1QJMA

Crystal structure of a complex of lactoferrin with a lanthanide ion (sm3+) at 3.4 angstrom resolution
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
689
structure length
689
Chain Sequence
b'APRKSVRWCTISPAEAAKCAKFQRNMKKVRGPSVSCIRKTSSFECIQAIAANKADAVTLDGGLVYEAGLHPYKLRPVAAEVYQTRGKPQTRYYAVAVVKKGSGFQLNQLQGVKSCHTGLGRSAGWNIPIGTLRPYLNWTGPPEPLQKAVANFFSASCVPCADGKQYPNLCRLCAGTEADKCACSSQEPYFGYSGAFKCLENGAGDVAFVKDSTVFENLPDEAERDKYELLCPDNTRKPVDAFKECHLARVPSHAVVARSVDGREDLIWKLLHRAQEEFGRNKSSAFQLFGSTPGEQDLLFKDSALGFVRIPSQIDSGLYLGANYLTATQNLRETAAEVAARRERVVWCAVGPEEERKCKQWSDVSNRKVACASASTTEECIALVLKGEADALNLDGGFIYVAGKCGLVPVLAENQKSQNSNAPDCVHRPPEGYLAVAVVRKSDADLTWNSLSGKKSCHTGVGRTAAWNIPMGLLFNQTGSCKFDKFFSQSCAPGADPQSSLCALCVGNNENENKCMPNSEERYYGYTGAFRCLAEKAGDVAFVKDVTVLQNTDGKNSEPWAKDLKQEDFELLCLDGTRKPVAEAESCHLARAPNHAVVSQSDRAQHLKKVLFLQQDQFGGNGPDCPGKFCLFKSETKNLLFNDNTECLAELQGKTTYEQYLGSEYVTSITNLRRCSSSPLLEACAFLRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LACTOFERRIN
publication title Lactoferrin-Metal Interactions: First Crystal Structure of a Complex of Lactoferrin with a Lanthanide Ion (Sm3+) at 3.4 Angstrom Resolution
pubmed doi rcsb
molecule tags Lactoferrin
total genus 211
structure length 689
sequence length 689
ec nomenclature
pdb deposition date 1999-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA04
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qjmA03
4LATA 2HAUA 3DELB 3FVOA 3SESA 1WVJA 3O6HA 3O6IA 2O1MA 1B4ZA 3C4MA 2RC7A 1MXYA 3FVNA 3OSQA 1H3DA 2F5XA 5TU0A 3VVFA 4GL0A 3SEUA 3U8QA 1VSOA 4PE5B 3VLVA 2ZNTA 2A5SA 3PUZE 4E0XA 4XXUA 2A5TA 1VFDA 3B6TA 3D4CA 3IORA 1BIYA 4BDLA 3G3FA 1Y1MA 2Z8EA 3VVEA 3KJTA 3LSLA 1MQDA 3TPAA 1USYH 2Y7IA 2IEEA 3TQLA 4ZEKA 3D4GA 1JNFA 2Q89A 3N94A 1GR2A 2PT1A 3CG3A 3G3IA 5BWJA 5K2XA 4GXSB 4DXCA 1F9BA 4ZDMA 4F19A 3K4UA 1QUIA 1MXWA 2DVCA 2R6GE 1IQ7A 4BDOA 4DIGA 5F7VA 2ONRA 1LBBA 3CG1A 4H65A 4L17A 2H9BA 2QS1A 4FJPA 1FQBA 1R9LA 3O28A 4KYSA 1MDP1 3MVZA 2UVHA 3H6UA 2G93A 4QF9A 1NNTA 3CFXA 3E3KA 1EH3A 3LSFB 2F6GA 4F1YA 2Y7KA 3H6VA 2DWIA 1QUKA 3A3CA 3OO8A 4P0IA 4IO7A 4WEDA 1PB8A 4OENA 5DVIA 1MPBA 3G7WA 4RK2A 1SW1A 3TFLA 4IY6A 3H06B 4X1DA 1QW0A 4U4SA 3PGFA 3E4RA 4POWA 4PFYA 3TTRA 3U94A 3MUQA 3PPQA 1Y3QA 4Z7EA 2ZNSA 2RKMA 1PDAA 4X48A 5FHNA 3FVKA 1B1HA 1S9TA 4ESWA 1ELJA 2D21A 3OENA 3T22A 3C36A 3MWBA 2PT2A 1O64A 3UP9A 1EZOA 4LONB 4KFQA 2Q8JA 5I59A 4HW8A 2QMXA 4QHQA 3MVXA 3LSXA 3V83A 3MZ1A 4JB7A 1DPPA 3DP4A 4YICA 2VOZA 4LA9A 5JEIA 5J1DA 2QS4A 2XX8A 3IO6A 4DLDA 1D9VA 1Y4CA 3RUMA 5CBSA 1LAXA 3PPNA 4ISUA 5L9SA 2QS2A 3KGCA 4JSDA 1BLFA 2DQVA 1LSTA 2DE3A 2I58A 1B9JA 4NF8B 3PU5A 1QKBA 3KFMA 4LUBA 4M4GA 1JEUA 4U2RA 3N6TA 4LP2B 3RT6B 1FQDA 4LZ8A 1M5FA 1P1WA 1MY2A 4IO2A 1WDNA 2V3TA 3U72A 2HAVA 3UIFA 3SERA 2QMWA 1US5A 4F2OA 1GVCA 4N07A 1OQHA 2F97A 1LB9A 1FQEA 1H45A 4OXVA 3O2AA 1ANFA 1OMPA 2H4IA 4G8HA 3T9HB 3KOSA 5H8NA 4R2BA 4U1ZA 5I59B 1XOCA 2HZLA 3ODBA 3THIA 4NEDA 2XXTA 3T96B 3FGSA 2KLFA 2OBGA 1SI0A 4JSOA 5I2KA 3H6TA 3IJXB 1OLAA 4GWOA 3QUFA 3GBBA 4GIZA 2Z23A 3RGYA 3Q28A 1DTZA 1BP5A 4NF4A 4RK9A 3IB0A 1IZ1A 3I5OA 3PD8A 2QPQA 2PX1A 4PFWA 3HPIA 1B05A 1URSA 1JETA 3K1PA 4ELOA 3KOTA 2Q2CA 3GLBA 2REGA 2O7IA 1LCTA 3V89B 3TYHA 4UACA 2GRVA 4WKMA 3PUVE 1LFGA 1JVYA 4YU0A 4X1BA 2O68A 4G8NA 3VE1B 1FTJA 4G68B 5I58B 2B65A 3O97A 2Y7WA 1N0TA 5H8QA 2HFBA 4XTCQ 5A5XB 3QSLA 3FD3A 4FEDA 2V25A 3FJMA 3H3GA 3FXQA 1UTBA 3KSJA 5I57A 4C1TA 4H8JA 3BFTA 2RCAA 2HCAA 5H8NB 2VD3A 3CSGA 2V3QA 3IR1A 4ELQA 2H98A 2DE4A 4F1VA 1PBQA 3DP6A 3ILTB 1LAGE 1FQAA 3MBPA 1DPEA 1SD3A 2QRYA 1SYIA 4FECA 1AH5A 3KG2A 3HCQA 3OO6A 5CRYA 2XXPA 3IJOB 3K0VA 3U1OA 4NF4B 4F22A 2DVZA 2RC9A 2QSXA 2I3VA 3Q25A 5KDTB 1P99A 2OWTA 4QSCA 3ZKKA 4P0GA 1Y3PA 4PQJA 5CMKA 5JK4A 1ATGA 3M3LA 4H0WA 4TOZA 1I69A 1B3EA 1XS5A 4H5FA 4R6YA 3PUWE 2VD2A 1LFIA 4I1DA 3PV0E 1US4A 3EHSA 5KZTA 3ECRA 2E0SA 4OMBA 1Z7ME 1D4NA 3MC2A 4ZE9A 3TCGA 5B70A 1M5CA 3CSBA 4Q5TA 1ZJLA 1MDQA 5H8QB 2YJPA 1A40A 2O1LA 3V8XB 4I62A 4HCWA 4U1OA 4TLLB 3GZGA 3MPLA 4QFNA 2W7YA 4G68C 4PFUA 3K02A 3DM0A 3MP6A 5I56B 1QKAA 2DE2A 3G3KA 1N76A 3T93B 2F35A 4OQOA 4YKKA 4OFJA 4MLQA 4KR5A 3KJ7A 4MLVA 4YMAA 3T9VA 4JBZA 2AYSA 4NWCA 4ND9A 3CFZA 4QFKA 1H43A 3H6WA 5I84A 1JQFA 2P0SA 2Q9TA 1A8EA 1B40A 4LQ2A 1MH3A 3IB1A 5AA2B 1VE4A 1MM7A 4X9TA 2RC8A 3RLFE 1LLSA 3Q27A 2Q88A 5HPQA 1JW4A 3QAXA 3MP8A 1M5EA 4NF5A 1Y9UA 2ZYNA 4RPOA 4FAJA 1B52A 4PETA 3C32A 1ZIUA 2PBWA 1BTJA 3VXBA 3A09A 4NE4A 2I0BA 3PD9A 1LGBC 1OQGA 4KYDA 3O29A 3GXAA 1XHYA 1LB8A 1MY4A 5EYFA 1MPCA 3H03A 3IOVA 4OFLA 3S9NC 2X26A 1NNPA 3I6VA 3LUYA 3EPEA 3CFLA 1UTHB 2UXAA 4OESA 4ELRA 2UYFA 2AL5A 2DWHA 5CMCA 3C9HA 5H8FA 1A55A 4OZ9A 5DVJA 4M1VA 5DTBA 5CC2A 4O3BA 1XT8A 1B58A 1MXUA 5H8SA 1B7UA 5LOMA 2QL3A 1XVXA 3M8UA 4GXAA 2LAOA 2P1SA 4YMBA 3PUYE 4DE8A 3FUZA 5ICTA 1A54A 2A5TB 1NMUA 4MH5A 1EZ9A 3K00A 4HCYA 3BBRA 1II5A 5CMMA 3QUJA 4YAHX 5B7DA 4OERA 5FTHA 4KPTA 3EN3A 3KN3A 3K1MA 1NNKA 4OFOA 1ZTYA 4NF5B 1FTMA 1UIUA 5FHMA 3TODA 3QK6A 3TUSA 2XD2A 5KCJA 4QFLA 4F2QA 1MXZA 1GGGA 5FHOA 4IO6A 3FXUA 4MBPA 1ZKBA 4R73A 2Z8FA 5EHSA 3ZSFA 3HV1A 1H76A 4EF1A 1N04A 3GBAA 2ZYKA 1GTKA 1NL5A 1M5DA 4YB5A 4ZEDA 2HQ0A 3TMGA 1YCJA 4OWDA 1ZLQA 1N7WA 3OMBA 2OK2A 5H8FB 1SW5A 3TAJA 5AA4A 2RCBA 1DOTA 1ZBMA 2CMOA 1B4HA 1I6BA 5L9MA 3C33A 4LZ7A 1FQCA 4ELPA 1XVYA 3TCHA 1SW4A 2QJEA 4F29A 1TT1A 2G29A 1URDA 2XX7A 4H5GA 4NF6A 4FATA 2XXVA 1SQYA 4RYAA 4ZECA 1B46A 1Z7NE 2M8CA 4U22A 1LBCA 4R9FA 4U23A 4NTLA 2XXQA 1SW2A 2V93A 2GHAA 3G3HA 4GL8A 2CZLA 2O7UA 4KCDA 1B5HA 3T9XB 1MM6A 3OELA 3HHGA 3UGWA 2E1SA 3PPPA 4YB7A 3LR1A 4N13A 5KCJB 3QIMA 1B6HA 3ZS6A 3KBRA 5AE4A 1P1UA 3IOTA 4C0RA 1N84A 1B7HA 4OETA 3SEYA 3L6HA 2AIXA 2ONKE 2H5YA 4O3AA 2O84X 5HBCA 3K6UA 1IXGA 3G3GA 3UORA 4LQ5A 3EF7A 1DMBA 3N5LA 3HSTA 4UA8A 2DP8A 3V5AA 1TFDA 3RN8A 4ONYA 3VLUA 2OLBA 2XHDA 3WAEA 3E9XA 2GFEA 3O9PA 5L8DA 4KD5A 2D5WA 1B0HA 4GOTA 4OHNA 1TWYA 2FA7A 3OEKA 2DXYA 4K3FA 2FYIA 2IA4A 4OEVA 1NH8A 2NWJA 4DXUA 2DSFA 4F31B 3HN0A 2Y7PA 3MP1A 3MVYA 1LFHA 3K6WA 3O6GA 4F3SA 4H67A 4XKPA 4XKQA 3W9WA 4HTGA 4OTEA 3W15C 3T9UA 2R9JA 2I4BA 1P1QA 3FV2A 4GQOA 5AA2D 1FQFA 1R9QA 3MW0A 4ZEIA 1IEJA 4DXBA 1SBPA 3S2VA 5JTYA 4F3GA 2B3BA 5ITOA 3ZKLA 2AL4A 4ESXA 3RNNA 1DTGA 5TPAA 3LBSA 1A8FA 2UVIA 5DEXA 1QULA 4QSEA 4P11A 2Z8DA 4YKIA 4G4PA 4PP0A 4ECFA 1SVXB 2P2AA 3OD7A 4R72A 1I6QA 5I2KB 3IOUA 1B3GA 3B7DA 1A99A 1OLCA 1MXXA 1I6AA 1OIBA 3OOAA 1EZPA 4GVOA 1JVXA 4R9GA 2XXUA 1POY1 2ZNUA 5IKBA 5EHMA 3CRBA 4NWDA 1B3HA 1B3FA 4MF3A 4H1XA 1QUJA 4IY5A 4Q30B 3WAFA 1MQIA 3PPOA 1PC3A 4OYVA 1NH7A 2FNCA 3K6VA 3TTNA 1QJMA 1M5BA 2GH9A 3K1NA 1P1OA 3C34A 4GFRA 3FVGA 2GHBA 2REJA 2YPNA 3W9VA 4EF2A 2F7CA 3OSRA 2X7PA 4I8CA 4PFTA 4RNSA 4EQBA 1IXHA 1OVTA 1UTBB 5I57B 1MY0A 1MQHA 5ICQA 2V3UA 5CM6A 3VXCA 4EUOA 2Q2AA 4LZ5A 1YAEA 3VFJA 2BJJX 2V84A 4BDNA 1IUDA 2I4CA 3ILUB 3JV9A 4F3PA 3B6QA 1B5IA 3H7MA 3LSWA 1VFEA 2VHAA 5F1QA 4G2ZA 4QFOA 3SEWA 1MXVA 2B3FA 4LVQA 3A3UA 1N3XA 2DXRA 1B3LA 3RQTA 4WEPA 4EQ7A 2UVJA 3SDFA 5IAIA 4O3CA 3CIJA 1B51A 1MY3A 3TQWA 5L9OA 2DOJA 4BDMA 1AL3A 3USDA 3SKPA 1EU8A 5CI5A 5H8HA 4ZEBA 2XXWA 4RXLA 1AIVA 4ZS9A 3KSXA 1PBPA 2PYYA 3TEPA 3MAMA 2VP1A 4JWOA 2F7BA 1YPNA 3Q26A 1P1NA 4TQUQ 3AXFA 3EHUA 3C35A 3SEVA 2XD3A 4R6HA 4TLMB 3O66A 2UVGA 2I0CA 5DYHA 3IO4A 3R26A 3TELA 2DWAA 1IITA 3IB2A 1A7LA 3Q29A 3U92A 3IOWA 1SYHA 4KI0E 2RF1A 3CI8A 4RA1A 4ZEFA 4AB6A 4XIGQ 3CR9A 4Q8RA 4XKNA 1Y1ZA 1UQWA 2I49A 4IGRA 2DS9A 3UN6A 2ZYOA 3T66A 3FV1A 1CB6A 3FJ7A 2Y84A 1MRPA 1URGA 4IB2A 3G3JA 3ONMA 1T0KA 4R74A 2DYXA 3RTFB 3L6GA 1HSEA 1MQJA 4NF8A 3HO7A 1B32A 1D9YA 4F39A 2O51A 4KCCA 5HM4B 1HSJA 1FTOA 3FASA 5I2NA 1R1NA 3KN7A 3K2DA 2HZKA 1KWHA 1TFAA 5H8HB 4KYEA 3MVWA 5FTIA 3KEIA 1Y20A 3M3KA 1GV8A 1WODA 4YZZA 4QSDA 3BKIB 2HXWA 2XXXA 3IAZA 2F6PA 2THIA 1JEVA 3DP8A 1MQGA 5ELVA 1O7TA 3PMWA 1ZMGA 1RYOA 1PB9A 3I3VA 4R2FA 3UA8A 3IX1A 3FZVA 3K6XA 1SI1A 2PVUA 4BLAA 3EHTA 3JZJA 1DSNA 3PPRA 1MPDA 3TZAA 3OXNA 4DZ1A 2XXHA 4JXIA 4QRZA 1FCKA 2I3WA 3IK6B 3FJGA 4GF8A 2NVUB 3LC8A 2UYEA 1MY1A 1B5JA 1UIVA 2NOOA 2F34A 2HEUA 3S9LC 2XXRA 1B2HA 3HHFA 4NMYA 3VDFA 3S9MC 1XC1A 4G77A 2H99A 3N26A 1YTVA 3U93A 5I2NB 2ONSA 3R7XA 3TKDA 4IGTA 4FEBA 4EXLA 1D3KA 3PMVA 4RPNA 5TP9A 3VVDA 4AQ4A 4G68A 2NUVA 3OO7A 2X7QA 3BFUA 5I58A 4C1UA 2DWJA 3PUXE 1ZU0A 1B7ZA 3KZGA 4RJZA 5A5XA 3MZBA 4Q0CA 4F3BA 2ESNA 4JDFA 1FTLA 1OVBA 5ISUA 1IXCA 2ALUA 4ZE8A 2YLNA 4KQPA 1O63A 3UK4A 2PMSA 1CE2A 2OZZA 2ZXTA 3MPKA 1AOVA 4EDPA 1QVSA 4BDRA 1IIWA 1PEBA 3QYTA 2OCUA 5DVFA 4IO5A 3RTWB 2XXYA 5AA4B 5ITPA 1N7XA 3VV5A 1JW5A 5KDTA 1AMFA 3VLWA 2OWSA 3M3FA 4DCYA 2ZYMA 3RT8A 4IO4A 4NF6B 2F8DA 4JWXA 1FW0A 2RINA 1R6ZA 4AB5A 2D3IA 1J1NA 4RY1A 4GLIA 3DLNA 3PMXA 2R71A 3TCFA 3TTKA 2OJTA 5M2VA 2VGQA 1PB7A 5TP9B 1USYE 4WXJA 2NXOA 1Q1KA 4ZZEA 5AA1A 4Z0IA 1MS7A 2QS3A 2XXIA 4F1UA 2O6AA 4IO3A 3TTLA 2ABHA 2XX9A 3MQ9A 5I56A 5DT6A 1MG1A 5CMBA 4FIMA 1NKXA 4GD5A 1N3WA 1JW1A 3TTMA 4EXKA 4OVJA 1TXFA 4MFIA 5AA3A 3SEXA 1VR5A 3P7IA 4XKRA 3JYRA 4KHZE 3B6WA 1RYXA 4DCXA 2ZMBA 3MZ9A 3SETA 3E13X 4THIA 1B1XA 3KN8A 1Y4TA 3R6UA 4H6DA 1LAFE 2F7AA 4GRKA 1H44A 1IXIA 4EQ9A 3RY3A 5BUUA 4R6KA 4JWYA 4ZZAA 4YKPA 4QFPA 3S9EA 3TDJA 5AA2A 4E0WA 2I48A 3MJNA 1NNFA 4OEUA 4DDDA 1LCFA 4BDQA 2F78A 5K2YA 4G8MA 4YKJA 4YB6A 3OEMA 2F36A 1Y3NA 4FE8A 3RPWA 2Y7RA 3FATA 1SDXA 3CVGA 3QXMA 3F11A 2WKYA 2Z22A 5JTYB 2ANJA 3IL1B 3C31A 4R75A 1Q35A 3OO9A 1RKMA 1S7YA 2I6EA 1MH4A 4U21A 5TPAB 1S50A 5DEXB 4POXA 3FXRA 1B0LA 3N6UA 1POTA 3S4UA 3K01A 1LAHE 1HSLA 1FTKA 2H25A 3FIRA 2O69A 4I9DA 4HS7A 4FORA 4U4XA 5CBRA 1L5TA 1NFTA 1UTHA 4F18A 3EQ1A 4H8IA 1BKAA 3H4ZA 4N6PA
