4P11A

Native crystal structure of mltf pseudomonas aeruginosa
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
428
structure length
428
Chain Sequence
APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase F
publication title Native crystal structure of MltF Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 152
structure length 428
sequence length 428
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2014-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p11A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p11A02
1I6BA 4YB7A 3MAMA 1M5DA 4GFRA 1OIBA 3V89B 4H65A 1KWHA 1GGGA 3FIRA 5TPAA 4EXLA 1B3GA 2G93A 5ICQA 1ZBMA 4EQ7A 3G3JA 1L5TA 1R9LA 4KCDA 1P1NA 3W15C 1B0LA 1US4A 4G8NA 5F1QA 2ZYMA 4F1YA 3GZGA 1N76A 3TELA 4JWOA 4IO7A 4HW8A 1PB9A 2ZNTA 3Q26A 5DVFA 1H44A 1IXGA 2O6AA 2QRYA 2NVUB 4YKIA 4OFLA 4N6PA 3FATA 1MXXA 3O66A 5H8QB 3SKPA 3UP9A 2GHAA 3QK6A 4H8IA 3K6WA 4ECFA 1LFHA 1VFDA 2ONRA 3IAZA 5TP9A 1URDA 3F11A 1Q1KA 4DE8A 1B5JA 5CMKA 3VVDA 1ZTYA 1UIVA 4OQOA 5F7VA 5CMMA 3GXAA 3OO9A 3EQ1A 2O1MA 2V25A 4M1VA 1A7LA 3V8XB 4QFOA 3VLWA 3IO6A 2V84A 1QULA 1TXFA 3TKDA 4GWOA 1FTMA 2VD2A 2DXRA 3N26A 1URSA 3PD8A 2LAOA 3CSGA 1AOVA 5EHSA 2RCBA 4DXBA 4DZ1A 1XT8A 1SW1A 1LFIA 1XOCA 3CI8A 3H6WA 3A3CA 1POY1 3QUFA 4OENA 1LAXA 4Z7EA 1OQGA 3CSBA 1I69A 4RK9A 4PE5B 1NH8A 3SEYA 3T9UA 2UXAA 1JW5A 5FTIA 4OZ9A 4G68C 1F9BA 1I6QA 2Y7RA 3OO7A 3THIA 1T0KA 3FASA 2B3BA 3IB2A 1HSLA 5L8DA 4YB6A 3IK6B 3Q25A 3B6QA 5CBSA 5FHOA 4ELPA 4XKQA 2DWJA 4H0WA 5IKBA 3IOVA 1A40A 2KLFA 4PFWA 5DT6A 2H99A 2RC9A 1MM7A 2HEUA 3DP8A 2DE3A 4ZEFA 3MUQA 4ELOA 4EF1A 2O68A 2Y84A 3FXRA 1MY4A 4LQ5A 3KG2A 3PPOA 1VR5A 4OYVA 4LP2B 2QMWA 1LLSA 3LR1A 1B9JA 2H98A 2Q8JA 3RTFB 1NFTA 1B51A 3N5LA 3K1PA 5EHMA 3TUSA 2OCUA 1LAFE 1JW1A 5DYHA 1NNFA 2HFBA 5HM4B 3CIJA 1PBPA 3OOAA 5H8FA 1POTA 3U94A 2AYSA 2GHBA 2O69A 2QMXA 5L9OA 1SDXA 3MP8A 1PB7A 5HBCA 3DM0A 1ZLQA 2QS1A 1B3LA 2P0SA 1FQAA 1B6HA 3PGFA 2ZNSA 5JEIA 4QFKA 1GVCA 1M5BA 4G77A 1FQEA 1FTKA 3OELA 1QUJA 3KOTA 2DYXA 2GRVA 3D4CA 2PMSA 1PDAA 1UTBA 4XXUA 1N3XA 3PPQA 4R6YA 1BIYA 3S9NC 1AH5A 3FJ7A 1IUDA 1Y3NA 4ZEIA 3IX1A 3I3VA 2X7PA 3TTKA 3W9VA 1UTHA 1JNFA 1N84A 3PPPA 1LB8A 5DEXB 2H9BA 3W9WA 3C4MA 2WKYA 3IOUA 4KCCA 5CMBA 4TOZA 2OK2A 4NWCA 1NNTA 5H8SA 4NF8B 1B7ZA 5I56A 3S2VA 4ESXA 1SI1A 1LBBA 3OSQA 4EF2A 4R74A 3U92A 2Z23A 1LAGE 3UORA 2VGQA 1XVXA 3HPIA 1VFEA 3ONMA 5AA4B 5KDTA 3UA8A 1GV8A 4ZZAA 4OEVA 4NF5B 4F19A 2UVJA 3O6GA 3PUXE 5H8NA 3E13X 4AB6A 1EZPA 4TQUQ 1PC3A 1MQIA 3I6VA 4RJZA 3IL1B 3O29A 2PVUA 2I6EA 1Z7ME 4L17A 4JSDA 3RN8A 2IEEA 3H7MA 4R6HA 4O3AA 1D3KA 3FV1A 4BDQA 3C35A 2F8DA 5I2KA 3QUJA 5DTBA 3TZAA 2DWAA 1MY3A 1H43A 1Y4TA 2PX1A 2A5TB 3I5OA 3HSTA 3JV9A 4DDDA 3LSFB 5I84A 3MVYA 1P99A 1AMFA 3N6TA 4IGRA 4YAHX 5DVIA 2QPQA 4BDOA 3V5AA 1I6AA 5DVJA 3OXNA 2F7BA 2M8CA 1SW2A 3S4UA 2ABHA 1LCFA 3IR1A 4R2BA 1MQHA 1EZ9A 2UVIA 5AA1A 1H76A 3VXBA 1AL3A 3EHTA 3KJ7A 1IQ7A 5CC2A 1PEBA 2REJA 3O28A 3H6VA 1TWYA 3PUWE 4FATA 1MY0A 4QSDA 3M3LA 1B4ZA 3DELB 1ZMGA 4F1VA 2NWJA 4QFPA 4NMYA 3T93B 4TLMB 1O64A 3H03A 5ISUA 3MVWA 5KCJB 4G68A 1UIUA 1JVYA 2H4IA 3D4GA 1JW4A 2V93A 2NXOA 2V3QA 2XX9A 3K1NA 3VE1B 5J1DA 1A8EA 4QSCA 4RYAA 4I62A 4ONYA 4NF6A 1QKBA 4WEPA 1OLCA 1ZU0A 3G3FA 5TPAB 2UYFA 4IY6A 4OEUA 5FTHA 4NF6B 1MQJA 2XX8A 1FQFA 1Y1MA 3BFTA 1J1NA 1CB6A 4OMBA 4I9DA 1DMBA 4QHQA 3PU5A 4M4GA 4YKPA 3SDFA 3TYHA 4NTLA 3H4ZA 2VP1A 1Q35A 4POWA 3VXCA 3PMWA 1OLAA 2DVZA 5BUUA 4P11A 3RUMA 2DVCA 1B05A 4QFLA 2P2AA 4PQJA 5CM6A 1PBQA 4EQBA 3FJGA 4BDRA 3IOWA 3ILTB 3ILUB 1MDQA 2XXXA 2I4CA 2ONSA 3G3GA 4IO5A 5AA2A 3CRBA 4BDLA 1RKMA 4RA1A 3UK4A 2A5SA 2F78A 4R6KA 4F1UA 5TP9B 2F7AA 3QAXA 3LSWA 2CZLA 3U72A 5AA2B 1JVXA 3PV0E 4RPOA 3KEIA 3LC8A 4MLQA 3IJOB 1Y3QA 4OHNA 1P1OA 2V3TA 1P1WA 3RLFE 4ZEDA 3CVGA 1ANFA 3N94A 1H45A 3C32A 4GIZA 1MDP1 4QSEA 4FE8A 1B32A 3TAJA 3GLBA 3E3KA 4I1DA 1II5A 2XHDA 3TTLA 3PUZE 1GTKA 4GLIA 1FQDA 4WKMA 3L6GA 2F7CA 1B40A 2THIA 4GXAA 1URGA 3C33A 2OWSA 2Q9TA 4TLLB 2RINA 3N6UA 3MBPA 1SI0A 4ZECA 1IITA 2XXIA 2R71A 4NWDA 4NEDA 4KD5A 2ZNUA 4RXLA 5LOMA 2OJTA 3S9LC 4OWDA 4Q30B 3ODBA 3JZJA 3M3KA 4U1OA 3IOTA 3MZ1A 3MPKA 2V3UA 3MC2A 2RCAA 2VOZA 1IXHA 5AA2D 2B3FA 4KI0E 1O7TA 3FVNA 1AIVA 5ELVA 3TCHA 4FIMA 3EHSA 1MXVA 3R26A 4U4XA 1LGBC 5FHNA 3U93A 3CG3A 2VD3A 3FXQA 1XVYA 5CBRA 3GBAA 5ICTA 4RNSA 3PD9A 3TODA 4FAJA 2FA7A 4G4PA 3ZKLA 3EF7A 1EH3A 4YB5A 2RKMA 4H5FA 4JXIA 5H8FB 3TMGA 4FORA 1PB8A 2PBWA 4F3SA 1IZ1A 3SETA 4UA8A 5A5XA 3K0VA 2Q2AA 4JBZA 4NE4A 4R2FA 3TTNA 3MJNA 3RT8A 2AL5A 3KSXA 1S50A 4P0IA 3B6WA 1SW4A 1QUKA 5I59A 2QL3A 2HAVA 1B3FA 4X48A 3G3HA 1MQDA 2I3VA 1UTBB 3QYTA 4U4SA 4F22A 1VSOA 1IEJA 2F6PA 4KQPA 3QSLA 5I59B 3TTRA 1NNKA 3HHGA 4IO6A 3UN6A 3OO6A 5H8HA 1UTHB 2D21A 4N13A 1YPNA 1MH3A 3K6XA 4AB5A 3WAFA 3HCQA 1DTZA 3KN8A 3ZSFA 1IXCA 5L9MA 3O97A 1LSTA 2Q88A 4BDNA 3PPNA 3E4RA 1B1XA 5CI5A 5I56B 3KOSA 1R9QA 3G3IA 1B3EA 2XX7A 4OFOA 1QW0A 3KN3A 1JEUA 3VLVA 3KN7A 4NF4A 3DP4A 3PUYE 3FGSA 3MVZA 3VV5A 2I0CA 3SEXA 2PT2A 3M8UA 2Q2CA 1LBCA 4XIGQ 5ITOA 3GBBA 5KDTB 3LSLA 3PMXA 4NF4B 5IAIA 3P7IA 5H8NB 2I3WA 3CFLA 4QF9A 4GL0A 3MWBA 2O7UA 5I57A 2YJPA 4LZ8A 2ANJA 3PUVE 2ZYOA 3G3KA 1OVBA 5CRYA 3VLUA 4OESA 4ELQA 4IGTA 3O6HA 3RPWA 3E9XA 4Q5TA 2F34A 4G8HA 1HSEA 3M3FA 4LVQA 3ZS6A 3KFMA 4LZ5A 4U22A 1YCJA 4HCWA 2QS4A 5I2KB 3TFLA 1TFAA 4ZS9A 3OD7A 3LBSA 3A3UA 4EDPA 3CFZA 1B3HA 1MPDA 1B5IA 1N7WA 2XXUA 3RQTA 3FV2A 2ZXTA 2RF1A 3RT6B 2H5YA 1HSJA 4K3FA 4R9GA 4LQ2A 1B2HA 1SW5A 2QSXA 4P0GA 4JWXA 1NH7A 1MPBA 4ZE8A 3MZ9A 3G7WA 3HO7A 4OETA 2BJJX 2D5WA 1FTLA 2RC8A 1QVSA 3K6VA 1MXYA 5JK4A 1LAHE 2F35A 2DWHA 3H6UA 3TEPA 2X7QA 3K01A 3FUZA 2Y7IA 1S9TA 4XTCQ 1MXWA 2F97A 1SYHA 3MW0A 3FD3A 2DSFA 2YPNA 2ZYNA 4JB7A 1Y4CA 3T22A 3TPAA 4HTGA 5ITPA 1YAEA 1SBPA 2O1LA 4BDMA 3VDFA 2DQVA 1Z7NE 5AE4A 3O6IA 3CR9A 3CG1A 2CMOA 3S9MC 2ZMBA 1USYE 2XXTA 2Z8FA 1B7UA 3R6UA 5AA3A 4G68B 3KGCA 1IIWA 3UGWA 4DCXA 1FCKA 1XS5A 4OTEA 4DIGA 3FZVA 2F6GA 3O9PA 2I48A 4PFTA 1WVJA 5TU0A 4ESWA 3RY3A 1A55A 4R72A 1GR2A 1YTVA 1DOTA 5B70A 4ZEBA 3K00A 4Q8RA 2FYIA 2AL4A 4IY5A 3B7DA 4JDFA 1ZJLA 4FEDA 4H67A 4KFQA 1NNPA 1SVXB 5H8QA 4F3BA 4F18A 3AXFA 4F3PA 1OVTA 4U23A 3FVOA 1MXZA 5K2YA 1VE4A 1R1NA 3T9HB 1M5EA 4F39A 3FVKA 2HAUA 2HZLA 3JYRA 2UVGA 3EHUA 3TTMA 3KJTA 2Y7KA 2HXWA 3MP6A 4MLVA 2UYEA 1N7XA 2X26A 2G29A 4E0XA 3RGYA 1B7HA 1RYOA 3KSJA 1RYXA 3R7XA 3ZKKA 2QJEA 3MQ9A 1NMUA 2PYYA 4LUBA 4DCYA 1XHYA 1LCTA 2ALUA 2GH9A 3OEKA 4R73A 2I0BA 3UIFA 1BTJA 2O84X 1FQBA 1MH4A 4KR5A 3Q28A 3U1OA 4LATA 2Y7WA 4EQ9A 1Y9UA 4POXA 3IB1A 3WAEA 3DP6A 4F3GA 4FJPA 1N0TA 4H5GA 4EUOA 3H3GA 2XXQA 4LZ7A 1LFGA 1BP5A 4O3BA 4THIA 1S7YA 3T9VA 2XD3A 4F2OA 2DS9A 3IJXB 3K4UA 1OQHA 1MXUA 2Z8EA 3IO4A 3VVEA 3S9EA 4ELRA 2XXPA 4XKRA 3PMVA 4KPTA 1DTGA 2XD2A 5L9SA 2DOJA 1SQYA 1UQWA 4ND9A 4C1UA 3RNNA 4GXSB 1B46A 3MPLA 2Y7PA 4PFUA 3T66A 3EN3A 3IORA 2H25A 2I58A 2OLBA 3OENA 4OFJA 3EPEA 3QXMA 4X9TA 2NOOA 3OSRA 4GF8A 4C1TA 3QIMA 2B65A 4EXKA 1MG1A 2Q89A 1M5CA 3SEUA 3C31A 2VHAA 4AQ4A 2Z8DA 4E0WA 1SYIA 4O3CA 1B0HA 2OWTA 1QJMA 2AIXA 4U21A 1MY1A 4F2QA 3FJMA 3RTWB 1EU8A 1N04A 1QKAA 2OBGA 4YKJA 2O51A 2XXRA 2HZKA 5CMCA 1MQGA 1ZKBA 4X1DA 1MY2A 1B4HA 1WODA 3O2AA 1Y20A 4MF3A 2F5XA 2I4BA 1A8FA 3DLNA 5KZTA 4YMBA 3VVFA 1MM6A 1IXIA 2ZYKA 1LB9A 3BKIB 4GVOA 3BBRA 4BLAA 5JTYA 2O7IA 4PETA 4LONB 1SD3A 5A5XB 4HS7A 2PT1A 4YMAA 1USYH 2XXYA 1D4NA 3K02A 4GL8A 2REGA 5JTYB 3B6TA 1DPPA 4KYDA 2QS2A 4Q0CA 1FQCA 2XXHA 1JETA 1M5FA 2E0SA 4WEDA 4YU0A 4C0RA 4DLDA 4R9FA 4KYEA 1TT1A 1A54A 3Q27A 3V83A 1Y1ZA 4XKNA 3A09A 5FHMA 5HPQA 3HN0A 5DEXA 3MVXA 1EZOA 2W7YA 4GOTA 4IO3A 3K2DA 1O63A 2ONKE 4DXCA 4YICA 1JEVA 3LSXA 5H8HB 4OERA 4NF8A 4YKKA 3SEWA 2Z22A 4DXUA 2UVHA 3SERA 1WDNA 4ZE9A 4H8JA 1JQFA 5M2VA 4GRKA 4RY1A 1BLFA 2NUVA 1QUIA 1ATGA 5AA4A 1A99A 3TQLA 4RK2A 3TDJA 3TQWA 2IA4A 4NF5A 2XXWA 1B52A 3CFXA 4H1XA 3BFUA 2D3IA 4KYSA 3LUYA 4JWYA 2E1SA 1NL5A 4KHZE 5I58A 5B7DA 3OO8A 2DE4A 3Q29A 5EYFA 3C9HA 4IB2A 3OMBA 4G8MA 4ZZEA 2DE2A 1ELJA 4Z0IA 1B5HA 3MP1A 4XKPA 1TFDA 2XXVA 5I58B 1N3WA 4UACA 4H6DA 3KZGA 2R6GE 5K2XA 2RC7A 5I57B 1DPEA 3FXUA 4QRZA 4OVJA 2HCAA 4MBPA 1B58A 1CE2A 4I8CA 4LA9A 4GQOA 3HV1A 4HCYA 3PPRA 4U1ZA 3IB0A 4X1BA 2A5TA 3HHFA 3ECRA 4ZEKA 5I2NA 4MH5A 4RPNA 4IO4A 4OXVA 1R6ZA 5I2NB 2F36A 5BWJA 4MFIA 2R9JA 3C34A 3MZBA 4N07A 4PFYA 2ESNA 1XC1A 1ZIUA 3OEMA 1P1QA 4U2RA 2DWIA 3TCGA 1D9VA 3L6HA 3TCFA 1BKAA 1DSNA 4FEBA 3KBRA 4IO2A 4GD5A 1FTOA 3U8QA 3USDA 3H6TA 1NKXA 3SESA 3FVGA 3T9XB 3C36A 4YZZA 2I49A 2DP8A 3SEVA 4JSOA 2QS3A 2DXYA 2HQ0A 4R75A 1OMPA 3VFJA 1FW0A 1MPCA 2FNCA 2P1SA 4PP0A 1MRPA 3T96B 1FTJA 3K6UA 1Y3PA 1D9YA 3K1MA 4FECA 5KCJA 1P1UA 1MS7A 4ZDMA 2YLNA 3H06B 4F31B 4WXJA 2GFEA 4G2ZA 1H3DA 4ISUA 4QFNA 1US5A 1B1HA 2OZZA 4F29A
