1QJMA

Crystal structure of a complex of lactoferrin with a lanthanide ion (sm3+) at 3.4 angstrom resolution
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lactoferrin-Metal Interactions: First Crystal Structure of a Complex of Lactoferrin with a Lanthanide Ion (Sm3+) at 3.4 Angstrom Resolution
pubmed doi rcsb
molecule tags Lactoferrin
molecule keywords LACTOFERRIN
total genus 211
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA03
1MY3A 1R9QA 2ALUA 1S9TA 3FV2A 1D9YA 3FVOA 3T9HB 4KYEA 5A5XB 3T66A 2Z8EA 4YMAA 3VVFA 2IA4A 5I2NB 3MUQA 4OEVA 3FVNA 5I2KA 1LFHA 2XXUA 1IEJA 1XOCA 2I48A 2YPNA 3PD9A 2NWJA 5DTBA 1ZMGA 3OO9A 4NF8A 1Z7NE 3T9UA 4HTGA 3KG2A 1HSEA 4GL0A 4QSCA 1FW0A 3KOTA 3TTLA 2E1SA 2DE3A 4ELPA 4ZE9A 5I58A 3M8UA 2QMXA 3H3GA 4EDPA 1OVBA 1OVTA 3VVEA 1QUJA 3PPNA 5H8HB 2V3QA 3MPLA 2M8CA 5DEXB 3FV1A 1LLSA 5DVIA 3IB2A 3BKIB 4I1DA 3N6UA 4KYDA 2W7YA 1POTA 3EHTA 3HHGA 4X1BA 2PYYA 4LUBA 1B6HA 2ONSA 3DLNA 3OO6A 5FHMA 4QFKA 3O66A 1KWHA 2RKMA 4IGRA 2F34A 3TCHA 4ZS9A 5HPQA 3T93B 2F8DA 1VSOA 4E0WA 1IITA 1P99A 3MWBA 4FEBA 4H65A 4EQ9A 4F3SA 3W15C 4G2ZA 2F7BA 2FNCA 3C36A 1IUDA 2XD3A 4JWYA 1MDP1 3ONMA 5EHSA 4E0XA 5DYHA 4G8NA 2BJJX 4OZ9A 3OO8A 2AIXA 4R72A 3SKPA 2F6GA 2GFEA 3EPEA 4FEDA 1LAFE 2I3WA 2XX8A 4QSDA 5H8FB 2XD2A 5H8QB 2XXIA 3O97A 2V84A 4F39A 4U2RA 1M5CA 1DSNA 2DXYA 2Q2AA 3QYTA 4WEDA 3M3LA 5AA2B 5CRYA 1WODA 5I59A 3B6WA 3OEMA 4K3FA 1NH7A 4U23A 3TUSA 2THIA 3FVGA 1B32A 2VD2A 3LBSA 2UXAA 1Y4CA 1R1NA 3TELA 1D4NA 5J1DA 5CMMA 4LZ5A 2O69A 3K6UA 3LSXA 3FJGA 1YCJA 1B51A 3CG1A 4WKMA 3VLUA 5L9OA 2I0BA 3RGYA 3FVKA 2A5TB 3E9XA 2IEEA 1UTHA 4LONB 5I84A 4PETA 1H76A 1A40A 2QMWA 1MM6A 4OENA 3E3KA 4KPTA 4QF9A 4QHQA 1EZ9A 4RPNA 4DXCA 5A5XA 2G29A 3V83A 1B52A 3KZGA 3RUMA 3PU5A 4R6YA 4EQ7A 3G3FA 1UTBA 3L6GA 1PB9A 2ZXTA 3CFLA 4NEDA 2O84X 4ZEFA 3SERA 4XKNA 1F9BA 2PX1A 3OELA 1GGGA 1BIYA 1YAEA 3C33A 1B1HA 1B3LA 3A3UA 3O6GA 1B3HA 4IO5A 4OVJA 3K6VA 1VR5A 1QUIA 3N94A 4H67A 4JB7A 4LA9A 2OWTA 4PFWA 4RXLA 5DVJA 2VGQA 5ICTA 1B5HA 3C4MA 4ZE8A 3WAFA 3VLVA 3N5LA 4XKQA 3GBBA 1WVJA 1AOVA 1JVYA 2XXHA 1SDXA 3CG3A 1QJMA 2ZNUA 2H98A 2Y84A 3B6QA 3K0VA 1LSTA 1NL5A 3KEIA 4KD5A 4R2FA 4YU0A 4Z7EA 2B3FA 4YICA 1H43A 4IO7A 4YKKA 5LOMA 3RPWA 1UTHB 3MW0A 5I58B 2HZLA 3PMXA 4R74A 5JTYA 1B9JA 2PBWA 1QVSA 3TDJA 1SI1A 2G93A 3O9PA 4H5GA 4ZEDA 2XXXA 5DVFA 4GRKA 3T96B 4HS7A 5CM6A 3AXFA 3K1MA 4EF1A 3PPQA 1Q35A 1IXHA 5K2XA 4THIA 1B0LA 4ZDMA 3QSLA 5ITOA 4F1VA 3E13X 5AA4A 2NUVA 1VFDA 2I58A 4ISUA 4U1OA 2QPQA 2F7AA 2GHBA 3RNNA 2DWAA 1MPCA 1N76A 1SW5A 4MLVA 4EQBA 3OSRA 3IORA 1VE4A 1Y3NA 4NF6B 3K00A 3K02A 3H06B 2XX7A 1FTOA 1B7HA 1MQJA 1A55A 1OIBA 1MRPA 4ND9A 2AL5A 2DSFA 2H25A 3HPIA 3Q28A 1Y20A 1EU8A 2DVCA 3B7DA 3IOTA 3QIMA 4OQOA 1US5A 3IR1A 2REJA 4PP0A 5I57A 2XXWA 3TEPA 5I59B 4ZZEA 4LQ5A 4R75A 4R2BA 2DWHA 1NNTA 1JNFA 1SYHA 1YPNA 3BBRA 4TLLB 3H4ZA 3TKDA 4BLAA 1PEBA 3O29A 3HHFA 3OEKA 4EUOA 4F18A 1N84A 5H8QA 1FCKA 1QUKA 1A54A 2PT2A 4RPOA 1YTVA 4TQUQ 3TTNA 4DXUA 2OK2A 4FECA 4OXVA 3IJXB 4MFIA 3RT6B 3TQLA 1QW0A 3S9MC 1LCFA 2DQVA 2A5TA 3JZJA 3O6IA 4OMBA 1MQGA 3PMWA 1FQBA 1O64A 3IK6B 1P1UA 1LAHE 3Q25A 2Z8FA 1USYE 1Q1KA 4KYSA 5CMBA 5I2KB 2X7PA 3KJTA 3PPOA 2HAVA 3ZSFA 2WKYA 1M5EA 3MP8A 4X9TA 1FQCA 2I0CA 2ESNA 3I3VA 4Q5TA 2D21A 1MY4A 1XT8A 2NXOA 3I6VA 2VP1A 2RC9A 1Y1MA 1MG1A 3IB1A 4X1DA 3EHUA 2I4BA 4LATA 1B3GA 4NF6A 5I2NA 4OWDA 1B58A 2ZYMA 1B5JA 3H6UA 4NF5A 4F19A 5TP9B 2I3VA 3HCQA 4O3AA 3QUJA 2OBGA 4GQOA 4R6KA 1N3WA 2ANJA 2H4IA 4BDRA 4Q8RA 2XXYA 3M3FA 3V5AA 1PBPA 1UQWA 1ZU0A 3Q27A 3D4CA 2AL4A 2RC8A 4I62A 2H5YA 2O68A 2X26A 1LGBC 2Y7RA 2HFBA 1S50A 2I4CA 3K2DA 3MP6A 4YKPA 3RQTA 4KFQA 3UORA 1P1WA 2AYSA 2CZLA 4OETA 5I56A 3MC2A 3O6HA 4LP2B 4YB5A 4C1TA 2B3BA 1T0KA 2Z8DA 5JTYB 1MXUA 3C9HA 3TAJA 3N26A 4RY1A 1FQEA 1RYOA 2HZKA 1I6AA 1JEVA 2F78A 4C1UA 2YJPA 3PUVE 1LB8A 3MVYA 1BKAA 1NMUA 4U22A 3LC8A 3KJ7A 4JWXA 4R73A 2ZYOA 1LFGA 3UP9A 1AH5A 1TT1A 2DS9A 2I49A 2Q2CA 2V3UA 3K01A 4RYAA 4FE8A 3VVDA 1R9LA 3O28A 1POY1 1OLAA 2OLBA 3MBPA 3TCFA 4G4PA 4GXAA 1Z7ME 2XXQA 4U21A 3LUYA 2XXPA 3R6UA 3SDFA 1MQIA 2F7CA 3U1OA 4IB2A 3MZ1A 1MXYA 5KDTA 1TWYA 4NF8B 1IIWA 1IXGA 4QSEA 4XXUA 4WEPA 1MXZA 2Q88A 4O3CA 4OFJA 3EN3A 4OERA 3KSXA 2R71A 2ZYKA 3FXUA 3G3HA 4F3BA 2H99A 3T9VA 1B2HA 2DOJA 3D4GA 3IJOB 3SEUA 3S9NC 5B7DA 4H5FA 3IL1B 2DE2A 3CR9A 2Q89A 1NNPA 1SYIA 3T9XB 1B4ZA 4Q30B 4GXSB 1FTMA 2PVUA 3DELB 3WAEA 1DMBA 2FA7A 5H8HA 1SI0A 3IAZA 1O63A 3VLWA 4DLDA 3G3GA 3S9LC 2O7IA 5KCJB 1M5DA 3CRBA 3ILUB 4U4SA 4JSDA 2QS4A 2DYXA 3PUWE 3K6WA 4N07A 5EYFA 5L8DA 3FGSA 3H03A 1ZIUA 4H8IA 4F3GA 4YB7A 3RTWB 1B5IA 3G3KA 1B4HA 4ONYA 3THIA 3UN6A 2CMOA 3FJ7A 3VFJA 4F1UA 5AE4A 4IO4A 2NVUB 1I6BA 4DCXA 1OQGA 1PB7A 1B1XA 2RCAA 2QS2A 5TU0A 5L9MA 3SEYA 4MH5A 1NKXA 3KGCA 5HBCA 3ILTB 4F2OA 1SW4A 1MY0A 2F5XA 3KN3A 4LQ2A 1MPBA 5AA2A 4QRZA 2OZZA 2HEUA 1XHYA 1SW1A 4PQJA 3T22A 1DPPA 1JW5A 3CIJA 1PB8A 2B65A 2PMSA 4TLMB 3JYRA 3U92A 1H3DA 2VD3A 4IY5A 3TZAA 2HAUA 2Q9TA 3VV5A 4FIMA 2Y7IA 4OTEA 4TOZA 1D9VA 1PDAA 3B6TA 3LSLA 2Y7KA 1URGA 2OWSA 3SETA 4OESA 4NWCA 2Y7PA 5CMKA 1QKAA 3V89B 3ZKKA 4I9DA 5BUUA 1A8EA 1FTJA 2UVIA 4NWDA 3IB0A 3MQ9A 4OEUA 1LBCA 3EHSA 5I56B 5JEIA 1LCTA 1FQFA 4G68B 4GFRA 1N7WA 4RK9A 1H45A 1WDNA 2XHDA 4NE4A 2H9BA 3VXCA 5AA3A 5FTHA 3MZ9A 2DP8A 1GVCA 4ESWA 4DCYA 4IGTA 3LSWA 3RT8A 3TQWA 4X48A 4BDOA 1USYH 4F1YA 4R9GA 4H6DA 3TMGA 3CFXA 5AA4B 3BFTA 4ZEKA 4JBZA 2UVJA 1L5TA 3R26A 5ELVA 4BDNA 5ITPA 5I57B 5IKBA 1A99A 1I6QA 1LB9A 3OSQA 3U72A 5AA2D 1BLFA 3KN8A 1LAXA 1NNKA 2ZYNA 3PUYE 1MXXA 4LZ7A 1UTBB 3H6WA 4QFOA 4IO6A 4YAHX 2PT1A 3IO6A 2GHAA 4F31B 2RCBA 1N7XA 4JSOA 4OYVA 4U4XA 5CBSA 1S7YA 2VHAA 3I5OA 3G3IA 4BDMA 4QFPA 4GVOA 3TTKA 3HN0A 4KI0E 3H6VA 4BDQA 3U94A 2O6AA 3PPPA 1MDQA 1A8FA 2VOZA 3IOUA 5JK4A 2F97A 4RA1A 5M2VA 1VFEA 1DPEA 1RKMA 3PGFA 4XKRA 2F35A 2E0SA 3OOAA 5KCJA 2FYIA 4GOTA 2OCUA 3PMVA 4EF2A 4ESXA 4FATA 4MLQA 5B70A 1MS7A 3K1NA 1DTZA 2GRVA 2ONRA 4NF4B 3UK4A 1B05A 1TXFA 2HCAA 3FATA 4R9FA 2NOOA 2Q8JA 5TP9A 4H0WA 1HSLA 1XC1A 3PV0E 5H8FA 4F22A 4KHZE 4YZZA 4I8CA 3OD7A 1MXWA 5CMCA 1Y3QA 2UVGA 1TFDA 4UA8A 3A09A 1FTLA 3G7WA 3QUFA 5IAIA 2UVHA 1B46A 4G8HA 3RTFB 1SD3A 3KOSA 1URSA 1B3EA 4N13A 1SVXB 4ELOA 2V25A 2XXRA 4GL8A 3DM0A 2V3TA 3OENA 3C31A 3HV1A 1AMFA 2F36A 1OQHA 3FASA 4OFLA 5BWJA 3CSGA 1FQDA 1EZOA 1TFAA 2RC7A 1GR2A 2DWJA 3CI8A 3KN7A 1FTKA 1P1OA 3IOVA 4C0RA 3P7IA 3C35A 3Q29A 3M3KA 1MH4A 3LSFB 4PFYA 1B40A 4FJPA 3LR1A 3S4UA 3VE1B 1M5BA 2O7UA 4YKJA 3IX1A 4KR5A 2RINA 1I69A 1XVYA 3TYHA 3S9EA 1MQDA 4YKIA 3UIFA 1URDA 5KDTB 3C32A 2QJEA 1II5A 3RY3A 2XX9A 4ELRA 2QSXA 2QS3A 4JDFA 3GZGA 2V93A 1UIUA 4GF8A 1NNFA 4P0IA 1ATGA 3TODA 1B0HA 2QS1A 4NF5B 4PFUA 4RK2A 4F2QA 3K4UA 2REGA 2P0SA 3Q26A 1AIVA 3QXMA 3OXNA 4KQPA 1CB6A 3FIRA 2O51A 2Y7WA 4NTLA 3TPAA 4LZ8A 4WXJA 4DIGA 1ZKBA 1B7ZA 5KZTA 3EQ1A 3MVWA 2P1SA 1DOTA 1JVXA 1N04A 1R6ZA 5H8NB 3A3CA 4F3PA 2D3IA 4GIZA 1SW2A 3DP6A 4IO3A 3IO4A 4H8JA 2YLNA 1JEUA 2ZNTA 3SEVA 4O3BA 4DZ1A 2O1MA 4DDDA 3FUZA 1GTKA 4ZEIA 3VXBA 3MVZA 5FHOA 4HCWA 3UGWA 2Z22A 1AL3A 3MAMA 3MVXA 5HM4B 1LAGE 3FXRA 1Y9UA 2XXTA 1QKBA 4JXIA 2UYFA 3TTRA 1MM7A 2P2AA 4JWOA 4OFOA 2DWIA 4MF3A 3MJNA 5TPAA 3IOWA 3K6XA 1ZBMA 4NMYA 1PBQA 1CE2A 4IY6A 1P1QA 1NFTA 4N6PA 4KCCA 3QK6A 1IXIA 3PD8A 3H6TA 3CVGA 1DTGA 2OJTA 3O2AA 5F7VA 4ZZAA 3U93A 4FORA 1Y4TA 3K1PA 3MPKA 4G8MA 4LVQA 3OMBA 5FTIA 3BFUA 1SBPA 1A7LA 1BP5A 1P1NA 2GH9A 1MXVA 2QL3A 3HO7A 1UIVA 4IO2A 1B7UA 4PE5B 5EHMA 4FAJA 1MY2A 1ZLQA 1Y3PA 5H8SA 3QAXA 4GWOA 5K2YA 4AQ4A 1N0TA 1HSJA 5DEXA 4UACA 4XTCQ 2I6EA 3FXQA 3KBRA 2DE4A 1ELJA 1J1NA 1MPDA 3H7MA 5CBRA 3V8XB 2UYEA 2F6PA 3R7XA 1IQ7A 1JW4A 2O1LA 3ECRA 4F29A 1BTJA 4R6HA 5CI5A 4AB6A 3W9WA 4QFLA 4G68A 4POWA 2ONKE 1XS5A 3E4RA 3L6HA 3TTMA 3ODBA 3VDFA 3PPRA 5L9SA 2DVZA 5DT6A 5AA1A 4HW8A 2X7QA 2R6GE 4QFNA 4Z0IA 1IXCA 1MH3A 3G3JA 4OHNA 3W9VA 3ZS6A 1OLCA 3RN8A 5CC2A 3S2VA 2HQ0A 1B3FA 1EH3A 1PC3A 4BDLA 1SQYA 3SEXA 1ZJLA 4P11A 1N3XA 2A5SA 3F11A 4AB5A 1JQFA 4M1VA 1FQAA 3SEWA 1LFIA 1QULA 3TFLA 2R9JA 2HXWA 3C34A 4G68C 4YB6A 1EZPA 3PUZE 1IZ1A 3CFZA 3U8QA 2KLFA 1RYXA 3OO7A 4RNSA 4P0GA 1M5FA 4POXA 4H1XA 3RLFE 5H8NA 3USDA 1MY1A 3EF7A 3GBAA 4EXKA 4L17A 2DXRA 4KCDA 2XXVA 3KFMA 4XIGQ 2QRYA 4HCYA 1LBBA 2ZNSA 3FD3A 5FHNA 1D3KA 3ZKLA 1US4A 4GD5A 3TCGA 4XKPA 1ZTYA 1JW1A 4YMBA 2RF1A 5F1QA 4RJZA 4PFTA 4ECFA 2LAOA 4ZECA 4ELQA 4NF4A 4MBPA 1ANFA 1O7TA 3JV9A 3FZVA 5ISUA 3CSBA 1JETA 3DP4A 3GXAA 2ABHA 3PUXE 3SESA 3UA8A 1Y1ZA 1XVXA 4ZEBA 1MQHA 4U1ZA 3GLBA 2Z23A 1H44A 4DE8A 4DXBA 5ICQA 3MZBA 5TPAB 1NH8A 3MP1A 2ZMBA 3DP8A 3KSJA 4Q0CA 4EXLA 2D5WA 1OMPA 3HSTA 1GV8A 3FJMA 4G77A 4GLIA 4M4GA 3N6TA
