1QJMA

Crystal structure of a complex of lactoferrin with a lanthanide ion (sm3+) at 3.4 angstrom resolution
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
689
structure length
689
Chain Sequence
APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lactoferrin
molecule keywords LACTOFERRIN
publication title Lactoferrin-Metal Interactions: First Crystal Structure of a Complex of Lactoferrin with a Lanthanide Ion (Sm3+) at 3.4 Angstrom Resolution
pubmed doi rcsb
total genus 211
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA03
1EH3A 3E13X 5EHMA 1NNKA 3CRBA 2RCBA 2OJTA 1A40A 1PEBA 2H98A 5F7VA 4OZ9A 4ELRA 2O69A 1ZBMA 4U23A 2Q88A 1N3WA 2I0CA 2GH9A 1MDQA 3M8UA 2XXQA 4F31B 3G3FA 3VVDA 2O6AA 4YB7A 4DXUA 3HV1A 1Y1MA 3OEKA 4GFRA 1JETA 5BWJA 2QPQA 1USYE 4KFQA 4KD5A 3OEMA 1EZPA 1TWYA 2R71A 3U92A 5CRYA 1LLSA 3H6WA 4YMBA 1Q1KA 1M5EA 2ONRA 4YAHX 3FVOA 1B40A 4DCXA 2DSFA 4AQ4A 1MY3A 2DWJA 3DM0A 4TLMB 1N76A 4BDQA 1MXVA 2UVJA 3O9PA 4H0WA 1Q35A 1BLFA 1IEJA 2V93A 4R72A 5TP9B 4G68B 1P1NA 3B6QA 3H3GA 4M4GA 3K6UA 1JW1A 2PVUA 3Q27A 2M8CA 4MLVA 4R73A 1WVJA 4DE8A 3LC8A 4H8JA 3UK4A 4R75A 2ALUA 2PYYA 3C32A 3CVGA 2UYEA 4F29A 4IGRA 4G68C 3B7DA 4QHQA 4ELOA 5AE4A 4G4PA 1DPEA 3FV2A 4OYVA 5FTIA 4WXJA 3KSJA 1MY0A 4LONB 4XTCQ 1AMFA 5IAIA 5CMKA 4NE4A 3MP8A 4IO7A 2Q9TA 3IOUA 4ISUA 2QMWA 2O84X 5HBCA 1SW5A 2NOOA 3WAFA 3GZGA 1SI1A 2O1LA 3PU5A 4YKKA 3VDFA 2ZMBA 3T9UA 2E1SA 4WEPA 3V83A 1BIYA 4LZ8A 1B4HA 5EHSA 1B3HA 2PT2A 3S9MC 5I2NB 5CM6A 3IR1A 1OIBA 2YJPA 4MBPA 5L9SA 4GRKA 4EXLA 3BKIB 1XS5A 2O68A 5I59B 1MH4A 1SW1A 3K01A 4LZ5A 4H5FA 2F6PA 4G77A 4RA1A 3OO9A 5FTHA 4NF8B 4OMBA 3K4UA 1JEUA 4U2RA 4P0GA 2REGA 1ZTYA 2HAVA 5ICQA 2X26A 3S9EA 1LFIA 2XX9A 1I6AA 2ONSA 3TDJA 1MQDA 1MRPA 3E4RA 3JV9A 4KQPA 2F8DA 5I56B 1R1NA 2DQVA 5DVJA 3MQ9A 2B65A 4ONYA 1MQIA 5J1DA 4QF9A 1N0TA 4DIGA 5TP9A 3MZBA 4XKPA 3DP8A 4G2ZA 1B0LA 3O28A 1Y4CA 4H67A 4XKNA 5A5XB 3FUZA 4OENA 1JVYA 4DXCA 4ZZEA 4MFIA 4F1UA 3UGWA 1PBPA 4F3BA 2RCAA 1SDXA 1BKAA 4ZDMA 4GWOA 3O66A 3H7MA 2AYSA 1NNPA 2F7BA 1AH5A 3RN8A 4F2QA 1UTHA 1FTLA 2V3UA 3FATA 1QUIA 4XIGQ 1QKAA 2ABHA 2DWAA 4JWYA 3PD8A 3QUJA 3A09A 3IAZA 1B9JA 4P0IA 3RY3A 2XXHA 3M3LA 3VLWA 5ITPA 3G3JA 4JWOA 1AL3A 3UA8A 3SDFA 4OETA 3VVEA 3SEYA 1MXZA 4QFNA 2Y7KA 4PP0A 5I2NA 3HPIA 2Z8EA 4FEBA 3TTLA 1ZIUA 1B6HA 1FQBA 1AIVA 1GVCA 1FTJA 3DELB 3KEIA 4YKIA 4YKPA 4PFTA 4YZZA 5IKBA 5I59A 1ZU0A 4C1TA 1MPCA 4H8IA 3FD3A 3RGYA 2Z23A 4ELPA 2RC9A 1Z7ME 3TUSA 1M5BA 2P0SA 3K1NA 1B3EA 3IB1A 5FHMA 1R9QA 4OFJA 1ZLQA 4ZE8A 3TTNA 4F39A 4Q8RA 3PV0E 3AXFA 5H8FB 4R2BA 4U4XA 3ZKKA 2RKMA 3EHTA 3LSLA 3W15C 3PMVA 2DXYA 1QVSA 3LR1A 3C34A 1H44A 2UXAA 1ZKBA 4FIMA 2I3WA 5AA2A 2QS4A 2VD3A 1B3GA 3W9WA 4Q5TA 5DEXA 1S7YA 3CFZA 3MZ1A 1Y1ZA 4TLLB 1DSNA 4ND9A 1Y9UA 3VLVA 5I57B 1H45A 3SERA 2G93A 5L8DA 1MG1A 2F34A 1LAGE 2Z8DA 3RT8A 3A3UA 3PD9A 4RXLA 2GHBA 4ESXA 2R6GE 3C35A 3UN6A 1I69A 4EQ7A 1NFTA 2Q8JA 3TAJA 4R6KA 1MY2A 5HM4B 4DDDA 4PE5B 4NWCA 2ANJA 3N94A 5H8SA 4YICA 2DVCA 2H4IA 1S9TA 1YPNA 3S9NC 3K1MA 5DT6A 3ZS6A 1UQWA 4PFUA 5JTYA 3CFXA 3T66A 4JWXA 1MQGA 1URGA 1B1HA 3MC2A 1IXIA 4QFLA 1IQ7A 2A5TA 4H6DA 1NL5A 3D4GA 5KCJA 4PQJA 3MZ9A 1VR5A 3IB2A 1FQCA 2F7AA 4WEDA 3FASA 1I6BA 4YB6A 1FQDA 3A3CA 2O7IA 4KYDA 4PFYA 1OVTA 3KG2A 3E9XA 4IB2A 3HO7A 1NH8A 1N7XA 1SVXB 4PFWA 3TKDA 1IITA 3K1PA 2QS3A 2DP8A 4RK2A 3DP6A 3SETA 4GXSB 4ZEBA 1D3KA 3VFJA 1DTZA 3VXCA 4RY1A 4R9GA 2XXXA 3N5LA 3IK6B 3U8QA 4X9TA 2I58A 2XX7A 1LAXA 2I3VA 2P1SA 2OLBA 3KGCA 3U93A 1PDAA 4F18A 1D9YA 3TTKA 1KWHA 3SEVA 1R9LA 2ONKE 3G3KA 3RNNA 1QJMA 4RYAA 1MDP1 3O6IA 1OMPA 5KDTB 3QYTA 1LBCA 4QFKA 3C4MA 4F1YA 1B1XA 5DVIA 1B5HA 4AB6A 1FQEA 2NWJA 2F6GA 3CR9A 3FJMA 1LCTA 1F9BA 1MM6A 3S4UA 4OEUA 3PUXE 1SW4A 1DOTA 4NEDA 1SBPA 4KI0E 3PUVE 3CSBA 4NMYA 4R2FA 4XXUA 3VLUA 2VD2A 2UVHA 5I58B 1B5JA 1MPBA 4ESWA 3RPWA 1RKMA 4GXAA 3OOAA 2DE3A 1UTBB 4JDFA 1LAFE 3CI8A 2XXWA 3MPLA 3MP1A 1A8FA 3Q25A 4KCCA 1N3XA 4BDNA 3H6VA 5DTBA 3H4ZA 2VHAA 2XXUA 4Z7EA 4FE8A 4Q30B 3CG1A 4NF4A 4C0RA 1D4NA 3WAEA 2PBWA 4IO2A 4FECA 4GL0A 2XXYA 4AB5A 1URDA 2DE2A 4F3PA 3THIA 4THIA 3H03A 1DPPA 2Q89A 4BDMA 4WKMA 1A55A 4DCYA 3L6GA 1LB9A 1N84A 1NNFA 3W9VA 4FORA 4OVJA 5L9OA 1FQFA 4RK9A 1IXHA 1IIWA 1RYOA 3S2VA 3EHSA 2WKYA 2O1MA 4QFOA 5K2XA 3QXMA 3TTMA 2QJEA 1B58A 1SQYA 1B2HA 5CMMA 4EXKA 1B05A 2LAOA 4H65A 3ILTB 1B3LA 3MJNA 2RC7A 4EQ9A 5ICTA 4L17A 4MLQA 3VXBA 2YLNA 2I6EA 3PMXA 4HCYA 2H99A 1URSA 3FVNA 4BDLA 4U4SA 2OWSA 3LUYA 3TZAA 3M3FA 1FQAA 3QIMA 4IO3A 1IXCA 1H43A 4IY6A 3QUFA 4C1UA 2V3TA 1FW0A 3KFMA 1B51A 4KYSA 3JYRA 3K6WA 4FAJA 3OD7A 2XD3A 3CIJA 4ELQA 1Y3QA 4G8HA 3HN0A 4QSCA 2E0SA 1USYH 3ZSFA 3GBBA 2IEEA 3PPPA 4OQOA 3K0VA 4GOTA 3RLFE 5FHOA 3TCHA 3L6HA 4G68A 4UA8A 2ZYKA 1OLAA 1SW2A 2ZXTA 3F11A 3LSWA 3CFLA 1GR2A 3UORA 1M5DA 3S9LC 4F3SA 1BP5A 3OENA 4RJZA 3MAMA 1PB7A 3V89B 1CB6A 1TFAA 1H76A 3PUYE 1B0HA 4LATA 3TQWA 1PBQA 4JB7A 4Z0IA 4R9FA 2NUVA 3DLNA 1IXGA 2I4CA 4ZEIA 3G3IA 1L5TA 5EYFA 3TCGA 4HTGA 2D5WA 3TCFA 5CBRA 4LVQA 1B32A 3BFUA 2DE4A 1US5A 5I84A 3OSQA 1O63A 2UVIA 5CI5A 1POTA 4U22A 2BJJX 3T9HB 4X1BA 3OO8A 3RUMA 1A99A 4ZE9A 2RINA 4TQUQ 3FJ7A 5DVFA 1HSJA 2DVZA 1P1WA 2Y7WA 2F5XA 1XVXA 4EF2A 1VSOA 4UACA 3H6TA 3UP9A 2UYFA 3KOTA 1LFGA 1JNFA 3RQTA 4Q0CA 4NF8A 2XXIA 1B46A 2CMOA 3TMGA 3C36A 3KN7A 3H06B 1P1OA 4X1DA 2OWTA 1QULA 2GRVA 1OQGA 2FYIA 2QS2A 1PB8A 3C31A 2HZKA 3ILUB 5I56A 1YCJA 3GXAA 3IX1A 4KCDA 2V84A 1ATGA 4XKRA 4N13A 3IO6A 4G8MA 3IJOB 5H8HB 5CMCA 3O29A 1B3FA 3O6GA 1AOVA 3CG3A 2HEUA 3G7WA 4PETA 3CSGA 2AIXA 3K6VA 2QS1A 1PB9A 2ZNTA 5A5XA 3K2DA 4GQOA 3G3HA 5TPAB 3PPNA 2I48A 1LB8A 4U1ZA 2ZYNA 3BFTA 3QAXA 1LGBC 1D9VA 3FGSA 2DOJA 4F2OA 1O64A 1QUKA 1XHYA 4DLDA 4NTLA 2Y7PA 4FJPA 3B6WA 1JVXA 1TT1A 4JXIA 2OCUA 2DXRA 3P7IA 4N6PA 3UIFA 3IOWA 2A5SA 4F22A 4EDPA 3LSXA 4F1VA 4GD5A 2RC8A 4ZEFA 3T9VA 4U1OA 3T9XB 4POWA 1NNTA 1QKBA 1GTKA 2H25A 3I3VA 4LQ2A 2I0BA 3O97A 5KZTA 4ZECA 4OFLA 5H8NB 3SESA 1FTOA 3PUZE 2DYXA 4NWDA 3EHUA 3MPKA 3B6TA 1MXWA 2CZLA 1B5IA 3D4CA 1M5FA 2RF1A 4OEVA 1MS7A 2ZNUA 4GVOA 2XHDA 1XT8A 4ZEKA 4LQ5A 3TYHA 4JBZA 4JSOA 5JK4A 1LCFA 2F7CA 2X7QA 2V25A 1B4ZA 4KYEA 2X7PA 2QL3A 4GIZA 4I8CA 1P99A 1SYHA 1S50A 2GHAA 2Z22A 5H8FA 3U94A 3MVXA 5AA2D 2Y7RA 1UIUA 4G8NA 1B52A 3ODBA 2ESNA 5H8HA 1NMUA 4RPNA 3IOVA 4LA9A 2H5YA 3SEXA 3PGFA 3KSXA 4QFPA 2AL4A 1NH7A 2XX8A 3O6HA 3Q28A 1ZMGA 5I57A 3LBSA 4P11A 5TPAA 3RTWB 1WODA 3VV5A 4FATA 3TFLA 3MVZA 3N6TA 3SEWA 2DWHA 4YU0A 4RNSA 5CC2A 4FEDA 1A7LA 2HFBA 3MUQA 5AA1A 4R6HA 2Y7IA 3IO4A 3HSTA 3VE1B 4POXA 3HCQA 2Y84A 3R6UA 2ZYMA 4YMAA 4N07A 5L9MA 4KR5A 3PUWE 4DZ1A 5TU0A 1IUDA 2UVGA 2I49A 3FXRA 1LBBA 2GFEA 3OSRA 1MM7A 1QW0A 2H9BA 4NF6B 1JW4A 3FIRA 5H8NA 3T22A 4HW8A 1DMBA 3EQ1A 3EN3A 3IORA 4IY5A 4R74A 3KOSA 3IL1B 3FZVA 1SYIA 2XXPA 2HAUA 5B7DA 2Q2CA 3Q29A 3U72A 4F3GA 2Z8FA 1A54A 1OVBA 4MH5A 2B3BA 5BUUA 1JW5A 4I1DA 1US4A 3RT6B 2QRYA 4QSDA 4H5GA 4LUBA 3SEUA 3BBRA 1UTHB 3HHFA 4O3AA 2DWIA 1M5CA 2V3QA 1GV8A 1HSLA 5ISUA 3PPQA 3OO6A 1LSTA 1MQHA 2KLFA 3GBAA 1LAHE 1MY4A 1YAEA 2O7UA 3H6UA 1SI0A 3MVWA 3E3KA 3PPRA 4QRZA 1T0KA 3K6XA 3VVFA 3OO7A 4YKJA 2REJA 4OFOA 5KDTA 2HCAA 1SD3A 5AA4B 1Y3NA 3TPAA 4E0XA 1XC1A 1EU8A 4IO4A 5AA3A 3TEPA 2THIA 3RTFB 1CE2A 4XKQA 5B70A 3OXNA 5H8QB 2XXRA 4GL8A 4GLIA 2I4BA 5I2KB 1ANFA 4BDOA 1VFDA 5M2VA 1XOCA 2O51A 1MXXA 3QSLA 1ZJLA 5I58A 4EF1A 4TOZA 3K02A 3LSFB 1EZOA 3MP6A 1MXUA 3SKPA 1N7WA 3QK6A 2ZNSA 1UTBA 3MW0A 3MVYA 4KPTA 4GF8A 4DXBA 2ZYOA 1MXYA 5AA2B 4NF6A 4OERA 4R6YA 1WDNA 5DEXB 5CMBA 3JZJA 1RYXA 2P2AA 4O3BA 5HPQA 3C33A 4BDRA 5FHNA 2XD2A 1N04A 3R7XA 3KBRA 2YPNA 1VE4A 1FTMA 4ECFA 1IZ1A 3V5AA 3KN8A 2DS9A 2VP1A 3T93B 4K3FA 2FA7A 2OZZA 2Q2AA 1H3DA 1DTGA 4OXVA 2HZLA 3FXUA 1YTVA 4NF5B 1B7HA 1EZ9A 1JQFA 4IGTA 2G29A 5JTYB 1TFDA 3MWBA 3GLBA 5K2YA 2IA4A 2QSXA 1MQJA 1UIVA 2A5TB 5KCJB 3U1OA 5AA4A 3G3GA 3EF7A 3N26A 3KN3A 3N6UA 2F78A 4HCWA 2NXOA 2PT1A 2VGQA 1Y20A 5H8QA 1OQHA 3ECRA 3FV1A 1PC3A 4I62A 4O3CA 1J1NA 2FNCA 5LOMA 5CBSA 2R9JA 3M3KA 4H1XA 1Y3PA 5I2KA 1FTKA 4OWDA 1FCKA 3FVGA 5ELVA 3I6VA 4RPOA 1B7UA 3TELA 3ONMA 1TXFA 3T96B 4KHZE 1GGGA 1MY1A 1R6ZA 1NKXA 2HXWA 1ELJA 1A8EA 3FXQA 2NVUB 1XVYA 3OELA 2OK2A 2QMXA 4EQBA 2AL5A 3DP4A 1Y4TA 2HQ0A 1HSEA 3KJTA 4HS7A 4ZZAA 1II5A 1B7ZA 3TODA 2VOZA 3KJ7A 4BLAA 3I5OA 3HHGA 4F19A 3ZKLA 4OTEA 4QSEA 4ZEDA 2D21A 3V8XB 4IO6A 2W7YA 3TTRA 4E0WA 3FVKA 1BTJA 1LFHA 2PX1A 1I6QA 4MF3A 1POY1 2XXVA 2OBGA 5DYHA 2F35A 2PMSA 2F97A 4LP2B 4ZS9A 4I9DA 3PPOA 3IJXB 3O2AA 5JEIA 4EUOA 2B3FA 3IB0A 4M1VA 1JEVA 3FJGA 3EPEA 4NF5A 3IOTA 1P1UA 3OMBA 1MPDA 3PMWA 1QUJA 4LZ7A 4OESA 5F1QA 2D3IA 3TQLA 5ITOA 3Q26A 1MH3A 3USDA 2XXTA 4IO5A 1VFEA 4X48A 4U21A 3K00A 3R26A 4OHNA 1O7TA 3KZGA 1P1QA 1OLCA 2F36A 4NF4B 4JSDA 1Z7NE 3MBPA 4YB5A 3C9HA
