1PC3A

Crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
333
structure length
333
Chain Sequence
VATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Phosphate-binding protein 1
publication title Crystal structure of M tuberculosis ABC phosphate transport receptor: specificity and charge compensation dominated by ion-dipole interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 118
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pc3A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1pc3A02
3SEWA 2V3TA 1FTJA 3SEUA 3O2AA 3V89B 4NWCA 1GR2A 4N07A 4EQ9A 4H1XA 4H5GA 3W15C 3Q27A 3TTRA 1P1UA 1ZTYA 3MAMA 1QULA 2Z22A 1US4A 3FV1A 2HXWA 3QUFA 4OEVA 1N7WA 1BLFA 3A09A 1B40A 1DMBA 3KG2A 1B2HA 5AE4A 4I9DA 1GGGA 4KQPA 3G3IA 2YLNA 2XXPA 4G8HA 2PT1A 2F34A 3TTLA 1URSA 4XKQA 3DM0A 1M5DA 4KCCA 3K00A 1ZMGA 4ISUA 3RQTA 1LCFA 1MXVA 1MY1A 2VP1A 3RY3A 3VLVA 4DXUA 1N04A 4Z7EA 1R6ZA 4UA8A 4HCWA 4IO5A 3Q29A 4LZ5A 3TCHA 2HQ0A 4RJZA 3H6UA 4FIMA 4IY6A 4EUOA 3SDFA 3IB2A 2PVUA 3OXNA 4QSDA 2H9BA 4JXIA 2R9JA 3KN7A 5ITPA 2E0SA 4POWA 4F2QA 1IUDA 3TUSA 5I59A 3G7WA 3G3GA 1EZPA 2V25A 2I0BA 1BIYA 3GLBA 3FGSA 3EPEA 5IAIA 4XXUA 3CG3A 4H5FA 4KR5A 5HBCA 1LSTA 2UVIA 2OZZA 1MXWA 4G4PA 2R71A 2REGA 5DT6A 4XKNA 3D4CA 3O9PA 3SETA 1DSNA 4TLMB 4M4GA 1P1NA 2ZYKA 1SBPA 2Y7WA 3U72A 2Y7KA 1XC1A 3EHSA 4BDRA 3KN3A 4XIGQ 5I59B 5BWJA 3SEYA 2Z8FA 4ELPA 5F7VA 1Y4TA 3IOTA 3N94A 4ZZAA 2AL4A 2V93A 3OOAA 3HN0A 2F7AA 3MPLA 2UVGA 3CRBA 2IEEA 2UVHA 3G3KA 1LB9A 1PBQA 3PGFA 3BKIB 3CVGA 1PB8A 4OETA 2P2AA 1FQAA 4Q5TA 1CE2A 2DE2A 3O66A 1S9TA 3CFLA 1LFIA 4JBZA 4QF9A 3VFJA 4GOTA 1ZLQA 2X7PA 4F3PA 2O51A 4YB7A 4ZDMA 3RTFB 2QS1A 1NL5A 1A8EA 1FQBA 2QL3A 3JZJA 3EHUA 4U4XA 5DTBA 4MBPA 2I4CA 2HAVA 2ONSA 1XT8A 1B52A 3H6WA 1NFTA 1QUJA 3FXRA 3O6HA 2DOJA 2ZNSA 1R9QA 3FJMA 4GL0A 4QSEA 2DWIA 4HS7A 1NKXA 4R6KA 3UGWA 2Q89A 1XVYA 1D3KA 5CMMA 1JVYA 5L9SA 1SQYA 5KDTA 2ALUA 1DPEA 4GFRA 3PU5A 2H99A 4YZZA 1NH7A 2G29A 1B5IA 4DCYA 3TDJA 4QHQA 4ELOA 4DDDA 2RC7A 3T22A 1EH3A 4GIZA 4P11A 1FQDA 4OHNA 4IY5A 3G3FA 4GXSB 2CZLA 1HSJA 4OFJA 5KDTB 3FXQA 3KOTA 2DXRA 5FTHA 3FATA 5DEXA 1JW1A 1XOCA 3VDFA 1RYOA 3MW0A 4OVJA 3IOVA 4KD5A 1B4ZA 4GRKA 4IO2A 3TPAA 3SEVA 2OK2A 3O6IA 5KCJA 4U22A 3Q28A 3S4UA 4DXBA 3KBRA 3O97A 3KSXA 2DQVA 1R9LA 2FNCA 4MF3A 3ZS6A 3V8XB 3VLUA 4YICA 2OJTA 5L8DA 1BTJA 4OMBA 3C35A 3CSGA 2XXUA 3E9XA 3QIMA 1LGBC 2XXIA 4FATA 4G77A 3U93A 3FXUA 4OQOA 4PP0A 1MDP1 1RKMA 3HO7A 2XXYA 2Q2AA 2NVUB 5DEXB 4ZE8A 3IK6B 4F31B 2RC9A 2ABHA 5K2YA 3MVZA 1YAEA 4H67A 3K4UA 2W7YA 1TT1A 3KOSA 4ZEBA 4O3AA 5KCJB 5H8QA 2AL5A 5IKBA 3K01A 1M5CA 2OLBA 3N6UA 1ATGA 4HW8A 1FQEA 4GQOA 1MY2A 4YMAA 4YAHX 3GBBA 2QS4A 4NMYA 4OXVA 4HTGA 3DP8A 1YPNA 4I1DA 3ILUB 4L17A 5EHMA 1UTBA 3QYTA 3ONMA 2F6GA 1B7UA 3GBAA 1IXGA 4THIA 2O1LA 2PBWA 4RK2A 4OFOA 4GLIA 1B0HA 4RPNA 4F2OA 3RUMA 4E0WA 5H8QB 1MM6A 1OVTA 1IXIA 4JWXA 3WAEA 5CBSA 2QMXA 3H4ZA 4RY1A 2X7QA 3H6TA 1IXHA 4P0IA 3MZ9A 3KZGA 2WKYA 4NF4A 3MP1A 3IX1A 1OQGA 4AQ4A 1UTBB 4PFTA 3TFLA 3HV1A 5HM4B 5CMBA 4AB5A 3MJNA 4F19A 1L5TA 2I3WA 1RYXA 3TZAA 3BFUA 1VSOA 2XXWA 3M3LA 5AA3A 2F8DA 4GVOA 4C1UA 2HZKA 1B05A 3N6TA 4R2BA 1P1QA 1SW2A 4LP2B 3LSWA 1R1NA 1USYE 4NF4B 4BDNA 4F1VA 4F3GA 3DELB 1LCTA 1OVBA 4ESXA 2I0CA 4X1DA 1B0LA 1DOTA 1D4NA 1LFHA 4KFQA 2DE3A 3BFTA 4UACA 2F35A 3KEIA 3L6GA 3E3KA 4FE8A 1II5A 3K6XA 4KYDA 2Q88A 1IXCA 4PFWA 1IQ7A 3IJXB 3MVYA 1FTMA 3K02A 4JDFA 4GD5A 1FCKA 1IITA 2HFBA 2QPQA 4NF8A 3V5AA 3IL1B 5H8FA 3QSLA 3B7DA 3EQ1A 3DLNA 3QXMA 3TQWA 1WDNA 5CRYA 4LUBA 1MPDA 4RPOA 1LAFE 2GHBA 1QUIA 3ODBA 2Z8EA 5CMKA 3OELA 5J1DA 1N3XA 5TU0A 4RYAA 2QRYA 4LQ2A 4ZS9A 2VOZA 1EZOA 5AA4A 3UK4A 3PD9A 1TXFA 4IGRA 4G2ZA 1PEBA 2O68A 3ZSFA 3T66A 1GVCA 4NF8B 3TTMA 3CFXA 1CB6A 2NWJA 3ECRA 5H8FB 3LBSA 4R9GA 3OENA 1MS7A 4F1UA 1M5FA 3LR1A 4WKMA 1D9VA 5AA4B 1OLCA 4FEBA 3MVWA 1BP5A 3I6VA 1MQIA 1WVJA 3K6WA 4PQJA 1NNPA 5EHSA 4LZ8A 1N3WA 2UVJA 3PPQA 4YB5A 3VE1B 5CM6A 3K6UA 5DVFA 4AB6A 4ONYA 4YMBA 4BDMA 1AL3A 3FVNA 4C1TA 1URGA 1MH4A 3OEMA 3KFMA 1QKAA 2ZNUA 1P99A 4R73A 2F97A 4H0WA 4X48A 2DS9A 4EF1A 1XVXA 2O7UA 3OO7A 4EF2A 2RCAA 1M5EA 3UA8A 1NH8A 4M1VA 4BLAA 2YPNA 3ZKKA 2ONKE 3B6QA 3VVEA 1N7XA 3TCGA 5AA2A 4U1OA 2ESNA 4C0RA 1Y1MA 4BDLA 2B3FA 2DXYA 1YTVA 3IORA 2H98A 1SD3A 1I69A 2Q9TA 1NNFA 3S9MC 4U1ZA 3THIA 1POTA 2RC8A 4FORA 3MUQA 3U8QA 2ZMBA 2I48A 2PT2A 1SYIA 3UIFA 1I6QA 3E13X 4G68A 4OEUA 2XXHA 3AXFA 1MXXA 4IO4A 3T9XB 1B46A 4ND9A 5DVIA 3B6TA 5AA2B 2M8CA 5JK4A 2A5TA 3FIRA 4F39A 1XHYA 4IO6A 1B51A 4EXKA 3C33A 2NXOA 3QUJA 2XXXA 3TKDA 3T93B 1T0KA 1VFDA 4WEPA 2AYSA 3FJGA 4R75A 1MPBA 1SW5A 2P0SA 1MPCA 2F36A 3HHFA 2HAUA 2H5YA 2RF1A 3OO6A 4MFIA 3RT8A 2DWJA 1UQWA 4G68B 3FV2A 1B58A 3S9LC 4ZZEA 3M8UA 2CMOA 2A5TB 1B7HA 2VHAA 2F78A 2XXQA 4KCDA 3K1MA 3U1OA 3MP6A 4H65A 3F11A 3G3JA 4GWOA 5TPAA 2I6EA 3OO9A 2H4IA 2Y84A 4RA1A 1AOVA 4FJPA 3R6UA 2O84X 3TEPA 4R72A 3KJTA 1URDA 3O28A 4KYSA 3HSTA 4OWDA 4NF5A 5JTYA 4H8IA 3TQLA 4F1YA 3B6WA 4O3BA 2DE4A 3KSJA 4ZEIA 4N6PA 3CIJA 1AH5A 1QKBA 5TPAB 4OYVA 5FHMA 4ESWA 3OMBA 3PMXA 4OFLA 4PE5B 1Q1KA 3M3FA 4E0XA 5CMCA 2REJA 1B7ZA 4PETA 4HCYA 3MBPA 3H3GA 3RN8A 1H43A 1UIUA 4ELQA 4RNSA 3SKPA 3PPRA 4MH5A 4YKPA 4NF5B 3TAJA 5JTYB 4JWOA 2QS3A 1N76A 3MWBA 3JV9A 1UIVA 4DE8A 1LBCA 4KYEA 1J1NA 3LSLA 3FJ7A 3RTWB 1HSLA 3KN8A 3E4RA 1US5A 4PFUA 4U2RA 1JW5A 3UN6A 3PD8A 4NE4A 4QFNA 1SI0A 1A40A 5FHOA 2BJJX 1Z7NE 4YB6A 4NWDA 1O7TA 5DVJA 2DSFA 2I3VA 3Q26A 4XKPA 3RPWA 1LLSA 1FTKA 1SYHA 3MQ9A 1LB8A 2A5SA 2DVZA 2NOOA 4FECA 1S50A 1MQDA 2AIXA 4G8NA 2RCBA 4I62A 4TOZA 4G68C 3TTNA 1A55A 3OD7A 1DTZA 1NNKA 3CI8A 1F9BA 3QK6A 5H8NA 1QJMA 3RNNA 3IB0A 2HZLA 5I2NA 1NNTA 3GXAA 4R74A 3TMGA 3S9EA 3C32A 3N5LA 2I49A 3RGYA 1JNFA 3IB1A 3T9VA 2ZNTA 3LUYA 4H8JA 3I3VA 5B7DA 3D4GA 3FVKA 3MZ1A 3LSFB 3UORA 4U21A 3EHTA 1B5HA 2YJPA 1PB7A 1QVSA 4OENA 4EQ7A 5ITOA 3OSQA 2F6PA 1OMPA 4FAJA 1MG1A 2NUVA 1UTHA 4X9TA 2ZYMA 5H8NB 4N13A 4F3BA 3Q25A 3T9HB 5I2NB 5DYHA 5B70A 3FUZA 3TCFA 1GTKA 5AA2D 5BUUA 1LFGA 4YKKA 3S2VA 1N0TA 2Q8JA 1TFAA 1MXUA 3GZGA 1B1XA 4TLLB 4QFLA 1VFEA 2B3BA 5L9OA 1JEUA 2UYFA 5KZTA 2UXAA 3IR1A 1UTHB 4F3SA 3LSXA 4YKJA 4RK9A 2DYXA 4JWYA 3FVOA 1Z7ME 2GFEA 1OQHA 4JSDA 1A99A 2VD2A 3USDA 1B1HA 3PPOA 5H8HA 1B3EA 3C9HA 1LAXA 2XD3A 1MY3A 4G8MA 1O63A 3TELA 5L9MA 2V3UA 3IO4A 2PMSA 5JEIA 4ZEDA 3TYHA 4QFPA 3W9VA 1JW4A 2O1MA 4R9FA 2DP8A 3TODA 2XD2A 2DVCA 3MVXA 2O7IA 2OWTA 4F18A 2UYEA 1Y9UA 3R7XA 1O64A 3KJ7A 1MM7A 1JVXA 5ICTA 5H8HB 4NTLA 2KLFA 4KI0E 3ZKLA 3CG1A 5ICQA 2VD3A 2XXTA 3H7MA 3JYRA 3H06B 3U92A 2F7CA 2O6AA 3FD3A 1QUKA 5HPQA 3A3CA 3O29A 1MY0A 4IB2A 3TTKA 2QJEA 2Z8DA 4MLQA 3VXBA 5F1QA 4KPTA 2XXRA 2QSXA 3UP9A 4O3CA 1ZJLA 1P1OA 3WAFA 4EDPA 4U4SA 1Y3QA 3VXCA 3QAXA 1FQCA 5AA1A 3C4MA 1B3LA 3VLWA 2THIA 4GXAA 4YKIA 4ZEKA 1B3HA 2Q2CA 2ZXTA 1FW0A 4LQ5A 4PFYA 3CSBA 4EXLA 2OCUA 3C36A 1Y4CA 4Q0CA 3OSRA 3PUZE 1H44A 5I2KA 1POY1 3MZBA 1N84A 3VV5A 2HCAA 3HPIA 2LAOA 2GH9A 1QW0A 4BDQA 1MDQA 1MXYA 2FA7A 4F22A 4JB7A 1AMFA 2RINA 3IJOB 1PBPA 1TWYA 5FTIA 1H45A 4R2FA 3FASA 3IOUA 4ELRA 3RLFE 3VVDA 2R6GE 1DPPA 4RXLA 2OBGA 2XXVA 3PUYE 4R6HA 5H8SA 2DWAA 4OZ9A 2ZYOA 1MQJA 3O6GA 4QRZA 5M2VA 3K1NA 1JETA 3PPPA 1Y1ZA 3I5OA 2Z23A 1B9JA 4KHZE 5A5XA 5I2KB 1NMUA 2Y7PA 4F29A 5FHNA 3SERA 2X26A 2F7BA 2Y7IA 1FQFA 4R6YA 1SDXA 1FTLA 2ZYNA 3BBRA 3P7IA 2GHAA 1EU8A 3A3UA 1TFDA 3N26A 1B3FA 4POXA 4IO3A 3L6HA 1LAHE 4GL8A 4IO7A 3PV0E 4Z0IA 3PMVA 4DZ1A 4OTEA 3K1PA 1PDAA 2V3QA 3MPKA 3OO8A 3V83A 2P1SA 3C34A 4BDOA 2ONRA 1SVXB 3CR9A 1IEJA 3RT6B 1B4HA 1USYH 5A5XB 3H6VA 4H6DA 3HHGA 4LATA 4NEDA 2E1SA 3FZVA 1SW1A 4NF6A 3MC2A 4FEDA 3C31A 4QSCA 2FYIA 4LONB 3PUWE 2OWSA 4GF8A 1H76A 4QFKA 2XX7A 2V84A 2O69A 1SW4A 1B5JA 3M3KA 1Q35A 2IA4A 4ZEFA 3HCQA 1MQGA 3FVGA 5EYFA 2F5XA 3IOWA 4K3FA 4MLVA 5I84A 2RKMA 2G93A 2XX8A 3KGCA 3T96B 4WEDA 1EZ9A 1D9YA 4LVQA 4IGTA 4ECFA 3EN3A 1FTOA 1OLAA 3R26A 1M5BA 2D3IA 1ZBMA 4NF6B 5K2XA 1MH3A 1YCJA 1S7YA 3K6VA 4EQBA 1A8FA 4X1BA 5CC2A 1PB9A 1Y3PA 4TQUQ 1JEVA 1ZKBA 5CBRA 5I56A 1PC3A 3PUXE 1I6AA 3VVFA 1ZIUA 5ISUA 2VGQA 4LZ7A 4JSOA 1MQHA 3K2DA 5I58A 1MY4A 2XX9A 5CI5A 4LA9A 4OESA 1B6HA 2PX1A 3CFZA 3PPNA 4XTCQ 5TP9A 3T9UA 1OIBA 2I4BA 1IZ1A 2DWHA 3H03A 2D21A 1A54A 1BKAA 5LOMA 1VR5A 2QMWA 4DXCA 1AIVA 1B3GA 3PMWA 1WODA 5I56B 4Q30B 1IIWA 2PYYA 4WXJA 1LAGE 5ELVA 3ILTB 4Q8RA 1SI1A 1LBBA 2QS2A 3SEXA 5I58B 1MXZA 1DTGA 3PUVE 5I57A 4QFOA 2I58A 4P0GA 2ANJA 2XHDA 3SESA 3U94A 1A7LA 5TP9B 1Y3NA 2B65A 4DIGA 1B32A 3OEKA 4DLDA 1GV8A 3MP8A 3G3HA 1Y20A 2H25A 3DP6A 1VE4A 3IAZA 1ANFA 4YU0A 1ZU0A 1I6BA 4XKRA 1KWHA 3K0VA 2GRVA 1H3DA 4I8CA 4U23A 2D5WA 3EF7A 4ZECA 1MRPA 1P1WA 5I57B 1XS5A 2HEUA 3DP4A 3S9NC 3LC8A 1HSEA 4OERA 4DCXA 2Y7RA 4ZE9A 1ELJA 1JQFA 3IO6A 3W9WA
