4P11A

Native crystal structure of mltf pseudomonas aeruginosa
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
428
structure length
428
Chain Sequence
APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase F
publication title Native crystal structure of MltF Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 152
structure length 428
sequence length 428
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2014-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p11A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p11A02
4LQ5A 3O29A 4F19A 4OWDA 3ZKKA 1VSOA 3T9UA 2DVCA 2DP8A 5AE4A 1MH3A 2DS9A 2UVGA 2PBWA 5DVIA 1HSLA 5AA1A 1IXGA 2Y7KA 4M1VA 3RGYA 2AL5A 2XXQA 1Y3PA 4GXSB 4OFOA 4FEBA 3N26A 4F31B 4LZ5A 3K6WA 2HZKA 3FXQA 1LFGA 1OQGA 4F3GA 4R9FA 2UYFA 1B51A 1MY3A 4H5GA 1YAEA 1H43A 2H99A 2PYYA 1B3HA 1QJMA 3RT8A 4KYDA 3SETA 3I6VA 4YKKA 3TAJA 3OMBA 3IOWA 3IO6A 3RLFE 2P2AA 2QS3A 3TTMA 2E1SA 3N6TA 1FQFA 3H03A 5I57A 1US4A 3VV5A 4RYAA 4PFYA 4H5FA 4IY5A 3RPWA 1B3LA 4WKMA 1MS7A 2ZNTA 3PU5A 3ECRA 3LSLA 2DSFA 1O64A 3UP9A 1Y20A 1DTGA 1XVXA 5TPAB 2UVJA 1BLFA 3DM0A 4KI0E 4Q30B 3O6IA 3MVZA 2Y7RA 3CFLA 1LFHA 3KOTA 1MXZA 3MQ9A 4HCYA 2XXXA 2I0BA 2Z23A 2B3BA 2ZNUA 1VR5A 3TCFA 1P1OA 4MBPA 3C32A 5DTBA 5I2NA 5K2XA 5AA4B 4F29A 4K3FA 1MY2A 3IB0A 4R75A 5L9OA 4Q0CA 4YICA 5DVJA 1ZKBA 4R6YA 3UORA 1BTJA 1LGBC 4ZEBA 3ZKLA 5ITPA 1Y3NA 5H8NA 3K1PA 5I58B 3HN0A 1MQIA 3SDFA 4LZ7A 1TFDA 5FTIA 3H6UA 3N94A 4ZEKA 1UTHA 4PETA 3TUSA 2QPQA 3Q25A 4OZ9A 1DOTA 2H25A 3ODBA 1ZJLA 1ZTYA 1IUDA 2F5XA 4KQPA 3FVKA 1AL3A 1HSEA 1N3WA 3KN7A 3HHGA 2LAOA 4DXCA 3SEVA 3LBSA 2HEUA 5CI5A 4QF9A 2O1MA 3PD9A 2ABHA 2DE3A 1II5A 3H6VA 1NMUA 1Y4CA 3CIJA 1MRPA 1QUKA 3PUVE 2UYEA 1SDXA 4RXLA 1GV8A 2XD2A 3PPRA 4RA1A 3OEMA 3OO8A 4KCDA 1NFTA 3OD7A 1JW4A 3T9HB 3U92A 3A09A 4XKNA 1MXXA 3DLNA 4BDRA 3R6UA 1A8EA 4FATA 2F36A 4G8HA 4TLLB 3FVNA 1Q35A 2AIXA 4OEUA 5BUUA 2HCAA 5H8SA 5H8FB 4U4XA 2Y7WA 4R73A 1QKAA 3RNNA 4I9DA 2A5TB 3IJOB 1L5TA 1Y3QA 4FEDA 1D3KA 3H6TA 4NF8B 5H8HB 3IX1A 1JVYA 3S9MC 1LAHE 2I3WA 3CR9A 4HS7A 3BBRA 5A5XA 4YZZA 3V89B 2OZZA 1B1HA 2OLBA 1T0KA 1EZ9A 3QYTA 4F39A 4FE8A 1F9BA 4KCCA 4IGRA 4ZEIA 3MP8A 4O3AA 3EHUA 3VVDA 2RC9A 3L6HA 1B7UA 1AOVA 1P99A 2GHBA 1VE4A 1IIWA 4NF4B 4ZECA 3MVWA 2F97A 4JDFA 1H76A 4ZS9A 4XTCQ 5AA4A 4EF2A 1HSJA 4RY1A 2Q9TA 4OHNA 3B6QA 1A8FA 5L9MA 3SERA 1FQAA 4YKIA 5F7VA 1OIBA 2F6PA 3IOTA 1LBCA 4ZDMA 5I58A 2Z22A 1S7YA 4YB5A 2XX8A 5FTHA 4IB2A 1PC3A 1Y9UA 1M5EA 4OYVA 1OLAA 3IB1A 4YMAA 1DMBA 4OERA 4U23A 1TFAA 2Y7IA 3UN6A 1NKXA 4MH5A 1B7HA 1EU8A 4TQUQ 5I57B 3KGCA 5JTYA 1R1NA 1ZBMA 5IKBA 3MAMA 4ELPA 3S9NC 5I59A 5AA2D 3CFZA 4RPOA 4ONYA 5I2KA 1N84A 1OVBA 3W9WA 1PB8A 1FTJA 4E0XA 2Z8EA 2ZYMA 5AA2B 4ZEFA 3VXCA 2QSXA 1FQEA 3O2AA 3R26A 4KD5A 1MM6A 1D4NA 4FJPA 4FORA 3USDA 2ONRA 3VVEA 2Q89A 1LB9A 3Q28A 2XXUA 3O97A 1P1UA 2H98A 5CBSA 1MG1A 2QL3A 5HPQA 1WODA 5H8FA 5I2NB 2QMWA 2V3QA 3MUQA 3VXBA 4JWYA 1MQJA 4H65A 4X1BA 2GRVA 3OO6A 3N6UA 3MZBA 1JQFA 4MFIA 2OK2A 3RUMA 4LATA 5DEXB 3K01A 4WEDA 5CMMA 3EHSA 3IK6B 1UTHB 5CMBA 3L6GA 3ONMA 2QMXA 4C1TA 4R6KA 1CB6A 4ESWA 4OENA 5HBCA 4OETA 2F8DA 3FJ7A 5IAIA 4C1UA 4DXUA 1POY1 4OFJA 3K0VA 1MPDA 3CSGA 4C0RA 1FCKA 4F3PA 1QW0A 1M5BA 2VOZA 4N13A 1SW5A 5CC2A 3FD3A 2Z8FA 3C31A 1N0TA 2XXPA 3KZGA 1FTMA 1MH4A 4ESXA 3M3FA 4NF4A 2RCAA 4ZZAA 1GGGA 3RN8A 3TMGA 3FVOA 1NH7A 1ELJA 1B5HA 3O9PA 1AMFA 1LBBA 3K1MA 4NEDA 3C9HA 1US5A 5H8QB 4YU0A 4H6DA 3FZVA 3MZ9A 4X9TA 1B3EA 1LAFE 3FJGA 1JEUA 3B6TA 4F1YA 2KLFA 1LAXA 1A7LA 3C36A 2DVZA 3E4RA 4U1OA 2VP1A 1R9LA 3DP4A 1MXWA 3I3VA 3LUYA 4G8MA 3FXRA 3GZGA 3GLBA 3K4UA 1TT1A 3BFTA 3G3JA 3IJXB 2NVUB 3HV1A 3T9XB 4H8IA 2R9JA 2CMOA 2DWHA 5A5XB 2QRYA 1XC1A 3TQWA 4IO3A 3E9XA 2REGA 3KN3A 4PP0A 4POWA 4R2FA 1MDQA 2XXYA 2VD3A 1M5FA 1Y1MA 5AA2A 4TLMB 3IOUA 3C35A 2GHAA 5I84A 1RKMA 4TOZA 2O69A 3JYRA 1SW4A 4PFUA 4ZE8A 2H9BA 1H3DA 1SI0A 3RTFB 3THIA 1JEVA 3QUFA 3BFUA 2H5YA 3LSWA 2AYSA 3CSBA 4GL0A 3TKDA 5B7DA 2HXWA 3EPEA 1VFEA 4H0WA 4QSEA 3A3CA 3V83A 4DLDA 3LC8A 1XS5A 3FGSA 4U22A 3K00A 3UIFA 1MPBA 2UXAA 5DEXA 2R6GE 2I58A 1R6ZA 3JZJA 2DE2A 4IO5A 2H4IA 4QSDA 4BLAA 1N04A 3D4GA 5HM4B 3DP6A 5JTYB 3TEPA 2I6EA 3F11A 2IEEA 4ND9A 1PBPA 1MQDA 3FASA 1XVYA 1B3GA 3JV9A 5I59B 3PUXE 5BWJA 5TP9B 1A40A 1MXYA 1IITA 5I2KB 4LVQA 1I6BA 3Q27A 1NNTA 4G4PA 5F1QA 4IO6A 3TTNA 3H06B 4NF5B 1SI1A 5H8QA 4R6HA 3IL1B 3KG2A 1B5IA 4PFTA 1NNFA 3RY3A 3TTLA 2VD2A 4OESA 1JVXA 1P1QA 3ZS6A 2PT1A 4EUOA 4OVJA 3KJ7A 3KSJA 1GTKA 2RKMA 1DTZA 4YMBA 2OJTA 1GR2A 4PQJA 2RC8A 4BDMA 1AIVA 4QFKA 1B32A 2I4CA 3M8UA 4P0IA 3CVGA 3FJMA 3SEXA 2OWSA 1B1XA 4U2RA 1LFIA 2X7QA 4JWXA 3QSLA 3TZAA 4RK9A 5JK4A 2BJJX 1P1WA 4I1DA 2M8CA 4XKQA 4RNSA 1ANFA 3KBRA 3N5LA 1YCJA 4PE5B 1MY4A 4I8CA 3G3IA 3QXMA 1LCFA 2OBGA 4ELOA 4XXUA 3UK4A 1IXHA 1MQGA 4O3CA 4F2QA 4IO2A 1USYE 2F6GA 1IEJA 1ZMGA 3TTRA 4MF3A 3VLUA 3T93B 2O1LA 4G68A 1MPCA 3OELA 4M4GA 3W9VA 4EQBA 1FTOA 3PV0E 4P11A 3H6WA 4GIZA 2DWIA 4QFOA 4OTEA 1S9TA 4NWCA 3PPPA 4WEPA 3PPQA 3IOVA 4Q8RA 1NL5A 4XIGQ 4KHZE 4R72A 4QFPA 2XX7A 2F7CA 1ZU0A 2PMSA 3MPKA 4YB7A 1QVSA 2P1SA 2DOJA 4PFWA 4KFQA 1JW1A 5L9SA 3C33A 4YKPA 3TYHA 2I48A 1Q1KA 3G7WA 1LAGE 4FAJA 3FV2A 3PUYE 3VDFA 3IB2A 3TCHA 4U4SA 4KPTA 1B58A 1SYHA 2O51A 4GWOA 4LUBA 1SW1A 2ZXTA 2HAUA 3DELB 4L17A 3T66A 2RC7A 3VVFA 4F3BA 4GQOA 2HQ0A 3KFMA 2DWAA 2GFEA 2O6AA 4WXJA 2QS1A 3U72A 3A3UA 2O68A 3LR1A 5TP9A 5I56A 4BDOA 3HSTA 1FTKA 2O7IA 2UVIA 1S50A 4IY6A 3SEYA 5EYFA 2D3IA 4AB5A 2XXRA 2QJEA 4QRZA 4NMYA 1SQYA 4NF5A 5L8DA 2DE4A 2V93A 3FUZA 2ANJA 1SVXB 3K6UA 2I3VA 3U94A 4NF6A 3O66A 3H7MA 1OVTA 4JSDA 5FHOA 3MP6A 2ZNSA 3KOSA 1N7WA 1JW5A 3SKPA 1Z7ME 1IXIA 5KZTA 1WVJA 3K6VA 3TPAA 3MC2A 4LQ2A 1NNKA 4YAHX 3WAEA 2B3FA 3MBPA 4RK2A 5JEIA 4FIMA 1UQWA 1DSNA 3O6GA 4BDQA 4ECFA 4EXKA 1VFDA 1ZLQA 5ICTA 4LP2B 2FNCA 3VLWA 2X26A 1URDA 3CI8A 4GD5A 4OEVA 4NTLA 1FW0A 5KDTA 3ILTB 2XXTA 2V84A 4F1UA 4R9GA 4UA8A 5ICQA 4U21A 1TXFA 4ZEDA 3PUWE 1NNPA 4F22A 1Y1ZA 2DXRA 1GVCA 2XXVA 3O6HA 2X7PA 1MY0A 4JBZA 5EHMA 4N6PA 4GXAA 1USYH 1WDNA 3MZ1A 4X1DA 3K2DA 4DCYA 4F2OA 3GBBA 1MM7A 3U93A 2HZLA 1AH5A 3QIMA 1B4ZA 4H8JA 2PX1A 3B7DA 3U1OA 2V25A 3KEIA 1UTBA 1SYIA 2WKYA 2F78A 4G68C 2D5WA 4AQ4A 1SD3A 2RINA 3PPNA 4DZ1A 3M3LA 3KN8A 4JXIA 3G3KA 4GRKA 1BP5A 5FHNA 1B40A 4JWOA 4G77A 3RTWB 1ZIUA 1J1NA 3IR1A 4XKPA 4EQ7A 3T9VA 3CRBA 4XKRA 1B2HA 4R2BA 1M5DA 2DYXA 2YLNA 3TELA 2FA7A 4GF8A 3UGWA 4RJZA 4LONB 4IGTA 1JETA 3G3HA 2ZYOA 4OXVA 4F1VA 3MW0A 4EXLA 1LB8A 1FQCA 1B3FA 5DYHA 2XXHA 3HO7A 4G68B 1XOCA 4QHQA 3S9EA 4O3BA 3G3GA 4KR5A 3EN3A 4OFLA 4GOTA 1A54A 3T96B 1MQHA 1B5JA 4DIGA 4F18A 3OOAA 1Z7NE 5CBRA 2OWTA 3FVGA 1XHYA 1A99A 4JB7A 4GVOA 2Q88A 5AA3A 5ELVA 3P7IA 3PPOA 3OENA 3MP1A 4HW8A 3SESA 3V8XB 1B0HA 2ALUA 5DVFA 4BDNA 2R71A 3MVXA 3O28A 3PMVA 3H3GA 3D4CA 1OLCA 3B6WA 4GFRA 4QFNA 1SBPA 2PT2A 1MDP1 4HTGA 1URSA 2YPNA 2NXOA 4MLQA 3TODA 3EHTA 3PMWA 1P1NA 3EF7A 2DXYA 1UIVA 3OEKA 2F34A 3WAFA 5CM6A 3TDJA 4NWDA 1IXCA 2P0SA 3U8QA 4GLIA 2XXIA 1I6AA 3CG1A 2IA4A 2RF1A 2Q2CA 4P0GA 3GXAA 5I56B 2Y7PA 1PB7A 1TWYA 3K6XA 3M3KA 1M5CA 1B0LA 3S9LC 3TTKA 4X48A 2RCBA 3FIRA 3T22A 4LA9A 4IO7A 1H44A 1MXUA 3QAXA 2VHAA 3UA8A 3MPLA 1B4HA 4RPNA 1EZPA 4LZ8A 3PMXA 1SW2A 4FECA 4H1XA 2ZYKA 5TU0A 3PUZE 4ZZEA 3OO7A 3IAZA 4GL8A 1MXVA 5EHSA 3Q26A 4NF6B 2A5SA 4Z7EA 4HCWA 5FHMA 3E3KA 2Y84A 2I49A 1IQ7A 3H4ZA 2DQVA 2I4BA 2O7UA 3QUJA 5LOMA 4DE8A 1BIYA 4F3SA 1KWHA 1D9YA 2REJA 3V5AA 1B05A 4KYSA 5CMKA 4OQOA 2UVHA 3KSXA 1POTA 4DXBA 1R9QA 1D9VA 4G2ZA 1B52A 4Z0IA 1B6HA 1B46A 4U1ZA 1QKBA 2XD3A 5KCJB 1N76A 2GH9A 5KDTB 3IORA 2NWJA 2THIA 2I0CA 1QUJA 4IO4A 2ESNA 2W7YA 3OO9A 2Q8JA 3KJTA 4YB6A 1MY1A 5TPAA 3CG3A 4OMBA 3DP8A 3C4MA 1O7TA 4ISUA 1FQBA 1PBQA 3FXUA 3RT6B 2D21A 3VLVA 5CMCA 3IO4A 5M2VA 1I69A 1EH3A 3VE1B 1UIUA 4EQ9A 1EZOA 2AL4A 5B70A 2QS4A 3MVYA 3VFJA 2XX9A 4R74A 4N07A 3FV1A 1B7ZA 3HHFA 1RYXA 1IZ1A 4NE4A 3C34A 1LLSA 1UTBB 1Y4TA 2CZLA 4THIA 2OCUA 3R7XA 2B65A 4BDLA 3E13X 1LSTA 4MLVA 3LSXA 3S2VA 1LCTA 1QUIA 4EF1A 2F35A 2F7BA 2V3UA 4ELQA 5K2YA 3EQ1A 2G29A 4QSCA 1OQHA 1A55A 3HPIA 3I5OA 2V3TA 2E0SA 2PVUA 2HFBA 1CE2A 3SEWA 2ONSA 2Q2AA 3ZSFA 2ZYNA 3AXFA 5DT6A 2F7AA 2O84X 1N7XA 4AB6A 1XT8A 3PD8A 1I6QA 4Q5TA 4E0WA 4ZE9A 2G93A 2NUVA 3K02A 3LSFB 4POXA 1B9JA 1FQDA 2ZMBA 1ATGA 2YJPA 2NOOA 1NH8A 3OXNA 2HAVA 1H45A 3MJNA 3BKIB 2XHDA 1PDAA 1YPNA 1BKAA 3RQTA 4DDDA 2FYIA 4KYEA 4H67A 1DPEA 3TFLA 4YKJA 2VGQA 3TCGA 2QS2A 3QK6A 3ILUB 1DPPA 2Z8DA 1PB9A 4I62A 4ELRA 3TQLA 3K1NA 3OSQA 1PEBA 3PGFA 2ONKE 1QULA 2A5TA 1JNFA 4QFLA 4G8NA 2XXWA 2DWJA 3FATA 5KCJA 4NF8A 5H8HA 5H8NB 1YTVA 5ITOA 1URGA 3CFXA 4UACA 4EDPA 3OSRA 3W15C 1RYOA 1O63A 3MWBA 4DCXA 3GBAA 1N3XA 5ISUA 3G3FA 3Q29A 1FTLA 3SEUA 1OMPA 3S4UA 5J1DA 3HCQA 5CRYA 4JSOA