chains in the Genus database with same CATH superfamily
1EH3A 3E13X 5EHMA 1NNKA 3CRBA 2RCBA 4IR8A 4XEQA 2OJTA 1A40A 1PEBA 1NUZA 2H98A 5F7VA 4OZ9A 4ELRA 2O69A 1ZBMA 4U23A 2Q88A 1FRPA 1N3WA 2I0CA 2GH9A 1MDQA 3SZPA 3M8UA 2XXQA 4PFRA 5IZ1A 4F31B 3G3FA 3VVDA 2O6AA 3B50A 4YB7A 4DXUA 3HV1A 1Y1MA 4HE1A 3OEKA 4PAFA 5IGAA 4GFRA 5EQ9A 1JETA 1KA1A 5BWJA 2QPQA 1USYE 4KFQA 4PCDA 4KD5A 2B4LA 2WYPA 3OEMA 1EZPA 1TWYA 2R71A 3U92A 5CRYA 1LLSA 3H6WA 4YMBA 1Q1KA 4PC9A 1M5EA 2ONRA 4YAHX 4NF0A 3FVOA 1B40A 4DCXA 2DSFA 4AQ4A 1MY3A 2DWJA 2CZHA 3DM0A 4TLMB 1N76A 4BDQA 1MXVA 2UVJA 3QMFA 3O9PA 4H0WA 3LUZA 1Q35A 1BLFA 1IEJA 4G61A 1LBWA 2V93A 4R72A 3E79A 5TP9B 4G68B 1P1NA 3B6QA 3H3GA 4M4GA 2FVZA 3K6UA 1JW1A 2PVUA 3Q27A 2M8CA 4MLVA 4R73A 1WVJA 4N17A 4DE8A 3LC8A 4H8JA 3UK4A 2FIEA 4P3LA 4R75A 2ALUA 2PYYA 3C32A 3CVGA 2UYEA 4I3YA 4F29A 4IGRA 4G68C 5LTCA 3B7DA 4QHQA 4ELOA 5AE4A 4G4PA 1DPEA 4AS4A 3FV2A 4OYVA 2V4CA 5FTIA 4WXJA 3KSJA 1MY0A 2XWKA 4N4UA 4LONB 4XTCQ 1AMFA 3T0JA 5IAIA 5CMKA 4NE4A 3MP8A 3GYYA 4IO7A 2Q9TA 3IOUA 1BK4A 4ISUA 2QMWA 2O84X 5HBCA 1SW5A 2NOOA 3WAFA 3GZGA 1D9QA 1SI1A 2FBPA 2O1LA 4O7MA 3PU5A 3IFCA 4YKKA 4OA4A 3VDFA 2ZMBA 3T9UA 2E1SA 4WEPA 2KR0A 3V83A 1BIYA 4LZ8A 1B4HA 5EHSA 1B3HA 2PT2A 3S9MC 5I2NB 5CM6A 4XF5A 3IR1A 4N8YA 1OIBA 2YJPA 4MBPA 5EYGA 5L9SA 2WYKA 4GRKA 2XWVA 4EXLA 3BKIB 1XS5A 2O68A 5I59B 1MH4A 4JVCA 1SW1A 3K01A 3HFUA 4LZ5A 4H5FA 2F6PA 4G77A 4RA1A 3OO9A 5FTHA 4NF8B 4OMBA 3K4UA 1JEUA 1DCUA 4U2RA 4P0GA 2REGA 1ZTYA 2HAVA 5ICQA 2X26A 3S9EA 1LFIA 2XX9A 1I6AA 2ONSA 3TDJA 1DK4A 1MRPA 1MQDA 4PGNA 3E4RA 3JV9A 4KQPA 2F8DA 5I56B 1R1NA 2DQVA 5DVJA 3MQ9A 2B65A 4ONYA 1MQIA 5J1DA 4QF9A 1N0TA 4DIGA 5TP9A 5IZ3B 4PF8A 4P47A 3MZBA 4XKPA 3DP8A 4G2ZA 1B0LA 3O28A 1Y4CA 4H67A 4XKNA 4NGUA 3RPLB 4PAIA 5A5XB 3FUZA 4OENA 1JVYA 4DXCA 4ZZEA 4MFIA 4PDHA 2WEFA 1QGXA 4F1UA 3UGWA 1PBPA 2L5VA 4F3BA 4GWYA 2RCAA 1SDXA 1BKAA 4ZDMA 4GWOA 3O66A 3H7MA 2AYSA 1NNPA 2F7BA 1AH5A 3RN8A 4F2QA 1UTHA 1FTLA 2V3UA 3FATA 1QUIA 4XIGQ 5I3SA 1QKAA 2ABHA 2DWAA 4UABA 4JWYA 3PD8A 3QUJA 3A09A 1KA0A 3IAZA 1B9JA 4P0IA 3RY3A 1NV0A 2XXHA 3M3LA 3VLWA 5ITPA 3G3JA 4JWOA 1AL3A 3UA8A 3SDFA 4OETA 3VVEA 3SEYA 1MXZA 4QFNA 2Y7KA 4PP0A 5I2NA 3HPIA 4GWWA 2Z8EA 4FEBA 3TTLA 1ZIUA 2JJKA 4NN3A 1B6HA 1IMAA 1FQBA 1AIVA 1GVCA 1FTJA 3DELB 3KEIA 4YKIA 4YKPA 4PFTA 4YZZA 5IKBA 5I59A 1ZU0A 3B8BA 4C1TA 1MPCA 4O94A 4H8IA 4GWUA 3FD3A 3RGYA 2Z23A 4ELPA 2RC9A 1Z7ME 3TUSA 1M5BA 4PTKA 2P0SA 3K1NA 1B3EA 2Y5KA 3IB1A 5FHMA 1FBCA 4JVDA 1R9QA 4OFJA 1ZLQA 4PDDA 4ZE8A 3TTNA 4F39A 4Q8RA 3PV0E 3AXFA 1FBFA 5H8FB 4R2BA 4U4XA 3ZKKA 2RKMA 3EHTA 3LSLA 3W15C 3PMVA 2DXYA 1QVSA 3LR1A 3C34A 1H44A 2UXAA 1ZKBA 2OWZA 4FIMA 2I3WA 5AA2A 2QS4A 2VD3A 1B3GA 3W9WA 4Q5TA 5DEXA 4DI3D 1S7YA 3CFZA 3MZ1A 1Y1ZA 4TLLB 1DSNA 4ND9A 1Y9UA 3VLVA 4GX4A 5I57B 1H45A 3SERA 2G93A 5L8DA 1MG1A 2F34A 2FIXA 1LAGE 2Z8DA 3RT8A 3A3UA 2CEXA 3PD9A 4RXLA 2GHBA 4ESXA 2R6GE 3C35A 3UN6A 1I69A 4EQ7A 1NFTA 2Q8JA 4HXVA 3TAJA 4R6KA 1MY2A 5HM4B 1DBZA 4DDDA 4PE5B 4NWCA 2HXRA 2ANJA 3N94A 1YZ0A 5H8SA 4YICA 2DVCA 2H4IA 1S9TA 1YPNA 3S9NC 1FBPA 3K1MA 5DT6A 3ZS6A 2Q74A 3PTYA 1UQWA 1YXIA 4PFUA 5JTYA 3CFXA 3T66A 4JWXA 3KBZA 2PFYA 1MQGA 1URGA 1B1HA 3MC2A 1IXIA 4QFLA 1IQ7A 2A5TA 4H6DA 1NL5A 3D4GA 5KCJA 4PQJA 3MZ9A 1VR5A 3IB2A 1FQCA 2F7AA 1SPIA 4WEDA 3FASA 1I6BA 2MKZA 4YB6A 1FQDA 3A3CA 2O7IA 4KYDA 4PFYA 4GWZA 1OVTA 1FPJA 3KG2A 3E9XA 4IB2A 4OVPA 3HO7A 1NH8A 1N7XA 1SVXB 4PFWA 3TKDA 1IITA 3K1PA 2QS3A 2DP8A 4RK2A 1NV1A 3DP6A 3SETA 4GXSB 4ZEBA 1JP4A 1D3KA 2WX9A 3VFJA 1DTZA 3VXCA 4RY1A 4R9GA 2XXXA 3N5LA 1CNQA 3IK6B 3U8QA 4X9TA 2I58A 2XX7A 1LAXA 2I3VA 2P1SA 2OLBA 3KGCA 5ET6A 3U93A 1VDWA 1PDAA 4F18A 1D9YA 1FSAA 3TTKA 1KWHA 3SEVA 4I40A 1R9LA 2ONKE 3G3KA 4XFEA 3RNNA 1QJMA 4RYAA 1MDP1 3O6IA 1OMPA 5KDTB 3QYTA 1LBCA 4MMPA 4QFKA 3C4MA 4N91A 4F1YA 1B1XA 5DVIA 1NV6A 4MNPA 1B5HA 4AB6A 1FQEA 1RDYA 2NWJA 2F6GA 3CR9A 3FJMA 4MNCA 1LCTA 1F9BA 1MM6A 1FPGA 3S4UA 4OEUA 3PUXE 1SW4A 1DOTA 4OANA 4NEDA 1SBPA 4KI0E 3PUVE 3CSBA 4NMYA 4R2FA 4XXUA 3VLUA 3ROJA 2VD2A 2UVHA 4PBHA 5I58B 1B5JA 1MPBA 4ESWA 1IMFA 3RPWA 1LBYA 1RKMA 4GXAA 3D1RA 3OOAA 2DE3A 1UTBB 4JDFA 1LAFE 3CI8A 2XXWA 3MPLA 3MP1A 4AS5A 1A8FA 3Q25A 4KCCA 1N3XA 4BDNA 3H6VA 5DTBA 3H4ZA 2VHAA 2XXUA 4Z7EA 4FE8A 4Q30B 3CG1A 4NF4A 1NV7A 4C0RA 1D4NA 3WAEA 2PBWA 4IO2A 4FECA 4GL0A 2XXYA 4AB5A 1URDA 2DE2A 4F3PA 3THIA 4THIA 3H03A 4N8GA 1DPPA 2Q89A 1NV3A 4BDMA 5T3JA 4WKMA 1A55A 4DCYA 4P8BA 3L6GA 1LB9A 1N84A 1NNFA 3W9VA 4GX3A 1K9YA 4FORA 4OVJA 5L9OA 1FQFA 2Y5LA 4RK9A 1IXHA 1IIWA 1RYOA 1FBGA 3S2VA 3EHSA 2WKYA 2O1MA 4QFOA 5K2XA 3QXMA 3TTMA 2QJEA 1B58A 1SQYA 1B2HA 5CMMA 4EXKA 1B05A 2LAOA 4H65A 3ILTB 1B3LA 3MJNA 2RC7A 4EQ9A 5ICTA 4L17A 4MLQA 4NG7A 3VXBA 2YLNA 2I6EA 3PMXA 4HCYA 2FHYA 2H99A 1URSA 3FVNA 4BDLA 2QFLA 4U4SA 2OWSA 3LUYA 3TZAA 3M3FA 1FQAA 3QIMA 4IO3A 1IXCA 4GWXA 1H43A 4IY6A 3QUFA 4MIJA 4C1UA 2V3TA 1FW0A 3KFMA 1B51A 1Q9DA 4KYSA 3JYRA 3K6WA 4FAJA 1IMBA 3OD7A 2XD3A 3CIJA 4ELQA 2QVVA 1Y3QA 4G8HA 3HN0A 4QSCA 2E0SA 1USYH 3ZSFA 3GBBA 2IEEA 3PPPA 4OQOA 3K0VA 4GOTA 3RLFE 5FHOA 3TCHA 3L6HA 2CZIA 4G68A 4UA8A 2ZYKA 1OLAA 1INPA 1SW2A 2ZXTA 3F11A 3LSWA 3U65A 3CFLA 2WBBA 1GR2A 5EYHA 1NV5A 3UORA 1EYJA 1M5DA 3S9LC 4F3SA 1BP5A 3OENA 4MHFA 4PFBA 4RJZA 3MAMA 1PB7A 4P56A 3V89B 1CB6A 1TFAA 3T1BA 1H76A 3PUYE 1B0HA 2B4MA 4LATA 3TQWA 1XI6A 1PBQA 4JB7A 4Z0IA 1IMDA 4R9FA 2NUVA 3DLNA 1IXGA 2I4CA 4ZEIA 3G3IA 1L5TA 5EYFA 3TCGA 4HTGA 2D5WA 3TCFA 5CBRA 4LVQA 1B32A 3BFUA 2DE4A 1US5A 5I84A 3OSQA 1IMCA 1O63A 4GBVA 2UVIA 5CI5A 1POTA 4U22A 3KC1A 2BJJX 2XWOA 3T9HB 2VPNA 4PF6A 4X1BA 3OO8A 3RUMA 1A99A 4ZE9A 2RINA 4TQUQ 3FJ7A 5DVFA 1HSJA 2DVZA 1P1WA 4I3EA 4MEVA 1FJ9A 2Y7WA 2F5XA 2ZZXA 1XVXA 4EF2A 1VSOA 4UACA 3H6TA 3UP9A 4OVQA 2CZKA 1FTAA 2UYFA 3KOTA 1LFGA 1JNFA 3RQTA 4Q0CA 4NF8A 2XXIA 1B46A 1RDXA 2CMOA 3TMGA 3C36A 3KN7A 2XWIA 3H06B 1P1OA 4X1DA 2OWTA 3NOHA 1QULA 2GRVA 1NUXA 1OQGA 2FYIA 2QS2A 1PB8A 3C31A 2HZKA 3ILUB 5I56A 1YCJA 3GXAA 1FPEA 3IX1A 4KCDA 2V84A 1ATGA 4XKRA 4N13A 3IO6A 3ISPA 4G8MA 3IJOB 5IZ3A 4OVRA 5H8HB 5CMCA 3O29A 1B3FA 4PAKA 3O6GA 1AOVA 3CG3A 2HEUA 3G7WA 3MSTA 4PETA 2R8TA 3CSGA 2AIXA 3K6VA 3RPLA 2KQZA 2QS1A 1PB9A 2ZNTA 5A5XA 3K2DA 2WBDA 1IMEA 4GQOA 3G3HA 5TPAB 3PPNA 2F3DA 2I48A 2ZZWA 1LB8A 4U1ZA 2ZYNA 3BFTA 3QAXA 1LGBC 4OVSA 1D9VA 3FGSA 2DOJA 4F2OA 1LBZA 1O64A 1QUKA 1XHYA 4DLDA 4NTLA 4KXPA 2Y7PA 4FJPA 3B6WA 1JVXA 1TT1A 4JXIA 3A29A 2OCUA 2DXRA 3P7IA 4N6PA 3UIFA 1FPIA 3IOWA 2A5SA 4F22A 4EDPA 3LSXA 4F1VA 4DI4B 4H45A 3RYDA 4GD5A 2RC8A 4ZEFA 3T9VA 4U1OA 3T9XB 4POWA 1NNTA 1QKBA 1FPDA 1GTKA 2VPOA 2H25A 3I3VA 4LQ2A 1EYIA 2HHMA 4P9KA 2I0BA 3O97A 5KZTA 4ZECA 4OFLA 5H8NB 3SESA 1FTOA 3PUZE 2DYXA 4NWDA 3EHUA 3MPKA 3B6TA 1MXWA 2CZLA 1B5IA 3D4CA 1M5FA 2RF1A 4OEVA 1MS7A 2ZNUA 4GVOA 5ET5A 2BJIA 2XHDA 1XT8A 4ZEKA 4LQ5A 3TYHA 4JBZA 4JSOA 5JK4A 1LCFA 2F7CA 2X7QA 2CEYA 2V25A 1B4ZA 4PGPA 4KYEA 2X7PA 2QL3A 4GIZA 4I8CA 4LN5A 1P99A 1SYHA 1S50A 4O8MA 2PFZA 2HPGA 2GHAA 3KC0A 2Z22A 5H8FA 3U94A 3MVXA 4G8NA 2Y7RA 1UIUA 5AA2D 1B52A 3ODBA 4O7IA 2ESNA 4QBAA 5H8HA 1NMUA 4RPNA 3IOVA 4LA9A 2H5YA 3SEXA 3PGFA 3KSXA 4QFPA 2AL4A 1G0HA 1NH7A 2XX8A 2DDKA 3O6HA 3Q28A 1ZMGA 4GX6A 1G0IA 5I57A 3LBSA 3BIHA 4P11A 5TPAA 3RTWB 2P3VA 1WODA 4H46A 3VV5A 4NHBA 4FATA 4HE0A 3TFLA 3MVZA 3N6TA 3SEWA 4MAGA 2DWHA 4YU0A 4RNSA 5CC2A 4FEDA 1A7LA 2HFBA 4NAPA 3MUQA 5AA1A 4R6HA 2Y7IA 3IO4A 3HSTA 3VE1B 4POXA 3HCQA 2Y84A 3R6UA 4QXDA 1FPFA 2ZYMA 1LBXA 5IZZA 4YMAA 4N07A 5L9MA 4KR5A 3CHGA 3PUWE 4DZ1A 4N6KA 5TU0A 1IUDA 2UVGA 2I49A 3FXRA 1LBBA 2GFEA 3OSRA 1MM7A 2F3BA 1QW0A 2H9BA 1NV2A 4NF6B 1JW4A 3FIRA 5H8NA 3T22A 5IM2A 4HW8A 1DMBA 3EQ1A 3EN3A 3IORA 4IY5A 4R74A 3FBPA 3KOSA 3IL1B 3FZVA 1NUYA 1SYIA 2XXPA 2HAUA 5B7DA 2Q2CA 3Q29A 2Q8MA 3U72A 4F3GA 2Z8FA 1A54A 1OVBA 4MH5A 2B3BA 5BUUA 1JW5A 4I1DA 1US4A 3RT6B 2QRYA 4QSDA 4H5GA 2XXKA 4LUBA 3SEUA 3BBRA 1UTHB 3HHFA 4O3AA 2DWIA 1M5CA 2V3QA 1KZ8A 3LV0A 4X8RA 1HSLA 1GV8A 5ISUA 4MNIA 3PPQA 5I5PA 3OO6A 1LSTA 1MQHA 