chains in the Genus database with same CATH superfamily
3SEWA 2V3TA 1FTJA 3SEUA 3O2AA 3V89B 4NWCA 1GR2A 4N07A 5EQAA 4EQ9A 4H1XA 4H5GA 3W15C 3Q27A 3TTRA 1P1UA 1ZTYA 3MAMA 1QULA 2Z22A 1US4A 3FV1A 2HXWA 3QUFA 4OEVA 3RPLB 1N7WA 1BLFA 3A09A 1B40A 1DMBA 3KG2A 1B2HA 5AE4A 1G0HA 4I9DA 1GGGA 4KQPA 3G3IA 5ET7A 2YLNA 2XXPA 4PC9A 4G8HA 2PT1A 2F34A 3TTLA 1URSA 4XKQA 3DM0A 1M5DA 3LUZA 3K00A 4KCCA 1ZMGA 4ISUA 3RQTA 1LCFA 1MXVA 1MY1A 2VP1A 3RY3A 3VLVA 4DXUA 1NV0A 1N04A 4Z7EA 1R6ZA 4UA8A 4HCWA 4IO5A 1DK4A 3Q29A 4LZ5A 3TCHA 2HQ0A 4RJZA 3H6UA 4FIMA 4IY6A 4EUOA 1IMBA 3SDFA 3IB2A 4IR8A 2PVUA 1NV4A 3OXNA 1NV2A 2H9BA 1INPA 4QSDA 4JXIA 2R9JA 3KN7A 5ITPA 2E0SA 4H46A 4POWA 4P1LA 4F2QA 1IUDA 1RDYA 3TUSA 5I59A 3G7WA 3G3GA 4PFRA 1EZPA 2V25A 2I0BA 1BIYA 3GLBA 3FGSA 3EPEA 5IAIA 4XXUA 3CG3A 4H5FA 4KR5A 5HBCA 1LSTA 2UVIA 2OZZA 1MXWA 4G4PA 2R71A 2REGA 5DT6A 4XKNA 3D4CA 3O9PA 4MAGA 3SETA 5ET5A 1DSNA 4TLMB 4M4GA 1P1NA 2ZYKA 2Q8MA 1SBPA 2Y7WA 1QGXA 3U72A 2Y7KA 1XC1A 3EHSA 3FXBA 4BDRA 3KN3A 4XIGQ 5I59B 5BWJA 3SEYA 2Z8FA 4ELPA 5F7VA 1Y4TA 3IOTA 3N94A 4ZZAA 2AL4A 2V93A 3OOAA 2HXRA 3HN0A 2F7AA 3MPLA 2UVGA 3CRBA 2IEEA 2UVHA 2ZZXA 3G3KA 1LB9A 1PBQA 4GWXA 3CHGA 3PGFA 3BKIB 3CVGA 1PB8A 4OETA 2P2AA 1FQAA 4Q5TA 1LBVA 1CE2A 2DE2A 3O66A 2V4CA 1S9TA 1FPJA 4PDHA 5ET6A 3CFLA 1LFIA 4JBZA 4QF9A 3VFJA 4GOTA 1ZLQA 4MHFA 5IGAA 2X7PA 4F3PA 2JJKA 2O51A 4HE1A 4YB7A 4ZDMA 3RTFB 2QS1A 1NL5A 3D1RA 1A8EA 1FQBA 2QL3A 3JZJA 3EHUA 4U4XA 5DTBA 4MBPA 2I4CA 2HAVA 2MKZA 2ONSA 1XT8A 1B52A 3H6WA 1NFTA 4X8RA 1QUJA 3FXRA 3O6HA 2DOJA 1BK4A 2ZNSA 1R9QA 2L5VA 3FJMA 2WX9A 4GL0A 4QSEA 4PTKA 2DWIA 3QMFA 4HS7A 1NKXA 2CEYA 4R6KA 3UGWA 2Q89A 1XVYA 4GBVA 2Y5LA 1D3KA 5CMMA 1JVYA 5L9SA 1SQYA 4GWSA 5KDTA 1FSAA 2ALUA 4GWZA 2KQZA 1NUZA 1DPEA 4GFRA 3PU5A 2H99A 4YZZA 3IFAA 1NH7A 2G29A 1B5IA 4DCYA 3TDJA 5ESYA 4QHQA 4ELOA 4DDDA 2RC7A 3T22A 2Y5KA 1EH3A 1XI6A 4GIZA 4HE0A 4P11A 1FPFA 1FQDA 4OHNA 4IY5A 2WYPA 4GWWA 3G3FA 4PGNA 3KBZA 4GXSB 2CZLA 1HSJA 4OFJA 5KDTB 3FXQA 3KOTA 2DXRA 5FTHA 3FATA 4GX6A 5DEXA 1JW1A 4I3EA 1XOCA 3VDFA 1RYOA 4OVJA 3MW0A 3IOVA 4KD5A 1B4ZA 1LEVA 4GRKA 4IO2A 3TPAA 3SEVA 2OK2A 2VT5A 3O6IA 5KCJA 1FTAA 4U22A 3Q28A 3B50A 3S4UA 4DXBA 3KBRA 3O97A 3KSXA 1VDWA 2DQVA 1R9LA 2FNCA 4MF3A 3ZS6A 4NQ8A 3V8XB 3VLUA 4YICA 2HHMA 2OJTA 5L8DA 1BTJA 1LBYA 4OMBA 3C35A 3CSGA 2XXUA 3E9XA 3QIMA 1LGBC 2XXIA 4G77A 4FATA 3U93A 3FXUA 4OQOA 4PP0A 1MDP1 1RKMA 3HO7A 4NX1A 2XXYA 2Q2AA 2NVUB 5DEXB 4ZE8A 4JVIA 3IK6B 4F31B 2RC9A 2ABHA 5K2YA 3MVZA 1KZ8A 1YAEA 4H67A 3K4UA 2W7YA 4PAKA 1TT1A 3KOSA 4ZEBA 4O3AA 5KCJB 5H8QA 2AL5A 5IKBA 2QFLA 3K01A 1M5CA 2OLBA 3N6UA 1ATGA 4HW8A 1D9QA 1FQEA 4GQOA 1MY2A 2XWVA 4YMAA 4O7MA 4I3YA 2P3NA 1IMFA 4YAHX 1IMCA 3GBBA 2QS4A 4NMYA 4OXVA 4HTGA 3DP8A 1YPNA 4PDDA 4I1DA 1G0IA 3ILUB 4NF0A 4L17A 5EHMA 1UTBA 3QYTA 3ONMA 2F6GA 1B7UA 3GBAA 1IXGA 4THIA 2O1LA 2PBWA 4RK2A 4OFOA 4MMPA 4GLIA 3ISPA 1B0HA 1NUXA 4QBAA 4RPNA 4F2OA 3RUMA 4E0WA 5H8QB 4MNPA 1MM6A 1OVTA 1IXIA 4JWXA 3WAEA 5CBSA 2QMXA 3H4ZA 4RY1A 2FIXA 2X7QA 3H6TA 1IXHA 4P0IA 3MZ9A 3KZGA 2WKYA 4NF4A 3MP1A 4DI3D 3IX1A 1OQGA 4AQ4A 4N6KA 1UTBB 4PFTA 3TFLA 3HV1A 5HM4B 4PGPA 5CMBA 4AB5A 1IMEA 3MJNA 4F19A 1L5TA 2I3WA 1RYXA 3TZAA 3BFUA 1VSOA 2XXWA 4HXVA 3M3LA 3A29A 4MX6A 5AA3A 2F8DA 4GVOA 4C1UA 2HZKA 1RDZA 1B05A 3N6TA 4R2BA 1P1QA 1SW2A 4LP2B 3LSWA 1R1NA 1USYE 4NF4B 4BDNA 4F1VA 4F3GA 3DELB 1LCTA 1OVBA 4ESXA 2I0CA 4X1DA 1B0LA 1DOTA 1D4NA 1LFHA 4KFQA 2DE3A 3BFTA 4UACA 2F35A 1NUYA 3KEIA 3L6GA 3E3KA 4FE8A 1II5A 3K6XA 4KYDA 4PCDA 2Q88A 1IXCA 4PFWA 1IQ7A 3IJXB 3MVYA 1FTMA 4P3LA 3K02A 4JDFA 4GD5A 1FCKA 3MSTA 1IITA 2XWIA 5IZZA 2HFBA 2QPQA 4NF8A 4N6DA 3V5AA 4P56A 3IL1B 5H8FA 4O8MA 4AS4A 3QSLA 3B7DA 3EQ1A 3DLNA 4PFBA 3QXMA 3TQWA 1WDNA 2VPNA 4AS5A 2B4MA 5CRYA 4LUBA 1MPDA 4RPOA 1LAFE 2GHBA 4PFIA 1QUIA 3ODBA 4OVQA 2Z8EA 5CMKA 3OELA 5J1DA 1N3XA 5TU0A 4RYAA 2QRYA 4LQ2A 4ZS9A 2VOZA 1EZOA 5AA4A 3UK4A 3PD9A 1TXFA 4IGRA 4G2ZA 1PEBA 2O68A 3ZSFA 3T66A 1GVCA 4N81A 4NF8B 3TTMA 3CFXA 1CB6A 2NWJA 3ECRA 2WEFA 5H8FB 3LBSA 4R9GA 3OENA 3MYUA 4GWYA 2HPGA 2PFYA 3U65A 1MS7A 2QVVA 4F1UA 4WKMA 1M5FA 3LR1A 1D9VA 5AA4B 1OLCA 4FEBA 3MVWA 1BP5A 3I6VA 1MQIA 1WVJA 3K6WA 4PQJA 1NNPA 5EHSA 4LZ8A 1N3WA 4MNCA 2UVJA 3PPQA 4YB5A 3VE1B 5CM6A 3K6UA 5DVFA 4AB6A 4ONYA 4YMBA 4BDMA 1AL3A 3FVNA 4N15A 4C1TA 1URGA 3RYDA 1MH4A 3OEMA 1LBZA 3KFMA 1QKAA 4XF5A 2ZNUA 1P99A 4R73A 2F97A 4N4UA 4H0WA 4X48A 2DS9A 4EF1A 1XVXA 2O7UA 3OO7A 2R8TA 4JVDA 4EF2A 2RCAA 1M5EA 3UA8A 1NH8A 4M1VA 4BLAA 2YPNA 3ZKKA 2ONKE 3B6QA 3VVEA 3KC1A 1N7XA 3TCGA 5AA2A 4MNIA 4U1OA 2ESNA 4C0RA 1Y1MA 2PCRA 4BDLA 2B3FA 2DXYA 1IMDA 1YTVA 3IORA 2H98A 1SD3A 1I69A 2Q9TA 1NNFA 3S9MC 4G61A 4U1ZA 3THIA 1POTA 2RC8A 4FORA 3MUQA 3U8QA 2ZMBA 2I48A 2PT2A 1SYIA 3UIFA 1I6QA 3E13X 4NG7A 1FRPA 4G68A 4OEUA 2XXHA 4NGUA 1FBGA 1FPKA 3AXFA 2KR0A 1MXXA 1FPLA 4IO4A 3LV0A 3T9XB 1B46A 4ND9A 5DVIA 3B6TA 5AA2B 2M8CA 5JK4A 2A5TA 3FIRA 4F39A 1XHYA 4IO6A 5EQ7A 1YZ0A 1B51A 4EXKA 3C33A 2OWZA 2NXOA 3T1BA 3QUJA 2XXXA 3TKDA 3T93B 1T0KA 1VFDA 4WEPA 1YXIA 2AYSA 3FJGA 4R75A 1MPBA 1SW5A 2P0SA 2XXKA 1MPCA 2F36A 1IMAA 5A5LA 3HHFA 2HAUA 2H5YA 5FBPA 2RF1A 3OO6A 4MFIA 3NOHA 3RT8A 3SZPA 4LN5A 4N91A 2DWJA 1UQWA 4G68B 3FV2A 1B58A 3S9LC 4ZZEA 3M8UA 2CMOA 2A5TB 1B7HA 2VHAA 5DW8A 2F78A 2XXQA 4KCDA 1K9ZA 3K1MA 3U1OA 3MP6A 4NN3A 4H65A 3F11A 3G3JA 4GWOA 5TPAA 2I6EA 3OO9A 2H4IA 2Y84A 4RA1A 1AOVA 4FJPA 3FBPA 3R6UA 2O84X 3TEPA 1DBZA 4R72A 3KJTA 1FBHA 1URDA 3O28A 4KYSA 3HSTA 4OWDA 4NF5A 5JTYA 4H8IA 3TQLA 4F1YA 3B6WA 4O3BA 3ROJA 2DE4A 3KSJA 4ZEIA 4N6PA 3CIJA 1AH5A 1QKBA 4PF8A 5TPAB 4OYVA 5FHMA 4ESWA 3OMBA 3PMXA 4OFLA 4PE5B 4X04A 1Q1KA 3M3FA 4E0XA 5CMCA 2REJA 1B7ZA 4PETA 4HCYA 3MBPA 3H3GA 3RN8A 3BIGA 5I5PA 1H43A 1UIUA 4ELQA 4RNSA 3SKPA 3PPRA 4MH5A 4OVSA 4YKPA 4NF5B 3TAJA 5JTYB 4JWOA 2QS3A 1N76A 3MWBA 3JV9A 1UIVA 1FPEA 4DE8A 1LBCA 4KYEA 1J1NA 4MJOA 3LSLA 3FJ7A 3RTWB 1HSLA 3KN8A 3E4RA 1US5A 4PFUA 4U2RA 1JW5A 3UN6A 3PD8A 4NE4A 1Q9DA 4QFNA 2CEXA 1SI0A 4P8BA 1A40A 1NV7A 4P47A 5FHOA 2BJJX 2GQ1A 1Z7NE 4YB6A 2CZIA 4NWDA 1O7TA 5DVJA 2DSFA 2I3VA 3Q26A 4XKPA 3RPWA 1LLSA 1FTKA 1SYHA 3MQ9A 1LB8A 2A5SA 2DVZA 2NOOA 4FECA 3E79A 1S50A 1MQDA 1NV1A 2AIXA 4G8NA 2RCBA 2WBDA 4I62A 4TOZA 4OVPA 4G68C 4GX4A 3TTNA 1A55A 3OD7A 1DTZA 1NNKA 3CI8A 1F9BA 3QK6A 1EYKA 5H8NA 1QJMA 3RNNA 3IB0A 2HZLA 5I2NA 1NNTA 3GXAA 1YYZA 2ZZWA 4R74A 3TMGA 3S9EA 5LDZA 2BJIA 3C32A 1FBEA 3N5LA 2I49A 3RGYA 1JNFA 3IB1A 3T9VA 4HE2A 2ZNTA 3LUYA 4H8JA 3I3VA 5B7DA 3D4GA 2CZHA 3FVKA 3MZ1A 3LSFB 3UORA 4U21A 3EHTA 3BIHA 1B5HA 2YJPA 1PB7A 1QVSA 4OENA 4EQ7A 5ITOA 3OSQA 2F6PA 1OMPA 4FAJA 1MG1A 2NUVA 1UTHA 4X9TA 2ZYMA 5H8NB 3RPLA 4N13A 4F3BA 3Q25A 3T9HB 5I2NB 5DYHA 5B70A 3FUZA 3TCFA 1GTKA 5AA2D 5BUUA 4UABA 1LFGA 4YKKA 3S2VA 2F3BA 1N0TA 2Q8JA 1TFAA 1MXUA 3GZGA 1B1XA 4TLLB 4OVTA 4QFLA 1FBFA 1VFEA 2B3BA 5L9OA 1JEUA 2UYFA 5KZTA 2UXAA 3IR1A 1UTHB 2FHYA 4F3SA 3LSXA 2VPOA 4PBQA 4PAIA 4YKJA 4RK9A 2QVUA 2DYXA 1LBWA 4JWYA 1FBCA 4GBWA 3FVOA 1Z7ME 2GFEA 1OQHA 4JSDA 1A99A 2VD2A 3EKIA 3USDA 1B1HA 2FBPA 2XA5A 3PPOA 4GX3A 5H8HA 1B3EA 3C9HA 3B8BA 1LAXA 2XD3A 4DI4B 1MY3A 4G8MA 1O63A 4QXDA 3TELA 5L9MA 1AWBA 2V3UA 3IO4A 1KA0A 2PMSA 5JEIA 4ZEDA 3HFUA 3TYHA 3PTYA 4QFPA 3W9VA 1JW4A 4XFEA 2O1MA 4R9FA 4O7IA 2DP8A 1FJ6A 3TODA 2XD2A 2DVCA 3MVXA 2O7IA 2OWTA 4F18A 2UYEA 1Y9UA 3R7XA 1O64A 4OANA 3KJ7A 1MM7A 1JVXA 5ICTA 5I7IA 3E78A 1EYIA 5H8HB 4NTLA 2KLFA 4KI0E 3ZKLA 3CG1A 5ICQA 2VD3A 2XXTA 4XEQA 3H7MA 3JYRA 2P3VA 1FPBA 3H06B 3U92A 2F7CA 2O6AA 3FD3A 1QUKA 4PF6A 5HPQA 3A3CA 3O29A 5IZ1A 1NV3A 5F24A 1MY0A 4IB2A 5J16A 3TTKA 2QJEA 2Z8DA 4MLQA 5ET8A 3VXBA 5F1QA 4KPTA 1NUWA 5EQ8A 2B4LA 4N8GA 2XXRA 2QSXA 3UP9A 4O3CA 1ZJLA 1P1OA 3WAFA 4EDPA 4U4SA 1LBXA 4PE3A 1Y3QA 2FVZA 3VXCA 3QAXA 1FQCA 5EYHA 5AA1A 3C4MA 1B3LA 3VLWA 2THIA 4GXAA 4YKIA 4ZEKA 4NHBA 1CNQA 1B3HA 2Q2CA 2ZXTA 4JVCA 1FW0A 4LQ5A 4PFYA 3CSBA 4EXLA 1SPIA 2OCUA 3C36A 1Y4CA 4Q0CA 1FPGA 3OSRA 3PUZE 1H44A 5I2KA 4NAPA 1POY1 3MZBA 1N84A 3VV5A 2HCAA 3HPIA 2LAOA 2GH9A 