1PC3A

Crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
333
structure length
333
Chain Sequence
VATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate-binding protein 1
publication title Crystal structure of M tuberculosis ABC phosphate transport receptor: specificity and charge compensation dominated by ion-dipole interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transport protein
total genus 118
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pc3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pc3A02
1TT1A 5H8NA 1EU8A 2G29A 5EHMA 4ZDMA 1AOVA 2DE2A 2GRVA 3FJGA 3QYTA 3KEIA 3O6HA 2RC9A 2F34A 2ZXTA 4NWCA 1JVXA 4QFPA 4H0WA 1PEBA 2RCAA 3G3HA 1B3FA 3MP8A 2ONRA 1Y3NA 2FNCA 2PMSA 4XKNA 3RY3A 4DE8A 1B4ZA 3U94A 3UORA 3HHGA 1OVBA 2REJA 3RNNA 4EF2A 3K6VA 4QRZA 1ZIUA 1VFDA 1Y4CA 1HSJA 3HSTA 3VE1B 3JYRA 1AMFA 1N76A 4N13A 4U4XA 4NF4B 3SESA 4F1VA 2F6GA 3K4UA 3ILUB 4TOZA 2H4IA 1ANFA 2XXUA 4JWXA 1LFGA 4OVJA 5ISUA 2G93A 5I2NB 2BJJX 3KBRA 1J1NA 3LSFB 3TUSA 1B32A 3N26A 2I6EA 2V93A 2ZYKA 4ECFA 4PQJA 1DPPA 1POY1 2X7QA 4YICA 2QJEA 4ZEIA 4NF8B 4G8MA 3G3KA 2Z8EA 4WEPA 1NFTA 3T9HB 2AYSA 3U8QA 1H76A 3C31A 4GIZA 4DZ1A 3G3GA 3MP6A 3CIJA 5L9OA 1Q1KA 2Y7RA 2QPQA 1NNTA 3O6IA 3L6HA 5I59A 1AL3A 1B51A 2F8DA 1MQJA 1QVSA 3CG1A 5IKBA 1P1QA 3S9MC 4U1OA 3DP6A 4G8NA 2O68A 1OQGA 3VVFA 4OYVA 4QSCA 2I4BA 1UTBB 3S4UA 4QSDA 3K6XA 4MFIA 5KCJB 2O1LA 4MLVA 1B7HA 5I56B 3SEYA 1QKBA 1SD3A 2DWHA 2Q9TA 3V8XB 3O29A 1LAXA 4LVQA 4YB5A 4IO6A 1WDNA 3FATA 3QAXA 2V3TA 1US5A 4JWOA 3OELA 3FVOA 2DWJA 3UGWA 4YB7A 1S50A 3RPWA 3Q29A 1P1WA 1O7TA 5J1DA 3UN6A 4OENA 3EN3A 1SW1A 3U72A 3OSQA 3MAMA 3LSLA 4LZ7A 2Y7KA 2E1SA 1JQFA 3L6GA 2LAOA 1UTHA 3E4RA 5FHOA 5HBCA 1IZ1A 1MG1A 3A3CA 2A5TA 1LLSA 4JXIA 3RT8A 5K2XA 3VLUA 3I5OA 4XIGQ 3IAZA 2F35A 3EHUA 4WKMA 4F29A 4R2FA 5CM6A 3R7XA 4FE8A 3OO7A 5CC2A 3E13X 1B52A 3C36A 3PUYE 3THIA 4TLMB 3QSLA 4F1YA 1LBBA 3IB1A 4U2RA 4KI0E 2F36A 3T66A 1MRPA 1XC1A 1QJMA 1EZOA 1MS7A 2F6PA 2GHBA 3G3JA 1H3DA 4GFRA 3T93B 2QRYA 2PVUA 5DEXA 3CFLA 2O84X 4QHQA 1HSLA 5I59B 4ZZEA 3K1NA 3M3FA 4UA8A 2DXYA 1A99A 3K1MA 1SI0A 1DSNA 1MM7A 4F18A 2B3FA 3N94A 4PETA 3ONMA 4ND9A 2XXRA 4G68B 2FA7A 4ZECA 4OETA 2F7BA 1PB9A 2Q89A 3DLNA 4DXUA 2QS2A 2QS1A 4I1DA 3MVXA 3T96B 1N0TA 1MXYA 1POTA 3LUYA 3TDJA 4U4SA 1SI1A 2FYIA 3GBBA 1B58A 4DDDA 1T0KA 3KJ7A 5I58B 1OQHA 3K1PA 1N04A 1TWYA 2XXWA 2M8CA 3IB2A 2ZMBA 4R9FA 5CMMA 3G7WA 4IO2A 2E0SA 3O66A 3TCGA 2OCUA 3GZGA 1SBPA 3T9XB 3MJNA 3E9XA 4P0IA 1NKXA 3W15C 1B40A 4GL0A 3RT6B 3PMWA 3H4ZA 3KOTA 3G3FA 3HCQA 1XOCA 3IOTA 4F3SA 4LA9A 4PFWA 4H67A 1B3LA 1URSA 3B7DA 4ZZAA 5DVIA 4AB5A 4RY1A 4MLQA 4YKPA 3TKDA 3GBAA 1ZU0A 3T22A 1H44A 3CSGA 4F3PA 3K00A 1B7UA 2A5TB 1TXFA 4JBZA 2ONSA 3VVEA 1OVTA 3MUQA 5TU0A 1N7WA 3C33A 3H6VA 1OLAA 2QS4A 4YZZA 5JTYB 1NNFA 3TAJA 3R26A 4EQ9A 2DXRA 1VE4A 2KLFA 4R6KA 1FTLA 4IGTA 2O7IA 4GRKA 1FQCA 4M4GA 4OFOA 1XVYA 4GWOA 1LB8A 1D9VA 2OWTA 2UVHA 2QL3A 3LC8A 2XD3A 4BDMA 3MVZA 4H1XA 5DEXB 1B5HA 4EQ7A 3ZKKA 2XXXA 4YKIA 2P1SA 4FIMA 3KN3A 4OHNA 1MPBA 1WODA 2OK2A 1MPCA 3RTWB 1BTJA 1SW5A 1OMPA 3KSJA 2H5YA 1XT8A 4KYEA 4HCWA 1N7XA 3OENA 2XXYA 4NF5B 4IO3A 5BWJA 2F97A 2NUVA 3QK6A 3N5LA 1YAEA 1FQAA 2RF1A 4ELRA 2XXPA 1PB8A 2XX7A 2HEUA 4JSDA 4LONB 3TYHA 3IO6A 1IXIA 3JZJA 3H6WA 2O7UA 3LSWA 2H98A 3G3IA 3FVGA 4IY5A 1NMUA 3PPNA 5KDTB 4DIGA 4O3BA 1PBPA 1S7YA 4ZEKA 1FTJA 2I58A 4OXVA 1M5EA 5CMCA 3RN8A 3TZAA 3DELB 3SETA 4RK9A 1JW5A 5JK4A 3C35A 3WAFA 2V84A 4KPTA 4LUBA 1CB6A 3CI8A 5EYFA 3SEUA 4PP0A 5ITOA 2OJTA 3MZ9A 4LZ8A 3S9LC 5ICQA 2OBGA 2REGA 1MXXA 1TFDA 4FATA 3V5AA 3SERA 4QF9A 3KOSA 2PX1A 4EUOA 4MF3A 1MY1A 2PT1A 2I48A 3PPRA 2DWAA 4YMBA 1R1NA 2QMXA 3KFMA 4RXLA 1XS5A 1I6AA 3PUZE 1R6ZA 4OTEA 1O64A 2XD2A 4KCCA 2B65A 3K01A 1ZJLA 2XXTA 4OFJA 4OZ9A 1IIWA 5DVJA 3VLVA 1A55A 4ONYA 2OLBA 1A8EA 4WXJA 1QULA 3Q26A 5CMKA 1N84A 3IL1B 4R2BA 4GVOA 4QFKA 4G68A 3B6WA 1AH5A 1RKMA 3OO6A 3MP1A 4BDLA 2DVZA 2Z8FA 5F1QA 2RKMA 4MBPA 1OLCA 1FTKA 3OD7A 4JWYA 3IB0A 3VLWA 3TQLA 4QFLA 4GXAA 4R73A 4OEVA 3OSRA 1LCTA 1LSTA 2HQ0A 3FJ7A 5I58A 5TP9B 4F39A 4M1VA 4IO7A 3H7MA 2H9BA 1NNKA 1LBCA 3FASA 2NVUB 3K0VA 1UQWA 1ELJA 5DT6A 4OEUA 3WAEA 2DE4A 3S2VA 4KHZE 1GV8A 5H8SA 5H8FB 3EHSA 2R9JA 3P7IA 2CMOA 4G8HA 4ISUA 1P99A 4MH5A 3UA8A 4KD5A 4O3CA 3QUFA 4GQOA 2H25A 4IB2A 4F2QA 1H45A 5I2KB 4YB6A 2CZLA 1NH7A 1B3EA 3ECRA 4IGRA 1LFIA 3KN8A 2RINA 4R9GA 2Q88A 4EF1A 4OMBA 1GTKA 2O1MA 3HN0A 3VXCA 1Y4TA 1MQHA 1ZTYA 2HCAA 2VP1A 4GF8A 4U1ZA 1SYIA 2WKYA 4PFUA 1GVCA 1D9YA 5JTYA 3KSXA 1B3HA 2RCBA 3PPPA 1FCKA 3CFXA 4G77A 3TODA 3EF7A 3TTKA 4H8IA 4OQOA 3DM0A 1URGA 5H8HB 3CFZA 2VD2A 2P0SA 2DQVA 2PYYA 3MPLA 3IOUA 1B05A 3FXQA 2D3IA 2GFEA 4F3GA 2XHDA 2Y7PA 5HM4B 1N3XA 3VV5A 2X26A 1YCJA 2NOOA 4GL8A 4RJZA 4I8CA 1JEVA 1USYE 3IX1A 2DP8A 2OWSA 3VDFA 1QUIA 4EXKA 5ICTA 3LSXA 1UIVA 1LAGE 3OO8A 2GHAA 3MVYA 1SW2A 2ZNSA 1I69A 2IA4A 2DE3A 4NF5A 4TQUQ 3USDA 5M2VA 1MM6A 2DWIA 3FUZA 1URDA 3MZBA 5L9SA 4G2ZA 3B6QA 1EZ9A 3V83A 4Q5TA 2ONKE 3VFJA 4XKPA 5KDTA 2HAUA 3IOVA 4OFLA 5AA2B 1JW1A 1S9TA 4NEDA 3PGFA 1JETA 1I6QA 2XXVA 1H43A 1DMBA 2VD3A 2O69A 4I9DA 3RLFE 1Z7ME 3TTLA 4FORA 1Y9UA 4ZS9A 1FQBA 2A5SA 1XHYA 5I57A 4FEDA 3C9HA 4PE5B 4AQ4A 2Z8DA 3FXRA 1IXGA 3FV1A 3RUMA 3SDFA 3TFLA 2R71A 1QW0A 5FHMA 1MQGA 3K2DA 2V25A 3FV2A 1NNPA 4Q8RA 4AB6A 2PBWA 3TTNA 5ITPA 2UYEA 3PPOA 3FVKA 1VR5A 4ELPA 1PC3A 3CRBA 4F19A 2UVIA 1M5FA 4EQBA 4GOTA 4OESA 1R9LA 3HV1A 3MW0A 4R6HA 3M3LA 1Y3QA 1FW0A 4OERA 3FJMA 5CI5A 4HCYA 4JB7A 2QS3A 1D3KA 4FJPA 1BKAA 1VFEA 2YJPA 2GH9A 3PU5A 4H5GA 4IO5A 3CVGA 1B9JA 1CE2A 3O6GA 3GXAA 3A3UA 2RC8A 3TTMA 4DLDA 5CBSA 2Y84A 3IJXB 4F31B 3W9VA 4JSOA 4DCYA 2UVGA 4RA1A 1DOTA 2P2AA 3E3KA 1SW4A 1OIBA 2OZZA 1JVYA 4NF6B 1AIVA 3FXUA 4X48A 1A54A 1I6BA 3KN7A 1LGBC 5H8QB 3RGYA 1LCFA 3TCFA 5A5XB 1IUDA 3RTFB 5TPAB 2ESNA 3O2AA 5TP9A 1DTGA 1P1OA 3OEMA 2ANJA 1A40A 3GLBA 1EZPA 3IK6B 2ZYOA 3OXNA 4ZEBA 3TMGA 1MY0A 2F7AA 2ZYNA 3TEPA 3IO4A 1LAFE 4PFYA 3PUWE 2HZKA 4WEDA 5AA2D 1F9BA 4H8JA 1II5A 4POXA 4EDPA 5H8FA 4Z7EA 4QFOA 4XKRA 4GLIA 4R74A 2DOJA 3PPQA 3O28A 3TQWA 1NL5A 1US4A 4KR5A 4BDNA 5I2KA 2DSFA 1FTOA 3VXBA 2ALUA 1L5TA 4I62A 1JNFA 5I57B 3IR1A 5ELVA 4BDOA 4LQ2A 1QKAA 1IXHA 1M5BA 2ZYMA 4QSEA 5CRYA 1MXUA 5F7VA 2X7PA 4LATA 2XXQA 3MWBA 3OEKA 4U21A 4P0GA 1JW4A 2YPNA 3R6UA 4DCXA 3UP9A 4JDFA 5FTIA 1MY3A 2NXOA 3Q27A 4ESWA 4R6YA 4L17A 1P1UA 1ZLQA 4LP2B 2Q2CA 1Q35A 5H8HA 5AA4B 2PT2A 3M8UA 4X1DA 4RK2A 3U93A 1B6HA 3K02A 3DP8A 3KJTA 3N6UA 3RQTA 4E0XA 1GGGA 3O97A 1A7LA 1M5CA 4N07A 3IORA 4BLAA 1NH8A 5B70A 2V3QA 1IEJA 3FVNA 3MQ9A 4FAJA 3MZ1A 4YU0A 4PFTA 4LZ5A 1BLFA 3FIRA 4NMYA 1B3GA 4LQ5A 2V3UA 2QSXA 3FGSA 1VSOA 1PB7A 4KCDA 1RYOA 3ZSFA 4U22A 3H06B 1EH3A 2B3BA 2NWJA 4XKQA 4EXLA 5CMBA 3IOWA 2I49A 2UVJA 2ZNUA 3JV9A 1TFAA 3S9NC 5AA2A 4KQPA 1ZMGA 5KZTA 3PMVA 3IJOB 3CSBA 1FQEA 2UYFA 2QMWA 4NWDA 4Z0IA 5B7DA 1ZBMA 1B1HA 5L9MA 3H03A 3ZS6A 4XXUA 2Q2AA 4THIA 5H8NB 3ZKLA 3KGCA 4UACA 4GXSB 4HW8A 2XX9A 1FTMA 3H3GA 3BKIB 5EHSA 4POWA 3HPIA 2R6GE 4DXBA 1LAHE 4GD5A 3ILTB 1B5JA 3F11A 1YTVA 1MY4A 3QXMA 1ZKBA 3UIFA 2HAVA 1PBQA 3QUJA 3U92A 2XXHA 4ELQA 1MPDA 2ABHA 3VVDA 3MPKA 4YAHX 1QUJA 2W7YA 3SEWA 4C1TA 1PDAA 4Q0CA 4K3FA 2RC7A 2YLNA 1GR2A 2XX8A 4KFQA 3Q25A 4TLLB 1A8FA 4ZEDA 4R72A 3SEXA 1DPEA 1MXWA 3KZGA 1IXCA 1HSEA 1WVJA 4OWDA 4BDQA 1MDQA 2O51A 1JEUA 5DYHA 3OMBA 4F1UA 2VHAA 5DTBA 3SKPA 1P1NA 1XVXA 3EQ1A 1RYXA 5CBRA 3BFUA 4NF6A 1KWHA 1ATGA 2DS9A 3KG2A 1DTZA 1B2HA 1M5DA 3N6TA 4E0WA 3PD9A 2UXAA 3FZVA 4F3BA 4RPOA 1MY2A 2I0CA 5H8QA 3H6UA 3A09A 2D21A 3BBRA 5A5XA 5TPAA 3W9WA 1QUKA 1SYHA 3HO7A 4H5FA 2I4CA 4YMAA 3EHTA 3SEVA 5HPQA 3MC2A 1FQFA 3K6UA 5JEIA 1O63A 3Q28A 3UK4A 2Q8JA 4KYDA 2HFBA 3DP4A 4FECA 5I84A 5AA3A 2VGQA 4X1BA 4FEBA 5IAIA 3QIMA 1LFHA 3D4GA 4O3AA 5AE4A 1SQYA 4NE4A 2THIA 2VOZA 3PUXE 3MVWA 1B0HA 3TELA 3PV0E 1B5IA 1LB9A 2Y7IA 4G4PA 1B46A 4H65A 5DVFA 1MQIA 2XXIA 3T9VA 3TPAA 3PMXA 1B4HA 1YPNA 4BDRA 4H6DA 4RNSA 2IEEA 2H99A 3D4CA 1UIUA 3M3KA 2ZNTA 3T9UA 3C32A 1BIYA 5AA1A 1MQDA 4XTCQ 3OOAA 3CR9A 1BP5A 4NF4A 3TTRA 2AL5A 5AA4A 2O6AA 3EPEA 3U1OA 3TCHA 5FTHA 1MDP1 3I3VA 1Y20A 3FD3A 1D4NA 5I2NA 3LR1A 3LBSA 4C1UA 3MBPA 2F5XA 1UTHB 2Z23A 2AL4A 4YKKA 1B0LA 3AXFA 4ESXA 4F22A 2F7CA 3I6VA 4QFNA 3V89B 3ODBA 2DVCA 1MH3A 4NF8A 1IITA 1B1XA 1B7ZA 2HZLA 1Y1MA 3H6TA 4R75A 3BFTA 2Z22A 3O9PA 4U23A 4X9TA 4HS7A 1FQDA 2I3VA 4RPNA 1Y3PA 3OO9A 2D5WA 4F2OA 1USYH 3C34A 4ZE9A 4C0RA 4NTLA 3S9EA 1Y1ZA 3PUVE 4P11A 1MXZA 2I3WA 1SDXA 1N3WA 3PD8A 4ZEFA 1MH4A 4YKJA 2AIXA 4G68C 3K6WA 3CG3A 3C4MA 4IY6A 2DYXA 3B6TA 1IQ7A 5LOMA 1UTBA 4RYAA 2HXWA 4HTGA 2Y7WA 2I0BA 2F78A 4KYSA 3HHFA 5FHNA 5KCJA 1Z7NE 4Q30B 5I56A 4DXCA 5K2YA 4ELOA 1SVXB 4ZE8A 5L8DA 4IO4A 1R9QA 4N6PA 5BUUA 1MXVA