chains in the Genus database with same CATH superfamily
4LQ5A 3O29A 4F19A 4OWDA 3ZKKA 1VSOA 3T9UA 2DVCA 4N8YA 2DP8A 5AE4A 1MH3A 2DS9A 2WBDA 2UVGA 2PBWA 1RDZA 5DVIA 1FJ6A 1HSLA 5AA1A 1IXGA 2Y7KA 5DW8A 4M1VA 3RGYA 2AL5A 2XXQA 1Y3PA 4GXSB 2DDKA 2ZZXA 4OFOA 4FEBA 3N26A 4F31B 4LZ5A 3K6WA 2HZKA 3FXQA 1LFGA 4PDDA 1OQGA 4F3GA 4R9FA 2UYFA 1B51A 1MY3A 4H5GA 1YAEA 1H43A 2H99A 2PYYA 1B3HA 1QJMA 3RT8A 4KYDA 3SETA 2OX3A 3I6VA 4YKKA 3TAJA 3OMBA 3IOWA 3IO6A 3RLFE 2P2AA 2QS3A 3TTMA 2E1SA 3N6TA 1FQFA 3H03A 1FBHA 5I57A 1US4A 3LUZA 3VV5A 4RYAA 4PFYA 4H5FA 4IY5A 3RPWA 1B3LA 4WKMA 1MS7A 2ZNTA 3PU5A 3ECRA 3LSLA 2DSFA 1O64A 3UP9A 1Y20A 1DTGA 1XVXA 5TPAB 2UVJA 4P9KA 1BLFA 3DM0A 4KI0E 4Q30B 3O6IA 1FSAA 3MVZA 2Y7RA 3HFUA 1IMAA 3CFLA 5A5LA 1LFHA 3U65A 3KOTA 1MXZA 3MQ9A 4HCYA 2XXXA 2I0BA 1KA1A 2Z23A 4UABA 2F3DA 2B3BA 1YXIA 2ZNUA 1VR5A 4X04A 3TCFA 1D9QA 1P1OA 4MBPA 3C32A 5DTBA 4PF8A 5I2NA 5K2XA 5AA4B 4K3FA 1MY2A 3IB0A 4R75A 5ESYA 4F29A 5L9OA 4Q0CA 4YICA 5DVJA 2FHYA 1ZKBA 4R6YA 4MMPA 3UORA 1BTJA 1LGBC 4ZEBA 3ZKLA 5ITPA 1Y3NA 5H8NA 3K1PA 5I58B 3HN0A 1MQIA 3SDFA 4LZ7A 1TFDA 5FTIA 1IMBA 3H6UA 3N94A 4ZEKA 1UTHA 4PETA 3TUSA 2QPQA 3Q25A 3A29A 4P3LA 4OZ9A 1DOTA 2H25A 3ODBA 1ZJLA 1ZTYA 1IUDA 2F5XA 2XWOA 4KQPA 3FVKA 1AL3A 1HSEA 1N3WA 3KN7A 3HHGA 2LAOA 4DXCA 3SEVA 3LBSA 2HEUA 5CI5A 4QF9A 2O1MA 3PD9A 2ABHA 2DE3A 1II5A 3H6VA 2WX9A 1NMUA 1Y4CA 3CIJA 1MRPA 1QUKA 1NUZA 3PUVE 2UYEA 1SDXA 4RXLA 2VPNA 1GV8A 2XD2A 3PPRA 4RA1A 3OEMA 3OO8A 4KCDA 3B50A 4OVQA 1NFTA 3OD7A 1JW4A 3T9HB 3U92A 3A09A 4XKNA 1KA0A 1MXXA 4QBAA 3DLNA 4BDRA 3R6UA 1A8EA 1SPIA 4FATA 2F36A 4G8HA 4TLLB 3FVNA 1Q35A 2AIXA 4OEUA 5BUUA 2HCAA 1NV6A 5H8SA 5H8FB 4U4XA 5IZZA 1LBXA 2Y7WA 4R73A 1FBFA 1QKAA 3RNNA 4I9DA 5EYHA 2A5TB 3T0JA 2VT5A 1IMFA 3IJOB 1L5TA 1Y3QA 4FEDA 1D3KA 1FPKA 2GQ1A 3H6TA 4NF8B 5H8HB 3IX1A 1JVYA 3S9MC 1LAHE 4PBHA 2I3WA 3CR9A 4HS7A 3BBRA 2R8TA 1IMEA 5A5XA 1K9YA 2XA5A 4YZZA 3V89B 2WEFA 4G61A 2OZZA 1B1HA 2OLBA 1T0KA 1EZ9A 3QYTA 4FE8A 4F39A 1F9BA 4KCCA 4IGRA 4ZEIA 3MP8A 4O3AA 3ISPA 2FIXA 3EHUA 3VVDA 2RC9A 3L6HA 1B7UA 4PCDA 1AOVA 4O7MA 1P99A 2GHBA 1VE4A 1IIWA 4NF4B 4ZECA 3MVWA 2F97A 4JDFA 1H76A 5T3JA 4ZS9A 4XTCQ 5AA4A 3MSTA 4EF2A 1HSJA 4RY1A 2Q9TA 4OHNA 3B6QA 1A8FA 2B4LA 5L9MA 3SERA 1FQAA 4YKIA 5I7IA 5F7VA 1OIBA 2F6PA 3IOTA 1LBCA 4ZDMA 5I58A 2Z22A 1S7YA 4YB5A 2XX8A 5FTHA 2WBBA 2HHMA 4IB2A 1PC3A 4PF6A 1Y9UA 1M5EA 4OYVA 1OLAA 3IB1A 4YMAA 1DMBA 4OERA 4U23A 4P47A 1TFAA 2Y7IA 3UN6A 1NKXA 4MH5A 1B7HA 1EU8A 4TQUQ 5I57B 3KGCA 5JTYA 1R1NA 1ZBMA 5ET6A 5IKBA 3MAMA 4N15A 4ELPA 3S9NC 2PFZA 5I59A 5AA2D 3CFZA 4RPOA 4GX6A 4ONYA 5I2KA 1N84A 1OVBA 3W9WA 1PB8A 1FTJA 5EQAA 4E0XA 2Z8EA 2ZYMA 5AA2B 4ZEFA 3VXCA 4N6KA 2QSXA 1FQEA 4NHBA 2QVVA 2WYKA 3O2AA 3R26A 4JVDA 4KD5A 1NV5A 1MM6A 1D4NA 4FJPA 4FORA 3USDA 2ONRA 3VVEA 2Q89A 2Y5LA 1LB9A 3Q28A 2XXUA 3O97A 1P1UA 2H98A 5CBSA 1MG1A 2QL3A 5HPQA 1WODA 5H8FA 5I2NB 2QMWA 2V3QA 3MUQA 3VXBA 4JWYA 4NG7A 1MQJA 4H65A 4X1BA 4PFBA 2GRVA 4P56A 3OO6A 3N6UA 3MZBA 3T1BA 4PFIA 1JQFA 4MFIA 2CEYA 4N6DA 2OK2A 3RUMA 4LATA 4WEDA 3K01A 5DEXB 5CMMA 3KBZA 3EHSA 2QVUA 3IK6B 1UTHB 5CMBA 3L6GA 3ONMA 2QMXA 4DI3D 4C1TA 4R6KA 1CB6A 4ESWA 4OENA 5HBCA 4OETA 2F8DA 3FJ7A 5IAIA 4C1UA 4DXUA 3RYDA 1POY1 4OFJA 3K0VA 1MPDA 3CSGA 4C0RA 2HXRA 1FCKA 4F3PA 4PDHA 1QW0A 1M5BA 2VOZA 4N13A 2ZZWA 1SW5A 5CC2A 3FD3A 2Z8FA 3C31A 1N0TA 2XXPA 4OVTA 3KZGA 1FTMA 1MH4A 4ESXA 3M3FA 4NF4A 2RCAA 4PAFA 4ZZAA 1FBDA 1GGGA 3RN8A 3TMGA 4I3EA 3FVOA 1NH7A 1ELJA 1B5HA 3O9PA 1AMFA 1LBBA 3K1MA 4NEDA 3C9HA 1US5A 5H8QB 4XEQA 4YU0A 4H6DA 3FZVA 3MZ9A 4X9TA 1B3EA 1LAFE 3FJGA 1JEUA 3B6TA 4F1YA 4GX4A 2KLFA 1LAXA 4GBVA 4OANA 5ET5A 1A7LA 3C36A 2DVZA 3E4RA 4U1OA 2VP1A 1R9LA 3DP4A 4NGUA 1MXWA 3I3VA 3LUYA 4G8MA 3FXRA 3GZGA 3GLBA 3K4UA 1TT1A 3BFTA 3G3JA 1NV3A 3IJXB 2NVUB 3HV1A 3T9XB 4H8IA 2R9JA 2CMOA 2DWHA 5A5XB 1FPGA 2QRYA 1XC1A 3TQWA 4IO3A 3PTYA 3E9XA 2REGA 1FPJA 3GYYA 3IFAA 4PAIA 5EQ8A 3KN3A 4PP0A 4POWA 4R2FA 4HXVA 1MDQA 3BIGA 2XXYA 2VD3A 1M5FA 1FJ9A 1Y1MA 5AA2A 4TLMB 3IOUA 3C35A 2GHAA 5I84A 1RKMA 4TOZA 2O69A 4P1EA 3JYRA 1SW4A 4PFUA 4ZE8A 2H9BA 4MEVA 1H3DA 1SI0A 3RTFB 3THIA 1JEVA 3QUFA 3BFUA 2H5YA 3LSWA 2AYSA 3CSBA 4GL0A 3TKDA 5EQ9A 5B7DA 2CEXA 2HXWA 3EPEA 1VFEA 4H0WA 1EYJA 4QSEA 2L5VA 4PBQA 3A3CA 3V83A 4DLDA 3LC8A 1XS5A 3FGSA 4JVIA 2JJKA 4U22A 3K00A 3UIFA 1MPBA 2UXAA 5DEXA 2R6GE 4PC9A 2I58A 1R6ZA 4H45A 3JZJA 2DE2A 4IO5A 2PCRA 2H4IA 4QSDA 4XF5A 4GWSA 4BLAA 1N04A 3D4GA 2KQZA 5HM4B 3DP6A 5JTYB 3TEPA 2I6EA 3F11A 2IEEA 4ND9A 1PBPA 4HE1A 1MQDA 3FASA 1XVYA 4MNIA 1B3GA 3JV9A 1AWBA 5I59B 3PUXE 4PGPA 5BWJA 5TP9B 1A40A 1MXYA 1IITA 1NUWA 4PFRA 5I2KB 1FPEA 2FBPA 4NF0A 4LVQA 1I6BA 3Q27A 1NNTA 4G4PA 5F1QA 4IO6A 3TTNA 3H06B 4NF5B 1SI1A 5H8QA 4R6HA 3IL1B 3KG2A 1B5IA 1JP4A 4PFTA 1NNFA 3RY3A 2Y5KA 2VD2A 4OESA 1JVXA 1P1QA 3TTLA 3ZS6A 2PT1A 4EUOA 4OVJA 3KJ7A 3KSJA 1GTKA 2RKMA 1DTZA 4YMBA 2OJTA 1GR2A 4PQJA 2RC8A 4BDMA 1AIVA 4MJOA 4QFKA 1B32A 2I4CA 2P3NA 3M8UA 1IMDA 4P0IA 3CVGA 3FJMA 3SEXA 2OWSA 1B1XA 4U2RA 1LFIA 2X7QA 4JWXA 3QSLA 3TZAA 4RK9A 5JK4A 2BJJX 1P1WA 4I1DA 5ET7A 2M8CA 4XKQA 1FPDA 4RNSA 1ANFA 1FBEA 4OVRA 3KBRA 3N5LA 1YCJA 4PE5B 3FXBA 1MY4A 4I8CA 3G3IA 3QXMA 1LCFA 2OBGA 4ELOA 4XXUA 3UK4A 1IXHA 1MQGA 4O3CA 4F2QA 2F3BA 4IO2A 1USYE 2F6GA 1IEJA 4N4UA 1ZMGA 3TTRA 4MF3A 3VLUA 3T93B 2O1LA 4G68A 1MPCA 1LEVA 3OELA 4M4GA 3SZPA 3W9VA 4EQBA 1FTOA 3PV0E 4P11A 3CHGA 3H6WA 4GIZA 2DWIA 4QFOA 4OTEA 1S9TA 4NWCA 3PPPA 4WEPA 3PPQA 3IOVA 4Q8RA 1NL5A 4XIGQ 4KHZE 4R72A 4QFPA 2XX7A 1XI6A 2F7CA 1ZU0A 2PMSA 3MPKA 1G0HA 4YB7A 1QVSA 2P1SA 1FPLA 2DOJA 4PFWA 4KFQA 1JW1A 5L9SA 3C33A 4YKPA 3TYHA 2I48A 1Q1KA 3G7WA 4H46A 1LAGE 4FAJA 3FV2A 3PUYE 3VDFA 3IB2A 3TCHA 4GWXA 4U4SA 4KPTA 1B58A 1SYHA 2O51A 4GWOA 2CZHA 4LUBA 1SW1A 2ZXTA 2HAUA 4O8MA 4OVPA 3DELB 4L17A 3T66A 2RC7A 3VVFA 4F3BA 4GQOA 5IZ1A 5I5PA 2HQ0A 3KFMA 2DWAA 2GFEA 2O6AA 4WXJA 2QS1A 3FBPA 3U72A 3A3UA 2O68A 3LR1A 5TP9A 5I56A 1FBPA 4OVSA 4BDOA 3HSTA 1FTKA 2O7IA 2UVIA 1S50A 4IY6A 3SEYA 5EYFA 2D3IA 4AB5A 2XXRA 2QJEA 4QRZA 4NMYA 1SQYA 4NF5A 1NV2A 5L8DA 2DE4A 2KR0A 4N91A 1LBZA 4PGNA 2V93A 3FUZA 2ANJA 1SVXB 1NUXA 3K6UA 4O94A 2I3VA 3NOHA 3U94A 4NF6A 3O66A 3H7MA 1OVTA 5J16A 4JSDA 5FHOA 4X8RA 3MP6A 2ZNSA 3KOSA 2XXKA 1N7WA 1JW5A 3SKPA 1Z7ME 1IXIA 5KZTA 1WVJA 4NQ8A 3K6VA 3TPAA 3MC2A 4LQ2A 1NNKA 4YAHX 2B3FA 3WAEA 3MBPA 4RK2A 5JEIA 4FIMA 1UQWA 1DSNA 3O6GA 4BDQA 4ECFA 4EXKA 1VFDA 1ZLQA 5ICTA 4LP2B 5LDZA 2FNCA 3VLWA 2Q74A 2X26A 1URDA 3CI8A 4GD5A 4OEVA 4NTLA 1YZ0A 1FW0A 4MIJA 5KDTA 3ILTB 2XXTA 2V84A 4F1UA 4R9GA 4UA8A 5ICQA 4U21A 4GX3A 1TXFA 4ZEDA 2HPGA 4GBWA 2XWKA 3PUWE 1NNPA 4F22A 1Y1ZA 2DXRA 1GVCA 2XXVA 3O6HA 5EYGA 2X7PA 1MY0A 4JBZA 4MAGA 5EHMA 4N6PA 4GXAA 5IM2A 1USYH 1WDNA 3MZ1A 4X1DA 3K2DA 4DCYA 4F2OA 3GBBA 4MCOA 1MM7A 4PTKA 3U93A 2HZLA 1AH5A 1QGXA 3QIMA 2VPOA 1B4ZA 4H8JA 5I3SA 1G0IA 1NV7A 2PX1A 3B7DA 3U1OA 4PAKA 2V25A 3KEIA 4I40A 1UTBA 1SYIA 2WKYA 2F78A 4G68C 2D5WA 4AQ4A 1SD3A 2RINA 3PPNA 4DZ1A 3M3LA 3KN8A 4JXIA 3G3KA 3RPLB 4GRKA 1BP5A 5FHNA 1B40A 4JWOA 4G77A 3RTWB 1LBWA 1ZIUA 1J1NA 3IR1A 4XKPA 4EQ7A 3T9VA 4NAPA 3CRBA 4XKRA 2CZKA 2ZZVA 1B2HA 1Q9DA 4R2BA 4IR8A 1M5DA 2DYXA 2B4MA 2YLNA 3TELA 1FPFA 4KXPA 2FA7A 4GF8A 3UGWA 4RJZA 4LONB 1FRPA 4IGTA 1JETA 3G3HA 2ZYOA 4OXVA 4F1VA 3MW0A 4EXLA 1LB8A 1FQCA 1INPA 1B3FA 5DYHA 1FPIA 2XXHA 3HO7A 4G68B 1XOCA 4QHQA 3S9EA 4O3BA 3G3GA 4KR5A 3EN3A 4OFLA 4GOTA 1VDWA 1A54A 3T96B 1MQHA 2MKZA 1FBGA 1B5JA 4DIGA 4F18A 3OOAA 1Z7NE 5CBRA 2OWTA 3FVGA 1XHYA 4OA4A 1A99A 4JB7A 4GVOA 2Q88A 4N8GA 5AA3A 5ELVA 3P7IA 3PPOA 1K9ZA 3OENA 4MHFA 3MP1A 4HW8A 3SESA 3V8XB 4MNPA 1B0HA 2ALUA 5DVFA 4BDNA 2R71A 3MVXA 3O28A 3PMVA 2FIEA 3H3GA 3E79A 3D4CA 3ROJA 1OLCA 3B6WA 4GFRA 4QFNA 1SBPA 1DCUA 1NUYA 2PT2A 1MDP1 4HE2A 4HTGA 1URSA 2YPNA 2NXOA 5IZ3B 1LBVA 4MLQA 3TODA 3EHTA 3PMWA 1P1NA 4N81A 3EF7A 2DXYA 1UIVA 3OEKA 2F34A 3WAFA 5CM6A 3TDJA 4NWDA 1IXCA 2P0SA 3U8QA 4GLIA 2XXIA 5F24A 2PFYA 1I6AA 3CG1A 2IA4A 2RF1A 5IGAA 2Q2CA 4MNCA 4P0GA 