chains in the Genus database with same CATH superfamily
4LATA 2HAUA 3DELB 4MMPA 3FVOA 3SESA 2XXKA 1NUZA 2Y5KA 1FJ6A 1WVJA 3O6HA 3O6IA 2O1MA 1B4ZA 3C4MA 2RC7A 1MXYA 3FVNA 3OSQA 1H3DA 2F5XA 5TU0A 3VVFA 4GL0A 4MNIA 3SEUA 3U8QA 1VSOA 4PE5B 2WX9A 3VLVA 3RPLA 2ZNTA 2A5SA 3PUZE 4E0XA 4XXUA 2A5TA 1VFDA 3B6TA 3D4CA 3IORA 1BIYA 1RDYA 5ET6A 2VPOA 4BDLA 3G3FA 1Y1MA 2Z8EA 3VVEA 3KJTA 3LSLA 2Y5LA 1MQDA 3TPAA 1USYH 2Y7IA 2IEEA 3TQLA 1FPIA 4ZEKA 3D4GA 1JNFA 1FPKA 2Q89A 3N94A 1GR2A 2PT1A 3CG3A 3G3IA 5BWJA 5K2XA 4GXSB 4DXCA 1F9BA 4ZDMA 4F19A 3K4UA 1QUIA 1MXWA 3A29A 2DVCA 2R6GE 1IQ7A 4PAKA 4BDOA 4DIGA 5F7VA 2ONRA 1LBBA 3CG1A 4H65A 3B8BA 2R8TA 4L17A 4O7IA 2H9BA 2QS1A 4FJPA 1FQBA 1R9LA 3O28A 4KYSA 1MDP1 3MVZA 2UVHA 3H6UA 2G93A 4QF9A 1NNTA 3CFXA 3E3KA 1EH3A 3LSFB 1KZ8A 2F6GA 4F1YA 2Y7KA 3H6VA 2DWIA 1QUKA 3A3CA 3OO8A 4P0IA 4IO7A 4GWSA 4P1EA 4WEDA 1PB8A 4OENA 5DVIA 1MPBA 3G7WA 4RK2A 1SW1A 3TFLA 4IY6A 3H06B 4X1DA 1QW0A 4NF0A 1NUXA 4U4SA 3PGFA 3E4RA 4POWA 4MIJA 4PFYA 1LEVA 3TTRA 3U94A 3MUQA 3PPQA 1Y3QA 4Z7EA 2ZZWA 2ZNSA 3ROJA 2RKMA 1PDAA 4X48A 5FHNA 3FVKA 4MNCA 1B1HA 1S9TA 4ESWA 1ELJA 2D21A 3OENA 3T22A 3C36A 3MWBA 2PT2A 1O64A 3UP9A 1EZOA 4LONB 4KFQA 2Q8JA 3BIGA 5I59A 4HW8A 5EYHA 2QMXA 4QHQA 3MVXA 3LSXA 4P8BA 3V83A 3MZ1A 4JB7A 1DPPA 1NUWA 1FJ9A 3DP4A 4YICA 2VOZA 4LA9A 5JEIA 5J1DA 2QS4A 2XX8A 3IO6A 4DLDA 1D9VA 1Y4CA 3RUMA 5CBSA 4I40A 4PDDA 1LAXA 3PPNA 3FXBA 4ISUA 5L9SA 2QS2A 3KGCA 4JSDA 1BLFA 2DQVA 1LSTA 2DE3A 2I58A 1B9JA 4PF6A 4NF8B 3PU5A 1QKBA 3KFMA 2KQZA 4LUBA 4M4GA 5IM2A 1JEUA 4U2RA 3N6TA 3FBPA 4OA4A 3MYUA 4LP2B 3RT6B 1FQDA 4LZ8A 1M5FA 1P1WA 1MY2A 4IO2A 1WDNA 2V3TA 3U72A 1NV3A 4PGPA 1FBPA 2HAVA 3UIFA 3SERA 2QMWA 2HPGA 4NX1A 3LUZA 1US5A 4F2OA 1GVCA 4N07A 1OQHA 2F97A 1LB9A 1FQEA 1H45A 2F3BA 2QVRA 4OXVA 3O2AA 1ANFA 1OMPA 2H4IA 4G8HA 3T9HB 3KOSA 5H8NA 4R2BA 4U1ZA 5I59B 1XOCA 2HZLA 1LBVA 3ODBA 4PGNA 3THIA 4NEDA 2XXTA 3T96B 3FGSA 2KLFA 2OBGA 1SI0A 4JSOA 2B4LA 5I2KA 3H6TA 3IJXB 1OLAA 4GWOA 3QUFA 3GBBA 4GIZA 2Z23A 3QMFA 4O8MA 3RGYA 3Q28A 1DTZA 1BP5A 1G0IA 4NF4A 4P9KA 4RK9A 3IB0A 1IZ1A 3I5OA 3PD8A 2QPQA 2PX1A 4PFWA 3HPIA 1B05A 1FSAA 3IFAA 1URSA 1JETA 3K1PA 4ELOA 3KOTA 2Q2CA 3GLBA 2REGA 2OWZA 2O7IA 1LCTA 3D1RA 3V89B 3TYHA 4UACA 2GRVA 4WKMA 1K9ZA 3PUVE 1LFGA 1JVYA 4YU0A 4X1BA 2O68A 4G8NA 3VE1B 1FTJA 4G68B 4KXPA 2B65A 5I58B 3LV0A 3O97A 2Y7WA 4GWZA 1N0TA 5H8QA 4DI3D 2HFBA 4XTCQ 5A5XB 3QSLA 3FD3A 4FEDA 2V25A 3FJMA 3H3GA 3FXQA 1UTBA 3KSJA 5I57A 4C1TA 1LBZA 4H8JA 3BFTA 2RCAA 2HCAA 5H8NB 1RDXA 2VD3A 3CSGA 2V3QA 3IR1A 4ELQA 2H98A 2DE4A 4F1VA 1PBQA 3DP6A 3ILTB 1LAGE 1NUYA 4GBVA 1FQAA 3MBPA 1KA1A 1DPEA 1SD3A 4OANA 2QRYA 1SYIA 2WBBA 4FECA 1AH5A 3KG2A 3GYYA 3HCQA 3OO6A 5CRYA 2XXPA 3IJOB 3K0VA 3U1OA 4NF4B 4F22A 2DVZA 2RC9A 2QSXA 2I3VA 3Q25A 5KDTB 1P99A 2OWTA 4QSCA 4MJOA 3ZKKA 4P0GA 1Y3PA 4PQJA 2CZIA 5CMKA 5JK4A 1ATGA 3M3LA 4H0WA 4TOZA 4PFIA 1I69A 1B3EA 1XS5A 4H5FA 4R6YA 3PUWE 2VD2A 1Q9DA 1LFIA 4I1DA 3PV0E 1US4A 3EHSA 5KZTA 3ECRA 2E0SA 4OMBA 1Z7ME 1D4NA 3MC2A 2HXRA 2PFYA 4ZE9A 3TCGA 5B70A 1M5CA 5IZ1A 1LBXA 3CSBA 4NG7A 4Q5TA 1ZJLA 1MDQA 4HXVA 5H8QB 2YJPA 1A40A 2O1LA 1NV6A 3V8XB 4I62A 4HCWA 4U1OA 4TLLB 3GZGA 3MPLA 4QFNA 2W7YA 4G68C 4PFUA 3K02A 3DM0A 3MP6A 5I56B 1QKAA 2DE2A 3G3KA 1N76A 3T93B 4PCDA 2F35A 5IZZA 4OQOA 4YKKA 4OFJA 2QVUA 4MLQA 4KR5A 1YXIA 3KJ7A 4MLVA 4YMAA 3T9VA 4PBHA 1EYKA 4JBZA 2AYSA 4NWCA 4ND9A 3CFZA 4MX6A 4QFKA 1VDWA 1H43A 3H6WA 5I84A 1JQFA 2P0SA 2Q9TA 1A8EA 1B40A 4N81A 4LQ2A 1MH3A 3IB1A 5AA2B 4H46A 1VE4A 1MM7A 4X9TA 2RC8A 1FTAA 3RLFE 1LLSA 3Q27A 2Q88A 5HPQA 5J16A 1JW4A 3QAXA 3MP8A 1M5EA 4NF5A 4LN5A 1Y9UA 2ZYNA 4RPOA 4FAJA 1B52A 4PETA 3C32A 1ZIUA 2PBWA 1BTJA 3VXBA 3A09A 4NE4A 2I0BA 3PD9A 1LGBC 1OQGA 4KYDA 3O29A 3GXAA 2F3DA 5ESYA 2XWIA 1XHYA 1LB8A 1MY4A 2CEYA 4GX4A 1DCUA 5EYFA 3HFUA 1MPCA 3H03A 4OFLA 3IOVA 3S9NC 2X26A 3PTYA 4N4UA 1NNPA 3I6VA 3LUYA 3EKIA 3EPEA 3B50A 3CFLA 1UTHB 2KR0A 2UXAA 4OESA 5LTCA 4ELRA 1IMDA 1D9QA 2UYFA 2AL5A 2DWHA 5CMCA 3C9HA 5H8FA 1A55A 4OZ9A 5DVJA 4M1VA 5DTBA 4NAPA 5CC2A 4O3BA 4GX3A 1XT8A 1B58A 1MXUA 5H8SA 1B7UA 5LOMA 2QL3A 1XVXA 1FRPA 3M8UA 4GXAA 2LAOA 3RPLB 2P1SA 4YMBA 1RDZA 3PUYE 4DE8A 3FUZA 5ICTA 1A54A 2A5TB 1NMUA 4MH5A 1EZ9A 3K00A 4HCYA 3BBRA 1II5A 5CMMA 3QUJA 4YAHX 5B7DA 4OERA 1FPDA 5FTHA 1NV0A 4KPTA 3EN3A 2FIXA 3KN3A 3K1MA 1NNKA 4OFOA 1ZTYA 4NF5B 1FTMA 1UIUA 4GWWA 5FHMA 3TODA 3QK6A 3TUSA 2ZZVA 1YZ0A 2XD2A 3U65A 5KCJA 4QFLA 5F24A 4F2QA 1MXZA 1GGGA 5FHOA 4IO6A 3FXUA 4PBQA 4MBPA 1ZKBA 1NV1A 4R73A 2Z8FA 2CZHA 3CHGA 4UABA 5EQ7A 5EHSA 3ZSFA 3HV1A 1H76A 1LBWA 4EF1A 4G61A 1N04A 3GBAA 2ZYKA 1GTKA 4OVSA 1NL5A 1M5DA 4YB5A 4JVIA 4ZEDA 2HQ0A 3TMGA 1NV4A 1YCJA 4PTKA 4OWDA 1ZLQA 1N7WA 3OMBA 2OK2A 5H8FB 1SW5A 3TAJA 5AA4A 2RCBA 1DOTA 1ZBMA 2CMOA 1B4HA 1I6BA 5L9MA 4MEVA 3C33A 4LZ7A 1FQCA 4ELPA 1XVYA 3TCHA 1SW4A 2QJEA 4F29A 1TT1A 2G29A 1URDA 2XX7A 4H5GA 4NF6A 4FATA 2XXVA 1SQYA 4RYAA 4MCOA 4ZECA 1B46A 1Z7NE 2M8CA 4N17A 4U22A 1LBCA 4R9FA 4U23A 4NTLA 2XXQA 1SW2A 2V93A 2GHAA 3G3HA 4GL8A 1AWBA 2CZLA 2O7UA 4KCDA 1B5HA 3T9XB 1MM6A 3OELA 3T0JA 3HHGA 3UGWA 4PC9A 2E1SA 3PPPA 4YB7A 3LR1A 4N13A 5KCJB 3QIMA 1B6HA 3ZS6A 3KBRA 5AE4A 1P1UA 2XWVA 3IOTA 4C0RA 1N84A 1B7HA 4OETA 3SEYA 3L6HA 2AIXA 2ONKE 2H5YA 4O3AA 2O84X 5HBCA 3NOHA 3K6UA 1IXGA 3G3GA 3UORA 4LQ5A 3EF7A 1BK4A 1DMBA 3N5LA 3HSTA 4UA8A 2DP8A 3V5AA 1TFDA 3RN8A 4ONYA 3VLUA 2OLBA 3E79A 2XHDA 3WAEA 3E9XA 2GFEA 3O9PA 4IR8A 5L8DA 4KD5A 3KC0A 2D5WA 1FBHA 1B0HA 4GOTA 4OHNA 2XWOA 1TWYA 2FA7A 3OEKA 2DXYA 4K3FA 2FYIA 4P56A 4GX6A 2IA4A 4OEVA 1NH8A 2NWJA 4DXUA 2DSFA 4F31B 3HN0A 2Y7PA 3MP1A 2P3NA 3MVYA 1LFHA 3K6WA 3O6GA 4F3SA 4H67A 1FPGA 5I3SA 4XKPA 3KC1A 4GBWA 4XKQA 3W9WA 4HTGA 4OTEA 2GQ1A 3W15C 3T9UA 2R9JA 2I4BA 5A5LA 1P1QA 3FV2A 4GQOA 4O94A 5AA2D 1FBDA 1FPJA 2WYPA 2WEFA 4PAFA 1FQFA 1R9QA 3MW0A 4ZEIA 1IEJA 4DXBA 1SBPA 3S2VA 5JTYA 4F3GA 3BIHA 2B3BA 5ITOA 3ZKLA 2AL4A 4ESXA 5FBPA 4NHBA 3RNNA 1DTGA 5TPAA 3LBSA 4X04A 1A8FA 2UVIA 5DEXA 1QULA 4QSEA 4P11A 2Z8DA 1IMCA 4YKIA 4G4PA 4PP0A 4ECFA 1SVXB 2P2AA 3OD7A 4R72A 1I6QA 5I2KB 3IOUA 1B3GA 3B7DA 1A99A 1OLCA 1FPEA 1MXXA 1I6AA 5ET5A 1OIBA 3OOAA 1EZPA 4GVOA 1G0HA 2MKZA 1JVXA 4R9GA 2XXUA 1POY1 4QBAA 1EYJA 2ZNUA 5IKBA 5EHMA 3CRBA 4N15A 4NWDA 1B3HA 5EYGA 1B3FA 2B4MA 4MF3A 4H1XA 1QUJA 4IY5A 2QVVA 4PF8A 4Q30B 4MNPA 3WAFA 2VPNA 1MQIA 3PPOA 1PC3A 4OYVA 1NH7A 2FNCA 3K6VA 4P3LA 3TTNA 1QJMA 1M5BA 2GH9A 3K1NA 1P1OA 3C34A 4GFRA 3FVGA 2GHBA 2REJA 2YPNA 3W9VA 4EF2A 2F7CA 1NV5A 3OSRA 2VT5A 2X7PA 1LBYA 4I8CA 4PFTA 4RNSA 4EQBA 1IXHA 1OVTA 1UTBB 5I57B 5IZ3A 1MY0A 1MQHA 5ICQA 4FBPA 2V3UA 1DBZA 5CM6A 3VXCA 4EUOA 2Q2AA 4LZ5A 1YAEA 3VFJA 2BJJX 2V84A 4BDNA 4PDHA 1IUDA 2I4CA 2OX3A 3ILUB 1QGXA 3JV9A 4F3PA 3IFCA 3B6QA 1B5IA 3H7MA 3LSWA 1VFEA 2VHAA 5F1QA 4I3EA 1NI9A 4G2ZA 4QFOA 3SEWA 1MXVA 3T1BA 2B3FA 4LVQA 1CNQA 3A3UA 1N3XA 2DXRA 1B3LA 4HE1A 4WEPA 3RQTA 4EQ7A 5ET8A 1EYIA 4AS4A 2UVJA 3SDFA 5IAIA 4O3CA 3CIJA 1B51A 1MY3A 3TQWA 5L9OA 2DOJA 4BDMA 1AL3A 3USDA 3SKPA 1EU8A 5CI5A 5H8HA 4ZEBA 2XXWA 4RXLA 1AIVA 4ZS9A 3KSXA 1PBPA 2Q8MA 2PYYA 3TEPA 3MAMA 2VP1A 4JWOA 2F7BA 4NGUA 5EQ9A 1YPNA 3Q26A 4I3YA 1P1NA 4NN3A 4TQUQ 3AXFA 3EHUA 4DI4B 3C35A 3SEVA 2XD3A 4R6HA 4TLMB 3O66A 2UVGA 2I0CA 5DYHA 3IO4A 3R26A 3TELA 2DWAA 1IITA 3IB2A 1A7LA 5IZ3B 3Q29A 3U92A 3IOWA 1SYHA 4KI0E 2RF1A 1FBCA 