2KLFA 3GBAA 1LAHE 1MY4A 1YAEA 2O7UA 3H6UA 1SI0A 3MVWA 3E3KA 3PPRA 4QRZA 5DW8A 1T0KA 3K6XA 5FBPA 3VVFA 3EKIA 3OO7A 4YKJA 2REJA 4OFOA 5KDTA 2HCAA 1SD3A 5AA4B 1Y3NA 3TPAA 1LEVA 4E0XA 1XC1A 1FPLA 1EU8A 3MYUA 5J16A 4IO4A 5AA3A 3TEPA 2THIA 3RTFB 1CE2A 4XKQA 1NV4A 5EQAA 2OX3A 5B70A 3OXNA 2VT5A 5H8QB 2XXRA 2QVRA 4GL8A 2P3NA 4GLIA 2I4BA 5I2KB 1ANFA 4BDOA 4MX6A 1VFDA 5M2VA 1XOCA 2O51A 1MXXA 3QSLA 1ZJLA 5I58A 5LDZA 4EF1A 1NI9A 4TOZA 3K02A 3LSFB 1EZOA 3MP6A 1MXUA 3SKPA 1EYKA 1N7WA 3QK6A 2ZNSA 1UTBA 3IFAA 3MW0A 3MVYA 4KPTA 4GF8A 4DXBA 2ZYOA 1MXYA 5AA2B 4NF6A 4OERA 4R6YA 1WDNA 4MCOA 5DEXB 5CMBA 3JZJA 1RYXA 2P2AA 4O3BA 5HPQA 3C33A 4BDRA 5FHNA 2XD2A 1N04A 4OVTA 3R7XA 3KBRA 2YPNA 1VE4A 1FTMA 4N6DA 4ECFA 1IZ1A 3V5AA 3KN8A 2DS9A 2VP1A 3T93B 4K3FA 2FA7A 2OZZA 2Q2AA 1H3DA 1FPKA 1DTGA 4OXVA 2HZLA 1FBHA 3FXUA 1YTVA 4NF5B 1B7HA 1EZ9A 1JQFA 4IGTA 2G29A 5JTYB 1TFDA 3MWBA 2QVUA 5ET8A 3GLBA 5K2YA 2IA4A 2QSXA 1MQJA 1UIVA 2A5TB 2PCRA 5KCJB 3U1OA 5AA4A 3G3GA 3EF7A 3N26A 3KN3A 3N6UA 2F78A 4P1EA 4HCWA 2NXOA 2PT1A 4FBPA 2VGQA 4P1LA 1Y20A 4MJOA 5H8QA 1OQHA 3ECRA 2ZZVA 3FV1A 1PC3A 4I62A 4JVIA 4X04A 4O3CA 1J1NA 5F24A 2FNCA 5LOMA 5CBSA 2R9JA 3M3KA 4H1XA 1Y3PA 5I2KA 4N15A 4GWSA 5EQ7A 4PBQA 1FTKA 4OWDA 1FCKA 3FVGA 5ELVA 3I6VA 4RPOA 1B7UA 3BIGA 3TELA 2XA5A 3ONMA 1TXFA 3T96B 4KHZE 1GGGA 1MY1A 1R6ZA 1NKXA 2HXWA 1ELJA 4NX1A 1A8EA 3FXQA 2NVUB 1XVYA 3OELA 5A5LA 2OK2A 2QMXA 4EQBA 2AL5A 3DP4A 1Y4TA 2HQ0A 4N81A 1HSEA 3KJTA 4HS7A 1AWBA 1K9ZA 4ZZAA 1II5A 1B7ZA 5ET7A 3TODA 1RDZA 2VOZA 3KJ7A 4BLAA 3I5OA 3HHGA 3FXBA 4F19A 4GBWA 5ESYA 3ZKLA 4OTEA 1FBDA 4QSEA 4ZEDA 2D21A 3V8XB 4IO6A 2W7YA 3TTRA 4E0WA 2GQ1A 3FVKA 1BTJA 1LFHA 2PX1A 1I6QA 4MF3A 1POY1 2XXVA 2OBGA 5DYHA 2F35A 1LBVA 2PMSA 2F97A 4LP2B 4ZS9A 4I9DA 3PPOA 3IJXB 3O2AA 5JEIA 3E78A 4EUOA 1FJ6A 2B3FA 3IB0A 4M1VA 1JEVA 3FJGA 3EPEA 4NF5A 3IOTA 1P1UA 1NUWA 3OMBA 1MPDA 3PMWA 1QUJA 4LZ7A 4OESA 4PFIA 5F1QA 4NQ8A 2D3IA 3TQLA 5ITOA 3Q26A 5I7IA 1MH3A 3USDA 1FPBA 2XXTA 4IO5A 1VFEA 4X48A 4U21A 3K00A 3R26A 4HE2A 4OHNA 1FBEA 1O7TA 3KZGA 1P1QA 1OLCA 5EQ8A 2F36A 4NF4B 4JSDA 1Z7NE 3MBPA 1YYZA 4PE3A 4YB5A 3C9HA
chains in the Genus database with same CATH topology
1EH3A 3E13X 5EHMA 1NNKA 3CRBA 2RCBA 2OJTA 1A40A 1PEBA 2H98A 5F7VA 4OZ9A 4ELRA 2O69A 1ZBMA 4U23A 2Q88A 1N3WA 2I0CA 2GH9A 1MDQA 3M8UA 2XXQA 4F31B 3G3FA 3VVDA 2O6AA 4YB7A 4DXUA 3HV1A 1Y1MA 3OEKA 4GFRA 1JETA 5BWJA 2QPQA 1USYE 4KFQA 4KD5A 3OEMA 1EZPA 1TWYA 2R71A 3U92A 5CRYA 1LLSA 3H6WA 4YMBA 1Q1KA 1M5EA 2ONRA 4YAHX 3FVOA 1B40A 4DCXA 2DSFA 4AQ4A 1MY3A 2DWJA 3DM0A 4TLMB 1N76A 4BDQA 1MXVA 2UVJA 3O9PA 4H0WA 1Q35A 1BLFA 1IEJA 2V93A 4R72A 5TP9B 4G68B 1P1NA 3B6QA 3H3GA 4M4GA 3K6UA 1JW1A 2PVUA 3Q27A 2M8CA 4MLVA 4R73A 1WVJA 4DE8A 3LC8A 4H8JA 3UK4A 4R75A 2ALUA 2PYYA 3C32A 3CVGA 2UYEA 4F29A 4IGRA 4G68C 3B7DA 4QHQA 4ELOA 5AE4A 4G4PA 1DPEA 3FV2A 4OYVA 5FTIA 4WXJA 3KSJA 1MY0A 4LONB 4XTCQ 1AMFA 5IAIA 5CMKA 4NE4A 3MP8A 4IO7A 2Q9TA 3IOUA 4ISUA 2QMWA 2O84X 5HBCA 1SW5A 2NOOA 3WAFA 3GZGA 1SI1A 2O1LA 3PU5A 4YKKA 3VDFA 2ZMBA 3T9UA 2E1SA 4WEPA 3V83A 1BIYA 4LZ8A 1B4HA 5EHSA 1B3HA 2PT2A 3S9MC 5I2NB 5CM6A 3IR1A 1OIBA 2YJPA 4MBPA 5L9SA 4GRKA 4EXLA 3BKIB 1XS5A 2O68A 5I59B 1MH4A 1SW1A 3K01A 4LZ5A 4H5FA 2F6PA 4G77A 4RA1A 3OO9A 5FTHA 4NF8B 4OMBA 3K4UA 1JEUA 4U2RA 4P0GA 2REGA 1ZTYA 2HAVA 5ICQA 2X26A 3S9EA 1LFIA 2XX9A 1I6AA 2ONSA 3TDJA 1MQDA 1MRPA 3E4RA 3JV9A 4KQPA 2F8DA 5I56B 1R1NA 2DQVA 5DVJA 3MQ9A 2B65A 4ONYA 1MQIA 5J1DA 4QF9A 1N0TA 4DIGA 5TP9A 3MZBA 4XKPA 3DP8A 4G2ZA 1B0LA 3O28A 1Y4CA 4H67A 4XKNA 5A5XB 3FUZA 4OENA 1JVYA 4DXCA 4ZZEA 4MFIA 4F1UA 3UGWA 1PBPA 4F3BA 2RCAA 1SDXA 1BKAA 4ZDMA 4GWOA 3O66A 3H7MA 2AYSA 1NNPA 2F7BA 1AH5A 3RN8A 4F2QA 1UTHA 1FTLA 2V3UA 3FATA 1QUIA 4XIGQ 1QKAA 2ABHA 2DWAA 4JWYA 3PD8A 3QUJA 3A09A 3IAZA 1B9JA 4P0IA 3RY3A 2XXHA 3M3LA 3VLWA 5ITPA 3G3JA 4JWOA 1AL3A 3UA8A 3SDFA 4OETA 3VVEA 3SEYA 1MXZA 4QFNA 2Y7KA 4PP0A 5I2NA 3HPIA 2Z8EA 4FEBA 3TTLA 1ZIUA 1B6HA 1FQBA 1AIVA 1GVCA 1FTJA 3DELB 3KEIA 4YKIA 4YKPA 4PFTA 4YZZA 5IKBA 5I59A 1ZU0A 4C1TA 1MPCA 4H8IA 3FD3A 3RGYA 2Z23A 4ELPA 2RC9A 1Z7ME 3TUSA 1M5BA 2P0SA 3K1NA 1B3EA 3IB1A 5FHMA 1R9QA 4OFJA 1ZLQA 4ZE8A 3TTNA 4F39A 4Q8RA 3PV0E 3AXFA 5H8FB 4R2BA 4U4XA 3ZKKA 2RKMA 3EHTA 3LSLA 3W15C 3PMVA 2DXYA 1QVSA 3LR1A 3C34A 1H44A 2UXAA 1ZKBA 4FIMA 2I3WA 5AA2A 2QS4A 2VD3A 1B3GA 3W9WA 4Q5TA 5DEXA 1S7YA 3CFZA 3MZ1A 1Y1ZA 4TLLB 1DSNA 4ND9A 1Y9UA 3VLVA 5I57B 1H45A 3SERA 2G93A 5L8DA 1MG1A 2F34A 1LAGE 2Z8DA 3RT8A 3A3UA 3PD9A 4RXLA 2GHBA 4ESXA 2R6GE 3C35A 3UN6A 1I69A 4EQ7A 1NFTA 2Q8JA 3TAJA 4R6KA 1MY2A 5HM4B 4DDDA 4PE5B 4NWCA 2ANJA 3N94A 5H8SA 4YICA 2DVCA 2H4IA 1S9TA 1YPNA 3S9NC 3K1MA 5DT6A 3ZS6A 1UQWA 4PFUA 5JTYA 3CFXA 3T66A 4JWXA 1MQGA 1URGA 1B1HA 3MC2A 1IXIA 4QFLA 1IQ7A 2A5TA 4H6DA 1NL5A 3D4GA 5KCJA 4PQJA 3MZ9A 1VR5A 3IB2A 1FQCA 2F7AA 4WEDA 3FASA 1I6BA 4YB6A 1FQDA 3A3CA 2O7IA 4KYDA 4PFYA 1OVTA 3KG2A 3E9XA 4IB2A 3HO7A 1NH8A 1N7XA 1SVXB 4PFWA 3TKDA 1IITA 3K1PA 2QS3A 2DP8A 4RK2A 3DP6A 3SETA 4GXSB 4ZEBA 1D3KA 3VFJA 1DTZA 3VXCA 4RY1A 4R9GA 2XXXA 3N5LA 3IK6B 3U8QA 4X9TA 2I58A 2XX7A 1LAXA 2I3VA 2P1SA 2OLBA 3KGCA 3U93A 1PDAA 4F18A 1D9YA 3TTKA 1KWHA 3SEVA 1R9LA 2ONKE 3G3KA 3RNNA 1QJMA 4RYAA 1MDP1 3O6IA 1OMPA 5KDTB 3QYTA 1LBCA 4QFKA 3C4MA 4F1YA 1B1XA 5DVIA 1B5HA 4AB6A 1FQEA 2NWJA 2F6GA 3CR9A 3FJMA 1LCTA 1F9BA 1MM6A 3S4UA 4OEUA 3PUXE 1SW4A 1DOTA 4NEDA 1SBPA 4KI0E 3PUVE 3CSBA 4NMYA 4R2FA 4XXUA 3VLUA 2VD2A 2UVHA 5I58B 1B5JA 1MPBA 4ESWA 3RPWA 1RKMA 4GXAA 3OOAA 2DE3A 1UTBB 4JDFA 1LAFE 3CI8A 2XXWA 3MPLA 3MP1A 1A8FA 3Q25A 4KCCA 1N3XA 4BDNA 3H6VA 5DTBA 3H4ZA 2VHAA 2XXUA 4Z7EA 4FE8A 4Q30B 3CG1A 4NF4A 4C0RA 1D4NA 3WAEA 2PBWA 4IO2A 4FECA 4GL0A 2XXYA 4AB5A 1URDA 2DE2A 4F3PA 3THIA 4THIA 3H03A 1DPPA 2Q89A 4BDMA 4WKMA 1A55A 4DCYA 3L6GA 1LB9A 1N84A 1NNFA 3W9VA 4FORA 4OVJA 5L9OA 1FQFA 4RK9A 1IXHA 1IIWA 1RYOA 3S2VA 3EHSA 2WKYA 2O1MA 4QFOA 5K2XA 3QXMA 3TTMA 2QJEA 1B58A 1SQYA 1B2HA 5CMMA 4EXKA 1B05A 2LAOA 4H65A 3ILTB 1B3LA 3MJNA 2RC7A 4EQ9A 5ICTA 4L17A 4MLQA 3VXBA 2YLNA 2I6EA 3PMXA 4HCYA 2H99A 1URSA 3FVNA 4BDLA 4U4SA 2OWSA 3LUYA 3TZAA 3M3FA 1FQAA 3QIMA 4IO3A 1IXCA 1H43A 4IY6A 3QUFA 4C1UA 2V3TA 1FW0A 3KFMA 1B51A 4KYSA 3JYRA 3K6WA 4FAJA 3OD7A 2XD3A 3CIJA 4ELQA 1Y3QA 4G8HA 3HN0A 4QSCA 2E0SA 1USYH 3ZSFA 3GBBA 2IEEA 3PPPA 4OQOA 3K0VA 4GOTA 3RLFE 5FHOA 3TCHA 3L6HA 4G68A 4UA8A 2ZYKA 1OLAA 1SW2A 2ZXTA 3F11A 3LSWA 3CFLA 1GR2A 3UORA 1M5DA 3S9LC 4F3SA 1BP5A 3OENA 4RJZA 3MAMA 1PB7A 3V89B 1CB6A 1TFAA 1H76A 3PUYE 1B0HA 4LATA 3TQWA 1PBQA 4JB7A 4Z0IA 4R9FA 2NUVA 3DLNA 1IXGA 2I4CA 4ZEIA 3G3IA 1L5TA 5EYFA 3TCGA 4HTGA 2D5WA 3TCFA 5CBRA 4LVQA 1B32A 3BFUA 2DE4A 1US5A 5I84A 3OSQA 1O63A 2UVIA 5CI5A 1POTA 4U22A 2BJJX 3T9HB 4X1BA 3OO8A 3RUMA 1A99A 4ZE9A 2RINA 4TQUQ 3FJ7A 5DVFA 1HSJA 2DVZA 1P1WA 2Y7WA 2F5XA 1XVXA 4EF2A 1VSOA 4UACA 3H6TA 3UP9A 2UYFA 3KOTA 1LFGA 1JNFA 3RQTA 4Q0CA 4NF8A 2XXIA 1B46A 2CMOA 3TMGA 3C36A 3KN7A 3H06B 1P1OA 4X1DA 2OWTA 1QULA 2GRVA 1OQGA 2FYIA 2QS2A 1PB8A 3C31A 2HZKA 3ILUB 5I56A 1YCJA 3GXAA 3IX1A 4KCDA 2V84A 1ATGA 4XKRA 4N13A 3IO6A 4G8MA 3IJOB 5H8HB 5CMCA 3O29A 1B3FA 3O6GA 1AOVA 3CG3A 2HEUA 3G7WA 4PETA 3CSGA 2AIXA 3K6VA 2QS1A 1PB9A 2ZNTA 5A5XA 3K2DA 4GQOA 3G3HA 5TPAB 3PPNA 2I48A 1LB8A 4U1ZA 2ZYNA 3BFTA 3QAXA 1LGBC 1D9VA 3FGSA 2DOJA 4F2OA 1O64A 1QUKA 1XHYA 4DLDA 4NTLA 2Y7PA 4FJPA 3B6WA 1JVXA 1TT1A 4JXIA 2OCUA 2DXRA 3P7IA 4N6PA 3UIFA 3IOWA 2A5SA 4F22A 4EDPA 3LSXA 4F1VA 4GD5A 2RC8A 4ZEFA 3T9VA 4U1OA 3T9XB 4POWA 1NNTA 1QKBA 1GTKA 2H25A 3I3VA 4LQ2A 2I0BA 3O97A 5KZTA 4ZECA 4OFLA 5H8NB 3SESA 1FTOA 3PUZE 2DYXA 4NWDA 3EHUA 3MPKA 3B6TA 1MXWA 2CZLA 1B5IA 3D4CA 1M5FA 2RF1A 4OEVA 1MS7A 2ZNUA 4GVOA 2XHDA 1XT8A 4ZEKA 4LQ5A 3TYHA 4JBZA 4JSOA 5JK4A 1LCFA 2F7CA 2X7QA 2V25A 1B4ZA 4KYEA 2X7PA 2QL3A 4GIZA 4I8CA 1P99A 1SYHA 1S50A 2GHAA 2Z22A 5H8FA 3U94A 3MVXA 5AA2D 2Y7RA 1UIUA 4G8NA 1B52A 3ODBA 2ESNA 5H8HA 1NMUA 4RPNA 3IOVA 4LA9A 2H5YA 3SEXA 3PGFA 3KSXA 4QFPA 2AL4A 1NH7A 2XX8A 3O6HA 3Q28A 1ZMGA 5I57A 3LBSA 4P11A 5TPAA 3RTWB 1WODA 3VV5A 4FATA 3TFLA 3MVZA 3N6TA 3SEWA 2DWHA 4YU0A 4RNSA 5CC2A 4FEDA 1A7LA 2HFBA 3MUQA 5AA1A 4R6HA 2Y7IA 3IO4A 3HSTA 3VE1B 4POXA 3HCQA 2Y84A 3R6UA 2ZYMA 4YMAA 4N07A 5L9MA 4KR5A 3PUWE 4DZ1A 5TU0A 1IUDA 2UVGA 2I49A 3FXRA 1LBBA 2GFEA 3OSRA 1MM7A 1QW0A 2H9BA 4NF6B 1JW4A 3FIRA 5H8NA 3T22A 4HW8A 1DMBA 3EQ1A 3EN3A 3IORA 