chains in the Genus database with same CATH superfamily
1I6BA 4QXDA 4YB7A 3MAMA 1M5DA 4GFRA 1OIBA 3V89B 4H65A 1KWHA 1GGGA 2DDKA 4PAFA 5ET5A 3FIRA 5TPAA 4EXLA 1B3GA 1FTAA 2G93A 5ICQA 1ZBMA 3T1BA 4EQ7A 3G3JA 1L5TA 1R9LA 4KCDA 1P1NA 5ET7A 3W15C 1FJ9A 1B0LA 1US4A 4G8NA 5F1QA 2ZYMA 4F1YA 3GZGA 1N76A 3TELA 4JWOA 4IO7A 2QVUA 4HW8A 4NGUA 1PB9A 2ZNTA 1DBZA 3Q26A 3MYUA 1IMDA 5DVFA 1H44A 1IXGA 2O6AA 2QRYA 2NVUB 4YKIA 3FXBA 4OFLA 4N6PA 3FATA 1MXXA 3O66A 5H8QB 4PBHA 3SKPA 4P3LA 3UP9A 5EQ8A 2GHAA 4P8BA 3QK6A 4H8IA 3K6WA 4G61A 1INPA 4ECFA 1LFHA 1VFDA 2ONRA 3IAZA 5TP9A 1URDA 4MHFA 3F11A 1Q1KA 4DE8A 1B5JA 5CMKA 3VVDA 1FPJA 4HXVA 1K9YA 1ZTYA 1UIVA 4OQOA 4N4UA 5F7VA 5CMMA 3GXAA 3OO9A 1EYIA 3EQ1A 1FPLA 2F3BA 2O1MA 2V25A 4M1VA 1NV4A 1A7LA 3V8XB 4QFOA 3VLWA 3IO6A 1NV0A 2V84A 1QULA 1TXFA 3TKDA 4GWOA 1FTMA 2VD2A 2CZHA 2DXRA 3N26A 5I5PA 1URSA 3PD8A 2LAOA 3CSGA 1AOVA 5EHSA 2RCBA 4DXBA 4DZ1A 4MNCA 1XT8A 1SW1A 1LFIA 1XOCA 3CI8A 3H6WA 3CHGA 3A3CA 1POY1 3QUFA 4OENA 1LAXA 4Z7EA 1OQGA 3CSBA 1I69A 4RK9A 4PE5B 1NH8A 4MCOA 3SEYA 4MNIA 3T9UA 2UXAA 1JW5A 3GYYA 5FTIA 4OZ9A 4G68C 1F9BA 1I6QA 2Y7RA 3OO7A 3THIA 1T0KA 2P3NA 1NUWA 3FASA 2B3BA 3IB2A 1HSLA 5L8DA 4YB6A 1BK4A 3IK6B 3Q25A 3B6QA 5CBSA 5FHOA 4ELPA 4XKQA 2DWJA 4H0WA 5IKBA 3IOVA 1A40A 2KLFA 4NQ8A 4PFWA 5DT6A 4OVSA 2H99A 2RC9A 2PFZA 1MM7A 2HEUA 3DP8A 2DE3A 4ZEFA 3MUQA 4ELOA 4EF1A 2O68A 2Y84A 3FXRA 2XWIA 1MY4A 4LQ5A 3KG2A 3PPOA 1VR5A 4OYVA 4LP2B 2QMWA 1LLSA 3LR1A 4N17A 1B9JA 2H98A 2Q8JA 3RTFB 1NFTA 1B51A 3N5LA 2GQ1A 3K1PA 5EHMA 3TUSA 3HFUA 4IR8A 2OCUA 4LN5A 1LAFE 1JW1A 5DYHA 1NNFA 2HFBA 5HM4B 3CIJA 1PBPA 4NG7A 3OOAA 4OVQA 5H8FA 1POTA 3U94A 2AYSA 2QVVA 2GHBA 3QMFA 3E78A 1FJ6A 2O69A 2HPGA 2QMXA 5L9OA 1SDXA 3MP8A 1PB7A 5HBCA 3DM0A 1ZLQA 2FIXA 2QS1A 1B3LA 4X04A 2P0SA 1FQAA 1B6HA 1NV3A 2QFLA 4O7MA 3SZPA 2XXKA 3PGFA 2ZNSA 5JEIA 4QFKA 1GVCA 1M5BA 4G77A 1FQEA 1FTKA 1RDYA 3OELA 1QUJA 2ZZWA 3KOTA 2DYXA 2GRVA 3D4CA 2ZZVA 2PMSA 1PDAA 2CZIA 1UTBA 4XXUA 1N3XA 5ET6A 3PPQA 4R6YA 1BIYA 3S9NC 1AH5A 3FJ7A 1IUDA 1Y3NA 4ZEIA 3IX1A 3I3VA 2X7PA 4MIJA 3TTKA 3W9VA 1UTHA 1JNFA 1N84A 3PPPA 1LB8A 5DEXB 4AS4A 2H9BA 3W9WA 3C4MA 1FBGA 2WKYA 3IOUA 4KCCA 5CMBA 4TOZA 2OK2A 4NWCA 1NNTA 5H8SA 4NF8B 1B7ZA 5I56A 4N81A 2PFYA 3KC1A 3S2VA 4ESXA 1SI1A 1LBBA 3OSQA 4EF2A 4R74A 3U92A 2Z23A 1LAGE 4FBPA 3UORA 2VGQA 4P56A 1XVXA 1XI6A 3HPIA 1VFEA 3ONMA 4MAGA 5IZZA 5AA4B 5KDTA 3UA8A 1GV8A 4ZZAA 2FBPA 4OEVA 4NF5B 4F19A 2UVJA 3O6GA 3PUXE 4PFRA 1G0IA 5H8NA 3E13X 4AB6A 1EZPA 4TQUQ 4OVPA 1PC3A 1MQIA 3I6VA 5T3JA 4RJZA 3IL1B 3O29A 2PVUA 2I6EA 1Z7ME 4L17A 4JSDA 3RN8A 2IEEA 3H7MA 4R6HA 4O3AA 1D3KA 3FV1A 4BDQA 3C35A 5EYHA 2F8DA 5I2KA 3QUJA 5DTBA 3TZAA 2DWAA 1MY3A 1H43A 1Y4TA 1NV5A 2PX1A 2A5TB 3I5OA 4NN3A 3HSTA 3JV9A 4DDDA 3LSFB 5I84A 4P1LA 3MVYA 1P99A 1AMFA 4O94A 2P3VA 2B4MA 3N6TA 5IZ3A 4IGRA 4YAHX 5DVIA 2VPOA 2QPQA 2Y5KA 4BDOA 3V5AA 1I6AA 5DW8A 5DVJA 3OXNA 1DCUA 5IZ3B 2F7BA 2M8CA 1SW2A 5LDZA 3S4UA 1VDWA 3U65A 2ABHA 1LCFA 3IR1A 4R2BA 1MQHA 1EZ9A 2UVIA 1KA1A 4OANA 5AA1A 1H76A 3VXBA 1AL3A 3EHTA 3KJ7A 1IQ7A 5CC2A 2CZKA 1PEBA 4JVDA 2REJA 4N8YA 3O28A 3H6VA 1TWYA 3PUWE 4FATA 1FPGA 1MY0A 4QSDA 3M3LA 1B4ZA 3DELB 1ZMGA 4F1VA 2NWJA 4QFPA 4NMYA 4TLMB 3T93B 1O64A 2XWKA 3H03A 4MNPA 5ISUA 3MVWA 5KCJB 4G68A 1UIUA 1JVYA 2H4IA 3D4GA 1JW4A 4PTKA 2V93A 2NXOA 2V3QA 2XX9A 3K1NA 1AWBA 3VE1B 5J1DA 1A8EA 1KZ8A 4QSCA 4RYAA 4I62A 4PDDA 4ONYA 4NF6A 1QKBA 2HXRA 4WEPA 4AS5A 1OLCA 1ZU0A 3G3FA 5TPAB 2UYFA 4IY6A 4OEUA 5FTHA 4NF6B 1MQJA 2XX8A 2BJIA 1FQFA 1Y1MA 3BFTA 1J1NA 1CB6A 4OMBA 4HE0A 4I9DA 1DMBA 1NUYA 4QHQA 3PU5A 4M4GA 3KC0A 4YKPA 3SDFA 3TYHA 4NTLA 3H4ZA 2VP1A 1Q35A 2XA5A 4POWA 3VXCA 3PMWA 1OLAA 2DVZA 5BUUA 4P11A 3RUMA 2DVCA 1B05A 4QFLA 2P2AA 4PQJA 5CM6A 1PBQA 4EQBA 3FJGA 4BDRA 3IOWA 3ILTB 3ILUB 4HE2A 1MDQA 2XXXA 2I4CA 4PF6A 2ONSA 3G3GA 3NOHA 4IO5A 5AA2A 3CRBA 4BDLA 1RKMA 4JVIA 4RA1A 3B50A 3UK4A 2A5SA 2F78A 4R6KA 4F1UA 5TP9B 2F7AA 3QAXA 4PFIA 4UABA 3LSWA 2CZLA 3U72A 5AA2B 1JVXA 3PV0E 4RPOA 3KEIA 4N6KA 3LC8A 4MLQA 3IJOB 1Y3QA 4OHNA 1P1OA 2V3TA 1P1WA 3RLFE 4ZEDA 3CVGA 1LBVA 1ANFA 3B8BA 3N94A 1H45A 3C32A 4GIZA 1FPKA 3E79A 2KR0A 1MDP1 4QSEA 4FE8A 1B32A 1YYZA 5F24A 3TAJA 3GLBA 3E3KA 4I1DA 1II5A 2XHDA 3TTLA 3PUZE 1GTKA 4GLIA 2CEXA 1FQDA 4WKMA 1IMEA 3L6GA 4GWZA 2F7CA 1B40A 2THIA 4GXAA 4I3YA 1URGA 3C33A 2OWSA 2F3DA 2Q9TA 4TLLB 2RINA 3N6UA 3MBPA 1SI0A 4GX4A 4ZECA 1IITA 2FHYA 2XXIA 2R71A 4NWDA 4NEDA 4KD5A 2ZNUA 4RXLA 5LOMA 2OJTA 3S9LC 4OWDA 4Q30B 3ODBA 3JZJA 3M3KA 4U1OA 3IOTA 3MZ1A 1NI9A 3MPKA 5I3SA 2V3UA 4XEQA 3MC2A 1CNQA 2RCAA 2VOZA 1IXHA 4PGNA 5AA2D 2B3FA 4KI0E 1FBEA 1O7TA 2XWVA 4H46A 3FVNA 1AIVA 5ELVA 3TCHA 4FIMA 3EHSA 1MXVA 3R26A 4U4XA 1LGBC 4PC9A 5FHNA 3U93A 3CG3A 1FBDA 2VD3A 3FXQA 1XVYA 5A5LA 5CBRA 3GBAA 5ICTA 4RNSA 3PD9A 3TODA 4FAJA 2FA7A 4G4PA 4I3EA 3ZKLA 3EF7A 1EH3A 4YB5A 2RKMA 4H5FA 4JXIA 4OVRA 5H8FB 2VPNA 2PCRA 3TMGA 5J16A 2HHMA 4FORA 1PB8A 2PBWA 4F3SA 1RDXA 1IZ1A 4O7IA 3SETA 4UA8A 2WEFA 3K0VA 5A5XA 2Q2AA 4JBZA 4NE4A 4R2FA 3TTNA 3MJNA 3RT8A 2AL5A 3KSXA 1KA0A 3RPLA 1S50A 4P0IA 4MMPA 1IMFA 3B6WA 1SW4A 1QUKA 5I59A 2QL3A 2HAVA 3LUZA 3KBZA 4MEVA 1B3FA 4X48A 3G3HA 1MQDA 3FBPA 5IZ1A 2I3VA 1UTBB 3QYTA 4U4SA 4F22A 1VSOA 1IEJA 2F6PA 4KQPA 3MSTA 3QSLA 5I59B 4NAPA 3TTRA 5ESYA 1NNKA 3HHGA 4IO6A 4OA4A 5EQ7A 3UN6A 3OO6A 5H8HA 1UTHB 2D21A 4N13A 1YPNA 1MH3A 3K6XA 5EYGA 4AB5A 3WAFA 1FBCA 2WYKA 3HCQA 1DTZA 3KN8A 3ZSFA 1IXCA 5L9MA 3O97A 1LSTA 1NV6A 2Q88A 4DI3D 4BDNA 3PPNA 3E4RA 1B1XA 2V4CA 5CI5A 5I56B 3KOSA 1R9QA 3G3IA 2WBBA 1B3EA 2XX7A 4OFOA 1QW0A 3KN3A 1JEUA 3VLVA 5I7IA 3KN7A 3T0JA 4NF4A 3DP4A 3PUYE 3FGSA 3MVZA 3VV5A 5IGAA 2I0CA 3SEXA 2PT2A 3M8UA 2Q2CA 1LBCA 4XIGQ 5ITOA 3GBBA 5KDTB 3LSLA 3PMXA 4NF4B 5IAIA 3P7IA 5H8NB 4N8GA 2I3WA 3CFLA 4QF9A 4GL0A 3MWBA 2O7UA 1JP4A 5I57A 2YJPA 4LZ8A 2Q8MA 2ANJA 3PUVE 2ZYOA 3G3KA 1OVBA 5CRYA 3VLUA 4OESA 4ELQA 4IGTA 2FVZA 3O6HA 3RPWA 3E9XA 4Q5TA 2F34A 4G8HA 1HSEA 3BIHA 3M3FA 4LVQA 3ZS6A 3KFMA 4LZ5A 4U22A 1YCJA 4HCWA 4N91A 2QS4A 1Q9DA 5I2KB 3TFLA 1TFAA 4ZS9A 3OD7A 3LBSA 3A3UA 4EDPA 3CFZA 1B3HA 4MX6A 1MPDA 1B5IA 1N7WA 2XXUA 3RQTA 3FV2A 2ZXTA 2RF1A 3RT6B 2H5YA 1HSJA 4K3FA 4R9GA 4LQ2A 1B2HA 1SW5A 2QSXA 4P0GA 4JWXA 2L5VA 1NH7A 1MPBA 4ZE8A 3MZ9A 3G7WA 3HO7A 4OETA 2BJJX 1NV2A 2D5WA 1FTLA 2RC8A 2Q74A 1QVSA 3K6VA 1MXYA 2QVRA 4P1EA 5JK4A 1LAHE 2F35A 2JJKA 2DWHA 3H6UA 3TEPA 2X7QA 3K01A 3FUZA 2Y7IA 1S9TA 4XTCQ 1MXWA 2F97A 1SYHA 3MW0A 3FD3A 5FBPA 2DSFA 2YPNA 2ZYNA 4JB7A 1Y4CA 4OVTA 3T22A 3TPAA 2Y5LA 4HTGA 5ITPA 1YAEA 1SBPA 2O1LA 4BDMA 3VDFA 2DQVA 1Z7NE 5AE4A 3O6IA 3CR9A 3CG1A 2CMOA 3S9MC 2ZMBA 1USYE 2XXTA 2Z8FA 1B7UA 3R6UA 5AA3A 4G68B 3KGCA 1K9ZA 1IIWA 3UGWA 4DCXA 1FCKA 1XS5A 4OTEA 4DIGA 3FZVA 2F6GA 3O9PA 2I48A 4PFTA 1WVJA 5TU0A 4ESWA 3RY3A 1A55A 4R72A 1GR2A 2MKZA 1FPFA 1YTVA 1DOTA 5B70A 4ZEBA 3K00A 4Q8RA 2FYIA 2AL4A 4IY5A 1LBZA 3B7DA 4JDFA 1ZJLA 4XFEA 4FEDA 4H67A 4KFQA 1NNPA 1SVXB 1FSAA 5H8QA 4F3BA 4F18A 3AXFA 3EKIA 4F3PA 4GX3A 1OVTA 4U23A 2WBDA 1MXZA 3FVOA 5K2YA 4N15A 1VE4A 4HE1A 1R1NA 3T9HB 1M5EA 4F39A 3FVKA 2HAUA 2HZLA 3JYRA 2UVGA 3EHUA 3TTMA 1IMBA 3IFCA 3KJTA 4P9KA 2Y7KA 2HXWA 3MP6A 1EYKA 4MLVA 2UYEA 1N7XA 5ET8A 2X26A 2G29A 4E0XA 3RGYA 1B7HA 1RYOA 3KSJA 1RYXA 1FBHA 3R7XA 3ZKKA 2QJEA 3BIGA 1G0HA 3MQ9A 1NMUA 2PYYA 4LUBA 4DCYA 1XHYA 1LCTA 2ALUA 2GH9A 1IMAA 3OEKA 4R73A 2I0BA 3UIFA 1BTJA 2O84X 5LTCA 1FQBA 1MH4A 4KR5A 3Q28A 4GWSA 1FPBA 3U1OA 4LATA 2Y7WA 4EQ9A 1Y9UA 4POXA 3IB1A 3WAEA 3DP6A 4PAKA 3ROJA 4F3GA 4FJPA 1N0TA 4H5GA 4EUOA 3H3GA 2XXQA 4LZ7A 1LFGA 1BP5A 4O3BA 1EYJA 1FPDA 4THIA 1S7YA 3T9VA 2XD3A 4F2OA 2DS9A 3IJXB 3K4UA 1OQHA 1MXUA 2WX9A 2Z8EA 3IO4A 3VVEA 3S9EA 4ELRA 2XXPA 1FPIA 4XKRA 2B4LA 3PMVA 4GWXA 4KPTA 1DTGA 2XD2A 5L9SA 2DOJA 1NUXA 1SQYA 1UQWA 4ND9A 4QBAA 4C1UA 1FBPA 3RNNA 4GXSB 1B46A 3MPLA 2Y7PA 4PFUA 3T66A 3EN3A 3IORA 1FPEA 2H25A 2I58A 2OLBA 3OENA 3EPEA 3PTYA 4OFJA 3QXMA 4X9TA 2NOOA 3OSRA 4GF8A 3D1RA 4C1TA 3QIMA 2B65A 4EXKA 1MG1A 2Q89A 1M5CA 3SEUA 3C31A 