3CI8A 4RA1A 4ZEFA 4AB6A 4XIGQ 3CR9A 4Q8RA 5EQAA 4XKNA 1Y1ZA 1UQWA 2I49A 4IGRA 4PE3A 2DS9A 3UN6A 2ZYOA 3T66A 3FV1A 1CB6A 3FJ7A 2Y84A 1MRPA 1URGA 4IB2A 3G3JA 4XEQA 1IMAA 3ONMA 1T0KA 4R74A 2DYXA 3RTFB 1FBEA 3L6GA 1HSEA 1MQJA 4NF8A 3HO7A 1B32A 1D9YA 4F39A 2O51A 4KCCA 4NQ8A 5HM4B 1HSJA 1FTOA 3FASA 5I2NA 1R1NA 3KN7A 3K2DA 2HZKA 1FPFA 1KWHA 1TFAA 5H8HB 4KYEA 3E78A 3MVWA 4MAGA 4N8YA 5FTIA 3KEIA 1Y20A 1IMEA 3M3KA 1GV8A 1WODA 4GWXA 4YZZA 4X8RA 4QSDA 3BKIB 2HXWA 2XXXA 3IAZA 4HE0A 2F6PA 2THIA 4OVRA 1JEVA 4JVDA 3DP8A 1MQGA 5ELVA 1O7TA 3PMWA 1RYOA 1ZMGA 5DW8A 2QFLA 1PB9A 3I3VA 4R2FA 4JVCA 3UA8A 3IX1A 3FZVA 3K6XA 1SI1A 4XF5A 2PVUA 4BLAA 3EHTA 3JZJA 1DSNA 3PPRA 4N8GA 1MPDA 3TZAA 3OXNA 4DZ1A 4P1LA 2XXHA 4JXIA 4QRZA 1FCKA 2I3WA 3IK6B 3FJGA 4GF8A 2NVUB 3LC8A 2UYEA 1MY1A 2ZZXA 1B5JA 1UIVA 2NOOA 2F34A 5IGAA 2HEUA 2L5VA 3S9LC 2XXRA 1B2HA 3HHFA 4NMYA 2FBPA 3VDFA 4GWYA 3S9MC 1XC1A 4G77A 2H99A 3N26A 1YTVA 3U93A 5I2NB 2Q74A 2P3VA 2ONSA 3R7XA 1NV2A 3TKDA 5LDZA 4IGTA 4FEBA 4EXLA 1D3KA 3PMVA 4RPNA 5TP9A 3VVDA 4AQ4A 4G68A 2NUVA 3OO7A 2X7QA 3BFUA 5I58A 4C1UA 1KA0A 4N6KA 2DWJA 3PUXE 4O7MA 1ZU0A 5T3JA 1B7ZA 3KZGA 4RJZA 5A5XA 3MZBA 4Q0CA 4F3BA 2ESNA 4JDFA 1FBGA 1FTLA 1OVBA 4AS5A 5ISUA 1IXCA 2ALUA 4ZE8A 2FHYA 2YLNA 2DDKA 4KQPA 1O63A 3UK4A 4N6DA 2PMSA 1CE2A 2OZZA 2ZXTA 3MPKA 1AOVA 1FPLA 4EDPA 1QVSA 4BDRA 1IIWA 1PEBA 3QYTA 5EQ8A 2OCUA 3MSTA 5DVFA 4IO5A 3RTWB 2XXYA 5AA4B 2CZKA 1IMBA 5ITPA 2V4CA 5I5PA 1N7XA 3VV5A 1JW5A 5KDTA 1AMFA 3VLWA 2OWSA 3M3FA 4DCYA 4OVTA 2ZYMA 3RT8A 1IMFA 4IO4A 4NF6B 2F8DA 4JWXA 1FW0A 2RINA 1R6ZA 4AB5A 4RY1A 2D3IA 1J1NA 1NV7A 4GLIA 3DLNA 3PMXA 2R71A 3TCFA 3TTKA 2OJTA 5M2VA 2VGQA 1PB7A 2XWKA 5TP9B 1USYE 4WXJA 2NXOA 1Q1KA 4ZZEA 1FPBA 3ISPA 5AA1A 4Z0IA 1MS7A 2QS3A 2XXIA 1XI6A 4F1UA 2O6AA 4IO3A 3TTLA 2FVZA 2CEXA 2ABHA 2XX9A 3MQ9A 5I56A 4OVPA 4GWUA 5DT6A 1MG1A 5CMBA 4FIMA 1NKXA 4GD5A 3RYDA 1N3WA 1JW1A 3TTMA 4EXKA 4OVJA 3KBZA 1TXFA 3SZPA 4MFIA 5AA3A 3SEXA 1VR5A 3P7IA 4XKRA 3JYRA 4KHZE 3B6WA 1RYXA 4DCXA 2ZMBA 3MZ9A 3SETA 3E13X 4THIA 1B1XA 3KN8A 1Y4TA 3R6UA 1K9YA 4OVQA 4H6DA 1LAFE 2F7AA 1SPIA 4PFRA 4GRKA 1H44A 1IXIA 4P47A 4EQ9A 3RY3A 5BUUA 2XA5A 4R6KA 4QXDA 4JWYA 4ZZAA 2PFZA 4YKPA 4QFPA 3S9EA 3TDJA 5AA2A 4E0WA 2I48A 3MJNA 1NNFA 4OEUA 4DDDA 1LCFA 2WYKA 4BDQA 2F78A 5K2YA 4G8MA 4YKJA 4YB6A 2FIEA 4PAIA 4PFBA 1JP4A 3OEMA 2F36A 1Y3NA 4FE8A 3RPWA 2Y7RA 2PCRA 3FATA 1SDXA 3CVGA 1YYZA 1FBFA 3QXMA 3F11A 2WKYA 2Z22A 1DK4A 5JTYB 5I7IA 4MHFA 2ANJA 3IL1B 3C31A 4R75A 1Q35A 3OO9A 1RKMA 2HHMA 1S7YA 2I6EA 1MH4A 4HE2A 4U21A 5TPAB 5ET7A 1S50A 5DEXB 2JJKA 4POXA 4N91A 3FXRA 1B0LA 3N6UA 1POTA 3S4UA 3K01A 1LAHE 1HSLA 1FTKA 2H25A 3FIRA 2O69A 4H45A 4XFEA 4I9DA 2BJIA 4HS7A 4FORA 4U4XA 5CBRA 1L5TA 1NFTA 1UTHA 4F18A 2WBDA 3EQ1A 1INPA 4H8IA 1BKAA 3H4ZA 4N6PA
chains in the Genus database with same CATH topology
4LATA 2HAUA 3DELB 3FVOA 3SESA 1WVJA 3O6HA 3O6IA 2O1MA 1B4ZA 3C4MA 2RC7A 1MXYA 3FVNA 3OSQA 1H3DA 2F5XA 5TU0A 3VVFA 4GL0A 3SEUA 3U8QA 1VSOA 4PE5B 3VLVA 2ZNTA 2A5SA 3PUZE 4E0XA 4XXUA 2A5TA 1VFDA 3B6TA 3D4CA 3IORA 1BIYA 4BDLA 3G3FA 1Y1MA 2Z8EA 3VVEA 3KJTA 3LSLA 1MQDA 3TPAA 1USYH 2Y7IA 2IEEA 3TQLA 4ZEKA 3D4GA 1JNFA 2Q89A 3N94A 1GR2A 2PT1A 3CG3A 3G3IA 5BWJA 5K2XA 4GXSB 4DXCA 1F9BA 4ZDMA 4F19A 3K4UA 1QUIA 1MXWA 2DVCA 2R6GE 1IQ7A 4BDOA 4DIGA 5F7VA 2ONRA 1LBBA 3CG1A 4H65A 4L17A 2H9BA 2QS1A 4FJPA 1FQBA 1R9LA 3O28A 4KYSA 1MDP1 3MVZA 2UVHA 3H6UA 2G93A 4QF9A 1NNTA 3CFXA 3E3KA 1EH3A 3LSFB 2F6GA 4F1YA 2Y7KA 3H6VA 2DWIA 1QUKA 3A3CA 3OO8A 4P0IA 4IO7A 4WEDA 1PB8A 4OENA 5DVIA 1MPBA 3G7WA 4RK2A 1SW1A 3TFLA 4IY6A 3H06B 4X1DA 1QW0A 4U4SA 3PGFA 3E4RA 4POWA 4PFYA 3TTRA 3U94A 3MUQA 3PPQA 1Y3QA 4Z7EA 2ZNSA 2RKMA 1PDAA 4X48A 5FHNA 3FVKA 1B1HA 1S9TA 4ESWA 1ELJA 2D21A 3OENA 3T22A 3C36A 3MWBA 2PT2A 1O64A 3UP9A 1EZOA 4LONB 4KFQA 2Q8JA 5I59A 4HW8A 2QMXA 4QHQA 3MVXA 3LSXA 3V83A 3MZ1A 4JB7A 1DPPA 3DP4A 4YICA 2VOZA 4LA9A 5JEIA 5J1DA 2QS4A 2XX8A 3IO6A 4DLDA 1D9VA 1Y4CA 3RUMA 5CBSA 1LAXA 3PPNA 4ISUA 5L9SA 2QS2A 3KGCA 4JSDA 1BLFA 2DQVA 1LSTA 2DE3A 2I58A 1B9JA 4NF8B 3PU5A 1QKBA 3KFMA 4LUBA 4M4GA 1JEUA 4U2RA 3N6TA 4LP2B 3RT6B 1FQDA 4LZ8A 1M5FA 1P1WA 1MY2A 4IO2A 1WDNA 2V3TA 3U72A 2HAVA 3UIFA 3SERA 2QMWA 1US5A 4F2OA 1GVCA 4N07A 1OQHA 2F97A 1LB9A 1FQEA 1H45A 4OXVA 3O2AA 1ANFA 1OMPA 2H4IA 4G8HA 3T9HB 3KOSA 5H8NA 4R2BA 4U1ZA 5I59B 1XOCA 2HZLA 3ODBA 3THIA 4NEDA 2XXTA 3T96B 3FGSA 2KLFA 2OBGA 1SI0A 4JSOA 5I2KA 3H6TA 3IJXB 1OLAA 4GWOA 3QUFA 3GBBA 4GIZA 2Z23A 3RGYA 3Q28A 1DTZA 1BP5A 4NF4A 4RK9A 3IB0A 1IZ1A 3I5OA 3PD8A 2QPQA 2PX1A 4PFWA 3HPIA 1B05A 1URSA 1JETA 3K1PA 4ELOA 3KOTA 2Q2CA 3GLBA 2REGA 2O7IA 1LCTA 3V89B 3TYHA 4UACA 2GRVA 4WKMA 3PUVE 1LFGA 1JVYA 4YU0A 4X1BA 2O68A 4G8NA 3VE1B 1FTJA 4G68B 5I58B 2B65A 3O97A 2Y7WA 1N0TA 5H8QA 2HFBA 4XTCQ 5A5XB 3QSLA 3FD3A 4FEDA 2V25A 3FJMA 3H3GA 3FXQA 1UTBA 3KSJA 5I57A 4C1TA 4H8JA 3BFTA 2RCAA 2HCAA 5H8NB 2VD3A 3CSGA 2V3QA 3IR1A 4ELQA 2H98A 2DE4A 4F1VA 1PBQA 3DP6A 3ILTB 1LAGE 1FQAA 3MBPA 1DPEA 1SD3A 2QRYA 1SYIA 4FECA 1AH5A 3KG2A 3HCQA 3OO6A 5CRYA 2XXPA 3IJOB 3K0VA 3U1OA 4NF4B 4F22A 2DVZA 2RC9A 2QSXA 2I3VA 3Q25A 5KDTB 1P99A 2OWTA 4QSCA 3ZKKA 4P0GA 1Y3PA 4PQJA 5CMKA 5JK4A 1ATGA 3M3LA 4H0WA 4TOZA 1I69A 1B3EA 1XS5A 4H5FA 4R6YA 3PUWE 2VD2A 1LFIA 4I1DA 3PV0E 1US4A 3EHSA 5KZTA 3ECRA 2E0SA 4OMBA 1Z7ME 1D4NA 3MC2A 4ZE9A 3TCGA 5B70A 1M5CA 3CSBA 4Q5TA 1ZJLA 1MDQA 5H8QB 2YJPA 1A40A 2O1LA 3V8XB 4I62A 4HCWA 4U1OA 4TLLB 3GZGA 3MPLA 4QFNA 2W7YA 4G68C 4PFUA 3K02A 3DM0A 3MP6A 5I56B 1QKAA 2DE2A 3G3KA 1N76A 3T93B 2F35A 4OQOA 4YKKA 4OFJA 4MLQA 4KR5A 3KJ7A 4MLVA 4YMAA 3T9VA 4JBZA 2AYSA 4NWCA 4ND9A 3CFZA 4QFKA 1H43A 3H6WA 5I84A 1JQFA 2P0SA 2Q9TA 1A8EA 1B40A 4LQ2A 1MH3A 3IB1A 5AA2B 1VE4A 1MM7A 4X9TA 2RC8A 3RLFE 1LLSA 3Q27A 2Q88A 5HPQA 1JW4A 3QAXA 3MP8A 1M5EA 4NF5A 1Y9UA 2ZYNA 4RPOA 4FAJA 1B52A 4PETA 3C32A 1ZIUA 2PBWA 1BTJA 3VXBA 3A09A 4NE4A 2I0BA 3PD9A 1LGBC 1OQGA 4KYDA 3O29A 3GXAA 1XHYA 1LB8A 1MY4A 5EYFA 1MPCA 3H03A 3IOVA 4OFLA 3S9NC 2X26A 1NNPA 3I6VA 3LUYA 3EPEA 3CFLA 1UTHB 2UXAA 4OESA 4ELRA 2UYFA 2AL5A 2DWHA 5CMCA 3C9HA 5H8FA 1A55A 4OZ9A 5DVJA 4M1VA 5DTBA 5CC2A 4O3BA 1XT8A 1B58A 1MXUA 5H8SA 1B7UA 5LOMA 2QL3A 1XVXA 3M8UA 4GXAA 2LAOA 2P1SA 4YMBA 3PUYE 4DE8A 3FUZA 5ICTA 1A54A 2A5TB 1NMUA 4MH5A 1EZ9A 3K00A 4HCYA 3BBRA 1II5A 5CMMA 3QUJA 4YAHX 5B7DA 4OERA 5FTHA 4KPTA 3EN3A 3KN3A 3K1MA 1NNKA 4OFOA 1ZTYA 4NF5B 1FTMA 1UIUA 5FHMA 3TODA 3QK6A 3TUSA 2XD2A 5KCJA 4QFLA 4F2QA 1MXZA 1GGGA 5FHOA 4IO6A 3FXUA 4MBPA 1ZKBA 4R73A 2Z8FA 5EHSA 3ZSFA 3HV1A 1H76A 4EF1A 1N04A 3GBAA 2ZYKA 1GTKA 1NL5A 1M5DA 4YB5A 4ZEDA 2HQ0A 3TMGA 1YCJA 4OWDA 1ZLQA 1N7WA 3OMBA 2OK2A 5H8FB 1SW5A 3TAJA 5AA4A 2RCBA 1DOTA 1ZBMA 2CMOA 1B4HA 1I6BA 5L9MA 3C33A 4LZ7A 1FQCA 4ELPA 1XVYA 3TCHA 1SW4A 2QJEA 4F29A 1TT1A 2G29A 1URDA 2XX7A 4H5GA 4NF6A 4FATA 2XXVA 1SQYA 4RYAA 4ZECA 1B46A 1Z7NE 2M8CA 4U22A 1LBCA 4R9FA 4U23A 4NTLA 2XXQA 1SW2A 2V93A 2GHAA 3G3HA 4GL8A 2CZLA 2O7UA 4KCDA 1B5HA 3T9XB 1MM6A 3OELA 3HHGA 3UGWA 2E1SA 3PPPA 4YB7A 3LR1A 4N13A 5KCJB 3QIMA 1B6HA 3ZS6A 3KBRA 5AE4A 1P1UA 3IOTA 4C0RA 1N84A 1B7HA 4OETA 3SEYA 3L6HA 2AIXA 2ONKE 2H5YA 4O3AA 2O84X 5HBCA 3K6UA 1IXGA 3G3GA 3UORA 4LQ5A 3EF7A 1DMBA 3N5LA 3HSTA 4UA8A 2DP8A 3V5AA 1TFDA 3RN8A 4ONYA 3VLUA 2OLBA 2XHDA 3WAEA 3E9XA 2GFEA 3O9PA 5L8DA 4KD5A 2D5WA 1B0HA 4GOTA 4OHNA 1TWYA 2FA7A 3OEKA 2DXYA 4K3FA 2FYIA 2IA4A 4OEVA 1NH8A 2NWJA 4DXUA 2DSFA 4F31B 3HN0A 2Y7PA 3MP1A 3MVYA 1LFHA 3K6WA 3O6GA 4F3SA 4H67A 4XKPA 4XKQA 3W9WA 4HTGA 4OTEA 3W15C 3T9UA 2R9JA 2I4BA 1P1QA 3FV2A 4GQOA 5AA2D 1FQFA 1R9QA 3MW0A 4ZEIA 1IEJA 4DXBA 1SBPA 3S2VA 5JTYA 4F3GA 2B3BA 5ITOA 3ZKLA 2AL4A 4ESXA 3RNNA 1DTGA 5TPAA 3LBSA 1A8FA 2UVIA 5DEXA 1QULA 4QSEA 4P11A 2Z8DA 4YKIA 4G4PA 4PP0A 4ECFA 1SVXB 2P2AA 3OD7A 4R72A 1I6QA 5I2KB 3IOUA 1B3GA 3B7DA 1A99A 1OLCA 1MXXA 1I6AA 1OIBA 3OOAA 1EZPA 4GVOA 1JVXA 4R9GA 2XXUA 1POY1 2ZNUA 5IKBA 5EHMA 3CRBA 4NWDA 1B3HA 1B3FA 4MF3A 4H1XA 1QUJA 4IY5A 4Q30B 3WAFA 1MQIA 3PPOA 1PC3A 4OYVA 1NH7A 2FNCA 3K6VA 3TTNA 1QJMA 1M5BA 2GH9A 3K1NA 1P1OA 3C34A 4GFRA 3FVGA 2GHBA 2REJA 2YPNA 3W9VA 4EF2A 2F7CA 3OSRA 2X7PA 4I8CA 4PFTA 4RNSA 4EQBA 1IXHA 1OVTA 1UTBB 5I57B 1MY0A 1MQHA 5ICQA 2V3UA 5CM6A 3VXCA 4EUOA 2Q2AA 4LZ5A 1YAEA 3VFJA 2BJJX 2V84A 4BDNA 1IUDA 2I4CA 3ILUB 3JV9A 4F3PA 3B6QA 1B5IA 3H7MA 3LSWA 1VFEA 2VHAA 5F1QA 4G2ZA 4QFOA 3SEWA 1MXVA 2B3FA 4LVQA 3A3UA 1N3XA 2DXRA 1B3LA 3RQTA 4WEPA 4EQ7A 2UVJA 3SDFA 5IAIA 4O3CA 3CIJA 1B51A 1MY3A 3TQWA 5L9OA 