3GXAA 5I56B 2Y7PA 2XWIA 1PB7A 1TWYA 3K6XA 3M3KA 1M5CA 1B0LA 3S9LC 3TTKA 4X48A 2RCBA 3FIRA 3T22A 1BK4A 4I3YA 4LA9A 1NV4A 1H44A 1MXUA 4IO7A 3KC1A 3QAXA 2VHAA 3UA8A 3MPLA 1B4HA 4RPNA 1CNQA 1EZPA 4LZ8A 3PMXA 1SW2A 4FECA 4H1XA 2ZYKA 5TU0A 3PUZE 4ZZEA 3OO7A 3IAZA 4GL8A 3B8BA 1MXVA 1KZ8A 2V4CA 3QMFA 5EHSA 3Q26A 4NF6B 2A5SA 4Z7EA 4HCWA 5FHMA 3RPLA 3E3KA 1EYKA 2Y84A 2I49A 1IMCA 4PE3A 1IQ7A 3H4ZA 2DQVA 2I4BA 2O7UA 3QUJA 5LOMA 1FPBA 4DE8A 1BIYA 4F3SA 1KWHA 1D9YA 2REJA 3V5AA 1B05A 4KYSA 5CMKA 2P3VA 4JVCA 2QFLA 3LV0A 4OQOA 1RDYA 2UVHA 3KSXA 1POTA 5ET8A 4DXBA 1R9QA 1D9VA 4G2ZA 1B52A 4Z0IA 1B6HA 1B46A 4N17A 4U1ZA 1QKBA 2XD3A 5KCJB 1N76A 2GH9A 5KDTB 3IORA 2NWJA 2QVRA 2THIA 2I0CA 1QUJA 4IO4A 2ESNA 2W7YA 3OO9A 1DBZA 2Q8JA 3KJTA 4YB6A 1MY1A 3BIHA 5TPAA 3CG3A 4OMBA 3DP8A 3C4MA 1O7TA 4ISUA 1FQBA 1YYZA 1PBQA 3FXUA 4GWYA 3RT6B 3D1RA 2D21A 3VLVA 5CMCA 3IO4A 5M2VA 1I69A 1EH3A 3VE1B 3IFCA 1UIUA 4EQ9A 2WYPA 1EZOA 2AL4A 5B70A 2QS4A 1NI9A 4QXDA 3MVYA 3VFJA 2XX9A 1NV1A 4N07A 4R74A 3FV1A 1B7ZA 3E78A 2XWVA 3HHFA 4NN3A 1RYXA 1IZ1A 4NE4A 3C34A 1LLSA 5LTCA 4NX1A 4P8BA 1UTBB 1Y4TA 2OWZA 2CZLA 4THIA 2OCUA 3R7XA 2B65A 1RDXA 4BDLA 3E13X 1LSTA 4MLVA 5IZ3A 3LSXA 4LN5A 3S2VA 1LCTA 1QUIA 2BJIA 4EF1A 2F35A 2F7BA 2V3UA 4ELQA 5FBPA 4FBPA 3MYUA 5K2YA 3EQ1A 1LBYA 2G29A 4QSCA 1OQHA 1A55A 2CZIA 3HPIA 3I5OA 2V3TA 2E0SA 2PVUA 2HFBA 4AS5A 4DI4B 1CE2A 3SEWA 2ONSA 2Q2AA 3ZSFA 2ZYNA 3AXFA 5DT6A 2F7AA 2O84X 1N7XA 4AB6A 4GWWA 1XT8A 3PD8A 1I6QA 4Q5TA 4E0WA 4ZE9A 2G93A 2NUVA 3K02A 3LSFB 4POXA 1B9JA 1FQDA 1FTAA 2ZMBA 1ATGA 2YJPA 2NOOA 3KC0A 5EQ7A 1NH8A 3OXNA 2HAVA 1H45A 1FBCA 3MJNA 3BKIB 2XHDA 1PDAA 1YPNA 1BKAA 3RQTA 4DDDA 2FYIA 4MX6A 4KYEA 4H67A 1DPEA 4HE0A 3TFLA 4YKJA 2VGQA 3TCGA 2QS2A 3QK6A 3ILUB 1DPPA 2Z8DA 1PB9A 4I62A 4ELRA 3TQLA 3EKIA 3K1NA 3OSQA 1PEBA 3PGFA 2ONKE 1QULA 2A5TA 1JNFA 2Q8MA 4QFLA 4G8NA 2XXWA 4AS4A 2DWJA 3FATA 5KCJA 4NF8A 5H8HA 5H8NB 4GWZA 1YTVA 5ITOA 1DK4A 1URGA 3CFXA 4P1LA 4UACA 4EDPA 3OSRA 3W15C 1RYOA 1O63A 4O7IA 3MWBA 4DCXA 3GBAA 1N3XA 4XFEA 5ISUA 3G3FA 3Q29A 2FVZA 1FTLA 1EYIA 3SEUA 1OMPA 3S4UA 4GWUA 5J1DA 3HCQA 1NV0A 5CRYA 4JSOA
chains in the Genus database with same CATH topology
4LQ5A 3O29A 4F19A 4OWDA 3ZKKA 1VSOA 3T9UA 2DVCA 2DP8A 5AE4A 1MH3A 2DS9A 2UVGA 2PBWA 5DVIA 1HSLA 5AA1A 1IXGA 2Y7KA 4M1VA 3RGYA 2AL5A 2XXQA 1Y3PA 4GXSB 4OFOA 4FEBA 3N26A 4F31B 4LZ5A 3K6WA 2HZKA 3FXQA 1LFGA 1OQGA 4F3GA 4R9FA 2UYFA 1B51A 1MY3A 4H5GA 1YAEA 1H43A 2H99A 2PYYA 1B3HA 1QJMA 3RT8A 4KYDA 3SETA 3I6VA 4YKKA 3TAJA 3OMBA 3IOWA 3IO6A 3RLFE 2P2AA 2QS3A 3TTMA 2E1SA 3N6TA 1FQFA 3H03A 5I57A 1US4A 3VV5A 4RYAA 4PFYA 4H5FA 4IY5A 3RPWA 1B3LA 4WKMA 1MS7A 2ZNTA 3PU5A 3ECRA 3LSLA 2DSFA 1O64A 3UP9A 1Y20A 1DTGA 1XVXA 5TPAB 2UVJA 1BLFA 3DM0A 4KI0E 4Q30B 3O6IA 3MVZA 2Y7RA 3CFLA 1LFHA 3KOTA 1MXZA 3MQ9A 4HCYA 2XXXA 2I0BA 2Z23A 2B3BA 2ZNUA 1VR5A 3TCFA 1P1OA 4MBPA 3C32A 5DTBA 5I2NA 5K2XA 5AA4B 4F29A 4K3FA 1MY2A 3IB0A 4R75A 5L9OA 4Q0CA 4YICA 5DVJA 1ZKBA 4R6YA 3UORA 1BTJA 1LGBC 4ZEBA 3ZKLA 5ITPA 1Y3NA 5H8NA 3K1PA 5I58B 3HN0A 1MQIA 3SDFA 4LZ7A 1TFDA 5FTIA 3H6UA 3N94A 4ZEKA 1UTHA 4PETA 3TUSA 2QPQA 3Q25A 4OZ9A 1DOTA 2H25A 3ODBA 1ZJLA 1ZTYA 1IUDA 2F5XA 4KQPA 3FVKA 1AL3A 1HSEA 1N3WA 3KN7A 3HHGA 2LAOA 4DXCA 3SEVA 3LBSA 2HEUA 5CI5A 4QF9A 2O1MA 3PD9A 2ABHA 2DE3A 1II5A 3H6VA 1NMUA 1Y4CA 3CIJA 1MRPA 1QUKA 3PUVE 2UYEA 1SDXA 4RXLA 1GV8A 2XD2A 3PPRA 4RA1A 3OEMA 3OO8A 4KCDA 1NFTA 3OD7A 1JW4A 3T9HB 3U92A 3A09A 4XKNA 1MXXA 3DLNA 4BDRA 3R6UA 1A8EA 4FATA 2F36A 4G8HA 4TLLB 3FVNA 1Q35A 2AIXA 4OEUA 5BUUA 2HCAA 5H8SA 5H8FB 4U4XA 2Y7WA 4R73A 1QKAA 3RNNA 4I9DA 2A5TB 3IJOB 1L5TA 1Y3QA 4FEDA 1D3KA 3H6TA 4NF8B 5H8HB 3IX1A 1JVYA 3S9MC 1LAHE 2I3WA 3CR9A 4HS7A 3BBRA 5A5XA 4YZZA 3V89B 2OZZA 1B1HA 2OLBA 1T0KA 1EZ9A 3QYTA 4F39A 4FE8A 1F9BA 4KCCA 4IGRA 4ZEIA 3MP8A 4O3AA 3EHUA 3VVDA 2RC9A 3L6HA 1B7UA 1AOVA 1P99A 2GHBA 1VE4A 1IIWA 4NF4B 4ZECA 3MVWA 2F97A 4JDFA 1H76A 4ZS9A 4XTCQ 5AA4A 4EF2A 1HSJA 4RY1A 2Q9TA 4OHNA 3B6QA 1A8FA 5L9MA 3SERA 1FQAA 4YKIA 5F7VA 1OIBA 2F6PA 3IOTA 1LBCA 4ZDMA 5I58A 2Z22A 1S7YA 4YB5A 2XX8A 5FTHA 4IB2A 1PC3A 1Y9UA 1M5EA 4OYVA 1OLAA 3IB1A 4YMAA 1DMBA 4OERA 4U23A 1TFAA 2Y7IA 3UN6A 1NKXA 4MH5A 1B7HA 1EU8A 4TQUQ 5I57B 3KGCA 5JTYA 1R1NA 1ZBMA 5IKBA 3MAMA 4ELPA 3S9NC 5I59A 5AA2D 3CFZA 4RPOA 4ONYA 5I2KA 1N84A 1OVBA 3W9WA 1PB8A 1FTJA 4E0XA 2Z8EA 2ZYMA 5AA2B 4ZEFA 3VXCA 2QSXA 1FQEA 3O2AA 3R26A 4KD5A 1MM6A 1D4NA 4FJPA 4FORA 3USDA 2ONRA 3VVEA 2Q89A 1LB9A 3Q28A 2XXUA 3O97A 1P1UA 2H98A 5CBSA 1MG1A 2QL3A 5HPQA 1WODA 5H8FA 5I2NB 2QMWA 2V3QA 3MUQA 3VXBA 4JWYA 1MQJA 4H65A 4X1BA 2GRVA 3OO6A 3N6UA 3MZBA 1JQFA 4MFIA 2OK2A 3RUMA 4LATA 5DEXB 3K01A 4WEDA 5CMMA 3EHSA 3IK6B 1UTHB 5CMBA 3L6GA 3ONMA 2QMXA 4C1TA 4R6KA 1CB6A 4ESWA 4OENA 5HBCA 4OETA 2F8DA 3FJ7A 5IAIA 4C1UA 4DXUA 1POY1 4OFJA 3K0VA 1MPDA 3CSGA 4C0RA 1FCKA 4F3PA 1QW0A 1M5BA 2VOZA 4N13A 1SW5A 5CC2A 3FD3A 2Z8FA 3C31A 1N0TA 2XXPA 3KZGA 1FTMA 1MH4A 4ESXA 3M3FA 4NF4A 2RCAA 4ZZAA 1GGGA 3RN8A 3TMGA 3FVOA 1NH7A 1ELJA 1B5HA 3O9PA 1AMFA 1LBBA 3K1MA 4NEDA 3C9HA 1US5A 5H8QB 4YU0A 4H6DA 3FZVA 3MZ9A 4X9TA 1B3EA 1LAFE 3FJGA 1JEUA 3B6TA 4F1YA 2KLFA 1LAXA 1A7LA 3C36A 2DVZA 3E4RA 4U1OA 2VP1A 1R9LA 3DP4A 1MXWA 3I3VA 3LUYA 4G8MA 3FXRA 3GZGA 3GLBA 3K4UA 1TT1A 3BFTA 3G3JA 3IJXB 2NVUB 3HV1A 3T9XB 4H8IA 2R9JA 2CMOA 2DWHA 5A5XB 2QRYA 1XC1A 3TQWA 4IO3A 3E9XA 2REGA 3KN3A 4PP0A 4POWA 4R2FA 1MDQA 2XXYA 2VD3A 1M5FA 1Y1MA 5AA2A 4TLMB 3IOUA 3C35A 2GHAA 5I84A 1RKMA 4TOZA 2O69A 3JYRA 1SW4A 4PFUA 4ZE8A 2H9BA 1H3DA 1SI0A 3RTFB 3THIA 1JEVA 3QUFA 3BFUA 2H5YA 3LSWA 2AYSA 3CSBA 4GL0A 3TKDA 5B7DA 2HXWA 3EPEA 1VFEA 4H0WA 4QSEA 3A3CA 3V83A 4DLDA 3LC8A 1XS5A 3FGSA 4U22A 3K00A 3UIFA 1MPBA 2UXAA 5DEXA 2R6GE 2I58A 1R6ZA 3JZJA 2DE2A 4IO5A 2H4IA 4QSDA 4BLAA 1N04A 3D4GA 5HM4B 3DP6A 5JTYB 3TEPA 2I6EA 3F11A 2IEEA 4ND9A 1PBPA 1MQDA 3FASA 1XVYA 1B3GA 3JV9A 5I59B 3PUXE 5BWJA 5TP9B 1A40A 1MXYA 1IITA 5I2KB 4LVQA 1I6BA 3Q27A 1NNTA 4G4PA 5F1QA 4IO6A 3TTNA 3H06B 4NF5B 1SI1A 5H8QA 4R6HA 3IL1B 3KG2A 1B5IA 4PFTA 1NNFA 3RY3A 3TTLA 2VD2A 4OESA 1JVXA 1P1QA 3ZS6A 2PT1A 4EUOA 4OVJA 3KJ7A 3KSJA 1GTKA 2RKMA 1DTZA 4YMBA 2OJTA 1GR2A 4PQJA 2RC8A 4BDMA 1AIVA 4QFKA 1B32A 2I4CA 3M8UA 4P0IA 3CVGA 3FJMA 3SEXA 2OWSA 1B1XA 4U2RA 1LFIA 2X7QA 4JWXA 3QSLA 3TZAA 4RK9A 5JK4A 2BJJX 1P1WA 4I1DA 2M8CA 4XKQA 4RNSA 1ANFA 3KBRA 3N5LA 1YCJA 4PE5B 1MY4A 4I8CA 3G3IA 3QXMA 1LCFA 2OBGA 4ELOA 4XXUA 3UK4A 1IXHA 1MQGA 4O3CA 4F2QA 4IO2A 1USYE 2F6GA 1IEJA 1ZMGA 3TTRA 4MF3A 3VLUA 3T93B 2O1LA 4G68A 1MPCA 3OELA 4M4GA 3W9VA 4EQBA 1FTOA 3PV0E 4P11A 3H6WA 4GIZA 2DWIA 4QFOA 4OTEA 1S9TA 4NWCA 3PPPA 4WEPA 3PPQA 3IOVA 4Q8RA 1NL5A 4XIGQ 4KHZE 4R72A 4QFPA 2XX7A 2F7CA 1ZU0A 2PMSA 3MPKA 4YB7A 1QVSA 2P1SA 2DOJA 4PFWA 4KFQA 1JW1A 5L9SA 3C33A 4YKPA 3TYHA 2I48A 1Q1KA 3G7WA 1LAGE 4FAJA 3FV2A 3PUYE 3VDFA 3IB2A 3TCHA 4U4SA 4KPTA 1B58A 1SYHA 2O51A 4GWOA 4LUBA 1SW1A 2ZXTA 2HAUA 3DELB 4L17A 3T66A 2RC7A 3VVFA 4F3BA 4GQOA 2HQ0A 3KFMA 2DWAA 2GFEA 2O6AA 4WXJA 2QS1A 3U72A 3A3UA 2O68A 3LR1A 5TP9A 5I56A 4BDOA 3HSTA 1FTKA 2O7IA 2UVIA 1S50A 4IY6A 3SEYA 5EYFA 2D3IA 4AB5A 2XXRA 2QJEA 4QRZA 4NMYA 1SQYA 4NF5A 5L8DA 2DE4A 2V93A 3FUZA 2ANJA 1SVXB 3K6UA 2I3VA 3U94A 4NF6A 3O66A 3H7MA 1OVTA 4JSDA 5FHOA 3MP6A 2ZNSA 3KOSA 1N7WA 1JW5A 3SKPA 1Z7ME 1IXIA 5KZTA 1WVJA 3K6VA 3TPAA 3MC2A 4LQ2A 1NNKA 4YAHX 3WAEA 2B3FA 3MBPA 4RK2A 5JEIA 4FIMA 1UQWA 1DSNA 3O6GA 4BDQA 4ECFA 4EXKA 1VFDA 1ZLQA 5ICTA 4LP2B 2FNCA 3VLWA 2X26A 1URDA 3CI8A 4GD5A 4OEVA 4NTLA 1FW0A 5KDTA 3ILTB 2XXTA 2V84A 4F1UA 4R9GA 4UA8A 5ICQA 4U21A 1TXFA 4ZEDA 3PUWE 1NNPA 4F22A 1Y1ZA 2DXRA 1GVCA 2XXVA 3O6HA 2X7PA 1MY0A 4JBZA 5EHMA 4N6PA 4GXAA 1USYH 1WDNA 3MZ1A 4X1DA 3K2DA 4DCYA 4F2OA 3GBBA 1MM7A 3U93A 2HZLA 1AH5A 3QIMA 1B4ZA 4H8JA 2PX1A 3B7DA 3U1OA 2V25A 3KEIA 1UTBA 1SYIA 2WKYA 2F78A 4G68C 2D5WA 4AQ4A 1SD3A 2RINA 3PPNA 4DZ1A 3M3LA 3KN8A 4JXIA 3G3KA 4GRKA 1BP5A 5FHNA 1B40A 4JWOA 4G77A 3RTWB 1ZIUA 1J1NA 3IR1A 4XKPA 4EQ7A 3T9VA 3CRBA 4XKRA 1B2HA 4R2BA 1M5DA 2DYXA 2YLNA 3TELA 2FA7A 4GF8A 3UGWA 4RJZA 4LONB 4IGTA 1JETA 3G3HA 2ZYOA 4OXVA 4F1VA 3MW0A 4EXLA 1LB8A 1FQCA 1B3FA 5DYHA 2XXHA 3HO7A 4G68B 1XOCA 4QHQA 3S9EA 4O3BA 3G3GA 4KR5A 3EN3A 4OFLA 4GOTA 1A54A 3T96B 1MQHA 1B5JA 4DIGA 4F18A 3OOAA 1Z7NE 5CBRA 2OWTA 3FVGA 1XHYA 1A99A 4JB7A 4GVOA 2Q88A 5AA3A 5ELVA 3P7IA 3PPOA 3OENA 3MP1A 4HW8A 3SESA 3V8XB 