1QJMA

Crystal structure of a complex of lactoferrin with a lanthanide ion (sm3+) at 3.4 angstrom resolution
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lactoferrin-Metal Interactions: First Crystal Structure of a Complex of Lactoferrin with a Lanthanide Ion (Sm3+) at 3.4 Angstrom Resolution
pubmed doi rcsb
molecule tags Lactoferrin
molecule keywords LACTOFERRIN
total genus 211
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA03
2NUVA 4H5FA 5H8QB 4QSDA 5CMCA 3RN8A 2V84A 3VXCA 1P1OA 2V3TA 1ANFA 1ZIUA 4DXBA 4LZ7A 1IIWA 1MM7A 4QSEA 3U8QA 3IOVA 3IJXB 3RY3A 3DP6A 2ZNUA 4JSDA 1LAFE 1MPBA 4JWXA 3KSXA 2XX8A 2GRVA 3A09A 3QUFA 5L9OA 3O9PA 4IO2A 1MDQA 4TLLB 3UA8A 3TMGA 5A5XA 4GOTA 1IXIA 2PYYA 2XXRA 1MQJA 2XD2A 3ZS6A 4BDOA 4F2QA 1MY2A 3MUQA 3DM0A 3OXNA 4JWOA 2DS9A 4TQUQ 2Q89A 4WEDA 5ELVA 5FTIA 3WAFA 4FE8A 1JQFA 4DXCA 3U94A 3N26A 4NE4A 4IO6A 3IO6A 3PPOA 5H8HB 2H5YA 4RK9A 5TP9A 3TCGA 5I84A 2GHAA 5I56A 5HM4B 3CR9A 2Z8FA 1DPEA 5AA3A 3EF7A 5L9MA 5I59A 4NEDA 4XXUA 3L6HA 4IGTA 5L9SA 4F3BA 4H67A 2ANJA 4OESA 2O1LA 3RTFB 4KCDA 1B3EA 3C32A 2QS3A 2VOZA 2HZLA 1PC3A 4QFOA 1VFDA 3FVKA 2XXPA 1D9YA 2B3FA 3MQ9A 2ZYMA 2XXQA 3KJTA 3PMVA 4G68C 3QSLA 4KFQA 4JWYA 3VLWA 1GV8A 2UYFA 2XXVA 4GLIA 3LSLA 1FQFA 5FHOA 3OEMA 4R73A 4DCYA 1AL3A 1B7UA 3MVYA 5KDTA 1AIVA 2LAOA 3SEWA 2Y7IA 4OETA 3TTLA 4NF4A 3CG3A 4F39A 4FATA 2VGQA 4YMBA 2UVIA 3GXAA 1B7ZA 1H45A 3QAXA 1MXXA 2VHAA 4MF3A 1VR5A 4E0XA 4FAJA 3TTRA 4YMAA 4KI0E 3I5OA 2NXOA 3PMXA 1N04A 1N0TA 2DE3A 1B2HA 1B5JA 4FJPA 4U21A 2ZYNA 4GFRA 3W9WA 1QUIA 1ZBMA 1MRPA 2O68A 1B3FA 1B6HA 2F7BA 3K6WA 1B3HA 1XVYA 3KOTA 3MZ1A 4KPTA 4ZE8A 4H65A 1FTJA 4ZS9A 3W15C 3T96B 1LLSA 1IQ7A 2I4CA 4NF5B 1WODA 2D21A 2I3VA 2OLBA 3L6GA 4KQPA 1MH4A 3B6QA 3IL1B 4PE5B 3K6VA 5F7VA 1M5CA 4BLAA 2DWJA 2YLNA 2REGA 1PDAA 3FV2A 3IK6B 3UIFA 4OFJA 2G29A 4IGRA 2FYIA 4ND9A 4POXA 3O66A 1N84A 2AL5A 2Y7PA 2XD3A 3M3FA 3FVNA 3MC2A 2ALUA 4QHQA 5CM6A 2UVHA 3VLVA 1MM6A 1MQHA 2ZYKA 2AIXA 1P1UA 3Q27A 1ZU0A 2HAUA 4O3CA 3U72A 1LB8A 4ZE9A 4F22A 1LCFA 3VFJA 4C1UA 3UK4A 3U93A 4R72A 3SKPA 4RK2A 5J1DA 2H4IA 4XTCQ 3PUYE 1A40A 1B3LA 4P11A 3IB0A 4KYSA 1N3XA 3M8UA 1FQAA 4U4SA 5HBCA 1LAHE 3H3GA 3K1PA 1VSOA 1PB8A 2OWTA 1NNFA 1US5A 3K6XA 4OMBA 1L5TA 1DSNA 1FQDA 1QKAA 3A3UA 4MLQA 1PBPA 4LA9A 4ZEDA 3HHFA 1R9QA 3LC8A 4M1VA 3TQWA 4K3FA 4U4XA 1XVXA 4EQBA 1PB9A 1N3WA 1B05A 3LSXA 1UTHB 4RJZA 5EYFA 3TTNA 4DXUA 1M5DA 2DWAA 1A55A 3KG2A 4GL8A 4YZZA 5I58B 3RQTA 1MQDA 4C0RA 1FCKA 3IOWA 4MFIA 5CMMA 1QULA 2D5WA 3S2VA 5LOMA 1NNPA 3E13X 4QRZA 1SW4A 2D3IA 1IUDA 1QVSA 2REJA 2XXUA 3G3HA 3G3KA 4IO3A 2XXWA 1I6BA 4YKIA 1LAGE 3CFZA 2OBGA 1MQGA 1Y3PA 3EN3A 2UYEA 4ONYA 1NMUA 3BKIB 4H1XA 4HTGA 3Q25A 2QS1A 2F7AA 1B0LA 2Z22A 2RC7A 3ILUB 4MLVA 1XC1A 4WEPA 3MJNA 4OERA 3CSGA 3N94A 5CRYA 2QJEA 3K01A 5H8SA 1DPPA 1QUJA 4R9GA 1B1HA 1UIUA 4EXKA 4F3PA 1B40A 2HAVA 4RYAA 2QRYA 4DLDA 1EZOA 4TLMB 3ZSFA 1BLFA 5B7DA 3THIA 2O69A 4LZ8A 4TOZA 5I2NB 2Z8DA 3KJ7A 3ODBA 1B3GA 3FZVA 2Y7WA 3EHSA 1MXYA 4R6YA 2RKMA 2OCUA 3TDJA 3MVZA 1URSA 3JV9A 3K2DA 4NWDA 3I6VA 1Y4CA 4KD5A 2F6GA 1A54A 2VD2A 1BP5A 3OSRA 2YPNA 4AB5A 5TPAB 1XS5A 3FIRA 3S9LC 3QUJA 4WKMA 4LZ5A 3TKDA 1A99A 4Z7EA 2OZZA 5ICTA 3QYTA 3USDA 1MY3A 1MPCA 3FXUA 1YAEA 4BDQA 4DIGA 5AE4A 3UP9A 4EQ7A 4NMYA 1IITA 5TPAA 2BJJX 3S4UA 1EZ9A 5H8NA 4ZZEA 3RNNA 3TODA 5H8FB 3TCFA 3FVOA 4F2OA 4GIZA 1B9JA 3MZ9A 3T9VA 1IXHA 3MAMA 4Q5TA 1ZTYA 5AA1A 2XXXA 4ZDMA 1A8FA 3PUWE 4OHNA 1M5FA 3N5LA 4KHZE 3KN7A 4O3AA 4KYDA 2CZLA 4U1OA 3VDFA 2HZKA 1QW0A 3TYHA 4ELOA 4NF6B 1JEVA 2DP8A 3R26A 2OWSA 4I62A 3HCQA 1P99A 2V93A 3FVGA 2O84X 3W9VA 1B1XA 4ZEBA 3MP8A 1Z7ME 2I48A 3PPPA 5EHSA 1B5HA 1S9TA 1Z7NE 1H76A 2X7PA 3KFMA 4KYEA 3FJGA 1OVBA 3M3KA 3FJMA 1SBPA 1FW0A 1HSJA 1FTKA 1LB9A 3FJ7A 3MBPA 2Q8JA 3TELA 2ONSA 4EXLA 5KCJB 2P2AA 2B3BA 3H6VA 4G2ZA 4NTLA 1IZ1A 1GTKA 2Q88A 5I57B 1B52A 1JEUA 2DYXA 2PMSA 3C4MA 2H9BA 1Q1KA 1Y1ZA 4C1TA 4BDNA 3DP8A 3KSJA 3LUYA 5CC2A 2P0SA 4ZEIA 5CI5A 4N6PA 4U22A 4NF4B 1HSLA 5K2XA 4U1ZA 4LQ5A 3FD3A 1LFGA 2B65A 4XIGQ 1SYHA 2RINA 4G4PA 4L17A 4THIA 1NNTA 3MP6A 3N6UA 2I0CA 2UVGA 5AA4B 1B51A 1Q35A 4PP0A 1T0KA 3RT6B 1RYXA 1D9VA 2ONRA 4UA8A 4ESXA 1P1NA 3PD8A 1YCJA 2XHDA 3G3GA 3LSWA 3O29A 1AH5A 1SI1A 2XX7A 1IXGA 1OVTA 3QK6A 1PEBA 1MS7A 3FV1A 4RPOA 3G3FA 1BTJA 2GH9A 3DP4A 4AB6A 4DE8A 5FHMA 3K0VA 1MPDA 1S7YA 5JTYB 4LQ2A 1JW5A 1B46A 1O64A 2Y84A 2DVCA 3E9XA 3MPLA 3OELA 4RA1A 3IO4A 3KEIA 2RCBA 2X26A 3RT8A 2I6EA 1XOCA 1MY4A 1URDA 2ONKE 3K1NA 5JK4A 2I0BA 1P1QA 3CG1A 3SEUA 2F8DA 4I1DA 2F34A 3U92A 3KGCA 4YKPA 5H8QA 1DOTA 3PMWA 4ELQA 1SW2A 3MVWA 5BUUA 2DSFA 3CVGA 3PV0E 4N13A 4ZECA 3PD9A 4X9TA 4Q8RA 1ZKBA 3UGWA 1XT8A 1JW4A 3FATA 3H6TA 5I2NA 2RC8A 3MZBA 4U2RA 1B5IA 4IY5A 3M3LA 3TUSA 1NH7A 5DT6A 4BDRA 1LSTA 4R6HA 2HCAA 1TFDA 2GHBA 3E3KA 4G68A 5JEIA 2DE2A 4I8CA 3P7IA 1R9LA 3FGSA 4H6DA 3EPEA 2O6AA 2UVJA 4R75A 4F1UA 3A3CA 3K00A 1CE2A 2H98A 3C33A 3C31A 3G3JA 4X1DA 5DVFA 2F7CA 3IX1A 4JDFA 4Z0IA 3HHGA 3OO9A 1JNFA 3MW0A 4H0WA 5CBSA 1I6QA 1II5A 2F78A 3EHTA 1TXFA 4LATA 2PX1A 5I56B 1VFEA 3IB1A 3PUVE 1BIYA 1A7LA 2V3UA 1N7WA 2Y7KA 1O7TA 4IO5A 1SDXA 3FXRA 1P1WA 4F3GA 5I57A 3S9NC 4F1VA 5H8NB 4RY1A 2Q9TA 5DTBA 1N76A 3SEYA 3QIMA 3TTKA 3VVEA 2O1MA 1WDNA 4PQJA 3TPAA 2FNCA 4FORA 1FTLA 3GLBA 3MWBA 3QXMA 1YTVA 1KWHA 3ONMA 5TP9B 4G68B 3IR1A 1JVXA 1ATGA 4PFTA 4GXAA 4HW8A 3VXBA 2DWHA 2F6PA 1RYOA 3CSBA 2XXHA 3G3IA 1MQIA 3O28A 3O6GA 4OEUA 2HXWA 4ZEFA 4YKJA 5ITOA 1FQEA 3B6TA 3VV5A 1SYIA 1S50A 3OD7A 4GVOA 1B58A 2HEUA 4PFUA 2AL4A 1LBBA 1B7HA 1NH8A 2ABHA 2O7UA 2I4BA 1POTA 1PBQA 4HCWA 4OXVA 3VVFA 2HFBA 4LP2B 5DYHA 3ECRA 3GZGA 1JW1A 3B6WA 3PPRA 2DVZA 4IB2A 3RPWA 3BFTA 2PT1A 3UN6A 3C34A 3RGYA 1EH3A 1UQWA 3H03A 3MPKA 3CIJA 4LVQA 3WAEA 4BDLA 1UTBB 4GF8A 2ZXTA 3IOUA 1MDP1 3JZJA 2Q2AA 1QUKA 1TFAA 4P0GA 4QFKA 3JYRA 1NFTA 1OLAA 3KZGA 2NVUB 4LONB 4EF2A 4FEDA 3H4ZA 1OQGA 2DXRA 2AYSA 3OO6A 4R6KA 1URGA 3DLNA 4YB6A 1QKBA 3D4CA 1D3KA 4OYVA 4ZZAA 5KDTB 1UTBA 3H06B 1MXWA 1VE4A 3K6UA 3O6HA 4YB5A 5CBRA 1FTOA 2DXYA 3PUXE 2DWIA 4N07A 2E0SA 4NF8A 1Y9UA 4NF6A 4YU0A 4KR5A 3TQLA 5I2KA 4XKQA 2Q2CA 4RXLA 5B70A 3OO8A 4Q0CA 2VP1A 1R6ZA 3T66A 4EF1A 3F11A 4OZ9A 5FTHA 1B4ZA 1BKAA 3HSTA 3HV1A 5AA2B 2ZMBA 2DQVA 4MH5A 5I58A 3VVDA 3H6UA 2A5TA 2DOJA 5ITPA 3OENA 4QSCA 3EQ1A 3LSFB 3Q28A 4FIMA 4LUBA 4U23A 3K4UA 3V8XB 3HO7A 1HSEA 1MH3A 1EZPA 4GWOA 3S9EA 3TZAA 4HCYA 4G77A 4OTEA 3H6WA 4OWDA 1USYH 2ZNSA 3SDFA 1F9BA 3ZKKA 1IEJA 5IKBA 4PFYA 4RPNA 4XKNA 2A5SA 4QFLA 3U1OA 4G8NA 4F29A 5AA2A 3DELB 2R9JA 1SW1A 1US4A 3HN0A 2NOOA 1RKMA 1H3DA 3LR1A 4ISUA 3OSQA 2QS4A 4OFOA 1GVCA 2F35A 2PT2A 4BDMA 5ICQA 2QSXA 3IAZA 1DTGA 1OIBA 4IO7A 3SEXA 2XXTA 4JBZA 4YB7A 2UXAA 2CMOA 1FTMA 4NF5A 3OMBA 4H5GA 4RNSA 4FECA 4NWCA 2G93A 2W7YA 4QF9A 2RF1A 3FUZA 2A5TB 3O97A 4DZ1A 5KZTA 1LFIA 2IA4A 3PPQA 4G8HA 4MBPA 5AA2D 3R7XA 2E1SA 4QFNA 5K2YA 1SVXB 5TU0A 4ELRA 4F31B 4JXIA 4F18A 2QS2A 1ELJA 1LAXA 1SW5A 4E0WA 3MVXA 3I3VA 3RUMA 3O2AA 1EU8A 1I6AA 3E4RA 5F1QA 2NWJA 4R9FA 4F19A 4F1YA 3IOTA 1TWYA 4YICA 4QFPA 3SERA 2KLFA 2Y7RA 2HQ0A 2PVUA 1FQCA 1OQHA 3C36A 3KOSA 3O6IA 3OOAA 4KCCA 2P1SA 4OQOA 4R74A 2QMXA 4JSOA 4XKPA 4ZEKA 5L8DA 4F3SA 3KN8A 1NNKA 1R1NA 3ZKLA 1ZJLA 1J1NA 2I3WA 2M8CA 2R6GE 5FHNA 1A8EA 1NL5A 4DDDA 4IO4A 4GL0A 1H44A 1FQBA 4R2FA 4WXJA 5DVJA 4H8IA 1D4NA 1JETA 3CRBA 2ESNA 3TTMA 5M2VA 4IY6A 5AA4A 2O7IA 1B4HA 4G8MA 3B7DA 1JVYA 4X48A 2ZNTA 3IORA 3VLUA 3TEPA 3SESA 1WVJA 2GFEA 1H43A 1LCTA 3GBAA 2RCAA 3V5AA 3N6TA 4OVJA 1POY1 3PUZE 2QPQA 4X1BA 3OO7A 4ECFA 1NKXA 1PB7A 4UACA 2I58A 3H7MA 1CB6A 3FXQA 3PPNA 3UORA 1OLCA 1Y3NA 2PBWA 1B32A 1UIVA 1O63A 2YJPA 4YKKA 2Z8EA 5H8HA 1DMBA 5CMKA 3IB2A 5ISUA 3Q26A 4R2BA 3SEVA 3S9MC 4OENA 4GQOA 5A5XB 5KCJA 4AQ4A 4EDPA 1USYE 3C9HA 4JB7A 3SETA 3CFXA 3KBRA 2XX9A 2I49A 1OMPA 1LBCA 4I9DA 5DEXB 4PETA 5BWJA 2H25A 4M4GA 3HPIA 3T9XB 2O51A 1YPNA 1SD3A 2QMWA 3R6UA 4OEVA 2THIA 1TT1A 1B0HA 2Z23A 2ZYOA 3ILTB 1Y20A 1Y3QA 2OJTA 5DEXA 5H8FA 3T9UA 3T93B 3KN3A 5EHMA 5DVIA 4GXSB 1AMFA 1LGBC 1Y1MA 4Q30B 4ESWA 3K02A 3Q29A 1UTHA 2VD3A 4EUOA 5IAIA 2XXIA 1LFHA 3TFLA 3LBSA 3T22A 1AOVA 1GR2A 2IEEA 3IJOB 1N7XA 2QL3A 3PGFA 5CMBA 3VE1B 5HPQA 3V83A 3C35A 1M5BA 2F5XA 2OK2A 3TAJA 1IXCA 2F36A 1I69A 3RLFE 1MXZA 3BFUA 4O3BA 2FA7A 4P0IA 1MXUA 1MXVA 1Y4TA 4GRKA 4EQ9A 3G7WA 1ZMGA 3D4GA 1GGGA 1ZLQA 4GD5A 4H8JA 4YAHX 2DE4A 2WKYA 1MY0A 4POWA 3PU5A 4XKRA 1M5EA 2RC9A 1XHYA 4HS7A 4PFWA 1SI0A 1DTZA 3FASA 3RTWB 3TCHA 4OFLA 3AXFA 3K1MA 3EHUA 3OEKA 4NF8B 1MY1A 5I2KB 3V89B 4DCXA 3BBRA 2F97A 2V3QA 3CI8A 1QJMA 2V25A 3MP1A 4ELPA 2XXYA 3CFLA 2R71A 5I59B 2H99A 1SQYA 3T9HB 2X7QA 5JTYA 1MG1A 4FEBA 3GBBA