2VHAA 4AQ4A 2Z8DA 4E0WA 1SYIA 2WYPA 4O3CA 1B0HA 2OWTA 4P47A 1QJMA 2AIXA 4PDHA 1LBWA 4U21A 4MJOA 4PF8A 1MY1A 2VT5A 4F2QA 2XWOA 3FJMA 3RTWB 1EU8A 1N04A 1QKAA 2OBGA 4YKJA 4GWUA 4PE3A 2O51A 2XXRA 2HZKA 5CMCA 1MQGA 1ZKBA 4X1DA 1MY2A 1B4HA 1WODA 3O2AA 1Y20A 4MF3A 2F5XA 2I4BA 1A8FA 3DLNA 5KZTA 4YMBA 3VVFA 4PCDA 1MM6A 4GWYA 1IXIA 4JVCA 2ZYKA 1LB9A 3BKIB 4GVOA 3BBRA 4BLAA 5JTYA 2O7IA 1FBFA 2KQZA 4GBWA 4PETA 4LONB 1SD3A 5A5XB 4HS7A 4XF5A 2PT1A 4YMAA 1USYH 2R8TA 2XXYA 1SPIA 1D4NA 3K02A 4GL8A 2REGA 5JTYB 3B6TA 1DPPA 4KYDA 2QS2A 1D9QA 3RPLB 4Q0CA 1FQCA 2XXHA 5IM2A 1JETA 1M5FA 2E0SA 4WEDA 1FRPA 4YU0A 4C0RA 4PBQA 4DLDA 4R9FA 4KYEA 1TT1A 1A54A 1YZ0A 3Q27A 3V83A 1Y1ZA 4XKNA 1LBXA 3A09A 5FHMA 5HPQA 3HN0A 5DEXA 4GBVA 3MVXA 1EZOA 2W7YA 4PFBA 4GOTA 5EQAA 4IO3A 3K2DA 3ISPA 1O63A 2ONKE 4DXCA 4YICA 3RYDA 2FIEA 1JEVA 3LSXA 5H8HB 4OERA 4NF8A 4YKKA 4GWWA 3SEWA 2Z22A 4DXUA 2UVHA 3SERA 1WDNA 4ZE9A 4H8JA 1JQFA 3IFAA 5M2VA 4GRKA 4RY1A 1BLFA 4NF0A 1NV7A 2NUVA 1QUIA 3A29A 1ATGA 1NUZA 5AA4A 1A99A 3TQLA 4RK2A 3TDJA 3TQWA 2IA4A 4NF5A 2XXWA 1B52A 3CFXA 4H1XA 1DK4A 3BFUA 2D3IA 4KYSA 3LUYA 4JWYA 2E1SA 1NL5A 4KHZE 4PGPA 4I40A 5I58A 5B7DA 3OO8A 2DE4A 3Q29A 5EYFA 3C9HA 4IB2A 3OMBA 4G8MA 1YXIA 4ZZEA 2DE2A 1ELJA 4Z0IA 1B5HA 3MP1A 4XKPA 1TFDA 2XXVA 5I58B 1N3WA 4UACA 4H6DA 3KZGA 2R6GE 5K2XA 2RC7A 5I57B 1DPEA 3FXUA 4QRZA 4OVJA 2HCAA 2OWZA 4MBPA 1B58A 1CE2A 4I8CA 4LA9A 4GQOA 3HV1A 4HCYA 5EQ9A 3PPRA 4U1ZA 3IB0A 4X1BA 2A5TA 4NX1A 3HHFA 3ECRA 4ZEKA 5I2NA 4MH5A 1LEVA 4RPNA 4IO4A 4N6DA 4OXVA 2OX3A 4H45A 1R6ZA 5I2NB 2F36A 1IMCA 5BWJA 4MFIA 2R9JA 3C34A 3MZBA 4N07A 4PFYA 2ESNA 4O8MA 1XC1A 1ZIUA 3OEMA 1P1QA 4U2RA 2DWIA 3TCGA 1D9VA 3L6HA 3TCFA 1BKAA 1DSNA 4FEBA 1RDZA 4DI4B 3KBRA 4IO2A 4GD5A 1FTOA 3U8QA 3USDA 3H6TA 1NKXA 3SESA 3FVGA 3T9XB 1LBYA 3C36A 4YZZA 2I49A 2DP8A 3SEVA 4JSOA 4GX6A 2QS3A 4NHBA 2DXYA 1QGXA 2HQ0A 4R75A 1OMPA 3VFJA 1FW0A 1NV1A 1MPCA 2FNCA 2CEYA 2P1SA 4PP0A 1MRPA 3T96B 1FTJA 3K6UA 1Y3PA 1D9YA 3K1MA 4FECA 5KCJA 1P1UA 1MS7A 4ZDMA 2YLNA 3H06B 4F31B 4X8RA 4KXPA 4WXJA 2GFEA 4PAIA 4G2ZA 1H3DA 4ISUA 4QFNA 1US5A 1B1HA 2ZZXA 3LV0A 2OZZA 4F29A
chains in the Genus database with same CATH topology
1I6BA 4YB7A 3MAMA 1M5DA 4GFRA 1OIBA 3V89B 4H65A 1KWHA 1GGGA 3FIRA 5TPAA 4EXLA 1B3GA 2G93A 5ICQA 1ZBMA 4EQ7A 3G3JA 1L5TA 1R9LA 4KCDA 1P1NA 3W15C 1B0LA 1US4A 4G8NA 5F1QA 2ZYMA 4F1YA 3GZGA 1N76A 3TELA 4JWOA 4IO7A 4HW8A 1PB9A 2ZNTA 3Q26A 5DVFA 1H44A 1IXGA 2O6AA 2QRYA 2NVUB 4YKIA 4OFLA 4N6PA 3FATA 1MXXA 3O66A 5H8QB 3SKPA 3UP9A 2GHAA 3QK6A 4H8IA 3K6WA 4ECFA 1LFHA 1VFDA 2ONRA 3IAZA 5TP9A 1URDA 3F11A 1Q1KA 4DE8A 1B5JA 5CMKA 3VVDA 1ZTYA 1UIVA 4OQOA 5F7VA 5CMMA 3GXAA 3OO9A 3EQ1A 2O1MA 2V25A 4M1VA 1A7LA 3V8XB 4QFOA 3VLWA 3IO6A 2V84A 1QULA 1TXFA 3TKDA 4GWOA 1FTMA 2VD2A 2DXRA 3N26A 1URSA 3PD8A 2LAOA 3CSGA 1AOVA 5EHSA 2RCBA 4DXBA 4DZ1A 1XT8A 1SW1A 1LFIA 1XOCA 3CI8A 3H6WA 3A3CA 1POY1 3QUFA 4OENA 1LAXA 4Z7EA 1OQGA 3CSBA 1I69A 4RK9A 4PE5B 1NH8A 3SEYA 3T9UA 2UXAA 1JW5A 5FTIA 4OZ9A 4G68C 1F9BA 1I6QA 2Y7RA 3OO7A 3THIA 1T0KA 3FASA 2B3BA 3IB2A 1HSLA 5L8DA 4YB6A 3IK6B 3Q25A 3B6QA 5CBSA 5FHOA 4ELPA 4XKQA 2DWJA 4H0WA 5IKBA 3IOVA 1A40A 2KLFA 4PFWA 5DT6A 2H99A 2RC9A 1MM7A 2HEUA 3DP8A 2DE3A 4ZEFA 3MUQA 4ELOA 4EF1A 2O68A 2Y84A 3FXRA 1MY4A 4LQ5A 3KG2A 3PPOA 1VR5A 4OYVA 4LP2B 2QMWA 1LLSA 3LR1A 1B9JA 2H98A 2Q8JA 3RTFB 1NFTA 1B51A 3N5LA 3K1PA 5EHMA 3TUSA 2OCUA 1LAFE 1JW1A 5DYHA 1NNFA 2HFBA 5HM4B 3CIJA 1PBPA 3OOAA 5H8FA 1POTA 3U94A 2AYSA 2GHBA 2O69A 2QMXA 5L9OA 1SDXA 3MP8A 1PB7A 5HBCA 3DM0A 1ZLQA 2QS1A 1B3LA 2P0SA 1FQAA 1B6HA 3PGFA 2ZNSA 5JEIA 4QFKA 1GVCA 1M5BA 4G77A 1FQEA 1FTKA 3OELA 1QUJA 3KOTA 2DYXA 2GRVA 3D4CA 2PMSA 1PDAA 1UTBA 4XXUA 1N3XA 3PPQA 4R6YA 1BIYA 3S9NC 1AH5A 3FJ7A 1IUDA 1Y3NA 4ZEIA 3IX1A 3I3VA 2X7PA 3TTKA 3W9VA 1UTHA 1JNFA 1N84A 3PPPA 1LB8A 5DEXB 2H9BA 3W9WA 3C4MA 2WKYA 3IOUA 4KCCA 5CMBA 4TOZA 2OK2A 4NWCA 1NNTA 5H8SA 4NF8B 1B7ZA 5I56A 3S2VA 4ESXA 1SI1A 1LBBA 3OSQA 4EF2A 4R74A 3U92A 2Z23A 1LAGE 3UORA 2VGQA 1XVXA 3HPIA 1VFEA 3ONMA 5AA4B 5KDTA 3UA8A 1GV8A 4ZZAA 4OEVA 4NF5B 4F19A 2UVJA 3O6GA 3PUXE 5H8NA 3E13X 4AB6A 1EZPA 4TQUQ 1PC3A 1MQIA 3I6VA 4RJZA 3IL1B 3O29A 2PVUA 2I6EA 1Z7ME 4L17A 4JSDA 3RN8A 2IEEA 3H7MA 4R6HA 4O3AA 1D3KA 3FV1A 4BDQA 3C35A 2F8DA 5I2KA 3QUJA 5DTBA 3TZAA 2DWAA 1MY3A 1H43A 1Y4TA 2PX1A 2A5TB 3I5OA 3HSTA 3JV9A 4DDDA 3LSFB 5I84A 3MVYA 1P99A 1AMFA 3N6TA 4IGRA 4YAHX 5DVIA 2QPQA 4BDOA 3V5AA 1I6AA 5DVJA 3OXNA 2F7BA 2M8CA 1SW2A 3S4UA 2ABHA 1LCFA 3IR1A 4R2BA 1MQHA 1EZ9A 2UVIA 5AA1A 1H76A 3VXBA 1AL3A 3EHTA 3KJ7A 1IQ7A 5CC2A 1PEBA 2REJA 3O28A 3H6VA 1TWYA 3PUWE 4FATA 1MY0A 4QSDA 3M3LA 1B4ZA 3DELB 1ZMGA 4F1VA 2NWJA 4QFPA 4NMYA 3T93B 4TLMB 1O64A 3H03A 5ISUA 3MVWA 5KCJB 4G68A 1UIUA 1JVYA 2H4IA 3D4GA 1JW4A 2V93A 2NXOA 2V3QA 2XX9A 3K1NA 3VE1B 5J1DA 1A8EA 4QSCA 4RYAA 4I62A 4ONYA 4NF6A 1QKBA 4WEPA 1OLCA 1ZU0A 3G3FA 5TPAB 2UYFA 4IY6A 4OEUA 5FTHA 4NF6B 1MQJA 2XX8A 1FQFA 1Y1MA 3BFTA 1J1NA 1CB6A 4OMBA 4I9DA 1DMBA 4QHQA 3PU5A 4M4GA 4YKPA 3SDFA 3TYHA 4NTLA 3H4ZA 2VP1A 1Q35A 4POWA 3VXCA 3PMWA 1OLAA 2DVZA 5BUUA 4P11A 3RUMA 2DVCA 1B05A 4QFLA 2P2AA 4PQJA 5CM6A 1PBQA 4EQBA 3FJGA 4BDRA 3IOWA 3ILTB 3ILUB 1MDQA 2XXXA 2I4CA 2ONSA 3G3GA 4IO5A 5AA2A 3CRBA 4BDLA 1RKMA 4RA1A 3UK4A 2A5SA 2F78A 4R6KA 4F1UA 5TP9B 2F7AA 3QAXA 3LSWA 2CZLA 3U72A 5AA2B 1JVXA 3PV0E 4RPOA 3KEIA 3LC8A 4MLQA 3IJOB 1Y3QA 4OHNA 1P1OA 2V3TA 1P1WA 3RLFE 4ZEDA 3CVGA 1ANFA 3N94A 1H45A 3C32A 4GIZA 1MDP1 4QSEA 4FE8A 1B32A 3TAJA 3GLBA 3E3KA 4I1DA 1II5A 2XHDA 3TTLA 3PUZE 1GTKA 4GLIA 1FQDA 4WKMA 3L6GA 2F7CA 1B40A 2THIA 4GXAA 1URGA 3C33A 2OWSA 2Q9TA 4TLLB 2RINA 3N6UA 3MBPA 1SI0A 4ZECA 1IITA 2XXIA 2R71A 4NWDA 4NEDA 4KD5A 2ZNUA 4RXLA 5LOMA 2OJTA 3S9LC 4OWDA 4Q30B 3ODBA 3JZJA 3M3KA 4U1OA 3IOTA 3MZ1A 3MPKA 2V3UA 3MC2A 2RCAA 2VOZA 1IXHA 5AA2D 2B3FA 4KI0E 1O7TA 3FVNA 1AIVA 5ELVA 3TCHA 4FIMA 3EHSA 1MXVA 3R26A 4U4XA 1LGBC 5FHNA 3U93A 3CG3A 2VD3A 3FXQA 1XVYA 5CBRA 3GBAA 5ICTA 4RNSA 3PD9A 3TODA 4FAJA 2FA7A 4G4PA 3ZKLA 3EF7A 1EH3A 4YB5A 2RKMA 4H5FA 4JXIA 5H8FB 3TMGA 4FORA 1PB8A 2PBWA 4F3SA 1IZ1A 3SETA 4UA8A 5A5XA 3K0VA 2Q2AA 4JBZA 4NE4A 4R2FA 3TTNA 3MJNA 3RT8A 2AL5A 3KSXA 1S50A 4P0IA 3B6WA 1SW4A 1QUKA 5I59A 2QL3A 2HAVA 1B3FA 4X48A 3G3HA 1MQDA 2I3VA 1UTBB 3QYTA 4U4SA 4F22A 1VSOA 1IEJA 2F6PA 4KQPA 3QSLA 5I59B 3TTRA 1NNKA 3HHGA 4IO6A 3UN6A 3OO6A 5H8HA 1UTHB 2D21A 4N13A 1YPNA 1MH3A 3K6XA 4AB5A 3WAFA 3HCQA 1DTZA 3KN8A 3ZSFA 1IXCA 5L9MA 3O97A 1LSTA 2Q88A 4BDNA 3PPNA 3E4RA 1B1XA 5CI5A 5I56B 3KOSA 1R9QA 3G3IA 1B3EA 2XX7A 4OFOA 1QW0A 3KN3A 1JEUA 3VLVA 3KN7A 4NF4A 3DP4A 3PUYE 3FGSA 3MVZA 3VV5A 2I0CA 3SEXA 2PT2A 3M8UA 2Q2CA 1LBCA 4XIGQ 5ITOA 3GBBA 5KDTB 3LSLA 3PMXA 4NF4B 5IAIA 3P7IA 5H8NB 2I3WA 3CFLA 4QF9A 4GL0A 3MWBA 2O7UA 5I57A 2YJPA 4LZ8A 2ANJA 3PUVE 2ZYOA 3G3KA 1OVBA 5CRYA 3VLUA 4OESA 4ELQA 4IGTA 3O6HA 3RPWA 3E9XA 4Q5TA 2F34A 4G8HA 1HSEA 3M3FA 4LVQA 3ZS6A 3KFMA 4LZ5A 4U22A 1YCJA 4HCWA 2QS4A 5I2KB 3TFLA 1TFAA 4ZS9A 3OD7A 3LBSA 3A3UA 4EDPA 3CFZA 1B3HA 1MPDA 1B5IA 1N7WA 2XXUA 3RQTA 3FV2A 2ZXTA 2RF1A 3RT6B 2H5YA 1HSJA 4K3FA 4R9GA 4LQ2A 1B2HA 1SW5A 2QSXA 4P0GA 4JWXA 1NH7A 1MPBA 4ZE8A 3MZ9A 3G7WA 3HO7A 4OETA 2BJJX 2D5WA 1FTLA 2RC8A 1QVSA 3K6VA 1MXYA 5JK4A 1LAHE 2F35A 2DWHA 3H6UA 3TEPA 2X7QA 3K01A 3FUZA 2Y7IA 1S9TA 4XTCQ 1MXWA 2F97A 1SYHA 3MW0A 3FD3A 2DSFA 2YPNA 2ZYNA 4JB7A 1Y4CA 3T22A 3TPAA 4HTGA 5ITPA 1YAEA 1SBPA 2O1LA 4BDMA 3VDFA 2DQVA 1Z7NE 5AE4A 3O6IA 3CR9A 3CG1A 2CMOA 3S9MC 2ZMBA 1USYE 2XXTA 2Z8FA 1B7UA 3R6UA 5AA3A 4G68B 3KGCA 1IIWA 3UGWA 4DCXA 1FCKA 1XS5A 4OTEA 4DIGA 3FZVA 2F6GA 3O9PA 2I48A 4PFTA 1WVJA 5TU0A 4ESWA 3RY3A 1A55A 4R72A 1GR2A 1YTVA 1DOTA 5B70A 4ZEBA 3K00A 4Q8RA 2FYIA 2AL4A 4IY5A 3B7DA 4JDFA 1ZJLA 4FEDA 4H67A 4KFQA 1NNPA 1SVXB 5H8QA 4F3BA 4F18A 3AXFA 4F3PA 1OVTA 4U23A 3FVOA 1MXZA 5K2YA 1VE4A 1R1NA 3T9HB 1M5EA 4F39A 3FVKA 2HAUA 2HZLA 3JYRA 2UVGA 3EHUA 3TTMA 3KJTA 2Y7KA 2HXWA 3MP6A 4MLVA 2UYEA 1N7XA 2X26A 2G29A 4E0XA 3RGYA 1B7HA 1RYOA 3KSJA 1RYXA 3R7XA 3ZKKA 2QJEA 3MQ9A 1NMUA 2PYYA 4LUBA 4DCYA 1XHYA 1LCTA 2ALUA 2GH9A 3OEKA 4R73A 2I0BA 3UIFA 1BTJA 2O84X 1FQBA 1MH4A 4KR5A 3Q28A 3U1OA 4LATA 2Y7WA 4EQ9A 1Y9UA 4POXA 3IB1A 3WAEA 3DP6A 4F3GA 4FJPA 1N0TA 4H5GA 4EUOA 3H3GA 2XXQA 4LZ7A 1LFGA 1BP5A 4O3BA 4THIA 1S7YA 3T9VA 2XD3A 4F2OA 2DS9A 3IJXB 3K4UA 1OQHA 1MXUA 2Z8EA 3IO4A 3VVEA 3S9EA 4ELRA 2XXPA 