1B0HA 2ALUA 5DVFA 4BDNA 2R71A 3MVXA 3O28A 3PMVA 3H3GA 3D4CA 1OLCA 3B6WA 4GFRA 4QFNA 1SBPA 2PT2A 1MDP1 4HTGA 1URSA 2YPNA 2NXOA 4MLQA 3TODA 3EHTA 3PMWA 1P1NA 3EF7A 2DXYA 1UIVA 3OEKA 2F34A 3WAFA 5CM6A 3TDJA 4NWDA 1IXCA 2P0SA 3U8QA 4GLIA 2XXIA 1I6AA 3CG1A 2IA4A 2RF1A 2Q2CA 4P0GA 3GXAA 5I56B 2Y7PA 1PB7A 1TWYA 3K6XA 3M3KA 1M5CA 1B0LA 3S9LC 3TTKA 4X48A 2RCBA 3FIRA 3T22A 4LA9A 4IO7A 1H44A 1MXUA 3QAXA 2VHAA 3UA8A 3MPLA 1B4HA 4RPNA 1EZPA 4LZ8A 3PMXA 1SW2A 4FECA 4H1XA 2ZYKA 5TU0A 3PUZE 4ZZEA 3OO7A 3IAZA 4GL8A 1MXVA 5EHSA 3Q26A 4NF6B 2A5SA 4Z7EA 4HCWA 5FHMA 3E3KA 2Y84A 2I49A 1IQ7A 3H4ZA 2DQVA 2I4BA 2O7UA 3QUJA 5LOMA 4DE8A 1BIYA 4F3SA 1KWHA 1D9YA 2REJA 3V5AA 1B05A 4KYSA 5CMKA 4OQOA 2UVHA 3KSXA 1POTA 4DXBA 1R9QA 1D9VA 4G2ZA 1B52A 4Z0IA 1B6HA 1B46A 4U1ZA 1QKBA 2XD3A 5KCJB 1N76A 2GH9A 5KDTB 3IORA 2NWJA 2THIA 2I0CA 1QUJA 4IO4A 2ESNA 2W7YA 3OO9A 2Q8JA 3KJTA 4YB6A 1MY1A 5TPAA 3CG3A 4OMBA 3DP8A 3C4MA 1O7TA 4ISUA 1FQBA 1PBQA 3FXUA 3RT6B 2D21A 3VLVA 5CMCA 3IO4A 5M2VA 1I69A 1EH3A 3VE1B 1UIUA 4EQ9A 1EZOA 2AL4A 5B70A 2QS4A 3MVYA 3VFJA 2XX9A 4R74A 4N07A 3FV1A 1B7ZA 3HHFA 1RYXA 1IZ1A 4NE4A 3C34A 1LLSA 1UTBB 1Y4TA 2CZLA 4THIA 2OCUA 3R7XA 2B65A 4BDLA 3E13X 1LSTA 4MLVA 3LSXA 3S2VA 1LCTA 1QUIA 4EF1A 2F35A 2F7BA 2V3UA 4ELQA 5K2YA 3EQ1A 2G29A 4QSCA 1OQHA 1A55A 3HPIA 3I5OA 2V3TA 2E0SA 2PVUA 2HFBA 1CE2A 3SEWA 2ONSA 2Q2AA 3ZSFA 2ZYNA 3AXFA 5DT6A 2F7AA 2O84X 1N7XA 4AB6A 1XT8A 3PD8A 1I6QA 4Q5TA 4E0WA 4ZE9A 2G93A 2NUVA 3K02A 3LSFB 4POXA 1B9JA 1FQDA 2ZMBA 1ATGA 2YJPA 2NOOA 1NH8A 3OXNA 2HAVA 1H45A 3MJNA 3BKIB 2XHDA 1PDAA 1YPNA 1BKAA 3RQTA 4DDDA 2FYIA 4KYEA 4H67A 1DPEA 3TFLA 4YKJA 2VGQA 3TCGA 2QS2A 3QK6A 3ILUB 1DPPA 2Z8DA 1PB9A 4I62A 4ELRA 3TQLA 3K1NA 3OSQA 1PEBA 3PGFA 2ONKE 1QULA 2A5TA 1JNFA 4QFLA 4G8NA 2XXWA 2DWJA 3FATA 5KCJA 4NF8A 5H8HA 5H8NB 1YTVA 5ITOA 1URGA 3CFXA 4UACA 4EDPA 3OSRA 3W15C 1RYOA 1O63A 3MWBA 4DCXA 3GBAA 1N3XA 5ISUA 3G3FA 3Q29A 1FTLA 3SEUA 1OMPA 3S4UA 5J1DA 3HCQA 5CRYA 4JSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQ5 A;  3O29 A;  4F19 A;  4OWD A;  3ZKK A;  1VSO A;  3T9U A;  2DVC A;  2DP8 A;  5AE4 A;  1MH3 A;  2DS9 A;  2UVG A;  2PBW A;  5DVI A;  1HSL A;  5AA1 A;  1IXG A;  2Y7K A;  4M1V A;  3RGY A;  2AL5 A;  2XXQ A;  1Y3P A;  4GXS B;  4OFO A;  4FEB A;  3N26 A;  4F31 B;  4LZ5 A;  3K6W A;  2HZK A;  3FXQ A;  1LFG A;  1OQG A;  4F3G A;  4R9F A;  2UYF A;  1B51 A;  1MY3 A;  4H5G A;  1YAE A;  1H43 A;  2H99 A;  2PYY A;  1B3H A;  1QJM A;  3RT8 A;  4KYD A;  3SET A;  3I6V A;  4YKK A;  3TAJ A;  3OMB A;  3IOW A;  3IO6 A;  3RLF E;  2P2A A;  2QS3 A;  3TTM A;  2E1S A;  3N6T A;  1FQF A;  3H03 A;  5I57 A;  1US4 A;  3VV5 A;  4RYA A;  4PFY A;  4H5F A;  4IY5 A;  3RPW A;  1B3L A;  4WKM A;  1MS7 A;  2ZNT A;  3PU5 A;  3ECR A;  3LSL A;  2DSF A;  1O64 A;  3UP9 A;  1Y20 A;  1DTG A;  1XVX A;  5TPA B;  2UVJ A;  1BLF A;  3DM0 A;  4KI0 E;  4Q30 B;  3O6I A;  3MVZ A;  2Y7R A;  3CFL A;  1LFH A;  3KOT A;  1MXZ A;  3MQ9 A;  4HCY A;  2XXX A;  2I0B A;  2Z23 A;  2B3B A;  2ZNU A;  1VR5 A;  3TCF A;  1P1O A;  4MBP A;  3C32 A;  5DTB A;  5I2N A;  5K2X A;  5AA4 B;  4F29 A;  4K3F A;  1MY2 A;  3IB0 A;  4R75 A;  5L9O A;  4Q0C A;  4YIC A;  5DVJ A;  1ZKB A;  4R6Y A;  3UOR A;  1BTJ A;  1LGB C;  4ZEB A;  3ZKL A;  5ITP A;  1Y3N A;  5H8N A;  3K1P A;  5I58 B;  3HN0 A;  1MQI A;  3SDF A;  4LZ7 A;  1TFD A;  5FTI A;  3H6U A;  3N94 A;  4ZEK A;  1UTH A;  4PET A;  3TUS A;  2QPQ A;  3Q25 A;  4OZ9 A;  1DOT A;  2H25 A;  3ODB A;  1ZJL A;  1ZTY A;  1IUD A;  2F5X A;  4KQP A;  3FVK A;  1AL3 A;  1HSE A;  1N3W A;  3KN7 A;  3HHG A;  2LAO A;  4DXC A;  3SEV A;  3LBS A;  2HEU A;  5CI5 A;  4QF9 A;  2O1M A;  3PD9 A;  2ABH A;  2DE3 A;  1II5 A;  3H6V A;  1NMU A;  1Y4C A;  3CIJ A;  1MRP A;  1QUK A;  3PUV E;  2UYE A;  1SDX A;  4RXL A;  1GV8 A;  2XD2 A;  3PPR A;  4RA1 A;  3OEM A;  3OO8 A;  4KCD A;  1NFT A;  3OD7 A;  1JW4 A;  3T9H B;  3U92 A;  3A09 A;  4XKN A;  1MXX A;  3DLN A;  4BDR A;  3R6U A;  1A8E A;  4FAT A;  2F36 A;  4G8H A;  4TLL B;  3FVN A;  1Q35 A;  2AIX A;  4OEU A;  5BUU A;  2HCA A;  5H8S A;  5H8F B;  4U4X A;  2Y7W A;  4R73 A;  1QKA A;  3RNN A;  4I9D A;  2A5T B;  3IJO B;  1L5T A;  1Y3Q A;  4FED A;  1D3K A;  3H6T A;  4NF8 B;  5H8H B;  3IX1 A;  1JVY A;  3S9M C;  1LAH E;  2I3W A;  3CR9 A;  4HS7 A;  3BBR A;  5A5X A;  4YZZ A;  3V89 B;  2OZZ A;  1B1H A;  2OLB A;  1T0K A;  1EZ9 A;  3QYT A;  4F39 A;  4FE8 A;  1F9B A;  4KCC A;  4IGR A;  4ZEI A;  3MP8 A;  4O3A A;  3EHU A;  3VVD A;  2RC9 A;  3L6H A;  1B7U A;  1AOV A;  1P99 A;  2GHB A;  1VE4 A;  1IIW A;  4NF4 B;  4ZEC A;  3MVW A;  2F97 A;  4JDF A;  1H76 A;  4ZS9 A;  4XTC Q;  5AA4 A;  4EF2 A;  1HSJ A;  4RY1 A;  2Q9T A;  4OHN A;  3B6Q A;  1A8F A;  5L9M A;  3SER A;  1FQA A;  4YKI A;  5F7V A;  1OIB A;  2F6P A;  3IOT A;  1LBC A;  4ZDM A;  5I58 A;  2Z22 A;  1S7Y A;  4YB5 A;  2XX8 A;  5FTH A;  4IB2 A;  1PC3 A;  1Y9U A;  1M5E A;  4OYV A;  1OLA A;  3IB1 A;  4YMA A;  1DMB A;  4OER A;  4U23 A;  1TFA A;  2Y7I A;  3UN6 A;  1NKX A;  4MH5 A;  1B7H A;  1EU8 A;  4TQU Q;  5I57 B;  3KGC A;  5JTY A;  1R1N A;  1ZBM A;  5IKB A;  3MAM A;  4ELP A;  3S9N C;  5I59 A;  5AA2 D;  3CFZ A;  4RPO A;  4ONY A;  5I2K A;  1N84 A;  1OVB A;  3W9W A;  1PB8 A;  1FTJ A;  4E0X A;  2Z8E A;  2ZYM A;  5AA2 B;  4ZEF A;  3VXC A;  2QSX A;  1FQE A;  3O2A A;  3R26 A;  4KD5 A;  1MM6 A;  1D4N A;  4FJP A;  4FOR A;  3USD A;  2ONR A;  3VVE A;  2Q89 A;  1LB9 A;  3Q28 A;  2XXU A;  3O97 A;  1P1U A;  2H98 A;  5CBS A;  1MG1 A;  2QL3 A;  5HPQ A;  1WOD A;  5H8F A;  5I2N B;  2QMW A;  2V3Q A;  3MUQ A;  3VXB A;  4JWY A;  1MQJ A;  4H65 A;  4X1B A;  2GRV A;  3OO6 A;  3N6U A;  3MZB A;  1JQF A;  4MFI A;  2OK2 A;  3RUM A;  4LAT A;  5DEX B;  3K01 A;  4WED A;  5CMM A;  3EHS A;  3IK6 B;  1UTH B;  5CMB A;  3L6G A;  3ONM A;  2QMX A;  4C1T A;  4R6K A;  1CB6 A;  4ESW A;  4OEN A;  5HBC A;  4OET A;  2F8D A;  3FJ7 A;  5IAI A;  4C1U A;  4DXU A;  1POY 1;  4OFJ A;  3K0V A;  1MPD A;  3CSG A;  4C0R A;  1FCK A;  4F3P A;  1QW0 A;  1M5B A;  2VOZ A;  4N13 A;  1SW5 A;  5CC2 A;  3FD3 A;  2Z8F A;  3C31 A;  1N0T A;  2XXP A;  3KZG A;  1FTM A;  1MH4 A;  4ESX A;  3M3F A;  4NF4 A;  2RCA A;  4ZZA A;  1GGG A;  3RN8 A;  3TMG A;  3FVO A;  1NH7 A;  1ELJ A;  1B5H A;  3O9P A;  1AMF A;  1LBB A;  3K1M A;  4NED A;  3C9H A;  1US5 A;  5H8Q B;  4YU0 A;  4H6D A;  3FZV A;  3MZ9 A;  4X9T A;  1B3E A;  1LAF E;  3FJG A;  1JEU A;  3B6T A;  4F1Y A;  2KLF A;  1LAX A;  1A7L A;  3C36 A;  2DVZ A;  3E4R A;  4U1O A;  2VP1 A;  1R9L A;  3DP4 A;  1MXW A;  3I3V A;  3LUY A;  4G8M A;  3FXR A;  3GZG A;  3GLB A;  3K4U A;  1TT1 A;  3BFT A;  3G3J A;  3IJX B;  2NVU B;  3HV1 A;  3T9X B;  4H8I A;  2R9J A;  2CMO A;  2DWH A;  5A5X B;  2QRY A;  1XC1 A;  3TQW A;  4IO3 A;  3E9X A;  2REG A;  3KN3 A;  4PP0 A;  4POW A;  4R2F A;  1MDQ A;  2XXY A;  2VD3 A;  1M5F A;  1Y1M A;  5AA2 A;  4TLM B;  3IOU A;  3C35 A;  2GHA A;  5I84 A;  1RKM A;  4TOZ A;  2O69 A;  3JYR A;  1SW4 A;  4PFU A;  4ZE8 A;  2H9B A;  1H3D A;  1SI0 A;  3RTF B;  3THI A;  1JEV A;  3QUF A;  3BFU A;  2H5Y A;  3LSW A;  2AYS A;  3CSB A;  4GL0 A;  3TKD A;  5B7D A;  2HXW A;  3EPE A;  1VFE A;  4H0W A;  4QSE A;  3A3C A;  3V83 A;  4DLD A;  3LC8 A;  1XS5 A;  3FGS A;  4U22 A;  3K00 A;  3UIF A;  1MPB A;  2UXA A;  5DEX A;  2R6G E;  2I58 A;  1R6Z A;  3JZJ A;  2DE2 A;  4IO5 A;  2H4I A;  4QSD A;  4BLA A;  1N04 A;  3D4G A;  5HM4 B;  3DP6 A;  5JTY B;  3TEP A;  2I6E A;  3F11 A;  2IEE A;  4ND9 A;  1PBP A;  1MQD A;  3FAS A;  1XVY A;  1B3G A;  3JV9 A;  5I59 B;  3PUX E;  5BWJ A;  5TP9 B;  1A40 A;  1MXY A;  1IIT A;  5I2K B;  4LVQ A;  1I6B A;  3Q27 A;  1NNT A;  4G4P A;  5F1Q A;  4IO6 A;  3TTN A;  3H06 B;  4NF5 B;  1SI1 A;  5H8Q A;  4R6H A;  3IL1 B;  3KG2 A;  1B5I A;  4PFT A;  1NNF A;  3RY3 A;  3TTL A;  2VD2 A;  4OES A;  1JVX A;  1P1Q A;  3ZS6 A;  2PT1 A;  4EUO A;  4OVJ A;  3KJ7 A;  3KSJ A;  1GTK A;  2RKM A;  1DTZ A;  4YMB A;  2OJT A;  1GR2 A;  4PQJ A;  2RC8 A;  4BDM A;  1AIV A;  4QFK A;  1B32 A;  2I4C A;  3M8U A;  4P0I A;  3CVG A;  3FJM A;  3SEX A;  2OWS A;  1B1X A;  4U2R A;  1LFI A;  2X7Q A;  4JWX A;  3QSL A;  3TZA A;  4RK9 A;  5JK4 A;  2BJJ X;  1P1W A;  4I1D A;  2M8C A;  4XKQ A;  4RNS A;  1ANF A;  3KBR A;  3N5L A;  1YCJ A;  4PE5 B;  1MY4 A;  4I8C A;  3G3I A;  3QXM A;  1LCF A;  2OBG A;  4ELO