chains in the Genus database with same CATH superfamily
5CMCA 1P1OA 1SPIA 1ZIUA 4DXBA 1IIWA 4JSDA 1LAFE 2XX8A 3A09A 3QUFA 4IO2A 1FBCA 4GOTA 4F2QA 4N6KA 3TKDA 2DS9A 4TQUQ 2Q89A 5FTIA 3U94A 5HM4B 3CR9A 5AA3A 1DPEA 5L9SA 4NEDA 4XXUA 4IGTA 4OESA 2WBBA 2O1LA 1B3EA 4QFOA 4DLDA 4TLLB 1VFDA 3PMVA 2B3FA 3VLWA 4JWYA 2UYFA 2XXVA 2Q74A 1EYJA 3OEMA 1AIVA 2LAOA 4DI4B 5H8FA 3FXBA 2VGQA 2UVIA 1B7ZA 2VHAA 4MNPA 1VR5A 4FAJA 1G0IA 1N0TA 4FJPA 2ZYNA 1QUIA 2F7BA 3K6WA 4KPTA 4H65A 4ZS9A 3W15C 3T96B 1IQ7A 1WODA 2D21A 4O7IA 4PE5B 3K6VA 4HE1A 1IMAA 3UIFA 4I3YA 3O66A 3MC2A 3FVNA 2UVHA 3VLVA 1MM6A 3U72A 1LCFA 2DDKA 1B3LA 4P11A 3IB0A 1N3XA 3H3GA 1PB8A 1L5TA 4LA9A 5EQAA 4K3FA 1NV3A 4EQBA 3LSXA 1B05A 5EYFA 1NUWA 1M5DA 4YZZA 3RQTA 3IOWA 2XXUA 1IUDA 3G3KA 2XXWA 4ONYA 2QS1A 2RC7A 2QJEA 3K01A 1FJ6A 2QFLA 4TLMB 3U65A 2Y7WA 4R6YA 4GWUA 3TDJA 3K2DA 2F6GA 1FBGA 2VD2A 3OSRA 2YPNA 3S9LC 4WKMA 4LZ5A 4BDQA 1IITA 2BJJX 1B9JA 3MZ9A 1A8FA 3PUWE 4NHBA 4O3AA 3D1RA 2OWSA 1RDYA 1FSAA 1B1XA 4ZEBA 3MP8A 2XA5A 1Z7NE 1NUYA 3FJ7A 2P2AA 2B3BA 2Y5LA 1JEUA 2DYXA 1Y1ZA 4OVPA 3KSJA 4BDNA 4N6PA 5K2XA 2RINA 3B8BA 4L17A 3MP6A 2I0CA 1JP4A 2UVGA 4X8RA 4PP0A 1RYXA 4ESXA 4QBAA 3G3GA 3LSWA 5IZ3B 4RPOA 3FV1A 5LTCA 5FHMA 3K0VA 5IM2A 1O64A 3MPLA 1FPIA 2RCBA 3RT8A 3CG1A 2F8DA 3U92A 3KGCA 1DOTA 4XEQA 4ELQA 1SW2A 3PV0E 4X9TA 3H6TA 3MZBA 2VT5A 4GWXA 3E3KA 2DE2A 1NV6A 3FGSA 3EPEA 3A3CA 1CE2A 2F7CA 3OO9A 5CBSA 1I6QA 1TXFA 3IB1A 1BIYA 1O7TA 1SDXA 5ESYA 5DTBA 3TTKA 4PQJA 3TPAA 2FNCA 1EYIA 1FTLA 3IFCA 4G68B 3IR1A 1JVXA 2B4MA 3CSBA 2XXHA 4OEUA 2HXWA 4ZEFA 1FQEA 3OD7A 4GVOA 4MNIA 1POTA 1NV7A 3GZGA 1JW1A 3PPRA 2PT1A 1FBDA 4BDLA 2QVVA 3CIJA 3IOUA 1MDP1 3JZJA 1TFAA 3JYRA 2CZKA 4PF8A 4NGUA 3PUXE 2DWIA 4XKQA 4RXLA 4Q0CA 2VP1A 4EF1A 3F11A 4OZ9A 3HV1A 1RDZA 2DOJA 3OENA 4FIMA 1FBHA 4U23A 3V8XB 1HSEA 3TZAA 4MAGA 4OWDA 1IEJA 4RPNA 4XKNA 1VDWA 3U1OA 1SW1A 4O8MA 2PCRA 1RKMA 3OSQA 3IAZA 5EQ8A 3SEXA 2XXTA 2G93A 3FUZA 3O97A 2IA4A 5AA2D 4QFNA 4F31B 4JXIA 4F18A 4QFPA 2KLFA 1FQCA 3KOSA 4R74A 5L8DA 4XKPA 4ZEKA 3KN8A 5DW8A 3PTYA 1J1NA 2M8CA 3CRBA 3TTMA 2O7IA 1B4HA 4X48A 3IORA 1LCTA 1POY1 4ECFA 1INPA 1NKXA 1CB6A 3FXQA 1OLCA 1Y3NA 2YJPA 1B32A 1O63A 3RPLA 2XWIA 4JB7A 1OMPA 4N91A 4M4GA 3T9XB 2O51A 2QMWA 2THIA 1TT1A 1B0HA 2Z23A 2OJTA 3T93B 5EHMA 2VD3A 4EUOA 5IAIA 2XXIA 1LFHA 1AOVA 5I7IA 3V83A 5CMBA 3KC1A 1LBVA 1MXZA 2ZZXA 4O3BA 3G7WA 1ZLQA 3QMFA 4AS4A 4PFWA 3FASA 3RTWB 3ROJA 3EHUA 5I2KB 1KA1A 2F97A 2R71A 2H99A 1SQYA 2X7QA 4E0WA 2F3BA 4JWXA 1YZ0A 3UA8A 1K9YA 3MUQA 3DM0A 5ELVA 3WAFA 4H45A 4DXCA 3N26A 4NE4A 5H8HB 4RK9A 5I84A 4MX6A 5I59A 3EF7A 5L9MA 4F3BA 4H67A 4KCDA 3C32A 2QS3A 2HZLA 1PC3A 3MQ9A 1FPJA 1D9YA 4G68C 5M2VA 2ZYMA 3QSLA 4KFQA 1GV8A 4DCYA 3IFAA 1AL3A 3MVYA 3SEWA 2Y7IA 3TTLA 4F39A 4FATA 1MXXA 4MF3A 4E0XA 4YMAA 4NX1A 3I5OA 3PMXA 1B2HA 1B5JA 4U21A 2FIEA 2O68A 4PGPA 1B3FA 1B6HA 1XVYA 4ZE8A 4XFEA 1FTJA 2GQ1A 3E78A 2PFYA 2I3VA 2OLBA 1MH4A 5F7VA 4NF0A 1M5CA 2YLNA 1PDAA 3A29A 2G29A 2FYIA 4ND9A 4POXA 1NV2A 1N84A 5A5LA 4OVRA 2ZYKA 3Q27A 1P1UA 2CZHA 2XXKA 4O3CA 3UK4A 3SKPA 4XTCQ 4KYSA 3M8UA 1FQAA 4U4SA 3K1PA 3K6XA 4OMBA 4I40A 1DSNA 3A3UA 3HHFA 1R9QA 4U4XA 4RJZA 4DXUA 4PC9A 3TTNA 2DWAA 5CMMA 3S2VA 4QRZA 4PTKA 1I6BA 1LAGE 2OBGA 1Y3PA 2UYEA 5ET7A 4HTGA 3Q25A 1B0LA 4MIJA 3N94A 5I56B 5H8SA 4EXKA 1DPPA 4F3PA 1B1HA 4JVIA 4RYAA 2O69A 4LZ8A 2Z8DA 3ODBA 3FZVA 1MXYA 2RKMA 4NWDA 3I6VA 4KD5A 1A54A 1BP5A 1XS5A 5ET6A 4DIGA 4NMYA 5TPAA 3TODA 4ZZEA 4GIZA 4NQ8A 3T9VA 1IXHA 3MAMA 4Q5TA 1M5FA 3N5LA 3KN7A 4ELOA 2HZKA 1JEVA 2DP8A 3R26A 4I62A 3FVGA 3KFMA 3FJGA 1OVBA 3M3KA 1FW0A 1FTKA 3TELA 5KCJB 3H6VA 1FPEA 4G2ZA 1GTKA 3C4MA 5CC2A 3LUYA 4ZEIA 5CI5A 4GBWA 3FD3A 1SYHA 4G4PA 4THIA 3RT6B 3LV0A 1P1NA 1YCJA 3KC0A 3O29A 1OVTA 3QK6A 1MS7A 1BTJA 2GH9A 4PF6A 5JTYB 4LQ2A 2Y84A 2DVCA 3E9XA 4RA1A 2I6EA 1URDA 2F34A 4YKPA 5BUUA 3MVWA 2WEFA 4NN3A 4N81A 1XT8A 3FATA 3M3LA 3TUSA 1NH7A 5IZ3A 3P7IA 2UVJA 4N8YA 4R75A 3K00A 4JDFA 3B50A 1JNFA 4H0WA 4LATA 1LBWA 1A7LA 1N7WA 3FXRA 4F3GA 1P1WA 5I57A 3S9NC 4F1VA 4RY1A 2Q9TA 3GLBA 1LEVA 4PFTA 4HW8A 2DWHA 2F6PA 3O28A 3O6GA 1B58A 4PFUA 2ABHA 4OXVA 4PBHA 3B6WA 3RGYA 1EH3A 4N8GA 4GF8A 2ZXTA 1DCUA 4N4UA 1NFTA 1OLAA 3KZGA 4EF2A 2Y5KA 2DXRA 4YB6A 1URGA 1FPKA 3DLNA 3D4CA 1D3KA 5EQ9A 1XI6A 4JVDA 2R8TA 3RPLB 4YU0A 4NF8A 1Y9UA 2QVUA 5FTHA 1B4ZA 1BKAA 3HSTA 2ZMBA 2DQVA 3VVDA 4QSCA 3EQ1A 1EZPA 4GWOA 4G77A 3H6WA 1USYH 4PFYA 4PFIA 4JVCA 1RDXA 1NV5A 5IGAA 1OIBA 4JBZA 1FPBA 3OMBA 4RNSA 4FECA 2W7YA 5KZTA 3PPQA 2E1SA 1SVXB 2QS2A 3MVXA 3RUMA 1FPFA 2NWJA 3IOTA 3SERA 2HQ0A 4MNCA 4F3SA 4JSOA 1R1NA 1ZJLA 1NL5A 4H8IA 4IY6A 4G8MA 2ZNTA 3TEPA 2I58A 1UIVA 5H8HA 1FPLA 5CMKA 3IB2A 3Q26A 4R2BA 5A5XB 4EDPA 1USYE 4DI3D 2OX3A 3KBRA 2XX9A 2I49A 4I9DA 3HPIA 4N15A 2VPNA 4OEVA 4PFBA 1Y20A 5DEXA 4UABA 2OWZA 3LBSA 3T22A 1NUXA 1GR2A 2IEEA 1N7XA 1M5BA 2F5XA 3TAJA 3RLFE 4OVQA 4P0IA 2FA7A 1AWBA 4GD5A 4H8JA 2WKYA 1MY0A 4POWA 2RC9A 1SI0A 3TCHA 4OFLA 4NF8B 1MY1A 2WBDA 5ET5A 4DCXA 2V4CA 3CFLA 4HE2A 1QGXA 4QSDA 1FBFA 3VXCA 2V3TA 1MM7A 4QSEA 3ISPA 3IJXB 2HHMA 1IMCA 3KSXA 3O9PA 1MDQA 1IXIA 2XXRA 1MQJA 3ZS6A 1MY2A 4WEDA 4IO6A 3IO6A 2H5YA 3TCGA 2XWVA 2GHAA 5I56A 1K9ZA 3L6HA 2ANJA 3FVKA 3KJTA 5FHOA 4R73A 1B7UA 4YMBA 4OETA 3QAXA 3GXAA 1H45A 3TTRA 4KI0E 2NXOA 2DE3A 1LBXA 3W9WA 1B3HA 3KOTA 3MZ1A 2CEXA 4NF5B 3L6GA 3B6QA 3IL1B 5IZ1A 2DWJA 3FV2A 4IGRA 3M3FA 4QHQA 1MQHA 1ZU0A 2HAUA 2HPGA 4RK2A 5J1DA 2H4IA 3PUYE 1A40A 5HBCA 1QKAA 1FQDA 5KCJA 3LC8A 4M1VA 3TQWA 1XVXA 1PB9A 1N3WA 1UTHB 2P3NA 1A55A 3CHGA 4C0RA 5LOMA 2D5WA 4HE0A 1NNPA 3E13X 3G3HA 2D3IA 1QVSA 2REJA 4IO3A 3CFZA 1MQGA 4NAPA 5T3JA 1NMUA 3BKIB 1XC1A 4WEPA 4OERA 5CRYA 2QRYA 4TOZA 3KJ7A 1B3GA 3MVZA 1URSA 3JV9A 4AB5A 4Z7EA 2OZZA 3USDA 1MPCA 4EQ7A 3S4UA 4QXDA 5H8NA 4GX3A 3TCFA 3FVOA 4F2OA 1ZTYA 5AA1A 2XXXA 4KYDA 2CZLA 4U1OA 3TYHA 4NF6B 1Z7ME 1S9TA 4ZE9A 2X7PA 2VPOA 1IMFA 5I57B 2Q88A 2PMSA 4C1TA 2KR0A 1HSLA 4LQ5A 4XIGQ 3N6UA 1BK4A 4P1LA 1B51A 1Q35A 2ONRA 3PD8A 2XHDA 4NG7A 3SZPA 1AH5A 1IXGA 2P3VA 1EZOA 4DE8A 4AB6A 1G0HA 1JW5A 1B46A 3IO4A 5JK4A 3SEUA 4I1DA 3PMWA 4N13A 3CVGA 4ZECA 1KA0A 4PDDA 2MKZA 4Q8RA 1ZKBA 2KQZA 3UGWA 5I2NA 2RC8A 5ET8A 1B5IA 5DT6A 4R6HA 5JEIA 4H6DA 2O6AA 4F1UA 5DVFA 4X1DA 3IX1A 3HHGA 1DK4A 1Q9DA 1II5A 3EHTA 2PX1A 1VFEA 3PUVE 2Y7KA 1FTAA 4IO5A 4PGNA 1LBYA 1N76A 3SEYA 3QIMA 1YYZA 1WDNA 3MWBA 1KWHA 3ONMA 5TP9B 2JJKA 1MQIA 4OANA 4IR8A 5ITOA 3B6TA 2HEUA 2AL4A 1LBBA 1B7HA 1NH8A 2O7UA 4HCWA 4O94A 3VVFA 1PBQA 4LP2B 3ECRA 3RPWA 2DVZA 1IMDA 3BFTA 3MSTA 3C34A 1NUZA 1UQWA 3H03A 3MPKA 3WAEA 4LVQA 4PFRA 1UTBB 2QVRA 2Q2AA 2NVUB 4LONB 4FEDA 4R6KA 3OO6A 5KDTB 1UTBA 3H06B 3K6UA 1VE4A 3O6HA 5CBRA 1FTOA 4NF6A 3TQLA 2E0SA 3MYUA 5I2KA 3BIHA 2Q2CA 1NV0A 5B70A 1R6ZA 3T66A 5AA2B 3H6UA 4P56A 4LUBA 3HO7A 4HCYA 1KZ8A 2HXRA 3ZKKA 5IKBA 4F29A 4G8NA 5AA2A 3DELB 1H3DA 1GVCA 2F35A 2PT2A 2QSXA 4IO7A 2CMOA 1FTMA 4H5GA 3RYDA 4QF9A 4DZ1A 2RF1A 2A5TB 4GX4A 1LFIA 4G8HA 4MBPA 3R7XA 5K2YA 1SW5A 4MEVA 3O2AA 1I6AA 3E4RA 5F1QA 4F1YA 4R9FA 4YICA 2Y7RA 2PVUA 4KCCA 4OQOA 2QMXA 3ZKLA 2FIXA 5FHNA 4IO4A 1H44A 4R2FA 2WYKA 3B7DA 1JVYA 3VLUA 3SESA 1WVJA 2GFEA 4PCDA 3V5AA 2RCAA 4PAFA 3N6TA 2QPQA 1PB7A 4UACA 2Z8EA 3SEVA 4AQ4A 1FBEA 3CFXA 5BWJA 3EKIA 1IMEA 1SD3A 4N17A 1Y3QA 3KBZA 5DVIA 1AMFA 1Y1MA 4Q30B 3K02A 5I3SA 3TFLA 3VE1B 3C35A 2OK2A 2F36A 1I69A 3BFUA 4PBQA 1MXVA 1Y4TA 4GRKA 1D9QA 4YAHX 2DE4A 1M5EA 4HS7A 1DTZA 4PAIA 3BBRA 1YXIA 3BIGA 3T9HB 5JTYA 1MG1A 4FEBA 2NUVA 4H5FA 3RN8A 2V84A 2CEYA 1ANFA 4LZ7A 3U8QA 3IOVA 3RY3A 3DP6A 2ZNUA 1MPBA 2GRVA 5L9OA 3TMGA 5A5XA 2PYYA 4BDOA 2XD2A 3OXNA 4JWOA 4FE8A 1JQFA 3PPOA 4MMPA 4I3EA 2Z8FA 1FJ9A 3RTFB 4OVSA 2VOZA 1EYKA 5H8QB 2XXPA 2XXQA 4GLIA 5I5PA 3LSLA 1FQFA 1FBPA 5KDTA 4NF4A 3CG3A 5AE4A 1N04A 4GFRA 1ZBMA 1MRPA 1LLSA 2I4CA 4KQPA 4GWZA 4OVTA 4BLAA 2REGA 3IK6B 5EQ7A 4OFJA 4P3LA 2Y7PA 2AL5A 2XD3A 2ALUA 5CM6A 2AIXA 1LB8A 4F22A 3VFJA 4C1UA 3U93A 4R72A 2XWOA 2BJIA 1LAHE 1VSOA 2OWTA 1NNFA 1US5A 4MLQA 1PBPA 4ZEDA 5EYHA 3KG2A 4GL8A 5I58B 1MQDA 1FCKA 4MFIA 1QULA 3GYYA 1SW4A 4YKIA 4G61A 3EN3A 