2XXYA

Crystal structure of the gluk2 (glur6) d776k lbd dimer in complex with kainate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRKKITIAILQLQEEGKLHMMKEKWW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
total genus 80
structure length 248
sequence length 248
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxyA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxyA02
2NWJA 1A54A 4F31B 3H7MA 1FQDA 3W15C 2PBWA 1RYXA 4NWDA 5KCJB 1IXIA 1TWYA 4M4GA 4ZZAA 1MM7A 1UQWA 4YMBA 3ECRA 3GBAA 3K4UA 3K6WA 1UTBB 3G3HA 3SEXA 1N0TA 3E13X 4BDLA 1RKMA 1ATGA 3VVDA 2O69A 2ZXTA 4EDPA 5EHSA 3K1MA 5DEXA 4F1YA 1B40A 2LAOA 5H8SA 1XVXA 4ZS9A 3TTKA 3IOUA 3IB0A 3H6TA 2V84A 1R6ZA 3IOVA 1F9BA 2PT1A 5EYFA 1IITA 4OWDA 1IXCA 1MDQA 4GOTA 1ANFA 1H44A 4OMBA 4DLDA 2IA4A 4NF5B 1CE2A 1D9YA 2Z8FA 1MY0A 4ZE8A 5L9MA 1SW2A 2ALUA 2BJJX 4HCWA 4YB6A 3PPQA 3TZAA 1B4HA 4F3SA 2F6PA 2HZLA 2ONSA 3G3JA 4LVQA 2OLBA 5TP9B 3OO8A 3DLNA 4N07A 1P1WA 2I0BA 4WKMA 2V3TA 4G68A 5HM4B 2XXPA 1EZ9A 2OWSA 3GBBA 3KG2A 2QS1A 3K1NA 3KGCA 4THIA 2HQ0A 2I0CA 2OJTA 1IEJA 1JVXA 1SW5A 5TPAB 5JK4A 4DCYA 4YB7A 3PUYE 2I4BA 2NOOA 4YAHX 1SW1A 3FJMA 4X48A 1FQEA 3PPRA 3BFUA 2DVZA 4ESXA 5ITPA 4OXVA 2YPNA 4FE8A 1R9QA 4C0RA 3FZVA 1XS5A 1URDA 2DVCA 1DPPA 1AIVA 3TKDA 5AA3A 1XOCA 1B5JA 1BTJA 3CSGA 5EHMA 3U72A 3HPIA 1MY2A 1MH4A 3U1OA 2F35A 1UTHB 4R2FA 3VVEA 5TP9A 2B3FA 5F1QA 1MXUA 4PFWA 1Y4CA 1Y4TA 3SERA 3D4CA 4OQOA 4FAJA 4U21A 3MPLA 2O68A 5TU0A 1URGA 3CVGA 4H6DA 4YMAA 3LC8A 2XD3A 3FATA 3EN3A 1FQFA 3OOAA 3OEMA 2Q88A 2HAVA 3TAJA 2W7YA 3T9HB 5LOMA 2GH9A 4HCYA 1JW1A 2Y7KA 4IB2A 3PD8A 4EUOA 3IL1B 2VGQA 2XXVA 1USYH 2H98A 4ZEFA 2I3VA 5H8NB 1MY1A 4YB5A 3IO4A 4DXBA 4H8JA 1MXZA 3FIRA 4WEPA 2GFEA 4H65A 2F78A 4JXIA 4U23A 1VFDA 2HAUA 1SDXA 4JWYA 4GVOA 1B0LA 2ABHA 4ZE9A 1A99A 3KSJA 4F3BA 3K1PA 3T93B 4IO4A 4KYDA 1NH7A 3VLUA 4YZZA 4RNSA 3IOWA 4IO3A 1GR2A 1O7TA 3OXNA 4GD5A 1UIUA 3N6TA 4NF6B 4DXCA 3C33A 5I59B 1S7YA 1MXVA 3LSWA 1MH3A 1JETA 5KDTA 1WDNA 3TCFA 4BDMA 4DIGA 4U1OA 1ZMGA 2QS3A 3KZGA 4MLVA 4F2OA 3N5LA 3TODA 5KZTA 5FHOA 1FTOA 3HN0A 2XXQA 1MS7A 4QF9A 5I57A 1N84A 3FXUA 4ELQA 5CC2A 5CI5A 3TTRA 4HTGA 2A5TA 3KFMA 2B3BA 1A8FA 1LCTA 1P1OA 2DXYA 4AB5A 2XX9A 2V93A 4RY1A 1QUKA 3BKIB 4ESWA 