA 4KI0E 1RYOA 2XX9A 1IXCA 2G93A 4JSDA 3R6UA 1MY3A 4YB7A 3HHGA 4RNSA 1LFHA 5TP9A 5CBSA 4RXLA 3RTFB 2FNCA 2YJPA 4RA1A 2DXRA 3E9XA 3U93A 2ZNTA 2V84A 4YKKA 5I59A 4AB6A 3OSQA 2XXQA 3BKIB 1OLCA 3RPWA 3W9VA 1B7HA 4ONYA 2HXWA 1DPPA 1L5TA 1B40A 2ABHA 3S9LC 3OEKA 4YKPA 1LFIA 1A54A 3T93B 1ATGA 1IUDA 3QUJA 2XD3A 2DE3A 1LB8A 3HO7A 3OO8A 3FIRA 1QUKA 2OWTA 1M5EA 1VE4A 3M3LA 2QJEA 3MUQA 4GLIA 4RYAA 3TTKA 4LZ8A 1YPNA 3LC8A 4GRKA 3MVWA 2BJJX 4NEDA 4QSDA 4FATA 2UYEA 2HAUA 2YPNA 2W7YA 1B3GA 3GBAA 3GXAA 1QKAA 2O6AA 2O7UA 3A3UA 3PD9A 1A40A 3TCFA 4G4PA 5CRYA 1OIBA 3SETA 3GZGA 1UTHB 3K6XA 2O7IA 2O68A 2VOZA 3HCQA 1BLFA 4QFKA 1URSA 4GF8A 1PB8A 5A5XA 1H44A 4H0WA 1NMUA 2HCAA 2A5TB 4NF5B 2O51A 3K6VA 4GL0A 5FTHA 2HZLA 3HSTA 4NF8A 3MC2A 4OFOA 4F3GA 3OO9A 5DEXB 3DELB 3MVXA 2NUVA 3E3KA 3SDFA 4MLVA 4NWCA 1MPDA 1NNTA 3IB1A 4I1DA 3EHSA 1B52A 5ICTA 5CMKA 4ZEKA 2H99A 1EU8A 2F5XA 2I58A 3H7MA 1ZKBA 2PYYA 5AA4A 4ELRA 2IA4A 3H03A 1FQAA 1MH3A 5I58A 5AA2D 4AB5A 3PMXA 2V3UA 2ZNSA 5F1QA 1IXIA 4N13A 4UA8A 5CC2A 1URGA 4OWDA 4XTCQ 1I6AA 2H98A 3TEPA 1DPEA 2Y7WA 1UIUA 2VD3A 2Q89A 4LQ5A 4R6YA 4OETA 3MAMA 3PUWE 4ZEBA 5EHMA 2ESNA 1ZJLA 3FATA 3B6TA 1T0KA 1US5A 2XXUA 3UORA 1UQWA 1H76A 3CVGA 5ITOA 3K2DA 5I2KB 3Q27A 4DXUA 2REJA 1B5HA 2Q9TA 4AQ4A 1USYE 3TPAA 2XX8A 4DLDA 5TU0A 1FQCA 3H6UA 2Q2CA 1DMBA 3G3GA 1UIVA 4NF6B 3EHTA 1CB6A 3DLNA 3TDJA 4BDRA 4POWA 3PGFA 1MY0A 4TLMB 2AIXA 2NWJA 2ONKE 4Q30B 2F6GA 1JETA 2RINA 1II5A 3KEIA 4PP0A 4U4XA 5FTIA 3V8XB 5JTYB 1NNKA 4P11A 1MXUA 3DP8A 2F6PA 4ELQA 3IJXB 3O6GA 3H3GA 1XT8A 2DQVA 1B5IA 2OLBA 3SEWA 5B70A 3O6HA 4OYVA 1Y4CA 5DVFA 2ZYOA 1B5JA 2QPQA 1YTVA 2F7AA 3C4MA 4U23A 1KWHA 1O63A 1N7WA 1LBBA 4ESWA 4G77A 4DCYA 4YMAA 3V89B 3B6WA 2R71A 5KDTB 4LATA 1LB9A 4RPNA 1ZBMA 1MS7A 3B6QA 1F9BA 2QS3A 3H06B 5KZTA 1H43A 4HCWA 2REGA 4OFLA 3Q28A 1Y3PA 4IGRA 3IB0A 4GFRA 2Z22A 3C34A 2UVJA 1Y4TA 2V93A 3HN0A 3G3HA 1N3WA 5H8FB 3RN8A 4QFLA 5I58B 4FECA 5KCJA 4OTEA 3PPRA 1P1WA 4LP2B 3TQWA 5M2VA 1JEVA 1MXWA 1QUJA 4NF4B 5I56B 3VLWA 2RC8A 2UVHA 3OELA 2LAOA 1JW4A 4RK2A 4U21A 3IORA 2QMWA 4R9FA 1B7ZA 2OCUA 1I69A 2A5SA 4ND9A 1ZLQA 4IO2A 4FJPA 1B3EA 3Q26A 3I6VA 3MVYA 4C0RA 3N6UA 3MPKA 3MPLA 1UTBB 5H8QA 1MPCA 4U4SA 2ALUA 1LFGA 4EF1A 4R6KA 3CFLA 2H5YA 1XHYA 5I2NA 2VHAA 2XXYA 4HS7A 3C36A 4R72A 3DP4A 3VFJA 3JYRA 2Y7PA 4PFYA 3FXRA 4RY1A 3LSLA 3CSGA 4F31B 3K0VA 3RY3A 4DXCA 1OLAA 1WODA 4H5FA 4KYDA 4XKRA 2WKYA 3PD8A 1LAXA 2B3FA 3N26A 4IO4A 4G68C 4YMBA 4ZEDA 3BBRA 1BKAA 1XOCA 1R9LA 4XXUA 4EQ7A 1JNFA 3UP9A 4OEVA 3HHFA 1A7LA 2XXPA 3LBSA 4R9GA 2B3BA 3RTWB 2UYFA 1IXHA 2ZNUA 5ISUA 2PX1A 1TFDA 1XVXA 5CMMA 2UVGA 1Y1ZA 1A8FA 2ZYMA 2XHDA 4WEDA 4TLLB 2DSFA 3SEXA 4ZEIA 4BDOA 3MZ9A 1SYIA 2O84X 4EDPA 1NKXA 3JV9A 3TCGA 4F3PA 2V25A 3THIA 2P2AA 1M5BA 4OMBA 4LA9A 3UIFA 3O29A 5H8NB 3C31A 4UACA 4IO6A 4F1UA 1B46A 1IXGA 3T66A 1M5FA 5JEIA 3QUFA 3LSWA 1VFEA 2Y84A 5H8SA 4NMYA 1B3LA 4IY6A 1S50A 4NTLA 5I84A 4ZECA 3FV1A 3PPPA 4OZ9A 1POY1 3K1NA 1Q1KA 2I49A 4FE8A 2ZMBA 1CE2A 4WKMA 5AA2B 3F11A 3TTNA 4GXSB 5DT6A 5ICQA 3H6TA 4JB7A 4MH5A 3N5LA 3GBBA 1D4NA 4OQOA 3M3FA 3USDA 3VE1B 3N6TA 1BP5A 3IOTA 1N84A 3CR9A 5AE4A 3CSBA 1Z7NE 1OQHA 1GV8A 1R6ZA 4FORA 1JVXA 2F35A 4LZ5A 4MFIA 2DWJA 4F39A 5HBCA 1TT1A 4JBZA 1VSOA 2Q8JA 1SI1A 5AA3A 2HFBA 2GH9A 3MP8A 1QUIA 4G8MA 3C35A 5TPAB 1O7TA 1YCJA 1S9TA 2Q2AA 5I57B 3Q29A 2QL3A 3T9UA 4F22A 1N7XA 3LUYA 3PUYE 1P1OA 2PBWA 3TELA 1TWYA 4GOTA 1AIVA 3OENA 2R9JA 3H4ZA 4KPTA 1B1HA 2Y7KA 3R26A 1DSNA 4E0XA 3MBPA 4P0GA 1JW1A 2DE4A 5L9SA 5HM4B 1SBPA 3ODBA 1D3KA 3CIJA 3A3CA 4ECFA 3V5AA 1SYHA 2X7QA 2RF1A 1N04A 3QYTA 1B3HA 4ISUA 2P1SA 1OMPA 3WAFA 4LQ2A 4ELOA 3VXCA 3EN3A 2QRYA 5FHMA 3L6HA 5TP9B 2D21A 4YZZA 1QULA 2ZYNA 3I5OA 3PUZE 2OZZA 2CZLA 4OVJA 5FHNA 3L6GA 3O9PA 5I59B 2XXTA 1SDXA 3T9HB 1BTJA 3S2VA 3FVOA 4R2BA 3UN6A 2QS1A 1IEJA 1B0HA 3KOSA 1BIYA 4N6PA 1GVCA 4F1YA 3QIMA 3VVDA 1SQYA 1HSLA 1N0TA 3TTMA 4THIA 4OXVA 3ZSFA 4XKNA 1SW4A 2ONSA 4XKPA 2O1MA 4KCCA 3LSXA 3QXMA 2QMXA 4H6DA 5ITPA 3KGCA 4JWXA 4ZEFA 4GVOA 3FD3A 1R9QA 2VGQA 1MQJA 1LCFA 2PMSA 2ZXTA 3D4GA 3K4UA 1Y1MA 3U72A 1IZ1A 3KN3A 1NH8A 2DWIA 3IO4A 1H3DA 1IIWA 1FTOA 1MXYA 3CFZA 3KJ7A 4QF9A 3S9MC 4ZE8A 4WXJA 3IB2A 4G68A 2E0SA 3OMBA 5HPQA 4KFQA 1IQ7A 4ZZAA 1SVXB 3TAJA 4LVQA 3TFLA 1MM7A 3GLBA 3IOWA 3G3JA 5J1DA 2X7PA 4H1XA 3W15C 1H45A 1MY4A 5A5XB 5H8HA 3TODA 3OD7A 1PDAA 4H8IA 1SW5A 3BFTA 4GWOA 3CRBA 2UXAA 4QFNA 3S9NC 3G7WA 4NF8B 4XKQA 4ZS9A 2M8CA 4U22A 4MBPA 4BLAA 2DWHA 1MDQA 2GRVA 2IEEA 3RLFE 2RC9A 2NVUB 1B3FA 1B58A 2HAVA 2OJTA 4GD5A 5CMBA 3FUZA 3CI8A 3G3FA 3TTRA 2NOOA 2B65A 4QHQA 4QSCA 3TUSA 4G8HA 2HEUA 3FVKA 4BDLA 1OVBA 3B7DA 3KSJA 4FAJA 5AA4B 1N76A 4GL8A 2I4BA 3KBRA 1NFTA 4EXKA 4JXIA 3OO6A 2XXWA 3Q25A 1PBPA 2DVCA 3SESA 3EPEA 2RKMA 2DS9A 3TCHA 3P7IA 2FYIA 3MZ1A 5EYFA 4XIGQ 4L17A 4DE8A 1HSJA 1ZIUA 1GTKA 4R75A 5FHOA 1MQGA 4GXAA 4DZ1A 1B4HA 5BWJA 1FQFA 1LSTA 1O64A 1ELJA 3LSFB 1RYXA 1M5CA 3S9EA 5CBRA 2DE2A 2O1LA 3K6UA 4I8CA 1MQHA 2DVZA 4FEBA 4F29A 4EF2A 1WVJA 2AYSA 3IR1A 3KZGA 1MM6A 1B6HA 4YKJA 4FEDA 3MW0A 3MZBA 4IB2A 3IJOB 3IK6B 4YAHX 1UTHA 2P0SA 1POTA 4Q0CA 1B1XA 4RK9A 1Y3NA 1P1NA 4BDNA 4KCDA 4U1ZA 2ZYKA 4R2FA 5LOMA 5L9MA 5CM6A 1LCTA 2KLFA 1JVYA 3SKPA 4JSOA 2FA7A 2XD2A 4K3FA 4NF5A 5DVJA 2QSXA 4Q5TA 1MXZA 2DXYA 1PB7A 2Y7RA 1MQDA 2Z8FA 3V83A 1FTMA 3U94A 5DEXA 1EZ9A 2V3TA 3T9XB 1FW0A 4YB5A 3SEYA 4G8NA 3FASA 1JW5A 2F97A 1I6BA 4DXBA 3TYHA 2NXOA 5B7DA 2I3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9H A;  4F18 A;  1ZU0 A;  1MDP 1;  3RT6 B;  4Z7E A;  1B4Z A;  2RC7 A;  4Q8R A;  1DTG A;  4F1V A;  2XXI A;  4X1D A;  4KHZ E;  4M4G A;  4YKI A;  3U92 A;  3W9W A;  3MJN A;  