4P11A

Native crystal structure of mltf pseudomonas aeruginosa
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
428
structure length
428
Chain Sequence
APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Membrane-bound lytic murein transglycosylase F
publication title Native crystal structure of MltF Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 152
structure length 428
sequence length 428
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2014-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p11A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p11A02
2LAOA 1MQDA 4E0XA 3DLNA 3CRBA 1S7YA 3IO6A 3OEKA 3T9HB 1IQ7A 1MM6A 3IOWA 3P7IA 1URSA 5ICTA 3TTKA 4NF6B 4KD5A 5A5XB 4KYDA 1Z7NE 2A5TA 1UTHB 2ONRA 2YPNA 1N7XA 4OEVA 5CC2A 4KYSA 4GOTA 4N13A 2I49A 3FATA 5ELVA 3O28A 4IO6A 1B52A 2F35A 1PBQA 3DM0A 1PC3A 1SVXB 2GFEA 4RPNA 3ZSFA 3ZKLA 3IORA 4F1YA 2V3UA 1Y1MA 3M8UA 3K6XA 2F7BA 1OLCA 2QMWA 3IOVA 3B6QA 4IY6A 3IB0A 3K1PA 3TMGA 3MPLA 2QL3A 3PU5A 3BBRA 3C35A 2GHAA 4G68B 5I2KA 2B3BA 3KZGA 5AA4B 4DXCA 1FQBA 1M5CA 1QUJA 1LAXA 1IITA 1MQGA 2F7AA 3G3KA 1M5EA 4YMBA 3B6WA 3R26A 3KSXA 3T66A 3IJXB 3TODA 3PUXE 2F6PA 1XOCA 2XX7A 4P0GA 1YPNA 3EF7A 2Y84A 1LB8A 5L9MA 4F3SA 3G3IA 3E9XA 4QFPA 2OK2A 4XKNA 1RYXA 1Y4CA 3HO7A 3FIRA 3VDFA 4LUBA 2AIXA 3Q27A 3RGYA 3S2VA 4BDOA 3K00A 2RF1A 3O6IA 4GL0A 3FVKA 3PMVA 4N07A 3LSWA 4QSDA 2DVCA 1AMFA 5I2NB 1FCKA 1Y9UA 4NF4B 2RC8A 2R71A 1D4NA 5JTYB 3N6TA 4PP0A 1B9JA 4MBPA 1USYE 3CSGA 4OMBA 3EHUA 5DVIA 3UP9A 3FVOA 2I48A 1MS7A 3SETA 4F22A 2V25A 1DTGA 2YJPA 2H4IA 1N04A 3CSBA 3K0VA 1DMBA 4X1DA 4HCWA 2ZNTA 4F2OA 2ANJA 3OO9A 2O7IA 1JW4A 4WKMA 2XD2A 1UTBB 4O3CA 4DCXA 5AA2B 5I56A 3MVYA 5H8NB 4TLMB 3O6HA 4ELPA 4TOZA 5CMKA 4I8CA 2Y7PA 5HBCA 4KYEA 1O64A 3PV0E 2G93A 4PFUA 1MXYA 2O1MA 1A7LA 1JEVA 2W7YA 4PQJA 1BIYA 4F2QA 3FASA 3W9VA 2E1SA 3K4UA 4DCYA 4X48A 2XXWA 3LSXA 1Y3PA 4X9TA 5H8FA 5CMBA 5I59A 4ZZAA 3LSLA 4R2BA 2Q89A 5L9SA 2O69A 3MVXA 3OO8A 5KZTA 4YU0A 4ONYA 2PT1A 1B40A 3PPNA 1JW1A 4ZEFA 4MLVA 4O3AA 2WKYA 3ODBA 4IO7A 4ZEDA 3PPRA 2QS1A 1R1NA 5FTHA 1F9BA 5DYHA 1ZU0A 4U4SA 5I58A 3TCFA 1MXXA 3UORA 3T9VA 3CFLA 4ZEKA 3I5OA 5CI5A 4LONB 1B3EA 2XXTA 2D5WA 2VP1A 2O51A 4UACA 1QW0A 4XXUA 3N26A 3I3VA 1MXZA 2HZLA 4GRKA 1S9TA 5IKBA 4ZEIA 5M2VA 3CI8A 3IL1B 4F1UA 3QUFA 1B1HA 1YAEA 5CBRA 4P0IA 5TP9A 1ZMGA 2Z23A 1RKMA 3HHGA 2Y7WA 4H5GA 4R73A 3T96B 1MG1A 3WAFA 3FVGA 2OWSA 1P1OA 3BKIB 4LQ2A 2F8DA 3FUZA 3HPIA 1EH3A 3USDA 2ESNA 1ZJLA 3R7XA 1H45A 5H8HB 3Q26A 2QJEA 2NXOA 4GXAA 4U22A 1MXUA 2OZZA 2H25A 5AA1A 1FW0A 4F31B 1B7UA 1UIVA 4LATA 2RC7A 1SDXA 5DTBA 2ZYOA 4EF1A 3FZVA 2Y7RA 4GWOA 3M3KA 3Q29A 3TTMA 1JEUA 2PBWA 3PUYE 4ZS9A 4M1VA 2XXYA 1J1NA 5EHSA 3EQ1A 2I58A 2ZNUA 1JETA 2R6GE 5TPAA 5J1DA 4JXIA 2AL4A 4OFLA 2O1LA 3ZS6A 2IA4A 4QF9A 4BDRA 5ITOA 4DZ1A 4LZ5A 3LR1A 4ZZEA 4G77A 4RYAA 4H1XA 3TCHA 2Q8JA 3C9HA 1BTJA 3SEXA 1R6ZA 2NWJA 5TU0A 2QS3A 1HSJA 2B65A 1SI1A 2YLNA 2OCUA 3H6TA 1Q1KA 3O66A 1B3GA 4NF5A 3U72A 3RPWA 2HAVA 3U93A 3B6TA 1SQYA 1MQIA 4G8MA 4PETA 3K1MA 2OWTA 1SYHA 4R75A 5ITPA 2B3FA 4WEDA 3LSFB 4G68C 4R6YA 5A5XA 1UTHA 3V89B 2P2AA 4YKIA 2I4BA 5B70A 1MXWA 1N76A 2XXRA 1O63A 1B3HA 2NVUB 2DYXA 1B7HA 4XTCQ 1B4HA 1IXIA 1IXGA 3FJMA 3H6VA 3TYHA 2QRYA 2THIA 4DIGA 1MY1A 4EXLA 4Q0CA 1VFEA 4H65A 4P11A 1EZ9A 4F19A 3HSTA 2X7QA 1XT8A 3TQWA 4O3BA 1AOVA 4G68A 5AA4A 3KN3A 3MC2A 3PD8A 1MY4A 5F7VA 5I84A 1NNFA 4F18A 1URGA 5KDTA 1Y3NA 3C31A 1D3KA 2X7PA 4NMYA 3VV5A 3FV1A 3PMWA 5FTIA 4YKPA 3K01A 3VVDA 4KR5A 3PD9A 3HN0A 4RJZA 2CZLA 3IOUA 2QPQA 2XD3A 3IB1A 2I0CA 2QS2A 4GIZA 3OOAA 2P1SA 3UN6A 4BLAA 3GBAA 1B05A 1ELJA 3RTWB 4R2FA 4U21A 2Q88A 4Z0IA 1CB6A 3O2AA 4MFIA 3VXCA 5CMMA 3RUMA 1IEJA 3CFXA 4LZ7A 3V5AA 2DWHA 3D4CA 3H6WA 3SDFA 3S9NC 1LSTA 1MY2A 4RPOA 4KHZE 4FATA 3FD3A 1P1WA 3CR9A 4NTLA 1PEBA 1PB9A 3EN3A 5JTYA 3ZKKA 3F11A 5H8SA 2XXIA 4FJPA 4KPTA 5IAIA 4ECFA 3U94A 5LOMA 2REJA 3CFZA 1MY3A 1B32A 1A40A 2A5TB 3MZ9A 4NE4A 1H44A 1FTLA 4QFNA 3E4RA 1JVXA 4U1OA 5ISUA 3K6UA 2VHAA 1N84A 4U1ZA 1FTJA 4DXBA 1UTBA 4N6PA 1A8FA 5DVJA 2NUVA 5H8NA 2ALUA 1A8EA 2BJJX 4BDMA 4FAJA 2Y7IA 3R6UA 4YB5A 3QSLA 3H7MA 3V8XB 1MPDA 1DOTA 2HFBA 4OETA 2V84A 2QSXA 3A09A 3ILUB 3O9PA 5I57A 3CVGA 3QUJA 3RLFE 1ZLQA 4F3GA 3BFUA 2DS9A 4GL8A 1P1NA 1LGBC 1US4A 2GH9A 5CMCA 5AA3A 5I2KB 3TTNA 3T22A 2ZNSA 1NH8A 3KG2A 4K3FA 3U1OA 4XKQA 4OWDA 1VR5A 3OELA 4IO4A 5F1QA 1BKAA 3JV9A 1YCJA 1LAGE 3MWBA 1OIBA 2IEEA 4LZ8A 3D4GA 4Q30B 4FEBA 2UVGA 4JBZA 4ELRA 3E13X 2UYFA 3OMBA 3TKDA 4EQ9A 1HSEA 1M5BA 2PX1A 4H67A 4H8JA 3FGSA 1H43A 1VE4A 3SESA 1LBBA 3S9MC 4DE8A 3TCGA 2P0SA 5H8QA 4IGTA 4QHQA 4GD5A 4U23A 3PPQA 1GVCA 3QK6A 3UA8A 4ELOA 1ZKBA 4JSOA 4HTGA 1LBCA 2AYSA 1GTKA 3MP8A 1Y20A 3G3JA 1XVXA 5DEXA 4OFOA 3PMXA 1TFAA 2OLBA 2DVZA 4R9GA 2HZKA 1NNKA 3K02A 4XIGQ 1JW5A 4BDLA 2AL5A 3TPAA 1B1XA 4KI0E 3CG1A 1MM7A 2RCAA 4TQUQ 1WVJA 1RYOA 4IGRA 3SEVA 4I62A 4E0WA 3E3KA 3L6GA 1SW1A 1B4ZA 4MH5A 3T9XB 2DP8A 2ONSA 1TXFA 4WEPA 1IUDA 5I56B 3PUZE 3UK4A 2XXPA 3I6VA 1I6AA 1NL5A 3W15C 3N5LA 4RXLA 3VLWA 4ESWA 4Q8RA 3JYRA 4KCDA 1KWHA 4WXJA 1OQGA 3MAMA 3SEUA 1B0HA 2RKMA 1IXCA 3ILTB 3K6VA 2G29A 1UQWA 3IX1A 3KN7A 3WAEA 2ONKE 2UVHA 3KBRA 5H8FB 2ZYMA 3T9UA 5I59B 1FQCA 4IO5A 2XHDA 1SI0A 1Y3QA 4ZEBA 4YKJA 2XX9A 4M4GA 3MP6A 4F39A 2VGQA 4F1VA 4ZDMA 2UVIA 1VSOA 3M3FA 2O84X 1IIWA 2O7UA 3VLUA 1NKXA 4OESA 4QSEA 5I58B 4BDQA 5KCJA 2XXUA 3K6WA 1MQHA 3THIA 4JB7A 1MPBA 4EUOA 4YMAA 4NEDA 1DTZA 2Z8EA 2XX8A 2DE4A 4R9FA 1EZOA 1NFTA 2RC9A 3RN8A 4G8NA 2I4CA 4PFYA 1T0KA 2VD3A 4YB6A 3HHFA 5CM6A 5TP9B 2X26A 1MH4A 5DT6A 3FXRA 3TUSA 1D9YA 3OENA 3TZAA 5B7DA 1FQAA 3MQ9A 1MDQA 2Z8DA 5AA2D 3L6HA 4NWCA 4LVQA 1TT1A 2V3TA 4RY1A 1PDAA 4QSCA 2RCBA 4G4PA 4ZECA 3EHTA 2FYIA 3KSJA 1MY0A 1VFDA 3A3CA 4NF6A 1GGGA 2REGA 4KQPA 1A55A 3LUYA 3BFTA 1I6BA 1O7TA 5EHMA 3FV2A 4KFQA 3GLBA 4POXA 2HCAA 3FJGA 2KLFA 1FTOA 4NF8B 1NNTA 4LQ5A 3LBSA 1N3XA 4L17A 3IAZA 1NH7A 3UIFA 2GRVA 2UVJA 1BLFA 3KFMA 3OXNA 3KJTA 4X1BA 2O68A 3C33A 5BWJA 1LAFE 1MQJA 2FNCA 4FE8A 3RQTA 1MH3A 4C0RA 2D3IA 5JEIA 1OLAA 2Y7KA 1FTKA 2GHBA 2HAUA 1QUIA 2H9BA 2DWJA 4IO3A 1FQFA 1USYH 1PBPA 3U8QA 4BDNA 4R6KA 1ATGA 4R74A 2V93A 2Z8FA 4NF5B 1OQHA 3IK6B 2H99A 1B6HA 3SKPA 4RK2A 3K1NA 1SYIA 2H5YA 1GR2A 4F3BA 1US5A 5FHOA 3TAJA 4AQ4A 4YB7A 3W9WA 4HS7A 2PVUA 5CBSA 1Z7ME 4QFLA 3RTFB 3KJ7A 1LFHA 1ZBMA 3B7DA 4R6HA 3TEPA 5JK4A 1R9QA 4GLIA 3RT6B 1Q35A 4IB2A 2QMXA 4OQOA 4JWOA 1NMUA 3KOSA 4G2ZA 4LP2B 1POY1 2UYEA 1QJMA 1FQDA 1Y1ZA 4C1TA 4MF3A 4YZZA 3VXBA 1N3WA 5HM4B 3QXMA 4JSDA 4OTEA 5I2NA 1L5TA 3MBPA 4HW8A 1P1QA 4NF4A 4AB6A 3KN8A 2R9JA 1B46A 3TELA 1B0LA 2DE3A 1UIUA 4XKPA 4EQBA 4JWYA 2Z22A 4EQ7A 1LAHE 5FHNA 1QUKA 2DXRA 3MVZA 3V83A 4H8IA 2DXYA 3OD7A 5ICQA 2M8CA 1SD3A 1SW2A 5KDTB 1D9VA 4GVOA 1LB9A 1R9LA 3IR1A 4PE5B 3PGFA 1BP5A 5AA2A 4THIA 4GFRA 3N6UA 4FEDA 1P1UA 4ELQA 4FECA 3IJOB 5K2XA 4GQOA 4ISUA 4U4XA 4NWDA 3FXQA 2UXAA 3TTLA 3KEIA 1DPPA 1LLSA 3S9EA 4RK9A 3RY3A 1CE2A 1POTA 3CG3A 1LFIA 1B7ZA 4MLQA 2PYYA 4Z7EA 2F97A 1GV8A 2DQVA 2F5XA 1I69A 3PUWE 4OVJA 1IZ1A 2DOJA 5DVFA 3KGCA 3G7WA 1URDA 3OO6A 2XXQA 3C4MA 4DXUA 4OENA 3IB2A 1JNFA 1I6QA 1B5JA 4H6DA 3N94A 4GXSB 5CRYA 3SERA 2VOZA 3FXUA 4HCYA 3H6UA 3TQLA 2VD2A 2ZYKA 3VLVA 1XC1A 3AXFA 4OXVA 2RINA 3PUVE 1OVBA 3H03A 3RT8A 2DWIA 4H5FA 3ONMA 2F34A 3H4ZA 3S4UA 2XXVA 3MW0A 3LC8A 2H98A 4EDPA 1WDNA 4YAHX 4EF2A 2A5SA 4YICA 3OO7A 2F78A 4GF8A 1B5IA 1PB7A 1P99A 1B5HA 3PPOA 5I57B 3SEYA 2FA7A 3K2DA 2F6GA 1SW5A 4QRZA 1EU8A 2DE2A 2HEUA 4DLDA 1OVTA 4LA9A 1B2HA 3H06B 3Q25A 4RA1A 5H8HA 3DP4A 3QIMA 3MP1A 1SBPA 4C1UA 2HXWA 3ECRA 4PFWA 2I6EA 3FVNA 2V3QA 4JDFA 1N0TA 4FORA 1MXVA 3VVEA 2I3WA 1DPEA 3VFJA 1IXHA 3CIJA 4OEUA 4OZ9A 4I9DA 1DSNA 3G3FA 2F7CA 4U2RA 4I1DA 1M5DA 4JWXA 4POWA 5FHMA 2OJTA 3O29A 1QVSA 3M3LA 5H8QB 3A3UA 1YTVA 3U92A 4ZE9A 4QFOA 3PPPA 4TLLB 3DELB 3OEMA 4UA8A 2ZYNA 4IY5A 4DDDA 3RNNA 3TDJA 3JZJA 5DEXB 5HPQA 1HSLA 2PT2A 2O6AA 4IO2A 3MJNA 1ZIUA 1S50A 3C32A 4F3PA 3G3HA 3UGWA 2XXHA 1N7WA 1A99A 2PMSA 3EPEA 2NOOA 2XXXA 3SEWA 4OFJA 3OSRA 4YKKA 2Q2AA 1H76A 2Q2CA 3H3GA 4FIMA 3DP8A 5L9OA 1AH5A 4F29A 2ABHA 1EZPA 2DWAA 3TTRA 3FJ7A 3MUQA 1LCFA 1JQFA 1B58A 2F36A 3VVFA 4OYVA 1QKAA 3C36A 4NF8A 1LCTA 3GBBA 2I0BA 1JVYA 3TFLA 3OSQA 1PB8A 4Q5TA 1XVYA 2I3VA 4PFTA 3S9LC 1B3LA 3QYTA 4R72A 3HCQA 3O6GA 1WODA 3EHSA 3C34A 1Y4TA 4EXKA 4XKRA 1XS5A 4OHNA 3IOTA 3MZBA 1A54A 1II5A 1ANFA 3DP6A 3O97A 4ND9A 3GXAA 4ESXA 3MZ1A 1QULA 1XHYA 3MPKA 1SW4A 3VE1B 3HV1A 2HQ0A 5AE4A 1FTMA 3Q28A 1MRPA 2ZXTA 4AB5A 1TFDA 5KCJB 1MPCA 3G3GA 2CMOA 1M5FA 4H0WA 1MDP1 1QKBA 4RNSA 5L8DA 4OERA 2Q9TA 5BUUA 1B3FA 1TWYA 5TPAB 1AL3A 5K2YA 2DSFA 2D21A 4QFKA 4ZE8A 2QS4A 2ZMBA 1AIVA 4KCCA 1ZTYA 3KOTA 1NNPA 3QAXA 1B51A 4G8HA 1H3DA 1OMPA 1FQEA 3MVWA 2E0SA 5EYFA 1LFGA 3IO4A 3T93B 2OBGA 3GZGA