chains in the Genus database with same CATH superfamily
1MY3A 4PAKA 1D9YA 3T9HB 4YMAA 2IA4A 3MUQA 3FVNA 4P1LA 2XXUA 1XOCA 2YPNA 4PAFA 5DTBA 1ZMGA 4HE1A 3M8UA 1OVBA 5H8HB 5DEXB 4PBQA 3HHGA 3OO6A 3O66A 4IGRA 2F34A 1VSOA 3MWBA 2FNCA 3C36A 1IUDA 4NQ8A 4E0XA 5DYHA 1LAFE 3QYTA 1DSNA 3M3LA 3B6WA 3OEMA 4K3FA 1NH7A 4GWZA 3LBSA 2UXAA 1Y4CA 5CMMA 3K6UA 4WKMA 1B51A 2IEEA 4LONB 4PETA 4RPNA 3E3KA 3V83A 4EQ7A 1PB9A 2ZXTA 4NEDA 4ZEFA 3OELA 4OVJA 1B3LA 3N94A 4GX4A 2VGQA 5ICTA 3WAFA 3N5LA 4XKQA 3GBBA 1WVJA 1JVYA 4MAGA 4R2FA 4YICA 5LOMA 2HZLA 2PBWA 2F3DA 2XXXA 5DVFA 4GRKA 3K1MA 1Q35A 1IXHA 4THIA 5ITOA 1SW5A 3OSRA 1VE4A 3K00A 1B7HA 3Q28A 1Y20A 3IOTA 4PP0A 5IZ3A 5I57A 3TEPA 2DWHA 1NNTA 4BLAA 3OEKA 4F18A 1N84A 4TQUQ 1RDZA 4DXUA 4MFIA 3TQLA 2DQVA 2A5TA 3KBZA 4OMBA 2CZHA 1LAHE 2WBBA 4Q5TA 2VP1A 3IB1A 4LATA 4OWDA 2FHYA 3HCQA 3QUJA 1QGXA 2OBGA 4GQOA 2H4IA 1JP4A 1VDWA 3M3FA 4XFEA 3Q27A 3D4CA 2HPGA 2RC8A 2ZZVA 2X26A 3B8BA 2HFBA 1S50A 3FBPA 4KFQA 3UORA 3O6HA 4YB5A 4PDDA 2B3BA 1T0KA 2Z8DA 5JTYB 3C9HA 1IMCA 3N26A 1I6AA 1JEVA 3PUVE 4PGPA 3MVYA 3LC8A 3KJ7A 4JWXA 1LFGA 3UP9A 4RYAA 4FE8A 1POY1 3TCFA 4GBVA 4G4PA 2XXQA 1MQIA 2F7CA 5KDTA 1MXYA 1TWYA 1IIWA 4QSEA 1NV2A 2ZYKA 3G3HA 3T9VA 4H5FA 3IL1B 2PVUA 5H8HA 1O63A 3S9LC 2O7IA 3ILUB 1YXIA 2QS4A 1FPBA 2DYXA 3K6WA 4N07A 5L8DA 3H03A 4F3GA 4ONYA 2VPNA 4DCXA 1PB7A 3KGCA 1RDXA 1SW4A 4LQ2A 5AA2A 4DI4B 3JYRA 3U92A 2VD3A 4IY5A 3B6TA 3LSLA 3SETA 2OWSA 1QKAA 3ZKKA 1FTJA 4NWDA 4OEUA 1LBCA 1LCTA 1H45A 1WDNA 3MSTA 5FTHA 3MZ9A 2DP8A 3RT8A 3TQWA 5AA4B 4H6DA 4ZEKA 1L5TA 4OVPA 1LB9A 1BLFA 3H6WA 2GHAA 1N7XA 4JSOA 2VHAA 4BDMA 4KI0E 1NUWA 2F97A 4RA1A 5M2VA 1DPEA 3PGFA 2F35A 1FPDA 4GOTA 3PMVA 4MLQA 3K1NA 1FTAA 1TXFA 2HCAA 2NOOA 1XC1A 4I8CA 3OD7A 3LV0A 5IAIA 3KOSA 1B3EA 4ELOA 4GL8A 2V3TA 1EZOA 2PFZA 2RC7A 3CI8A 3KN7A 3IOVA 3P7IA 3M3KA 3LSFB 1B40A 3LR1A 2O7UA 4PFIA 1I69A 4MMPA 3TYHA 2QJEA 2XX9A 4JDFA 2QS3A 3GZGA 1NNFA 4PFUA 3K4UA 3QXMA 2O51A 4NTLA 4DIGA 1B7ZA 1N04A 2D3IA 1SW2A 4DZ1A 3VXBA 2FIEA 3MVZA 5FHOA 1Y9UA 2UYFA 4OFOA 2XXKA 3IOWA 4NMYA 4IY6A 3SZPA 1IXIA 3H6TA 5F7VA 4ZZAA 4FORA 3OMBA 5FTIA 3BFUA 4MX6A 1P1NA 4IO2A 4PE5B 1UIVA 4FAJA 1ZLQA 1Y3PA 3QAXA 4AQ4A 1NUZA 3FXQA 3KBRA 4PC9A 1ELJA 3H7MA 2O1LA 1JW4A 3ECRA 4F29A 4MJOA 3ODBA 3VDFA 3PPRA 5DT6A 2X7QA 4Z0IA 1EYIA 3G3JA 4OHNA 3W9VA 1OLCA 3RN8A 3S2VA 1N3XA 2A5SA 3F11A 3TFLA 1IZ1A 1RDYA 4P0GA 3USDA 3RLFE 4P1EA 4EXKA 3GBAA 4L17A 4KCDA 1LBBA 3FD3A 5FHNA 1D3KA 3ZKLA 4GD5A 1JW1A 2B4LA 2OWZA 5F1QA 4RJZA 4PFTA 4MBPA 1ANFA 1O7TA 2P3NA 3PUXE 1MQHA 3MZBA 5TPAB 2ZMBA 3KSJA 4Q0CA 3HSTA 4G77A 4NGUA 4HE0A 2ALUA 5A5XB 4KYEA 3T66A 2Z8EA 5I2NB 1LFHA 2I48A 3PD9A 3OO9A 1Z7NE 3KG2A 1HSEA 4GL0A 4QSCA 3TTLA 2E1SA 5I58A 2QMXA 1QUJA 3PPNA 2V3QA 3MPLA 1FSAA 5DVIA 3IB2A 4I1DA 1FBCA 4X1BA 2ONSA 3DLNA 4QFKA 5EQAA 4E0WA 1P99A 1BK4A 4F3SA 4FEBA 4EQ9A 4G2ZA 2F7BA 2XD3A 4JWYA 1MDP1 4OZ9A 3OO8A 4R72A 3SKPA 3EPEA 4FEDA 2I3WA 2XD2A 2XXIA 3O97A 4U2RA 1M5CA 2DXYA 5CRYA 1WODA 5I59A 2Q74A 3TUSA 1G0HA 1KA1A 5J1DA 4LZ5A 4MHFA 2XWKA 3FJGA 3CG1A 4N4UA 2I0BA 4N91A 3FVKA 3E9XA 3RGYA 5I84A 1H76A 4QF9A 1MM6A 4OENA 4QHQA 2GQ1A 4DXCA 2G29A 3KZGA 1SPIA 4N6DA 3PU5A 4NAPA 4R6YA 1UTBA 3L6GA 3CFLA 1F9BA 5EQ9A 1B1HA 3K6VA 4LA9A 1FJ9A 4PFWA 2XXHA 3W15C 1QJMA 2ZNUA 2Y84A 3B6QA 1LSTA 3KEIA 4Z7EA 2V4CA 4PFBA 4YKKA 1UTHB 4R74A 1SI1A 2G93A 4ZEDA 3T96B 4HS7A 3AXFA 4GWUA 3QSLA 4F1VA 5AA4A 3CHGA 2I58A 3IORA 1MQJA 1A55A 2DSFA 1US5A 1NUYA 2CZKA 3IR1A 4R2BA 1SYHA 3BBRA 1IMBA 3TKDA 4EUOA 4N15A 5H8QA 1QUKA 1A54A 4RPOA 1YTVA 2OK2A 3IJXB 1QW0A 3JZJA 3PMWA 3Q25A 1FQBA 1O64A 1P1UA 2P3VA 2X7PA 3PPOA 1M5EA 4NHBA 1FQCA 2I0CA 2ESNA 3I3VA 2NXOA 1XT8A 2RC9A 1Y1MA 4X1DA 5TP9B 2I3VA 4BDRA 5IM2A 3V5AA 1FPIA 1UQWA 4XF5A 2O68A 5H8NB 1LGBC 2AYSA 4C1TA 1MXUA 4RY1A 1FBHA 2YJPA 1LB8A 3D1RA 1BKAA 4X04A 2DS9A 3K01A 4F1UA 1OLAA 3LUYA 2XXPA 4IB2A 4G61A 4OERA 1AWBA 3FXUA 4F3BA 3IJOB 5B7DA 2DE2A 3T9XB 1FPJA 4Q30B 1SI0A 3IAZA 4DLDA 4U4SA 1DBZA 3FGSA 3THIA 3UN6A 3FJ7A 5AE4A 1DCUA 1I6BA 1B1XA 5TU0A 4F2OA 1NKXA 3ILTB 3KN3A 1FPEA 1NV1A 4QRZA 2OZZA 4O8MA 2HEUA 4TLMB 1JW5A 3CIJA 1KZ8A 4TOZA 3EKIA 1PDAA 1URGA 4NWCA 4AS4A 4GBWA 2WYPA 1A8EA 2ZZWA 3IB0A 5JEIA 1FQFA 4G68B 3VXCA 2XHDA 2H9BA 4ESWA 3LSWA 4X48A 3CFXA 4JBZA 4UABA 3R26A 4BDNA 5I5PA 4PTKA 5IKBA 3OSQA 2ZYNA 1NV5A 1FPLA 1LBWA 4QFOA 4F31B 4OYVA 1S7YA 3G3IA 4GVOA 3H6VA 2O6AA 1MDQA 2VOZA 3IOUA 1RKMA 5KCJA 2OCUA 4EF2A 4FATA 1MS7A 3UK4A 2BJIA 1B05A 2HXRA 4F22A 2KQZA 3QUFA 2UVHA 4N13A 1SVXB 3DM0A 3OENA 3FASA 4OFLA 1TFAA 2DWJA 3E78A 3RYDA 3C35A 3Q29A 2WYKA 5ET7A 3S4UA 3S9EA 5KDTB 3C32A 1FBGA 3RY3A 4ELRA 4P0IA 4F2QA 4KQPA 1CB6A 3HFUA 4WXJA 1ZKBA 5KZTA 3MVWA 2P1SA 1JVXA 4MEVA 4F3PA 3DP6A 4IO3A 2VPOA 2JJKA 3SEVA 4PFRA 4DDDA 3FUZA 4ZEIA 4OANA 3UGWA 4MNPA 2Z22A 3MVXA 5HM4B 3FXRA 2PFYA 4JXIA 3TTRA 2P2AA 4JWOA 4DI3D 4MF3A 1CE2A 1NFTA 4KCCA 2OJTA 2Y5KA 3K1PA 3MPKA 4G8MA 3V89B 4LUBA 1SBPA 1A7LA 1BP5A 2QL3A 3HO7A 4GWOA 1N0TA 4PF6A 4XTCQ 4NN3A 4N6KA 1J1NA 1MPDA 3R7XA 5IGAA 3W9WA 4POWA 3L6HA 3TTMA 1LEVA 4O7IA 5CMKA 1PC3A 4HXVA 3SEXA 1ZJLA 5I7IA 1FQAA 2ZZXA 1QULA 2HXWA 4P56A 2KLFA 4POXA 5IZ1A 4H1XA 1MY1A 3EF7A 2CEXA 2WEFA 1US4A 2DDKA 5J16A 2LAOA 4ZECA 5ISUA 3CSBA 1JETA 1FPFA 3GXAA 3SESA 3UA8A 1XVXA 4ZEBA 4GX6A 3GLBA 4DE8A 5ET6A 1NH8A 2B4MA 4OA4A 2D5WA 4GLIA 3U65A 3FV2A 1S9TA 4H46A 5EQ8A 4NG7A 2CEYA 4NF8A 4HTGA 1FW0A 2DE3A 4ELPA 4ZE9A 3VVEA 3FV1A 1LLSA 3BKIB 1NUXA 4KYDA 2W7YA 3EHTA 2PYYA 1B6HA 5FHMA 3TCHA 3T93B 5DW8A 2F8DA 4H65A 5EHSA 2BJJX 2F6GA 2XX8A 5H8FB 2V84A 4WEDA 4GWWA 2Q2AA 4U23A 1XI6A 1B32A 4NX1A 3TELA 2O69A 3LSXA 2A5TB 1UTHA 1A40A 2QMWA 4KPTA 3RUMA 2PX1A 1BIYA 3O6GA 4MIJA 3TDJA 1QUIA 4H67A 2OWTA 2XA5A 4N17A 4ZE8A 1AOVA 1SDXA 3NOHA 2H98A 4KD5A 1K9YA 4IO7A 5I58B 1B9JA 4H5GA 3O9PA 1B0LA 2NUVA 1VFDA 4ISUA 4U1OA 2QPQA 2DWAA 1KA0A 1MPCA 4EQBA 4NF6B 5FBPA 3FXBA 3MYUA 2F3BA 2H25A 3HPIA 1EU8A 2DVCA 2QFLA 4PGNA 2REJA 4PF8A 4GWXA 4ZZEA 4R75A 2OX3A 4TLLB 1PEBA 3O29A 3TTNA 3RT6B 1LCFA 5CMBA 4KYSA 1Q1KA 5I2KB 3KJTA 2HAVA 3ZSFA 2WKYA 3MP8A 1EYKA 2D21A 1MY4A 1MG1A 5I2NA 3EHUA 1B3GA 3H6UA 1N3WA 4I62A 4YKPA 3MP6A 4JVIA 5EYHA 2CZLA 4OETA 1FPGA 4LP2B 5LTCA 1RYOA 4U22A 2ZYOA 1AH5A 2I49A 2V3UA 1R9LA 3O28A 2OLBA 4GXAA 5LDZA 1Z7ME 2FBPA 3SDFA 3MZ1A 4XXUA 1MXZA 2H99A 4MNIA 1B2HA 2DOJA 3S9NC 1YZ0A 3CR9A 2Q89A 1NNPA 5F24A 3G3GA 5KCJB 1FPKA 3PUWE 3RTWB 3G3KA 3VFJA 1OQGA 3A29A 2QS2A 5L9MA 4MH5A 5HBCA 1MY0A 2F5XA 1G0IA 1SW1A 4PQJA 3T22A 1DPPA 2QVRA 3TZAA 2Q9TA 3VV5A 4N8YA 1D9VA 4OESA 2Y7PA 2UVIA 3MQ9A 5I56B 5AA3A 4DCYA 1USYH 4R9GA 2XWVA 5ELVA 5ITPA 1A99A 3KN8A 1LAXA 1IMFA 1MXXA 4IO6A 2PT1A 2RCBA 1NI9A 3TTKA 5JK4A 1VFEA 2E0SA 4NF4B 2HHMA 4R9FA 2Q8JA 5TP9A 4H0WA 4H45A 3PV0E 5I3SA 5H8FA 2UVGA 1TFDA 3A09A 1FTLA 3BIGA 3G7WA 3LUZA 1B46A 3PTYA 2V25A 2XXRA 3HV1A 1AMFA 3CSGA 5ESYA 1YYZA 1FTKA 1P1OA 4C0RA 1FBDA 4PFYA 4FJPA 4YKJA 3IX1A 4KR5A 2RINA 1MQDA 5ET8A 1II5A 2QSXA 1UIUA 4GF8A 1B0HA 4OVQA 2REGA 3OXNA 2Y7WA 4P9KA 4QBAA 4O3BA 2O1MA 1EYJA 1AL3A 3MAMA 1FRPA 2XXTA 1MM7A 1ZBMA 1P1QA 3GYYA 3O2AA 1Y4TA 5EHMA 1B7UA 1MY2A 5H8SA 5K2YA 1D9QA 2I6EA 3E79A 5CBRA 3V8XB 4LN5A 5T3JA 1BTJA 4FBPA 5CI5A 5A5LA 2ONKE 3E4RA 2FIXA 2QVUA 5AA1A 4BDOA 2QVVA 3ZS6A 4BDLA 2HQ0A 1B3FA 4JVCA 1SQYA 2VT5A 3KC0A 4P11A 4AB5A 1JQFA 3SEWA 4YB6A 1EZPA 3PUZE 3U8QA 4OVSA 3OO7A 4AS5A 4RNSA 1M5FA 2DXRA 2XXVA 1NV7A 3KFMA 1ZTYA 1IMAA 3FZVA 3DP4A 1Y1ZA 1LBXA 4U1ZA 2Z23A 1FBFA 1H44A 4DXBA 5ICQA 4O7MA 4I40A 3DP8A 1OMPA 1DK4A 1R9QA 3FVOA 3VVFA 4OEVA 5I2KA 1IEJA 2NWJA 3T9UA 3KOTA 1FBPA 3H3GA 4EDPA 1OVTA 2M8CA 5ET5A 3N6UA 1POTA 4OVRA 4I3EA 3T0JA 1KWHA 2RKMA 4ZS9A 5HPQA 1IITA 3BIHA 3ONMA 4G8NA 2AIXA 2GFEA 2Y5LA 4QSDA 4O94A 5H8QB 4F39A 5AA2B 2THIA 3FVGA 1IMEA 2VD2A 4PCDA 1R1NA 3ISPA 1D4NA 1YCJA 3VLUA 5L9OA 1EZ9A 4PBHA 5A5XA 1B52A 4PE3A 3G3FA 2O84X 3SERA 4XKNA 1GGGA 1YAEA 4IO5A 3C33A 3A3UA 1B3HA 1VR5A 4JB7A 4RXLA 5DVJA 1B5HA 3C4MA 3VLVA 3CG3A 1NV6A 3K0VA 4YU0A 1NL5A 2B3FA 3ROJA 1H43A 3RPWA 3MW0A 3PMXA 5JTYA 1QVSA 5CM6A 4EF1A 3PPQA 5K2XA 4ZDMA 1LBYA 3E13X 2F7AA 2GHBA 3RNNA 