chains in the Genus database with same CATH superfamily
4NHBA 3MSTA 1K9ZA 1TT1A 5H8NA 1EU8A 2G29A 2WYPA 5EHMA 4ZDMA 1AOVA 2DE2A 2GRVA 3FJGA 3QYTA 3KEIA 1FRPA 3O6HA 3E78A 4NAPA 2RC9A 2F34A 2ZXTA 4NWCA 2FVZA 4MHFA 1JVXA 4QFPA 4H0WA 1PEBA 2PCRA 2RCAA 3G3HA 1INPA 1B3FA 3MP8A 2ONRA 1Y3NA 2FNCA 2PMSA 3QMFA 4XKNA 3RY3A 4DE8A 1B4ZA 3U94A 3UORA 3HHGA 1OVBA 2REJA 3RNNA 4EF2A 3K6VA 3KBZA 4QRZA 2VPOA 1ZIUA 1VFDA 1LBVA 1Y4CA 1HSJA 3HSTA 3VE1B 3JYRA 1AMFA 1N76A 4N13A 2F3BA 1YZ0A 4NX1A 4NF4B 4U4XA 3SESA 4F1VA 2F6GA 3K4UA 3ILUB 4TOZA 2H4IA 1ANFA 2XXUA 5IZZA 4JWXA 1LFGA 4OVJA 4P9KA 5ISUA 2G93A 5I2NB 2BJJX 3KBRA 1J1NA 3FXBA 3LSFB 3TUSA 1B32A 3N26A 4FBPA 2I6EA 2ZZVA 2V93A 2ZYKA 4PQJA 4ECFA 1DPPA 1POY1 2JJKA 2PFZA 2X7QA 4YICA 2QJEA 4ZEIA 4NF8B 4G8MA 3G3KA 2Z8EA 4WEPA 1VDWA 1NFTA 4OA4A 2AYSA 3T9HB 3U8QA 1H76A 3C31A 4GIZA 4DZ1A 3G3GA 3MP6A 3CIJA 5L9OA 1Q1KA 2Y7RA 2QPQA 1NNTA 2MKZA 3O6IA 3L6HA 1NI9A 5I59A 1RDYA 1AL3A 1B51A 4QBAA 2F8DA 1MQJA 3RPLA 1CNQA 1QVSA 3CG1A 5IKBA 1P1QA 3S9MC 4U1OA 4PGPA 3DP6A 4G8NA 2O68A 1OQGA 3VVFA 4OYVA 4QSCA 2I4BA 1UTBB 3S4UA 4QSDA 5LDZA 3K6XA 4MFIA 4LN5A 5KCJB 2O1LA 4MLVA 1B7HA 5I56B 3SEYA 4PAKA 1QKBA 1SD3A 2DWHA 2PFYA 2Q9TA 3V8XB 3O29A 1LAXA 4LVQA 4YB5A 5IZ3B 4IO6A 4P47A 1WDNA 3FATA 3QAXA 4GBVA 2V3TA 1US5A 4JWOA 3OELA 3FVOA 2DWJA 3UGWA 4YB7A 3KC1A 1S50A 3RPWA 3Q29A 1P1WA 1O7TA 5J1DA 3UN6A 4OENA 3EN3A 1SW1A 3U72A 3OSQA 3MAMA 1NV0A 3LSLA 5EYHA 4LZ7A 2Y7KA 2E1SA 1JQFA 3L6GA 2LAOA 1UTHA 3E4RA 5FHOA 5HBCA 1NV3A 1IZ1A 1MG1A 3A3CA 2A5TA 1LLSA 4JXIA 3RT8A 5K2XA 3VLUA 3I5OA 4XIGQ 3IAZA 2F35A 3EHUA 4WKMA 4F29A 4R2FA 5CM6A 3R7XA 4FE8A 3OO7A 3D1RA 4HE2A 4HE1A 5CC2A 3E13X 1B52A 3C36A 3PUYE 3THIA 4TLMB 3QSLA 4F1YA 1LBBA 1AWBA 3IB1A 4U2RA 4KI0E 2F36A 3T66A 1MRPA 1XC1A 1QJMA 1EZOA 1MS7A 2F6PA 2GHBA 3G3JA 1H3DA 4GFRA 3T93B 2CZIA 2QRYA 1FBCA 2PVUA 5DEXA 3CFLA 1NUWA 1JP4A 2O84X 4QHQA 1FPEA 5EQ7A 2HPGA 1HSLA 2XA5A 5I59B 4ZZEA 3K1NA 5FBPA 3M3FA 4UA8A 2DXYA 1A99A 3K1MA 4AS5A 1SI0A 3RPLB 1DSNA 2QVRA 1MM7A 5IGAA 4F18A 1FTAA 2B3FA 3N94A 4PETA 3ONMA 4ND9A 2XXRA 4G68B 2FA7A 4ZECA 2OX3A 4OETA 3IFCA 2F7BA 1PB9A 2Q89A 3DLNA 4DXUA 2QS2A 3NOHA 2QS1A 4IR8A 4I1DA 3MVXA 3T96B 1N0TA 4MCOA 1MXYA 1POTA 3LUYA 3TDJA 4U4SA 1DK4A 1SI1A 2FYIA 3GBBA 4H45A 1B58A 4DDDA 1T0KA 3KJ7A 5I58B 1OQHA 3K1PA 1N04A 1TWYA 2XXWA 2M8CA 3IB2A 2ZMBA 4R9FA 5CMMA 3G7WA 4IO2A 2E0SA 3O66A 3TCGA 2OCUA 3GZGA 1SBPA 1LEVA 3T9XB 3MJNA 3E9XA 4P0IA 2P3VA 1NKXA 3W15C 4KXPA 1B40A 4GL0A 4MMPA 3RT6B 3PMWA 2WEFA 3H4ZA 3KOTA 3G3FA 1IMBA 3ROJA 3HCQA 1XOCA 3IOTA 4F3SA 4LA9A 4PFWA 4H67A 1B3LA 1URSA 1FPDA 1YYZA 3B7DA 4OVRA 4ZZAA 2HHMA 5DVIA 4AB5A 4RY1A 2XWIA 4MLQA 4YKPA 3TKDA 3GBAA 1ZU0A 3T22A 1FBPA 1LBYA 1H44A 3CSGA 4F3PA 3K00A 4N15A 1B7UA 2A5TB 1TXFA 4JBZA 2ONSA 3VVEA 1OVTA 3MUQA 1FPIA 5TU0A 1N7WA 1FPLA 3C33A 3H6VA 1OLAA 2QS4A 4YZZA 5JTYB 1NNFA 5ET8A 3TAJA 3R26A 4EQ9A 2DXRA 1VE4A 2KLFA 4R6KA 1FTLA 4IGTA 2O7IA 4GRKA 1FQCA 4M4GA 4OFOA 1XVYA 4GWOA 4P1LA 1LB8A 1D9VA 2OWTA 2UVHA 1FPJA 2QL3A 2V4CA 3LC8A 2XD3A 4BDMA 1LBZA 3MVZA 4H1XA 5DEXB 1B5HA 4EQ7A 2WBDA 3ZKKA 2XXXA 4YKIA 2P1SA 2CEYA 2VT5A 4FIMA 3KN3A 4OHNA 1MPBA 4XEQA 1WODA 2OK2A 5IZ3A 1MPCA 3T1BA 3RTWB 1NV2A 1BTJA 1SW5A 1OMPA 3KSJA 2H5YA 1XT8A 4KYEA 4HCWA 1N7XA 3OENA 5EQAA 2XXYA 4NF5B 4IO3A 5BWJA 2F97A 2NUVA 3QK6A 3N5LA 1YAEA 4JVIA 1FQAA 2RF1A 4X8RA 4ELRA 2R8TA 2XXPA 1PB8A 2XX7A 2HEUA 4O7IA 4JSDA 4LONB 3TYHA 2DDKA 3IO6A 1IXIA 3JZJA 3H6WA 2O7UA 3LSWA 2H98A 3G3IA 3FVGA 4IY5A 1NMUA 1KA0A 3PPNA 4DIGA 5KDTB 4O3BA 1PBPA 2KR0A 1S7YA 4ZEKA 1FTJA 2I58A 4OXVA 1M5EA 5CMCA 4PGNA 3RN8A 4GBWA 3TZAA 3DELB 3SETA 4RK9A 1JW5A 5JK4A 3C35A 3WAFA 1IMDA 2V84A 4KPTA 1CB6A 4LUBA 3CI8A 4NN3A 5EYFA 3SEUA 4PP0A 5ITOA 2OJTA 3MZ9A 4LZ8A 3S9LC 5ICQA 2OBGA 2REGA 1MXXA 1TFDA 4FATA 3V5AA 3SERA 4QF9A 3KOSA 2PX1A 2HXRA 1NUXA 4EUOA 4MF3A 1MY1A 2PT1A 2I48A 3PPRA 2DWAA 4YMBA 1R1NA 2QMXA 3KFMA 4RXLA 1XS5A 1IMFA 1I6AA 3PUZE 1R6ZA 4OTEA 1O64A 3B50A 2XD2A 4KCCA 2B65A 3RYDA 3K01A 1ZJLA 2XXTA 4OFJA 1FPKA 4OZ9A 1IIWA 5DVJA 3VLVA 1A55A 4ONYA 2OLBA 1A8EA 4WXJA 1QULA 3Q26A 5CMKA 1N84A 3IL1B 4R2BA 4GVOA 4QFKA 2XWOA 4G68A 3B6WA 1AH5A 1RKMA 3OO6A 3MP1A 4X04A 2GQ1A 3KC0A 4BDLA 2DVZA 2Z8FA 2CZHA 5F1QA 2RKMA 4MBPA 1OLCA 4I3YA 1FTKA 3OD7A 3LUZA 4JWYA 3IB0A 3VLWA 3TQLA 4QFLA 4GXAA 4R73A 4OEVA 3OSRA 1LCTA 3SZPA 1LSTA 2HQ0A 3FJ7A 5I58A 5TP9B 4F39A 4M1VA 4IO7A 3H7MA 2H9BA 1NNKA 1LBCA 3FASA 1FBGA 2NVUB 3K0VA 1SPIA 1UQWA 1ELJA 5DT6A 4OEUA 3WAEA 2DE4A 3S2VA 4KHZE 1GV8A 5H8SA 5H8FB 2FIXA 3EHSA 2R9JA 3P7IA 3LV0A 2CMOA 4G8HA 4ISUA 1P99A 4MH5A 3UA8A 4KD5A 4O3CA 3QUFA 4GQOA 1NUYA 2H25A 4IB2A 4F2QA 1H45A 5I2KB 4O7MA 4YB6A 2CZLA 1NH7A 1B3EA 3ECRA 4IGRA 1LFIA 3KN8A 2RINA 4R9GA 2Q88A 4EF1A 4OMBA 1GTKA 2O1MA 3HN0A 3VXCA 1Y4TA 1MQHA 1ZTYA 4N8GA 2HCAA 2VP1A 4GF8A 4U1ZA 1SYIA 2WKYA 4PFUA 1GVCA 4PFBA 1D9YA 5JTYA 2ZZXA 3KSXA 1B3HA 1FSAA 2RCBA 3PPPA 1FCKA 3CFXA 4G77A 3TODA 3EF7A 3TTKA 4H8IA 4OQOA 3DM0A 1URGA 5H8HB 3CFZA 2VD2A 2P0SA 4MNCA 2DQVA 1NUZA 4PDDA 2PYYA 2VPNA 4O94A 3IOUA 3MPLA 3U65A 1B05A 3FXQA 1LBXA 2D3IA 2GFEA 4F3GA 2XHDA 2Y7PA 5HM4B 2XXKA 1N3XA 1FBEA 3VV5A 2X26A 1YCJA 2NOOA 4GL8A 4RJZA 4I8CA 1JEVA 2OWZA 1USYE 3IX1A 3PTYA 2DP8A 5T3JA 2OWSA 3VDFA 1QUIA 4EXKA 4PC9A 5ICTA 3LSXA 1UIVA 1LAGE 3OO8A 2GHAA 3MVYA 4NF0A 1SW2A 2ZNSA 1I69A 2WX9A 2IA4A 1KZ8A 2ZZWA 3ISPA 2DE3A 4NF5A 1LBWA 4TQUQ 3USDA 5M2VA 1MM6A 2DWIA 3FUZA 1URDA 3MZBA 4P56A 4MJOA 4NGUA 5L9SA 4G2ZA 3B6QA 1EZ9A 3V83A 4Q5TA 2ONKE 3VFJA 4XKPA 5KDTA 2HAUA 3IOVA 4OFLA 5AA2B 1JW1A 1S9TA 4NEDA 3PGFA 1JETA 1I6QA 2XXVA 4GWSA 1H43A 1DMBA 2VD3A 2O69A 2KQZA 4I9DA 3RLFE 1Z7ME 3TTLA 4FORA 1Y9UA 4ZS9A 1FQBA 2A5SA 1XHYA 5I57A 4FEDA 4OVQA 3C9HA 4PE5B 4AQ4A 2Z8DA 4N91A 3FXRA 1IXGA 3FV1A 3RUMA 3SDFA 3TFLA 2R71A 1NV5A 1QW0A 4OANA 5FHMA 5IM2A 1MQGA 3K2DA 2V25A 3FV2A 4GX4A 1NNPA 4Q8RA 4AB6A 2PBWA 3TTNA 4DI4B 5ITPA 2UYEA 2XWVA 3PPOA 3FVKA 1VR5A 4ELPA 5LTCA 1PC3A 3CRBA 4AS4A 4F19A 2UVIA 1M5FA 4EQBA 4GOTA 4OESA 1R9LA 3HV1A 3MW0A 4N81A 4HXVA 4R6HA 5EQ9A 3M3LA 1Y3QA 1FW0A 4OERA 3FJMA 5CI5A 4HCYA 4JB7A 2QS3A 3B8BA 1D3KA 4FJPA 1BKAA 1VFEA 2YJPA 2GH9A 3PU5A 4N6KA 4H5GA 4IO5A 4PDHA 1FJ6A 3CVGA 1B9JA 1CE2A 3O6GA 3GXAA 3A3UA 2RC8A 3TTMA 4DI3D 4DLDA 5CBSA 2Y84A 3IJXB 4F31B 3W9VA 4JSOA 2CEXA 5I5PA 4DCYA 2UVGA 4RA1A 1DOTA 2P2AA 4QXDA 3E3KA 1SW4A 1OIBA 2OZZA 1JVYA 4NF6B 1AIVA 3FXUA 4JVDA 4X48A 1A54A 1I6BA 4PAIA 3KN7A 1LGBC 5H8QB 3RGYA 1LCFA 3TCFA 5A5XB 1IUDA 3RTFB 5TPAB 5J16A 2ESNA 3O2AA 5I3SA 5TP9A 1DTGA 1P1OA 5ET5A 3OEMA 2ANJA 1A40A 3T0JA 4MX6A 3GLBA 1EZPA 3IK6B 2ZYOA 3OXNA 4MAGA 4ZEBA 3TMGA 1MY0A 2F7AA 2ZYNA 4UABA 3TEPA 3IO4A 1LAFE 4PFYA 3E79A 3PUWE 2HZKA 4WEDA 5AA2D 3A29A 5I7IA 1F9BA 4H8JA 1II5A 4POXA 1EYKA 4EDPA 5H8FA 4Z7EA 4QFOA 4XKRA 4GLIA 4R74A 2DOJA 3PPQA 3O28A 3TQWA 1NL5A 1US4A 4KR5A 4PCDA 4BDNA 5I2KA 2DSFA 2WYKA 1FTOA 3VXBA 2QVUA 2ALUA 1L5TA 4I62A 1JNFA 5I57B 3IR1A 5ELVA 4BDOA 4LQ2A 1DBZA 1FBFA 1KA1A 1QKAA 1IXHA 1M5BA 2ZYMA 4MNIA 4QSEA 4OVSA 2Y5KA 5CRYA 3HFUA 1MXUA 5F7VA 2X7PA 4LATA 5EYGA 4N4UA 2XXQA 3MWBA 3OEKA 4U21A 4P0GA 1JW4A 2YPNA 3BIGA 3R6UA 2F3DA 4JDFA 5FTIA 3UP9A 4DCXA 1MY3A 2NXOA 3Q27A 1Q9DA 2QVVA 4ESWA 1NV6A 4R6YA 4L17A 1P1UA 2QFLA 1ZLQA 4LP2B 2Q2CA 1Q35A 5H8HA 5AA4B 5A5LA 2PT2A 3M8UA 4X1DA 4RK2A 3U93A 1B6HA 3K02A 3DP8A 3KJTA 3N6UA 3RQTA 4E0XA 1GGGA 4G61A 4PE3A 4P8BA 1A7LA 3O97A 1M5CA 4N07A 3IORA 4BLAA 1NH8A 4PBQA 4MEVA 5B70A 2V3QA 1IEJA 3FVNA 3MQ9A 4FAJA 3MZ1A 4YU0A 5IZ1A 4PFTA 4LZ5A 1BLFA 3FIRA 4NMYA 1B3GA 4LQ5A 2V3UA 2QSXA 3FGSA 1K9YA 1VSOA 1PB7A 4KCDA 1RYOA 3ZSFA 4H46A 4U22A 4O8MA 3H06B 1EH3A 2B3BA 2NWJA 4XKQA 4EXLA 5ET7A 5CMBA 3IOWA 2I49A 2UVJA 2ZNUA 3JV9A 1TFAA 1FPBA 1IMAA 3S9NC 5AA2A 4KQPA 1DCUA 1ZMGA 5KZTA 3PMVA 3IJOB 3CSBA 1FQEA 2UYFA 2QMWA 2L5VA 4NWDA 4Z0IA 5B7DA 1ZBMA 1B1HA 5L9MA 3H03A 1QGXA 3ZS6A 4XXUA 2Q2AA 4THIA 5H8NB 3ZKLA 3KGCA 4UACA 2CZKA 4GXSB 4HW8A 2XX9A 1FTMA 2BJIA 3H3GA 3BKIB 4GX6A 5EHSA 4POWA 2FBPA 3HPIA 2R6GE 4DXBA 3IFAA 1LAHE 4GD5A 