3HPI A;  3MP6 A;  3FXQ A;  4ELP A;  2I48 A;  1D9V A;  1FQD A;  2I6E A;  1NH7 A;  4X48 A;  1ZTY A;  3IX1 A;  5L9O A;  4PET A;  1MPB A;  1WDN A;  3ECR A;  5DVI A;  1URD A;  4EQ9 A;  4PE5 B;  1XC1 A;  3C33 A;  3SEV A;  4BDM A;  1B32 A;  1NNP A;  4HTG A;  5JK4 A;  1GGG A;  1PC3 A;  4BDQ A;  1VR5 A;  5KCJ B;  3MVZ A;  4OEU A;  1QVS A;  5I2K A;  3LR1 A;  3H6V A;  4IO7 A;  2O69 A;  3H6W A;  3SER A;  1MG1 A;  3KN8 A;  4ZE9 A;  1PBQ A;  5DTB A;  2H25 A;  3KG2 A;  3BFU A;  3G3I A;  2Z8D A;  5CI5 A;  3RUM A;  4RJZ A;  1TFA A;  4PQJ A;  1RKM A;  3N94 A;  2ONR A;  4NF6 A;  3VLU A;  4R73 A;  2CMO A;  3R7X A;  4OEN A;  2D5W A;  3FJM A;  1FTK A;  1FQB A;  4NE4 A;  1LBC A;  5H8Q B;  3OXN A;  4KD5 A;  3IO6 A;  4F3S A;  3TKD A;  1DTZ A;  1P1Q A;  3TZA A;  1QKB A;  3VVF A;  5JTY A;  2Y7I A;  5I2N B;  1M5D A;  2XXV A;  4QRZ A;  1LLS A;  1MQI A;  3MQ9 A;  3M8U A;  1VFD A;  1MY2 A;  2GFE A;  4JDF A;  3UK4 A;  4FIM A;  2H4I A;  3IOU A;  1Y20 A;  1AL3 A;  1EZO A;  1A55 A;  3G3K A;  5K2X A;  4LON B;  4I9D A;  1B0L A;  1DOT A;  4N07 A;  2AL4 A;  2QS2 A;  3PUV E;  3SEU A;  3OO7 A;  3EHU A;  4GQO A;  4P0I A;  3PPO A;  3ZKL A;  5KDT A;  2ANJ A;  3K02 A;  3I3V A;  3WAE A;  3FGS A;  2VP1 A;  4QFP A;  3D4C A;  4ZDM A;  3ILT B;  1Y9U A;  3IL1 B;  1US4 A;  3EQ1 A;  2F78 A;  2XXX A;  4H8J A;  5BUU A;  2RCB A;  4M1V A;  2F7C A;  1YAE A;  2F36 A;  1P1U A;  1I6Q A;  1NNF A;  2XXR A;  1J1N A;  4ZZE A;  3ZKK A;  2F7B A;  1QJM A;  3FZV A;  4EXL A;  1AOV A;  5H8F A;  2Q88 A;  3K1M A;  2RCA A;  4H5G A;  3O28 A;  4O3B A;  4C1U A;  5CMC A;  2V3Q A;  3FVG A;  3E13 X;  1FCK A;  1Z7M E;  4NF4 A;  5AA1 A;  4E0W A;  5I56 A;  2QS4 A;  4KYS A;  4X9T A;  3AXF A;  2X26 A;  2XXH A;  1A99 A;  1FQE A;  5K2Y A;  4DDD A;  4HCY A;  1N3X A;  1XS5 A;  3JZJ A;  2OK2 A;  3C32 A;  4H67 A;  1MXX A;  3VVE A;  3KFM A;  1Y3Q A;  2GHA A;  1EZP A;  3U8Q A;  2DYX A;  4QSE A;  1UTB A;  4F3B A;  3E4R A;  3QSL A;  3U1O A;  1MXV A;  2VD2 A;  2F34 A;  3QK6 A;  4YU0 A;  3DM0 A;  3T22 A;  2DOJ A;  1AMF A;  2I0C A;  1LAH E;  3O97 A;  5EHS A;  1PB9 A;  1SI0 A;  3EF7 A;  2OBG A;  3ZS6 A;  2XX7 A;  5F7V A;  3T9V A;  1GR2 A;  4WEP A;  2D3I A;  2I0B A;  1MY1 A;  4GIZ A;  4U2R A;  3K01 A;  3QAX A;  4KR5 A;  2AL5 A;  5L8D A;  3FJ7 A;  1B05 A;  3MWB A;  4X1B A;  1Q35 A;  1LAF E;  3OOA A;  3K1P A;  4ESX A;  4JWY A;  4PFW A;  3KN7 A;  1B2H A;  3CG3 A;  4RPO A;  3RT8 A;  3PPN A;  2YLN A;  3PU5 A;  4DIG A;  3T96 B;  3OEM A;  1D9Y A;  4H65 A;  2HQ0 A;  2OWS A;  4PFU A;  2R6G E;  4OFJ A;  4IY5 A;  2E1S A;  2F8D A;  4O3A A;  1XVY A;  3HV1 A;  4R6H A;  3IOV A;  3O6I A;  4U1O A;  1SW1 A;  1QW0 A;  1B9J A;  2DWA A;  3FV2 A;  3UGW A;  4MLQ A;  1PEB A;  1NL5 A;  2G29 A;  4LUB A;  5H8N A;  3RNN A;  4EUO A;  4OES A;  3ONM A;  1SD3 A;  2Z8E A;  1JQF A;  3S4U A;  3TQL A;  5IKB A;  3K00 A;  3UA8 A;  3KJT A;  3IAZ A;  4F2O A;  3KSX A;  1A8E A;  1HSE A;  4C1T A;  3DP6 A;  5ELV A;  1P99 A;  1OVT A;  3PV0 E;  2H9B A;  1OQG A;  1LGB C;  5AA2 A;  3VLV A;  1FTJ A;  1S7Y A;  1USY H;  1JEU A;  4KYE A;  3TTL A;  1FTL A;  2GHB A;  4PFT A;  1ANF A;  3OSR A;  3ILU B;  2THI A;  4Z0I A;  4POX A;  3VXB A;  4TOZ A;  5IAI A;  4I62 A;  3O66 A;  1ZMG A;  4MF3 A;  1LAG E;  1R1N A;  4DCX A;  1MRP A;  5DYH A;  1B51 A;  4F2Q A;  4G2Z A;  3CG1 A;  3MP1 A;  1SW2 A;  4IO3 A;  3M3K A;  3VDF A;  3PMV A;  4TQU Q;  4HW8 A;  2PT2 A;  4NWD A;  4EQB A;  2Z23 A;  1TXF A;  3KOT A;  4YIC A;  1MH4 A;  1AH5 A;  4LZ7 A;  5TPA A;  4OER A;  1IIT A;  4YB6 A;  3PMW A;  2A5T A;  4R74 A;  2PVU A;  5I57 A;  4O3C A;  1EH3 A;  3FVN A;  4QFO A;  3K6W A;  4OHN A;  2UVI A;  3PUX E;  3FXU A;  3FJG A;  3VV5 A;  1B7U A;  4JWO A;  2I3V A;  2DP8 A;  3O2A A;  4G68 B;  3PPQ A;  4F19 A;  3CFX A;  4IGT A;  3RQT A;  3A09 A;  3TMG A;  4IO5 A;  2I4C A;  2PT1 A;  5H8H B;  3RGY A;  4KQP A;  2HZK A;  4KI0 E;  1RYO A;  2XX9 A;  1IXC A;  2G93 A;  4JSD A;  3R6U A;  1MY3 A;  4YB7 A;  3HHG A;  4RNS A;  1LFH A;  5TP9 A;  5CBS A;  4RXL A;  3RTF B;  2FNC A;  2YJP A;  4RA1 A;  2DXR A;  3E9X A;  3U93 A;  2ZNT A;  2V84 A;  4YKK A;  5I59 A;  4AB6 A;  3OSQ A;  2XXQ A;  3BKI B;  1OLC A;  3RPW A;  3W9V A;  1B7H A;  4ONY A;  2HXW A;  1DPP A;  1L5T A;  1B40 A;  2ABH A;  3S9L C;  3OEK A;  4YKP A;  1LFI A;  1A54 A;  3T93 B;  1ATG A;  1IUD A;  3QUJ A;  2XD3 A;  2DE3 A;  1LB8 A;  3HO7 A;  3OO8 A;  3FIR A;  1QUK A;  2OWT A;  1M5E A;  1VE4 A;  3M3L A;  2QJE A;  3MUQ A;  4GLI A;  4RYA A;  3TTK A;  4LZ8 A;  1YPN A;  3LC8 A;  4GRK A;  3MVW A;  2BJJ X;  4NED A;  4QSD A;  4FAT A;  2UYE A;  2HAU A;  2YPN A;  2W7Y A;  1B3G A;  3GBA A;  3GXA A;  1QKA A;  2O6A A;  2O7U A;  3A3U A;  3PD9 A;  1A40 A;  3TCF A;  4G4P A;  5CRY A;  1OIB A;  3SET A;  3GZG A;  1UTH B;  3K6X A;  2O7I A;  2O68 A;  2VOZ A;  3HCQ A;  1BLF A;  4QFK A;  1URS A;  4GF8 A;  1PB8 A;  5A5X A;  1H44 A;  4H0W A;  1NMU A;  2HCA A;  2A5T B;  4NF5 B;  2O51 A;  3K6V A;  4GL0 A;  5FTH A;  2HZL A;  3HST A;  4NF8 A;  3MC2 A;  4OFO A;  4F3G A;  3OO9 A;  5DEX B;  3DEL B;  3MVX A;  2NUV A;  3E3K A;  3SDF A;  4MLV A;  4NWC A;  1MPD A;  1NNT A;  3IB1 A;  4I1D A;  3EHS A;  1B52 A;  5ICT A;  5CMK A;  4ZEK A;  2H99 A;  1EU8 A;  2F5X A;  2I58 A;  3H7M A;  1ZKB A;  2PYY A;  5AA4 A;  4ELR A;  2IA4 A;  3H03 A;  1FQA A;  1MH3 A;  5I58 A;  5AA2 D;  4AB5 A;  3PMX A;  2V3U A;  2ZNS A;  5F1Q A;  1IXI A;  4N13 A;  4UA8 A;  5CC2 A;  1URG A;  4OWD A;  4XTC Q;  1I6A A;  2H98 A;  3TEP A;  1DPE A;  2Y7W A;  1UIU A;  2VD3 A;  2Q89 A;  4LQ5 A;  4R6Y A;  4OET A;  3MAM A;  3PUW E;  4ZEB A;  5EHM A;  2ESN