1N76A 4MLVA 1Y3NA 3K02A 3H06B 2XX7A 1FTOA 1OIBA 1MRPA 4ND9A 2AL5A 3QIMA 3B7DA 4OQOA 4XEQA 4N8GA 2XXWA 2R8TA 5I59B 4LQ5A 1YPNA 1JNFA 2XWIA 3H4ZA 3HHFA 2KR0A 1FCKA 2PT2A 4FECA 4OXVA 4PDHA 3S9MC 3O6IA 1MQGA 4NF4A 3IK6B 3U93A 2Z8FA 1USYE 4X9TA 2FVZA 3I6VA 4NF6A 2I4BA 1B58A 2ZYMA 1B5JA 4NF5A 4F19A 4O3AA 4R6KA 4Q8RA 1CNQA 2ANJA 2XXYA 1PBPA 1ZU0A 1FBEA 2AL4A 2H5YA 2Y7RA 3K2DA 2I4CA 3RQTA 1P1WA 4X8RA 5I56A 3MC2A 4PAIA 3RPLA 3TAJA 1FQEA 2HZKA 2F78A 4C1UA 1NMUA 1NV3A 4R73A 1TT1A 2Q2CA 3VVDA 3MBPA 4U21A 3R6UA 3U1OA 4NF8B 1IXGA 4WEPA 2Q88A 4O3CA 4OFJA 3EN3A 3KSXA 2R71A 3T1BA 3D4GA 3SEUA 1SYIA 1B4ZA 2XWOA 4GXSB 1FTMA 3RPLB 3DELB 3WAEA 1DMBA 2FA7A 3VLWA 1FJ6A 1M5DA 3CRBA 2L5VA 4JSDA 4KXPA 5EYFA 1ZIUA 3KC1A 4H8IA 4YB7A 1B5IA 1B4HA 1K9ZA 2CMOA 4IO4A 2NVUB 2RCAA 3SEYA 4GX3A 1MPBA 1XHYA 1PB8A 2B65A 2PMSA 2WX9A 1H3DA 2HAUA 4FIMA 2Y7IA 4OTEA 2Y7KA 4I9DA 5BUUA 1IMDA 1NV0A 3EHSA 4GFRA 4RK9A 1N7WA 4NE4A 5EYGA 1GVCA 4IGTA 3IFAA 4F1YA 3TMGA 3BFTA 1LBZA 2UVJA 5IZ3B 5I57B 1I6QA 2Q8MA 3U72A 5AA2D 1NNKA 3PUYE 4LZ7A 1UTBB 4YAHX 3IO6A 4U4XA 5CBSA 3I5OA 2WBDA 4QFPA 3HN0A 3U94A 3IFCA 3PPPA 1A8FA 4GWSA 4XKRA 3OOAA 2FYIA 4QXDA 4ESXA 5B70A 1DTZA 2GRVA 2ONRA 4HE2A 3FATA 4JVDA 1HSLA 4KHZE 4YZZA 1MXWA 5CMCA 1Y3QA 4UA8A 4G8HA 4P8BA 3RTFB 1SD3A 1URSA 3C31A 2F36A 1OQHA 5BWJA 1FQDA 1GR2A 2MKZA 4IR8A 4MNCA 4P47A 1MH4A 3VE1B 1M5BA 1XVYA 4YKIA 3UIFA 1URDA 2V93A 1ATGA 3TODA 4NF5B 2QS1A 4RK2A 3Q26A 2P0SA 1AIVA 1INPA 5IZZA 3FIRA 4NF0A 3TPAA 4LZ8A 3EQ1A 1DOTA 1R6ZA 3A3CA 4GIZA 4I3YA 1NV4A 3IO4A 2YLNA 1JEUA 2ZNTA 4H8JA 1GTKA 4HCWA 1LBVA 1LAGE 1QKBA 2DWIA 3MJNA 5TPAA 3K6XA 1PBQA 4N6PA 3QK6A 3PD8A 3CVGA 1DTGA 4MCOA 4N81A 4LVQA 2GH9A 4BDQA 1MXVA 4P3LA 1HSJA 5DEXA 2PCRA 4UACA 2DE4A 2UYEA 2F6PA 1IQ7A 4R6HA 4AB6A 4QFLA 4G68A 1XS5A 5L9SA 2DVZA 4HW8A 2R6GE 4QFNA 1IXCA 1MH3A 5CC2A 1Q9DA 1EH3A 3QMFA 4M1VA 1LFIA 2R9JA 4G68C 3C34A 3CFZA 1RYXA 4GWYA 5H8NA 4OVTA 4XIGQ 2QRYA 4HCYA 5EQ7A 2ZNSA 3TCGA 4XKPA 4YMBA 2RF1A 4ECFA 4ELQA 3JV9A 2ABHA 2CZIA 3MP1A 4EXLA 1GV8A 3FJMA 4M4GA 3B50A 3N6TA
chains in the Genus database with same CATH topology
1MY3A 1R9QA 2ALUA 1S9TA 3FV2A 1D9YA 3FVOA 3T9HB 4KYEA 5A5XB 3T66A 2Z8EA 4YMAA 3VVFA 2IA4A 5I2NB 3MUQA 4OEVA 3FVNA 5I2KA 1LFHA 2XXUA 1IEJA 1XOCA 2I48A 2YPNA 3PD9A 2NWJA 5DTBA 1ZMGA 3OO9A 4NF8A 1Z7NE 3T9UA 4HTGA 3KG2A 1HSEA 4GL0A 4QSCA 1FW0A 3KOTA 3TTLA 2E1SA 2DE3A 4ELPA 4ZE9A 5I58A 3M8UA 2QMXA 3H3GA 4EDPA 1OVBA 1OVTA 3VVEA 1QUJA 3PPNA 5H8HB 2V3QA 3MPLA 2M8CA 5DEXB 3FV1A 1LLSA 5DVIA 3IB2A 3BKIB 4I1DA 3N6UA 4KYDA 2W7YA 1POTA 3EHTA 3HHGA 4X1BA 2PYYA 4LUBA 1B6HA 2ONSA 3DLNA 3OO6A 5FHMA 4QFKA 3O66A 1KWHA 2RKMA 4IGRA 2F34A 3TCHA 4ZS9A 5HPQA 3T93B 2F8DA 1VSOA 4E0WA 1IITA 1P99A 3MWBA 4FEBA 4H65A 4EQ9A 4F3SA 3W15C 4G2ZA 2F7BA 2FNCA 3C36A 1IUDA 2XD3A 4JWYA 1MDP1 3ONMA 5EHSA 4E0XA 5DYHA 4G8NA 2BJJX 4OZ9A 3OO8A 2AIXA 4R72A 3SKPA 2F6GA 2GFEA 3EPEA 4FEDA 1LAFE 2I3WA 2XX8A 4QSDA 5H8FB 2XD2A 5H8QB 2XXIA 3O97A 2V84A 4F39A 4U2RA 1M5CA 1DSNA 2DXYA 2Q2AA 3QYTA 4WEDA 3M3LA 5AA2B 5CRYA 1WODA 5I59A 3B6WA 3OEMA 4K3FA 1NH7A 4U23A 3TUSA 2THIA 3FVGA 1B32A 2VD2A 3LBSA 2UXAA 1Y4CA 1R1NA 3TELA 1D4NA 5J1DA 5CMMA 4LZ5A 2O69A 3K6UA 3LSXA 3FJGA 1YCJA 1B51A 3CG1A 4WKMA 3VLUA 5L9OA 2I0BA 3RGYA 3FVKA 2A5TB 3E9XA 2IEEA 1UTHA 4LONB 5I84A 4PETA 1H76A 1A40A 2QMWA 1MM6A 4OENA 3E3KA 4KPTA 4QF9A 4QHQA 1EZ9A 4RPNA 4DXCA 5A5XA 2G29A 3V83A 1B52A 3KZGA 3RUMA 3PU5A 4R6YA 4EQ7A 3G3FA 1UTBA 3L6GA 1PB9A 2ZXTA 3CFLA 4NEDA 2O84X 4ZEFA 3SERA 4XKNA 1F9BA 2PX1A 3OELA 1GGGA 1BIYA 1YAEA 3C33A 1B1HA 1B3LA 3A3UA 3O6GA 1B3HA 4IO5A 4OVJA 3K6VA 1VR5A 1QUIA 3N94A 4H67A 4JB7A 4LA9A 2OWTA 4PFWA 4RXLA 5DVJA 2VGQA 5ICTA 1B5HA 3C4MA 4ZE8A 3WAFA 3VLVA 3N5LA 4XKQA 3GBBA 1WVJA 1AOVA 1JVYA 2XXHA 1SDXA 3CG3A 1QJMA 2ZNUA 2H98A 2Y84A 3B6QA 3K0VA 1LSTA 1NL5A 3KEIA 4KD5A 4R2FA 4YU0A 4Z7EA 2B3FA 4YICA 1H43A 4IO7A 4YKKA 5LOMA 3RPWA 1UTHB 3MW0A 5I58B 2HZLA 3PMXA 4R74A 5JTYA 1B9JA 2PBWA 1QVSA 3TDJA 1SI1A 2G93A 3O9PA 4H5GA 4ZEDA 2XXXA 5DVFA 4GRKA 3T96B 4HS7A 5CM6A 3AXFA 3K1MA 4EF1A 3PPQA 1Q35A 1IXHA 5K2XA 4THIA 1B0LA 4ZDMA 3QSLA 5ITOA 4F1VA 3E13X 5AA4A 2NUVA 1VFDA 2I58A 4ISUA 4U1OA 2QPQA 2F7AA 2GHBA 3RNNA 2DWAA 1MPCA 1N76A 1SW5A 4MLVA 4EQBA 3OSRA 3IORA 1VE4A 1Y3NA 4NF6B 3K00A 3K02A 3H06B 2XX7A 1FTOA 1B7HA 1MQJA 1A55A 1OIBA 1MRPA 4ND9A 2AL5A 2DSFA 2H25A 3HPIA 3Q28A 1Y20A 1EU8A 2DVCA 3B7DA 3IOTA 3QIMA 4OQOA 1US5A 3IR1A 2REJA 4PP0A 5I57A 2XXWA 3TEPA 5I59B 4ZZEA 4LQ5A 4R75A 4R2BA 2DWHA 1NNTA 1JNFA 1SYHA 1YPNA 3BBRA 4TLLB 3H4ZA 3TKDA 4BLAA 1PEBA 3O29A 3HHFA 3OEKA 4EUOA 4F18A 1N84A 5H8QA 1FCKA 1QUKA 1A54A 2PT2A 4RPOA 1YTVA 4TQUQ 3TTNA 4DXUA 2OK2A 4FECA 4OXVA 3IJXB 4MFIA 3RT6B 3TQLA 1QW0A 3S9MC 1LCFA 2DQVA 2A5TA 3JZJA 3O6IA 4OMBA 1MQGA 3PMWA 1FQBA 1O64A 3IK6B 1P1UA 1LAHE 3Q25A 2Z8FA 1USYE 1Q1KA 4KYSA 5CMBA 5I2KB 2X7PA 3KJTA 3PPOA 2HAVA 3ZSFA 2WKYA 1M5EA 3MP8A 4X9TA 1FQCA 2I0CA 2ESNA 3I3VA 4Q5TA 2D21A 1MY4A 1XT8A 2NXOA 3I6VA 2VP1A 2RC9A 1Y1MA 1MG1A 3IB1A 4X1DA 3EHUA 2I4BA 4LATA 1B3GA 4NF6A 5I2NA 4OWDA 1B58A 2ZYMA 1B5JA 3H6UA 4NF5A 4F19A 5TP9B 2I3VA 3HCQA 4O3AA 3QUJA 2OBGA 4GQOA 4R6KA 1N3WA 2ANJA 2H4IA 4BDRA 4Q8RA 2XXYA 3M3FA 3V5AA 1PBPA 1UQWA 1ZU0A 3Q27A 3D4CA 2AL4A 2RC8A 4I62A 2H5YA 2O68A 2X26A 1LGBC 2Y7RA 2HFBA 1S50A 2I4CA 3K2DA 3MP6A 4YKPA 3RQTA 4KFQA 3UORA 1P1WA 2AYSA 2CZLA 4OETA 5I56A 3MC2A 3O6HA 4LP2B 4YB5A 4C1TA 2B3BA 1T0KA 2Z8DA 5JTYB 1MXUA 3C9HA 3TAJA 3N26A 4RY1A 1FQEA 1RYOA 2HZKA 1I6AA 1JEVA 2F78A 4C1UA 2YJPA 3PUVE 1LB8A 3MVYA 1BKAA 1NMUA 4U22A 3LC8A 3KJ7A 4JWXA 4R73A 2ZYOA 1LFGA 3UP9A 1AH5A 1TT1A 2DS9A 2I49A 2Q2CA 2V3UA 3K01A 4RYAA 4FE8A 3VVDA 1R9LA 3O28A 1POY1 1OLAA 2OLBA 3MBPA 3TCFA 4G4PA 4GXAA 1Z7ME 2XXQA 4U21A 3LUYA 2XXPA 3R6UA 3SDFA 1MQIA 2F7CA 3U1OA 4IB2A 3MZ1A 1MXYA 5KDTA 1TWYA 4NF8B 1IIWA 1IXGA 4QSEA 4XXUA 4WEPA 1MXZA 2Q88A 4O3CA 4OFJA 3EN3A 4OERA 3KSXA 2R71A 2ZYKA 3FXUA 3G3HA 4F3BA 2H99A 3T9VA 1B2HA 2DOJA 3D4GA 3IJOB 3SEUA 3S9NC 5B7DA 4H5FA 3IL1B 2DE2A 3CR9A 2Q89A 1NNPA 1SYIA 3T9XB 1B4ZA 4Q30B 4GXSB 1FTMA 2PVUA 3DELB 3WAEA 1DMBA 2FA7A 5H8HA 1SI0A 3IAZA 1O63A 3VLWA 4DLDA 3G3GA 3S9LC 2O7IA 5KCJB 1M5DA 3CRBA 3ILUB 4U4SA 4JSDA 2QS4A 2DYXA 3PUWE 3K6WA 4N07A 5EYFA 5L8DA 3FGSA 3H03A 1ZIUA 4H8IA 4F3GA 4YB7A 3RTWB 1B5IA 3G3KA 1B4HA 4ONYA 3THIA 3UN6A 2CMOA 3FJ7A 3VFJA 4F1UA 5AE4A 4IO4A 2NVUB 1I6BA 4DCXA 1OQGA 1PB7A 1B1XA 2RCAA 2QS2A 5TU0A 5L9MA 3SEYA 4MH5A 1NKXA 3KGCA 5HBCA 3ILTB 4F2OA 1SW4A 1MY0A 2F5XA 3KN3A 4LQ2A 1MPBA 5AA2A 4QRZA 2OZZA 2HEUA 1XHYA 1SW1A 4PQJA 3T22A 1DPPA 1JW5A 3CIJA 1PB8A 2B65A 2PMSA 4TLMB 3JYRA 3U92A 1H3DA 2VD3A 4IY5A 3TZAA 2HAUA 2Q9TA 3VV5A 4FIMA 2Y7IA 4OTEA 4TOZA 1D9VA 1PDAA 3B6TA 3LSLA 2Y7KA 1URGA 2OWSA 3SETA 4OESA 4NWCA 2Y7PA 5CMKA 1QKAA 3V89B 3ZKKA 4I9DA 5BUUA 1A8EA 1FTJA 2UVIA 4NWDA 3IB0A 3MQ9A 4OEUA 1LBCA 3EHSA 5I56B 5JEIA 1LCTA 1FQFA 4G68B 4GFRA 1N7WA 4RK9A 1H45A 1WDNA 2XHDA 4NE4A 2H9BA 3VXCA 5AA3A 5FTHA 3MZ9A 2DP8A 1GVCA 4ESWA 4DCYA 4IGTA 3LSWA 3RT8A 3TQWA 4X48A 4BDOA 1USYH 4F1YA 4R9GA 4H6DA 3TMGA 3CFXA 5AA4B 3BFTA 4ZEKA 4JBZA 2UVJA 1L5TA 3R26A 5ELVA 4BDNA 5ITPA 5I57B 5IKBA 1A99A 1I6QA 1LB9A 3OSQA 3U72A 5AA2D 1BLFA 3KN8A 1LAXA 1NNKA 2ZYNA 3PUYE 1MXXA 4LZ7A 1UTBB 3H6WA 4QFOA 4IO6A 4YAHX 2PT1A 3IO6A 2GHAA 4F31B 2RCBA 1N7XA 4JSOA 4OYVA 4U4XA 5CBSA 1S7YA 2VHAA 3I5OA 3G3IA 4BDMA 4QFPA 4GVOA 3TTKA 3HN0A 4KI0E 3H6VA 4BDQA 3U94A 2O6AA 3PPPA 1MDQA 1A8FA 2VOZA 3IOUA 5JK4A 2F97A 4RA1A 5M2VA 1VFEA 1DPEA 1RKMA 3PGFA 4XKRA 2F35A 2E0SA 3OOAA 5KCJA 2FYIA 4GOTA 2OCUA 3PMVA 4EF2A 4ESXA 4FATA 4MLQA 5B70A 1MS7A 3K1NA 1DTZA 2GRVA 2ONRA 4NF4B 3UK4A 1B05A 1TXFA 2HCAA 3FATA 4R9FA 2NOOA 2Q8JA 5TP9A 4H0WA 1HSLA 1XC1A 3PV0E 5H8FA 4F22A 4KHZE 4YZZA 4I8CA 3OD7A 1MXWA 5CMCA 1Y3QA 2UVGA 1TFDA 4UA8A 3A09A 1FTLA 3G7WA 3QUFA 5IAIA 2UVHA 1B46A 4G8HA 3RTFB 1SD3A 3KOSA 1URSA 1B3EA 4N13A 1SVXB 4ELOA 2V25A 2XXRA 4GL8A 3DM0A 2V3TA 3OENA 3C31A 3HV1A 1AMFA 2F36A 1OQHA 3FASA 4OFLA 5BWJA 3CSGA 1FQDA 1EZOA 1TFAA 2RC7A 1GR2A 2DWJA 3CI8A 3KN7A 1FTKA 1P1OA 3IOVA 4C0RA 3P7IA 3C35A 3Q29A 3M3KA 1MH4A 3LSFB 4PFYA 1B40A 4FJPA 3LR1A 3S4UA 3VE1B 1M5BA 2O7UA 4YKJA 3IX1A 4KR5A 2RINA 1I69A 1XVYA 3TYHA 3S9EA 1MQDA 4YKIA 3UIFA 1URDA 5KDTB 3C32A 2QJEA 1II5A 3RY3A 2XX9A 4ELRA 2QSXA 2QS3A 4JDFA 3GZGA 2V93A 1UIUA 4GF8A 1NNFA 4P0IA 1ATGA 3TODA 1B0HA 2QS1A 4NF5B 4PFUA 4RK2A 