2ZZWA 4H1XA 4FBPA 2Z22A 2F7AA 3ILUB 4MLVA 3MJNA 3CSGA 1QUJA 4R9GA 1UIUA 1B40A 2HAVA 3ZSFA 3LUZA 1BLFA 2FBPA 5B7DA 2CZIA 3THIA 5I2NB 1FRPA 3EHSA 3T0JA 2OCUA 2L5VA 4P9KA 1Y4CA 4PE3A 5FBPA 5TPAB 3FIRA 3QUJA 1A99A 5ICTA 1NI9A 3QYTA 1MY3A 3FXUA 1YAEA 3UP9A 1EZ9A 5F24A 3RNNA 5H8FB 1NV1A 2B4LA 4ZDMA 4OHNA 3NOHA 4KHZE 4AS5A 3VDFA 1QW0A 3HCQA 1P99A 2V93A 2F3DA 2O84X 3W9VA 2I48A 5TP9A 3PPPA 5EHSA 1B5HA 1H76A 4KYEA 3FJMA 1SBPA 1HSJA 3MBPA 1LB9A 4GWSA 2Q8JA 2ONSA 4EXLA 4NTLA 1IZ1A 1B52A 2H9BA 1Q1KA 3DP8A 2P0SA 4U22A 4NF4B 4U1ZA 1LFGA 2B65A 1NNTA 5AA4B 1T0KA 2WX9A 1D9VA 4UA8A 1SI1A 2XX7A 1PEBA 3G3FA 3DP4A 1MPDA 1S7YA 3HFUA 3OELA 4MCOA 3KEIA 2X26A 2ONKE 1XOCA 1MY4A 3K1NA 2I0BA 1P1QA 5H8QA 2DSFA 3PD9A 4GX6A 1JW4A 2WYPA 4U2RA 4IY5A 4BDRA 1LSTA 2HCAA 1TFDA 2GHBA 4G68A 4I8CA 1R9LA 5LDZA 2H98A 3C33A 3C31A 3G3JA 1CNQA 4Z0IA 3MW0A 1LBZA 2F78A 1DBZA 1FPGA 2V3UA 4OA4A 5H8NB 3VVEA 2O1MA 4FORA 3QXMA 1YTVA 4P1EA 1ATGA 4GXAA 3VXBA 4LN5A 1RYOA 3G3IA 4P8BA 4YKJA 3VV5A 1SYIA 1S50A 3V89B 2I4BA 2HFBA 5DYHA 3UN6A 4IB2A 3GBBA 4QFKA 1QUKA 4P0GA 3H4ZA 1OQGA 4O7MA 2AYSA 4HXVA 4ZZAA 1QKBA 4OYVA 1MXWA 4YB5A 4N07A 2DXYA 4KR5A 4KXPA 2XWKA 3OO8A 2FHYA 5I58A 4MH5A 2A5TA 3LSFB 3Q28A 3K4UA 1MH3A 3S9EA 4OTEA 2ZNSA 3SDFA 1F9BA 4MHFA 2A5SA 4QFLA 2R9JA 1US4A 3HN0A 2NOOA 4ISUA 3LR1A 2QS4A 4OFOA 4BDMA 1DTGA 4YB7A 2UXAA 4NF5A 4NWCA 4ELRA 5TU0A 4N6DA 1NV4A 2Q8MA 1ELJA 1LAXA 3I3VA 1EU8A 4F19A 4X04A 1TWYA 3O6IA 3C36A 1OQHA 3OOAA 5ITPA 5J16A 2P1SA 1NNKA 2I3WA 2R6GE 1A8EA 4DDDA 4GL0A 1FQBA 4WXJA 5DVJA 1D4NA 1JETA 2ESNA 4XF5A 5AA4A 4PDHA 4GWYA 1H43A 3GBAA 4GWWA 4OVJA 3PUZE 4X1BA 3OO7A 4GBVA 3H7MA 4PAKA 3PPNA 3UORA 2PBWA 4YKKA 4MJOA 1DMBA 5ISUA 3S9MC 4OENA 4GQOA 3E79A 3C9HA 3SETA 1LBCA 5DEXB 4PETA 2H25A 2FVZA 1YPNA 3R6UA 2ZYOA 3ILTB 3T9UA 3KN3A 1FPDA 4H46A 4GXSB 1LGBC 4ESWA 3Q29A 1UTHA 2PFZA 3IJOB 2QL3A 3PGFA 5HPQA 1IXCA 1MXUA 4EQ9A 1ZMGA 3D4GA 1GGGA 5IZZA 1IMBA 2ZZVA 3FBPA 3PU5A 4XKRA 1XHYA 3AXFA 3K1MA 3OEKA 2V3QA 3CI8A 1QJMA 2V25A 3MP1A 4P47A 2XXYA 4ELPA 3T1BA 5I59B 5ICQA 5EYGA
chains in the Genus database with same CATH topology
2NUVA 4H5FA 5H8QB 4QSDA 5CMCA 3RN8A 2V84A 3VXCA 1P1OA 2V3TA 1ANFA 1ZIUA 4DXBA 4LZ7A 1IIWA 1MM7A 4QSEA 3U8QA 3IOVA 3IJXB 3RY3A 3DP6A 2ZNUA 4JSDA 1LAFE 1MPBA 4JWXA 3KSXA 2XX8A 2GRVA 3A09A 3QUFA 5L9OA 3O9PA 4IO2A 1MDQA 4TLLB 3UA8A 3TMGA 5A5XA 4GOTA 1IXIA 2PYYA 2XXRA 1MQJA 2XD2A 3ZS6A 4BDOA 4F2QA 1MY2A 3MUQA 3DM0A 3OXNA 4JWOA 2DS9A 4TQUQ 2Q89A 4WEDA 5ELVA 5FTIA 3WAFA 4FE8A 1JQFA 4DXCA 3U94A 3N26A 4NE4A 4IO6A 3IO6A 3PPOA 5H8HB 2H5YA 4RK9A 5TP9A 3TCGA 5I84A 2GHAA 5I56A 5HM4B 3CR9A 2Z8FA 1DPEA 5AA3A 3EF7A 5L9MA 5I59A 4NEDA 4XXUA 3L6HA 4IGTA 5L9SA 4F3BA 4H67A 2ANJA 4OESA 2O1LA 3RTFB 4KCDA 1B3EA 3C32A 2QS3A 2VOZA 2HZLA 1PC3A 4QFOA 1VFDA 3FVKA 2XXPA 1D9YA 2B3FA 3MQ9A 2ZYMA 2XXQA 3KJTA 3PMVA 4G68C 3QSLA 4KFQA 4JWYA 3VLWA 1GV8A 2UYFA 2XXVA 4GLIA 3LSLA 1FQFA 5FHOA 3OEMA 4R73A 4DCYA 1AL3A 1B7UA 3MVYA 5KDTA 1AIVA 2LAOA 3SEWA 2Y7IA 4OETA 3TTLA 4NF4A 3CG3A 4F39A 4FATA 2VGQA 4YMBA 2UVIA 3GXAA 1B7ZA 1H45A 3QAXA 1MXXA 2VHAA 4MF3A 1VR5A 4E0XA 4FAJA 3TTRA 4YMAA 4KI0E 3I5OA 2NXOA 3PMXA 1N04A 1N0TA 2DE3A 1B2HA 1B5JA 4FJPA 4U21A 2ZYNA 4GFRA 3W9WA 1QUIA 1ZBMA 1MRPA 2O68A 1B3FA 1B6HA 2F7BA 3K6WA 1B3HA 1XVYA 3KOTA 3MZ1A 4KPTA 4ZE8A 4H65A 1FTJA 4ZS9A 3W15C 3T96B 1LLSA 1IQ7A 2I4CA 4NF5B 1WODA 2D21A 2I3VA 2OLBA 3L6GA 4KQPA 1MH4A 3B6QA 3IL1B 4PE5B 3K6VA 5F7VA 1M5CA 4BLAA 2DWJA 2YLNA 2REGA 1PDAA 3FV2A 3IK6B 3UIFA 4OFJA 2G29A 4IGRA 2FYIA 4ND9A 4POXA 3O66A 1N84A 2AL5A 2Y7PA 2XD3A 3M3FA 3FVNA 3MC2A 2ALUA 4QHQA 5CM6A 2UVHA 3VLVA 1MM6A 1MQHA 2ZYKA 2AIXA 1P1UA 3Q27A 1ZU0A 2HAUA 4O3CA 3U72A 1LB8A 4ZE9A 4F22A 1LCFA 3VFJA 4C1UA 3UK4A 3U93A 4R72A 3SKPA 4RK2A 5J1DA 2H4IA 4XTCQ 3PUYE 1A40A 1B3LA 4P11A 3IB0A 4KYSA 1N3XA 3M8UA 1FQAA 4U4SA 5HBCA 1LAHE 3H3GA 3K1PA 1VSOA 1PB8A 2OWTA 1NNFA 1US5A 3K6XA 4OMBA 1L5TA 1DSNA 1FQDA 1QKAA 3A3UA 4MLQA 1PBPA 4LA9A 4ZEDA 3HHFA 1R9QA 3LC8A 4M1VA 3TQWA 4K3FA 4U4XA 1XVXA 4EQBA 1PB9A 1N3WA 1B05A 3LSXA 1UTHB 4RJZA 5EYFA 3TTNA 4DXUA 1M5DA 2DWAA 1A55A 3KG2A 4GL8A 4YZZA 5I58B 3RQTA 1MQDA 4C0RA 1FCKA 3IOWA 4MFIA 5CMMA 1QULA 2D5WA 3S2VA 5LOMA 1NNPA 3E13X 4QRZA 1SW4A 2D3IA 1IUDA 1QVSA 2REJA 2XXUA 3G3HA 3G3KA 4IO3A 2XXWA 1I6BA 4YKIA 1LAGE 3CFZA 2OBGA 1MQGA 1Y3PA 3EN3A 2UYEA 4ONYA 1NMUA 3BKIB 4H1XA 4HTGA 3Q25A 2QS1A 2F7AA 1B0LA 2Z22A 2RC7A 3ILUB 4MLVA 1XC1A 4WEPA 3MJNA 4OERA 3CSGA 3N94A 5CRYA 2QJEA 3K01A 5H8SA 1DPPA 1QUJA 4R9GA 1B1HA 1UIUA 4EXKA 4F3PA 1B40A 2HAVA 4RYAA 2QRYA 4DLDA 1EZOA 4TLMB 3ZSFA 1BLFA 5B7DA 3THIA 2O69A 4LZ8A 4TOZA 5I2NB 2Z8DA 3KJ7A 3ODBA 1B3GA 3FZVA 2Y7WA 3EHSA 1MXYA 4R6YA 2RKMA 2OCUA 3TDJA 3MVZA 1URSA 3JV9A 3K2DA 4NWDA 3I6VA 1Y4CA 4KD5A 2F6GA 1A54A 2VD2A 1BP5A 3OSRA 2YPNA 4AB5A 5TPAB 1XS5A 3FIRA 3S9LC 3QUJA 4WKMA 4LZ5A 3TKDA 1A99A 4Z7EA 2OZZA 5ICTA 3QYTA 3USDA 1MY3A 1MPCA 3FXUA 1YAEA 4BDQA 4DIGA 5AE4A 3UP9A 4EQ7A 4NMYA 1IITA 5TPAA 2BJJX 3S4UA 1EZ9A 5H8NA 4ZZEA 3RNNA 3TODA 5H8FB 3TCFA 3FVOA 4F2OA 4GIZA 1B9JA 3MZ9A 3T9VA 1IXHA 3MAMA 4Q5TA 1ZTYA 5AA1A 2XXXA 4ZDMA 1A8FA 3PUWE 4OHNA 1M5FA 3N5LA 4KHZE 3KN7A 4O3AA 4KYDA 2CZLA 4U1OA 3VDFA 2HZKA 1QW0A 3TYHA 4ELOA 4NF6B 1JEVA 2DP8A 3R26A 2OWSA 4I62A 3HCQA 1P99A 2V93A 3FVGA 2O84X 3W9VA 1B1XA 4ZEBA 3MP8A 1Z7ME 2I48A 3PPPA 5EHSA 1B5HA 1S9TA 1Z7NE 1H76A 2X7PA 3KFMA 4KYEA 3FJGA 1OVBA 3M3KA 3FJMA 1SBPA 1FW0A 1HSJA 1FTKA 1LB9A 3FJ7A 3MBPA 2Q8JA 3TELA 2ONSA 4EXLA 5KCJB 2P2AA 2B3BA 3H6VA 4G2ZA 4NTLA 1IZ1A 1GTKA 2Q88A 5I57B 1B52A 1JEUA 2DYXA 2PMSA 3C4MA 2H9BA 1Q1KA 1Y1ZA 4C1TA 4BDNA 3DP8A 3KSJA 3LUYA 5CC2A 2P0SA 4ZEIA 5CI5A 4N6PA 4U22A 4NF4B 1HSLA 5K2XA 4U1ZA 4LQ5A 3FD3A 1LFGA 2B65A 4XIGQ 1SYHA 2RINA 4G4PA 4L17A 4THIA 1NNTA 3MP6A 3N6UA 2I0CA 2UVGA 5AA4B 1B51A 1Q35A 4PP0A 1T0KA 3RT6B 1RYXA 1D9VA 2ONRA 4UA8A 4ESXA 1P1NA 3PD8A 1YCJA 2XHDA 3G3GA 3LSWA 3O29A 1AH5A 1SI1A 2XX7A 1IXGA 1OVTA 3QK6A 1PEBA 1MS7A 3FV1A 4RPOA 3G3FA 1BTJA 2GH9A 3DP4A 4AB6A 4DE8A 5FHMA 3K0VA 1MPDA 1S7YA 5JTYB 4LQ2A 1JW5A 1B46A 1O64A 2Y84A 2DVCA 3E9XA 3MPLA 3OELA 4RA1A 3IO4A 3KEIA 2RCBA 2X26A 3RT8A 2I6EA 1XOCA 1MY4A 1URDA 2ONKE 3K1NA 5JK4A 2I0BA 1P1QA 3CG1A 3SEUA 2F8DA 4I1DA 2F34A 3U92A 3KGCA 4YKPA 5H8QA 1DOTA 3PMWA 4ELQA 1SW2A 3MVWA 5BUUA 2DSFA 3CVGA 3PV0E 4N13A 4ZECA 3PD9A 4X9TA 4Q8RA 1ZKBA 3UGWA 1XT8A 1JW4A 3FATA 3H6TA 5I2NA 2RC8A 3MZBA 4U2RA 1B5IA 4IY5A 3M3LA 3TUSA 1NH7A 5DT6A 4BDRA 1LSTA 4R6HA 2HCAA 1TFDA 2GHBA 3E3KA 4G68A 5JEIA 2DE2A 4I8CA 3P7IA 1R9LA 3FGSA 4H6DA 3EPEA 2O6AA 2UVJA 4R75A 4F1UA 3A3CA 3K00A 1CE2A 2H98A 3C33A 3C31A 3G3JA 4X1DA 5DVFA 2F7CA 3IX1A 4JDFA 4Z0IA 3HHGA 3OO9A 1JNFA 3MW0A 4H0WA 5CBSA 1I6QA 1II5A 2F78A 3EHTA 1TXFA 4LATA 2PX1A 5I56B 1VFEA 3IB1A 3PUVE 1BIYA 1A7LA 2V3UA 1N7WA 2Y7KA 1O7TA 4IO5A 1SDXA 3FXRA 1P1WA 4F3GA 5I57A 3S9NC 4F1VA 5H8NB 4RY1A 2Q9TA 5DTBA 1N76A 3SEYA 3QIMA 3TTKA 3VVEA 2O1MA 1WDNA 4PQJA 3TPAA 2FNCA 4FORA 1FTLA 3GLBA 3MWBA 3QXMA 1YTVA 1KWHA 3ONMA 5TP9B 4G68B 3IR1A 1JVXA 1ATGA 4PFTA 4GXAA 4HW8A 3VXBA 2DWHA 2F6PA 1RYOA 3CSBA 2XXHA 3G3IA 1MQIA 3O28A 3O6GA 4OEUA 2HXWA 4ZEFA 4YKJA 5ITOA 1FQEA 3B6TA 3VV5A 1SYIA 1S50A 3OD7A 4GVOA 1B58A 2HEUA 4PFUA 2AL4A 1LBBA 1B7HA 1NH8A 2ABHA 2O7UA 2I4BA 1POTA 1PBQA 4HCWA 4OXVA 3VVFA 2HFBA 4LP2B 5DYHA 3ECRA 3GZGA 1JW1A 3B6WA 3PPRA 2DVZA 4IB2A 3RPWA 3BFTA 2PT1A 3UN6A 3C34A 3RGYA 1EH3A 1UQWA 3H03A 3MPKA 3CIJA 4LVQA 3WAEA 4BDLA 1UTBB 4GF8A 2ZXTA 3IOUA 1MDP1 3JZJA 2Q2AA 1QUKA 1TFAA 4P0GA 4QFKA 3JYRA 1NFTA 1OLAA 3KZGA 2NVUB 4LONB 4EF2A 4FEDA 3H4ZA 1OQGA 2DXRA 2AYSA 3OO6A 4R6KA 1URGA 3DLNA 4YB6A 1QKBA 3D4CA 1D3KA 4OYVA 4ZZAA 5KDTB 1UTBA 3H06B 1MXWA 1VE4A 3K6UA 3O6HA 4YB5A 5CBRA 1FTOA 2DXYA 3PUXE 2DWIA 4N07A 2E0SA 4NF8A 1Y9UA 4NF6A 4YU0A 4KR5A 3TQLA 5I2KA 4XKQA 2Q2CA 4RXLA 5B70A 3OO8A 4Q0CA 2VP1A 1R6ZA 3T66A 4EF1A 3F11A 4OZ9A 5FTHA 1B4ZA 1BKAA 3HSTA 3HV1A 5AA2B 2ZMBA 2DQVA 4MH5A 5I58A 3VVDA 3H6UA 2A5TA 2DOJA 5ITPA 3OENA 4QSCA 3EQ1A 3LSFB 3Q28A 4FIMA 4LUBA 4U23A 3K4UA 3V8XB 3HO7A 1HSEA 1MH3A 1EZPA 4GWOA 3S9EA 3TZAA 4HCYA 4G77A 4OTEA 3H6WA 4OWDA 1USYH 2ZNSA 3SDFA 1F9BA 3ZKKA 1IEJA 5IKBA 4PFYA 4RPNA 4XKNA 2A5SA 4QFLA 3U1OA 4G8NA 4F29A 5AA2A 3DELB 2R9JA 1SW1A 1US4A 3HN0A 2NOOA 1RKMA 1H3DA 3LR1A 4ISUA 3OSQA 2QS4A 4OFOA 1GVCA 2F35A 2PT2A 4BDMA 5ICQA 2QSXA 3IAZA 1DTGA 1OIBA 4IO7A 3SEXA 2XXTA 4JBZA 4YB7A 2UXAA 