4XKRA 3PMVA 4KPTA 1DTGA 2XD2A 5L9SA 2DOJA 1SQYA 1UQWA 4ND9A 4C1UA 3RNNA 4GXSB 1B46A 3MPLA 2Y7PA 4PFUA 3T66A 3EN3A 3IORA 2H25A 2I58A 2OLBA 3OENA 4OFJA 3EPEA 3QXMA 4X9TA 2NOOA 3OSRA 4GF8A 4C1TA 3QIMA 2B65A 4EXKA 1MG1A 2Q89A 1M5CA 3SEUA 3C31A 2VHAA 4AQ4A 2Z8DA 4E0WA 1SYIA 4O3CA 1B0HA 2OWTA 1QJMA 2AIXA 4U21A 1MY1A 4F2QA 3FJMA 3RTWB 1EU8A 1N04A 1QKAA 2OBGA 4YKJA 2O51A 2XXRA 2HZKA 5CMCA 1MQGA 1ZKBA 4X1DA 1MY2A 1B4HA 1WODA 3O2AA 1Y20A 4MF3A 2F5XA 2I4BA 1A8FA 3DLNA 5KZTA 4YMBA 3VVFA 1MM6A 1IXIA 2ZYKA 1LB9A 3BKIB 4GVOA 3BBRA 4BLAA 5JTYA 2O7IA 4PETA 4LONB 1SD3A 5A5XB 4HS7A 2PT1A 4YMAA 1USYH 2XXYA 1D4NA 3K02A 4GL8A 2REGA 5JTYB 3B6TA 1DPPA 4KYDA 2QS2A 4Q0CA 1FQCA 2XXHA 1JETA 1M5FA 2E0SA 4WEDA 4YU0A 4C0RA 4DLDA 4R9FA 4KYEA 1TT1A 1A54A 3Q27A 3V83A 1Y1ZA 4XKNA 3A09A 5FHMA 5HPQA 3HN0A 5DEXA 3MVXA 1EZOA 2W7YA 4GOTA 4IO3A 3K2DA 1O63A 2ONKE 4DXCA 4YICA 1JEVA 3LSXA 5H8HB 4OERA 4NF8A 4YKKA 3SEWA 2Z22A 4DXUA 2UVHA 3SERA 1WDNA 4ZE9A 4H8JA 1JQFA 5M2VA 4GRKA 4RY1A 1BLFA 2NUVA 1QUIA 1ATGA 5AA4A 1A99A 3TQLA 4RK2A 3TDJA 3TQWA 2IA4A 4NF5A 2XXWA 1B52A 3CFXA 4H1XA 3BFUA 2D3IA 4KYSA 3LUYA 4JWYA 2E1SA 1NL5A 4KHZE 5I58A 5B7DA 3OO8A 2DE4A 3Q29A 5EYFA 3C9HA 4IB2A 3OMBA 4G8MA 4ZZEA 2DE2A 1ELJA 4Z0IA 1B5HA 3MP1A 4XKPA 1TFDA 2XXVA 5I58B 1N3WA 4UACA 4H6DA 3KZGA 2R6GE 5K2XA 2RC7A 5I57B 1DPEA 3FXUA 4QRZA 4OVJA 2HCAA 4MBPA 1B58A 1CE2A 4I8CA 4LA9A 4GQOA 3HV1A 4HCYA 3PPRA 4U1ZA 3IB0A 4X1BA 2A5TA 3HHFA 3ECRA 4ZEKA 5I2NA 4MH5A 4RPNA 4IO4A 4OXVA 1R6ZA 5I2NB 2F36A 5BWJA 4MFIA 2R9JA 3C34A 3MZBA 4N07A 4PFYA 2ESNA 1XC1A 1ZIUA 3OEMA 1P1QA 4U2RA 2DWIA 3TCGA 1D9VA 3L6HA 3TCFA 1BKAA 1DSNA 4FEBA 3KBRA 4IO2A 4GD5A 1FTOA 3U8QA 3USDA 3H6TA 1NKXA 3SESA 3FVGA 3T9XB 3C36A 4YZZA 2I49A 2DP8A 3SEVA 4JSOA 2QS3A 2DXYA 2HQ0A 4R75A 1OMPA 3VFJA 1FW0A 1MPCA 2FNCA 2P1SA 4PP0A 1MRPA 3T96B 1FTJA 3K6UA 1Y3PA 1D9YA 3K1MA 4FECA 5KCJA 1P1UA 1MS7A 4ZDMA 2YLNA 3H06B 4F31B 4WXJA 2GFEA 4G2ZA 1H3DA 4ISUA 4QFNA 1US5A 1B1HA 2OZZA 4F29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6B A;  4YB7 A;  3MAM A;  1M5D A;  4GFR A;  1OIB A;  3V89 B;  4H65 A;  1KWH A;  1GGG A;  3FIR A;  5TPA A;  4EXL A;  1B3G A;  2G93 A;  5ICQ A;  1ZBM A;  4EQ7 A;  3G3J A;  1L5T A;  1R9L A;  4KCD A;  1P1N A;  3W15 C;  1B0L A;  1US4 A;  4G8N A;  5F1Q A;  2ZYM A;  4F1Y A;  3GZG A;  1N76 A;  3TEL A;  4JWO A;  4IO7 A;  4HW8 A;  1PB9 A;  2ZNT A;  3Q26 A;  5DVF A;  1H44 A;  1IXG A;  2O6A A;  2QRY A;  2NVU B;  4YKI A;  4OFL A;  4N6P A;  3FAT A;  1MXX A;  3O66 A;  5H8Q B;  3SKP A;  3UP9 A;  2GHA A;  3QK6 A;  4H8I A;  3K6W A;  4ECF A;  1LFH A;  1VFD A;  2ONR A;  3IAZ A;  5TP9 A;  1URD A;  3F11 A;  1Q1K A;  4DE8 A;  1B5J A;  5CMK A;  3VVD A;  1ZTY A;  1UIV A;  4OQO A;  5F7V A;  5CMM A;  3GXA A;  3OO9 A;  3EQ1 A;  2O1M A;  2V25 A;  4M1V A;  1A7L A;  3V8X B;  4QFO A;  3VLW A;  3IO6 A;  2V84 A;  1QUL A;  1TXF A;  3TKD A;  4GWO A;  1FTM A;  2VD2 A;  2DXR A;  3N26 A;  1URS A;  3PD8 A;  2LAO A;  3CSG A;  1AOV A;  5EHS A;  2RCB A;  4DXB A;  4DZ1 A;  1XT8 A;  1SW1 A;  1LFI A;  1XOC A;  3CI8 A;  3H6W A;  3A3C A;  1POY 1;  3QUF A;  4OEN A;  1LAX A;  4Z7E A;  1OQG A;  3CSB A;  1I69 A;  4RK9 A;  4PE5 B;  1NH8 A;  3SEY A;  3T9U A;  2UXA A;  1JW5 A;  5FTI A;  4OZ9 A;  4G68 C;  1F9B A;  1I6Q A;  2Y7R A;  3OO7 A;  3THI A;  1T0K A;  3FAS A;  2B3B A;  3IB2 A;  1HSL A;  5L8D A;  4YB6 A;  3IK6 B;  3Q25 A;  3B6Q A;  5CBS A;  5FHO A;  4ELP A;  4XKQ A;  2DWJ A;  4H0W A;  5IKB A;  3IOV A;  1A40 A;  2KLF A;  4PFW A;  5DT6 A;  2H99 A;  2RC9 A;  1MM7 A;  2HEU A;  3DP8 A;  2DE3 A;  4ZEF A;  3MUQ A;  4ELO A;  4EF1 A;  2O68 A;  2Y84 A;  3FXR A;  1MY4 A;  4LQ5 A;  3KG2 A;  3PPO A;  1VR5 A;  4OYV A;  4LP2 B;  2QMW A;  1LLS A;  3LR1 A;  1B9J A;  2H98 A;  2Q8J A;  3RTF B;  1NFT A;  1B51 A;  3N5L A;  3K1P A;  5EHM A;  3TUS A;  2OCU A;  1LAF E;  1JW1 A;  5DYH A;  1NNF A;  2HFB A;  5HM4 B;  3CIJ A;  1PBP A;  3OOA A;  5H8F A;  1POT A;  3U94 A;  2AYS A;  2GHB A;  2O69 A;  2QMX A;  5L9O A;  1SDX A;  3MP8 A;  1PB7 A;  5HBC A;  3DM0 A;  1ZLQ A;  2QS1 A;  1B3L A;  2P0S A;  1FQA A;  1B6H A;  3PGF A;  2ZNS A;  5JEI A;  4QFK A;  1GVC A;  1M5B A;  4G77 A;  1FQE A;  1FTK A;  3OEL A;  1QUJ A;  3KOT A;  2DYX A;  2GRV A;  3D4C A;  2PMS A;  1PDA A;  1UTB A;  4XXU A;  1N3X A;  3PPQ A;  4R6Y A;  1BIY A;  3S9N C;  1AH5 A;  3FJ7 A;  1IUD A;  1Y3N A;  4ZEI A;  3IX1 A;  3I3V A;  2X7P A;  3TTK A;  3W9V A;  1UTH A;  1JNF A;  1N84 A;  3PPP A;  1LB8 A;  5DEX B;  2H9B A;  3W9W A;  3C4M A;  2WKY A;  3IOU A;  4KCC A;  5CMB A;  4TOZ A;  2OK2 A;  4NWC A;  1NNT A;  5H8S A;  4NF8 B;  1B7Z A;  5I56 A;  3S2V A;  4ESX A;  1SI1 A;  1LBB A;  3OSQ A;  4EF2 A;  4R74 A;  3U92 A;  2Z23 A;  1LAG E;  3UOR A;  2VGQ A;  1XVX A;  3HPI A;  1VFE A;  3ONM A;  5AA4 B;  5KDT A;  3UA8 A;  1GV8 A;  4ZZA A;  4OEV A;  4NF5 B;  4F19 A;  2UVJ A;  3O6G A;  3PUX E;  5H8N A;  3E13 X;  4AB6 A;  1EZP A;  4TQU Q;  1PC3 A;  1MQI A;  3I6V A;  4RJZ A;  3IL1 B;  3O29 A;  2PVU A;  2I6E A;  1Z7M E;  4L17 A;  4JSD A;  3RN8 A;  2IEE A;  3H7M A;  4R6H A;  4O3A A;  1D3K A;  3FV1 A;  4BDQ A;  3C35 A;  2F8D A;  5I2K A;  3QUJ A;  5DTB A;  3TZA A;  2DWA A;  1MY3 A;  1H43 A;  1Y4T A;  2PX1 A;  2A5T B;  3I5O A;  3HST A;  3JV9 A;  4DDD A;  3LSF B;  5I84 A;  3MVY A;  1P99 A;  1AMF A;  3N6T A;  4IGR A;  4YAH X;  5DVI A;  2QPQ A;  4BDO A;  3V5A A;  1I6A A;  5DVJ A;  3OXN A;  2F7B A;  2M8C A;  1SW2 A;  3S4U A;  2ABH A;  1LCF A;  3IR1 A;  4R2B A;  1MQH A;  1EZ9 A;  2UVI A;  5AA1 A;  1H76 A;  3VXB A;  1AL3 A;  3EHT A;  3KJ7 A;  1IQ7 A;  5CC2 A;  1PEB A;  2REJ A;  3O28 A;  3H6V A;  1TWY A;  3PUW E;  4FAT A;  1MY0 A;  4QSD A;  3M3L A;  1B4Z A;  3DEL B;  1ZMG A;  4F1V A;  2NWJ A;  4QFP A;  4NMY A;  3T93 B;  4TLM B;  1O64 A;  3H03 A;  5ISU A;  3MVW A;  5KCJ B;  4G68 A;  1UIU A;  1JVY A;  2H4I A;  3D4G A;  1JW4 A;  2V93 A;  2NXO A;  2V3Q A;  2XX9 A;  3K1N A;  3VE1 B;  5J1D A;  1A8E A;  4QSC A;  4RYA A;  4I62 A;  4ONY A;  4NF6 A;  1QKB A;  4WEP A;  1OLC A;  1ZU0 A;  3G3F A;  5TPA B;  2UYF A;  4IY6 A;  4OEU A;  5FTH A;  4NF6 B;  1MQJ A;  2XX8 A;  1FQF A;  1Y1M A;  3BFT A;  1J1N A;  1CB6 A;  4OMB A;  4I9D A;  1DMB A;  4QHQ A;  3PU5 A;  4M4G A;  4YKP A;  3SDF A;  3TYH A;  4NTL A;  3H4Z A;  2VP1 A;  1Q35 A;  4POW A;  3VXC A;  3PMW A;  1OLA A;  2DVZ A;  5BUU A;  4P11 A;  3RUM A;  2DVC A;  1B05 A;  4QFL A;  2P2A A;  4PQJ A;  5CM6 A;  1PBQ A;  4EQB A;  3FJG A;  4BDR A;  3IOW A;  3ILT B;  3ILU B;  1MDQ A;  2XXX A;  2I4C A;  2ONS A;  3G3G A;  4IO5 A;  5AA2 A;  3CRB A;  4BDL A;  1RKM A;  4RA1 A;  3UK4 A;  2A5S A;  2F78 A;  4R6K A;  4F1U A;  5TP9 B;  2F7A A;  3QAX A;  3LSW A;  2CZL A;  3U72 A;  5AA2 B;  1JVX A;  3PV0 E;  4RPO A;  3KEI A;  3LC8 A;  4MLQ A;  3IJO B;  1Y3Q A;  4OHN A;  1P1O A;  2V3T A;  1P1W A;  3RLF E;  4ZED A;  3CVG A;  1ANF A;  3N94 A;  1H45 A;  3C32 A;  4GIZ A;  1MDP 1;  4QSE A;  4FE8 A;  1B32 A;  3TAJ A;  3GLB A;  3E3K A;  4I1D A;  1II5 A;  2XHD A;  3TTL A;  3PUZ E;  1GTK A;  4GLI A;  1FQD A;  4WKM A;  3L6G A;  2F7C A;  1B40 A;  2THI A;  4GXA A;  1URG A;  3C33 A;  2OWS A;  2Q9T A;  4TLL B;  2RIN A;  3N6U A;  3MBP A;  1SI0 A;  4ZEC A;  1IIT A;  2XXI A;  2R71 A;  4NWD A;  4NED A;  4KD5 A;  2ZNU A;  4RXL A;  5LOM A;  2OJT A;  3S9L C;  4OWD A;  4Q30 B;  3ODB A;  3JZJ A;  3M3K A;  4U1O A;  3IOT A;  3MZ1 A;  3MPK A;  2V3U A;  3MC2 A;  2RCA A;  2VOZ A;  1IXH A;  5AA2 D;  2B3F A;  4KI0 E;  1O7T A;  3FVN A;  1AIV A;  5ELV A;  3TCH A;  4FIM A;  3EHS A;  1MXV A;  3R26 A;  4U4X A;  1LGB C;  5FHN A;  3U93 A;  3CG3 A;  2VD3 A;  3FXQ A;  1XVY A;  5CBR A;  3GBA A;  5ICT A;  4RNS A;  3PD9 A;  3TOD A;  4FAJ A;  2FA7 A;  4G4P A;  3ZKL A;  3EF7 A;  1EH3 A;  4YB5 A;  2RKM A;  4H5F A;  4JXI A;  5H8F B;  3TMG A;  4FOR A;  1PB8 A;  2PBW A;  4F3S A;  1IZ1 A;  3SET A;  4UA8 A;  5A5X A;  3K0V A;  2Q2A A;  4JBZ A;  4NE4 A;  4R2F A;  3TTN A;  3MJN A;  3RT8 A;  2AL5 A;  3KSX A;  1S50 A;  4P0I A;  3B6W A;  1SW4 A;  1QUK A;  5I59 A;  2QL3 A;  2HAV A;  1B3F A;  4X48 A;  3G3H A;  1MQD A;  2I3V A;  1UTB B;  3QYT A;  4U4S A;  4F22 A;  1VSO A;  1IEJ A;  2F6P A;  4KQP A;  3QSL A;  5I59 B;  3TTR A;  1NNK A;  3HHG A;  4IO6 A;  3UN6 A;  3OO6 A;  5H8H A;  1UTH B;  2D21 A;  4N13 A;  1YPN A;  1MH3 A;  3K6X A;  4AB5 