3ILTB 1B5JA 3F11A 4OVPA 1YTVA 1MY4A 3QXMA 1ZKBA 3GYYA 3UIFA 2HAVA 1PBQA 3QUJA 3U92A 2XXHA 4ELQA 1MPDA 4PAFA 2ABHA 3VVDA 3MPKA 4GWYA 4YAHX 1QUJA 2W7YA 3SEWA 4C1TA 2P3NA 1PDAA 4Q0CA 4K3FA 2RC7A 2YLNA 4MNPA 1GR2A 2XX8A 4KFQA 4N8YA 4XF5A 3Q25A 3MYUA 1A8FA 4TLLB 4ZEDA 2FHYA 4R72A 1NV1A 3SEXA 5F24A 1DPEA 1MXWA 3KZGA 1IXCA 2B4LA 1HSEA 5ESYA 1WVJA 4OWDA 4BDQA 1MDQA 2O51A 1JEUA 5DYHA 3OMBA 4F1UA 1NV4A 2VHAA 1NV7A 4GX3A 5DTBA 3SKPA 1P1NA 4P3LA 1XVXA 3EQ1A 1G0HA 5ET6A 1RYXA 5CBRA 2Q8MA 3BFUA 4NF6A 1KWHA 1ATGA 2DS9A 3KG2A 1DTZA 1B2HA 1M5DA 3N6TA 4E0WA 3PD9A 2UXAA 3FZVA 4F3BA 4RPOA 1MY2A 2I0CA 5H8QA 3H6UA 3A09A 2D21A 3BBRA 5A5XA 5TPAA 3BIHA 3W9WA 1QUKA 1SYHA 3HO7A 4H5FA 2I4CA 4YMAA 3EHTA 3SEVA 5HPQA 3MC2A 1FQFA 3K6UA 5JEIA 1O63A 1D9QA 3Q28A 3UK4A 2Q8JA 4KYDA 4JVCA 1XI6A 2HFBA 3DP4A 4FECA 5I84A 5AA3A 4GWUA 2VGQA 4X1BA 4PFIA 1IMCA 4FEBA 5IAIA 3QIMA 2WBBA 1G0IA 4N17A 3FBPA 1LFHA 3D4GA 4O3AA 4GWWA 5AE4A 1SQYA 4NE4A 4PFRA 2THIA 1FBHA 2VOZA 3PUXE 3MVWA 1B0HA 2B4MA 3TELA 3PV0E 1B5IA 1LB9A 1EYIA 2Y7IA 4G4PA 1B46A 4H65A 5DVFA 1MQIA 2XXIA 3T9VA 3TPAA 3PMXA 1B4HA 1YPNA 4NQ8A 4NG7A 4BDRA 4H6DA 1RDZA 4RNSA 2IEEA 4OVTA 2H99A 3D4CA 1UIUA 3M3KA 4N6DA 2ZNTA 3T9UA 3C32A 1BIYA 5AA1A 1MQDA 4XTCQ 3OOAA 3CR9A 1BP5A 4NF4A 3TTRA 2AL5A 5AA4A 2O6AA 3EPEA 3U1OA 3TCHA 5FTHA 1MDP1 1EYJA 3I3VA 4PF8A 1Y20A 3FD3A 1D4NA 4MIJA 5I2NA 3LR1A 1BK4A 3LBSA 3CHGA 3MBPA 4C1UA 2F5XA 1UTHB 2Z23A 2AL4A 4YKKA 1YXIA 1B0LA 3AXFA 4ESXA 4F22A 1FPFA 2F7CA 3I6VA 3EKIA 4QFNA 3V89B 3ODBA 2DVCA 2FIEA 1MH3A 4NF8A 1IITA 1B1XA 2Q74A 1B7ZA 2HZLA 4I40A 1Y1MA 3H6TA 4R75A 3BFTA 2Z22A 3O9PA 1IMEA 4U23A 4X9TA 4HS7A 4I3EA 1FPGA 1FBDA 1FQDA 4GWXA 2I3VA 1FJ9A 4RPNA 1Y3PA 3OO9A 2D5WA 4F2OA 1USYH 3C34A 4ZE9A 4C0RA 4NTLA 3S9EA 1Y1ZA 3PUVE 4PTKA 4P11A 1MXZA 2I3WA 1SDXA 5DW8A 1N3WA 3PD8A 4ZEFA 4PF6A 2Y5LA 1MH4A 4HE0A 4P1EA 4YKJA 2AIXA 4GWZA 4G68C 3K6WA 3CG3A 3C4MA 4IY6A 2DYXA 3B6TA 1IQ7A 5LOMA 1RDXA 1UTBA 2XWKA 4XFEA 4RYAA 2HXWA 4HTGA 2Y7WA 2I0BA 2F78A 4KYSA 4PBHA 3HHFA 5FHNA 5KCJA 1Z7NE 4Q30B 5I56A 4DXCA 5EQ8A 5K2YA 4ELOA 1SVXB 4ZE8A 5L8DA 4IO4A 1R9QA 4N6PA 5BUUA 1MXVA
chains in the Genus database with same CATH topology
1TT1A 5H8NA 1EU8A 2G29A 5EHMA 4ZDMA 1AOVA 2DE2A 2GRVA 3FJGA 3QYTA 3KEIA 3O6HA 2RC9A 2F34A 2ZXTA 4NWCA 1JVXA 4QFPA 4H0WA 1PEBA 2RCAA 3G3HA 1B3FA 3MP8A 2ONRA 1Y3NA 2FNCA 2PMSA 4XKNA 3RY3A 4DE8A 1B4ZA 3U94A 3UORA 3HHGA 1OVBA 2REJA 3RNNA 4EF2A 3K6VA 4QRZA 1ZIUA 1VFDA 1Y4CA 1HSJA 3HSTA 3VE1B 3JYRA 1AMFA 1N76A 4N13A 4U4XA 4NF4B 3SESA 4F1VA 2F6GA 3K4UA 3ILUB 4TOZA 2H4IA 1ANFA 2XXUA 4JWXA 1LFGA 4OVJA 5ISUA 2G93A 5I2NB 2BJJX 3KBRA 1J1NA 3LSFB 3TUSA 1B32A 3N26A 2I6EA 2V93A 2ZYKA 4ECFA 4PQJA 1DPPA 1POY1 2X7QA 4YICA 2QJEA 4ZEIA 4NF8B 4G8MA 3G3KA 2Z8EA 4WEPA 1NFTA 3T9HB 2AYSA 3U8QA 1H76A 3C31A 4GIZA 4DZ1A 3G3GA 3MP6A 3CIJA 5L9OA 1Q1KA 2Y7RA 2QPQA 1NNTA 3O6IA 3L6HA 5I59A 1AL3A 1B51A 2F8DA 1MQJA 1QVSA 3CG1A 5IKBA 1P1QA 3S9MC 4U1OA 3DP6A 4G8NA 2O68A 1OQGA 3VVFA 4OYVA 4QSCA 2I4BA 1UTBB 3S4UA 4QSDA 3K6XA 4MFIA 5KCJB 2O1LA 4MLVA 1B7HA 5I56B 3SEYA 1QKBA 1SD3A 2DWHA 2Q9TA 3V8XB 3O29A 1LAXA 4LVQA 4YB5A 4IO6A 1WDNA 3FATA 3QAXA 2V3TA 1US5A 4JWOA 3OELA 3FVOA 2DWJA 3UGWA 4YB7A 1S50A 3RPWA 3Q29A 1P1WA 1O7TA 5J1DA 3UN6A 4OENA 3EN3A 1SW1A 3U72A 3OSQA 3MAMA 3LSLA 4LZ7A 2Y7KA 2E1SA 1JQFA 3L6GA 2LAOA 1UTHA 3E4RA 5FHOA 5HBCA 1IZ1A 1MG1A 3A3CA 2A5TA 1LLSA 4JXIA 3RT8A 5K2XA 3VLUA 3I5OA 4XIGQ 3IAZA 2F35A 3EHUA 4WKMA 4F29A 4R2FA 5CM6A 3R7XA 4FE8A 3OO7A 5CC2A 3E13X 1B52A 3C36A 3PUYE 3THIA 4TLMB 3QSLA 4F1YA 1LBBA 3IB1A 4U2RA 4KI0E 2F36A 3T66A 1MRPA 1XC1A 1QJMA 1EZOA 1MS7A 2F6PA 2GHBA 3G3JA 1H3DA 4GFRA 3T93B 2QRYA 2PVUA 5DEXA 3CFLA 2O84X 4QHQA 1HSLA 5I59B 4ZZEA 3K1NA 3M3FA 4UA8A 2DXYA 1A99A 3K1MA 1SI0A 1DSNA 1MM7A 4F18A 2B3FA 3N94A 4PETA 3ONMA 4ND9A 2XXRA 4G68B 2FA7A 4ZECA 4OETA 2F7BA 1PB9A 2Q89A 3DLNA 4DXUA 2QS2A 2QS1A 4I1DA 3MVXA 3T96B 1N0TA 1MXYA 1POTA 3LUYA 3TDJA 4U4SA 1SI1A 2FYIA 3GBBA 1B58A 4DDDA 1T0KA 3KJ7A 5I58B 1OQHA 3K1PA 1N04A 1TWYA 2XXWA 2M8CA 3IB2A 2ZMBA 4R9FA 5CMMA 3G7WA 4IO2A 2E0SA 3O66A 3TCGA 2OCUA 3GZGA 1SBPA 3T9XB 3MJNA 3E9XA 4P0IA 1NKXA 3W15C 1B40A 4GL0A 3RT6B 3PMWA 3H4ZA 3KOTA 3G3FA 3HCQA 1XOCA 3IOTA 4F3SA 4LA9A 4PFWA 4H67A 1B3LA 1URSA 3B7DA 4ZZAA 5DVIA 4AB5A 4RY1A 4MLQA 4YKPA 3TKDA 3GBAA 1ZU0A 3T22A 1H44A 3CSGA 4F3PA 3K00A 1B7UA 2A5TB 1TXFA 4JBZA 2ONSA 3VVEA 1OVTA 3MUQA 5TU0A 1N7WA 3C33A 3H6VA 1OLAA 2QS4A 4YZZA 5JTYB 1NNFA 3TAJA 3R26A 4EQ9A 2DXRA 1VE4A 2KLFA 4R6KA 1FTLA 4IGTA 2O7IA 4GRKA 1FQCA 4M4GA 4OFOA 1XVYA 4GWOA 1LB8A 1D9VA 2OWTA 2UVHA 2QL3A 3LC8A 2XD3A 4BDMA 3MVZA 4H1XA 5DEXB 1B5HA 4EQ7A 3ZKKA 2XXXA 4YKIA 2P1SA 4FIMA 3KN3A 4OHNA 1MPBA 1WODA 2OK2A 1MPCA 3RTWB 1BTJA 1SW5A 1OMPA 3KSJA 2H5YA 1XT8A 4KYEA 4HCWA 1N7XA 3OENA 2XXYA 4NF5B 4IO3A 5BWJA 2F97A 2NUVA 3QK6A 3N5LA 1YAEA 1FQAA 2RF1A 4ELRA 2XXPA 1PB8A 2XX7A 2HEUA 4JSDA 4LONB 3TYHA 3IO6A 1IXIA 3JZJA 3H6WA 2O7UA 3LSWA 2H98A 3G3IA 3FVGA 4IY5A 1NMUA 3PPNA 5KDTB 4DIGA 4O3BA 1PBPA 1S7YA 4ZEKA 1FTJA 2I58A 4OXVA 1M5EA 5CMCA 3RN8A 3TZAA 3DELB 3SETA 4RK9A 1JW5A 5JK4A 3C35A 3WAFA 2V84A 4KPTA 4LUBA 1CB6A 3CI8A 5EYFA 3SEUA 4PP0A 5ITOA 2OJTA 3MZ9A 4LZ8A 3S9LC 5ICQA 2OBGA 2REGA 1MXXA 1TFDA 4FATA 3V5AA 3SERA 4QF9A 3KOSA 2PX1A 4EUOA 4MF3A 1MY1A 2PT1A 2I48A 3PPRA 2DWAA 4YMBA 1R1NA 2QMXA 3KFMA 4RXLA 1XS5A 1I6AA 3PUZE 1R6ZA 4OTEA 1O64A 2XD2A 4KCCA 2B65A 3K01A 1ZJLA 2XXTA 4OFJA 4OZ9A 1IIWA 5DVJA 3VLVA 1A55A 4ONYA 2OLBA 1A8EA 4WXJA 1QULA 3Q26A 5CMKA 1N84A 3IL1B 4R2BA 4GVOA 4QFKA 4G68A 3B6WA 1AH5A 1RKMA 3OO6A 3MP1A 4BDLA 2DVZA 2Z8FA 5F1QA 2RKMA 4MBPA 1OLCA 1FTKA 3OD7A 4JWYA 3IB0A 3VLWA 3TQLA 4QFLA 4GXAA 4R73A 4OEVA 3OSRA 1LCTA 1LSTA 2HQ0A 3FJ7A 5I58A 5TP9B 4F39A 4M1VA 4IO7A 3H7MA 2H9BA 1NNKA 1LBCA 3FASA 2NVUB 3K0VA 1UQWA 1ELJA 5DT6A 4OEUA 3WAEA 2DE4A 3S2VA 4KHZE 1GV8A 5H8SA 5H8FB 3EHSA 2R9JA 3P7IA 2CMOA 4G8HA 4ISUA 1P99A 4MH5A 3UA8A 4KD5A 4O3CA 3QUFA 4GQOA 2H25A 4IB2A 4F2QA 1H45A 5I2KB 4YB6A 2CZLA 1NH7A 1B3EA 3ECRA 4IGRA 1LFIA 3KN8A 2RINA 4R9GA 2Q88A 4EF1A 4OMBA 1GTKA 2O1MA 3HN0A 3VXCA 1Y4TA 1MQHA 1ZTYA 2HCAA 2VP1A 4GF8A 4U1ZA 1SYIA 2WKYA 4PFUA 1GVCA 1D9YA 5JTYA 3KSXA 1B3HA 2RCBA 3PPPA 1FCKA 3CFXA 4G77A 3TODA 3EF7A 3TTKA 4H8IA 4OQOA 3DM0A 1URGA 5H8HB 3CFZA 2VD2A 2P0SA 2DQVA 2PYYA 3MPLA 3IOUA 1B05A 3FXQA 2D3IA 2GFEA 4F3GA 2XHDA 2Y7PA 5HM4B 1N3XA 3VV5A 2X26A 1YCJA 2NOOA 4GL8A 4RJZA 4I8CA 1JEVA 1USYE 3IX1A 2DP8A 2OWSA 3VDFA 1QUIA 4EXKA 5ICTA 3LSXA 1UIVA 1LAGE 3OO8A 2GHAA 3MVYA 1SW2A 2ZNSA 1I69A 2IA4A 2DE3A 4NF5A 4TQUQ 3USDA 5M2VA 1MM6A 2DWIA 3FUZA 1URDA 3MZBA 5L9SA 4G2ZA 3B6QA 1EZ9A 3V83A 4Q5TA 2ONKE 3VFJA 4XKPA 5KDTA 2HAUA 3IOVA 4OFLA 5AA2B 1JW1A 1S9TA 4NEDA 3PGFA 1JETA 1I6QA 2XXVA 1H43A 1DMBA 2VD3A 2O69A 4I9DA 3RLFE 1Z7ME 3TTLA 4FORA 1Y9UA 4ZS9A 1FQBA 2A5SA 1XHYA 5I57A 4FEDA 3C9HA 4PE5B 4AQ4A 2Z8DA 3FXRA 1IXGA 3FV1A 3RUMA 3SDFA 3TFLA 2R71A 1QW0A 5FHMA 1MQGA 3K2DA 2V25A 3FV2A 1NNPA 4Q8RA 4AB6A 2PBWA 3TTNA 5ITPA 2UYEA 3PPOA 3FVKA 1VR5A 4ELPA 1PC3A 3CRBA 4F19A 2UVIA 1M5FA 4EQBA 4GOTA 4OESA 1R9LA 3HV1A 3MW0A 4R6HA 3M3LA 1Y3QA 1FW0A 4OERA 3FJMA 5CI5A 4HCYA 4JB7A 2QS3A 1D3KA 4FJPA 1BKAA 1VFEA 2YJPA 2GH9A 3PU5A 4H5GA 4IO5A 3CVGA 1B9JA 1CE2A 3O6GA 3GXAA 3A3UA 2RC8A 3TTMA 4DLDA 5CBSA 2Y84A 3IJXB 4F31B 3W9VA 4JSOA 4DCYA 2UVGA 4RA1A 1DOTA 2P2AA 3E3KA 1SW4A 1OIBA 2OZZA 1JVYA 4NF6B 1AIVA 3FXUA 4X48A 1A54A 1I6BA 3KN7A 1LGBC 5H8QB 3RGYA 1LCFA 3TCFA 5A5XB 1IUDA 3RTFB 5TPAB 2ESNA 3O2AA 5TP9A 1DTGA 1P1OA 3OEMA 2ANJA 1A40A 3GLBA 1EZPA 3IK6B 2ZYOA 3OXNA 4ZEBA 3TMGA 1MY0A 2F7AA 2ZYNA 3TEPA 3IO4A 1LAFE 4PFYA 3PUWE 2HZKA 4WEDA 5AA2D 1F9BA 4H8JA 1II5A 4POXA 4EDPA 5H8FA 4Z7EA 4QFOA 4XKRA 4GLIA 4R74A 2DOJA 3PPQA 3O28A 3TQWA 1NL5A 1US4A 4KR5A 4BDNA 5I2KA 2DSFA 1FTOA 3VXBA 2ALUA 1L5TA 4I62A 1JNFA 5I57B 3IR1A 5ELVA 4BDOA 4LQ2A 1QKAA 1IXHA 1M5BA 2ZYMA 4QSEA 5CRYA 1MXUA 5F7VA 2X7PA 4LATA 2XXQA 3MWBA 3OEKA 4U21A 4P0GA 1JW4A 2YPNA 3R6UA 4DCXA 3UP9A 4JDFA 5FTIA 1MY3A 2NXOA 3Q27A 4ESWA 4R6YA 4L17A 1P1UA 1ZLQA 4LP2B 2Q2CA 1Q35A 5H8HA 5AA4B 2PT2A 3M8UA 4X1DA 4RK2A 3U93A 1B6HA 3K02A 3DP8A 3KJTA 3N6UA 3RQTA 4E0XA 1GGGA 3O97A 1A7LA 1M5CA 4N07A 3IORA 4BLAA 1NH8A 5B70A 2V3QA 1IEJA 3FVNA 3MQ9A 4FAJA 3MZ1A 4YU0A 4PFTA 4LZ5A 1BLFA 3FIRA 4NMYA 1B3GA 4LQ5A 2V3UA 2QSXA 3FGSA 1VSOA 1PB7A 4KCDA 1RYOA 3ZSFA 4U22A 3H06B 1EH3A 2B3BA 2NWJA 