1QW0A 4BDQA 1MDQA 1MXYA 2FA7A 4F22A 4JB7A 1AMFA 2RINA 3IJOB 1PBPA 1TWYA 3GYYA 5FTIA 1H45A 4R2FA 3FASA 3IOUA 4ELRA 3RLFE 1FPIA 5T3JA 3VVDA 2R6GE 1DPPA 4RXLA 2OBGA 1NV5A 2XXVA 3PUYE 4R6HA 5H8SA 2DWAA 4OZ9A 2ZYOA 1MQJA 3O6GA 4QRZA 5M2VA 3K1NA 1JETA 4PBHA 3PPPA 1Y1ZA 3I5OA 2Z23A 1B9JA 4KHZE 5A5XA 5I2KB 1NMUA 2Y7PA 4F29A 4N8YA 5FHNA 3SERA 2X26A 2F7BA 2Y7IA 1FQFA 4R6YA 5I3SA 1K9YA 1RDXA 1SDXA 1FTLA 2ZYNA 3BBRA 3P7IA 2GHAA 1EU8A 3A3UA 1TFDA 2Q74A 1B3FA 3N26A 4OA4A 4POXA 4IO3A 3L6HA 1LAHE 4GL8A 3T0JA 4IO7A 2F3DA 4MCOA 3PV0E 4Z0IA 3PMVA 4DZ1A 4OTEA 3K1PA 1PDAA 2V3QA 3MPKA 3OO8A 3V83A 2P1SA 3C34A 4BDOA 5EQ9A 2ONRA 1NI9A 1SVXB 3CR9A 1IEJA 3RT6B 4FBPA 1B4HA 1USYH 5A5XB 3H6VA 4H6DA 3HHGA 4LATA 4NEDA 2XWOA 2E1SA 1FBPA 3FZVA 1SW1A 4NF6A 3MC2A 4FEDA 3C31A 4QSCA 2FYIA 4LONB 2DDKA 3PUWE 2OWSA 4GF8A 1H76A 4QFKA 2XX7A 2V84A 2O69A 4I40A 1SW4A 1B5JA 3M3KA 1Q35A 2IA4A 4ZEFA 3HCQA 1MQGA 3FVGA 1NV6A 5EYFA 2F5XA 3IOWA 4K3FA 3IFCA 4MLVA 5I84A 2RKMA 1FPDA 2G93A 2XX8A 3KGCA 3T96B 2WYKA 4WEDA 1EZ9A 1D9YA 4LVQA 4IGTA 5LTCA 4ECFA 3EN3A 1FTOA 1OLAA 3R26A 1M5BA 2D3IA 1ZBMA 4NF6B 4PAFA 5K2XA 1MH3A 1YCJA 1S7YA 3K6VA 4EQBA 1A8FA 4X1BA 5CC2A 1PB9A 1Y3PA 4TQUQ 1JEVA 1ZKBA 4MEVA 5CBRA 5I56A 1PC3A 3PUXE 1I6AA 3VVFA 1ZIUA 5ISUA 2VGQA 4LZ7A 4JSOA 4GWUA 1MQHA 1JP4A 3K2DA 1FJ9A 5I58A 1MY4A 2XX9A 5CI5A 4LA9A 5IZ3A 4OESA 1B6HA 2PX1A 3CFZA 3PPNA 4XTCQ 5TP9A 3T9UA 1OIBA 2I4BA 1IZ1A 1EYJA 2DWHA 3H03A 2D21A 1A54A 1BKAA 5LOMA 4OVRA 1VR5A 2FIEA 2OX3A 2QMWA 4O94A 4DXCA 4KXPA 1AIVA 1B3GA 3PMWA 1WODA 5I56B 4Q30B 1IIWA 1FBDA 2PYYA 4WXJA 1LAGE 5ELVA 2QVRA 3ILTB 4Q8RA 1SI1A 1LBBA 2QS2A 3SEXA 5I58B 1MXZA 5EYGA 5IZ3B 1DTGA 2WBBA 3PUVE 5I57A 4QFOA 2I58A 4P0GA 1KA1A 2ANJA 1DCUA 2XHDA 3SESA 3U94A 1A7LA 5TP9B 4N17A 1Y3NA 2B65A 2ZZVA 4DIGA 1B32A 3OEKA 4DLDA 5IM2A 1GV8A 3MP8A 3G3HA 1Y20A 2H25A 3DP6A 1VE4A 3IAZA 1ANFA 1ZU0A 4YU0A 1I6BA 4XKRA 1KWHA 3K0VA 2GRVA 1H3DA 4I8CA 2PFZA 4U23A 2D5WA 2XWKA 3EF7A 2CZKA 4ZECA 4MIJA 4P1EA 1MRPA 1P1WA 4H45A 5I57B 1XS5A 2HEUA 3DP4A 3S9NC 3LC8A 1HSEA 4OERA 4DCXA 2Y7RA 4ZE9A 1ELJA 1JQFA 3IO6A 3W9WA 4P9KA 3KC0A
chains in the Genus database with same CATH topology
3SEWA 2V3TA 1FTJA 3SEUA 3O2AA 3V89B 4NWCA 1GR2A 4N07A 4EQ9A 4H1XA 4H5GA 3W15C 3Q27A 3TTRA 1P1UA 1ZTYA 3MAMA 1QULA 2Z22A 1US4A 3FV1A 2HXWA 3QUFA 4OEVA 1N7WA 1BLFA 3A09A 1B40A 1DMBA 3KG2A 1B2HA 5AE4A 4I9DA 1GGGA 4KQPA 3G3IA 2YLNA 2XXPA 4G8HA 2PT1A 2F34A 3TTLA 1URSA 4XKQA 3DM0A 1M5DA 4KCCA 3K00A 1ZMGA 4ISUA 3RQTA 1LCFA 1MXVA 1MY1A 2VP1A 3RY3A 3VLVA 4DXUA 1N04A 4Z7EA 1R6ZA 4UA8A 4HCWA 4IO5A 3Q29A 4LZ5A 3TCHA 2HQ0A 4RJZA 3H6UA 4FIMA 4IY6A 4EUOA 3SDFA 3IB2A 2PVUA 3OXNA 4QSDA 2H9BA 4JXIA 2R9JA 3KN7A 5ITPA 2E0SA 4POWA 4F2QA 1IUDA 3TUSA 5I59A 3G7WA 3G3GA 1EZPA 2V25A 2I0BA 1BIYA 3GLBA 3FGSA 3EPEA 5IAIA 4XXUA 3CG3A 4H5FA 4KR5A 5HBCA 1LSTA 2UVIA 2OZZA 1MXWA 4G4PA 2R71A 2REGA 5DT6A 4XKNA 3D4CA 3O9PA 3SETA 1DSNA 4TLMB 4M4GA 1P1NA 2ZYKA 1SBPA 2Y7WA 3U72A 2Y7KA 1XC1A 3EHSA 4BDRA 3KN3A 4XIGQ 5I59B 5BWJA 3SEYA 2Z8FA 4ELPA 5F7VA 1Y4TA 3IOTA 3N94A 4ZZAA 2AL4A 2V93A 3OOAA 3HN0A 2F7AA 3MPLA 2UVGA 3CRBA 2IEEA 2UVHA 3G3KA 1LB9A 1PBQA 3PGFA 3BKIB 3CVGA 1PB8A 4OETA 2P2AA 1FQAA 4Q5TA 1CE2A 2DE2A 3O66A 1S9TA 3CFLA 1LFIA 4JBZA 4QF9A 3VFJA 4GOTA 1ZLQA 2X7PA 4F3PA 2O51A 4YB7A 4ZDMA 3RTFB 2QS1A 1NL5A 1A8EA 1FQBA 2QL3A 3JZJA 3EHUA 4U4XA 5DTBA 4MBPA 2I4CA 2HAVA 2ONSA 1XT8A 1B52A 3H6WA 1NFTA 1QUJA 3FXRA 3O6HA 2DOJA 2ZNSA 1R9QA 3FJMA 4GL0A 4QSEA 2DWIA 4HS7A 1NKXA 4R6KA 3UGWA 2Q89A 1XVYA 1D3KA 5CMMA 1JVYA 5L9SA 1SQYA 5KDTA 2ALUA 1DPEA 4GFRA 3PU5A 2H99A 4YZZA 1NH7A 2G29A 1B5IA 4DCYA 3TDJA 4QHQA 4ELOA 4DDDA 2RC7A 3T22A 1EH3A 4GIZA 4P11A 1FQDA 4OHNA 4IY5A 3G3FA 4GXSB 2CZLA 1HSJA 4OFJA 5KDTB 3FXQA 3KOTA 2DXRA 5FTHA 3FATA 5DEXA 1JW1A 1XOCA 3VDFA 1RYOA 3MW0A 4OVJA 3IOVA 4KD5A 1B4ZA 4GRKA 4IO2A 3TPAA 3SEVA 2OK2A 3O6IA 5KCJA 4U22A 3Q28A 3S4UA 4DXBA 3KBRA 3O97A 3KSXA 2DQVA 1R9LA 2FNCA 4MF3A 3ZS6A 3V8XB 3VLUA 4YICA 2OJTA 5L8DA 1BTJA 4OMBA 3C35A 3CSGA 2XXUA 3E9XA 3QIMA 1LGBC 2XXIA 4FATA 4G77A 3U93A 3FXUA 4OQOA 4PP0A 1MDP1 1RKMA 3HO7A 2XXYA 2Q2AA 2NVUB 5DEXB 4ZE8A 3IK6B 4F31B 2RC9A 2ABHA 5K2YA 3MVZA 1YAEA 4H67A 3K4UA 2W7YA 1TT1A 3KOSA 4ZEBA 4O3AA 5KCJB 5H8QA 2AL5A 5IKBA 3K01A 1M5CA 2OLBA 3N6UA 1ATGA 4HW8A 1FQEA 4GQOA 1MY2A 4YMAA 4YAHX 3GBBA 2QS4A 4NMYA 4OXVA 4HTGA 3DP8A 1YPNA 4I1DA 3ILUB 4L17A 5EHMA 1UTBA 3QYTA 3ONMA 2F6GA 1B7UA 3GBAA 1IXGA 4THIA 2O1LA 2PBWA 4RK2A 4OFOA 4GLIA 1B0HA 4RPNA 4F2OA 3RUMA 4E0WA 5H8QB 1MM6A 1OVTA 1IXIA 4JWXA 3WAEA 5CBSA 2QMXA 3H4ZA 4RY1A 2X7QA 3H6TA 1IXHA 4P0IA 3MZ9A 3KZGA 2WKYA 4NF4A 3MP1A 3IX1A 1OQGA 4AQ4A 1UTBB 4PFTA 3TFLA 3HV1A 5HM4B 5CMBA 4AB5A 3MJNA 4F19A 1L5TA 2I3WA 1RYXA 3TZAA 3BFUA 1VSOA 2XXWA 3M3LA 5AA3A 2F8DA 4GVOA 4C1UA 2HZKA 1B05A 3N6TA 4R2BA 1P1QA 1SW2A 4LP2B 3LSWA 1R1NA 1USYE 4NF4B 4BDNA 4F1VA 4F3GA 3DELB 1LCTA 1OVBA 4ESXA 2I0CA 4X1DA 1B0LA 1DOTA 1D4NA 1LFHA 4KFQA 2DE3A 3BFTA 4UACA 2F35A 3KEIA 3L6GA 3E3KA 4FE8A 1II5A 3K6XA 4KYDA 2Q88A 1IXCA 4PFWA 1IQ7A 3IJXB 3MVYA 1FTMA 3K02A 4JDFA 4GD5A 1FCKA 1IITA 2HFBA 2QPQA 4NF8A 3V5AA 3IL1B 5H8FA 3QSLA 3B7DA 3EQ1A 3DLNA 3QXMA 3TQWA 1WDNA 5CRYA 4LUBA 1MPDA 4RPOA 1LAFE 2GHBA 1QUIA 3ODBA 2Z8EA 5CMKA 3OELA 5J1DA 1N3XA 5TU0A 4RYAA 2QRYA 4LQ2A 4ZS9A 2VOZA 1EZOA 5AA4A 3UK4A 3PD9A 1TXFA 4IGRA 4G2ZA 1PEBA 2O68A 3ZSFA 3T66A 1GVCA 4NF8B 3TTMA 3CFXA 1CB6A 2NWJA 3ECRA 5H8FB 3LBSA 4R9GA 3OENA 1MS7A 4F1UA 1M5FA 3LR1A 4WKMA 1D9VA 5AA4B 1OLCA 4FEBA 3MVWA 1BP5A 3I6VA 1MQIA 1WVJA 3K6WA 4PQJA 1NNPA 5EHSA 4LZ8A 1N3WA 2UVJA 3PPQA 4YB5A 3VE1B 5CM6A 3K6UA 5DVFA 4AB6A 4ONYA 4YMBA 4BDMA 1AL3A 3FVNA 4C1TA 1URGA 1MH4A 3OEMA 3KFMA 1QKAA 2ZNUA 1P99A 4R73A 2F97A 4H0WA 4X48A 2DS9A 4EF1A 1XVXA 2O7UA 3OO7A 4EF2A 2RCAA 1M5EA 3UA8A 1NH8A 4M1VA 4BLAA 2YPNA 3ZKKA 2ONKE 3B6QA 3VVEA 1N7XA 3TCGA 5AA2A 4U1OA 2ESNA 4C0RA 1Y1MA 4BDLA 2B3FA 2DXYA 1YTVA 3IORA 2H98A 1SD3A 1I69A 2Q9TA 1NNFA 3S9MC 4U1ZA 3THIA 1POTA 2RC8A 4FORA 3MUQA 3U8QA 2ZMBA 2I48A 2PT2A 1SYIA 3UIFA 1I6QA 3E13X 4G68A 4OEUA 2XXHA 3AXFA 1MXXA 4IO4A 3T9XB 1B46A 4ND9A 5DVIA 3B6TA 5AA2B 2M8CA 5JK4A 2A5TA 3FIRA 4F39A 1XHYA 4IO6A 1B51A 4EXKA 3C33A 2NXOA 3QUJA 2XXXA 3TKDA 3T93B 1T0KA 1VFDA 4WEPA 2AYSA 3FJGA 4R75A 1MPBA 1SW5A 2P0SA 1MPCA 2F36A 3HHFA 2HAUA 2H5YA 2RF1A 3OO6A 4MFIA 3RT8A 2DWJA 1UQWA 4G68B 3FV2A 1B58A 3S9LC 4ZZEA 3M8UA 2CMOA 2A5TB 1B7HA 2VHAA 2F78A 2XXQA 4KCDA 3K1MA 3U1OA 3MP6A 4H65A 3F11A 3G3JA 4GWOA 5TPAA 2I6EA 3OO9A 2H4IA 2Y84A 4RA1A 1AOVA 4FJPA 3R6UA 2O84X 3TEPA 4R72A 3KJTA 1URDA 3O28A 4KYSA 3HSTA 4OWDA 4NF5A 5JTYA 4H8IA 3TQLA 4F1YA 3B6WA 4O3BA 2DE4A 3KSJA 4ZEIA 4N6PA 3CIJA 1AH5A 1QKBA 5TPAB 4OYVA 5FHMA 4ESWA 3OMBA 3PMXA 4OFLA 4PE5B 1Q1KA 3M3FA 4E0XA 5CMCA 2REJA 1B7ZA 4PETA 4HCYA 3MBPA 3H3GA 3RN8A 1H43A 1UIUA 4ELQA 4RNSA 3SKPA 3PPRA 4MH5A 4YKPA 4NF5B 3TAJA 5JTYB 4JWOA 2QS3A 1N76A 3MWBA 3JV9A 1UIVA 4DE8A 1LBCA 4KYEA 1J1NA 3LSLA 3FJ7A 3RTWB 1HSLA 3KN8A 3E4RA 1US5A 4PFUA 4U2RA 1JW5A 3UN6A 3PD8A 4NE4A 4QFNA 1SI0A 1A40A 5FHOA 2BJJX 1Z7NE 4YB6A 4NWDA 1O7TA 5DVJA 2DSFA 2I3VA 3Q26A 4XKPA 3RPWA 1LLSA 1FTKA 1SYHA 3MQ9A 1LB8A 2A5SA 2DVZA 2NOOA 4FECA 1S50A 1MQDA 2AIXA 4G8NA 2RCBA 4I62A 4TOZA 4G68C 3TTNA 1A55A 3OD7A 1DTZA 1NNKA 3CI8A 1F9BA 3QK6A 5H8NA 1QJMA 3RNNA 3IB0A 2HZLA 5I2NA 1NNTA 3GXAA 4R74A 3TMGA 3S9EA 3C32A 3N5LA 2I49A 3RGYA 1JNFA 3IB1A 3T9VA 2ZNTA 3LUYA 4H8JA 3I3VA 5B7DA 3D4GA 3FVKA 3MZ1A 3LSFB 3UORA 4U21A 3EHTA 1B5HA 2YJPA 1PB7A 1QVSA 4OENA 4EQ7A 5ITOA 3OSQA 2F6PA 1OMPA 4FAJA 1MG1A 2NUVA 1UTHA 4X9TA 2ZYMA 5H8NB 4N13A 4F3BA 3Q25A 3T9HB 5I2NB 5DYHA 5B70A 3FUZA 3TCFA 1GTKA 5AA2D 5BUUA 1LFGA 4YKKA 3S2VA 1N0TA 2Q8JA 1TFAA 1MXUA 3GZGA 1B1XA 4TLLB 4QFLA 1VFEA 2B3BA 5L9OA 1JEUA 2UYFA 5KZTA 2UXAA 3IR1A 1UTHB 4F3SA 3LSXA 4YKJA 4RK9A 2DYXA 4JWYA 3FVOA 1Z7ME 2GFEA 1OQHA 4JSDA 1A99A 2VD2A 3USDA 1B1HA 3PPOA 5H8HA 1B3EA 3C9HA 1LAXA 2XD3A 1MY3A 4G8MA 1O63A 3TELA 5L9MA 2V3UA 3IO4A 2PMSA 5JEIA 4ZEDA 3TYHA 4QFPA 3W9VA 1JW4A 2O1MA 4R9FA 2DP8A 3TODA 2XD2A 2DVCA 3MVXA 2O7IA 2OWTA 4F18A 2UYEA 1Y9UA 3R7XA 1O64A 3KJ7A 1MM7A 1JVXA 5ICTA 5H8HB 4NTLA 2KLFA 4KI0E 3ZKLA 3CG1A 5ICQA 2VD3A 2XXTA 3H7MA 3JYRA 3H06B 3U92A 2F7CA 2O6AA 3FD3A 1QUKA 5HPQA 3A3CA 3O29A 1MY0A 4IB2A 3TTKA 2QJEA 2Z8DA 4MLQA 3VXBA 5F1QA 4KPTA 2XXRA 2QSXA 3UP9A 4O3CA 1ZJLA 1P1OA 3WAFA 4EDPA 4U4SA 1Y3QA 3VXCA 3QAXA 1FQCA 