A;  1ZJL A;  3FAT A;  3B6T A;  1T0K A;  1US5 A;  2XXU A;  3UOR A;  1UQW A;  1H76 A;  3CVG A;  5ITO A;  3K2D A;  5I2K B;  3Q27 A;  4DXU A;  2REJ A;  1B5H A;  2Q9T A;  4AQ4 A;  1USY E;  3TPA A;  2XX8 A;  4DLD A;  5TU0 A;  1FQC A;  3H6U A;  2Q2C A;  1DMB A;  3G3G A;  1UIV A;  4NF6 B;  3EHT A;  1CB6 A;  3DLN A;  3TDJ A;  4BDR A;  4POW A;  3PGF A;  1MY0 A;  4TLM B;  2AIX A;  2NWJ A;  2ONK E;  4Q30 B;  2F6G A;  1JET A;  2RIN A;  1II5 A;  3KEI A;  4PP0 A;  4U4X A;  5FTI A;  3V8X B;  5JTY B;  1NNK A;  4P11 A;  1MXU A;  3DP8 A;  2F6P A;  4ELQ A;  3IJX B;  3O6G A;  3H3G A;  1XT8 A;  2DQV A;  1B5I A;  2OLB A;  3SEW A;  5B70 A;  3O6H A;  4OYV A;  1Y4C A;  5DVF A;  2ZYO A;  1B5J A;  2QPQ A;  1YTV A;  2F7A A;  3C4M A;  4U23 A;  1KWH A;  1O63 A;  1N7W A;  1LBB A;  4ESW A;  4G77 A;  4DCY A;  4YMA A;  3V89 B;  3B6W A;  2R71 A;  5KDT B;  4LAT A;  1LB9 A;  4RPN A;  1ZBM A;  1MS7 A;  3B6Q A;  1F9B A;  2QS3 A;  3H06 B;  5KZT A;  1H43 A;  4HCW A;  2REG A;  4OFL A;  3Q28 A;  1Y3P A;  4IGR A;  3IB0 A;  4GFR A;  2Z22 A;  3C34 A;  2UVJ A;  1Y4T A;  2V93 A;  3HN0 A;  3G3H A;  1N3W A;  5H8F B;  3RN8 A;  4QFL A;  5I58 B;  4FEC A;  5KCJ A;  4OTE A;  3PPR A;  1P1W A;  4LP2 B;  3TQW A;  5M2V A;  1JEV A;  1MXW A;  1QUJ A;  4NF4 B;  5I56 B;  3VLW A;  2RC8 A;  2UVH A;  3OEL A;  2LAO A;  1JW4 A;  4RK2 A;  4U21 A;  3IOR A;  2QMW A;  4R9F A;  1B7Z A;  2OCU A;  1I69 A;  2A5S A;  4ND9 A;  1ZLQ A;  4IO2 A;  4FJP A;  1B3E A;  3Q26 A;  3I6V A;  3MVY A;  4C0R A;  3N6U A;  3MPK A;  3MPL A;  1UTB B;  5H8Q A;  1MPC A;  4U4S A;  2ALU A;  1LFG A;  4EF1 A;  4R6K A;  3CFL A;  2H5Y A;  1XHY A;  5I2N A;  2VHA A;  2XXY A;  4HS7 A;  3C36 A;  4R72 A;  3DP4 A;  3VFJ A;  3JYR A;  2Y7P A;  4PFY A;  3FXR A;  4RY1 A;  3LSL A;  3CSG A;  4F31 B;  3K0V A;  3RY3 A;  4DXC A;  1OLA A;  1WOD A;  4H5F A;  4KYD A;  4XKR A;  2WKY A;  3PD8 A;  1LAX A;  2B3F A;  3N26 A;  4IO4 A;  4G68 C;  4YMB A;  4ZED A;  3BBR A;  1BKA A;  1XOC A;  1R9L A;  4XXU A;  4EQ7 A;  1JNF A;  3UP9 A;  4OEV A;  3HHF A;  1A7L A;  2XXP A;  3LBS A;  4R9G A;  2B3B A;  3RTW B;  2UYF A;  1IXH A;  2ZNU A;  5ISU A;  2PX1 A;  1TFD A;  1XVX A;  5CMM A;  2UVG A;  1Y1Z A;  1A8F A;  2ZYM A;  2XHD A;  4WED A;  4TLL B;  2DSF A;  3SEX A;  4ZEI A;  4BDO A;  3MZ9 A;  1SYI A;  2O84 X;  4EDP A;  1NKX A;  3JV9 A;  3TCG A;  4F3P A;  2V25 A;  3THI A;  2P2A A;  1M5B A;  4OMB A;  4LA9 A;  3UIF A;  3O29 A;  5H8N B;  3C31 A;  4UAC A;  4IO6 A;  4F1U A;  1B46 A;  1IXG A;  3T66 A;  1M5F A;  5JEI A;  3QUF A;  3LSW A;  1VFE A;  2Y84 A;  5H8S A;  4NMY A;  1B3L A;  4IY6 A;  1S50 A;  4NTL A;  5I84 A;  4ZEC A;  3FV1 A;  3PPP A;  4OZ9 A;  1POY 1;  3K1N A;  1Q1K A;  2I49 A;  4FE8 A;  2ZMB A;  1CE2 A;  4WKM A;  5AA2 B;  3F11 A;  3TTN A;  4GXS B;  5DT6 A;  5ICQ A;  3H6T A;  4JB7 A;  4MH5 A;  3N5L A;  3GBB A;  1D4N A;  4OQO A;  3M3F A;  3USD A;  3VE1 B;  3N6T A;  1BP5 A;  3IOT A;  1N84 A;  3CR9 A;  5AE4 A;  3CSB A;  1Z7N E;  1OQH A;  1GV8 A;  1R6Z A;  4FOR A;  1JVX A;  2F35 A;  4LZ5 A;  4MFI A;  2DWJ A;  4F39 A;  5HBC A;  1TT1 A;  4JBZ A;  1VSO A;  2Q8J A;  1SI1 A;  5AA3 A;  2HFB A;  2GH9 A;  3MP8 A;  1QUI A;  4G8M A;  3C35 A;  5TPA B;  1O7T A;  1YCJ A;  1S9T A;  2Q2A A;  5I57 B;  3Q29 A;  2QL3 A;  3T9U A;  4F22 A;  1N7X A;  3LUY A;  3PUY E;  1P1O A;  2PBW A;  3TEL A;  1TWY A;  4GOT A;  1AIV A;  3OEN A;  2R9J A;  3H4Z A;  4KPT A;  1B1H A;  2Y7K A;  3R26 A;  1DSN A;  4E0X A;  3MBP A;  4P0G A;  1JW1 A;  2DE4 A;  5L9S A;  5HM4 B;  1SBP A;  3ODB A;  1D3K A;  3CIJ A;  3A3C A;  4ECF A;  3V5A A;  1SYH A;  2X7Q A;  2RF1 A;  1N04 A;  3QYT A;  1B3H A;  4ISU A;  2P1S A;  1OMP A;  3WAF A;  4LQ2 A;  4ELO A;  3VXC A;  3EN3 A;  2QRY A;  5FHM A;  3L6H A;  5TP9 B;  2D21 A;  4YZZ A;  1QUL A;  2ZYN A;  3I5O A;  3PUZ E;  2OZZ A;  2CZL A;  4OVJ A;  5FHN A;  3L6G A;  3O9P A;  5I59 B;  2XXT A;  1SDX A;  3T9H B;  1BTJ A;  3S2V A;  3FVO A;  4R2B A;  3UN6 A;  2QS1 A;  1IEJ A;  1B0H A;  3KOS A;  1BIY A;  4N6P A;  1GVC A;  4F1Y A;  3QIM A;  3VVD A;  1SQY A;  1HSL A;  1N0T A;  3TTM A;  4THI A;  4OXV A;  3ZSF A;  4XKN A;  1SW4 A;  2ONS A;  4XKP A;  2O1M A;  4KCC A;  3LSX A;  3QXM A;  2QMX A;  4H6D A;  5ITP A;  3KGC A;  4JWX A;  4ZEF A;  4GVO A;  3FD3 A;  1R9Q A;  2VGQ A;  1MQJ A;  1LCF A;  2PMS A;  2ZXT A;  3D4G A;  3K4U A;  1Y1M A;  3U72 A;  1IZ1 A;  3KN3 A;  1NH8 A;  2DWI A;  3IO4 A;  1H3D A;  1IIW A;  1FTO A;  1MXY A;  3CFZ A;  3KJ7 A;  4QF9 A;  3S9M C;  4ZE8 A;  4WXJ A;  3IB2 A;  4G68 A;  2E0S A;  3OMB A;  5HPQ A;  4KFQ A;  1IQ7 A;  4ZZA A;  1SVX B;  3TAJ A;  4LVQ A;  3TFL A;  1MM7 A;  3GLB A;  3IOW A;  3G3J A;  5J1D A;  2X7P A;  4H1X A;  3W15 C;  1H45 A;  1MY4 A;  5A5X B;  5H8H A;  3TOD A;  3OD7 A;  1PDA A;  4H8I A;  1SW5 A;  3BFT A;  4GWO A;  3CRB A;  2UXA A;  4QFN A;  3S9N C;  3G7W A;  4NF8 B;  4XKQ A;  4ZS9 A;  2M8C A;  4U22 A;  4MBP A;  4BLA A;  2DWH A;  1MDQ A;  2GRV A;  2IEE A;  3RLF E;  2RC9 A;  2NVU B;  1B3F A;  1B58 A;  2HAV A;  2OJT A;  4GD5 A;  5CMB A;  3FUZ A;  3CI8 A;  3G3F A;  3TTR A;  2NOO A;  2B65 A;  4QHQ A;  4QSC A;  3TUS A;  4G8H A;  2HEU A;  3FVK A;  4BDL A;  1OVB A;  3B7D A;  3KSJ A;  4FAJ A;  5AA4 B;  1N76 A;  4GL8 A;  2I4B A;  3KBR A;  1NFT A;  4EXK A;  4JXI A;  3OO6 A;  2XXW A;  3Q25 A;  1PBP A;  2DVC A;  3SES A;  3EPE A;  2RKM A;  2DS9 A;  3TCH A;  3P7I A;  2FYI A;  3MZ1 A;  5EYF A;  4XIG Q;  4L17 A;  4DE8 A;  1HSJ A;  1ZIU A;  1GTK A;  4R75 A;  5FHO A;  1MQG A;  4GXA A;  4DZ1 A;  1B4H A;  5BWJ A;  1FQF A;  1LST A;  1O64 A;  1ELJ A;  3LSF B;  1RYX A;  1M5C A;  3S9E A;  5CBR A;  2DE2 A;  2O1L A;  3K6U A;  4I8C A;  1MQH A;  2DVZ A;  4FEB A;  4F29 A;  4EF2 A;  1WVJ A;  2AYS A;  3IR1 A;  3KZG A;  1MM6 A;  1B6H A;  4YKJ A;  4FED A;  3MW0 A;  3MZB A;  4IB2 A;  3IJO B;  3IK6 B;  4YAH X;  1UTH A;  2P0S A;  1POT A;  4Q0C A;  1B1X A;  4RK9 A;  1Y3N A;  1P1N A;  4BDN A;  4KCD A;  4U1Z A;  2ZYK A;  4R2F A;  5LOM A;  5L9M A;  5CM6 A;  1LCT A;  2KLF A;  1JVY A;  3SKP A;  4JSO A;  2FA7 A;  2XD2 A;  4K3F A;  4NF5 A;  5DVJ A;  2QSX A;  4Q5T A;  1MXZ A;  2DXY A;  1PB7 A;  2Y7R A;  1MQD A;  2Z8F A;  3V83 A;  1FTM A;  3U94 A;  5DEX A;  1EZ9 A;  2V3T A;  3T9X B;  1FW0 A;  4YB5 A;  3SEY A;  4G8N A;  3FAS A;  1JW5 A;  2F97 A;  1I6B A;  4DXB A;  3TYH A;  2NXO A;  5B7D A;  2I3W A; 