4XKQA 4EXLA 5CMBA 3IOWA 2I49A 2UVJA 2ZNUA 3JV9A 1TFAA 3S9NC 5AA2A 4KQPA 1ZMGA 5KZTA 3PMVA 3IJOB 3CSBA 1FQEA 2UYFA 2QMWA 4NWDA 4Z0IA 5B7DA 1ZBMA 1B1HA 5L9MA 3H03A 3ZS6A 4XXUA 2Q2AA 4THIA 5H8NB 3ZKLA 3KGCA 4UACA 4GXSB 4HW8A 2XX9A 1FTMA 3H3GA 3BKIB 5EHSA 4POWA 3HPIA 2R6GE 4DXBA 1LAHE 4GD5A 3ILTB 1B5JA 3F11A 1YTVA 1MY4A 3QXMA 1ZKBA 3UIFA 2HAVA 1PBQA 3QUJA 3U92A 2XXHA 4ELQA 1MPDA 2ABHA 3VVDA 3MPKA 4YAHX 1QUJA 2W7YA 3SEWA 4C1TA 1PDAA 4Q0CA 4K3FA 2RC7A 2YLNA 1GR2A 2XX8A 4KFQA 3Q25A 4TLLB 1A8FA 4ZEDA 4R72A 3SEXA 1DPEA 1MXWA 3KZGA 1IXCA 1HSEA 1WVJA 4OWDA 4BDQA 1MDQA 2O51A 1JEUA 5DYHA 3OMBA 4F1UA 2VHAA 5DTBA 3SKPA 1P1NA 1XVXA 3EQ1A 1RYXA 5CBRA 3BFUA 4NF6A 1KWHA 1ATGA 2DS9A 3KG2A 1DTZA 1B2HA 1M5DA 3N6TA 4E0WA 3PD9A 2UXAA 3FZVA 4F3BA 4RPOA 1MY2A 2I0CA 5H8QA 3H6UA 3A09A 2D21A 3BBRA 5A5XA 5TPAA 3W9WA 1QUKA 1SYHA 3HO7A 4H5FA 2I4CA 4YMAA 3EHTA 3SEVA 5HPQA 3MC2A 1FQFA 3K6UA 5JEIA 1O63A 3Q28A 3UK4A 2Q8JA 4KYDA 2HFBA 3DP4A 4FECA 5I84A 5AA3A 2VGQA 4X1BA 4FEBA 5IAIA 3QIMA 1LFHA 3D4GA 4O3AA 5AE4A 1SQYA 4NE4A 2THIA 2VOZA 3PUXE 3MVWA 1B0HA 3TELA 3PV0E 1B5IA 1LB9A 2Y7IA 4G4PA 1B46A 4H65A 5DVFA 1MQIA 2XXIA 3T9VA 3TPAA 3PMXA 1B4HA 1YPNA 4BDRA 4H6DA 4RNSA 2IEEA 2H99A 3D4CA 1UIUA 3M3KA 2ZNTA 3T9UA 3C32A 1BIYA 5AA1A 1MQDA 4XTCQ 3OOAA 3CR9A 1BP5A 4NF4A 3TTRA 2AL5A 5AA4A 2O6AA 3EPEA 3U1OA 3TCHA 5FTHA 1MDP1 3I3VA 1Y20A 3FD3A 1D4NA 5I2NA 3LR1A 3LBSA 4C1UA 3MBPA 2F5XA 1UTHB 2Z23A 2AL4A 4YKKA 1B0LA 3AXFA 4ESXA 4F22A 2F7CA 3I6VA 4QFNA 3V89B 3ODBA 2DVCA 1MH3A 4NF8A 1IITA 1B1XA 1B7ZA 2HZLA 1Y1MA 3H6TA 4R75A 3BFTA 2Z22A 3O9PA 4U23A 4X9TA 4HS7A 1FQDA 2I3VA 4RPNA 1Y3PA 3OO9A 2D5WA 4F2OA 1USYH 3C34A 4ZE9A 4C0RA 4NTLA 3S9EA 1Y1ZA 3PUVE 4P11A 1MXZA 2I3WA 1SDXA 1N3WA 3PD8A 4ZEFA 1MH4A 4YKJA 2AIXA 4G68C 3K6WA 3CG3A 3C4MA 4IY6A 2DYXA 3B6TA 1IQ7A 5LOMA 1UTBA 4RYAA 2HXWA 4HTGA 2Y7WA 2I0BA 2F78A 4KYSA 3HHFA 5FHNA 5KCJA 1Z7NE 4Q30B 5I56A 4DXCA 5K2YA 4ELOA 1SVXB 4ZE8A 5L8DA 4IO4A 1R9QA 4N6PA 5BUUA 1MXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TT1 A;  5H8N A;  1EU8 A;  2G29 A;  5EHM A;  4ZDM A;  1AOV A;  2DE2 A;  2GRV A;  3FJG A;  3QYT A;  3KEI A;  3O6H A;  2RC9 A;  2F34 A;  2ZXT A;  4NWC A;  1JVX A;  4QFP A;  4H0W A;  1PEB A;  2RCA A;  3G3H A;  1B3F A;  3MP8 A;  2ONR A;  1Y3N A;  2FNC A;  2PMS A;  4XKN A;  3RY3 A;  4DE8 A;  1B4Z A;  3U94 A;  3UOR A;  3HHG A;  1OVB A;  2REJ A;  3RNN A;  4EF2 A;  3K6V A;  4QRZ A;  1ZIU A;  1VFD A;  1Y4C A;  1HSJ A;  3HST A;  3VE1 B;  3JYR A;  1AMF A;  1N76 A;  4N13 A;  4U4X A;  4NF4 B;  3SES A;  4F1V A;  2F6G A;  3K4U A;  3ILU B;  4TOZ A;  2H4I A;  1ANF A;  2XXU A;  4JWX A;  1LFG A;  4OVJ A;  5ISU A;  2G93 A;  5I2N B;  2BJJ X;  3KBR A;  1J1N A;  3LSF B;  3TUS A;  1B32 A;  3N26 A;  2I6E A;  2V93 A;  2ZYK A;  4ECF A;  4PQJ A;  1DPP A;  1POY 1;  2X7Q A;  4YIC A;  2QJE A;  4ZEI A;  4NF8 B;  4G8M A;  3G3K A;  2Z8E A;  4WEP A;  1NFT A;  3T9H B;  2AYS A;  3U8Q A;  1H76 A;  3C31 A;  4GIZ A;  4DZ1 A;  3G3G A;  3MP6 A;  3CIJ A;  5L9O A;  1Q1K A;  2Y7R A;  2QPQ A;  1NNT A;  3O6I A;  3L6H A;  5I59 A;  1AL3 A;  1B51 A;  2F8D A;  1MQJ A;  1QVS A;  3CG1 A;  5IKB A;  1P1Q A;  3S9M C;  4U1O A;  3DP6 A;  4G8N A;  2O68 A;  1OQG A;  3VVF A;  4OYV A;  4QSC A;  2I4B A;  1UTB B;  3S4U A;  4QSD A;  3K6X A;  4MFI A;  5KCJ B;  2O1L A;  4MLV A;  1B7H A;  5I56 B;  3SEY A;  1QKB A;  1SD3 A;  2DWH A;  2Q9T A;  3V8X B;  3O29 A;  1LAX A;  4LVQ A;  4YB5 A;  4IO6 A;  1WDN A;  3FAT A;  3QAX A;  2V3T A;  1US5 A;  4JWO A;  3OEL A;  3FVO A;  2DWJ A;  3UGW A;  4YB7 A;  1S50 A;  3RPW A;  3Q29 A;  1P1W A;  1O7T A;  5J1D A;  3UN6 A;  4OEN A;  3EN3 A;  1SW1 A;  3U72 A;  3OSQ A;  3MAM A;  3LSL A;  4LZ7 A;  2Y7K A;  2E1S A;  1JQF A;  3L6G A;  2LAO A;  1UTH A;  3E4R A;  5FHO A;  5HBC A;  1IZ1 A;  1MG1 A;  3A3C A;  2A5T A;  1LLS A;  4JXI A;  3RT8 A;  5K2X A;  3VLU A;  3I5O A;  4XIG Q;  3IAZ A;  2F35 A;  3EHU A;  4WKM A;  4F29 A;  4R2F A;  5CM6 A;  3R7X A;  4FE8 A;  3OO7 A;  5CC2 A;  3E13 X;  1B52 A;  3C36 A;  3PUY E;  3THI A;  4TLM B;  3QSL A;  4F1Y A;  1LBB A;  3IB1 A;  4U2R A;  4KI0 E;  2F36 A;  3T66 A;  1MRP A;  1XC1 A;  1QJM A;  1EZO A;  1MS7 A;  2F6P A;  2GHB A;  3G3J A;  1H3D A;  4GFR A;  3T93 B;  2QRY A;  2PVU A;  5DEX A;  3CFL A;  2O84 X;  4QHQ A;  1HSL A;  5I59 B;  4ZZE A;  3K1N A;  3M3F A;  4UA8 A;  2DXY A;  1A99 A;  3K1M A;  1SI0 A;  1DSN A;  1MM7 A;  4F18 A;  2B3F A;  3N94 A;  4PET A;  3ONM A;  4ND9 A;  2XXR A;  4G68 B;  2FA7 A;  4ZEC A;  4OET A;  2F7B A;  1PB9 A;  2Q89 A;  3DLN A;  4DXU A;  2QS2 A;  2QS1 A;  4I1D A;  3MVX A;  3T96 B;  1N0T A;  1MXY A;  1POT A;  3LUY A;  3TDJ A;  4U4S A;  1SI1 A;  2FYI A;  3GBB A;  1B58 A;  4DDD A;  1T0K A;  3KJ7 A;  5I58 B;  1OQH A;  3K1P A;  1N04 A;  1TWY A;  2XXW A;  2M8C A;  3IB2 A;  2ZMB A;  4R9F A;  5CMM A;  3G7W A;  4IO2 A;  2E0S A;  3O66 A;  3TCG A;  2OCU A;  3GZG A;  1SBP A;  3T9X B;  3MJN A;  3E9X A;  4P0I A;  1NKX A;  3W15 C;  1B40 A;  4GL0 A;  3RT6 B;  3PMW A;  3H4Z A;  3KOT A;  3G3F A;  3HCQ A;  1XOC A;  3IOT A;  4F3S A;  4LA9 A;  4PFW A;  4H67 A;  1B3L A;  1URS A;  3B7D A;  4ZZA A;  5DVI A;  4AB5 A;  4RY1 A;  4MLQ A;  4YKP A;  3TKD A;  3GBA A;  1ZU0 A;  3T22 A;  1H44 A;  3CSG A;  4F3P A;  3K00 A;  1B7U A;  2A5T B;  1TXF A;  4JBZ A;  2ONS A;  3VVE A;  1OVT A;  3MUQ A;  5TU0 A;  1N7W A;  3C33 A;  3H6V A;  1OLA A;  2QS4 A;  4YZZ A;  5JTY B;  1NNF A;  3TAJ A;  3R26 A;  4EQ9 A;  2DXR A;  1VE4 A;  2KLF A;  4R6K A;  1FTL A;  4IGT A;  2O7I A;  4GRK A;  1FQC A;  4M4G A;  4OFO A;  1XVY A;  4GWO A;  1LB8 A;  1D9V A;  2OWT A;  2UVH A;  2QL3 A;  3LC8 A;  2XD3 A;  4BDM A;  3MVZ A;  4H1X A;  5DEX B;  1B5H A;  4EQ7 A;  3ZKK A;  2XXX A;  4YKI A;  2P1S A;  4FIM A;  3KN3 A;  4OHN A;  1MPB A;  1WOD A;  2OK2 A;  1MPC A;  3RTW B;  1BTJ A;  1SW5 A;  1OMP A;  3KSJ A;  2H5Y A;  1XT8 A;  4KYE A;  4HCW A;  1N7X A;  3OEN A;  2XXY A;  4NF5 B;  4IO3 A;  5BWJ A;  2F97 A;  2NUV A;  3QK6 A;  3N5L A;  1YAE A;  1FQA A;  2RF1 A;  4ELR A;  2XXP A;  1PB8 A;  2XX7 A;  2HEU A;  4JSD A;  4LON B;  3TYH A;  3IO6 A;  1IXI A;  3JZJ A;  3H6W A;  2O7U A;  3LSW A;  2H98 A;  3G3I A;  3FVG A;  4IY5 A;  1NMU A;  3PPN A;  5KDT B;  4DIG A;  4O3B A;  1PBP A;  1S7Y A;  4ZEK A;  1FTJ A;  2I58 A;  4OXV A;  1M5E A;  5CMC A;  3RN8 A;  3TZA A;  3DEL B;  3SET A;  4RK9 A;  1JW5 A;  5JK4 A;  3C35 A;  3WAF A;  2V84 A;  4KPT A;  4LUB A;  1CB6 A;  3CI8 A;  5EYF A;  3SEU A;  4PP0 A;  5ITO A;  2OJT A;  3MZ9 A;  4LZ8 A;  3S9L C;  5ICQ A;  2OBG A;  2REG A;  1MXX A;  1TFD A;  4FAT A;  3V5A A;  3SER A;  4QF9 A;  3KOS A;  2PX1 A;  4EUO A;  4MF3 A;  1MY1 A;  2PT1 A;  2I48 A;  3PPR A;  2DWA A;  4YMB A;  1R1N A;  2QMX A;  3KFM A;  4RXL A;  1XS5 A;  1I6A A;  3PUZ E;  1R6Z A;  4OTE A;  1O64 A;  2XD2 A;  4KCC A;  2B65 A;  3K01 A;  1ZJL A;  2XXT A;  4OFJ A;  4OZ9 A;  1IIW A;  5DVJ A;  3VLV A;  1A55 A;  4ONY A;  2OLB A;  1A8E A;  4WXJ A;  1QUL A;  3Q26 A;  5CMK A;  1N84 A;  3IL1 B;  4R2B A;  4GVO A;  4QFK A;  4G68 A;  3B6W A;  1AH5 A;  1RKM A;  3OO6 A;  3MP1 A;  4BDL A;  2DVZ A;  2Z8F A;  5F1Q A;  2RKM A;  4MBP A;  1OLC A;  1FTK A;  3OD7 A;  4JWY A;  3IB0 A;  3VLW A;  3TQL A;  4QFL A;  4GXA A;  4R73 A;  4OEV A;  3OSR A;  1LCT A;  1LST A;  2HQ0 A;  3FJ7 A;  5I58 A;  5TP9 B;  4F39 A;  4M1V A;  4IO7 A;  3H7M A;  2H9B A;  1NNK A;  1LBC A;  3FAS A;  2NVU B;  3K0V A;  1UQW A;  1ELJ A;  5DT6 A;  4OEU A;  3WAE A;  2DE4 A;  3S2V A;  4KHZ E;  1GV8 A;  5H8S A;  5H8F B;  3EHS A;  2R9J A;  3P7I A;  2CMO A;  4G8H A;  4ISU A;  1P99 A;  4MH5 A;  3UA8 A;  4KD5 A;  4O3C A;  3QUF A;  4GQO A;  2H25 A;  4IB2 A;  4F2Q A;  1H45 A;  5I2K B;  4YB6 A;  2CZL A;  1NH7 A;  1B3E A;  3ECR A;  4IGR A;  1LFI A;  3KN8 A;  2RIN A;  4R9G A;  2Q88 A;  4EF1 A;  4OMB A;  1GTK A;  2O1M A;  3HN0 A;  3VXC A;  1Y4T A;  1MQH A;  1ZTY A;  2HCA A;  2VP1 A;  4GF8 A;  4U1Z A;  1SYI A;  2WKY A;  4PFU A;  1GVC A;  1D9Y A;  5JTY A;  3KSX A;  1B3H A;  2RCB A;  3PPP A;  1FCK A;  3CFX A;  4G77 A;  3TOD A;  3EF7 A;  3TTK A;  4H8I A;  4OQO A;  3DM0 A;  1URG A;  5H8H B;  3CFZ A;  2VD2 A;  2P0S A;  2DQV A;  2PYY A;  3MPL A;  3IOU A;  1B05 A;  3FXQ A;  2D3I A;  2GFE A;  4F3G A;  2XHD A;  2Y7P A;  5HM4 B;  1N3X A;  3VV5 A;  2X26 A;  1YCJ A;  2NOO A;  4GL8 A;  4RJZ A;  4I8C