5AA1A 3C4MA 1B3LA 3VLWA 2THIA 4GXAA 4YKIA 4ZEKA 1B3HA 2Q2CA 2ZXTA 1FW0A 4LQ5A 4PFYA 3CSBA 4EXLA 2OCUA 3C36A 1Y4CA 4Q0CA 3OSRA 3PUZE 1H44A 5I2KA 1POY1 3MZBA 1N84A 3VV5A 2HCAA 3HPIA 2LAOA 2GH9A 1QW0A 4BDQA 1MDQA 1MXYA 2FA7A 4F22A 4JB7A 1AMFA 2RINA 3IJOB 1PBPA 1TWYA 5FTIA 1H45A 4R2FA 3FASA 3IOUA 4ELRA 3RLFE 3VVDA 2R6GE 1DPPA 4RXLA 2OBGA 2XXVA 3PUYE 4R6HA 5H8SA 2DWAA 4OZ9A 2ZYOA 1MQJA 3O6GA 4QRZA 5M2VA 3K1NA 1JETA 3PPPA 1Y1ZA 3I5OA 2Z23A 1B9JA 4KHZE 5A5XA 5I2KB 1NMUA 2Y7PA 4F29A 5FHNA 3SERA 2X26A 2F7BA 2Y7IA 1FQFA 4R6YA 1SDXA 1FTLA 2ZYNA 3BBRA 3P7IA 2GHAA 1EU8A 3A3UA 1TFDA 3N26A 1B3FA 4POXA 4IO3A 3L6HA 1LAHE 4GL8A 4IO7A 3PV0E 4Z0IA 3PMVA 4DZ1A 4OTEA 3K1PA 1PDAA 2V3QA 3MPKA 3OO8A 3V83A 2P1SA 3C34A 4BDOA 2ONRA 1SVXB 3CR9A 1IEJA 3RT6B 1B4HA 1USYH 5A5XB 3H6VA 4H6DA 3HHGA 4LATA 4NEDA 2E1SA 3FZVA 1SW1A 4NF6A 3MC2A 4FEDA 3C31A 4QSCA 2FYIA 4LONB 3PUWE 2OWSA 4GF8A 1H76A 4QFKA 2XX7A 2V84A 2O69A 1SW4A 1B5JA 3M3KA 1Q35A 2IA4A 4ZEFA 3HCQA 1MQGA 3FVGA 5EYFA 2F5XA 3IOWA 4K3FA 4MLVA 5I84A 2RKMA 2G93A 2XX8A 3KGCA 3T96B 4WEDA 1EZ9A 1D9YA 4LVQA 4IGTA 4ECFA 3EN3A 1FTOA 1OLAA 3R26A 1M5BA 2D3IA 1ZBMA 4NF6B 5K2XA 1MH3A 1YCJA 1S7YA 3K6VA 4EQBA 1A8FA 4X1BA 5CC2A 1PB9A 1Y3PA 4TQUQ 1JEVA 1ZKBA 5CBRA 5I56A 1PC3A 3PUXE 1I6AA 3VVFA 1ZIUA 5ISUA 2VGQA 4LZ7A 4JSOA 1MQHA 3K2DA 5I58A 1MY4A 2XX9A 5CI5A 4LA9A 4OESA 1B6HA 2PX1A 3CFZA 3PPNA 4XTCQ 5TP9A 3T9UA 1OIBA 2I4BA 1IZ1A 2DWHA 3H03A 2D21A 1A54A 1BKAA 5LOMA 1VR5A 2QMWA 4DXCA 1AIVA 1B3GA 3PMWA 1WODA 5I56B 4Q30B 1IIWA 2PYYA 4WXJA 1LAGE 5ELVA 3ILTB 4Q8RA 1SI1A 1LBBA 2QS2A 3SEXA 5I58B 1MXZA 1DTGA 3PUVE 5I57A 4QFOA 2I58A 4P0GA 2ANJA 2XHDA 3SESA 3U94A 1A7LA 5TP9B 1Y3NA 2B65A 4DIGA 1B32A 3OEKA 4DLDA 1GV8A 3MP8A 3G3HA 1Y20A 2H25A 3DP6A 1VE4A 3IAZA 1ANFA 4YU0A 1ZU0A 1I6BA 4XKRA 1KWHA 3K0VA 2GRVA 1H3DA 4I8CA 4U23A 2D5WA 3EF7A 4ZECA 1MRPA 1P1WA 5I57B 1XS5A 2HEUA 3DP4A 3S9NC 3LC8A 1HSEA 4OERA 4DCXA 2Y7RA 4ZE9A 1ELJA 1JQFA 3IO6A 3W9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEW A;  2V3T A;  1FTJ A;  3SEU A;  3O2A A;  3V89 B;  4NWC A;  1GR2 A;  4N07 A;  4EQ9 A;  4H1X A;  4H5G A;  3W15 C;  3Q27 A;  3TTR A;  1P1U A;  1ZTY A;  3MAM A;  1QUL A;  2Z22 A;  1US4 A;  3FV1 A;  2HXW A;  3QUF A;  4OEV A;  1N7W A;  1BLF A;  3A09 A;  1B40 A;  1DMB A;  3KG2 A;  1B2H A;  5AE4 A;  4I9D A;  1GGG A;  4KQP A;  3G3I A;  2YLN A;  2XXP A;  4G8H A;  2PT1 A;  2F34 A;  3TTL A;  1URS A;  4XKQ A;  3DM0 A;  1M5D A;  4KCC A;  3K00 A;  1ZMG A;  4ISU A;  3RQT A;  1LCF A;  1MXV A;  1MY1 A;  2VP1 A;  3RY3 A;  3VLV A;  4DXU A;  1N04 A;  4Z7E A;  1R6Z A;  4UA8 A;  4HCW A;  4IO5 A;  3Q29 A;  4LZ5 A;  3TCH A;  2HQ0 A;  4RJZ A;  3H6U A;  4FIM A;  4IY6 A;  4EUO A;  3SDF A;  3IB2 A;  2PVU A;  3OXN A;  4QSD A;  2H9B A;  4JXI A;  2R9J A;  3KN7 A;  5ITP A;  2E0S A;  4POW A;  4F2Q A;  1IUD A;  3TUS A;  5I59 A;  3G7W A;  3G3G A;  1EZP A;  2V25 A;  2I0B A;  1BIY A;  3GLB A;  3FGS A;  3EPE A;  5IAI A;  4XXU A;  3CG3 A;  4H5F A;  4KR5 A;  5HBC A;  1LST A;  2UVI A;  2OZZ A;  1MXW A;  4G4P A;  2R71 A;  2REG A;  5DT6 A;  4XKN A;  3D4C A;  3O9P A;  3SET A;  1DSN A;  4TLM B;  4M4G A;  1P1N A;  2ZYK A;  1SBP A;  2Y7W A;  3U72 A;  2Y7K A;  1XC1 A;  3EHS A;  4BDR A;  3KN3 A;  4XIG Q;  5I59 B;  5BWJ A;  3SEY A;  2Z8F A;  4ELP A;  5F7V A;  1Y4T A;  3IOT A;  3N94 A;  4ZZA A;  2AL4 A;  2V93 A;  3OOA A;  3HN0 A;  2F7A A;  3MPL A;  2UVG A;  3CRB A;  2IEE A;  2UVH A;  3G3K A;  1LB9 A;  1PBQ A;  3PGF A;  3BKI B;  3CVG A;  1PB8 A;  4OET A;  2P2A A;  1FQA A;  4Q5T A;  1CE2 A;  2DE2 A;  3O66 A;  1S9T A;  3CFL A;  1LFI A;  4JBZ A;  4QF9 A;  3VFJ A;  4GOT A;  1ZLQ A;  2X7P A;  4F3P A;  2O51 A;  4YB7 A;  4ZDM A;  3RTF B;  2QS1 A;  1NL5 A;  1A8E A;  1FQB A;  2QL3 A;  3JZJ A;  3EHU A;  4U4X A;  5DTB A;  4MBP A;  2I4C A;  2HAV A;  2ONS A;  1XT8 A;  1B52 A;  3H6W A;  1NFT A;  1QUJ A;  3FXR A;  3O6H A;  2DOJ A;  2ZNS A;  1R9Q A;  3FJM A;  4GL0 A;  4QSE A;  2DWI A;  4HS7 A;  1NKX A;  4R6K A;  3UGW A;  2Q89 A;  1XVY A;  1D3K A;  5CMM A;  1JVY A;  5L9S A;  1SQY A;  5KDT A;  2ALU A;  1DPE A;  4GFR A;  3PU5 A;  2H99 A;  4YZZ A;  1NH7 A;  2G29 A;  1B5I A;  4DCY A;  3TDJ A;  4QHQ A;  4ELO A;  4DDD A;  2RC7 A;  3T22 A;  1EH3 A;  4GIZ A;  4P11 A;  1FQD A;  4OHN A;  4IY5 A;  3G3F A;  4GXS B;  2CZL A;  1HSJ A;  4OFJ A;  5KDT B;  3FXQ A;  3KOT A;  2DXR A;  5FTH A;  3FAT A;  5DEX A;  1JW1 A;  1XOC A;  3VDF A;  1RYO A;  3MW0 A;  4OVJ A;  3IOV A;  4KD5 A;  1B4Z A;  4GRK A;  4IO2 A;  3TPA A;  3SEV A;  2OK2 A;  3O6I A;  5KCJ A;  4U22 A;  3Q28 A;  3S4U A;  4DXB A;  3KBR A;  3O97 A;  3KSX A;  2DQV A;  1R9L A;  2FNC A;  4MF3 A;  3ZS6 A;  3V8X B;  3VLU A;  4YIC A;  2OJT A;  5L8D A;  1BTJ A;  4OMB A;  3C35 A;  3CSG A;  2XXU A;  3E9X A;  3QIM A;  1LGB C;  2XXI A;  4FAT A;  4G77 A;  3U93 A;  3FXU A;  4OQO A;  4PP0 A;  1MDP 1;  1RKM A;  3HO7 A;  2XXY A;  2Q2A A;  2NVU B;  5DEX B;  4ZE8 A;  3IK6 B;  4F31 B;  2RC9 A;  2ABH A;  5K2Y A;  3MVZ A;  1YAE A;  4H67 A;  3K4U A;  2W7Y A;  1TT1 A;  3KOS A;  4ZEB A;  4O3A A;  5KCJ B;  5H8Q A;  2AL5 A;  5IKB A;  3K01 A;  1M5C A;  2OLB A;  3N6U A;  1ATG A;  4HW8 A;  1FQE A;  4GQO A;  1MY2 A;  4YMA A;  4YAH X;  3GBB A;  2QS4 A;  4NMY A;  4OXV A;  4HTG A;  3DP8 A;  1YPN A;  4I1D A;  3ILU B;  4L17 A;  5EHM A;  1UTB A;  3QYT A;  3ONM A;  2F6G A;  1B7U A;  3GBA A;  1IXG A;  4THI A;  2O1L A;  2PBW A;  4RK2 A;  4OFO A;  4GLI A;  1B0H A;  4RPN A;  4F2O A;  3RUM A;  4E0W A;  5H8Q B;  1MM6 A;  1OVT A;  1IXI A;  4JWX A;  3WAE A;  5CBS A;  2QMX A;  3H4Z A;  4RY1 A;  2X7Q A;  3H6T A;  1IXH A;  4P0I A;  3MZ9 A;  3KZG A;  2WKY A;  4NF4 A;  3MP1 A;  3IX1 A;  1OQG A;  4AQ4 A;  1UTB B;  4PFT A;  3TFL A;  3HV1 A;  5HM4 B;  5CMB A;  4AB5 A;  3MJN A;  4F19 A;  1L5T A;  2I3W A;  1RYX A;  3TZA A;  3BFU A;  1VSO A;  2XXW A;  3M3L A;  5AA3 A;  2F8D A;  4GVO A;  4C1U A;  2HZK A;  1B05 A;  3N6T A;  4R2B A;  1P1Q A;  1SW2 A;  4LP2 B;  3LSW A;  1R1N A;  1USY E;  4NF4 B;  4BDN A;  4F1V A;  4F3G A;  3DEL B;  1LCT A;  1OVB A;  4ESX A;  2I0C A;  4X1D A;  1B0L A;  1DOT A;  1D4N A;  1LFH A;  4KFQ A;  2DE3 A;  3BFT A;  4UAC A;  2F35 A;  3KEI A;  3L6G A;  3E3K A;  4FE8 A;  1II5 A;  3K6X A;  4KYD A;  2Q88 A;  1IXC A;  4PFW A;  1IQ7 A;  3IJX B;  3MVY A;  1FTM A;  3K02 A;  4JDF A;  4GD5 A;  1FCK A;  1IIT A;  2HFB A;  2QPQ A;  4NF8 A;  3V5A A;  3IL1 B;  5H8F A;  3QSL A;  3B7D A;  3EQ1 A;  3DLN A;  3QXM A;  3TQW A;  1WDN A;  5CRY A;  4LUB A;  1MPD A;  4RPO A;  1LAF E;  2GHB A;  1QUI A;  3ODB A;  2Z8E A;  5CMK A;  3OEL A;  5J1D A;  1N3X A;  5TU0 A;  4RYA A;  2QRY A;  4LQ2 A;  4ZS9 A;  2VOZ A;  1EZO A;  5AA4 A;  3UK4 A;  3PD9 A;  1TXF A;  4IGR A;  4G2Z A;  1PEB A;  2O68 A;  3ZSF A;  3T66 A;  1GVC A;  4NF8 B;  3TTM A;  3CFX A;  1CB6 A;  2NWJ A;  3ECR A;  5H8F B;  3LBS A;  4R9G A;  3OEN A;  1MS7 A;  4F1U A;  1M5F A;  3LR1 A;  4WKM A;  1D9V A;  5AA4 B;  1OLC A;  4FEB A;  3MVW A;  1BP5 A;  3I6V A;  1MQI A;  1WVJ A;  3K6W A;  4PQJ A;  1NNP A;  5EHS A;  4LZ8 A;  1N3W A;  2UVJ A;  3PPQ A;  4YB5 A;  3VE1 B;  5CM6 A;  3K6U A;  5DVF A;  4AB6 A;  4ONY A;  4YMB A;  4BDM A;  1AL3 A;  3FVN A;  4C1T A;  1URG A;  1MH4 A;  3OEM A;  3KFM A;  1QKA A;  2ZNU A;  1P99 A;  4R73 A;  2F97 A;  4H0W A;  4X48 A;  2DS9 A;  4EF1 A;  1XVX A;  2O7U A;  3OO7 A;  4EF2 A;  2RCA A;  1M5E A;  3UA8 A;  1NH8 A;  4M1V A;  4BLA A;  2YPN A;  3ZKK A;  2ONK E;  3B6Q A;  3VVE A;  1N7X A;  3TCG A;  5AA2 A;  4U1O A;  2ESN A;  4C0R A;  1Y1M A;  4BDL A;  2B3F A;  2DXY A;  1YTV A;  3IOR A;  2H98 A;  1SD3 A;  1I69 A;  2Q9T A;  1NNF A;  3S9M C;  4U1Z A;  3THI A;  1POT A;  2RC8 A;  4FOR A;  3MUQ A;  3U8Q A;  2ZMB A;  2I48 A;  2PT2 A;  1SYI A;  3UIF A;  1I6Q A;  3E13 X;  4G68 A;  4OEU A;  2XXH A;  3AXF A;  1MXX A;  4IO4 A;  3T9X B;  1B46 A;  4ND9 A;  5DVI A;  3B6T A;  5AA2 B;  2M8C A;  5JK4 A;  2A5T A;  3FIR A;  4F39 A;  1XHY A;  4IO6 A;  1B51 A;  4EXK A;  3C33 A;  2NXO A;  3QUJ A;  2XXX A;  3TKD A;  3T93 B;  1T0K A;  1VFD A;  4WEP A;  2AYS A;  3FJG A;  4R75 A;  1MPB A;  1SW5 A;  2P0S A;  1MPC A;  2F36 A;  3HHF A;  2HAU A;  2H5Y A;  2RF1 A;  3OO6 A;  4MFI A;  3RT8 A;  2DWJ A;  1UQW A;  4G68 B;  3FV2 A;  1B58 A;  3S9L C;  4ZZE A;  3M8U A;  2CMO A;  2A5T B;  1B7H A;  2VHA A;  2F78 A;  