A;  3WAF A;  3HCQ A;  1DTZ A;  3KN8 A;  3ZSF A;  1IXC A;  5L9M A;  3O97 A;  1LST A;  2Q88 A;  4BDN A;  3PPN A;  3E4R A;  1B1X A;  5CI5 A;  5I56 B;  3KOS A;  1R9Q A;  3G3I A;  1B3E A;  2XX7 A;  4OFO A;  1QW0 A;  3KN3 A;  1JEU A;  3VLV A;  3KN7 A;  4NF4 A;  3DP4 A;  3PUY E;  3FGS A;  3MVZ A;  3VV5 A;  2I0C A;  3SEX A;  2PT2 A;  3M8U A;  2Q2C A;  1LBC A;  4XIG Q;  5ITO A;  3GBB A;  5KDT B;  3LSL A;  3PMX A;  4NF4 B;  5IAI A;  3P7I A;  5H8N B;  2I3W A;  3CFL A;  4QF9 A;  4GL0 A;  3MWB A;  2O7U A;  5I57 A;  2YJP A;  4LZ8 A;  2ANJ A;  3PUV E;  2ZYO A;  3G3K A;  1OVB A;  5CRY A;  3VLU A;  4OES A;  4ELQ A;  4IGT A;  3O6H A;  3RPW A;  3E9X A;  4Q5T A;  2F34 A;  4G8H A;  1HSE A;  3M3F A;  4LVQ A;  3ZS6 A;  3KFM A;  4LZ5 A;  4U22 A;  1YCJ A;  4HCW A;  2QS4 A;  5I2K B;  3TFL A;  1TFA A;  4ZS9 A;  3OD7 A;  3LBS A;  3A3U A;  4EDP A;  3CFZ A;  1B3H A;  1MPD A;  1B5I A;  1N7W A;  2XXU A;  3RQT A;  3FV2 A;  2ZXT A;  2RF1 A;  3RT6 B;  2H5Y A;  1HSJ A;  4K3F A;  4R9G A;  4LQ2 A;  1B2H A;  1SW5 A;  2QSX A;  4P0G A;  4JWX A;  1NH7 A;  1MPB A;  4ZE8 A;  3MZ9 A;  3G7W A;  3HO7 A;  4OET A;  2BJJ X;  2D5W A;  1FTL A;  2RC8 A;  1QVS A;  3K6V A;  1MXY A;  5JK4 A;  1LAH E;  2F35 A;  2DWH A;  3H6U A;  3TEP A;  2X7Q A;  3K01 A;  3FUZ A;  2Y7I A;  1S9T A;  4XTC Q;  1MXW A;  2F97 A;  1SYH A;  3MW0 A;  3FD3 A;  2DSF A;  2YPN A;  2ZYN A;  4JB7 A;  1Y4C A;  3T22 A;  3TPA A;  4HTG A;  5ITP A;  1YAE A;  1SBP A;  2O1L A;  4BDM A;  3VDF A;  2DQV A;  1Z7N E;  5AE4 A;  3O6I A;  3CR9 A;  3CG1 A;  2CMO A;  3S9M C;  2ZMB A;  1USY E;  2XXT A;  2Z8F A;  1B7U A;  3R6U A;  5AA3 A;  4G68 B;  3KGC A;  1IIW A;  3UGW A;  4DCX A;  1FCK A;  1XS5 A;  4OTE A;  4DIG A;  3FZV A;  2F6G A;  3O9P A;  2I48 A;  4PFT A;  1WVJ A;  5TU0 A;  4ESW A;  3RY3 A;  1A55 A;  4R72 A;  1GR2 A;  1YTV A;  1DOT A;  5B70 A;  4ZEB A;  3K00 A;  4Q8R A;  2FYI A;  2AL4 A;  4IY5 A;  3B7D A;  4JDF A;  1ZJL A;  4FED A;  4H67 A;  4KFQ A;  1NNP A;  1SVX B;  5H8Q A;  4F3B A;  4F18 A;  3AXF A;  4F3P A;  1OVT A;  4U23 A;  3FVO A;  1MXZ A;  5K2Y A;  1VE4 A;  1R1N A;  3T9H B;  1M5E A;  4F39 A;  3FVK A;  2HAU A;  2HZL A;  3JYR A;  2UVG A;  3EHU A;  3TTM A;  3KJT A;  2Y7K A;  2HXW A;  3MP6 A;  4MLV A;  2UYE A;  1N7X A;  2X26 A;  2G29 A;  4E0X A;  3RGY A;  1B7H A;  1RYO A;  3KSJ A;  1RYX A;  3R7X A;  3ZKK A;  2QJE A;  3MQ9 A;  1NMU A;  2PYY A;  4LUB A;  4DCY A;  1XHY A;  1LCT A;  2ALU A;  2GH9 A;  3OEK A;  4R73 A;  2I0B A;  3UIF A;  1BTJ A;  2O84 X;  1FQB A;  1MH4 A;  4KR5 A;  3Q28 A;  3U1O A;  4LAT A;  2Y7W A;  4EQ9 A;  1Y9U A;  4POX A;  3IB1 A;  3WAE A;  3DP6 A;  4F3G A;  4FJP A;  1N0T A;  4H5G A;  4EUO A;  3H3G A;  2XXQ A;  4LZ7 A;  1LFG A;  1BP5 A;  4O3B A;  4THI A;  1S7Y A;  3T9V A;  2XD3 A;  4F2O A;  2DS9 A;  3IJX B;  3K4U A;  1OQH A;  1MXU A;  2Z8E A;  3IO4 A;  3VVE A;  3S9E A;  4ELR A;  2XXP A;  4XKR A;  3PMV A;  4KPT A;  1DTG A;  2XD2 A;  5L9S A;  2DOJ A;  1SQY A;  1UQW A;  4ND9 A;  4C1U A;  3RNN A;  4GXS B;  1B46 A;  3MPL A;  2Y7P A;  4PFU A;  3T66 A;  3EN3 A;  3IOR A;  2H25 A;  2I58 A;  2OLB A;  3OEN A;  4OFJ A;  3EPE A;  3QXM A;  4X9T A;  2NOO A;  3OSR A;  4GF8 A;  4C1T A;  3QIM A;  2B65 A;  4EXK A;  1MG1 A;  2Q89 A;  1M5C A;  3SEU A;  3C31 A;  2VHA A;  4AQ4 A;  2Z8D A;  4E0W A;  1SYI A;  4O3C A;  1B0H A;  2OWT A;  1QJM A;  2AIX A;  4U21 A;  1MY1 A;  4F2Q A;  3FJM A;  3RTW B;  1EU8 A;  1N04 A;  1QKA A;  2OBG A;  4YKJ A;  2O51 A;  2XXR A;  2HZK A;  5CMC A;  1MQG A;  1ZKB A;  4X1D A;  1MY2 A;  1B4H A;  1WOD A;  3O2A A;  1Y20 A;  4MF3 A;  2F5X A;  2I4B A;  1A8F A;  3DLN A;  5KZT A;  4YMB A;  3VVF A;  1MM6 A;  1IXI A;  2ZYK A;  1LB9 A;  3BKI B;  4GVO A;  3BBR A;  4BLA A;  5JTY A;  2O7I A;  4PET A;  4LON B;  1SD3 A;  5A5X B;  4HS7 A;  2PT1 A;  4YMA A;  1USY H;  2XXY A;  1D4N A;  3K02 A;  4GL8 A;  2REG A;  5JTY B;  3B6T A;  1DPP A;  4KYD A;  2QS2 A;  4Q0C A;  1FQC A;  2XXH A;  1JET A;  1M5F A;  2E0S A;  4WED A;  4YU0 A;  4C0R A;  4DLD A;  4R9F A;  4KYE A;  1TT1 A;  1A54 A;  3Q27 A;  3V83 A;  1Y1Z A;  4XKN A;  3A09 A;  5FHM A;  5HPQ A;  3HN0 A;  5DEX A;  3MVX A;  1EZO A;  2W7Y A;  4GOT A;  4IO3 A;  3K2D A;  1O63 A;  2ONK E;  4DXC A;  4YIC A;  1JEV A;  3LSX A;  5H8H B;  4OER A;  4NF8 A;  4YKK A;  3SEW A;  2Z22 A;  4DXU A;  2UVH A;  3SER A;  1WDN A;  4ZE9 A;  4H8J A;  1JQF A;  5M2V A;  4GRK A;  4RY1 A;  1BLF A;  2NUV A;  1QUI A;  1ATG A;  5AA4 A;  1A99 A;  3TQL A;  4RK2 A;  3TDJ A;  3TQW A;  2IA4 A;  4NF5 A;  2XXW A;  1B52 A;  3CFX A;  4H1X A;  3BFU A;  2D3I A;  4KYS A;  3LUY A;  4JWY A;  2E1S A;  1NL5 A;  4KHZ E;  5I58 A;  5B7D A;  3OO8 A;  2DE4 A;  3Q29 A;  5EYF A;  3C9H A;  4IB2 A;  3OMB A;  4G8M A;  4ZZE A;  2DE2 A;  1ELJ A;  4Z0I A;  1B5H A;  3MP1 A;  4XKP A;  1TFD A;  2XXV A;  5I58 B;  1N3W A;  4UAC A;  4H6D A;  3KZG A;  2R6G E;  5K2X A;  2RC7 A;  5I57 B;  1DPE A;  3FXU A;  4QRZ A;  4OVJ A;  2HCA A;  4MBP A;  1B58 A;  1CE2 A;  4I8C A;  4LA9 A;  4GQO A;  3HV1 A;  4HCY A;  3PPR A;  4U1Z A;  3IB0 A;  4X1B A;  2A5T A;  3HHF A;  3ECR A;  4ZEK A;  5I2N A;  4MH5 A;  4RPN A;  4IO4 A;  4OXV A;  1R6Z A;  5I2N B;  2F36 A;  5BWJ A;  4MFI A;  2R9J A;  3C34 A;  3MZB A;  4N07 A;  4PFY A;  2ESN A;  1XC1 A;  1ZIU A;  3OEM A;  1P1Q A;  4U2R A;  2DWI A;  3TCG A;  1D9V A;  3L6H A;  3TCF A;  1BKA A;  1DSN A;  4FEB A;  3KBR A;  4IO2 A;  4GD5 A;  1FTO A;  3U8Q A;  3USD A;  3H6T A;  1NKX A;  3SES A;  3FVG A;  3T9X B;  3C36 A;  4YZZ A;  2I49 A;  2DP8 A;  3SEV A;  4JSO A;  2QS3 A;  2DXY A;  2HQ0 A;  4R75 A;  1OMP A;  3VFJ A;  1FW0 A;  1MPC A;  2FNC A;  2P1S A;  4PP0 A;  1MRP A;  3T96 B;  1FTJ A;  3K6U A;  1Y3P A;  1D9Y A;  3K1M A;  4FEC A;  5KCJ A;  1P1U A;  1MS7 A;  4ZDM A;  2YLN A;  3H06 B;  4F31 B;  4WXJ A;  2GFE A;  4G2Z A;  1H3D A;  4ISU A;  4QFN A;  1US5 A;  1B1H A;  2OZZ A;  4F29 A; 
#chains in the Genus database with same CATH topology
 1I6B A;  4QXD A;  4YB7 A;  3MAM A;  1M5D A;  4GFR A;  1OIB A;  3V89 B;  4H65 A;  1KWH A;  1GGG A;  2DDK A;  4PAF A;  5ET5 A;  3FIR A;  5TPA A;  4EXL A;  1B3G A;  1FTA A;  2G93 A;  5ICQ A;  1ZBM A;  3T1B A;  4EQ7 A;  3G3J A;  1L5T A;  1R9L A;  4KCD A;  1P1N A;  5ET7 A;  3W15 C;  1FJ9 A;  1B0L A;  1US4 A;  4G8N A;  5F1Q A;  2ZYM A;  4F1Y A;  3GZG A;  1N76 A;  3TEL A;  4JWO A;  4IO7 A;  2QVU A;  4HW8 A;  4NGU A;  1PB9 A;  2ZNT A;  1DBZ A;  3Q26 A;  3MYU A;  1IMD A;  5DVF A;  1H44 A;  1IXG A;  2O6A A;  2QRY A;  2NVU B;  4YKI A;  3FXB A;  4OFL A;  4N6P A;  3FAT A;  1MXX A;  3O66 A;  5H8Q B;  4PBH A;  3SKP A;  4P3L A;  3UP9 A;  5EQ8 A;  2GHA A;  4P8B A;  3QK6 A;  4H8I A;  3K6W A;  4G61 A;  1INP A;  4ECF A;  1LFH A;  1VFD A;  2ONR A;  3IAZ A;  5TP9 A;  1URD A;  4MHF A;  3F11 A;  1Q1K A;  4DE8 A;  1B5J A;  5CMK A;  3VVD A;  1FPJ A;  4HXV A;  1K9Y A;  1ZTY A;  1UIV A;  4OQO A;  4N4U A;  5F7V A;  5CMM A;  3GXA A;  3OO9 A;  1EYI A;  3EQ1 A;  1FPL A;  2F3B A;  2O1M A;  2V25 A;  4M1V A;  1NV4 A;  1A7L A;  3V8X B;  4QFO A;  3VLW A;  3IO6 A;  1NV0 A;  2V84 A;  1QUL A;  1TXF A;  3TKD A;  4GWO A;  1FTM A;  2VD2 A;  2CZH A;  2DXR A;  3N26 A;  5I5P A;  1URS A;  3PD8 A;  2LAO A;  3CSG A;  1AOV A;  5EHS A;  2RCB A;  4DXB A;  4DZ1 A;  4MNC A;  1XT8 A;  1SW1 A;  1LFI A;  1XOC A;  3CI8 A;  3H6W A;  3CHG A;  3A3C A;  1POY 1;  3QUF A;  4OEN A;  1LAX A;  4Z7E A;  1OQG A;  3CSB A;  1I69 A;  4RK9 A;  4PE5 B;  1NH8 A;  4MCO A;  3SEY A;  4MNI A;  3T9U A;  2UXA A;  1JW5 A;  3GYY A;  5FTI A;  4OZ9 A;  4G68 C;  1F9B A;  1I6Q A;  2Y7R A;  3OO7 A;  3THI A;  1T0K A;  2P3N A;  1NUW A;  3FAS A;  2B3B A;  3IB2 A;  1HSL A;  5L8D A;  4YB6 A;  1BK4 A;  3IK6 B;  3Q25 A;  3B6Q A;  5CBS A;  5FHO A;  4ELP A;  4XKQ A;  2DWJ A;  4H0W A;  5IKB A;  3IOV A;  1A40 A;  2KLF A;  4NQ8 A;  4PFW A;  5DT6 A;  4OVS A;  2H99 A;  2RC9 A;  2PFZ A;  1MM7 A;  2HEU A;  3DP8 A;  2DE3 A;  4ZEF A;  3MUQ A;  4ELO A;  4EF1 A;  2O68 A;  2Y84 A;  3FXR A;  2XWI A;  1MY4 A;  4LQ5 A;  3KG2 A;  3PPO A;  1VR5 A;  4OYV A;  4LP2 B;  2QMW A;  1LLS A;  3LR1 A;  4N17 A;  1B9J A;  2H98 A;  2Q8J A;  3RTF B;  1NFT A;  1B51 A;  3N5L A;  2GQ1 A;  3K1P A;  5EHM A;  3TUS A;  3HFU A;  4IR8 A;  2OCU A;  4LN5 A;  1LAF E;  1JW1 A;  5DYH A;  1NNF A;  2HFB A;  5HM4 B;  3CIJ A;  1PBP A;  4NG7 A;  3OOA