2CMOA 1FTMA 4NF5A 3OMBA 4H5GA 4RNSA 4FECA 4NWCA 2G93A 2W7YA 4QF9A 2RF1A 3FUZA 2A5TB 3O97A 4DZ1A 5KZTA 1LFIA 2IA4A 3PPQA 4G8HA 4MBPA 5AA2D 3R7XA 2E1SA 4QFNA 5K2YA 1SVXB 5TU0A 4ELRA 4F31B 4JXIA 4F18A 2QS2A 1ELJA 1LAXA 1SW5A 4E0WA 3MVXA 3I3VA 3RUMA 3O2AA 1EU8A 1I6AA 3E4RA 5F1QA 2NWJA 4R9FA 4F19A 4F1YA 3IOTA 1TWYA 4YICA 4QFPA 3SERA 2KLFA 2Y7RA 2HQ0A 2PVUA 1FQCA 1OQHA 3C36A 3KOSA 3O6IA 3OOAA 4KCCA 2P1SA 4OQOA 4R74A 2QMXA 4JSOA 4XKPA 4ZEKA 5L8DA 4F3SA 3KN8A 1NNKA 1R1NA 3ZKLA 1ZJLA 1J1NA 2I3WA 2M8CA 2R6GE 5FHNA 1A8EA 1NL5A 4DDDA 4IO4A 4GL0A 1H44A 1FQBA 4R2FA 4WXJA 5DVJA 4H8IA 1D4NA 1JETA 3CRBA 2ESNA 3TTMA 5M2VA 4IY6A 5AA4A 2O7IA 1B4HA 4G8MA 3B7DA 1JVYA 4X48A 2ZNTA 3IORA 3VLUA 3TEPA 3SESA 1WVJA 2GFEA 1H43A 1LCTA 3GBAA 2RCAA 3V5AA 3N6TA 4OVJA 1POY1 3PUZE 2QPQA 4X1BA 3OO7A 4ECFA 1NKXA 1PB7A 4UACA 2I58A 3H7MA 1CB6A 3FXQA 3PPNA 3UORA 1OLCA 1Y3NA 2PBWA 1B32A 1UIVA 1O63A 2YJPA 4YKKA 2Z8EA 5H8HA 1DMBA 5CMKA 3IB2A 5ISUA 3Q26A 4R2BA 3SEVA 3S9MC 4OENA 4GQOA 5A5XB 5KCJA 4AQ4A 4EDPA 1USYE 3C9HA 4JB7A 3SETA 3CFXA 3KBRA 2XX9A 2I49A 1OMPA 1LBCA 4I9DA 5DEXB 4PETA 5BWJA 2H25A 4M4GA 3HPIA 3T9XB 2O51A 1YPNA 1SD3A 2QMWA 3R6UA 4OEVA 2THIA 1TT1A 1B0HA 2Z23A 2ZYOA 3ILTB 1Y20A 1Y3QA 2OJTA 5DEXA 5H8FA 3T9UA 3T93B 3KN3A 5EHMA 5DVIA 4GXSB 1AMFA 1LGBC 1Y1MA 4Q30B 4ESWA 3K02A 3Q29A 1UTHA 2VD3A 4EUOA 5IAIA 2XXIA 1LFHA 3TFLA 3LBSA 3T22A 1AOVA 1GR2A 2IEEA 3IJOB 1N7XA 2QL3A 3PGFA 5CMBA 3VE1B 5HPQA 3V83A 3C35A 1M5BA 2F5XA 2OK2A 3TAJA 1IXCA 2F36A 1I69A 3RLFE 1MXZA 3BFUA 4O3BA 2FA7A 4P0IA 1MXUA 1MXVA 1Y4TA 4GRKA 4EQ9A 3G7WA 1ZMGA 3D4GA 1GGGA 1ZLQA 4GD5A 4H8JA 4YAHX 2DE4A 2WKYA 1MY0A 4POWA 3PU5A 4XKRA 1M5EA 2RC9A 1XHYA 4HS7A 4PFWA 1SI0A 1DTZA 3FASA 3RTWB 3TCHA 4OFLA 3AXFA 3K1MA 3EHUA 3OEKA 4NF8B 1MY1A 5I2KB 3V89B 4DCXA 3BBRA 2F97A 2V3QA 3CI8A 1QJMA 2V25A 3MP1A 4ELPA 2XXYA 3CFLA 2R71A 5I59B 2H99A 1SQYA 3T9HB 2X7QA 5JTYA 1MG1A 4FEBA 3GBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUV A;  4H5F A;  5H8Q B;  4QSD A;  5CMC A;  3RN8 A;  2V84 A;  3VXC A;  1P1O A;  2V3T A;  1ANF A;  1ZIU A;  4DXB A;  4LZ7 A;  1IIW A;  1MM7 A;  4QSE A;  3U8Q A;  3IOV A;  3IJX B;  3RY3 A;  3DP6 A;  2ZNU A;  4JSD A;  1LAF E;  1MPB A;  4JWX A;  3KSX A;  2XX8 A;  2GRV A;  3A09 A;  3QUF A;  5L9O A;  3O9P A;  4IO2 A;  1MDQ A;  4TLL B;  3UA8 A;  3TMG A;  5A5X A;  4GOT A;  1IXI A;  2PYY A;  2XXR A;  1MQJ A;  2XD2 A;  3ZS6 A;  4BDO A;  4F2Q A;  1MY2 A;  3MUQ A;  3DM0 A;  3OXN A;  4JWO A;  2DS9 A;  4TQU Q;  2Q89 A;  4WED A;  5ELV A;  5FTI A;  3WAF A;  4FE8 A;  1JQF A;  4DXC A;  3U94 A;  3N26 A;  4NE4 A;  4IO6 A;  3IO6 A;  3PPO A;  5H8H B;  2H5Y A;  4RK9 A;  5TP9 A;  3TCG A;  5I84 A;  2GHA A;  5I56 A;  5HM4 B;  3CR9 A;  2Z8F A;  1DPE A;  5AA3 A;  3EF7 A;  5L9M A;  5I59 A;  4NED A;  4XXU A;  3L6H A;  4IGT A;  5L9S A;  4F3B A;  4H67 A;  2ANJ A;  4OES A;  2O1L A;  3RTF B;  4KCD A;  1B3E A;  3C32 A;  2QS3 A;  2VOZ A;  2HZL A;  1PC3 A;  4QFO A;  1VFD A;  3FVK A;  2XXP A;  1D9Y A;  2B3F A;  3MQ9 A;  2ZYM A;  2XXQ A;  3KJT A;  3PMV A;  4G68 C;  3QSL A;  4KFQ A;  4JWY A;  3VLW A;  1GV8 A;  2UYF A;  2XXV A;  4GLI A;  3LSL A;  1FQF A;  5FHO A;  3OEM A;  4R73 A;  4DCY A;  1AL3 A;  1B7U A;  3MVY A;  5KDT A;  1AIV A;  2LAO A;  3SEW A;  2Y7I A;  4OET A;  3TTL A;  4NF4 A;  3CG3 A;  4F39 A;  4FAT A;  2VGQ A;  4YMB A;  2UVI A;  3GXA A;  1B7Z A;  1H45 A;  3QAX A;  1MXX A;  2VHA A;  4MF3 A;  1VR5 A;  4E0X A;  4FAJ A;  3TTR A;  4YMA A;  4KI0 E;  3I5O A;  2NXO A;  3PMX A;  1N04 A;  1N0T A;  2DE3 A;  1B2H A;  1B5J A;  4FJP A;  4U21 A;  2ZYN A;  4GFR A;  3W9W A;  1QUI A;  1ZBM A;  1MRP A;  2O68 A;  1B3F A;  1B6H A;  2F7B A;  3K6W A;  1B3H A;  1XVY A;  3KOT A;  3MZ1 A;  4KPT A;  4ZE8 A;  4H65 A;  1FTJ A;  4ZS9 A;  3W15 C;  3T96 B;  1LLS A;  1IQ7 A;  2I4C A;  4NF5 B;  1WOD A;  2D21 A;  2I3V A;  2OLB A;  3L6G A;  4KQP A;  1MH4 A;  3B6Q A;  3IL1 B;  4PE5 B;  3K6V A;  5F7V A;  1M5C A;  4BLA A;  2DWJ A;  2YLN A;  2REG A;  1PDA A;  3FV2 A;  3IK6 B;  3UIF A;  4OFJ A;  2G29 A;  4IGR A;  2FYI A;  4ND9 A;  4POX A;  3O66 A;  1N84 A;  2AL5 A;  2Y7P A;  2XD3 A;  3M3F A;  3FVN A;  3MC2 A;  2ALU A;  4QHQ A;  5CM6 A;  2UVH A;  3VLV A;  1MM6 A;  1MQH A;  2ZYK A;  2AIX A;  1P1U A;  3Q27 A;  1ZU0 A;  2HAU A;  4O3C A;  3U72 A;  1LB8 A;  4ZE9 A;  4F22 A;  1LCF A;  3VFJ A;  4C1U A;  3UK4 A;  3U93 A;  4R72 A;  3SKP A;  4RK2 A;  5J1D A;  2H4I A;  4XTC Q;  3PUY E;  1A40 A;  1B3L A;  4P11 A;  3IB0 A;  4KYS A;  1N3X A;  3M8U A;  1FQA A;  4U4S A;  5HBC A;  1LAH E;  3H3G A;  3K1P A;  1VSO A;  1PB8 A;  2OWT A;  1NNF A;  1US5 A;  3K6X A;  4OMB A;  1L5T A;  1DSN A;  1FQD A;  1QKA A;  3A3U A;  4MLQ A;  1PBP A;  4LA9 A;  4ZED A;  3HHF A;  1R9Q A;  3LC8 A;  4M1V A;  3TQW A;  4K3F A;  4U4X A;  1XVX A;  4EQB A;  1PB9 A;  1N3W A;  1B05 A;  3LSX A;  1UTH B;  4RJZ A;  5EYF A;  3TTN A;  4DXU A;  1M5D A;  2DWA A;  1A55 A;  3KG2 A;  4GL8 A;  4YZZ A;  5I58 B;  3RQT A;  1MQD A;  4C0R A;  1FCK A;  3IOW A;  4MFI A;  5CMM A;  1QUL A;  2D5W A;  3S2V A;  5LOM A;  1NNP A;  3E13 X;  4QRZ A;  1SW4 A;  2D3I A;  1IUD A;  1QVS A;  2REJ A;  2XXU A;  3G3H A;  3G3K A;  4IO3 A;  2XXW A;  1I6B A;  4YKI A;  1LAG E;  3CFZ A;  2OBG A;  1MQG A;  1Y3P A;  3EN3 A;  2UYE A;  4ONY A;  1NMU A;  3BKI B;  4H1X A;  4HTG A;  3Q25 A;  2QS1 A;  2F7A A;  1B0L A;  2Z22 A;  2RC7 A;  3ILU B;  4MLV A;  1XC1 A;  4WEP A;  3MJN A;  4OER A;  3CSG A;  3N94 A;  5CRY A;  2QJE A;  3K01 A;  5H8S A;  1DPP A;  1QUJ A;  4R9G A;  1B1H A;  1UIU A;  4EXK A;  4F3P A;  1B40 A;  2HAV A;  4RYA A;  2QRY A;  4DLD A;  1EZO A;  4TLM B;  3ZSF A;  1BLF A;  5B7D A;  3THI A;  2O69 A;  4LZ8 A;  4TOZ A;  5I2N B;  2Z8D A;  3KJ7 A;  3ODB A;  1B3G A;  3FZV A;  2Y7W A;  3EHS A;  1MXY A;  4R6Y A;  2RKM A;  2OCU A;  3TDJ A;  3MVZ A;  1URS A;  3JV9 A;  3K2D A;  4NWD A;  3I6V A;  1Y4C A;  4KD5 A;  2F6G A;  1A54 A;  2VD2 A;  1BP5 A;  3OSR A;  2YPN A;  4AB5 A;  5TPA B;  1XS5 A;  3FIR A;  3S9L C;  3QUJ A;  4WKM A;  4LZ5 A;  3TKD A;  1A99 A;  4Z7E A;  2OZZ A;  5ICT A;  3QYT A;  3USD A;  1MY3 A;  1MPC A;  3FXU A;  1YAE A;  4BDQ A;  4DIG A;  5AE4 A;  3UP9 A;  4EQ7 A;  4NMY A;  1IIT A;  5TPA A;  2BJJ X;  3S4U A;  1EZ9 A;  5H8N A;  4ZZE A;  3RNN A;  3TOD A;  5H8F B;  3TCF A;  3FVO A;  4F2O A;  4GIZ A;  1B9J A;  3MZ9 A;  3T9V A;  1IXH A;  3MAM A;  4Q5T A;  1ZTY A;  5AA1 A;  2XXX A;  4ZDM A;  1A8F A;  3PUW E;  4OHN A;  1M5F A;  3N5L A;  4KHZ E;  3KN7 A;  4O3A A;  4KYD A;  2CZL A;  4U1O A;  3VDF A;  2HZK A;  1QW0 A;  3TYH A;  4ELO A;  4NF6 B;  1JEV A;  2DP8 A;  3R26 A;  2OWS A;  4I62 A;  3HCQ A;  1P99 A;  2V93 A;  3FVG A;  2O84 X;  3W9V A;  1B1X A;  4ZEB A;  3MP8 A;  1Z7M E;  2I48 A;  3PPP A;  5EHS A;  1B5H A;  1S9T A;  1Z7N E;  1H76 A;  2X7P A;  3KFM A;  4KYE A;  3FJG A;  1OVB A;  3M3K A;  3FJM A;  1SBP A;  1FW0 A;  1HSJ A;  1FTK A;  1LB9 A;  3FJ7 A;  3MBP A;  2Q8J A;  3TEL A;  2ONS A;  4EXL A;  5KCJ B;  2P2A A;  2B3B A;  3H6V A;  4G2Z A;  4NTL A;  1IZ1 A;  1GTK A;  2Q88 A;  5I57 B;  1B52 A;  1JEU A;  2DYX A;  2PMS A;  3C4M A;  2H9B A;  1Q1K A;  1Y1Z A;  4C1T A;  4BDN A;  3DP8 A;  3KSJ A;  3LUY A;  5CC2 A;  2P0S A;  4ZEI A;  5CI5 A;  4N6P A;  4U22 A;  4NF4 B;  1HSL A;  5K2X A;  4U1Z A;  4LQ5 A;  3FD3 A;  1LFG A;  2B65 A;  4XIG Q;  1SYH A;  2RIN A;  4G4P A;  4L17 A;  4THI A;  1NNT A;  3MP6 A;  3N6U A;  2I0C A;  2UVG A;  5AA4 B;  1B51 A;  1Q35 A;  4PP0 A;  1T0K A;  3RT6 B;  1RYX A;  1D9V A;  2ONR A;  4UA8 A;  4ESX A;  1P1N A;  3PD8 A;  1YCJ A;  2XHD A;  3G3G A;  3LSW A;  3O29 A;  1AH5 A;  1SI1 A;  2XX7 A;  1IXG A;  1OVT A;  3QK6 A;  1PEB A;  1MS7 A;  3FV1 A;  4RPO A;  3G3F A;  1BTJ A;  2GH9 A;  3DP4 A;  4AB6 A;  4DE8 A;  5FHM A;  3K0V A;  1MPD A;  1S7Y A;  5JTY B;  4LQ2 A;  1JW5 A;  1B46 A;  1O64 A;  2Y84 A;  2DVC A;  3E9X A;  3MPL A;  3OEL A;  4RA1 A;  3IO4 A;  3KEI A;  2RCB A;  2X26 A;  3RT8 A;  2I6E A;  1XOC A;  1MY4 A;  1URD A;  2ONK E;  3K1N A;  5JK4 A;  2I0B A;  1P1Q A;  3CG1 A;  3SEU A;  2F8D A;  4I1D A;  2F34 A;  3U92 A;  3KGC A;  4YKP A;  5H8Q A;  1DOT A;  3PMW A;  4ELQ A;  1SW2 A;  3MVW A;  5BUU A;  2DSF A;  3CVG A;  3PV0 E;  4N13 A;  4ZEC A;  3PD9 A;  4X9T A;  4Q8R A;  1ZKB A;  3UGW A;  1XT8 A;  1JW4 A;  3FAT A;  3H6T A;  5I2N A;  2RC8 A;  