#chains in the Genus database with same CATH topology
 3C9H A;  4F18 A;  1ZU0 A;  1RDY A;  1MDP 1;  3RT6 B;  4Z7E A;  4G61 A;  1B4Z A;  2RC7 A;  4Q8R A;  1DTG A;  1FPK A;  4MNI A;  4F1V A;  2XXI A;  4OVT A;  1DBZ A;  4X1D A;  1FBD A;  4KHZ E;  4M4G A;  4YKI A;  3U92 A;  5ET5 A;  3W9W A;  3MJN A;  2P3N A;  3HPI A;  3MP6 A;  3FXQ A;  4NHB A;  4I3Y A;  2I48 A;  1D9V A;  4ELP A;  1FQD A;  2I6E A;  1NH7 A;  4X48 A;  1FPB A;  1ZTY A;  3IX1 A;  5L9O A;  4PET A;  1MPB A;  1WDN A;  3ECR A;  5DVI A;  1URD A;  4EQ9 A;  4PE5 B;  1XC1 A;  3C33 A;  3SEV A;  4P56 A;  4BDM A;  1B32 A;  1NNP A;  4HTG A;  5JK4 A;  4PC9 A;  1GGG A;  1PC3 A;  4BDQ A;  1VR5 A;  5KCJ B;  3MVZ A;  4OEU A;  1QVS A;  5I2K A;  3LR1 A;  4MAG A;  2V4C A;  3H6V A;  4IO7 A;  4XF5 A;  2O69 A;  3H6W A;  3SER A;  4MCO A;  1MG1 A;  3KN8 A;  4ZE9 A;  4PAK A;  1PBQ A;  5DTB A;  2H25 A;  3KG2 A;  2HPG A;  3BFU A;  3G3I A;  2Z8D A;  5CI5 A;  3RUM A;  4RJZ A;  1TFA A;  4PQJ A;  1RKM A;  3N94 A;  1CNQ A;  2ONR A;  4NF6 A;  3VLU A;  4R73 A;  4PFB A;  3B8B A;  1FPE A;  2CMO A;  4N8G A;  3R7X A;  1LBY A;  5I3S A;  4OEN A;  2D5W A;  3FJM A;  1FTK A;  4P1L A;  3RPL A;  2WYK A;  1FQB A;  4I3E A;  4NE4 A;  1LBC A;  5H8Q B;  3OXN A;  4KD5 A;  3IO6 A;  4F3S A;  3TKD A;  1DTZ A;  1P1Q A;  3TZA A;  1QKB A;  3VVF A;  5JTY A;  2Y7I A;  5I2N B;  2WBD A;  1M5D A;  2XXV A;  4QRZ A;  3T0J A;  1LLS A;  1MQI A;  3MQ9 A;  1XI6 A;  3M8U A;  4O8M A;  1NV3 A;  1VFD A;  1MY2 A;  2GFE A;  4HXV A;  4JDF A;  2MKZ A;  3UK4 A;  4OVS A;  4FIM A;  2H4I A;  2XWV A;  3IOU A;  1Y20 A;  4QBA A;  1AL3 A;  1EZO A;  1A55 A;  2HHM A;  3G3K A;  5K2X A;  4LON B;  4I9D A;  1B0L A;  1DOT A;  4N07 A;  2AL4 A;  2QS2 A;  3PUV E;  3SEU A;  3OO7 A;  3EHU A;  4GQO A;  4P0I A;  1NV2 A;  3PPO A;  3ZKL A;  5IZ3 A;  5KDT A;  2ANJ A;  3K02 A;  3I3V A;  3WAE A;  3FGS A;  5I7I A;  2VP1 A;  4PTK A;  4QFP A;  3D4C A;  4ZDM A;  3ILT B;  1Y9U A;  3IL1 B;  1US4 A;  3EQ1 A;  2F78 A;  2XXX A;  1NV5 A;  4H8J A;  5BUU A;  2RCB A;  4M1V A;  2F7C A;  1YAE A;  4P47 A;  2F36 A;  1NUZ A;  1P1U A;  1Q9D A;  4I40 A;  4OA4 A;  1I6Q A;  2ZZW A;  3LUZ A;  1NNF A;  1DCU A;  2XXR A;  3KC0 A;  1J1N A;  4ZZE A;  3ZKK A;  2QFL A;  4PE3 A;  2F7B A;  4HE2 A;  1QJM A;  3FZV A;  4EXL A;  1AOV A;  5H8F A;  2Q88 A;  3K1M A;  2RCA A;  4H5G A;  3O28 A;  4O3B A;  4GWZ A;  4C1U A;  1FPF A;  4JVD A;  5CMC A;  2V3Q A;  3FVG A;  3E13 X;  1FCK A;  1Z7M E;  1NV7 A;  4NF4 A;  5AA1 A;  4E0W A;  5I56 A;  2QS4 A;  4KYS A;  4X9T A;  3AXF A;  3BIH A;  4MX6 A;  2X26 A;  2XXH A;  1A99 A;  1FQE A;  5K2Y A;  4DDD A;  4HCY A;  1N3X A;  1DK4 A;  1XS5 A;  5EQ8 A;  3JZJ A;  2OK2 A;  3C32 A;  4H67 A;  1MXX A;  3VVE A;  3KFM A;  1Y3Q A;  2GHA A;  1EZP A;  3U8Q A;  2DYX A;  4QSE A;  1UTB A;  4F3B A;  2FVZ A;  3E4R A;  3QSL A;  3ISP A;  3U1O A;  1MXV A;  1FTA A;  2VD2 A;  2F34 A;  3QK6 A;  4YU0 A;  3DM0 A;  3T22 A;  2DOJ A;  2Y5L A;  2F3D A;  1AMF A;  2I0C A;  1LAH E;  3O97 A;  5EHS A;  1PB9 A;  1SI0 A;  3EF7 A;  1RDX A;  2OBG A;  2VPN A;  3ZS6 A;  2XX7 A;  5F7V A;  3T9V A;  1GR2 A;  4WEP A;  2D3I A;  4HE0 A;  2I0B A;  1MY1 A;  4GIZ A;  4U2R A;  3K01 A;  3QAX A;  5IGA A;  4KR5 A;  2AL5 A;  5L8D A;  1RDZ A;  3FJ7 A;  1B05 A;  3MWB A;  4X1B A;  1Q35 A;  1LAF E;  3OOA A;  3K1P A;  4ESX A;  4JWY A;  4PFW A;  3KN7 A;  1B2H A;  3CG3 A;  4RPO A;  3RT8 A;  3PPN A;  2YLN A;  3EKI A;  3PU5 A;  4DIG A;  3T96 B;  3OEM A;  1D9Y A;  4H65 A;  2HQ0 A;  2OWS A;  4PFU A;  2R6G E;  4OFJ A;  4IY5 A;  2E1S A;  2F8D A;  4O3A A;  5ET8 A;  1XVY A;  3HV1 A;  4R6H A;  4AS5 A;  3IOV A;  4P9K A;  3O6I A;  4U1O A;  1SW1 A;  1QW0 A;  1B9J A;  4N8Y A;  2FHY A;  2DWA A;  3FV2 A;  3UGW A;  4MLQ A;  1PEB A;  1NL5 A;  2G29 A;  2XWK A;  4LUB A;  3T1B A;  5H8N A;  3RNN A;  4EUO A;  4OES A;  3ONM A;  1SD3 A;  2Z8E A;  1JQF A;  3S4U A;  3TQL A;  5IKB A;  3K00 A;  3UA8 A;  3KJT A;  3IAZ A;  4F2O A;  2HXR A;  4N4U A;  3KSX A;  4GWX A;  1A8E A;  1FPG A;  4DI4 B;  4GX3 A;  1HSE A;  4QXD A;  4C1T A;  3DP6 A;  5ELV A;  1P99 A;  1OVT A;  3PV0 E;  2H9B A;  1OQG A;  1LGB C;  5AA2 A;  1EYJ A;  3VLV A;  3FXB A;  1FPD A;  1FTJ A;  1S7Y A;  1USY H;  1JEU A;  4PBQ A;  3MYU A;  4JVI A;  4KYE A;  2XWI A;  3TTL A;  1FTL A;  2GHB A;  4PFT A;  1ANF A;  3OSR A;  3ILU B;  2THI A;  4Z0I A;  4POX A;  3VXB A;  4TOZ A;  5IAI A;  3MST A;  4I62 A;  3O66 A;  1ZMG A;  4MF3 A;  1LAG E;  1R1N A;  4DCX A;  1MRP A;  2OX3 A;  5DYH A;  1B51 A;  4F2Q A;  4G2Z A;  3CG1 A;  3MP1 A;  1SW2 A;  4IO3 A;  3M3K A;  3VDF A;  3PMV A;  4TQU Q;  4HW8 A;  2PT2 A;  4NWD A;  5FBP A;  4EQB A;  2Z23 A;  1TXF A;  3KOT A;  4YIC A;  1MH4 A;  1AH5 A;  4LZ7 A;  5TPA A;  4OER A;  2ZZV A;  1IIT A;  4YB6 A;  3PMW A;  4N81 A;  2A5T A;  4R74 A;  2PVU A;  5I57 A;  4MJO A;  4O3C A;  1EH3 A;  3FVN A;  4QFO A;  3K6W