4JB7A 1H45A 3O28A 3IO6A 3MVXA 1I69A 4BLAA 4H67A 2H5YA 5DYHA 4IGTA 3DP4A 3K00A 5I59A 5I2NA 1VR5A 2ONRA 2D5WA 4EXLA 1QVSA 3QAXA 2P1SA 4ONYA 1SD3A 4ND9A 3ZSFA 3PMVA 4H5FA 4EXKA 1MQIA 3BFTA 3C36A 3EHTA 3S2VA 1MRPA 4PFTA 1ZIUA 1Y3NA 4QFLA 2UYFA 1PDAA 1QKBA 2V25A 3IX1A 3I6VA 1B58A 1JW4A 3JZJA 4X1DA 3RPWA 5AA4B 2GHBA 2R6GE 2Y7PA 2OWTA 1QJMA 3RLFE 1LAHE 1EZOA 4I9DA 4F29A 2Y7IA 1MPCA 2ZMBA 4F18A 2FYIA 4YKIA 1VFEA 3I5OA 4HS7A 4OENA 2XXXA 5DVIA 1QW0A 3VXBA 3TUSA 5I56B 3WAFA 2VD2A 5L9OA 4GIZA 4EF2A 3QSLA 3KJ7A 4Z7EA 4IO2A 1Y9UA 4H5GA 5CM6A 2M8CA 3M3LA 3T66A 1A7LA 1B7UA 1M5BA 3AXFA 2ZYMA 5HBCA 1YTVA 2RKMA 2ZNSA 3C32A 4WEDA 1MY3A 5K2YA 2H99A 3RNNA 4U4XA 3F11A 4ISUA 1M5CA 1XT8A 3LSLA 1BKAA 1FCKA 4R2BA 5CMCA 1I6BA 1MY4A 4RJZA 3T9VA 2CZLA 2I6EA 3GXAA 4G68C 4QHQA 4F22A 4ELOA 1DMBA 3MBPA 4XXUA 1VE4A 4R73A 3B6TA 2XXIA 5AA4A 4OETA 3VFJA 2UVGA 3PMXA 1ZJLA 4QFPA 1SVXB 4R6KA 3FV1A 3PV0E 5DVFA 5AA2B 1H76A 2F36A 1GV8A 4I1DA 4O3CA 3MP6A 4K3FA 3MAMA 5FHNA 2D21A 2ZNTA 4PETA 4ELPA 4TLLB 3IB1A 2Q8JA 1VSOA 3QUFA 1QULA 3QK6A 4NF4B 3OO9A 1N3XA 1A55A 1HSJA 1LFHA 4BDQA 3PPNA 4KR5A 2F7BA 3ILUB 4ZEBA 4ELRA 3FVKA 3MUQA 1Q35A 3TTNA 2WKYA 3I3VA 2V3UA 5I58B 3UIFA 1JQFA 4NF8B 5ISUA 3O9PA 2ZYOA 1PB7A 3MW0A 2X7QA 2HXWA 1A8EA 2HEUA 4MF3A 2DS9A 2O51A 3N26A 3M8UA 3OENA 1DTGA 1CB6A 4GXSB 4AQ4A 3IOTA 5KCJA 2NXOA 3UN6A 2ZYNA 1UTBA 1B1HA 3SKPA 2XX8A 2I48A 1LFGA 3KOSA 1TT1A 1GGGA 1B6HA 3RY3A 5A5XB 2Y84A 1SYHA 1Y1ZA 2E1SA 4NF4A 1JEVA 4MLQA 3IAZA 1NKXA 2REGA 4JDFA 1ZTYA 4YKPA 4F2QA 1B4ZA 5AA1A 1JW5A 2Q9TA 1QUJA 1MXXA 4BDOA 3N94A 4QFNA 1D3KA 1B46A 3PUXE 4Z0IA 2QSXA 1LBCA 4NF5A 5M2VA 2H4IA 1J1NA 4GXAA 4M1VA 5AE4A 4FJPA 1B52A 2ONKE 1Y3QA 1LCFA 4LP2B 4G77A 3PU5A 2PVUA 3FVGA 1O63A 3FGSA 1M5DA 2QL3A 4KFQA 3B6QA 3SEYA 4EQBA 1M5EA 3MZ1A 3RTFB 2DWIA 1TXFA 4TOZA 3LUYA 1R1NA 1FW0A 1XVYA 2QMWA 4WXJA 4RK9A 2PMSA 3K0VA 4LQ5A 3E4RA 1QKAA 3H4ZA 5TPAA 2OZZA 3UA8A 3H06B 3SETA 4N13A 4BDRA 5I2KB 3KN7A 3H6VA 4KD5A 1B1XA 4RXLA 3FXQA 4YKKA 3PPPA 3TQWA 2RC7A 3C35A 3CR9A 1I6QA 1WVJA 1POTA 3GZGA 1O64A 3RN8A 3PD9A 4I8CA 3QUJA 4HW8A 3MQ9A 3R26A 4OERA 4XTCQ 4KCCA 1UTHA 3TCHA 5IKBA 4DDDA 3R6UA 1LAFE 1MQDA 3SEUA 2DOJA 1OIBA 4Q0CA 4KPTA 2DE2A 4C1TA 2XHDA 3M3FA 1R9LA 4RA1A 2DWAA 4R6HA 2QPQA 