A;  4OVQ A;  5H8F A;  1POT A;  3U94 A;  2AYS A;  2QVV A;  2GHB A;  3QMF A;  3E78 A;  1FJ6 A;  2O69 A;  2HPG A;  2QMX A;  5L9O A;  1SDX A;  3MP8 A;  1PB7 A;  5HBC A;  3DM0 A;  1ZLQ A;  2FIX A;  2QS1 A;  1B3L A;  4X04 A;  2P0S A;  1FQA A;  1B6H A;  1NV3 A;  2QFL A;  4O7M A;  3SZP A;  2XXK A;  3PGF A;  2ZNS A;  5JEI A;  4QFK A;  1GVC A;  1M5B A;  4G77 A;  1FQE A;  1FTK A;  1RDY A;  3OEL A;  1QUJ A;  2ZZW A;  3KOT A;  2DYX A;  2GRV A;  3D4C A;  2ZZV A;  2PMS A;  1PDA A;  2CZI A;  1UTB A;  4XXU A;  1N3X A;  5ET6 A;  3PPQ A;  4R6Y A;  1BIY A;  3S9N C;  1AH5 A;  3FJ7 A;  1IUD A;  1Y3N A;  4ZEI A;  3IX1 A;  3I3V A;  2X7P A;  4MIJ A;  3TTK A;  3W9V A;  1UTH A;  1JNF A;  1N84 A;  3PPP A;  1LB8 A;  5DEX B;  4AS4 A;  2H9B A;  3W9W A;  3C4M A;  1FBG A;  2WKY A;  3IOU A;  4KCC A;  5CMB A;  4TOZ A;  2OK2 A;  4NWC A;  1NNT A;  5H8S A;  4NF8 B;  1B7Z A;  5I56 A;  4N81 A;  2PFY A;  3KC1 A;  3S2V A;  4ESX A;  1SI1 A;  1LBB A;  3OSQ A;  4EF2 A;  4R74 A;  3U92 A;  2Z23 A;  1LAG E;  4FBP A;  3UOR A;  2VGQ A;  4P56 A;  1XVX A;  1XI6 A;  3HPI A;  1VFE A;  3ONM A;  4MAG A;  5IZZ A;  5AA4 B;  5KDT A;  3UA8 A;  1GV8 A;  4ZZA A;  2FBP A;  4OEV A;  4NF5 B;  4F19 A;  2UVJ A;  3O6G A;  3PUX E;  4PFR A;  1G0I A;  5H8N A;  3E13 X;  4AB6 A;  1EZP A;  4TQU Q;  4OVP A;  1PC3 A;  1MQI A;  3I6V A;  5T3J A;  4RJZ A;  3IL1 B;  3O29 A;  2PVU A;  2I6E A;  1Z7M E;  4L17 A;  4JSD A;  3RN8 A;  2IEE A;  3H7M A;  4R6H A;  4O3A A;  1D3K A;  3FV1 A;  4BDQ A;  3C35 A;  5EYH A;  2F8D A;  5I2K A;  3QUJ A;  5DTB A;  3TZA A;  2DWA A;  1MY3 A;  1H43 A;  1Y4T A;  1NV5 A;  2PX1 A;  2A5T B;  3I5O A;  4NN3 A;  3HST A;  3JV9 A;  4DDD A;  3LSF B;  5I84 A;  4P1L A;  3MVY A;  1P99 A;  1AMF A;  4O94 A;  2P3V A;  2B4M A;  3N6T A;  5IZ3 A;  4IGR A;  4YAH X;  5DVI A;  2VPO A;  2QPQ A;  2Y5K A;  4BDO A;  3V5A A;  1I6A A;  5DW8 A;  5DVJ A;  3OXN A;  1DCU A;  5IZ3 B;  2F7B A;  2M8C A;  1SW2 A;  5LDZ A;  3S4U A;  1VDW A;  3U65 A;  2ABH A;  1LCF A;  3IR1 A;  4R2B A;  1MQH A;  1EZ9 A;  2UVI A;  1KA1 A;  4OAN A;  5AA1 A;  1H76 A;  3VXB A;  1AL3 A;  3EHT A;  3KJ7 A;  1IQ7 A;  5CC2 A;  2CZK A;  1PEB A;  4JVD A;  2REJ A;  4N8Y A;  3O28 A;  3H6V A;  1TWY A;  3PUW E;  4FAT A;  1FPG A;  1MY0 A;  4QSD A;  3M3L A;  1B4Z A;  3DEL B;  1ZMG A;  4F1V A;  2NWJ A;  4QFP A;  4NMY A;  4TLM B;  3T93 B;  1O64 A;  2XWK A;  3H03 A;  4MNP A;  5ISU A;  3MVW A;  5KCJ B;  4G68 A;  1UIU A;  1JVY A;  2H4I A;  3D4G A;  1JW4 A;  4PTK A;  2V93 A;  2NXO A;  2V3Q A;  2XX9 A;  3K1N A;  1AWB A;  3VE1 B;  5J1D A;  1A8E A;  1KZ8 A;  4QSC A;  4RYA A;  4I62 A;  4PDD A;  4ONY A;  4NF6 A;  1QKB A;  2HXR A;  4WEP A;  4AS5 A;  1OLC A;  1ZU0 A;  3G3F A;  5TPA B;  2UYF A;  4IY6 A;  4OEU A;  5FTH A;  4NF6 B;  1MQJ A;  2XX8 A;  2BJI A;  1FQF A;  1Y1M A;  3BFT A;  1J1N A;  1CB6 A;  4OMB A;  4HE0 A;  4I9D A;  1DMB A;  1NUY A;  4QHQ A;  3PU5 A;  4M4G A;  3KC0 A;  4YKP A;  3SDF A;  3TYH A;  4NTL A;  3H4Z A;  2VP1 A;  1Q35 A;  2XA5 A;  4POW A;  3VXC A;  3PMW A;  1OLA A;  2DVZ A;  5BUU A;  4P11 A;  3RUM A;  2DVC A;  1B05 A;  4QFL A;  2P2A A;  4PQJ A;  5CM6 A;  1PBQ A;  4EQB A;  3FJG A;  4BDR A;  3IOW A;  3ILT B;  3ILU B;  4HE2 A;  1MDQ A;  2XXX A;  2I4C A;  4PF6 A;  2ONS A;  3G3G A;  3NOH A;  4IO5 A;  5AA2 A;  3CRB A;  4BDL A;  1RKM A;  4JVI A;  4RA1 A;  3B50 A;  3UK4 A;  2A5S A;  2F78 A;  4R6K A;  4F1U A;  5TP9 B;  2F7A A;  3QAX A;  4PFI A;  4UAB A;  3LSW A;  2CZL A;  3U72 A;  5AA2 B;  1JVX A;  3PV0 E;  4RPO A;  3KEI A;  4N6K A;  3LC8 A;  4MLQ A;  3IJO B;  1Y3Q A;  4OHN A;  1P1O A;  2V3T A;  1P1W A;  3RLF E;  4ZED A;  3CVG A;  1LBV A;  1ANF A;  3B8B A;  3N94 A;  1H45 A;  3C32 A;  4GIZ A;  1FPK A;  3E79 A;  2KR0 A;  1MDP 1;  4QSE A;  4FE8 A;  1B32 A;  1YYZ A;  5F24 A;  3TAJ A;  3GLB A;  3E3K A;  4I1D A;  1II5 A;  2XHD A;  3TTL A;  3PUZ E;  1GTK A;  4GLI A;  2CEX A;  1FQD A;  4WKM A;  1IME A;  3L6G A;  4GWZ A;  2F7C A;  1B40 A;  2THI A;  4GXA A;  4I3Y A;  1URG A;  3C33 A;  2OWS A;  2F3D A;  2Q9T A;  4TLL B;  2RIN A;  3N6U A;  3MBP A;  1SI0 A;  4GX4 A;  4ZEC A;  1IIT A;  2FHY A;  2XXI A;  2R71 A;  4NWD A;  4NED A;  4KD5 A;  2ZNU A;  4RXL A;  5LOM A;  2OJT A;  3S9L C;  4OWD A;  4Q30 B;  3ODB A;  3JZJ A;  3M3K A;  4U1O A;  3IOT A;  3MZ1 A;  1NI9 A;  3MPK A;  5I3S A;  2V3U A;  4XEQ A;  3MC2 A;  1CNQ A;  2RCA A;  2VOZ A;  1IXH A;  4PGN A;  5AA2 D;  2B3F A;  4KI0 E;  1FBE A;  1O7T A;  2XWV A;  4H46 A;  3FVN A;  1AIV A;  5ELV A;  3TCH A;  4FIM A;  3EHS A;  1MXV A;  3R26 A;  4U4X A;  1LGB C;  4PC9 A;  5FHN A;  3U93 A;  3CG3 A;  1FBD A;  2VD3 A;  3FXQ A;  1XVY A;  5A5L A;  5CBR A;  3GBA A;  5ICT A;  4RNS A;  3PD9 A;  3TOD A;  4FAJ A;  2FA7 A;  4G4P A;  4I3E A;  3ZKL A;  3EF7 A;  1EH3 A;  4YB5 A;  2RKM A;  4H5F A;  4JXI A;  4OVR A;  5H8F B;  2VPN A;  2PCR A;  3TMG A;  5J16 A;  2HHM A;  4FOR A;  1PB8 A;  2PBW A;  4F3S A;  1RDX A;  1IZ1 A;  4O7I A;  3SET A;  4UA8 A;  2WEF A;  3K0V A;  5A5X A;  2Q2A A;  4JBZ A;  4NE4 A;  4R2F A;  3TTN A;  3MJN A;  3RT8 A;  2AL5 A;  3KSX A;  1KA0 A;  3RPL A;  1S50 A;  4P0I A;  4MMP A;  1IMF A;  3B6W A;  1SW4 A;  1QUK A;  5I59 A;  2QL3 A;  2HAV A;  3LUZ A;  3KBZ A;  4MEV A;  1B3F A;  4X48 A;  3G3H A;  1MQD A;  3FBP A;  5IZ1 A;  2I3V A;  1UTB B;  3QYT A;  4U4S A;  4F22 A;  1VSO A;  1IEJ A;  2F6P A;  4KQP A;  3MST A;  3QSL A;  5I59 B;  4NAP A;  3TTR A;  5ESY A;  1NNK A;  3HHG A;  4IO6 A;  4OA4 A;  5EQ7 A;  3UN6 A;  3OO6 A;  5H8H A;  1UTH B;  2D21 A;  4N13 A;  1YPN A;  1MH3 A;  3K6X A;  5EYG A;  4AB5 A;  3WAF A;  1FBC A;  2WYK A;  3HCQ A;  1DTZ A;  3KN8 A;  3ZSF A;  1IXC A;  5L9M A;  3O97 A;  1LST A;  1NV6 A;  2Q88 A;  4DI3 D;  4BDN A;  3PPN A;  3E4R A;  1B1X A;  2V4C A;  5CI5 A;  5I56 B;  3KOS A;  1R9Q A;  3G3I A;  2WBB A;  1B3E A;  2XX7 A;  4OFO A;  1QW0 A;  3KN3 A;  1JEU A;  3VLV A;  5I7I A;  3KN7 A;  3T0J A;  4NF4 A;  3DP4 A;  3PUY E;  3FGS A;  3MVZ A;  3VV5 A;  5IGA A;  2I0C A;  3SEX A;  2PT2 A;  3M8U A;  2Q2C A;  1LBC A;  4XIG Q;  5ITO A;  3GBB A;  5KDT B;  3LSL A;  3PMX A;  4NF4 B;  5IAI A;  3P7I A;  5H8N B;  4N8G A;  2I3W A;  3CFL A;  4QF9 A;  4GL0 A;  3MWB A;  2O7U A;  1JP4 A;  5I57 A;  2YJP A;  4LZ8 A;  2Q8M A;  2ANJ A;  3PUV E;  2ZYO A;  3G3K A;  1OVB A;  5CRY A;  3VLU A;  4OES A;  4ELQ A;  4IGT A;  2FVZ A;  3O6H A;  3RPW A;  3E9X A;  4Q5T A;  2F34 A;  4G8H A;  1HSE A;  3BIH A;  3M3F A;  4LVQ A;  3ZS6 A;  3KFM A;  4LZ5 A;  4U22 A;  1YCJ A;  4HCW A;  4N91 A;  2QS4 A;  1Q9D A;  5I2K B;  3TFL A;  1TFA A;  4ZS9 A;  3OD7 A;  3LBS A;  3A3U A;  4EDP A;  3CFZ A;  1B3H A;  4MX6 A;  1MPD A;  1B5I A;  1N7W A;  2XXU A;  3RQT A;  3FV2 A;  2ZXT A;  2RF1 A;  3RT6 B;  2H5Y A;  1HSJ A;  4K3F A;  4R9G A;  4LQ2 A;  1B2H A;  1SW5 A;  2QSX A;  4P0G A;  4JWX A;  2L5V A;  1NH7 A;  1MPB A;  4ZE8 A;  3MZ9 A;  3G7W A;  3HO7 A;  4OET A;  2BJJ X;  1NV2 A;  2D5W A;  1FTL A;  2RC8 A;  2Q74 A;  1QVS A;  3K6V A;  1MXY A;  2QVR A;  4P1E A;  5JK4 A;  1LAH E;  2F35 A;  2JJK A;  2DWH A;  3H6U A;  3TEP A;  2X7Q A;  3K01 A;  3FUZ A;  2Y7I A;  1S9T A;  4XTC Q;  1MXW A;  2F97 A;  1SYH A;  3MW0 A;  3FD3 A;  5FBP A;  2DSF A;  2YPN A;  2ZYN A;  4JB7 A;  1Y4C A;  4OVT A;  3T22 A;  3TPA A;  2Y5L A;  4HTG A;  5ITP A;  1YAE A;  1SBP A;  2O1L A;  4BDM A;  3VDF A;  2DQV A;  1Z7N E;  5AE4 A;  3O6I A;  3CR9 A;  3CG1 A;  2CMO A;  3S9M C;  2ZMB A;  1USY E;  2XXT A;  2Z8F A;  1B7U A;  3R6U A;  5AA3 A;  4G68 B;  3KGC A;  1K9Z A;  1IIW A;  3UGW A;  4DCX A;  1FCK A;  1XS5 A;  4OTE A;  4DIG A;  3FZV A;  2F6G A;  3O9P A;  2I48 A;  4PFT A;  1WVJ A;  5TU0 A;  4ESW A;  3RY3 A;  1A55 A;  4R72 A;  1GR2 A;  2MKZ A;  1FPF A;  1YTV A;  1DOT A;  5B70 A;  4ZEB A;  3K00 A;  4Q8R A;  2FYI A;  2AL4 A;  4IY5 A;  1LBZ A;  3B7D A;  4JDF A;  1ZJL A;  4XFE A;  4FED A;  4H67 A;  4KFQ A;  1NNP A;  1SVX B;  1FSA A;  5H8Q A;  4F3B A;  4F18 A;  3AXF A;  3EKI A;  4F3P A;  4GX3 A;  1OVT A;  4U23 A;  2WBD A;  1MXZ A;  3FVO A;  5K2Y A;  4N15 A;  1VE4 A;  4HE1 A;  1R1N A;  3T9H B;  1M5E A;  4F39 A;  3FVK A;  2HAU A;  2HZL A;  3JYR A;  2UVG A;  3EHU A;  3TTM A;  1IMB A;  3IFC A;  3KJT A;  4P9K A;  2Y7K A;  2HXW A;  3MP6 A;  1EYK A;  4MLV A;  2UYE A;  1N7X A;  5ET8 A;  2X26 A;  2G29 A;  4E0X A;  3RGY A;  1B7H A;  1RYO A;  