4IY5A 4R74A 3KOSA 3IL1B 3FZVA 1SYIA 2XXPA 2HAUA 5B7DA 2Q2CA 3Q29A 3U72A 4F3GA 2Z8FA 1A54A 1OVBA 4MH5A 2B3BA 5BUUA 1JW5A 4I1DA 1US4A 3RT6B 2QRYA 4QSDA 4H5GA 4LUBA 3SEUA 3BBRA 1UTHB 3HHFA 4O3AA 2DWIA 1M5CA 2V3QA 1GV8A 1HSLA 5ISUA 3PPQA 3OO6A 1LSTA 1MQHA 2KLFA 3GBAA 1LAHE 1MY4A 1YAEA 2O7UA 3H6UA 1SI0A 3MVWA 3E3KA 3PPRA 4QRZA 1T0KA 3K6XA 3VVFA 3OO7A 4YKJA 2REJA 4OFOA 5KDTA 2HCAA 1SD3A 5AA4B 1Y3NA 3TPAA 4E0XA 1XC1A 1EU8A 4IO4A 5AA3A 3TEPA 2THIA 3RTFB 1CE2A 4XKQA 5B70A 3OXNA 5H8QB 2XXRA 4GL8A 4GLIA 2I4BA 5I2KB 1ANFA 4BDOA 1VFDA 5M2VA 1XOCA 2O51A 1MXXA 3QSLA 1ZJLA 5I58A 4EF1A 4TOZA 3K02A 3LSFB 1EZOA 3MP6A 1MXUA 3SKPA 1N7WA 3QK6A 2ZNSA 1UTBA 3MW0A 3MVYA 4KPTA 4GF8A 4DXBA 2ZYOA 1MXYA 5AA2B 4NF6A 4OERA 4R6YA 1WDNA 5DEXB 5CMBA 3JZJA 1RYXA 2P2AA 4O3BA 5HPQA 3C33A 4BDRA 5FHNA 2XD2A 1N04A 3R7XA 3KBRA 2YPNA 1VE4A 1FTMA 4ECFA 1IZ1A 3V5AA 3KN8A 2DS9A 2VP1A 3T93B 4K3FA 2FA7A 2OZZA 2Q2AA 1H3DA 1DTGA 4OXVA 2HZLA 3FXUA 1YTVA 4NF5B 1B7HA 1EZ9A 1JQFA 4IGTA 2G29A 5JTYB 1TFDA 3MWBA 3GLBA 5K2YA 2IA4A 2QSXA 1MQJA 1UIVA 2A5TB 5KCJB 3U1OA 5AA4A 3G3GA 3EF7A 3N26A 3KN3A 3N6UA 2F78A 4HCWA 2NXOA 2PT1A 2VGQA 1Y20A 5H8QA 1OQHA 3ECRA 3FV1A 1PC3A 4I62A 4O3CA 1J1NA 2FNCA 5LOMA 5CBSA 2R9JA 3M3KA 4H1XA 1Y3PA 5I2KA 1FTKA 4OWDA 1FCKA 3FVGA 5ELVA 3I6VA 4RPOA 1B7UA 3TELA 3ONMA 1TXFA 3T96B 4KHZE 1GGGA 1MY1A 1R6ZA 1NKXA 2HXWA 1ELJA 1A8EA 3FXQA 2NVUB 1XVYA 3OELA 2OK2A 2QMXA 4EQBA 2AL5A 3DP4A 1Y4TA 2HQ0A 1HSEA 3KJTA 4HS7A 4ZZAA 1II5A 1B7ZA 3TODA 2VOZA 3KJ7A 4BLAA 3I5OA 3HHGA 4F19A 3ZKLA 4OTEA 4QSEA 4ZEDA 2D21A 3V8XB 4IO6A 2W7YA 3TTRA 4E0WA 3FVKA 1BTJA 1LFHA 2PX1A 1I6QA 4MF3A 1POY1 2XXVA 2OBGA 5DYHA 2F35A 2PMSA 2F97A 4LP2B 4ZS9A 4I9DA 3PPOA 3IJXB 3O2AA 5JEIA 4EUOA 2B3FA 3IB0A 4M1VA 1JEVA 3FJGA 3EPEA 4NF5A 3IOTA 1P1UA 3OMBA 1MPDA 3PMWA 1QUJA 4LZ7A 4OESA 5F1QA 2D3IA 3TQLA 5ITOA 3Q26A 1MH3A 3USDA 2XXTA 4IO5A 1VFEA 4X48A 4U21A 3K00A 3R26A 4OHNA 1O7TA 3KZGA 1P1QA 1OLCA 2F36A 4NF4B 4JSDA 1Z7NE 3MBPA 4YB5A 3C9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH3 A;  3E13 X;  5EHM A;  1NNK A;  3CRB A;  2RCB A;  2OJT A;  1A40 A;  1PEB A;  2H98 A;  5F7V A;  4OZ9 A;  4ELR A;  2O69 A;  1ZBM A;  4U23 A;  2Q88 A;  1N3W A;  2I0C A;  2GH9 A;  1MDQ A;  3M8U A;  2XXQ A;  4F31 B;  3G3F A;  3VVD A;  2O6A A;  4YB7 A;  4DXU A;  3HV1 A;  1Y1M A;  3OEK A;  4GFR A;  1JET A;  5BWJ A;  2QPQ A;  1USY E;  4KFQ A;  4KD5 A;  3OEM A;  1EZP A;  1TWY A;  2R71 A;  3U92 A;  5CRY A;  1LLS A;  3H6W A;  4YMB A;  1Q1K A;  1M5E A;  2ONR A;  4YAH X;  3FVO A;  1B40 A;  4DCX A;  2DSF A;  4AQ4 A;  1MY3 A;  2DWJ A;  3DM0 A;  4TLM B;  1N76 A;  4BDQ A;  1MXV A;  2UVJ A;  3O9P A;  4H0W A;  1Q35 A;  1BLF A;  1IEJ A;  2V93 A;  4R72 A;  5TP9 B;  4G68 B;  1P1N A;  3B6Q A;  3H3G A;  4M4G A;  3K6U A;  1JW1 A;  2PVU A;  3Q27 A;  2M8C A;  4MLV A;  4R73 A;  1WVJ A;  4DE8 A;  3LC8 A;  4H8J A;  3UK4 A;  4R75 A;  2ALU A;  2PYY A;  3C32 A;  3CVG A;  2UYE A;  4F29 A;  4IGR A;  4G68 C;  3B7D A;  4QHQ A;  4ELO A;  5AE4 A;  4G4P A;  1DPE A;  3FV2 A;  4OYV A;  5FTI A;  4WXJ A;  3KSJ A;  1MY0 A;  4LON B;  4XTC Q;  1AMF A;  5IAI A;  5CMK A;  4NE4 A;  3MP8 A;  4IO7 A;  2Q9T A;  3IOU A;  4ISU A;  2QMW A;  2O84 X;  5HBC A;  1SW5 A;  2NOO A;  3WAF A;  3GZG A;  1SI1 A;  2O1L A;  3PU5 A;  4YKK A;  3VDF A;  2ZMB A;  3T9U A;  2E1S A;  4WEP A;  3V83 A;  1BIY A;  4LZ8 A;  1B4H A;  5EHS A;  1B3H A;  2PT2 A;  3S9M C;  5I2N B;  5CM6 A;  3IR1 A;  1OIB A;  2YJP A;  4MBP A;  5L9S A;  4GRK A;  4EXL A;  3BKI B;  1XS5 A;  2O68 A;  5I59 B;  1MH4 A;  1SW1 A;  3K01 A;  4LZ5 A;  4H5F A;  2F6P A;  4G77 A;  4RA1 A;  3OO9 A;  5FTH A;  4NF8 B;  4OMB A;  3K4U A;  1JEU A;  4U2R A;  4P0G A;  2REG A;  1ZTY A;  2HAV A;  5ICQ A;  2X26 A;  3S9E A;  1LFI A;  2XX9 A;  1I6A A;  2ONS A;  3TDJ A;  1MQD A;  1MRP A;  3E4R A;  3JV9 A;  4KQP A;  2F8D A;  5I56 B;  1R1N A;  2DQV A;  5DVJ A;  3MQ9 A;  2B65 A;  4ONY A;  1MQI A;  5J1D A;  4QF9 A;  1N0T A;  4DIG A;  5TP9 A;  3MZB A;  4XKP A;  3DP8 A;  4G2Z A;  1B0L A;  3O28 A;  1Y4C A;  4H67 A;  4XKN A;  5A5X B;  3FUZ A;  4OEN A;  1JVY A;  4DXC A;  4ZZE A;  4MFI A;  4F1U A;  3UGW A;  1PBP A;  4F3B A;  2RCA A;  1SDX A;  1BKA A;  4ZDM A;  4GWO A;  3O66 A;  3H7M A;  2AYS A;  1NNP A;  2F7B A;  1AH5 A;  3RN8 A;  4F2Q A;  1UTH A;  1FTL A;  2V3U A;  3FAT A;  1QUI A;  4XIG Q;  1QKA A;  2ABH A;  2DWA A;  4JWY A;  3PD8 A;  3QUJ A;  3A09 A;  3IAZ A;  1B9J A;  4P0I A;  3RY3 A;  2XXH A;  3M3L A;  3VLW A;  5ITP A;  3G3J A;  4JWO A;  1AL3 A;  3UA8 A;  3SDF A;  4OET A;  3VVE A;  3SEY A;  1MXZ A;  4QFN A;  2Y7K A;  4PP0 A;  5I2N A;  3HPI A;  2Z8E A;  4FEB A;  3TTL A;  1ZIU A;  1B6H A;  1FQB A;  1AIV A;  1GVC A;  1FTJ A;  3DEL B;  3KEI A;  4YKI A;  4YKP A;  4PFT A;  4YZZ A;  5IKB A;  5I59 A;  1ZU0 A;  4C1T A;  1MPC A;  4H8I A;  3FD3 A;  3RGY A;  2Z23 A;  4ELP A;  2RC9 A;  1Z7M E;  3TUS A;  1M5B A;  2P0S A;  3K1N A;  1B3E A;  3IB1 A;  5FHM A;  1R9Q A;  4OFJ A;  1ZLQ A;  4ZE8 A;  3TTN A;  4F39 A;  4Q8R A;  3PV0 E;  3AXF A;  5H8F B;  4R2B A;  4U4X A;  3ZKK A;  2RKM A;  3EHT A;  3LSL A;  3W15 C;  3PMV A;  2DXY A;  1QVS A;  3LR1 A;  3C34 A;  1H44 A;  2UXA A;  1ZKB A;  4FIM A;  2I3W A;  5AA2 A;  2QS4 A;  2VD3 A;  1B3G A;  3W9W A;  4Q5T A;  5DEX A;  1S7Y A;  3CFZ A;  3MZ1 A;  1Y1Z A;  4TLL B;  1DSN A;  4ND9 A;  1Y9U A;  3VLV A;  5I57 B;  1H45 A;  3SER A;  2G93 A;  5L8D A;  1MG1 A;  2F34 A;  1LAG E;  2Z8D A;  3RT8 A;  3A3U A;  3PD9 A;  4RXL A;  2GHB A;  4ESX A;  2R6G E;  3C35 A;  3UN6 A;  1I69 A;  4EQ7 A;  1NFT A;  2Q8J A;  3TAJ A;  4R6K A;  1MY2 A;  5HM4 B;  4DDD A;  4PE5 B;  4NWC A;  2ANJ A;  3N94 A;  5H8S A;  4YIC A;  2DVC A;  2H4I A;  1S9T A;  1YPN A;  3S9N C;  3K1M A;  5DT6 A;  3ZS6 A;  1UQW A;  4PFU A;  5JTY A;  3CFX A;  3T66 A;  4JWX A;  1MQG A;  1URG A;  1B1H A;  3MC2 A;  1IXI A;  4QFL A;  1IQ7 A;  2A5T A;  4H6D A;  1NL5 A;  3D4G A;  5KCJ A;  4PQJ A;  3MZ9 A;  1VR5 A;  3IB2 A;  1FQC A;  2F7A A;  4WED A;  3FAS A;  1I6B A;  4YB6 A;  1FQD A;  3A3C A;  2O7I A;  4KYD A;  4PFY A;  1OVT A;  3KG2 A;  3E9X A;  4IB2 A;  3HO7 A;  1NH8 A;  1N7X A;  1SVX B;  4PFW A;  3TKD A;  1IIT A;  3K1P A;  2QS3 A;  2DP8 A;  4RK2 A;  3DP6 A;  3SET A;  4GXS B;  4ZEB A;  1D3K A;  3VFJ A;  1DTZ A;  3VXC A;  4RY1 A;  4R9G A;  2XXX A;  3N5L A;  3IK6 B;  3U8Q A;  4X9T A;  2I58 A;  2XX7 A;  1LAX A;  2I3V A;  2P1S A;  2OLB A;  3KGC A;  3U93 A;  1PDA A;  4F18 A;  1D9Y A;  3TTK A;  1KWH A;  3SEV A;  1R9L A;  2ONK E;  3G3K A;  3RNN A;  1QJM A;  4RYA A;  1MDP 1;  3O6I A;  1OMP A;  5KDT B;  3QYT A;  1LBC A;  4QFK A;  3C4M A;  4F1Y A;  1B1X A;  5DVI A;  1B5H A;  4AB6 A;  1FQE A;  2NWJ A;  2F6G A;  3CR9 A;  3FJM A;  1LCT A;  1F9B A;  1MM6 A;  3S4U A;  4OEU A;  3PUX E;  1SW4 A;  1DOT A;  4NED A;  1SBP A;  4KI0 E;  3PUV E;  3CSB A;  4NMY A;  4R2F A;  4XXU A;  3VLU A;  2VD2 A;  2UVH A;  5I58 B;  1B5J A;  1MPB A;  4ESW A;  3RPW A;  1RKM A;  4GXA A;  3OOA A;  2DE3 A;  1UTB B;  4JDF A;  1LAF E;  3CI8 A;  2XXW A;  3MPL A;  3MP1 A;  1A8F A;  3Q25 A;  4KCC A;  1N3X A;  4BDN A;  3H6V A;  5DTB A;  3H4Z A;  2VHA A;  2XXU A;  4Z7E A;  4FE8 A;  4Q30 B;  3CG1 A;  4NF4 A;  4C0R A;  1D4N A;  3WAE A;  2PBW A;  4IO2 A;  4FEC A;  4GL0 A;  2XXY A;  4AB5 A;  1URD A;  2DE2 A;  4F3P A;  3THI A;  4THI A;  3H03 A;  1DPP A;  2Q89 A;  4BDM A;  4WKM A;  1A55 A;  4DCY A;  3L6G A;  1LB9 A;  1N84 A;  1NNF A;  3W9V A;  4FOR A;  4OVJ A;  5L9O A;  1FQF A;  4RK9 A;  1IXH A;  1IIW A;  1RYO A;  3S2V A;  3EHS A;  2WKY A;  2O1M A;  4QFO A;  5K2X A;  3QXM A;  3TTM A;  2QJE A;  1B58 A;  1SQY A;  1B2H A;  5CMM A;  4EXK A;  1B05 A;  2LAO A;  4H65 A;  3ILT B;  1B3L A;  3MJN A;  2RC7 A;  4EQ9 A;  5ICT A;  4L17 A;  4MLQ A;  3VXB A;  2YLN A;  2I6E A;  3PMX A;  4HCY A;  2H99 A;  1URS A;  3FVN A;  4BDL A;  4U4S A;  2OWS A;  3LUY A;  3TZA A;  3M3F A;  1FQA A;  3QIM A;  4IO3 A;  1IXC A;  1H43 A;  4IY6 A;  3QUF A;  4C1U A;  2V3T A;  1FW0 A;  3KFM A;  1B51 A;  4KYS A;  3JYR A;  3K6W A;  4FAJ A;  3OD7 A;  2XD3 A;  3CIJ A;  4ELQ A;  1Y3Q A;  4G8H A;  3HN0 A;  4QSC A;  2E0S A;  1USY H;  3ZSF A;  3GBB A;  2IEE A;  3PPP A;  4OQO A;  3K0V A;  4GOT A;  3RLF E;  5FHO A;  3TCH A;  3L6H A;  4G68 A;  4UA8 A;  2ZYK A;  1OLA A;  1SW2 A;  2ZXT A;  3F11 A;  3LSW A;  3CFL A;  