3JYRA 1A40A 3MP8A 4OEUA 2Z8EA 3MWBA 4LZ5A 3MZBA 3M3KA 4XKNA 3GLBA 4MH5A 3OEKA 2THIA 4GF8A 1NMUA 2QMXA 1FQCA 4OFLA 2REJA 4UA8A 3TTLA 4Q8RA 2DXRA 4IGRA 4P0GA 5H8NA 5CBRA 3N6UA 1HSEA 3V83A 2FNCA 4E0WA 4U22A 3G7WA 5L8DA 5FTIA 3K6VA 5H8HB 1MM6A 2DP8A 4PFYA 1FTJA 3SDFA 4DXUA 3RT6B 4I62A 4XIGQ 3MC2A 1EH3A 2O7UA 2Y7RA 2O6AA 1Z7NE 1LB8A 1B5IA 4KYEA 4PQJA 3ILTB 4R9FA 4R75A 3G3FA 4MFIA 4ZECA 4GLIA 4OEVA 4NF6A 4F1UA 4G4PA 1Y20A 3A3UA 1UIVA 1B7ZA 4DCXA 4F3GA 3Q26A 4QFKA 3QIMA 2HZKA 4H8IA 3DM0A 1Z7ME 2XXTA 3TEPA 2Z8DA 1P1QA 3PMWA 1OMPA 2IEEA 5ELVA 3A09A 4U1ZA 1IQ7A 5J1DA 1PB9A 4L17A 4OESA 4DZ1A 3CG1A 3O2AA 3ZKKA 3CG3A 2DWHA 1NL5A 4IO7A 1ZU0A 1GVCA 3S9EA 2UVJA 4POWA 2DE4A 3QYTA 4JSDA 2V3QA 3MZ9A 1OLAA 2KLFA 4U2RA 1MQGA 3Q29A 2DYXA 4OFOA 3CSBA 1N04A 2DWJA 2QS4A 3VLVA 2H25A 3E3KA 1JNFA 3FXRA 3FV2A 3PPOA 3RT8A 2D3IA 4QSEA 1NFTA 4F19A 2O1LA 3IB2A 4JWOA 5I84A 4KQPA 3FVOA 3R7XA 3D4GA 3THIA 3VDFA 4NEDA 4R9GA 1EU8A 5K2XA 3MVYA 4RYAA 3G3IA 2Z23A 5L9SA 2YLNA 3H03A 5DEXB 4LQ2A 1AH5A 3ZS6A 4IY5A 5JTYB 3VV5A 1PC3A 2RF1A 3T96B 5CMBA 4RPNA 1MG1A 2ANJA 3G3GA 3PGFA 1QUIA 3IK6B 4H1XA 4OYVA 2CMOA 3CFZA 4NTLA 3MVZA 4KYSA 3MVWA 2Y7WA 4O3AA 1LAXA 1POY1 4G8NA 2I58A 1N7XA 3HO7A 3EPEA 4GQOA 2H9BA 5IAIA 4IO5A 1SYIA 3HCQA 3MP1A 3SEVA 4XKPA 1B32A 1H43A 4LONB 1HSLA 2UXAA 5I56A 2E0SA 4MBPA 2O7IA 2PYYA 2G29A 3KJTA 2DQVA 3CFLA 4BDNA 1XHYA 4G68B 4XKRA 4AB6A 5DVJA 4R74A 4FEDA 4PE5B 2A5SA 1NNKA 3TDJA 4LATA 5AA2D 3HHFA 2I3WA 1PBQA 4R72A 1FQBA 3U93A 5JTYA 2RCAA 4G8HA 1PBPA 3EF7A 1NNPA 1ELJA 1S9TA 3U8QA 1DTZA 1MXYA 2F97A 4YKJA 1FQAA 2HCAA 3FUZA 1AOVA 3VVFA 1B5HA 1B3GA 2AL4A 1LGBC 4G8MA 1B7HA 2PX1A 4YU0A 5DT6A 1TFDA 4G2ZA 3IR1A 3SESA 1OQHA 2X26A 3OMBA 1B9JA 4GWOA 2OK2A 3Q27A 4LUBA 1MDP1 3RQTA 2RINA 3K6UA 2ZNUA 3O6GA 3KBRA 5AA2A 4FIMA 3O29A 4GRKA 5BWJA 1LFIA 3TFLA 4FECA 3PUVE 3LR1A 3DELB 4IO6A 2XXYA 1IXGA 1JEUA 3K02A 3PUZE 4QRZA 2QJEA 3B7DA 3EHUA 1T0KA 4KI0E 4F39A 4O3BA 2F34A 1Y3PA 1OQGA 3OO6A 2HFBA 1SI1A 2F5XA 4TLMB 4KHZE 3RUMA 2FA7A 3KEIA 4NE4A 3ZKLA 4C1UA 1H3DA 4OZ9A 4Q30B 5I58A 3IJXB 2Q89A 1FTMA 3C9HA 3C4MA 3EHSA 1DOTA 3B6WA 4NF8A 3K2DA 5H8QB 1NNTA 4ZDMA 4EF1A 4R6YA 1BP5A 1PEBA 2F7AA 1LAGE 2XXWA 2G93A 4FATA 1PB8A 3P7IA 3FASA 1ZKBA 2DSFA 3IORA 1IUDA 