1PC3A

Crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
333
structure length
333
Chain Sequence
VATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of M tuberculosis ABC phosphate transport receptor: specificity and charge compensation dominated by ion-dipole interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transport protein
molecule keywords Phosphate-binding protein 1
total genus 118
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pc3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pc3A02
1Q1KA 1B7ZA 1B4HA 4YMBA 4OXVA 2GHAA 4FIMA 3RGYA 2UVHA 3EN3A 1R9QA 2P0SA 2H9BA 2O69A 3MPLA 4GF8A 3Q28A 4KYEA 5TP9A 5AE4A 1UTBA 1D9VA 5I59B 5I84A 5ISUA 4IGTA 4QFNA 4G2ZA 4IO4A 3KGCA 2VD2A 4ZDMA 3LSXA 4QFKA 1LFHA 1MY3A 2F5XA 3QUFA 4ESWA 1MQIA 1JQFA 1PBPA 3TFLA 4JWOA 2DXYA 1RYXA 2NUVA 4GXAA 1QVSA 3RUMA 2HXWA 2VOZA 4RXLA 5IAIA 4OQOA 3L6GA 5TU0A 2Q89A 3RTFB 3EHSA 4MLVA 2Y7RA 3HN0A 3ILUB 3O29A 3RTWB 4ELRA 1LAFE 1SW2A 2HAVA 2XXYA 4YKKA 4PFYA 5K2YA 2X26A 4HS7A 3UGWA 1YPNA 5ITOA 4U22A 2QS1A 4IO2A 5LOMA 1B5HA 4F18A 4F3SA 3G3GA 3GZGA 2XXHA 3L6HA 4RA1A 3TTRA 3BBRA 4ZEIA 2FYIA 1ZLQA 2P2AA 3FV2A 3ONMA 4JXIA 4RPOA 3K02A 3EQ1A 4F19A 4F2OA 1DPEA 3GXAA 5A5XA 3QAXA 2PX1A 4H1XA 1H44A 4WEDA 4THIA 1IEJA 3TQLA 4EQ7A 5L9SA 1LGBC 4QSDA 4H0WA 3SERA 2WKYA 5IKBA 1FCKA 2XX7A 3EPEA 1Q35A 4XTCQ 2UXAA 2ZYNA 2UVJA 3CR9A 1USYE 2QSXA 4GLIA 4JSDA 4UACA 1AMFA 3DELB 4BDRA 3DP8A 1P1QA 4IO7A 1S7YA 1Z7ME 4LUBA 3LSLA 4R9FA 3OOAA 2DQVA 1HSJA 4NF4A 4F2QA 2XXUA 1MDP1 3O97A 1I6BA 3FIRA 3K4UA 4H8JA 1II5A 4NEDA 3T9XB 1M5CA 1Y3QA 5DVFA 3O6GA 3U72A 1ZJLA 3SKPA 1OIBA 1OMPA 1Y1MA 2BJJX 3KSXA 1GVCA 4EQ9A 4NF5A 4R72A 3O6IA 3VVFA 3RT6B 1IIWA 2DWJA 3WAEA 4QFOA 2HAUA 3SDFA 1FQBA 4F1VA 1A99A 1PC3A 5JTYA 2PT1A 1MRPA 1MY2A 1DOTA 2OJTA 3TEPA 4KYSA 3Q26A 3JZJA 1GGGA 4KCDA 2E0SA 3TCGA 2XD3A 1LFIA 3K00A 3D4CA 5KDTB 2Q2CA 1MXYA 3EHUA 3LSFB 1N04A 2V3QA 3TODA 3CI8A 2I0CA 3M8UA 3C33A 3R7XA 4YMAA 3V83A 1B32A 1MM7A 1N3XA 1B3HA 1AH5A 1B52A 1I6AA 2DXRA 2I0BA 1SI1A 2ONSA 2Q9TA 3MP6A 3S9LC 3TCFA 3VLWA 1SD3A 3KN7A 3VDFA 1N7XA 1XVYA 1O63A 4I1DA 4U4SA 4ECFA 1IZ1A 3H6VA 1PB8A 4WKMA 1URDA 2H5YA 3KFMA 5CI5A 3RLFE 1MQGA 3QYTA 1KWHA 3VXBA 4L17A 3LSWA 3KBRA 3GLBA 3BFUA 4DDDA 4ZECA 2I3WA 1N84A 5M2VA 2DWIA 1LSTA 3TCHA 1FTKA 4BDMA 4FJPA 4EXLA 1SVXB 4H5GA 2ZMBA 3N5LA 3S9MC 3KJ7A 3TPAA 3FXRA 3OO7A 1GTKA 3PPOA 4ZEDA 4Q0CA 3VXCA 1R9LA 5H8HB 1N0TA 2DSFA 2VP1A 2X7PA 3RN8A 2P1SA 3R6UA 3T22A 2D21A 3I3VA 3P7IA 4OWDA 2RF1A 4FE8A 3CRBA 1CE2A 2AYSA 4XKPA 4OZ9A 2UYEA 3FZVA 4JBZA 3CVGA 4EQBA 2FA7A 1I69A 4LQ5A 2XXPA 1MY4A 3PU5A 5TP9B 5ICTA 4H6DA 3TTMA 5AA3A 1CB6A 3CFXA 2UVIA 4YKJA 3SESA 5I2NA 2E1SA 3IOUA 1HSLA 1B1XA 2ABHA 3CIJA 4YU0A 3G3HA 1PDAA 2OK2A 1ANFA 2PMSA 5H8SA 4MFIA 2XXTA 3TAJA 2O6AA 3MJNA 1B3GA 3DM0A 2Y7IA 5CMCA 4HCYA 3V8XB 2QS3A 1QKBA 1QUKA 4GWOA 2NXOA 2REGA 4YKPA 4G4PA 2ZYOA 3IOTA 2FNCA 4GL8A 5KCJA 1TFDA 2OWSA 1D4NA 1FTOA 1I6QA 1BLFA 1FTJA 4FEDA 3U94A 1OLCA 3N6TA 3KOTA 3MBPA 2DOJA 4OETA 1JETA 3A09A 4LP2B 4BDLA 1LAHE 1XOCA 3SETA 5KZTA 4U4XA 4ELQA 3QK6A 3FXUA 1P99A 3K6UA 3LC8A 3MVYA 4O3BA 1F9BA 5TPAB 3W9WA 4NMYA 4KHZE 3HCQA 3HHGA 3C34A 4GFRA 4YAHX 2XHDA 5K2XA 1B5JA 1ZMGA 3RY3A 2GH9A 3TTNA 3O66A 5H8NB 2O1LA 4ZZAA 2AIXA 5DEXA 2F7AA 1ZU0A 4OVJA 3KN3A 3PPRA 5AA1A 3H6UA 2Q2AA 2DVCA 1B5IA 3FV1A 5EYFA 5CBSA 2O51A 1XS5A 2Q8JA 3SEWA 4F29A 5JEIA 2DP8A 4F3PA 4KD5A 3FGSA 1B51A 2YLNA 3ECRA 4KI0E 1M5BA 3OSRA 1LFGA 3TELA 1TWYA 4P0IA 3TTLA 3A3CA 3CFZA 1MPCA 2QRYA 4R73A 1DPPA 1XVXA 4LVQA 1QULA 4POWA 3VFJA 3FJ7A 4JDFA 2CMOA 3SEVA 3PUXE 4KCCA 1H43A 4R75A 4RK2A 3MW0A 5I57A 3HO7A 4YB6A 1ELJA 1B3EA 1POTA 1BKAA 2A5TA 1D9YA 3FJMA 3I5OA 3K01A 2DVZA 2ONKE 2UYFA 4X9TA 1B6HA 1A55A 4NWCA 2RC9A 2ZYKA 3T96B 2GRVA 2PBWA 1MQJA 2VD3A 3PPNA 2Q88A 3FASA 3R26A 1NFTA 2H25A 4OEUA 4RY1A 1M5DA 3PUVE 3USDA 4Z7EA 1R1NA 3H3GA 4QHQA 3B6WA 2ZNUA 1H45A 2PT2A 5I58B 4P11A 3THIA 1RYOA 3PV0E 1N76A 2OZZA 1P1NA 1D3KA 1NH7A 3VLVA 4P0GA 3M3LA 2B3FA 5CMBA 4LZ5A 4Q5TA 4YB7A 3G3IA 1B2HA 2QS2A 5DVJA 5F1QA 5FHOA 5AA2B 3MWBA 3FUZA 2HQ0A 5FHMA 4N07A 3N26A 2V93A 1A54A 3UIFA 1MH3A 1NNTA 1Y20A 3KSJA 3MP1A 4X1DA 1FQDA 1WODA 2HZKA 1M5FA 2G93A 2PYYA 2R6GE 2O68A 3C9HA 1US4A 2GFEA 4LQ2A 4M1VA 3W15C 1VSOA 4RPNA 5DTBA 3ZSFA 3QUJA 3ZS6A 1B0HA 3K6XA 2I58A 1MQHA 3MVZA 5H8HA 3PGFA 4DLDA 3TYHA 4RYAA 3QIMA 3PMVA 3U8QA 1R6ZA 4IO6A 4G68A 2QL3A 4E0XA 5H8QB 3UA8A 1XC1A 2DE3A 1IITA 4NWDA 1A8EA 4NTLA 3OO6A 3C4MA 2H98A 4MF3A 2F78A 5F7VA 4E0WA 1MPBA 2AL4A 1LAGE 3UP9A 4ELOA 5I2NB 2QPQA 3Q27A 1S50A 4QFLA 4IY5A 4OMBA 1FW0A 3K2DA 2XXQA 3LUYA 2H99A 3IOWA 3PD9A 4ISUA 1SW5A 2R71A 3IJXB 2RCBA 4K3FA 1GV8A 2RCAA 2ZNTA 2QMXA 1VFDA 2RINA 2XXIA 3SEYA 1IUDA 3MC2A 1UQWA 3MUQA 1O64A 1Y4CA 1NKXA 2F97A 3IO4A 3C32A 4IB2A 4NF6A 4FATA 1MDQA 1MXXA 4TLMB 5L9OA 1B4ZA 1Y4TA 3PUYE 1O7TA 1OLAA 2DS9A 4IO5A 4MLQA 4U1ZA 4EF1A 4ZE9A 1UTHB 3OXNA 3K1NA 3SEUA 3VE1B 2DWHA 3OMBA 5EHMA 1MXVA 4QRZA 3G3FA 1P1UA 4G8MA 1MY0A 4R2BA 3T93B 1A7LA 5CC2A 1LCFA 3H03A 4ZZEA 1J1NA 1VR5A 5EHSA 4AQ4A 4GVOA 5B7DA 2HEUA 3TMGA 3U93A 1TT1A 3VV5A 1POY1 5TPAA 3MZ1A 1UTBB 2ESNA 1IQ7A 2Z8EA 3IO6A 4POXA 5CRYA 1ATGA 4ZEKA 5H8NA 4OHNA 2YPNA 3KJTA 2OCUA 3I6VA 4JSOA 3FVGA 4H67A 4R6KA 1FTMA 5I56B 3Q29A 5FTIA 1OVTA 1B7HA 2I49A 1BTJA 3BFTA 4C1TA 3HSTA 4O3CA 4R6HA 1FQAA 3G7WA 1ZTYA 3SEXA 2NVUB 5I2KA 1H76A 3AXFA 1LB9A 3FXQA 1MY1A 3FJGA 4GD5A 1N7WA 4OFLA 4ZEBA 1OQGA 4OESA 2DE4A 3M3KA 1WDNA 3H4ZA 1JW1A 1QUJA 3IB0A 2Y7PA 1EZPA 1BP5A 3IORA 4FECA 4DXUA 1DSNA 4EXKA 2VGQA 3V5AA 3RPWA 4H5FA 5A5XB 3FATA 1MG1A 3C36A 2UVGA 2V25A 3S9NC 1TXFA 2Y7WA 2A5SA 4YZZA 2XD2A 2XX9A 4X1BA 4DZ1A 2OBGA 3IJOB 3OO8A 4HW8A 4O3AA 5KDTA 3E3KA 3N6UA 3ZKLA 1FQCA 4LATA 5AA4B 4G77A 3JYRA 3K6WA 4PE5B 4BLAA 4ELPA 4TLLB 3FVKA 1B58A 4C0RA 1LB8A 5L8DA 5I58A 2DWAA 4RJZA 3PPQA 2F6PA 2O84X 3PMWA 5DT6A 3MP8A 3TUSA 4MH5A 1JVXA 1VFEA 5I57B 4HTGA 4OERA 4KYDA 4I62A 3HHFA 3V89B 4PQJA 4QSCA 4GOTA 4DCYA 5AA2A 1FQFA 1OVBA 4YICA 2OLBA 1LBBA 2QS4A 1EZOA 2XX8A 4ZEFA 4I8CA 3K6VA 1YTVA 1Y9UA 1B46A 4PFWA 4TOZA 3S9EA 3MZ9A 4NF5B 3TDJA 4FORA 1WVJA 3H7MA 3HPIA 3OELA 2REJA 1B0LA 2ONRA 2F6GA 3ILTB 1LAXA 1NNPA 5JTYB 2KLFA 5H8FA 3PD8A 4NF8B 3G3KA 4DIGA 4F1UA 2F7CA 3IL1B 3B6QA 3O9PA 5HBCA 2IA4A 2ANJA 4WEPA 2XXXA 4EDPA 4AB5A 3BKIB 3K1MA 3O2AA 5AA2D 4JWXA 4R9GA 3W9VA 3FVOA 4XKRA 1GR2A 2O7UA 1FQEA 3U92A 3T9VA 4F22A 2I4BA 3C35A 3WAFA 2W7YA 2NOOA 3M3FA 4HCWA 1JEVA 4LZ8A 1T0KA 3T9UA 3CFLA 4F3GA 2OWTA 2I48A 4ONYA 5ICQA 1B40A 1SYHA 4BDQA 5ELVA 1EH3A 4IGRA 2LAOA 2F35A 1US5A 4NF6B 1QJMA 1MXWA 2Z22A 2I3VA 3S4UA 5KCJB 4F3BA 4F1YA 4KQPA 4H8IA 4XKQA 1JW4A 1S9TA 3EF7A 4X48A 3FVNA 4Z0IA 2XXWA 3MZBA 4G8HA 5I2KB 3TZAA 3VVEA 4U1OA 3KEIA 1DTZA 1QW0A 3IAZA 1XT8A 4PETA 4RNSA 4ESXA 4Q8RA 3UORA 2RKMA 2CZLA 1SI0A 2H4IA 3RQTA 4DE8A 1ZIUA 2HCAA 5I59A 3TTKA 3G3JA 1RKMA 1SW4A 1NNKA 3OENA 3OO9A 1MH4A 5DEXB 2R9JA 2THIA 2Y7KA 4U21A 3MVWA 1N3WA 1IXHA 2QMWA 4I9DA 4BDNA 5ITPA 1PB7A 3LBSA 2O1MA 3T66A 5I56A 4WXJA 4U23A 2ZYMA 3GBBA 3RT8A 4PFUA 2QJEA 1A40A 3CG1A 4OFOA 4XIGQ 3QSLA 1M5EA 1URGA 4LA9A 2RC7A 3A3UA 3PPPA 1JNFA 1VE4A 3IB2A 3KOSA 3QXMA 4R74A 2X7QA 4G68C 2HZLA 3B7DA 3CSGA 3N94A 1EZ9A 1TFAA 3MVXA 3IOVA 4GXSB 4ZE8A 5CM6A 1SQYA 3LR1A 1SYIA 1FTLA 2YJPA 2ZXTA 5L9MA 1MPDA 1NH8A 4H65A 3ZKKA 1JEUA 2XXVA 4MBPA 5J1DA 2A5TB 4NE4A 1BIYA 4U2RA 4BDOA 3TQWA 2O7IA 1H3DA 1AOVA 4ZS9A 4AB6A 1MXZA 2Z8FA 3KG2A 1P1WA 4M4GA 1QUIA 4KPTA 4KFQA 4C1UA 4JB7A 4DXBA 1YCJA 2F8DA 4JWYA 4LZ7A 4R6YA 4YKIA 1DMBA 2NWJA 5AA4A 5B70A 2G29A 3DP6A 3DP4A 1USYH 1XHYA 5FTHA 4N6PA 4YB5A 3TKDA 1HSEA 3IR1A 3CG3A 1Z7NE 4NF4B 1Y3NA 3K1PA 1PB9A 2VHAA 4R2FA 2V3TA 1JW5A 1UIUA 2AL5A 1B9JA 3MPKA 3UN6A 2B3BA 1PBQA 4PP0A 2DYXA 1A8FA 4Q30B 5BWJA 2Y84A 4G8NA 5FHNA 2D5WA 3KN8A 2B65A 4UA8A 4GRKA 3Q25A 2F34A 3EHTA 3DLNA 3K0VA 4GL0A 4PFTA 5DYHA 3RNNA 4F39A 5JK4A 2Z23A 5BUUA 3VVDA 3MAMA 2V3UA 3IX1A 4XKNA 1LBCA 3T9HB 3IK6B 2IEEA 3F11A 3IB1A 3OD7A 1B05A 1JVYA 1MXUA 1SBPA 1UIVA 1YAEA 2V84A 1NNFA 3B6TA 3H06B 3PMXA 4OTEA 4RK9A 5H8FB 3VLUA 4NF8A 4G68B 4FAJA 1LCTA 2F36A 3FD3A 4OYVA 4QSEA 3E13X 3ODBA 5H8QA 4DXCA 4EUOA 1Y1ZA 1B3LA 2RC8A 3C31A 3KZGA 1IXIA 3UK4A 4F31B 1AIVA 5HPQA 3S2VA 1IXGA 3E9XA 3D4GA 1SDXA 3OEMA 2GHBA 2DE2A 5CMKA 4DCXA 2HFBA 1URSA 3OEKA 1Y3PA 1B3FA 1EU8A 3OSQA 4N13A 5CMMA 3MQ9A 4EF2A 2XXRA 4IY6A 4FEBA 3CSBA 1AL3A 3PUZE 1SW1A 4LONB 4OFJA 3O28A 3U1OA 3JV9A 1MM6A 1LLSA 2Z8DA 3H6WA 4GIZA 4GQOA 2ALUA 4IO3A 4XXUA 1L5TA 4OENA 1B1HA 2I4CA 1B7UA 3HV1A 1ZKBA 3O6HA 1P1OA 1ZBMA 2PVUA 2ZNSA 2I6EA 2M8CA 1NL5A 1OQHA 3E4RA 1PEBA 4ND9A 4OEVA 4QFPA 1NMUA 4QF9A 1DTGA 1MS7A 2D3IA 1UTHA 1IXCA 2F7BA 5HM4B 1MQDA 4TQUQ 3GBAA 5CBRA 5DVIA 3PUWE 4KR5A 3H6TA 1QKAA