A;  1JEV A;  1USY E;  3IX1 A;  2DP8 A;  2OWS A;  3VDF A;  1QUI A;  4EXK A;  5ICT A;  3LSX A;  1UIV A;  1LAG E;  3OO8 A;  2GHA A;  3MVY A;  1SW2 A;  2ZNS A;  1I69 A;  2IA4 A;  2DE3 A;  4NF5 A;  4TQU Q;  3USD A;  5M2V A;  1MM6 A;  2DWI A;  3FUZ A;  1URD A;  3MZB A;  5L9S A;  4G2Z A;  3B6Q A;  1EZ9 A;  3V83 A;  4Q5T A;  2ONK E;  3VFJ A;  4XKP A;  5KDT A;  2HAU A;  3IOV A;  4OFL A;  5AA2 B;  1JW1 A;  1S9T A;  4NED A;  3PGF A;  1JET A;  1I6Q A;  2XXV A;  1H43 A;  1DMB A;  2VD3 A;  2O69 A;  4I9D A;  3RLF E;  1Z7M E;  3TTL A;  4FOR A;  1Y9U A;  4ZS9 A;  1FQB A;  2A5S A;  1XHY A;  5I57 A;  4FED A;  3C9H A;  4PE5 B;  4AQ4 A;  2Z8D A;  3FXR A;  1IXG A;  3FV1 A;  3RUM A;  3SDF A;  3TFL A;  2R71 A;  1QW0 A;  5FHM A;  1MQG A;  3K2D A;  2V25 A;  3FV2 A;  1NNP A;  4Q8R A;  4AB6 A;  2PBW A;  3TTN A;  5ITP A;  2UYE A;  3PPO A;  3FVK A;  1VR5 A;  4ELP A;  1PC3 A;  3CRB A;  4F19 A;  2UVI A;  1M5F A;  4EQB A;  4GOT A;  4OES A;  1R9L A;  3HV1 A;  3MW0 A;  4R6H A;  3M3L A;  1Y3Q A;  1FW0 A;  4OER A;  3FJM A;  5CI5 A;  4HCY A;  4JB7 A;  2QS3 A;  1D3K A;  4FJP A;  1BKA A;  1VFE A;  2YJP A;  2GH9 A;  3PU5 A;  4H5G A;  4IO5 A;  3CVG A;  1B9J A;  1CE2 A;  3O6G A;  3GXA A;  3A3U A;  2RC8 A;  3TTM A;  4DLD A;  5CBS A;  2Y84 A;  3IJX B;  4F31 B;  3W9V A;  4JSO A;  4DCY A;  2UVG A;  4RA1 A;  1DOT A;  2P2A A;  3E3K A;  1SW4 A;  1OIB A;  2OZZ A;  1JVY A;  4NF6 B;  1AIV A;  3FXU A;  4X48 A;  1A54 A;  1I6B A;  3KN7 A;  1LGB C;  5H8Q B;  3RGY A;  1LCF A;  3TCF A;  5A5X B;  1IUD A;  3RTF B;  5TPA B;  2ESN A;  3O2A A;  5TP9 A;  1DTG A;  1P1O A;  3OEM A;  2ANJ A;  1A40 A;  3GLB A;  1EZP A;  3IK6 B;  2ZYO A;  3OXN A;  4ZEB A;  3TMG A;  1MY0 A;  2F7A A;  2ZYN A;  3TEP A;  3IO4 A;  1LAF E;  4PFY A;  3PUW E;  2HZK A;  4WED A;  5AA2 D;  1F9B A;  4H8J A;  1II5 A;  4POX A;  4EDP A;  5H8F A;  4Z7E A;  4QFO A;  4XKR A;  4GLI A;  4R74 A;  2DOJ A;  3PPQ A;  3O28 A;  3TQW A;  1NL5 A;  1US4 A;  4KR5 A;  4BDN A;  5I2K A;  2DSF A;  1FTO A;  3VXB A;  2ALU A;  1L5T A;  4I62 A;  1JNF A;  5I57 B;  3IR1 A;  5ELV A;  4BDO A;  4LQ2 A;  1QKA A;  1IXH A;  1M5B A;  2ZYM A;  4QSE A;  5CRY A;  1MXU A;  5F7V A;  2X7P A;  4LAT A;  2XXQ A;  3MWB A;  3OEK A;  4U21 A;  4P0G A;  1JW4 A;  2YPN A;  3R6U A;  4DCX A;  3UP9 A;  4JDF A;  5FTI A;  1MY3 A;  2NXO A;  3Q27 A;  4ESW A;  4R6Y A;  4L17 A;  1P1U A;  1ZLQ A;  4LP2 B;  2Q2C A;  1Q35 A;  5H8H A;  5AA4 B;  2PT2 A;  3M8U A;  4X1D A;  4RK2 A;  3U93 A;  1B6H A;  3K02 A;  3DP8 A;  3KJT A;  3N6U A;  3RQT A;  4E0X A;  1GGG A;  3O97 A;  1A7L A;  1M5C A;  4N07 A;  3IOR A;  4BLA A;  1NH8 A;  5B70 A;  2V3Q A;  1IEJ A;  3FVN A;  3MQ9 A;  4FAJ A;  3MZ1 A;  4YU0 A;  4PFT A;  4LZ5 A;  1BLF A;  3FIR A;  4NMY A;  1B3G A;  4LQ5 A;  2V3U A;  2QSX A;  3FGS A;  1VSO A;  1PB7 A;  4KCD A;  1RYO A;  3ZSF A;  4U22 A;  3H06 B;  1EH3 A;  2B3B A;  2NWJ A;  4XKQ A;  4EXL A;  5CMB A;  3IOW A;  2I49 A;  2UVJ A;  2ZNU A;  3JV9 A;  1TFA A;  3S9N C;  5AA2 A;  4KQP A;  1ZMG A;  5KZT A;  3PMV A;  3IJO B;  3CSB A;  1FQE A;  2UYF A;  2QMW A;  4NWD A;  4Z0I A;  5B7D A;  1ZBM A;  1B1H A;  5L9M A;  3H03 A;  3ZS6 A;  4XXU A;  2Q2A A;  4THI A;  5H8N B;  3ZKL A;  3KGC A;  4UAC A;  4GXS B;  4HW8 A;  2XX9 A;  1FTM A;  3H3G A;  3BKI B;  5EHS A;  4POW A;  3HPI A;  2R6G E;  4DXB A;  1LAH E;  4GD5 A;  3ILT B;  1B5J A;  3F11 A;  1YTV A;  1MY4 A;  3QXM A;  1ZKB A;  3UIF A;  2HAV A;  1PBQ A;  3QUJ A;  3U92 A;  2XXH A;  4ELQ A;  1MPD A;  2ABH A;  3VVD A;  3MPK A;  4YAH X;  1QUJ A;  2W7Y A;  3SEW A;  4C1T A;  1PDA A;  4Q0C A;  4K3F A;  2RC7 A;  2YLN A;  1GR2 A;  2XX8 A;  4KFQ A;  3Q25 A;  4TLL B;  1A8F A;  4ZED A;  4R72 A;  3SEX A;  1DPE A;  1MXW A;  3KZG A;  1IXC A;  1HSE A;  1WVJ A;  4OWD A;  4BDQ A;  1MDQ A;  2O51 A;  1JEU A;  5DYH A;  3OMB A;  4F1U A;  2VHA A;  5DTB A;  3SKP A;  1P1N A;  1XVX A;  3EQ1 A;  1RYX A;  5CBR A;  3BFU A;  4NF6 A;  1KWH A;  1ATG A;  2DS9 A;  3KG2 A;  1DTZ A;  1B2H A;  1M5D A;  3N6T A;  4E0W A;  3PD9 A;  2UXA A;  3FZV A;  4F3B A;  4RPO A;  1MY2 A;  2I0C A;  5H8Q A;  3H6U A;  3A09 A;  2D21 A;  3BBR A;  5A5X A;  5TPA A;  3W9W A;  1QUK A;  1SYH A;  3HO7 A;  4H5F A;  2I4C A;  4YMA A;  3EHT A;  3SEV A;  5HPQ A;  3MC2 A;  1FQF A;  3K6U A;  5JEI A;  1O63 A;  3Q28 A;  3UK4 A;  2Q8J A;  4KYD A;  2HFB A;  3DP4 A;  4FEC A;  5I84 A;  5AA3 A;  2VGQ A;  4X1B A;  4FEB A;  5IAI A;  3QIM A;  1LFH A;  3D4G A;  4O3A A;  5AE4 A;  1SQY A;  4NE4 A;  2THI A;  2VOZ A;  3PUX E;  3MVW A;  1B0H A;  3TEL A;  3PV0 E;  1B5I A;  1LB9 A;  2Y7I A;  4G4P A;  1B46 A;  4H65 A;  5DVF A;  1MQI A;  2XXI A;  3T9V A;  3TPA A;  3PMX A;  1B4H A;  1YPN A;  4BDR A;  4H6D A;  4RNS A;  2IEE A;  2H99 A;  3D4C A;  1UIU A;  3M3K A;  2ZNT A;  3T9U A;  3C32 A;  1BIY A;  5AA1 A;  1MQD A;  4XTC Q;  3OOA A;  3CR9 A;  1BP5 A;  4NF4 A;  3TTR A;  2AL5 A;  5AA4 A;  2O6A A;  3EPE A;  3U1O A;  3TCH A;  5FTH A;  1MDP 1;  3I3V A;  1Y20 A;  3FD3 A;  1D4N A;  5I2N A;  3LR1 A;  3LBS A;  4C1U A;  3MBP A;  2F5X A;  1UTH B;  2Z23 A;  2AL4 A;  4YKK A;  1B0L A;  3AXF A;  4ESX A;  4F22 A;  2F7C A;  3I6V A;  4QFN A;  3V89 B;  3ODB A;  2DVC A;  1MH3 A;  4NF8 A;  1IIT A;  1B1X A;  1B7Z A;  2HZL A;  1Y1M A;  3H6T A;  4R75 A;  3BFT A;  2Z22 A;  3O9P A;  4U23 A;  4X9T A;  4HS7 A;  1FQD A;  2I3V A;  4RPN A;  1Y3P A;  3OO9 A;  2D5W A;  4F2O A;  1USY H;  3C34 A;  4ZE9 A;  4C0R A;  4NTL A;  3S9E A;  1Y1Z A;  3PUV E;  4P11 A;  1MXZ A;  2I3W A;  1SDX A;  1N3W A;  3PD8 A;  4ZEF A;  1MH4 A;  4YKJ A;  2AIX A;  4G68 C;  3K6W A;  3CG3 A;  3C4M A;  4IY6 A;  2DYX A;  3B6T A;  1IQ7 A;  5LOM A;  1UTB A;  4RYA A;  2HXW A;  4HTG A;  2Y7W A;  2I0B A;  2F78 A;  4KYS A;  3HHF A;  5FHN A;  5KCJ A;  1Z7N E;  4Q30 B;  5I56 A;  4DXC A;  5K2Y A;  4ELO A;  1SVX B;  4ZE8 A;  5L8D A;  4IO4 A;  1R9Q A;  4N6P A;  5BUU A;  1MXV A; 
#chains in the Genus database with same CATH topology
 4NHB A;  3MST A;  1K9Z A;  1TT1 A;  5H8N A;  1EU8 A;  2G29 A;  2WYP A;  5EHM A;  4ZDM A;  1AOV A;  2DE2 A;  2GRV A;  3FJG A;  3QYT A;  3KEI A;  1FRP A;  3O6H A;  3E78 A;  4NAP A;  2RC9 A;  2F34 A;  2ZXT A;  4NWC A;  2FVZ A;  4MHF A;  1JVX A;  4QFP A;  4H0W A;  1PEB A;  2PCR A;  2RCA A;  3G3H A;  1INP A;  1B3F A;  3MP8 A;  2ONR A;  1Y3N A;  2FNC A;  2PMS A;  3QMF A;  4XKN A;  3RY3 A;  4DE8 A;  1B4Z A;  3U94 A;  3UOR A;  3HHG A;  1OVB A;  2REJ A;  3RNN A;  4EF2 A;  3K6V A;  3KBZ A;  4QRZ A;  2VPO A;  1ZIU A;  1VFD A;  1LBV A;  1Y4C A;  1HSJ A;  3HST A;  3VE1 B;  3JYR A;  1AMF A;  1N76 A;  4N13 A;  2F3B A;  1YZ0 A;  4NX1 A;  4NF4 B;  4U4X A;  3SES A;  4F1V A;  2F6G A;  3K4U A;  3ILU B;  4TOZ A;  2H4I A;  1ANF A;  2XXU A;  5IZZ A;  4JWX A;  1LFG A;  4OVJ A;  4P9K A;  5ISU A;  2G93 A;  5I2N B;  2BJJ X;  3KBR A;  1J1N A;  3FXB A;  3LSF B;  3TUS A;  1B32 A;  3N26 A;  4FBP A;  2I6E A;  2ZZV A;  2V93 A;  2ZYK A;  4PQJ A;  4ECF A;  1DPP A;  1POY 1;  2JJK A;  2PFZ A;  2X7Q A;  4YIC A;  2QJE A;  4ZEI A;  4NF8 B;  4G8M A;  3G3K A;  2Z8E A;  4WEP A;  1VDW A;  1NFT A;  4OA4 A;  2AYS A;  3T9H B;  3U8Q A;  1H76 A;  3C31 A;  4GIZ A;  4DZ1 A;  3G3G A;  3MP6 A;  3CIJ A;  5L9O A;  1Q1K A;  2Y7R A;  2QPQ A;  1NNT A;  2MKZ A;  3O6I A;  3L6H A;  1NI9 A;  5I59 A;  1RDY A;  1AL3 A;  1B51 A;  4QBA A;  2F8D A;  1MQJ A;  3RPL A;  1CNQ A;  1QVS A;  3CG1 A;  5IKB A;  1P1Q A;  3S9M C;  4U1O A;  4PGP A;  3DP6 A;  4G8N A;  2O68 A;  1OQG A;  3VVF A;  4OYV A;  4QSC A;  2I4B A;  1UTB B;  3S4U A;  4QSD A;  5LDZ A;  3K6X A;  4MFI A;  4LN5 A;  5KCJ B;  2O1L A;  4MLV A;  1B7H A;  5I56 B;  3SEY A;  4PAK A;  1QKB A;  1SD3 A;  2DWH A;  2PFY A;  2Q9T A;  3V8X B;  3O29 A;  1LAX A;  4LVQ A;  4YB5 A;  5IZ3 B;  4IO6 A;  4P47 A;  1WDN A;  3FAT A;  3QAX A;  4GBV A;  2V3T A;  1US5 A;  4JWO A;  3OEL A;  3FVO A;  2DWJ A;  3UGW A;  4YB7 A;  3KC1 A;  1S50 A;  3RPW A;  3Q29 A;  1P1W A;  1O7T A;  5J1D A;  3UN6 A;  4OEN A;  3EN3 A;  1SW1 A;  3U72 A;  3OSQ A;  3MAM A;  1NV0 A;  3LSL A;  5EYH A;  4LZ7 A;  2Y7K A;  2E1S A;  1JQF A;  3L6G A;  2LAO A;  1UTH A;  3E4R A;  5FHO A;  5HBC A;  1NV3 A;  1IZ1 A;  1MG1 A;  3A3C A;  2A5T A;  1LLS A;  4JXI A;  3RT8 A;  5K2X A;  3VLU A;  3I5O A;  4XIG Q;  3IAZ A;  2F35 A;  3EHU A;  4WKM A;  4F29 A;  4R2F A;  5CM6 A;  3R7X A;  4FE8 A;  