2XXQ A;  4KCD A;  3K1M A;  3U1O A;  3MP6 A;  4H65 A;  3F11 A;  3G3J A;  4GWO A;  5TPA A;  2I6E A;  3OO9 A;  2H4I A;  2Y84 A;  4RA1 A;  1AOV A;  4FJP A;  3R6U A;  2O84 X;  3TEP A;  4R72 A;  3KJT A;  1URD A;  3O28 A;  4KYS A;  3HST A;  4OWD A;  4NF5 A;  5JTY A;  4H8I A;  3TQL A;  4F1Y A;  3B6W A;  4O3B A;  2DE4 A;  3KSJ A;  4ZEI A;  4N6P A;  3CIJ A;  1AH5 A;  1QKB A;  5TPA B;  4OYV A;  5FHM A;  4ESW A;  3OMB A;  3PMX A;  4OFL A;  4PE5 B;  1Q1K A;  3M3F A;  4E0X A;  5CMC A;  2REJ A;  1B7Z A;  4PET A;  4HCY A;  3MBP A;  3H3G A;  3RN8 A;  1H43 A;  1UIU A;  4ELQ A;  4RNS A;  3SKP A;  3PPR A;  4MH5 A;  4YKP A;  4NF5 B;  3TAJ A;  5JTY B;  4JWO A;  2QS3 A;  1N76 A;  3MWB A;  3JV9 A;  1UIV A;  4DE8 A;  1LBC A;  4KYE A;  1J1N A;  3LSL A;  3FJ7 A;  3RTW B;  1HSL A;  3KN8 A;  3E4R A;  1US5 A;  4PFU A;  4U2R A;  1JW5 A;  3UN6 A;  3PD8 A;  4NE4 A;  4QFN A;  1SI0 A;  1A40 A;  5FHO A;  2BJJ X;  1Z7N E;  4YB6 A;  4NWD A;  1O7T A;  5DVJ A;  2DSF A;  2I3V A;  3Q26 A;  4XKP A;  3RPW A;  1LLS A;  1FTK A;  1SYH A;  3MQ9 A;  1LB8 A;  2A5S A;  2DVZ A;  2NOO A;  4FEC A;  1S50 A;  1MQD A;  2AIX A;  4G8N A;  2RCB A;  4I62 A;  4TOZ A;  4G68 C;  3TTN A;  1A55 A;  3OD7 A;  1DTZ A;  1NNK A;  3CI8 A;  1F9B A;  3QK6 A;  5H8N A;  1QJM A;  3RNN A;  3IB0 A;  2HZL A;  5I2N A;  1NNT A;  3GXA A;  4R74 A;  3TMG A;  3S9E A;  3C32 A;  3N5L A;  2I49 A;  3RGY A;  1JNF A;  3IB1 A;  3T9V A;  2ZNT A;  3LUY A;  4H8J A;  3I3V A;  5B7D A;  3D4G A;  3FVK A;  3MZ1 A;  3LSF B;  3UOR A;  4U21 A;  3EHT A;  1B5H A;  2YJP A;  1PB7 A;  1QVS A;  4OEN A;  4EQ7 A;  5ITO A;  3OSQ A;  2F6P A;  1OMP A;  4FAJ A;  1MG1 A;  2NUV A;  1UTH A;  4X9T A;  2ZYM A;  5H8N B;  4N13 A;  4F3B A;  3Q25 A;  3T9H B;  5I2N B;  5DYH A;  5B70 A;  3FUZ A;  3TCF A;  1GTK A;  5AA2 D;  5BUU A;  1LFG A;  4YKK A;  3S2V A;  1N0T A;  2Q8J A;  1TFA A;  1MXU A;  3GZG A;  1B1X A;  4TLL B;  4QFL A;  1VFE A;  2B3B A;  5L9O A;  1JEU A;  2UYF A;  5KZT A;  2UXA A;  3IR1 A;  1UTH B;  4F3S A;  3LSX A;  4YKJ A;  4RK9 A;  2DYX A;  4JWY A;  3FVO A;  1Z7M E;  2GFE A;  1OQH A;  4JSD A;  1A99 A;  2VD2 A;  3USD A;  1B1H A;  3PPO A;  5H8H A;  1B3E A;  3C9H A;  1LAX A;  2XD3 A;  1MY3 A;  4G8M A;  1O63 A;  3TEL A;  5L9M A;  2V3U A;  3IO4 A;  2PMS A;  5JEI A;  4ZED A;  3TYH A;  4QFP A;  3W9V A;  1JW4 A;  2O1M A;  4R9F A;  2DP8 A;  3TOD A;  2XD2 A;  2DVC A;  3MVX A;  2O7I A;  2OWT A;  4F18 A;  2UYE A;  1Y9U A;  3R7X A;  1O64 A;  3KJ7 A;  1MM7 A;  1JVX A;  5ICT A;  5H8H B;  4NTL A;  2KLF A;  4KI0 E;  3ZKL A;  3CG1 A;  5ICQ A;  2VD3 A;  2XXT A;  3H7M A;  3JYR A;  3H06 B;  3U92 A;  2F7C A;  2O6A A;  3FD3 A;  1QUK A;  5HPQ A;  3A3C A;  3O29 A;  1MY0 A;  4IB2 A;  3TTK A;  2QJE A;  2Z8D A;  4MLQ A;  3VXB A;  5F1Q A;  4KPT A;  2XXR A;  2QSX A;  3UP9 A;  4O3C A;  1ZJL A;  1P1O A;  3WAF A;  4EDP A;  4U4S A;  1Y3Q A;  3VXC A;  3QAX A;  1FQC A;  5AA1 A;  3C4M A;  1B3L A;  3VLW A;  2THI A;  4GXA A;  4YKI A;  4ZEK A;  1B3H A;  2Q2C A;  2ZXT A;  1FW0 A;  4LQ5 A;  4PFY A;  3CSB A;  4EXL A;  2OCU A;  3C36 A;  1Y4C A;  4Q0C A;  3OSR A;  3PUZ E;  1H44 A;  5I2K A;  1POY 1;  3MZB A;  1N84 A;  3VV5 A;  2HCA A;  3HPI A;  2LAO A;  2GH9 A;  1QW0 A;  4BDQ A;  1MDQ A;  1MXY A;  2FA7 A;  4F22 A;  4JB7 A;  1AMF A;  2RIN A;  3IJO B;  1PBP A;  1TWY A;  5FTI A;  1H45 A;  4R2F A;  3FAS A;  3IOU A;  4ELR A;  3RLF E;  3VVD A;  2R6G E;  1DPP A;  4RXL A;  2OBG A;  2XXV A;  3PUY E;  4R6H A;  5H8S A;  2DWA A;  4OZ9 A;  2ZYO A;  1MQJ A;  3O6G A;  4QRZ A;  5M2V A;  3K1N A;  1JET A;  3PPP A;  1Y1Z A;  3I5O A;  2Z23 A;  1B9J A;  4KHZ E;  5A5X A;  5I2K B;  1NMU A;  2Y7P A;  4F29 A;  5FHN A;  3SER A;  2X26 A;  2F7B A;  2Y7I A;  1FQF A;  4R6Y A;  1SDX A;  1FTL A;  2ZYN A;  3BBR A;  3P7I A;  2GHA A;  1EU8 A;  3A3U A;  1TFD A;  3N26 A;  1B3F A;  4POX A;  4IO3 A;  3L6H A;  1LAH E;  4GL8 A;  4IO7 A;  3PV0 E;  4Z0I A;  3PMV A;  4DZ1 A;  4OTE A;  3K1P A;  1PDA A;  2V3Q A;  3MPK A;  3OO8 A;  3V83 A;  2P1S A;  3C34 A;  4BDO A;  2ONR A;  1SVX B;  3CR9 A;  1IEJ A;  3RT6 B;  1B4H A;  1USY H;  5A5X B;  3H6V A;  4H6D A;  3HHG A;  4LAT A;  4NED A;  2E1S A;  3FZV A;  1SW1 A;  4NF6 A;  3MC2 A;  4FED A;  3C31 A;  4QSC A;  2FYI A;  4LON B;  3PUW E;  2OWS A;  4GF8 A;  1H76 A;  4QFK A;  2XX7 A;  2V84 A;  2O69 A;  1SW4 A;  1B5J A;  3M3K A;  1Q35 A;  2IA4 A;  4ZEF A;  3HCQ A;  1MQG A;  3FVG A;  5EYF A;  2F5X A;  3IOW A;  4K3F A;  4MLV A;  5I84 A;  2RKM A;  2G93 A;  2XX8 A;  3KGC A;  3T96 B;  4WED A;  1EZ9 A;  1D9Y A;  4LVQ A;  4IGT A;  4ECF A;  3EN3 A;  1FTO A;  1OLA A;  3R26 A;  1M5B A;  2D3I A;  1ZBM A;  4NF6 B;  5K2X A;  1MH3 A;  1YCJ A;  1S7Y A;  3K6V A;  4EQB A;  1A8F A;  4X1B A;  5CC2 A;  1PB9 A;  1Y3P A;  4TQU Q;  1JEV A;  1ZKB A;  5CBR A;  5I56 A;  1PC3 A;  3PUX E;  1I6A A;  3VVF A;  1ZIU A;  5ISU A;  2VGQ A;  4LZ7 A;  4JSO A;  1MQH A;  3K2D A;  5I58 A;  1MY4 A;  2XX9 A;  5CI5 A;  4LA9 A;  4OES A;  1B6H A;  2PX1 A;  3CFZ A;  3PPN A;  4XTC Q;  5TP9 A;  3T9U A;  1OIB A;  2I4B A;  1IZ1 A;  2DWH A;  3H03 A;  2D21 A;  1A54 A;  1BKA A;  5LOM A;  1VR5 A;  2QMW A;  4DXC A;  1AIV A;  1B3G A;  3PMW A;  1WOD A;  5I56 B;  4Q30 B;  1IIW A;  2PYY A;  4WXJ A;  1LAG E;  5ELV A;  3ILT B;  4Q8R A;  1SI1 A;  1LBB A;  2QS2 A;  3SEX A;  5I58 B;  1MXZ A;  1DTG A;  3PUV E;  5I57 A;  4QFO A;  2I58 A;  4P0G A;  2ANJ A;  2XHD A;  3SES A;  3U94 A;  1A7L A;  5TP9 B;  1Y3N A;  2B65 A;  4DIG A;  1B32 A;  3OEK A;  4DLD A;  1GV8 A;  3MP8 A;  3G3H A;  1Y20 A;  2H25 A;  3DP6 A;  1VE4 A;  3IAZ A;  1ANF A;  4YU0 A;  1ZU0 A;  1I6B A;  4XKR A;  1KWH A;  3K0V A;  2GRV A;  1H3D A;  4I8C A;  4U23 A;  2D5W A;  3EF7 A;  4ZEC A;  1MRP A;  1P1W A;  5I57 B;  1XS5 A;  2HEU A;  3DP4 A;  3S9N C;  3LC8 A;  1HSE A;  4OER A;  4DCX A;  2Y7R A;  4ZE9 A;  1ELJ A;  1JQF A;  3IO6 A;  3W9W A; 
#chains in the Genus database with same CATH topology
 3SEW A;  2V3T A;  1FTJ A;  3SEU A;  3O2A A;  3V89 B;  4NWC A;  1GR2 A;  4N07 A;  5EQA A;  4EQ9 A;  4H1X A;  4H5G A;  3W15 C;  3Q27 A;  3TTR A;  1P1U A;  1ZTY A;  3MAM A;  1QUL A;  2Z22 A;  1US4 A;  3FV1 A;  2HXW A;  3QUF A;  4OEV A;  3RPL B;  1N7W A;  1BLF A;  3A09 A;  1B40 A;  1DMB A;  3KG2 A;  1B2H A;  5AE4 A;  1G0H A;  4I9D A;  1GGG A;  4KQP A;  3G3I A;  5ET7 A;  2YLN A;  2XXP A;  4PC9 A;  4G8H A;  2PT1 A;  2F34 A;  3TTL A;  1URS A;  4XKQ A;  3DM0 A;  1M5D A;  3LUZ A;  3K00 A;  4KCC A;  1ZMG A;  4ISU A;  3RQT A;  1LCF A;  1MXV A;  1MY1 A;  2VP1 A;  3RY3 A;  3VLV A;  4DXU A;  1NV0 A;  1N04 A;  4Z7E A;  1R6Z A;  4UA8 A;  4HCW A;  4IO5 A;  1DK4 A;  3Q29 A;  4LZ5 A;  3TCH A;  2HQ0 A;  4RJZ A;  3H6U A;  4FIM A;  4IY6 A;  4EUO A;  1IMB A;  3SDF A;  3IB2 A;  4IR8 A;  2PVU A;  1NV4 A;  3OXN A;  1NV2 A;  2H9B A;  1INP A;  4QSD A;  4JXI A;  2R9J A;  3KN7 A;  5ITP A;  2E0S A;  4H46 A;  4POW A;  4P1L A;  4F2Q A;  1IUD A;  1RDY A;  3TUS A;  5I59 A;  3G7W A;  3G3G A;  4PFR A;  1EZP A;  2V25 A;  2I0B A;  1BIY A;  3GLB A;  3FGS A;  3EPE A;  5IAI A;  4XXU A;  3CG3 A;  4H5F A;  4KR5 A;  5HBC A;  1LST A;  2UVI A;  2OZZ A;  1MXW A;  4G4P A;  2R71 A;  2REG A;  5DT6 A;  4XKN A;  3D4C A;  3O9P A;  4MAG A;  3SET A;  5ET5 A;  1DSN A;  4TLM B;  4M4G A;  1P1N A;  2ZYK A;  2Q8M A;  1SBP A;  2Y7W A;  1QGX A;  3U72 A;  2Y7K A;  1XC1 A;  3EHS A;  3FXB A;  4BDR A;  3KN3 A;  4XIG Q;  5I59 B;  5BWJ A;  3SEY A;  2Z8F A;  4ELP A;  5F7V A;  1Y4T A;  3IOT A;  3N94 A;  4ZZA A;  2AL4 A;  2V93 A;  3OOA A;  2HXR A;  3HN0 A;  2F7A A;  3MPL A;  2UVG A;  3CRB A;  2IEE A;  2UVH A;  2ZZX A;  3G3K A;  1LB9 A;  1PBQ A;  4GWX A;  3CHG A;  3PGF A;  3BKI B;  3CVG A;  1PB8 A;  4OET A;  2P2A A;  1FQA A;  4Q5T A;  1LBV A;  1CE2 A;  2DE2 A;  3O66 A;  2V4C A;  1S9T A;  1FPJ A;  4PDH A;  5ET6 A;  3CFL A;  1LFI A;  4JBZ A;  4QF9 A;  3VFJ A;  4GOT A;  1ZLQ A;  4MHF A;  5IGA A;  2X7P A;  4F3P A;  2JJK A;  2O51 A;  4HE1 A;  4YB7 A;  4ZDM A;  3RTF B;  2QS1 A;  1NL5 A;  3D1R A;  1A8E A;  1FQB A;  2QL3 A;  3JZJ A;  3EHU A;  4U4X A;  5DTB A;  4MBP A;  2I4C A;  2HAV A;  2MKZ A;  2ONS A;  1XT8 A;  1B52 A;  3H6W A;  1NFT A;  4X8R A;  1QUJ A;  3FXR A;  3O6H A;  2DOJ A;  1BK4 A;  2ZNS A;  1R9Q A;  2L5V A;  3FJM A;  2WX9 A;  4GL0 A;  4QSE A;  4PTK A;  2DWI A;  3QMF A;  4HS7 A;  1NKX A;  