3O6HA 2GHAA 3W9VA 1RYOA 2UYEA 2XX7A 4XKQA 3LSFB 5JEIA 5CBSA 1DSNA 1P1UA 3EQ1A 2F6GA 3C31A 3K6XA 3E9XA 1B3FA 5A5XA 1US4A 1YAEA 3CI8A 1B51A 2XXHA 1P99A 3TPAA 3FD3A 4Q5TA 3S9MC 2OCUA 1NNFA 4QSCA 3KOTA 5KDTB 3V5AA 2AIXA 1DPEA 1YCJA 3LSXA 3O97A 5ICTA 3H6WA 3U92A 3TCGA 3KN3A 4EQ9A 3VE1B 3TMGA 4OTEA 5CRYA 1SBPA 3VLWA 3RTWB 4P0IA 3K01A 1II5A 4OHNA 2F7CA 3OSRA 3TTMA 5H8QA 1LB9A 5I57B 2P2AA 2VOZA 3T9XB 1B3HA 3S9LC 2YJPA 2A5TB 1FTLA 4KCDA 4EQ7A 1YPNA 4NWCA 3CFXA 2QRYA 1D4NA 3O6IA 2Q2AA 1US5A 2NUVA 3FVNA 3JV9A 1USYE 1GTKA 3L6GA 4ZEIA 5BUUA 1AMFA 3OD7A 1OVTA 1BIYA 4PP0A 2XXRA 4JWXA 1ZLQA 4GL8A 5B7DA 1IIWA 3W9WA 2I49A 5I2NB 1ZBMA 4DE8A 4TQUQ 5ITOA 1MPDA 4JBZA 4RPOA 3H3GA 2AL5A 1D9VA 3ODBA 3U94A 3DP6A 3G3KA 3VXCA 5I2KA 3UP9A 1S50A 1LLSA 1TFAA 2RCBA 3CIJA 2R71A 3WAEA 4E0XA 1N76A 3DP8A 2Q2CA 1MQJA 2AYSA 1IZ1A 2P0SA 2X7PA 2OBGA 3C34A 3MJNA 5H8FB 3V89B 2Z22A 4LZ8A 4P11A 4F1VA 3LBSA 2RC9A 3SEWA 1L5TA 3USDA 4X9TA 3ONMA 1SQYA 2R9JA 3S4UA 4YICA 4FORA 2ZYKA 1MQHA 4QFOA 1JVYA 3L6HA 1SW4A 4N6PA 3UK4A 3TQLA 3TELA 1FTKA 1AL3A 2XXUA 2I4CA 1IXHA 4LA9A 2O1MA 1XC1A 1WODA 1Q1KA 4NMYA 3O66A 1MPBA 1B3LA 1N7WA 3HSTA 1NH8A 4POXA 2O84X 1SI0A 1LBBA 4UACA 5B70A 2RC8A 1M5FA 2B65A 3MPKA 5H8HA 2PT2A 1B2HA 4OVJA 4RK2A 5F7VA 3Q28A 5H8FA 1MXWA 3KSXA 4QSDA 3A3CA 3OO7A 1LSTA 1KWHA 4LZ7A 3H6UA 3OSQA 4F3PA 2GRVA 4U4SA 4GFRA 3T22A 2F8DA 3BBRA 1N3WA 5FTHA 1OLCA 1EZPA 3Q25A 5CMKA 4PFUA 1B0HA 4OFJA 2VHAA 3UORA 1BLFA 2XD2A 4GL0A 2ESNA 1P1NA 1I6AA 3S9NC 2QS2A 3OELA 2UVHA 1Y1MA 3CRBA 3HHGA 3IJOB 3T9UA 1B05A 1B3EA 3FJGA 5CMMA 3UGWA 4H0WA 3QXMA 2UVIA 3PUWE 4ZEDA 4ECFA 5FHMA 5ICQA 3FJ7A 3HV1A 3V8XB 3RGYA 2DE3A 5HPQA 1URSA 3TYHA 2VP1A 4IY6A 1OVBA 3KN8A 4X1BA 2NVUB 4ZEKA 2VD3A 5DTBA 4FEBA 4ZZEA 4JSOA
chains in the Genus database with same CATH superfamily
4LN5A 2NWJA 1A54A 4F31B 5EQ9A 3H7MA 1FQDA 3B50A 2PBWA 2Y5LA 5ESYA 3W15C 1RYXA 4NWDA 5KCJB 3MSTA 1IXIA 1TWYA 4M4GA 4ZZAA 1MM7A 1UQWA 4N8YA 4YMBA 3ECRA 3GBAA 3K4UA 3K6WA 1UTBB 1FPBA 3G3HA 3SEXA 3RPLB 1N0TA 3E13X 5J16A 4BDLA 1RKMA 4P1EA 1ATGA 4PAKA 3VVDA 1LBVA 4PGPA 2O69A 4O7IA 2P3VA 2ZXTA 4EDPA 5EHSA 3K1MA 5DEXA 4N15A 4F1YA 5I7IA 1B40A 2LAOA 5H8SA 2PFZA 1XVXA 4ZS9A 3TTKA 3IOUA 3IB0A 3H6TA 2V84A 1R6ZA 4PFBA 