A;  4XXU A;  3UK4 A;  1IXH A;  1MQG A;  4O3C A;  4F2Q A;  4IO2 A;  1USY E;  2F6G A;  1IEJ A;  1ZMG A;  3TTR A;  4MF3 A;  3VLU A;  3T93 B;  2O1L A;  4G68 A;  1MPC A;  3OEL A;  4M4G A;  3W9V A;  4EQB A;  1FTO A;  3PV0 E;  4P11 A;  3H6W A;  4GIZ A;  2DWI A;  4QFO A;  4OTE A;  1S9T A;  4NWC A;  3PPP A;  4WEP A;  3PPQ A;  3IOV A;  4Q8R A;  1NL5 A;  4XIG Q;  4KHZ E;  4R72 A;  4QFP A;  2XX7 A;  2F7C A;  1ZU0 A;  2PMS A;  3MPK A;  4YB7 A;  1QVS A;  2P1S A;  2DOJ A;  4PFW A;  4KFQ A;  1JW1 A;  5L9S A;  3C33 A;  4YKP A;  3TYH A;  2I48 A;  1Q1K A;  3G7W A;  1LAG E;  4FAJ A;  3FV2 A;  3PUY E;  3VDF A;  3IB2 A;  3TCH A;  4U4S A;  4KPT A;  1B58 A;  1SYH A;  2O51 A;  4GWO A;  4LUB A;  1SW1 A;  2ZXT A;  2HAU A;  3DEL B;  4L17 A;  3T66 A;  2RC7 A;  3VVF A;  4F3B A;  4GQO A;  2HQ0 A;  3KFM A;  2DWA A;  2GFE A;  2O6A A;  4WXJ A;  2QS1 A;  3U72 A;  3A3U A;  2O68 A;  3LR1 A;  5TP9 A;  5I56 A;  4BDO A;  3HST A;  1FTK A;  2O7I A;  2UVI A;  1S50 A;  4IY6 A;  3SEY A;  5EYF A;  2D3I A;  4AB5 A;  2XXR A;  2QJE A;  4QRZ A;  4NMY A;  1SQY A;  4NF5 A;  5L8D A;  2DE4 A;  2V93 A;  3FUZ A;  2ANJ A;  1SVX B;  3K6U A;  2I3V A;  3U94 A;  4NF6 A;  3O66 A;  3H7M A;  1OVT A;  4JSD A;  5FHO A;  3MP6 A;  2ZNS A;  3KOS A;  1N7W A;  1JW5 A;  3SKP A;  1Z7M E;  1IXI A;  5KZT A;  1WVJ A;  3K6V A;  3TPA A;  3MC2 A;  4LQ2 A;  1NNK A;  4YAH X;  3WAE A;  2B3F A;  3MBP A;  4RK2 A;  5JEI A;  4FIM A;  1UQW A;  1DSN A;  3O6G A;  4BDQ A;  4ECF A;  4EXK A;  1VFD A;  1ZLQ A;  5ICT A;  4LP2 B;  2FNC A;  3VLW A;  2X26 A;  1URD A;  3CI8 A;  4GD5 A;  4OEV A;  4NTL A;  1FW0 A;  5KDT A;  3ILT B;  2XXT A;  2V84 A;  4F1U A;  4R9G A;  4UA8 A;  5ICQ A;  4U21 A;  1TXF A;  4ZED A;  3PUW E;  1NNP A;  4F22 A;  1Y1Z A;  2DXR A;  1GVC A;  2XXV A;  3O6H A;  2X7P A;  1MY0 A;  4JBZ A;  5EHM A;  4N6P A;  4GXA A;  1USY H;  1WDN A;  3MZ1 A;  4X1D A;  3K2D A;  4DCY A;  4F2O A;  3GBB A;  1MM7 A;  3U93 A;  2HZL A;  1AH5 A;  3QIM A;  1B4Z A;  4H8J A;  2PX1 A;  3B7D A;  3U1O A;  2V25 A;  3KEI A;  1UTB A;  1SYI A;  2WKY A;  2F78 A;  4G68 C;  2D5W A;  4AQ4 A;  1SD3 A;  2RIN A;  3PPN A;  4DZ1 A;  3M3L A;  3KN8 A;  4JXI A;  3G3K A;  4GRK A;  1BP5 A;  5FHN A;  1B40 A;  4JWO A;  4G77 A;  3RTW B;  1ZIU A;  1J1N A;  3IR1 A;  4XKP A;  4EQ7 A;  3T9V A;  3CRB A;  4XKR A;  1B2H A;  4R2B A;  1M5D A;  2DYX A;  2YLN A;  3TEL A;  2FA7 A;  4GF8 A;  3UGW A;  4RJZ A;  4LON B;  4IGT A;  1JET A;  3G3H A;  2ZYO A;  4OXV A;  4F1V A;  3MW0 A;  4EXL A;  1LB8 A;  1FQC A;  1B3F A;  5DYH A;  2XXH A;  3HO7 A;  4G68 B;  1XOC A;  4QHQ A;  3S9E A;  4O3B A;  3G3G A;  4KR5 A;  3EN3 A;  4OFL A;  4GOT A;  1A54 A;  3T96 B;  1MQH A;  1B5J A;  4DIG A;  4F18 A;  3OOA A;  1Z7N E;  5CBR A;  2OWT A;  3FVG A;  1XHY A;  1A99 A;  4JB7 A;  4GVO A;  2Q88 A;  5AA3 A;  5ELV A;  3P7I A;  3PPO A;  3OEN A;  3MP1 A;  4HW8 A;  3SES A;  3V8X B;  1B0H A;  2ALU A;  5DVF A;  4BDN A;  2R71 A;  3MVX A;  3O28 A;  3PMV A;  3H3G A;  3D4C A;  1OLC A;  3B6W A;  4GFR A;  4QFN A;  1SBP A;  2PT2 A;  1MDP 1;  4HTG A;  1URS A;  2YPN A;  2NXO A;  4MLQ A;  3TOD A;  3EHT A;  3PMW A;  1P1N A;  3EF7 A;  2DXY A;  1UIV A;  3OEK A;  2F34 A;  3WAF A;  5CM6 A;  3TDJ A;  4NWD A;  1IXC A;  2P0S A;  3U8Q A;  4GLI A;  2XXI A;  1I6A A;  3CG1 A;  2IA4 A;  2RF1 A;  2Q2C A;  4P0G A;  3GXA A;  5I56 B;  2Y7P A;  1PB7 A;  1TWY A;  3K6X A;  3M3K A;  1M5C A;  1B0L A;  3S9L C;  3TTK A;  4X48 A;  2RCB A;  3FIR A;  3T22 A;  4LA9 A;  4IO7 A;  1H44 A;  1MXU A;  3QAX A;  2VHA A;  3UA8 A;  3MPL A;  1B4H A;  4RPN A;  1EZP A;  4LZ8 A;  3PMX A;  1SW2 A;  4FEC A;  4H1X A;  2ZYK A;  5TU0 A;  3PUZ E;  4ZZE A;  3OO7 A;  3IAZ A;  4GL8 A;  1MXV A;  5EHS A;  3Q26 A;  4NF6 B;  2A5S A;  4Z7E A;  4HCW A;  5FHM A;  3E3K A;  2Y84 A;  2I49 A;  1IQ7 A;  3H4Z A;  2DQV A;  2I4B A;  2O7U A;  3QUJ A;  5LOM A;  4DE8 A;  1BIY A;  4F3S A;  1KWH A;  1D9Y A;  2REJ A;  3V5A A;  1B05 A;  4KYS A;  5CMK A;  4OQO A;  2UVH A;  3KSX A;  1POT A;  4DXB A;  1R9Q A;  1D9V A;  4G2Z A;  1B52 A;  4Z0I A;  1B6H A;  1B46 A;  4U1Z A;  1QKB A;  2XD3 A;  5KCJ B;  1N76 A;  2GH9 A;  5KDT B;  3IOR A;  2NWJ A;  2THI A;  2I0C A;  1QUJ A;  4IO4 A;  2ESN A;  2W7Y A;  3OO9 A;  2Q8J A;  3KJT A;  4YB6 A;  1MY1 A;  5TPA A;  3CG3 A;  4OMB A;  3DP8 A;  3C4M A;  1O7T A;  4ISU A;  1FQB A;  1PBQ A;  3FXU A;  3RT6 B;  2D21 A;  3VLV A;  5CMC A;  3IO4 A;  5M2V A;  1I69 A;  1EH3 A;  3VE1 B;  1UIU A;  4EQ9 A;  1EZO A;  2AL4 A;  5B70 A;  2QS4 A;  3MVY A;  3VFJ A;  2XX9 A;  4R74 A;  4N07 A;  3FV1 A;  1B7Z A;  3HHF A;  1RYX A;  1IZ1 A;  4NE4 A;  3C34 A;  1LLS A;  1UTB B;  1Y4T A;  2CZL A;  4THI A;  2OCU A;  3R7X A;  2B65 A;  4BDL A;  3E13 X;  1LST A;  4MLV A;  3LSX A;  3S2V A;  1LCT A;  1QUI A;  4EF1 A;  2F35 A;  2F7B A;  2V3U A;  4ELQ A;  5K2Y A;  3EQ1 A;  2G29 A;  4QSC A;  1OQH A;  1A55 A;  3HPI A;  3I5O A;  2V3T A;  2E0S A;  2PVU A;  2HFB A;  1CE2 A;  3SEW A;  2ONS A;  2Q2A A;  3ZSF A;  2ZYN A;  3AXF A;  5DT6 A;  2F7A A;  2O84 X;  1N7X A;  4AB6 A;  1XT8 A;  3PD8 A;  1I6Q A;  4Q5T A;  4E0W A;  4ZE9 A;  2G93 A;  2NUV A;  3K02 A;  3LSF B;  4POX A;  1B9J A;  1FQD A;  2ZMB A;  1ATG A;  2YJP A;  2NOO A;  1NH8 A;  3OXN A;  2HAV A;  1H45 A;  3MJN A;  3BKI B;  2XHD A;  1PDA A;  1YPN A;  1BKA A;  3RQT A;  4DDD A;  2FYI A;  4KYE A;  4H67 A;  1DPE A;  3TFL A;  4YKJ A;  2VGQ A;  3TCG A;  2QS2 A;  3QK6 A;  3ILU B;  1DPP A;  2Z8D A;  1PB9 A;  4I62 A;  4ELR A;  3TQL A;  3K1N A;  3OSQ A;  1PEB A;  3PGF A;  2ONK E;  1QUL A;  2A5T A;  1JNF A;  4QFL A;  4G8N A;  2XXW A;  2DWJ A;  3FAT A;  5KCJ A;  4NF8 A;  5H8H A;  5H8N B;  1YTV A;  5ITO A;  1URG A;  3CFX A;  4UAC A;  4EDP A;  3OSR A;  3W15 C;  1RYO A;  1O63 A;  3MWB A;  4DCX A;  3GBA A;  1N3X A;  5ISU A;  3G3F A;  3Q29 A;  1FTL A;  3SEU A;  1OMP A;  3S4U A;  5J1D A;  3HCQ A;  5CRY A;  4JSO A; 
#chains in the Genus database with same CATH topology
 4LQ5 A;  3O29 A;  4F19 A;  4OWD A;  3ZKK A;  1VSO A;  3T9U A;  2DVC A;  4N8Y A;  2DP8 A;  5AE4 A;  1MH3 A;  2DS9 A;  2WBD A;  2UVG A;  2PBW A;  1RDZ A;  5DVI A;  1FJ6 A;  1HSL A;  5AA1 A;  1IXG A;  2Y7K A;  5DW8 A;  4M1V A;  3RGY A;  2AL5 A;  2XXQ A;  1Y3P A;  4GXS B;  2DDK A;  2ZZX A;  4OFO A;  4FEB A;  3N26 A;  4F31 B;  4LZ5 A;  3K6W A;  2HZK A;  3FXQ A;  1LFG A;  4PDD A;  1OQG A;  4F3G A;  4R9F A;  2UYF A;  1B51 A;  1MY3 A;  4H5G A;  1YAE A;  1H43 A;  2H99 A;  2PYY A;  1B3H A;  1QJM A;  3RT8 A;  4KYD A;  3SET A;  2OX3 A;  3I6V A;  4YKK A;  3TAJ A;  3OMB A;  3IOW A;  3IO6 A;  3RLF E;  2P2A A;  2QS3 A;  3TTM A;  2E1S A;  3N6T A;  1FQF A;  3H03 A;  1FBH A;  5I57 A;  1US4 A;  3LUZ A;  3VV5 A;  4RYA A;  4PFY A;  4H5F A;  4IY5 A;  3RPW A;  1B3L A;  4WKM A;  1MS7 A;  2ZNT A;  3PU5 A;  3ECR A;  3LSL A;  2DSF A;  1O64 A;  3UP9 A;  1Y20 A;  1DTG A;  1XVX A;  5TPA B;  2UVJ A;  4P9K A;  1BLF A;  3DM0 A;  4KI0 E;  4Q30 B;  3O6I A;  1FSA A;  3MVZ A;  2Y7R A;  3HFU A;  1IMA A;  3CFL A;  5A5L A;  1LFH A;  3U65 A;  3KOT A;  1MXZ A;  3MQ9 A;  4HCY A;  2XXX A;  2I0B A;  1KA1 A;  2Z23 A;  4UAB A;  2F3D A;  2B3B A;  1YXI A;  2ZNU A;  1VR5 A;  4X04 A;  3TCF A;  1D9Q A;  1P1O A;  4MBP A;  3C32 A;  5DTB A;  4PF8 A;  5I2N A;  5K2X A;  5AA4 B;  4K3F A;  1MY2 A;  3IB0 A;  4R75 A;  5ESY A;  4F29 A;  5L9O A;  4Q0C A;  4YIC A;  5DVJ A;  2FHY A;  1ZKB A;  4R6Y A;  4MMP A;  3UOR A;  1BTJ A;  1LGB C;  4ZEB A;  3ZKL A;  5ITP A;  1Y3N A;  5H8N A;  3K1P A;  5I58 B;  3HN0 A;  1MQI A;  3SDF A;  4LZ7 A;  1TFD A;  5FTI A;  1IMB A;  3H6U A;  3N94 A;  4ZEK A;  1UTH A;  4PET A;  3TUS A;  2QPQ A;  3Q25 A;  3A29 A;  4P3L A;  4OZ9 A;  1DOT A;  2H25 A;  3ODB A;  1ZJL A;  1ZTY A;  1IUD A;  2F5X A;  2XWO A;  4KQP A;  3FVK A;  1AL3 A;  1HSE A;  1N3W A;  3KN7 A;  3HHG A;  2LAO A;  4DXC A;  3SEV A;  3LBS A;  2HEU A;  5CI5 A;  4QF9 A;  2O1M A;  3PD9 A;  2ABH A;  2DE3 A;  1II5 A;  3H6V A;  2WX9 A;  1NMU A;  1Y4C A;  3CIJ A;  1MRP A;  1QUK A;  1NUZ A;  3PUV E;  2UYE A;  1SDX A;  4RXL A;  2VPN A;  1GV8 A;  2XD2 A;  3PPR A;  4RA1 A;  3OEM A;  3OO8 A;  4KCD A;  3B50 A;  4OVQ A;  1NFT A;  3OD7 A;  1JW4 A;  3T9H B;  3U92 A;  3A09 A;  4XKN A;  1KA0 A;  1MXX A;  4QBA A;  3DLN A;  4BDR A;  3R6U A;  1A8E A;  1SPI A;  4FAT A;  2F36 A;  4G8H A;  4TLL B;  3FVN A;  1Q35 