chains in the Genus database with same CATH superfamily
2LAOA 1MQDA 4E0XA 3DLNA 3CRBA 1S7YA 3FBPA 3IO6A 4NQ8A 1FJ9A 3OEKA 3T9HB 1IQ7A 1MM6A 1NV2A 3IOWA 3P7IA 1URSA 5ICTA 1NV3A 4JVIA 2MKZA 2FBPA 3TTKA 4NF6B 4KD5A 5A5XB 4KYDA 1Z7NE 2A5TA 1UTHB 2ONRA 4PCDA 2YPNA 1N7XA 4OEVA 3T0JA 5CC2A 4KYSA 4GOTA 1YZ0A 4N6DA 4N13A 2I49A 3FATA 4N15A 5ELVA 1LEVA 3O28A 4IO6A 1B52A 2F35A 1PBQA 3DM0A 1PC3A 4NG7A 3B8BA 1SVXB 4OVQA 2GFEA 4RPNA 1K9ZA 3ZSFA 3ZKLA 3IORA 4F1YA 2V3UA 1Y1MA 4GX3A 4PGPA 3M8UA 3K6XA 2F7BA 1OLCA 2QMWA 3IOVA 3B6QA 4IY6A 3IB0A 3K1PA 3TMGA 3MPLA 2QL3A 3PU5A 3BBRA 3C35A 2GHAA 4G68B 5I2KA 2B3BA 3KZGA 5AA4B 4DXCA 1FQBA 1M5CA 1QUJA 1LAXA 1IITA 1MQGA 2F7AA 3G3KA 3SZPA 1M5EA 4YMBA 3B6WA 3E79A 2GQ1A 3R26A 3KSXA 3T66A 3IJXB 3TODA 3PUXE 2F6PA 1XOCA 2XX7A 5EQ9A 5IM2A 4P0GA 1YPNA 3EF7A 4PBHA 2Y84A 1LB8A 5L9MA 4HE0A 4F3SA 3G3IA 4X04A 3E9XA 4QFPA 5ET6A 1FPDA 2OK2A 4XKNA 1NI9A 1RYXA 1Y4CA 3HO7A 3FIRA 3VDFA 4LUBA 2AIXA 5DW8A 3Q27A 3RGYA 3S2VA 4BDOA 2L5VA 3K00A 2RF1A 3O6IA 4GL0A 3FVKA 3PMVA 2P3NA 2CZHA 4N07A 3LSWA 4QSDA 2DVCA 1AMFA 5I2NB 1FCKA 1Y9UA 4NF4B 2RC8A 5ET5A 2R71A 4G61A 1D4NA 5JTYB 3N6TA 4PP0A 1B9JA 4OVSA 4MBPA 1USYE 3CSGA 4OMBA 3EHUA 5DVIA 3UP9A 5I7IA 3FVOA 2I48A 1MS7A 3SETA 4F22A 4O7MA 2V25A 1DTGA 2YJPA 4NX1A 2H4IA 1N04A 3CSBA 3K0VA 1DMBA 4X1DA 4HCWA 2ZNTA 4F2OA 2ANJA 3OO9A 2O7IA 1JW4A 4WKMA 2XD2A 5EQ8A 1UTBB 4O3CA 4NF0A 4DCXA 5AA2B 5I56A 3MVYA 5H8NB 4TLMB 5IZ3B 3O6HA 4GWUA 4ELPA 4PAFA 4TOZA 5CMKA 3KBZA 4I8CA 2Y7PA 5HBCA 4KYEA 1O64A 3PV0E 2G93A 4PFUA 1MXYA 2O1MA 1A7LA 1JEVA 4DI3D 2W7YA 4PQJA 1BIYA 4F2QA 3FASA 3W9VA 2E1SA 3K4UA 4DCYA 4X48A 5ET7A 2XXWA 3LSXA 1Y3PA 4X9TA 5H8FA 4PF6A 5CMBA 4GBWA 5I59A 4ZZAA 3LSLA 4R2BA 2Q89A 5L9SA 2O69A 3MVXA 3OO8A 5KZTA 4YU0A 4MJOA 4ONYA 2PT1A 1B40A 3PPNA 1JW1A 4ZEFA 1FBHA 4MLVA 4O3AA 1DBZA 4XEQA 2Q8MA 2WKYA 3ODBA 4IO7A 4ZEDA 3PPRA 2QS1A 5LDZA 1R1NA 5FTHA 1F9BA 5DYHA 1ZU0A 4U4SA 5I58A 3TCFA 1MXXA 3UORA 3T9VA 3CFLA 3RYDA 4ZEKA 3LUZA 3I5OA 1NV4A 5CI5A 4LONB 1B3EA 5A5LA 2XXTA 2D5WA 4GWWA 5F24A 2VP1A 2O51A 4GWSA 4UACA 1QW0A 4XXUA 3N26A 3I3VA 1MXZA 2HZLA 4GRKA 1S9TA 5IKBA 4ZEIA 5M2VA 3CI8A 3IL1B 4F1UA 3QUFA 1LBWA 1B1HA 1YAEA 5CBRA 4P0IA 5TP9A 1ZMGA 1IMCA 5EQAA 2CEXA 4PAKA 2Z23A 1RKMA 3HHGA 3RPLA 2Y7WA 4H5GA 4R73A 4PFBA 3T96B 1FSAA 1MG1A 3WAFA 3FVGA 2OWSA 1P1OA 3BKIB 4LQ2A 2F8DA 1FPGA 3FUZA 3HPIA 1EH3A 5EYHA 3USDA 2ESNA 3KC0A 1ZJLA 3R7XA 1H45A 5H8HB 3Q26A 2QJEA 2NXOA 4GXAA 4U22A 1MXUA 5IGAA 1KZ8A 2OZZA 2H25A 5AA1A 1FW0A 4F31B 1B7UA 2QVRA 2VPOA 1UIVA 4LATA 2RC7A 1SDXA 5DTBA 2ZYOA 4EF1A 1FRPA 3KC1A 4NGUA 3FZVA 2Y7RA 1NUYA 4GWOA 3M3KA 3Q29A 4QXDA 3TTMA 3CHGA 1JEUA 3IFAA 2QVUA 2FIEA 2PBWA 3PUYE 4ZS9A 4M1VA 2XXYA 1J1NA 5EHSA 3EQ1A 2I58A 2ZNUA 1EYKA 1JETA 2R6GE 2VPNA 5TPAA 1NV5A 5J1DA 4JXIA 2AL4A 4MIJA 4OFLA 2O1LA 3ZS6A 2IA4A 4QF9A 4BDRA 5ITOA 4DZ1A 4LZ5A 3LR1A 4ZZEA 4G77A 3HFUA 4RYAA 4H1XA 3TCHA 1EYIA 2Q8JA 2WYKA 3C9HA 1BTJA 2WBBA 3SEXA 1R6ZA 2NWJA 5TU0A 2QS3A 1HSJA 2B65A 1SI1A 2YLNA 2OCUA 3H6TA 1Q1KA 3O66A 2HXRA 1CNQA 1B3GA 4NF5A 3U72A 3RPWA 2HAVA 3U93A 3B6TA 1SQYA 1MQIA 4G8MA 2QVVA 4PETA 3K1MA 2OWTA 1SYHA 4R75A 5ITPA 2B3FA 4WEDA 3U65A 3LSFB 4G68C 4R6YA 4PDHA 5A5XA 1UTHA 3V89B 2P2AA 4YKIA 2OX3A 2I4BA 5B70A 1MXWA 1N76A 2XXRA 1O63A 1B3HA 2NVUB 2DYXA 1B7HA 4XTCQ 1B4HA 1IXIA 1IXGA 3FJMA 3H6VA 4IR8A 3TYHA 2QRYA 2THIA 1LBXA 3T1BA 4GWYA 4DIGA 1MY1A 4EXLA 2Y5KA 4Q0CA 1VFEA 4H65A 4P11A 1K9YA 4GX6A 1NUWA 1EZ9A 4GWXA 1IMFA 4F19A 3HSTA 2X7QA 1XT8A 1YXIA 3TQWA 4O3BA 1AOVA 4G68A 5AA4A 3KN3A 3MC2A 3PD8A 1MY4A 1D9QA 5F7VA 5I84A 1NNFA 4F18A 1URGA 4P56A 5KDTA 1Y3NA 3C31A 1D3KA 2X7PA 4NMYA 5EQ7A 3VV5A 3FV1A 5ET8A 3PMWA 5FTIA 4YKPA 3K01A 3VVDA 4QBAA 4KR5A 3PD9A 1FJ6A 4NHBA 3HN0A 4RJZA 5J16A 2CZLA 3IOUA 2QPQA 2XD3A 3IB1A 2I0CA 2QS2A 4GIZA 3OOAA 2P1SA 3UN6A 4BLAA 3GBAA 1B05A 1ELJA 3RTWB 4R2FA 4U21A 2Q88A 4Z0IA 1CB6A 1KA1A 3O2AA 4MFIA 3VXCA 5CMMA 3RUMA 1IEJA 1EYJA 3CFXA 4LZ7A 3V5AA 2DWHA 1YYZA 3D4CA 4PTKA 3H6WA 3SDFA 3S9NC 1LSTA 1MY2A 4P8BA 4RPOA 1SPIA 4KHZE 4FATA 3FD3A 1P1WA 3CR9A 4NTLA 1PEBA 1PB9A 3EN3A 4GBVA 5JTYA 3ZKKA 4MX6A 3F11A 5H8SA 2XXIA 1LBYA 4FJPA 4KPTA 5IAIA 4ECFA 3U94A 5LOMA 2REJA 3CFZA 1MY3A 3MZ9A 1B32A 1A40A 2A5TB 4N81A 1H44A 4NE4A 3E78A 4O8MA 1FTLA 4QFNA 3E4RA 1JVXA 4U1OA 4I3YA 5ISUA 3K6UA 2VHAA 1N84A 4U1ZA 1FTJA 4DXBA 1UTBA 4N6PA 1A8FA 5DVJA 2NUVA 5H8NA 2ALUA 1A8EA 2BJJX 5IZ3A 4BDMA 4FAJA 2Y7IA 3R6UA 4YB5A 3QSLA 3H7MA 3V8XB 1MPDA 1DOTA 2HFBA 4OETA 2V84A 4MCOA 3ROJA 2QSXA 3A09A 3ILUB 4PBQA 3O9PA 5I57A 3CVGA 3QUJA 3RLFE 1ZLQA 4F3GA 3BFUA 2DS9A 5I5PA 2XWOA 4GL8A 1P1NA 1LGBC 1US4A 2GH9A 5CMCA 5AA3A 5I2KB 3TTNA 3T22A 4PFIA 2ZNSA 1NH8A 3KG2A 4K3FA 3U1OA 4XKQA 4OWDA 1VR5A 1LBVA 3OELA 4IO4A 2FVZA 5F1QA 1BKAA 3JV9A 1YCJA 1LAGE 1NV7A 3MWBA 1OIBA 2IEEA 4LZ8A 3D4GA 4Q30B 4FEBA 1FBPA 4MNIA 2UVGA 4JBZA 4ELRA 3E13X 2UYFA 3OMBA 4OVTA 3TKDA 4EQ9A 1HSEA 4OVPA 1M5BA 2PX1A 4H67A 4H8JA 3FGSA 1H43A 4N8GA 4MAGA 1VE4A 3SESA 1LBBA 3S9MC 4DE8A 3TCGA 2P0SA 5H8QA 4IGTA 4MHFA 4QHQA 4GD5A 4U23A 5T3JA 3PPQA 1GVCA 3QK6A 3PTYA 3UA8A 4ELOA 1ZKBA 4JSOA 4HE2A 4HTGA 1LBCA 2XWKA 2AYSA 1GTKA 2Q74A 3MP8A 1Y20A 3G3JA 1XVXA 5DEXA 4OFOA 2WBDA 3PMXA 1TFAA 2OLBA 2DVZA 4N91A 4R9GA 2HZKA 1NNKA 3K02A 4XIGQ 1JW5A 4BDLA 2AL5A 3TPAA 1B1XA 4KI0E 3CG1A 1MM7A 2RCAA 4TQUQ 1WVJA 1RYOA 4N17A 4IGRA 3SEVA 4I62A 4E0WA 3E3KA 3L6GA 1SW1A 1B4ZA 4MH5A 3T9XB 2DP8A 2ONSA 1TXFA 4WEPA 1IUDA 3FXBA 5I56B 3PUZE 3UK4A 2XXPA 2CZIA 3I6VA 1I6AA 1NL5A 3W15C 4XF5A 3N5LA 4RXLA 3VLWA 1JP4A 3BIGA 4ESWA 4Q8RA 3JYRA 4KCDA 4O7IA 1KWHA 4WXJA 1OQGA 3MAMA 3SEUA 1B0HA 2RKMA 1IXCA 3ILTB 2B4MA 3K6VA 2G29A 1UQWA 3IX1A 3KN7A 3WAEA 2ONKE 2UVHA 3KBRA 1NV6A 5H8FB 2ZYMA 3T9UA 5I59B 1FQCA 2XXKA 4OANA 4IO5A 5ESYA 2XHDA 4XFEA 1SI0A 1Y3QA 4ZEBA 4YKJA 2XX9A 4M4GA 3MP6A 2B4LA 4F39A 2VGQA 4F1VA 4ZDMA 1FPJA 2UVIA 1IMBA 1VSOA 3M3FA 2XA5A 1INPA 2O84X 1IIWA 2O7UA 3VLUA 2XWVA 1NKXA 4OESA 4PC9A 4QSEA 5I58B 4BDQA 4OVRA 5KCJA 2XXUA 3K6WA 1MQHA 3THIA 4JB7A 2HHMA 1MPBA 4EUOA 4YMAA 4NEDA 1DTZA 2Z8EA 2F3DA 1LBZA 2XX8A 2DE4A 4R9FA 1EZOA 1NFTA 2RC9A 4O94A 3RN8A 4G8NA 2I4CA 4PFYA 1T0KA 2VD3A 4YB6A 3HHFA 5CM6A 5TP9B 3MYUA 4MNPA 1NV1A 2X26A 3RPLB 1MH4A 1RDYA 5DT6A 3FXRA 3TUSA 1D9YA 3OENA 2V4CA 2PFZA 2VT5A 3TZAA 5B7DA 1FQAA 3MQ9A 1MDQA 1G0HA 2Z8DA 5AA2D 3L6HA 4NWCA 4LVQA 1TT1A 2V3TA 4I3EA 4RY1A 2CEYA 1PDAA 4QSCA 2RCBA 4G4PA 4ZECA 4MMPA 3EHTA 2FYIA 3KSJA 1MY0A 1VFDA 3A3CA 4NF6A 1GGGA 2REGA 4KQPA 4N4UA 1A55A 3LUYA 3BFTA 1I6BA 1O7TA 5EHMA 3FV2A 4KFQA 3GLBA 4POXA 2HCAA 3FJGA 2KLFA 1FTOA 4NF8B 1NNTA 4LQ5A 3LBSA 1N3XA 4L17A 3IAZA 1NH7A 3UIFA 2GRVA 2UVJA 1BLFA 3KFMA 3OXNA 3KJTA 4X1BA 2O68A 3C33A 5BWJA 1LAFE 1DCUA 1RDZA 1MQJA 2FNCA 2XWIA 4FE8A 3RQTA 1MH3A 4C0RA 2D3IA 5JEIA 1OLAA 2Y7KA 1FTKA 2GHBA 2HAUA 1FPBA 1QUIA 2H9BA 4AS4A 1NUXA 5FBPA 2DWJA 4IO3A 1FQFA 1USYH 1PBPA 1Q9DA 3U8QA 2QFLA 4BDNA 4R6KA 1ATGA 4R74A 2V93A 2Z8FA 4NF5B 1OQHA 3IK6B 2H99A 1B6HA 3SKPA 4RK2A 3K1NA 1SYIA 2H5YA 2ZZXA 3BIHA 1GR2A 2OWZA 4NAPA 4F3BA 1US5A 5FHOA 3TAJA 4AQ4A 4YB7A 3W9WA 4HS7A 2PVUA 5CBSA 1Z7ME 4PDDA 4QFLA 3RTFB 3KJ7A 1LFHA 1ZBMA 3B7DA 2FIXA 1IMDA 4R6HA 3TEPA 5JK4A 1R9QA 3EKIA 4GLIA 3RT6B 1Q35A 4DI4B 4IB2A 2QMXA 4OQOA 1FBEA 4X8RA 1NUZA 4JWOA 1NMUA 3KOSA 4G2ZA 4LP2B 2ZZWA 1POY1 2UYEA 1QJMA 1FQDA 1Y1ZA 4C1TA 4MF3A 4YZZA 3VXBA 1N3WA 5HM4B 3QXMA 2ZZVA 4JSDA 4OTEA 5I2NA 1L5TA 3MBPA 4HW8A 1P1QA 4NF4A 4AB6A 3KN8A 2R9JA 1B46A 3TELA 1XI6A 1B0LA 2DE3A 1UIUA 4XKPA 1FPKA 4EQBA 1BK4A 4JWYA 2Z22A 4EQ7A 1LAHE 5FHNA 1QUKA 2DXRA 3MVZA 4P3LA 3V83A 4H8IA 2DXYA 3OD7A 2WEFA 5ICQA 2M8CA 5IZ1A 1SD3A 1SW2A 5KDTB 1D9VA 4GVOA 1LB9A 1R9LA 3IR1A 4PE5B 3PGFA 1BP5A 1G0IA 5AA2A 4THIA 4GFRA 3N6UA 4FEDA 4UABA 1P1UA 4ELQA 4FECA 3IJOB 5K2XA 4GQOA 4ISUA 4U4XA 4NWDA 3FXQA 2UXAA 3TTLA 3KEIA 3IFCA 1DPPA 1LLSA 3S9EA 4RK9A 3RY3A 1CE2A 1POTA 3CG3A 2PCRA 1LFIA 1B7ZA 4MLQA 4P1EA 2PYYA 4Z7EA 2F97A 1GV8A 2DQVA 2F5XA 2CZKA 1I69A 2WYPA 3PUWE 4OVJA 1IZ1A 