3MZB A;  4U2R A;  1B5I A;  4IY5 A;  3M3L A;  3TUS A;  1NH7 A;  5DT6 A;  4BDR A;  1LST A;  4R6H A;  2HCA A;  1TFD A;  2GHB A;  3E3K A;  4G68 A;  5JEI A;  2DE2 A;  4I8C A;  3P7I A;  1R9L A;  3FGS A;  4H6D A;  3EPE A;  2O6A A;  2UVJ A;  4R75 A;  4F1U A;  3A3C A;  3K00 A;  1CE2 A;  2H98 A;  3C33 A;  3C31 A;  3G3J A;  4X1D A;  5DVF A;  2F7C A;  3IX1 A;  4JDF A;  4Z0I A;  3HHG A;  3OO9 A;  1JNF A;  3MW0 A;  4H0W A;  5CBS A;  1I6Q A;  1II5 A;  2F78 A;  3EHT A;  1TXF A;  4LAT A;  2PX1 A;  5I56 B;  1VFE A;  3IB1 A;  3PUV E;  1BIY A;  1A7L A;  2V3U A;  1N7W A;  2Y7K A;  1O7T A;  4IO5 A;  1SDX A;  3FXR A;  1P1W A;  4F3G A;  5I57 A;  3S9N C;  4F1V A;  5H8N B;  4RY1 A;  2Q9T A;  5DTB A;  1N76 A;  3SEY A;  3QIM A;  3TTK A;  3VVE A;  2O1M A;  1WDN A;  4PQJ A;  3TPA A;  2FNC A;  4FOR A;  1FTL A;  3GLB A;  3MWB A;  3QXM A;  1YTV A;  1KWH A;  3ONM A;  5TP9 B;  4G68 B;  3IR1 A;  1JVX A;  1ATG A;  4PFT A;  4GXA A;  4HW8 A;  3VXB A;  2DWH A;  2F6P A;  1RYO A;  3CSB A;  2XXH A;  3G3I A;  1MQI A;  3O28 A;  3O6G A;  4OEU A;  2HXW A;  4ZEF A;  4YKJ A;  5ITO A;  1FQE A;  3B6T A;  3VV5 A;  1SYI A;  1S50 A;  3OD7 A;  4GVO A;  1B58 A;  2HEU A;  4PFU A;  2AL4 A;  1LBB A;  1B7H A;  1NH8 A;  2ABH A;  2O7U A;  2I4B A;  1POT A;  1PBQ A;  4HCW A;  4OXV A;  3VVF A;  2HFB A;  4LP2 B;  5DYH A;  3ECR A;  3GZG A;  1JW1 A;  3B6W A;  3PPR A;  2DVZ A;  4IB2 A;  3RPW A;  3BFT A;  2PT1 A;  3UN6 A;  3C34 A;  3RGY A;  1EH3 A;  1UQW A;  3H03 A;  3MPK A;  3CIJ A;  4LVQ A;  3WAE A;  4BDL A;  1UTB B;  4GF8 A;  2ZXT A;  3IOU A;  1MDP 1;  3JZJ A;  2Q2A A;  1QUK A;  1TFA A;  4P0G A;  4QFK A;  3JYR A;  1NFT A;  1OLA A;  3KZG A;  2NVU B;  4LON B;  4EF2 A;  4FED A;  3H4Z A;  1OQG A;  2DXR A;  2AYS A;  3OO6 A;  4R6K A;  1URG A;  3DLN A;  4YB6 A;  1QKB A;  3D4C A;  1D3K A;  4OYV A;  4ZZA A;  5KDT B;  1UTB A;  3H06 B;  1MXW A;  1VE4 A;  3K6U A;  3O6H A;  4YB5 A;  5CBR A;  1FTO A;  2DXY A;  3PUX E;  2DWI A;  4N07 A;  2E0S A;  4NF8 A;  1Y9U A;  4NF6 A;  4YU0 A;  4KR5 A;  3TQL A;  5I2K A;  4XKQ A;  2Q2C A;  4RXL A;  5B70 A;  3OO8 A;  4Q0C A;  2VP1 A;  1R6Z A;  3T66 A;  4EF1 A;  3F11 A;  4OZ9 A;  5FTH A;  1B4Z A;  1BKA A;  3HST A;  3HV1 A;  5AA2 B;  2ZMB A;  2DQV A;  4MH5 A;  5I58 A;  3VVD A;  3H6U A;  2A5T A;  2DOJ A;  5ITP A;  3OEN A;  4QSC A;  3EQ1 A;  3LSF B;  3Q28 A;  4FIM A;  4LUB A;  4U23 A;  3K4U A;  3V8X B;  3HO7 A;  1HSE A;  1MH3 A;  1EZP A;  4GWO A;  3S9E A;  3TZA A;  4HCY A;  4G77 A;  4OTE A;  3H6W A;  4OWD A;  1USY H;  2ZNS A;  3SDF A;  1F9B A;  3ZKK A;  1IEJ A;  5IKB A;  4PFY A;  4RPN A;  4XKN A;  2A5S A;  4QFL A;  3U1O A;  4G8N A;  4F29 A;  5AA2 A;  3DEL B;  2R9J A;  1SW1 A;  1US4 A;  3HN0 A;  2NOO A;  1RKM A;  1H3D A;  3LR1 A;  4ISU A;  3OSQ A;  2QS4 A;  4OFO A;  1GVC A;  2F35 A;  2PT2 A;  4BDM A;  5ICQ A;  2QSX A;  3IAZ A;  1DTG A;  1OIB A;  4IO7 A;  3SEX A;  2XXT A;  4JBZ A;  4YB7 A;  2UXA A;  2CMO A;  1FTM A;  4NF5 A;  3OMB A;  4H5G A;  4RNS A;  4FEC A;  4NWC A;  2G93 A;  2W7Y A;  4QF9 A;  2RF1 A;  3FUZ A;  2A5T B;  3O97 A;  4DZ1 A;  5KZT A;  1LFI A;  2IA4 A;  3PPQ A;  4G8H A;  4MBP A;  5AA2 D;  3R7X A;  2E1S A;  4QFN A;  5K2Y A;  1SVX B;  5TU0 A;  4ELR A;  4F31 B;  4JXI A;  4F18 A;  2QS2 A;  1ELJ A;  1LAX A;  1SW5 A;  4E0W A;  3MVX A;  3I3V A;  3RUM A;  3O2A A;  1EU8 A;  1I6A A;  3E4R A;  5F1Q A;  2NWJ A;  4R9F A;  4F19 A;  4F1Y A;  3IOT A;  1TWY A;  4YIC A;  4QFP A;  3SER A;  2KLF A;  2Y7R A;  2HQ0 A;  2PVU A;  1FQC A;  1OQH A;  3C36 A;  3KOS A;  3O6I A;  3OOA A;  4KCC A;  2P1S A;  4OQO A;  4R74 A;  2QMX A;  4JSO A;  4XKP A;  4ZEK A;  5L8D A;  4F3S A;  3KN8 A;  1NNK A;  1R1N A;  3ZKL A;  1ZJL A;  1J1N A;  2I3W A;  2M8C A;  2R6G E;  5FHN A;  1A8E A;  1NL5 A;  4DDD A;  4IO4 A;  4GL0 A;  1H44 A;  1FQB A;  4R2F A;  4WXJ A;  5DVJ A;  4H8I A;  1D4N A;  1JET A;  3CRB A;  2ESN A;  3TTM A;  5M2V A;  4IY6 A;  5AA4 A;  2O7I A;  1B4H A;  4G8M A;  3B7D A;  1JVY A;  4X48 A;  2ZNT A;  3IOR A;  3VLU A;  3TEP A;  3SES A;  1WVJ A;  2GFE A;  1H43 A;  1LCT A;  3GBA A;  2RCA A;  3V5A A;  3N6T A;  4OVJ A;  1POY 1;  3PUZ E;  2QPQ A;  4X1B A;  3OO7 A;  4ECF A;  1NKX A;  1PB7 A;  4UAC A;  2I58 A;  3H7M A;  1CB6 A;  3FXQ A;  3PPN A;  3UOR A;  1OLC A;  1Y3N A;  2PBW A;  1B32 A;  1UIV A;  1O63 A;  2YJP A;  4YKK A;  2Z8E A;  5H8H A;  1DMB A;  5CMK A;  3IB2 A;  5ISU A;  3Q26 A;  4R2B A;  3SEV A;  3S9M C;  4OEN A;  4GQO A;  5A5X B;  5KCJ A;  4AQ4 A;  4EDP A;  1USY E;  3C9H A;  4JB7 A;  3SET A;  3CFX A;  3KBR A;  2XX9 A;  2I49 A;  1OMP A;  1LBC A;  4I9D A;  5DEX B;  4PET A;  5BWJ A;  2H25 A;  4M4G A;  3HPI A;  3T9X B;  2O51 A;  1YPN A;  1SD3 A;  2QMW A;  3R6U A;  4OEV A;  2THI A;  1TT1 A;  1B0H A;  2Z23 A;  2ZYO A;  3ILT B;  1Y20 A;  1Y3Q A;  2OJT A;  5DEX A;  5H8F A;  3T9U A;  3T93 B;  3KN3 A;  5EHM A;  5DVI A;  4GXS B;  1AMF A;  1LGB C;  1Y1M A;  4Q30 B;  4ESW A;  3K02 A;  3Q29 A;  1UTH A;  2VD3 A;  4EUO A;  5IAI A;  2XXI A;  1LFH A;  3TFL A;  3LBS A;  3T22 A;  1AOV A;  1GR2 A;  2IEE A;  3IJO B;  1N7X A;  2QL3 A;  3PGF A;  5CMB A;  3VE1 B;  5HPQ A;  3V83 A;  3C35 A;  1M5B A;  2F5X A;  2OK2 A;  3TAJ A;  1IXC A;  2F36 A;  1I69 A;  3RLF E;  1MXZ A;  3BFU A;  4O3B A;  2FA7 A;  4P0I A;  1MXU A;  1MXV A;  1Y4T A;  4GRK A;  4EQ9 A;  3G7W A;  1ZMG A;  3D4G A;  1GGG A;  1ZLQ A;  4GD5 A;  4H8J A;  4YAH X;  2DE4 A;  2WKY A;  1MY0 A;  4POW A;  3PU5 A;  4XKR A;  1M5E A;  2RC9 A;  1XHY A;  4HS7 A;  4PFW A;  1SI0 A;  1DTZ A;  3FAS A;  3RTW B;  3TCH A;  4OFL A;  3AXF A;  3K1M A;  3EHU A;  3OEK A;  4NF8 B;  1MY1 A;  5I2K B;  3V89 B;  4DCX A;  3BBR A;  2F97 A;  2V3Q A;  3CI8 A;  1QJM A;  2V25 A;  3MP1 A;  4ELP A;  2XXY A;  3CFL A;  2R71 A;  5I59 B;  2H99 A;  1SQY A;  3T9H B;  2X7Q A;  5JTY A;  1MG1 A;  4FEB A;  3GBB A; 
#chains in the Genus database with same CATH topology
 5CMC A;  1P1O A;  1SPI A;  1ZIU A;  4DXB A;  1IIW A;  4JSD A;  1LAF E;  2XX8 A;  3A09 A;  3QUF A;  4IO2 A;  1FBC A;  4GOT A;  4F2Q A;  4N6K A;  3TKD A;  2DS9 A;  4TQU Q;  2Q89 A;  5FTI A;  3U94 A;  5HM4 B;  3CR9 A;  5AA3 A;  1DPE A;  5L9S A;  4NED A;  4XXU A;  4IGT A;  4OES A;  2WBB A;  2O1L A;  1B3E A;  4QFO A;  4DLD A;  4TLL B;  1VFD A;  3PMV A;  2B3F A;  3VLW A;  4JWY A;  2UYF A;  2XXV A;  2Q74 A;  1EYJ A;  3OEM A;  1AIV A;  2LAO A;  4DI4 B;  5H8F A;  3FXB A;  2VGQ A;  2UVI A;  1B7Z A;  2VHA A;  4MNP A;  1VR5 A;  4FAJ A;  1G0I A;  1N0T A;  4FJP A;  2ZYN A;  1QUI A;  2F7B A;  3K6W A;  4KPT A;  4H65 A;  4ZS9 A;  3W15 C;  3T96 B;  1IQ7 A;  1WOD A;  2D21 A;  4O7I A;  4PE5 B;  3K6V A;  4HE1 A;  1IMA A;  3UIF A;  4I3Y A;  3O66 A;  3MC2 A;  3FVN A;  2UVH A;  3VLV A;  1MM6 A;  3U72 A;  1LCF A;  2DDK A;  1B3L A;  4P11 A;  3IB0 A;  1N3X A;  3H3G A;  1PB8 A;  1L5T A;  4LA9 A;  5EQA A;  4K3F A;  1NV3 A;  4EQB A;  3LSX A;  1B05 A;  5EYF A;  1NUW A;  1M5D A;  4YZZ A;  3RQT A;  3IOW A;  2XXU A;  1IUD A;  3G3K A;  2XXW A;  4ONY A;  2QS1 A;  2RC7 A;  2QJE A;  3K01 A;  1FJ6 A;  2QFL A;  4TLM B;  3U65 A;  2Y7W A;  4R6Y A;  4GWU A;  3TDJ A;  3K2D A;  2F6G A;  1FBG A;  2VD2 A;  3OSR A;  2YPN A;  3S9L C;  4WKM A;  4LZ5 A;  4BDQ A;  1IIT A;  2BJJ X;  1B9J A;  3MZ9 A;  1A8F A;  3PUW E;  4NHB A;  4O3A A;  3D1R A;  2OWS A;  1RDY A;  1FSA A;  1B1X A;  4ZEB A;  3MP8 A;  2XA5 A;  1Z7N E;  1NUY A;  3FJ7 A;  2P2A A;  2B3B A;  2Y5L A;  1JEU A;  2DYX A;  1Y1Z A;  4OVP A;  3KSJ A;  4BDN A;  4N6P A;  5K2X A;  2RIN A;  3B8B A;  4L17 A;  3MP6 A;  2I0C A;  1JP4 A;  2UVG A;  4X8R A;  4PP0 A;  1RYX A;  4ESX A;  4QBA A;  3G3G A;  3LSW A;  5IZ3 B;  4RPO A;  3FV1 A;  5LTC A;  5FHM A;  3K0V A;  5IM2 A;  1O64 A;  3MPL A;  1FPI A;  2RCB A;  3RT8 A;  3CG1 A;  2F8D A;  3U92 A;  3KGC A;  1DOT A;  4XEQ A;  4ELQ A;  1SW2 A;  3PV0 E;  4X9T A;  3H6T A;  3MZB A;  2VT5 A;  4GWX A;  3E3K A;  2DE2 A;  1NV6 A;  3FGS A;  3EPE A;  3A3C A;  1CE2 A;  2F7C A;  3OO9 A;  5CBS A;  1I6Q A;  1TXF A;  3IB1 A;  1BIY A;  1O7T A;  1SDX A;  5ESY A;  5DTB A;  3TTK A;  4PQJ A;  3TPA A;  2FNC A;  1EYI A;  1FTL A;  3IFC A;  4G68 B;  3IR1 A;  1JVX A;  2B4M A;  3CSB A;  2XXH A;  4OEU A;  2HXW A;  4ZEF A;  1FQE A;  3OD7 A;  4GVO A;  4MNI A;  1POT A;  1NV7 A;  3GZG A;  1JW1 A;  3PPR A;  2PT1 A;  1FBD A;  4BDL A;  2QVV