chains in the Genus database with same CATH superfamily
1B7ZA 4YMBA 2CZKA 4OXVA 4FIMA 2UVHA 3EN3A 5EQ7A 3MPLA 4GF8A 4JVCA 1UTBA 5I84A 4IO4A 4OVRA 2VD2A 1LFHA 1MY3A 2F5XA 4ESWA 1MQIA 3RUMA 4MLVA 4ELRA 2PCRA 3G3GA 3GXAA 3QAXA 3TQLA 4THIA 2KQZA 4XTCQ 4GLIA 4BDRA 2DQVA 1HSJA 2B4MA 2XXUA 1MDP1 3FIRA 3K4UA 3T9XB 1D9QA 1IMBA 3O6IA 5ET6A 1FQBA 4F1VA 2PT1A 4GWYA 1DOTA 3TEPA 3JZJA 2E0SA 1LFIA 2Q2CA 1MXYA 3LSFB 3CI8A 1KZ8A 1YXIA 4MFIA 1B3HA 2I0BA 1B52A 2Q9TA 3KN7A 3VDFA 1N7XA 4U4SA 3KFMA 3RLFE 5I57A 4L17A 3GLBA 3GYYA 1N84A 1FTKA 3OO7A 3PPOA 4ZEDA 1N0TA 2DSFA 3I3VA 5IZ3B 4FE8A 1CE2A 2AYSA 3FZVA 1FBEA 2FA7A 4H6DA 1CB6A 5I2NA 1ANFA 4AS5A 2XXTA 5CMCA 4HCYA 1QKBA 2REGA 4PGNA 5KCJA 1TFDA 2OWSA 1FTJA 1OLCA 3A09A 4LP2B 3SETA 5TPAB 3W9WA 4KHZE 4YAHX 4IR8A 4PAIA 1FBGA 1LBZA 3H6UA 5FBPA 1B5IA 2QVUA 1XS5A 2Q8JA 3SEWA 3A3CA 1DPPA 1QULA 4N6DA 4OA4A 1H43A 3MW0A 1B3EA 1POTA 1BKAA 3K01A 2HXRA 2DVZA 1A55A 4N6KA 1MQJA 3FASA 1NFTA 2H25A 4RY1A 3USDA 4Z7EA 4QHQA 3B6WA 1H45A 3PV0E 3M3LA 5CMBA 4YB7A 2HQ0A 1MH3A 1Y20A 1NV0A 1M5FA 2G93A 4LQ2A 4DLDA 2I58A 4PF8A 4RYAA 3QIMA 3PMVA 4IO6A 2QL3A 3UA8A 2DE3A 1IITA 4NWDA 2F78A 5F7VA 2Y5KA 2AL4A 4ELOA 1S50A 3PD9A 1SW5A 2RCAA 2ZNTA 1VFDA 2XXIA 1NKXA 3B50A 3IO4A 5L9OA 1B4ZA 1Y4TA 1UTHB 3SEUA 3OMBA 4QRZA 1P1UA 2F3DA 1A7LA 5CC2A 1LCFA 1VR5A 2HEUA 1POY1 4POXA 1ATGA 5H8NA 1FBCA 3I6VA 4R6KA 4H67A 3Q29A 5FTIA 4C1TA 3HSTA 1FQAA 1ZTYA 5I7IA 3FXQA 1MY1A 3M3KA 1JW1A 1QUJA 1BP5A 4DXUA 4H5FA 2WYKA 1MG1A 2UVGA 5ET7A 2A5SA 2XD2A 2XX9A 4X1BA 4DZ1A 2OBGA 3IJOB 3ZKLA 1FQCA 2MKZA 4LATA 4PE5B 1LB8A 5I58A 2DWAA 3PPQA 2FIXA 3PMWA 4QSCA 2OLBA 2QS4A 4I8CA 3S9EA 4NF5B 5JTYB 3RPLA 5H8FA 2F7CA 2Q8MA 3O9PA 4GX4A 2ANJA 1IMAA 5IGAA 2XXXA 3BKIB 3K1MA 4R9GA 3W9VA 4MNCA 3FVOA 1GR2A 4F22A 3U92A 3T9VA 3C35A 3WAFA 1T0KA 4LZ8A 3CFLA 2OWTA 5ICQA 4NF6B 1QJMA 5KCJB 4F3BA 4NX1A 3E78A 4H8IA 3EF7A 4X48A 3FVNA 3MZBA 5EQAA 4ESXA 1XT8A 4DE8A 1SI0A 2H4IA 1ZIUA 3TTKA 1NNKA 3OENA 2Y7KA 2QMWA 4I9DA 4WXJA 4X04A 3RT8A 3CG1A 1A40A 2CEXA 4XKRA 3PPPA 3IB2A 3KBZA 2X7QA 2HZLA 3CSGA 2YJPA 2ZXTA 3D1RA 1NH8A 2O7IA 1H3DA 4ZS9A 2Z8FA 3KG2A 4JB7A 4R6YA 1IMDA 2V4CA 4N6PA 1INPA 1Y3NA 4R2FA 1PBQA 3ISPA 4UA8A 3Q25A 3DLNA 2Z23A 3VVDA 3IK6B 2IEEA 1B05A 1IMEA 1JVYA 1NNFA 3PMXA 4FAJA 4OYVA 4QSEA 4DXCA 4EUOA 3C31A 1B3LA 1EYJA 3D4GA 5CMKA 4DCXA 2HFBA 1URSA 3OEKA 1B3FA 1EU8A 4N4UA 2XXRA 3O28A 4GIZA 4GQOA 1ZKBA 2PVUA 2I6EA 4QFPA 4OEVA 1PEBA 2P3NA 1Q9DA 1UTHA 1IXCA 4TQUQ 5CBRA 5DVIA 1Q1KA 3PTYA 2GHAA 3RGYA 2O69A 4PAFA 5I59B 5AE4A 4NQ8A 3KGCA 2PFZA 4JWOA 1DBZA 1QVSA 4RXLA 4QXDA 5TU0A 2Q89A 1RDYA 3EHSA 2Y7RA 3U65A 1LAFE 4H46A 5LOMA 3HFUA 1B5HA 3ROJA 3GZGA 3TTRA 3BBRA 4ZEIA 2FYIA 4JXIA 4GWZA 1YZ0A 1IEJA 1FPKA 2WKYA 2XA5A 1KA1A 2XX7A 3EPEA 4JSDA 5EQ9A 3DELB 1P1QA 1S7YA 4R9FA 3OOAA 4NF4A 4NEDA 4NAPA 1M5CA 3O6GA 1ZJLA 1OMPA 3KSXA 4NF5A 3RT6B 2DWJA 3SDFA 3RPLB 5JTYA 1MY2A 4KYSA 2XD3A 3K00A 5KDTB 1N04A 4QBAA 3R7XA 4YMAA 1MM7A 3S9LC 1I6AA 1SI1A 3MP6A 1XVYA 1O63A 3H6VA 1PB8A 1URDA 2H5YA 1KWHA 3KBRA 3BFUA 4ZECA 2I3WA 4EXLA 5EQ8A 3KC0A 4P56A 1R9LA 5H8HB 3RN8A 1FPGA 5ESYA 3CRBA 4XKPA 4MNPA 4OZ9A 2UYEA 3CVGA 4EQBA 1I69A 1MY4A 2F3BA 3PU5A 3TTMA 2UVIA 4YKJA 1HSLA 2OK2A 5H8SA 2O6AA 2Y7IA 1QUKA 4GWOA 4O7MA 2FNCA 4MX6A 2OX3A 4GL8A 1NV2A 3U94A 3N6TA 1JETA 4PTKA 3FXUA 3MVYA 4I3YA 3TUSA 3HHGA 2XHDA 3TTNA 3RY3A 2O1LA 2AIXA 5DEXA 5CBSA 2O51A 4KD5A 3MYUA 4PFIA 4NN3A 4PF6A 1TWYA 5AA2D 1MPCA 4R73A 4LVQA 3FJ7A 2CMOA 3SEVA 4KCCA 3HO7A 1D9YA 2A5TA 4X9TA 2ZYKA 5I3SA 5JK4A 2Q88A 3T0JA 1M5DA 3PUVE 3H3GA 2ZNUA 2PT2A 1N76A 2OZZA 1D3KA 4P0GA 4N8GA 5FHOA 3FUZA 5FHMA 3N26A 2V93A 4X1DA 2R6GE 3C9HA 3W15C 2O68A 1US4A 2GFEA 1VSOA 4RPNA 5DTBA 3QUJA 1B0HA 3MVZA 4PFRA 1R6ZA 4E0XA 4G68A 5H8QB 1XC1A 3OO6A 3FBPA 3UP9A 1AWBA 2R71A 3IJXB 2RCBA 3SZPA 2QMXA 2RINA 3SEYA 1IUDA 1Y4CA 2HPGA 4NF6A 1O7TA 2DS9A 4MLQA 3IFAA 3G3FA 4NHBA 3MSTA 5LDZA 3H03A 4ZZEA 5B7DA 3TMGA 3VV5A 2JJKA 3MZ1A 1UTBB 2ESNA 5CRYA 4ZEKA 2YPNA 4JSOA 3FVGA 2I49A 1NV7A 2NVUB 4GD5A 1N7WA 1WDNA 3H4ZA 3IB0A 1DSNA 2CZIA 3S9NC 1TXFA 4HW8A 5KDTA 3OO8A 3E3KA 3JYRA 3K6WA 1B58A 3NOHA 5L8DA 1LBYA 2F6PA 4MMPA 1JVXA 3V89B 1AOVA 5AA2A 1LBBA 1Y9UA 4PFWA 3TDJA 3HPIA 1B0LA 1RDZA 4GWWA 2KLFA 3PD8A 4F1UA 2VPNA 2IA4A 3O2AA 2O7UA 1FQEA 2WBBA 2I4BA 2NOOA 4HCWA 3T9UA 2XWIA 5ELVA 1EH3A 4IGRA 1FPIA 1US5A 2I3VA 2P3VA 4F1YA 1S9TA 4Z0IA 4BDQA 5I2KB 3VVEA 3IAZA 4Q8RA 4PETA 5IZ3A 2RKMA 3RYDA 3RQTA 2HCAA 5I59A 1MH4A 2R9JA 2THIA 3MVWA 5ITPA 1PB7A 2O1MA 4GBVA 3GBBA 2QJEA 4UABA 3QSLA 4OVTA 1JNFA 3KOSA 4R74A 4G68C 4ZE8A 1TFAA 3ZKKA 1FJ9A 4NE4A 4U2RA 1FPLA 4AB6A 1MXZA 1P1WA 4M4GA 4KPTA 1DMBA 2G29A 1XHYA 1Z7NE 4NF4B 2V3TA 3UN6A 2AL5A 1B9JA 2B3BA 4PP0A 4Q30B 4G8NA 2D5WA 4GRKA 4PFTA 5DYHA 3EHTA 3RNNA 2PFYA 1LEVA 3IFCA 3MAMA 4OVQA 4XKNA 3T9HB 1SPIA 3F11A 4RK9A 2F36A 3FD3A 1G0IA 3UK4A 3S2VA 3OEMA 1IXGA 1LBWA 1LBXA 3E9XA 1YYZA 1SW1A 1MM6A 1LLSA 2ALUA 4IO3A 4XXUA 1L5TA 1P1OA 2L5VA 2M8CA 4ND9A 1EYKA 5HM4B 1NV6A 3GBAA 1FPJA 5A5LA 1B4HA 4MAGA 4O7IA 2P0SA 1FTAA 4KYEA 4I40A 4IGTA 1NV5A 4QFKA 3QUFA 1PBPA 1RYXA 2HXWA 2VOZA 3L6GA 3RTFB 3O29A 3HN0A 3RTWB 2XXYA 5K2YA 2HAVA 3UGWA 4PFYA 2X26A 4HS7A 5ITOA 4U22A 4IO2A 4F3SA 1XI6A 2P2AA 1ZLQA 4F2OA 3ONMA 5A5XA 3K02A 3EQ1A 4F19A 1CNQA 1DPEA 4DI4B 2PX1A 4H1XA 1H44A 4WEDA 1FRPA 1LGBC 4PC9A 4QSDA 5IKBA 1FCKA 1Q35A 2UXAA 2ZYNA 2UVJA 1USYE 2OWZA 1Z7ME 3O97A 1I6BA 4P1LA 1II5A 3U72A 1OIBA 4EQ9A 1GVCA 3VVFA 1A99A 2OJTA 1GGGA 4KCDA 2WBDA 3D4CA 3EHUA 2I0CA 3M8UA 1B32A 3LSWA 4PAKA 2DXRA 2ONSA 4I1DA 4WKMA 5CI5A 1FPBA 1MQGA 3VXBA 3TCHA 2DWIA 1LSTA 3N5LA 3S9MC 3TPAA 3FXRA 4Q0CA 3VXCA 2X7PA 3R6UA 2RF1A 4JBZA 4LQ5A 5TP9B 5ICTA 1DK4A 3SESA 2E1SA 3IOUA 4YU0A 1B1XA 2ABHA 2PMSA 1B3GA 1EYIA 2QS3A 4O94A 2NXOA 4GBWA 4G4PA 2ZYOA 1D4NA 1FTOA 1I6QA 1BLFA 5F24A 2DOJA 4OETA 5EYGA 1XOCA 4ELQA 3QK6A 3K6UA 4O3BA 1F9BA 3C34A 5K2XA 4P3LA 2CZHA 1B5JA 1ZMGA 2GH9A 4ZZAA 2F7AA 4OVJA 3KN3A 3PPRA 2Q2AA 2DVCA 4GWSA 4F29A 5JEIA 4KI0E 1B51A 3TELA 1M5BA 3OSRA 1LFGA 2FBPA 4P0IA 3TTLA 3CFZA 1XVXA 3VFJA 4JDFA 4R75A 4RK2A 4YB6A 1ELJA 3I5OA 2UYFA 1B6HA 4NWCA 2GRVA 4OEUA 2QVVA 3THIA 1RYOA 1P1NA 3VLVA 2B3FA 4LZ5A 4Q5TA 4DI3D 5DVJA 5AA2B 3MWBA 4XFEA 1IMCA 3UIFA 1NNTA 2BJIA 3KSJA 4GX3A 1WODA 1FQDA 4M1VA 3ZSFA 3K6XA 5H8HA 4N8YA 4NTLA 3C4MA 2H98A 4AS4A 4E0WA 1LAGE 2QPQA 4IY5A 4G61A 1FW0A 3K2DA 2XXQA 3LUYA 2H99A 3IOWA 4I3EA 4K3FA 4PFBA 1GV8A 1O64A 2F97A 4IB2A 3C32A 4FATA 1MDQA 4GWXA 4U1ZA 4IO5A 4EF1A 3VE1B 1QGXA 4G8MA 4PBQA 3T93B 1J1NA 5EYHA 2KR0A 1FBFA 4H45A 2Z8EA 3IO6A 2XWKA 4OHNA 2OCUA 1DCUA 5I56B 1OVTA 1B7HA 1BTJA 3BFTA 4O3CA 4R6HA 3SEXA 1H76A 4OFLA 2DE4A 2Y7PA 4EXKA 2VGQA 3RPWA 3C36A 2V25A 2Y7WA 4YZZA 4G77A 2GQ1A 4BLAA 4ELPA 4TLLB 4RJZA 4KXPA 2O84X 3MP8A 5IZZA 4MH5A 1VFEA 5I57B 4HTGA 4OERA 4KYDA 4I62A 4GOTA 3CHGA 1OVBA 4OANA 4ZEFA 3K6VA 1B46A 4TOZA 1WVJA 3H7MA 2ONRA 2F6GA 3ILTB 1NNPA 2XXKA 1BK4A 2R8TA 4NF8B 1NI9A 3G3KA 1NV3A 3B6QA 4WEPA 1FBDA 4JWXA 4P1EA 2W7YA 3M3FA 1JEVA 2I48A 4ONYA 1B40A 1SYHA 2LAOA 3S4UA 4XKQA 1JW4A 2XWVA 4G8HA 3TZAA 4U1OA 3KEIA 1DTZA 1QW0A 2VT5A 4JVDA 4RNSA 2CZLA 5IZ1A 1SW4A 4NF0A 3LBSA 3T66A 2ZYMA 4MEVA 4XIGQ 1M5EA 1URGA 4PBHA 4LA9A 2RC7A 3B8BA 3B7DA 3N94A 3MVXA 5CM6A 1SYIA 4GX6A 1JEUA 2XXVA 4MBPA 1BIYA 3LV0A 4DXBA 1QUIA 1YCJA 5AA4A 5B70A 1NUYA 4MNIA 5FTHA 1USYH 3TKDA 2B4LA 1A8FA 3KN8A 2F34A 4F39A 4P47A 3IX1A 1LBCA 2V84A 1UIVA 3H06B 1K9ZA 3B6TA 3VLUA 4OTEA 1LCTA 3ODBA 1Y1ZA 4MJOA 1IXIA 1SDXA 2GHBA 3OSQA 4EF2A 4IY6A 3U1OA 3JV9A 4OVSA 4OENA 5AA1A 1B1HA 2I4CA 1B7UA 3HV1A 3O6HA 1ZBMA 5L9SA 1NMUA 1DTGA 1MS7A 2D3IA 2F7BA 1MQDA 4KR5A 5I2KA 3A29A 1R9QA 1VDWA 2H9BA 4P9KA 3BIGA 3Q28A 5TP9A 5ISUA 1D9VA 4QFNA 4G2ZA 4ZDMA 3LSXA 3TFLA 1JQFA 2DXYA 2NUVA 4GXAA 5IAIA 4OQOA 4MIJA 3ILUB 1SW2A 4YKKA 4C1UA 2HHMA 1YPNA 2QS1A 3LUZA 4F18A 3L6HA 2XXHA 4RA1A 3FV2A 4RPOA 4LN5A 4EQ7A 4H0WA 3SERA 4XEQA 1FPEA 3CR9A 4UACA 2QSXA 1AMFA 3DP8A 4IO7A 4MHFA 4LUBA 4NGUA 3LSLA 1NUXA 4F2QA 4H8JA 1Y3QA 4PE3A 5DVFA 3SKPA 1Y1MA 2BJJX 4R72A 