A;  4OHN A;  2UVI A;  3PUX E;  3FXU A;  3FJG A;  3LV0 A;  3VV5 A;  1B7U A;  4JWO A;  2I3V A;  2DP8 A;  4N91 A;  3O2A A;  4G68 B;  3PPQ A;  1YZ0 A;  4F19 A;  3CFX A;  4IGT A;  3RQT A;  3A09 A;  3TMG A;  4IO5 A;  2I4C A;  1YYZ A;  2PT1 A;  5H8H B;  3RGY A;  4KQP A;  2HZK A;  4KI0 E;  1RYO A;  2BJI A;  5LTC A;  2XX9 A;  1IXC A;  4OVP A;  2G93 A;  4JSD A;  1IMA A;  3R6U A;  1MY3 A;  4YB7 A;  3HHG A;  4RNS A;  1LFH A;  5TP9 A;  5CBS A;  4RXL A;  3RTF B;  2FNC A;  4GBW A;  2YJP A;  4RA1 A;  2DXR A;  3E9X A;  3U93 A;  2CEY A;  2ZNT A;  2V84 A;  4PGN A;  4YKK A;  1IMF A;  5I59 A;  4AB6 A;  3OSQ A;  2XXQ A;  3BKI B;  1OLC A;  3RPW A;  3W9V A;  4ONY A;  1B7H A;  3HFU A;  2HXW A;  1DPP A;  4OVR A;  1L5T A;  1B40 A;  2ABH A;  3S9L C;  3OEK A;  4YKP A;  1LFI A;  1A54 A;  3PTY A;  3T93 B;  1ATG A;  2WX9 A;  1IUD A;  3QUJ A;  2PFZ A;  1JP4 A;  1FBF A;  2XD3 A;  2DE3 A;  1LB8 A;  3HO7 A;  3OO8 A;  4AS4 A;  3FIR A;  3KBZ A;  2L5V A;  1QUK A;  2OWT A;  1M5E A;  1VE4 A;  4PGP A;  3M3L A;  2QJE A;  3MUQ A;  4GLI A;  3IFC A;  4RYA A;  3TTK A;  4LZ8 A;  1YPN A;  1IMC A;  3LC8 A;  4GRK A;  3MVW A;  2BJJ X;  4GWS A;  4NED A;  4QSD A;  4FAT A;  2UYE A;  2HAU A;  2YPN A;  2W7Y A;  1B3G A;  3GBA A;  3GXA A;  1QKA A;  2O6A A;  2O7U A;  3A3U A;  4MNC A;  3PD9 A;  1A40 A;  3TCF A;  4G4P A;  5CRY A;  1IMD A;  1OIB A;  3SET A;  4H45 A;  3GZG A;  1UTH B;  2WBB A;  3K6X A;  2O7I A;  2O68 A;  2VOZ A;  4O94 A;  3HCQ A;  1BLF A;  4QFK A;  1FJ9 A;  1URS A;  4GF8 A;  3IFA A;  1PB8 A;  5A5X A;  1H44 A;  4H0W A;  2PCR A;  4H46 A;  1NMU A;  2HCA A;  2A5T B;  4NF5 B;  2O51 A;  3K6V A;  4GL0 A;  5FTH A;  1LBW A;  2HZL A;  3HST A;  4NF8 A;  5ET6 A;  3MC2 A;  4OFO A;  4GX6 A;  4F3G A;  3OO9 A;  5DEX B;  3DEL B;  3MVX A;  2NUV A;  3E3K A;  3SDF A;  4NX1 A;  4MLV A;  4NWC A;  1MPD A;  1NNT A;  3IB1 A;  2DDK A;  1SPI A;  4I1D A;  3EHS A;  1B52 A;  4GX4 A;  5ICT A;  5CMK A;  4ZEK A;  2H99 A;  4MEV A;  1EU8 A;  2F5X A;  1QGX A;  2I58 A;  3H7M A;  1ZKB A;  2PYY A;  5AA4 A;  4ELR A;  2IA4 A;  3H03 A;  4FBP A;  1FQA A;  1MH3 A;  5I58 A;  5AA2 D;  4AB5 A;  5F24 A;  3PMX A;  2V3U A;  2ZNS A;  5F1Q A;  4MNP A;  1IXI A;  4N13 A;  4UA8 A;  5CC2 A;  4NN3 A;  1URG A;  4OWD A;  4XTC Q;  1I6A A;  2WYP A;  1AWB A;  2H98 A;  3TEP A;  1DPE A;  2Y7W A;  1UIU A;  2VD3 A;  2XXK A;  2Q89 A;  4LQ5 A;  4R6Y A;  4OET A;  3MAM A;  3PUW E;  4ZEB A;  5EHM A;  2ESN A;  4PF6 A;  4PFR A;  1ZJL A;  3FAT A;  3B6T A;  1T0K A;  1US5 A;  2XXU A;  3UOR A;  1UQW A;  1H76 A;  4MIJ A;  3CVG A;  5ITO A;  3K2D A;  5I2K B;  3Q27 A;  4DXU A;  2REJ A;  1B5H A;  5I5P A;  2Q9T A;  4AQ4 A;  1NV4 A;  1USY E;  2ZZX A;  3TPA A;  2XX8 A;  4LN5 A;  4DLD A;  5TU0 A;  1FQC A;  3H6U A;  2Q2C A;  4PAI A;  1DMB A;  3G3G A;  1UIV A;  4NF6 B;  3EHT A;  1NUX A;  1CB6 A;  3DLN A;  4PDH A;  3TDJ A;  4BDR A;  4POW A;  3PGF A;  1MY0 A;  4TLM B;  2AIX A;  2NWJ A;  2ONK E;  3RPL B;  4Q30 B;  2F6G A;  1JET A;  2RIN A;  1II5 A;  1FSA A;  3KEI A;  4PP0 A;  4U4X A;  5FTI A;  4KXP A;  4X8R A;  3V8X B;  5JTY B;  1NNK A;  4P11 A;  1MXU A;  3DP8 A;  2F6P A;  4ELQ A;  3E78 A;  3IJX B;  3O6G A;  3H3G A;  1XT8 A;  4DI3 D;  2DQV A;  1B5I A;  2OLB A;  2P3V A;  3SEW A;  3BIG A;  1FPJ A;  5B70 A;  3O6H A;  4OYV A;  1Y4C A;  5DVF A;  2ZYO A;  1B5J A;  2CZI A;  2QPQ A;  1YTV A;  1KA0 A;  2F7A A;  3C4M A;  4U23 A;  3B50 A;  1KWH A;  4GWW A;  4PF8 A;  1O63 A;  1N7W A;  1LBB A;  4ESW A;  4G77 A;  1BK4 A;  4DCY A;  4YMA A;  3V89 B;  2PFY A;  3B6W A;  2R71 A;  5IZ3 B;  5KDT B;  4LAT A;  1LB9 A;  4RPN A;  1LBV A;  1ZBM A;  1MS7 A;  2KQZ A;  3B6Q A;  1F9B A;  1VDW A;  2QS3 A;  3H06 B;  5KZT A;  1H43 A;  4HCW A;  2REG A;  4OFL A;  3Q28 A;  1Y3P A;  4IGR A;  3IB0 A;  3D1R A;  4GFR A;  2Z22 A;  3C34 A;  2UVJ A;  1Y4T A;  1FPL A;  2V93 A;  3HN0 A;  3G3H A;  1N3W A;  5H8F B;  3RN8 A;  4QFL A;  5I58 B;  4FEC A;  5KCJ A;  4OTE A;  3PPR A;  1P1W A;  4LP2 B;  3TQW A;  5M2V A;  1JEV A;  1MXW A;  1QUJ A;  4NF4 B;  5I56 B;  2B4L A;  3VLW A;  2RC8 A;  2UVH A;  3OEL A;  2LAO A;  1JW4 A;  4RK2 A;  4U21 A;  3IOR A;  2QMW A;  4R9F A;  1B7Z A;  2OCU A;  1I69 A;  2FIX A;  2A5S A;  4ND9 A;  1ZLQ A;  4IO2 A;  4FJP A;  1B3E A;  3Q26 A;  3I6V A;  2FIE A;  3MVY A;  3N6U A;  4C0R A;  3MPK A;  3MPL A;  1FBC A;  1UTB B;  5H8Q A;  1MPC A;  4U4S A;  2ALU A;  1LFG A;  4EF1 A;  4MMP A;  4R6K A;  3CFL A;  4NG7 A;  2H5Y A;  1XHY A;  4PDD A;  5I2N A;  2VHA A;  2XXY A;  4HS7 A;  3C36 A;  4R72 A;  3DP4 A;  3VFJ A;  3JYR A;  2Y7P A;  4PFY A;  1KA1 A;  3FXR A;  4RY1 A;  3LSL A;  2B4M A;  3CSG A;  5EQ9 A;  4F31 B;  3K0V A;  1EYI A;  3RY3 A;  4DXC A;  1OLA A;  1WOD A;  4H5F A;  4KYD A;  4XKR A;  2WKY A;  3PD8 A;  1LAX A;  2B3F A;  3N26 A;  4IO4 A;  4G68 C;  4PAF A;  4YMB A;  4ZED A;  3BBR A;  5ET7 A;  1BKA A;  1XOC A;  1R9L A;  4XXU A;  4EQ7 A;  1JNF A;  3UP9 A;  4OEV A;  3HHF A;  1A7L A;  2XXP A;  3LBS A;  4R9G A;  2B3B A;  5EYG A;  3RTW B;  2UYF A;  1IXH A;  2ZNU A;  3U65 A;  4OAN A;  4UAB A;  5ISU A;  2PX1 A;  3RYD A;  1TFD A;  1XVX A;  1EYK A;  5CMM A;  2UVG A;  1Y1Z A;  1A8F A;  2ZYM A;  2QVR A;  2XHD A;  3NOH A;  4WED A;  4TLL B;  2DSF A;  1G0I A;  3SEX A;  4ZEI A;  4BDO A;  3MZ9 A;  5EYH A;  1SYI A;  4NGU A;  2O84 X;  4EDP A;  1NKX A;  3JV9 A;  3TCG A;  4F3P A;  2V25 A;  3THI A;  1YXI A;  1NUY A;  3GYY A;  2P2A A;  1M5B A;  3CHG A;  3FBP A;  4OMB A;  4LA9 A;  3UIF A;  3O29 A;  1FRP A;  5H8N B;  4NF0 A;  3C31 A;  4UAC A;  4IO6 A;  4F1U A;  1B46 A;  1IXG A;  3T66 A;  2OWZ A;  1M5F A;  5JEI A;  3QUF A;  