A;  3CIJ A;  3IOU A;  1MDP 1;  3JZJ A;  1TFA A;  3JYR A;  2CZK A;  4PF8 A;  4NGU A;  3PUX E;  2DWI A;  4XKQ A;  4RXL A;  4Q0C A;  2VP1 A;  4EF1 A;  3F11 A;  4OZ9 A;  3HV1 A;  1RDZ A;  2DOJ A;  3OEN A;  4FIM A;  1FBH A;  4U23 A;  3V8X B;  1HSE A;  3TZA A;  4MAG A;  4OWD A;  1IEJ A;  4RPN A;  4XKN A;  1VDW A;  3U1O A;  1SW1 A;  4O8M A;  2PCR A;  1RKM A;  3OSQ A;  3IAZ A;  5EQ8 A;  3SEX A;  2XXT A;  2G93 A;  3FUZ A;  3O97 A;  2IA4 A;  5AA2 D;  4QFN A;  4F31 B;  4JXI A;  4F18 A;  4QFP A;  2KLF A;  1FQC A;  3KOS A;  4R74 A;  5L8D A;  4XKP A;  4ZEK A;  3KN8 A;  5DW8 A;  3PTY A;  1J1N A;  2M8C A;  3CRB A;  3TTM A;  2O7I A;  1B4H A;  4X48 A;  3IOR A;  1LCT A;  1POY 1;  4ECF A;  1INP A;  1NKX A;  1CB6 A;  3FXQ A;  1OLC A;  1Y3N A;  2YJP A;  1B32 A;  1O63 A;  3RPL A;  2XWI A;  4JB7 A;  1OMP A;  4N91 A;  4M4G A;  3T9X B;  2O51 A;  2QMW A;  2THI A;  1TT1 A;  1B0H A;  2Z23 A;  2OJT A;  3T93 B;  5EHM A;  2VD3 A;  4EUO A;  5IAI A;  2XXI A;  1LFH A;  1AOV A;  5I7I A;  3V83 A;  5CMB A;  3KC1 A;  1LBV A;  1MXZ A;  2ZZX A;  4O3B A;  3G7W A;  1ZLQ A;  3QMF A;  4AS4 A;  4PFW A;  3FAS A;  3RTW B;  3ROJ A;  3EHU A;  5I2K B;  1KA1 A;  2F97 A;  2R71 A;  2H99 A;  1SQY A;  2X7Q A;  4E0W A;  2F3B A;  4JWX A;  1YZ0 A;  3UA8 A;  1K9Y A;  3MUQ A;  3DM0 A;  5ELV A;  3WAF A;  4H45 A;  4DXC A;  3N26 A;  4NE4 A;  5H8H B;  4RK9 A;  5I84 A;  4MX6 A;  5I59 A;  3EF7 A;  5L9M A;  4F3B A;  4H67 A;  4KCD A;  3C32 A;  2QS3 A;  2HZL A;  1PC3 A;  3MQ9 A;  1FPJ A;  1D9Y A;  4G68 C;  5M2V A;  2ZYM A;  3QSL A;  4KFQ A;  1GV8 A;  4DCY A;  3IFA A;  1AL3 A;  3MVY A;  3SEW A;  2Y7I A;  3TTL A;  4F39 A;  4FAT A;  1MXX A;  4MF3 A;  4E0X A;  4YMA A;  4NX1 A;  3I5O A;  3PMX A;  1B2H A;  1B5J A;  4U21 A;  2FIE A;  2O68 A;  4PGP A;  1B3F A;  1B6H A;  1XVY A;  4ZE8 A;  4XFE A;  1FTJ A;  2GQ1 A;  3E78 A;  2PFY A;  2I3V A;  2OLB A;  1MH4 A;  5F7V A;  4NF0 A;  1M5C A;  2YLN A;  1PDA A;  3A29 A;  2G29 A;  2FYI A;  4ND9 A;  4POX A;  1NV2 A;  1N84 A;  5A5L A;  4OVR A;  2ZYK A;  3Q27 A;  1P1U A;  2CZH A;  2XXK A;  4O3C A;  3UK4 A;  3SKP A;  4XTC Q;  4KYS A;  3M8U A;  1FQA A;  4U4S A;  3K1P A;  3K6X A;  4OMB A;  4I40 A;  1DSN A;  3A3U A;  3HHF A;  1R9Q A;  4U4X A;  4RJZ A;  4DXU A;  4PC9 A;  3TTN A;  2DWA A;  5CMM A;  3S2V A;  4QRZ A;  4PTK A;  1I6B A;  1LAG E;  2OBG A;  1Y3P A;  2UYE A;  5ET7 A;  4HTG A;  3Q25 A;  1B0L A;  4MIJ A;  3N94 A;  5I56 B;  5H8S A;  4EXK A;  1DPP A;  4F3P A;  1B1H A;  4JVI A;  4RYA A;  2O69 A;  4LZ8 A;  2Z8D A;  3ODB A;  3FZV A;  1MXY A;  2RKM A;  4NWD A;  3I6V A;  4KD5 A;  1A54 A;  1BP5 A;  1XS5 A;  5ET6 A;  4DIG A;  4NMY A;  5TPA A;  3TOD A;  4ZZE A;  4GIZ A;  4NQ8 A;  3T9V A;  1IXH A;  3MAM A;  4Q5T A;  1M5F A;  3N5L A;  3KN7 A;  4ELO A;  2HZK A;  1JEV A;  2DP8 A;  3R26 A;  4I62 A;  3FVG A;  3KFM A;  3FJG A;  1OVB A;  3M3K A;  1FW0 A;  1FTK A;  3TEL A;  5KCJ B;  3H6V A;  1FPE A;  4G2Z A;  1GTK A;  3C4M A;  5CC2 A;  3LUY A;  4ZEI A;  5CI5 A;  4GBW A;  3FD3 A;  1SYH A;  4G4P A;  4THI A;  3RT6 B;  3LV0 A;  1P1N A;  1YCJ A;  3KC0 A;  3O29 A;  1OVT A;  3QK6 A;  1MS7 A;  1BTJ A;  2GH9 A;  4PF6 A;  5JTY B;  4LQ2 A;  2Y84 A;  2DVC A;  3E9X A;  4RA1 A;  2I6E A;  1URD A;  2F34 A;  4YKP A;  5BUU A;  3MVW A;  2WEF A;  4NN3 A;  4N81 A;  1XT8 A;  3FAT A;  3M3L A;  3TUS A;  1NH7 A;  5IZ3 A;  3P7I A;  2UVJ A;  4N8Y A;  4R75 A;  3K00 A;  4JDF A;  3B50 A;  1JNF A;  4H0W A;  4LAT A;  1LBW A;  1A7L A;  1N7W A;  3FXR A;  4F3G A;  1P1W A;  5I57 A;  3S9N C;  4F1V A;  4RY1 A;  2Q9T A;  3GLB A;  1LEV A;  4PFT A;  4HW8 A;  2DWH A;  2F6P A;  3O28 A;  3O6G A;  1B58 A;  4PFU A;  2ABH A;  4OXV A;  4PBH A;  3B6W A;  3RGY A;  1EH3 A;  4N8G A;  4GF8 A;  2ZXT A;  1DCU A;  4N4U A;  1NFT A;  1OLA A;  3KZG A;  4EF2 A;  2Y5K A;  2DXR A;  4YB6 A;  1URG A;  1FPK A;  3DLN A;  3D4C A;  1D3K A;  5EQ9 A;  1XI6 A;  4JVD A;  2R8T A;  3RPL B;  4YU0 A;  4NF8 A;  1Y9U A;  2QVU A;  5FTH A;  1B4Z A;  1BKA A;  3HST A;  2ZMB A;  2DQV A;  3VVD A;  4QSC A;  3EQ1 A;  1EZP A;  4GWO A;  4G77 A;  3H6W A;  1USY H;  4PFY A;  4PFI A;  4JVC A;  1RDX A;  1NV5 A;  5IGA A;  1OIB A;  4JBZ A;  1FPB A;  3OMB A;  4RNS A;  4FEC A;  2W7Y A;  5KZT A;  3PPQ A;  2E1S A;  1SVX B;  2QS2 A;  3MVX A;  3RUM A;  1FPF A;  2NWJ A;  3IOT A;  3SER A;  2HQ0 A;  4MNC A;  4F3S A;  4JSO A;  1R1N A;  1ZJL A;  1NL5 A;  4H8I A;  4IY6 A;  4G8M A;  2ZNT A;  3TEP A;  2I58 A;  1UIV A;  5H8H A;  1FPL A;  5CMK A;  3IB2 A;  3Q26 A;  4R2B A;  5A5X B;  4EDP A;  1USY E;  4DI3 D;  2OX3 A;  3KBR A;  2XX9 A;  2I49 A;  4I9D A;  3HPI A;  4N15 A;  2VPN A;  4OEV A;  4PFB A;  1Y20 A;  5DEX A;  4UAB A;  2OWZ A;  3LBS A;  3T22 A;  1NUX A;  1GR2 A;  2IEE A;  1N7X A;  1M5B A;  2F5X A;  3TAJ A;  3RLF E;  4OVQ A;  4P0I A;  2FA7 A;  1AWB A;  4GD5 A;  4H8J A;  2WKY A;  1MY0 A;  4POW A;  2RC9 A;  1SI0 A;  3TCH A;  4OFL A;  4NF8 B;  1MY1 A;  2WBD A;  5ET5 A;  4DCX A;  2V4C A;  3CFL A;  4HE2 A;  1QGX A;  4QSD A;  1FBF A;  3VXC A;  2V3T A;  1MM7 A;  4QSE A;  3ISP A;  3IJX B;  2HHM A;  1IMC A;  3KSX A;  3O9P A;  1MDQ A;  1IXI A;  2XXR A;  1MQJ A;  3ZS6 A;  1MY2 A;  4WED A;  4IO6 A;  3IO6 A;  2H5Y A;  3TCG A;  2XWV A;  2GHA A;  5I56 A;  1K9Z A;  3L6H A;  2ANJ A;  3FVK A;  3KJT A;  5FHO A;  4R73 A;  1B7U A;  4YMB A;  4OET A;  3QAX A;  3GXA A;  1H45 A;  3TTR A;  4KI0 E;  2NXO A;  2DE3 A;  1LBX A;  3W9W A;  1B3H A;  3KOT A;  3MZ1 A;  2CEX A;  4NF5 B;  3L6G A;  3B6Q A;  3IL1 B;  5IZ1 A;  2DWJ A;  3FV2 A;  4IGR A;  3M3F A;  4QHQ A;  1MQH A;  1ZU0 A;  2HAU A;  2HPG A;  4RK2 A;  5J1D A;  2H4I A;  3PUY E;  1A40 A;  5HBC A;  1QKA A;  1FQD A;  5KCJ A;  3LC8 A;  4M1V A;  3TQW A;  1XVX A;  1PB9 A;  1N3W A;  1UTH B;  2P3N A;  1A55 A;  3CHG A;  4C0R A;  5LOM A;  2D5W A;  4HE0 A;  1NNP A;  3E13 X;  3G3H A;  2D3I A;  1QVS A;  2REJ A;  4IO3 A;  3CFZ A;  1MQG A;  4NAP A;  5T3J A;  1NMU A;  3BKI B;  1XC1 A;  4WEP A;  4OER A;  5CRY A;  2QRY A;  4TOZ A;  3KJ7 A;  1B3G A;  3MVZ A;  1URS A;  3JV9 A;  4AB5 A;  4Z7E A;  2OZZ A;  3USD A;  1MPC A;  4EQ7 A;  3S4U A;  4QXD A;  5H8N A;  4GX3 A;  3TCF A;  3FVO A;  4F2O A;  1ZTY A;  5AA1 A;  2XXX A;  4KYD A;  2CZL A;  4U1O A;  3TYH A;  4NF6 B;  1Z7M E;  1S9T A;  4ZE9 A;  2X7P A;  2VPO A;  1IMF A;  5I57 B;  2Q88 A;  2PMS A;  4C1T A;  2KR0 A;  1HSL A;  4LQ5 A;  4XIG Q;  3N6U A;  1BK4 A;  4P1L A;  1B51 A;  1Q35 A;  2ONR A;  3PD8 A;  2XHD A;  4NG7 A;  3SZP A;  1AH5 A;  1IXG A;  2P3V A;  1EZO A;  4DE8 A;  4AB6 A;  1G0H A;  1JW5 A;  1B46 A;  3IO4 A;  5JK4 A;  3SEU A;  4I1D A;  3PMW A;  4N13 A;  3CVG A;  4ZEC A;  1KA0 A;  4PDD A;  2MKZ A;  4Q8R A;  1ZKB A;  2KQZ A;  3UGW A;  5I2N A;  2RC8 A;  5ET8 A;  1B5I A;  5DT6 A;  4R6H A;  5JEI A;  4H6D A;  2O6A A;  4F1U A;  5DVF A;  4X1D A;  3IX1 A;  3HHG A;  1DK4 A;  1Q9D A;  1II5 A;  3EHT A;  2PX1 A;  1VFE A;  3PUV E;  2Y7K A;  1FTA A;  4IO5 A;  4PGN A;  1LBY A;  1N76 A;  3SEY A;  3QIM A;  1YYZ A;  1WDN A;  3MWB A;  1KWH A;  3ONM A;  5TP9 B;  2JJK A;  1MQI A;  4OAN A;  4IR8 A;  5ITO A;  3B6T A;  2HEU A;  2AL4 A;  1LBB A;  1B7H A;  1NH8 A;  2O7U A;  4HCW A;  4O94 A;  3VVF A;  1PBQ A;  4LP2 B;  3ECR A;  3RPW A;  2DVZ A;  1IMD A;  3BFT A;  3MST A;  3C34 A;  1NUZ A;  1UQW A;  3H03 A;  3MPK A;  3WAE A;  4LVQ A;  4PFR A;  1UTB B;  2QVR A;  2Q2A A;  2NVU B;  4LON B;  4FED A;  4R6K A;  3OO6 A;  5KDT B;  1UTB A;  3H06 B;  3K6U A;  1VE4 A;  3O6H A;  5CBR A;  1FTO A;  4NF6 A;  3TQL A;  2E0S A;  3MYU A;  5I2K A;  3BIH A;  2Q2C A;  1NV0 A;  5B70 A;  1R6Z A;  3T66 A;  5AA2 B;  3H6U A;  4P56 A;  4LUB A;  3HO7 A;  4HCY A;  1KZ8 A;  2HXR A;  3ZKK A;  5IKB A;  4F29 A;  4G8N A;  5AA2 A;  3DEL B;  1H3D A;  1GVC A;  2F35 A;  2PT2 A;  2QSX A;  4IO7 A;  2CMO A;  1FTM A;  4H5G A;  3RYD A;  4QF9 A;  4DZ1 A;  2RF1 A;  2A5T B;  4GX4 A;  1LFI A;  4G8H A;  4MBP A;  3R7X A;  5K2Y A;  1SW5 A;  4MEV A;  3O2A A;  1I6A A;  3E4R A;  5F1Q A;  4F1Y A;  4R9F A;  4YIC A;  2Y7R A;  2PVU A;  4KCC A;  4OQO A;  2QMX A;  3ZKL A;  2FIX A;  5FHN A;  4IO4 A;  1H44 A;  4R2F A;  2WYK A;  3B7D A;  1JVY A;  3VLU A;  3SES A;  1WVJ A;  2GFE A;  4PCD A;  3V5A A;  2RCA A;  4PAF A;  3N6T A;  2QPQ A;  1PB7 A;  4UAC A;  2Z8E A;  3SEV A;  4AQ4 A;  1FBE A;  3CFX A;  5BWJ A;  3EKI A;  1IME