3IOVA 1F9BA 2PT1A 5EYFA 1IITA 3E78A 4OWDA 1IXCA 1MDQA 4GOTA 1ANFA 1H44A 4OMBA 4DLDA 2OX3A 2IA4A 4NF5B 1CE2A 1D9YA 2Z8FA 1MY0A 4ZE8A 5L9MA 1SW2A 2ALUA 2HXRA 2BJJX 4HCWA 4YB6A 3PPQA 3TZAA 1B4HA 1QGXA 4F3SA 2F6PA 2HZLA 4N81A 2ZZWA 2ONSA 3G3JA 4LVQA 1FBFA 2OLBA 5TP9B 3OO8A 3DLNA 2FHYA 4N07A 1FPGA 1P1WA 2I0BA 4WKMA 1FSAA 4N6DA 2V3TA 4G68A 5HM4B 1FPIA 2XXPA 1EZ9A 2OWSA 3GBBA 3KG2A 2QS1A 4NGUA 3K1NA 3KGCA 4THIA 2HQ0A 2I0CA 2OJTA 1IEJA 1AWBA 1JVXA 1SW5A 5TPAB 5JK4A 4DCYA 4YB7A 3PUYE 2I4BA 2NOOA 4YAHX 1SW1A 2BJIA 3FJMA 2XWOA 4X48A 1FQEA 3PPRA 1NUZA 3BFUA 2DVZA 1FBDA 4ESXA 5ITPA 4OXVA 2YPNA 4FE8A 4GX6A 1R9QA 1NV3A 4C0RA 3FZVA 1XS5A 2P3NA 1URDA 2DVCA 1DPPA 1AIVA 3TKDA 5AA3A 1XOCA 1B5JA 1BTJA 3CSGA 4MNPA 5EHMA 3U72A 3HPIA 1MY2A 1MH4A 2FIEA 3U1OA 2F35A 1UTHB 4R2FA 3VVEA 5TP9A 2B3FA 5F1QA 1MXUA 4PFWA 1Y4CA 1Y4TA 3SERA 3D4CA 4OQOA 4FAJA 4U21A 1NV5A 3MPLA 2O68A 5TU0A 1URGA 3CVGA 4H6DA 4YMAA 3LC8A 2XD3A 3FATA 3EN3A 1FQFA 3OOAA 3OEMA 2Q88A 2HAVA 4PC9A 3TAJA 2W7YA 3T9HB 5LOMA 5ET8A 2GH9A 4HCYA 1JW1A 2Y7KA 4IB2A 3PD8A 4EUOA 3IL1B 2XWIA 2VGQA 1NUYA 2XXVA 1USYH 2H98A 4ZEFA 2I3VA 5H8NB 2XWVA 1MY1A 4YB5A 3QMFA 3IO4A 4DXBA 4H8JA 1MXZA 3FIRA 4WEPA 2GFEA 4H65A 2F78A 4JXIA 4U23A 3PTYA 1VFDA 2HAUA 4MNCA 1SDXA 4JWYA 4GVOA 1B0LA 2ABHA 4ZE9A 1A99A 3KSJA 4F3BA 3K1PA 3T93B 1NV7A 4IO4A 5DW8A 4UABA 4KYDA 1NH7A 3VLUA 2Q74A 4YZZA 4RNSA 3IOWA 4IO3A 1GR2A 1O7TA 3OXNA 4GD5A 1UIUA 3N6TA 4X8RA 1LBWA 4NF6B 1FBGA 1NUWA 4DXCA 3C33A 5I59B 5F24A 1S7YA 1MXVA 3LSWA 1MH3A 1JETA 5KDTA 1WDNA 3TCFA 4BDMA 4DIGA 4PDDA 4U1OA 1ZMGA 2QS3A 3KZGA 4MLVA 4F2OA 3N5LA 3TODA 5KZTA 5FHOA 1FTOA 5I5PA 4PGNA 4PFIA 3HN0A 2XXQA 1MS7A 4QF9A 4PFRA 5I57A 1N84A 3FXUA 4ELQA 5CC2A 5CI5A 3TTRA 2V4CA 4HTGA 2A5TA 3KFMA 2B3BA 1A8FA 1LCTA 1P1OA 2DXYA 4AB5A 2XX9A 2V93A 4RY1A 1QUKA 3BKIB 4ESWA 4JB7A 1H45A 1KA1A 3IO6A 3O28A 3MVXA 1I69A 4BLAA 4X04A 4H67A 2H5YA 5DYHA 4IGTA 3DP4A 3K00A 5I59A 5I2NA 1VR5A 2ONRA 3SZPA 4PF8A 2D5WA 4EXLA 1QVSA 3QAXA 2P1SA 4ONYA 4MMPA 1IMBA 4O7MA 1SD3A 4ND9A 3ZSFA 3PMVA 4H5FA 4EXKA 3T0JA 1MQIA 3BFTA 3C36A 3EHTA 2Y5KA 3S2VA 1MRPA 4PFTA 1ZIUA 4MIJA 1Y3NA 4QFLA 2UYFA 1PDAA 1QKBA 4GBVA 2V25A 3IX1A 5LTCA 3I6VA 1D9QA 3BIGA 1B58A 1JW4A 1RDXA 3JZJA 4X1DA 3RPWA 5AA4B 2GHBA 