2CEY A;  4R6K A;  3UGW A;  2Q89 A;  1XVY A;  4GBV A;  2Y5L A;  1D3K A;  5CMM A;  1JVY A;  5L9S A;  1SQY A;  4GWS A;  5KDT A;  1FSA A;  2ALU A;  4GWZ A;  2KQZ A;  1NUZ A;  1DPE A;  4GFR A;  3PU5 A;  2H99 A;  4YZZ A;  3IFA A;  1NH7 A;  2G29 A;  1B5I A;  4DCY A;  3TDJ A;  5ESY A;  4QHQ A;  4ELO A;  4DDD A;  2RC7 A;  3T22 A;  2Y5K A;  1EH3 A;  1XI6 A;  4GIZ A;  4HE0 A;  4P11 A;  1FPF A;  1FQD A;  4OHN A;  4IY5 A;  2WYP A;  4GWW A;  3G3F A;  4PGN A;  3KBZ A;  4GXS B;  2CZL A;  1HSJ A;  4OFJ A;  5KDT B;  3FXQ A;  3KOT A;  2DXR A;  5FTH A;  3FAT A;  4GX6 A;  5DEX A;  1JW1 A;  4I3E A;  1XOC A;  3VDF A;  1RYO A;  4OVJ A;  3MW0 A;  3IOV A;  4KD5 A;  1B4Z A;  1LEV A;  4GRK A;  4IO2 A;  3TPA A;  3SEV A;  2OK2 A;  2VT5 A;  3O6I A;  5KCJ A;  1FTA A;  4U22 A;  3Q28 A;  3B50 A;  3S4U A;  4DXB A;  3KBR A;  3O97 A;  3KSX A;  1VDW A;  2DQV A;  1R9L A;  2FNC A;  4MF3 A;  3ZS6 A;  4NQ8 A;  3V8X B;  3VLU A;  4YIC A;  2HHM A;  2OJT A;  5L8D A;  1BTJ A;  1LBY A;  4OMB A;  3C35 A;  3CSG A;  2XXU A;  3E9X A;  3QIM A;  1LGB C;  2XXI A;  4G77 A;  4FAT A;  3U93 A;  3FXU A;  4OQO A;  4PP0 A;  1MDP 1;  1RKM A;  3HO7 A;  4NX1 A;  2XXY A;  2Q2A A;  2NVU B;  5DEX B;  4ZE8 A;  4JVI A;  3IK6 B;  4F31 B;  2RC9 A;  2ABH A;  5K2Y A;  3MVZ A;  1KZ8 A;  1YAE A;  4H67 A;  3K4U A;  2W7Y A;  4PAK A;  1TT1 A;  3KOS A;  4ZEB A;  4O3A A;  5KCJ B;  5H8Q A;  2AL5 A;  5IKB A;  2QFL A;  3K01 A;  1M5C A;  2OLB A;  3N6U A;  1ATG A;  4HW8 A;  1D9Q A;  1FQE A;  4GQO A;  1MY2 A;  2XWV A;  4YMA A;  4O7M A;  4I3Y A;  2P3N A;  1IMF A;  4YAH X;  1IMC A;  3GBB A;  2QS4 A;  4NMY A;  4OXV A;  4HTG A;  3DP8 A;  1YPN A;  4PDD A;  4I1D A;  1G0I A;  3ILU B;  4NF0 A;  4L17 A;  5EHM A;  1UTB A;  3QYT A;  3ONM A;  2F6G A;  1B7U A;  3GBA A;  1IXG A;  4THI A;  2O1L A;  2PBW A;  4RK2 A;  4OFO A;  4MMP A;  4GLI A;  3ISP A;  1B0H A;  1NUX A;  4QBA A;  4RPN A;  4F2O A;  3RUM A;  4E0W A;  5H8Q B;  4MNP A;  1MM6 A;  1OVT A;  1IXI A;  4JWX A;  3WAE A;  5CBS A;  2QMX A;  3H4Z A;  4RY1 A;  2FIX A;  2X7Q A;  3H6T A;  1IXH A;  4P0I A;  3MZ9 A;  3KZG A;  2WKY A;  4NF4 A;  3MP1 A;  4DI3 D;  3IX1 A;  1OQG A;  4AQ4 A;  4N6K A;  1UTB B;  4PFT A;  3TFL A;  3HV1 A;  5HM4 B;  4PGP A;  5CMB A;  4AB5 A;  1IME A;  3MJN A;  4F19 A;  1L5T A;  2I3W A;  1RYX A;  3TZA A;  3BFU A;  1VSO A;  2XXW A;  4HXV A;  3M3L A;  3A29 A;  4MX6 A;  5AA3 A;  2F8D A;  4GVO A;  4C1U A;  2HZK A;  1RDZ A;  1B05 A;  3N6T A;  4R2B A;  1P1Q A;  1SW2 A;  4LP2 B;  3LSW A;  1R1N A;  1USY E;  4NF4 B;  4BDN A;  4F1V A;  4F3G A;  3DEL B;  1LCT A;  1OVB A;  4ESX A;  2I0C A;  4X1D A;  1B0L A;  1DOT A;  1D4N A;  1LFH A;  4KFQ A;  2DE3 A;  3BFT A;  4UAC A;  2F35 A;  1NUY A;  3KEI A;  3L6G A;  3E3K A;  4FE8 A;  1II5 A;  3K6X A;  4KYD A;  4PCD A;  2Q88 A;  1IXC A;  4PFW A;  1IQ7 A;  3IJX B;  3MVY A;  1FTM A;  4P3L A;  3K02 A;  4JDF A;  4GD5 A;  1FCK A;  3MST A;  1IIT A;  2XWI A;  5IZZ A;  2HFB A;  2QPQ A;  4NF8 A;  4N6D A;  3V5A A;  4P56 A;  3IL1 B;  5H8F A;  4O8M A;  4AS4 A;  3QSL A;  3B7D A;  3EQ1 A;  3DLN A;  4PFB A;  3QXM A;  3TQW A;  1WDN A;  2VPN A;  4AS5 A;  2B4M A;  5CRY A;  4LUB A;  1MPD A;  4RPO A;  1LAF E;  2GHB A;  4PFI A;  1QUI A;  3ODB A;  4OVQ A;  2Z8E A;  5CMK A;  3OEL A;  5J1D A;  1N3X A;  5TU0 A;  4RYA A;  2QRY A;  4LQ2 A;  4ZS9 A;  2VOZ A;  1EZO A;  5AA4 A;  3UK4 A;  3PD9 A;  1TXF A;  4IGR A;  4G2Z A;  1PEB A;  2O68 A;  3ZSF A;  3T66 A;  1GVC A;  4N81 A;  4NF8 B;  3TTM A;  3CFX A;  1CB6 A;  2NWJ A;  3ECR A;  2WEF A;  5H8F B;  3LBS A;  4R9G A;  3OEN A;  3MYU A;  4GWY A;  2HPG A;  2PFY A;  3U65 A;  1MS7 A;  2QVV A;  4F1U A;  4WKM A;  1M5F A;  3LR1 A;  1D9V A;  5AA4 B;  1OLC A;  4FEB A;  3MVW A;  1BP5 A;  3I6V A;  1MQI A;  1WVJ A;  3K6W A;  4PQJ A;  1NNP A;  5EHS A;  4LZ8 A;  1N3W A;  4MNC A;  2UVJ A;  3PPQ A;  4YB5 A;  3VE1 B;  5CM6 A;  3K6U A;  5DVF A;  4AB6 A;  4ONY A;  4YMB A;  4BDM A;  1AL3 A;  3FVN A;  4N15 A;  4C1T A;  1URG A;  3RYD A;  1MH4 A;  3OEM A;  1LBZ A;  3KFM A;  1QKA A;  4XF5 A;  2ZNU A;  1P99 A;  4R73 A;  2F97 A;  4N4U A;  4H0W A;  4X48 A;  2DS9 A;  4EF1 A;  1XVX A;  2O7U A;  3OO7 A;  2R8T A;  4JVD A;  4EF2 A;  2RCA A;  1M5E A;  3UA8 A;  1NH8 A;  4M1V A;  4BLA A;  2YPN A;  3ZKK A;  2ONK E;  3B6Q A;  3VVE A;  3KC1 A;  1N7X A;  3TCG A;  5AA2 A;  4MNI A;  4U1O A;  2ESN A;  4C0R A;  1Y1M A;  2PCR A;  4BDL A;  2B3F A;  2DXY A;  1IMD A;  1YTV A;  3IOR A;  2H98 A;  1SD3 A;  1I69 A;  2Q9T A;  1NNF A;  3S9M C;  4G61 A;  4U1Z A;  3THI A;  1POT A;  2RC8 A;  4FOR A;  3MUQ A;  3U8Q A;  2ZMB A;  2I48 A;  2PT2 A;  1SYI A;  3UIF A;  1I6Q A;  3E13 X;  4NG7 A;  1FRP A;  4G68 A;  4OEU A;  2XXH A;  4NGU A;  1FBG A;  1FPK A;  3AXF A;  2KR0 A;  1MXX A;  1FPL A;  4IO4 A;  3LV0 A;  3T9X B;  1B46 A;  4ND9 A;  5DVI A;  3B6T A;  5AA2 B;  2M8C A;  5JK4 A;  2A5T A;  3FIR A;  4F39 A;  1XHY A;  4IO6 A;  5EQ7 A;  1YZ0 A;  1B51 A;  4EXK A;  3C33 A;  2OWZ A;  2NXO A;  3T1B A;  3QUJ A;  2XXX A;  3TKD A;  3T93 B;  1T0K A;  1VFD A;  4WEP A;  1YXI A;  2AYS A;  3FJG A;  4R75 A;  1MPB A;  1SW5 A;  2P0S A;  2XXK A;  1MPC A;  2F36 A;  1IMA A;  5A5L A;  3HHF A;  2HAU A;  2H5Y A;  5FBP A;  2RF1 A;  3OO6 A;  4MFI A;  3NOH A;  3RT8 A;  3SZP A;  4LN5 A;  4N91 A;  2DWJ A;  1UQW A;  4G68 B;  3FV2 A;  1B58 A;  3S9L C;  4ZZE A;  3M8U A;  2CMO A;  2A5T B;  1B7H A;  2VHA A;  5DW8 A;  2F78 A;  2XXQ A;  4KCD A;  1K9Z A;  3K1M A;  3U1O A;  3MP6 A;  4NN3 A;  4H65 A;  3F11 A;  3G3J A;  4GWO A;  5TPA A;  2I6E A;  3OO9 A;  2H4I A;  2Y84 A;  4RA1 A;  1AOV A;  4FJP A;  3FBP A;  3R6U A;  2O84 X;  3TEP A;  1DBZ A;  4R72 A;  3KJT A;  1FBH A;  1URD A;  3O28 A;  4KYS A;  3HST A;  4OWD A;  4NF5 A;  5JTY A;  4H8I A;  3TQL A;  4F1Y A;  3B6W A;  4O3B A;  3ROJ A;  2DE4 A;  3KSJ A;  4ZEI A;  4N6P A;  3CIJ A;  1AH5 A;  1QKB A;  4PF8 A;  5TPA B;  4OYV A;  5FHM A;  4ESW A;  3OMB A;  3PMX A;  4OFL A;  4PE5 B;  4X04 A;  1Q1K A;  3M3F A;  4E0X A;  5CMC A;  2REJ A;  1B7Z A;  4PET A;  4HCY A;  3MBP A;  3H3G A;  3RN8 A;  3BIG A;  5I5P A;  1H43 A;  1UIU A;  4ELQ A;  4RNS A;  3SKP A;  3PPR A;  4MH5 A;  4OVS A;  4YKP A;  4NF5 B;  3TAJ A;  5JTY B;  4JWO A;  2QS3 A;  1N76 A;  3MWB A;  3JV9 A;  1UIV A;  1FPE A;  4DE8 A;  1LBC A;  4KYE A;  1J1N A;  4MJO A;  3LSL A;  3FJ7 A;  3RTW B;  1HSL A;  3KN8 A;  3E4R A;  1US5 A;  4PFU A;  4U2R A;  1JW5 A;  3UN6 A;  3PD8 A;  4NE4 A;  1Q9D A;  4QFN A;  2CEX A;  1SI0 A;  4P8B A;  1A40 A;  1NV7 A;  4P47 A;  5FHO A;  2BJJ X;  2GQ1 A;  1Z7N E;  4YB6 A;  2CZI A;  4NWD A;  1O7T A;  5DVJ A;  2DSF A;  2I3V A;  3Q26 A;  4XKP A;  3RPW A;  1LLS A;  1FTK A;  1SYH A;  3MQ9 A;  1LB8 A;  2A5S A;  2DVZ A;  2NOO A;  4FEC A;  3E79 A;  1S50 A;  1MQD A;  1NV1 A;  2AIX A;  4G8N A;  2RCB A;  2WBD A;  4I62 A;  4TOZ A;  4OVP A;  4G68 C;  4GX4 A;  3TTN A;  1A55 A;  3OD7 A;  1DTZ A;  1NNK A;  3CI8 A;  1F9B A;  3QK6 A;  1EYK A;  5H8N A;  1QJM A;  3RNN A;  3IB0 A;  2HZL A;  5I2N A;  1NNT A;  3GXA A;  1YYZ A;  2ZZW A;  4R74 A;  3TMG A;  3S9E A;  5LDZ A;  2BJI A;  3C32 A;  1FBE A;  3N5L A;  2I49 A;  3RGY A;  1JNF A;  3IB1 A;  3T9V A;  4HE2 A;  2ZNT A;  3LUY A;  4H8J A;  3I3V A;  5B7D A;  3D4G A;  2CZH A;  3FVK A;  3MZ1 A;  3LSF B;  3UOR A;  4U21 A;  3EHT A;  3BIH A;  1B5H A;  2YJP A;  1PB7 A;  1QVS A;  4OEN A;  4EQ7 A;  5ITO A;  3OSQ A;  2F6P A;  1OMP A;  4FAJ A;  1MG1 A;  2NUV A;  1UTH A;  4X9T A;  2ZYM A;  5H8N B;  3RPL A;  4N13 A;  4F3B A;  3Q25 A;  3T9H B;  5I2N B;  5DYH A;  5B70 A;  3FUZ A;  3TCF A;  1GTK A;  5AA2 D;  5BUU A;  4UAB A;  1LFG A;  4YKK A;  3S2V A;  2F3B A;  1N0T A;  2Q8J A;  1TFA A;  1MXU A;  3GZG A;  1B1X A;  4TLL B;  4OVT A;  4QFL A;  1FBF A;  1VFE A;  2B3B A;  5L9O A;  1JEU A;  2UYF A;  5KZT A;  2UXA A;  3IR1 A;  1UTH B;  2FHY A;  4F3S A;  3LSX A;  2VPO A;  4PBQ A;  4PAI A;  4YKJ A;  4RK9 A;  2QVU A;  2DYX A;  1LBW A;  4JWY A;  1FBC A;  4GBW A;  3FVO A;  1Z7M E;  2GFE A;  1OQH A;  4JSD A;  1A99 A;  2VD2 A;  3EKI A;  3USD A;  1B1H A;  2FBP A;  2XA5 A;  3PPO A;  4GX3 A;  5H8H A;  1B3E A;  3C9H A;  3B8B A;  1LAX A;  2XD3 A;  4DI4 B;  1MY3 A;  4G8M A;  1O63 A;  4QXD A;  3TEL A;  5L9M A;  1AWB A;  2V3U A;  3IO4 A;  1KA0 A;  2PMS A;  5JEI A;  4ZED A;  3HFU A;  3TYH A;  3PTY A;  4QFP A;  3W9V