3KSJ A;  1RYX A;  1FBH A;  3R7X A;  3ZKK A;  2QJE A;  3BIG A;  1G0H A;  3MQ9 A;  1NMU A;  2PYY A;  4LUB A;  4DCY A;  1XHY A;  1LCT A;  2ALU A;  2GH9 A;  1IMA A;  3OEK A;  4R73 A;  2I0B A;  3UIF A;  1BTJ A;  2O84 X;  5LTC A;  1FQB A;  1MH4 A;  4KR5 A;  3Q28 A;  4GWS A;  1FPB A;  3U1O A;  4LAT A;  2Y7W A;  4EQ9 A;  1Y9U A;  4POX A;  3IB1 A;  3WAE A;  3DP6 A;  4PAK A;  3ROJ A;  4F3G A;  4FJP A;  1N0T A;  4H5G A;  4EUO A;  3H3G A;  2XXQ A;  4LZ7 A;  1LFG A;  1BP5 A;  4O3B A;  1EYJ A;  1FPD A;  4THI A;  1S7Y A;  3T9V A;  2XD3 A;  4F2O A;  2DS9 A;  3IJX B;  3K4U A;  1OQH A;  1MXU A;  2WX9 A;  2Z8E A;  3IO4 A;  3VVE A;  3S9E A;  4ELR A;  2XXP A;  1FPI A;  4XKR A;  2B4L A;  3PMV A;  4GWX A;  4KPT A;  1DTG A;  2XD2 A;  5L9S A;  2DOJ A;  1NUX A;  1SQY A;  1UQW A;  4ND9 A;  4QBA A;  4C1U A;  1FBP A;  3RNN A;  4GXS B;  1B46 A;  3MPL A;  2Y7P A;  4PFU A;  3T66 A;  3EN3 A;  3IOR A;  1FPE A;  2H25 A;  2I58 A;  2OLB A;  3OEN A;  3EPE A;  3PTY A;  4OFJ A;  3QXM A;  4X9T A;  2NOO A;  3OSR A;  4GF8 A;  3D1R A;  4C1T A;  3QIM A;  2B65 A;  4EXK A;  1MG1 A;  2Q89 A;  1M5C A;  3SEU A;  3C31 A;  2VHA A;  4AQ4 A;  2Z8D A;  4E0W A;  1SYI A;  2WYP A;  4O3C A;  1B0H A;  2OWT A;  4P47 A;  1QJM A;  2AIX A;  4PDH A;  1LBW A;  4U21 A;  4MJO A;  4PF8 A;  1MY1 A;  2VT5 A;  4F2Q A;  2XWO A;  3FJM A;  3RTW B;  1EU8 A;  1N04 A;  1QKA A;  2OBG A;  4YKJ A;  4GWU A;  4PE3 A;  2O51 A;  2XXR A;  2HZK A;  5CMC A;  1MQG A;  1ZKB A;  4X1D A;  1MY2 A;  1B4H A;  1WOD A;  3O2A A;  1Y20 A;  4MF3 A;  2F5X A;  2I4B A;  1A8F A;  3DLN A;  5KZT A;  4YMB A;  3VVF A;  4PCD A;  1MM6 A;  4GWY A;  1IXI A;  4JVC A;  2ZYK A;  1LB9 A;  3BKI B;  4GVO A;  3BBR A;  4BLA A;  5JTY A;  2O7I A;  1FBF A;  2KQZ A;  4GBW A;  4PET A;  4LON B;  1SD3 A;  5A5X B;  4HS7 A;  4XF5 A;  2PT1 A;  4YMA A;  1USY H;  2R8T A;  2XXY A;  1SPI A;  1D4N A;  3K02 A;  4GL8 A;  2REG A;  5JTY B;  3B6T A;  1DPP A;  4KYD A;  2QS2 A;  1D9Q A;  3RPL B;  4Q0C A;  1FQC A;  2XXH A;  5IM2 A;  1JET A;  1M5F A;  2E0S A;  4WED A;  1FRP A;  4YU0 A;  4C0R A;  4PBQ A;  4DLD A;  4R9F A;  4KYE A;  1TT1 A;  1A54 A;  1YZ0 A;  3Q27 A;  3V83 A;  1Y1Z A;  4XKN A;  1LBX A;  3A09 A;  5FHM A;  5HPQ A;  3HN0 A;  5DEX A;  4GBV A;  3MVX A;  1EZO A;  2W7Y A;  4PFB A;  4GOT A;  5EQA A;  4IO3 A;  3K2D A;  3ISP A;  1O63 A;  2ONK E;  4DXC A;  4YIC A;  3RYD A;  2FIE A;  1JEV A;  3LSX A;  5H8H B;  4OER A;  4NF8 A;  4YKK A;  4GWW A;  3SEW A;  2Z22 A;  4DXU A;  2UVH A;  3SER A;  1WDN A;  4ZE9 A;  4H8J A;  1JQF A;  3IFA A;  5M2V A;  4GRK A;  4RY1 A;  1BLF A;  4NF0 A;  1NV7 A;  2NUV A;  1QUI A;  3A29 A;  1ATG A;  1NUZ A;  5AA4 A;  1A99 A;  3TQL A;  4RK2 A;  3TDJ A;  3TQW A;  2IA4 A;  4NF5 A;  2XXW A;  1B52 A;  3CFX A;  4H1X A;  1DK4 A;  3BFU A;  2D3I A;  4KYS A;  3LUY A;  4JWY A;  2E1S A;  1NL5 A;  4KHZ E;  4PGP A;  4I40 A;  5I58 A;  5B7D A;  3OO8 A;  2DE4 A;  3Q29 A;  5EYF A;  3C9H A;  4IB2 A;  3OMB A;  4G8M A;  1YXI A;  4ZZE A;  2DE2 A;  1ELJ A;  4Z0I A;  1B5H A;  3MP1 A;  4XKP A;  1TFD A;  2XXV A;  5I58 B;  1N3W A;  4UAC A;  4H6D A;  3KZG A;  2R6G E;  5K2X A;  2RC7 A;  5I57 B;  1DPE A;  3FXU A;  4QRZ A;  4OVJ A;  2HCA A;  2OWZ A;  4MBP A;  1B58 A;  1CE2 A;  4I8C A;  4LA9 A;  4GQO A;  3HV1 A;  4HCY A;  5EQ9 A;  3PPR A;  4U1Z A;  3IB0 A;  4X1B A;  2A5T A;  4NX1 A;  3HHF A;  3ECR A;  4ZEK A;  5I2N A;  4MH5 A;  1LEV A;  4RPN A;  4IO4 A;  4N6D A;  4OXV A;  2OX3 A;  4H45 A;  1R6Z A;  5I2N B;  2F36 A;  1IMC A;  5BWJ A;  4MFI A;  2R9J A;  3C34 A;  3MZB A;  4N07 A;  4PFY A;  2ESN A;  4O8M A;  1XC1 A;  1ZIU A;  3OEM A;  1P1Q A;  4U2R A;  2DWI A;  3TCG A;  1D9V A;  3L6H A;  3TCF A;  1BKA A;  1DSN A;  4FEB A;  1RDZ A;  4DI4 B;  3KBR A;  4IO2 A;  4GD5 A;  1FTO A;  3U8Q A;  3USD A;  3H6T A;  1NKX A;  3SES A;  3FVG A;  3T9X B;  1LBY A;  3C36 A;  4YZZ A;  2I49 A;  2DP8 A;  3SEV A;  4JSO A;  4GX6 A;  2QS3 A;  4NHB A;  2DXY A;  1QGX A;  2HQ0 A;  4R75 A;  1OMP A;  3VFJ A;  1FW0 A;  1NV1 A;  1MPC A;  2FNC A;  2CEY A;  2P1S A;  4PP0 A;  1MRP A;  3T96 B;  1FTJ A;  3K6U A;  1Y3P A;  1D9Y A;  3K1M A;  4FEC A;  5KCJ A;  1P1U A;  1MS7 A;  4ZDM A;  2YLN A;  3H06 B;  4F31 B;  4X8R A;  4KXP A;  4WXJ A;  2GFE A;  4PAI A;  4G2Z A;  1H3D A;  4ISU A;  4QFN A;  1US5 A;  1B1H A;  2ZZX A;  3LV0 A;  2OZZ A;  4F29 A; 
#chains in the Genus database with same CATH homology
 1I6B A;  4YB7 A;  3MAM A;  1M5D A;  4GFR A;  1OIB A;  3V89 B;  4H65 A;  1KWH A;  1GGG A;  3FIR A;  5TPA A;  4EXL A;  1B3G A;  2G93 A;  5ICQ A;  1ZBM A;  4EQ7 A;  3G3J A;  1L5T A;  1R9L A;  4KCD A;  1P1N A;  3W15 C;  1B0L A;  1US4 A;  4G8N A;  5F1Q A;  2ZYM A;  4F1Y A;  3GZG A;  1N76 A;  3TEL A;  4JWO A;  4IO7 A;  4HW8 A;  1PB9 A;  2ZNT A;  3Q26 A;  5DVF A;  1H44 A;  1IXG A;  2O6A A;  2QRY A;  2NVU B;  4YKI A;  4OFL A;  4N6P A;  3FAT A;  1MXX A;  3O66 A;  5H8Q B;  3SKP A;  3UP9 A;  2GHA A;  3QK6 A;  4H8I A;  3K6W A;  4ECF A;  1LFH A;  1VFD A;  2ONR A;  3IAZ A;  5TP9 A;  1URD A;  3F11 A;  1Q1K A;  4DE8 A;  1B5J A;  5CMK A;  3VVD A;  1ZTY A;  1UIV A;  4OQO A;  5F7V A;  5CMM A;  3GXA A;  3OO9 A;  3EQ1 A;  2O1M A;  2V25 A;  4M1V A;  1A7L A;  3V8X B;  4QFO A;  3VLW A;  3IO6 A;  2V84 A;  1QUL A;  1TXF A;  3TKD A;  4GWO A;  1FTM A;  2VD2 A;  2DXR A;  3N26 A;  1URS A;  3PD8 A;  2LAO A;  3CSG A;  1AOV A;  5EHS A;  2RCB A;  4DXB A;  4DZ1 A;  1XT8 A;  1SW1 A;  1LFI A;  1XOC A;  3CI8 A;  3H6W A;  3A3C A;  1POY 1;  3QUF A;  4OEN A;  1LAX A;  4Z7E A;  1OQG A;  3CSB A;  1I69 A;  4RK9 A;  4PE5 B;  1NH8 A;  3SEY A;  3T9U A;  2UXA A;  1JW5 A;  5FTI A;  4OZ9 A;  4G68 C;  1F9B A;  1I6Q A;  2Y7R A;  3OO7 A;  3THI A;  1T0K A;  3FAS A;  2B3B A;  3IB2 A;  1HSL A;  5L8D A;  4YB6 A;  3IK6 B;  3Q25 A;  3B6Q A;  5CBS A;  5FHO A;  4ELP A;  4XKQ A;  2DWJ A;  4H0W A;  5IKB A;  3IOV A;  1A40 A;  2KLF A;  4PFW A;  5DT6 A;  2H99 A;  2RC9 A;  1MM7 A;  2HEU A;  3DP8 A;  2DE3 A;  4ZEF A;  3MUQ A;  4ELO A;  4EF1 A;  2O68 A;  2Y84 A;  3FXR A;  1MY4 A;  4LQ5 A;  3KG2 A;  3PPO A;  1VR5 A;  4OYV A;  4LP2 B;  2QMW A;  1LLS A;  3LR1 A;  1B9J A;  2H98 A;  2Q8J A;  3RTF B;  1NFT A;  1B51 A;  3N5L A;  3K1P A;  5EHM A;  3TUS A;  2OCU A;  1LAF E;  1JW1 A;  5DYH A;  1NNF A;  2HFB A;  5HM4 B;  3CIJ A;  1PBP A;  3OOA A;  5H8F A;  1POT A;  3U94 A;  2AYS A;  2GHB A;  2O69 A;  2QMX A;  5L9O A;  1SDX A;  3MP8 A;  1PB7 A;  5HBC A;  3DM0 A;  1ZLQ A;  2QS1 A;  1B3L A;  2P0S A;  1FQA A;  1B6H A;  3PGF A;  2ZNS A;  5JEI A;  4QFK A;  1GVC A;  1M5B A;  4G77 A;  1FQE A;  1FTK A;  3OEL A;  1QUJ A;  3KOT A;  2DYX A;  2GRV A;  3D4C A;  2PMS A;  1PDA A;  1UTB A;  4XXU A;  1N3X A;  3PPQ A;  4R6Y A;  1BIY A;  3S9N C;  1AH5 A;  3FJ7 A;  1IUD A;  1Y3N A;  4ZEI A;  3IX1 A;  3I3V A;  2X7P A;  3TTK A;  3W9V A;  1UTH A;  1JNF A;  1N84 A;  3PPP A;  1LB8 A;  5DEX B;  2H9B A;  3W9W A;  3C4M A;  2WKY A;  3IOU A;  4KCC A;  5CMB A;  4TOZ A;  2OK2 A;  4NWC A;  1NNT A;  5H8S A;  4NF8 B;  1B7Z A;  5I56 A;  3S2V A;  4ESX A;  1SI1 A;  1LBB A;  3OSQ A;  4EF2 A;  4R74 A;  3U92 A;  2Z23 A;  1LAG E;  3UOR A;  2VGQ A;  1XVX A;  3HPI A;  1VFE A;  3ONM A;  5AA4 B;  5KDT A;  3UA8 A;  1GV8 A;  4ZZA A;  4OEV A;  4NF5 B;  4F19 A;  2UVJ A;  3O6G A;  3PUX E;  5H8N A;  3E13 X;  4AB6 A;  1EZP A;  4TQU Q;  1PC3 A;  1MQI A;  3I6V A;  4RJZ A;  3IL1 B;  3O29 A;  2PVU A;  2I6E A;  1Z7M E;  4L17 A;  4JSD A;  3RN8 A;  2IEE A;  3H7M A;  4R6H A;  4O3A A;  1D3K A;  3FV1 A;  4BDQ A;  3C35 A;  2F8D A;  5I2K A;  3QUJ A;  5DTB A;  3TZA A;  2DWA A;  1MY3 A;  1H43 A;  1Y4T A;  2PX1 A;  2A5T B;  3I5O A;  3HST A;  3JV9 A;  4DDD A;  3LSF B;  5I84 A;  3MVY A;  1P99 A;  1AMF A;  3N6T A;  4IGR A;  4YAH X;  5DVI A;  2QPQ A;  4BDO A;  3V5A A;  1I6A A;  5DVJ A;  3OXN A;  2F7B A;  2M8C A;  1SW2 A;  3S4U A;  2ABH A;  1LCF A;  3IR1 A;  4R2B A;  1MQH A;  1EZ9 A;  2UVI A;  5AA1 A;  1H76 A;  3VXB A;  1AL3 A;  3EHT A;  3KJ7 A;  1IQ7 A;  5CC2 A;  1PEB A;  2REJ A;  3O28 A;  3H6V A;  1TWY A;  3PUW E;  4FAT A;  1MY0 A;  4QSD A;  3M3L A;  1B4Z A;  3DEL B;  1ZMG A;  4F1V A;  2NWJ A;  4QFP A;  4NMY A;  3T93 B;  4TLM B;  1O64 A;  3H03 A;  5ISU A;  3MVW A;  5KCJ B;  4G68 A;  1UIU A;  1JVY A;  2H4I A;  3D4G A;  1JW4 A;  2V93 A;  2NXO A;  2V3Q A;  2XX9 A;  3K1N A;  3VE1 B;  5J1D