1IIWA 3WAEA 4QFOA 2HAUA 1PC3A 1MRPA 3Q26A 3TCGA 2V3QA 3TODA 2WYPA 3C33A 3V83A 1N3XA 4HXVA 1AH5A 5T3JA 4X8RA 3TCFA 1SD3A 3VLWA 2ZZXA 4ECFA 1IZ1A 1NV4A 3QYTA 4DDDA 5M2VA 4BDMA 4FJPA 1SVXB 4H5GA 2ZMBA 3KJ7A 1GTKA 2VP1A 1G0HA 2P1SA 5I5PA 3T22A 2D21A 3P7IA 4OWDA 2XXPA 5AA3A 3CFXA 2FHYA 3CIJA 3G3HA 1PDAA 4O8MA 2WEFA 3TAJA 3MJNA 3DM0A 3V8XB 4YKPA 3IOTA 4N91A 4NG7A 4N81A 1FSAA 4FEDA 3EKIA 3KOTA 3MBPA 4BDLA 1LAHE 5KZTA 4U4XA 2CEYA 3LC8A 1P99A 4EDPA 2FIEA 4NMYA 3HCQA 4GFRA 5H8NB 3O66A 5LTCA 1ZU0A 3FV1A 5EYFA 4PDDA 4GWUA 2DP8A 4F3PA 3FGSA 3ECRA 2YLNA 2QRYA 4POWA 3PUXE 3FJMA 2ONKE 5ET8A 2RC9A 3T96B 2PBWA 3PPNA 2VD3A 3R26A 1R1NA 3FXBA 4P8BA 5I58B 4P11A 5IM2A 4PDHA 1NH7A 3G3IA 1B2HA 2QS2A 3BIHA 5F1QA 4N07A 1JP4A 1K9YA 1A54A 3MP1A 2HZKA 2PYYA 1NUWA 3ZS6A 1MQHA 3PGFA 1KA0A 3TYHA 3U8QA 5J16A 1FBPA 1A8EA 4MF3A 1MPBA 4N15A 5I2NB 3Q27A 4QFLA 4OMBA 2ZZWA 4ISUA 3MC2A 1UQWA 3MUQA 4TLMB 1MXXA 3PUYE 4ZE9A 1OLAA 3OXNA 3K1NA 2DWHA 5EHMA 1MXVA 4R2BA 1MY0A 5EHSA 4AQ4A 4GVOA 3U93A 1TT1A 5TPAA 1IQ7A 3KJTA 1FTMA 2ZZVA 3G7WA 1NV1A 3AXFA 1LB9A 3FJGA 4ZEBA 1OQGA 4OESA 4HE0A 4PGPA 1LBVA 1EZPA 3IORA 4FECA 3V5AA 4MCOA 3KC1A 5A5XB 3FATA 4XF5A 4OVPA 4O3AA 3N6UA 5AA4B 4HE2A 3FVKA 4C0RA 1FJ6A 4N17A 5DT6A 4HE1A 4DCYA 3HHFA 4PQJA 1FQFA 4YICA 1EZOA 2XX8A 1YTVA 3MZ9A 4FORA 2VPOA 3OELA 2REJA 3E79A 2XWOA 1LAXA 4DIGA 3IL1B 5HBCA 1FBHA 1FPFA 2FVZA 2DDKA 4AB5A 4F3GA 2Y5LA 2QVRA 2F35A 1MXWA 2Z22A 1FPDA 4KQPA 2XXWA 3T1BA 3UORA 3G3JA 1RKMA 5DW8A 3OO9A 5DEXB 4U21A 1N3WA 1IXHA 4BDNA 5I56A 4U23A 4PFUA 4OFOA 2WX9A 3A3UA 1VE4A 3QXMA 1EZ9A 4GXSB 3IOVA 1SQYA 3LR1A 1FTLA 5L9MA 1MPDA 4H65A 4JVIA 5J1DA 2A5TB 4BDOA 3TQWA 4PCDA 2Q74A 4KFQA 2F8DA 4JWYA 4LZ7A 4YKIA 2NWJA 3DP6A 3DP4A 4YB5A 1HSEA 3IR1A 3CG3A 3K1PA 1PB9A 2VHAA 5ET5A 4FBPA 1JW5A 1UIUA 3MPKA 2DYXA 5BWJA 2Y84A 5FHNA 2B65A 3K0VA 4GL0A 5BUUA 2V3UA 3IB1A 3OD7A 1YAEA 1MXUA 1IMFA 1SBPA 5H8FB 4NF8A 4G68B 5H8QA 3E13X 2QFLA 2RC8A 3KZGA 4F31B 1AIVA 5HPQA 2DE2A 1Y3PA 4N13A 5CMMA 3MQ9A 4OFJA 4FEBA 3CSBA 1AL3A 3PUZE 4LONB 2Z8DA 3H6WA 2ZNSA 3E4RA 1NL5A 1NUZA 1OQHA 1RDXA 4QF9A 3QMFA 3PUWE 3H6TA 1QKAA
chains in the Genus database with same CATH topology
1Q1KA 1B7ZA 1B4HA 4YMBA 4OXVA 2GHAA 4FIMA 3RGYA 2UVHA 3EN3A 1R9QA 2P0SA 2H9BA 2O69A 3MPLA 4GF8A 3Q28A 4KYEA 5TP9A 5AE4A 1UTBA 1D9VA 5I59B 5I84A 5ISUA 4IGTA 4QFNA 4G2ZA 4IO4A 3KGCA 2VD2A 4ZDMA 3LSXA 4QFKA 1LFHA 1MY3A 2F5XA 3QUFA 4ESWA 1MQIA 1JQFA 1PBPA 3TFLA 4JWOA 2DXYA 1RYXA 2NUVA 4GXAA 1QVSA 3RUMA 2HXWA 2VOZA 4RXLA 5IAIA 4OQOA 3L6GA 5TU0A 2Q89A 3RTFB 3EHSA 4MLVA 2Y7RA 3HN0A 3ILUB 3O29A 3RTWB 4ELRA 1LAFE 1SW2A 2HAVA 2XXYA 4YKKA 4PFYA 5K2YA 2X26A 4HS7A 3UGWA 1YPNA 5ITOA 4U22A 2QS1A 4IO2A 5LOMA 1B5HA 4F18A 4F3SA 3G3GA 3GZGA 2XXHA 3L6HA 4RA1A 3TTRA 3BBRA 4ZEIA 2FYIA 1ZLQA 2P2AA 3FV2A 3ONMA 4JXIA 4RPOA 3K02A 3EQ1A 4F19A 4F2OA 1DPEA 3GXAA 5A5XA 3QAXA 2PX1A 4H1XA 1H44A 4WEDA 4THIA 1IEJA 3TQLA 4EQ7A 5L9SA 1LGBC 4QSDA 4H0WA 3SERA 2WKYA 5IKBA 1FCKA 2XX7A 3EPEA 1Q35A 4XTCQ 2UXAA 2ZYNA 2UVJA 3CR9A 1USYE 2QSXA 4GLIA 4JSDA 4UACA 1AMFA 3DELB 4BDRA 3DP8A 1P1QA 4IO7A 1S7YA 1Z7ME 4LUBA 3LSLA 4R9FA 3OOAA 2DQVA 1HSJA 4NF4A 4F2QA 2XXUA 1MDP1 3O97A 1I6BA 3FIRA 3K4UA 4H8JA 1II5A 4NEDA 3T9XB 1M5CA 1Y3QA 5DVFA 3O6GA 3U72A 1ZJLA 3SKPA 1OIBA 1OMPA 1Y1MA 2BJJX 3KSXA 1GVCA 4EQ9A 4NF5A 4R72A 3O6IA 3VVFA 3RT6B 1IIWA 2DWJA 3WAEA 4QFOA 2HAUA 3SDFA 1FQBA 4F1VA 1A99A 1PC3A 5JTYA 2PT1A 1MRPA 1MY2A 1DOTA 2OJTA 3TEPA 4KYSA 3Q26A 3JZJA 1GGGA 4KCDA 2E0SA 3TCGA 2XD3A 1LFIA 3K00A 3D4CA 5KDTB 2Q2CA 1MXYA 3EHUA 3LSFB 1N04A 2V3QA 3TODA 3CI8A 2I0CA 3M8UA 3C33A 3R7XA 4YMAA 3V83A 1B32A 1MM7A 1N3XA 1B3HA 1AH5A 1B52A 1I6AA 2DXRA 2I0BA 1SI1A 2ONSA 2Q9TA 3MP6A 3S9LC 3TCFA 3VLWA 1SD3A 3KN7A 3VDFA 1N7XA 1XVYA 1O63A 4I1DA 4U4SA 4ECFA 1IZ1A 3H6VA 1PB8A 4WKMA 1URDA 2H5YA 3KFMA 5CI5A 3RLFE 1MQGA 3QYTA 1KWHA 3VXBA 4L17A 3LSWA 3KBRA 3GLBA 3BFUA 4DDDA 4ZECA 2I3WA 1N84A 5M2VA 2DWIA 1LSTA 3TCHA 1FTKA 4BDMA 4FJPA 4EXLA 1SVXB 4H5GA 2ZMBA 3N5LA 3S9MC 3KJ7A 3TPAA 3FXRA 3OO7A 1GTKA 3PPOA 4ZEDA 4Q0CA 3VXCA 1R9LA 5H8HB 1N0TA 2DSFA 2VP1A 2X7PA 3RN8A 2P1SA 3R6UA 3T22A 2D21A 3I3VA 3P7IA 4OWDA 2RF1A 4FE8A 3CRBA 1CE2A 2AYSA 4XKPA 4OZ9A 2UYEA 3FZVA 4JBZA 3CVGA 4EQBA 2FA7A 1I69A 4LQ5A 2XXPA 1MY4A 3PU5A 5TP9B 5ICTA 4H6DA 3TTMA 5AA3A 1CB6A 3CFXA 2UVIA 4YKJA 3SESA 5I2NA 2E1SA 3IOUA 1HSLA 1B1XA 2ABHA 3CIJA 4YU0A 3G3HA 1PDAA 2OK2A 1ANFA 2PMSA 5H8SA 4MFIA 2XXTA 3TAJA 2O6AA 3MJNA 1B3GA 3DM0A 2Y7IA 5CMCA 4HCYA 3V8XB 2QS3A 1QKBA 1QUKA 4GWOA 2NXOA 2REGA 4YKPA 4G4PA 2ZYOA 3IOTA 2FNCA 4GL8A 5KCJA 1TFDA 2OWSA 1D4NA 1FTOA 1I6QA 1BLFA 1FTJA 4FEDA 3U94A 1OLCA 3N6TA 3KOTA 3MBPA 2DOJA 4OETA 1JETA 3A09A 4LP2B 4BDLA 1LAHE 1XOCA 3SETA 5KZTA 4U4XA 4ELQA 3QK6A 3FXUA 1P99A 3K6UA 3LC8A 3MVYA 4O3BA 1F9BA 5TPAB 3W9WA 4NMYA 4KHZE 3HCQA 3HHGA 3C34A 4GFRA 4YAHX 2XHDA 5K2XA 1B5JA 1ZMGA 3RY3A 2GH9A 3TTNA 3O66A 5H8NB 2O1LA 4ZZAA 2AIXA 5DEXA 2F7AA 1ZU0A 4OVJA 3KN3A 3PPRA 5AA1A 3H6UA 2Q2AA 2DVCA 1B5IA 3FV1A 5EYFA 5CBSA 2O51A 1XS5A 2Q8JA 3SEWA 4F29A 5JEIA 2DP8A 4F3PA 4KD5A 3FGSA 1B51A 2YLNA 3ECRA 4KI0E 1M5BA 3OSRA 1LFGA 3TELA 1TWYA 4P0IA 3TTLA 3A3CA 3CFZA 1MPCA 2QRYA 4R73A 1DPPA 1XVXA 4LVQA 1QULA 4POWA 3VFJA 3FJ7A 4JDFA 2CMOA 3SEVA 3PUXE 4KCCA 1H43A 4R75A 4RK2A 3MW0A 5I57A 3HO7A 4YB6A 1ELJA 1B3EA 1POTA 1BKAA 2A5TA 1D9YA 3FJMA 3I5OA 3K01A 2DVZA 2ONKE 2UYFA 4X9TA 1B6HA 1A55A 4NWCA 2RC9A 2ZYKA 3T96B 2GRVA 2PBWA 1MQJA 2VD3A 3PPNA 2Q88A 3FASA 3R26A 1NFTA 2H25A 4OEUA 4RY1A 1M5DA 3PUVE 3USDA 4Z7EA 1R1NA 3H3GA 4QHQA 3B6WA 2ZNUA 1H45A 2PT2A 5I58B 4P11A 3THIA 1RYOA 3PV0E 1N76A 2OZZA 1P1NA 1D3KA 1NH7A 3VLVA 4P0GA 3M3LA 2B3FA 5CMBA 4LZ5A 4Q5TA 4YB7A 3G3IA 1B2HA 2QS2A 5DVJA 5F1QA 5FHOA 5AA2B 3MWBA 3FUZA 2HQ0A 5FHMA 4N07A 3N26A 2V93A 1A54A 3UIFA 1MH3A 1NNTA 1Y20A 3KSJA 3MP1A 4X1DA 1FQDA 1WODA 2HZKA 1M5FA 2G93A 2PYYA 2R6GE 2O68A 3C9HA 1US4A 2GFEA 4LQ2A 4M1VA 3W15C 1VSOA 4RPNA 5DTBA 3ZSFA 3QUJA 3ZS6A 1B0HA 3K6XA 2I58A 1MQHA 3MVZA 5H8HA 3PGFA 4DLDA 3TYHA 4RYAA 3QIMA 3PMVA 3U8QA 1R6ZA 4IO6A 4G68A 2QL3A 4E0XA 5H8QB 3UA8A 1XC1A 2DE3A 1IITA 4NWDA 1A8EA 4NTLA 3OO6A 3C4MA 2H98A 4MF3A 2F78A 5F7VA 4E0WA 1MPBA 2AL4A 1LAGE 3UP9A 4ELOA 5I2NB 2QPQA 3Q27A 1S50A 4QFLA 4IY5A 4OMBA 1FW0A 3K2DA 2XXQA 3LUYA 2H99A 3IOWA 3PD9A 4ISUA 1SW5A 2R71A 3IJXB 2RCBA 4K3FA 1GV8A 2RCAA 2ZNTA 2QMXA 1VFDA 2RINA 2XXIA 3SEYA 1IUDA 3MC2A 1UQWA 3MUQA 1O64A 1Y4CA 1NKXA 2F97A 3IO4A 3C32A 4IB2A 4NF6A 4FATA 1MDQA 1MXXA 4TLMB 5L9OA 1B4ZA 1Y4TA 3PUYE 1O7TA 1OLAA 2DS9A 4IO5A 4MLQA 4U1ZA 4EF1A 4ZE9A 1UTHB 3OXNA 3K1NA 3SEUA 3VE1B 2DWHA 3OMBA 5EHMA 1MXVA 4QRZA 3G3FA 1P1UA 4G8MA 1MY0A 4R2BA 3T93B 1A7LA 5CC2A 1LCFA 3H03A 4ZZEA 1J1NA 1VR5A 5EHSA 4AQ4A 4GVOA 5B7DA 2HEUA 3TMGA 3U93A 1TT1A 3VV5A 1POY1 5TPAA 3MZ1A 1UTBB 2ESNA 1IQ7A 2Z8EA 3IO6A 4POXA 5CRYA 1ATGA 4ZEKA 5H8NA 4OHNA 2YPNA 3KJTA 2OCUA 3I6VA 4JSOA 3FVGA 4H67A 4R6KA 1FTMA 5I56B 3Q29A 5FTIA 1OVTA 1B7HA 2I49A 1BTJA 3BFTA 4C1TA 3HSTA 4O3CA 4R6HA 1FQAA 3G7WA 1ZTYA 3SEXA 2NVUB 5I2KA 1H76A 3AXFA 1LB9A 3FXQA 1MY1A 3FJGA 4GD5A 1N7WA 4OFLA 4ZEBA 1OQGA 4OESA 2DE4A 3M3KA 1WDNA 3H4ZA 1JW1A 1QUJA 3IB0A 2Y7PA 1EZPA 1BP5A 3IORA 4FECA 4DXUA 1DSNA 4EXKA 2VGQA 3V5AA 3RPWA 4H5FA 5A5XB 3FATA 1MG1A 3C36A 2UVGA 2V25A 3S9NC 1TXFA 2Y7WA 2A5SA 4YZZA 2XD2A 2XX9A 4X1BA 4DZ1A 2OBGA 3IJOB 3OO8A 4HW8A 4O3AA 5KDTA 3E3KA 3N6UA 3ZKLA 1FQCA 4LATA 5AA4B 4G77A 3JYRA 3K6WA 4PE5B 4BLAA 4ELPA 4TLLB 3FVKA 1B58A 4C0RA 1LB8A 5L8DA 5I58A 2DWAA 4RJZA 3PPQA 2F6PA 2O84X 3PMWA 5DT6A 3MP8A 3TUSA 4MH5A 1JVXA 1VFEA 5I57B 4HTGA 4OERA 4KYDA 4I62A 3HHFA 3V89B 4PQJA 4QSCA 4GOTA 4DCYA 5AA2A 1FQFA 1OVBA 4YICA 2OLBA 1LBBA 2QS4A 1EZOA 2XX8A 4ZEFA 4I8CA 3K6VA 1YTVA 1Y9UA 1B46A 4PFWA 4TOZA 3S9EA 3MZ9A 4NF5B 3TDJA 4FORA 1WVJA 3H7MA 3HPIA 3OELA 2REJA 1B0LA 2ONRA 2F6GA 3ILTB 1LAXA 1NNPA 5JTYB 2KLFA 5H8FA 3PD8A 4NF8B 3G3KA 4DIGA 4F1UA 2F7CA 3IL1B 3B6QA 3O9PA 5HBCA 2IA4A 2ANJA 4WEPA 2XXXA 4EDPA 4AB5A 3BKIB 3K1MA 3O2AA 5AA2D 4JWXA 4R9GA 3W9VA 3FVOA 4XKRA 1GR2A 2O7UA 1FQEA 3U92A 3T9VA 4F22A 2I4BA 3C35A 3WAFA 2W7YA 2NOOA 3M3FA 4HCWA 1JEVA 4LZ8A 1T0KA 3T9UA 3CFLA 4F3GA 2OWTA 2I48A 4ONYA 5ICQA 1B40A 1SYHA 4BDQA 5ELVA 1EH3A 4IGRA 2LAOA 2F35A 1US5A 4NF6B 1QJMA 1MXWA 2Z22A 2I3VA 3S4UA 5KCJB 4F3BA 4F1YA 4KQPA 4H8IA 4XKQA 1JW4A 1S9TA 3EF7A 4X48A 3FVNA 4Z0IA 2XXWA 3MZBA 4G8HA 5I2KB 3TZAA 3VVEA 4U1OA 3KEIA 