2DOJA 4BDMA 1AL3A 3USDA 3SKPA 1EU8A 5CI5A 5H8HA 4ZEBA 2XXWA 4RXLA 1AIVA 4ZS9A 3KSXA 1PBPA 2PYYA 3TEPA 3MAMA 2VP1A 4JWOA 2F7BA 1YPNA 3Q26A 1P1NA 4TQUQ 3AXFA 3EHUA 3C35A 3SEVA 2XD3A 4R6HA 4TLMB 3O66A 2UVGA 2I0CA 5DYHA 3IO4A 3R26A 3TELA 2DWAA 1IITA 3IB2A 1A7LA 3Q29A 3U92A 3IOWA 1SYHA 4KI0E 2RF1A 3CI8A 4RA1A 4ZEFA 4AB6A 4XIGQ 3CR9A 4Q8RA 4XKNA 1Y1ZA 1UQWA 2I49A 4IGRA 2DS9A 3UN6A 2ZYOA 3T66A 3FV1A 1CB6A 3FJ7A 2Y84A 1MRPA 1URGA 4IB2A 3G3JA 3ONMA 1T0KA 4R74A 2DYXA 3RTFB 3L6GA 1HSEA 1MQJA 4NF8A 3HO7A 1B32A 1D9YA 4F39A 2O51A 4KCCA 5HM4B 1HSJA 1FTOA 3FASA 5I2NA 1R1NA 3KN7A 3K2DA 2HZKA 1KWHA 1TFAA 5H8HB 4KYEA 3MVWA 5FTIA 3KEIA 1Y20A 3M3KA 1GV8A 1WODA 4YZZA 4QSDA 3BKIB 2HXWA 2XXXA 3IAZA 2F6PA 2THIA 1JEVA 3DP8A 1MQGA 5ELVA 1O7TA 3PMWA 1ZMGA 1RYOA 1PB9A 3I3VA 4R2FA 3UA8A 3IX1A 3FZVA 3K6XA 1SI1A 2PVUA 4BLAA 3EHTA 3JZJA 1DSNA 3PPRA 1MPDA 3TZAA 3OXNA 4DZ1A 2XXHA 4JXIA 4QRZA 1FCKA 2I3WA 3IK6B 3FJGA 4GF8A 2NVUB 3LC8A 2UYEA 1MY1A 1B5JA 1UIVA 2NOOA 2F34A 2HEUA 3S9LC 2XXRA 1B2HA 3HHFA 4NMYA 3VDFA 3S9MC 1XC1A 4G77A 2H99A 3N26A 1YTVA 3U93A 5I2NB 2ONSA 3R7XA 3TKDA 4IGTA 4FEBA 4EXLA 1D3KA 3PMVA 4RPNA 5TP9A 3VVDA 4AQ4A 4G68A 2NUVA 3OO7A 2X7QA 3BFUA 5I58A 4C1UA 2DWJA 3PUXE 1ZU0A 1B7ZA 3KZGA 4RJZA 5A5XA 3MZBA 4Q0CA 4F3BA 2ESNA 4JDFA 1FTLA 1OVBA 5ISUA 1IXCA 2ALUA 4ZE8A 2YLNA 4KQPA 1O63A 3UK4A 2PMSA 1CE2A 2OZZA 2ZXTA 3MPKA 1AOVA 4EDPA 1QVSA 4BDRA 1IIWA 1PEBA 3QYTA 2OCUA 5DVFA 4IO5A 3RTWB 2XXYA 5AA4B 5ITPA 1N7XA 3VV5A 1JW5A 5KDTA 1AMFA 3VLWA 2OWSA 3M3FA 4DCYA 2ZYMA 3RT8A 4IO4A 4NF6B 2F8DA 4JWXA 1FW0A 2RINA 1R6ZA 4AB5A 2D3IA 1J1NA 4RY1A 4GLIA 3DLNA 3PMXA 2R71A 3TCFA 3TTKA 2OJTA 5M2VA 2VGQA 1PB7A 5TP9B 1USYE 4WXJA 2NXOA 1Q1KA 4ZZEA 5AA1A 4Z0IA 1MS7A 2QS3A 2XXIA 4F1UA 2O6AA 4IO3A 3TTLA 2ABHA 2XX9A 3MQ9A 5I56A 5DT6A 1MG1A 5CMBA 4FIMA 1NKXA 4GD5A 1N3WA 1JW1A 3TTMA 4EXKA 4OVJA 1TXFA 4MFIA 5AA3A 3SEXA 1VR5A 3P7IA 4XKRA 3JYRA 4KHZE 3B6WA 1RYXA 4DCXA 2ZMBA 3MZ9A 3SETA 3E13X 4THIA 1B1XA 3KN8A 1Y4TA 3R6UA 4H6DA 1LAFE 2F7AA 4GRKA 1H44A 1IXIA 4EQ9A 3RY3A 5BUUA 4R6KA 4JWYA 4ZZAA 4YKPA 4QFPA 3S9EA 3TDJA 5AA2A 4E0WA 2I48A 3MJNA 1NNFA 4OEUA 4DDDA 1LCFA 4BDQA 2F78A 5K2YA 4G8MA 4YKJA 4YB6A 3OEMA 2F36A 1Y3NA 4FE8A 3RPWA 2Y7RA 3FATA 1SDXA 3CVGA 3QXMA 3F11A 2WKYA 2Z22A 5JTYB 2ANJA 3IL1B 3C31A 4R75A 1Q35A 3OO9A 1RKMA 1S7YA 2I6EA 1MH4A 4U21A 5TPAB 1S50A 5DEXB 4POXA 3FXRA 1B0LA 3N6UA 1POTA 3S4UA 3K01A 1LAHE 1HSLA 1FTKA 2H25A 3FIRA 2O69A 4I9DA 4HS7A 4FORA 4U4XA 5CBRA 1L5TA 1NFTA 1UTHA 4F18A 3EQ1A 4H8IA 1BKAA 3H4ZA 4N6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAT A;  2HAU A;  3DEL B;  3FVO A;  3SES A;  1WVJ A;  3O6H A;  3O6I A;  2O1M A;  1B4Z A;  3C4M A;  2RC7 A;  1MXY A;  3FVN A;  3OSQ A;  1H3D A;  2F5X A;  5TU0 A;  3VVF A;  4GL0 A;  3SEU A;  3U8Q A;  1VSO A;  4PE5 B;  3VLV A;  2ZNT A;  2A5S A;  3PUZ E;  4E0X A;  4XXU A;  2A5T A;  1VFD A;  3B6T A;  3D4C A;  3IOR A;  1BIY A;  4BDL A;  3G3F A;  1Y1M A;  2Z8E A;  3VVE A;  3KJT A;  3LSL A;  1MQD A;  3TPA A;  1USY H;  2Y7I A;  2IEE A;  3TQL A;  4ZEK A;  3D4G A;  1JNF A;  2Q89 A;  3N94 A;  1GR2 A;  2PT1 A;  3CG3 A;  3G3I A;  5BWJ A;  5K2X A;  4GXS B;  4DXC A;  1F9B A;  4ZDM A;  4F19 A;  3K4U A;  1QUI A;  1MXW A;  2DVC A;  2R6G E;  1IQ7 A;  4BDO A;  4DIG A;  5F7V A;  2ONR A;  1LBB A;  3CG1 A;  4H65 A;  4L17 A;  2H9B A;  2QS1 A;  4FJP A;  1FQB A;  1R9L A;  3O28 A;  4KYS A;  1MDP 1;  3MVZ A;  2UVH A;  3H6U A;  2G93 A;  4QF9 A;  1NNT A;  3CFX A;  3E3K A;  1EH3 A;  3LSF B;  2F6G A;  4F1Y A;  2Y7K A;  3H6V A;  2DWI A;  1QUK A;  3A3C A;  3OO8 A;  4P0I A;  4IO7 A;  4WED A;  1PB8 A;  4OEN A;  5DVI A;  1MPB A;  3G7W A;  4RK2 A;  1SW1 A;  3TFL A;  4IY6 A;  3H06 B;  4X1D A;  1QW0 A;  4U4S A;  3PGF A;  3E4R A;  4POW A;  4PFY A;  3TTR A;  3U94 A;  3MUQ A;  3PPQ A;  1Y3Q A;  4Z7E A;  2ZNS A;  2RKM A;  1PDA A;  4X48 A;  5FHN A;  3FVK A;  1B1H A;  1S9T A;  4ESW A;  1ELJ A;  2D21 A;  3OEN A;  3T22 A;  3C36 A;  3MWB A;  2PT2 A;  1O64 A;  3UP9 A;  1EZO A;  4LON B;  4KFQ A;  2Q8J A;  5I59 A;  4HW8 A;  2QMX A;  4QHQ A;  3MVX A;  3LSX A;  3V83 A;  3MZ1 A;  4JB7 A;  1DPP A;  3DP4 A;  4YIC A;  2VOZ A;  4LA9 A;  5JEI A;  5J1D A;  2QS4 A;  2XX8 A;  3IO6 A;  4DLD A;  1D9V A;  1Y4C A;  3RUM A;  5CBS A;  1LAX A;  3PPN A;  4ISU A;  5L9S A;  2QS2 A;  3KGC A;  4JSD A;  1BLF A;  2DQV A;  1LST A;  2DE3 A;  2I58 A;  1B9J A;  4NF8 B;  3PU5 A;  1QKB A;  3KFM A;  4LUB A;  4M4G A;  1JEU A;  4U2R A;  3N6T A;  4LP2 B;  3RT6 B;  1FQD A;  4LZ8 A;  1M5F A;  1P1W A;  1MY2 A;  4IO2 A;  1WDN A;  2V3T A;  3U72 A;  2HAV A;  3UIF A;  3SER A;  2QMW A;  1US5 A;  4F2O A;  1GVC A;  4N07 A;  1OQH A;  2F97 A;  1LB9 A;  1FQE A;  1H45 A;  4OXV A;  3O2A A;  1ANF A;  1OMP A;  2H4I A;  4G8H A;  3T9H B;  3KOS A;  5H8N A;  4R2B A;  4U1Z A;  5I59 B;  1XOC A;  2HZL A;  3ODB A;  3THI A;  4NED A;  2XXT A;  3T96 B;  3FGS A;  2KLF A;  2OBG A;  1SI0 A;  4JSO A;  5I2K A;  3H6T A;  3IJX B;  1OLA A;  4GWO A;  3QUF A;  3GBB A;  4GIZ A;  2Z23 A;  3RGY A;  3Q28 A;  1DTZ A;  1BP5 A;  4NF4 A;  4RK9 A;  3IB0 A;  1IZ1 A;  3I5O A;  3PD8 A;  2QPQ A;  2PX1 A;  4PFW A;  3HPI A;  1B05 A;  1URS A;  1JET A;  3K1P A;  4ELO A;  3KOT A;  2Q2C A;  3GLB A;  2REG A;  2O7I A;  1LCT A;  3V89 B;  3TYH A;  4UAC A;  2GRV A;  4WKM A;  3PUV E;  1LFG A;  1JVY A;  4YU0 A;  4X1B A;  2O68 A;  4G8N A;  3VE1 B;  1FTJ A;  4G68 B;  5I58 B;  2B65 A;  3O97 A;  2Y7W A;  1N0T A;  5H8Q A;  2HFB A;  4XTC Q;  5A5X B;  3QSL A;  3FD3 A;  4FED A;  2V25 A;  3FJM A;  3H3G A;  3FXQ A;  1UTB A;  3KSJ A;  5I57 A;  4C1T A;  4H8J A;  3BFT A;  2RCA A;  2HCA A;  5H8N B;  2VD3 A;  3CSG A;  2V3Q A;  3IR1 A;  4ELQ A;  2H98 A;  2DE4 A;  4F1V A;  1PBQ A;  3DP6 A;  3ILT B;  1LAG E;  1FQA A;  3MBP A;  1DPE A;  1SD3 A;  2QRY A;  1SYI A;  4FEC A;  1AH5 A;  3KG2 A;  3HCQ A;  3OO6 A;  5CRY A;  2XXP A;  3IJO B;  3K0V A;  3U1O A;  4NF4 B;  4F22 A;  2DVZ A;  2RC9 A;  2QSX A;  2I3V A;  3Q25 A;  5KDT B;  1P99 A;  2OWT A;  4QSC A;  3ZKK A;  4P0G A;  1Y3P A;  4PQJ A;  5CMK A;  5JK4 A;  1ATG A;  3M3L A;  4H0W A;  4TOZ A;  1I69 A;  1B3E A;  1XS5 A;  4H5F A;  4R6Y A;  3PUW E;  2VD2 A;  1LFI A;  4I1D A;  3PV0 E;  1US4 A;  3EHS A;  5KZT A;  3ECR A;  2E0S A;  4OMB A;  1Z7M E;  1D4N A;  3MC2 A;  4ZE9 A;  3TCG A;  5B70 A;  1M5C A;  3CSB A;  4Q5T A;  1ZJL A;  1MDQ A;  5H8Q B;  2YJP A;  1A40 A;  2O1L A;  3V8X B;  4I62 A;  4HCW A;  4U1O A;  4TLL B;  3GZG A;  3MPL A;  4QFN A;  2W7Y A;  4G68 C;  4PFU A;  3K02 A;  3DM0 A;  3MP6 A;  5I56 B;  1QKA A;  2DE2 A;  3G3K A;  1N76 A;  3T93 B;  2F35 A;  4OQO A;  4YKK A;  4OFJ A;  4MLQ A;  4KR5 A;  3KJ7 A;  4MLV A;  4YMA A;  3T9V A;  4JBZ A;  2AYS A;  4NWC A;  4ND9 A;  3CFZ A;  4QFK A;  1H43 A;  3H6W A;  5I84 A;  1JQF A;  2P0S A;  2Q9T A;  1A8E A;  1B40 A;  4LQ2 A;  1MH3 A;  3IB1 A;  5AA2 B;  1VE4 A;  1MM7 A;  4X9T A;  2RC8 A;  3RLF E;  1LLS A;  3Q27 A;  2Q88 A;  5HPQ A;  1JW4 A;  3QAX A;  3MP8 A;  1M5E A;  4NF5 A;  1Y9U A;  2ZYN A;  4RPO A;  4FAJ A;  1B52 A;  4PET A;  3C32 A;  1ZIU A;  2PBW A;  1BTJ A;  3VXB A;  3A09 A;  4NE4 A;  2I0B A;  3PD9 A;  1LGB C;  1OQG A;  4KYD A;  3O29 A;  3GXA A;  1XHY A;  1LB8 A;  1MY4 A;  5EYF A;  1MPC A;  3H03 A;  3IOV A;  4OFL A;  3S9N C;  2X26 A;  1NNP A;  3I6V A;  3LUY A;  3EPE A;  3CFL A;  1UTH B;  2UXA A;  4OES A;  4ELR A;  2UYF A;  2AL5 A;  2DWH A;  5CMC A;  3C9H A;  5H8F A;  1A55 A;  4OZ9 A;  5DVJ A;  4M1V A;  5DTB A;  5CC2 A;  4O3B A;  1XT8 A;  1B58 A;  1MXU A;  5H8S A;  1B7U A;  5LOM A;  2QL3 A;  1XVX A;  3M8U A;  4GXA A;  2LAO A;  2P1S A;  4YMB A;  3PUY E;  4DE8 A;  3FUZ A;  5ICT A;  1A54 A;  2A5T B;  1NMU A;  4MH5 A;  1EZ9 A;  3K00 A;  4HCY A;  3BBR A;  1II5 A;  5CMM A;  3QUJ A;  4YAH X;  5B7D A;  4OER A;  5FTH A;  4KPT A;  3EN3 A;  3KN3 A;  3K1M A;  1NNK A;  4OFO A;  1ZTY A;  4NF5 B;  1FTM A;  1UIU A;  5FHM A;  3TOD A;  3QK6 A;  3TUS A;  2XD2 A;  5KCJ A;  4QFL A;  4F2Q A;  1MXZ A;  1GGG A;  5FHO A;  4IO6 A;  3FXU A;  4MBP A;  1ZKB A;  4R73 A;  2Z8F A;  5EHS A;  3ZSF A;  3HV1 A;  1H76 A;  4EF1 A;  1N04 A;  3GBA A;  2ZYK A;  1GTK A;  1NL5 A;  1M5D A;  4YB5 A;  4ZED A;  2HQ0 A;  3TMG A;  1YCJ A;  4OWD A;  1ZLQ A;  1N7W A;  3OMB A;  2OK2 A;  5H8F B;  1SW5 A;  3TAJ A;  5AA4 A;  2RCB A;  1DOT A;  1ZBM A;  2CMO A;  1B4H A;  1I6B A;  5L9M A;  3C33 A;  4LZ7 A;  1FQC A;  4ELP A;  1XVY A;  3TCH A;  1SW4 A;  2QJE A;  4F29 A;  1TT1 