A;  1SD3 A;  4N17 A;  1Y3Q A;  3KBZ A;  5DVI A;  1AMF A;  1Y1M A;  4Q30 B;  3K02 A;  5I3S A;  3TFL A;  3VE1 B;  3C35 A;  2OK2 A;  2F36 A;  1I69 A;  3BFU A;  4PBQ A;  1MXV A;  1Y4T A;  4GRK A;  1D9Q A;  4YAH X;  2DE4 A;  1M5E A;  4HS7 A;  1DTZ A;  4PAI A;  3BBR A;  1YXI A;  3BIG A;  3T9H B;  5JTY A;  1MG1 A;  4FEB A;  2NUV A;  4H5F A;  3RN8 A;  2V84 A;  2CEY A;  1ANF A;  4LZ7 A;  3U8Q A;  3IOV A;  3RY3 A;  3DP6 A;  2ZNU A;  1MPB A;  2GRV A;  5L9O A;  3TMG A;  5A5X A;  2PYY A;  4BDO A;  2XD2 A;  3OXN A;  4JWO A;  4FE8 A;  1JQF A;  3PPO A;  4MMP A;  4I3E A;  2Z8F A;  1FJ9 A;  3RTF B;  4OVS A;  2VOZ A;  1EYK A;  5H8Q B;  2XXP A;  2XXQ A;  4GLI A;  5I5P A;  3LSL A;  1FQF A;  1FBP A;  5KDT A;  4NF4 A;  3CG3 A;  5AE4 A;  1N04 A;  4GFR A;  1ZBM A;  1MRP A;  1LLS A;  2I4C A;  4KQP A;  4GWZ A;  4OVT A;  4BLA A;  2REG A;  3IK6 B;  5EQ7 A;  4OFJ A;  4P3L A;  2Y7P A;  2AL5 A;  2XD3 A;  2ALU A;  5CM6 A;  2AIX A;  1LB8 A;  4F22 A;  3VFJ A;  4C1U A;  3U93 A;  4R72 A;  2XWO A;  2BJI A;  1LAH E;  1VSO A;  2OWT A;  1NNF A;  1US5 A;  4MLQ A;  1PBP A;  4ZED A;  5EYH A;  3KG2 A;  4GL8 A;  5I58 B;  1MQD A;  1FCK A;  4MFI A;  1QUL A;  3GYY A;  1SW4 A;  4YKI A;  4G61 A;  3EN3 A;  2ZZW A;  4H1X A;  4FBP A;  2Z22 A;  2F7A A;  3ILU B;  4MLV A;  3MJN A;  3CSG A;  1QUJ A;  4R9G A;  1UIU A;  1B40 A;  2HAV A;  3ZSF A;  3LUZ A;  1BLF A;  2FBP A;  5B7D A;  2CZI A;  3THI A;  5I2N B;  1FRP A;  3EHS A;  3T0J A;  2OCU A;  2L5V A;  4P9K A;  1Y4C A;  4PE3 A;  5FBP A;  5TPA B;  3FIR A;  3QUJ A;  1A99 A;  5ICT A;  1NI9 A;  3QYT A;  1MY3 A;  3FXU A;  1YAE A;  3UP9 A;  1EZ9 A;  5F24 A;  3RNN A;  5H8F B;  1NV1 A;  2B4L A;  4ZDM A;  4OHN A;  3NOH A;  4KHZ E;  4AS5 A;  3VDF A;  1QW0 A;  3HCQ A;  1P99 A;  2V93 A;  2F3D A;  2O84 X;  3W9V A;  2I48 A;  5TP9 A;  3PPP A;  5EHS A;  1B5H A;  1H76 A;  4KYE A;  3FJM A;  1SBP A;  1HSJ A;  3MBP A;  1LB9 A;  4GWS A;  2Q8J A;  2ONS A;  4EXL A;  4NTL A;  1IZ1 A;  1B52 A;  2H9B A;  1Q1K A;  3DP8 A;  2P0S A;  4U22 A;  4NF4 B;  4U1Z A;  1LFG A;  2B65 A;  1NNT A;  5AA4 B;  1T0K A;  2WX9 A;  1D9V A;  4UA8 A;  1SI1 A;  2XX7 A;  1PEB A;  3G3F A;  3DP4 A;  1MPD A;  1S7Y A;  3HFU A;  3OEL A;  4MCO A;  3KEI A;  2X26 A;  2ONK E;  1XOC A;  1MY4 A;  3K1N A;  2I0B A;  1P1Q A;  5H8Q A;  2DSF A;  3PD9 A;  4GX6 A;  1JW4 A;  2WYP A;  4U2R A;  4IY5 A;  4BDR A;  1LST A;  2HCA A;  1TFD A;  2GHB A;  4G68 A;  4I8C A;  1R9L A;  5LDZ A;  2H98 A;  3C33 A;  3C31 A;  3G3J A;  1CNQ A;  4Z0I A;  3MW0 A;  1LBZ A;  2F78 A;  1DBZ A;  1FPG A;  2V3U A;  4OA4 A;  5H8N B;  3VVE A;  2O1M A;  4FOR A;  3QXM A;  1YTV A;  4P1E A;  1ATG A;  4GXA A;  3VXB A;  4LN5 A;  1RYO A;  3G3I A;  4P8B A;  4YKJ A;  3VV5 A;  1SYI A;  1S50 A;  3V89 B;  2I4B A;  2HFB A;  5DYH A;  3UN6 A;  4IB2 A;  3GBB A;  4QFK A;  1QUK A;  4P0G A;  3H4Z A;  1OQG A;  4O7M A;  2AYS A;  4HXV A;  4ZZA A;  1QKB A;  4OYV A;  1MXW A;  4YB5 A;  4N07 A;  2DXY A;  4KR5 A;  4KXP A;  2XWK A;  3OO8 A;  2FHY A;  5I58 A;  4MH5 A;  2A5T A;  3LSF B;  3Q28 A;  3K4U A;  1MH3 A;  3S9E A;  4OTE A;  2ZNS A;  3SDF A;  1F9B A;  4MHF A;  2A5S A;  4QFL A;  2R9J A;  1US4 A;  3HN0 A;  2NOO A;  4ISU A;  3LR1 A;  2QS4 A;  4OFO A;  4BDM A;  1DTG A;  4YB7 A;  2UXA A;  4NF5 A;  4NWC A;  4ELR A;  5TU0 A;  4N6D A;  1NV4 A;  2Q8M A;  1ELJ A;  1LAX A;  3I3V A;  1EU8 A;  4F19 A;  4X04 A;  1TWY A;  3O6I A;  3C36 A;  1OQH A;  3OOA A;  5ITP A;  5J16 A;  2P1S A;  1NNK A;  2I3W A;  2R6G E;  1A8E A;  4DDD A;  4GL0 A;  1FQB A;  4WXJ A;  5DVJ A;  1D4N A;  1JET A;  2ESN A;  4XF5 A;  5AA4 A;  4PDH A;  4GWY A;  1H43 A;  3GBA A;  4GWW A;  4OVJ A;  3PUZ E;  4X1B A;  3OO7 A;  4GBV A;  3H7M A;  4PAK A;  3PPN A;  3UOR A;  2PBW A;  4YKK A;  4MJO A;  1DMB A;  5ISU A;  3S9M C;  4OEN A;  4GQO A;  3E79 A;  3C9H A;  3SET A;  1LBC A;  5DEX B;  4PET A;  2H25 A;  2FVZ A;  1YPN A;  3R6U A;  2ZYO A;  3ILT B;  3T9U A;  3KN3 A;  1FPD A;  4H46 A;  4GXS B;  1LGB C;  4ESW A;  3Q29 A;  1UTH A;  2PFZ A;  3IJO B;  2QL3 A;  3PGF A;  5HPQ A;  1IXC A;  1MXU A;  4EQ9 A;  1ZMG A;  3D4G A;  1GGG A;  5IZZ A;  1IMB A;  2ZZV A;  3FBP A;  3PU5 A;  4XKR A;  1XHY A;  3AXF A;  3K1M A;  3OEK A;  2V3Q A;  3CI8 A;  1QJM A;  2V25 A;  3MP1 A;  4P47 A;  2XXY A;  4ELP A;  3T1B A;  5I59 B;  5ICQ A;  5EYG A; 
#chains in the Genus database with same CATH homology
 2NUV A;  4H5F A;  5H8Q B;  4QSD A;  5CMC A;  3RN8 A;  2V84 A;  3VXC A;  1P1O A;  2V3T A;  1ANF A;  1ZIU A;  4DXB A;  4LZ7 A;  1IIW A;  1MM7 A;  4QSE A;  3U8Q A;  3IOV A;  3IJX B;  3RY3 A;  3DP6 A;  2ZNU A;  4JSD A;  1LAF E;  1MPB A;  4JWX A;  3KSX A;  2XX8 A;  2GRV A;  3A09 A;  3QUF A;  5L9O A;  3O9P A;  4IO2 A;  1MDQ A;  4TLL B;  3UA8 A;  3TMG A;  5A5X A;  4GOT A;  1IXI A;  2PYY A;  2XXR A;  1MQJ A;  2XD2 A;  3ZS6 A;  4BDO A;  4F2Q A;  1MY2 A;  3MUQ A;  3DM0 A;  3OXN A;  4JWO A;  2DS9 A;  4TQU Q;  2Q89 A;  4WED A;  5ELV A;  5FTI A;  3WAF A;  4FE8 A;  1JQF A;  4DXC A;  3U94 A;  3N26 A;  4NE4 A;  4IO6 A;  3IO6 A;  3PPO A;  5H8H B;  2H5Y A;  4RK9 A;  5TP9 A;  3TCG A;  5I84 A;  2GHA A;  5I56 A;  5HM4 B;  3CR9 A;  2Z8F A;  1DPE A;  5AA3 A;  3EF7 A;  5L9M A;  5I59 A;  4NED A;  4XXU A;  3L6H A;  4IGT A;  5L9S A;  4F3B A;  4H67 A;  2ANJ A;  4OES A;  2O1L A;  3RTF B;  4KCD A;  1B3E A;  3C32 A;  2QS3 A;  2VOZ A;  2HZL A;  1PC3 A;  4QFO A;  1VFD A;  3FVK A;  2XXP A;  1D9Y A;  2B3F A;  3MQ9 A;  2ZYM A;  2XXQ A;  3KJT A;  3PMV A;  4G68 C;  3QSL A;  4KFQ A;  4JWY A;  3VLW A;  1GV8 A;  2UYF A;  2XXV A;  4GLI A;  3LSL A;  1FQF A;  5FHO A;  3OEM A;  4R73 A;  4DCY A;  1AL3 A;  1B7U A;  3MVY A;  5KDT A;  1AIV A;  2LAO A;  3SEW A;  2Y7I A;  4OET A;  3TTL A;  4NF4 A;  3CG3 A;  4F39 A;  4FAT A;  2VGQ A;  4YMB A;  2UVI A;  3GXA A;  1B7Z A;  1H45 A;  3QAX A;  1MXX A;  2VHA A;  4MF3 A;  1VR5 A;  4E0X A;  4FAJ A;  3TTR A;  4YMA A;  4KI0 E;  3I5O A;  2NXO A;  3PMX A;  1N04 A;  1N0T A;  2DE3 A;  1B2H A;  1B5J A;  4FJP A;  4U21 A;  2ZYN A;  4GFR A;  3W9W A;  1QUI A;  1ZBM A;  1MRP A;  2O68 A;  1B3F A;  1B6H A;  2F7B A;  3K6W A;  1B3H A;  1XVY A;  3KOT A;  3MZ1 A;  4KPT A;  4ZE8 A;  4H65 A;  1FTJ A;  4ZS9 A;  3W15 C;  3T96 B;  1LLS A;  1IQ7 A;  2I4C A;  4NF5 B;  1WOD A;  2D21 A;  2I3V A;  2OLB A;  3L6G A;  4KQP A;  1MH4 A;  3B6Q A;  3IL1 B;  4PE5 B;  3K6V A;  5F7V A;  1M5C A;  4BLA A;  2DWJ A;  2YLN A;  2REG A;  1PDA A;  3FV2 A;  3IK6 B;  3UIF A;  4OFJ A;  2G29 A;  4IGR A;  2FYI A;  4ND9 A;  4POX A;  3O66 A;  1N84 A;  2AL5 A;  2Y7P A;  2XD3 A;  3M3F A;  3FVN A;  3MC2 A;  2ALU A;  4QHQ A;  5CM6 A;  2UVH A;  3VLV A;  1MM6 A;  1MQH A;  2ZYK A;  2AIX A;  1P1U A;  3Q27 A;  1ZU0 A;  2HAU A;  4O3C A;  3U72 A;  1LB8 A;  4ZE9 A;  4F22 A;  1LCF A;  3VFJ A;  4C1U A;  3UK4 A;  3U93 A;  4R72 A;  3SKP A;  4RK2 A;  5J1D A;  2H4I A;  4XTC Q;  3PUY E;  1A40 A;  1B3L A;  4P11 A;  3IB0 A;  4KYS A;  1N3X A;  3M8U A;  1FQA A;  4U4S A;  5HBC A;  1LAH E;  3H3G A;  3K1P A;  1VSO A;  1PB8 A;  2OWT A;  1NNF A;  1US5 A;  3K6X A;  4OMB A;  1L5T A;  1DSN A;  1FQD A;  1QKA A;  3A3U A;  4MLQ A;  1PBP A;  4LA9 A;  4ZED A;  3HHF A;  1R9Q A;  3LC8 A;  4M1V A;  3TQW A;  4K3F A;  4U4X A;  1XVX A;  4EQB A;  1PB9 A;  1N3W A;  1B05 A;  3LSX A;  1UTH B;  4RJZ A;  5EYF A;  3TTN A;  4DXU A;  1M5D A;  2DWA A;  1A55 A;  3KG2 A;  4GL8 A;  4YZZ A;  5I58 B;  3RQT A;  1MQD A;  4C0R A;  1FCK A;  3IOW A;  4MFI A;  5CMM A;  1QUL A;  2D5W A;  3S2V A;  5LOM A;  1NNP A;  3E13 X;  4QRZ A;  1SW4 A;  2D3I A;  1IUD A;  1QVS A;  2REJ A;  2XXU A;  3G3H A;  3G3K A;  4IO3 A;  2XXW A;  1I6B A;  4YKI A;  1LAG E;  3CFZ A;  2OBG A;  1MQG A;  1Y3P A;  3EN3 A;  2UYE A;  4ONY A;  1NMU A;  3BKI B;  4H1X A;  4HTG A;  3Q25 A;  2QS1 A;  2F7A A;  1B0L A;  2Z22 A;  2RC7 A;  3ILU B;  4MLV A;  1XC1 A;  4WEP A;  3MJN A;  4OER A;  3CSG A;  3N94 A;  5CRY A;  2QJE A;  3K01 A;  5H8S A;  1DPP A;  1QUJ A;  4R9G A;  1B1H A;  1UIU A;  4EXK A;  4F3P A;  1B40 A;  2HAV A;  4RYA A;  2QRY A;  4DLD A;  1EZO A;  4TLM B;  3ZSF A;  1BLF A;  5B7D A;  3THI A;  2O69 A;  4LZ8 A;  4TOZ A;  5I2N B;  2Z8D A;  3KJ7 A;  3ODB A;  1B3G A;  3FZV A;  2Y7W A;  3EHS A;  1MXY A;  4R6Y A;  2RKM A;  2OCU A;  3TDJ A;  3MVZ A;  1URS A;  3JV9 A;  3K2D A;  4NWD A;  3I6V A;  1Y4C A;  4KD5 