4F2QA 3K4UA 2REGA 2P0SA 3Q26A 1AIVA 3QXMA 3OXNA 4KQPA 1CB6A 3FIRA 2O51A 2Y7WA 4NTLA 3TPAA 4LZ8A 4WXJA 4DIGA 1ZKBA 1B7ZA 5KZTA 3EQ1A 3MVWA 2P1SA 1DOTA 1JVXA 1N04A 1R6ZA 5H8NB 3A3CA 4F3PA 2D3IA 4GIZA 1SW2A 3DP6A 4IO3A 3IO4A 4H8JA 2YLNA 1JEUA 2ZNTA 3SEVA 4O3BA 4DZ1A 2O1MA 4DDDA 3FUZA 1GTKA 4ZEIA 3VXBA 3MVZA 5FHOA 4HCWA 3UGWA 2Z22A 1AL3A 3MAMA 3MVXA 5HM4B 1LAGE 3FXRA 1Y9UA 2XXTA 1QKBA 4JXIA 2UYFA 3TTRA 1MM7A 2P2AA 4JWOA 4OFOA 2DWIA 4MF3A 3MJNA 5TPAA 3IOWA 3K6XA 1ZBMA 4NMYA 1PBQA 1CE2A 4IY6A 1P1QA 1NFTA 4N6PA 4KCCA 3QK6A 1IXIA 3PD8A 3H6TA 3CVGA 1DTGA 2OJTA 3O2AA 5F7VA 4ZZAA 3U93A 4FORA 1Y4TA 3K1PA 3MPKA 4G8MA 4LVQA 3OMBA 5FTIA 3BFUA 1SBPA 1A7LA 1BP5A 1P1NA 2GH9A 1MXVA 2QL3A 3HO7A 1UIVA 4IO2A 1B7UA 4PE5B 5EHMA 4FAJA 1MY2A 1ZLQA 1Y3PA 5H8SA 3QAXA 4GWOA 5K2YA 4AQ4A 1N0TA 1HSJA 5DEXA 4UACA 4XTCQ 2I6EA 3FXQA 3KBRA 2DE4A 1ELJA 1J1NA 1MPDA 3H7MA 5CBRA 3V8XB 2UYEA 2F6PA 3R7XA 1IQ7A 1JW4A 2O1LA 3ECRA 4F29A 1BTJA 4R6HA 5CI5A 4AB6A 3W9WA 4QFLA 4G68A 4POWA 2ONKE 1XS5A 3E4RA 3L6HA 3TTMA 3ODBA 3VDFA 3PPRA 5L9SA 2DVZA 5DT6A 5AA1A 4HW8A 2X7QA 2R6GE 4QFNA 4Z0IA 1IXCA 1MH3A 3G3JA 4OHNA 3W9VA 3ZS6A 1OLCA 3RN8A 5CC2A 3S2VA 2HQ0A 1B3FA 1EH3A 1PC3A 4BDLA 1SQYA 3SEXA 1ZJLA 4P11A 1N3XA 2A5SA 3F11A 4AB5A 1JQFA 4M1VA 1FQAA 3SEWA 1LFIA 1QULA 3TFLA 2R9JA 2HXWA 3C34A 4G68C 4YB6A 1EZPA 3PUZE 1IZ1A 3CFZA 3U8QA 2KLFA 1RYXA 3OO7A 4RNSA 4P0GA 1M5FA 4POXA 4H1XA 3RLFE 5H8NA 3USDA 1MY1A 3EF7A 3GBAA 4EXKA 4L17A 2DXRA 4KCDA 2XXVA 3KFMA 4XIGQ 2QRYA 4HCYA 1LBBA 2ZNSA 3FD3A 5FHNA 1D3KA 3ZKLA 1US4A 4GD5A 3TCGA 4XKPA 1ZTYA 1JW1A 4YMBA 2RF1A 5F1QA 4RJZA 4PFTA 4ECFA 2LAOA 4ZECA 4ELQA 4NF4A 4MBPA 1ANFA 1O7TA 3JV9A 3FZVA 5ISUA 3CSBA 1JETA 3DP4A 3GXAA 2ABHA 3PUXE 3SESA 3UA8A 1Y1ZA 1XVXA 4ZEBA 1MQHA 4U1ZA 3GLBA 2Z23A 1H44A 4DE8A 4DXBA 5ICQA 3MZBA 5TPAB 1NH8A 3MP1A 2ZMBA 3DP8A 3KSJA 4Q0CA 4EXLA 2D5WA 1OMPA 3HSTA 1GV8A 3FJMA 4G77A 4GLIA 4M4GA 3N6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MY3 A;  1R9Q A;  2ALU A;  1S9T A;  3FV2 A;  1D9Y A;  3FVO A;  3T9H B;  4KYE A;  5A5X B;  3T66 A;  2Z8E A;  4YMA A;  3VVF A;  2IA4 A;  5I2N B;  3MUQ A;  4OEV A;  3FVN A;  5I2K A;  1LFH A;  2XXU A;  1IEJ A;  1XOC A;  2I48 A;  2YPN A;  3PD9 A;  2NWJ A;  5DTB A;  1ZMG A;  3OO9 A;  4NF8 A;  1Z7N E;  3T9U A;  4HTG A;  3KG2 A;  1HSE A;  4GL0 A;  4QSC A;  1FW0 A;  3KOT A;  3TTL A;  2E1S A;  2DE3 A;  4ELP A;  4ZE9 A;  5I58 A;  3M8U A;  2QMX A;  3H3G A;  4EDP A;  1OVB A;  1OVT A;  3VVE A;  1QUJ A;  3PPN A;  5H8H B;  2V3Q A;  3MPL A;  2M8C A;  5DEX B;  3FV1 A;  1LLS A;  5DVI A;  3IB2 A;  3BKI B;  4I1D A;  3N6U A;  4KYD A;  2W7Y A;  1POT A;  3EHT A;  3HHG A;  4X1B A;  2PYY A;  4LUB A;  1B6H A;  2ONS A;  3DLN A;  3OO6 A;  5FHM A;  4QFK A;  3O66 A;  1KWH A;  2RKM A;  4IGR A;  2F34 A;  3TCH A;  4ZS9 A;  5HPQ A;  3T93 B;  2F8D A;  1VSO A;  4E0W A;  1IIT A;  1P99 A;  3MWB A;  4FEB A;  4H65 A;  4EQ9 A;  4F3S A;  3W15 C;  4G2Z A;  2F7B A;  2FNC A;  3C36 A;  1IUD A;  2XD3 A;  4JWY A;  1MDP 1;  3ONM A;  5EHS A;  4E0X A;  5DYH A;  4G8N A;  2BJJ X;  4OZ9 A;  3OO8 A;  2AIX A;  4R72 A;  3SKP A;  2F6G A;  2GFE A;  3EPE A;  4FED A;  1LAF E;  2I3W A;  2XX8 A;  4QSD A;  5H8F B;  2XD2 A;  5H8Q B;  2XXI A;  3O97 A;  2V84 A;  4F39 A;  4U2R A;  1M5C A;  1DSN A;  2DXY A;  2Q2A A;  3QYT A;  4WED A;  3M3L A;  5AA2 B;  5CRY A;  1WOD A;  5I59 A;  3B6W A;  3OEM A;  4K3F A;  1NH7 A;  4U23 A;  3TUS A;  2THI A;  3FVG A;  1B32 A;  2VD2 A;  3LBS A;  2UXA A;  1Y4C A;  1R1N A;  3TEL A;  1D4N A;  5J1D A;  5CMM A;  4LZ5 A;  2O69 A;  3K6U A;  3LSX A;  3FJG A;  1YCJ A;  1B51 A;  3CG1 A;  4WKM A;  3VLU A;  5L9O A;  2I0B A;  3RGY A;  3FVK A;  2A5T B;  3E9X A;  2IEE A;  1UTH A;  4LON B;  5I84 A;  4PET A;  1H76 A;  1A40 A;  2QMW A;  1MM6 A;  4OEN A;  3E3K A;  4KPT A;  4QF9 A;  4QHQ A;  1EZ9 A;  4RPN A;  4DXC A;  5A5X A;  2G29 A;  3V83 A;  1B52 A;  3KZG A;  3RUM A;  3PU5 A;  4R6Y A;  4EQ7 A;  3G3F A;  1UTB A;  3L6G A;  1PB9 A;  2ZXT A;  3CFL A;  4NED A;  2O84 X;  4ZEF A;  3SER A;  4XKN A;  1F9B A;  2PX1 A;  3OEL A;  1GGG A;  1BIY A;  1YAE A;  3C33 A;  1B1H A;  1B3L A;  3A3U A;  3O6G A;  1B3H A;  4IO5 A;  4OVJ A;  3K6V A;  1VR5 A;  1QUI A;  3N94 A;  4H67 A;  4JB7 A;  4LA9 A;  2OWT A;  4PFW A;  4RXL A;  5DVJ A;  2VGQ A;  5ICT A;  1B5H A;  3C4M A;  4ZE8 A;  3WAF A;  3VLV A;  3N5L A;  4XKQ A;  3GBB A;  1WVJ A;  1AOV A;  1JVY A;  2XXH A;  1SDX A;  3CG3 A;  1QJM A;  2ZNU A;  2H98 A;  2Y84 A;  3B6Q A;  3K0V A;  1LST A;  1NL5 A;  3KEI A;  4KD5 A;  4R2F A;  4YU0 A;  4Z7E A;  2B3F A;  4YIC A;  1H43 A;  4IO7 A;  4YKK A;  5LOM A;  3RPW A;  1UTH B;  3MW0 A;  5I58 B;  2HZL A;  3PMX A;  4R74 A;  5JTY A;  1B9J A;  2PBW A;  1QVS A;  3TDJ A;  1SI1 A;  2G93 A;  3O9P A;  4H5G A;  4ZED A;  2XXX A;  5DVF A;  4GRK A;  3T96 B;  4HS7 A;  5CM6 A;  3AXF A;  3K1M A;  4EF1 A;  3PPQ A;  1Q35 A;  1IXH A;  5K2X A;  4THI A;  1B0L A;  4ZDM A;  3QSL A;  5ITO A;  4F1V A;  3E13 X;  5AA4 A;  2NUV A;  1VFD A;  2I58 A;  4ISU A;  4U1O A;  2QPQ A;  2F7A A;  2GHB A;  3RNN A;  2DWA A;  1MPC A;  1N76 A;  1SW5 A;  4MLV A;  4EQB A;  3OSR A;  3IOR A;  1VE4 A;  1Y3N A;  4NF6 B;  3K00 A;  3K02 A;  3H06 B;  2XX7 A;  1FTO A;  1B7H A;  1MQJ A;  1A55 A;  1OIB A;  1MRP A;  4ND9 A;  2AL5 A;  2DSF A;  2H25 A;  3HPI A;  3Q28 A;  1Y20 A;  1EU8 A;  2DVC A;  3B7D A;  3IOT A;  3QIM A;  4OQO A;  1US5 A;  3IR1 A;  2REJ A;  4PP0 A;  5I57 A;  2XXW A;  3TEP A;  5I59 B;  4ZZE A;  4LQ5 A;  4R75 A;  4R2B A;  2DWH A;  1NNT A;  1JNF A;  1SYH A;  1YPN A;  3BBR A;  4TLL B;  3H4Z A;  3TKD A;  4BLA A;  1PEB A;  3O29 A;  3HHF A;  3OEK A;  4EUO A;  4F18 A;  1N84 A;  5H8Q A;  1FCK A;  1QUK A;  1A54 A;  2PT2 A;  4RPO A;  1YTV A;  4TQU Q;  3TTN A;  4DXU A;  2OK2 A;  4FEC A;  4OXV A;  3IJX B;  4MFI A;  3RT6 B;  3TQL A;  1QW0 A;  3S9M C;  1LCF A;  2DQV A;  2A5T A;  3JZJ A;  3O6I A;  4OMB A;  1MQG A;  3PMW A;  1FQB A;  1O64 A;  3IK6 B;  1P1U A;  1LAH E;  3Q25 A;  2Z8F A;  1USY E;  1Q1K A;  4KYS A;  5CMB A;  5I2K B;  2X7P A;  3KJT A;  3PPO A;  2HAV A;  3ZSF A;  2WKY A;  1M5E A;  3MP8 A;  4X9T A;  1FQC A;  2I0C A;  2ESN A;  3I3V A;  4Q5T A;  2D21 A;  1MY4 A;  1XT8 A;  2NXO A;  3I6V A;  2VP1 A;  2RC9 A;  1Y1M A;  1MG1 A;  3IB1 A;  4X1D A;  3EHU A;  2I4B A;  4LAT A;  1B3G A;  4NF6 A;  5I2N A;  4OWD A;  1B58 A;  2ZYM A;  1B5J A;  3H6U A;  4NF5 A;  4F19 A;  5TP9 B;  2I3V A;  3HCQ A;  4O3A A;  3QUJ A;  2OBG A;  4GQO A;  4R6K A;  1N3W A;  2ANJ A;  2H4I A;  4BDR A;  4Q8R A;  2XXY A;  3M3F A;  3V5A A;  1PBP A;  1UQW A;  1ZU0 A;  3Q27 A;  3D4C A;  2AL4 A;  2RC8 A;  4I62 A;  2H5Y A;  2O68 A;  2X26 A;  1LGB C;  2Y7R A;  2HFB A;  1S50 A;  2I4C A;  3K2D A;  3MP6 A;  4YKP A;  3RQT A;  4KFQ A;  3UOR A;  1P1W A;  2AYS A;  2CZL A;  4OET A;  5I56 A;  3MC2 A;  3O6H A;  4LP2 B;  4YB5 A;  4C1T A;  2B3B A;  1T0K A;  2Z8D A;  5JTY B;  1MXU A;  3C9H A;  3TAJ A;  3N26 A;  4RY1 A;  1FQE A;  1RYO A;  2HZK A;  1I6A A;  1JEV A;  2F78 A;  4C1U A;  2YJP A;  3PUV E;  1LB8 A;  3MVY A;  1BKA A;  1NMU A;  4U22 A;  3LC8 A;  3KJ7 A;  4JWX A;  4R73 A;  2ZYO A;  1LFG A;  3UP9 A;  1AH5 A;  1TT1 A;  2DS9 A;  2I49 A;  2Q2C A;  2V3U A;  3K01 A;  4RYA A;  4FE8 A;  3VVD A;  1R9L A;  3O28 A;  1POY 1;  1OLA A;  2OLB A;  3MBP A;  3TCF A;  4G4P A;  4GXA A;  1Z7M E;  2XXQ A;  4U21 A;  3LUY A;  2XXP A;  3R6U A;  3SDF A;  1MQI A;  2F7C A;  3U1O A;  4IB2 A;  3MZ1 A;  1MXY A;  5KDT A;  1TWY A;  4NF8 B;  1IIW A;  1IXG A;  4QSE A;  4XXU A;  4WEP A;  1MXZ A;  2Q88 A;  4O3C A;  4OFJ A;  3EN3 A;  4OER A;  3KSX A;  2R71 A;  2ZYK A;  3FXU A;  3G3H A;  4F3B A;  2H99 A;  3T9V A;  1B2H A;  2DOJ A;  3D4G A;  3IJO B;  3SEU A;  3S9N C;  5B7D A;  4H5F A;  3IL1 B;  2DE2 A;  3CR9 A;  2Q89 A;  1NNP A;  1SYI A;  3T9X B;  1B4Z A;  4Q30 B;  4GXS B;  1FTM A;  2PVU A;  3DEL B;  3WAE A;  1DMB A;  2FA7 A;  5H8H A;  1SI0 A;  3IAZ A;  1O63 A;  3VLW A;  4DLD A;  3G3G A;  3S9L C;  2O7I A;  5KCJ B;  1M5D A;  3CRB A;  3ILU B;  4U4S A;  4JSD A;  2QS4 A;  2DYX A;  3PUW E;  3K6W A;  4N07 A;  5EYF A;  5L8D A;  3FGS A;  3H03 A;  1ZIU A;  4H8I A;  4F3G A;  4YB7 A;  3RTW B;  1B5I A;  3G3K A;  1B4H A;  4ONY A;  3THI A;  3UN6 A;  2CMO A;  3FJ7 A;  3VFJ A;  4F1U A;  5AE4 A;  4IO4 A;  2NVU B;  1I6B A;  4DCX A;  1OQG