A;  1JW4 A;  4XFE A;  2O1M A;  4R9F A;  4O7I A;  2DP8 A;  1FJ6 A;  3TOD A;  2XD2 A;  2DVC A;  3MVX A;  2O7I A;  2OWT A;  4F18 A;  2UYE A;  1Y9U A;  3R7X A;  1O64 A;  4OAN A;  3KJ7 A;  1MM7 A;  1JVX A;  5ICT A;  5I7I A;  3E78 A;  1EYI A;  5H8H B;  4NTL A;  2KLF A;  4KI0 E;  3ZKL A;  3CG1 A;  5ICQ A;  2VD3 A;  2XXT A;  4XEQ A;  3H7M A;  3JYR A;  2P3V A;  1FPB A;  3H06 B;  3U92 A;  2F7C A;  2O6A A;  3FD3 A;  1QUK A;  4PF6 A;  5HPQ A;  3A3C A;  3O29 A;  5IZ1 A;  1NV3 A;  5F24 A;  1MY0 A;  4IB2 A;  5J16 A;  3TTK A;  2QJE A;  2Z8D A;  4MLQ A;  5ET8 A;  3VXB A;  5F1Q A;  4KPT A;  1NUW A;  5EQ8 A;  2B4L A;  4N8G A;  2XXR A;  2QSX A;  3UP9 A;  4O3C A;  1ZJL A;  1P1O A;  3WAF A;  4EDP A;  4U4S A;  1LBX A;  4PE3 A;  1Y3Q A;  2FVZ A;  3VXC A;  3QAX A;  1FQC A;  5EYH A;  5AA1 A;  3C4M A;  1B3L A;  3VLW A;  2THI A;  4GXA A;  4YKI A;  4ZEK A;  4NHB A;  1CNQ A;  1B3H A;  2Q2C A;  2ZXT A;  4JVC A;  1FW0 A;  4LQ5 A;  4PFY A;  3CSB A;  4EXL A;  1SPI A;  2OCU A;  3C36 A;  1Y4C A;  4Q0C A;  1FPG A;  3OSR A;  3PUZ E;  1H44 A;  5I2K A;  4NAP A;  1POY 1;  3MZB A;  1N84 A;  3VV5 A;  2HCA A;  3HPI A;  2LAO A;  2GH9 A;  1QW0 A;  4BDQ A;  1MDQ A;  1MXY A;  2FA7 A;  4F22 A;  4JB7 A;  1AMF A;  2RIN A;  3IJO B;  1PBP A;  1TWY A;  3GYY A;  5FTI A;  1H45 A;  4R2F A;  3FAS A;  3IOU A;  4ELR A;  3RLF E;  1FPI A;  5T3J A;  3VVD A;  2R6G E;  1DPP A;  4RXL A;  2OBG A;  1NV5 A;  2XXV A;  3PUY E;  4R6H A;  5H8S A;  2DWA A;  4OZ9 A;  2ZYO A;  1MQJ A;  3O6G A;  4QRZ A;  5M2V A;  3K1N A;  1JET A;  4PBH A;  3PPP A;  1Y1Z A;  3I5O A;  2Z23 A;  1B9J A;  4KHZ E;  5A5X A;  5I2K B;  1NMU A;  2Y7P A;  4F29 A;  4N8Y A;  5FHN A;  3SER A;  2X26 A;  2F7B A;  2Y7I A;  1FQF A;  4R6Y A;  5I3S A;  1K9Y A;  1RDX A;  1SDX A;  1FTL A;  2ZYN A;  3BBR A;  3P7I A;  2GHA A;  1EU8 A;  3A3U A;  1TFD A;  2Q74 A;  1B3F A;  3N26 A;  4OA4 A;  4POX A;  4IO3 A;  3L6H A;  1LAH E;  4GL8 A;  3T0J A;  4IO7 A;  2F3D A;  4MCO A;  3PV0 E;  4Z0I A;  3PMV A;  4DZ1 A;  4OTE A;  3K1P A;  1PDA A;  2V3Q A;  3MPK A;  3OO8 A;  3V83 A;  2P1S A;  3C34 A;  4BDO A;  5EQ9 A;  2ONR A;  1NI9 A;  1SVX B;  3CR9 A;  1IEJ A;  3RT6 B;  4FBP A;  1B4H A;  1USY H;  5A5X B;  3H6V A;  4H6D A;  3HHG A;  4LAT A;  4NED A;  2XWO A;  2E1S A;  1FBP A;  3FZV A;  1SW1 A;  4NF6 A;  3MC2 A;  4FED A;  3C31 A;  4QSC A;  2FYI A;  4LON B;  2DDK A;  3PUW E;  2OWS A;  4GF8 A;  1H76 A;  4QFK A;  2XX7 A;  2V84 A;  2O69 A;  4I40 A;  1SW4 A;  1B5J A;  3M3K A;  1Q35 A;  2IA4 A;  4ZEF A;  3HCQ A;  1MQG A;  3FVG A;  1NV6 A;  5EYF A;  2F5X A;  3IOW A;  4K3F A;  3IFC A;  4MLV A;  5I84 A;  2RKM A;  1FPD A;  2G93 A;  2XX8 A;  3KGC A;  3T96 B;  2WYK A;  4WED A;  1EZ9 A;  1D9Y A;  4LVQ A;  4IGT A;  5LTC A;  4ECF A;  3EN3 A;  1FTO A;  1OLA A;  3R26 A;  1M5B A;  2D3I A;  1ZBM A;  4NF6 B;  4PAF A;  5K2X A;  1MH3 A;  1YCJ A;  1S7Y A;  3K6V A;  4EQB A;  1A8F A;  4X1B A;  5CC2 A;  1PB9 A;  1Y3P A;  4TQU Q;  1JEV A;  1ZKB A;  4MEV A;  5CBR A;  5I56 A;  1PC3 A;  3PUX E;  1I6A A;  3VVF A;  1ZIU A;  5ISU A;  2VGQ A;  4LZ7 A;  4JSO A;  4GWU A;  1MQH A;  1JP4 A;  3K2D A;  1FJ9 A;  5I58 A;  1MY4 A;  2XX9 A;  5CI5 A;  4LA9 A;  5IZ3 A;  4OES A;  1B6H A;  2PX1 A;  3CFZ A;  3PPN A;  4XTC Q;  5TP9 A;  3T9U A;  1OIB A;  2I4B A;  1IZ1 A;  1EYJ A;  2DWH A;  3H03 A;  2D21 A;  1A54 A;  1BKA A;  5LOM A;  4OVR A;  1VR5 A;  2FIE A;  2OX3 A;  2QMW A;  4O94 A;  4DXC A;  4KXP A;  1AIV A;  1B3G A;  3PMW A;  1WOD A;  5I56 B;  4Q30 B;  1IIW A;  1FBD A;  2PYY A;  4WXJ A;  1LAG E;  5ELV A;  2QVR A;  3ILT B;  4Q8R A;  1SI1 A;  1LBB A;  2QS2 A;  3SEX A;  5I58 B;  1MXZ A;  5EYG A;  5IZ3 B;  1DTG A;  2WBB A;  3PUV E;  5I57 A;  4QFO A;  2I58 A;  4P0G A;  1KA1 A;  2ANJ A;  1DCU A;  2XHD A;  3SES A;  3U94 A;  1A7L A;  5TP9 B;  4N17 A;  1Y3N A;  2B65 A;  2ZZV A;  4DIG A;  1B32 A;  3OEK A;  4DLD A;  5IM2 A;  1GV8 A;  3MP8 A;  3G3H A;  1Y20 A;  2H25 A;  3DP6 A;  1VE4 A;  3IAZ A;  1ANF A;  1ZU0 A;  4YU0 A;  1I6B A;  4XKR A;  1KWH A;  3K0V A;  2GRV A;  1H3D A;  4I8C A;  2PFZ A;  4U23 A;  2D5W A;  2XWK A;  3EF7 A;  2CZK A;  4ZEC A;  4MIJ A;  4P1E A;  1MRP A;  1P1W A;  4H45 A;  5I57 B;  1XS5 A;  2HEU A;  3DP4 A;  3S9N C;  3LC8 A;  1HSE A;  4OER A;  4DCX A;  2Y7R A;  4ZE9 A;  1ELJ A;  1JQF A;  3IO6 A;  3W9W A;  4P9K A;  3KC0 A; 
#chains in the Genus database with same CATH homology
 3SEW A;  2V3T A;  1FTJ A;  3SEU A;  3O2A A;  3V89 B;  4NWC A;  1GR2 A;  4N07 A;  4EQ9 A;  4H1X A;  4H5G A;  3W15 C;  3Q27 A;  3TTR A;  1P1U A;  1ZTY A;  3MAM A;  1QUL A;  2Z22 A;  1US4 A;  3FV1 A;  2HXW A;  3QUF A;  4OEV A;  1N7W A;  1BLF A;  3A09 A;  1B40 A;  1DMB A;  3KG2 A;  1B2H A;  5AE4 A;  4I9D A;  1GGG A;  4KQP A;  3G3I A;  2YLN A;  2XXP A;  4G8H A;  2PT1 A;  2F34 A;  3TTL A;  1URS A;  4XKQ A;  3DM0 A;  1M5D A;  4KCC A;  3K00 A;  1ZMG A;  4ISU A;  3RQT A;  1LCF A;  1MXV A;  1MY1 A;  2VP1 A;  3RY3 A;  3VLV A;  4DXU A;  1N04 A;  4Z7E A;  1R6Z A;  4UA8 A;  4HCW A;  4IO5 A;  3Q29 A;  4LZ5 A;  3TCH A;  2HQ0 A;  4RJZ A;  3H6U A;  4FIM A;  4IY6 A;  4EUO A;  3SDF A;  3IB2 A;  2PVU A;  3OXN A;  4QSD A;  2H9B A;  4JXI A;  2R9J A;  3KN7 A;  5ITP A;  2E0S A;  4POW A;  4F2Q A;  1IUD A;  3TUS A;  5I59 A;  3G7W A;  3G3G A;  1EZP A;  2V25 A;  2I0B A;  1BIY A;  3GLB A;  3FGS A;  3EPE A;  5IAI A;  4XXU A;  3CG3 A;  4H5F A;  4KR5 A;  5HBC A;  1LST A;  2UVI A;  2OZZ A;  1MXW A;  4G4P A;  2R71 A;  2REG A;  5DT6 A;  4XKN A;  3D4C A;  3O9P A;  3SET A;  1DSN A;  4TLM B;  4M4G A;  1P1N A;  2ZYK A;  1SBP A;  2Y7W A;  3U72 A;  2Y7K A;  1XC1 A;  3EHS A;  4BDR A;  3KN3 A;  4XIG Q;  5I59 B;  5BWJ A;  3SEY A;  2Z8F A;  4ELP A;  5F7V A;  1Y4T A;  3IOT A;  3N94 A;  4ZZA A;  2AL4 A;  2V93 A;  3OOA A;  3HN0 A;  2F7A A;  3MPL A;  2UVG A;  3CRB A;  2IEE A;  2UVH A;  3G3K A;  1LB9 A;  1PBQ A;  3PGF A;  3BKI B;  3CVG A;  1PB8 A;  4OET A;  2P2A A;  1FQA A;  4Q5T A;  1CE2 A;  2DE2 A;  3O66 A;  1S9T A;  3CFL A;  1LFI A;  4JBZ A;  4QF9 A;  3VFJ A;  4GOT A;  1ZLQ A;  2X7P A;  4F3P A;  2O51 A;  4YB7 A;  4ZDM A;  3RTF B;  2QS1 A;  1NL5 A;  1A8E A;  1FQB A;  2QL3 A;  3JZJ A;  3EHU A;  4U4X A;  5DTB A;  4MBP A;  2I4C A;  2HAV A;  2ONS A;  1XT8 A;  1B52 A;  3H6W A;  1NFT A;  1QUJ A;  3FXR A;  3O6H A;  2DOJ A;  2ZNS A;  1R9Q A;  3FJM A;  4GL0 A;  4QSE A;  2DWI A;  4HS7 A;  1NKX A;  4R6K A;  3UGW A;  2Q89 A;  1XVY A;  1D3K A;  5CMM A;  1JVY A;  5L9S A;  1SQY A;  5KDT A;  2ALU A;  1DPE A;  4GFR A;  3PU5 A;  2H99 A;  4YZZ A;  1NH7 A;  2G29 A;  1B5I A;  4DCY A;  3TDJ A;  4QHQ A;  4ELO A;  4DDD A;  2RC7 A;  3T22 A;  1EH3 A;  4GIZ A;  4P11 A;  1FQD A;  4OHN A;  4IY5 A;  3G3F A;  4GXS B;  2CZL A;  1HSJ A;  4OFJ A;  5KDT B;  3FXQ A;  3KOT A;  2DXR A;  5FTH A;  3FAT A;  5DEX A;  1JW1 A;  1XOC A;  3VDF A;  1RYO A;  3MW0 A;  4OVJ A;  3IOV A;  4KD5 A;  1B4Z A;  4GRK A;  4IO2 A;  3TPA A;  3SEV A;  2OK2 A;  3O6I A;  5KCJ A;  4U22 A;  3Q28 A;  3S4U A;  4DXB A;  3KBR A;  3O97 A;  3KSX A;  2DQV A;  1R9L A;  2FNC A;  4MF3 A;  3ZS6 A;  3V8X B;  3VLU A;  4YIC A;  2OJT A;  5L8D A;  1BTJ A;  4OMB A;  3C35 A;  3CSG A;  2XXU A;  3E9X A;  3QIM A;  1LGB C;  2XXI A;  4FAT A;  4G77 A;  3U93 A;  3FXU A;  4OQO A;  4PP0 A;  1MDP 1;  1RKM A;  3HO7 A;  2XXY A;  2Q2A A;  2NVU B;  5DEX B;  4ZE8 A;  3IK6 B;  4F31 B;  2RC9 A;  2ABH A;  5K2Y A;  3MVZ A;  1YAE A;  4H67 A;  3K4U A;  2W7Y A;  1TT1 A;  3KOS A;  4ZEB A;  4O3A A;  5KCJ B;  5H8Q A;  2AL5 A;  5IKB A;  3K01 A;  1M5C A;  2OLB A;  3N6U A;  1ATG A;  4HW8 A;  1FQE A;  4GQO A;  1MY2 A;  4YMA A;  4YAH X;  3GBB A;  2QS4 A;  4NMY A;  4OXV A;  4HTG A;  3DP8 A;  1YPN A;  4I1D A;  3ILU B;  4L17 A;  5EHM A;  1UTB A;  3QYT A;  3ONM A;  2F6G A;  1B7U A;  3GBA A;  1IXG A;  4THI A;  2O1L A;  2PBW A;  4RK2 A;  4OFO A;  4GLI A;  1B0H A;  4RPN A;  4F2O A;  3RUM A;  4E0W A;  5H8Q B;  1MM6 A;  1OVT A;  1IXI A;  4JWX A;  3WAE A;  5CBS A;  2QMX A;  3H4Z A;  4RY1 A;  2X7Q A;  3H6T A;  1IXH A;  4P0I A;  3MZ9 A;  3KZG A;  2WKY A;  4NF4 A;  3MP1 A;  3IX1 A;  1OQG A;  4AQ4 A;  1UTB B;  4PFT A;  3TFL A;  3HV1 A;  5HM4 B;  5CMB A;  4AB5 A;  3MJN A;  4F19 A;  1L5T A;  2I3W A;  1RYX A;  3TZA A;  3BFU A;  1VSO A;  2XXW A;  3M3L A;  5AA3 A;  2F8D A;  4GVO A;  4C1U A;  2HZK A;  1B05 A;  3N6T