1GR2 A;  3UOR A;  1M5D A;  3S9L C;  4F3S A;  1BP5 A;  3OEN A;  4RJZ A;  3MAM A;  1PB7 A;  3V89 B;  1CB6 A;  1TFA A;  1H76 A;  3PUY E;  1B0H A;  4LAT A;  3TQW A;  1PBQ A;  4JB7 A;  4Z0I A;  4R9F A;  2NUV A;  3DLN A;  1IXG A;  2I4C A;  4ZEI A;  3G3I A;  1L5T A;  5EYF A;  3TCG A;  4HTG A;  2D5W A;  3TCF A;  5CBR A;  4LVQ A;  1B32 A;  3BFU A;  2DE4 A;  1US5 A;  5I84 A;  3OSQ A;  1O63 A;  2UVI A;  5CI5 A;  1POT A;  4U22 A;  2BJJ X;  3T9H B;  4X1B A;  3OO8 A;  3RUM A;  1A99 A;  4ZE9 A;  2RIN A;  4TQU Q;  3FJ7 A;  5DVF A;  1HSJ A;  2DVZ A;  1P1W A;  2Y7W A;  2F5X A;  1XVX A;  4EF2 A;  1VSO A;  4UAC A;  3H6T A;  3UP9 A;  2UYF A;  3KOT A;  1LFG A;  1JNF A;  3RQT A;  4Q0C A;  4NF8 A;  2XXI A;  1B46 A;  2CMO A;  3TMG A;  3C36 A;  3KN7 A;  3H06 B;  1P1O A;  4X1D A;  2OWT A;  1QUL A;  2GRV A;  1OQG A;  2FYI A;  2QS2 A;  1PB8 A;  3C31 A;  2HZK A;  3ILU B;  5I56 A;  1YCJ A;  3GXA A;  3IX1 A;  4KCD A;  2V84 A;  1ATG A;  4XKR A;  4N13 A;  3IO6 A;  4G8M A;  3IJO B;  5H8H B;  5CMC A;  3O29 A;  1B3F A;  3O6G A;  1AOV A;  3CG3 A;  2HEU A;  3G7W A;  4PET A;  3CSG A;  2AIX A;  3K6V A;  2QS1 A;  1PB9 A;  2ZNT A;  5A5X A;  3K2D A;  4GQO A;  3G3H A;  5TPA B;  3PPN A;  2I48 A;  1LB8 A;  4U1Z A;  2ZYN A;  3BFT A;  3QAX A;  1LGB C;  1D9V A;  3FGS A;  2DOJ A;  4F2O A;  1O64 A;  1QUK A;  1XHY A;  4DLD A;  4NTL A;  2Y7P A;  4FJP A;  3B6W A;  1JVX A;  1TT1 A;  4JXI A;  2OCU A;  2DXR A;  3P7I A;  4N6P A;  3UIF A;  3IOW A;  2A5S A;  4F22 A;  4EDP A;  3LSX A;  4F1V A;  4GD5 A;  2RC8 A;  4ZEF A;  3T9V A;  4U1O A;  3T9X B;  4POW A;  1NNT A;  1QKB A;  1GTK A;  2H25 A;  3I3V A;  4LQ2 A;  2I0B A;  3O97 A;  5KZT A;  4ZEC A;  4OFL A;  5H8N B;  3SES A;  1FTO A;  3PUZ E;  2DYX A;  4NWD A;  3EHU A;  3MPK A;  3B6T A;  1MXW A;  2CZL A;  1B5I A;  3D4C A;  1M5F A;  2RF1 A;  4OEV A;  1MS7 A;  2ZNU A;  4GVO A;  2XHD A;  1XT8 A;  4ZEK A;  4LQ5 A;  3TYH A;  4JBZ A;  4JSO A;  5JK4 A;  1LCF A;  2F7C A;  2X7Q A;  2V25 A;  1B4Z A;  4KYE A;  2X7P A;  2QL3 A;  4GIZ A;  4I8C A;  1P99 A;  1SYH A;  1S50 A;  2GHA A;  2Z22 A;  5H8F A;  3U94 A;  3MVX A;  5AA2 D;  2Y7R A;  1UIU A;  4G8N A;  1B52 A;  3ODB A;  2ESN A;  5H8H A;  1NMU A;  4RPN A;  3IOV A;  4LA9 A;  2H5Y A;  3SEX A;  3PGF A;  3KSX A;  4QFP A;  2AL4 A;  1NH7 A;  2XX8 A;  3O6H A;  3Q28 A;  1ZMG A;  5I57 A;  3LBS A;  4P11 A;  5TPA A;  3RTW B;  1WOD A;  3VV5 A;  4FAT A;  3TFL A;  3MVZ A;  3N6T A;  3SEW A;  2DWH A;  4YU0 A;  4RNS A;  5CC2 A;  4FED A;  1A7L A;  2HFB A;  3MUQ A;  5AA1 A;  4R6H A;  2Y7I A;  3IO4 A;  3HST A;  3VE1 B;  4POX A;  3HCQ A;  2Y84 A;  3R6U A;  2ZYM A;  4YMA A;  4N07 A;  5L9M A;  4KR5 A;  3PUW E;  4DZ1 A;  5TU0 A;  1IUD A;  2UVG A;  2I49 A;  3FXR A;  1LBB A;  2GFE A;  3OSR A;  1MM7 A;  1QW0 A;  2H9B A;  4NF6 B;  1JW4 A;  3FIR A;  5H8N A;  3T22 A;  4HW8 A;  1DMB A;  3EQ1 A;  3EN3 A;  3IOR A;  4IY5 A;  4R74 A;  3KOS A;  3IL1 B;  3FZV A;  1SYI A;  2XXP A;  2HAU A;  5B7D A;  2Q2C A;  3Q29 A;  3U72 A;  4F3G A;  2Z8F A;  1A54 A;  1OVB A;  4MH5 A;  2B3B A;  5BUU A;  1JW5 A;  4I1D A;  1US4 A;  3RT6 B;  2QRY A;  4QSD A;  4H5G A;  4LUB A;  3SEU A;  3BBR A;  1UTH B;  3HHF A;  4O3A A;  2DWI A;  1M5C A;  2V3Q A;  1GV8 A;  1HSL A;  5ISU A;  3PPQ A;  3OO6 A;  1LST A;  1MQH A;  2KLF A;  3GBA A;  1LAH E;  1MY4 A;  1YAE A;  2O7U A;  3H6U A;  1SI0 A;  3MVW A;  3E3K A;  3PPR A;  4QRZ A;  1T0K A;  3K6X A;  3VVF A;  3OO7 A;  4YKJ A;  2REJ A;  4OFO A;  5KDT A;  2HCA A;  1SD3 A;  5AA4 B;  1Y3N A;  3TPA A;  4E0X A;  1XC1 A;  1EU8 A;  4IO4 A;  5AA3 A;  3TEP A;  2THI A;  3RTF B;  1CE2 A;  4XKQ A;  5B70 A;  3OXN A;  5H8Q B;  2XXR A;  4GL8 A;  4GLI A;  2I4B A;  5I2K B;  1ANF A;  4BDO A;  1VFD A;  5M2V A;  1XOC A;  2O51 A;  1MXX A;  3QSL A;  1ZJL A;  5I58 A;  4EF1 A;  4TOZ A;  3K02 A;  3LSF B;  1EZO A;  3MP6 A;  1MXU A;  3SKP A;  1N7W A;  3QK6 A;  2ZNS A;  1UTB A;  3MW0 A;  3MVY A;  4KPT A;  4GF8 A;  4DXB A;  2ZYO A;  1MXY A;  5AA2 B;  4NF6 A;  4OER A;  4R6Y A;  1WDN A;  5DEX B;  5CMB A;  3JZJ A;  1RYX A;  2P2A A;  4O3B A;  5HPQ A;  3C33 A;  4BDR A;  5FHN A;  2XD2 A;  1N04 A;  3R7X A;  3KBR A;  2YPN A;  1VE4 A;  1FTM A;  4ECF A;  1IZ1 A;  3V5A A;  3KN8 A;  2DS9 A;  2VP1 A;  3T93 B;  4K3F A;  2FA7 A;  2OZZ A;  2Q2A A;  1H3D A;  1DTG A;  4OXV A;  2HZL A;  3FXU A;  1YTV A;  4NF5 B;  1B7H A;  1EZ9 A;  1JQF A;  4IGT A;  2G29 A;  5JTY B;  1TFD A;  3MWB A;  3GLB A;  5K2Y A;  2IA4 A;  2QSX A;  1MQJ A;  1UIV A;  2A5T B;  5KCJ B;  3U1O A;  5AA4 A;  3G3G A;  3EF7 A;  3N26 A;  3KN3 A;  3N6U A;  2F78 A;  4HCW A;  2NXO A;  2PT1 A;  2VGQ A;  1Y20 A;  5H8Q A;  1OQH A;  3ECR A;  3FV1 A;  1PC3 A;  4I62 A;  4O3C A;  1J1N A;  2FNC A;  5LOM A;  5CBS A;  2R9J A;  3M3K A;  4H1X A;  1Y3P A;  5I2K A;  1FTK A;  4OWD A;  1FCK A;  3FVG A;  5ELV A;  3I6V A;  4RPO A;  1B7U A;  3TEL A;  3ONM A;  1TXF A;  3T96 B;  4KHZ E;  1GGG A;  1MY1 A;  1R6Z A;  1NKX A;  2HXW A;  1ELJ A;  1A8E A;  3FXQ A;  2NVU B;  1XVY A;  3OEL A;  2OK2 A;  2QMX A;  4EQB A;  2AL5 A;  3DP4 A;  1Y4T A;  2HQ0 A;  1HSE A;  3KJT A;  4HS7 A;  4ZZA A;  1II5 A;  1B7Z A;  3TOD A;  2VOZ A;  3KJ7 A;  4BLA A;  3I5O A;  3HHG A;  4F19 A;  3ZKL A;  4OTE A;  4QSE A;  4ZED A;  2D21 A;  3V8X B;  4IO6 A;  2W7Y A;  3TTR A;  4E0W A;  3FVK A;  1BTJ A;  1LFH A;  2PX1 A;  1I6Q A;  4MF3 A;  1POY 1;  2XXV A;  2OBG A;  5DYH A;  2F35 A;  2PMS A;  2F97 A;  4LP2 B;  4ZS9 A;  4I9D A;  3PPO A;  3IJX B;  3O2A A;  5JEI A;  4EUO A;  2B3F A;  3IB0 A;  4M1V A;  1JEV A;  3FJG A;  3EPE A;  4NF5 A;  3IOT A;  1P1U A;  3OMB A;  1MPD A;  3PMW A;  1QUJ A;  4LZ7 A;  4OES A;  5F1Q A;  2D3I A;  3TQL A;  5ITO A;  3Q26 A;  1MH3 A;  3USD A;  2XXT A;  4IO5 A;  1VFE A;  4X48 A;  4U21 A;  3K00 A;  3R26 A;  4OHN A;  1O7T A;  3KZG A;  1P1Q A;  1OLC A;  2F36 A;  4NF4 B;  4JSD A;  1Z7N E;  3MBP A;  4YB5 A;  3C9H A; 
#chains in the Genus database with same CATH topology
 1EH3 A;  3E13 X;  5EHM A;  1NNK A;  3CRB A;  2RCB A;  4IR8 A;  4XEQ A;  2OJT A;  1A40 A;  1PEB A;  1NUZ A;  2H98 A;  5F7V A;  4OZ9 A;  4ELR A;  2O69 A;  1ZBM A;  4U23 A;  2Q88 A;  1FRP A;  1N3W A;  2I0C A;  2GH9 A;  1MDQ A;  3SZP A;  3M8U A;  2XXQ A;  4PFR A;  5IZ1 A;  4F31 B;  3G3F A;  3VVD A;  2O6A A;  3B50 A;  4YB7 A;  4DXU A;  3HV1 A;  1Y1M A;  4HE1 A;  3OEK A;  4PAF A;  5IGA A;  4GFR A;  5EQ9 A;  1JET A;  1KA1 A;  5BWJ A;  2QPQ A;  1USY E;  4KFQ A;  4PCD A;  4KD5 A;  2B4L A;  2WYP A;  3OEM A;  1EZP A;  1TWY A;  2R71 A;  3U92 A;  5CRY A;  1LLS A;  3H6W A;  4YMB A;  1Q1K A;  4PC9 A;  1M5E A;  2ONR A;  4YAH X;  4NF0 A;  3FVO A;  1B40 A;  4DCX A;  2DSF A;  4AQ4 A;  1MY3 A;  2DWJ A;  2CZH A;  3DM0 A;  4TLM B;  1N76 A;  4BDQ A;  1MXV A;  2UVJ A;  3QMF A;  3O9P A;  4H0W A;  3LUZ A;  1Q35 A;  1BLF A;  1IEJ A;  4G61 A;  1LBW A;  2V93 A;  4R72 A;  3E79 A;  5TP9 B;  4G68 B;  1P1N A;  3B6Q A;  3H3G A;  4M4G A;  2FVZ A;  3K6U A;  1JW1 A;  2PVU A;  3Q27 A;  2M8C A;  4MLV A;  4R73 A;  1WVJ A;  4N17 A;  4DE8 A;  3LC8 A;  4H8J A;  3UK4 A;  2FIE A;  4P3L A;  4R75 A;  2ALU A;  2PYY A;  3C32 A;  3CVG A;  2UYE A;  4I3Y A;  4F29 A;  4IGR A;  4G68 C;  5LTC A;  3B7D A;  4QHQ A;  4ELO A;  5AE4 A;  4G4P A;  1DPE A;  4AS4 A;  3FV2 A;  4OYV A;  2V4C A;  5FTI A;  4WXJ A;  3KSJ A;  1MY0 A;  2XWK A;  4N4U A;  4LON B;  4XTC Q;  1AMF A;  3T0J A;  5IAI A;  5CMK A;  4NE4 A;  3MP8 A;  3GYY A;  4IO7 A;  2Q9T A;  3IOU A;  1BK4 A;  4ISU A;  2QMW A;  2O84 X;  5HBC A;  1SW5 A;  2NOO A;  3WAF A;  3GZG A;  1D9Q A;  1SI1 A;  2FBP A;  2O1L A;  4O7M A;  3PU5 A;  3IFC A;  4YKK A;  4OA4 A;  3VDF A;  2ZMB A;  3T9U A;  2E1S A;  4WEP A;  2KR0 A;  3V83 A;  1BIY A;  4LZ8 A;  1B4H A;  5EHS A;  1B3H A;  2PT2 A;  3S9M C;  5I2N B;  5CM6 A;  4XF5 A;  3IR1 A;  4N8Y A;  1OIB A;  2YJP A;  4MBP A;  5EYG A;  5L9S A;  2WYK A;  4GRK A;  2XWV A;  4EXL A;  3BKI B;  1XS5 A;  2O68 A;  5I59 B;  1MH4 A;  4JVC A;  1SW1 A;  3K01 A;  3HFU A;  4LZ5 A;  4H5F A;  2F6P A;  4G77 A;  4RA1 A;  3OO9 A;  5FTH A;  4NF8 B;  4OMB A;  3K4U A;  1JEU A;  1DCU A;  4U2R A;  4P0G A;  2REG A;  1ZTY A;  2HAV A;  5ICQ A;  2X26 A;  3S9E A;  1LFI A;  2XX9 A;  1I6A A;  2ONS A;  3TDJ A;  1DK4 A;  1MRP A;  1MQD A;  4PGN A;  3E4R A;  3JV9 A;  4KQP A;  2F8D A;  5I56 B;  1R1N A;  2DQV A;  5DVJ A;  3MQ9 