A;  2F6G A;  1A54 A;  2VD2 A;  1BP5 A;  3OSR A;  2YPN A;  4AB5 A;  5TPA B;  1XS5 A;  3FIR A;  3S9L C;  3QUJ A;  4WKM A;  4LZ5 A;  3TKD A;  1A99 A;  4Z7E A;  2OZZ A;  5ICT A;  3QYT A;  3USD A;  1MY3 A;  1MPC A;  3FXU A;  1YAE A;  4BDQ A;  4DIG A;  5AE4 A;  3UP9 A;  4EQ7 A;  4NMY A;  1IIT A;  5TPA A;  2BJJ X;  3S4U A;  1EZ9 A;  5H8N A;  4ZZE A;  3RNN A;  3TOD A;  5H8F B;  3TCF A;  3FVO A;  4F2O A;  4GIZ A;  1B9J A;  3MZ9 A;  3T9V A;  1IXH A;  3MAM A;  4Q5T A;  1ZTY A;  5AA1 A;  2XXX A;  4ZDM A;  1A8F A;  3PUW E;  4OHN A;  1M5F A;  3N5L A;  4KHZ E;  3KN7 A;  4O3A A;  4KYD A;  2CZL A;  4U1O A;  3VDF A;  2HZK A;  1QW0 A;  3TYH A;  4ELO A;  4NF6 B;  1JEV A;  2DP8 A;  3R26 A;  2OWS A;  4I62 A;  3HCQ A;  1P99 A;  2V93 A;  3FVG A;  2O84 X;  3W9V A;  1B1X A;  4ZEB A;  3MP8 A;  1Z7M E;  2I48 A;  3PPP A;  5EHS A;  1B5H A;  1S9T A;  1Z7N E;  1H76 A;  2X7P A;  3KFM A;  4KYE A;  3FJG A;  1OVB A;  3M3K A;  3FJM A;  1SBP A;  1FW0 A;  1HSJ A;  1FTK A;  1LB9 A;  3FJ7 A;  3MBP A;  2Q8J A;  3TEL A;  2ONS A;  4EXL A;  5KCJ B;  2P2A A;  2B3B A;  3H6V A;  4G2Z A;  4NTL A;  1IZ1 A;  1GTK A;  2Q88 A;  5I57 B;  1B52 A;  1JEU A;  2DYX A;  2PMS A;  3C4M A;  2H9B A;  1Q1K A;  1Y1Z A;  4C1T A;  4BDN A;  3DP8 A;  3KSJ A;  3LUY A;  5CC2 A;  2P0S A;  4ZEI A;  5CI5 A;  4N6P A;  4U22 A;  4NF4 B;  1HSL A;  5K2X A;  4U1Z A;  4LQ5 A;  3FD3 A;  1LFG A;  2B65 A;  4XIG Q;  1SYH A;  2RIN A;  4G4P A;  4L17 A;  4THI A;  1NNT A;  3MP6 A;  3N6U A;  2I0C A;  2UVG A;  5AA4 B;  1B51 A;  1Q35 A;  4PP0 A;  1T0K A;  3RT6 B;  1RYX A;  1D9V A;  2ONR A;  4UA8 A;  4ESX A;  1P1N A;  3PD8 A;  1YCJ A;  2XHD A;  3G3G A;  3LSW A;  3O29 A;  1AH5 A;  1SI1 A;  2XX7 A;  1IXG A;  1OVT A;  3QK6 A;  1PEB A;  1MS7 A;  3FV1 A;  4RPO A;  3G3F A;  1BTJ A;  2GH9 A;  3DP4 A;  4AB6 A;  4DE8 A;  5FHM A;  3K0V A;  1MPD A;  1S7Y A;  5JTY B;  4LQ2 A;  1JW5 A;  1B46 A;  1O64 A;  2Y84 A;  2DVC A;  3E9X A;  3MPL A;  3OEL A;  4RA1 A;  3IO4 A;  3KEI A;  2RCB A;  2X26 A;  3RT8 A;  2I6E A;  1XOC A;  1MY4 A;  1URD A;  2ONK E;  3K1N A;  5JK4 A;  2I0B A;  1P1Q A;  3CG1 A;  3SEU A;  2F8D A;  4I1D A;  2F34 A;  3U92 A;  3KGC A;  4YKP A;  5H8Q A;  1DOT A;  3PMW A;  4ELQ A;  1SW2 A;  3MVW A;  5BUU A;  2DSF A;  3CVG A;  3PV0 E;  4N13 A;  4ZEC A;  3PD9 A;  4X9T A;  4Q8R A;  1ZKB A;  3UGW A;  1XT8 A;  1JW4 A;  3FAT A;  3H6T A;  5I2N A;  2RC8 A;  3MZB A;  4U2R A;  1B5I A;  4IY5 A;  3M3L A;  3TUS A;  1NH7 A;  5DT6 A;  4BDR A;  1LST A;  4R6H A;  2HCA A;  1TFD A;  2GHB A;  3E3K A;  4G68 A;  5JEI A;  2DE2 A;  4I8C A;  3P7I A;  1R9L A;  3FGS A;  4H6D A;  3EPE A;  2O6A A;  2UVJ A;  4R75 A;  4F1U A;  3A3C A;  3K00 A;  1CE2 A;  2H98 A;  3C33 A;  3C31 A;  3G3J A;  4X1D A;  5DVF A;  2F7C A;  3IX1 A;  4JDF A;  4Z0I A;  3HHG A;  3OO9 A;  1JNF A;  3MW0 A;  4H0W A;  5CBS A;  1I6Q A;  1II5 A;  2F78 A;  3EHT A;  1TXF A;  4LAT A;  2PX1 A;  5I56 B;  1VFE A;  3IB1 A;  3PUV E;  1BIY A;  1A7L A;  2V3U A;  1N7W A;  2Y7K A;  1O7T A;  4IO5 A;  1SDX A;  3FXR A;  1P1W A;  4F3G A;  5I57 A;  3S9N C;  4F1V A;  5H8N B;  4RY1 A;  2Q9T A;  5DTB A;  1N76 A;  3SEY A;  3QIM A;  3TTK A;  3VVE A;  2O1M A;  1WDN A;  4PQJ A;  3TPA A;  2FNC A;  4FOR A;  1FTL A;  3GLB A;  3MWB A;  3QXM A;  1YTV A;  1KWH A;  3ONM A;  5TP9 B;  4G68 B;  3IR1 A;  1JVX A;  1ATG A;  4PFT A;  4GXA A;  4HW8 A;  3VXB A;  2DWH A;  2F6P A;  1RYO A;  3CSB A;  2XXH A;  3G3I A;  1MQI A;  3O28 A;  3O6G A;  4OEU A;  2HXW A;  4ZEF A;  4YKJ A;  5ITO A;  1FQE A;  3B6T A;  3VV5 A;  1SYI A;  1S50 A;  3OD7 A;  4GVO A;  1B58 A;  2HEU A;  4PFU A;  2AL4 A;  1LBB A;  1B7H A;  1NH8 A;  2ABH A;  2O7U A;  2I4B A;  1POT A;  1PBQ A;  4HCW A;  4OXV A;  3VVF A;  2HFB A;  4LP2 B;  5DYH A;  3ECR A;  3GZG A;  1JW1 A;  3B6W A;  3PPR A;  2DVZ A;  4IB2 A;  3RPW A;  3BFT A;  2PT1 A;  3UN6 A;  3C34 A;  3RGY A;  1EH3 A;  1UQW A;  3H03 A;  3MPK A;  3CIJ A;  4LVQ A;  3WAE A;  4BDL A;  1UTB B;  4GF8 A;  2ZXT A;  3IOU A;  1MDP 1;  3JZJ A;  2Q2A A;  1QUK A;  1TFA A;  4P0G A;  4QFK A;  3JYR A;  1NFT A;  1OLA A;  3KZG A;  2NVU B;  4LON B;  4EF2 A;  4FED A;  3H4Z A;  1OQG A;  2DXR A;  2AYS A;  3OO6 A;  4R6K A;  1URG A;  3DLN A;  4YB6 A;  1QKB A;  3D4C A;  1D3K A;  4OYV A;  4ZZA A;  5KDT B;  1UTB A;  3H06 B;  1MXW A;  1VE4 A;  3K6U A;  3O6H A;  4YB5 A;  5CBR A;  1FTO A;  2DXY A;  3PUX E;  2DWI A;  4N07 A;  2E0S A;  4NF8 A;  1Y9U A;  4NF6 A;  4YU0 A;  4KR5 A;  3TQL A;  5I2K A;  4XKQ A;  2Q2C A;  4RXL A;  5B70 A;  3OO8 A;  4Q0C A;  2VP1 A;  1R6Z A;  3T66 A;  4EF1 A;  3F11 A;  4OZ9 A;  5FTH A;  1B4Z A;  1BKA A;  3HST A;  3HV1 A;  5AA2 B;  2ZMB A;  2DQV A;  4MH5 A;  5I58 A;  3VVD A;  3H6U A;  2A5T A;  2DOJ A;  5ITP A;  3OEN A;  4QSC A;  3EQ1 A;  3LSF B;  3Q28 A;  4FIM A;  4LUB A;  4U23 A;  3K4U A;  3V8X B;  3HO7 A;  1HSE A;  1MH3 A;  1EZP A;  4GWO A;  3S9E A;  3TZA A;  4HCY A;  4G77 A;  4OTE A;  3H6W A;  4OWD A;  1USY H;  2ZNS A;  3SDF A;  1F9B A;  3ZKK A;  1IEJ A;  5IKB A;  4PFY A;  4RPN A;  4XKN A;  2A5S A;  4QFL A;  3U1O A;  4G8N A;  4F29 A;  5AA2 A;  3DEL B;  2R9J A;  1SW1 A;  1US4 A;  3HN0 A;  2NOO A;  1RKM A;  1H3D A;  3LR1 A;  4ISU A;  3OSQ A;  2QS4 A;  4OFO A;  1GVC A;  2F35 A;  2PT2 A;  4BDM A;  5ICQ A;  2QSX A;  3IAZ A;  1DTG A;  1OIB A;  4IO7 A;  3SEX A;  2XXT A;  4JBZ A;  4YB7 A;  2UXA A;  2CMO A;  1FTM A;  4NF5 A;  3OMB A;  4H5G A;  4RNS A;  4FEC A;  4NWC A;  2G93 A;  2W7Y A;  4QF9 A;  2RF1 A;  3FUZ A;  2A5T B;  3O97 A;  4DZ1 A;  5KZT A;  1LFI A;  2IA4 A;  3PPQ A;  4G8H A;  4MBP A;  5AA2 D;  3R7X A;  2E1S A;  4QFN A;  5K2Y A;  1SVX B;  5TU0 A;  4ELR A;  4F31 B;  4JXI A;  4F18 A;  2QS2 A;  1ELJ A;  1LAX A;  1SW5 A;  4E0W A;  3MVX A;  3I3V A;  3RUM A;  3O2A A;  1EU8 A;  1I6A A;  3E4R A;  5F1Q A;  2NWJ A;  4R9F A;  4F19 A;  4F1Y A;  3IOT A;  1TWY A;  4YIC A;  4QFP A;  3SER A;  2KLF A;  2Y7R A;  2HQ0 A;  2PVU A;  1FQC A;  1OQH A;  3C36 A;  3KOS A;  3O6I A;  3OOA A;  4KCC A;  2P1S A;  4OQO A;  4R74 A;  2QMX A;  4JSO A;  4XKP A;  4ZEK A;  5L8D A;  4F3S A;  3KN8 A;  1NNK A;  1R1N A;  3ZKL A;  1ZJL A;  1J1N A;  2I3W A;  2M8C A;  2R6G E;  5FHN A;  1A8E A;  1NL5 A;  4DDD A;  4IO4 A;  4GL0 A;  1H44 A;  1FQB A;  4R2F A;  4WXJ A;  5DVJ A;  4H8I A;  1D4N A;  1JET A;  3CRB A;  2ESN A;  3TTM A;  5M2V A;  4IY6 A;  5AA4 A;  2O7I A;  1B4H A;  4G8M A;  3B7D A;  1JVY A;  4X48 A;  2ZNT A;  3IOR A;  3VLU A;  3TEP A;  3SES A;  1WVJ A;  2GFE A;  1H43 A;  1LCT A;  3GBA A;  2RCA A;  3V5A A;  3N6T A;  4OVJ A;  1POY 1;  3PUZ E;  2QPQ A;  4X1B A;  3OO7 A;  4ECF A;  1NKX A;  1PB7 A;  4UAC A;  2I58 A;  3H7M A;  1CB6 A;  3FXQ A;  3PPN A;  3UOR A;  1OLC A;  1Y3N A;  2PBW A;  1B32 A;  1UIV A;  1O63 A;  2YJP A;  4YKK A;  2Z8E A;  5H8H A;  1DMB A;  5CMK A;  3IB2 A;  5ISU A;  3Q26 A;  4R2B A;  3SEV A;  3S9M C;  4OEN A;  4GQO A;  5A5X B;  5KCJ A;  4AQ4 A;  4EDP A;  1USY E;  3C9H A;  4JB7 A;  3SET A;  3CFX A;  3KBR A;  2XX9 A;  2I49 A;  1OMP A;  1LBC A;  4I9D A;  5DEX B;  4PET A;  5BWJ A;  2H25 A;  4M4G A;  3HPI A;  3T9X B;  2O51 A;  1YPN A;  1SD3 A;  2QMW A;  3R6U A;  4OEV A;  2THI A;  1TT1 A;  1B0H A;  2Z23 A;  2ZYO A;  3ILT B;  1Y20 A;  1Y3Q A;  2OJT A;  5DEX A;  5H8F A;  3T9U A;  3T93 B;  3KN3 A;  5EHM A;  5DVI A;  4GXS B;  1AMF A;  1LGB C;  1Y1M A;  4Q30 B;  4ESW A;  3K02 A;  3Q29 A;  1UTH A;  2VD3 A;  4EUO A;  5IAI A;  2XXI A;  1LFH A;  3TFL A;  3LBS A;  3T22 A;  1AOV A;  1GR2 A;  2IEE A;  3IJO B;  1N7X A;  2QL3 A;  3PGF A;  5CMB A;  3VE1 B;  5HPQ A;  3V83 A;  3C35 A;  1M5B A;  2F5X A;  2OK2 A;  3TAJ A;  1IXC A;  2F36 A;  1I69 A;  3RLF E;  1MXZ A;  3BFU A;  4O3B A;  2FA7 A;  4P0I A;  1MXU A;  1MXV A;  1Y4T A;  4GRK A;  4EQ9 A;  3G7W A;  1ZMG A;  3D4G A;  1GGG A;  1ZLQ A;  4GD5 A;  4H8J A;  4YAH X;  2DE4 A;  2WKY A;  1MY0 A;  4POW A;  3PU5 A;  4XKR A;  1M5E A;  2RC9 A;  1XHY A;  4HS7 A;  4PFW A;  1SI0 A;  1DTZ A;  3FAS A;  3RTW B;  3TCH A;  4OFL A;  3AXF A;  3K1M A;  3EHU A;  3OEK A;  4NF8 B;  1MY1 A;  5I2K B;  3V89 B;  4DCX A;  3BBR A;  2F97 A;  2V3Q A;  3CI8 A;  1QJM A;  2V25 A;  3MP1 A;  4ELP A;  2XXY A;  3CFL A;  2R71 A;  5I59 B;  2H99 A;  1SQY A;  3T9H B;  2X7Q A;  5JTY A;  1MG1 A;  4FEB A;  3GBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...