A;  2G29 A;  1URD A;  2XX7 A;  4H5G A;  4NF6 A;  4FAT A;  2XXV A;  1SQY A;  4RYA A;  4ZEC A;  1B46 A;  1Z7N E;  2M8C A;  4U22 A;  1LBC A;  4R9F A;  4U23 A;  4NTL A;  2XXQ A;  1SW2 A;  2V93 A;  2GHA A;  3G3H A;  4GL8 A;  2CZL A;  2O7U A;  4KCD A;  1B5H A;  3T9X B;  1MM6 A;  3OEL A;  3HHG A;  3UGW A;  2E1S A;  3PPP A;  4YB7 A;  3LR1 A;  4N13 A;  5KCJ B;  3QIM A;  1B6H A;  3ZS6 A;  3KBR A;  5AE4 A;  1P1U A;  3IOT A;  4C0R A;  1N84 A;  1B7H A;  4OET A;  3SEY A;  3L6H A;  2AIX A;  2ONK E;  2H5Y A;  4O3A A;  2O84 X;  5HBC A;  3K6U A;  1IXG A;  3G3G A;  3UOR A;  4LQ5 A;  3EF7 A;  1DMB A;  3N5L A;  3HST A;  4UA8 A;  2DP8 A;  3V5A A;  1TFD A;  3RN8 A;  4ONY A;  3VLU A;  2OLB A;  2XHD A;  3WAE A;  3E9X A;  2GFE A;  3O9P A;  5L8D A;  4KD5 A;  2D5W A;  1B0H A;  4GOT A;  4OHN A;  1TWY A;  2FA7 A;  3OEK A;  2DXY A;  4K3F A;  2FYI A;  2IA4 A;  4OEV A;  1NH8 A;  2NWJ A;  4DXU A;  2DSF A;  4F31 B;  3HN0 A;  2Y7P A;  3MP1 A;  3MVY A;  1LFH A;  3K6W A;  3O6G A;  4F3S A;  4H67 A;  4XKP A;  4XKQ A;  3W9W A;  4HTG A;  4OTE A;  3W15 C;  3T9U A;  2R9J A;  2I4B A;  1P1Q A;  3FV2 A;  4GQO A;  5AA2 D;  1FQF A;  1R9Q A;  3MW0 A;  4ZEI A;  1IEJ A;  4DXB A;  1SBP A;  3S2V A;  5JTY A;  4F3G A;  2B3B A;  5ITO A;  3ZKL A;  2AL4 A;  4ESX A;  3RNN A;  1DTG A;  5TPA A;  3LBS A;  1A8F A;  2UVI A;  5DEX A;  1QUL A;  4QSE A;  4P11 A;  2Z8D A;  4YKI A;  4G4P A;  4PP0 A;  4ECF A;  1SVX B;  2P2A A;  3OD7 A;  4R72 A;  1I6Q A;  5I2K B;  3IOU A;  1B3G A;  3B7D A;  1A99 A;  1OLC A;  1MXX A;  1I6A A;  1OIB A;  3OOA A;  1EZP A;  4GVO A;  1JVX A;  4R9G A;  2XXU A;  1POY 1;  2ZNU A;  5IKB A;  5EHM A;  3CRB A;  4NWD A;  1B3H A;  1B3F A;  4MF3 A;  4H1X A;  1QUJ A;  4IY5 A;  4Q30 B;  3WAF A;  1MQI A;  3PPO A;  1PC3 A;  4OYV A;  1NH7 A;  2FNC A;  3K6V A;  3TTN A;  1QJM A;  1M5B A;  2GH9 A;  3K1N A;  1P1O A;  3C34 A;  4GFR A;  3FVG A;  2GHB A;  2REJ A;  2YPN A;  3W9V A;  4EF2 A;  2F7C A;  3OSR A;  2X7P A;  4I8C A;  4PFT A;  4RNS A;  4EQB A;  1IXH A;  1OVT A;  1UTB B;  5I57 B;  1MY0 A;  1MQH A;  5ICQ A;  2V3U A;  5CM6 A;  3VXC A;  4EUO A;  2Q2A A;  4LZ5 A;  1YAE A;  3VFJ A;  2BJJ X;  2V84 A;  4BDN A;  1IUD A;  2I4C A;  3ILU B;  3JV9 A;  4F3P A;  3B6Q A;  1B5I A;  3H7M A;  3LSW A;  1VFE A;  2VHA A;  5F1Q A;  4G2Z A;  4QFO A;  3SEW A;  1MXV A;  2B3F A;  4LVQ A;  3A3U A;  1N3X A;  2DXR A;  1B3L A;  3RQT A;  4WEP A;  4EQ7 A;  2UVJ A;  3SDF A;  5IAI A;  4O3C A;  3CIJ A;  1B51 A;  1MY3 A;  3TQW A;  5L9O A;  2DOJ A;  4BDM A;  1AL3 A;  3USD A;  3SKP A;  1EU8 A;  5CI5 A;  5H8H A;  4ZEB A;  2XXW A;  4RXL A;  1AIV A;  4ZS9 A;  3KSX A;  1PBP A;  2PYY A;  3TEP A;  3MAM A;  2VP1 A;  4JWO A;  2F7B A;  1YPN A;  3Q26 A;  1P1N A;  4TQU Q;  3AXF A;  3EHU A;  3C35 A;  3SEV A;  2XD3 A;  4R6H A;  4TLM B;  3O66 A;  2UVG A;  2I0C A;  5DYH A;  3IO4 A;  3R26 A;  3TEL A;  2DWA A;  1IIT A;  3IB2 A;  1A7L A;  3Q29 A;  3U92 A;  3IOW A;  1SYH A;  4KI0 E;  2RF1 A;  3CI8 A;  4RA1 A;  4ZEF A;  4AB6 A;  4XIG Q;  3CR9 A;  4Q8R A;  4XKN A;  1Y1Z A;  1UQW A;  2I49 A;  4IGR A;  2DS9 A;  3UN6 A;  2ZYO A;  3T66 A;  3FV1 A;  1CB6 A;  3FJ7 A;  2Y84 A;  1MRP A;  1URG A;  4IB2 A;  3G3J A;  3ONM A;  1T0K A;  4R74 A;  2DYX A;  3RTF B;  3L6G A;  1HSE A;  1MQJ A;  4NF8 A;  3HO7 A;  1B32 A;  1D9Y A;  4F39 A;  2O51 A;  4KCC A;  5HM4 B;  1HSJ A;  1FTO A;  3FAS A;  5I2N A;  1R1N A;  3KN7 A;  3K2D A;  2HZK A;  1KWH A;  1TFA A;  5H8H B;  4KYE A;  3MVW A;  5FTI A;  3KEI A;  1Y20 A;  3M3K A;  1GV8 A;  1WOD A;  4YZZ A;  4QSD A;  3BKI B;  2HXW A;  2XXX A;  3IAZ A;  2F6P A;  2THI A;  1JEV A;  3DP8 A;  1MQG A;  5ELV A;  1O7T A;  3PMW A;  1ZMG A;  1RYO A;  1PB9 A;  3I3V A;  4R2F A;  3UA8 A;  3IX1 A;  3FZV A;  3K6X A;  1SI1 A;  2PVU A;  4BLA A;  3EHT A;  3JZJ A;  1DSN A;  3PPR A;  1MPD A;  3TZA A;  3OXN A;  4DZ1 A;  2XXH A;  4JXI A;  4QRZ A;  1FCK A;  2I3W A;  3IK6 B;  3FJG A;  4GF8 A;  2NVU B;  3LC8 A;  2UYE A;  1MY1 A;  1B5J A;  1UIV A;  2NOO A;  2F34 A;  2HEU A;  3S9L C;  2XXR A;  1B2H A;  3HHF A;  4NMY A;  3VDF A;  3S9M C;  1XC1 A;  4G77 A;  2H99 A;  3N26 A;  1YTV A;  3U93 A;  5I2N B;  2ONS A;  3R7X A;  3TKD A;  4IGT A;  4FEB A;  4EXL A;  1D3K A;  3PMV A;  4RPN A;  5TP9 A;  3VVD A;  4AQ4 A;  4G68 A;  2NUV A;  3OO7 A;  2X7Q A;  3BFU A;  5I58 A;  4C1U A;  2DWJ A;  3PUX E;  1ZU0 A;  1B7Z A;  3KZG A;  4RJZ A;  5A5X A;  3MZB A;  4Q0C A;  4F3B A;  2ESN A;  4JDF A;  1FTL A;  1OVB A;  5ISU A;  1IXC A;  2ALU A;  4ZE8 A;  2YLN A;  4KQP A;  1O63 A;  3UK4 A;  2PMS A;  1CE2 A;  2OZZ A;  2ZXT A;  3MPK A;  1AOV A;  4EDP A;  1QVS A;  4BDR A;  1IIW A;  1PEB A;  3QYT A;  2OCU A;  5DVF A;  4IO5 A;  3RTW B;  2XXY A;  5AA4 B;  5ITP A;  1N7X A;  3VV5 A;  1JW5 A;  5KDT A;  1AMF A;  3VLW A;  2OWS A;  3M3F A;  4DCY A;  2ZYM A;  3RT8 A;  4IO4 A;  4NF6 B;  2F8D A;  4JWX A;  1FW0 A;  2RIN A;  1R6Z A;  4AB5 A;  2D3I A;  1J1N A;  4RY1 A;  4GLI A;  3DLN A;  3PMX A;  2R71 A;  3TCF A;  3TTK A;  2OJT A;  5M2V A;  2VGQ A;  1PB7 A;  5TP9 B;  1USY E;  4WXJ A;  2NXO A;  1Q1K A;  4ZZE A;  5AA1 A;  4Z0I A;  1MS7 A;  2QS3 A;  2XXI A;  4F1U A;  2O6A A;  4IO3 A;  3TTL A;  2ABH A;  2XX9 A;  3MQ9 A;  5I56 A;  5DT6 A;  1MG1 A;  5CMB A;  4FIM A;  1NKX A;  4GD5 A;  1N3W A;  1JW1 A;  3TTM A;  4EXK A;  4OVJ A;  1TXF A;  4MFI A;  5AA3 A;  3SEX A;  1VR5 A;  3P7I A;  4XKR A;  3JYR A;  4KHZ E;  3B6W A;  1RYX A;  4DCX A;  2ZMB A;  3MZ9 A;  3SET A;  3E13 X;  4THI A;  1B1X A;  3KN8 A;  1Y4T A;  3R6U A;  4H6D A;  1LAF E;  2F7A A;  4GRK A;  1H44 A;  1IXI A;  4EQ9 A;  3RY3 A;  5BUU A;  4R6K A;  4JWY A;  4ZZA A;  4YKP A;  4QFP A;  3S9E A;  3TDJ A;  5AA2 A;  4E0W A;  2I48 A;  3MJN A;  1NNF A;  4OEU A;  4DDD A;  1LCF A;  4BDQ A;  2F78 A;  5K2Y A;  4G8M A;  4YKJ A;  4YB6 A;  3OEM A;  2F36 A;  1Y3N A;  4FE8 A;  3RPW A;  2Y7R A;  3FAT A;  1SDX A;  3CVG A;  3QXM A;  3F11 A;  2WKY A;  2Z22 A;  5JTY B;  2ANJ A;  3IL1 B;  3C31 A;  4R75 A;  1Q35 A;  3OO9 A;  1RKM A;  1S7Y A;  2I6E A;  1MH4 A;  4U21 A;  5TPA B;  1S50 A;  5DEX B;  4POX A;  3FXR A;  1B0L A;  3N6U A;  1POT A;  3S4U A;  3K01 A;  1LAH E;  1HSL A;  1FTK A;  2H25 A;  3FIR A;  2O69 A;  4I9D A;  4HS7 A;  4FOR A;  4U4X A;  5CBR A;  1L5T A;  1NFT A;  1UTH A;  4F18 A;  3EQ1 A;  4H8I A;  1BKA A;  3H4Z A;  4N6P A; 
#chains in the Genus database with same CATH topology
 4LAT A;  2HAU A;  3DEL B;  4MMP A;  3FVO A;  3SES A;  2XXK A;  1NUZ A;  2Y5K A;  1FJ6 A;  1WVJ A;  3O6H A;  3O6I A;  2O1M A;  1B4Z A;  3C4M A;  2RC7 A;  1MXY A;  3FVN A;  3OSQ A;  1H3D A;  2F5X A;  5TU0 A;  3VVF A;  4GL0 A;  4MNI A;  3SEU A;  3U8Q A;  1VSO A;  4PE5 B;  2WX9 A;  3VLV A;  3RPL A;  2ZNT A;  2A5S A;  3PUZ E;  4E0X A;  4XXU A;  2A5T A;  1VFD A;  3B6T A;  3D4C A;  3IOR A;  1BIY A;  1RDY A;  5ET6 A;  2VPO A;  4BDL A;  3G3F A;  1Y1M A;  2Z8E A;  3VVE A;  3KJT A;  3LSL A;  2Y5L A;  1MQD A;  3TPA A;  1USY H;  2Y7I A;  2IEE A;  3TQL A;  1FPI A;  4ZEK A;  3D4G A;  1JNF A;  1FPK A;  2Q89 A;  3N94 A;  1GR2 A;  2PT1 A;  3CG3 A;  3G3I A;  5BWJ A;  5K2X A;  4GXS B;  4DXC A;  1F9B A;  4ZDM A;  4F19 A;  3K4U A;  1QUI A;  1MXW A;  3A29 A;  2DVC A;  2R6G E;  1IQ7 A;  4PAK A;  4BDO A;  4DIG A;  5F7V A;  2ONR A;  1LBB A;  3CG1 A;  4H65 A;  3B8B A;  2R8T A;  4L17 A;  4O7I A;  2H9B A;  2QS1 A;  4FJP A;  1FQB A;  1R9L A;  3O28 A;  4KYS A;  1MDP 1;  3MVZ A;  2UVH A;  3H6U A;  2G93 A;  4QF9 A;  1NNT A;  3CFX A;  3E3K A;  1EH3 A;  3LSF B;  1KZ8 A;  2F6G A;  4F1Y A;  2Y7K A;  3H6V A;  2DWI A;  1QUK A;  3A3C A;  3OO8 A;  4P0I A;  4IO7 A;  4GWS A;  4P1E A;  4WED A;  1PB8 A;  4OEN A;  5DVI A;  1MPB A;  3G7W A;  4RK2 A;  1SW1 A;  3TFL A;  4IY6 A;  3H06 B;  4X1D A;  1QW0 A;  4NF0 A;  1NUX A;  4U4S A;  3PGF A;  3E4R A;  4POW A;  4MIJ A;  4PFY A;  1LEV A;  3TTR A;  3U94 A;  3MUQ A;  3PPQ A;  1Y3Q A;  4Z7E A;  2ZZW A;  2ZNS A;  3ROJ A;  2RKM A;  1PDA A;  4X48 A;  5FHN A;  3FVK A;  4MNC A;  1B1H A;  1S9T A;  4ESW A;  1ELJ A;  2D21 A;  3OEN A;  3T22 A;  3C36 A;  3MWB A;  2PT2 A;  1O64 A;  3UP9 A;  1EZO A;  4LON B;  4KFQ A;  2Q8J A;  3BIG A;  5I59 A;  4HW8 A;  5EYH A;  2QMX A;  4QHQ A;  3MVX A;  3LSX A;  4P8B A;  3V83 A;  3MZ1 A;  4JB7 A;  1DPP A;  1NUW A;  1FJ9 A;  3DP4 A;  4YIC A;  2VOZ A;  4LA9 A;  5JEI A;  5J1D A;  2QS4 A;  2XX8 A;  3IO6 A;  4DLD A;  1D9V A;  1Y4C A;  3RUM A;  5CBS A;  4I40 A;  4PDD A;  1LAX A;  3PPN A;  3FXB A;  4ISU A;  5L9S A;  2QS2 A;  3KGC A;  4JSD A;  1BLF A;  2DQV A;  1LST A;  2DE3 A;  2I58 A;  1B9J A;  4PF6 A;  4NF8 B;  3PU5 A;  1QKB A;  3KFM A;  2KQZ A;  4LUB A;  4M4G A;  5IM2 A;  1JEU A;  4U2R A;  3N6T A;  3FBP A;  4OA4 A;  3MYU A;  4LP2 B;  3RT6 B;  1FQD A;  4LZ8 A;  1M5F A;  1P1W A;  1MY2 A;  4IO2 A;  1WDN A;  2V3T A;  3U72 A;  1NV3 A;  4PGP A;  1FBP A;  2HAV A;  3UIF A;  3SER A;  2QMW A;  2HPG A;  4NX1 A;  3LUZ A;  1US5 A;  4F2O A;  1GVC A;  4N07 A;  1OQH A;  2F97 A;  1LB9 A;  1FQE A;  1H45 A;  2F3B A;  2QVR A;  4OXV A;  3O2A A;  1ANF A;  1OMP A;  2H4I A;  4G8H A;  3T9H B;  3KOS A;  5H8N A;  4R2B A;  4U1Z A;  5I59 B;  1XOC A;  2HZL A;  1LBV A;  3ODB A;  4PGN A;  3THI A;  4NED A;  2XXT A;  3T96 B;  3FGS A;  2KLF A;  2OBG A;  1SI0 A;  4JSO A;  2B4L A;  5I2K A;  3H6T A;  3IJX B;  1OLA A;  4GWO A;  3QUF A;  3GBB A;  4GIZ A;  2Z23 A;  3QMF A;  4O8M A;  3RGY A;  3Q28 A;  1DTZ A;  1BP5 A;  1G0I A;  4NF4 A;  4P9K A;  4RK9 A;  3IB0 A;  1IZ1 A;  3I5O A;  3PD8 A;  2QPQ A;  2PX1 A;  4PFW A;  3HPI A;  1B05 A;  1FSA A;  3IFA A;  1URS A;  1JET A;  3K1P A;  4ELO A;  3KOT A;  2Q2C A;  3GLB A;  2REG A;  2OWZ A;  2O7I A;  1LCT A;  3D1R A;  3V89 B;  3TYH A;  4UAC A;  2GRV A;  4WKM A;  1K9Z A;  3PUV E;  1LFG A;  1JVY A;  4YU0 A;  4X1B A;  2O68 A;  4G8N A;  3VE1 B;  1FTJ A;  4G68 B;  4KXP A;  2B65 A;  5I58 B;  3LV0 A;  3O97 A;  2Y7W A;  4GWZ A;  1N0T A;  5H8Q A;  4DI3 D;  2HFB A;  4XTC Q;  5A5X B;  3QSL A;  3FD3 A;  4FED A;  2V25 A;  3FJM A;  3H3G A;  3FXQ A;  1UTB A;  3KSJ A;  5I57 A;  4C1T A;  1LBZ A;  4H8J A;  3BFT A;  2RCA A;  2HCA A;  5H8N B;  1RDX A;  2VD3 A;  3CSG A;  2V3Q A;  3IR1 A;  4ELQ A;  2H98 A;  2DE4 A;  4F1V A;  1PBQ A;  3DP6 A;  3ILT B;  1LAG E;  1NUY A;  4GBV A;  1FQA A;  3MBP A;  1KA1 A;  1DPE A;  1SD3 A;  4OAN A;  2QRY A;  1SYI A;  2WBB A;  4FEC A;  1AH5 A;  3KG2 A;  3GYY A;  3HCQ A;  3OO6 A;  5CRY A;  2XXP A;  3IJO B;  3K0V A;  3U1O A;  4NF4 B;  4F22 A;  2DVZ A;  2RC9 A;  2QSX A;  2I3V A;  3Q25 A;  5KDT B;  1P99 A;  2OWT A;  4QSC A;  4MJO A;  3ZKK A;  4P0G A;  1Y3P A;  4PQJ A;  2CZI A;  5CMK A;  5JK4 A;  1ATG A;  3M3L A;  4H0W A;  4TOZ A;  4PFI A;  1I69 A;  1B3E A;  1XS5 A;  4H5F A;  4R6Y A;  3PUW E;  2VD2 A;  1Q9D A;  1LFI A;  4I1D A;  3PV0 E;  1US4 A;  3EHS A;  5KZT A;  3ECR A;  2E0S A;  4OMB A;  1Z7M E;  1D4N A;  3MC2 A;  2HXR A;  2PFY A;  4ZE9 A;  3TCG A;  5B70 A;  1M5C A;  5IZ1 A;  1LBX A;  3CSB A;  4NG7 A;  4Q5T A;  1ZJL A;  1MDQ A;  4HXV A;  5H8Q B;  2YJP A;  1A40 A;  2O1L A;  1NV6 A;  3V8X B;  4I62 A;  4HCW A;  4U1O A;  4TLL B;  3GZG A;  3MPL A;  4QFN A;  2W7Y A;  4G68 C;  4PFU A;  3K02 A;  3DM0 A;  3MP6 A;  5I56 B;  1QKA A;  2DE2 A;  3G3K A;  1N76 A;  3T93 B;  4PCD A;  2F35 A;  5IZZ A;  4OQO A;  4YKK A;  4OFJ A;  2QVU A;  4MLQ A;  4KR5 A;  1YXI A;  3KJ7 A;  4MLV A;  4YMA A;  3T9V A;  4PBH A;  1EYK A;  4JBZ A;  2AYS A;  4NWC A;  4ND9 A;  3CFZ A;  4MX6 A;  4QFK A;  1VDW A;  1H43 A;  3H6W A;  5I84 A;  1JQF A;  2P0S A;  2Q9T A;  1A8E A;  1B40 A;  4N81 A;  4LQ2 A;  1MH3 A;  3IB1 A;  5AA2 B;  4H46 A;  1VE4 A;  1MM7 A;  4X9T A;  2RC8 A;  1FTA A;  3RLF E;  1LLS A;  3Q27 A;  2Q88 A;  5HPQ A;  5J16 A;  1JW4 A;  3QAX A;  3MP8 A;  1M5E A;  4NF5 A;  4LN5 A;  1Y9U A;  2ZYN A;  4RPO A;  4FAJ A;  1B52 A;  4PET A;  3C32 A;  1ZIU A;  2PBW A;  1BTJ A;  3VXB A;  3A09 A;  4NE4 A;  2I0B A;  3PD9 A;  1LGB C;  1OQG A;  4KYD A;  3O29 A;  3GXA A;  2F3D A;  5ESY A;  2XWI A;  1XHY A;  1LB8 A;  1MY4 A;  2CEY A;  4GX4 A;  1DCU A;  5EYF A;  3HFU A;  1MPC A;  3H03 A;  4OFL A;  3IOV A;  3S9N C;  2X26 A;  3PTY A;  4N4U A;  1NNP A;  3I6V A;  3LUY A;  3EKI A;  3EPE A;  3B50 A;  3CFL A;  1UTH B;  2KR0 A;  2UXA A;  4OES A;  5LTC A;  4ELR A;  1IMD A;  1D9Q A;  2UYF A;  2AL5 A;  2DWH A;  5CMC A;  3C9H A;  5H8F A;  1A55 A;  4OZ9 A;  5DVJ A;  4M1V A;  5DTB A;  4NAP A;  5CC2 A;  4O3B A;  4GX3 A;  1XT8 A;  1B58 A;  1MXU A;  5H8S A;  1B7U A;  5LOM A;  2QL3 A;  1XVX A;  1FRP A;  3M8U A;  4GXA A;  2LAO A;  3RPL B;  2P1S A;  4YMB A;  1RDZ A;  3PUY E;  4DE8 A;  3FUZ A;  5ICT A;  1A54 A;  2A5T B;  1NMU A;  4MH5 A;  1EZ9 A;  3K00 A;  4HCY A;  3BBR A;  1II5 A;  5CMM A;  3QUJ A;  4YAH X;  5B7D A;  4OER A;  1FPD A;  5FTH A;  1NV0 A;  4KPT A;  3EN3 A;  2FIX A;  3KN3 A;  3K1M A;  1NNK A;  4OFO A;  1ZTY A;  4NF5 B;  1FTM A;  1UIU A;  4GWW A;  5FHM A;  3TOD A;  3QK6 A;  3TUS A;  2ZZV A;  1YZ0 A;  2XD2 A;  3U65 A;  5KCJ A;  4QFL A;  5F24 A;  4F2Q A;  1MXZ A;  1GGG A;  5FHO A;  4IO6 A;  3FXU A;  4PBQ A;  4MBP A;  1ZKB A;  1NV1 A;  4R73 A;  2Z8F A;  2CZH A;  3CHG A;  4UAB A;  5EQ7 A;  5EHS A;  3ZSF A;  3HV1 A;  1H76 A;  1LBW A;  4EF1 A;  4G61 A;  1N04 A;  3GBA A;  2ZYK A;  1GTK A;  4OVS A;  1NL5 A;  1M5D A;  4YB5 A;  4JVI A;  4ZED A;  2HQ0 A;  3TMG A;  1NV4 A;  1YCJ A;  4PTK A;  4OWD A;  1ZLQ A;  1N7W A;  3OMB A;  2OK2 A;  5H8F B;  1SW5 A;  3TAJ A;  5AA4 A;  2RCB A;  1DOT A;  1ZBM A;  2CMO A;  1B4H A;  1I6B A;  5L9M A;  4MEV A;  3C33 A;  4LZ7 A;  1FQC A;  4ELP A;  1XVY A;  3TCH A;  1SW4 A;  2QJE A;  4F29 A;  1TT1 A;  2G29 A;  1URD A;  2XX7 A;  4H5G A;  4NF6 A;  4FAT A;  2XXV A;  1SQY A;  4RYA A;  4MCO A;  4ZEC A;  1B46 A;  1Z7N E;  2M8C A;  4N17 A;  4U22 A;  1LBC A;  4R9F A;  4U23 A;  4NTL A;  2XXQ A;  1SW2 A;  2V93 A;  2GHA A;  3G3H A;  4GL8 A;  1AWB A;  2CZL A;  2O7U A;  4KCD A;  1B5H A;  3T9X B;  1MM6 A;  3OEL A;  3T0J A;  3HHG A;  3UGW A;  4PC9 A;  2E1S A;  3PPP A;  4YB7 A;  3LR1 A;  4N13 A;  5KCJ B;  3QIM A;  1B6H A;  3ZS6 A;  3KBR A;  5AE4 A;  1P1U A;  2XWV A;  3IOT A;  4C0R A;  1N84 A;  1B7H A;  4OET A;  3SEY A;  3L6H A;  2AIX A;  2ONK E;  2H5Y A;  4O3A A;  2O84 X;  5HBC A;  3NOH A;  3K6U A;  1IXG A;  3G3G A;  3UOR A;  4LQ5 A;  3EF7 A;  1BK4 A;  1DMB A;  3N5L A;  3HST A;  4UA8 A;  2DP8 A;  3V5A A;  1TFD A;  3RN8 A;  4ONY A;  3VLU A;  2OLB A;  3E79 A;  2XHD A;  3WAE A;  3E9X A;  2GFE A;  3O9P A;  4IR8 A;  5L8D A;  4KD5 A;  3KC0 A;  2D5W A;  1FBH A;  1B0H A;  4GOT A;  4OHN A;  2XWO A;  1TWY A;  2FA7 A;  3OEK A;  2DXY A;  4K3F A;  2FYI A;  4P56 A;  4GX6 A;  2IA4 A;  4OEV A;  1NH8 A;  2NWJ A;  4DXU A;  2DSF A;  4F31 B;  3HN0 A;  2Y7P A;  3MP1 A;  2P3N A;  3MVY A;  1LFH A;  3K6W A;  3O6G A;  4F3S A;  4H67 A;  1FPG A;  5I3S A;  4XKP A;  3KC1 A;  4GBW A;  4XKQ A;  3W9W A;  4HTG A;  4OTE A;  2GQ1 A;  3W15 C;  3T9U A;  2R9J A;  2I4B A;  5A5L A;  1P1Q A;  3FV2 A;  4GQO A;  4O94 A;  5AA2 D;  1FBD A;  1FPJ A;  2WYP A;  2WEF A;  4PAF A;  1FQF A;  1R9Q A;  3MW0 A;  4ZEI A;  1IEJ A;  4DXB A;  1SBP A;  3S2V A;  5JTY A;  4F3G A;  3BIH A;  2B3B A;  5ITO A;  3ZKL A;  2AL4 A;  4ESX A;  5FBP A;  4NHB A;  3RNN A;  1DTG A;  5TPA A;  3LBS A;  4X04 A;  1A8F A;  2UVI A;  5DEX A;  1QUL A;  4QSE A;  4P11 A;  2Z8D A;  1IMC A;  4YKI A;  4G4P A;  4PP0 A;  4ECF A;  1SVX B;  2P2A A;  3OD7 A;  4R72 A;  1I6Q A;  5I2K B;  3IOU A;  1B3G A;  3B7D A;  1A99 A;  1OLC A;  1FPE A;  1MXX A;  1I6A A;  5ET5 A;  1OIB A;  3OOA A;  1EZP A;  4GVO A;  1G0H A;  2MKZ A;  1JVX A;  4R9G A;  2XXU A;  1POY 1;  4QBA A;  1EYJ A;  2ZNU A;  5IKB A;  5EHM A;  3CRB A;  4N15 A;  4NWD A;  1B3H A;  5EYG A;  1B3F A;  2B4M A;  4MF3 A;  4H1X A;  1QUJ A;  4IY5 A;  2QVV A;  4PF8 A;  4Q30 B;  4MNP A;  3WAF A;  2VPN A;  1MQI A;  3PPO A;  1PC3 A;  4OYV A;  1NH7 A;  2FNC A;  3K6V A;  4P3L A;  3TTN A;  1QJM A;  1M5B A;  2GH9 A;  3K1N A;  1P1O A;  3C34 A;  4GFR A;  3FVG A;  2GHB A;  2REJ A;  2YPN A;  3W9V A;  4EF2 A;  2F7C A;  1NV5 A;  3OSR A;  2VT5 A;  2X7P A;  1LBY A;  4I8C A;  4PFT A;  4RNS A;  4EQB A;  1IXH A;  1OVT A;  1UTB B;  5I57 B;  5IZ3 A;  1MY0 A;  1MQH A;  5ICQ A;  4FBP A;  2V3U A;  1DBZ A;  5CM6 A;  3VXC A;  4EUO A;  2Q2A A;  4LZ5 A;  1YAE A;  3VFJ A;  2BJJ X;  2V84 A;  4BDN A;  4PDH A;  1IUD A;  2I4C A;  2OX3 A;  3ILU B;  1QGX A;  3JV9 A;  4F3P A;  3IFC A;  3B6Q A;  1B5I A;  3H7M A;  3LSW A;  1VFE A;  2VHA A;  5F1Q A;  4I3E A;  1NI9 A;  4G2Z A;  4QFO A;  3SEW A;  1MXV A;  3T1B A;  2B3F A;  4LVQ A;  1CNQ A;  3A3U A;  1N3X A;  2DXR A;  1B3L A;  4HE1 A;  4WEP A;  3RQT A;  4EQ7 A;  5ET8 A;  1EYI A;  4AS4 A;  2UVJ A;  3SDF A;  5IAI A;  4O3C A;  3CIJ A;  1B51 A;  1MY3 A;  3TQW A;  5L9O A;  2DOJ A;  4BDM A;  1AL3 A;  3USD A;  3SKP A;  1EU8 A;  5CI5 A;  5H8H A;  4ZEB A;  2XXW A;  4RXL A;  1AIV A;  4ZS9 A;  3KSX A;  1PBP A;  2Q8M A;  2PYY A;  