A;  2B65 A;  4ONY A;  1MQI A;  5J1D A;  4QF9 A;  1N0T A;  4DIG A;  5TP9 A;  5IZ3 B;  4PF8 A;  4P47 A;  3MZB A;  4XKP A;  3DP8 A;  4G2Z A;  1B0L A;  3O28 A;  1Y4C A;  4H67 A;  4XKN A;  4NGU A;  3RPL B;  4PAI A;  5A5X B;  3FUZ A;  4OEN A;  1JVY A;  4DXC A;  4ZZE A;  4MFI A;  4PDH A;  2WEF A;  1QGX A;  4F1U A;  3UGW A;  1PBP A;  2L5V A;  4F3B A;  4GWY A;  2RCA A;  1SDX A;  1BKA A;  4ZDM A;  4GWO A;  3O66 A;  3H7M A;  2AYS A;  1NNP A;  2F7B A;  1AH5 A;  3RN8 A;  4F2Q A;  1UTH A;  1FTL A;  2V3U A;  3FAT A;  1QUI A;  4XIG Q;  5I3S A;  1QKA A;  2ABH A;  2DWA A;  4UAB A;  4JWY A;  3PD8 A;  3QUJ A;  3A09 A;  1KA0 A;  3IAZ A;  1B9J A;  4P0I A;  3RY3 A;  1NV0 A;  2XXH A;  3M3L A;  3VLW A;  5ITP A;  3G3J A;  4JWO A;  1AL3 A;  3UA8 A;  3SDF A;  4OET A;  3VVE A;  3SEY A;  1MXZ A;  4QFN A;  2Y7K A;  4PP0 A;  5I2N A;  3HPI A;  4GWW A;  2Z8E A;  4FEB A;  3TTL A;  1ZIU A;  2JJK A;  4NN3 A;  1B6H A;  1IMA A;  1FQB A;  1AIV A;  1GVC A;  1FTJ A;  3DEL B;  3KEI A;  4YKI A;  4YKP A;  4PFT A;  4YZZ A;  5IKB A;  5I59 A;  1ZU0 A;  3B8B A;  4C1T A;  1MPC A;  4O94 A;  4H8I A;  4GWU A;  3FD3 A;  3RGY A;  2Z23 A;  4ELP A;  2RC9 A;  1Z7M E;  3TUS A;  1M5B A;  4PTK A;  2P0S A;  3K1N A;  1B3E A;  2Y5K A;  3IB1 A;  5FHM A;  1FBC A;  4JVD A;  1R9Q A;  4OFJ A;  1ZLQ A;  4PDD A;  4ZE8 A;  3TTN A;  4F39 A;  4Q8R A;  3PV0 E;  3AXF A;  1FBF A;  5H8F B;  4R2B A;  4U4X A;  3ZKK A;  2RKM A;  3EHT A;  3LSL A;  3W15 C;  3PMV A;  2DXY A;  1QVS A;  3LR1 A;  3C34 A;  1H44 A;  2UXA A;  1ZKB A;  2OWZ A;  4FIM A;  2I3W A;  5AA2 A;  2QS4 A;  2VD3 A;  1B3G A;  3W9W A;  4Q5T A;  5DEX A;  4DI3 D;  1S7Y A;  3CFZ A;  3MZ1 A;  1Y1Z A;  4TLL B;  1DSN A;  4ND9 A;  1Y9U A;  3VLV A;  4GX4 A;  5I57 B;  1H45 A;  3SER A;  2G93 A;  5L8D A;  1MG1 A;  2F34 A;  2FIX A;  1LAG E;  2Z8D A;  3RT8 A;  3A3U A;  2CEX A;  3PD9 A;  4RXL A;  2GHB A;  4ESX A;  2R6G E;  3C35 A;  3UN6 A;  1I69 A;  4EQ7 A;  1NFT A;  2Q8J A;  4HXV A;  3TAJ A;  4R6K A;  1MY2 A;  5HM4 B;  1DBZ A;  4DDD A;  4PE5 B;  4NWC A;  2HXR A;  2ANJ A;  3N94 A;  1YZ0 A;  5H8S A;  4YIC A;  2DVC A;  2H4I A;  1S9T A;  1YPN A;  3S9N C;  1FBP A;  3K1M A;  5DT6 A;  3ZS6 A;  2Q74 A;  3PTY A;  1UQW A;  1YXI A;  4PFU A;  5JTY A;  3CFX A;  3T66 A;  4JWX A;  3KBZ A;  2PFY A;  1MQG A;  1URG A;  1B1H A;  3MC2 A;  1IXI A;  4QFL A;  1IQ7 A;  2A5T A;  4H6D A;  1NL5 A;  3D4G A;  5KCJ A;  4PQJ A;  3MZ9 A;  1VR5 A;  3IB2 A;  1FQC A;  2F7A A;  1SPI A;  4WED A;  3FAS A;  1I6B A;  2MKZ A;  4YB6 A;  1FQD A;  3A3C A;  2O7I A;  4KYD A;  4PFY A;  4GWZ A;  1OVT A;  1FPJ A;  3KG2 A;  3E9X A;  4IB2 A;  4OVP A;  3HO7 A;  1NH8 A;  1N7X A;  1SVX B;  4PFW A;  3TKD A;  1IIT A;  3K1P A;  2QS3 A;  2DP8 A;  4RK2 A;  1NV1 A;  3DP6 A;  3SET A;  4GXS B;  4ZEB A;  1JP4 A;  1D3K A;  2WX9 A;  3VFJ A;  1DTZ A;  3VXC A;  4RY1 A;  4R9G A;  2XXX A;  3N5L A;  1CNQ A;  3IK6 B;  3U8Q A;  4X9T A;  2I58 A;  2XX7 A;  1LAX A;  2I3V A;  2P1S A;  2OLB A;  3KGC A;  5ET6 A;  3U93 A;  1VDW A;  1PDA A;  4F18 A;  1D9Y A;  1FSA A;  3TTK A;  1KWH A;  3SEV A;  4I40 A;  1R9L A;  2ONK E;  3G3K A;  4XFE A;  3RNN A;  1QJM A;  4RYA A;  1MDP 1;  3O6I A;  1OMP A;  5KDT B;  3QYT A;  1LBC A;  4MMP A;  4QFK A;  3C4M A;  4N91 A;  4F1Y A;  1B1X A;  5DVI A;  1NV6 A;  4MNP A;  1B5H A;  4AB6 A;  1FQE A;  1RDY A;  2NWJ A;  2F6G A;  3CR9 A;  3FJM A;  4MNC A;  1LCT A;  1F9B A;  1MM6 A;  1FPG A;  3S4U A;  4OEU A;  3PUX E;  1SW4 A;  1DOT A;  4OAN A;  4NED A;  1SBP A;  4KI0 E;  3PUV E;  3CSB A;  4NMY A;  4R2F A;  4XXU A;  3VLU A;  3ROJ A;  2VD2 A;  2UVH A;  4PBH A;  5I58 B;  1B5J A;  1MPB A;  4ESW A;  1IMF A;  3RPW A;  1LBY A;  1RKM A;  4GXA A;  3D1R A;  3OOA A;  2DE3 A;  1UTB B;  4JDF A;  1LAF E;  3CI8 A;  2XXW A;  3MPL A;  3MP1 A;  4AS5 A;  1A8F A;  3Q25 A;  4KCC A;  1N3X A;  4BDN A;  3H6V A;  5DTB A;  3H4Z A;  2VHA A;  2XXU A;  4Z7E A;  4FE8 A;  4Q30 B;  3CG1 A;  4NF4 A;  1NV7 A;  4C0R A;  1D4N A;  3WAE A;  2PBW A;  4IO2 A;  4FEC A;  4GL0 A;  2XXY A;  4AB5 A;  1URD A;  2DE2 A;  4F3P A;  3THI A;  4THI A;  3H03 A;  4N8G A;  1DPP A;  2Q89 A;  1NV3 A;  4BDM A;  5T3J A;  4WKM A;  1A55 A;  4DCY A;  4P8B A;  3L6G A;  1LB9 A;  1N84 A;  1NNF A;  3W9V A;  4GX3 A;  1K9Y A;  4FOR A;  4OVJ A;  5L9O A;  1FQF A;  2Y5L A;  4RK9 A;  1IXH A;  1IIW A;  1RYO A;  1FBG A;  3S2V A;  3EHS A;  2WKY A;  2O1M A;  4QFO A;  5K2X A;  3QXM A;  3TTM A;  2QJE A;  1B58 A;  1SQY A;  1B2H A;  5CMM A;  4EXK A;  1B05 A;  2LAO A;  4H65 A;  3ILT B;  1B3L A;  3MJN A;  2RC7 A;  4EQ9 A;  5ICT A;  4L17 A;  4MLQ A;  4NG7 A;  3VXB A;  2YLN A;  2I6E A;  3PMX A;  4HCY A;  2FHY A;  2H99 A;  1URS A;  3FVN A;  4BDL A;  2QFL A;  4U4S A;  2OWS A;  3LUY A;  3TZA A;  3M3F A;  1FQA A;  3QIM A;  4IO3 A;  1IXC A;  4GWX A;  1H43 A;  4IY6 A;  3QUF A;  4MIJ A;  4C1U A;  2V3T A;  1FW0 A;  3KFM A;  1B51 A;  1Q9D A;  4KYS A;  3JYR A;  3K6W A;  4FAJ A;  1IMB A;  3OD7 A;  2XD3 A;  3CIJ A;  4ELQ A;  2QVV A;  1Y3Q A;  4G8H A;  3HN0 A;  4QSC A;  2E0S A;  1USY H;  3ZSF A;  3GBB A;  2IEE A;  3PPP A;  4OQO A;  3K0V A;  4GOT A;  3RLF E;  5FHO A;  3TCH A;  3L6H A;  2CZI A;  4G68 A;  4UA8 A;  2ZYK A;  1OLA A;  1INP A;  1SW2 A;  2ZXT A;  3F11 A;  3LSW A;  3U65 A;  3CFL A;  2WBB A;  1GR2 A;  5EYH A;  1NV5 A;  3UOR A;  1EYJ A;  1M5D A;  3S9L C;  4F3S A;  1BP5 A;  3OEN A;  4MHF A;  4PFB A;  4RJZ A;  3MAM A;  1PB7 A;  4P56 A;  3V89 B;  1CB6 A;  1TFA A;  3T1B A;  1H76 A;  3PUY E;  1B0H A;  2B4M A;  4LAT A;  3TQW A;  1XI6 A;  1PBQ A;  4JB7 A;  4Z0I A;  1IMD A;  4R9F A;  2NUV A;  3DLN A;  1IXG A;  2I4C A;  4ZEI A;  3G3I A;  1L5T A;  5EYF A;  3TCG A;  4HTG A;  2D5W A;  3TCF A;  5CBR A;  4LVQ A;  1B32 A;  3BFU A;  2DE4 A;  1US5 A;  5I84 A;  3OSQ A;  1IMC A;  1O63 A;  4GBV A;  2UVI A;  5CI5 A;  1POT A;  4U22 A;  3KC1 A;  2BJJ X;  2XWO A;  3T9H B;  2VPN A;  4PF6 A;  4X1B A;  3OO8 A;  3RUM A;  1A99 A;  4ZE9 A;  2RIN A;  4TQU Q;  3FJ7 A;  5DVF A;  1HSJ A;  2DVZ A;  1P1W A;  4I3E A;  4MEV A;  1FJ9 A;  2Y7W A;  2F5X A;  2ZZX A;  1XVX A;  4EF2 A;  1VSO A;  4UAC A;  3H6T A;  3UP9 A;  4OVQ A;  2CZK A;  1FTA A;  2UYF A;  3KOT A;  1LFG A;  1JNF A;  3RQT A;  4Q0C A;  4NF8 A;  2XXI A;  1B46 A;  1RDX A;  2CMO A;  3TMG A;  3C36 A;  3KN7 A;  2XWI A;  3H06 B;  1P1O A;  4X1D A;  2OWT A;  3NOH A;  1QUL A;  2GRV A;  1NUX A;  1OQG A;  2FYI A;  2QS2 A;  1PB8 A;  3C31 A;  2HZK A;  3ILU B;  5I56 A;  1YCJ A;  3GXA A;  1FPE A;  3IX1 A;  4KCD A;  2V84 A;  1ATG A;  4XKR A;  4N13 A;  3IO6 A;  3ISP A;  4G8M A;  3IJO B;  5IZ3 A;  4OVR A;  5H8H B;  5CMC A;  3O29 A;  1B3F A;  4PAK A;  3O6G A;  1AOV A;  3CG3 A;  2HEU A;  3G7W A;  3MST A;  4PET A;  2R8T A;  3CSG A;  2AIX A;  3K6V A;  3RPL A;  2KQZ A;  2QS1 A;  1PB9 A;  2ZNT A;  5A5X A;  3K2D A;  2WBD A;  1IME A;  4GQO A;  3G3H A;  5TPA B;  3PPN A;  2F3D A;  2I48 A;  2ZZW A;  1LB8 A;  4U1Z A;  2ZYN A;  3BFT A;  3QAX A;  1LGB C;  4OVS A;  1D9V A;  3FGS A;  2DOJ A;  4F2O A;  1LBZ A;  1O64 A;  1QUK A;  1XHY A;  4DLD A;  4NTL A;  4KXP A;  2Y7P A;  4FJP A;  3B6W A;  1JVX A;  1TT1 A;  4JXI A;  3A29 A;  2OCU A;  2DXR A;  3P7I A;  4N6P A;  3UIF A;  1FPI A;  3IOW A;  2A5S A;  4F22 A;  4EDP A;  3LSX A;  4F1V A;  4DI4 B;  4H45 A;  3RYD A;  4GD5 A;  2RC8 A;  4ZEF A;  3T9V A;  4U1O A;  3T9X B;  4POW A;  1NNT A;  1QKB A;  1FPD A;  1GTK A;  2VPO A;  2H25 A;  3I3V A;  4LQ2 A;  1EYI A;  2HHM A;  4P9K A;  2I0B A;  3O97 A;  5KZT A;  4ZEC A;  4OFL A;  5H8N B;  3SES A;  1FTO A;  3PUZ E;  2DYX A;  4NWD A;  3EHU A;  3MPK A;  3B6T A;  1MXW A;  2CZL A;  1B5I A;  3D4C A;  1M5F A;  2RF1 A;  4OEV A;  1MS7 A;  2ZNU A;  4GVO A;  5ET5 A;  2BJI A;  2XHD A;  1XT8 A;  4ZEK A;  4LQ5 A;  3TYH A;  4JBZ A;  4JSO A;  5JK4 A;  1LCF A;  2F7C A;  2X7Q A;  2CEY A;  2V25 A;  1B4Z A;  4PGP A;  4KYE A;  2X7P A;  2QL3 A;  4GIZ A;  4I8C A;  4LN5 A;  1P99 A;  1SYH A;  1S50 A;  4O8M A;  2PFZ A;  2HPG A;  2GHA A;  3KC0 A;  2Z22 A;  5H8F A;  3U94 A;  3MVX A;  4G8N A;  2Y7R A;  1UIU A;  5AA2 D;  1B52 A;  3ODB A;  4O7I A;  2ESN A;  4QBA A;  5H8H A;  1NMU A;  4RPN A;  3IOV A;  4LA9 A;  2H5Y A;  3SEX A;  3PGF A;  3KSX A;  4QFP A;  2AL4 A;  1G0H A;  1NH7 A;  2XX8 A;  2DDK A;  3O6H A;  3Q28 A;  1ZMG A;  4GX6 A;  1G0I A;  5I57 A;  3LBS A;  3BIH A;  4P11 A;  