3LSW A;  1VFE A;  2F3B A;  2Y84 A;  2XWO A;  4IR8 A;  5H8S A;  4NMY A;  1B3L A;  4IY6 A;  1S50 A;  4P8B A;  4NTL A;  1NUW A;  5I84 A;  1FBP A;  4ZEC A;  3FV1 A;  3PPP A;  4OZ9 A;  4O7M A;  1POY 1;  3K1N A;  1Q1K A;  2I49 A;  4FE8 A;  2ZMB A;  1CE2 A;  3KC1 A;  4WKM A;  5AA2 B;  3F11 A;  3TTN A;  4GXS B;  5DT6 A;  5ICQ A;  3H6T A;  4JB7 A;  2R8T A;  3N5L A;  3GBB A;  4MH5 A;  2CZK A;  4NAP A;  4P1E A;  1D4N A;  4OQO A;  3M3F A;  2JJK A;  3USD A;  4PFI A;  3VE1 B;  3N6T A;  1BP5 A;  4O7I A;  3IOT A;  1N84 A;  3CR9 A;  5AE4 A;  3CSB A;  1Z7N E;  1OQH A;  1GV8 A;  2VPO A;  1R6Z A;  4FOR A;  1JVX A;  2F35 A;  4LZ5 A;  1G0H A;  2CEX A;  4MFI A;  4NQ8 A;  2DWJ A;  4F39 A;  5HBC A;  1TT1 A;  4JBZ A;  1VSO A;  2Q8J A;  2GQ1 A;  1SI1 A;  5AA3 A;  2HFB A;  2GH9 A;  3MP8 A;  1QUI A;  4G8M A;  3C35 A;  5TPA B;  3QMF A;  1O7T A;  1D9Q A;  5EQ7 A;  1YCJ A;  1S9T A;  2Q2A A;  5I57 B;  3Q29 A;  2QL3 A;  3T9U A;  4F22 A;  4PCD A;  1N7X A;  5IM2 A;  2QVV A;  3LUY A;  3PUY E;  4N6K A;  1P1O A;  2PBW A;  3TEL A;  1TWY A;  4GOT A;  1AIV A;  3OEN A;  1NV0 A;  2R9J A;  1FJ6 A;  3H4Z A;  4KPT A;  1B1H A;  2Y7K A;  3R26 A;  3ROJ A;  1DSN A;  4E0X A;  5T3J A;  3MBP A;  4P0G A;  1JW1 A;  2DE4 A;  5L9S A;  5HM4 B;  5J16 A;  1SBP A;  3ODB A;  1D3K A;  3CIJ A;  3A3C A;  4N17 A;  4ECF A;  3V5A A;  1SYH A;  2X7Q A;  2RF1 A;  1N04 A;  3QYT A;  1B3H A;  4ISU A;  2P1S A;  1IMB A;  1OMP A;  3WAF A;  4LQ2 A;  4ELO A;  3VXC A;  4JVC A;  3EN3 A;  2QRY A;  5FHM A;  3L6H A;  5TP9 B;  2D21 A;  4YZZ A;  1QUL A;  2ZYN A;  3I5O A;  3PUZ E;  2OZZ A;  2CZL A;  4OVJ A;  5FHN A;  4GWU A;  3L6G A;  3O9P A;  5I59 B;  2XXT A;  1SDX A;  2XA5 A;  3T9H B;  1BTJ A;  3S2V A;  3FVO A;  4R2B A;  3UN6 A;  2QS1 A;  1IEJ A;  1B0H A;  3KOS A;  1BIY A;  4N6P A;  1GVC A;  4F1Y A;  3QIM A;  3VVD A;  1SQY A;  1HSL A;  1N0T A;  3TTM A;  4THI A;  4X04 A;  4OXV A;  3ZSF A;  5A5L A;  4XKN A;  5IZZ A;  1SW4 A;  2ONS A;  4XKP A;  2O1M A;  4KCC A;  3LSX A;  3QXM A;  2QMX A;  4H6D A;  5ITP A;  1NI9 A;  2WEF A;  3KGC A;  1KZ8 A;  1FPI A;  4JWX A;  1NV1 A;  4ZEF A;  4HE1 A;  4GVO A;  2Q74 A;  3FD3 A;  1R9Q A;  2VGQ A;  1MQJ A;  1LCF A;  2PMS A;  2ZXT A;  3D4G A;  3K4U A;  1Y1M A;  3U72 A;  1IZ1 A;  2Y5K A;  3KN3 A;  1NH8 A;  2DWI A;  3IO4 A;  1H3D A;  1IIW A;  4N6D A;  1FTO A;  1MXY A;  3CFZ A;  2FBP A;  3KJ7 A;  4QF9 A;  3S9M C;  4ZE8 A;  4WXJ A;  3IB2 A;  4P3L A;  3SZP A;  4G68 A;  2E0S A;  3OMB A;  5HPQ A;  4KFQ A;  1IQ7 A;  4ZZA A;  1SVX B;  3TAJ A;  4LVQ A;  3TFL A;  1MM7 A;  3GLB A;  3IOW A;  3G3J A;  5J1D A;  2X7P A;  4H1X A;  5IZ1 A;  3W15 C;  1H45 A;  1MY4 A;  5A5X B;  5H8H A;  3TOD A;  3OD7 A;  1PDA A;  1LEV A;  4H8I A;  1SW5 A;  3BFT A;  4GWO A;  3CRB A;  2UXA A;  4QFN A;  3S9N C;  3G7W A;  4NF8 B;  4XKQ A;  4ZS9 A;  2M8C A;  4U22 A;  4MBP A;  4XEQ A;  4BLA A;  2DWH A;  1NV6 A;  1MDQ A;  2GRV A;  2IEE A;  3E79 A;  3RLF E;  2RC9 A;  4GBV A;  2NVU B;  1B3F A;  1B58 A;  2QVU A;  2HAV A;  2OJT A;  4GD5 A;  2Q8M A;  5CMB A;  3FUZ A;  3CI8 A;  3G3F A;  3TTR A;  2NOO A;  1K9Y A;  4MHF A;  2B65 A;  4QHQ A;  4QSC A;  3TUS A;  4G8H A;  5ESY A;  2HEU A;  3FVK A;  4BDL A;  1OVB A;  3B7D A;  3KSJ A;  4FAJ A;  5AA4 B;  1N76 A;  4GL8 A;  1FBE A;  5EQA A;  5LDZ A;  2I4B A;  3KBR A;  1NFT A;  4EXK A;  4PBH A;  1LBZ A;  4JXI A;  3A29 A;  3OO6 A;  2XXW A;  3Q25 A;  1PBP A;  2DVC A;  3SES A;  1FBH A;  3EPE A;  2RKM A;  2DS9 A;  2KR0 A;  3TCH A;  3P7I A;  2FYI A;  3MZ1 A;  1IME A;  5EYF A;  4XIG Q;  4L17 A;  4DE8 A;  1HSJ A;  1ZIU A;  1GTK A;  4R75 A;  5FHO A;  1MQG A;  4GXA A;  4DZ1 A;  1B4H A;  5BWJ A;  1FQF A;  1LST A;  1K9Z A;  1O64 A;  1ELJ A;  4OVQ A;  3LSF B;  1RYX A;  1M5C A;  3S9E A;  5CBR A;  2DE2 A;  2O1L A;  3K6U A;  4I8C A;  1MQH A;  2DVZ A;  4FEB A;  4F29 A;  4EF2 A;  1WVJ A;  2AYS A;  3IR1 A;  3KZG A;  1MM6 A;  1B6H A;  4YKJ A;  4FED A;  3MW0 A;  5DW8 A;  3MZB A;  4IB2 A;  3IJO B;  3IK6 B;  4YAH X;  1UTH A;  2P0S A;  1POT A;  4Q0C A;  1B1X A;  4RK9 A;  1Y3N A;  1P1N A;  4BDN A;  4KCD A;  4U1Z A;  2ZYK A;  4R2F A;  5LOM A;  5L9M A;  5CM6 A;  1LCT A;  2KLF A;  1JVY A;  3SKP A;  4JSO A;  2FA7 A;  1LBX A;  2XD2 A;  4K3F A;  4NF5 A;  5DVJ A;  2QSX A;  4Q5T A;  1MXZ A;  2VT5 A;  4GWY A;  2DXY A;  1PB7 A;  2Y7R A;  1MQD A;  2Z8F A;  3V83 A;  1FTM A;  3U94 A;  5DEX A;  1EZ9 A;  2V3T A;  3T9X B;  1FW0 A;  4YB5 A;  1FBG A;  3SEY A;  4XFE A;  4G8N A;  3FAS A;  4N15 A;  1JW5 A;  2F97 A;  2CZH A;  1I6B A;  4DXB A;  3TYH A;  2NXO A;  5B7D A;  1INP A;  2I3W A; 
#chains in the Genus database with same CATH homology
 3C9H A;  4F18 A;  1ZU0 A;  1MDP 1;  3RT6 B;  4Z7E A;  1B4Z A;  2RC7 A;  4Q8R A;  1DTG A;  4F1V A;  2XXI A;  4X1D A;  4KHZ E;  4M4G A;  4YKI A;  3U92 A;  3W9W A;  3MJN A;  3HPI A;  3MP6 A;  3FXQ A;  4ELP A;  2I48 A;  1D9V A;  1FQD A;  2I6E A;  1NH7 A;  4X48 A;  1ZTY A;  3IX1 A;  5L9O A;  4PET A;  1MPB A;  1WDN A;  3ECR A;  5DVI A;  1URD A;  4EQ9 A;  4PE5 B;  1XC1 A;  3C33 A;  3SEV A;  4BDM A;  1B32 A;  1NNP A;  4HTG A;  5JK4 A;  1GGG A;  1PC3 A;  4BDQ A;  1VR5 A;  5KCJ B;  3MVZ A;  4OEU A;  1QVS A;  5I2K A;  3LR1 A;  3H6V A;  4IO7 A;  2O69 A;  3H6W A;  3SER A;  1MG1 A;  3KN8 A;  4ZE9 A;  1PBQ A;  5DTB A;  2H25 A;  3KG2 A;  3BFU A;  3G3I A;  2Z8D A;  5CI5 A;  3RUM A;  4RJZ A;  1TFA A;  4PQJ A;  1RKM A;  3N94 A;  2ONR A;  4NF6 A;  3VLU A;  4R73 A;  2CMO A;  3R7X A;  4OEN A;  2D5W A;  3FJM A;  1FTK A;  1FQB A;  4NE4 A;  1LBC A;  5H8Q B;  3OXN A;  4KD5 A;  3IO6 A;  4F3S A;  3TKD A;  1DTZ A;  1P1Q A;  3TZA A;  1QKB