3OO7 A;  3D1R A;  4HE2 A;  4HE1 A;  5CC2 A;  3E13 X;  1B52 A;  3C36 A;  3PUY E;  3THI A;  4TLM B;  3QSL A;  4F1Y A;  1LBB A;  1AWB A;  3IB1 A;  4U2R A;  4KI0 E;  2F36 A;  3T66 A;  1MRP A;  1XC1 A;  1QJM A;  1EZO A;  1MS7 A;  2F6P A;  2GHB A;  3G3J A;  1H3D A;  4GFR A;  3T93 B;  2CZI A;  2QRY A;  1FBC A;  2PVU A;  5DEX A;  3CFL A;  1NUW A;  1JP4 A;  2O84 X;  4QHQ A;  1FPE A;  5EQ7 A;  2HPG A;  1HSL A;  2XA5 A;  5I59 B;  4ZZE A;  3K1N A;  5FBP A;  3M3F A;  4UA8 A;  2DXY A;  1A99 A;  3K1M A;  4AS5 A;  1SI0 A;  3RPL B;  1DSN A;  2QVR A;  1MM7 A;  5IGA A;  4F18 A;  1FTA A;  2B3F A;  3N94 A;  4PET A;  3ONM A;  4ND9 A;  2XXR A;  4G68 B;  2FA7 A;  4ZEC A;  2OX3 A;  4OET A;  3IFC A;  2F7B A;  1PB9 A;  2Q89 A;  3DLN A;  4DXU A;  2QS2 A;  3NOH A;  2QS1 A;  4IR8 A;  4I1D A;  3MVX A;  3T96 B;  1N0T A;  4MCO A;  1MXY A;  1POT A;  3LUY A;  3TDJ A;  4U4S A;  1DK4 A;  1SI1 A;  2FYI A;  3GBB A;  4H45 A;  1B58 A;  4DDD A;  1T0K A;  3KJ7 A;  5I58 B;  1OQH A;  3K1P A;  1N04 A;  1TWY A;  2XXW A;  2M8C A;  3IB2 A;  2ZMB A;  4R9F A;  5CMM A;  3G7W A;  4IO2 A;  2E0S A;  3O66 A;  3TCG A;  2OCU A;  3GZG A;  1SBP A;  1LEV A;  3T9X B;  3MJN A;  3E9X A;  4P0I A;  2P3V A;  1NKX A;  3W15 C;  4KXP A;  1B40 A;  4GL0 A;  4MMP A;  3RT6 B;  3PMW A;  2WEF A;  3H4Z A;  3KOT A;  3G3F A;  1IMB A;  3ROJ A;  3HCQ A;  1XOC A;  3IOT A;  4F3S A;  4LA9 A;  4PFW A;  4H67 A;  1B3L A;  1URS A;  1FPD A;  1YYZ A;  3B7D A;  4OVR A;  4ZZA A;  2HHM A;  5DVI A;  4AB5 A;  4RY1 A;  2XWI A;  4MLQ A;  4YKP A;  3TKD A;  3GBA A;  1ZU0 A;  3T22 A;  1FBP A;  1LBY A;  1H44 A;  3CSG A;  4F3P A;  3K00 A;  4N15 A;  1B7U A;  2A5T B;  1TXF A;  4JBZ A;  2ONS A;  3VVE A;  1OVT A;  3MUQ A;  1FPI A;  5TU0 A;  1N7W A;  1FPL A;  3C33 A;  3H6V A;  1OLA A;  2QS4 A;  4YZZ A;  5JTY B;  1NNF A;  5ET8 A;  3TAJ A;  3R26 A;  4EQ9 A;  2DXR A;  1VE4 A;  2KLF A;  4R6K A;  1FTL A;  4IGT A;  2O7I A;  4GRK A;  1FQC A;  4M4G A;  4OFO A;  1XVY A;  4GWO A;  4P1L A;  1LB8 A;  1D9V A;  2OWT A;  2UVH A;  1FPJ A;  2QL3 A;  2V4C A;  3LC8 A;  2XD3 A;  4BDM A;  1LBZ A;  3MVZ A;  4H1X A;  5DEX B;  1B5H A;  4EQ7 A;  2WBD A;  3ZKK A;  2XXX A;  4YKI A;  2P1S A;  2CEY A;  2VT5 A;  4FIM A;  3KN3 A;  4OHN A;  1MPB A;  4XEQ A;  1WOD A;  2OK2 A;  5IZ3 A;  1MPC A;  3T1B A;  3RTW B;  1NV2 A;  1BTJ A;  1SW5 A;  1OMP A;  3KSJ A;  2H5Y A;  1XT8 A;  4KYE A;  4HCW A;  1N7X A;  3OEN A;  5EQA A;  2XXY A;  4NF5 B;  4IO3 A;  5BWJ A;  2F97 A;  2NUV A;  3QK6 A;  3N5L A;  1YAE A;  4JVI A;  1FQA A;  2RF1 A;  4X8R A;  4ELR A;  2R8T A;  2XXP A;  1PB8 A;  2XX7 A;  2HEU A;  4O7I A;  4JSD A;  4LON B;  3TYH A;  2DDK A;  3IO6 A;  1IXI A;  3JZJ A;  3H6W A;  2O7U A;  3LSW A;  2H98 A;  3G3I A;  3FVG A;  4IY5 A;  1NMU A;  1KA0 A;  3PPN A;  4DIG A;  5KDT B;  4O3B A;  1PBP A;  2KR0 A;  1S7Y A;  4ZEK A;  1FTJ A;  2I58 A;  4OXV A;  1M5E A;  5CMC A;  4PGN A;  3RN8 A;  4GBW A;  3TZA A;  3DEL B;  3SET A;  4RK9 A;  1JW5 A;  5JK4 A;  3C35 A;  3WAF A;  1IMD A;  2V84 A;  4KPT A;  1CB6 A;  4LUB A;  3CI8 A;  4NN3 A;  5EYF A;  3SEU A;  4PP0 A;  5ITO A;  2OJT A;  3MZ9 A;  4LZ8 A;  3S9L C;  5ICQ A;  2OBG A;  2REG A;  1MXX A;  1TFD A;  4FAT A;  3V5A A;  3SER A;  4QF9 A;  3KOS A;  2PX1 A;  2HXR A;  1NUX A;  4EUO A;  4MF3 A;  1MY1 A;  2PT1 A;  2I48 A;  3PPR A;  2DWA A;  4YMB A;  1R1N A;  2QMX A;  3KFM A;  4RXL A;  1XS5 A;  1IMF A;  1I6A A;  3PUZ E;  1R6Z A;  4OTE A;  1O64 A;  3B50 A;  2XD2 A;  4KCC A;  2B65 A;  3RYD A;  3K01 A;  1ZJL A;  2XXT A;  4OFJ A;  1FPK A;  4OZ9 A;  1IIW A;  5DVJ A;  3VLV A;  1A55 A;  4ONY A;  2OLB A;  1A8E A;  4WXJ A;  1QUL A;  3Q26 A;  5CMK A;  1N84 A;  3IL1 B;  4R2B A;  4GVO A;  4QFK A;  2XWO A;  4G68 A;  3B6W A;  1AH5 A;  1RKM A;  3OO6 A;  3MP1 A;  4X04 A;  2GQ1 A;  3KC0 A;  4BDL A;  2DVZ A;  2Z8F A;  2CZH A;  5F1Q A;  2RKM A;  4MBP A;  1OLC A;  4I3Y A;  1FTK A;  3OD7 A;  3LUZ A;  4JWY A;  3IB0 A;  3VLW A;  3TQL A;  4QFL A;  4GXA A;  4R73 A;  4OEV A;  3OSR A;  1LCT A;  3SZP A;  1LST A;  2HQ0 A;  3FJ7 A;  5I58 A;  5TP9 B;  4F39 A;  4M1V A;  4IO7 A;  3H7M A;  2H9B A;  1NNK A;  1LBC A;  3FAS A;  1FBG A;  2NVU B;  3K0V A;  1SPI A;  1UQW A;  1ELJ A;  5DT6 A;  4OEU A;  3WAE A;  2DE4 A;  3S2V A;  4KHZ E;  1GV8 A;  5H8S A;  5H8F B;  2FIX A;  3EHS A;  2R9J A;  3P7I A;  3LV0 A;  2CMO A;  4G8H A;  4ISU A;  1P99 A;  4MH5 A;  3UA8 A;  4KD5 A;  4O3C A;  3QUF A;  4GQO A;  1NUY A;  2H25 A;  4IB2 A;  4F2Q A;  1H45 A;  5I2K B;  4O7M A;  4YB6 A;  2CZL A;  1NH7 A;  1B3E A;  3ECR A;  4IGR A;  1LFI A;  3KN8 A;  2RIN A;  4R9G A;  2Q88 A;  4EF1 A;  4OMB A;  1GTK A;  2O1M A;  3HN0 A;  3VXC A;  1Y4T A;  1MQH A;  1ZTY A;  4N8G A;  2HCA A;  2VP1 A;  4GF8 A;  4U1Z A;  1SYI A;  2WKY A;  4PFU A;  1GVC A;  4PFB A;  1D9Y A;  5JTY A;  2ZZX A;  3KSX A;  1B3H A;  1FSA A;  2RCB A;  3PPP A;  1FCK A;  3CFX A;  4G77 A;  3TOD A;  3EF7 A;  3TTK A;  4H8I A;  4OQO A;  3DM0 A;  1URG A;  5H8H B;  3CFZ A;  2VD2 A;  2P0S A;  4MNC A;  2DQV A;  1NUZ A;  4PDD A;  2PYY A;  2VPN A;  4O94 A;  3IOU A;  3MPL A;  3U65 A;  1B05 A;  3FXQ A;  1LBX A;  2D3I A;  2GFE A;  4F3G A;  2XHD A;  2Y7P A;  5HM4 B;  2XXK A;  1N3X A;  1FBE A;  3VV5 A;  2X26 A;  1YCJ A;  2NOO A;  4GL8 A;  4RJZ A;  4I8C A;  1JEV A;  2OWZ A;  1USY E;  3IX1 A;  3PTY A;  2DP8 A;  5T3J A;  2OWS A;  3VDF A;  1QUI A;  4EXK A;  4PC9 A;  5ICT A;  3LSX A;  1UIV A;  1LAG E;  3OO8 A;  2GHA A;  3MVY A;  4NF0 A;  1SW2 A;  2ZNS A;  1I69 A;  2WX9 A;  2IA4 A;  1KZ8 A;  2ZZW A;  3ISP A;  2DE3 A;  4NF5 A;  1LBW A;  4TQU Q;  3USD A;  5M2V A;  1MM6 A;  2DWI A;  3FUZ A;  1URD A;  3MZB A;  4P56 A;  4MJO A;  4NGU A;  5L9S A;  4G2Z A;  3B6Q A;  1EZ9 A;  3V83 A;  4Q5T A;  2ONK E;  3VFJ A;  4XKP A;  5KDT A;  2HAU A;  3IOV A;  4OFL A;  5AA2 B;  1JW1 A;  1S9T A;  4NED A;  3PGF A;  1JET A;  1I6Q A;  2XXV A;  4GWS A;  1H43 A;  1DMB A;  2VD3 A;  2O69 A;  2KQZ A;  4I9D A;  3RLF E;  1Z7M E;  3TTL A;  4FOR A;  1Y9U A;  4ZS9 A;  1FQB A;  2A5S A;  1XHY A;  5I57 A;  4FED A;  4OVQ A;  3C9H A;  4PE5 B;  4AQ4 A;  2Z8D A;  4N91 A;  3FXR A;  1IXG A;  3FV1 A;  3RUM A;  3SDF A;  3TFL A;  2R71 A;  1NV5 A;  1QW0 A;  4OAN A;  5FHM A;  5IM2 A;  1MQG A;  3K2D A;  2V25 A;  3FV2 A;  4GX4 A;  1NNP A;  4Q8R A;  4AB6 A;  2PBW A;  3TTN A;  4DI4 B;  5ITP A;  2UYE A;  2XWV A;  3PPO A;  3FVK A;  1VR5 A;  4ELP A;  5LTC A;  1PC3 A;  3CRB A;  4AS4 A;  4F19 A;  2UVI A;  1M5F A;  4EQB A;  4GOT A;  4OES A;  1R9L A;  3HV1 A;  3MW0 A;  4N81 A;  4HXV A;  4R6H A;  5EQ9 A;  3M3L A;  1Y3Q A;  1FW0 A;  4OER A;  3FJM A;  5CI5 A;  4HCY A;  4JB7 A;  2QS3 A;  3B8B A;  1D3K A;  4FJP A;  1BKA A;  1VFE A;  2YJP A;  2GH9 A;  3PU5 A;  4N6K A;  4H5G A;  4IO5 A;  4PDH A;  1FJ6 A;  3CVG A;  1B9J A;  1CE2 A;  3O6G A;  3GXA A;  3A3U A;  2RC8 A;  3TTM A;  4DI3 D;  4DLD A;  5CBS A;  2Y84 A;  3IJX B;  4F31 B;  3W9V A;  4JSO A;  2CEX A;  5I5P A;  4DCY A;  2UVG A;  4RA1 A;  1DOT A;  2P2A A;  4QXD A;  3E3K A;  1SW4 A;  1OIB A;  2OZZ A;  1JVY A;  4NF6 B;  1AIV A;  3FXU A;  4JVD A;  4X48 A;  1A54 A;  1I6B A;  4PAI A;  3KN7 A;  1LGB C;  5H8Q B;  3RGY A;  1LCF A;  3TCF A;  5A5X B;  1IUD A;  3RTF B;  5TPA B;  5J16 A;  2ESN A;  3O2A A;  5I3S A;  5TP9 A;  1DTG A;  1P1O A;  5ET5 A;  3OEM A;  2ANJ A;  1A40 A;  3T0J A;  4MX6 A;  3GLB A;  1EZP A;  3IK6 B;  2ZYO A;  3OXN A;  4MAG A;  4ZEB A;  3TMG A;  1MY0 A;  2F7A A;  2ZYN A;  4UAB A;  3TEP A;  3IO4 A;  1LAF E;  4PFY A;  3E79 A;  3PUW E;  2HZK A;  4WED A;  5AA2 D;  3A29 A;  5I7I A;  1F9B A;  4H8J A;  1II5 A;  4POX A;  1EYK A;  4EDP A;  5H8F A;  4Z7E A;  4QFO A;  4XKR A;  4GLI A;  4R74 A;  2DOJ A;  3PPQ A;  3O28 A;  3TQW A;  1NL5 A;  1US4 A;  4KR5 A;  4PCD A;  4BDN A;  5I2K A;  2DSF A;  2WYK A;  1FTO A;  3VXB A;  2QVU A;  2ALU A;  1L5T A;  4I62 A;  1JNF A;  5I57 B;  3IR1 A;  5ELV A;  4BDO A;  4LQ2 A;  1DBZ A;  1FBF A;  1KA1 A;  1QKA A;  1IXH A;  1M5B A;  2ZYM A;  4MNI A;  4QSE A;  4OVS A;  2Y5K A;  5CRY A;  3HFU A;  1MXU A;  5F7V A;  2X7P A;  4LAT A;  5EYG A;  4N4U A;  2XXQ A;  3MWB A;  3OEK A;  4U21 A;  4P0G A;  1JW4 A;  2YPN A;  3BIG A;  3R6U A;  2F3D A;  4JDF A;  5FTI A;  3UP9 A;  4DCX A;  1MY3 A;  2NXO A;  3Q27 A;  1Q9D A;  2QVV A;  4ESW A;  1NV6 A;  4R6Y A;  4L17 A;  1P1U A;  2QFL A;  1ZLQ A;  