5TPA A;  3RTW B;  2P3V A;  1WOD A;  4H46 A;  3VV5 A;  4NHB A;  4FAT A;  4HE0 A;  3TFL A;  3MVZ A;  3N6T A;  3SEW A;  4MAG A;  2DWH A;  4YU0 A;  4RNS A;  5CC2 A;  4FED A;  1A7L A;  2HFB A;  4NAP A;  3MUQ A;  5AA1 A;  4R6H A;  2Y7I A;  3IO4 A;  3HST A;  3VE1 B;  4POX A;  3HCQ A;  2Y84 A;  3R6U A;  4QXD A;  1FPF A;  2ZYM A;  1LBX A;  5IZZ A;  4YMA A;  4N07 A;  5L9M A;  4KR5 A;  3CHG A;  3PUW E;  4DZ1 A;  4N6K A;  5TU0 A;  1IUD A;  2UVG A;  2I49 A;  3FXR A;  1LBB A;  2GFE A;  3OSR A;  1MM7 A;  2F3B A;  1QW0 A;  2H9B A;  1NV2 A;  4NF6 B;  1JW4 A;  3FIR A;  5H8N A;  3T22 A;  5IM2 A;  4HW8 A;  1DMB A;  3EQ1 A;  3EN3 A;  3IOR A;  4IY5 A;  4R74 A;  3FBP A;  3KOS A;  3IL1 B;  3FZV A;  1NUY A;  1SYI A;  2XXP A;  2HAU A;  5B7D A;  2Q2C A;  3Q29 A;  2Q8M A;  3U72 A;  4F3G A;  2Z8F A;  1A54 A;  1OVB A;  4MH5 A;  2B3B A;  5BUU A;  1JW5 A;  4I1D A;  1US4 A;  3RT6 B;  2QRY A;  4QSD A;  4H5G A;  2XXK A;  4LUB A;  3SEU A;  3BBR A;  1UTH B;  3HHF A;  4O3A A;  2DWI A;  1M5C A;  2V3Q A;  1KZ8 A;  3LV0 A;  4X8R A;  1HSL A;  1GV8 A;  5ISU A;  4MNI A;  3PPQ A;  5I5P A;  3OO6 A;  1LST A;  1MQH A;  2KLF A;  3GBA A;  1LAH E;  1MY4 A;  1YAE A;  2O7U A;  3H6U A;  1SI0 A;  3MVW A;  3E3K A;  3PPR A;  4QRZ A;  5DW8 A;  1T0K A;  3K6X A;  5FBP A;  3VVF A;  3EKI A;  3OO7 A;  4YKJ A;  2REJ A;  4OFO A;  5KDT A;  2HCA A;  1SD3 A;  5AA4 B;  1Y3N A;  3TPA A;  1LEV A;  4E0X A;  1XC1 A;  1FPL A;  1EU8 A;  3MYU A;  5J16 A;  4IO4 A;  5AA3 A;  3TEP A;  2THI A;  3RTF B;  1CE2 A;  4XKQ A;  1NV4 A;  5EQA A;  2OX3 A;  5B70 A;  3OXN A;  2VT5 A;  5H8Q B;  2XXR A;  2QVR A;  4GL8 A;  2P3N A;  4GLI A;  2I4B A;  5I2K B;  1ANF A;  4BDO A;  4MX6 A;  1VFD A;  5M2V A;  1XOC A;  2O51 A;  1MXX A;  3QSL A;  1ZJL A;  5I58 A;  5LDZ A;  4EF1 A;  1NI9 A;  4TOZ A;  3K02 A;  3LSF B;  1EZO A;  3MP6 A;  1MXU A;  3SKP A;  1EYK A;  1N7W A;  3QK6 A;  2ZNS A;  1UTB A;  3IFA A;  3MW0 A;  3MVY A;  4KPT A;  4GF8 A;  4DXB A;  2ZYO A;  1MXY A;  5AA2 B;  4NF6 A;  4OER A;  4R6Y A;  1WDN A;  4MCO A;  5DEX B;  5CMB A;  3JZJ A;  1RYX A;  2P2A A;  4O3B A;  5HPQ A;  3C33 A;  4BDR A;  5FHN A;  2XD2 A;  1N04 A;  4OVT A;  3R7X A;  3KBR A;  2YPN A;  1VE4 A;  1FTM A;  4N6D A;  4ECF A;  1IZ1 A;  3V5A A;  3KN8 A;  2DS9 A;  2VP1 A;  3T93 B;  4K3F A;  2FA7 A;  2OZZ A;  2Q2A A;  1H3D A;  1FPK A;  1DTG A;  4OXV A;  2HZL A;  1FBH A;  3FXU A;  1YTV A;  4NF5 B;  1B7H A;  1EZ9 A;  1JQF A;  4IGT A;  2G29 A;  5JTY B;  1TFD A;  3MWB A;  2QVU A;  5ET8 A;  3GLB A;  5K2Y A;  2IA4 A;  2QSX A;  1MQJ A;  1UIV A;  2A5T B;  2PCR A;  5KCJ B;  3U1O A;  5AA4 A;  3G3G A;  3EF7 A;  3N26 A;  3KN3 A;  3N6U A;  2F78 A;  4P1E A;  4HCW A;  2NXO A;  2PT1 A;  4FBP A;  2VGQ A;  4P1L A;  1Y20 A;  4MJO A;  5H8Q A;  1OQH A;  3ECR A;  2ZZV A;  3FV1 A;  1PC3 A;  4I62 A;  4JVI A;  4X04 A;  4O3C A;  1J1N A;  5F24 A;  2FNC A;  5LOM A;  5CBS A;  2R9J A;  3M3K A;  4H1X A;  1Y3P A;  5I2K A;  4N15 A;  4GWS A;  5EQ7 A;  4PBQ A;  1FTK A;  4OWD A;  1FCK A;  3FVG A;  5ELV A;  3I6V A;  4RPO A;  1B7U A;  3BIG A;  3TEL A;  2XA5 A;  3ONM A;  1TXF A;  3T96 B;  4KHZ E;  1GGG A;  1MY1 A;  1R6Z A;  1NKX A;  2HXW A;  1ELJ A;  4NX1 A;  1A8E A;  3FXQ A;  2NVU B;  1XVY A;  3OEL A;  5A5L A;  2OK2 A;  2QMX A;  4EQB A;  2AL5 A;  3DP4 A;  1Y4T A;  2HQ0 A;  4N81 A;  1HSE A;  3KJT A;  4HS7 A;  1AWB A;  1K9Z A;  4ZZA A;  1II5 A;  1B7Z A;  5ET7 A;  3TOD A;  1RDZ A;  2VOZ A;  3KJ7 A;  4BLA A;  3I5O A;  3HHG A;  3FXB A;  4F19 A;  4GBW A;  5ESY A;  3ZKL A;  4OTE A;  1FBD A;  4QSE A;  4ZED A;  2D21 A;  3V8X B;  4IO6 A;  2W7Y A;  3TTR A;  4E0W A;  2GQ1 A;  3FVK A;  1BTJ A;  1LFH A;  2PX1 A;  1I6Q A;  4MF3 A;  1POY 1;  2XXV A;  2OBG A;  5DYH A;  2F35 A;  1LBV A;  2PMS A;  2F97 A;  4LP2 B;  4ZS9 A;  4I9D A;  3PPO A;  3IJX B;  3O2A A;  5JEI A;  3E78 A;  4EUO A;  1FJ6 A;  2B3F A;  3IB0 A;  4M1V A;  1JEV A;  3FJG A;  3EPE A;  4NF5 A;  3IOT A;  1P1U A;  1NUW A;  3OMB A;  1MPD A;  3PMW A;  1QUJ A;  4LZ7 A;  4OES A;  4PFI A;  5F1Q A;  4NQ8 A;  2D3I A;  3TQL A;  5ITO A;  3Q26 A;  5I7I A;  1MH3 A;  3USD A;  1FPB A;  2XXT A;  4IO5 A;  1VFE A;  4X48 A;  4U21 A;  3K00 A;  3R26 A;  4HE2 A;  4OHN A;  1FBE A;  1O7T A;  3KZG A;  1P1Q A;  1OLC A;  5EQ8 A;  2F36 A;  4NF4 B;  4JSD A;  1Z7N E;  3MBP A;  1YYZ A;  4PE3 A;  4YB5 A;  3C9H A; 
#chains in the Genus database with same CATH homology
 1EH3 A;  3E13 X;  5EHM A;  1NNK A;  3CRB A;  2RCB A;  2OJT A;  1A40 A;  1PEB A;  2H98 A;  5F7V A;  4OZ9 A;  4ELR A;  2O69 A;  1ZBM A;  4U23 A;  2Q88 A;  1N3W A;  2I0C A;  2GH9 A;  1MDQ A;  3M8U A;  2XXQ A;  4F31 B;  3G3F A;  3VVD A;  2O6A A;  4YB7 A;  4DXU A;  3HV1 A;  1Y1M A;  3OEK A;  4GFR A;  1JET A;  5BWJ A;  2QPQ A;  1USY E;  4KFQ A;  4KD5 A;  3OEM A;  1EZP A;  1TWY A;  2R71 A;  3U92 A;  5CRY A;  1LLS A;  3H6W A;  4YMB A;  1Q1K A;  1M5E A;  2ONR A;  4YAH X;  3FVO A;  1B40 A;  4DCX A;  2DSF A;  4AQ4 A;  1MY3 A;  2DWJ A;  3DM0 A;  4TLM B;  1N76 A;  4BDQ A;  1MXV A;  2UVJ A;  3O9P A;  4H0W A;  1Q35 A;  1BLF A;  1IEJ A;  2V93 A;  4R72 A;  5TP9 B;  4G68 B;  1P1N A;  3B6Q A;  3H3G A;  4M4G A;  3K6U A;  1JW1 A;  2PVU A;  3Q27 A;  2M8C A;  4MLV A;  4R73 A;  1WVJ A;  4DE8 A;  3LC8 A;  4H8J A;  3UK4 A;  4R75 A;  2ALU A;  2PYY A;  3C32 A;  3CVG A;  2UYE A;  4F29 A;  4IGR A;  4G68 C;  3B7D A;  4QHQ A;  4ELO A;  5AE4 A;  4G4P A;  1DPE A;  3FV2 A;  4OYV A;  5FTI A;  4WXJ A;  3KSJ A;  1MY0 A;  4LON B;  4XTC Q;  1AMF A;  5IAI A;  5CMK A;  4NE4 A;  3MP8 A;  4IO7 A;  2Q9T A;  3IOU A;  4ISU A;  2QMW A;  2O84 X;  5HBC A;  1SW5 A;  2NOO A;  3WAF A;  3GZG A;  1SI1 A;  2O1L A;  3PU5 A;  4YKK A;  3VDF A;  2ZMB A;  3T9U A;  2E1S A;  4WEP A;  3V83 A;  1BIY A;  4LZ8 A;  1B4H A;  5EHS A;  1B3H A;  2PT2 A;  3S9M C;  5I2N B;  5CM6 A;  3IR1 A;  1OIB A;  2YJP A;  4MBP A;  5L9S A;  4GRK A;  4EXL A;  3BKI B;  1XS5 A;  2O68 A;  5I59 B;  1MH4 A;  1SW1 A;  3K01 A;  4LZ5 A;  4H5F A;  2F6P A;  4G77 A;  4RA1 A;  3OO9 A;  5FTH A;  4NF8 B;  4OMB A;  3K4U A;  1JEU A;  4U2R A;  4P0G A;  2REG A;  1ZTY A;  2HAV A;  5ICQ A;  2X26 A;  3S9E A;  1LFI A;  2XX9 A;  1I6A A;  2ONS A;  3TDJ A;  1MQD A;  1MRP A;  3E4R A;  3JV9 A;  4KQP A;  2F8D A;  5I56 B;  1R1N A;  2DQV A;  5DVJ A;  3MQ9 A;  2B65 A;  4ONY A;  1MQI A;  5J1D A;  4QF9 A;  1N0T A;  4DIG A;  5TP9 A;  3MZB A;  4XKP A;  3DP8 A;  4G2Z A;  1B0L A;  3O28 A;  1Y4C A;  4H67 A;  4XKN A;  5A5X B;  3FUZ A;  4OEN A;  1JVY A;  4DXC A;  4ZZE A;  4MFI A;  4F1U A;  3UGW A;  1PBP A;  4F3B A;  2RCA A;  1SDX A;  1BKA A;  4ZDM A;  4GWO A;  3O66 A;  3H7M A;  2AYS A;  1NNP A;  2F7B A;  1AH5 A;  3RN8 A;  4F2Q A;  1UTH A;  1FTL A;  2V3U A;  3FAT A;  1QUI A;  4XIG Q;  1QKA A;  2ABH A;  2DWA A;  4JWY A;  3PD8 A;  3QUJ A;  3A09 A;  3IAZ A;  1B9J A;  4P0I A;  3RY3 A;  2XXH A;  3M3L A;  3VLW A;  5ITP A;  3G3J A;  4JWO A;  1AL3 A;  3UA8 A;  3SDF A;  4OET A;  3VVE A;  3SEY A;  1MXZ A;  4QFN A;  2Y7K A;  4PP0 A;  5I2N A;  3HPI A;  2Z8E A;  4FEB A;  3TTL A;  1ZIU A;  1B6H A;  1FQB A;  1AIV A;  1GVC A;  1FTJ A;  3DEL B;  3KEI A;  4YKI A;  4YKP A;  4PFT A;  4YZZ A;  5IKB A;  5I59 A;  1ZU0 A;  4C1T A;  1MPC A;  4H8I A;  3FD3 A;  3RGY A;  2Z23 A;  4ELP A;  2RC9 A;  1Z7M E;  3TUS A;  1M5B A;  2P0S A;  3K1N A;  1B3E A;  3IB1 A;  5FHM A;  1R9Q A;  4OFJ A;  1ZLQ A;  4ZE8 A;  3TTN A;  4F39 A;  4Q8R A;  3PV0 E;  3AXF A;  5H8F B;  4R2B A;  4U4X A;  3ZKK A;  2RKM A;  3EHT A;  3LSL A;  3W15 C;  3PMV A;  2DXY A;  1QVS A;  3LR1 A;  3C34 A;  1H44 A;  2UXA A;  1ZKB A;  4FIM A;  2I3W A;  5AA2 A;  2QS4 A;  2VD3 A;  1B3G A;  3W9W A;  4Q5T A;  5DEX A;  1S7Y A;  3CFZ A;  3MZ1 A;  1Y1Z A;  4TLL B;  1DSN A;  4ND9 A;  1Y9U A;  3VLV A;  5I57 B;  1H45 A;  3SER A;  2G93 A;  5L8D A;  1MG1 A;  2F34 A;  1LAG E;  2Z8D A;  3RT8 A;  3A3U A;  3PD9 A;  4RXL A;  2GHB A;  4ESX A;  2R6G E;  3C35 A;  3UN6 A;  1I69 A;  4EQ7 A;  1NFT A;  2Q8J A;  3TAJ A;  4R6K A;  1MY2 A;  5HM4 B;  4DDD A;  4PE5 B;  4NWC A;  2ANJ A;  3N94 A;  5H8S A;  4YIC A;  2DVC A;  2H4I A;  1S9T A;  1YPN A;  3S9N C;  3K1M A;  5DT6 A;  3ZS6 A;  1UQW A;  4PFU A;  5JTY A;  3CFX A;  3T66 A;  4JWX A;  1MQG A;  1URG A;  1B1H A;  3MC2 A;  1IXI A;  4QFL A;  1IQ7 A;  2A5T A;  4H6D A;  1NL5 A;  3D4G A;  5KCJ A;  4PQJ A;  3MZ9 A;  