A;  2AIX A;  4OEU A;  5BUU A;  2HCA A;  1NV6 A;  5H8S A;  5H8F B;  4U4X A;  5IZZ A;  1LBX A;  2Y7W A;  4R73 A;  1FBF A;  1QKA A;  3RNN A;  4I9D A;  5EYH A;  2A5T B;  3T0J A;  2VT5 A;  1IMF A;  3IJO B;  1L5T A;  1Y3Q A;  4FED A;  1D3K A;  1FPK A;  2GQ1 A;  3H6T A;  4NF8 B;  5H8H B;  3IX1 A;  1JVY A;  3S9M C;  1LAH E;  4PBH A;  2I3W A;  3CR9 A;  4HS7 A;  3BBR A;  2R8T A;  1IME A;  5A5X A;  1K9Y A;  2XA5 A;  4YZZ A;  3V89 B;  2WEF A;  4G61 A;  2OZZ A;  1B1H A;  2OLB A;  1T0K A;  1EZ9 A;  3QYT A;  4FE8 A;  4F39 A;  1F9B A;  4KCC A;  4IGR A;  4ZEI A;  3MP8 A;  4O3A A;  3ISP A;  2FIX A;  3EHU A;  3VVD A;  2RC9 A;  3L6H A;  1B7U A;  4PCD A;  1AOV A;  4O7M A;  1P99 A;  2GHB A;  1VE4 A;  1IIW A;  4NF4 B;  4ZEC A;  3MVW A;  2F97 A;  4JDF A;  1H76 A;  5T3J A;  4ZS9 A;  4XTC Q;  5AA4 A;  3MST A;  4EF2 A;  1HSJ A;  4RY1 A;  2Q9T A;  4OHN A;  3B6Q A;  1A8F A;  2B4L A;  5L9M A;  3SER A;  1FQA A;  4YKI A;  5I7I A;  5F7V A;  1OIB A;  2F6P A;  3IOT A;  1LBC A;  4ZDM A;  5I58 A;  2Z22 A;  1S7Y A;  4YB5 A;  2XX8 A;  5FTH A;  2WBB A;  2HHM A;  4IB2 A;  1PC3 A;  4PF6 A;  1Y9U A;  1M5E A;  4OYV A;  1OLA A;  3IB1 A;  4YMA A;  1DMB A;  4OER A;  4U23 A;  4P47 A;  1TFA A;  2Y7I A;  3UN6 A;  1NKX A;  4MH5 A;  1B7H A;  1EU8 A;  4TQU Q;  5I57 B;  3KGC A;  5JTY A;  1R1N A;  1ZBM A;  5ET6 A;  5IKB A;  3MAM A;  4N15 A;  4ELP A;  3S9N C;  2PFZ A;  5I59 A;  5AA2 D;  3CFZ A;  4RPO A;  4GX6 A;  4ONY A;  5I2K A;  1N84 A;  1OVB A;  3W9W A;  1PB8 A;  1FTJ A;  5EQA A;  4E0X A;  2Z8E A;  2ZYM A;  5AA2 B;  4ZEF A;  3VXC A;  4N6K A;  2QSX A;  1FQE A;  4NHB A;  2QVV A;  2WYK A;  3O2A A;  3R26 A;  4JVD A;  4KD5 A;  1NV5 A;  1MM6 A;  1D4N A;  4FJP A;  4FOR A;  3USD A;  2ONR A;  3VVE A;  2Q89 A;  2Y5L A;  1LB9 A;  3Q28 A;  2XXU A;  3O97 A;  1P1U A;  2H98 A;  5CBS A;  1MG1 A;  2QL3 A;  5HPQ A;  1WOD A;  5H8F A;  5I2N B;  2QMW A;  2V3Q A;  3MUQ A;  3VXB A;  4JWY A;  4NG7 A;  1MQJ A;  4H65 A;  4X1B A;  4PFB A;  2GRV A;  4P56 A;  3OO6 A;  3N6U A;  3MZB A;  3T1B A;  4PFI A;  1JQF A;  4MFI A;  2CEY A;  4N6D A;  2OK2 A;  3RUM A;  4LAT A;  4WED A;  3K01 A;  5DEX B;  5CMM A;  3KBZ A;  3EHS A;  2QVU A;  3IK6 B;  1UTH B;  5CMB A;  3L6G A;  3ONM A;  2QMX A;  4DI3 D;  4C1T A;  4R6K A;  1CB6 A;  4ESW A;  4OEN A;  5HBC A;  4OET A;  2F8D A;  3FJ7 A;  5IAI A;  4C1U A;  4DXU A;  3RYD A;  1POY 1;  4OFJ A;  3K0V A;  1MPD A;  3CSG A;  4C0R A;  2HXR A;  1FCK A;  4F3P A;  4PDH A;  1QW0 A;  1M5B A;  2VOZ A;  4N13 A;  2ZZW A;  1SW5 A;  5CC2 A;  3FD3 A;  2Z8F A;  3C31 A;  1N0T A;  2XXP A;  4OVT A;  3KZG A;  1FTM A;  1MH4 A;  4ESX A;  3M3F A;  4NF4 A;  2RCA A;  4PAF A;  4ZZA A;  1FBD A;  1GGG A;  3RN8 A;  3TMG A;  4I3E A;  3FVO A;  1NH7 A;  1ELJ A;  1B5H A;  3O9P A;  1AMF A;  1LBB A;  3K1M A;  4NED A;  3C9H A;  1US5 A;  5H8Q B;  4XEQ A;  4YU0 A;  4H6D A;  3FZV A;  3MZ9 A;  4X9T A;  1B3E A;  1LAF E;  3FJG A;  1JEU A;  3B6T A;  4F1Y A;  4GX4 A;  2KLF A;  1LAX A;  4GBV A;  4OAN A;  5ET5 A;  1A7L A;  3C36 A;  2DVZ A;  3E4R A;  4U1O A;  2VP1 A;  1R9L A;  3DP4 A;  4NGU A;  1MXW A;  3I3V A;  3LUY A;  4G8M A;  3FXR A;  3GZG A;  3GLB A;  3K4U A;  1TT1 A;  3BFT A;  3G3J A;  1NV3 A;  3IJX B;  2NVU B;  3HV1 A;  3T9X B;  4H8I A;  2R9J A;  2CMO A;  2DWH A;  5A5X B;  1FPG A;  2QRY A;  1XC1 A;  3TQW A;  4IO3 A;  3PTY A;  3E9X A;  2REG A;  1FPJ A;  3GYY A;  3IFA A;  4PAI A;  5EQ8 A;  3KN3 A;  4PP0 A;  4POW A;  4R2F A;  4HXV A;  1MDQ A;  3BIG A;  2XXY A;  2VD3 A;  1M5F A;  1FJ9 A;  1Y1M A;  5AA2 A;  4TLM B;  3IOU A;  3C35 A;  2GHA A;  5I84 A;  1RKM A;  4TOZ A;  2O69 A;  4P1E A;  3JYR A;  1SW4 A;  4PFU A;  4ZE8 A;  2H9B A;  4MEV A;  1H3D A;  1SI0 A;  3RTF B;  3THI A;  1JEV A;  3QUF A;  3BFU A;  2H5Y A;  3LSW A;  2AYS A;  3CSB A;  4GL0 A;  3TKD A;  5EQ9 A;  5B7D A;  2CEX A;  2HXW A;  3EPE A;  1VFE A;  4H0W A;  1EYJ A;  4QSE A;  2L5V A;  4PBQ A;  3A3C A;  3V83 A;  4DLD A;  3LC8 A;  1XS5 A;  3FGS A;  4JVI A;  2JJK A;  4U22 A;  3K00 A;  3UIF A;  1MPB A;  2UXA A;  5DEX A;  2R6G E;  4PC9 A;  2I58 A;  1R6Z A;  4H45 A;  3JZJ A;  2DE2 A;  4IO5 A;  2PCR A;  2H4I A;  4QSD A;  4XF5 A;  4GWS A;  4BLA A;  1N04 A;  3D4G A;  2KQZ A;  5HM4 B;  3DP6 A;  5JTY B;  3TEP A;  2I6E A;  3F11 A;  2IEE A;  4ND9 A;  1PBP A;  4HE1 A;  1MQD A;  3FAS A;  1XVY A;  4MNI A;  1B3G A;  3JV9 A;  1AWB A;  5I59 B;  3PUX E;  4PGP A;  5BWJ A;  5TP9 B;  1A40 A;  1MXY A;  1IIT A;  1NUW A;  4PFR A;  5I2K B;  1FPE A;  2FBP A;  4NF0 A;  4LVQ A;  1I6B A;  3Q27 A;  1NNT A;  4G4P A;  5F1Q A;  4IO6 A;  3TTN A;  3H06 B;  4NF5 B;  1SI1 A;  5H8Q A;  4R6H A;  3IL1 B;  3KG2 A;  1B5I A;  1JP4 A;  4PFT A;  1NNF A;  3RY3 A;  2Y5K A;  2VD2 A;  4OES A;  1JVX A;  1P1Q A;  3TTL A;  3ZS6 A;  2PT1 A;  4EUO A;  4OVJ A;  3KJ7 A;  3KSJ A;  1GTK A;  2RKM A;  1DTZ A;  4YMB A;  2OJT A;  1GR2 A;  4PQJ A;  2RC8 A;  4BDM A;  1AIV A;  4MJO A;  4QFK A;  1B32 A;  2I4C A;  2P3N A;  3M8U A;  1IMD A;  4P0I A;  3CVG A;  3FJM A;  3SEX A;  2OWS A;  1B1X A;  4U2R A;  1LFI A;  2X7Q A;  4JWX A;  3QSL A;  3TZA A;  4RK9 A;  5JK4 A;  2BJJ X;  1P1W A;  4I1D A;  5ET7 A;  2M8C A;  4XKQ A;  1FPD A;  4RNS A;  1ANF A;  1FBE A;  4OVR A;  3KBR A;  3N5L A;  1YCJ A;  4PE5 B;  3FXB A;  1MY4 A;  4I8C A;  3G3I A;  3QXM A;  1LCF A;  2OBG A;  4ELO A;  4XXU A;  3UK4 A;  1IXH A;  1MQG A;  4O3C A;  4F2Q A;  2F3B A;  4IO2 A;  1USY E;  2F6G A;  1IEJ A;  4N4U A;  1ZMG A;  3TTR A;  4MF3 A;  3VLU A;  3T93 B;  2O1L A;  4G68 A;  1MPC A;  1LEV A;  3OEL A;  4M4G A;  3SZP A;  3W9V A;  4EQB A;  1FTO A;  3PV0 E;  4P11 A;  3CHG A;  3H6W A;  4GIZ A;  2DWI A;  4QFO A;  4OTE A;  1S9T A;  4NWC A;  3PPP A;  4WEP A;  3PPQ A;  3IOV A;  4Q8R A;  1NL5 A;  4XIG Q;  4KHZ E;  4R72 A;  4QFP A;  2XX7 A;  1XI6 A;  2F7C A;  1ZU0 A;  2PMS A;  3MPK A;  1G0H A;  4YB7 A;  1QVS A;  2P1S A;  1FPL A;  2DOJ A;  4PFW A;  4KFQ A;  1JW1 A;  5L9S A;  3C33 A;  4YKP A;  3TYH A;  2I48 A;  1Q1K A;  3G7W A;  4H46 A;  1LAG E;  4FAJ A;  3FV2 A;  3PUY E;  3VDF A;  3IB2 A;  3TCH A;  4GWX A;  4U4S A;  4KPT A;  1B58 A;  1SYH A;  2O51 A;  4GWO A;  2CZH A;  4LUB A;  1SW1 A;  2ZXT A;  2HAU A;  4O8M A;  4OVP A;  3DEL B;  4L17 A;  3T66 A;  2RC7 A;  3VVF A;  4F3B A;  4GQO A;  5IZ1 A;  5I5P A;  2HQ0 A;  3KFM A;  2DWA A;  2GFE A;  2O6A A;  4WXJ A;  2QS1 A;  3FBP A;  3U72 A;  3A3U A;  2O68 A;  3LR1 A;  5TP9 A;  5I56 A;  1FBP A;  4OVS A;  4BDO A;  3HST A;  1FTK A;  2O7I A;  2UVI A;  1S50 A;  4IY6 A;  3SEY A;  5EYF A;  2D3I A;  4AB5 A;  2XXR A;  2QJE A;  4QRZ A;  4NMY A;  1SQY A;  4NF5 A;  1NV2 A;  5L8D A;  2DE4 A;  2KR0 A;  4N91 A;  1LBZ A;  4PGN A;  2V93 A;  3FUZ A;  2ANJ A;  1SVX B;  1NUX A;  3K6U A;  4O94 A;  2I3V A;  3NOH A;  3U94 A;  4NF6 A;  3O66 A;  3H7M A;  1OVT A;  5J16 A;  4JSD A;  5FHO A;  4X8R A;  3MP6 A;  2ZNS A;  3KOS A;  2XXK A;  1N7W A;  1JW5 A;  3SKP A;  1Z7M E;  1IXI A;  5KZT A;  1WVJ A;  4NQ8 A;  3K6V A;  3TPA A;  3MC2 A;  4LQ2 A;  1NNK A;  4YAH X;  2B3F A;  3WAE A;  3MBP A;  4RK2 A;  5JEI A;  4FIM A;  1UQW A;  1DSN A;  3O6G A;  4BDQ A;  4ECF A;  4EXK A;  1VFD A;  1ZLQ A;  5ICT A;  4LP2 B;  5LDZ A;  2FNC A;  3VLW A;  2Q74 A;  2X26 A;  1URD A;  3CI8 A;  4GD5 A;  4OEV A;  4NTL A;  1YZ0 A;  1FW0 A;  4MIJ A;  5KDT A;  3ILT B;  2XXT A;  2V84 A;  4F1U A;  4R9G A;  4UA8 A;  5ICQ A;  4U21 A;  4GX3 A;  1TXF A;  4ZED A;  2HPG A;  4GBW A;  2XWK A;  3PUW E;  1NNP A;  4F22 A;  1Y1Z A;  2DXR A;  1GVC A;  2XXV A;  3O6H A;  5EYG A;  2X7P A;  1MY0 A;  4JBZ A;  4MAG A;  5EHM A;  4N6P A;  4GXA A;  5IM2 A;  1USY H;  1WDN A;  3MZ1 A;  4X1D A;  3K2D A;  4DCY A;  4F2O A;  3GBB A;  4MCO A;  1MM7 A;  4PTK A;  3U93 A;  2HZL A;  1AH5 A;  1QGX A;  3QIM A;  2VPO A;  1B4Z A;  4H8J A;  5I3S A;  1G0I A;  1NV7 A;  2PX1 A;  3B7D A;  3U1O A;  4PAK A;  2V25 A;  3KEI A;  4I40 A;  1UTB A;  1SYI A;  2WKY A;  2F78 A;  4G68 C;  2D5W A;  4AQ4 A;  1SD3 A;  2RIN A;  3PPN A;  4DZ1 A;  3M3L A;  3KN8 A;  4JXI A;  3G3K A;  3RPL B;  4GRK A;  1BP5 A;  5FHN A;  1B40 A;  4JWO A;  4G77 A;  3RTW B;  1LBW A;  1ZIU A;  1J1N A;  3IR1 A;  4XKP A;  4EQ7 A;  3T9V A;  4NAP A;  3CRB A;  4XKR A;  2CZK A;  2ZZV A;  1B2H A;  1Q9D A;  4R2B A;  4IR8 A;  1M5D A;  2DYX A;  2B4M A;  2YLN A;  3TEL A;  1FPF A;  4KXP A;  2FA7 A;  4GF8 A;  3UGW A;  