2DOJA 5DVFA 3KGCA 3G7WA 3NOHA 1URDA 3OO6A 2XXQA 3C4MA 4DXUA 5LTCA 4OENA 3IB2A 1JNFA 1I6QA 1B5JA 4H6DA 3N94A 4GXSB 5CRYA 3SERA 2VOZA 4I40A 3FXUA 4HCYA 2PFYA 3H6UA 3TQLA 4LN5A 4PGNA 2R8TA 2VD2A 2ZYKA 3VLVA 1XC1A 3AXFA 2F3BA 5EYGA 4OXVA 2RINA 3PUVE 1OVBA 5IZZA 2HPGA 3H03A 3RT8A 2DWIA 4H5FA 3ONMA 2F34A 3H4ZA 3S4UA 3QMFA 2XXVA 3MW0A 3LC8A 2H98A 4EDPA 1WDNA 1FPIA 4YAHX 4EF2A 2A5SA 4YICA 3OO7A 2F78A 4GF8A 1B5IA 1PB7A 1RDXA 1P99A 1B5HA 1VDWA 3PPOA 5I57B 3SEYA 2FA7A 3K2DA 2Y5LA 2F6GA 4H46A 1SW5A 4QRZA 1EU8A 2DE2A 2HEUA 4DLDA 1OVTA 4LA9A 1KA0A 1B2HA 3H06B 3Q25A 4PFRA 4RA1A 4HE1A 5H8HA 3DP4A 3QIMA 1IMAA 2WX9A 3MP1A 1SBPA 3ECRA 2HXWA 4PFWA 4C1UA 2I6EA 2JJKA 3FVNA 1AWBA 2V3QA 4JDFA 4OA4A 1N0TA 4FORA 1MXVA 3VVEA 2I3WA 1DPEA 4P9KA 1FBDA 3VFJA 1IXHA 3CIJA 4OEUA 1IMEA 4OZ9A 4N6KA 4I9DA 1DSNA 3G3FA 2F7CA 4U2RA 3GYYA 4I1DA 1M5DA 4JWXA 4POWA 1QGXA 4H45A 5FHMA 1DK4A 2OJTA 3O29A 1QVSA 3M3LA 5H8QB 3A3UA 1YTVA 3U92A 4ZE9A 4QFOA 3PPPA 4TLLB 3DELB 3OEMA 4UA8A 2ZYNA 4IY5A 4GWZA 4DDDA 3RNNA 3TDJA 3A29A 3JZJA 5DEXB 5HPQA 1HSLA 2PT2A 2O6AA 4IO2A 3B50A 3MJNA 1ZIUA 3LV0A 1S50A 3C32A 3MSTA 4F3PA 3G3HA 3UGWA 2XXHA 1N7WA 1A99A 2PMSA 3EPEA 2NOOA 2XXXA 3SEWA 4OFJA 3OSRA 4YKKA 2Q2AA 1H76A 2Q2CA 3H3GA 4FIMA 3DP8A 4JVCA 5L9OA 4JVDA 2FHYA 1AH5A 4F29A 2ABHA 3D1RA 1EZPA 2DWAA 3TTRA 3FJ7A 4N8YA 3MUQA 4MEVA 1LCFA 1JQFA 5I3SA 1B58A 2F36A 3VVFA 1FBGA 4GX4A 4KXPA 2BJIA 4OYVA 1QKAA 3C36A 4NF8A 1LCTA 3GBBA 2I0BA 1JVYA 3TFLA 3OSQA 1PB8A 4Q5TA 1XVYA 2I3VA 4PFTA 2KQZA 3S9LC 1B3LA 3QYTA 4R72A 3HCQA 3O6GA 3ISPA 1WODA 3EHSA 3C34A 1Y4TA 4EXKA 4XKRA 1FBFA 1FTAA 1XS5A 4OHNA 3IOTA 3MZBA 1A54A 1II5A 1ANFA 3DP6A 3O97A 4ND9A 3GXAA 4ESXA 3MZ1A 1QULA 1XHYA 3MPKA 1SW4A 3VE1B 3HV1A 2HQ0A 1FBCA 5AE4A 1FTMA 4NN3A 3Q28A 1MRPA 4MNCA 1NV0A 4PAIA 2ZXTA 4AB5A 1TFDA 4PF8A 5KCJB 1MPCA 3G3GA 1FPEA 2DDKA 1FPLA 2CMOA 1M5FA 4H0WA 1MDP1 1QKBA 4RNSA 5L8DA 4OERA 2P3VA 2Q9TA 5BUUA 1B3FA 1TWYA 4HXVA 5TPAB 1AL3A 5K2YA 2DSFA 2D21A 1FPFA 4QFKA 4PE3A 4ZE8A 4FBPA 2QS4A 2ZMBA 1AIVA 4KCCA 4P47A 1ZTYA 4AS5A 3KOTA 1NNPA 3QAXA 1B51A 4G8HA 2KR0A 1H3DA 4P1LA 1OMPA 1FQEA 3MVWA 2E0SA 5EYFA 1LFGA 3IO4A 3T93B 2OBGA 3GZGA
chains in the Genus database with same CATH topology
2LAOA 1MQDA 4E0XA 3DLNA 3CRBA 1S7YA 3IO6A 3OEKA 3T9HB 1IQ7A 1MM6A 3IOWA 3P7IA 1URSA 5ICTA 3TTKA 4NF6B 4KD5A 5A5XB 4KYDA 1Z7NE 2A5TA 1UTHB 2ONRA 2YPNA 1N7XA 4OEVA 5CC2A 4KYSA 4GOTA 4N13A 2I49A 3FATA 5ELVA 3O28A 4IO6A 1B52A 2F35A 1PBQA 3DM0A 1PC3A 1SVXB 2GFEA 4RPNA 3ZSFA 3ZKLA 3IORA 4F1YA 2V3UA 1Y1MA 3M8UA 3K6XA 2F7BA 1OLCA 2QMWA 3IOVA 3B6QA 4IY6A 3IB0A 3K1PA 3TMGA 3MPLA 2QL3A 3PU5A 3BBRA 3C35A 2GHAA 4G68B 5I2KA 2B3BA 3KZGA 5AA4B 4DXCA 1FQBA 1M5CA 1QUJA 1LAXA 1IITA 1MQGA 2F7AA 3G3KA 1M5EA 4YMBA 3B6WA 3R26A 3KSXA 3T66A 3IJXB 3TODA 3PUXE 2F6PA 1XOCA 2XX7A 4P0GA 1YPNA 3EF7A 2Y84A 1LB8A 5L9MA 4F3SA 3G3IA 3E9XA 4QFPA 2OK2A 4XKNA 1RYXA 1Y4CA 3HO7A 3FIRA 3VDFA 4LUBA 2AIXA 3Q27A 3RGYA 3S2VA 4BDOA 3K00A 2RF1A 3O6IA 4GL0A 3FVKA 3PMVA 4N07A 3LSWA 4QSDA 2DVCA 1AMFA 5I2NB 1FCKA 1Y9UA 4NF4B 2RC8A 2R71A 1D4NA 5JTYB 3N6TA 4PP0A 1B9JA 4MBPA 1USYE 3CSGA 4OMBA 3EHUA 5DVIA 3UP9A 3FVOA 2I48A 1MS7A 3SETA 4F22A 2V25A 1DTGA 2YJPA 2H4IA 1N04A 3CSBA 3K0VA 1DMBA 4X1DA 4HCWA 2ZNTA 4F2OA 2ANJA 3OO9A 2O7IA 1JW4A 4WKMA 2XD2A 1UTBB 4O3CA 4DCXA 5AA2B 5I56A 3MVYA 5H8NB 4TLMB 3O6HA 4ELPA 4TOZA 5CMKA 4I8CA 2Y7PA 5HBCA 4KYEA 1O64A 3PV0E 2G93A 4PFUA 1MXYA 2O1MA 1A7LA 1JEVA 2W7YA 4PQJA 1BIYA 4F2QA 3FASA 3W9VA 2E1SA 3K4UA 4DCYA 4X48A 2XXWA 3LSXA 1Y3PA 4X9TA 5H8FA 5CMBA 5I59A 4ZZAA 3LSLA 4R2BA 2Q89A 5L9SA 2O69A 3MVXA 3OO8A 5KZTA 4YU0A 4ONYA 2PT1A 1B40A 3PPNA 1JW1A 4ZEFA 4MLVA 4O3AA 2WKYA 3ODBA 4IO7A 4ZEDA 3PPRA 2QS1A 1R1NA 5FTHA 1F9BA 5DYHA 1ZU0A 4U4SA 5I58A 3TCFA 1MXXA 3UORA 3T9VA 3CFLA 4ZEKA 3I5OA 5CI5A 4LONB 1B3EA 2XXTA 2D5WA 2VP1A 2O51A 4UACA 1QW0A 4XXUA 3N26A 3I3VA 1MXZA 2HZLA 4GRKA 1S9TA 5IKBA 4ZEIA 5M2VA 3CI8A 3IL1B 4F1UA 3QUFA 1B1HA 1YAEA 5CBRA 4P0IA 5TP9A 1ZMGA 2Z23A 1RKMA 3HHGA 2Y7WA 4H5GA 4R73A 3T96B 1MG1A 3WAFA 3FVGA 2OWSA 1P1OA 3BKIB 4LQ2A 2F8DA 3FUZA 3HPIA 1EH3A 3USDA 2ESNA 1ZJLA 3R7XA 1H45A 5H8HB 3Q26A 2QJEA 2NXOA 4GXAA 4U22A 1MXUA 2OZZA 2H25A 5AA1A 1FW0A 4F31B 1B7UA 1UIVA 4LATA 2RC7A 1SDXA 5DTBA 2ZYOA 4EF1A 3FZVA 2Y7RA 4GWOA 3M3KA 3Q29A 3TTMA 1JEUA 2PBWA 3PUYE 4ZS9A 4M1VA 2XXYA 1J1NA 5EHSA 3EQ1A 2I58A 2ZNUA 1JETA 2R6GE 5TPAA 5J1DA 4JXIA 2AL4A 4OFLA 2O1LA 3ZS6A 2IA4A 4QF9A 4BDRA 5ITOA 4DZ1A 4LZ5A 3LR1A 4ZZEA 4G77A 4RYAA 4H1XA 3TCHA 2Q8JA 3C9HA 1BTJA 3SEXA 1R6ZA 2NWJA 5TU0A 2QS3A 1HSJA 2B65A 1SI1A 2YLNA 2OCUA 3H6TA 1Q1KA 3O66A 1B3GA 4NF5A 3U72A 3RPWA 2HAVA 3U93A 3B6TA 1SQYA 1MQIA 4G8MA 4PETA 3K1MA 2OWTA 1SYHA 4R75A 5ITPA 2B3FA 4WEDA 3LSFB 4G68C 4R6YA 5A5XA 1UTHA 3V89B 2P2AA 4YKIA 2I4BA 5B70A 1MXWA 1N76A 2XXRA 1O63A 1B3HA 2NVUB 2DYXA 1B7HA 4XTCQ 1B4HA 1IXIA 1IXGA 3FJMA 3H6VA 3TYHA 2QRYA 2THIA 4DIGA 1MY1A 4EXLA 4Q0CA 1VFEA 4H65A 4P11A 1EZ9A 4F19A 3HSTA 2X7QA 1XT8A 3TQWA 4O3BA 1AOVA 4G68A 5AA4A 3KN3A 3MC2A 3PD8A 1MY4A 5F7VA 5I84A 1NNFA 4F18A 1URGA 5KDTA 1Y3NA 3C31A 1D3KA 2X7PA 4NMYA 3VV5A 3FV1A 3PMWA 5FTIA 4YKPA 3K01A 3VVDA 4KR5A 3PD9A 3HN0A 4RJZA 2CZLA 3IOUA 2QPQA 2XD3A 3IB1A 2I0CA 2QS2A 4GIZA 3OOAA 2P1SA 3UN6A 4BLAA 3GBAA 1B05A 1ELJA 3RTWB 4R2FA 4U21A 2Q88A 4Z0IA 1CB6A 3O2AA 4MFIA 3VXCA 5CMMA 3RUMA 1IEJA 3CFXA 4LZ7A 3V5AA 2DWHA 3D4CA 3H6WA 3SDFA 3S9NC 1LSTA 1MY2A 4RPOA 4KHZE 4FATA 3FD3A 1P1WA 3CR9A 4NTLA 1PEBA 1PB9A 3EN3A 5JTYA 3ZKKA 3F11A 5H8SA 2XXIA 4FJPA 4KPTA 5IAIA 4ECFA 3U94A 5LOMA 2REJA 3CFZA 1MY3A 1B32A 1A40A 2A5TB 3MZ9A 4NE4A 1H44A 1FTLA 4QFNA 3E4RA 1JVXA 4U1OA 5ISUA 3K6UA 2VHAA 1N84A 4U1ZA 1FTJA 4DXBA 1UTBA 4N6PA 1A8FA 5DVJA 2NUVA 5H8NA 2ALUA 1A8EA 2BJJX 4BDMA 4FAJA 2Y7IA 3R6UA 4YB5A 3QSLA 3H7MA 3V8XB 1MPDA 1DOTA 2HFBA 4OETA 2V84A 2QSXA 3A09A 3ILUB 3O9PA 5I57A 3CVGA 3QUJA 3RLFE 1ZLQA 4F3GA 3BFUA 2DS9A 4GL8A 1P1NA 1LGBC 1US4A 2GH9A 5CMCA 5AA3A 5I2KB 3TTNA 3T22A 2ZNSA 1NH8A 3KG2A 4K3FA 3U1OA 4XKQA 4OWDA 1VR5A 3OELA 4IO4A 5F1QA 1BKAA 3JV9A 1YCJA 1LAGE 3MWBA 1OIBA 2IEEA 4LZ8A 3D4GA 4Q30B 4FEBA 2UVGA 4JBZA 4ELRA 3E13X 2UYFA 3OMBA 3TKDA 4EQ9A 1HSEA 1M5BA 2PX1A 4H67A 4H8JA 3FGSA 1H43A 1VE4A 3SESA 1LBBA 3S9MC 4DE8A 3TCGA 2P0SA 5H8QA 4IGTA 4QHQA 4GD5A 4U23A 3PPQA 1GVCA 3QK6A 3UA8A 4ELOA 1ZKBA 4JSOA 4HTGA 1LBCA 2AYSA 1GTKA 3MP8A 1Y20A 3G3JA 1XVXA 5DEXA 4OFOA 3PMXA 1TFAA 2OLBA 2DVZA 4R9GA 2HZKA 1NNKA 3K02A 4XIGQ 1JW5A 4BDLA 2AL5A 3TPAA 1B1XA 4KI0E 3CG1A 1MM7A 2RCAA 4TQUQ 1WVJA 1RYOA 4IGRA 3SEVA 4I62A 4E0WA 3E3KA 3L6GA 1SW1A 1B4ZA 4MH5A 3T9XB 2DP8A 2ONSA 1TXFA 4WEPA 1IUDA 5I56B 3PUZE 3UK4A 2XXPA 3I6VA 1I6AA 1NL5A 3W15C 3N5LA 4RXLA 3VLWA 4ESWA 4Q8RA 3JYRA 4KCDA 1KWHA 4WXJA 1OQGA 3MAMA 3SEUA 1B0HA 2RKMA 1IXCA 3ILTB 3K6VA 2G29A 1UQWA 3IX1A 3KN7A 3WAEA 2ONKE 2UVHA 3KBRA 5H8FB 2ZYMA 3T9UA 5I59B 1FQCA 4IO5A 2XHDA 1SI0A 1Y3QA 4ZEBA 4YKJA 2XX9A 4M4GA 3MP6A 4F39A 2VGQA 4F1VA 4ZDMA 2UVIA 1VSOA 3M3FA 2O84X 1IIWA 2O7UA 3VLUA 1NKXA 4OESA 4QSEA 5I58B 4BDQA 5KCJA 2XXUA 3K6WA 1MQHA 3THIA 4JB7A 1MPBA 4EUOA 4YMAA 4NEDA 1DTZA 2Z8EA 2XX8A 2DE4A 4R9FA 1EZOA 1NFTA 2RC9A 3RN8A 4G8NA 2I4CA 4PFYA 1T0KA 2VD3A 4YB6A 3HHFA 5CM6A 5TP9B 2X26A 1MH4A 5DT6A 3FXRA 3TUSA 1D9YA 3OENA 3TZAA 5B7DA 1FQAA 3MQ9A 1MDQA 2Z8DA 5AA2D 3L6HA 4NWCA 4LVQA 1TT1A 2V3TA 4RY1A 1PDAA 4QSCA 2RCBA 4G4PA 4ZECA 3EHTA 2FYIA 3KSJA 1MY0A 1VFDA 3A3CA 4NF6A 1GGGA 2REGA 4KQPA 1A55A 3LUYA 3BFTA 1I6BA 1O7TA 5EHMA 3FV2A 4KFQA 3GLBA 4POXA 2HCAA 3FJGA 2KLFA 1FTOA 4NF8B 1NNTA 4LQ5A 3LBSA 1N3XA 4L17A 3IAZA 1NH7A 3UIFA 2GRVA 2UVJA 1BLFA 3KFMA 3OXNA 3KJTA 4X1BA 2O68A 3C33A 5BWJA 1LAFE 1MQJA 2FNCA 4FE8A 3RQTA 1MH3A 4C0RA 2D3IA 5JEIA 1OLAA 2Y7KA 1FTKA 2GHBA 2HAUA 1QUIA 2H9BA 2DWJA 4IO3A 1FQFA 1USYH 1PBPA 3U8QA 4BDNA 4R6KA 1ATGA 4R74A 2V93A 2Z8FA 4NF5B 1OQHA 3IK6B 2H99A 1B6HA 3SKPA 4RK2A 3K1NA 1SYIA 2H5YA 1GR2A 4F3BA 1US5A 5FHOA 3TAJA 4AQ4A 4YB7A 3W9WA 4HS7A 2PVUA 5CBSA 1Z7ME 4QFLA 3RTFB 3KJ7A 1LFHA 1ZBMA 3B7DA 4R6HA 3TEPA 5JK4A 1R9QA 4GLIA 3RT6B 1Q35A 4IB2A 2QMXA 4OQOA 4JWOA 1NMUA 3KOSA 4G2ZA 4LP2B 1POY1 2UYEA 1QJMA 1FQDA 1Y1ZA 4C1TA 4MF3A 4YZZA 3VXBA 1N3WA 5HM4B 3QXMA 4JSDA 4OTEA 5I2NA 1L5TA 3MBPA 4HW8A 1P1QA 4NF4A 4AB6A 3KN8A 2R9JA 1B46A 3TELA 1B0LA 2DE3A 1UIUA 4XKPA 4EQBA 4JWYA 2Z22A 4EQ7A 1LAHE 5FHNA 1QUKA 2DXRA 3MVZA 3V83A 4H8IA 2DXYA 3OD7A 5ICQA 2M8CA 1SD3A 1SW2A 5KDTB 