3TEP A;  3MAM A;  2VP1 A;  4JWO A;  2F7B A;  4NGU A;  5EQ9 A;  1YPN A;  3Q26 A;  4I3Y A;  1P1N A;  4NN3 A;  4TQU Q;  3AXF A;  3EHU A;  4DI4 B;  3C35 A;  3SEV A;  2XD3 A;  4R6H A;  4TLM B;  3O66 A;  2UVG A;  2I0C A;  5DYH A;  3IO4 A;  3R26 A;  3TEL A;  2DWA A;  1IIT A;  3IB2 A;  1A7L A;  5IZ3 B;  3Q29 A;  3U92 A;  3IOW A;  1SYH A;  4KI0 E;  2RF1 A;  1FBC A;  3CI8 A;  4RA1 A;  4ZEF A;  4AB6 A;  4XIG Q;  3CR9 A;  4Q8R A;  5EQA A;  4XKN A;  1Y1Z A;  1UQW A;  2I49 A;  4IGR A;  4PE3 A;  2DS9 A;  3UN6 A;  2ZYO A;  3T66 A;  3FV1 A;  1CB6 A;  3FJ7 A;  2Y84 A;  1MRP A;  1URG A;  4IB2 A;  3G3J A;  4XEQ A;  1IMA A;  3ONM A;  1T0K A;  4R74 A;  2DYX A;  3RTF B;  1FBE A;  3L6G A;  1HSE A;  1MQJ A;  4NF8 A;  3HO7 A;  1B32 A;  1D9Y A;  4F39 A;  2O51 A;  4KCC A;  4NQ8 A;  5HM4 B;  1HSJ A;  1FTO A;  3FAS A;  5I2N A;  1R1N A;  3KN7 A;  3K2D A;  2HZK A;  1FPF A;  1KWH A;  1TFA A;  5H8H B;  4KYE A;  3E78 A;  3MVW A;  4MAG A;  4N8Y A;  5FTI A;  3KEI A;  1Y20 A;  1IME A;  3M3K A;  1GV8 A;  1WOD A;  4GWX A;  4YZZ A;  4X8R A;  4QSD A;  3BKI B;  2HXW A;  2XXX A;  3IAZ A;  4HE0 A;  2F6P A;  2THI A;  4OVR A;  1JEV A;  4JVD A;  3DP8 A;  1MQG A;  5ELV A;  1O7T A;  3PMW A;  1RYO A;  1ZMG A;  5DW8 A;  2QFL A;  1PB9 A;  3I3V A;  4R2F A;  4JVC A;  3UA8 A;  3IX1 A;  3FZV A;  3K6X A;  1SI1 A;  4XF5 A;  2PVU A;  4BLA A;  3EHT A;  3JZJ A;  1DSN A;  3PPR A;  4N8G A;  1MPD A;  3TZA A;  3OXN A;  4DZ1 A;  4P1L A;  2XXH A;  4JXI A;  4QRZ A;  1FCK A;  2I3W A;  3IK6 B;  3FJG A;  4GF8 A;  2NVU B;  3LC8 A;  2UYE A;  1MY1 A;  2ZZX A;  1B5J A;  1UIV A;  2NOO A;  2F34 A;  5IGA A;  2HEU A;  2L5V A;  3S9L C;  2XXR A;  1B2H A;  3HHF A;  4NMY A;  2FBP A;  3VDF A;  4GWY A;  3S9M C;  1XC1 A;  4G77 A;  2H99 A;  3N26 A;  1YTV A;  3U93 A;  5I2N B;  2Q74 A;  2P3V A;  2ONS A;  3R7X A;  1NV2 A;  3TKD A;  5LDZ A;  4IGT A;  4FEB A;  4EXL A;  1D3K A;  3PMV A;  4RPN A;  5TP9 A;  3VVD A;  4AQ4 A;  4G68 A;  2NUV A;  3OO7 A;  2X7Q A;  3BFU A;  5I58 A;  4C1U A;  1KA0 A;  4N6K A;  2DWJ A;  3PUX E;  4O7M A;  1ZU0 A;  5T3J A;  1B7Z A;  3KZG A;  4RJZ A;  5A5X A;  3MZB A;  4Q0C A;  4F3B A;  2ESN A;  4JDF A;  1FBG A;  1FTL A;  1OVB A;  4AS5 A;  5ISU A;  1IXC A;  2ALU A;  4ZE8 A;  2FHY A;  2YLN A;  2DDK A;  4KQP A;  1O63 A;  3UK4 A;  4N6D A;  2PMS A;  1CE2 A;  2OZZ A;  2ZXT A;  3MPK A;  1AOV A;  1FPL A;  4EDP A;  1QVS A;  4BDR A;  1IIW A;  1PEB A;  3QYT A;  5EQ8 A;  2OCU A;  3MST A;  5DVF A;  4IO5 A;  3RTW B;  2XXY A;  5AA4 B;  2CZK A;  1IMB A;  5ITP A;  2V4C A;  5I5P A;  1N7X A;  3VV5 A;  1JW5 A;  5KDT A;  1AMF A;  3VLW A;  2OWS A;  3M3F A;  4DCY A;  4OVT A;  2ZYM A;  3RT8 A;  1IMF A;  4IO4 A;  4NF6 B;  2F8D A;  4JWX A;  1FW0 A;  2RIN A;  1R6Z A;  4AB5 A;  4RY1 A;  2D3I A;  1J1N A;  1NV7 A;  4GLI A;  3DLN A;  3PMX A;  2R71 A;  3TCF A;  3TTK A;  2OJT A;  5M2V A;  2VGQ A;  1PB7 A;  2XWK A;  5TP9 B;  1USY E;  4WXJ A;  2NXO A;  1Q1K A;  4ZZE A;  1FPB A;  3ISP A;  5AA1 A;  4Z0I A;  1MS7 A;  2QS3 A;  2XXI A;  1XI6 A;  4F1U A;  2O6A A;  4IO3 A;  3TTL A;  2FVZ A;  2CEX A;  2ABH A;  2XX9 A;  3MQ9 A;  5I56 A;  4OVP A;  4GWU A;  5DT6 A;  1MG1 A;  5CMB A;  4FIM A;  1NKX A;  4GD5 A;  3RYD A;  1N3W A;  1JW1 A;  3TTM A;  4EXK A;  4OVJ A;  3KBZ A;  1TXF A;  3SZP A;  4MFI A;  5AA3 A;  3SEX A;  1VR5 A;  3P7I A;  4XKR A;  3JYR A;  4KHZ E;  3B6W A;  1RYX A;  4DCX A;  2ZMB A;  3MZ9 A;  3SET A;  3E13 X;  4THI A;  1B1X A;  3KN8 A;  1Y4T A;  3R6U A;  1K9Y A;  4OVQ A;  4H6D A;  1LAF E;  2F7A A;  1SPI A;  4PFR A;  4GRK A;  1H44 A;  1IXI A;  4P47 A;  4EQ9 A;  3RY3 A;  5BUU A;  2XA5 A;  4R6K A;  4QXD A;  4JWY A;  4ZZA A;  2PFZ A;  4YKP A;  4QFP A;  3S9E A;  3TDJ A;  5AA2 A;  4E0W A;  2I48 A;  3MJN A;  1NNF A;  4OEU A;  4DDD A;  1LCF A;  2WYK A;  4BDQ A;  2F78 A;  5K2Y A;  4G8M A;  4YKJ A;  4YB6 A;  2FIE A;  4PAI A;  4PFB A;  1JP4 A;  3OEM A;  2F36 A;  1Y3N A;  4FE8 A;  3RPW A;  2Y7R A;  2PCR A;  3FAT A;  1SDX A;  3CVG A;  1YYZ A;  1FBF A;  3QXM A;  3F11 A;  2WKY A;  2Z22 A;  1DK4 A;  5JTY B;  5I7I A;  4MHF A;  2ANJ A;  3IL1 B;  3C31 A;  4R75 A;  1Q35 A;  3OO9 A;  1RKM A;  2HHM A;  1S7Y A;  2I6E A;  1MH4 A;  4HE2 A;  4U21 A;  5TPA B;  5ET7 A;  1S50 A;  5DEX B;  2JJK A;  4POX A;  4N91 A;  3FXR A;  1B0L A;  3N6U A;  1POT A;  3S4U A;  3K01 A;  1LAH E;  1HSL A;  1FTK A;  2H25 A;  3FIR A;  2O69 A;  4H45 A;  4XFE A;  4I9D A;  2BJI A;  4HS7 A;  4FOR A;  4U4X A;  5CBR A;  1L5T A;  1NFT A;  1UTH A;  4F18 A;  2WBD A;  3EQ1 A;  1INP A;  4H8I A;  1BKA A;  3H4Z A;  4N6P A; 
#chains in the Genus database with same CATH homology
 4LAT A;  2HAU A;  3DEL B;  3FVO A;  3SES A;  1WVJ A;  3O6H A;  3O6I A;  2O1M A;  1B4Z A;  3C4M A;  2RC7 A;  1MXY A;  3FVN A;  3OSQ A;  1H3D A;  2F5X A;  5TU0 A;  3VVF A;  4GL0 A;  3SEU A;  3U8Q A;  1VSO A;  4PE5 B;  3VLV A;  2ZNT A;  2A5S A;  3PUZ E;  4E0X A;  4XXU A;  2A5T A;  1VFD A;  3B6T A;  3D4C A;  3IOR A;  1BIY A;  4BDL A;  3G3F A;  1Y1M A;  2Z8E A;  3VVE A;  3KJT A;  3LSL A;  1MQD A;  3TPA A;  1USY H;  2Y7I A;  2IEE A;  3TQL A;  4ZEK A;  3D4G A;  1JNF A;  2Q89 A;  3N94 A;  1GR2 A;  2PT1 A;  3CG3 A;  3G3I A;  5BWJ A;  5K2X A;  4GXS B;  4DXC A;  1F9B A;  4ZDM A;  4F19 A;  3K4U A;  1QUI A;  1MXW A;  2DVC A;  2R6G E;  1IQ7 A;  4BDO A;  4DIG A;  5F7V A;  2ONR A;  1LBB A;  3CG1 A;  4H65 A;  4L17 A;  2H9B A;  2QS1 A;  4FJP A;  1FQB A;  1R9L A;  3O28 A;  4KYS A;  1MDP 1;  3MVZ A;  2UVH A;  3H6U A;  2G93 A;  4QF9 A;  1NNT A;  3CFX A;  3E3K A;  1EH3 A;  3LSF B;  2F6G A;  4F1Y A;  2Y7K A;  3H6V A;  2DWI A;  1QUK A;  3A3C A;  3OO8 A;  4P0I A;  4IO7 A;  4WED A;  1PB8 A;  4OEN A;  5DVI A;  1MPB A;  3G7W A;  4RK2 A;  1SW1 A;  3TFL A;  4IY6 A;  3H06 B;  4X1D A;  1QW0 A;  4U4S A;  3PGF A;  3E4R A;  4POW A;  4PFY A;  3TTR A;  3U94 A;  3MUQ A;  3PPQ A;  1Y3Q A;  4Z7E A;  2ZNS A;  2RKM A;  1PDA A;  4X48 A;  5FHN A;  3FVK A;  1B1H A;  1S9T A;  4ESW A;  1ELJ A;  2D21 A;  3OEN A;  3T22 A;  3C36 A;  3MWB A;  2PT2 A;  1O64 A;  3UP9 A;  1EZO A;  4LON B;  4KFQ A;  2Q8J A;  5I59 A;  4HW8 A;  2QMX A;  4QHQ A;  3MVX A;  3LSX A;  3V83 A;  3MZ1 A;  4JB7 A;  1DPP A;  3DP4 A;  4YIC A;  2VOZ A;  4LA9 A;  5JEI A;  5J1D A;  2QS4 A;  2XX8 A;  3IO6 A;  4DLD A;  1D9V A;  1Y4C A;  3RUM A;  5CBS A;  1LAX A;  3PPN A;  4ISU A;  5L9S A;  2QS2 A;  3KGC A;  4JSD A;  1BLF A;  2DQV A;  1LST A;  2DE3 A;  2I58 A;  1B9J A;  4NF8 B;  3PU5 A;  1QKB A;  3KFM A;  4LUB A;  4M4G A;  1JEU A;  4U2R A;  3N6T A;  4LP2 B;  3RT6 B;  1FQD A;  4LZ8 A;  1M5F A;  1P1W A;  1MY2 A;  4IO2 A;  1WDN A;  2V3T A;  3U72 A;  2HAV A;  3UIF A;  3SER A;  2QMW A;  1US5 A;  4F2O A;  1GVC A;  4N07 A;  1OQH A;  2F97 A;  1LB9 A;  1FQE A;  1H45 A;  4OXV A;  3O2A A;  1ANF A;  1OMP A;  2H4I A;  4G8H A;  3T9H B;  3KOS A;  5H8N A;  4R2B A;  4U1Z A;  5I59 B;  1XOC A;  2HZL A;  3ODB A;  3THI A;  4NED A;  2XXT A;  3T96 B;  3FGS A;  2KLF A;  2OBG A;  1SI0 A;  4JSO A;  5I2K A;  3H6T A;  3IJX B;  1OLA A;  4GWO A;  3QUF A;  3GBB A;  4GIZ A;  2Z23 A;  3RGY A;  3Q28 A;  1DTZ A;  1BP5 A;  4NF4 A;  4RK9 A;  3IB0 A;  1IZ1 A;  3I5O A;  3PD8 A;  2QPQ A;  2PX1 A;  4PFW A;  3HPI A;  1B05 A;  1URS A;  1JET A;  3K1P A;  4ELO A;  3KOT A;  2Q2C A;  3GLB A;  2REG A;  2O7I A;  1LCT A;  3V89 B;  3TYH A;  4UAC A;  2GRV A;  4WKM A;  3PUV E;  1LFG A;  1JVY A;  4YU0 A;  4X1B A;  2O68 A;  4G8N A;  3VE1 B;  1FTJ A;  4G68 B;  5I58 B;  2B65 A;  3O97 A;  2Y7W A;  1N0T A;  5H8Q A;  2HFB A;  4XTC Q;  5A5X B;  3QSL A;  3FD3 A;  4FED A;  2V25 A;  3FJM A;  3H3G A;  3FXQ A;  1UTB A;  3KSJ A;  5I57 A;  4C1T A;  4H8J A;  3BFT A;  2RCA A;  2HCA A;  5H8N B;  2VD3 A;  3CSG A;  2V3Q A;  3IR1 A;  4ELQ A;  2H98 A;  2DE4 A;  4F1V A;  1PBQ A;  3DP6 A;  3ILT B;  1LAG E;  1FQA A;  3MBP A;  1DPE A;  1SD3 A;  2QRY A;  1SYI A;  4FEC A;  1AH5 A;  3KG2 A;  3HCQ A;  3OO6 A;  5CRY A;  2XXP A;  3IJO B;  3K0V A;  3U1O A;  4NF4 B;  4F22 A;  2DVZ A;  2RC9 A;  2QSX A;  2I3V A;  3Q25 A;  5KDT B;  1P99 A;  2OWT A;  4QSC A;  3ZKK A;  4P0G A;  1Y3P A;  4PQJ A;  5CMK A;  5JK4 A;  1ATG A;  3M3L A;  4H0W A;  4TOZ A;  1I69 A;  1B3E A;  1XS5 A;  4H5F A;  4R6Y A;  3PUW E;  2VD2 A;  1LFI A;  4I1D A;  3PV0 E;  1US4 A;  3EHS A;  5KZT A;  3ECR A;  2E0S A;  4OMB A;  1Z7M E;  1D4N A;  3MC2 A;  4ZE9 A;  3TCG A;  5B70 A;  1M5C A;  3CSB A;  4Q5T A;  1ZJL A;  1MDQ A;  5H8Q B;  2YJP A;  1A40 