A;  3VVF A;  5JTY A;  2Y7I A;  5I2N B;  1M5D A;  2XXV A;  4QRZ A;  1LLS A;  1MQI A;  3MQ9 A;  3M8U A;  1VFD A;  1MY2 A;  2GFE A;  4JDF A;  3UK4 A;  4FIM A;  2H4I A;  3IOU A;  1Y20 A;  1AL3 A;  1EZO A;  1A55 A;  3G3K A;  5K2X A;  4LON B;  4I9D A;  1B0L A;  1DOT A;  4N07 A;  2AL4 A;  2QS2 A;  3PUV E;  3SEU A;  3OO7 A;  3EHU A;  4GQO A;  4P0I A;  3PPO A;  3ZKL A;  5KDT A;  2ANJ A;  3K02 A;  3I3V A;  3WAE A;  3FGS A;  2VP1 A;  4QFP A;  3D4C A;  4ZDM A;  3ILT B;  1Y9U A;  3IL1 B;  1US4 A;  3EQ1 A;  2F78 A;  2XXX A;  4H8J A;  5BUU A;  2RCB A;  4M1V A;  2F7C A;  1YAE A;  2F36 A;  1P1U A;  1I6Q A;  1NNF A;  2XXR A;  1J1N A;  4ZZE A;  3ZKK A;  2F7B A;  1QJM A;  3FZV A;  4EXL A;  1AOV A;  5H8F A;  2Q88 A;  3K1M A;  2RCA A;  4H5G A;  3O28 A;  4O3B A;  4C1U A;  5CMC A;  2V3Q A;  3FVG A;  3E13 X;  1FCK A;  1Z7M E;  4NF4 A;  5AA1 A;  4E0W A;  5I56 A;  2QS4 A;  4KYS A;  4X9T A;  3AXF A;  2X26 A;  2XXH A;  1A99 A;  1FQE A;  5K2Y A;  4DDD A;  4HCY A;  1N3X A;  1XS5 A;  3JZJ A;  2OK2 A;  3C32 A;  4H67 A;  1MXX A;  3VVE A;  3KFM A;  1Y3Q A;  2GHA A;  1EZP A;  3U8Q A;  2DYX A;  4QSE A;  1UTB A;  4F3B A;  3E4R A;  3QSL A;  3U1O A;  1MXV A;  2VD2 A;  2F34 A;  3QK6 A;  4YU0 A;  3DM0 A;  3T22 A;  2DOJ A;  1AMF A;  2I0C A;  1LAH E;  3O97 A;  5EHS A;  1PB9 A;  1SI0 A;  3EF7 A;  2OBG A;  3ZS6 A;  2XX7 A;  5F7V A;  3T9V A;  1GR2 A;  4WEP A;  2D3I A;  2I0B A;  1MY1 A;  4GIZ A;  4U2R A;  3K01 A;  3QAX A;  4KR5 A;  2AL5 A;  5L8D A;  3FJ7 A;  1B05 A;  3MWB A;  4X1B A;  1Q35 A;  1LAF E;  3OOA A;  3K1P A;  4ESX A;  4JWY A;  4PFW A;  3KN7 A;  1B2H A;  3CG3 A;  4RPO A;  3RT8 A;  3PPN A;  2YLN A;  3PU5 A;  4DIG A;  3T96 B;  3OEM A;  1D9Y A;  4H65 A;  2HQ0 A;  2OWS A;  4PFU A;  2R6G E;  4OFJ A;  4IY5 A;  2E1S A;  2F8D A;  4O3A A;  1XVY A;  3HV1 A;  4R6H A;  3IOV A;  3O6I A;  4U1O A;  1SW1 A;  1QW0 A;  1B9J A;  2DWA A;  3FV2 A;  3UGW A;  4MLQ A;  1PEB A;  1NL5 A;  2G29 A;  4LUB A;  5H8N A;  3RNN A;  4EUO A;  4OES A;  3ONM A;  1SD3 A;  2Z8E A;  1JQF A;  3S4U A;  3TQL A;  5IKB A;  3K00 A;  3UA8 A;  3KJT A;  3IAZ A;  4F2O A;  3KSX A;  1A8E A;  1HSE A;  4C1T A;  3DP6 A;  5ELV A;  1P99 A;  1OVT A;  3PV0 E;  2H9B A;  1OQG A;  1LGB C;  5AA2 A;  3VLV A;  1FTJ A;  1S7Y A;  1USY H;  1JEU A;  4KYE A;  3TTL A;  1FTL A;  2GHB A;  4PFT A;  1ANF A;  3OSR A;  3ILU B;  2THI A;  4Z0I A;  4POX A;  3VXB A;  4TOZ A;  5IAI A;  4I62 A;  3O66 A;  1ZMG A;  4MF3 A;  1LAG E;  1R1N A;  4DCX A;  1MRP A;  5DYH A;  1B51 A;  4F2Q A;  4G2Z A;  3CG1 A;  3MP1 A;  1SW2 A;  4IO3 A;  3M3K A;  3VDF A;  3PMV A;  4TQU Q;  4HW8 A;  2PT2 A;  4NWD A;  4EQB A;  2Z23 A;  1TXF A;  3KOT A;  4YIC A;  1MH4 A;  1AH5 A;  4LZ7 A;  5TPA A;  4OER A;  1IIT A;  4YB6 A;  3PMW A;  2A5T A;  4R74 A;  2PVU A;  5I57 A;  4O3C A;  1EH3 A;  3FVN A;  4QFO A;  3K6W A;  4OHN A;  2UVI A;  3PUX E;  3FXU A;  3FJG A;  3VV5 A;  1B7U A;  4JWO A;  2I3V A;  2DP8 A;  3O2A A;  4G68 B;  3PPQ A;  4F19 A;  3CFX A;  4IGT A;  3RQT A;  3A09 A;  3TMG A;  4IO5 A;  2I4C A;  2PT1 A;  5H8H B;  3RGY A;  4KQP A;  2HZK A;  4KI0 E;  1RYO A;  2XX9 A;  1IXC A;  2G93 A;  4JSD A;  3R6U A;  1MY3 A;  4YB7 A;  3HHG A;  4RNS A;  1LFH A;  5TP9 A;  5CBS A;  4RXL A;  3RTF B;  2FNC A;  2YJP A;  4RA1 A;  2DXR A;  3E9X A;  3U93 A;  2ZNT A;  2V84 A;  4YKK A;  5I59 A;  4AB6 A;  3OSQ A;  2XXQ A;  3BKI B;  1OLC A;  3RPW A;  3W9V A;  1B7H A;  4ONY A;  2HXW A;  1DPP A;  1L5T A;  1B40 A;  2ABH A;  3S9L C;  3OEK A;  4YKP A;  1LFI A;  1A54 A;  3T93 B;  1ATG A;  1IUD A;  3QUJ A;  2XD3 A;  2DE3 A;  1LB8 A;  3HO7 A;  3OO8 A;  3FIR A;  1QUK A;  2OWT A;  1M5E A;  1VE4 A;  3M3L A;  2QJE A;  3MUQ A;  4GLI A;  4RYA A;  3TTK A;  4LZ8 A;  1YPN A;  3LC8 A;  4GRK A;  3MVW A;  2BJJ X;  4NED A;  4QSD A;  4FAT A;  2UYE A;  2HAU A;  2YPN A;  2W7Y A;  1B3G A;  3GBA A;  3GXA A;  1QKA A;  2O6A A;  2O7U A;  3A3U A;  3PD9 A;  1A40 A;  3TCF A;  4G4P A;  5CRY A;  1OIB A;  3SET A;  3GZG A;  1UTH B;  3K6X A;  2O7I A;  2O68 A;  2VOZ A;  3HCQ A;  1BLF A;  4QFK A;  1URS A;  4GF8 A;  1PB8 A;  5A5X A;  1H44 A;  4H0W A;  1NMU A;  2HCA A;  2A5T B;  4NF5 B;  2O51 A;  3K6V A;  4GL0 A;  5FTH A;  2HZL A;  3HST A;  4NF8 A;  3MC2 A;  4OFO A;  4F3G A;  3OO9 A;  5DEX B;  3DEL B;  3MVX A;  2NUV A;  3E3K A;  3SDF A;  4MLV A;  4NWC A;  1MPD A;  1NNT A;  3IB1 A;  4I1D A;  3EHS A;  1B52 A;  5ICT A;  5CMK A;  4ZEK A;  2H99 A;  1EU8 A;  2F5X A;  2I58 A;  3H7M A;  1ZKB A;  2PYY A;  5AA4 A;  4ELR A;  2IA4 A;  3H03 A;  1FQA A;  1MH3 A;  5I58 A;  5AA2 D;  4AB5 A;  3PMX A;  2V3U A;  2ZNS A;  5F1Q A;  1IXI A;  4N13 A;  4UA8 A;  5CC2 A;  1URG A;  4OWD A;  4XTC Q;  1I6A A;  2H98 A;  3TEP A;  1DPE A;  2Y7W A;  1UIU A;  2VD3 A;  2Q89 A;  4LQ5 A;  4R6Y A;  4OET A;  3MAM A;  3PUW E;  4ZEB A;  5EHM A;  2ESN A;  1ZJL A;  3FAT A;  3B6T A;  1T0K A;  1US5 A;  2XXU A;  3UOR A;  1UQW A;  1H76 A;  3CVG A;  5ITO A;  3K2D A;  5I2K B;  3Q27 A;  4DXU A;  2REJ A;  1B5H A;  2Q9T A;  4AQ4 A;  1USY E;  3TPA A;  2XX8 A;  4DLD A;  5TU0 A;  1FQC A;  3H6U A;  2Q2C A;  1DMB A;  3G3G A;  1UIV A;  4NF6 B;  3EHT A;  1CB6 A;  3DLN A;  3TDJ A;  4BDR A;  4POW A;  3PGF A;  1MY0 A;  4TLM B;  2AIX A;  2NWJ A;  2ONK E;  4Q30 B;  2F6G A;  1JET A;  2RIN A;  1II5 A;  3KEI A;  4PP0 A;  4U4X A;  5FTI A;  3V8X B;  5JTY B;  1NNK A;  4P11 A;  1MXU A;  3DP8 A;  2F6P A;  4ELQ A;  3IJX B;  3O6G A;  3H3G A;  1XT8 A;  2DQV A;  1B5I A;  2OLB A;  3SEW A;  5B70 A;  3O6H A;  4OYV A;  1Y4C A;  5DVF A;  2ZYO A;  1B5J A;  2QPQ A;  1YTV A;  2F7A A;  3C4M A;  4U23 A;  1KWH A;  1O63 A;  1N7W A;  