1DTZA 1QW0A 3IAZA 1XT8A 4PETA 4RNSA 4ESXA 4Q8RA 3UORA 2RKMA 2CZLA 1SI0A 2H4IA 3RQTA 4DE8A 1ZIUA 2HCAA 5I59A 3TTKA 3G3JA 1RKMA 1SW4A 1NNKA 3OENA 3OO9A 1MH4A 5DEXB 2R9JA 2THIA 2Y7KA 4U21A 3MVWA 1N3WA 1IXHA 2QMWA 4I9DA 4BDNA 5ITPA 1PB7A 3LBSA 2O1MA 3T66A 5I56A 4WXJA 4U23A 2ZYMA 3GBBA 3RT8A 4PFUA 2QJEA 1A40A 3CG1A 4OFOA 4XIGQ 3QSLA 1M5EA 1URGA 4LA9A 2RC7A 3A3UA 3PPPA 1JNFA 1VE4A 3IB2A 3KOSA 3QXMA 4R74A 2X7QA 4G68C 2HZLA 3B7DA 3CSGA 3N94A 1EZ9A 1TFAA 3MVXA 3IOVA 4GXSB 4ZE8A 5CM6A 1SQYA 3LR1A 1SYIA 1FTLA 2YJPA 2ZXTA 5L9MA 1MPDA 1NH8A 4H65A 3ZKKA 1JEUA 2XXVA 4MBPA 5J1DA 2A5TB 4NE4A 1BIYA 4U2RA 4BDOA 3TQWA 2O7IA 1H3DA 1AOVA 4ZS9A 4AB6A 1MXZA 2Z8FA 3KG2A 1P1WA 4M4GA 1QUIA 4KPTA 4KFQA 4C1UA 4JB7A 4DXBA 1YCJA 2F8DA 4JWYA 4LZ7A 4R6YA 4YKIA 1DMBA 2NWJA 5AA4A 5B70A 2G29A 3DP6A 3DP4A 1USYH 1XHYA 5FTHA 4N6PA 4YB5A 3TKDA 1HSEA 3IR1A 3CG3A 1Z7NE 4NF4B 1Y3NA 3K1PA 1PB9A 2VHAA 4R2FA 2V3TA 1JW5A 1UIUA 2AL5A 1B9JA 3MPKA 3UN6A 2B3BA 1PBQA 4PP0A 2DYXA 1A8FA 4Q30B 5BWJA 2Y84A 4G8NA 5FHNA 2D5WA 3KN8A 2B65A 4UA8A 4GRKA 3Q25A 2F34A 3EHTA 3DLNA 3K0VA 4GL0A 4PFTA 5DYHA 3RNNA 4F39A 5JK4A 2Z23A 5BUUA 3VVDA 3MAMA 2V3UA 3IX1A 4XKNA 1LBCA 3T9HB 3IK6B 2IEEA 3F11A 3IB1A 3OD7A 1B05A 1JVYA 1MXUA 1SBPA 1UIVA 1YAEA 2V84A 1NNFA 3B6TA 3H06B 3PMXA 4OTEA 4RK9A 5H8FB 3VLUA 4NF8A 4G68B 4FAJA 1LCTA 2F36A 3FD3A 4OYVA 4QSEA 3E13X 3ODBA 5H8QA 4DXCA 4EUOA 1Y1ZA 1B3LA 2RC8A 3C31A 3KZGA 1IXIA 3UK4A 4F31B 1AIVA 5HPQA 3S2VA 1IXGA 3E9XA 3D4GA 1SDXA 3OEMA 2GHBA 2DE2A 5CMKA 4DCXA 2HFBA 1URSA 3OEKA 1Y3PA 1B3FA 1EU8A 3OSQA 4N13A 5CMMA 3MQ9A 4EF2A 2XXRA 4IY6A 4FEBA 3CSBA 1AL3A 3PUZE 1SW1A 4LONB 4OFJA 3O28A 3U1OA 3JV9A 1MM6A 1LLSA 2Z8DA 3H6WA 4GIZA 4GQOA 2ALUA 4IO3A 4XXUA 1L5TA 4OENA 1B1HA 2I4CA 1B7UA 3HV1A 1ZKBA 3O6HA 1P1OA 1ZBMA 2PVUA 2ZNSA 2I6EA 2M8CA 1NL5A 1OQHA 3E4RA 1PEBA 4ND9A 4OEVA 4QFPA 1NMUA 4QF9A 1DTGA 1MS7A 2D3IA 1UTHA 1IXCA 2F7BA 5HM4B 1MQDA 4TQUQ 3GBAA 5CBRA 5DVIA 3PUWE 4KR5A 3H6TA 1QKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q1K A;  1B7Z A;  1B4H A;  4YMB A;  4OXV A;  2GHA A;  4FIM A;  3RGY A;  2UVH A;  3EN3 A;  1R9Q A;  2P0S A;  2H9B A;  2O69 A;  3MPL A;  4GF8 A;  3Q28 A;  4KYE A;  5TP9 A;  5AE4 A;  1UTB A;  1D9V A;  5I59 B;  5I84 A;  5ISU A;  4IGT A;  4QFN A;  4G2Z A;  4IO4 A;  3KGC A;  2VD2 A;  4ZDM A;  3LSX A;  4QFK A;  1LFH A;  1MY3 A;  2F5X A;  3QUF A;  4ESW A;  1MQI A;  1JQF A;  1PBP A;  3TFL A;  4JWO A;  2DXY A;  1RYX A;  2NUV A;  4GXA A;  1QVS A;  3RUM A;  2HXW A;  2VOZ A;  4RXL A;  5IAI A;  4OQO A;  3L6G A;  5TU0 A;  2Q89 A;  3RTF B;  3EHS A;  4MLV A;  2Y7R A;  3HN0 A;  3ILU B;  3O29 A;  3RTW B;  4ELR A;  1LAF E;  1SW2 A;  2HAV A;  2XXY A;  4YKK A;  4PFY A;  5K2Y A;  2X26 A;  4HS7 A;  3UGW A;  1YPN A;  5ITO A;  4U22 A;  2QS1 A;  4IO2 A;  5LOM A;  1B5H A;  4F18 A;  4F3S A;  3G3G A;  3GZG A;  2XXH A;  3L6H A;  4RA1 A;  3TTR A;  3BBR A;  4ZEI A;  2FYI A;  1ZLQ A;  2P2A A;  3FV2 A;  3ONM A;  4JXI A;  4RPO A;  3K02 A;  3EQ1 A;  4F19 A;  4F2O A;  1DPE A;  3GXA A;  5A5X A;  3QAX A;  2PX1 A;  4H1X A;  1H44 A;  4WED A;  4THI A;  1IEJ A;  3TQL A;  4EQ7 A;  5L9S A;  1LGB C;  4QSD A;  4H0W A;  3SER A;  2WKY A;  5IKB A;  1FCK A;  2XX7 A;  3EPE A;  1Q35 A;  4XTC Q;  2UXA A;  2ZYN A;  2UVJ A;  3CR9 A;  1USY E;  2QSX A;  4GLI A;  4JSD A;  4UAC A;  1AMF A;  3DEL B;  4BDR A;  3DP8 A;  1P1Q A;  4IO7 A;  1S7Y A;  1Z7M E;  4LUB A;  3LSL A;  4R9F A;  3OOA A;  2DQV A;  1HSJ A;  4NF4 A;  4F2Q A;  2XXU A;  1MDP 1;  3O97 A;  1I6B A;  3FIR A;  3K4U A;  4H8J A;  1II5 A;  4NED A;  3T9X B;  1M5C A;  1Y3Q A;  5DVF A;  3O6G A;  3U72 A;  1ZJL A;  3SKP A;  1OIB A;  1OMP A;  1Y1M A;  2BJJ X;  3KSX A;  1GVC A;  4EQ9 A;  4NF5 A;  4R72 A;  3O6I A;  3VVF A;  3RT6 B;  1IIW A;  2DWJ A;  3WAE A;  4QFO A;  2HAU A;  3SDF A;  1FQB A;  4F1V A;  1A99 A;  1PC3 A;  5JTY A;  2PT1 A;  1MRP A;  1MY2 A;  1DOT A;  2OJT A;  3TEP A;  4KYS A;  3Q26 A;  3JZJ A;  1GGG A;  4KCD A;  2E0S A;  3TCG A;  2XD3 A;  1LFI A;  3K00 A;  3D4C A;  5KDT B;  2Q2C A;  1MXY A;  3EHU A;  3LSF B;  1N04 A;  2V3Q A;  3TOD A;  3CI8 A;  2I0C A;  3M8U A;  3C33 A;  3R7X A;  4YMA A;  3V83 A;  1B32 A;  1MM7 A;  1N3X A;  1B3H A;  1AH5 A;  1B52 A;  1I6A A;  2DXR A;  2I0B A;  1SI1 A;  2ONS A;  2Q9T A;  3MP6 A;  3S9L C;  3TCF A;  3VLW A;  1SD3 A;  3KN7 A;  3VDF A;  1N7X A;  1XVY A;  1O63 A;  4I1D A;  4U4S A;  4ECF A;  1IZ1 A;  3H6V A;  1PB8 A;  4WKM A;  1URD A;  2H5Y A;  3KFM A;  5CI5 A;  3RLF E;  1MQG A;  3QYT A;  1KWH A;  3VXB A;  4L17 A;  3LSW A;  3KBR A;  3GLB A;  3BFU A;  4DDD A;  4ZEC A;  2I3W A;  1N84 A;  5M2V A;  2DWI A;  1LST A;  3TCH A;  1FTK A;  4BDM A;  4FJP A;  4EXL A;  1SVX B;  4H5G A;  2ZMB A;  3N5L A;  3S9M C;  3KJ7 A;  3TPA A;  3FXR A;  3OO7 A;  1GTK A;  3PPO A;  4ZED A;  4Q0C A;  3VXC A;  1R9L A;  5H8H B;  1N0T A;  2DSF A;  2VP1 A;  2X7P A;  3RN8 A;  2P1S A;  3R6U A;  3T22 A;  2D21 A;  3I3V A;  3P7I A;  4OWD A;  2RF1 A;  4FE8 A;  3CRB A;  1CE2 A;  2AYS A;  4XKP A;  4OZ9 A;  2UYE A;  3FZV A;  4JBZ A;  3CVG A;  4EQB A;  2FA7 A;  1I69 A;  4LQ5 A;  2XXP A;  1MY4 A;  3PU5 A;  5TP9 B;  5ICT A;  4H6D A;  3TTM A;  5AA3 A;  1CB6 A;  3CFX A;  2UVI A;  4YKJ A;  3SES A;  5I2N A;  2E1S A;  3IOU A;  1HSL A;  1B1X A;  2ABH A;  3CIJ A;  4YU0 A;  3G3H A;  1PDA A;  2OK2 A;  1ANF A;  2PMS A;  5H8S A;  4MFI A;  2XXT A;  3TAJ A;  2O6A A;  3MJN A;  1B3G A;  3DM0 A;  2Y7I A;  5CMC A;  4HCY A;  3V8X B;  2QS3 A;  1QKB A;  1QUK A;  4GWO A;  2NXO A;  2REG A;  4YKP A;  4G4P A;  2ZYO A;  3IOT A;  2FNC A;  4GL8 A;  5KCJ A;  1TFD A;  2OWS A;  1D4N A;  1FTO A;  1I6Q A;  1BLF A;  1FTJ A;  4FED A;  3U94 A;  1OLC A;  3N6T A;  3KOT A;  3MBP A;  2DOJ A;  4OET A;  1JET A;  3A09 A;  4LP2 B;  4BDL A;  1LAH E;  1XOC A;  3SET A;  5KZT A;  4U4X A;  4ELQ A;  3QK6 A;  3FXU A;  1P99 A;  3K6U A;  3LC8 A;  3MVY A;  4O3B A;  1F9B A;  5TPA B;  3W9W A;  4NMY A;  4KHZ E;  3HCQ A;  3HHG A;  3C34 A;  4GFR A;  4YAH X;  2XHD A;  5K2X A;  1B5J A;  1ZMG A;  3RY3 A;  2GH9 A;  3TTN A;  3O66 A;  5H8N B;  2O1L A;  4ZZA A;  2AIX A;  5DEX A;  2F7A A;  1ZU0 A;  4OVJ A;  3KN3 A;  3PPR A;  5AA1 A;  3H6U A;  2Q2A A;  2DVC A;  1B5I A;  3FV1 A;  5EYF A;  5CBS A;  2O51 A;  1XS5 A;  2Q8J A;  3SEW A;  4F29 A;  5JEI A;  2DP8 A;  4F3P A;  4KD5 A;  3FGS A;  1B51 A;  2YLN A;  3ECR A;  4KI0 E;  1M5B A;  3OSR A;  1LFG A;  3TEL A;  1TWY A;  4P0I A;  3TTL A;  3A3C A;  3CFZ A;  1MPC A;  2QRY A;  4R73 A;  1DPP A;  1XVX A;  4LVQ A;  1QUL A;  4POW A;  3VFJ A;  3FJ7 A;  4JDF A;  2CMO A;  3SEV A;  3PUX E;  4KCC A;  1H43 A;  4R75 A;  4RK2 A;  3MW0 A;  5I57 A;  3HO7 A;  4YB6 A;  1ELJ A;  1B3E A;  1POT A;  1BKA A;  2A5T A;  1D9Y A;  3FJM A;  3I5O A;  3K01 A;  2DVZ A;  2ONK E;  2UYF A;  4X9T A;  1B6H A;  1A55 A;  4NWC A;  2RC9 A;  2ZYK A;  3T96 B;  2GRV A;  2PBW A;  1MQJ A;  2VD3 A;  3PPN A;  2Q88 A;  3FAS A;  3R26 A;  1NFT A;  2H25 A;  4OEU A;  4RY1 A;  1M5D A;  3PUV E;  3USD A;  4Z7E A;  1R1N A;  3H3G A;  4QHQ A;  3B6W A;  2ZNU A;  1H45 A;  2PT2 A;  5I58 B;  4P11 A;  3THI A;  1RYO A;  3PV0 E;  1N76 A;  2OZZ A;  1P1N A;  1D3K A;  1NH7 A;  3VLV A;  4P0G A;  3M3L A;  2B3F A;  5CMB A;  4LZ5 A;  4Q5T A;  4YB7 A;  3G3I A;  1B2H A;  2QS2 A;  5DVJ A;  5F1Q A;  5FHO A;  5AA2 B;  3MWB A;  3FUZ A;  2HQ0 A;  5FHM A;  4N07 A;  3N26 A;  2V93 A;  1A54 A;  3UIF A;  1MH3 A;  1NNT A;  1Y20 A;  3KSJ A;  3MP1 A;  4X1D A;  1FQD A;  1WOD A;  2HZK A;  1M5F A;  2G93 A;  2PYY A;  2R6G E;  2O68 A;  3C9H A;  1US4 A;  2GFE A;  4LQ2 A;  4M1V A;  3W15 C;  1VSO A;  4RPN A;  5DTB A;  3ZSF A;  3QUJ A;  3ZS6 A;  1B0H A;  3K6X A;  2I58 A;  1MQH A;  3MVZ A;  5H8H A;  3PGF A;  4DLD A;  3TYH A;  4RYA A;  3QIM A;  3PMV A;  3U8Q A;  1R6Z A;  4IO6 A;  4G68 A;  2QL3 A;  4E0X A;  5H8Q B;  3UA8 A;  1XC1 A;  2DE3 A;  1IIT A;  4NWD A;  1A8E A;  4NTL A;  3OO6 A;  3C4M A;  2H98 A;  4MF3 A;  2F78 A;  5F7V A;  4E0W A;  1MPB A;  2AL4 A;  1LAG E;  3UP9 A;  4ELO A;  5I2N B;  2QPQ A;  3Q27 A;  1S50 A;  4QFL A;  4IY5 A;  4OMB A;  1FW0 A;  3K2D A;  2XXQ A;  3LUY A;  2H99 A;  3IOW A;  3PD9 A;  4ISU A;  1SW5 A;  2R71 A;  3IJX B;  2RCB A;  4K3F A;  1GV8 A;  2RCA A;  2ZNT A;  2QMX A;  1VFD A;  2RIN A;  2XXI A;  3SEY A;  1IUD A;  3MC2 A;  1UQW A;  3MUQ A;  1O64 A;  1Y4C A;  1NKX