A;  4R2B A;  1P1Q A;  1SW2 A;  4LP2 B;  3LSW A;  1R1N A;  1USY E;  4NF4 B;  4BDN A;  4F1V A;  4F3G A;  3DEL B;  1LCT A;  1OVB A;  4ESX A;  2I0C A;  4X1D A;  1B0L A;  1DOT A;  1D4N A;  1LFH A;  4KFQ A;  2DE3 A;  3BFT A;  4UAC A;  2F35 A;  3KEI A;  3L6G A;  3E3K A;  4FE8 A;  1II5 A;  3K6X A;  4KYD A;  2Q88 A;  1IXC A;  4PFW A;  1IQ7 A;  3IJX B;  3MVY A;  1FTM A;  3K02 A;  4JDF A;  4GD5 A;  1FCK A;  1IIT A;  2HFB A;  2QPQ A;  4NF8 A;  3V5A A;  3IL1 B;  5H8F A;  3QSL A;  3B7D A;  3EQ1 A;  3DLN A;  3QXM A;  3TQW A;  1WDN A;  5CRY A;  4LUB A;  1MPD A;  4RPO A;  1LAF E;  2GHB A;  1QUI A;  3ODB A;  2Z8E A;  5CMK A;  3OEL A;  5J1D A;  1N3X A;  5TU0 A;  4RYA A;  2QRY A;  4LQ2 A;  4ZS9 A;  2VOZ A;  1EZO A;  5AA4 A;  3UK4 A;  3PD9 A;  1TXF A;  4IGR A;  4G2Z A;  1PEB A;  2O68 A;  3ZSF A;  3T66 A;  1GVC A;  4NF8 B;  3TTM A;  3CFX A;  1CB6 A;  2NWJ A;  3ECR A;  5H8F B;  3LBS A;  4R9G A;  3OEN A;  1MS7 A;  4F1U A;  1M5F A;  3LR1 A;  4WKM A;  1D9V A;  5AA4 B;  1OLC A;  4FEB A;  3MVW A;  1BP5 A;  3I6V A;  1MQI A;  1WVJ A;  3K6W A;  4PQJ A;  1NNP A;  5EHS A;  4LZ8 A;  1N3W A;  2UVJ A;  3PPQ A;  4YB5 A;  3VE1 B;  5CM6 A;  3K6U A;  5DVF A;  4AB6 A;  4ONY A;  4YMB A;  4BDM A;  1AL3 A;  3FVN A;  4C1T A;  1URG A;  1MH4 A;  3OEM A;  3KFM A;  1QKA A;  2ZNU A;  1P99 A;  4R73 A;  2F97 A;  4H0W A;  4X48 A;  2DS9 A;  4EF1 A;  1XVX A;  2O7U A;  3OO7 A;  4EF2 A;  2RCA A;  1M5E A;  3UA8 A;  1NH8 A;  4M1V A;  4BLA A;  2YPN A;  3ZKK A;  2ONK E;  3B6Q A;  3VVE A;  1N7X A;  3TCG A;  5AA2 A;  4U1O A;  2ESN A;  4C0R A;  1Y1M A;  4BDL A;  2B3F A;  2DXY A;  1YTV A;  3IOR A;  2H98 A;  1SD3 A;  1I69 A;  2Q9T A;  1NNF A;  3S9M C;  4U1Z A;  3THI A;  1POT A;  2RC8 A;  4FOR A;  3MUQ A;  3U8Q A;  2ZMB A;  2I48 A;  2PT2 A;  1SYI A;  3UIF A;  1I6Q A;  3E13 X;  4G68 A;  4OEU A;  2XXH A;  3AXF A;  1MXX A;  4IO4 A;  3T9X B;  1B46 A;  4ND9 A;  5DVI A;  3B6T A;  5AA2 B;  2M8C A;  5JK4 A;  2A5T A;  3FIR A;  4F39 A;  1XHY A;  4IO6 A;  1B51 A;  4EXK A;  3C33 A;  2NXO A;  3QUJ A;  2XXX A;  3TKD A;  3T93 B;  1T0K A;  1VFD A;  4WEP A;  2AYS A;  3FJG A;  4R75 A;  1MPB A;  1SW5 A;  2P0S A;  1MPC A;  2F36 A;  3HHF A;  2HAU A;  2H5Y A;  2RF1 A;  3OO6 A;  4MFI A;  3RT8 A;  2DWJ A;  1UQW A;  4G68 B;  3FV2 A;  1B58 A;  3S9L C;  4ZZE A;  3M8U A;  2CMO A;  2A5T B;  1B7H A;  2VHA A;  2F78 A;  2XXQ A;  4KCD A;  3K1M A;  3U1O A;  3MP6 A;  4H65 A;  3F11 A;  3G3J A;  4GWO A;  5TPA A;  2I6E A;  3OO9 A;  2H4I A;  2Y84 A;  4RA1 A;  1AOV A;  4FJP A;  3R6U A;  2O84 X;  3TEP A;  4R72 A;  3KJT A;  1URD A;  3O28 A;  4KYS A;  3HST A;  4OWD A;  4NF5 A;  5JTY A;  4H8I A;  3TQL A;  4F1Y A;  3B6W A;  4O3B A;  2DE4 A;  3KSJ A;  4ZEI A;  4N6P A;  3CIJ A;  1AH5 A;  1QKB A;  5TPA B;  4OYV A;  5FHM A;  4ESW A;  3OMB A;  3PMX A;  4OFL A;  4PE5 B;  1Q1K A;  3M3F A;  4E0X A;  5CMC A;  2REJ A;  1B7Z A;  4PET A;  4HCY A;  3MBP A;  3H3G A;  3RN8 A;  1H43 A;  1UIU A;  4ELQ A;  4RNS A;  3SKP A;  3PPR A;  4MH5 A;  4YKP A;  4NF5 B;  3TAJ A;  5JTY B;  4JWO A;  2QS3 A;  1N76 A;  3MWB A;  3JV9 A;  1UIV A;  4DE8 A;  1LBC A;  4KYE A;  1J1N A;  3LSL A;  3FJ7 A;  3RTW B;  1HSL A;  3KN8 A;  3E4R A;  1US5 A;  4PFU A;  4U2R A;  1JW5 A;  3UN6 A;  3PD8 A;  4NE4 A;  4QFN A;  1SI0 A;  1A40 A;  5FHO A;  2BJJ X;  1Z7N E;  4YB6 A;  4NWD A;  1O7T A;  5DVJ A;  2DSF A;  2I3V A;  3Q26 A;  4XKP A;  3RPW A;  1LLS A;  1FTK A;  1SYH A;  3MQ9 A;  1LB8 A;  2A5S A;  2DVZ A;  2NOO A;  4FEC A;  1S50 A;  1MQD A;  2AIX A;  4G8N A;  2RCB A;  4I62 A;  4TOZ A;  4G68 C;  3TTN A;  1A55 A;  3OD7 A;  1DTZ A;  1NNK A;  3CI8 A;  1F9B A;  3QK6 A;  5H8N A;  1QJM A;  3RNN A;  3IB0 A;  2HZL A;  5I2N A;  1NNT A;  3GXA A;  4R74 A;  3TMG A;  3S9E A;  3C32 A;  3N5L A;  2I49 A;  3RGY A;  1JNF A;  3IB1 A;  3T9V A;  2ZNT A;  3LUY A;  4H8J A;  3I3V A;  5B7D A;  3D4G A;  3FVK A;  3MZ1 A;  3LSF B;  3UOR A;  4U21 A;  3EHT A;  1B5H A;  2YJP A;  1PB7 A;  1QVS A;  4OEN A;  4EQ7 A;  5ITO A;  3OSQ A;  2F6P A;  1OMP A;  4FAJ A;  1MG1 A;  2NUV A;  1UTH A;  4X9T A;  2ZYM A;  5H8N B;  4N13 A;  4F3B A;  3Q25 A;  3T9H B;  5I2N B;  5DYH A;  5B70 A;  3FUZ A;  3TCF A;  1GTK A;  5AA2 D;  5BUU A;  1LFG A;  4YKK A;  3S2V A;  1N0T A;  2Q8J A;  1TFA A;  1MXU A;  3GZG A;  1B1X A;  4TLL B;  4QFL A;  1VFE A;  2B3B A;  5L9O A;  1JEU A;  2UYF A;  5KZT A;  2UXA A;  3IR1 A;  1UTH B;  4F3S A;  3LSX A;  4YKJ A;  4RK9 A;  2DYX A;  4JWY A;  3FVO A;  1Z7M E;  2GFE A;  1OQH A;  4JSD A;  1A99 A;  2VD2 A;  3USD A;  1B1H A;  3PPO A;  5H8H A;  1B3E A;  3C9H A;  1LAX A;  2XD3 A;  1MY3 A;  4G8M A;  1O63 A;  3TEL A;  5L9M A;  2V3U A;  3IO4 A;  2PMS A;  5JEI A;  4ZED A;  3TYH A;  4QFP A;  3W9V A;  1JW4 A;  2O1M A;  4R9F A;  2DP8 A;  3TOD A;  2XD2 A;  2DVC A;  3MVX A;  2O7I A;  2OWT A;  4F18 A;  2UYE A;  1Y9U A;  3R7X A;  1O64 A;  3KJ7 A;  1MM7 A;  1JVX A;  5ICT A;  5H8H B;  4NTL A;  2KLF A;  4KI0 E;  3ZKL A;  3CG1 A;  5ICQ A;  2VD3 A;  2XXT A;  3H7M A;  3JYR A;  3H06 B;  3U92 A;  2F7C A;  2O6A A;  3FD3 A;  1QUK A;  5HPQ A;  3A3C A;  3O29 A;  1MY0 A;  4IB2 A;  3TTK A;  2QJE A;  2Z8D A;  4MLQ A;  3VXB A;  5F1Q A;  4KPT A;  2XXR A;  2QSX A;  3UP9 A;  4O3C A;  1ZJL A;  1P1O A;  3WAF A;  4EDP A;  4U4S A;  1Y3Q A;  3VXC A;  3QAX A;  1FQC A;  5AA1 A;  3C4M A;  1B3L A;  3VLW A;  2THI A;  4GXA A;  4YKI A;  4ZEK A;  1B3H A;  2Q2C A;  2ZXT A;  1FW0 A;  4LQ5 A;  4PFY A;  3CSB A;  4EXL A;  2OCU A;  3C36 A;  1Y4C A;  4Q0C A;  3OSR A;  3PUZ E;  1H44 A;  5I2K A;  1POY 1;  3MZB A;  1N84 A;  3VV5 A;  2HCA A;  3HPI A;  2LAO A;  2GH9 A;  1QW0 A;  4BDQ A;  1MDQ A;  1MXY A;  2FA7 A;  4F22 A;  4JB7 A;  1AMF A;  2RIN A;  3IJO B;  1PBP A;  1TWY A;  5FTI A;  1H45 A;  4R2F A;  3FAS A;  3IOU A;  4ELR A;  3RLF E;  3VVD A;  2R6G E;  1DPP A;  4RXL A;  2OBG A;  2XXV A;  3PUY E;  4R6H A;  5H8S A;  2DWA A;  4OZ9 A;  2ZYO A;  1MQJ A;  3O6G A;  4QRZ A;  5M2V A;  3K1N A;  1JET A;  3PPP A;  1Y1Z A;  3I5O A;  2Z23 A;  1B9J A;  4KHZ E;  5A5X A;  5I2K B;  1NMU A;  2Y7P A;  4F29 A;  5FHN A;  3SER A;  2X26 A;  2F7B A;  2Y7I A;  1FQF A;  4R6Y A;  1SDX A;  1FTL A;  2ZYN A;  3BBR A;  3P7I A;  2GHA A;  1EU8 A;  3A3U A;  1TFD A;  3N26 A;  1B3F A;  4POX A;  4IO3 A;  3L6H A;  1LAH E;  4GL8 A;  4IO7 A;  3PV0 E;  4Z0I A;  3PMV A;  4DZ1 A;  4OTE A;  3K1P A;  1PDA A;  2V3Q A;  3MPK A;  3OO8 A;  3V83 A;  2P1S A;  3C34 A;  4BDO A;  2ONR A;  1SVX B;  3CR9 A;  1IEJ A;  3RT6 B;  1B4H A;  1USY H;  5A5X B;  3H6V A;  4H6D A;  3HHG A;  4LAT A;  4NED A;  2E1S A;  3FZV A;  1SW1 A;  4NF6 A;  3MC2 A;  4FED A;  3C31 A;  4QSC A;  2FYI A;  4LON B;  3PUW E;  2OWS A;  4GF8 A;  1H76 A;  4QFK A;  2XX7 A;  2V84 A;  2O69 A;  1SW4 A;  1B5J A;  3M3K A;  1Q35 A;  2IA4 A;  4ZEF A;  3HCQ A;  1MQG A;  3FVG A;  5EYF A;  2F5X A;  3IOW A;  4K3F A;  4MLV A;  5I84 A;  2RKM A;  2G93 A;  2XX8 A;  3KGC A;  3T96 B;  4WED A;  1EZ9 A;  1D9Y A;  4LVQ A;  4IGT A;  4ECF A;  3EN3 A;  1FTO A;  1OLA A;  3R26 A;  1M5B A;  2D3I A;  1ZBM A;  4NF6 B;  5K2X A;  1MH3 A;  1YCJ A;  1S7Y A;  3K6V A;  4EQB A;  1A8F A;  4X1B A;  5CC2 A;  1PB9 A;  1Y3P A;  4TQU Q;  1JEV A;  1ZKB A;  5CBR A;  5I56 A;  1PC3 A;  3PUX E;  1I6A A;  3VVF A;  1ZIU A;  5ISU A;  2VGQ A;  4LZ7 A;  4JSO A;  1MQH A;  3K2D A;  5I58 A;  1MY4 A;  2XX9 A;  5CI5 A;  4LA9 A;  4OES A;  1B6H A;  2PX1 A;  3CFZ A;  3PPN A;  4XTC Q;  5TP9 A;  3T9U A;  1OIB A;  2I4B A;  1IZ1 A;  2DWH A;  3H03 A;  2D21 A;  1A54 A;  1BKA A;  5LOM A;  1VR5 A;  2QMW A;  4DXC A;  1AIV A;  1B3G A;  3PMW A;  1WOD A;  5I56 B;  4Q30 B;  1IIW A;  2PYY A;  4WXJ A;  1LAG E;  5ELV A;  3ILT B;  4Q8R A;  1SI1 A;  1LBB A;  2QS2 A;  3SEX A;  5I58 B;  1MXZ A;  1DTG A;  3PUV E;  5I57 A;  4QFO A;  2I58 A;  4P0G A;  2ANJ A;  2XHD A;  3SES A;  3U94 A;  1A7L A;  5TP9 B;  1Y3N A;  2B65 A;  4DIG A;  1B32 A;  3OEK A;  4DLD A;  1GV8 A;  3MP8 A;  3G3H A;  1Y20 A;  2H25 A;  3DP6 A;  1VE4 A;  3IAZ A;  1ANF A;  4YU0 A;  1ZU0 A;  1I6B A;  4XKR A;  1KWH A;  3K0V A;  2GRV A;  1H3D A;  4I8C A;  4U23 A;  2D5W A;  3EF7 A;  4ZEC A;  1MRP A;  1P1W A;  5I57 B;  1XS5 A;  2HEU A;  3DP4 A;  3S9N C;  3LC8 A;  1HSE A;  4OER A;  4DCX A;  2Y7R A;  4ZE9 A;  1ELJ A;  1JQF A;  3IO6 A;  3W9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...