1LBB A;  4ESW A;  4G77 A;  4DCY A;  4YMA A;  3V89 B;  3B6W A;  2R71 A;  5KDT B;  4LAT A;  1LB9 A;  4RPN A;  1ZBM A;  1MS7 A;  3B6Q A;  1F9B A;  2QS3 A;  3H06 B;  5KZT A;  1H43 A;  4HCW A;  2REG A;  4OFL A;  3Q28 A;  1Y3P A;  4IGR A;  3IB0 A;  4GFR A;  2Z22 A;  3C34 A;  2UVJ A;  1Y4T A;  2V93 A;  3HN0 A;  3G3H A;  1N3W A;  5H8F B;  3RN8 A;  4QFL A;  5I58 B;  4FEC A;  5KCJ A;  4OTE A;  3PPR A;  1P1W A;  4LP2 B;  3TQW A;  5M2V A;  1JEV A;  1MXW A;  1QUJ A;  4NF4 B;  5I56 B;  3VLW A;  2RC8 A;  2UVH A;  3OEL A;  2LAO A;  1JW4 A;  4RK2 A;  4U21 A;  3IOR A;  2QMW A;  4R9F A;  1B7Z A;  2OCU A;  1I69 A;  2A5S A;  4ND9 A;  1ZLQ A;  4IO2 A;  4FJP A;  1B3E A;  3Q26 A;  3I6V A;  3MVY A;  4C0R A;  3N6U A;  3MPK A;  3MPL A;  1UTB B;  5H8Q A;  1MPC A;  4U4S A;  2ALU A;  1LFG A;  4EF1 A;  4R6K A;  3CFL A;  2H5Y A;  1XHY A;  5I2N A;  2VHA A;  2XXY A;  4HS7 A;  3C36 A;  4R72 A;  3DP4 A;  3VFJ A;  3JYR A;  2Y7P A;  4PFY A;  3FXR A;  4RY1 A;  3LSL A;  3CSG A;  4F31 B;  3K0V A;  3RY3 A;  4DXC A;  1OLA A;  1WOD A;  4H5F A;  4KYD A;  4XKR A;  2WKY A;  3PD8 A;  1LAX A;  2B3F A;  3N26 A;  4IO4 A;  4G68 C;  4YMB A;  4ZED A;  3BBR A;  1BKA A;  1XOC A;  1R9L A;  4XXU A;  4EQ7 A;  1JNF A;  3UP9 A;  4OEV A;  3HHF A;  1A7L A;  2XXP A;  3LBS A;  4R9G A;  2B3B A;  3RTW B;  2UYF A;  1IXH A;  2ZNU A;  5ISU A;  2PX1 A;  1TFD A;  1XVX A;  5CMM A;  2UVG A;  1Y1Z A;  1A8F A;  2ZYM A;  2XHD A;  4WED A;  4TLL B;  2DSF A;  3SEX A;  4ZEI A;  4BDO A;  3MZ9 A;  1SYI A;  2O84 X;  4EDP A;  1NKX A;  3JV9 A;  3TCG A;  4F3P A;  2V25 A;  3THI A;  2P2A A;  1M5B A;  4OMB A;  4LA9 A;  3UIF A;  3O29 A;  5H8N B;  3C31 A;  4UAC A;  4IO6 A;  4F1U A;  1B46 A;  1IXG A;  3T66 A;  1M5F A;  5JEI A;  3QUF A;  3LSW A;  1VFE A;  2Y84 A;  5H8S A;  4NMY A;  1B3L A;  4IY6 A;  1S50 A;  4NTL A;  5I84 A;  4ZEC A;  3FV1 A;  3PPP A;  4OZ9 A;  1POY 1;  3K1N A;  1Q1K A;  2I49 A;  4FE8 A;  2ZMB A;  1CE2 A;  4WKM A;  5AA2 B;  3F11 A;  3TTN A;  4GXS B;  5DT6 A;  5ICQ A;  3H6T A;  4JB7 A;  4MH5 A;  3N5L A;  3GBB A;  1D4N A;  4OQO A;  3M3F A;  3USD A;  3VE1 B;  3N6T A;  1BP5 A;  3IOT A;  1N84 A;  3CR9 A;  5AE4 A;  3CSB A;  1Z7N E;  1OQH A;  1GV8 A;  1R6Z A;  4FOR A;  1JVX A;  2F35 A;  4LZ5 A;  4MFI A;  2DWJ A;  4F39 A;  5HBC A;  1TT1 A;  4JBZ A;  1VSO A;  2Q8J A;  1SI1 A;  5AA3 A;  2HFB A;  2GH9 A;  3MP8 A;  1QUI A;  4G8M A;  3C35 A;  5TPA B;  1O7T A;  1YCJ A;  1S9T A;  2Q2A A;  5I57 B;  3Q29 A;  2QL3 A;  3T9U A;  4F22 A;  1N7X A;  3LUY A;  3PUY E;  1P1O A;  2PBW A;  3TEL A;  1TWY A;  4GOT A;  1AIV A;  3OEN A;  2R9J A;  3H4Z A;  4KPT A;  1B1H A;  2Y7K A;  3R26 A;  1DSN A;  4E0X A;  3MBP A;  4P0G A;  1JW1 A;  2DE4 A;  5L9S A;  5HM4 B;  1SBP A;  3ODB A;  1D3K A;  3CIJ A;  3A3C A;  4ECF A;  3V5A A;  1SYH A;  2X7Q A;  2RF1 A;  1N04 A;  3QYT A;  1B3H A;  4ISU A;  2P1S A;  1OMP A;  3WAF A;  4LQ2 A;  4ELO A;  3VXC A;  3EN3 A;  2QRY A;  5FHM A;  3L6H A;  5TP9 B;  2D21 A;  4YZZ A;  1QUL A;  2ZYN A;  3I5O A;  3PUZ E;  2OZZ A;  2CZL A;  4OVJ A;  5FHN A;  3L6G A;  3O9P A;  5I59 B;  2XXT A;  1SDX A;  3T9H B;  1BTJ A;  3S2V A;  3FVO A;  4R2B A;  3UN6 A;  2QS1 A;  1IEJ A;  1B0H A;  3KOS A;  1BIY A;  4N6P A;  1GVC A;  4F1Y A;  3QIM A;  3VVD A;  1SQY A;  1HSL A;  1N0T A;  3TTM A;  4THI A;  4OXV A;  3ZSF A;  4XKN A;  1SW4 A;  2ONS A;  4XKP A;  2O1M A;  4KCC A;  3LSX A;  3QXM A;  2QMX A;  4H6D A;  5ITP A;  3KGC A;  4JWX A;  4ZEF A;  4GVO A;  3FD3 A;  1R9Q A;  2VGQ A;  1MQJ A;  1LCF A;  2PMS A;  2ZXT A;  3D4G A;  3K4U A;  1Y1M A;  3U72 A;  1IZ1 A;  3KN3 A;  1NH8 A;  2DWI A;  3IO4 A;  1H3D A;  1IIW A;  1FTO A;  1MXY A;  3CFZ A;  3KJ7 A;  4QF9 A;  3S9M C;  4ZE8 A;  4WXJ A;  3IB2 A;  4G68 A;  2E0S A;  3OMB A;  5HPQ A;  4KFQ A;  1IQ7 A;  4ZZA A;  1SVX B;  3TAJ A;  4LVQ A;  3TFL A;  1MM7 A;  3GLB A;  3IOW A;  3G3J A;  5J1D A;  2X7P A;  4H1X A;  3W15 C;  1H45 A;  1MY4 A;  5A5X B;  5H8H A;  3TOD A;  3OD7 A;  1PDA A;  4H8I A;  1SW5 A;  3BFT A;  4GWO A;  3CRB A;  2UXA A;  4QFN A;  3S9N C;  3G7W A;  4NF8 B;  4XKQ A;  4ZS9 A;  2M8C A;  4U22 A;  4MBP A;  4BLA A;  2DWH A;  1MDQ A;  2GRV A;  2IEE A;  3RLF E;  2RC9 A;  2NVU B;  1B3F A;  1B58 A;  2HAV A;  2OJT A;  4GD5 A;  5CMB A;  3FUZ A;  3CI8 A;  3G3F A;  3TTR A;  2NOO A;  2B65 A;  4QHQ A;  4QSC A;  3TUS A;  4G8H A;  2HEU A;  3FVK A;  4BDL A;  1OVB A;  3B7D A;  3KSJ A;  4FAJ A;  5AA4 B;  1N76 A;  4GL8 A;  2I4B A;  3KBR A;  1NFT A;  4EXK A;  4JXI A;  3OO6 A;  2XXW A;  3Q25 A;  1PBP A;  2DVC A;  3SES A;  3EPE A;  2RKM A;  2DS9 A;  3TCH A;  3P7I A;  2FYI A;  3MZ1 A;  5EYF A;  4XIG Q;  4L17 A;  4DE8 A;  1HSJ A;  1ZIU A;  1GTK A;  4R75 A;  5FHO A;  1MQG A;  4GXA A;  4DZ1 A;  1B4H A;  5BWJ A;  1FQF A;  1LST A;  1O64 A;  1ELJ A;  3LSF B;  1RYX A;  1M5C A;  3S9E A;  5CBR A;  2DE2 A;  2O1L A;  3K6U A;  4I8C A;  1MQH A;  2DVZ A;  4FEB A;  4F29 A;  4EF2 A;  1WVJ A;  2AYS A;  3IR1 A;  3KZG A;  1MM6 A;  1B6H A;  4YKJ A;  4FED A;  3MW0 A;  3MZB A;  4IB2 A;  3IJO B;  3IK6 B;  4YAH X;  1UTH A;  2P0S A;  1POT A;  4Q0C A;  1B1X A;  4RK9 A;  1Y3N A;  1P1N A;  4BDN A;  4KCD A;  4U1Z A;  2ZYK A;  4R2F A;  5LOM A;  5L9M A;  5CM6 A;  1LCT A;  2KLF A;  1JVY A;  3SKP A;  4JSO A;  2FA7 A;  2XD2 A;  4K3F A;  4NF5 A;  5DVJ A;  2QSX A;  4Q5T A;  1MXZ A;  2DXY A;  1PB7 A;  2Y7R A;  1MQD A;  2Z8F A;  3V83 A;  1FTM A;  3U94 A;  5DEX A;  1EZ9 A;  2V3T A;  3T9X B;  1FW0 A;  4YB5 A;  3SEY A;  4G8N A;  3FAS A;  1JW5 A;  2F97 A;  1I6B A;  4DXB A;  3TYH A;  2NXO A;  5B7D A;  2I3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...