1VR5 A;  3IB2 A;  1FQC A;  2F7A A;  4WED A;  3FAS A;  1I6B A;  4YB6 A;  1FQD A;  3A3C A;  2O7I A;  4KYD A;  4PFY A;  1OVT A;  3KG2 A;  3E9X A;  4IB2 A;  3HO7 A;  1NH8 A;  1N7X A;  1SVX B;  4PFW A;  3TKD A;  1IIT A;  3K1P A;  2QS3 A;  2DP8 A;  4RK2 A;  3DP6 A;  3SET A;  4GXS B;  4ZEB A;  1D3K A;  3VFJ A;  1DTZ A;  3VXC A;  4RY1 A;  4R9G A;  2XXX A;  3N5L A;  3IK6 B;  3U8Q A;  4X9T A;  2I58 A;  2XX7 A;  1LAX A;  2I3V A;  2P1S A;  2OLB A;  3KGC A;  3U93 A;  1PDA A;  4F18 A;  1D9Y A;  3TTK A;  1KWH A;  3SEV A;  1R9L A;  2ONK E;  3G3K A;  3RNN A;  1QJM A;  4RYA A;  1MDP 1;  3O6I A;  1OMP A;  5KDT B;  3QYT A;  1LBC A;  4QFK A;  3C4M A;  4F1Y A;  1B1X A;  5DVI A;  1B5H A;  4AB6 A;  1FQE A;  2NWJ A;  2F6G A;  3CR9 A;  3FJM A;  1LCT A;  1F9B A;  1MM6 A;  3S4U A;  4OEU A;  3PUX E;  1SW4 A;  1DOT A;  4NED A;  1SBP A;  4KI0 E;  3PUV E;  3CSB A;  4NMY A;  4R2F A;  4XXU A;  3VLU A;  2VD2 A;  2UVH A;  5I58 B;  1B5J A;  1MPB A;  4ESW A;  3RPW A;  1RKM A;  4GXA A;  3OOA A;  2DE3 A;  1UTB B;  4JDF A;  1LAF E;  3CI8 A;  2XXW A;  3MPL A;  3MP1 A;  1A8F A;  3Q25 A;  4KCC A;  1N3X A;  4BDN A;  3H6V A;  5DTB A;  3H4Z A;  2VHA A;  2XXU A;  4Z7E A;  4FE8 A;  4Q30 B;  3CG1 A;  4NF4 A;  4C0R A;  1D4N A;  3WAE A;  2PBW A;  4IO2 A;  4FEC A;  4GL0 A;  2XXY A;  4AB5 A;  1URD A;  2DE2 A;  4F3P A;  3THI A;  4THI A;  3H03 A;  1DPP A;  2Q89 A;  4BDM A;  4WKM A;  1A55 A;  4DCY A;  3L6G A;  1LB9 A;  1N84 A;  1NNF A;  3W9V A;  4FOR A;  4OVJ A;  5L9O A;  1FQF A;  4RK9 A;  1IXH A;  1IIW A;  1RYO A;  3S2V A;  3EHS A;  2WKY A;  2O1M A;  4QFO A;  5K2X A;  3QXM A;  3TTM A;  2QJE A;  1B58 A;  1SQY A;  1B2H A;  5CMM A;  4EXK A;  1B05 A;  2LAO A;  4H65 A;  3ILT B;  1B3L A;  3MJN A;  2RC7 A;  4EQ9 A;  5ICT A;  4L17 A;  4MLQ A;  3VXB A;  2YLN A;  2I6E A;  3PMX A;  4HCY A;  2H99 A;  1URS A;  3FVN A;  4BDL A;  4U4S A;  2OWS A;  3LUY A;  3TZA A;  3M3F A;  1FQA A;  3QIM A;  4IO3 A;  1IXC A;  1H43 A;  4IY6 A;  3QUF A;  4C1U A;  2V3T A;  1FW0 A;  3KFM A;  1B51 A;  4KYS A;  3JYR A;  3K6W A;  4FAJ A;  3OD7 A;  2XD3 A;  3CIJ A;  4ELQ A;  1Y3Q A;  4G8H A;  3HN0 A;  4QSC A;  2E0S A;  1USY H;  3ZSF A;  3GBB A;  2IEE A;  3PPP A;  4OQO A;  3K0V A;  4GOT A;  3RLF E;  5FHO A;  3TCH A;  3L6H A;  4G68 A;  4UA8 A;  2ZYK A;  1OLA A;  1SW2 A;  2ZXT A;  3F11 A;  3LSW A;  3CFL A;  1GR2 A;  3UOR A;  1M5D A;  3S9L C;  4F3S A;  1BP5 A;  3OEN A;  4RJZ A;  3MAM A;  1PB7 A;  3V89 B;  1CB6 A;  1TFA A;  1H76 A;  3PUY E;  1B0H A;  4LAT A;  3TQW A;  1PBQ A;  4JB7 A;  4Z0I A;  4R9F A;  2NUV A;  3DLN A;  1IXG A;  2I4C A;  4ZEI A;  3G3I A;  1L5T A;  5EYF A;  3TCG A;  4HTG A;  2D5W A;  3TCF A;  5CBR A;  4LVQ A;  1B32 A;  3BFU A;  2DE4 A;  1US5 A;  5I84 A;  3OSQ A;  1O63 A;  2UVI A;  5CI5 A;  1POT A;  4U22 A;  2BJJ X;  3T9H B;  4X1B A;  3OO8 A;  3RUM A;  1A99 A;  4ZE9 A;  2RIN A;  4TQU Q;  3FJ7 A;  5DVF A;  1HSJ A;  2DVZ A;  1P1W A;  2Y7W A;  2F5X A;  1XVX A;  4EF2 A;  1VSO A;  4UAC A;  3H6T A;  3UP9 A;  2UYF A;  3KOT A;  1LFG A;  1JNF A;  3RQT A;  4Q0C A;  4NF8 A;  2XXI A;  1B46 A;  2CMO A;  3TMG A;  3C36 A;  3KN7 A;  3H06 B;  1P1O A;  4X1D A;  2OWT A;  1QUL A;  2GRV A;  1OQG A;  2FYI A;  2QS2 A;  1PB8 A;  3C31 A;  2HZK A;  3ILU B;  5I56 A;  1YCJ A;  3GXA A;  3IX1 A;  4KCD A;  2V84 A;  1ATG A;  4XKR A;  4N13 A;  3IO6 A;  4G8M A;  3IJO B;  5H8H B;  5CMC A;  3O29 A;  1B3F A;  3O6G A;  1AOV A;  3CG3 A;  2HEU A;  3G7W A;  4PET A;  3CSG A;  2AIX A;  3K6V A;  2QS1 A;  1PB9 A;  2ZNT A;  5A5X A;  3K2D A;  4GQO A;  3G3H A;  5TPA B;  3PPN A;  2I48 A;  1LB8 A;  4U1Z A;  2ZYN A;  3BFT A;  3QAX A;  1LGB C;  1D9V A;  3FGS A;  2DOJ A;  4F2O A;  1O64 A;  1QUK A;  1XHY A;  4DLD A;  4NTL A;  2Y7P A;  4FJP A;  3B6W A;  1JVX A;  1TT1 A;  4JXI A;  2OCU A;  2DXR A;  3P7I A;  4N6P A;  3UIF A;  3IOW A;  2A5S A;  4F22 A;  4EDP A;  3LSX A;  4F1V A;  4GD5 A;  2RC8 A;  4ZEF A;  3T9V A;  4U1O A;  3T9X B;  4POW A;  1NNT A;  1QKB A;  1GTK A;  2H25 A;  3I3V A;  4LQ2 A;  2I0B A;  3O97 A;  5KZT A;  4ZEC A;  4OFL A;  5H8N B;  3SES A;  1FTO A;  3PUZ E;  2DYX A;  4NWD A;  3EHU A;  3MPK A;  3B6T A;  1MXW A;  2CZL A;  1B5I A;  3D4C A;  1M5F A;  2RF1 A;  4OEV A;  1MS7 A;  2ZNU A;  4GVO A;  2XHD A;  1XT8 A;  4ZEK A;  4LQ5 A;  3TYH A;  4JBZ A;  4JSO A;  5JK4 A;  1LCF A;  2F7C A;  2X7Q A;  2V25 A;  1B4Z A;  4KYE A;  2X7P A;  2QL3 A;  4GIZ A;  4I8C A;  1P99 A;  1SYH A;  1S50 A;  2GHA A;  2Z22 A;  5H8F A;  3U94 A;  3MVX A;  5AA2 D;  2Y7R A;  1UIU A;  4G8N A;  1B52 A;  3ODB A;  2ESN A;  5H8H A;  1NMU A;  4RPN A;  3IOV A;  4LA9 A;  2H5Y A;  3SEX A;  3PGF A;  3KSX A;  4QFP A;  2AL4 A;  1NH7 A;  2XX8 A;  3O6H A;  3Q28 A;  1ZMG A;  5I57 A;  3LBS A;  4P11 A;  5TPA A;  3RTW B;  1WOD A;  3VV5 A;  4FAT A;  3TFL A;  3MVZ A;  3N6T A;  3SEW A;  2DWH A;  4YU0 A;  4RNS A;  5CC2 A;  4FED A;  1A7L A;  2HFB A;  3MUQ A;  5AA1 A;  4R6H A;  2Y7I A;  3IO4 A;  3HST A;  3VE1 B;  4POX A;  3HCQ A;  2Y84 A;  3R6U A;  2ZYM A;  4YMA A;  4N07 A;  5L9M A;  4KR5 A;  3PUW E;  4DZ1 A;  5TU0 A;  1IUD A;  2UVG A;  2I49 A;  3FXR A;  1LBB A;  2GFE A;  3OSR A;  1MM7 A;  1QW0 A;  2H9B A;  4NF6 B;  1JW4 A;  3FIR A;  5H8N A;  3T22 A;  4HW8 A;  1DMB A;  3EQ1 A;  3EN3 A;  3IOR A;  4IY5 A;  4R74 A;  3KOS A;  3IL1 B;  3FZV A;  1SYI A;  2XXP A;  2HAU A;  5B7D A;  2Q2C A;  3Q29 A;  3U72 A;  4F3G A;  2Z8F A;  1A54 A;  1OVB A;  4MH5 A;  2B3B A;  5BUU A;  1JW5 A;  4I1D A;  1US4 A;  3RT6 B;  2QRY A;  4QSD A;  4H5G A;  4LUB A;  3SEU A;  3BBR A;  1UTH B;  3HHF A;  4O3A A;  2DWI A;  1M5C A;  2V3Q A;  1GV8 A;  1HSL A;  5ISU A;  3PPQ A;  3OO6 A;  1LST A;  1MQH A;  2KLF A;  3GBA A;  1LAH E;  1MY4 A;  1YAE A;  2O7U A;  3H6U A;  1SI0 A;  3MVW A;  3E3K A;  3PPR A;  4QRZ A;  1T0K A;  3K6X A;  3VVF A;  3OO7 A;  4YKJ A;  2REJ A;  4OFO A;  5KDT A;  2HCA A;  1SD3 A;  5AA4 B;  1Y3N A;  3TPA A;  4E0X A;  1XC1 A;  1EU8 A;  4IO4 A;  5AA3 A;  3TEP A;  2THI A;  3RTF B;  1CE2 A;  4XKQ A;  5B70 A;  3OXN A;  5H8Q B;  2XXR A;  4GL8 A;  4GLI A;  2I4B A;  5I2K B;  1ANF A;  4BDO A;  1VFD A;  5M2V A;  1XOC A;  2O51 A;  1MXX A;  3QSL A;  1ZJL A;  5I58 A;  4EF1 A;  4TOZ A;  3K02 A;  3LSF B;  1EZO A;  3MP6 A;  1MXU A;  3SKP A;  1N7W A;  3QK6 A;  2ZNS A;  1UTB A;  3MW0 A;  3MVY A;  4KPT A;  4GF8 A;  4DXB A;  2ZYO A;  1MXY A;  5AA2 B;  4NF6 A;  4OER A;  4R6Y A;  1WDN A;  5DEX B;  5CMB A;  3JZJ A;  1RYX A;  2P2A A;  4O3B A;  5HPQ A;  3C33 A;  4BDR A;  5FHN A;  2XD2 A;  1N04 A;  3R7X A;  3KBR A;  2YPN A;  1VE4 A;  1FTM A;  4ECF A;  1IZ1 A;  3V5A A;  3KN8 A;  2DS9 A;  2VP1 A;  3T93 B;  4K3F A;  2FA7 A;  2OZZ A;  2Q2A A;  1H3D A;  1DTG A;  4OXV A;  2HZL A;  3FXU A;  1YTV A;  4NF5 B;  1B7H A;  1EZ9 A;  1JQF A;  4IGT A;  2G29 A;  5JTY B;  1TFD A;  3MWB A;  3GLB A;  5K2Y A;  2IA4 A;  2QSX A;  1MQJ A;  1UIV A;  2A5T B;  5KCJ B;  3U1O A;  5AA4 A;  3G3G A;  3EF7 A;  3N26 A;  3KN3 A;  3N6U A;  2F78 A;  4HCW A;  2NXO A;  2PT1 A;  2VGQ A;  1Y20 A;  5H8Q A;  1OQH A;  3ECR A;  3FV1 A;  1PC3 A;  4I62 A;  4O3C A;  1J1N A;  2FNC A;  5LOM A;  5CBS A;  2R9J A;  3M3K A;  4H1X A;  1Y3P A;  5I2K A;  1FTK A;  4OWD A;  1FCK A;  3FVG A;  5ELV A;  3I6V A;  4RPO A;  1B7U A;  3TEL A;  3ONM A;  1TXF A;  3T96 B;  4KHZ E;  1GGG A;  1MY1 A;  1R6Z A;  1NKX A;  2HXW A;  1ELJ A;  1A8E A;  3FXQ A;  2NVU B;  1XVY A;  3OEL A;  2OK2 A;  2QMX A;  4EQB A;  2AL5 A;  3DP4 A;  1Y4T A;  2HQ0 A;  1HSE A;  3KJT A;  4HS7 A;  4ZZA A;  1II5 A;  1B7Z A;  3TOD A;  2VOZ A;  3KJ7 A;  4BLA A;  3I5O A;  3HHG A;  4F19 A;  3ZKL A;  4OTE A;  4QSE A;  4ZED A;  2D21 A;  3V8X B;  4IO6 A;  2W7Y A;  3TTR A;  4E0W A;  3FVK A;  1BTJ A;  1LFH A;  2PX1 A;  1I6Q A;  4MF3 A;  1POY 1;  2XXV A;  2OBG A;  5DYH A;  2F35 A;  2PMS A;  2F97 A;  4LP2 B;  4ZS9 A;  4I9D A;  3PPO A;  3IJX B;  3O2A A;  5JEI A;  4EUO A;  2B3F A;  3IB0 A;  4M1V A;  1JEV A;  3FJG A;  3EPE A;  4NF5 A;  3IOT A;  1P1U A;  3OMB A;  1MPD A;  3PMW A;  1QUJ A;  4LZ7 A;  4OES A;  5F1Q A;  2D3I A;  3TQL A;  5ITO A;  3Q26 A;  1MH3 A;  3USD A;  2XXT A;  4IO5 A;  1VFE A;  4X48 A;  4U21 A;  3K00 A;  3R26 A;  4OHN A;  1O7T A;  3KZG A;  1P1Q A;  1OLC A;  2F36 A;  4NF4 B;  4JSD A;  1Z7N E;  3MBP A;  4YB5 A;  3C9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...