2R6GE 2Y7PA 2OWTA 4PAFA 1QJMA 3RLFE 1LAHE 1EZOA 5IZ1A 4I9DA 1SPIA 4F29A 2Y7IA 1MPCA 2ZMBA 4F18A 2FYIA 4MNIA 4YKIA 1VFEA 3I5OA 4HS7A 4PCDA 4OENA 1G0HA 4P3LA 2XXXA 5DVIA 1QW0A 1BK4A 1RDZA 3VXBA 3TUSA 5I56B 1NV1A 3WAFA 2VD2A 2ZZXA 4MX6A 4PTKA 5L9OA 4GIZA 4EF2A 1FPLA 3QSLA 3KJ7A 4Z7EA 4IO2A 1Y9UA 4H5GA 5CM6A 2M8CA 3M3LA 3T66A 1A7LA 1B7UA 1M5BA 5EYGA 3AXFA 3BIHA 4NF0A 2ZYMA 5HBCA 1YTVA 4O94A 2RKMA 4PDHA 2ZNSA 3C32A 4WEDA 1MY3A 5K2YA 2H99A 3RNNA 4U4XA 3F11A 4ISUA 1M5CA 5FBPA 1XT8A 3LSLA 1BKAA 1FCKA 4R2BA 5CMCA 1I6BA 1MY4A 4RJZA 3T9VA 2CZLA 2I6EA 3GXAA 4G68C 4QHQA 4F22A 4ELOA 1DMBA 3MBPA 4GWWA 4XXUA 1VE4A 4R73A 3B6TA 2XXIA 5AA4A 4OETA 3VFJA 2UVGA 3PMXA 1ZJLA 4QFPA 1SVXB 4R6KA 3FV1A 3PV0E 5DVFA 5AA2B 1H76A 2F36A 1NV4A 1GV8A 2QFLA 4I1DA 4O3CA 3MP6A 4K3FA 3MAMA 5FHNA 2D21A 4PF6A 2ZNTA 4PETA 4ELPA 4TLLB 2VPNA 3IB1A 2Q8JA 2R8TA 1VSOA 3QUFA 1QULA 3QK6A 4NF4B 3OO9A 1N3XA 1A55A 1HSJA 1LFHA 4BDQA 3PPNA 5IZ3A 4KR5A 2F7BA 4O8MA 3ILUB 2QVRA 4OA4A 4ZEBA 1FBHA 4ELRA 3FVKA 3MUQA 1Q35A 1DK4A 3TTNA 2HHMA 2WKYA 3I3VA 2V3UA 4N8GA 5I58B 1IMAA 1KA0A 3UIFA 4QXDA 1YXIA 1JQFA 4NF8B 5ISUA 3O9PA 2ZYOA 1PB7A 3MW0A 4AS4A 2X7QA 2HXWA 1A8EA 2HEUA 4MF3A 2DS9A 2QVVA 2O51A 1G0IA 3N26A 3M8UA 3OENA 1DTGA 1CB6A 4GXSB 4AQ4A 3IOTA 5KCJA 2NXOA 3UN6A 2ZYNA 1UTBA 1B1HA 3RPLA 3SKPA 2XX8A 2I48A 1LFGA 3KOSA 1TT1A 1GGGA 2CEXA 1B6HA 4GX4A 3RY3A 5A5XB 2Y84A 1SYHA 1Y1ZA 2E1SA 4NF4A 1JEVA 4MLQA 3IAZA 4N17A 1NKXA 2REGA 4JDFA 1ZTYA 4YKPA 4F2QA 1B4ZA 5AA1A 1JW5A 2Q9TA 1QUJA 1MXXA 4BDOA 3N94A 4QFNA 1D3KA 1B46A 3PUXE 4Z0IA 2QSXA 4P9KA 1LBCA 1Q9DA 2CZHA 4NF5A 2VPOA 5M2VA 2H4IA 5T3JA 1J1NA 3A29A 4GXAA 2FIXA 4M1VA 5AE4A 2JJKA 1B52A 4FJPA 2ONKE 1FJ9A 1Y3QA 1LCFA 4LP2B 4G77A 3PU5A 3FBPA 2PVUA 2WYPA 3FVGA 1O63A 3FGSA 1K9YA 1JP4A 1M5DA 3FXBA 2QL3A 4KFQA 3B6QA 3SEYA 1M5EA 3MZ1A 4EQBA 2DWIA 1TXFA 3RTFB 4TOZA 3LUYA 1R1NA 4HE1A 1FW0A 1XVYA 2FBPA 2QMWA 4WXJA 4RK9A 2PMSA 5ET5A 2XWKA 3K0VA 4LQ5A 3E4RA 1QKAA 3H4ZA 5TPAA 2OZZA 3UA8A 3H06B 3SETA 5ET7A 4P47A 4N13A 4BDRA 4N91A 5IM2A 1EYIA 5I2KB 3KN7A 3H6VA 4KD5A 1B1XA 4RXLA 3FXQA 2F3DA 4YKKA 3PPPA 3TQWA 2RC7A 3C35A 3CR9A 1I6QA 1WVJA 1POTA 3GZGA 4JVIA 1O64A 4PBQA 3RN8A 1FPJA 3PD9A 4I8CA 3QUJA 1KZ8A 4HW8A 3MQ9A 3R26A 4OERA 4H46A 