A;  2F97 A;  3IO4 A;  3C32 A;  4IB2 A;  4NF6 A;  4FAT A;  1MDQ A;  1MXX A;  4TLM B;  5L9O A;  1B4Z A;  1Y4T A;  3PUY E;  1O7T A;  1OLA A;  2DS9 A;  4IO5 A;  4MLQ A;  4U1Z A;  4EF1 A;  4ZE9 A;  1UTH B;  3OXN A;  3K1N A;  3SEU A;  3VE1 B;  2DWH A;  3OMB A;  5EHM A;  1MXV A;  4QRZ A;  3G3F A;  1P1U A;  4G8M A;  1MY0 A;  4R2B A;  3T93 B;  1A7L A;  5CC2 A;  1LCF A;  3H03 A;  4ZZE A;  1J1N A;  1VR5 A;  5EHS A;  4AQ4 A;  4GVO A;  5B7D A;  2HEU A;  3TMG A;  3U93 A;  1TT1 A;  3VV5 A;  1POY 1;  5TPA A;  3MZ1 A;  1UTB B;  2ESN A;  1IQ7 A;  2Z8E A;  3IO6 A;  4POX A;  5CRY A;  1ATG A;  4ZEK A;  5H8N A;  4OHN A;  2YPN A;  3KJT A;  2OCU A;  3I6V A;  4JSO A;  3FVG A;  4H67 A;  4R6K A;  1FTM A;  5I56 B;  3Q29 A;  5FTI A;  1OVT A;  1B7H A;  2I49 A;  1BTJ A;  3BFT A;  4C1T A;  3HST A;  4O3C A;  4R6H A;  1FQA A;  3G7W A;  1ZTY A;  3SEX A;  2NVU B;  5I2K A;  1H76 A;  3AXF A;  1LB9 A;  3FXQ A;  1MY1 A;  3FJG A;  4GD5 A;  1N7W A;  4OFL A;  4ZEB A;  1OQG A;  4OES A;  2DE4 A;  3M3K A;  1WDN A;  3H4Z A;  1JW1 A;  1QUJ A;  3IB0 A;  2Y7P A;  1EZP A;  1BP5 A;  3IOR A;  4FEC A;  4DXU A;  1DSN A;  4EXK A;  2VGQ A;  3V5A A;  3RPW A;  4H5F A;  5A5X B;  3FAT A;  1MG1 A;  3C36 A;  2UVG A;  2V25 A;  3S9N C;  1TXF A;  2Y7W A;  2A5S A;  4YZZ A;  2XD2 A;  2XX9 A;  4X1B A;  4DZ1 A;  2OBG A;  3IJO B;  3OO8 A;  4HW8 A;  4O3A A;  5KDT A;  3E3K A;  3N6U A;  3ZKL A;  1FQC A;  4LAT A;  5AA4 B;  4G77 A;  3JYR A;  3K6W A;  4PE5 B;  4BLA A;  4ELP A;  4TLL B;  3FVK A;  1B58 A;  4C0R A;  1LB8 A;  5L8D A;  5I58 A;  2DWA A;  4RJZ A;  3PPQ A;  2F6P A;  2O84 X;  3PMW A;  5DT6 A;  3MP8 A;  3TUS A;  4MH5 A;  1JVX A;  1VFE A;  5I57 B;  4HTG A;  4OER A;  4KYD A;  4I62 A;  3HHF A;  3V89 B;  4PQJ A;  4QSC A;  4GOT A;  4DCY A;  5AA2 A;  1FQF A;  1OVB A;  4YIC A;  2OLB A;  1LBB A;  2QS4 A;  1EZO A;  2XX8 A;  4ZEF A;  4I8C A;  3K6V A;  1YTV A;  1Y9U A;  1B46 A;  4PFW A;  4TOZ A;  3S9E A;  3MZ9 A;  4NF5 B;  3TDJ A;  4FOR A;  1WVJ A;  3H7M A;  3HPI A;  3OEL A;  2REJ A;  1B0L A;  2ONR A;  2F6G A;  3ILT B;  1LAX A;  1NNP A;  5JTY B;  2KLF A;  5H8F A;  3PD8 A;  4NF8 B;  3G3K A;  4DIG A;  4F1U A;  2F7C A;  3IL1 B;  3B6Q A;  3O9P A;  5HBC A;  2IA4 A;  2ANJ A;  4WEP A;  2XXX A;  4EDP A;  4AB5 A;  3BKI B;  3K1M A;  3O2A A;  5AA2 D;  4JWX A;  4R9G A;  3W9V A;  3FVO A;  4XKR A;  1GR2 A;  2O7U A;  1FQE A;  3U92 A;  3T9V A;  4F22 A;  2I4B A;  3C35 A;  3WAF A;  2W7Y A;  2NOO A;  3M3F A;  4HCW A;  1JEV A;  4LZ8 A;  1T0K A;  3T9U A;  3CFL A;  4F3G A;  2OWT A;  2I48 A;  4ONY A;  5ICQ A;  1B40 A;  1SYH A;  4BDQ A;  5ELV A;  1EH3 A;  4IGR A;  2LAO A;  2F35 A;  1US5 A;  4NF6 B;  1QJM A;  1MXW A;  2Z22 A;  2I3V A;  3S4U A;  5KCJ B;  4F3B A;  4F1Y A;  4KQP A;  4H8I A;  4XKQ A;  1JW4 A;  1S9T A;  3EF7 A;  4X48 A;  3FVN A;  4Z0I A;  2XXW A;  3MZB A;  4G8H A;  5I2K B;  3TZA A;  3VVE A;  4U1O A;  3KEI A;  1DTZ A;  1QW0 A;  3IAZ A;  1XT8 A;  4PET A;  4RNS A;  4ESX A;  4Q8R A;  3UOR A;  2RKM A;  2CZL A;  1SI0 A;  2H4I A;  3RQT A;  4DE8 A;  1ZIU A;  2HCA A;  5I59 A;  3TTK A;  3G3J A;  1RKM A;  1SW4 A;  1NNK A;  3OEN A;  3OO9 A;  1MH4 A;  5DEX B;  2R9J A;  2THI A;  2Y7K A;  4U21 A;  3MVW A;  1N3W A;  1IXH A;  2QMW A;  4I9D A;  4BDN A;  5ITP A;  1PB7 A;  3LBS A;  2O1M A;  3T66 A;  5I56 A;  4WXJ A;  4U23 A;  2ZYM A;  3GBB A;  3RT8 A;  4PFU A;  2QJE A;  1A40 A;  3CG1 A;  4OFO A;  4XIG Q;  3QSL A;  1M5E A;  1URG A;  4LA9 A;  2RC7 A;  3A3U A;  3PPP A;  1JNF A;  1VE4 A;  3IB2 A;  3KOS A;  3QXM A;  4R74 A;  2X7Q A;  4G68 C;  2HZL A;  3B7D A;  3CSG A;  3N94 A;  1EZ9 A;  1TFA A;  3MVX A;  3IOV A;  4GXS B;  4ZE8 A;  5CM6 A;  1SQY A;  3LR1 A;  1SYI A;  1FTL A;  2YJP A;  2ZXT A;  5L9M A;  1MPD A;  1NH8 A;  4H65 A;  3ZKK A;  1JEU A;  2XXV A;  4MBP A;  5J1D A;  2A5T B;  4NE4 A;  1BIY A;  4U2R A;  4BDO A;  3TQW A;  2O7I A;  1H3D A;  1AOV A;  4ZS9 A;  4AB6 A;  1MXZ A;  2Z8F A;  3KG2 A;  1P1W A;  4M4G A;  1QUI A;  4KPT A;  4KFQ A;  4C1U A;  4JB7 A;  4DXB A;  1YCJ A;  2F8D A;  4JWY A;  4LZ7 A;  4R6Y A;  4YKI A;  1DMB A;  2NWJ A;  5AA4 A;  5B70 A;  2G29 A;  3DP6 A;  3DP4 A;  1USY H;  1XHY A;  5FTH A;  4N6P A;  4YB5 A;  3TKD A;  1HSE A;  3IR1 A;  3CG3 A;  1Z7N E;  4NF4 B;  1Y3N A;  3K1P A;  1PB9 A;  2VHA A;  4R2F A;  2V3T A;  1JW5 A;  1UIU A;  2AL5 A;  1B9J A;  3MPK A;  3UN6 A;  2B3B A;  1PBQ A;  4PP0 A;  2DYX A;  1A8F A;  4Q30 B;  5BWJ A;  2Y84 A;  4G8N A;  5FHN A;  2D5W A;  3KN8 A;  2B65 A;  4UA8 A;  4GRK A;  3Q25 A;  2F34 A;  3EHT A;  3DLN A;  3K0V A;  4GL0 A;  4PFT A;  5DYH A;  3RNN A;  4F39 A;  5JK4 A;  2Z23 A;  5BUU A;  3VVD A;  3MAM A;  2V3U A;  3IX1 A;  4XKN A;  1LBC A;  3T9H B;  3IK6 B;  2IEE A;  3F11 A;  3IB1 A;  3OD7 A;  1B05 A;  1JVY A;  1MXU A;  1SBP A;  1UIV A;  1YAE A;  2V84 A;  1NNF A;  3B6T A;  3H06 B;  3PMX A;  4OTE A;  4RK9 A;  5H8F B;  3VLU A;  4NF8 A;  4G68 B;  4FAJ A;  1LCT A;  2F36 A;  3FD3 A;  4OYV A;  4QSE A;  3E13 X;  3ODB A;  5H8Q A;  4DXC A;  4EUO A;  1Y1Z A;  1B3L A;  2RC8 A;  3C31 A;  3KZG A;  1IXI A;  3UK4 A;  4F31 B;  1AIV A;  5HPQ A;  3S2V A;  1IXG A;  3E9X A;  3D4G A;  1SDX A;  3OEM A;  2GHB A;  2DE2 A;  5CMK A;  4DCX A;  2HFB A;  1URS A;  3OEK A;  1Y3P A;  1B3F A;  1EU8 A;  3OSQ A;  4N13 A;  5CMM A;  3MQ9 A;  4EF2 A;  2XXR A;  4IY6 A;  4FEB A;  3CSB A;  1AL3 A;  3PUZ E;  1SW1 A;  4LON B;  4OFJ A;  3O28 A;  3U1O A;  3JV9 A;  1MM6 A;  1LLS A;  2Z8D A;  3H6W A;  4GIZ A;  4GQO A;  2ALU A;  4IO3 A;  4XXU A;  1L5T A;  4OEN A;  1B1H A;  2I4C A;  1B7U A;  3HV1 A;  1ZKB A;  3O6H A;  1P1O A;  1ZBM A;  2PVU A;  2ZNS A;  2I6E A;  2M8C A;  1NL5 A;  1OQH A;  3E4R A;  1PEB A;  4ND9 A;  4OEV A;  4QFP A;  1NMU A;  4QF9 A;  1DTG A;  1MS7 A;  2D3I A;  1UTH A;  1IXC A;  2F7B A;  5HM4 B;  1MQD A;  4TQU Q;  3GBA A;  5CBR A;  5DVI A;  3PUW E;  4KR5 A;  3H6T A;  1QKA A; 
#chains in the Genus database with same CATH topology
 1B7Z A;  4YMB A;  2CZK A;  4OXV A;  4FIM A;  2UVH A;  3EN3 A;  5EQ7 A;  3MPL A;  4GF8 A;  4JVC A;  1UTB A;  5I84 A;  4IO4 A;  4OVR A;  2VD2 A;  1LFH A;  1MY3 A;  2F5X A;  4ESW A;  1MQI A;  3RUM A;  4MLV A;  4ELR A;  2PCR A;  3G3G A;  3GXA A;  3QAX A;  3TQL A;  4THI A;  2KQZ A;  4XTC Q;  4GLI A;  4BDR A;  2DQV A;  1HSJ A;  2B4M A;  2XXU A;  1MDP 1;  3FIR A;  3K4U A;  3T9X B;  1D9Q A;  1IMB A;  3O6I A;  5ET6 A;  1FQB A;  4F1V A;  2PT1 A;  4GWY A;  1DOT A;  3TEP A;  3JZJ A;  2E0S A;  1LFI A;  2Q2C A;  1MXY A;  3LSF B;  3CI8 A;  1KZ8 A;  1YXI A;  4MFI A;  1B3H A;  2I0B A;  1B52 A;  2Q9T A;  3KN7 A;  3VDF A;  1N7X A;  4U4S A;  3KFM A;  3RLF E;  5I57 A;  4L17 A;  3GLB A;  3GYY A;  1N84 A;  1FTK A;  3OO7 A;  3PPO A;  4ZED A;  1N0T A;  2DSF A;  3I3V A;  5IZ3 B;  4FE8 A;  1CE2 A;  2AYS A;  3FZV A;  1FBE A;  2FA7 A;  4H6D A;  1CB6 A;  5I2N A;  1ANF A;  4AS5 A;  2XXT A;  5CMC A;  4HCY A;  1QKB A;  2REG A;  4PGN A;  5KCJ A;  1TFD A;  2OWS A;  1FTJ A;  1OLC A;  3A09 A;  4LP2 B;  3SET A;  5TPA B;  3W9W A;  4KHZ E;  4YAH X;  4IR8 A;  4PAI A;  1FBG A;  1LBZ A;  3H6U A;  5FBP A;  1B5I A;  2QVU A;  1XS5 A;  2Q8J A;  3SEW A;  3A3C A;  1DPP A;  1QUL A;  4N6D A;  4OA4 A;  1H43 A;  3MW0 A;  1B3E A;  1POT A;  1BKA A;  3K01 A;  2HXR A;  2DVZ A;  1A55 A;  4N6K A;  1MQJ A;  3FAS A;  1NFT A;  2H25 A;  4RY1 A;  3USD A;  4Z7E A;  4QHQ A;  3B6W A;  1H45 A;  3PV0 E;  3M3L A;  5CMB A;  4YB7 A;  2HQ0 A;  1MH3 A;  1Y20 A;  1NV0 A;  1M5F A;  2G93 A;  4LQ2 A;  4DLD A;  2I58 A;  4PF8 A;  4RYA A;  3QIM A;  3PMV A;  4IO6 A;  2QL3 A;  3UA8 A;  2DE3 A;  1IIT A;  4NWD A;  2F78 A;  5F7V A;  2Y5K A;  2AL4 A;  4ELO A;  1S50 A;  3PD9 A;  1SW5 A;  2RCA A;  2ZNT A;  1VFD A;  2XXI A;  1NKX A;  3B50 A;  3IO4 A;  5L9O A;  1B4Z A;  1Y4T A;  1UTH B;  3SEU A;  3OMB A;  4QRZ A;  1P1U A;  2F3D A;  1A7L A;  5CC2 A;  1LCF A;  1VR5 A;  2HEU A;  1POY 1;  4POX A;  1ATG A;  5H8N A;  1FBC A;  3I6V A;  4R6K A;  4H67 A;  3Q29 A;  5FTI A;  4C1T A;  3HST A;  1FQA A;  1ZTY A;  5I7I A;  3FXQ A;  1MY1 A;  3M3K A;  1JW1 A;  1QUJ A;  1BP5 A;  4DXU A;  4H5F A;  2WYK A;  1MG1 A;  2UVG A;  5ET7 A;  2A5S A;  2XD2 A;  2XX9 A;  4X1B A;  4DZ1 A;  2OBG A;  3IJO B;  3ZKL A;  1FQC A;  2MKZ A;  4LAT A;  4PE5 B;  1LB8 A;  5I58 A;  2DWA A;  3PPQ A;  2FIX A;  3PMW A;  4QSC A;  2OLB A;  2QS4 A;  4I8C