1D9VA 4GVOA 1LB9A 1R9LA 3IR1A 4PE5B 3PGFA 1BP5A 5AA2A 4THIA 4GFRA 3N6UA 4FEDA 1P1UA 4ELQA 4FECA 3IJOB 5K2XA 4GQOA 4ISUA 4U4XA 4NWDA 3FXQA 2UXAA 3TTLA 3KEIA 1DPPA 1LLSA 3S9EA 4RK9A 3RY3A 1CE2A 1POTA 3CG3A 1LFIA 1B7ZA 4MLQA 2PYYA 4Z7EA 2F97A 1GV8A 2DQVA 2F5XA 1I69A 3PUWE 4OVJA 1IZ1A 2DOJA 5DVFA 3KGCA 3G7WA 1URDA 3OO6A 2XXQA 3C4MA 4DXUA 4OENA 3IB2A 1JNFA 1I6QA 1B5JA 4H6DA 3N94A 4GXSB 5CRYA 3SERA 2VOZA 3FXUA 4HCYA 3H6UA 3TQLA 2VD2A 2ZYKA 3VLVA 1XC1A 3AXFA 4OXVA 2RINA 3PUVE 1OVBA 3H03A 3RT8A 2DWIA 4H5FA 3ONMA 2F34A 3H4ZA 3S4UA 2XXVA 3MW0A 3LC8A 2H98A 4EDPA 1WDNA 4YAHX 4EF2A 2A5SA 4YICA 3OO7A 2F78A 4GF8A 1B5IA 1PB7A 1P99A 1B5HA 3PPOA 5I57B 3SEYA 2FA7A 3K2DA 2F6GA 1SW5A 4QRZA 1EU8A 2DE2A 2HEUA 4DLDA 1OVTA 4LA9A 1B2HA 3H06B 3Q25A 4RA1A 5H8HA 3DP4A 3QIMA 3MP1A 1SBPA 4C1UA 2HXWA 3ECRA 4PFWA 2I6EA 3FVNA 2V3QA 4JDFA 1N0TA 4FORA 1MXVA 3VVEA 2I3WA 1DPEA 3VFJA 1IXHA 3CIJA 4OEUA 4OZ9A 4I9DA 1DSNA 3G3FA 2F7CA 4U2RA 4I1DA 1M5DA 4JWXA 4POWA 5FHMA 2OJTA 3O29A 1QVSA 3M3LA 5H8QB 3A3UA 1YTVA 3U92A 4ZE9A 4QFOA 3PPPA 4TLLB 3DELB 3OEMA 4UA8A 2ZYNA 4IY5A 4DDDA 3RNNA 3TDJA 3JZJA 5DEXB 5HPQA 1HSLA 2PT2A 2O6AA 4IO2A 3MJNA 1ZIUA 1S50A 3C32A 4F3PA 3G3HA 3UGWA 2XXHA 1N7WA 1A99A 2PMSA 3EPEA 2NOOA 2XXXA 3SEWA 4OFJA 3OSRA 4YKKA 2Q2AA 1H76A 2Q2CA 3H3GA 4FIMA 3DP8A 5L9OA 1AH5A 4F29A 2ABHA 1EZPA 2DWAA 3TTRA 3FJ7A 3MUQA 1LCFA 1JQFA 1B58A 2F36A 3VVFA 4OYVA 1QKAA 3C36A 4NF8A 1LCTA 3GBBA 2I0BA 1JVYA 3TFLA 3OSQA 1PB8A 4Q5TA 1XVYA 2I3VA 4PFTA 3S9LC 1B3LA 3QYTA 4R72A 3HCQA 3O6GA 1WODA 3EHSA 3C34A 1Y4TA 4EXKA 4XKRA 1XS5A 4OHNA 3IOTA 3MZBA 1A54A 1II5A 1ANFA 3DP6A 3O97A 4ND9A 3GXAA 4ESXA 3MZ1A 1QULA 1XHYA 3MPKA 1SW4A 3VE1B 3HV1A 2HQ0A 5AE4A 1FTMA 3Q28A 1MRPA 2ZXTA 4AB5A 1TFDA 5KCJB 1MPCA 3G3GA 2CMOA 1M5FA 4H0WA 1MDP1 1QKBA 4RNSA 5L8DA 4OERA 2Q9TA 5BUUA 1B3FA 1TWYA 5TPAB 1AL3A 5K2YA 2DSFA 2D21A 4QFKA 4ZE8A 2QS4A 2ZMBA 1AIVA 4KCCA 1ZTYA 3KOTA 1NNPA 3QAXA 1B51A 4G8HA 1H3DA 1OMPA 1FQEA 3MVWA 2E0SA 5EYFA 1LFGA 3IO4A 3T93B 2OBGA 3GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAO A;  1MQD A;  4E0X A;  3DLN A;  3CRB A;  1S7Y A;  3IO6 A;  3OEK A;  3T9H B;  1IQ7 A;  1MM6 A;  3IOW A;  3P7I A;  1URS A;  5ICT A;  3TTK A;  4NF6 B;  4KD5 A;  5A5X B;  4KYD A;  1Z7N E;  2A5T A;  1UTH B;  2ONR A;  2YPN A;  1N7X A;  4OEV A;  5CC2 A;  4KYS A;  4GOT A;  4N13 A;  2I49 A;  3FAT A;  5ELV A;  3O28 A;  4IO6 A;  1B52 A;  2F35 A;  1PBQ A;  3DM0 A;  1PC3 A;  1SVX B;  2GFE A;  4RPN A;  3ZSF A;  3ZKL A;  3IOR A;  4F1Y A;  2V3U A;  1Y1M A;  3M8U A;  3K6X A;  2F7B A;  1OLC A;  2QMW A;  3IOV A;  3B6Q A;  4IY6 A;  3IB0 A;  3K1P A;  3TMG A;  3MPL A;  2QL3 A;  3PU5 A;  3BBR A;  3C35 A;  2GHA A;  4G68 B;  5I2K A;  2B3B A;  3KZG A;  5AA4 B;  4DXC A;  1FQB A;  1M5C A;  1QUJ A;  1LAX A;  1IIT A;  1MQG A;  2F7A A;  3G3K A;  1M5E A;  4YMB A;  3B6W A;  3R26 A;  3KSX A;  3T66 A;  3IJX B;  3TOD A;  3PUX E;  2F6P A;  1XOC A;  2XX7 A;  4P0G A;  1YPN A;  3EF7 A;  2Y84 A;  1LB8 A;  5L9M A;  4F3S A;  3G3I A;  3E9X A;  4QFP A;  2OK2 A;  4XKN A;  1RYX A;  1Y4C A;  3HO7 A;  3FIR A;  3VDF A;  4LUB A;  2AIX A;  3Q27 A;  3RGY A;  3S2V A;  4BDO A;  3K00 A;  2RF1 A;  3O6I A;  4GL0 A;  3FVK A;  3PMV A;  4N07 A;  3LSW A;  4QSD A;  2DVC A;  1AMF A;  5I2N B;  1FCK A;  1Y9U A;  4NF4 B;  2RC8 A;  2R71 A;  1D4N A;  5JTY B;  3N6T A;  4PP0 A;  1B9J A;  4MBP A;  1USY E;  3CSG A;  4OMB A;  3EHU A;  5DVI A;  3UP9 A;  3FVO A;  2I48 A;  1MS7 A;  3SET A;  4F22 A;  2V25 A;  1DTG A;  2YJP A;  2H4I A;  1N04 A;  3CSB A;  3K0V A;  1DMB A;  4X1D A;  4HCW A;  2ZNT A;  4F2O A;  2ANJ A;  3OO9 A;  2O7I A;  1JW4 A;  4WKM A;  2XD2 A;  1UTB B;  4O3C A;  4DCX A;  5AA2 B;  5I56 A;  3MVY A;  5H8N B;  4TLM B;  3O6H A;  4ELP A;  4TOZ A;  5CMK A;  4I8C A;  2Y7P A;  5HBC A;  4KYE A;  1O64 A;  3PV0 E;  2G93 A;  4PFU A;  1MXY A;  2O1M A;  1A7L A;  1JEV A;  2W7Y A;  4PQJ A;  1BIY A;  4F2Q A;  3FAS A;  3W9V A;  2E1S A;  3K4U A;  4DCY A;  4X48 A;  2XXW A;  3LSX A;  1Y3P A;  4X9T A;  5H8F A;  5CMB A;  5I59 A;  4ZZA A;  3LSL A;  4R2B A;  2Q89 A;  5L9S A;  2O69 A;  3MVX A;  3OO8 A;  5KZT A;  4YU0 A;  4ONY A;  2PT1 A;  1B40 A;  3PPN A;  1JW1 A;  4ZEF A;  4MLV A;  4O3A A;  2WKY A;  3ODB A;  4IO7 A;  4ZED A;  3PPR A;  2QS1 A;  1R1N A;  5FTH A;  1F9B A;  5DYH A;  1ZU0 A;  4U4S A;  5I58 A;  3TCF A;  1MXX A;  3UOR A;  3T9V A;  3CFL A;  4ZEK A;  3I5O A;  5CI5 A;  4LON B;  1B3E A;  2XXT A;  2D5W A;  2VP1 A;  2O51 A;  4UAC A;  1QW0 A;  4XXU A;  3N26 A;  3I3V A;  1MXZ A;  2HZL A;  4GRK A;  1S9T A;  5IKB A;  4ZEI A;  5M2V A;  3CI8 A;  3IL1 B;  4F1U A;  3QUF A;  1B1H A;  1YAE A;  5CBR A;  4P0I A;  5TP9 A;  1ZMG A;  2Z23 A;  1RKM A;  3HHG A;  2Y7W A;  4H5G A;  4R73 A;  3T96 B;  1MG1 A;  3WAF A;  3FVG A;  2OWS A;  1P1O A;  3BKI B;  4LQ2 A;  2F8D A;  3FUZ A;  3HPI A;  1EH3 A;  3USD A;  2ESN A;  1ZJL A;  3R7X A;  1H45 A;  5H8H B;  3Q26 A;  2QJE A;  2NXO A;  4GXA A;  4U22 A;  1MXU A;  2OZZ A;  2H25 A;  5AA1 A;  1FW0 A;  4F31 B;  1B7U A;  1UIV A;  4LAT A;  2RC7 A;  1SDX A;  5DTB A;  2ZYO A;  4EF1 A;  3FZV A;  2Y7R A;  4GWO A;  3M3K A;  3Q29 A;  3TTM A;  1JEU A;  2PBW A;  3PUY E;  4ZS9 A;  4M1V A;  2XXY A;  1J1N A;  5EHS A;  3EQ1 A;  2I58 A;  2ZNU A;  1JET A;  2R6G E;  5TPA A;  5J1D A;  4JXI A;  2AL4 A;  4OFL A;  2O1L A;  3ZS6 A;  2IA4 A;  4QF9 A;  4BDR A;  5ITO A;  4DZ1 A;  4LZ5 A;  3LR1 A;  4ZZE A;  4G77 A;  4RYA A;  4H1X A;  3TCH A;  2Q8J A;  3C9H A;  1BTJ A;  3SEX A;  1R6Z A;  2NWJ A;  5TU0 A;  2QS3 A;  1HSJ A;  2B65 A;  1SI1 A;  2YLN A;  2OCU A;  3H6T A;  1Q1K A;  3O66 A;  1B3G A;  4NF5 A;  3U72 A;  3RPW A;  2HAV A;  3U93 A;  3B6T A;  1SQY A;  1MQI A;  4G8M A;  4PET A;  3K1M A;  2OWT A;  1SYH A;  4R75 A;  5ITP A;  2B3F A;  4WED A;  3LSF B;  4G68 C;  4R6Y A;  5A5X A;  1UTH A;  3V89 B;  2P2A A;  4YKI A;  2I4B A;  5B70 A;  1MXW A;  1N76 A;  2XXR A;  1O63 A;  1B3H A;  2NVU B;  2DYX A;  1B7H A;  4XTC Q;  1B4H A;  1IXI A;  1IXG A;  3FJM A;  3H6V A;  3TYH A;  2QRY A;  2THI A;  4DIG A;  1MY1 A;  4EXL A;  4Q0C A;  1VFE A;  4H65 A;  4P11 A;  1EZ9 A;  4F19 A;  3HST A;  2X7Q A;  1XT8 A;  3TQW A;  4O3B A;  1AOV A;  4G68 A;  5AA4 A;  3KN3 A;  3MC2 A;  3PD8 A;  1MY4 A;  5F7V A;  5I84 A;  1NNF A;  4F18 A;  1URG A;  5KDT A;  1Y3N A;  3C31 A;  1D3K A;  2X7P A;  4NMY A;  3VV5 A;  3FV1 A;  3PMW A;  5FTI A;  4YKP A;  3K01 A;  3VVD A;  4KR5 A;  3PD9 A;  3HN0 A;  4RJZ A;  2CZL A;  3IOU A;  2QPQ A;  2XD3 A;  3IB1 A;  2I0C A;  2QS2 A;  4GIZ A;  3OOA A;  2P1S A;  3UN6 A;  4BLA A;  3GBA A;  1B05 A;  1ELJ A;  3RTW B;  4R2F A;  4U21 A;  2Q88 A;  4Z0I A;  1CB6 A;  3O2A A;  4MFI A;  3VXC A;  5CMM A;  3RUM A;  1IEJ A;  3CFX A;  4LZ7 A;  3V5A A;  2DWH A;  3D4C A;  3H6W A;  3SDF A;  3S9N C;  1LST A;  1MY2 A;  4RPO A;  4KHZ E;  4FAT A;  3FD3 A;  1P1W A;  3CR9 A;  4NTL A;  1PEB A;  1PB9 A;  3EN3 A;  5JTY A;  3ZKK A;  3F11 A;  5H8S A;  2XXI A;  4FJP A;  4KPT A;  5IAI A;  4ECF A;  3U94 A;  5LOM A;  2REJ A;  3CFZ A;  1MY3 A;  1B32 A;  1A40 A;  2A5T B;  3MZ9 A;  4NE4 A;  1H44 A;  1FTL A;  4QFN A;  3E4R A;  1JVX A;  4U1O A;  5ISU A;  3K6U A;  2VHA A;  1N84 A;  4U1Z A;  1FTJ A;  4DXB A;  1UTB A;  4N6P A;  1A8F A;  5DVJ A;  2NUV A;  5H8N A;  2ALU A;  1A8E A;  2BJJ X;  4BDM A;  4FAJ A;  2Y7I A;  3R6U A;  4YB5 A;  3QSL A;  3H7M A;  3V8X B;  1MPD A;  1DOT A;  2HFB A;  4OET A;  2V84 A;  2QSX A;  3A09 A;  3ILU B;  3O9P A;  5I57 A;  3CVG A;  3QUJ A;  3RLF E;  1ZLQ A;  4F3G A;  3BFU A;  2DS9 A;  4GL8 A;  1P1N A;  1LGB C;  1US4 A;  2GH9 A;  5CMC A;  5AA3 A;  5I2K B;  3TTN A;  3T22 A;  2ZNS A;  1NH8 A;  3KG2 A;  4K3F A;  3U1O A;  4XKQ A;  4OWD A;  1VR5 A;  3OEL A;  4IO4 A;  5F1Q A;  1BKA A;  3JV9 A;  1YCJ A;  1LAG E;  3MWB A;  1OIB A;  2IEE A;  4LZ8 A;  3D4G A;  4Q30 B;  4FEB A;  2UVG A;  4JBZ A;  4ELR A;  3E13 X;  2UYF A;  3OMB A;  3TKD A;  4EQ9 A;  1HSE A;  1M5B A;  2PX1 A;  4H67 A;  4H8J A;  3FGS A;  1H43 A;  1VE4 A;  3SES A;  1LBB A;  3S9M C;  4DE8 A;  3TCG A;  2P0S A;  5H8Q A;  4IGT A;  4QHQ A;  4GD5 A;  4U23 A;  3PPQ A;  1GVC A;  3QK6 A;  3UA8 A;  4ELO A;  1ZKB A;  4JSO A;  4HTG A;  1LBC A;  2AYS A;  1GTK A;  3MP8 A;  1Y20 A;  3G3J A;  1XVX A;  5DEX A;  4OFO A;  3PMX A;  1TFA A;  2OLB A;  2DVZ A;  4R9G A;  2HZK A;  1NNK A;  3K02 A;  4XIG Q;  