A;  1PB7 A;  1B1X A;  2RCA A;  2QS2 A;  5TU0 A;  5L9M A;  3SEY A;  4MH5 A;  1NKX A;  3KGC A;  5HBC A;  3ILT B;  4F2O A;  1SW4 A;  1MY0 A;  2F5X A;  3KN3 A;  4LQ2 A;  1MPB A;  5AA2 A;  4QRZ A;  2OZZ A;  2HEU A;  1XHY A;  1SW1 A;  4PQJ A;  3T22 A;  1DPP A;  1JW5 A;  3CIJ A;  1PB8 A;  2B65 A;  2PMS A;  4TLM B;  3JYR A;  3U92 A;  1H3D A;  2VD3 A;  4IY5 A;  3TZA A;  2HAU A;  2Q9T A;  3VV5 A;  4FIM A;  2Y7I A;  4OTE A;  4TOZ A;  1D9V A;  1PDA A;  3B6T A;  3LSL A;  2Y7K A;  1URG A;  2OWS A;  3SET A;  4OES A;  4NWC A;  2Y7P A;  5CMK A;  1QKA A;  3V89 B;  3ZKK A;  4I9D A;  5BUU A;  1A8E A;  1FTJ A;  2UVI A;  4NWD A;  3IB0 A;  3MQ9 A;  4OEU A;  1LBC A;  3EHS A;  5I56 B;  5JEI A;  1LCT A;  1FQF A;  4G68 B;  4GFR A;  1N7W A;  4RK9 A;  1H45 A;  1WDN A;  2XHD A;  4NE4 A;  2H9B A;  3VXC A;  5AA3 A;  5FTH A;  3MZ9 A;  2DP8 A;  1GVC A;  4ESW A;  4DCY A;  4IGT A;  3LSW A;  3RT8 A;  3TQW A;  4X48 A;  4BDO A;  1USY H;  4F1Y A;  4R9G A;  4H6D A;  3TMG A;  3CFX A;  5AA4 B;  3BFT A;  4ZEK A;  4JBZ A;  2UVJ A;  1L5T A;  3R26 A;  5ELV A;  4BDN A;  5ITP A;  5I57 B;  5IKB A;  1A99 A;  1I6Q A;  1LB9 A;  3OSQ A;  3U72 A;  5AA2 D;  1BLF A;  3KN8 A;  1LAX A;  1NNK A;  2ZYN A;  3PUY E;  1MXX A;  4LZ7 A;  1UTB B;  3H6W A;  4QFO A;  4IO6 A;  4YAH X;  2PT1 A;  3IO6 A;  2GHA A;  4F31 B;  2RCB A;  1N7X A;  4JSO A;  4OYV A;  4U4X A;  5CBS A;  1S7Y A;  2VHA A;  3I5O A;  3G3I A;  4BDM A;  4QFP A;  4GVO A;  3TTK A;  3HN0 A;  4KI0 E;  3H6V A;  4BDQ A;  3U94 A;  2O6A A;  3PPP A;  1MDQ A;  1A8F A;  2VOZ A;  3IOU A;  5JK4 A;  2F97 A;  4RA1 A;  5M2V A;  1VFE A;  1DPE A;  1RKM A;  3PGF A;  4XKR A;  2F35 A;  2E0S A;  3OOA A;  5KCJ A;  2FYI A;  4GOT A;  2OCU A;  3PMV A;  4EF2 A;  4ESX A;  4FAT A;  4MLQ A;  5B70 A;  1MS7 A;  3K1N A;  1DTZ A;  2GRV A;  2ONR A;  4NF4 B;  3UK4 A;  1B05 A;  1TXF A;  2HCA A;  3FAT A;  4R9F A;  2NOO A;  2Q8J A;  5TP9 A;  4H0W A;  1HSL A;  1XC1 A;  3PV0 E;  5H8F A;  4F22 A;  4KHZ E;  4YZZ A;  4I8C A;  3OD7 A;  1MXW A;  5CMC A;  1Y3Q A;  2UVG A;  1TFD A;  4UA8 A;  3A09 A;  1FTL A;  3G7W A;  3QUF A;  5IAI A;  2UVH A;  1B46 A;  4G8H A;  3RTF B;  1SD3 A;  3KOS A;  1URS A;  1B3E A;  4N13 A;  1SVX B;  4ELO A;  2V25 A;  2XXR A;  4GL8 A;  3DM0 A;  2V3T A;  3OEN A;  3C31 A;  3HV1 A;  1AMF A;  2F36 A;  1OQH A;  3FAS A;  4OFL A;  5BWJ A;  3CSG A;  1FQD A;  1EZO A;  1TFA A;  2RC7 A;  1GR2 A;  2DWJ A;  3CI8 A;  3KN7 A;  1FTK A;  1P1O A;  3IOV A;  4C0R A;  3P7I A;  3C35 A;  3Q29 A;  3M3K A;  1MH4 A;  3LSF B;  4PFY A;  1B40 A;  4FJP A;  3LR1 A;  3S4U A;  3VE1 B;  1M5B A;  2O7U A;  4YKJ A;  3IX1 A;  4KR5 A;  2RIN A;  1I69 A;  1XVY A;  3TYH A;  3S9E A;  1MQD A;  4YKI A;  3UIF A;  1URD A;  5KDT B;  3C32 A;  2QJE A;  1II5 A;  3RY3 A;  2XX9 A;  4ELR A;  2QSX A;  2QS3 A;  4JDF A;  3GZG A;  2V93 A;  1UIU A;  4GF8 A;  1NNF A;  4P0I A;  1ATG A;  3TOD A;  1B0H A;  2QS1 A;  4NF5 B;  4PFU A;  4RK2 A;  4F2Q A;  3K4U A;  2REG A;  2P0S A;  3Q26 A;  1AIV A;  3QXM A;  3OXN A;  4KQP A;  1CB6 A;  3FIR A;  2O51 A;  2Y7W A;  4NTL A;  3TPA A;  4LZ8 A;  4WXJ A;  4DIG A;  1ZKB A;  1B7Z A;  5KZT A;  3EQ1 A;  3MVW A;  2P1S A;  1DOT A;  1JVX A;  1N04 A;  1R6Z A;  5H8N B;  3A3C A;  4F3P A;  2D3I A;  4GIZ A;  1SW2 A;  3DP6 A;  4IO3 A;  3IO4 A;  4H8J A;  2YLN A;  1JEU A;  2ZNT A;  3SEV A;  4O3B A;  4DZ1 A;  2O1M A;  4DDD A;  3FUZ A;  1GTK A;  4ZEI A;  3VXB A;  3MVZ A;  5FHO A;  4HCW A;  3UGW A;  2Z22 A;  1AL3 A;  3MAM A;  3MVX A;  5HM4 B;  1LAG E;  3FXR A;  1Y9U A;  2XXT A;  1QKB A;  4JXI A;  2UYF A;  3TTR A;  1MM7 A;  2P2A A;  4JWO A;  4OFO A;  2DWI A;  4MF3 A;  3MJN A;  5TPA A;  3IOW A;  3K6X A;  1ZBM A;  4NMY A;  1PBQ A;  1CE2 A;  4IY6 A;  1P1Q A;  1NFT A;  4N6P A;  4KCC A;  3QK6 A;  1IXI A;  3PD8 A;  3H6T A;  3CVG A;  1DTG A;  2OJT A;  3O2A A;  5F7V A;  4ZZA A;  3U93 A;  4FOR A;  1Y4T A;  3K1P A;  3MPK A;  4G8M A;  4LVQ A;  3OMB A;  5FTI A;  3BFU A;  1SBP A;  1A7L A;  1BP5 A;  1P1N A;  2GH9 A;  1MXV A;  2QL3 A;  3HO7 A;  1UIV A;  4IO2 A;  1B7U A;  4PE5 B;  5EHM A;  4FAJ A;  1MY2 A;  1ZLQ A;  1Y3P A;  5H8S A;  3QAX A;  4GWO A;  5K2Y A;  4AQ4 A;  1N0T A;  1HSJ A;  5DEX A;  4UAC A;  4XTC Q;  2I6E A;  3FXQ A;  3KBR A;  2DE4 A;  1ELJ A;  1J1N A;  1MPD A;  3H7M A;  5CBR A;  3V8X B;  2UYE A;  2F6P A;  3R7X A;  1IQ7 A;  1JW4 A;  2O1L A;  3ECR A;  4F29 A;  1BTJ A;  4R6H A;  5CI5 A;  4AB6 A;  3W9W A;  4QFL A;  4G68 A;  4POW A;  2ONK E;  1XS5 A;  3E4R A;  3L6H A;  3TTM A;  3ODB A;  3VDF A;  3PPR A;  5L9S A;  2DVZ A;  5DT6 A;  5AA1 A;  4HW8 A;  2X7Q A;  2R6G E;  4QFN A;  4Z0I A;  1IXC A;  1MH3 A;  3G3J A;  4OHN A;  3W9V A;  3ZS6 A;  1OLC A;  3RN8 A;  5CC2 A;  3S2V A;  2HQ0 A;  1B3F A;  1EH3 A;  1PC3 A;  4BDL A;  1SQY A;  3SEX A;  1ZJL A;  4P11 A;  1N3X A;  2A5S A;  3F11 A;  4AB5 A;  1JQF A;  4M1V A;  1FQA A;  3SEW A;  1LFI A;  1QUL A;  3TFL A;  2R9J A;  2HXW A;  3C34 A;  4G68 C;  4YB6 A;  1EZP A;  3PUZ E;  1IZ1 A;  3CFZ A;  3U8Q A;  2KLF A;  1RYX A;  3OO7 A;  4RNS A;  4P0G A;  1M5F A;  4POX A;  4H1X A;  3RLF E;  5H8N A;  3USD A;  1MY1 A;  3EF7 A;  3GBA A;  4EXK A;  4L17 A;  2DXR A;  4KCD A;  2XXV A;  3KFM A;  4XIG Q;  2QRY A;  4HCY A;  1LBB A;  2ZNS A;  3FD3 A;  5FHN A;  1D3K A;  3ZKL A;  1US4 A;  4GD5 A;  3TCG A;  4XKP A;  1ZTY A;  1JW1 A;  4YMB A;  2RF1 A;  5F1Q A;  4RJZ A;  4PFT A;  4ECF A;  2LAO A;  4ZEC A;  4ELQ A;  4NF4 A;  4MBP A;  1ANF A;  1O7T A;  3JV9 A;  3FZV A;  5ISU A;  3CSB A;  1JET A;  3DP4 A;  3GXA A;  2ABH A;  3PUX E;  3SES A;  3UA8 A;  1Y1Z A;  1XVX A;  4ZEB A;  1MQH A;  4U1Z A;  3GLB A;  2Z23 A;  1H44 A;  4DE8 A;  4DXB A;  5ICQ A;  3MZB A;  5TPA B;  1NH8 A;  3MP1 A;  2ZMB A;  3DP8 A;  3KSJ A;  4Q0C A;  4EXL A;  2D5W A;  1OMP A;  3HST A;  1GV8 A;  3FJM A;  4G77 A;  4GLI A;  4M4G A;  3N6T A; 
#chains in the Genus database with same CATH topology
 1MY3 A;  4PAK A;  1D9Y A;  3T9H B;  4YMA A;  2IA4 A;  3MUQ A;  3FVN A;  4P1L A;  2XXU A;  1XOC A;  2YPN A;  4PAF A;  5DTB A;  1ZMG A;  4HE1 A;  3M8U A;  1OVB A;  5H8H B;  5DEX B;  4PBQ A;  3HHG A;  3OO6 A;  3O66 A;  4IGR A;  2F34 A;  1VSO A;  3MWB A;  2FNC A;  3C36 A;  1IUD A;  4NQ8 A;  4E0X A;  5DYH A;  1LAF E;  3QYT A;  1DSN A;  3M3L A;  3B6W A;  3OEM A;  4K3F A;  1NH7 A;  4GWZ A;  3LBS A;  2UXA A;  1Y4C A;  5CMM A;  3K6U A;  4WKM A;  1B51 A;  2IEE A;  4LON B;  4PET A;  4RPN A;  3E3K A;  3V83 A;  4EQ7 A;  1PB9 A;  2ZXT A;  4NED A;  4ZEF A;  3OEL A;  4OVJ A;  1B3L A;  3N94 A;  4GX4 A;  2VGQ A;  5ICT A;  3WAF A;  3N5L A;  4XKQ A;  3GBB A;  1WVJ A;  1JVY A;  4MAG A;  4R2F A;  4YIC A;  5LOM A;  2HZL A;  2PBW A;  2F3D A;  2XXX A;  5DVF A;  4GRK A;  3K1M A;  1Q35 A;  1IXH A;  4THI A;  5ITO A;  1SW5 A;  3OSR A;  1VE4 A;  3K00 A;  1B7H A;  3Q28 A;  1Y20 A;  3IOT A;  4PP0 A;  5IZ3 A;  5I57 A;  3TEP A;  2DWH A;  1NNT A;  4BLA A;  3OEK A;  4F18 A;  1N84 A;  4TQU Q;  1RDZ A;  4DXU A;  4MFI A;  3TQL A;  2DQV A;  2A5T A;  3KBZ A;  4OMB A;  2CZH A;  1LAH E;  2WBB A;  4Q5T A;  2VP1 A;  3IB1 A;  4LAT A;  4OWD A;  2FHY A;  3HCQ A;  3QUJ A;  1QGX A;  2OBG A;  4GQO A;  2H4I A;  1JP4 A;  1VDW A;  3M3F A;  4XFE A;  3Q27 A;  3D4C A;  2HPG A;  2RC8 A;  2ZZV A;  2X26 A;  3B8B A;  2HFB A;  1S50 A;  3FBP A;  4KFQ A;  3UOR A;  3O6H A;  4YB5 A;  4PDD A;  2B3B A;  1T0K A;  2Z8D A;  5JTY B;  3C9H A;  1IMC A;  3N26 A;  1I6A A;  1JEV A;  3PUV E;  4PGP A;  3MVY A;  3LC8 A;  3KJ7 A;  4JWX A;  1LFG A;  3UP9 A;  4RYA A;  4FE8 A;  1POY 1;  3TCF A;  4GBV A;  4G4P A;  2XXQ A;  1MQI A;  2F7C A;  5KDT A;  1MXY A;  1TWY A;  1IIW A;  4QSE A;  1NV2 A;  2ZYK A;  3G3H A;  3T9V A;  4H5F A;  3IL1 B;  2PVU A;  5H8H A;  1O63 A;  3S9L C;  2O7I A;  3ILU B;  1YXI A;  2QS4 A;  1FPB A;  2DYX A;  3K6W A;  4N07 A;  5L8D A;  3H03 A;  4F3G A;  4ONY A;  2VPN A;  4DCX A;  1PB7 A;  3KGC A;  1RDX A;  1SW4 A;  4LQ2 A;  5AA2 A;  4DI4 B;  3JYR A;  3U92 A;  2VD3 A;  4IY5 A;  3B6T A;  3LSL A;  3SET A;  2OWS A;  1QKA A;  3ZKK A;  1FTJ A;  4NWD A;  4OEU A;  1LBC A;  1LCT A;  1H45 A;  1WDN A;  3MST A;  5FTH A;  3MZ9 A;  2DP8 A;  3RT8 A;  3TQW A;  5AA4 B;  4H6D A;  4ZEK A;  1L5T A;  4OVP A;  1LB9 A;  1BLF A;  3H6W A;  2GHA A;  1N7X A;  4JSO A;  2VHA A;  4BDM A;  4KI0 E;  1NUW A;  2F97 A;  4RA1 A;  5M2V A;  1DPE A;  3PGF A;  2F35 A;  1FPD A;  4GOT A;  3PMV A;  4MLQ A;  3K1N A;  1FTA A;  1TXF A;  2HCA A;  2NOO A;  1XC1 A;  4I8C A;  3OD7 A;  3LV0 A;  5IAI A;  3KOS A;  1B3E A;  4ELO A;  4GL8 A;  2V3T A;  1EZO A;  2PFZ A;  2RC7 A;  3CI8 A;  3KN7 A;  3IOV A;  3P7I A;  3M3K A;  3LSF B;  1B40 A;  3LR1 A;  2O7U A;  4PFI A;  1I69 A;  4MMP A;  3TYH A;  2QJE A;  2XX9 A;  4JDF A;  2QS3 A;  3GZG A;  1NNF A;  4PFU A;  3K4U A;  3QXM A;  2O51 A;  4NTL A;  4DIG A;  1B7Z A;  1N04 A;  2D3I A;  1SW2 A;  4DZ1 A;  3VXB A;  2FIE A;  3MVZ A;  5FHO A;  1Y9U A;  2UYF A;  4OFO A;  2XXK A;  3IOW A;  4NMY A;  4IY6 A;  3SZP A;  1IXI A;  3H6T A;  5F7V A;  4ZZA A;  4FOR A;  3OMB A;  5FTI A;  3BFU A;  4MX6 A;  1P1N A;  4IO2 A;  4PE5 B;  1UIV A;  4FAJ A;  1ZLQ A;  1Y3P A;  3QAX A;  4AQ4 A;  1NUZ A;  3FXQ A;  3KBR A;  4PC9 A;  1ELJ A;  3H7M A;  2O1L A;  1JW4 A;  3ECR A;  4F29 A;  4MJO A;  3ODB A;  3VDF A;  3PPR A;  5DT6 A;  2X7Q A;  4Z0I A;  1EYI A;  3G3J A;  4OHN A;  3W9V A;  1OLC A;  3RN8 A;  3S2V A;  1N3X A;  2A5S A;  3F11 A;  3TFL A;  1IZ1 A;  1RDY A;  4P0G A;  3USD A;  3RLF E;  4P1E A;  4EXK A;  3GBA A;  4L17 A;  4KCD A;  1LBB A;  3FD3 A;  5FHN A;  1D3K A;  3ZKL A;  4GD5 A;  1JW1 A;  2B4L A;  2OWZ A;  5F1Q A;  4RJZ A;  4PFT A;  4MBP A;  1ANF A;  1O7T A;  2P3N A;  3PUX E;  1MQH A;  3MZB A;  5TPA B;  2ZMB A;  3KSJ A;  4Q0C A;  3HST A;  4G77 A;  4NGU A;  4HE0 A;  2ALU A;  5A5X B;  4KYE A;  3T66 A;  2Z8E A;  5I2N B;  1LFH A;  2I48 A;  3PD9 A;  3OO9 A;  1Z7N E;  3KG2 A;  1HSE A;  4GL0 A;  4QSC A;  3TTL A;  2E1S A;  5I58 A;  2QMX A;  1QUJ A;  3PPN A;  2V3Q A;  3MPL A;  1FSA A;  5DVI A;  3IB2 A;  4I1D A;  1FBC A;  4X1B A;  2ONS A;  3DLN A;  4QFK A;  5EQA A;  4E0W A;  1P99 A;  1BK4 A;  4F3S A;  4FEB A;  4EQ9 A;  4G2Z A;  2F7B A;  2XD3 A;  4JWY A;  1MDP 1;  4OZ9 A;  3OO8 A;  4R72 A;  3SKP A;  3EPE A;  4FED A;  2I3W A;  2XD2 A;  2XXI A;  3O97 A;  4U2R A;  1M5C A;  2DXY A;  5CRY A;  1WOD A;  5I59 A;  2Q74 A;  3TUS A;  1G0H A;  1KA1 A;  5J1D A;  4LZ5 A;  4MHF A;  2XWK A;  3FJG A;  3CG1 A;  4N4U A;  2I0B A;  4N91 A;  3FVK A;  3E9X A;  3RGY A;  5I84 A;  1H76 A;  4QF9 A;  1MM6 A;  4OEN A;  4QHQ A;  2GQ1 A;  4DXC A;  2G29 A;  3KZG A;  1SPI A;  4N6D A;  3PU5 A;  4NAP A;  4R6Y A;  1UTB A;  3L6G A;  3CFL A;  1F9B A;  5EQ9 A;  1B1H A;  3K6V A;  4LA9 A;  1FJ9 A;  4PFW A;  2XXH A;  3W15 C;  1QJM A;  2ZNU A;  2Y84 A;  3B6Q A;  1LST A;  3KEI A;  4Z7E A;  2V4C A;  4PFB A;  4YKK A;  1UTH B;  4R74 A;  1SI1 A;  2G93 A;  4ZED A;  3T96 B;  4HS7 A;  3AXF A;  4GWU A;  3QSL A;  4F1V A;  5AA4 A;  3CHG A;  2I58 A;  3IOR A;  1MQJ A;  1A55 A;  2DSF A;  1US5 A;  1NUY A;  2CZK A;  3IR1 A;  4R2B A;  1SYH A;  3BBR A;  1IMB A;  3TKD A;  4EUO A;  4N15 A;  5H8Q A;  1QUK A;  1A54 A;  4RPO A;  1YTV A;  2OK2 A;  3IJX B;  1QW0 A;  3JZJ A;  3PMW A;  3Q25 A;  1FQB A;  1O64 A;  1P1U A;  2P3V A;  2X7P A;  3PPO A;  1M5E A;  4NHB A;  1FQC A;  2I0C A;  2ESN A;  3I3V A;  2NXO A;  1XT8 A;  2RC9 A;  1Y1M A;  4X1D A;  5TP9 B;  2I3V A;  4BDR A;  5IM2 A;  3V5A A;  1FPI A;  1UQW A;  4XF5 A;  2O68 A;  5H8N B;  1LGB C;  2AYS A;  4C1T A;  1MXU A;  4RY1 A;  1FBH A;  2YJP A;  1LB8 A;  3D1R A;  1BKA A;  4X04 A;  2DS9 A;  3K01 A;  4F1U A;  1OLA A;  3LUY A;  2XXP A;  4IB2 A;  4G61 A;  4OER A;  1AWB A;  3FXU A;  4F3B A;  3IJO B;  5B7D A;  2DE2 A;  3T9X B;  1FPJ A;  4Q30 B;  1SI0 A;  3IAZ A;  4DLD A;  4U4S A;  1DBZ A;  3FGS A;  3THI A;  3UN6 A;  3FJ7 A;  5AE4 A;  1DCU A;  1I6B A;  1B1X A;  5TU0 A;  4F2O A;  1NKX A;  3ILT B;  3KN3 A;  1FPE A;  1NV1 A;  4QRZ A;  2OZZ A;  4O8M A;  2HEU A;  4TLM B;  1JW5 A;  3CIJ A;  1KZ8 A;  4TOZ A;  3EKI A;  1PDA A;  1URG A;  4NWC A;  4AS4 A;  4GBW A;  2WYP A;  1A8E A;  2ZZW A;  3IB0 A;  5JEI A;  1FQF A;  4G68 B;  3VXC A;  2XHD A;  2H9B A;  4ESW A;  3LSW A;  4X48 A;  3CFX A;  4JBZ A;  4UAB A;  3R26 A;  4BDN A;  5I5P A;  4PTK A;  5IKB A;  3OSQ A;  2ZYN A;  1NV5 A;  1FPL A;  1LBW A;  4QFO A;  4F31 B;  4OYV A;  1S7Y A;  3G3I A;  4GVO A;  3H6V A;  2O6A A;  1MDQ A;  2VOZ A;  3IOU A;  1RKM A;  5KCJ A;  2OCU A;  4EF2 A;  4FAT A;  1MS7 A;  3UK4 A;  2BJI A;  1B05 A;  2HXR A;  4F22 A;  2KQZ A;  3QUF A;  2UVH A;  4N13 A;  1SVX B;  3DM0 A;  3OEN A;  3FAS A;  4OFL A;  1TFA A;  2DWJ A;  3E78 A;  3RYD A;  3C35 A;  3Q29 A;  2WYK A;  5ET7 A;  3S4U A;  3S9E A;  5KDT B;  3C32 A;  1FBG A;  3RY3 A;  4ELR A;  4P0I A;  4F2Q A;  4KQP A;  1CB6 A;  3HFU A;  4WXJ A;  1ZKB A;  5KZT A;  3MVW A;  2P1S A;  1JVX A;  4MEV A;  4F3P A;  3DP6 A;  4IO3 A;  2VPO A;  2JJK A;  3SEV A;  4PFR A;  4DDD A;  3FUZ A;  4ZEI A;  4OAN A;  3UGW A;  4MNP A;  2Z22 A;  3MVX A;  5HM4 B;  3FXR A;  2PFY A;  4JXI A;  3TTR A;  2P2A A;  4JWO A;  4DI3 D;  4MF3 A;  1CE2 A;  1NFT A;  4KCC A;  2OJT A;  2Y5K A;  3K1P A;  3MPK A;  4G8M A;  3V89 B;  4LUB A;  1SBP A;  1A7L A;  1BP5 A;  2QL3 A;  3HO7 A;  4GWO A;  1N0T A;  4PF6 A;  4XTC Q;  4NN3 A;  4N6K A;  1J1N A;  1MPD A;  3R7X A;  5IGA A;  3W9W A;  4POW A;  3L6H A;  3TTM A;  1LEV A;  4O7I A;  5CMK A;  1PC3 A;  4HXV A;  3SEX A;  1ZJL A;  5I7I A;  1FQA A;  2ZZX A;  1QUL A;  2HXW A;  4P56 A;  2KLF A;  4POX A;  5IZ1 A;  4H1X A;  1MY1 A;  3EF7 A;  2CEX A;  2WEF A;  1US4 A;  2DDK A;  5J16 A;  2LAO A;  4ZEC A;  5ISU A;  3CSB A;  1JET A;  1FPF A;  3GXA A;  3SES A;  3UA8 A;  1XVX A;  4ZEB A;  4GX6 A;  3GLB A;  4DE8 A;  5ET6 A;  1NH8 A;  2B4M A;  4OA4 A;  2D5W A;  4GLI A;  3U65 A;  3FV2 A;  1S9T A;  4H46 A;  5EQ8 A;  4NG7 A;  2CEY A;  4NF8 A;  4HTG A;  1FW0 A;  2DE3 A;  4ELP A;  4ZE9 A;  3VVE A;  3FV1 A;  1LLS A;  3BKI B;  1NUX A;  4KYD A;  2W7Y A;  3EHT A;  2PYY A;  1B6H A;  5FHM A;  3TCH A;  3T93 B;  5DW8 A;  2F8D A;  4H65 A;  5EHS A;  2BJJ X;  2F6G A;  2XX8 A;  5H8F B;  2V84 A;  4WED A;  4GWW A;  2Q2A A;  4U23 A;  1XI6 A;  1B32 A;  4NX1 A;  3TEL A;  2O69 A;  3LSX A;  2A5T B;  1UTH A;  1A40 A;  2QMW A;  4KPT A;  3RUM A;  2PX1 A;  1BIY A;  3O6G A;  4MIJ A;  3TDJ A;  1QUI A;  4H67 A;  2OWT A;  2XA5 A;  4N17 A;  4ZE8 A;  1AOV A;  1SDX A;  3NOH A;  2H98 A;  4KD5 A;  1K9Y A;  4IO7 A;  5I58 B;  1B9J A;  4H5G A;  3O9P A;  1B0L A;  2NUV A;  1VFD A;  4ISU A;  4U1O A;  2QPQ A;  2DWA A;  1KA0 A;  1MPC A;  4EQB A;  4NF6 B;  5FBP A;  3FXB A;  3MYU A;  2F3B A;  2H25 A;  3HPI A;  1EU8 A;  2DVC A;  2QFL A;  4PGN A;  2REJ A;  4PF8 A;  4GWX A;  4ZZE A;  4R75 A;  2OX3 A;  4TLL B;  1PEB A;  3O29 A;  3TTN A;  3RT6 B;  1LCF A;  5CMB A;  4KYS A;  1Q1K A;  5I2K B;  3KJT A;  2HAV A;  3ZSF A;  2WKY A;  3MP8 A;  1EYK A;  2D21 A;  1MY4 A;  1MG1 A;  5I2N A;  3EHU A;  1B3G A;  3H6U A;  1N3W A;  4I62 A;  4YKP A;  3MP6 A;  4JVI A;  5EYH A;  2CZL A;  4OET A;  1FPG A;  4LP2 B;  5LTC A;  1RYO A;  4U22 A;  2ZYO A;  1AH5 A;  2I49 A;  2V3U A;  1R9L A;  3O28 A;  2OLB A;  4GXA A;  5LDZ A;  1Z7M E;  2FBP A;  3SDF A;  3MZ1 A;  4XXU A;  1MXZ A;  2H99 A;  4MNI A;  1B2H A;  2DOJ A;  3S9N C;  1YZ0 A;  3CR9 A;  2Q89 A;  1NNP A;  5F24 A;  3G3G A;  5KCJ B;  1FPK A;  3PUW E;  3RTW B;  3G3K A;  3VFJ A;  1OQG A;  3A29 A;  2QS2 A;  5L9M A;  4MH5 A;  5HBC A;  1MY0 A;  2F5X A;  1G0I A;  1SW1 A;  4PQJ A;  3T22 A;  1DPP A;  2QVR A;  3TZA A;  2Q9T A;  3VV5 A;  4N8Y A;  1D9V A;  4OES A;  2Y7P A;  2UVI A;  3MQ9 A;  5I56 B;  5AA3 A;  4DCY A;  1USY H;  4R9G A;  2XWV A;  5ELV A;  5ITP A;  1A99 A;  3KN8 A;  1LAX A;  1IMF A;  1MXX A;  4IO6 A;  2PT1 A;  2RCB A;  1NI9 A;  3TTK A;  5JK4 A;  1VFE A;  2E0S A;  4NF4 B;  2HHM A;  4R9F A;  2Q8J A;  5TP9 A;  4H0W A;  4H45 A;  3PV0 E;  5I3S A;  5H8F A;  2UVG A;  1TFD A;  3A09 A;  1FTL A;  3BIG A;  3G7W A;  3LUZ A;  1B46 A;  3PTY A;  2V25 A;  2XXR A;  3HV1 A;  1AMF A;  3CSG A;  5ESY A;  1YYZ A;  1FTK A;  1P1O A;  4C0R A;  1FBD A;  4PFY A;  4FJP A;  4YKJ A;  3IX1 A;  4KR5 A;  2RIN A;  1MQD A;  5ET8 A;  1II5 A;  2QSX A;  1UIU A;  4GF8 A;  1B0H A;  4OVQ A;  2REG A;  3OXN A;  2Y7W A;  4P9K A;  4QBA A;  4O3B A;  2O1M A;  1EYJ A;  1AL3 A;  3MAM A;  1FRP A;  2XXT A;  1MM7 A;  1ZBM A;  1P1Q A;  3GYY A;  3O2A A;  1Y4T A;  5EHM A;  1B7U A;  1MY2 A;  5H8S A;  5K2Y A;  1D9Q A;  2I6E A;  3E79 A;  5CBR A;  3V8X B;  4LN5 A;  5T3J A;  1BTJ A;  4FBP A;  5CI5 A;  5A5L A;  2ONK E;  3E4R A;  2FIX A;  2QVU A;  5AA1 A;  4BDO A;  2QVV A;  3ZS6 A;  4BDL A;  2HQ0 A;  1B3F