A;  3S9E A;  4NF5 B;  5JTY B;  3RPL A;  5H8F A;  2F7C A;  2Q8M A;  3O9P A;  4GX4 A;  2ANJ A;  1IMA A;  5IGA A;  2XXX A;  3BKI B;  3K1M A;  4R9G A;  3W9V A;  4MNC A;  3FVO A;  1GR2 A;  4F22 A;  3U92 A;  3T9V A;  3C35 A;  3WAF A;  1T0K A;  4LZ8 A;  3CFL A;  2OWT A;  5ICQ A;  4NF6 B;  1QJM A;  5KCJ B;  4F3B A;  4NX1 A;  3E78 A;  4H8I A;  3EF7 A;  4X48 A;  3FVN A;  3MZB A;  5EQA A;  4ESX A;  1XT8 A;  4DE8 A;  1SI0 A;  2H4I A;  1ZIU A;  3TTK A;  1NNK A;  3OEN A;  2Y7K A;  2QMW A;  4I9D A;  4WXJ A;  4X04 A;  3RT8 A;  3CG1 A;  1A40 A;  2CEX A;  4XKR A;  3PPP A;  3IB2 A;  3KBZ A;  2X7Q A;  2HZL A;  3CSG A;  2YJP A;  2ZXT A;  3D1R A;  1NH8 A;  2O7I A;  1H3D A;  4ZS9 A;  2Z8F A;  3KG2 A;  4JB7 A;  4R6Y A;  1IMD A;  2V4C A;  4N6P A;  1INP A;  1Y3N A;  4R2F A;  1PBQ A;  3ISP A;  4UA8 A;  3Q25 A;  3DLN A;  2Z23 A;  3VVD A;  3IK6 B;  2IEE A;  1B05 A;  1IME A;  1JVY A;  1NNF A;  3PMX A;  4FAJ A;  4OYV A;  4QSE A;  4DXC A;  4EUO A;  3C31 A;  1B3L A;  1EYJ A;  3D4G A;  5CMK A;  4DCX A;  2HFB A;  1URS A;  3OEK A;  1B3F A;  1EU8 A;  4N4U A;  2XXR A;  3O28 A;  4GIZ A;  4GQO A;  1ZKB A;  2PVU A;  2I6E A;  4QFP A;  4OEV A;  1PEB A;  2P3N A;  1Q9D A;  1UTH A;  1IXC A;  4TQU Q;  5CBR A;  5DVI A;  1Q1K A;  3PTY A;  2GHA A;  3RGY A;  2O69 A;  4PAF A;  5I59 B;  5AE4 A;  4NQ8 A;  3KGC A;  2PFZ A;  4JWO A;  1DBZ A;  1QVS A;  4RXL A;  4QXD A;  5TU0 A;  2Q89 A;  1RDY A;  3EHS A;  2Y7R A;  3U65 A;  1LAF E;  4H46 A;  5LOM A;  3HFU A;  1B5H A;  3ROJ A;  3GZG A;  3TTR A;  3BBR A;  4ZEI A;  2FYI A;  4JXI A;  4GWZ A;  1YZ0 A;  1IEJ A;  1FPK A;  2WKY A;  2XA5 A;  1KA1 A;  2XX7 A;  3EPE A;  4JSD A;  5EQ9 A;  3DEL B;  1P1Q A;  1S7Y A;  4R9F A;  3OOA A;  4NF4 A;  4NED A;  4NAP A;  1M5C A;  3O6G A;  1ZJL A;  1OMP A;  3KSX A;  4NF5 A;  3RT6 B;  2DWJ A;  3SDF A;  3RPL B;  5JTY A;  1MY2 A;  4KYS A;  2XD3 A;  3K00 A;  5KDT B;  1N04 A;  4QBA A;  3R7X A;  4YMA A;  1MM7 A;  3S9L C;  1I6A A;  1SI1 A;  3MP6 A;  1XVY A;  1O63 A;  3H6V A;  1PB8 A;  1URD A;  2H5Y A;  1KWH A;  3KBR A;  3BFU A;  4ZEC A;  2I3W A;  4EXL A;  5EQ8 A;  3KC0 A;  4P56 A;  1R9L A;  5H8H B;  3RN8 A;  1FPG A;  5ESY A;  3CRB A;  4XKP A;  4MNP A;  4OZ9 A;  2UYE A;  3CVG A;  4EQB A;  1I69 A;  1MY4 A;  2F3B A;  3PU5 A;  3TTM A;  2UVI A;  4YKJ A;  1HSL A;  2OK2 A;  5H8S A;  2O6A A;  2Y7I A;  1QUK A;  4GWO A;  4O7M A;  2FNC A;  4MX6 A;  2OX3 A;  4GL8 A;  1NV2 A;  3U94 A;  3N6T A;  1JET A;  4PTK A;  3FXU A;  3MVY A;  4I3Y A;  3TUS A;  3HHG A;  2XHD A;  3TTN A;  3RY3 A;  2O1L A;  2AIX A;  5DEX A;  5CBS A;  2O51 A;  4KD5 A;  3MYU A;  4PFI A;  4NN3 A;  4PF6 A;  1TWY A;  5AA2 D;  1MPC A;  4R73 A;  4LVQ A;  3FJ7 A;  2CMO A;  3SEV A;  4KCC A;  3HO7 A;  1D9Y A;  2A5T A;  4X9T A;  2ZYK A;  5I3S A;  5JK4 A;  2Q88 A;  3T0J A;  1M5D A;  3PUV E;  3H3G A;  2ZNU A;  2PT2 A;  1N76 A;  2OZZ A;  1D3K A;  4P0G A;  4N8G A;  5FHO A;  3FUZ A;  5FHM A;  3N26 A;  2V93 A;  4X1D A;  2R6G E;  3C9H A;  3W15 C;  2O68 A;  1US4 A;  2GFE A;  1VSO A;  4RPN A;  5DTB A;  3QUJ A;  1B0H A;  3MVZ A;  4PFR A;  1R6Z A;  4E0X A;  4G68 A;  5H8Q B;  1XC1 A;  3OO6 A;  3FBP A;  3UP9 A;  1AWB A;  2R71 A;  3IJX B;  2RCB A;  3SZP A;  2QMX A;  2RIN A;  3SEY A;  1IUD A;  1Y4C A;  2HPG A;  4NF6 A;  1O7T A;  2DS9 A;  4MLQ A;  3IFA A;  3G3F A;  4NHB A;  3MST A;  5LDZ A;  3H03 A;  4ZZE A;  5B7D A;  3TMG A;  3VV5 A;  2JJK A;  3MZ1 A;  1UTB B;  2ESN A;  5CRY A;  4ZEK A;  2YPN A;  4JSO A;  3FVG A;  2I49 A;  1NV7 A;  2NVU B;  4GD5 A;  1N7W A;  1WDN A;  3H4Z A;  3IB0 A;  1DSN A;  2CZI A;  3S9N C;  1TXF A;  4HW8 A;  5KDT A;  3OO8 A;  3E3K A;  3JYR A;  3K6W A;  1B58 A;  3NOH A;  5L8D A;  1LBY A;  2F6P A;  4MMP A;  1JVX A;  3V89 B;  1AOV A;  5AA2 A;  1LBB A;  1Y9U A;  4PFW A;  3TDJ A;  3HPI A;  1B0L A;  1RDZ A;  4GWW A;  2KLF A;  3PD8 A;  4F1U A;  2VPN A;  2IA4 A;  3O2A A;  2O7U A;  1FQE A;  2WBB A;  2I4B A;  2NOO A;  4HCW A;  3T9U A;  2XWI A;  5ELV A;  1EH3 A;  4IGR A;  1FPI A;  1US5 A;  2I3V A;  2P3V A;  4F1Y A;  1S9T A;  4Z0I A;  4BDQ A;  5I2K B;  3VVE A;  3IAZ A;  4Q8R A;  4PET A;  5IZ3 A;  2RKM A;  3RYD A;  3RQT A;  2HCA A;  5I59 A;  1MH4 A;  2R9J A;  2THI A;  3MVW A;  5ITP A;  1PB7 A;  2O1M A;  4GBV A;  3GBB A;  2QJE A;  4UAB A;  3QSL A;  4OVT A;  1JNF A;  3KOS A;  4R74 A;  4G68 C;  4ZE8 A;  1TFA A;  3ZKK A;  1FJ9 A;  4NE4 A;  4U2R A;  1FPL A;  4AB6 A;  1MXZ A;  1P1W A;  4M4G A;  4KPT A;  1DMB A;  2G29 A;  1XHY A;  1Z7N E;  4NF4 B;  2V3T A;  3UN6 A;  2AL5 A;  1B9J A;  2B3B A;  4PP0 A;  4Q30 B;  4G8N A;  2D5W A;  4GRK A;  4PFT A;  5DYH A;  3EHT A;  3RNN A;  2PFY A;  1LEV A;  3IFC A;  3MAM A;  4OVQ A;  4XKN A;  3T9H B;  1SPI A;  3F11 A;  4RK9 A;  2F36 A;  3FD3 A;  1G0I A;  3UK4 A;  3S2V A;  3OEM A;  1IXG A;  1LBW A;  1LBX A;  3E9X A;  1YYZ A;  1SW1 A;  1MM6 A;  1LLS A;  2ALU A;  4IO3 A;  4XXU A;  1L5T A;  1P1O A;  2L5V A;  2M8C A;  4ND9 A;  1EYK A;  5HM4 B;  1NV6 A;  3GBA A;  1FPJ A;  5A5L A;  1B4H A;  4MAG A;  4O7I A;  2P0S A;  1FTA A;  4KYE A;  4I40 A;  4IGT A;  1NV5 A;  4QFK A;  3QUF A;  1PBP A;  1RYX A;  2HXW A;  2VOZ A;  3L6G A;  3RTF B;  3O29 A;  3HN0 A;  3RTW B;  2XXY A;  5K2Y A;  2HAV A;  3UGW A;  4PFY A;  2X26 A;  4HS7 A;  5ITO A;  4U22 A;  4IO2 A;  4F3S A;  1XI6 A;  2P2A A;  1ZLQ A;  4F2O A;  3ONM A;  5A5X A;  3K02 A;  3EQ1 A;  4F19 A;  1CNQ A;  1DPE A;  4DI4 B;  2PX1 A;  4H1X A;  1H44 A;  4WED A;  1FRP A;  1LGB C;  4PC9 A;  4QSD A;  5IKB A;  1FCK A;  1Q35 A;  2UXA A;  2ZYN A;  2UVJ A;  1USY E;  2OWZ A;  1Z7M E;  3O97 A;  1I6B A;  4P1L A;  1II5 A;  3U72 A;  1OIB A;  4EQ9 A;  1GVC A;  3VVF A;  1A99 A;  2OJT A;  1GGG A;  4KCD A;  2WBD A;  3D4C A;  3EHU A;  2I0C A;  3M8U A;  1B32 A;  3LSW A;  4PAK A;  2DXR A;  2ONS A;  4I1D A;  4WKM A;  5CI5 A;  1FPB A;  1MQG A;  3VXB A;  3TCH A;  2DWI A;  1LST A;  3N5L A;  3S9M C;  3TPA A;  3FXR A;  4Q0C A;  3VXC A;  2X7P A;  3R6U A;  2RF1 A;  4JBZ A;  4LQ5 A;  5TP9 B;  5ICT A;  1DK4 A;  3SES A;  2E1S A;  3IOU A;  4YU0 A;  1B1X A;  2ABH A;  2PMS A;  1B3G A;  1EYI A;  2QS3 A;  4O94 A;  2NXO A;  4GBW A;  4G4P A;  2ZYO A;  1D4N A;  1FTO A;  1I6Q A;  1BLF A;  5F24 A;  2DOJ A;  4OET A;  5EYG A;  1XOC A;  4ELQ A;  3QK6 A;  3K6U A;  4O3B A;  1F9B A;  3C34 A;  5K2X A;  4P3L A;  2CZH A;  1B5J A;  1ZMG A;  2GH9 A;  4ZZA A;  2F7A A;  4OVJ A;  3KN3 A;  3PPR A;  2Q2A A;  2DVC A;  4GWS A;  4F29 A;  5JEI A;  4KI0 E;  1B51 A;  3TEL A;  1M5B A;  3OSR A;  1LFG A;  2FBP A;  4P0I A;  3TTL A;  3CFZ A;  1XVX A;  3VFJ A;  4JDF A;  4R75 A;  4RK2 A;  4YB6 A;  1ELJ A;  3I5O A;  2UYF A;  1B6H A;  4NWC A;  2GRV A;  4OEU A;  2QVV A;  3THI A;  1RYO A;  1P1N A;  3VLV A;  2B3F A;  4LZ5 A;  4Q5T A;  4DI3 D;  5DVJ A;  5AA2 B;  3MWB A;  4XFE A;  1IMC A;  3UIF A;  1NNT A;  2BJI A;  3KSJ A;  4GX3 A;  1WOD A;  1FQD A;  4M1V A;  3ZSF A;  3K6X A;  5H8H A;  4N8Y A;  4NTL A;  3C4M A;  2H98 A;  4AS4 A;  4E0W A;  1LAG E;  2QPQ A;  4IY5 A;  4G61 A;  1FW0 A;  3K2D A;  2XXQ A;  3LUY A;  2H99 A;  3IOW A;  4I3E A;  4K3F A;  4PFB A;  1GV8 A;  1O64 A;  2F97 A;  4IB2 A;  3C32 A;  4FAT A;  1MDQ A;  4GWX A;  4U1Z A;  4IO5 A;  4EF1 A;  3VE1 B;  1QGX A;  4G8M A;  4PBQ A;  3T93 B;  1J1N A;  5EYH A;  2KR0 A;  1FBF A;  4H45 A;  2Z8E A;  3IO6 A;  2XWK A;  4OHN A;  2OCU A;  1DCU A;  5I56 B;  1OVT A;  1B7H A;  1BTJ A;  3BFT A;  4O3C A;  4R6H A;  3SEX A;  1H76 A;  4OFL A;  2DE4 A;  2Y7P A;  4EXK A;  2VGQ A;  3RPW A;  3C36 A;  2V25 A;  2Y7W A;  4YZZ A;  4G77 A;  2GQ1 A;  4BLA A;  4ELP A;  4TLL B;  4RJZ A;  4KXP A;  2O84 X;  3MP8 A;  5IZZ A;  4MH5 A;  1VFE A;  5I57 B;  4HTG A;  4OER A;  4KYD A;  4I62 A;  4GOT A;  3CHG A;  1OVB A;  4OAN A;  4ZEF A;  3K6V A;  1B46 A;  4TOZ A;  1WVJ A;  3H7M A;  2ONR A;  2F6G A;  3ILT B;  1NNP A;  2XXK A;  1BK4 A;  2R8T A;  4NF8 B;  1NI9 A;  3G3K A;  1NV3 A;  3B6Q A;  4WEP A;  1FBD A;  4JWX A;  4P1E A;  2W7Y A;  3M3F A;  1JEV A;  2I48 A;  4ONY A;  1B40 A;  1SYH A;  2LAO A;  3S4U A;  4XKQ A;  1JW4 A;  2XWV A;  4G8H A;  3TZA A;  4U1O A;  3KEI A;  1DTZ A;  1QW0 A;  2VT5 A;  4JVD A;  4RNS A;  2CZL A;  5IZ1 A;  1SW4 A;  4NF0 A;  3LBS A;  3T66 A;  2ZYM A;  4MEV A;  4XIG Q;  1M5E A;  1URG A;  4PBH A;  4LA9 A;  2RC7 A;  3B8B A;  3B7D A;  3N94 A;  3MVX A;  5CM6 A;  1SYI A;  4GX6 