1JW5 A;  4BDL A;  2AL5 A;  3TPA A;  1B1X A;  4KI0 E;  3CG1 A;  1MM7 A;  2RCA A;  4TQU Q;  1WVJ A;  1RYO A;  4IGR A;  3SEV A;  4I62 A;  4E0W A;  3E3K A;  3L6G A;  1SW1 A;  1B4Z A;  4MH5 A;  3T9X B;  2DP8 A;  2ONS A;  1TXF A;  4WEP A;  1IUD A;  5I56 B;  3PUZ E;  3UK4 A;  2XXP A;  3I6V A;  1I6A A;  1NL5 A;  3W15 C;  3N5L A;  4RXL A;  3VLW A;  4ESW A;  4Q8R A;  3JYR A;  4KCD A;  1KWH A;  4WXJ A;  1OQG A;  3MAM A;  3SEU A;  1B0H A;  2RKM A;  1IXC A;  3ILT B;  3K6V A;  2G29 A;  1UQW A;  3IX1 A;  3KN7 A;  3WAE A;  2ONK E;  2UVH A;  3KBR A;  5H8F B;  2ZYM A;  3T9U A;  5I59 B;  1FQC A;  4IO5 A;  2XHD A;  1SI0 A;  1Y3Q A;  4ZEB A;  4YKJ A;  2XX9 A;  4M4G A;  3MP6 A;  4F39 A;  2VGQ A;  4F1V A;  4ZDM A;  2UVI A;  1VSO A;  3M3F A;  2O84 X;  1IIW A;  2O7U A;  3VLU A;  1NKX A;  4OES A;  4QSE A;  5I58 B;  4BDQ A;  5KCJ A;  2XXU A;  3K6W A;  1MQH A;  3THI A;  4JB7 A;  1MPB A;  4EUO A;  4YMA A;  4NED A;  1DTZ A;  2Z8E A;  2XX8 A;  2DE4 A;  4R9F A;  1EZO A;  1NFT A;  2RC9 A;  3RN8 A;  4G8N A;  2I4C A;  4PFY A;  1T0K A;  2VD3 A;  4YB6 A;  3HHF A;  5CM6 A;  5TP9 B;  2X26 A;  1MH4 A;  5DT6 A;  3FXR A;  3TUS A;  1D9Y A;  3OEN A;  3TZA A;  5B7D A;  1FQA A;  3MQ9 A;  1MDQ A;  2Z8D A;  5AA2 D;  3L6H A;  4NWC A;  4LVQ A;  1TT1 A;  2V3T A;  4RY1 A;  1PDA A;  4QSC A;  2RCB A;  4G4P A;  4ZEC A;  3EHT A;  2FYI A;  3KSJ A;  1MY0 A;  1VFD A;  3A3C A;  4NF6 A;  1GGG A;  2REG A;  4KQP A;  1A55 A;  3LUY A;  3BFT A;  1I6B A;  1O7T A;  5EHM A;  3FV2 A;  4KFQ A;  3GLB A;  4POX A;  2HCA A;  3FJG A;  2KLF A;  1FTO A;  4NF8 B;  1NNT A;  4LQ5 A;  3LBS A;  1N3X A;  4L17 A;  3IAZ A;  1NH7 A;  3UIF A;  2GRV A;  2UVJ A;  1BLF A;  3KFM A;  3OXN A;  3KJT A;  4X1B A;  2O68 A;  3C33 A;  5BWJ A;  1LAF E;  1MQJ A;  2FNC A;  4FE8 A;  3RQT A;  1MH3 A;  4C0R A;  2D3I A;  5JEI A;  1OLA A;  2Y7K A;  1FTK A;  2GHB A;  2HAU A;  1QUI A;  2H9B A;  2DWJ A;  4IO3 A;  1FQF A;  1USY H;  1PBP A;  3U8Q A;  4BDN A;  4R6K A;  1ATG A;  4R74 A;  2V93 A;  2Z8F A;  4NF5 B;  1OQH A;  3IK6 B;  2H99 A;  1B6H A;  3SKP A;  4RK2 A;  3K1N A;  1SYI A;  2H5Y A;  1GR2 A;  4F3B A;  1US5 A;  5FHO A;  3TAJ A;  4AQ4 A;  4YB7 A;  3W9W A;  4HS7 A;  2PVU A;  5CBS A;  1Z7M E;  4QFL A;  3RTF B;  3KJ7 A;  1LFH A;  1ZBM A;  3B7D A;  4R6H A;  3TEP A;  5JK4 A;  1R9Q A;  4GLI A;  3RT6 B;  1Q35 A;  4IB2 A;  2QMX A;  4OQO A;  4JWO A;  1NMU A;  3KOS A;  4G2Z A;  4LP2 B;  1POY 1;  2UYE A;  1QJM A;  1FQD A;  1Y1Z A;  4C1T A;  4MF3 A;  4YZZ A;  3VXB A;  1N3W A;  5HM4 B;  3QXM A;  4JSD A;  4OTE A;  5I2N A;  1L5T A;  3MBP A;  4HW8 A;  1P1Q A;  4NF4 A;  4AB6 A;  3KN8 A;  2R9J A;  1B46 A;  3TEL A;  1B0L A;  2DE3 A;  1UIU A;  4XKP A;  4EQB A;  4JWY A;  2Z22 A;  4EQ7 A;  1LAH E;  5FHN A;  1QUK A;  2DXR A;  3MVZ A;  3V83 A;  4H8I A;  2DXY A;  3OD7 A;  5ICQ A;  2M8C A;  1SD3 A;  1SW2 A;  5KDT B;  1D9V A;  4GVO A;  1LB9 A;  1R9L A;  3IR1 A;  4PE5 B;  3PGF A;  1BP5 A;  5AA2 A;  4THI A;  4GFR A;  3N6U A;  4FED A;  1P1U A;  4ELQ A;  4FEC A;  3IJO B;  5K2X A;  4GQO A;  4ISU A;  4U4X A;  4NWD A;  3FXQ A;  2UXA A;  3TTL A;  3KEI A;  1DPP A;  1LLS A;  3S9E A;  4RK9 A;  3RY3 A;  1CE2 A;  1POT A;  3CG3 A;  1LFI A;  1B7Z A;  4MLQ A;  2PYY A;  4Z7E A;  2F97 A;  1GV8 A;  2DQV A;  2F5X A;  1I69 A;  3PUW E;  4OVJ A;  1IZ1 A;  2DOJ A;  5DVF A;  3KGC A;  3G7W A;  1URD A;  3OO6 A;  2XXQ A;  3C4M A;  4DXU A;  4OEN A;  3IB2 A;  1JNF A;  1I6Q A;  1B5J A;  4H6D A;  3N94 A;  4GXS B;  5CRY A;  3SER A;  2VOZ A;  3FXU A;  4HCY A;  3H6U A;  3TQL A;  2VD2 A;  2ZYK A;  3VLV A;  1XC1 A;  3AXF A;  4OXV A;  2RIN A;  3PUV E;  1OVB A;  3H03 A;  3RT8 A;  2DWI A;  4H5F A;  3ONM A;  2F34 A;  3H4Z A;  3S4U A;  2XXV A;  3MW0 A;  3LC8 A;  2H98 A;  4EDP A;  1WDN A;  4YAH X;  4EF2 A;  2A5S A;  4YIC A;  3OO7 A;  2F78 A;  4GF8 A;  1B5I A;  1PB7 A;  1P99 A;  1B5H A;  3PPO A;  5I57 B;  3SEY A;  2FA7 A;  3K2D A;  2F6G A;  1SW5 A;  4QRZ A;  1EU8 A;  2DE2 A;  2HEU A;  4DLD A;  1OVT A;  4LA9 A;  1B2H A;  3H06 B;  3Q25 A;  4RA1 A;  5H8H A;  3DP4 A;  3QIM A;  3MP1 A;  1SBP A;  4C1U A;  2HXW A;  3ECR A;  4PFW A;  2I6E A;  3FVN A;  2V3Q A;  4JDF A;  1N0T A;  4FOR A;  1MXV A;  3VVE A;  2I3W A;  1DPE A;  3VFJ A;  1IXH A;  3CIJ A;  4OEU A;  4OZ9 A;  4I9D A;  1DSN A;  3G3F A;  2F7C A;  4U2R A;  4I1D A;  1M5D A;  4JWX A;  4POW A;  5FHM A;  2OJT A;  3O29 A;  1QVS A;  3M3L A;  5H8Q B;  3A3U A;  1YTV A;  3U92 A;  4ZE9 A;  4QFO A;  3PPP A;  4TLL B;  3DEL B;  3OEM A;  4UA8 A;  2ZYN A;  4IY5 A;  4DDD A;  3RNN A;  3TDJ A;  3JZJ A;  5DEX B;  5HPQ A;  1HSL A;  2PT2 A;  2O6A A;  4IO2 A;  3MJN A;  1ZIU A;  1S50 A;  3C32 A;  4F3P A;  3G3H A;  3UGW A;  2XXH A;  1N7W A;  1A99 A;  2PMS A;  3EPE A;  2NOO A;  2XXX A;  3SEW A;  4OFJ A;  3OSR A;  4YKK A;  2Q2A A;  1H76 A;  2Q2C A;  3H3G A;  4FIM A;  3DP8 A;  5L9O A;  1AH5 A;  4F29 A;  2ABH A;  1EZP A;  2DWA A;  3TTR A;  3FJ7 A;  3MUQ A;  1LCF A;  1JQF A;  1B58 A;  2F36 A;  3VVF A;  4OYV A;  1QKA A;  3C36 A;  4NF8 A;  1LCT A;  3GBB A;  2I0B A;  1JVY A;  3TFL A;  3OSQ A;  1PB8 A;  4Q5T A;  1XVY A;  2I3V A;  4PFT A;  3S9L C;  1B3L A;  3QYT A;  4R72 A;  3HCQ A;  3O6G A;  1WOD A;  3EHS A;  3C34 A;  1Y4T A;  4EXK A;  4XKR A;  1XS5 A;  4OHN A;  3IOT A;  3MZB A;  1A54 A;  1II5 A;  1ANF A;  3DP6 A;  3O97 A;  4ND9 A;  3GXA A;  4ESX A;  3MZ1 A;  1QUL A;  1XHY A;  3MPK A;  1SW4 A;  3VE1 B;  3HV1 A;  2HQ0 A;  5AE4 A;  1FTM A;  3Q28 A;  1MRP A;  2ZXT A;  4AB5 A;  1TFD A;  5KCJ B;  1MPC A;  3G3G A;  2CMO A;  1M5F A;  4H0W A;  1MDP 1;  1QKB A;  4RNS A;  5L8D A;  4OER A;  2Q9T A;  5BUU A;  1B3F A;  1TWY A;  5TPA B;  1AL3 A;  5K2Y A;  2DSF A;  2D21 A;  4QFK A;  4ZE8 A;  2QS4 A;  2ZMB A;  1AIV A;  4KCC A;  1ZTY A;  3KOT A;  1NNP A;  3QAX A;  1B51 A;  4G8H A;  1H3D A;  1OMP A;  1FQE A;  3MVW A;  2E0S A;  5EYF A;  1LFG A;  3IO4 A;  3T93 B;  2OBG A;  3GZG A; 
#chains in the Genus database with same CATH topology
 2LAO A;  1MQD A;  4E0X A;  3DLN A;  3CRB A;  1S7Y A;  3FBP A;  3IO6 A;  4NQ8 A;  1FJ9 A;  3OEK A;  3T9H B;  1IQ7 A;  1MM6 A;  1NV2 A;  3IOW A;  3P7I A;  1URS A;  5ICT A;  1NV3 A;  4JVI A;  2MKZ A;  2FBP A;  3TTK A;  4NF6 B;  4KD5 A;  5A5X B;  4KYD A;  1Z7N E;  2A5T A;  1UTH B;  2ONR A;  4PCD A;  2YPN A;  1N7X A;  4OEV A;  3T0J A;  5CC2 A;  4KYS A;  4GOT A;  1YZ0 A;  4N6D A;  4N13 A;  2I49 A;  3FAT A;  4N15 A;  5ELV A;  1LEV A;  3O28 A;  4IO6 A;  1B52 A;  2F35 A;  1PBQ A;  3DM0 A;  1PC3 A;  4NG7 A;  3B8B A;  1SVX B;  4OVQ A;  2GFE A;  4RPN A;  1K9Z A;  3ZSF A;  3ZKL A;  3IOR A;  4F1Y A;  2V3U A;  1Y1M A;  4GX3 A;  4PGP A;  3M8U A;  3K6X A;  2F7B A;  1OLC A;  2QMW A;  3IOV A;  3B6Q A;  4IY6 A;  3IB0 A;  3K1P A;  3TMG A;  3MPL A;  2QL3 A;  3PU5 A;  3BBR A;  3C35 A;  2GHA A;  4G68 B;  5I2K A;  2B3B A;  3KZG A;  5AA4 B;  4DXC A;  1FQB A;  1M5C A;  1QUJ A;  1LAX A;  1IIT A;  1MQG A;  2F7A A;  3G3K A;  3SZP A;  1M5E A;  4YMB A;  3B6W A;  3E79 A;  2GQ1 A;  3R26 A;  3KSX A;  3T66 A;  3IJX B;  3TOD A;  3PUX E;  2F6P A;  1XOC A;  2XX7 A;  5EQ9 A;  5IM2 A;  4P0G A;  1YPN A;  3EF7 A;  4PBH A;  2Y84 A;  1LB8 A;  5L9M A;  4HE0 A;  4F3S A;  3G3I A;  4X04 A;  3E9X A;  4QFP A;  5ET6 A;  1FPD A;  2OK2 A;  4XKN A;  1NI9 A;  1RYX A;  1Y4C A;  3HO7 A;  3FIR A;  3VDF A;  4LUB A;  2AIX A;  5DW8 A;  3Q27 A;  3RGY A;  3S2V A;  4BDO A;  2L5V A;  3K00 A;  2RF1 A;  3O6I A;  4GL0 A;  3FVK A;  3PMV A;  2P3N A;  2CZH A;  4N07 A;  3LSW A;  4QSD A;  2DVC A;  1AMF A;  5I2N B;  1FCK A;  1Y9U A;  4NF4 B;  2RC8 A;  5ET5 A;  2R71 A;  4G61 A;  1D4N A;  5JTY B;  3N6T A;  4PP0 A;  1B9J A;  4OVS A;  4MBP A;  1USY E;  3CSG A;  4OMB A;  3EHU A;  5DVI A;  3UP9 A;  5I7I A;  3FVO A;  2I48 A;  1MS7 A;  3SET A;  4F22 A;  4O7M A;  2V25 A;  1DTG A;  2YJP A;  4NX1 A;  2H4I A;  1N04 A;  3CSB A;  3K0V A;  1DMB A;  4X1D A;  4HCW A;  2ZNT A;  4F2O A;  2ANJ A;  3OO9 A;  2O7I A;  1JW4 A;  4WKM A;  2XD2 A;  5EQ8 A;  1UTB B;  4O3C A;  4NF0 A;  4DCX A;  5AA2 B;  5I56 A;  3MVY A;  5H8N B;  4TLM B;  5IZ3 B;  3O6H A;  4GWU A;  4ELP A;  4PAF A;  4TOZ A;  5CMK A;  3KBZ A;  4I8C A;  2Y7P A;  5HBC A;  4KYE A;  1O64 A;  3PV0 E;  2G93 A;  4PFU A;  1MXY A;  2O1M A;  1A7L A;  1JEV A;  4DI3 D;  2W7Y A;  4PQJ A;  1BIY A;  4F2Q A;  3FAS A;  3W9V A;  2E1S A;  3K4U A;  