A;  2O1L A;  3V8X B;  4I62 A;  4HCW A;  4U1O A;  4TLL B;  3GZG A;  3MPL A;  4QFN A;  2W7Y A;  4G68 C;  4PFU A;  3K02 A;  3DM0 A;  3MP6 A;  5I56 B;  1QKA A;  2DE2 A;  3G3K A;  1N76 A;  3T93 B;  2F35 A;  4OQO A;  4YKK A;  4OFJ A;  4MLQ A;  4KR5 A;  3KJ7 A;  4MLV A;  4YMA A;  3T9V A;  4JBZ A;  2AYS A;  4NWC A;  4ND9 A;  3CFZ A;  4QFK A;  1H43 A;  3H6W A;  5I84 A;  1JQF A;  2P0S A;  2Q9T A;  1A8E A;  1B40 A;  4LQ2 A;  1MH3 A;  3IB1 A;  5AA2 B;  1VE4 A;  1MM7 A;  4X9T A;  2RC8 A;  3RLF E;  1LLS A;  3Q27 A;  2Q88 A;  5HPQ A;  1JW4 A;  3QAX A;  3MP8 A;  1M5E A;  4NF5 A;  1Y9U A;  2ZYN A;  4RPO A;  4FAJ A;  1B52 A;  4PET A;  3C32 A;  1ZIU A;  2PBW A;  1BTJ A;  3VXB A;  3A09 A;  4NE4 A;  2I0B A;  3PD9 A;  1LGB C;  1OQG A;  4KYD A;  3O29 A;  3GXA A;  1XHY A;  1LB8 A;  1MY4 A;  5EYF A;  1MPC A;  3H03 A;  3IOV A;  4OFL A;  3S9N C;  2X26 A;  1NNP A;  3I6V A;  3LUY A;  3EPE A;  3CFL A;  1UTH B;  2UXA A;  4OES A;  4ELR A;  2UYF A;  2AL5 A;  2DWH A;  5CMC A;  3C9H A;  5H8F A;  1A55 A;  4OZ9 A;  5DVJ A;  4M1V A;  5DTB A;  5CC2 A;  4O3B A;  1XT8 A;  1B58 A;  1MXU A;  5H8S A;  1B7U A;  5LOM A;  2QL3 A;  1XVX A;  3M8U A;  4GXA A;  2LAO A;  2P1S A;  4YMB A;  3PUY E;  4DE8 A;  3FUZ A;  5ICT A;  1A54 A;  2A5T B;  1NMU A;  4MH5 A;  1EZ9 A;  3K00 A;  4HCY A;  3BBR A;  1II5 A;  5CMM A;  3QUJ A;  4YAH X;  5B7D A;  4OER A;  5FTH A;  4KPT A;  3EN3 A;  3KN3 A;  3K1M A;  1NNK A;  4OFO A;  1ZTY A;  4NF5 B;  1FTM A;  1UIU A;  5FHM A;  3TOD A;  3QK6 A;  3TUS A;  2XD2 A;  5KCJ A;  4QFL A;  4F2Q A;  1MXZ A;  1GGG A;  5FHO A;  4IO6 A;  3FXU A;  4MBP A;  1ZKB A;  4R73 A;  2Z8F A;  5EHS A;  3ZSF A;  3HV1 A;  1H76 A;  4EF1 A;  1N04 A;  3GBA A;  2ZYK A;  1GTK A;  1NL5 A;  1M5D A;  4YB5 A;  4ZED A;  2HQ0 A;  3TMG A;  1YCJ A;  4OWD A;  1ZLQ A;  1N7W A;  3OMB A;  2OK2 A;  5H8F B;  1SW5 A;  3TAJ A;  5AA4 A;  2RCB A;  1DOT A;  1ZBM A;  2CMO A;  1B4H A;  1I6B A;  5L9M A;  3C33 A;  4LZ7 A;  1FQC A;  4ELP A;  1XVY A;  3TCH A;  1SW4 A;  2QJE A;  4F29 A;  1TT1 A;  2G29 A;  1URD A;  2XX7 A;  4H5G A;  4NF6 A;  4FAT A;  2XXV A;  1SQY A;  4RYA A;  4ZEC A;  1B46 A;  1Z7N E;  2M8C A;  4U22 A;  1LBC A;  4R9F A;  4U23 A;  4NTL A;  2XXQ A;  1SW2 A;  2V93 A;  2GHA A;  3G3H A;  4GL8 A;  2CZL A;  2O7U A;  4KCD A;  1B5H A;  3T9X B;  1MM6 A;  3OEL A;  3HHG A;  3UGW A;  2E1S A;  3PPP A;  4YB7 A;  3LR1 A;  4N13 A;  5KCJ B;  3QIM A;  1B6H A;  3ZS6 A;  3KBR A;  5AE4 A;  1P1U A;  3IOT A;  4C0R A;  1N84 A;  1B7H A;  4OET A;  3SEY A;  3L6H A;  2AIX A;  2ONK E;  2H5Y A;  4O3A A;  2O84 X;  5HBC A;  3K6U A;  1IXG A;  3G3G A;  3UOR A;  4LQ5 A;  3EF7 A;  1DMB A;  3N5L A;  3HST A;  4UA8 A;  2DP8 A;  3V5A A;  1TFD A;  3RN8 A;  4ONY A;  3VLU A;  2OLB A;  2XHD A;  3WAE A;  3E9X A;  2GFE A;  3O9P A;  5L8D A;  4KD5 A;  2D5W A;  1B0H A;  4GOT A;  4OHN A;  1TWY A;  2FA7 A;  3OEK A;  2DXY A;  4K3F A;  2FYI A;  2IA4 A;  4OEV A;  1NH8 A;  2NWJ A;  4DXU A;  2DSF A;  4F31 B;  3HN0 A;  2Y7P A;  3MP1 A;  3MVY A;  1LFH A;  3K6W A;  3O6G A;  4F3S A;  4H67 A;  4XKP A;  4XKQ A;  3W9W A;  4HTG A;  4OTE A;  3W15 C;  3T9U A;  2R9J A;  2I4B A;  1P1Q A;  3FV2 A;  4GQO A;  5AA2 D;  1FQF A;  1R9Q A;  3MW0 A;  4ZEI A;  1IEJ A;  4DXB A;  1SBP A;  3S2V A;  5JTY A;  4F3G A;  2B3B A;  5ITO A;  3ZKL A;  2AL4 A;  4ESX A;  3RNN A;  1DTG A;  5TPA A;  3LBS A;  1A8F A;  2UVI A;  5DEX A;  1QUL A;  4QSE A;  4P11 A;  2Z8D A;  4YKI A;  4G4P A;  4PP0 A;  4ECF A;  1SVX B;  2P2A A;  3OD7 A;  4R72 A;  1I6Q A;  5I2K B;  3IOU A;  1B3G A;  3B7D A;  1A99 A;  1OLC A;  1MXX A;  1I6A A;  1OIB A;  3OOA A;  1EZP A;  4GVO A;  1JVX A;  4R9G A;  2XXU A;  1POY 1;  2ZNU A;  5IKB A;  5EHM A;  3CRB A;  4NWD A;  1B3H A;  1B3F A;  4MF3 A;  4H1X A;  1QUJ A;  4IY5 A;  4Q30 B;  3WAF A;  1MQI A;  3PPO A;  1PC3 A;  4OYV A;  1NH7 A;  2FNC A;  3K6V A;  3TTN A;  1QJM A;  1M5B A;  2GH9 A;  3K1N A;  1P1O A;  3C34 A;  4GFR A;  3FVG A;  2GHB A;  2REJ A;  2YPN A;  3W9V A;  4EF2 A;  2F7C A;  3OSR A;  2X7P A;  4I8C A;  4PFT A;  4RNS A;  4EQB A;  1IXH A;  1OVT A;  1UTB B;  5I57 B;  1MY0 A;  1MQH A;  5ICQ A;  2V3U A;  5CM6 A;  3VXC A;  4EUO A;  2Q2A A;  4LZ5 A;  1YAE A;  3VFJ A;  2BJJ X;  2V84 A;  4BDN A;  1IUD A;  2I4C A;  3ILU B;  3JV9 A;  4F3P A;  3B6Q A;  1B5I A;  3H7M A;  3LSW A;  1VFE A;  2VHA A;  5F1Q A;  4G2Z A;  4QFO A;  3SEW A;  1MXV A;  2B3F A;  4LVQ A;  3A3U A;  1N3X A;  2DXR A;  1B3L A;  3RQT A;  4WEP A;  4EQ7 A;  2UVJ A;  3SDF A;  5IAI A;  4O3C A;  3CIJ A;  1B51 A;  1MY3 A;  3TQW A;  5L9O A;  2DOJ A;  4BDM A;  1AL3 A;  3USD A;  3SKP A;  1EU8 A;  5CI5 A;  5H8H A;  4ZEB A;  2XXW A;  4RXL A;  1AIV A;  4ZS9 A;  3KSX A;  1PBP A;  2PYY A;  3TEP A;  3MAM A;  2VP1 A;  4JWO A;  2F7B A;  1YPN A;  3Q26 A;  1P1N A;  4TQU Q;  3AXF A;  3EHU A;  3C35 A;  3SEV A;  2XD3 A;  4R6H A;  4TLM B;  3O66 A;  2UVG A;  2I0C A;  5DYH A;  3IO4 A;  3R26 A;  3TEL A;  2DWA A;  1IIT A;  3IB2 A;  1A7L A;  3Q29 A;  3U92 A;  3IOW A;  1SYH A;  4KI0 E;  2RF1 A;  3CI8 A;  4RA1 A;  4ZEF A;  4AB6 A;  4XIG Q;  3CR9 A;  4Q8R A;  4XKN A;  1Y1Z A;  1UQW A;  2I49 A;  4IGR A;  2DS9 A;  3UN6 A;  2ZYO A;  3T66 A;  3FV1 A;  1CB6 A;  3FJ7 A;  2Y84 A;  1MRP A;  1URG A;  4IB2 A;  3G3J A;  3ONM A;  1T0K A;  4R74 A;  2DYX A;  3RTF B;  3L6G A;  1HSE A;  1MQJ A;  4NF8 A;  3HO7 A;  1B32 A;  1D9Y A;  4F39 A;  2O51 A;  4KCC A;  5HM4 B;  1HSJ A;  1FTO A;  3FAS A;  5I2N A;  1R1N A;  3KN7 A;  3K2D A;  2HZK A;  1KWH A;  1TFA A;  5H8H B;  4KYE A;  3MVW A;  5FTI A;  3KEI A;  1Y20 A;  3M3K A;  1GV8 A;  1WOD A;  4YZZ A;  4QSD A;  3BKI B;  2HXW A;  2XXX A;  3IAZ A;  2F6P A;  2THI A;  1JEV A;  3DP8 A;  1MQG A;  5ELV A;  1O7T A;  3PMW A;  1ZMG A;  1RYO A;  1PB9 A;  3I3V A;  4R2F A;  3UA8 A;  3IX1 A;  3FZV A;  3K6X A;  1SI1 A;  2PVU A;  4BLA A;  3EHT A;  3JZJ A;  1DSN A;  3PPR A;  1MPD A;  3TZA A;  3OXN A;  4DZ1 A;  2XXH A;  4JXI A;  4QRZ A;  1FCK A;  2I3W A;  3IK6 B;  3FJG A;  4GF8 A;  2NVU B;  3LC8 A;  2UYE A;  1MY1 A;  1B5J A;  1UIV A;  2NOO A;  2F34 A;  2HEU A;  3S9L C;  2XXR A;  1B2H A;  3HHF A;  4NMY A;  3VDF A;  3S9M C;  1XC1 A;  4G77 A;  2H99 A;  3N26 A;  1YTV A;  3U93 A;  5I2N B;  2ONS A;  3R7X A;  3TKD A;  4IGT A;  4FEB A;  4EXL A;  1D3K A;  3PMV A;  4RPN A;  5TP9 A;  3VVD A;  4AQ4 A;  4G68 A;  2NUV A;  3OO7 A;  2X7Q A;  3BFU A;  5I58 A;  4C1U A;  2DWJ A;  3PUX E;  1ZU0 A;  1B7Z A;  3KZG A;  4RJZ A;  5A5X A;  3MZB A;  4Q0C A;  4F3B A;  2ESN A;  4JDF A;  1FTL A;  1OVB A;  5ISU A;  1IXC A;  2ALU A;  4ZE8 A;  2YLN A;  4KQP A;  1O63 A;  3UK4 A;  2PMS A;  1CE2 A;  2OZZ A;  2ZXT A;  3MPK A;  1AOV A;  4EDP A;  1QVS A;  4BDR A;  1IIW A;  1PEB A;  3QYT A;  2OCU A;  5DVF A;  4IO5 A;  3RTW B;  2XXY A;  5AA4 B;  5ITP A;  1N7X A;  3VV5 A;  1JW5 A;  5KDT A;  1AMF A;  3VLW A;  2OWS A;  3M3F A;  4DCY A;  2ZYM A;  3RT8 A;  4IO4 A;  4NF6 B;  2F8D A;  4JWX A;  1FW0 A;  2RIN A;  1R6Z A;  4AB5 A;  2D3I A;  1J1N A;  4RY1 A;  4GLI A;  3DLN A;  3PMX A;  2R71 A;  3TCF A;  3TTK A;  2OJT A;  5M2V A;  2VGQ A;  1PB7 A;  5TP9 B;  1USY E;  4WXJ A;  2NXO A;  1Q1K A;  4ZZE A;  5AA1 A;  4Z0I A;  1MS7 A;  2QS3 A;  2XXI A;  4F1U A;  2O6A A;  4IO3 A;  3TTL A;  2ABH A;  2XX9 A;  3MQ9 A;  5I56 A;  5DT6 A;  1MG1 A;  5CMB A;  4FIM A;  1NKX A;  4GD5 A;  1N3W A;  1JW1 A;  3TTM A;  4EXK A;  4OVJ A;  1TXF A;  4MFI A;  5AA3 A;  3SEX A;  1VR5 A;  3P7I A;  4XKR A;  3JYR A;  4KHZ E;  3B6W A;  1RYX A;  4DCX A;  2ZMB A;  3MZ9 A;  3SET A;  3E13 X;  4THI A;  1B1X A;  3KN8 A;  1Y4T A;  3R6U A;  4H6D A;  1LAF E;  2F7A A;  4GRK A;  1H44 A;  1IXI A;  4EQ9 A;  3RY3 A;  5BUU A;  4R6K A;  4JWY A;  4ZZA A;  4YKP A;  4QFP A;  3S9E A;  3TDJ A;  5AA2 A;  4E0W A;  2I48 A;  3MJN A;  1NNF A;  4OEU A;  4DDD A;  1LCF A;  4BDQ A;  2F78 A;  5K2Y A;  4G8M A;  4YKJ A;  4YB6 A;  3OEM A;  2F36 A;  1Y3N A;  4FE8 A;  3RPW A;  2Y7R A;  3FAT A;  1SDX A;  3CVG A;  3QXM A;  3F11 A;  2WKY A;  2Z22 A;  5JTY B;  2ANJ A;  3IL1 B;  3C31 A;  4R75 A;  1Q35 A;  3OO9 A;  1RKM A;  1S7Y A;  2I6E A;  1MH4 A;  4U21 A;  5TPA B;  1S50 A;  5DEX B;  4POX A;  3FXR A;  1B0L A;  3N6U A;  1POT A;  3S4U A;  3K01 A;  1LAH E;  1HSL A;  1FTK A;  2H25 A;  3FIR A;  2O69 A;  4I9D A;  4HS7 A;  4FOR A;  4U4X A;  5CBR A;  1L5T A;  1NFT A;  1UTH A;  4F18 A;  3EQ1 A;  4H8I A;  1BKA A;  3H4Z A;  4N6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...