A;  1JEU A;  2XXV A;  4MBP A;  1BIY A;  3LV0 A;  4DXB A;  1QUI A;  1YCJ A;  5AA4 A;  5B70 A;  1NUY A;  4MNI A;  5FTH A;  1USY H;  3TKD A;  2B4L A;  1A8F A;  3KN8 A;  2F34 A;  4F39 A;  4P47 A;  3IX1 A;  1LBC A;  2V84 A;  1UIV A;  3H06 B;  1K9Z A;  3B6T A;  3VLU A;  4OTE A;  1LCT A;  3ODB A;  1Y1Z A;  4MJO A;  1IXI A;  1SDX A;  2GHB A;  3OSQ A;  4EF2 A;  4IY6 A;  3U1O A;  3JV9 A;  4OVS A;  4OEN A;  5AA1 A;  1B1H A;  2I4C A;  1B7U A;  3HV1 A;  3O6H A;  1ZBM A;  5L9S A;  1NMU A;  1DTG A;  1MS7 A;  2D3I A;  2F7B A;  1MQD A;  4KR5 A;  5I2K A;  3A29 A;  1R9Q A;  1VDW A;  2H9B A;  4P9K A;  3BIG A;  3Q28 A;  5TP9 A;  5ISU A;  1D9V A;  4QFN A;  4G2Z A;  4ZDM A;  3LSX A;  3TFL A;  1JQF A;  2DXY A;  2NUV A;  4GXA A;  5IAI A;  4OQO A;  4MIJ A;  3ILU B;  1SW2 A;  4YKK A;  4C1U A;  2HHM A;  1YPN A;  2QS1 A;  3LUZ A;  4F18 A;  3L6H A;  2XXH A;  4RA1 A;  3FV2 A;  4RPO A;  4LN5 A;  4EQ7 A;  4H0W A;  3SER A;  4XEQ A;  1FPE A;  3CR9 A;  4UAC A;  2QSX A;  1AMF A;  3DP8 A;  4IO7 A;  4MHF A;  4LUB A;  4NGU A;  3LSL A;  1NUX A;  4F2Q A;  4H8J A;  1Y3Q A;  4PE3 A;  5DVF A;  3SKP A;  1Y1M A;  2BJJ X;  4R72 A;  1IIW A;  3WAE A;  4QFO A;  2HAU A;  1PC3 A;  1MRP A;  3Q26 A;  3TCG A;  2V3Q A;  3TOD A;  2WYP A;  3C33 A;  3V83 A;  1N3X A;  4HXV A;  1AH5 A;  5T3J A;  4X8R A;  3TCF A;  1SD3 A;  3VLW A;  2ZZX A;  4ECF A;  1IZ1 A;  1NV4 A;  3QYT A;  4DDD A;  5M2V A;  4BDM A;  4FJP A;  1SVX B;  4H5G A;  2ZMB A;  3KJ7 A;  1GTK A;  2VP1 A;  1G0H A;  2P1S A;  5I5P A;  3T22 A;  2D21 A;  3P7I A;  4OWD A;  2XXP A;  5AA3 A;  3CFX A;  2FHY A;  3CIJ A;  3G3H A;  1PDA A;  4O8M A;  2WEF A;  3TAJ A;  3MJN A;  3DM0 A;  3V8X B;  4YKP A;  3IOT A;  4N91 A;  4NG7 A;  4N81 A;  1FSA A;  4FED A;  3EKI A;  3KOT A;  3MBP A;  4BDL A;  1LAH E;  5KZT A;  4U4X A;  2CEY A;  3LC8 A;  1P99 A;  4EDP A;  2FIE A;  4NMY A;  3HCQ A;  4GFR A;  5H8N B;  3O66 A;  5LTC A;  1ZU0 A;  3FV1 A;  5EYF A;  4PDD A;  4GWU A;  2DP8 A;  4F3P A;  3FGS A;  3ECR A;  2YLN A;  2QRY A;  4POW A;  3PUX E;  3FJM A;  2ONK E;  5ET8 A;  2RC9 A;  3T96 B;  2PBW A;  3PPN A;  2VD3 A;  3R26 A;  1R1N A;  3FXB A;  4P8B A;  5I58 B;  4P11 A;  5IM2 A;  4PDH A;  1NH7 A;  3G3I A;  1B2H A;  2QS2 A;  3BIH A;  5F1Q A;  4N07 A;  1JP4 A;  1K9Y A;  1A54 A;  3MP1 A;  2HZK A;  2PYY A;  1NUW A;  3ZS6 A;  1MQH A;  3PGF A;  1KA0 A;  3TYH A;  3U8Q A;  5J16 A;  1FBP A;  1A8E A;  4MF3 A;  1MPB A;  4N15 A;  5I2N B;  3Q27 A;  4QFL A;  4OMB A;  2ZZW A;  4ISU A;  3MC2 A;  1UQW A;  3MUQ A;  4TLM B;  1MXX A;  3PUY E;  4ZE9 A;  1OLA A;  3OXN A;  3K1N A;  2DWH A;  5EHM A;  1MXV A;  4R2B A;  1MY0 A;  5EHS A;  4AQ4 A;  4GVO A;  3U93 A;  1TT1 A;  5TPA A;  1IQ7 A;  3KJT A;  1FTM A;  2ZZV A;  3G7W A;  1NV1 A;  3AXF A;  1LB9 A;  3FJG A;  4ZEB A;  1OQG A;  4OES A;  4HE0 A;  4PGP A;  1LBV A;  1EZP A;  3IOR A;  4FEC A;  3V5A A;  4MCO A;  3KC1 A;  5A5X B;  3FAT A;  4XF5 A;  4OVP A;  4O3A A;  3N6U A;  5AA4 B;  4HE2 A;  3FVK A;  4C0R A;  1FJ6 A;  4N17 A;  5DT6 A;  4HE1 A;  4DCY A;  3HHF A;  4PQJ A;  1FQF A;  4YIC A;  1EZO A;  2XX8 A;  1YTV A;  3MZ9 A;  4FOR A;  2VPO A;  3OEL A;  2REJ A;  3E79 A;  2XWO A;  1LAX A;  4DIG A;  3IL1 B;  5HBC A;  1FBH A;  1FPF A;  2FVZ A;  2DDK A;  4AB5 A;  4F3G A;  2Y5L A;  2QVR A;  2F35 A;  1MXW A;  2Z22 A;  1FPD A;  4KQP A;  2XXW A;  3T1B A;  3UOR A;  3G3J A;  1RKM A;  5DW8 A;  3OO9 A;  5DEX B;  4U21 A;  1N3W A;  1IXH A;  4BDN A;  5I56 A;  4U23 A;  4PFU A;  4OFO A;  2WX9 A;  3A3U A;  1VE4 A;  3QXM A;  1EZ9 A;  4GXS B;  3IOV A;  1SQY A;  3LR1 A;  1FTL A;  5L9M A;  1MPD A;  4H65 A;  4JVI A;  5J1D A;  2A5T B;  4BDO A;  3TQW A;  4PCD A;  2Q74 A;  4KFQ A;  2F8D A;  4JWY A;  4LZ7 A;  4YKI A;  2NWJ A;  3DP6 A;  3DP4 A;  4YB5 A;  1HSE A;  3IR1 A;  3CG3 A;  3K1P A;  1PB9 A;  2VHA A;  5ET5 A;  4FBP A;  1JW5 A;  1UIU A;  3MPK A;  2DYX A;  5BWJ A;  2Y84 A;  5FHN A;  2B65 A;  3K0V A;  4GL0 A;  5BUU A;  2V3U A;  3IB1 A;  3OD7 A;  1YAE A;  1MXU A;  1IMF A;  1SBP A;  5H8F B;  4NF8 A;  4G68 B;  5H8Q A;  3E13 X;  2QFL A;  2RC8 A;  3KZG A;  4F31 B;  1AIV A;  5HPQ A;  2DE2 A;  1Y3P A;  4N13 A;  5CMM A;  3MQ9 A;  4OFJ A;  4FEB A;  3CSB A;  1AL3 A;  3PUZ E;  4LON B;  2Z8D A;  3H6W A;  2ZNS A;  3E4R A;  1NL5 A;  1NUZ A;  1OQH A;  1RDX A;  4QF9 A;  3QMF A;  3PUW E;  3H6T A;  1QKA A; 
#chains in the Genus database with same CATH homology
 1Q1K A;  1B7Z A;  1B4H A;  4YMB A;  4OXV A;  2GHA A;  4FIM A;  3RGY A;  2UVH A;  3EN3 A;  1R9Q A;  2P0S A;  2H9B A;  2O69 A;  3MPL A;  4GF8 A;  3Q28 A;  4KYE A;  5TP9 A;  5AE4 A;  1UTB A;  1D9V A;  5I59 B;  5I84 A;  5ISU A;  4IGT A;  4QFN A;  4G2Z A;  4IO4 A;  3KGC A;  2VD2 A;  4ZDM A;  3LSX A;  4QFK A;  1LFH A;  1MY3 A;  2F5X A;  3QUF A;  4ESW A;  1MQI A;  1JQF A;  1PBP A;  3TFL A;  4JWO A;  2DXY A;  1RYX A;  2NUV A;  4GXA A;  1QVS A;  3RUM A;  2HXW A;  2VOZ A;  4RXL A;  5IAI A;  4OQO A;  3L6G A;  5TU0 A;  2Q89 A;  3RTF B;  3EHS A;  4MLV A;  2Y7R A;  3HN0 A;  3ILU B;  3O29 A;  3RTW B;  4ELR A;  1LAF E;  1SW2 A;  2HAV A;  2XXY A;  4YKK A;  4PFY A;  5K2Y A;  2X26 A;  4HS7 A;  3UGW A;  1YPN A;  5ITO A;  4U22 A;  2QS1 A;  4IO2 A;  5LOM A;  1B5H A;  4F18 A;  4F3S A;  3G3G A;  3GZG A;  2XXH A;  3L6H A;  4RA1 A;  3TTR A;  3BBR A;  4ZEI A;  2FYI A;  1ZLQ A;  2P2A A;  3FV2 A;  3ONM A;  4JXI A;  4RPO A;  3K02 A;  3EQ1 A;  4F19 A;  4F2O A;  1DPE A;  3GXA A;  5A5X A;  3QAX A;  2PX1 A;  4H1X A;  1H44 A;  4WED A;  4THI A;  1IEJ A;  3TQL A;  4EQ7 A;  5L9S A;  1LGB C;  4QSD A;  4H0W A;  3SER A;  2WKY A;  5IKB A;  1FCK A;  2XX7 A;  3EPE A;  1Q35 A;  4XTC Q;  2UXA A;  2ZYN A;  2UVJ A;  3CR9 A;  1USY E;  2QSX A;  4GLI A;  4JSD A;  4UAC A;  1AMF A;  3DEL B;  4BDR A;  3DP8 A;  1P1Q A;  4IO7 A;  1S7Y A;  1Z7M E;  4LUB A;  3LSL A;  4R9F A;  3OOA A;  2DQV A;  1HSJ A;  4NF4 A;  4F2Q A;  2XXU A;  1MDP 1;  3O97 A;  1I6B A;  3FIR A;  3K4U A;  4H8J A;  1II5 A;  4NED A;  3T9X B;  1M5C A;  1Y3Q A;  5DVF A;  3O6G A;  3U72 A;  1ZJL A;  3SKP A;  1OIB A;  1OMP A;  1Y1M A;  2BJJ X;  3KSX A;  1GVC A;  4EQ9 A;  4NF5 A;  4R72 A;  3O6I A;  3VVF A;  3RT6 B;  1IIW A;  2DWJ A;  3WAE A;  4QFO A;  2HAU A;  3SDF A;  1FQB A;  4F1V A;  1A99 A;  1PC3 A;  5JTY A;  2PT1 A;  1MRP A;  1MY2 A;  1DOT A;  2OJT A;  3TEP A;  4KYS A;  3Q26 A;  3JZJ A;  1GGG A;  4KCD A;  2E0S A;  3TCG A;  2XD3 A;  1LFI A;  3K00 A;  3D4C A;  5KDT B;  2Q2C A;  1MXY A;  3EHU A;  3LSF B;  1N04 A;  2V3Q A;  3TOD A;  3CI8 A;  2I0C A;  3M8U A;  3C33 A;  3R7X A;  4YMA A;  3V83 A;  1B32 A;  1MM7 A;  1N3X A;  1B3H A;  1AH5 A;  1B52 A;  1I6A A;  2DXR A;  2I0B A;  1SI1 A;  2ONS A;  2Q9T A;  3MP6 A;  3S9L C;  3TCF A;  3VLW A;  1SD3 A;  3KN7 A;  3VDF A;  1N7X A;  1XVY A;  1O63 A;  4I1D A;  4U4S A;  4ECF A;  1IZ1 A;  3H6V A;  1PB8 A;  4WKM A;  1URD A;  2H5Y A;  3KFM A;  5CI5 A;  3RLF E;  1MQG A;  3QYT A;  1KWH A;  3VXB A;  4L17 A;  3LSW A;  3KBR A;  3GLB A;  3BFU A;  4DDD A;  4ZEC A;  2I3W A;  1N84 A;  5M2V A;  2DWI A;  1LST A;  3TCH A;  1FTK A;  4BDM A;  4FJP A;  4EXL A;  1SVX B;  4H5G A;  2ZMB A;  3N5L A;  3S9M C;  3KJ7 A;  3TPA A;  3FXR A;  3OO7 A;  1GTK A;  3PPO A;  4ZED A;  4Q0C A;  3VXC A;  1R9L A;  5H8H B;  1N0T A;  2DSF A;  2VP1 A;  2X7P A;  3RN8 A;  2P1S A;  3R6U A;  3T22 A;  2D21 A;  3I3V A;  3P7I A;  4OWD A;  2RF1 A;  4FE8 A;  3CRB A;  1CE2 A;  2AYS A;  4XKP A;  4OZ9 A;  2UYE A;  3FZV A;  4JBZ A;  3CVG A;  4EQB A;  2FA7 A;  1I69 A;  4LQ5 A;  2XXP A;  1MY4 A;  3PU5 A;  5TP9 B;  5ICT A;  4H6D A;  3TTM A;  5AA3 A;  1CB6 A;  3CFX A;  2UVI A;  4YKJ A;  3SES A;  5I2N A;  2E1S A;  3IOU A;  1HSL A;  1B1X A;  2ABH A;  3CIJ A;  4YU0 A;  3G3H A;  1PDA A;  2OK2 A;  1ANF A;  2PMS A;  5H8S A;  4MFI A;  2XXT A;  3TAJ A;  2O6A A;  3MJN A;  1B3G A;  3DM0 A;  2Y7I A;  5CMC A;  4HCY A;  3V8X B;  2QS3 A;  1QKB A;  1QUK A;  4GWO A;  2NXO A;  2REG A;  4YKP A;  4G4P A;  2ZYO A;  3IOT A;  2FNC A;  4GL8 A;  5KCJ A;  1TFD A;  2OWS A;  1D4N A;  1FTO A;  1I6Q A;  1BLF A;  1FTJ A;  4FED A;  3U94 A;  1OLC A;  3N6T A;  3KOT A;  3MBP A;  2DOJ A;  4OET A;  1JET A;  3A09 A;  4LP2 B;  4BDL A;  1LAH E;  1XOC A;  3SET A;  5KZT A;  4U4X A;  4ELQ A;  3QK6 A;  3FXU A;  1P99 A;  3K6U A;  3LC8 A;  3MVY A;  4O3B A;  1F9B A;  5TPA B;  3W9W A;  4NMY A;  4KHZ E;  3HCQ A;  3HHG A;  3C34 A;  4GFR A;  4YAH X;  2XHD A;  5K2X A;  1B5J A;  1ZMG A;  3RY3 A;  2GH9 A;  3TTN A;  3O66 A;  5H8N B;  2O1L A;  4ZZA A;  2AIX A;  5DEX A;  2F7A A;  1ZU0 A;  4OVJ A;  3KN3 A;  3PPR A;  5AA1 A;  3H6U A;  2Q2A A;  2DVC A;  1B5I A;  3FV1 A;  5EYF A;  5CBS A;  2O51 A;  1XS5 A;  2Q8J A;  3SEW A;  4F29 A;  5JEI A;  2DP8 A;  4F3P A;  4KD5 A;  3FGS A;  1B51 A;  2YLN A;  3ECR A;  4KI0 E;  1M5B A;  3OSR A;  1LFG A;  3TEL A;  1TWY A;  4P0I A;  3TTL A;  3A3C A;  3CFZ A;  1MPC A;  2QRY A;  4R73 A;  1DPP A;  1XVX A;  4LVQ A;  1QUL A;  4POW A;  3VFJ A;  3FJ7 A;  4JDF A;  2CMO A;  3SEV A;  3PUX E;  4KCC A;  1H43 A;  4R75 A;  4RK2 A;  3MW0 A;  5I57 A;  3HO7 A;  4YB6 A;  1ELJ A;  1B3E A;  1POT A;  1BKA A;  2A5T A;  1D9Y A;  3FJM A;  3I5O A;  3K01 A;  2DVZ A;  2ONK E;  2UYF A;  4X9T A;  1B6H A;  1A55 A;  4NWC A;  2RC9 A;  2ZYK A;  3T96 B;  2GRV A;  2PBW A;  1MQJ A;  2VD3 A;  3PPN A;  2Q88 A;  3FAS A;  3R26 A;  1NFT A;  2H25 A;  4OEU A;  4RY1 A;  1M5D A;  3PUV E;  3USD A;  4Z7E A;  1R1N A;  3H3G A;  4QHQ A;  3B6W A;  2ZNU A;  1H45 A;  2PT2 A;  5I58 B;  4P11 A;  3THI A;  1RYO A;  3PV0 E;  1N76 A;  2OZZ A;  1P1N A;  1D3K A;  1NH7 A;  3VLV A;  4P0G A;  3M3L A;  2B3F A;  5CMB A;  4LZ5 A;  4Q5T A;  4YB7 A;  3G3I A;  1B2H A;  2QS2 A;  5DVJ A;  5F1Q A;  5FHO A;  5AA2 B;  3MWB A;  3FUZ A;  2HQ0 A;  5FHM A;  4N07 A;  3N26 A;  2V93 A;  1A54 A;  3UIF A;  1MH3 A;  1NNT A;  1Y20 A;  3KSJ A;  3MP1 A;  4X1D A;  1FQD A;  1WOD A;  2HZK A;  1M5F A;  2G93 A;  2PYY A;  2R6G E;  2O68 A;  3C9H A;  1US4 A;  2GFE A;  4LQ2 A;  4M1V A;  3W15 C;  1VSO A;  4RPN A;  5DTB A;  3ZSF A;  3QUJ A;  3ZS6 A;  1B0H A;  3K6X A;  2I58 A;  1MQH A;  3MVZ A;  5H8H A;  3PGF A;  4DLD A;  3TYH A;  4RYA A;  3QIM A;  3PMV A;  3U8Q A;  1R6Z A;  4IO6 A;  4G68 A;  2QL3 A;  4E0X A;  5H8Q B;  3UA8 A;  1XC1 A;  2DE3 A;  1IIT A;  4NWD A;  1A8E A;  4NTL A;  3OO6 A;  3C4M A;  2H98 A;  4MF3 A;  2F78 A;  5F7V A;  4E0W A;  1MPB A;  2AL4 A;  1LAG E;  3UP9 A;  4ELO A;  5I2N B;  2QPQ A;  3Q27 A;  1S50 A;  4QFL A;  4IY5 A;  4OMB A;  1FW0 A;  3K2D A;  2XXQ A;  3LUY A;  2H99 A;  3IOW A;  3PD9 A;  4ISU A;  1SW5 A;  2R71 A;  3IJX B;  2RCB A;  4K3F A;  1GV8 A;  2RCA A;  2ZNT A;  2QMX A;  1VFD A;  2RIN A;  2XXI A;  3SEY A;  1IUD A;  3MC2 A;  1UQW A;  3MUQ A;  1O64 A;  1Y4C A;  1NKX A;  2F97 A;  3IO4 A;  3C32 A;  4IB2 A;  4NF6 A;  4FAT A;  1MDQ A;  1MXX A;  4TLM B;  5L9O A;  1B4Z A;  1Y4T A;  3PUY E;  1O7T A;  1OLA A;  2DS9 A;  4IO5 A;  4MLQ A;  4U1Z A;  4EF1 A;  4ZE9 A;  1UTH B;  3OXN A;  3K1N A;  3SEU A;  3VE1 B;  2DWH A;  3OMB A;  5EHM A;  1MXV A;  4QRZ A;  3G3F A;  1P1U A;  4G8M A;  1MY0 A;  4R2B A;  3T93 B;  1A7L A;  5CC2 A;  1LCF A;  3H03 A;  4ZZE A;  1J1N A;  1VR5 A;  5EHS A;  4AQ4 A;  4GVO A;  5B7D A;  2HEU A;  3TMG A;  3U93 A;  1TT1 A;  3VV5 A;  1POY 1;  5TPA A;  3MZ1 A;  1UTB B;  2ESN A;  1IQ7 A;  2Z8E A;  3IO6 A;  4POX A;  5CRY A;  1ATG A;  4ZEK A;  5H8N A;  4OHN A;  2YPN A;  3KJT A;  2OCU A;  3I6V A;  4JSO A;  3FVG A;  4H67 A;  4R6K A;  1FTM A;  5I56 B;  3Q29 A;  5FTI A;  1OVT A;  1B7H A;  2I49 A;  1BTJ A;  3BFT A;  4C1T A;  3HST A;  4O3C A;  4R6H A;  1FQA A;  3G7W A;  1ZTY A;  3SEX A;  2NVU B;  5I2K A;  1H76 A;  3AXF A;  1LB9 A;  3FXQ A;  1MY1 A;  3FJG A;  4GD5 A;  1N7W A;  4OFL A;  4ZEB A;  1OQG A;  4OES A;  2DE4 A;  3M3K A;  1WDN A;  3H4Z A;  1JW1 A;  1QUJ A;  3IB0 A;  2Y7P A;  1EZP A;  1BP5 A;  3IOR A;  4FEC A;  4DXU A;  1DSN A;  4EXK A;  2VGQ A;  3V5A A;  3RPW A;  4H5F A;  5A5X B;  3FAT A;  1MG1 A;  3C36 A;  2UVG A;  2V25 A;  3S9N C;  1TXF A;  2Y7W A;  2A5S A;  4YZZ A;  2XD2 A;  2XX9 A;  4X1B A;  4DZ1 A;  2OBG A;  3IJO B;  3OO8 A;  4HW8 A;  4O3A A;  5KDT A;  3E3K A;  3N6U A;  3ZKL A;  1FQC A;  4LAT A;  5AA4 B;  4G77 A;  3JYR A;  3K6W A;  4PE5 B;  4BLA A;  4ELP A;  4TLL B;  3FVK A;  1B58 A;  4C0R A;  1LB8 A;  5L8D A;  5I58 A;  2DWA A;  4RJZ A;  3PPQ A;  2F6P A;  2O84 X;  3PMW A;  5DT6 A;  3MP8 A;  3TUS A;  4MH5 A;  1JVX A;  1VFE A;  5I57 B;  4HTG A;  4OER A;  4KYD A;  4I62 A;  3HHF A;  3V89 B;  4PQJ A;  4QSC A;  4GOT A;  4DCY A;  5AA2 A;  1FQF A;  1OVB A;  4YIC A;  2OLB A;  1LBB A;  2QS4 A;  1EZO A;  2XX8 A;  4ZEF A;  4I8C A;  3K6V A;  1YTV A;  1Y9U A;  1B46 A;  4PFW A;  4TOZ A;  3S9E A;  3MZ9 A;  4NF5 B;  3TDJ A;  4FOR A;  1WVJ A;  3H7M A;  3HPI A;  3OEL A;  2REJ A;  1B0L A;  2ONR A;  2F6G A;  3ILT B;  1LAX A;  1NNP A;  5JTY B;  2KLF A;  5H8F A;  3PD8 A;  4NF8 B;  3G3K A;  4DIG A;  4F1U A;  2F7C A;  3IL1 B;  3B6Q A;  3O9P A;  5HBC A;  2IA4 A;  2ANJ A;  4WEP A;  2XXX A;  4EDP A;  4AB5 A;  3BKI B;  3K1M A;  3O2A A;  5AA2 D;  4JWX A;  4R9G A;  3W9V A;  3FVO A;  4XKR A;  1GR2 A;  2O7U A;  1FQE A;  3U92 A;  3T9V A;  4F22 A;  2I4B A;  3C35 A;  3WAF A;  2W7Y A;  2NOO A;  3M3F A;  4HCW A;  1JEV A;  4LZ8 A;  1T0K A;  3T9U A;  3CFL A;  4F3G A;  2OWT A;  2I48 A;  4ONY A;  5ICQ A;  1B40 A;  1SYH A;  4BDQ A;  5ELV A;  1EH3 A;  4IGR A;  2LAO A;  2F35 A;  1US5 A;  4NF6 B;  1QJM A;  1MXW A;  2Z22 A;  2I3V A;  3S4U A;  5KCJ B;  4F3B A;  4F1Y A;  4KQP A;  4H8I A;  4XKQ A;  1JW4 A;  1S9T A;  3EF7 A;  4X48 A;  3FVN A;  4Z0I A;  2XXW A;  3MZB A;  4G8H A;  5I2K B;  3TZA A;  3VVE A;  4U1O A;  3KEI A;  1DTZ A;  1QW0 A;  3IAZ A;  1XT8 A;  4PET A;  4RNS A;  4ESX A;  4Q8R A;  3UOR A;  2RKM A;  2CZL A;  1SI0 A;  2H4I A;  3RQT A;  4DE8 A;  1ZIU A;  2HCA A;  5I59 A;  3TTK A;  3G3J A;  1RKM A;  1SW4 A;  1NNK A;  3OEN A;  3OO9 A;  1MH4 A;  5DEX B;  2R9J A;  2THI A;  2Y7K A;  4U21 A;  3MVW A;  1N3W A;  1IXH A;  2QMW A;  4I9D A;  4BDN A;  5ITP A;  1PB7 A;  3LBS A;  2O1M A;  3T66 A;  5I56 A;  4WXJ A;  4U23 A;  2ZYM A;  3GBB A;  3RT8 A;  4PFU A;  2QJE A;  1A40 A;  3CG1 A;  4OFO A;  4XIG Q;  3QSL A;  1M5E A;  1URG A;  4LA9 A;  2RC7 A;  3A3U A;  3PPP A;  1JNF A;  1VE4 A;  3IB2 A;  3KOS A;  3QXM A;  4R74 A;  2X7Q A;  4G68 C;  2HZL A;  3B7D A;  3CSG A;  3N94 A;  1EZ9 A;  1TFA A;  3MVX A;  3IOV A;  4GXS B;  4ZE8 A;  5CM6 A;  1SQY A;  3LR1 A;  1SYI A;  1FTL A;  2YJP A;  2ZXT A;  5L9M A;  1MPD A;  1NH8 A;  4H65 A;  3ZKK A;  1JEU A;  2XXV A;  4MBP A;  5J1D A;  2A5T B;  4NE4 A;  1BIY A;  4U2R A;  4BDO A;  3TQW A;  2O7I A;  1H3D A;  1AOV A;  4ZS9 A;  4AB6 A;  1MXZ A;  2Z8F A;  3KG2 A;  1P1W A;  4M4G A;  1QUI A;  4KPT A;  4KFQ A;  4C1U A;  4JB7 A;  4DXB A;  1YCJ A;  2F8D A;  4JWY A;  4LZ7 A;  4R6Y A;  4YKI A;  1DMB A;  2NWJ A;  5AA4 A;  5B70 A;  2G29 A;  3DP6 A;  3DP4 A;  1USY H;  1XHY A;  5FTH A;  4N6P A;  4YB5 A;  3TKD A;  1HSE A;  3IR1 A;  3CG3 A;  1Z7N E;  4NF4 B;  1Y3N A;  3K1P A;  1PB9 A;  2VHA A;  4R2F A;  2V3T A;  1JW5 A;  1UIU A;  2AL5 A;  1B9J A;  3MPK A;  3UN6 A;  2B3B A;  1PBQ A;  4PP0 A;  2DYX A;  1A8F A;  4Q30 B;  5BWJ A;  2Y84 A;  4G8N A;  5FHN A;  2D5W A;  3KN8 A;  2B65 A;  4UA8 A;  4GRK A;  3Q25 A;  2F34 A;  3EHT A;  3DLN A;  3K0V A;  4GL0 A;  4PFT A;  5DYH A;  3RNN A;  4F39 A;  5JK4 A;  2Z23 A;  5BUU A;  3VVD A;  3MAM A;  2V3U A;  3IX1 A;  4XKN A;  1LBC A;  3T9H B;  3IK6 B;  2IEE A;  3F11 A;  3IB1 A;  3OD7 A;  1B05 A;  1JVY A;  1MXU A;  1SBP A;  1UIV A;  1YAE A;  2V84 A;  1NNF A;  3B6T A;  3H06 B;  3PMX A;  4OTE A;  4RK9 A;  5H8F B;  3VLU A;  4NF8 A;  4G68 B;  4FAJ A;  1LCT A;  2F36 A;  3FD3 A;  4OYV A;  4QSE A;  3E13 X;  3ODB A;  5H8Q A;  4DXC A;  4EUO A;  1Y1Z A;  1B3L A;  2RC8 A;  3C31 A;  3KZG A;  1IXI A;  3UK4 A;  4F31 B;  1AIV A;  5HPQ A;  3S2V A;  1IXG A;  3E9X A;  3D4G A;  1SDX A;  3OEM A;  2GHB A;  2DE2 A;  5CMK A;  4DCX A;  2HFB A;  1URS A;  3OEK A;  1Y3P A;  1B3F A;  1EU8 A;  3OSQ A;  4N13 A;  5CMM A;  3MQ9 A;  4EF2 A;  2XXR A;  4IY6 A;  4FEB A;  3CSB A;  1AL3 A;  3PUZ E;  1SW1 A;  4LON B;  4OFJ A;  3O28 A;  3U1O A;  3JV9 A;  1MM6 A;  1LLS A;  2Z8D A;  3H6W A;  4GIZ A;  4GQO A;  2ALU A;  4IO3 A;  4XXU A;  1L5T A;  4OEN A;  1B1H A;  2I4C A;  1B7U A;  3HV1 A;  1ZKB A;  3O6H A;  1P1O A;  1ZBM A;  2PVU A;  2ZNS A;  2I6E A;  2M8C A;  1NL5 A;  1OQH A;  3E4R A;  1PEB A;  4ND9 A;  4OEV A;  4QFP A;  1NMU A;  4QF9 A;  1DTG A;  1MS7 A;  2D3I A;  1UTH A;  1IXC A;  2F7B A;  5HM4 B;  1MQD A;  4TQU Q;  3GBA A;  5CBR A;  5DVI A;  3PUW E;  4KR5 A;  3H6T A;  1QKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...