A;  4JVC A;  1SQY A;  2VT5 A;  3KC0 A;  4P11 A;  4AB5 A;  1JQF A;  3SEW A;  4YB6 A;  1EZP A;  3PUZ E;  3U8Q A;  4OVS A;  3OO7 A;  4AS5 A;  4RNS A;  1M5F A;  2DXR A;  2XXV A;  1NV7 A;  3KFM A;  1ZTY A;  1IMA A;  3FZV A;  3DP4 A;  1Y1Z A;  1LBX A;  4U1Z A;  2Z23 A;  1FBF A;  1H44 A;  4DXB A;  5ICQ A;  4O7M A;  4I40 A;  3DP8 A;  1OMP A;  1DK4 A;  1R9Q A;  3FVO A;  3VVF A;  4OEV A;  5I2K A;  1IEJ A;  2NWJ A;  3T9U A;  3KOT A;  1FBP A;  3H3G A;  4EDP A;  1OVT A;  2M8C A;  5ET5 A;  3N6U A;  1POT A;  4OVR A;  4I3E A;  3T0J A;  1KWH A;  2RKM A;  4ZS9 A;  5HPQ A;  1IIT A;  3BIH A;  3ONM A;  4G8N A;  2AIX A;  2GFE A;  2Y5L A;  4QSD A;  4O94 A;  5H8Q B;  4F39 A;  5AA2 B;  2THI A;  3FVG A;  1IME A;  2VD2 A;  4PCD A;  1R1N A;  3ISP A;  1D4N A;  1YCJ A;  3VLU A;  5L9O A;  1EZ9 A;  4PBH A;  5A5X A;  1B52 A;  4PE3 A;  3G3F A;  2O84 X;  3SER A;  4XKN A;  1GGG A;  1YAE A;  4IO5 A;  3C33 A;  3A3U A;  1B3H A;  1VR5 A;  4JB7 A;  4RXL A;  5DVJ A;  1B5H A;  3C4M A;  3VLV A;  3CG3 A;  1NV6 A;  3K0V A;  4YU0 A;  1NL5 A;  2B3F A;  3ROJ A;  1H43 A;  3RPW A;  3MW0 A;  3PMX A;  5JTY A;  1QVS A;  5CM6 A;  4EF1 A;  3PPQ A;  5K2X A;  4ZDM A;  1LBY A;  3E13 X;  2F7A A;  2GHB A;  3RNN A;  1N76 A;  4MLV A;  1Y3N A;  3K02 A;  3H06 B;  2XX7 A;  1FTO A;  1OIB A;  1MRP A;  4ND9 A;  2AL5 A;  3QIM A;  3B7D A;  4OQO A;  4XEQ A;  4N8G A;  2XXW A;  2R8T A;  5I59 B;  4LQ5 A;  1YPN A;  1JNF A;  2XWI A;  3H4Z A;  3HHF A;  2KR0 A;  1FCK A;  2PT2 A;  4FEC A;  4OXV A;  4PDH A;  3S9M C;  3O6I A;  1MQG A;  4NF4 A;  3IK6 B;  3U93 A;  2Z8F A;  1USY E;  4X9T A;  2FVZ A;  3I6V A;  4NF6 A;  2I4B A;  1B58 A;  2ZYM A;  1B5J A;  4NF5 A;  4F19 A;  4O3A A;  4R6K A;  4Q8R A;  1CNQ A;  2ANJ A;  2XXY A;  1PBP A;  1ZU0 A;  1FBE A;  2AL4 A;  2H5Y A;  2Y7R A;  3K2D A;  2I4C A;  3RQT A;  1P1W A;  4X8R A;  5I56 A;  3MC2 A;  4PAI A;  3RPL A;  3TAJ A;  1FQE A;  2HZK A;  2F78 A;  4C1U A;  1NMU A;  1NV3 A;  4R73 A;  1TT1 A;  2Q2C A;  3VVD A;  3MBP A;  4U21 A;  3R6U A;  3U1O A;  4NF8 B;  1IXG A;  4WEP A;  2Q88 A;  4O3C A;  4OFJ A;  3EN3 A;  3KSX A;  2R71 A;  3T1B A;  3D4G A;  3SEU A;  1SYI A;  1B4Z A;  2XWO A;  4GXS B;  1FTM A;  3RPL B;  3DEL B;  3WAE A;  1DMB A;  2FA7 A;  3VLW A;  1FJ6 A;  1M5D A;  3CRB A;  2L5V A;  4JSD A;  4KXP A;  5EYF A;  1ZIU A;  3KC1 A;  4H8I A;  4YB7 A;  1B5I A;  1B4H A;  1K9Z A;  2CMO A;  4IO4 A;  2NVU B;  2RCA A;  3SEY A;  4GX3 A;  1MPB A;  1XHY A;  1PB8 A;  2B65 A;  2PMS A;  2WX9 A;  1H3D A;  2HAU A;  4FIM A;  2Y7I A;  4OTE A;  2Y7K A;  4I9D A;  5BUU A;  1IMD A;  1NV0 A;  3EHS A;  4GFR A;  4RK9 A;  1N7W A;  4NE4 A;  5EYG A;  1GVC A;  4IGT A;  3IFA A;  4F1Y A;  3TMG A;  3BFT A;  1LBZ A;  2UVJ A;  5IZ3 B;  5I57 B;  1I6Q A;  2Q8M A;  3U72 A;  5AA2 D;  1NNK A;  3PUY E;  4LZ7 A;  1UTB B;  4YAH X;  3IO6 A;  4U4X A;  5CBS A;  3I5O A;  2WBD A;  4QFP A;  3HN0 A;  3U94 A;  3IFC A;  3PPP A;  1A8F A;  4GWS A;  4XKR A;  3OOA A;  2FYI A;  4QXD A;  4ESX A;  5B70 A;  1DTZ A;  2GRV A;  2ONR A;  4HE2 A;  3FAT A;  4JVD A;  1HSL A;  4KHZ E;  4YZZ A;  1MXW A;  5CMC A;  1Y3Q A;  4UA8 A;  4G8H A;  4P8B A;  3RTF B;  1SD3 A;  1URS A;  3C31 A;  2F36 A;  1OQH A;  5BWJ A;  1FQD A;  1GR2 A;  2MKZ A;  4IR8 A;  4MNC A;  4P47 A;  1MH4 A;  3VE1 B;  1M5B A;  1XVY A;  4YKI A;  3UIF A;  1URD A;  2V93 A;  1ATG A;  3TOD A;  4NF5 B;  2QS1 A;  4RK2 A;  3Q26 A;  2P0S A;  1AIV A;  1INP A;  5IZZ A;  3FIR A;  4NF0 A;  3TPA A;  4LZ8 A;  3EQ1 A;  1DOT A;  1R6Z A;  3A3C A;  4GIZ A;  4I3Y A;  1NV4 A;  3IO4 A;  2YLN A;  1JEU A;  2ZNT A;  4H8J A;  1GTK A;  4HCW A;  1LBV A;  1LAG E;  1QKB A;  2DWI A;  3MJN A;  5TPA A;  3K6X A;  1PBQ A;  4N6P A;  3QK6 A;  3PD8 A;  3CVG A;  1DTG A;  4MCO A;  4N81 A;  4LVQ A;  2GH9 A;  4BDQ A;  1MXV A;  4P3L A;  1HSJ A;  5DEX A;  2PCR A;  4UAC A;  2DE4 A;  2UYE A;  2F6P A;  1IQ7 A;  4R6H A;  4AB6 A;  4QFL A;  4G68 A;  1XS5 A;  5L9S A;  2DVZ A;  4HW8 A;  2R6G E;  4QFN A;  1IXC A;  1MH3 A;  5CC2 A;  1Q9D A;  1EH3 A;  3QMF A;  4M1V A;  1LFI A;  2R9J A;  4G68 C;  3C34 A;  3CFZ A;  1RYX A;  4GWY A;  5H8N A;  4OVT A;  4XIG Q;  2QRY A;  4HCY A;  5EQ7 A;  2ZNS A;  3TCG A;  4XKP A;  4YMB A;  2RF1 A;  4ECF A;  4ELQ A;  3JV9 A;  2ABH A;  2CZI A;  3MP1 A;  4EXL A;  1GV8 A;  3FJM A;  4M4G A;  3B50 A;  3N6T A; 
#chains in the Genus database with same CATH homology
 1MY3 A;  1R9Q A;  2ALU A;  1S9T A;  3FV2 A;  1D9Y A;  3FVO A;  3T9H B;  4KYE A;  5A5X B;  3T66 A;  2Z8E A;  4YMA A;  3VVF A;  2IA4 A;  5I2N B;  3MUQ A;  4OEV A;  3FVN A;  5I2K A;  1LFH A;  2XXU A;  1IEJ A;  1XOC A;  2I48 A;  2YPN A;  3PD9 A;  2NWJ A;  5DTB A;  1ZMG A;  3OO9 A;  4NF8 A;  1Z7N E;  3T9U A;  4HTG A;  3KG2 A;  1HSE A;  4GL0 A;  4QSC A;  1FW0 A;  3KOT A;  3TTL A;  2E1S A;  2DE3 A;  4ELP A;  4ZE9 A;  5I58 A;  3M8U A;  2QMX A;  3H3G A;  4EDP A;  1OVB A;  1OVT A;  3VVE A;  1QUJ A;  3PPN A;  5H8H B;  2V3Q A;  3MPL A;  2M8C A;  5DEX B;  3FV1 A;  1LLS A;  5DVI A;  3IB2 A;  3BKI B;  4I1D A;  3N6U A;  4KYD A;  2W7Y A;  1POT A;  3EHT A;  3HHG A;  4X1B A;  2PYY A;  4LUB A;  1B6H A;  2ONS A;  3DLN A;  3OO6 A;  5FHM A;  4QFK A;  3O66 A;  1KWH A;  2RKM A;  4IGR A;  2F34 A;  3TCH A;  4ZS9 A;  5HPQ A;  3T93 B;  2F8D A;  1VSO A;  4E0W A;  1IIT A;  1P99 A;  3MWB A;  4FEB A;  4H65 A;  4EQ9 A;  4F3S A;  3W15 C;  4G2Z A;  2F7B A;  2FNC A;  3C36 A;  1IUD A;  2XD3 A;  4JWY A;  1MDP 1;  3ONM A;  5EHS A;  4E0X A;  5DYH A;  4G8N A;  2BJJ X;  4OZ9 A;  3OO8 A;  2AIX A;  4R72 A;  3SKP A;  2F6G A;  2GFE A;  3EPE A;  4FED A;  1LAF E;  2I3W A;  2XX8 A;  4QSD A;  5H8F B;  2XD2 A;  5H8Q B;  2XXI A;  3O97 A;  2V84 A;  4F39 A;  4U2R A;  1M5C A;  1DSN A;  2DXY A;  2Q2A A;  3QYT A;  4WED A;  3M3L A;  5AA2 B;  5CRY A;  1WOD A;  5I59 A;  3B6W A;  3OEM A;  4K3F A;  1NH7 A;  4U23 A;  3TUS A;  2THI A;  3FVG A;  1B32 A;  2VD2 A;  3LBS A;  2UXA A;  1Y4C A;  1R1N A;  3TEL A;  1D4N A;  5J1D A;  5CMM A;  4LZ5 A;  2O69 A;  3K6U A;  3LSX A;  3FJG A;  1YCJ A;  1B51 A;  3CG1 A;  4WKM A;  3VLU A;  5L9O A;  2I0B A;  3RGY A;  3FVK A;  2A5T B;  3E9X A;  2IEE A;  1UTH A;  4LON B;  5I84 A;  4PET A;  1H76 A;  1A40 A;  2QMW A;  1MM6 A;  4OEN A;  3E3K A;  4KPT A;  4QF9 A;  4QHQ A;  1EZ9 A;  4RPN A;  4DXC A;  5A5X A;  2G29 A;  3V83 A;  1B52 A;  3KZG A;  3RUM A;  3PU5 A;  4R6Y A;  4EQ7 A;  3G3F A;  1UTB A;  3L6G A;  1PB9 A;  2ZXT A;  3CFL A;  4NED A;  2O84 X;  4ZEF A;  3SER A;  4XKN A;  1F9B A;  2PX1 A;  3OEL A;  1GGG A;  1BIY A;  1YAE A;  3C33 A;  1B1H A;  1B3L A;  3A3U A;  3O6G A;  1B3H A;  4IO5 A;  4OVJ A;  3K6V A;  1VR5 A;  1QUI A;  3N94 A;  4H67 A;  4JB7 A;  4LA9 A;  2OWT A;  4PFW A;  4RXL A;  5DVJ A;  2VGQ A;  5ICT A;  1B5H A;  3C4M A;  4ZE8 A;  3WAF A;  3VLV A;  3N5L A;  4XKQ A;  3GBB A;  1WVJ A;  1AOV A;  1JVY A;  2XXH A;  1SDX A;  3CG3 A;  1QJM A;  2ZNU A;  2H98 A;  2Y84 A;  3B6Q A;  3K0V A;  1LST A;  1NL5 A;  3KEI A;  4KD5 A;  4R2F A;  4YU0 A;  4Z7E A;  2B3F A;  4YIC A;  1H43 A;  4IO7 A;  4YKK A;  5LOM A;  3RPW A;  1UTH B;  3MW0 A;  5I58 B;  2HZL A;  3PMX A;  4R74 A;  5JTY A;  1B9J A;  2PBW A;  1QVS A;  3TDJ A;  1SI1 A;  2G93 A;  3O9P A;  4H5G A;  4ZED A;  2XXX A;  5DVF A;  4GRK A;  3T96 B;  4HS7 A;  5CM6 A;  3AXF A;  3K1M A;  4EF1 A;  3PPQ A;  1Q35 A;  1IXH A;  5K2X A;  4THI A;  1B0L A;  4ZDM A;  3QSL A;  5ITO A;  4F1V A;  3E13 X;  5AA4 A;  2NUV A;  1VFD A;  2I58 A;  4ISU A;  4U1O A;  2QPQ A;  2F7A A;  2GHB A;  3RNN A;  2DWA A;  1MPC A;  1N76 A;  1SW5 A;  4MLV A;  4EQB A;  3OSR A;  3IOR A;  1VE4 A;  1Y3N A;  4NF6 B;  3K00 A;  3K02 A;  3H06 B;  2XX7 A;  1FTO A;  1B7H A;  1MQJ A;  1A55 A;  1OIB A;  1MRP A;  4ND9 A;  2AL5 A;  2DSF A;  2H25 A;  3HPI A;  3Q28 A;  1Y20 A;  1EU8 A;  2DVC A;  3B7D A;  3IOT A;  3QIM A;  4OQO A;  1US5 A;  3IR1 A;  2REJ A;  4PP0 A;  5I57 A;  2XXW A;  3TEP A;  5I59 B;  4ZZE A;  4LQ5 A;  4R75 A;  4R2B A;  2DWH A;  1NNT A;  1JNF A;  1SYH A;  1YPN A;  3BBR A;  4TLL B;  3H4Z A;  3TKD A;  4BLA A;  1PEB A;  3O29 A;  3HHF A;  3OEK A;  4EUO A;  4F18 A;  1N84 A;  5H8Q A;  1FCK A;  1QUK A;  1A54 A;  2PT2 A;  4RPO A;  1YTV A;  4TQU Q;  3TTN A;  4DXU A;  2OK2 A;  4FEC A;  4OXV A;  3IJX B;  4MFI A;  3RT6 B;  3TQL A;  1QW0 A;  3S9M C;  1LCF A;  2DQV A;  2A5T A;  3JZJ A;  3O6I