4DCY A;  4X48 A;  5ET7 A;  2XXW A;  3LSX A;  1Y3P A;  4X9T A;  5H8F A;  4PF6 A;  5CMB A;  4GBW A;  5I59 A;  4ZZA A;  3LSL A;  4R2B A;  2Q89 A;  5L9S A;  2O69 A;  3MVX A;  3OO8 A;  5KZT A;  4YU0 A;  4MJO A;  4ONY A;  2PT1 A;  1B40 A;  3PPN A;  1JW1 A;  4ZEF A;  1FBH A;  4MLV A;  4O3A A;  1DBZ A;  4XEQ A;  2Q8M A;  2WKY A;  3ODB A;  4IO7 A;  4ZED A;  3PPR A;  2QS1 A;  5LDZ A;  1R1N A;  5FTH A;  1F9B A;  5DYH A;  1ZU0 A;  4U4S A;  5I58 A;  3TCF A;  1MXX A;  3UOR A;  3T9V A;  3CFL A;  3RYD A;  4ZEK A;  3LUZ A;  3I5O A;  1NV4 A;  5CI5 A;  4LON B;  1B3E A;  5A5L A;  2XXT A;  2D5W A;  4GWW A;  5F24 A;  2VP1 A;  2O51 A;  4GWS A;  4UAC A;  1QW0 A;  4XXU A;  3N26 A;  3I3V A;  1MXZ A;  2HZL A;  4GRK A;  1S9T A;  5IKB A;  4ZEI A;  5M2V A;  3CI8 A;  3IL1 B;  4F1U A;  3QUF A;  1LBW A;  1B1H A;  1YAE A;  5CBR A;  4P0I A;  5TP9 A;  1ZMG A;  1IMC A;  5EQA A;  2CEX A;  4PAK A;  2Z23 A;  1RKM A;  3HHG A;  3RPL A;  2Y7W A;  4H5G A;  4R73 A;  4PFB A;  3T96 B;  1FSA A;  1MG1 A;  3WAF A;  3FVG A;  2OWS A;  1P1O A;  3BKI B;  4LQ2 A;  2F8D A;  1FPG A;  3FUZ A;  3HPI A;  1EH3 A;  5EYH A;  3USD A;  2ESN A;  3KC0 A;  1ZJL A;  3R7X A;  1H45 A;  5H8H B;  3Q26 A;  2QJE A;  2NXO A;  4GXA A;  4U22 A;  1MXU A;  5IGA A;  1KZ8 A;  2OZZ A;  2H25 A;  5AA1 A;  1FW0 A;  4F31 B;  1B7U A;  2QVR A;  2VPO A;  1UIV A;  4LAT A;  2RC7 A;  1SDX A;  5DTB A;  2ZYO A;  4EF1 A;  1FRP A;  3KC1 A;  4NGU A;  3FZV A;  2Y7R A;  1NUY A;  4GWO A;  3M3K A;  3Q29 A;  4QXD A;  3TTM A;  3CHG A;  1JEU A;  3IFA A;  2QVU A;  2FIE A;  2PBW A;  3PUY E;  4ZS9 A;  4M1V A;  2XXY A;  1J1N A;  5EHS A;  3EQ1 A;  2I58 A;  2ZNU A;  1EYK A;  1JET A;  2R6G E;  2VPN A;  5TPA A;  1NV5 A;  5J1D A;  4JXI A;  2AL4 A;  4MIJ A;  4OFL A;  2O1L A;  3ZS6 A;  2IA4 A;  4QF9 A;  4BDR A;  5ITO A;  4DZ1 A;  4LZ5 A;  3LR1 A;  4ZZE A;  4G77 A;  3HFU A;  4RYA A;  4H1X A;  3TCH A;  1EYI A;  2Q8J A;  2WYK A;  3C9H A;  1BTJ A;  2WBB A;  3SEX A;  1R6Z A;  2NWJ A;  5TU0 A;  2QS3 A;  1HSJ A;  2B65 A;  1SI1 A;  2YLN A;  2OCU A;  3H6T A;  1Q1K A;  3O66 A;  2HXR A;  1CNQ A;  1B3G A;  4NF5 A;  3U72 A;  3RPW A;  2HAV A;  3U93 A;  3B6T A;  1SQY A;  1MQI A;  4G8M A;  2QVV A;  4PET A;  3K1M A;  2OWT A;  1SYH A;  4R75 A;  5ITP A;  2B3F A;  4WED A;  3U65 A;  3LSF B;  4G68 C;  4R6Y A;  4PDH A;  5A5X A;  1UTH A;  3V89 B;  2P2A A;  4YKI A;  2OX3 A;  2I4B A;  5B70 A;  1MXW A;  1N76 A;  2XXR A;  1O63 A;  1B3H A;  2NVU B;  2DYX A;  1B7H A;  4XTC Q;  1B4H A;  1IXI A;  1IXG A;  3FJM A;  3H6V A;  4IR8 A;  3TYH A;  2QRY A;  2THI A;  1LBX A;  3T1B A;  4GWY A;  4DIG A;  1MY1 A;  4EXL A;  2Y5K A;  4Q0C A;  1VFE A;  4H65 A;  4P11 A;  1K9Y A;  4GX6 A;  1NUW A;  1EZ9 A;  4GWX A;  1IMF A;  4F19 A;  3HST A;  2X7Q A;  1XT8 A;  1YXI A;  3TQW A;  4O3B A;  1AOV A;  4G68 A;  5AA4 A;  3KN3 A;  3MC2 A;  3PD8 A;  1MY4 A;  1D9Q A;  5F7V A;  5I84 A;  1NNF A;  4F18 A;  1URG A;  4P56 A;  5KDT A;  1Y3N A;  3C31 A;  1D3K A;  2X7P A;  4NMY A;  5EQ7 A;  3VV5 A;  3FV1 A;  5ET8 A;  3PMW A;  5FTI A;  4YKP A;  3K01 A;  3VVD A;  4QBA A;  4KR5 A;  3PD9 A;  1FJ6 A;  4NHB A;  3HN0 A;  4RJZ A;  5J16 A;  2CZL A;  3IOU A;  2QPQ A;  2XD3 A;  3IB1 A;  2I0C A;  2QS2 A;  4GIZ A;  3OOA A;  2P1S A;  3UN6 A;  4BLA A;  3GBA A;  1B05 A;  1ELJ A;  3RTW B;  4R2F A;  4U21 A;  2Q88 A;  4Z0I A;  1CB6 A;  1KA1 A;  3O2A A;  4MFI A;  3VXC A;  5CMM A;  3RUM A;  1IEJ A;  1EYJ A;  3CFX A;  4LZ7 A;  3V5A A;  2DWH A;  1YYZ A;  3D4C A;  4PTK A;  3H6W A;  3SDF A;  3S9N C;  1LST A;  1MY2 A;  4P8B A;  4RPO A;  1SPI A;  4KHZ E;  4FAT A;  3FD3 A;  1P1W A;  3CR9 A;  4NTL A;  1PEB A;  1PB9 A;  3EN3 A;  4GBV A;  5JTY A;  3ZKK A;  4MX6 A;  3F11 A;  5H8S A;  2XXI A;  1LBY A;  4FJP A;  4KPT A;  5IAI A;  4ECF A;  3U94 A;  5LOM A;  2REJ A;  3CFZ A;  1MY3 A;  3MZ9 A;  1B32 A;  1A40 A;  2A5T B;  4N81 A;  1H44 A;  4NE4 A;  3E78 A;  4O8M A;  1FTL A;  4QFN A;  3E4R A;  1JVX A;  4U1O A;  4I3Y A;  5ISU A;  3K6U A;  2VHA A;  1N84 A;  4U1Z A;  1FTJ A;  4DXB A;  1UTB A;  4N6P A;  1A8F A;  5DVJ A;  2NUV A;  5H8N A;  2ALU A;  1A8E A;  2BJJ X;  5IZ3 A;  4BDM A;  4FAJ A;  2Y7I A;  3R6U A;  4YB5 A;  3QSL A;  3H7M A;  3V8X B;  1MPD A;  1DOT A;  2HFB A;  4OET A;  2V84 A;  4MCO A;  3ROJ A;  2QSX A;  3A09 A;  3ILU B;  4PBQ A;  3O9P A;  5I57 A;  3CVG A;  3QUJ A;  3RLF E;  1ZLQ A;  4F3G A;  3BFU A;  2DS9 A;  5I5P A;  2XWO A;  4GL8 A;  1P1N A;  1LGB C;  1US4 A;  2GH9 A;  5CMC A;  5AA3 A;  5I2K B;  3TTN A;  3T22 A;  4PFI A;  2ZNS A;  1NH8 A;  3KG2 A;  4K3F A;  3U1O A;  4XKQ A;  4OWD A;  1VR5 A;  1LBV A;  3OEL A;  4IO4 A;  2FVZ A;  5F1Q A;  1BKA A;  3JV9 A;  1YCJ A;  1LAG E;  1NV7 A;  3MWB A;  1OIB A;  2IEE A;  4LZ8 A;  3D4G A;  4Q30 B;  4FEB A;  1FBP A;  4MNI A;  2UVG A;  4JBZ A;  4ELR A;  3E13 X;  2UYF A;  3OMB A;  4OVT A;  3TKD A;  4EQ9 A;  1HSE A;  4OVP A;  1M5B A;  2PX1 A;  4H67 A;  4H8J A;  3FGS A;  1H43 A;  4N8G A;  4MAG A;  1VE4 A;  3SES A;  1LBB A;  3S9M C;  4DE8 A;  3TCG A;  2P0S A;  5H8Q A;  4IGT A;  4MHF A;  4QHQ A;  4GD5 A;  4U23 A;  5T3J A;  3PPQ A;  1GVC A;  3QK6 A;  3PTY A;  3UA8 A;  4ELO A;  1ZKB A;  4JSO A;  4HE2 A;  4HTG A;  1LBC A;  2XWK A;  2AYS A;  1GTK A;  2Q74 A;  3MP8 A;  1Y20 A;  3G3J A;  1XVX A;  5DEX A;  4OFO A;  2WBD A;  3PMX A;  1TFA A;  2OLB A;  2DVZ A;  4N91 A;  4R9G A;  2HZK A;  1NNK A;  3K02 A;  4XIG Q;  1JW5 A;  4BDL A;  2AL5 A;  3TPA A;  1B1X A;  4KI0 E;  3CG1 A;  1MM7 A;  2RCA A;  4TQU Q;  1WVJ A;  1RYO A;  4N17 A;  4IGR A;  3SEV A;  4I62 A;  4E0W A;  3E3K A;  3L6G A;  1SW1 A;  1B4Z A;  4MH5 A;  3T9X B;  2DP8 A;  2ONS A;  1TXF A;  4WEP A;  1IUD A;  3FXB A;  5I56 B;  3PUZ E;  3UK4 A;  2XXP A;  2CZI A;  3I6V A;  1I6A A;  1NL5 A;  3W15 C;  4XF5 A;  3N5L A;  4RXL A;  3VLW A;  1JP4 A;  3BIG A;  4ESW A;  4Q8R A;  3JYR A;  4KCD A;  4O7I A;  1KWH A;  4WXJ A;  1OQG A;  3MAM A;  3SEU A;  1B0H A;  2RKM A;  1IXC A;  3ILT B;  2B4M A;  3K6V A;  2G29 A;  1UQW A;  3IX1 A;  3KN7 A;  3WAE A;  2ONK E;  2UVH A;  3KBR A;  1NV6 A;  5H8F B;  2ZYM A;  3T9U A;  5I59 B;  1FQC A;  2XXK A;  4OAN A;  4IO5 A;  5ESY A;  2XHD A;  4XFE A;  1SI0 A;  1Y3Q A;  4ZEB A;  4YKJ A;  2XX9 A;  4M4G A;  3MP6 A;  2B4L A;  4F39 A;  2VGQ A;  4F1V A;  4ZDM A;  1FPJ A;  2UVI A;  1IMB A;  1VSO A;  3M3F A;  2XA5 A;  1INP A;  2O84 X;  1IIW A;  2O7U A;  3VLU A;  2XWV A;  1NKX A;  4OES A;  4PC9 A;  4QSE A;  5I58 B;  4BDQ A;  4OVR A;  5KCJ A;  2XXU A;  3K6W A;  1MQH A;  3THI A;  4JB7 A;  2HHM A;  1MPB A;  4EUO A;  4YMA A;  4NED A;  1DTZ A;  2Z8E A;  2F3D A;  1LBZ A;  2XX8 A;  2DE4 A;  4R9F A;  1EZO A;  1NFT A;  2RC9 A;  4O94 A;  3RN8 A;  4G8N A;  2I4C A;  4PFY A;  1T0K A;  2VD3 A;  4YB6 A;  3HHF A;  5CM6 A;  5TP9 B;  3MYU A;  4MNP A;  1NV1 A;  2X26 A;  3RPL B;  1MH4 A;  1RDY A;  5DT6 A;  3FXR A;  3TUS A;  1D9Y A;  3OEN A;  2V4C A;  2PFZ A;  2VT5 A;  3TZA A;  5B7D A;  1FQA A;  3MQ9 A;  1MDQ A;  1G0H A;  2Z8D A;  5AA2 D;  3L6H A;  4NWC A;  4LVQ A;  1TT1 A;  2V3T A;  4I3E A;  4RY1 A;  2CEY A;  1PDA A;  4QSC A;  2RCB A;  4G4P A;  4ZEC A;  4MMP A;  3EHT A;  2FYI A;  3KSJ A;  1MY0 A;  1VFD A;  3A3C A;  4NF6 A;  1GGG A;  2REG A;  4KQP A;  4N4U A;  1A55 A;  3LUY A;  3BFT A;  1I6B A;  1O7T A;  5EHM A;  3FV2 A;  4KFQ A;  3GLB A;  4POX A;  2HCA A;  3FJG A;  2KLF A;  1FTO A;  4NF8 B;  1NNT A;  4LQ5 A;  3LBS A;  1N3X A;  4L17 A;  3IAZ A;  1NH7 A;  3UIF A;  2GRV A;  2UVJ A;  1BLF A;  3KFM A;  3OXN A;  3KJT A;  4X1B A;  2O68 A;  3C33 A;  5BWJ A;  1LAF E;  1DCU A;  1RDZ A;  1MQJ A;  2FNC A;  2XWI A;  4FE8 A;  3RQT A;  1MH3 A;  4C0R A;  2D3I A;  5JEI A;  1OLA A;  2Y7K A;  1FTK A;  2GHB A;  2HAU A;  1FPB A;  1QUI A;  2H9B A;  4AS4 A;  1NUX A;  5FBP A;  2DWJ A;  4IO3 A;  1FQF A;  1USY H;  1PBP A;  1Q9D A;  3U8Q A;  2QFL A;  4BDN A;  4R6K A;  1ATG A;  4R74 A;  2V93 A;  2Z8F A;  4NF5 B;  1OQH A;  3IK6 B;  2H99 A;  1B6H A;  3SKP A;  4RK2 A;  3K1N A;  1SYI A;  2H5Y A;  2ZZX A;  3BIH A;  1GR2 A;  2OWZ A;  4NAP A;  4F3B A;  1US5 A;  5FHO A;  3TAJ A;  4AQ4 A;  4YB7 A;  3W9W A;  4HS7 A;  2PVU A;  5CBS A;  1Z7M E;  4PDD A;  4QFL A;  3RTF B;  3KJ7 A;  1LFH A;  1ZBM A;  3B7D A;  2FIX A;  1IMD A;  4R6H A;  3TEP A;  5JK4 A;  1R9Q A;  3EKI A;  4GLI A;  3RT6 B;  1Q35 A;  4DI4 B;  4IB2 A;  2QMX A;  4OQO A;  