4RJZ A;  4LON B;  1FRP A;  4IGT A;  1JET A;  3G3H A;  2ZYO A;  4OXV A;  4F1V A;  3MW0 A;  4EXL A;  1LB8 A;  1FQC A;  1INP A;  1B3F A;  5DYH A;  1FPI A;  2XXH A;  3HO7 A;  4G68 B;  1XOC A;  4QHQ A;  3S9E A;  4O3B A;  3G3G A;  4KR5 A;  3EN3 A;  4OFL A;  4GOT A;  1VDW A;  1A54 A;  3T96 B;  1MQH A;  2MKZ A;  1FBG A;  1B5J A;  4DIG A;  4F18 A;  3OOA A;  1Z7N E;  5CBR A;  2OWT A;  3FVG A;  1XHY A;  4OA4 A;  1A99 A;  4JB7 A;  4GVO A;  2Q88 A;  4N8G A;  5AA3 A;  5ELV A;  3P7I A;  3PPO A;  1K9Z A;  3OEN A;  4MHF A;  3MP1 A;  4HW8 A;  3SES A;  3V8X B;  4MNP A;  1B0H A;  2ALU A;  5DVF A;  4BDN A;  2R71 A;  3MVX A;  3O28 A;  3PMV A;  2FIE A;  3H3G A;  3E79 A;  3D4C A;  3ROJ A;  1OLC A;  3B6W A;  4GFR A;  4QFN A;  1SBP A;  1DCU A;  1NUY A;  2PT2 A;  1MDP 1;  4HE2 A;  4HTG A;  1URS A;  2YPN A;  2NXO A;  5IZ3 B;  1LBV A;  4MLQ A;  3TOD A;  3EHT A;  3PMW A;  1P1N A;  4N81 A;  3EF7 A;  2DXY A;  1UIV A;  3OEK A;  2F34 A;  3WAF A;  5CM6 A;  3TDJ A;  4NWD A;  1IXC A;  2P0S A;  3U8Q A;  4GLI A;  2XXI A;  5F24 A;  2PFY A;  1I6A A;  3CG1 A;  2IA4 A;  2RF1 A;  5IGA A;  2Q2C A;  4MNC A;  4P0G A;  3GXA A;  5I56 B;  2Y7P A;  2XWI A;  1PB7 A;  1TWY A;  3K6X A;  3M3K A;  1M5C A;  1B0L A;  3S9L C;  3TTK A;  4X48 A;  2RCB A;  3FIR A;  3T22 A;  1BK4 A;  4I3Y A;  4LA9 A;  1NV4 A;  1H44 A;  1MXU A;  4IO7 A;  3KC1 A;  3QAX A;  2VHA A;  3UA8 A;  3MPL A;  1B4H A;  4RPN A;  1CNQ A;  1EZP A;  4LZ8 A;  3PMX A;  1SW2 A;  4FEC A;  4H1X A;  2ZYK A;  5TU0 A;  3PUZ E;  4ZZE A;  3OO7 A;  3IAZ A;  4GL8 A;  3B8B A;  1MXV A;  1KZ8 A;  2V4C A;  3QMF A;  5EHS A;  3Q26 A;  4NF6 B;  2A5S A;  4Z7E A;  4HCW A;  5FHM A;  3RPL A;  3E3K A;  1EYK A;  2Y84 A;  2I49 A;  1IMC A;  4PE3 A;  1IQ7 A;  3H4Z A;  2DQV A;  2I4B A;  2O7U A;  3QUJ A;  5LOM A;  1FPB A;  4DE8 A;  1BIY A;  4F3S A;  1KWH A;  1D9Y A;  2REJ A;  3V5A A;  1B05 A;  4KYS A;  5CMK A;  2P3V A;  4JVC A;  2QFL A;  3LV0 A;  4OQO A;  1RDY A;  2UVH A;  3KSX A;  1POT A;  5ET8 A;  4DXB A;  1R9Q A;  1D9V A;  4G2Z A;  1B52 A;  4Z0I A;  1B6H A;  1B46 A;  4N17 A;  4U1Z A;  1QKB A;  2XD3 A;  5KCJ B;  1N76 A;  2GH9 A;  5KDT B;  3IOR A;  2NWJ A;  2QVR A;  2THI A;  2I0C A;  1QUJ A;  4IO4 A;  2ESN A;  2W7Y A;  3OO9 A;  1DBZ A;  2Q8J A;  3KJT A;  4YB6 A;  1MY1 A;  3BIH A;  5TPA A;  3CG3 A;  4OMB A;  3DP8 A;  3C4M A;  1O7T A;  4ISU A;  1FQB A;  1YYZ A;  1PBQ A;  3FXU A;  4GWY A;  3RT6 B;  3D1R A;  2D21 A;  3VLV A;  5CMC A;  3IO4 A;  5M2V A;  1I69 A;  1EH3 A;  3VE1 B;  3IFC A;  1UIU A;  4EQ9 A;  2WYP A;  1EZO A;  2AL4 A;  5B70 A;  2QS4 A;  1NI9 A;  4QXD A;  3MVY A;  3VFJ A;  2XX9 A;  1NV1 A;  4N07 A;  4R74 A;  3FV1 A;  1B7Z A;  3E78 A;  2XWV A;  3HHF A;  4NN3 A;  1RYX A;  1IZ1 A;  4NE4 A;  3C34 A;  1LLS A;  5LTC A;  4NX1 A;  4P8B A;  1UTB B;  1Y4T A;  2OWZ A;  2CZL A;  4THI A;  2OCU A;  3R7X A;  2B65 A;  1RDX A;  4BDL A;  3E13 X;  1LST A;  4MLV A;  5IZ3 A;  3LSX A;  4LN5 A;  3S2V A;  1LCT A;  1QUI A;  2BJI A;  4EF1 A;  2F35 A;  2F7B A;  2V3U A;  4ELQ A;  5FBP A;  4FBP A;  3MYU A;  5K2Y A;  3EQ1 A;  1LBY A;  2G29 A;  4QSC A;  1OQH A;  1A55 A;  2CZI A;  3HPI A;  3I5O A;  2V3T A;  2E0S A;  2PVU A;  2HFB A;  4AS5 A;  4DI4 B;  1CE2 A;  3SEW A;  2ONS A;  2Q2A A;  3ZSF A;  2ZYN A;  3AXF A;  5DT6 A;  2F7A A;  2O84 X;  1N7X A;  4AB6 A;  4GWW A;  1XT8 A;  3PD8 A;  1I6Q A;  4Q5T A;  4E0W A;  4ZE9 A;  2G93 A;  2NUV A;  3K02 A;  3LSF B;  4POX A;  1B9J A;  1FQD A;  1FTA A;  2ZMB A;  1ATG A;  2YJP A;  2NOO A;  3KC0 A;  5EQ7 A;  1NH8 A;  3OXN A;  2HAV A;  1H45 A;  1FBC A;  3MJN A;  3BKI B;  2XHD A;  1PDA A;  1YPN A;  1BKA A;  3RQT A;  4DDD A;  2FYI A;  4MX6 A;  4KYE A;  4H67 A;  1DPE A;  4HE0 A;  3TFL A;  4YKJ A;  2VGQ A;  3TCG A;  2QS2 A;  3QK6 A;  3ILU B;  1DPP A;  2Z8D A;  1PB9 A;  4I62 A;  4ELR A;  3TQL A;  3EKI A;  3K1N A;  3OSQ A;  1PEB A;  3PGF A;  2ONK E;  1QUL A;  2A5T A;  1JNF A;  2Q8M A;  4QFL A;  4G8N A;  2XXW A;  4AS4 A;  2DWJ A;  3FAT A;  5KCJ A;  4NF8 A;  5H8H A;  5H8N B;  4GWZ A;  1YTV A;  5ITO A;  1DK4 A;  1URG A;  3CFX A;  4P1L A;  4UAC A;  4EDP A;  3OSR A;  3W15 C;  1RYO A;  1O63 A;  4O7I A;  3MWB A;  4DCX A;  3GBA A;  1N3X A;  4XFE A;  5ISU A;  3G3F A;  3Q29 A;  2FVZ A;  1FTL A;  1EYI A;  3SEU A;  1OMP A;  3S4U A;  4GWU A;  5J1D A;  3HCQ A;  1NV0 A;  5CRY A;  4JSO A; 
#chains in the Genus database with same CATH homology
 4LQ5 A;  3O29 A;  4F19 A;  4OWD A;  3ZKK A;  1VSO A;  3T9U A;  2DVC A;  2DP8 A;  5AE4 A;  1MH3 A;  2DS9 A;  2UVG A;  2PBW A;  5DVI A;  1HSL A;  5AA1 A;  1IXG A;  2Y7K A;  4M1V A;  3RGY A;  2AL5 A;  2XXQ A;  1Y3P A;  4GXS B;  4OFO A;  4FEB A;  3N26 A;  4F31 B;  4LZ5 A;  3K6W A;  2HZK A;  3FXQ A;  1LFG A;  1OQG A;  4F3G A;  4R9F A;  2UYF A;  1B51 A;  1MY3 A;  4H5G A;  1YAE A;  1H43 A;  2H99 A;  2PYY A;  1B3H A;  1QJM A;  3RT8 A;  4KYD A;  3SET A;  3I6V A;  4YKK A;  3TAJ A;  3OMB A;  3IOW A;  3IO6 A;  3RLF E;  2P2A A;  2QS3 A;  3TTM A;  2E1S A;  3N6T A;  1FQF A;  3H03 A;  5I57 A;  1US4 A;  3VV5 A;  4RYA A;  4PFY A;  4H5F A;  4IY5 A;  3RPW A;  1B3L A;  4WKM A;  1MS7 A;  2ZNT A;  3PU5 A;  3ECR A;  3LSL A;  2DSF A;  1O64 A;  3UP9 A;  1Y20 A;  1DTG A;  1XVX A;  5TPA B;  2UVJ A;  1BLF A;  3DM0 A;  4KI0 E;  4Q30 B;  3O6I A;  3MVZ A;  2Y7R A;  3CFL A;  1LFH A;  3KOT A;  1MXZ A;  3MQ9 A;  4HCY A;  2XXX A;  2I0B A;  2Z23 A;  2B3B A;  2ZNU A;  1VR5 A;  3TCF A;  1P1O A;  4MBP A;  3C32 A;  5DTB A;  5I2N A;  5K2X A;  5AA4 B;  4F29 A;  4K3F A;  1MY2 A;  3IB0 A;  4R75 A;  5L9O A;  4Q0C A;  4YIC A;  5DVJ A;  1ZKB A;  4R6Y A;  3UOR A;  1BTJ A;  1LGB C;  4ZEB A;  3ZKL A;  5ITP A;  1Y3N A;  5H8N A;  3K1P A;  5I58 B;  3HN0 A;  1MQI A;  3SDF A;  4LZ7 A;  1TFD A;  5FTI A;  3H6U A;  3N94 A;  4ZEK A;  1UTH A;  4PET A;  3TUS A;  2QPQ A;  3Q25 A;  4OZ9 A;  1DOT A;  2H25 A;  3ODB A;  1ZJL A;  1ZTY A;  1IUD A;  2F5X A;  4KQP A;  3FVK A;  1AL3 A;  1HSE A;  1N3W A;  3KN7 A;  3HHG A;  2LAO A;  4DXC A;  3SEV A;  3LBS A;  2HEU A;  5CI5 A;  4QF9 A;  2O1M A;  3PD9 A;  2ABH A;  2DE3 A;  1II5 A;  3H6V A;  1NMU A;  1Y4C A;  3CIJ A;  1MRP A;  1QUK A;  3PUV E;  2UYE A;  1SDX A;  4RXL A;  1GV8 A;  2XD2 A;  3PPR A;  4RA1 A;  3OEM A;  3OO8 A;  4KCD A;  1NFT A;  3OD7 A;  1JW4 A;  3T9H B;  3U92 A;  3A09 A;  4XKN A;  1MXX A;  3DLN A;  4BDR A;  3R6U A;  1A8E A;  4FAT A;  2F36 A;  4G8H A;  4TLL B;  3FVN A;  1Q35 A;  2AIX A;  4OEU A;  5BUU A;  2HCA A;  5H8S A;  5H8F B;  4U4X A;  2Y7W A;  4R73 A;  1QKA A;  3RNN A;  4I9D A;  2A5T B;  3IJO B;  1L5T A;  1Y3Q A;  4FED A;  1D3K A;  3H6T A;  4NF8 B;  5H8H B;  3IX1 A;  1JVY A;  3S9M C;  1LAH E;  2I3W A;  3CR9 A;  4HS7 A;  3BBR A;  5A5X A;  4YZZ A;  3V89 B;  2OZZ A;  1B1H A;  2OLB A;  1T0K A;  1EZ9 A;  3QYT A;  4F39 A;  4FE8 A;  1F9B A;  4KCC A;  4IGR A;  4ZEI A;  3MP8 A;  4O3A A;  3EHU A;  3VVD A;  2RC9 A;  3L6H A;  1B7U A;  1AOV A;  1P99 A;  2GHB A;  1VE4 A;  1IIW A;  4NF4 B;  4ZEC A;  3MVW A;  2F97 A;  4JDF A;  1H76 A;  4ZS9 A;  4XTC Q;  5AA4 A;  4EF2 A;  1HSJ A;  4RY1 A;  2Q9T A;  4OHN A;  3B6Q A;  1A8F A;  5L9M A;  3SER A;  1FQA A;  4YKI A;  5F7V A;  1OIB A;  2F6P A;  3IOT A;  1LBC A;  4ZDM A;  5I58 A;  2Z22 A;  1S7Y A;  4YB5 A;  2XX8 A;  5FTH A;  4IB2 A;  1PC3 A;  1Y9U A;  1M5E A;  4OYV A;  1OLA A;  3IB1 A;  4YMA A;  1DMB A;  4OER A;  4U23 A;  1TFA A;  2Y7I A;  3UN6 A;  1NKX A;  4MH5 A;  1B7H A;  1EU8 A;  4TQU Q;  5I57 B;  3KGC A;  5JTY A;  1R1N A;  1ZBM A;  5IKB A;  3MAM A;  4ELP A;  3S9N C;  5I59 A;  5AA2 D;  3CFZ A;  4RPO A;  4ONY A;  5I2K A;  1N84 A;  1OVB A;  3W9W A;  1PB8 A;  1FTJ A;  4E0X A;  2Z8E A;  2ZYM A;  5AA2 B;  4ZEF A;  3VXC A;  2QSX A;  1FQE A;  3O2A A;  3R26 A;  4KD5 A;  1MM6 A;  1D4N A;  4FJP A;  4FOR A;  3USD A;  2ONR A;  3VVE A;  2Q89 A;  1LB9 A;  3Q28 A;  2XXU A;  3O97 A;  1P1U A;  2H98 A;  5CBS A;  1MG1 A;  2QL3 A;  5HPQ A;  1WOD A;  5H8F A;  5I2N B;  2QMW A;  2V3Q A;  3MUQ A;  3VXB A;  4JWY A;  1MQJ A;  4H65 A;  4X1B A;  2GRV A;  3OO6 A;  3N6U A;  3MZB A;  1JQF A;  4MFI A;  2OK2 A;  3RUM A;  4LAT A;  5DEX B;  3K01 A;  4WED A;  5CMM A;  3EHS A;  3IK6 B;  1UTH B;  5CMB A;  3L6G A;  3ONM A;  2QMX A;  4C1T A;  4R6K A;  1CB6 A;  4ESW A;  4OEN A;  5HBC A;  4OET A;  2F8D A;  3FJ7 A;  5IAI A;  4C1U A;  4DXU A;  1POY 1;  