4XTCQ 4KCCA 4GWYA 1UTHA 3TCHA 5IKBA 4DDDA 1FPFA 3R6UA 1LAFE 1MQDA 3SEUA 2DOJA 1OIBA 4Q0CA 4KPTA 2DE2A 4C1TA 2OWZA 2XHDA 3M3FA 1R9LA 4RA1A 2DWAA 3E79A 4R6HA 2QPQA 3JYRA 1A40A 3MP8A 4OEUA 2Z8EA 3MWBA 4LZ5A 3MZBA 4XKNA 3GLBA 1XI6A 4MH5A 2PCRA 2WYKA 3OEKA 2THIA 1NI9A 4GF8A 1NMUA 2QMXA 1FQCA 4OFLA 2KQZA 4HE0A 2REJA 4UA8A 3TTLA 4Q8RA 2DXRA 4IGRA 4P0GA 5H8NA 5CBRA 3N6UA 3D1RA 1HSEA 3V83A 2FNCA 4E0WA 4U22A 3G7WA 5L8DA 5FTIA 5EQ8A 3K6VA 5H8HB 1MM6A 2DP8A 4PFYA 1FTJA 3SDFA 4DXUA 3RT6B 4I62A 4XIGQ 3MC2A 1EH3A 2O7UA 2Y7RA 2O6AA 1Z7NE 1LB8A 1B5IA 2KR0A 4KYEA 4PQJA 3ILTB 2F3BA 4R9FA 1FPKA 4R75A 3G3FA 4MFIA 4ZECA 4GLIA 4OEVA 4NF6A 4F1UA 4G4PA 1Y20A 1FJ6A 3A3UA 1INPA 1UIVA 1B7ZA 4DCXA 5ET6A 4F3GA 3Q26A 4QFKA 3QIMA 2VT5A 2HZKA 4H8IA 3DM0A 1Z7ME 2XXTA 3TEPA 2Z8DA 1P1QA 1IMEA 3PMWA 1OMPA 2IEEA 5ELVA 1FRPA 3A09A 4U1ZA 1IQ7A 1IMFA 5J1DA 1PB9A 4L17A 4XF5A 4OESA 4DZ1A 3CG1A 3O2AA 2GQ1A 3ZKKA 3CG3A 2DWHA 3KC0A 1NL5A 4IO7A 1ZU0A 1GVCA 3S9EA 2UVJA 4POWA 2DE4A 3QYTA 4JSDA 4NHBA 2V3QA 3MZ9A 1OLAA 2KLFA 4U2RA 1MQGA 3IFAA 3Q29A 2DYXA 4MCOA 4OFOA 3CSBA 1N04A 2DWJA 2QS4A 3VLVA 2H25A 3E3KA 1JNFA 3FXRA 3FV2A 3PPOA 3RT8A 1FBCA 2D3IA 4QSEA 1NFTA 4F19A 2O1LA 3IB2A 4JWOA 5I84A 4KQPA 3FVOA 4I3EA 3R7XA 3D4GA 3THIA 3VDFA 4NEDA 4R9GA 1EU8A 4OVTA 5K2XA 3MVYA 4RYAA 3G3IA 1FBEA 1K9ZA 2Z23A 5L9SA 2YLNA 3H03A 4DI4B 3NOHA 5DEXB 4LQ2A 1AH5A 3ZS6A 4IY5A 5JTYB 4QBAA 3VV5A 1PC3A 2RF1A 3T96B 5CMBA 5LDZA 2CZKA 4RPNA 1MG1A 2ANJA 3G3GA 3PGFA 4MAGA 1QUIA 3IK6B 4H1XA 4OYVA 4H45A 2CMOA 3CFZA 4NTLA 3MVZA 4KYSA 5EYHA 3MVWA 2Y7WA 4O3AA 1LAXA 1POY1 4GWZA 4G8NA 2I58A 4HXVA 2WBBA 1N7XA 3HO7A 3GYYA 3EPEA 4GQOA 2H9BA 5IAIA 4IO5A 3ROJA 1SYIA 3HCQA 3MP1A 3SEVA 4XKPA 2XA5A 1B32A 1H43A 4LONB 1HSLA 2UXAA 1NV2A 5I56A 2E0SA 4MBPA 2O7IA 2PYYA 1FBPA 2G29A 1DCUA 3KJTA 4GBWA 2DQVA 3CFLA 4BDNA 1XHYA 4G68B 4XKRA 4OVSA 4AB6A 5DVJA 4R74A 4FEDA 4PE5B 4P56A 2A5SA 1NNKA 3TDJA 4LATA 5AA2D 3HHFA 1LEVA 2I3WA 1PBQA 4R72A 1FQBA 3U93A 5JTYA 2RCAA 4G8HA 1PBPA 3EF7A 4GWUA 1NNPA 1ELJA 1S9TA 3U8QA 1DTZA 1MXYA 2F97A 4YKJA 1NV0A 1FQAA 2HCAA 3FUZA 1AOVA 3VVFA 1B5HA 1B3GA 2AL4A 1LGBC 4G8MA 1B7HA 2PX1A 3KC1A 4YU0A 5DT6A 1TFDA 4G2ZA 2PFYA 3IR1A 3SESA 1OQHA 2X26A 3OMBA 1B9JA 4GWOA 2OK2A 3Q27A 4HE2A 