1FBE A;  4X8R A;  1NUZ A;  4JWO A;  1NMU A;  3KOS A;  4G2Z A;  4LP2 B;  2ZZW A;  1POY 1;  2UYE A;  1QJM A;  1FQD A;  1Y1Z A;  4C1T A;  4MF3 A;  4YZZ A;  3VXB A;  1N3W A;  5HM4 B;  3QXM A;  2ZZV A;  4JSD A;  4OTE A;  5I2N A;  1L5T A;  3MBP A;  4HW8 A;  1P1Q A;  4NF4 A;  4AB6 A;  3KN8 A;  2R9J A;  1B46 A;  3TEL A;  1XI6 A;  1B0L A;  2DE3 A;  1UIU A;  4XKP A;  1FPK A;  4EQB A;  1BK4 A;  4JWY A;  2Z22 A;  4EQ7 A;  1LAH E;  5FHN A;  1QUK A;  2DXR A;  3MVZ A;  4P3L A;  3V83 A;  4H8I A;  2DXY A;  3OD7 A;  2WEF A;  5ICQ A;  2M8C A;  5IZ1 A;  1SD3 A;  1SW2 A;  5KDT B;  1D9V A;  4GVO A;  1LB9 A;  1R9L A;  3IR1 A;  4PE5 B;  3PGF A;  1BP5 A;  1G0I A;  5AA2 A;  4THI A;  4GFR A;  3N6U A;  4FED A;  4UAB A;  1P1U A;  4ELQ A;  4FEC A;  3IJO B;  5K2X A;  4GQO A;  4ISU A;  4U4X A;  4NWD A;  3FXQ A;  2UXA A;  3TTL A;  3KEI A;  3IFC A;  1DPP A;  1LLS A;  3S9E A;  4RK9 A;  3RY3 A;  1CE2 A;  1POT A;  3CG3 A;  2PCR A;  1LFI A;  1B7Z A;  4MLQ A;  4P1E A;  2PYY A;  4Z7E A;  2F97 A;  1GV8 A;  2DQV A;  2F5X A;  2CZK A;  1I69 A;  2WYP A;  3PUW E;  4OVJ A;  1IZ1 A;  2DOJ A;  5DVF A;  3KGC A;  3G7W A;  3NOH A;  1URD A;  3OO6 A;  2XXQ A;  3C4M A;  4DXU A;  5LTC A;  4OEN A;  3IB2 A;  1JNF A;  1I6Q A;  1B5J A;  4H6D A;  3N94 A;  4GXS B;  5CRY A;  3SER A;  2VOZ A;  4I40 A;  3FXU A;  4HCY A;  2PFY A;  3H6U A;  3TQL A;  4LN5 A;  4PGN A;  2R8T A;  2VD2 A;  2ZYK A;  3VLV A;  1XC1 A;  3AXF A;  2F3B A;  5EYG A;  4OXV A;  2RIN A;  3PUV E;  1OVB A;  5IZZ A;  2HPG A;  3H03 A;  3RT8 A;  2DWI A;  4H5F A;  3ONM A;  2F34 A;  3H4Z A;  3S4U A;  3QMF A;  2XXV A;  3MW0 A;  3LC8 A;  2H98 A;  4EDP A;  1WDN A;  1FPI A;  4YAH X;  4EF2 A;  2A5S A;  4YIC A;  3OO7 A;  2F78 A;  4GF8 A;  1B5I A;  1PB7 A;  1RDX A;  1P99 A;  1B5H A;  1VDW A;  3PPO A;  5I57 B;  3SEY A;  2FA7 A;  3K2D A;  2Y5L A;  2F6G A;  4H46 A;  1SW5 A;  4QRZ A;  1EU8 A;  2DE2 A;  2HEU A;  4DLD A;  1OVT A;  4LA9 A;  1KA0 A;  1B2H A;  3H06 B;  3Q25 A;  4PFR A;  4RA1 A;  4HE1 A;  5H8H A;  3DP4 A;  3QIM A;  1IMA A;  2WX9 A;  3MP1 A;  1SBP A;  3ECR A;  2HXW A;  4PFW A;  4C1U A;  2I6E A;  2JJK A;  3FVN A;  1AWB A;  2V3Q A;  4JDF A;  4OA4 A;  1N0T A;  4FOR A;  1MXV A;  3VVE A;  2I3W A;  1DPE A;  4P9K A;  1FBD A;  3VFJ A;  1IXH A;  3CIJ A;  4OEU A;  1IME A;  4OZ9 A;  4N6K A;  4I9D A;  1DSN A;  3G3F A;  2F7C A;  4U2R A;  3GYY A;  4I1D A;  1M5D A;  4JWX A;  4POW A;  1QGX A;  4H45 A;  5FHM A;  1DK4 A;  2OJT A;  3O29 A;  1QVS A;  3M3L A;  5H8Q B;  3A3U A;  1YTV A;  3U92 A;  4ZE9 A;  4QFO A;  3PPP A;  4TLL B;  3DEL B;  3OEM A;  4UA8 A;  2ZYN A;  4IY5 A;  4GWZ A;  4DDD A;  3RNN A;  3TDJ A;  3A29 A;  3JZJ A;  5DEX B;  5HPQ A;  1HSL A;  2PT2 A;  2O6A A;  4IO2 A;  3B50 A;  3MJN A;  1ZIU A;  3LV0 A;  1S50 A;  3C32 A;  3MST A;  4F3P A;  3G3H A;  3UGW A;  2XXH A;  1N7W A;  1A99 A;  2PMS A;  3EPE A;  2NOO A;  2XXX A;  3SEW A;  4OFJ A;  3OSR A;  4YKK A;  2Q2A A;  1H76 A;  2Q2C A;  3H3G A;  4FIM A;  3DP8 A;  4JVC A;  5L9O A;  4JVD A;  2FHY A;  1AH5 A;  4F29 A;  2ABH A;  3D1R A;  1EZP A;  2DWA A;  3TTR A;  3FJ7 A;  4N8Y A;  3MUQ A;  4MEV A;  1LCF A;  1JQF A;  5I3S A;  1B58 A;  2F36 A;  3VVF A;  1FBG A;  4GX4 A;  4KXP A;  2BJI A;  4OYV A;  1QKA A;  3C36 A;  4NF8 A;  1LCT A;  3GBB A;  2I0B A;  1JVY A;  3TFL A;  3OSQ A;  1PB8 A;  4Q5T A;  1XVY A;  2I3V A;  4PFT A;  2KQZ A;  3S9L C;  1B3L A;  3QYT A;  4R72 A;  3HCQ A;  3O6G A;  3ISP A;  1WOD A;  3EHS A;  3C34 A;  1Y4T A;  4EXK A;  4XKR A;  1FBF A;  1FTA A;  1XS5 A;  4OHN A;  3IOT A;  3MZB A;  1A54 A;  1II5 A;  1ANF A;  3DP6 A;  3O97 A;  4ND9 A;  3GXA A;  4ESX A;  3MZ1 A;  1QUL A;  1XHY A;  3MPK A;  1SW4 A;  3VE1 B;  3HV1 A;  2HQ0 A;  1FBC A;  5AE4 A;  1FTM A;  4NN3 A;  3Q28 A;  1MRP A;  4MNC A;  1NV0 A;  4PAI A;  2ZXT A;  4AB5 A;  1TFD A;  4PF8 A;  5KCJ B;  1MPC A;  3G3G A;  1FPE A;  2DDK A;  1FPL A;  2CMO A;  1M5F A;  4H0W A;  1MDP 1;  1QKB A;  4RNS A;  5L8D A;  4OER A;  2P3V A;  2Q9T A;  5BUU A;  1B3F A;  1TWY A;  4HXV A;  5TPA B;  1AL3 A;  5K2Y A;  2DSF A;  2D21 A;  1FPF A;  4QFK A;  4PE3 A;  4ZE8 A;  4FBP A;  2QS4 A;  2ZMB A;  1AIV A;  4KCC A;  4P47 A;  1ZTY A;  4AS5 A;  3KOT A;  1NNP A;  3QAX A;  1B51 A;  4G8H A;  2KR0 A;  1H3D A;  4P1L A;  1OMP A;  1FQE A;  3MVW A;  2E0S A;  5EYF A;  1LFG A;  3IO4 A;  3T93 B;  2OBG A;  3GZG A; 
#chains in the Genus database with same CATH homology
 2LAO A;  1MQD A;  4E0X A;  3DLN A;  3CRB A;  1S7Y A;  3IO6 A;  3OEK A;  3T9H B;  1IQ7 A;  1MM6 A;  3IOW A;  3P7I A;  1URS A;  5ICT A;  3TTK A;  4NF6 B;  4KD5 A;  5A5X B;  4KYD A;  1Z7N E;  2A5T A;  1UTH B;  2ONR A;  2YPN A;  1N7X A;  4OEV A;  5CC2 A;  4KYS A;  4GOT A;  4N13 A;  2I49 A;  3FAT A;  5ELV A;  3O28 A;  4IO6 A;  1B52 A;  2F35 A;  1PBQ A;  3DM0 A;  1PC3 A;  1SVX B;  2GFE A;  4RPN A;  3ZSF A;  3ZKL A;  3IOR A;  4F1Y A;  2V3U A;  1Y1M A;  3M8U A;  3K6X A;  2F7B A;  1OLC A;  2QMW A;  3IOV A;  3B6Q A;  4IY6 A;  3IB0 A;  3K1P A;  3TMG A;  3MPL A;  2QL3 A;  3PU5 A;  3BBR A;  3C35 A;  2GHA A;  4G68 B;  5I2K A;  2B3B A;  3KZG A;  5AA4 B;  4DXC A;  1FQB A;  1M5C A;  1QUJ A;  1LAX A;  1IIT A;  1MQG A;  2F7A A;  3G3K A;  1M5E A;  4YMB A;  3B6W A;  3R26 A;  3KSX A;  3T66 A;  3IJX B;  3TOD A;  3PUX E;  2F6P A;  1XOC A;  2XX7 A;  4P0G A;  1YPN A;  3EF7 A;  2Y84 A;  1LB8 A;  5L9M A;  4F3S A;  3G3I A;  3E9X A;  4QFP A;  2OK2 A;  4XKN A;  1RYX A;  1Y4C A;  3HO7 A;  3FIR A;  3VDF A;  4LUB A;  2AIX A;  3Q27 A;  3RGY A;  3S2V A;  4BDO A;  3K00 A;  2RF1 A;  3O6I A;  4GL0 A;  3FVK A;  3PMV A;  4N07 A;  3LSW A;  4QSD A;  2DVC A;  1AMF A;  5I2N B;  1FCK A;  1Y9U A;  4NF4 B;  2RC8 A;  2R71 A;  1D4N A;  5JTY B;  3N6T A;  4PP0 A;  1B9J A;  4MBP A;  1USY E;  3CSG A;  4OMB A;  3EHU A;  5DVI A;  3UP9 A;  3FVO A;  2I48 A;  1MS7 A;  3SET A;  4F22 A;  2V25 A;  1DTG A;  2YJP A;  2H4I A;  1N04 A;  3CSB A;  3K0V A;  1DMB A;  4X1D A;  4HCW A;  2ZNT A;  4F2O A;  2ANJ A;  3OO9 A;  2O7I A;  1JW4 A;  4WKM A;  2XD2 A;  1UTB B;  4O3C A;  4DCX A;  5AA2 B;  5I56 A;  3MVY A;  5H8N B;  4TLM B;  3O6H A;  4ELP A;  4TOZ A;  5CMK A;  4I8C A;  2Y7P A;  5HBC A;  4KYE A;  1O64 A;  3PV0 E;  2G93 A;  4PFU A;  1MXY A;  2O1M A;  1A7L A;  1JEV A;  2W7Y A;  4PQJ A;  1BIY A;  4F2Q A;  3FAS A;  3W9V A;  2E1S A;  3K4U A;  4DCY A;  4X48 A;  2XXW A;  3LSX A;  1Y3P A;  4X9T A;  5H8F A;  5CMB A;  5I59 A;  4ZZA A;  3LSL A;  4R2B A;  2Q89 A;  5L9S A;  2O69 A;  3MVX A;  3OO8 A;  5KZT A;  4YU0 A;  4ONY A;  2PT1 A;  1B40 A;  3PPN A;  1JW1 A;  4ZEF A;  4MLV A;  4O3A A;  2WKY A;  3ODB A;  4IO7 A;  4ZED A;  3PPR A;  2QS1 A;  1R1N A;  5FTH A;  1F9B A;  5DYH A;  1ZU0 A;  4U4S A;  5I58 A;  3TCF A;  1MXX A;  3UOR A;  3T9V A;  3CFL A;  4ZEK A;  3I5O A;  5CI5 A;  4LON B;  1B3E A;  2XXT A;  2D5W A;  2VP1 A;  2O51 A;  4UAC A;  1QW0 A;  4XXU A;  3N26 A;  3I3V A;  1MXZ A;  2HZL A;  4GRK A;  1S9T A;  5IKB A;  4ZEI A;  5M2V A;  3CI8 A;  3IL1 B;  4F1U A;  3QUF A;  1B1H A;  1YAE A;  5CBR A;  4P0I A;  5TP9 A;  1ZMG A;  2Z23 A;  1RKM A;  3HHG A;  2Y7W A;  4H5G A;  4R73 A;  3T96 B;  1MG1 A;  3WAF A;  3FVG A;  2OWS A;  1P1O A;  3BKI B;  4LQ2 A;  2F8D A;  3FUZ A;  3HPI A;  1EH3 A;  3USD A;  2ESN A;  1ZJL A;  3R7X A;  1H45 A;  5H8H B;  3Q26 A;  2QJE A;  2NXO A;  4GXA A;  4U22 A;  1MXU A;  2OZZ A;  2H25 A;  5AA1 A;  1FW0 A;  4F31 B;  1B7U A;  1UIV A;  4LAT A;  2RC7 A;  1SDX A;  5DTB A;  2ZYO A;  4EF1 A;  3FZV A;  2Y7R A;  4GWO A;  3M3K A;  3Q29 A;  3TTM A;  1JEU A;  2PBW A;  3PUY E;  4ZS9 A;  4M1V A;  2XXY A;  1J1N A;  5EHS A;  3EQ1 A;  2I58 A;  2ZNU A;  1JET A;  2R6G E;  5TPA A;  5J1D A;  4JXI A;  2AL4 A;  4OFL A;  2O1L A;  3ZS6 A;  2IA4 A;  4QF9 A;  4BDR A;  5ITO A;  4DZ1 A;  4LZ5 A;  3LR1 A;  4ZZE A;  4G77 A;  4RYA A;  4H1X A;  3TCH A;  2Q8J A;  3C9H A;  1BTJ A;  3SEX A;  1R6Z A;  2NWJ A;  5TU0 A;  2QS3 A;  1HSJ A;  2B65 A;  1SI1 A;  2YLN A;  2OCU A;  3H6T A;  1Q1K A;  3O66 A;  1B3G A;  4NF5 A;  3U72 A;  3RPW A;  2HAV A;  3U93 A;  3B6T A;  1SQY A;  1MQI A;  4G8M A;  4PET A;  3K1M A;  2OWT A;  1SYH A;  4R75 A;  5ITP A;  2B3F A;  4WED A;  3LSF B;  4G68 C;  4R6Y A;  5A5X A;  1UTH A;  3V89 B;  2P2A A;  4YKI A;  2I4B A;  5B70 A;  1MXW A;  1N76 A;  2XXR A;  1O63 A;  1B3H A;  2NVU B;  2DYX A;  1B7H A;  4XTC Q;  1B4H