4OFJ A;  3K0V A;  1MPD A;  3CSG A;  4C0R A;  1FCK A;  4F3P A;  1QW0 A;  1M5B A;  2VOZ A;  4N13 A;  1SW5 A;  5CC2 A;  3FD3 A;  2Z8F A;  3C31 A;  1N0T A;  2XXP A;  3KZG A;  1FTM A;  1MH4 A;  4ESX A;  3M3F A;  4NF4 A;  2RCA A;  4ZZA A;  1GGG A;  3RN8 A;  3TMG A;  3FVO A;  1NH7 A;  1ELJ A;  1B5H A;  3O9P A;  1AMF A;  1LBB A;  3K1M A;  4NED A;  3C9H A;  1US5 A;  5H8Q B;  4YU0 A;  4H6D A;  3FZV A;  3MZ9 A;  4X9T A;  1B3E A;  1LAF E;  3FJG A;  1JEU A;  3B6T A;  4F1Y A;  2KLF A;  1LAX A;  1A7L A;  3C36 A;  2DVZ A;  3E4R A;  4U1O A;  2VP1 A;  1R9L A;  3DP4 A;  1MXW A;  3I3V A;  3LUY A;  4G8M A;  3FXR A;  3GZG A;  3GLB A;  3K4U A;  1TT1 A;  3BFT A;  3G3J A;  3IJX B;  2NVU B;  3HV1 A;  3T9X B;  4H8I A;  2R9J A;  2CMO A;  2DWH A;  5A5X B;  2QRY A;  1XC1 A;  3TQW A;  4IO3 A;  3E9X A;  2REG A;  3KN3 A;  4PP0 A;  4POW A;  4R2F A;  1MDQ A;  2XXY A;  2VD3 A;  1M5F A;  1Y1M A;  5AA2 A;  4TLM B;  3IOU A;  3C35 A;  2GHA A;  5I84 A;  1RKM A;  4TOZ A;  2O69 A;  3JYR A;  1SW4 A;  4PFU A;  4ZE8 A;  2H9B A;  1H3D A;  1SI0 A;  3RTF B;  3THI A;  1JEV A;  3QUF A;  3BFU A;  2H5Y A;  3LSW A;  2AYS A;  3CSB A;  4GL0 A;  3TKD A;  5B7D A;  2HXW A;  3EPE A;  1VFE A;  4H0W A;  4QSE A;  3A3C A;  3V83 A;  4DLD A;  3LC8 A;  1XS5 A;  3FGS A;  4U22 A;  3K00 A;  3UIF A;  1MPB A;  2UXA A;  5DEX A;  2R6G E;  2I58 A;  1R6Z A;  3JZJ A;  2DE2 A;  4IO5 A;  2H4I A;  4QSD A;  4BLA A;  1N04 A;  3D4G A;  5HM4 B;  3DP6 A;  5JTY B;  3TEP A;  2I6E A;  3F11 A;  2IEE A;  4ND9 A;  1PBP A;  1MQD A;  3FAS A;  1XVY A;  1B3G A;  3JV9 A;  5I59 B;  3PUX E;  5BWJ A;  5TP9 B;  1A40 A;  1MXY A;  1IIT A;  5I2K B;  4LVQ A;  1I6B A;  3Q27 A;  1NNT A;  4G4P A;  5F1Q A;  4IO6 A;  3TTN A;  3H06 B;  4NF5 B;  1SI1 A;  5H8Q A;  4R6H A;  3IL1 B;  3KG2 A;  1B5I A;  4PFT A;  1NNF A;  3RY3 A;  3TTL A;  2VD2 A;  4OES A;  1JVX A;  1P1Q A;  3ZS6 A;  2PT1 A;  4EUO A;  4OVJ A;  3KJ7 A;  3KSJ A;  1GTK A;  2RKM A;  1DTZ A;  4YMB A;  2OJT A;  1GR2 A;  4PQJ A;  2RC8 A;  4BDM A;  1AIV A;  4QFK A;  1B32 A;  2I4C A;  3M8U A;  4P0I A;  3CVG A;  3FJM A;  3SEX A;  2OWS A;  1B1X A;  4U2R A;  1LFI A;  2X7Q A;  4JWX A;  3QSL A;  3TZA A;  4RK9 A;  5JK4 A;  2BJJ X;  1P1W A;  4I1D A;  2M8C A;  4XKQ A;  4RNS A;  1ANF A;  3KBR A;  3N5L A;  1YCJ A;  4PE5 B;  1MY4 A;  4I8C A;  3G3I A;  3QXM A;  1LCF A;  2OBG A;  4ELO A;  4XXU A;  3UK4 A;  1IXH A;  1MQG A;  4O3C A;  4F2Q A;  4IO2 A;  1USY E;  2F6G A;  1IEJ A;  1ZMG A;  3TTR A;  4MF3 A;  3VLU A;  3T93 B;  2O1L A;  4G68 A;  1MPC A;  3OEL A;  4M4G A;  3W9V A;  4EQB A;  1FTO A;  3PV0 E;  4P11 A;  3H6W A;  4GIZ A;  2DWI A;  4QFO A;  4OTE A;  1S9T A;  4NWC A;  3PPP A;  4WEP A;  3PPQ A;  3IOV A;  4Q8R A;  1NL5 A;  4XIG Q;  4KHZ E;  4R72 A;  4QFP A;  2XX7 A;  2F7C A;  1ZU0 A;  2PMS A;  3MPK A;  4YB7 A;  1QVS A;  2P1S A;  2DOJ A;  4PFW A;  4KFQ A;  1JW1 A;  5L9S A;  3C33 A;  4YKP A;  3TYH A;  2I48 A;  1Q1K A;  3G7W A;  1LAG E;  4FAJ A;  3FV2 A;  3PUY E;  3VDF A;  3IB2 A;  3TCH A;  4U4S A;  4KPT A;  1B58 A;  1SYH A;  2O51 A;  4GWO A;  4LUB A;  1SW1 A;  2ZXT A;  2HAU A;  3DEL B;  4L17 A;  3T66 A;  2RC7 A;  3VVF A;  4F3B A;  4GQO A;  2HQ0 A;  3KFM A;  2DWA A;  2GFE A;  2O6A A;  4WXJ A;  2QS1 A;  3U72 A;  3A3U A;  2O68 A;  3LR1 A;  5TP9 A;  5I56 A;  4BDO A;  3HST A;  1FTK A;  2O7I A;  2UVI A;  1S50 A;  4IY6 A;  3SEY A;  5EYF A;  2D3I A;  4AB5 A;  2XXR A;  2QJE A;  4QRZ A;  4NMY A;  1SQY A;  4NF5 A;  5L8D A;  2DE4 A;  2V93 A;  3FUZ A;  2ANJ A;  1SVX B;  3K6U A;  2I3V A;  3U94 A;  4NF6 A;  3O66 A;  3H7M A;  1OVT A;  4JSD A;  5FHO A;  3MP6 A;  2ZNS A;  3KOS A;  1N7W A;  1JW5 A;  3SKP A;  1Z7M E;  1IXI A;  5KZT A;  1WVJ A;  3K6V A;  3TPA A;  3MC2 A;  4LQ2 A;  1NNK A;  4YAH X;  3WAE A;  2B3F A;  3MBP A;  4RK2 A;  5JEI A;  4FIM A;  1UQW A;  1DSN A;  3O6G A;  4BDQ A;  4ECF A;  4EXK A;  1VFD A;  1ZLQ A;  5ICT A;  4LP2 B;  2FNC A;  3VLW A;  2X26 A;  1URD A;  3CI8 A;  4GD5 A;  4OEV A;  4NTL A;  1FW0 A;  5KDT A;  3ILT B;  2XXT A;  2V84 A;  4F1U A;  4R9G A;  4UA8 A;  5ICQ A;  4U21 A;  1TXF A;  4ZED A;  3PUW E;  1NNP A;  4F22 A;  1Y1Z A;  2DXR A;  1GVC A;  2XXV A;  3O6H A;  2X7P A;  1MY0 A;  4JBZ A;  5EHM A;  4N6P A;  4GXA A;  1USY H;  1WDN A;  3MZ1 A;  4X1D A;  3K2D A;  4DCY A;  4F2O A;  3GBB A;  1MM7 A;  3U93 A;  2HZL A;  1AH5 A;  3QIM A;  1B4Z A;  4H8J A;  2PX1 A;  3B7D A;  3U1O A;  2V25 A;  3KEI A;  1UTB A;  1SYI A;  2WKY A;  2F78 A;  4G68 C;  2D5W A;  4AQ4 A;  1SD3 A;  2RIN A;  3PPN A;  4DZ1 A;  3M3L A;  3KN8 A;  4JXI A;  3G3K A;  4GRK A;  1BP5 A;  5FHN A;  1B40 A;  4JWO A;  4G77 A;  3RTW B;  1ZIU A;  1J1N A;  3IR1 A;  4XKP A;  4EQ7 A;  3T9V A;  3CRB A;  4XKR A;  1B2H A;  4R2B A;  1M5D A;  2DYX A;  2YLN A;  3TEL A;  2FA7 A;  4GF8 A;  3UGW A;  4RJZ A;  4LON B;  4IGT A;  1JET A;  3G3H A;  2ZYO A;  4OXV A;  4F1V A;  3MW0 A;  4EXL A;  1LB8 A;  1FQC A;  1B3F A;  5DYH A;  2XXH A;  3HO7 A;  4G68 B;  1XOC A;  4QHQ A;  3S9E A;  4O3B A;  3G3G A;  4KR5 A;  3EN3 A;  4OFL A;  4GOT A;  1A54 A;  3T96 B;  1MQH A;  1B5J A;  4DIG A;  4F18 A;  3OOA A;  1Z7N E;  5CBR A;  2OWT A;  3FVG A;  1XHY A;  1A99 A;  4JB7 A;  4GVO A;  2Q88 A;  5AA3 A;  5ELV A;  3P7I A;  3PPO A;  3OEN A;  3MP1 A;  4HW8 A;  3SES A;  3V8X B;  1B0H A;  2ALU A;  5DVF A;  4BDN A;  2R71 A;  3MVX A;  3O28 A;  3PMV A;  3H3G A;  3D4C A;  1OLC A;  3B6W A;  4GFR A;  4QFN A;  1SBP A;  2PT2 A;  1MDP 1;  4HTG A;  1URS A;  2YPN A;  2NXO A;  4MLQ A;  3TOD A;  3EHT A;  3PMW A;  1P1N A;  3EF7 A;  2DXY A;  1UIV A;  3OEK A;  2F34 A;  3WAF A;  5CM6 A;  3TDJ A;  4NWD A;  1IXC A;  2P0S A;  3U8Q A;  4GLI A;  2XXI A;  1I6A A;  3CG1 A;  2IA4 A;  2RF1 A;  2Q2C A;  4P0G A;  3GXA A;  5I56 B;  2Y7P A;  1PB7 A;  1TWY A;  3K6X A;  3M3K A;  1M5C A;  1B0L A;  3S9L C;  3TTK A;  4X48 A;  2RCB A;  3FIR A;  3T22 A;  4LA9 A;  4IO7 A;  1H44 A;  1MXU A;  3QAX A;  2VHA A;  3UA8 A;  3MPL A;  1B4H A;  4RPN A;  1EZP A;  4LZ8 A;  3PMX A;  1SW2 A;  4FEC A;  4H1X A;  2ZYK A;  5TU0 A;  3PUZ E;  4ZZE A;  3OO7 A;  3IAZ A;  4GL8 A;  1MXV A;  5EHS A;  3Q26 A;  4NF6 B;  2A5S A;  4Z7E A;  4HCW A;  5FHM A;  3E3K A;  2Y84 A;  2I49 A;  1IQ7 A;  3H4Z A;  2DQV A;  2I4B A;  2O7U A;  3QUJ A;  5LOM A;  4DE8 A;  1BIY A;  4F3S A;  1KWH A;  1D9Y A;  2REJ A;  3V5A A;  1B05 A;  4KYS A;  5CMK A;  4OQO A;  2UVH A;  3KSX A;  1POT A;  4DXB A;  1R9Q A;  1D9V A;  4G2Z A;  1B52 A;  4Z0I A;  1B6H A;  1B46 A;  4U1Z A;  1QKB A;  2XD3 A;  5KCJ B;  1N76 A;  2GH9 A;  5KDT B;  3IOR A;  2NWJ A;  2THI A;  2I0C A;  1QUJ A;  4IO4 A;  2ESN A;  2W7Y A;  3OO9 A;  2Q8J A;  3KJT A;  4YB6 A;  1MY1 A;  5TPA A;  3CG3 A;  4OMB A;  3DP8 A;  3C4M A;  1O7T A;  4ISU A;  1FQB A;  1PBQ A;  3FXU A;  3RT6 B;  2D21 A;  3VLV A;  5CMC A;  3IO4 A;  5M2V A;  1I69 A;  1EH3 A;  3VE1 B;  1UIU A;  4EQ9 A;  1EZO A;  2AL4 A;  5B70 A;  2QS4 A;  3MVY A;  3VFJ A;  2XX9 A;  4R74 A;  4N07 A;  3FV1 A;  1B7Z A;  3HHF A;  1RYX A;  1IZ1 A;  4NE4 A;  3C34 A;  1LLS A;  1UTB B;  1Y4T A;  2CZL A;  4THI A;  2OCU A;  3R7X A;  2B65 A;  4BDL A;  3E13 X;  1LST A;  4MLV A;  3LSX A;  3S2V A;  1LCT A;  1QUI A;  4EF1 A;  2F35 A;  2F7B A;  2V3U A;  4ELQ A;  5K2Y A;  3EQ1 A;  2G29 A;  4QSC A;  1OQH A;  1A55 A;  3HPI A;  3I5O A;  2V3T A;  2E0S A;  2PVU A;  2HFB A;  1CE2 A;  3SEW A;  2ONS A;  2Q2A A;  3ZSF A;  2ZYN A;  3AXF A;  5DT6 A;  2F7A A;  2O84 X;  1N7X A;  4AB6 A;  1XT8 A;  3PD8 A;  1I6Q A;  4Q5T A;  4E0W A;  4ZE9 A;  2G93 A;  2NUV A;  3K02 A;  3LSF B;  4POX A;  1B9J A;  1FQD A;  2ZMB A;  1ATG A;  2YJP A;  2NOO A;  1NH8 A;  3OXN A;  2HAV A;  1H45 A;  3MJN A;  3BKI B;  2XHD A;  1PDA A;  1YPN A;  1BKA A;  3RQT A;  4DDD A;  2FYI A;  4KYE A;  4H67 A;  1DPE A;  3TFL A;  4YKJ A;  2VGQ A;  3TCG A;  2QS2 A;  3QK6 A;  3ILU B;  1DPP A;  2Z8D A;  1PB9 A;  4I62 A;  4ELR A;  3TQL A;  3K1N A;  3OSQ A;  1PEB A;  3PGF A;  2ONK E;  1QUL A;  2A5T A;  1JNF A;  4QFL A;  4G8N A;  2XXW A;  2DWJ A;  3FAT A;  5KCJ A;  4NF8 A;  5H8H A;  5H8N B;  1YTV A;  5ITO A;  1URG A;  3CFX A;  4UAC A;  4EDP A;  3OSR A;  3W15 C;  1RYO A;  1O63 A;  3MWB A;  4DCX A;  3GBA A;  1N3X A;  5ISU A;  3G3F A;  3Q29 A;  1FTL A;  3SEU A;  1OMP A;  3S4U A;  5J1D A;  3HCQ A;  5CRY A;  4JSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...