A;  1A8E A;  4QSC A;  4RYA A;  4I62 A;  4ONY A;  4NF6 A;  1QKB A;  4WEP A;  1OLC A;  1ZU0 A;  3G3F A;  5TPA B;  2UYF A;  4IY6 A;  4OEU A;  5FTH A;  4NF6 B;  1MQJ A;  2XX8 A;  1FQF A;  1Y1M A;  3BFT A;  1J1N A;  1CB6 A;  4OMB A;  4I9D A;  1DMB A;  4QHQ A;  3PU5 A;  4M4G A;  4YKP A;  3SDF A;  3TYH A;  4NTL A;  3H4Z A;  2VP1 A;  1Q35 A;  4POW A;  3VXC A;  3PMW A;  1OLA A;  2DVZ A;  5BUU A;  4P11 A;  3RUM A;  2DVC A;  1B05 A;  4QFL A;  2P2A A;  4PQJ A;  5CM6 A;  1PBQ A;  4EQB A;  3FJG A;  4BDR A;  3IOW A;  3ILT B;  3ILU B;  1MDQ A;  2XXX A;  2I4C A;  2ONS A;  3G3G A;  4IO5 A;  5AA2 A;  3CRB A;  4BDL A;  1RKM A;  4RA1 A;  3UK4 A;  2A5S A;  2F78 A;  4R6K A;  4F1U A;  5TP9 B;  2F7A A;  3QAX A;  3LSW A;  2CZL A;  3U72 A;  5AA2 B;  1JVX A;  3PV0 E;  4RPO A;  3KEI A;  3LC8 A;  4MLQ A;  3IJO B;  1Y3Q A;  4OHN A;  1P1O A;  2V3T A;  1P1W A;  3RLF E;  4ZED A;  3CVG A;  1ANF A;  3N94 A;  1H45 A;  3C32 A;  4GIZ A;  1MDP 1;  4QSE A;  4FE8 A;  1B32 A;  3TAJ A;  3GLB A;  3E3K A;  4I1D A;  1II5 A;  2XHD A;  3TTL A;  3PUZ E;  1GTK A;  4GLI A;  1FQD A;  4WKM A;  3L6G A;  2F7C A;  1B40 A;  2THI A;  4GXA A;  1URG A;  3C33 A;  2OWS A;  2Q9T A;  4TLL B;  2RIN A;  3N6U A;  3MBP A;  1SI0 A;  4ZEC A;  1IIT A;  2XXI A;  2R71 A;  4NWD A;  4NED A;  4KD5 A;  2ZNU A;  4RXL A;  5LOM A;  2OJT A;  3S9L C;  4OWD A;  4Q30 B;  3ODB A;  3JZJ A;  3M3K A;  4U1O A;  3IOT A;  3MZ1 A;  3MPK A;  2V3U A;  3MC2 A;  2RCA A;  2VOZ A;  1IXH A;  5AA2 D;  2B3F A;  4KI0 E;  1O7T A;  3FVN A;  1AIV A;  5ELV A;  3TCH A;  4FIM A;  3EHS A;  1MXV A;  3R26 A;  4U4X A;  1LGB C;  5FHN A;  3U93 A;  3CG3 A;  2VD3 A;  3FXQ A;  1XVY A;  5CBR A;  3GBA A;  5ICT A;  4RNS A;  3PD9 A;  3TOD A;  4FAJ A;  2FA7 A;  4G4P A;  3ZKL A;  3EF7 A;  1EH3 A;  4YB5 A;  2RKM A;  4H5F A;  4JXI A;  5H8F B;  3TMG A;  4FOR A;  1PB8 A;  2PBW A;  4F3S A;  1IZ1 A;  3SET A;  4UA8 A;  5A5X A;  3K0V A;  2Q2A A;  4JBZ A;  4NE4 A;  4R2F A;  3TTN A;  3MJN A;  3RT8 A;  2AL5 A;  3KSX A;  1S50 A;  4P0I A;  3B6W A;  1SW4 A;  1QUK A;  5I59 A;  2QL3 A;  2HAV A;  1B3F A;  4X48 A;  3G3H A;  1MQD A;  2I3V A;  1UTB B;  3QYT A;  4U4S A;  4F22 A;  1VSO A;  1IEJ A;  2F6P A;  4KQP A;  3QSL A;  5I59 B;  3TTR A;  1NNK A;  3HHG A;  4IO6 A;  3UN6 A;  3OO6 A;  5H8H A;  1UTH B;  2D21 A;  4N13 A;  1YPN A;  1MH3 A;  3K6X A;  4AB5 A;  3WAF A;  3HCQ A;  1DTZ A;  3KN8 A;  3ZSF A;  1IXC A;  5L9M A;  3O97 A;  1LST A;  2Q88 A;  4BDN A;  3PPN A;  3E4R A;  1B1X A;  5CI5 A;  5I56 B;  3KOS A;  1R9Q A;  3G3I A;  1B3E A;  2XX7 A;  4OFO A;  1QW0 A;  3KN3 A;  1JEU A;  3VLV A;  3KN7 A;  4NF4 A;  3DP4 A;  3PUY E;  3FGS A;  3MVZ A;  3VV5 A;  2I0C A;  3SEX A;  2PT2 A;  3M8U A;  2Q2C A;  1LBC A;  4XIG Q;  5ITO A;  3GBB A;  5KDT B;  3LSL A;  3PMX A;  4NF4 B;  5IAI A;  3P7I A;  5H8N B;  2I3W A;  3CFL A;  4QF9 A;  4GL0 A;  3MWB A;  2O7U A;  5I57 A;  2YJP A;  4LZ8 A;  2ANJ A;  3PUV E;  2ZYO A;  3G3K A;  1OVB A;  5CRY A;  3VLU A;  4OES A;  4ELQ A;  4IGT A;  3O6H A;  3RPW A;  3E9X A;  4Q5T A;  2F34 A;  4G8H A;  1HSE A;  3M3F A;  4LVQ A;  3ZS6 A;  3KFM A;  4LZ5 A;  4U22 A;  1YCJ A;  4HCW A;  2QS4 A;  5I2K B;  3TFL A;  1TFA A;  4ZS9 A;  3OD7 A;  3LBS A;  3A3U A;  4EDP A;  3CFZ A;  1B3H A;  1MPD A;  1B5I A;  1N7W A;  2XXU A;  3RQT A;  3FV2 A;  2ZXT A;  2RF1 A;  3RT6 B;  2H5Y A;  1HSJ A;  4K3F A;  4R9G A;  4LQ2 A;  1B2H A;  1SW5 A;  2QSX A;  4P0G A;  4JWX A;  1NH7 A;  1MPB A;  4ZE8 A;  3MZ9 A;  3G7W A;  3HO7 A;  4OET A;  2BJJ X;  2D5W A;  1FTL A;  2RC8 A;  1QVS A;  3K6V A;  1MXY A;  5JK4 A;  1LAH E;  2F35 A;  2DWH A;  3H6U A;  3TEP A;  2X7Q A;  3K01 A;  3FUZ A;  2Y7I A;  1S9T A;  4XTC Q;  1MXW A;  2F97 A;  1SYH A;  3MW0 A;  3FD3 A;  2DSF A;  2YPN A;  2ZYN A;  4JB7 A;  1Y4C A;  3T22 A;  3TPA A;  4HTG A;  5ITP A;  1YAE A;  1SBP A;  2O1L A;  4BDM A;  3VDF A;  2DQV A;  1Z7N E;  5AE4 A;  3O6I A;  3CR9 A;  3CG1 A;  2CMO A;  3S9M C;  2ZMB A;  1USY E;  2XXT A;  2Z8F A;  1B7U A;  3R6U A;  5AA3 A;  4G68 B;  3KGC A;  1IIW A;  3UGW A;  4DCX A;  1FCK A;  1XS5 A;  4OTE A;  4DIG A;  3FZV A;  2F6G A;  3O9P A;  2I48 A;  4PFT A;  1WVJ A;  5TU0 A;  4ESW A;  3RY3 A;  1A55 A;  4R72 A;  1GR2 A;  1YTV A;  1DOT A;  5B70 A;  4ZEB A;  3K00 A;  4Q8R A;  2FYI A;  2AL4 A;  4IY5 A;  3B7D A;  4JDF A;  1ZJL A;  4FED A;  4H67 A;  4KFQ A;  1NNP A;  1SVX B;  5H8Q A;  4F3B A;  4F18 A;  3AXF A;  4F3P A;  1OVT A;  4U23 A;  3FVO A;  1MXZ A;  5K2Y A;  1VE4 A;  1R1N A;  3T9H B;  1M5E A;  4F39 A;  3FVK A;  2HAU A;  2HZL A;  3JYR A;  2UVG A;  3EHU A;  3TTM A;  3KJT A;  2Y7K A;  2HXW A;  3MP6 A;  4MLV A;  2UYE A;  1N7X A;  2X26 A;  2G29 A;  4E0X A;  3RGY A;  1B7H A;  1RYO A;  3KSJ A;  1RYX A;  3R7X A;  3ZKK A;  2QJE A;  3MQ9 A;  1NMU A;  2PYY A;  4LUB A;  4DCY A;  1XHY A;  1LCT A;  2ALU A;  2GH9 A;  3OEK A;  4R73 A;  2I0B A;  3UIF A;  1BTJ A;  2O84 X;  1FQB A;  1MH4 A;  4KR5 A;  3Q28 A;  3U1O A;  4LAT A;  2Y7W A;  4EQ9 A;  1Y9U A;  4POX A;  3IB1 A;  3WAE A;  3DP6 A;  4F3G A;  4FJP A;  1N0T A;  4H5G A;  4EUO A;  3H3G A;  2XXQ A;  4LZ7 A;  1LFG A;  1BP5 A;  4O3B A;  4THI A;  1S7Y A;  3T9V A;  2XD3 A;  4F2O A;  2DS9 A;  3IJX B;  3K4U A;  1OQH A;  1MXU A;  2Z8E A;  3IO4 A;  3VVE A;  3S9E A;  4ELR A;  2XXP A;  4XKR A;  3PMV A;  4KPT A;  1DTG A;  2XD2 A;  5L9S A;  2DOJ A;  1SQY A;  1UQW A;  4ND9 A;  4C1U A;  3RNN A;  4GXS B;  1B46 A;  3MPL A;  2Y7P A;  4PFU A;  3T66 A;  3EN3 A;  3IOR A;  2H25 A;  2I58 A;  2OLB A;  3OEN A;  4OFJ A;  3EPE A;  3QXM A;  4X9T A;  2NOO A;  3OSR A;  4GF8 A;  4C1T A;  3QIM A;  2B65 A;  4EXK A;  1MG1 A;  2Q89 A;  1M5C A;  3SEU A;  3C31 A;  2VHA A;  4AQ4 A;  2Z8D A;  4E0W A;  1SYI A;  4O3C A;  1B0H A;  2OWT A;  1QJM A;  2AIX A;  4U21 A;  1MY1 A;  4F2Q A;  3FJM A;  3RTW B;  1EU8 A;  1N04 A;  1QKA A;  2OBG A;  4YKJ A;  2O51 A;  2XXR A;  2HZK A;  5CMC A;  1MQG A;  1ZKB A;  4X1D A;  1MY2 A;  1B4H A;  1WOD A;  3O2A A;  1Y20 A;  4MF3 A;  2F5X A;  2I4B A;  1A8F A;  3DLN A;  5KZT A;  4YMB A;  3VVF A;  1MM6 A;  1IXI A;  2ZYK A;  1LB9 A;  3BKI B;  4GVO A;  3BBR A;  4BLA A;  5JTY A;  2O7I A;  4PET A;  4LON B;  1SD3 A;  5A5X B;  4HS7 A;  2PT1 A;  4YMA A;  1USY H;  2XXY A;  1D4N A;  3K02 A;  4GL8 A;  2REG A;  5JTY B;  3B6T A;  1DPP A;  4KYD A;  2QS2 A;  4Q0C A;  1FQC A;  2XXH A;  1JET A;  1M5F A;  2E0S A;  4WED A;  4YU0 A;  4C0R A;  4DLD A;  4R9F A;  4KYE A;  1TT1 A;  1A54 A;  3Q27 A;  3V83 A;  1Y1Z A;  4XKN A;  3A09 A;  5FHM A;  5HPQ A;  3HN0 A;  5DEX A;  3MVX A;  1EZO A;  2W7Y A;  4GOT A;  4IO3 A;  3K2D A;  1O63 A;  2ONK E;  4DXC A;  4YIC A;  1JEV A;  3LSX A;  5H8H B;  4OER A;  4NF8 A;  4YKK A;  3SEW A;  2Z22 A;  4DXU A;  2UVH A;  3SER A;  1WDN A;  4ZE9 A;  4H8J A;  1JQF A;  5M2V A;  4GRK A;  4RY1 A;  1BLF A;  2NUV A;  1QUI A;  1ATG A;  5AA4 A;  1A99 A;  3TQL A;  4RK2 A;  3TDJ A;  3TQW A;  2IA4 A;  4NF5 A;  2XXW A;  1B52 A;  3CFX A;  4H1X A;  3BFU A;  2D3I A;  4KYS A;  3LUY A;  4JWY A;  2E1S A;  1NL5 A;  4KHZ E;  5I58 A;  5B7D A;  3OO8 A;  2DE4 A;  3Q29 A;  5EYF A;  3C9H A;  4IB2 A;  3OMB A;  4G8M A;  4ZZE A;  2DE2 A;  1ELJ A;  4Z0I A;  1B5H A;  3MP1 A;  4XKP A;  1TFD A;  2XXV A;  5I58 B;  1N3W A;  4UAC A;  4H6D A;  3KZG A;  2R6G E;  5K2X A;  2RC7 A;  5I57 B;  1DPE A;  3FXU A;  4QRZ A;  4OVJ A;  2HCA A;  4MBP A;  1B58 A;  1CE2 A;  4I8C A;  4LA9 A;  4GQO A;  3HV1 A;  4HCY A;  3PPR A;  4U1Z A;  3IB0 A;  4X1B A;  2A5T A;  3HHF A;  3ECR A;  4ZEK A;  5I2N A;  4MH5 A;  4RPN A;  4IO4 A;  4OXV A;  1R6Z A;  5I2N B;  2F36 A;  5BWJ A;  4MFI A;  2R9J A;  3C34 A;  3MZB A;  4N07 A;  4PFY A;  2ESN A;  1XC1 A;  1ZIU A;  3OEM A;  1P1Q A;  4U2R A;  2DWI A;  3TCG A;  1D9V A;  3L6H A;  3TCF A;  1BKA A;  1DSN A;  4FEB A;  3KBR A;  4IO2 A;  4GD5 A;  1FTO A;  3U8Q A;  3USD A;  3H6T A;  1NKX A;  3SES A;  3FVG A;  3T9X B;  3C36 A;  4YZZ A;  2I49 A;  2DP8 A;  3SEV A;  4JSO A;  2QS3 A;  2DXY A;  2HQ0 A;  4R75 A;  1OMP A;  3VFJ A;  1FW0 A;  1MPC A;  2FNC A;  2P1S A;  4PP0 A;  1MRP A;  3T96 B;  1FTJ A;  3K6U A;  1Y3P A;  1D9Y A;  3K1M A;  4FEC A;  5KCJ A;  1P1U A;  1MS7 A;  4ZDM A;  2YLN A;  3H06 B;  4F31 B;  4WXJ A;  2GFE A;  4G2Z A;  1H3D A;  4ISU A;  4QFN A;  1US5 A;  1B1H A;  2OZZ A;  4F29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...