A;  1IXI A;  1IXG A;  3FJM A;  3H6V A;  3TYH A;  2QRY A;  2THI A;  4DIG A;  1MY1 A;  4EXL A;  4Q0C A;  1VFE A;  4H65 A;  4P11 A;  1EZ9 A;  4F19 A;  3HST A;  2X7Q A;  1XT8 A;  3TQW A;  4O3B A;  1AOV A;  4G68 A;  5AA4 A;  3KN3 A;  3MC2 A;  3PD8 A;  1MY4 A;  5F7V A;  5I84 A;  1NNF A;  4F18 A;  1URG A;  5KDT A;  1Y3N A;  3C31 A;  1D3K A;  2X7P A;  4NMY A;  3VV5 A;  3FV1 A;  3PMW A;  5FTI A;  4YKP A;  3K01 A;  3VVD A;  4KR5 A;  3PD9 A;  3HN0 A;  4RJZ A;  2CZL A;  3IOU A;  2QPQ A;  2XD3 A;  3IB1 A;  2I0C A;  2QS2 A;  4GIZ A;  3OOA A;  2P1S A;  3UN6 A;  4BLA A;  3GBA A;  1B05 A;  1ELJ A;  3RTW B;  4R2F A;  4U21 A;  2Q88 A;  4Z0I A;  1CB6 A;  3O2A A;  4MFI A;  3VXC A;  5CMM A;  3RUM A;  1IEJ A;  3CFX A;  4LZ7 A;  3V5A A;  2DWH A;  3D4C A;  3H6W A;  3SDF A;  3S9N C;  1LST A;  1MY2 A;  4RPO A;  4KHZ E;  4FAT A;  3FD3 A;  1P1W A;  3CR9 A;  4NTL A;  1PEB A;  1PB9 A;  3EN3 A;  5JTY A;  3ZKK A;  3F11 A;  5H8S A;  2XXI A;  4FJP A;  4KPT A;  5IAI A;  4ECF A;  3U94 A;  5LOM A;  2REJ A;  3CFZ A;  1MY3 A;  1B32 A;  1A40 A;  2A5T B;  3MZ9 A;  4NE4 A;  1H44 A;  1FTL A;  4QFN A;  3E4R A;  1JVX A;  4U1O A;  5ISU A;  3K6U A;  2VHA A;  1N84 A;  4U1Z A;  1FTJ A;  4DXB A;  1UTB A;  4N6P A;  1A8F A;  5DVJ A;  2NUV A;  5H8N A;  2ALU A;  1A8E A;  2BJJ X;  4BDM A;  4FAJ A;  2Y7I A;  3R6U A;  4YB5 A;  3QSL A;  3H7M A;  3V8X B;  1MPD A;  1DOT A;  2HFB A;  4OET A;  2V84 A;  2QSX A;  3A09 A;  3ILU B;  3O9P A;  5I57 A;  3CVG A;  3QUJ A;  3RLF E;  1ZLQ A;  4F3G A;  3BFU A;  2DS9 A;  4GL8 A;  1P1N A;  1LGB C;  1US4 A;  2GH9 A;  5CMC A;  5AA3 A;  5I2K B;  3TTN A;  3T22 A;  2ZNS A;  1NH8 A;  3KG2 A;  4K3F A;  3U1O A;  4XKQ A;  4OWD A;  1VR5 A;  3OEL A;  4IO4 A;  5F1Q A;  1BKA A;  3JV9 A;  1YCJ A;  1LAG E;  3MWB A;  1OIB A;  2IEE A;  4LZ8 A;  3D4G A;  4Q30 B;  4FEB A;  2UVG A;  4JBZ A;  4ELR A;  3E13 X;  2UYF A;  3OMB A;  3TKD A;  4EQ9 A;  1HSE A;  1M5B A;  2PX1 A;  4H67 A;  4H8J A;  3FGS A;  1H43 A;  1VE4 A;  3SES A;  1LBB A;  3S9M C;  4DE8 A;  3TCG A;  2P0S A;  5H8Q A;  4IGT A;  4QHQ A;  4GD5 A;  4U23 A;  3PPQ A;  1GVC A;  3QK6 A;  3UA8 A;  4ELO A;  1ZKB A;  4JSO A;  4HTG A;  1LBC A;  2AYS A;  1GTK A;  3MP8 A;  1Y20 A;  3G3J A;  1XVX A;  5DEX A;  4OFO A;  3PMX A;  1TFA A;  2OLB A;  2DVZ A;  4R9G A;  2HZK A;  1NNK A;  3K02 A;  4XIG Q;  1JW5 A;  4BDL A;  2AL5 A;  3TPA A;  1B1X A;  4KI0 E;  3CG1 A;  1MM7 A;  2RCA A;  4TQU Q;  1WVJ A;  1RYO A;  4IGR A;  3SEV A;  4I62 A;  4E0W A;  3E3K A;  3L6G A;  1SW1 A;  1B4Z A;  4MH5 A;  3T9X B;  2DP8 A;  2ONS A;  1TXF A;  4WEP A;  1IUD A;  5I56 B;  3PUZ E;  3UK4 A;  2XXP A;  3I6V A;  1I6A A;  1NL5 A;  3W15 C;  3N5L A;  4RXL A;  3VLW A;  4ESW A;  4Q8R A;  3JYR A;  4KCD A;  1KWH A;  4WXJ A;  1OQG A;  3MAM A;  3SEU A;  1B0H A;  2RKM A;  1IXC A;  3ILT B;  3K6V A;  2G29 A;  1UQW A;  3IX1 A;  3KN7 A;  3WAE A;  2ONK E;  2UVH A;  3KBR A;  5H8F B;  2ZYM A;  3T9U A;  5I59 B;  1FQC A;  4IO5 A;  2XHD A;  1SI0 A;  1Y3Q A;  4ZEB A;  4YKJ A;  2XX9 A;  4M4G A;  3MP6 A;  4F39 A;  2VGQ A;  4F1V A;  4ZDM A;  2UVI A;  1VSO A;  3M3F A;  2O84 X;  1IIW A;  2O7U A;  3VLU A;  1NKX A;  4OES A;  4QSE A;  5I58 B;  4BDQ A;  5KCJ A;  2XXU A;  3K6W A;  1MQH A;  3THI A;  4JB7 A;  1MPB A;  4EUO A;  4YMA A;  4NED A;  1DTZ A;  2Z8E A;  2XX8 A;  2DE4 A;  4R9F A;  1EZO A;  1NFT A;  2RC9 A;  3RN8 A;  4G8N A;  2I4C A;  4PFY A;  1T0K A;  2VD3 A;  4YB6 A;  3HHF A;  5CM6 A;  5TP9 B;  2X26 A;  1MH4 A;  5DT6 A;  3FXR A;  3TUS A;  1D9Y A;  3OEN A;  3TZA A;  5B7D A;  1FQA A;  3MQ9 A;  1MDQ A;  2Z8D A;  5AA2 D;  3L6H A;  4NWC A;  4LVQ A;  1TT1 A;  2V3T A;  4RY1 A;  1PDA A;  4QSC A;  2RCB A;  4G4P A;  4ZEC A;  3EHT A;  2FYI A;  3KSJ A;  1MY0 A;  1VFD A;  3A3C A;  4NF6 A;  1GGG A;  2REG A;  4KQP A;  1A55 A;  3LUY A;  3BFT A;  1I6B A;  1O7T A;  5EHM A;  3FV2 A;  4KFQ A;  3GLB A;  4POX A;  2HCA A;  3FJG A;  2KLF A;  1FTO A;  4NF8 B;  1NNT A;  4LQ5 A;  3LBS A;  1N3X A;  4L17 A;  3IAZ A;  1NH7 A;  3UIF A;  2GRV A;  2UVJ A;  1BLF A;  3KFM A;  3OXN A;  3KJT A;  4X1B A;  2O68 A;  3C33 A;  5BWJ A;  1LAF E;  1MQJ A;  2FNC A;  4FE8 A;  3RQT A;  1MH3 A;  4C0R A;  2D3I A;  5JEI A;  1OLA A;  2Y7K A;  1FTK A;  2GHB A;  2HAU A;  1QUI A;  2H9B A;  2DWJ A;  4IO3 A;  1FQF A;  1USY H;  1PBP A;  3U8Q A;  4BDN A;  4R6K A;  1ATG A;  4R74 A;  2V93 A;  2Z8F A;  4NF5 B;  1OQH A;  3IK6 B;  2H99 A;  1B6H A;  3SKP A;  4RK2 A;  3K1N A;  1SYI A;  2H5Y A;  1GR2 A;  4F3B A;  1US5 A;  5FHO A;  3TAJ A;  4AQ4 A;  4YB7 A;  3W9W A;  4HS7 A;  2PVU A;  5CBS A;  1Z7M E;  4QFL A;  3RTF B;  3KJ7 A;  1LFH A;  1ZBM A;  3B7D A;  4R6H A;  3TEP A;  5JK4 A;  1R9Q A;  4GLI A;  3RT6 B;  1Q35 A;  4IB2 A;  2QMX A;  4OQO A;  4JWO A;  1NMU A;  3KOS A;  4G2Z A;  4LP2 B;  1POY 1;  2UYE A;  1QJM A;  1FQD A;  1Y1Z A;  4C1T A;  4MF3 A;  4YZZ A;  3VXB A;  1N3W A;  5HM4 B;  3QXM A;  4JSD A;  4OTE A;  5I2N A;  1L5T A;  3MBP A;  4HW8 A;  1P1Q A;  4NF4 A;  4AB6 A;  3KN8 A;  2R9J A;  1B46 A;  3TEL A;  1B0L A;  2DE3 A;  1UIU A;  4XKP A;  4EQB A;  4JWY A;  2Z22 A;  4EQ7 A;  1LAH E;  5FHN A;  1QUK A;  2DXR A;  3MVZ A;  3V83 A;  4H8I A;  2DXY A;  3OD7 A;  5ICQ A;  2M8C A;  1SD3 A;  1SW2 A;  5KDT B;  1D9V A;  4GVO A;  1LB9 A;  1R9L A;  3IR1 A;  4PE5 B;  3PGF A;  1BP5 A;  5AA2 A;  4THI A;  4GFR A;  3N6U A;  4FED A;  1P1U A;  4ELQ A;  4FEC A;  3IJO B;  5K2X A;  4GQO A;  4ISU A;  4U4X A;  4NWD A;  3FXQ A;  2UXA A;  3TTL A;  3KEI A;  1DPP A;  1LLS A;  3S9E A;  4RK9 A;  3RY3 A;  1CE2 A;  1POT A;  3CG3 A;  1LFI A;  1B7Z A;  4MLQ A;  2PYY A;  4Z7E A;  2F97 A;  1GV8 A;  2DQV A;  2F5X A;  1I69 A;  3PUW E;  4OVJ A;  1IZ1 A;  2DOJ A;  5DVF A;  3KGC A;  3G7W A;  1URD A;  3OO6 A;  2XXQ A;  3C4M A;  4DXU A;  4OEN A;  3IB2 A;  1JNF A;  1I6Q A;  1B5J A;  4H6D A;  3N94 A;  4GXS B;  5CRY A;  3SER A;  2VOZ A;  3FXU A;  4HCY A;  3H6U A;  3TQL A;  2VD2 A;  2ZYK A;  3VLV A;  1XC1 A;  3AXF A;  4OXV A;  2RIN A;  3PUV E;  1OVB A;  3H03 A;  3RT8 A;  2DWI A;  4H5F A;  3ONM A;  2F34 A;  3H4Z A;  3S4U A;  2XXV A;  3MW0 A;  3LC8 A;  2H98 A;  4EDP A;  1WDN A;  4YAH X;  4EF2 A;  2A5S A;  4YIC A;  3OO7 A;  2F78 A;  4GF8 A;  1B5I A;  1PB7 A;  1P99 A;  1B5H A;  3PPO A;  5I57 B;  3SEY A;  2FA7 A;  3K2D A;  2F6G A;  1SW5 A;  4QRZ A;  1EU8 A;  2DE2 A;  2HEU A;  4DLD A;  1OVT A;  4LA9 A;  1B2H A;  3H06 B;  3Q25 A;  4RA1 A;  5H8H A;  3DP4 A;  3QIM A;  3MP1 A;  1SBP A;  4C1U A;  2HXW A;  3ECR A;  4PFW A;  2I6E A;  3FVN A;  2V3Q A;  4JDF A;  1N0T A;  4FOR A;  1MXV A;  3VVE A;  2I3W A;  1DPE A;  3VFJ A;  1IXH A;  3CIJ A;  4OEU A;  4OZ9 A;  4I9D A;  1DSN A;  3G3F A;  2F7C A;  4U2R A;  4I1D A;  1M5D A;  4JWX A;  4POW A;  5FHM A;  2OJT A;  3O29 A;  1QVS A;  3M3L A;  5H8Q B;  3A3U A;  1YTV A;  3U92 A;  4ZE9 A;  4QFO A;  3PPP A;  4TLL B;  3DEL B;  3OEM A;  4UA8 A;  2ZYN A;  4IY5 A;  4DDD A;  3RNN A;  3TDJ A;  3JZJ A;  5DEX B;  5HPQ A;  1HSL A;  2PT2 A;  2O6A A;  4IO2 A;  3MJN A;  1ZIU A;  1S50 A;  3C32 A;  4F3P A;  3G3H A;  3UGW A;  2XXH A;  1N7W A;  1A99 A;  2PMS A;  3EPE A;  2NOO A;  2XXX A;  3SEW A;  4OFJ A;  3OSR A;  4YKK A;  2Q2A A;  1H76 A;  2Q2C A;  3H3G A;  4FIM A;  3DP8 A;  5L9O A;  1AH5 A;  4F29 A;  2ABH A;  1EZP A;  2DWA A;  3TTR A;  3FJ7 A;  3MUQ A;  1LCF A;  1JQF A;  1B58 A;  2F36 A;  3VVF A;  4OYV A;  1QKA A;  3C36 A;  4NF8 A;  1LCT A;  3GBB A;  2I0B A;  1JVY A;  3TFL A;  3OSQ A;  1PB8 A;  4Q5T A;  1XVY A;  2I3V A;  4PFT A;  3S9L C;  1B3L A;  3QYT A;  4R72 A;  3HCQ A;  3O6G A;  1WOD A;  3EHS A;  3C34 A;  1Y4T A;  4EXK A;  4XKR A;  1XS5 A;  4OHN A;  3IOT A;  3MZB A;  1A54 A;  1II5 A;  1ANF A;  3DP6 A;  3O97 A;  4ND9 A;  3GXA A;  4ESX A;  3MZ1 A;  1QUL A;  1XHY A;  3MPK A;  1SW4 A;  3VE1 B;  3HV1 A;  2HQ0 A;  5AE4 A;  1FTM A;  3Q28 A;  1MRP A;  2ZXT A;  4AB5 A;  1TFD A;  5KCJ B;  1MPC A;  3G3G A;  2CMO A;  1M5F A;  4H0W A;  1MDP 1;  1QKB A;  4RNS A;  5L8D A;  4OER A;  2Q9T A;  5BUU A;  1B3F A;  1TWY A;  5TPA B;  1AL3 A;  5K2Y A;  2DSF A;  2D21 A;  4QFK A;  4ZE8 A;  2QS4 A;  2ZMB A;  1AIV A;  4KCC A;  1ZTY A;  3KOT A;  1NNP A;  3QAX A;  1B51 A;  4G8H A;  1H3D A;  1OMP A;  1FQE A;  3MVW A;  2E0S A;  5EYF A;  1LFG A;  3IO4 A;  3T93 B;  2OBG A;  3GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...