4LP2 B;  2Q2C A;  1Q35 A;  5H8H A;  5AA4 B;  5A5L A;  2PT2 A;  3M8U A;  4X1D A;  4RK2 A;  3U93 A;  1B6H A;  3K02 A;  3DP8 A;  3KJT A;  3N6U A;  3RQT A;  4E0X A;  1GGG A;  4G61 A;  4PE3 A;  4P8B A;  1A7L A;  3O97 A;  1M5C A;  4N07 A;  3IOR A;  4BLA A;  1NH8 A;  4PBQ A;  4MEV A;  5B70 A;  2V3Q A;  1IEJ A;  3FVN A;  3MQ9 A;  4FAJ A;  3MZ1 A;  4YU0 A;  5IZ1 A;  4PFT A;  4LZ5 A;  1BLF A;  3FIR A;  4NMY A;  1B3G A;  4LQ5 A;  2V3U A;  2QSX A;  3FGS A;  1K9Y A;  1VSO A;  1PB7 A;  4KCD A;  1RYO A;  3ZSF A;  4H46 A;  4U22 A;  4O8M A;  3H06 B;  1EH3 A;  2B3B A;  2NWJ A;  4XKQ A;  4EXL A;  5ET7 A;  5CMB A;  3IOW A;  2I49 A;  2UVJ A;  2ZNU A;  3JV9 A;  1TFA A;  1FPB A;  1IMA A;  3S9N C;  5AA2 A;  4KQP A;  1DCU A;  1ZMG A;  5KZT A;  3PMV A;  3IJO B;  3CSB A;  1FQE A;  2UYF A;  2QMW A;  2L5V A;  4NWD A;  4Z0I A;  5B7D A;  1ZBM A;  1B1H A;  5L9M A;  3H03 A;  1QGX A;  3ZS6 A;  4XXU A;  2Q2A A;  4THI A;  5H8N B;  3ZKL A;  3KGC A;  4UAC A;  2CZK A;  4GXS B;  4HW8 A;  2XX9 A;  1FTM A;  2BJI A;  3H3G A;  3BKI B;  4GX6 A;  5EHS A;  4POW A;  2FBP A;  3HPI A;  2R6G E;  4DXB A;  3IFA A;  1LAH E;  4GD5 A;  3ILT B;  1B5J A;  3F11 A;  4OVP A;  1YTV A;  1MY4 A;  3QXM A;  1ZKB A;  3GYY A;  3UIF A;  2HAV A;  1PBQ A;  3QUJ A;  3U92 A;  2XXH A;  4ELQ A;  1MPD A;  4PAF A;  2ABH A;  3VVD A;  3MPK A;  4GWY A;  4YAH X;  1QUJ A;  2W7Y A;  3SEW A;  4C1T A;  2P3N A;  1PDA A;  4Q0C A;  4K3F A;  2RC7 A;  2YLN A;  4MNP A;  1GR2 A;  2XX8 A;  4KFQ A;  4N8Y A;  4XF5 A;  3Q25 A;  3MYU A;  1A8F A;  4TLL B;  4ZED A;  2FHY A;  4R72 A;  1NV1 A;  3SEX A;  5F24 A;  1DPE A;  1MXW A;  3KZG A;  1IXC A;  2B4L A;  1HSE A;  5ESY A;  1WVJ A;  4OWD A;  4BDQ A;  1MDQ A;  2O51 A;  1JEU A;  5DYH A;  3OMB A;  4F1U A;  1NV4 A;  2VHA A;  1NV7 A;  4GX3 A;  5DTB A;  3SKP A;  1P1N A;  4P3L A;  1XVX A;  3EQ1 A;  1G0H A;  5ET6 A;  1RYX A;  5CBR A;  2Q8M A;  3BFU A;  4NF6 A;  1KWH A;  1ATG A;  2DS9 A;  3KG2 A;  1DTZ A;  1B2H A;  1M5D A;  3N6T A;  4E0W A;  3PD9 A;  2UXA A;  3FZV A;  4F3B A;  4RPO A;  1MY2 A;  2I0C A;  5H8Q A;  3H6U A;  3A09 A;  2D21 A;  3BBR A;  5A5X A;  5TPA A;  3BIH A;  3W9W A;  1QUK A;  1SYH A;  3HO7 A;  4H5F A;  2I4C A;  4YMA A;  3EHT A;  3SEV A;  5HPQ A;  3MC2 A;  1FQF A;  3K6U A;  5JEI A;  1O63 A;  1D9Q A;  3Q28 A;  3UK4 A;  2Q8J A;  4KYD A;  4JVC A;  1XI6 A;  2HFB A;  3DP4 A;  4FEC A;  5I84 A;  5AA3 A;  4GWU A;  2VGQ A;  4X1B A;  4PFI A;  1IMC A;  4FEB A;  5IAI A;  3QIM A;  2WBB A;  1G0I A;  4N17 A;  3FBP A;  1LFH A;  3D4G A;  4O3A A;  4GWW A;  5AE4 A;  1SQY A;  4NE4 A;  4PFR A;  2THI A;  1FBH A;  2VOZ A;  3PUX E;  3MVW A;  1B0H A;  2B4M A;  3TEL A;  3PV0 E;  1B5I A;  1LB9 A;  1EYI A;  2Y7I A;  4G4P A;  1B46 A;  4H65 A;  5DVF A;  1MQI A;  2XXI A;  3T9V A;  3TPA A;  3PMX A;  1B4H A;  1YPN A;  4NQ8 A;  4NG7 A;  4BDR A;  4H6D A;  1RDZ A;  4RNS A;  2IEE A;  4OVT A;  2H99 A;  3D4C A;  1UIU A;  3M3K A;  4N6D A;  2ZNT A;  3T9U A;  3C32 A;  1BIY A;  5AA1 A;  1MQD A;  4XTC Q;  3OOA A;  3CR9 A;  1BP5 A;  4NF4 A;  3TTR A;  2AL5 A;  5AA4 A;  2O6A A;  3EPE A;  3U1O A;  3TCH A;  5FTH A;  1MDP 1;  1EYJ A;  3I3V A;  4PF8 A;  1Y20 A;  3FD3 A;  1D4N A;  4MIJ A;  5I2N A;  3LR1 A;  1BK4 A;  3LBS A;  3CHG A;  3MBP A;  4C1U A;  2F5X A;  1UTH B;  2Z23 A;  2AL4 A;  4YKK A;  1YXI A;  1B0L A;  3AXF A;  4ESX A;  4F22 A;  1FPF A;  2F7C A;  3I6V A;  3EKI A;  4QFN A;  3V89 B;  3ODB A;  2DVC A;  2FIE A;  1MH3 A;  4NF8 A;  1IIT A;  1B1X A;  2Q74 A;  1B7Z A;  2HZL A;  4I40 A;  1Y1M A;  3H6T A;  4R75 A;  3BFT A;  2Z22 A;  3O9P A;  1IME A;  4U23 A;  4X9T A;  4HS7 A;  4I3E A;  1FPG A;  1FBD A;  1FQD A;  4GWX A;  2I3V A;  1FJ9 A;  4RPN A;  1Y3P A;  3OO9 A;  2D5W A;  4F2O A;  1USY H;  3C34 A;  4ZE9 A;  4C0R A;  4NTL A;  3S9E A;  1Y1Z A;  3PUV E;  4PTK A;  4P11 A;  1MXZ A;  2I3W A;  1SDX A;  5DW8 A;  1N3W A;  3PD8 A;  4ZEF A;  4PF6 A;  2Y5L A;  1MH4 A;  4HE0 A;  4P1E A;  4YKJ A;  2AIX A;  4GWZ A;  4G68 C;  3K6W A;  3CG3 A;  3C4M A;  4IY6 A;  2DYX A;  3B6T A;  1IQ7 A;  5LOM A;  1RDX A;  1UTB A;  2XWK A;  4XFE A;  4RYA A;  2HXW A;  4HTG A;  2Y7W A;  2I0B A;  2F78 A;  4KYS A;  4PBH A;  3HHF A;  5FHN A;  5KCJ A;  1Z7N E;  4Q30 B;  5I56 A;  4DXC A;  5EQ8 A;  5K2Y A;  4ELO A;  1SVX B;  4ZE8 A;  5L8D A;  4IO4 A;  1R9Q A;  4N6P A;  5BUU A;  1MXV A; 
#chains in the Genus database with same CATH homology
 1TT1 A;  5H8N A;  1EU8 A;  2G29 A;  5EHM A;  4ZDM A;  1AOV A;  2DE2 A;  2GRV A;  3FJG A;  3QYT A;  3KEI A;  3O6H A;  2RC9 A;  2F34 A;  2ZXT A;  4NWC A;  1JVX A;  4QFP A;  4H0W A;  1PEB A;  2RCA A;  3G3H A;  1B3F A;  3MP8 A;  2ONR A;  1Y3N A;  2FNC A;  2PMS A;  4XKN A;  3RY3 A;  4DE8 A;  1B4Z A;  3U94 A;  3UOR A;  3HHG A;  1OVB A;  2REJ A;  3RNN A;  4EF2 A;  3K6V A;  4QRZ A;  1ZIU A;  1VFD A;  1Y4C A;  1HSJ A;  3HST A;  3VE1 B;  3JYR A;  1AMF A;  1N76 A;  4N13 A;  4U4X A;  4NF4 B;  3SES A;  4F1V A;  2F6G A;  3K4U A;  3ILU B;  4TOZ A;  2H4I A;  1ANF A;  2XXU A;  4JWX A;  1LFG A;  4OVJ A;  5ISU A;  2G93 A;  5I2N B;  2BJJ X;  3KBR A;  1J1N A;  3LSF B;  3TUS A;  1B32 A;  3N26 A;  2I6E A;  2V93 A;  2ZYK A;  4ECF A;  4PQJ A;  1DPP A;  1POY 1;  2X7Q A;  4YIC A;  2QJE A;  4ZEI A;  4NF8 B;  4G8M A;  3G3K A;  2Z8E A;  4WEP A;  1NFT A;  3T9H B;  2AYS A;  3U8Q A;  1H76 A;  3C31 A;  4GIZ A;  4DZ1 A;  3G3G A;  3MP6 A;  3CIJ A;  5L9O A;  1Q1K A;  2Y7R A;  2QPQ A;  1NNT A;  3O6I A;  3L6H A;  5I59 A;  1AL3 A;  1B51 A;  2F8D A;  1MQJ A;  1QVS A;  3CG1 A;  5IKB A;  1P1Q A;  3S9M C;  4U1O A;  3DP6 A;  4G8N A;  2O68 A;  1OQG A;  3VVF A;  4OYV A;  4QSC A;  2I4B A;  1UTB B;  3S4U A;  4QSD A;  3K6X A;  4MFI A;  5KCJ B;  2O1L A;  4MLV A;  1B7H A;  5I56 B;  3SEY A;  1QKB A;  1SD3 A;  2DWH A;  2Q9T A;  3V8X B;  3O29 A;  1LAX A;  4LVQ A;  4YB5 A;  4IO6 A;  1WDN A;  3FAT A;  3QAX A;  2V3T A;  1US5 A;  4JWO A;  3OEL A;  3FVO A;  2DWJ A;  3UGW A;  4YB7 A;  1S50 A;  3RPW A;  3Q29 A;  1P1W A;  1O7T A;  5J1D A;  3UN6 A;  4OEN A;  3EN3 A;  1SW1 A;  3U72 A;  3OSQ A;  3MAM A;  3LSL A;  4LZ7 A;  2Y7K A;  2E1S A;  1JQF A;  3L6G A;  2LAO A;  1UTH A;  3E4R A;  5FHO A;  5HBC A;  1IZ1 A;  1MG1 A;  3A3C A;  2A5T A;  1LLS A;  4JXI A;  3RT8 A;  5K2X A;  3VLU A;  3I5O A;  4XIG Q;  3IAZ A;  2F35 A;  3EHU A;  4WKM A;  4F29 A;  4R2F A;  5CM6 A;  3R7X A;  4FE8 A;  3OO7 A;  5CC2 A;  3E13 X;  1B52 A;  3C36 A;  3PUY E;  3THI A;  4TLM B;  3QSL A;  4F1Y A;  1LBB A;  3IB1 A;  4U2R A;  4KI0 E;  2F36 A;  3T66 A;  1MRP A;  1XC1 A;  1QJM A;  1EZO A;  1MS7 A;  2F6P A;  2GHB A;  3G3J A;  1H3D A;  4GFR A;  3T93 B;  2QRY A;  2PVU A;  5DEX A;  3CFL A;  2O84 X;  4QHQ A;  1HSL A;  5I59 B;  4ZZE A;  3K1N A;  3M3F A;  4UA8 A;  2DXY A;  1A99 A;  3K1M A;  1SI0 A;  1DSN A;  1MM7 A;  4F18 A;  2B3F A;  3N94 A;  4PET A;  3ONM A;  4ND9 A;  2XXR A;  4G68 B;  2FA7 A;  4ZEC A;  4OET A;  2F7B A;  1PB9 A;  2Q89 A;  3DLN A;  4DXU A;  2QS2 A;  2QS1 A;  4I1D A;  3MVX A;  3T96 B;  1N0T A;  1MXY A;  1POT A;  3LUY A;  3TDJ A;  4U4S A;  1SI1 A;  2FYI A;  3GBB A;  1B58 A;  4DDD A;  1T0K A;  3KJ7 A;  5I58 B;  1OQH A;  3K1P A;  1N04 A;  1TWY A;  2XXW A;  2M8C A;  3IB2 A;  2ZMB A;  4R9F A;  5CMM A;  3G7W A;  4IO2 A;  2E0S A;  3O66 A;  3TCG A;  2OCU A;  3GZG A;  1SBP A;  3T9X B;  3MJN A;  3E9X A;  4P0I A;  1NKX A;  3W15 C;  1B40 A;  4GL0 A;  3RT6 B;  3PMW A;  3H4Z A;  3KOT A;  3G3F A;  3HCQ A;  1XOC A;  3IOT A;  4F3S A;  4LA9 A;  4PFW A;  4H67 A;  1B3L A;  1URS A;  3B7D A;  4ZZA A;  5DVI A;  4AB5 A;  4RY1 A;  4MLQ A;  4YKP A;  3TKD A;  3GBA A;  1ZU0 A;  3T22 A;  1H44 A;  3CSG A;  4F3P A;  3K00 A;  1B7U A;  2A5T B;  1TXF A;  4JBZ A;  2ONS A;  3VVE A;  1OVT A;  3MUQ A;  5TU0 A;  1N7W A;  3C33 A;  3H6V A;  1OLA A;  2QS4 A;  4YZZ A;  5JTY B;  1NNF A;  3TAJ A;  3R26 A;  4EQ9 A;  2DXR A;  1VE4 A;  2KLF A;  4R6K A;  1FTL A;  4IGT A;  2O7I A;  4GRK A;  1FQC A;  4M4G A;  4OFO A;  1XVY A;  4GWO A;  1LB8 A;  1D9V A;  2OWT A;  2UVH A;  2QL3 A;  3LC8 A;  2XD3 A;  4BDM A;  3MVZ A;  4H1X A;  5DEX B;  1B5H A;  4EQ7 A;  3ZKK A;  2XXX A;  4YKI A;  2P1S A;  4FIM A;  3KN3 A;  4OHN A;  1MPB A;  1WOD A;  2OK2 A;  1MPC A;  3RTW B;  1BTJ A;  1SW5 A;  1OMP A;  3KSJ A;  2H5Y A;  1XT8 A;  4KYE A;  4HCW A;  1N7X A;  3OEN A;  2XXY A;  4NF5 B;  4IO3 A;  5BWJ A;  2F97 A;  2NUV A;  3QK6 A;  3N5L A;  1YAE A;  1FQA A;  2RF1 A;  4ELR A;  2XXP A;  1PB8 A;  2XX7 A;  2HEU A;  4JSD A;  4LON B;  3TYH A;  3IO6 A;  1IXI A;  3JZJ A;  3H6W A;  2O7U A;  3LSW A;  2H98 A;  3G3I A;  3FVG A;  4IY5 A;  1NMU A;  3PPN A;  5KDT B;  4DIG A;  4O3B A;  1PBP A;  1S7Y A;  4ZEK A;  1FTJ A;  2I58 A;  4OXV A;  1M5E A;  5CMC A;  3RN8 A;  3TZA A;  3DEL B;  3SET A;  4RK9 A;  1JW5 A;  5JK4 A;  3C35 A;  3WAF A;  2V84 A;  4KPT A;  4LUB A;  1CB6 A;  3CI8 A;  5EYF A;  3SEU A;  4PP0 A;  5ITO A;  2OJT A;  3MZ9 A;  4LZ8 A;  3S9L C;  5ICQ A;  2OBG A;  2REG A;  1MXX A;  1TFD A;  4FAT A;  3V5A A;  3SER A;  4QF9 A;  3KOS A;  2PX1 A;  4EUO A;  4MF3 A;  1MY1 A;  2PT1 A;  2I48 A;  3PPR A;  2DWA A;  4YMB A;  1R1N A;  2QMX A;  3KFM A;  4RXL A;  1XS5 A;  1I6A A;  3PUZ E;  1R6Z A;  4OTE A;  1O64 A;  2XD2 A;  4KCC A;  2B65 A;  3K01 A;  1ZJL A;  2XXT A;  4OFJ A;  4OZ9 A;  1IIW A;  5DVJ A;  3VLV A;  1A55 A;  4ONY A;  2OLB A;  1A8E A;  4WXJ A;  1QUL A;  3Q26 A;  5CMK A;  1N84 A;  3IL1 B;  4R2B A;  4GVO A;  4QFK A;  4G68 A;  3B6W A;  1AH5 A;  1RKM A;  3OO6 A;  3MP1 A;  4BDL A;  2DVZ A;  2Z8F A;  5F1Q A;  2RKM A;  4MBP A;  1OLC A;  1FTK A;  3OD7 A;  4JWY A;  3IB0 A;  3VLW A;  3TQL A;  4QFL A;  4GXA A;  4R73 A;  4OEV A;  3OSR A;  1LCT A;  1LST A;  2HQ0 A;  3FJ7 A;  5I58 A;  5TP9 B;  4F39 A;  4M1V A;  4IO7 A;  3H7M A;  2H9B A;  1NNK A;  1LBC A;  3FAS A;  2NVU B;  3K0V A;  1UQW A;  1ELJ A;  5DT6 A;  4OEU A;  3WAE A;  2DE4 A;  3S2V A;  4KHZ E;  1GV8 A;  5H8S A;  5H8F B;  3EHS A;  2R9J A;  3P7I A;  2CMO A;  4G8H A;  4ISU A;  1P99 A;  4MH5 A;  3UA8 A;  4KD5 A;  4O3C A;  3QUF A;  4GQO A;  2H25 A;  4IB2 A;  4F2Q A;  1H45 A;  5I2K B;  4YB6 A;  2CZL A;  1NH7 A;  1B3E A;  3ECR A;  4IGR A;  1LFI A;  3KN8 A;  2RIN A;  4R9G A;  2Q88 A;  4EF1 A;  4OMB A;  1GTK A;  2O1M A;  3HN0 A;  3VXC A;  1Y4T A;  1MQH A;  1ZTY A;  2HCA A;  2VP1 A;  4GF8 A;  4U1Z A;  1SYI A;  2WKY A;  4PFU A;  1GVC A;  1D9Y A;  5JTY A;  3KSX A;  1B3H A;  2RCB A;  3PPP A;  1FCK A;  3CFX A;  4G77 A;  3TOD A;  3EF7 A;  3TTK A;  4H8I A;  4OQO A;  3DM0 A;  1URG A;  5H8H B;  3CFZ A;  2VD2 A;  2P0S A;  2DQV A;  2PYY A;  3MPL A;  3IOU A;  1B05 A;  3FXQ A;  2D3I A;  2GFE A;  4F3G A;  2XHD A;  2Y7P A;  5HM4 B;  1N3X A;  3VV5 A;  2X26 A;  1YCJ A;  2NOO A;  4GL8 A;  4RJZ A;  4I8C A;  1JEV A;  1USY E;  3IX1 A;  2DP8 A;  2OWS A;  3VDF A;  1QUI A;  4EXK A;  5ICT A;  3LSX A;  1UIV A;  1LAG E;  3OO8 A;  2GHA A;  3MVY A;  1SW2 A;  2ZNS A;  1I69 A;  2IA4 A;  2DE3 A;  4NF5 A;  4TQU Q;  3USD A;  5M2V A;  1MM6 A;  2DWI A;  3FUZ A;  1URD A;  3MZB A;  5L9S A;  4G2Z A;  3B6Q A;  1EZ9 A;  3V83 A;  4Q5T A;  2ONK E;  3VFJ A;  4XKP A;  5KDT A;  2HAU A;  3IOV A;  4OFL A;  5AA2 B;  1JW1 A;  1S9T A;  4NED A;  3PGF A;  1JET A;  1I6Q A;  2XXV A;  1H43 A;  1DMB A;  2VD3 A;  2O69 A;  4I9D A;  3RLF E;  1Z7M E;  3TTL A;  4FOR A;  1Y9U A;  4ZS9 A;  1FQB A;  2A5S A;  1XHY A;  5I57 A;  4FED A;  3C9H A;  4PE5 B;  4AQ4 A;  2Z8D A;  3FXR A;  1IXG A;  3FV1 A;  3RUM A;  3SDF A;  3TFL A;  2R71 A;  1QW0 A;  5FHM A;  1MQG A;  3K2D A;  2V25 A;  3FV2 A;  1NNP A;  4Q8R A;  4AB6 A;  2PBW A;  3TTN A;  5ITP A;  2UYE A;  3PPO A;  3FVK A;  1VR5 A;  4ELP A;  1PC3 A;  3CRB A;  4F19 A;  2UVI A;  1M5F A;  4EQB A;  4GOT A;  4OES A;  1R9L A;  3HV1 A;  3MW0 A;  4R6H A;  3M3L A;  1Y3Q A;  1FW0 A;  4OER A;  3FJM A;  5CI5 A;  4HCY A;  4JB7 A;  2QS3 A;  1D3K A;  4FJP A;  1BKA A;  1VFE A;  2YJP A;  2GH9 A;  3PU5 A;  4H5G A;  4IO5 A;  3CVG A;  1B9J A;  1CE2 A;  3O6G A;  3GXA A;  3A3U A;  2RC8 A;  3TTM A;  4DLD A;  5CBS A;  2Y84 A;  3IJX B;  4F31 B;  3W9V A;  4JSO A;  4DCY A;  2UVG A;  4RA1 A;  1DOT A;  2P2A A;  3E3K A;  1SW4 A;  1OIB A;  2OZZ A;  1JVY A;  4NF6 B;  1AIV A;  3FXU A;  4X48 A;  1A54 A;  1I6B A;  3KN7 A;  1LGB C;  5H8Q B;  3RGY A;  1LCF A;  3TCF A;  5A5X B;  1IUD A;  3RTF B;  5TPA B;  2ESN A;  3O2A A;  5TP9 A;  1DTG A;  1P1O A;  3OEM A;  2ANJ A;  1A40 A;  3GLB A;  1EZP A;  3IK6 B;  2ZYO A;  3OXN A;  4ZEB A;  3TMG A;  1MY0 A;  2F7A A;  2ZYN A;  3TEP A;  3IO4 A;  1LAF E;  4PFY A;  3PUW E;  2HZK A;  4WED A;  5AA2 D;  1F9B A;  4H8J A;  1II5 A;  4POX A;  4EDP A;  5H8F A;  4Z7E A;  4QFO A;  4XKR A;  4GLI A;  4R74 A;  2DOJ A;  3PPQ A;  3O28 A;  3TQW A;  1NL5 A;  1US4 A;  4KR5 A;  4BDN A;  5I2K A;  2DSF A;  1FTO A;  3VXB A;  2ALU A;  1L5T A;  4I62 A;  1JNF A;  5I57 B;  3IR1 A;  5ELV A;  4BDO A;  4LQ2 A;  1QKA A;  1IXH A;  1M5B A;  2ZYM A;  4QSE A;  5CRY A;  1MXU A;  5F7V A;  2X7P A;  4LAT A;  2XXQ A;  3MWB A;  3OEK A;  4U21 A;  4P0G A;  1JW4 A;  2YPN A;  3R6U A;  4DCX A;  3UP9 A;  4JDF A;  5FTI A;  1MY3 A;  2NXO A;  3Q27 A;  4ESW A;  4R6Y A;  4L17 A;  1P1U A;  1ZLQ A;  4LP2 B;  2Q2C A;  1Q35 A;  5H8H A;  5AA4 B;  2PT2 A;  3M8U A;  4X1D A;  4RK2 A;  3U93 A;  1B6H A;  3K02 A;  3DP8 A;  3KJT A;  3N6U A;  3RQT A;  4E0X A;  1GGG A;  3O97 A;  1A7L A;  1M5C A;  4N07 A;  3IOR A;  4BLA A;  1NH8 A;  5B70 A;  2V3Q A;  1IEJ A;  3FVN A;  3MQ9 A;  4FAJ A;  3MZ1 A;  4YU0 A;  4PFT A;  4LZ5 A;  1BLF A;  3FIR A;  4NMY A;  1B3G A;  4LQ5 A;  2V3U A;  2QSX A;  3FGS A;  1VSO A;  1PB7 A;  4KCD A;  1RYO A;  3ZSF A;  4U22 A;  3H06 B;  1EH3 A;  2B3B A;  2NWJ A;  4XKQ A;  4EXL A;  5CMB A;  3IOW A;  2I49 A;  2UVJ A;  2ZNU A;  3JV9 A;  1TFA A;  3S9N C;  5AA2 A;  4KQP A;  1ZMG A;  5KZT A;  3PMV A;  3IJO B;  3CSB A;  1FQE A;  2UYF A;  2QMW A;  4NWD A;  4Z0I A;  5B7D A;  1ZBM A;  1B1H A;  5L9M A;  3H03 A;  3ZS6 A;  4XXU A;  2Q2A A;  4THI A;  5H8N B;  3ZKL A;  3KGC A;  4UAC A;  4GXS B;  4HW8 A;  2XX9 A;  1FTM A;  3H3G A;  3BKI B;  5EHS A;  4POW A;  3HPI A;  2R6G E;  4DXB A;  1LAH E;  4GD5 A;  3ILT B;  1B5J A;  3F11 A;  1YTV A;  1MY4 A;  3QXM A;  1ZKB A;  3UIF A;  2HAV A;  1PBQ A;  3QUJ A;  3U92 A;  2XXH A;  4ELQ A;  1MPD A;  2ABH A;  3VVD A;  3MPK A;  4YAH X;  1QUJ A;  2W7Y A;  3SEW A;  4C1T A;  1PDA A;  4Q0C A;  4K3F A;  2RC7 A;  2YLN A;  1GR2 A;  2XX8 A;  4KFQ A;  3Q25 A;  4TLL B;  1A8F A;  4ZED A;  4R72 A;  3SEX A;  1DPE A;  1MXW A;  3KZG A;  1IXC A;  1HSE A;  1WVJ A;  4OWD A;  4BDQ A;  1MDQ A;  2O51 A;  1JEU A;  5DYH A;  3OMB A;  4F1U A;  2VHA A;  5DTB A;  3SKP A;  1P1N A;  1XVX A;  3EQ1 A;  1RYX A;  5CBR A;  3BFU A;  4NF6 A;  1KWH A;  1ATG A;  2DS9 A;  3KG2 A;  1DTZ A;  1B2H A;  1M5D A;  3N6T A;  4E0W A;  3PD9 A;  2UXA A;  3FZV A;  4F3B A;  4RPO A;  1MY2 A;  2I0C A;  5H8Q A;  3H6U A;  3A09 A;  2D21 A;  3BBR A;  5A5X A;  5TPA A;  3W9W A;  1QUK A;  1SYH A;  3HO7 A;  4H5F A;  2I4C A;  4YMA A;  3EHT A;  3SEV A;  5HPQ A;  3MC2 A;  1FQF A;  3K6U A;  5JEI A;  1O63 A;  3Q28 A;  3UK4 A;  2Q8J A;  4KYD A;  2HFB A;  3DP4 A;  4FEC A;  5I84 A;  5AA3 A;  2VGQ A;  4X1B A;  4FEB A;  5IAI A;  3QIM A;  1LFH A;  3D4G A;  4O3A A;  5AE4 A;  1SQY A;  4NE4 A;  2THI A;  2VOZ A;  3PUX E;  3MVW A;  1B0H A;  3TEL A;  3PV0 E;  1B5I A;  1LB9 A;  2Y7I A;  4G4P A;  1B46 A;  4H65 A;  5DVF A;  1MQI A;  2XXI A;  3T9V A;  3TPA A;  3PMX A;  1B4H A;  1YPN A;  4BDR A;  4H6D A;  4RNS A;  2IEE A;  2H99 A;  3D4C A;  1UIU A;  3M3K A;  2ZNT A;  3T9U A;  3C32 A;  1BIY A;  5AA1 A;  1MQD A;  4XTC Q;  3OOA A;  3CR9 A;  1BP5 A;  4NF4 A;  3TTR A;  2AL5 A;  5AA4 A;  2O6A A;  3EPE A;  3U1O A;  3TCH A;  5FTH A;  1MDP 1;  3I3V A;  1Y20 A;  3FD3 A;  1D4N A;  5I2N A;  3LR1 A;  3LBS A;  4C1U A;  3MBP A;  2F5X A;  1UTH B;  2Z23 A;  2AL4 A;  4YKK A;  1B0L A;  3AXF A;  4ESX A;  4F22 A;  2F7C A;  3I6V A;  4QFN A;  3V89 B;  3ODB A;  2DVC A;  1MH3 A;  4NF8 A;  1IIT A;  1B1X A;  1B7Z A;  2HZL A;  1Y1M A;  3H6T A;  4R75 A;  3BFT A;  2Z22 A;  3O9P A;  4U23 A;  4X9T A;  4HS7 A;  1FQD A;  2I3V A;  4RPN A;  1Y3P A;  3OO9 A;  2D5W A;  4F2O A;  1USY H;  3C34 A;  4ZE9 A;  4C0R A;  4NTL A;  3S9E A;  1Y1Z A;  3PUV E;  4P11 A;  1MXZ A;  2I3W A;  1SDX A;  1N3W A;  3PD8 A;  4ZEF A;  1MH4 A;  4YKJ A;  2AIX A;  4G68 C;  3K6W A;  3CG3 A;  3C4M A;  4IY6 A;  2DYX A;  3B6T A;  1IQ7 A;  5LOM A;  1UTB A;  4RYA A;  2HXW A;  4HTG A;  2Y7W A;  2I0B A;  2F78 A;  4KYS A;  3HHF A;  5FHN A;  5KCJ A;  1Z7N E;  4Q30 B;  5I56 A;  4DXC A;  5K2Y A;  4ELO A;  1SVX B;  4ZE8 A;  5L8D A;  4IO4 A;  1R9Q A;  4N6P A;  5BUU A;  1MXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...