A;  4OMB A;  1MQG A;  3PMW A;  1FQB A;  1O64 A;  3IK6 B;  1P1U A;  1LAH E;  3Q25 A;  2Z8F A;  1USY E;  1Q1K A;  4KYS A;  5CMB A;  5I2K B;  2X7P A;  3KJT A;  3PPO A;  2HAV A;  3ZSF A;  2WKY A;  1M5E A;  3MP8 A;  4X9T A;  1FQC A;  2I0C A;  2ESN A;  3I3V A;  4Q5T A;  2D21 A;  1MY4 A;  1XT8 A;  2NXO A;  3I6V A;  2VP1 A;  2RC9 A;  1Y1M A;  1MG1 A;  3IB1 A;  4X1D A;  3EHU A;  2I4B A;  4LAT A;  1B3G A;  4NF6 A;  5I2N A;  4OWD A;  1B58 A;  2ZYM A;  1B5J A;  3H6U A;  4NF5 A;  4F19 A;  5TP9 B;  2I3V A;  3HCQ A;  4O3A A;  3QUJ A;  2OBG A;  4GQO A;  4R6K A;  1N3W A;  2ANJ A;  2H4I A;  4BDR A;  4Q8R A;  2XXY A;  3M3F A;  3V5A A;  1PBP A;  1UQW A;  1ZU0 A;  3Q27 A;  3D4C A;  2AL4 A;  2RC8 A;  4I62 A;  2H5Y A;  2O68 A;  2X26 A;  1LGB C;  2Y7R A;  2HFB A;  1S50 A;  2I4C A;  3K2D A;  3MP6 A;  4YKP A;  3RQT A;  4KFQ A;  3UOR A;  1P1W A;  2AYS A;  2CZL A;  4OET A;  5I56 A;  3MC2 A;  3O6H A;  4LP2 B;  4YB5 A;  4C1T A;  2B3B A;  1T0K A;  2Z8D A;  5JTY B;  1MXU A;  3C9H A;  3TAJ A;  3N26 A;  4RY1 A;  1FQE A;  1RYO A;  2HZK A;  1I6A A;  1JEV A;  2F78 A;  4C1U A;  2YJP A;  3PUV E;  1LB8 A;  3MVY A;  1BKA A;  1NMU A;  4U22 A;  3LC8 A;  3KJ7 A;  4JWX A;  4R73 A;  2ZYO A;  1LFG A;  3UP9 A;  1AH5 A;  1TT1 A;  2DS9 A;  2I49 A;  2Q2C A;  2V3U A;  3K01 A;  4RYA A;  4FE8 A;  3VVD A;  1R9L A;  3O28 A;  1POY 1;  1OLA A;  2OLB A;  3MBP A;  3TCF A;  4G4P A;  4GXA A;  1Z7M E;  2XXQ A;  4U21 A;  3LUY A;  2XXP A;  3R6U A;  3SDF A;  1MQI A;  2F7C A;  3U1O A;  4IB2 A;  3MZ1 A;  1MXY A;  5KDT A;  1TWY A;  4NF8 B;  1IIW A;  1IXG A;  4QSE A;  4XXU A;  4WEP A;  1MXZ A;  2Q88 A;  4O3C A;  4OFJ A;  3EN3 A;  4OER A;  3KSX A;  2R71 A;  2ZYK A;  3FXU A;  3G3H A;  4F3B A;  2H99 A;  3T9V A;  1B2H A;  2DOJ A;  3D4G A;  3IJO B;  3SEU A;  3S9N C;  5B7D A;  4H5F A;  3IL1 B;  2DE2 A;  3CR9 A;  2Q89 A;  1NNP A;  1SYI A;  3T9X B;  1B4Z A;  4Q30 B;  4GXS B;  1FTM A;  2PVU A;  3DEL B;  3WAE A;  1DMB A;  2FA7 A;  5H8H A;  1SI0 A;  3IAZ A;  1O63 A;  3VLW A;  4DLD A;  3G3G A;  3S9L C;  2O7I A;  5KCJ B;  1M5D A;  3CRB A;  3ILU B;  4U4S A;  4JSD A;  2QS4 A;  2DYX A;  3PUW E;  3K6W A;  4N07 A;  5EYF A;  5L8D A;  3FGS A;  3H03 A;  1ZIU A;  4H8I A;  4F3G A;  4YB7 A;  3RTW B;  1B5I A;  3G3K A;  1B4H A;  4ONY A;  3THI A;  3UN6 A;  2CMO A;  3FJ7 A;  3VFJ A;  4F1U A;  5AE4 A;  4IO4 A;  2NVU B;  1I6B A;  4DCX A;  1OQG A;  1PB7 A;  1B1X A;  2RCA A;  2QS2 A;  5TU0 A;  5L9M A;  3SEY A;  4MH5 A;  1NKX A;  3KGC A;  5HBC A;  3ILT B;  4F2O A;  1SW4 A;  1MY0 A;  2F5X A;  3KN3 A;  4LQ2 A;  1MPB A;  5AA2 A;  4QRZ A;  2OZZ A;  2HEU A;  1XHY A;  1SW1 A;  4PQJ A;  3T22 A;  1DPP A;  1JW5 A;  3CIJ A;  1PB8 A;  2B65 A;  2PMS A;  4TLM B;  3JYR A;  3U92 A;  1H3D A;  2VD3 A;  4IY5 A;  3TZA A;  2HAU A;  2Q9T A;  3VV5 A;  4FIM A;  2Y7I A;  4OTE A;  4TOZ A;  1D9V A;  1PDA A;  3B6T A;  3LSL A;  2Y7K A;  1URG A;  2OWS A;  3SET A;  4OES A;  4NWC A;  2Y7P A;  5CMK A;  1QKA A;  3V89 B;  3ZKK A;  4I9D A;  5BUU A;  1A8E A;  1FTJ A;  2UVI A;  4NWD A;  3IB0 A;  3MQ9 A;  4OEU A;  1LBC A;  3EHS A;  5I56 B;  5JEI A;  1LCT A;  1FQF A;  4G68 B;  4GFR A;  1N7W A;  4RK9 A;  1H45 A;  1WDN A;  2XHD A;  4NE4 A;  2H9B A;  3VXC A;  5AA3 A;  5FTH A;  3MZ9 A;  2DP8 A;  1GVC A;  4ESW A;  4DCY A;  4IGT A;  3LSW A;  3RT8 A;  3TQW A;  4X48 A;  4BDO A;  1USY H;  4F1Y A;  4R9G A;  4H6D A;  3TMG A;  3CFX A;  5AA4 B;  3BFT A;  4ZEK A;  4JBZ A;  2UVJ A;  1L5T A;  3R26 A;  5ELV A;  4BDN A;  5ITP A;  5I57 B;  5IKB A;  1A99 A;  1I6Q A;  1LB9 A;  3OSQ A;  3U72 A;  5AA2 D;  1BLF A;  3KN8 A;  1LAX A;  1NNK A;  2ZYN A;  3PUY E;  1MXX A;  4LZ7 A;  1UTB B;  3H6W A;  4QFO A;  4IO6 A;  4YAH X;  2PT1 A;  3IO6 A;  2GHA A;  4F31 B;  2RCB A;  1N7X A;  4JSO A;  4OYV A;  4U4X A;  5CBS A;  1S7Y A;  2VHA A;  3I5O A;  3G3I A;  4BDM A;  4QFP A;  4GVO A;  3TTK A;  3HN0 A;  4KI0 E;  3H6V A;  4BDQ A;  3U94 A;  2O6A A;  3PPP A;  1MDQ A;  1A8F A;  2VOZ A;  3IOU A;  5JK4 A;  2F97 A;  4RA1 A;  5M2V A;  1VFE A;  1DPE A;  1RKM A;  3PGF A;  4XKR A;  2F35 A;  2E0S A;  3OOA A;  5KCJ A;  2FYI A;  4GOT A;  2OCU A;  3PMV A;  4EF2 A;  4ESX A;  4FAT A;  4MLQ A;  5B70 A;  1MS7 A;  3K1N A;  1DTZ A;  2GRV A;  2ONR A;  4NF4 B;  3UK4 A;  1B05 A;  1TXF A;  2HCA A;  3FAT A;  4R9F A;  2NOO A;  2Q8J A;  5TP9 A;  4H0W A;  1HSL A;  1XC1 A;  3PV0 E;  5H8F A;  4F22 A;  4KHZ E;  4YZZ A;  4I8C A;  3OD7 A;  1MXW A;  5CMC A;  1Y3Q A;  2UVG A;  1TFD A;  4UA8 A;  3A09 A;  1FTL A;  3G7W A;  3QUF A;  5IAI A;  2UVH A;  1B46 A;  4G8H A;  3RTF B;  1SD3 A;  3KOS A;  1URS A;  1B3E A;  4N13 A;  1SVX B;  4ELO A;  2V25 A;  2XXR A;  4GL8 A;  3DM0 A;  2V3T A;  3OEN A;  3C31 A;  3HV1 A;  1AMF A;  2F36 A;  1OQH A;  3FAS A;  4OFL A;  5BWJ A;  3CSG A;  1FQD A;  1EZO A;  1TFA A;  2RC7 A;  1GR2 A;  2DWJ A;  3CI8 A;  3KN7 A;  1FTK A;  1P1O A;  3IOV A;  4C0R A;  3P7I A;  3C35 A;  3Q29 A;  3M3K A;  1MH4 A;  3LSF B;  4PFY A;  1B40 A;  4FJP A;  3LR1 A;  3S4U A;  3VE1 B;  1M5B A;  2O7U A;  4YKJ A;  3IX1 A;  4KR5 A;  2RIN A;  1I69 A;  1XVY A;  3TYH A;  3S9E A;  1MQD A;  4YKI A;  3UIF A;  1URD A;  5KDT B;  3C32 A;  2QJE A;  1II5 A;  3RY3 A;  2XX9 A;  4ELR A;  2QSX A;  2QS3 A;  4JDF A;  3GZG A;  2V93 A;  1UIU A;  4GF8 A;  1NNF A;  4P0I A;  1ATG A;  3TOD A;  1B0H A;  2QS1 A;  4NF5 B;  4PFU A;  4RK2 A;  4F2Q A;  3K4U A;  2REG A;  2P0S A;  3Q26 A;  1AIV A;  3QXM A;  3OXN A;  4KQP A;  1CB6 A;  3FIR A;  2O51 A;  2Y7W A;  4NTL A;  3TPA A;  4LZ8 A;  4WXJ A;  4DIG A;  1ZKB A;  1B7Z A;  5KZT A;  3EQ1 A;  3MVW A;  2P1S A;  1DOT A;  1JVX A;  1N04 A;  1R6Z A;  5H8N B;  3A3C A;  4F3P A;  2D3I A;  4GIZ A;  1SW2 A;  3DP6 A;  4IO3 A;  3IO4 A;  4H8J A;  2YLN A;  1JEU A;  2ZNT A;  3SEV A;  4O3B A;  4DZ1 A;  2O1M A;  4DDD A;  3FUZ A;  1GTK A;  4ZEI A;  3VXB A;  3MVZ A;  5FHO A;  4HCW A;  3UGW A;  2Z22 A;  1AL3 A;  3MAM A;  3MVX A;  5HM4 B;  1LAG E;  3FXR A;  1Y9U A;  2XXT A;  1QKB A;  4JXI A;  2UYF A;  3TTR A;  1MM7 A;  2P2A A;  4JWO A;  4OFO A;  2DWI A;  4MF3 A;  3MJN A;  5TPA A;  3IOW A;  3K6X A;  1ZBM A;  4NMY A;  1PBQ A;  1CE2 A;  4IY6 A;  1P1Q A;  1NFT A;  4N6P A;  4KCC A;  3QK6 A;  1IXI A;  3PD8 A;  3H6T A;  3CVG A;  1DTG A;  2OJT A;  3O2A A;  5F7V A;  4ZZA A;  3U93 A;  4FOR A;  1Y4T A;  3K1P A;  3MPK A;  4G8M A;  4LVQ A;  3OMB A;  5FTI A;  3BFU A;  1SBP A;  1A7L A;  1BP5 A;  1P1N A;  2GH9 A;  1MXV A;  2QL3 A;  3HO7 A;  1UIV A;  4IO2 A;  1B7U A;  4PE5 B;  5EHM A;  4FAJ A;  1MY2 A;  1ZLQ A;  1Y3P A;  5H8S A;  3QAX A;  4GWO A;  5K2Y A;  4AQ4 A;  1N0T A;  1HSJ A;  5DEX A;  4UAC A;  4XTC Q;  2I6E A;  3FXQ A;  3KBR A;  2DE4 A;  1ELJ A;  1J1N A;  1MPD A;  3H7M A;  5CBR A;  3V8X B;  2UYE A;  2F6P A;  3R7X A;  1IQ7 A;  1JW4 A;  2O1L A;  3ECR A;  4F29 A;  1BTJ A;  4R6H A;  5CI5 A;  4AB6 A;  3W9W A;  4QFL A;  4G68 A;  4POW A;  2ONK E;  1XS5 A;  3E4R A;  3L6H A;  3TTM A;  3ODB A;  3VDF A;  3PPR A;  5L9S A;  2DVZ A;  5DT6 A;  5AA1 A;  4HW8 A;  2X7Q A;  2R6G E;  4QFN A;  4Z0I A;  1IXC A;  1MH3 A;  3G3J A;  4OHN A;  3W9V A;  3ZS6 A;  1OLC A;  3RN8 A;  5CC2 A;  3S2V A;  2HQ0 A;  1B3F A;  1EH3 A;  1PC3 A;  4BDL A;  1SQY A;  3SEX A;  1ZJL A;  4P11 A;  1N3X A;  2A5S A;  3F11 A;  4AB5 A;  1JQF A;  4M1V A;  1FQA A;  3SEW A;  1LFI A;  1QUL A;  3TFL A;  2R9J A;  2HXW A;  3C34 A;  4G68 C;  4YB6 A;  1EZP A;  3PUZ E;  1IZ1 A;  3CFZ A;  3U8Q A;  2KLF A;  1RYX A;  3OO7 A;  4RNS A;  4P0G A;  1M5F A;  4POX A;  4H1X A;  3RLF E;  5H8N A;  3USD A;  1MY1 A;  3EF7 A;  3GBA A;  4EXK A;  4L17 A;  2DXR A;  4KCD A;  2XXV A;  3KFM A;  4XIG Q;  2QRY A;  4HCY A;  1LBB A;  2ZNS A;  3FD3 A;  5FHN A;  1D3K A;  3ZKL A;  1US4 A;  4GD5 A;  3TCG A;  4XKP A;  1ZTY A;  1JW1 A;  4YMB A;  2RF1 A;  5F1Q A;  4RJZ A;  4PFT A;  4ECF A;  2LAO A;  4ZEC A;  4ELQ A;  4NF4 A;  4MBP A;  1ANF A;  1O7T A;  3JV9 A;  3FZV A;  5ISU A;  3CSB A;  1JET A;  3DP4 A;  3GXA A;  2ABH A;  3PUX E;  3SES A;  3UA8 A;  1Y1Z A;  1XVX A;  4ZEB A;  1MQH A;  4U1Z A;  3GLB A;  2Z23 A;  1H44 A;  4DE8 A;  4DXB A;  5ICQ A;  3MZB A;  5TPA B;  1NH8 A;  3MP1 A;  2ZMB A;  3DP8 A;  3KSJ A;  4Q0C A;  4EXL A;  2D5W A;  1OMP A;  3HST A;  1GV8 A;  3FJM A;  4G77 A;  4GLI A;  4M4G A;  3N6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...