4LUBA 1MDP1 3RQTA 2RINA 3K6UA 2ZNUA 3O6GA 3KBRA 4NX1A 5AA2A 4FIMA 2FVZA 3O29A 4GRKA 5BWJA 1LFIA 3TFLA 3ISPA 4FECA 3PUVE 3LR1A 3DELB 4IO6A 2XXYA 1IXGA 1JEUA 3K02A 2WEFA 3PUZE 4QRZA 2QJEA 4ZZEA 3B7DA 3EHUA 1T0KA 4KI0E 4F39A 4O3BA 2F34A 1Y3PA 1OQGA 3OO6A 2HFBA 1SI1A 4OVQA 2F5XA 4TLMB 4KHZE 3RUMA 4N4UA 2FA7A 3KEIA 4NE4A 3ZKLA 4C1UA 1H3DA 4OZ9A 4IR8A 4Q30B 5I58A 3IJXB 2Q89A 1FTMA 3C9HA 3C4MA 3EHSA 1DOTA 3B6WA 4NF8A 3K2DA 5H8QB 1NNTA 4ZDMA 4EF1A 4R6YA 4OANA 1BP5A 1PEBA 5IZZA 4XFEA 2F7AA 1LAGE 2XXWA 1LBYA 2G93A 4FATA 1PB8A 3P7IA 3FASA 1ZKBA 2DSFA 3IORA 4PE3A 1IUDA 1FPDA 3O6HA 2GHAA 3W9VA 1RYOA 4JVCA 2UYEA 5EQAA 4XEQA 4FBPA 2XX7A 4XKQA 3MYUA 3LSFB 5JEIA 5CBSA 1DSNA 1P1UA 3EQ1A 4JVDA 1DBZA 2F6GA 3C31A 3K6XA 3E9XA 1B3FA 4P8BA 5A5XA 1YYZA 1US4A 1YAEA 3CI8A 1B51A 2XXHA 1FPEA 1P99A 3TPAA 3FD3A 4Q5TA 3S9MC 2OCUA 1NNFA 4QSCA 3KOTA 5KDTB 3V5AA 2AIXA 2CZIA 1DPEA 3T1BA 1YCJA 3LSXA 3O97A 5ICTA 3H6WA 3U92A 3TCGA 3KN3A 4EQ9A 3VE1B 3TMGA 4OTEA 3IFCA 5CRYA 1SBPA 3VLWA 3RTWB 4P0IA 3K01A 1II5A 4OHNA 2F7CA 3OSRA 3TTMA 1LBZA 5H8QA 3LUZA 4DI3D 1LB9A 5I57B 2P2AA 2VOZA 3T9XB 1B3HA 3S9LC 1RDYA 2YJPA 2A5TB 1FTLA 2HPGA 4KCDA 4OVRA 4EQ7A 1YPNA 4NWCA 3CFXA 1LBXA 2QRYA 1D4NA 3O6IA 2Q2AA 1US5A 2NUVA 3FVNA 3JV9A 1USYE 1GTKA 3L6GA 4ZEIA 1NUXA 5BUUA 3B8BA 1AMFA 3OD7A 4KXPA 1OVTA 2WBDA 1BIYA 4PP0A 4NN3A 2XXRA 4JWXA 1ZLQA 4GL8A 5B7DA 1IIWA 3W9WA 2I49A 5I2NB 1ZBMA 4DE8A 4TQUQ 5ITOA 5I3SA 4GWSA 1MPDA 4JBZA 4RPOA 3H3GA 2AL5A 1D9VA 3ODBA 3U94A 3DP6A 3G3KA 3VXCA 5I2KA 3UP9A 1S50A 1EYKA 1LLSA 1TFAA 2RCBA 3CIJA 2R71A 3WAEA 4E0XA 1N76A 3DP8A 2Q2CA 1MQJA 2AYSA 1IZ1A 2P0SA 2X7PA 2OBGA 3C34A 2XXKA 3MJNA 4NG7A 5H8FB 3V89B 2Z22A 4LZ8A 4GX3A 4P11A 4F1VA 3LBSA 4I3YA 3RYDA 3U65A 2RC9A 3SEWA 1L5TA 4NQ8A 3USDA 2CEYA 2B4LA 4OVPA 4X9TA 3ONMA 1SQYA 2L5VA 2R9JA 3S4UA 4YICA 1YZ0A 4FORA 2ZYKA 4MJOA 1MQHA 4QFOA 1JVYA 3L6HA 1SW4A 4N6PA 3LV0A 3UK4A 3TQLA 3TELA 1FTKA 1AL3A 2XXUA 2I4CA 1IXHA 4LA9A 2O1MA 1XC1A 1WODA 1Q1KA 2ZZVA 4NMYA 2Q8MA 3O66A 1MPBA 1B3LA 1N7WA 4MEVA 3HSTA 1NH8A 4POXA 2O84X 5A5LA 1SI0A 1LBBA 3CHGA 4UACA 5B70A 2RC8A 1M5FA 2B65A 3MPKA 5H8HA 2PT2A 1B2HA 4OVJA 4RK2A 5F7VA 3Q28A 5H8FA 1MXWA 3KSXA 4QSDA 3HFUA 3A3CA 3OO7A 4G61A 1LSTA 1KWHA 4LZ7A 3H6UA 3OSQA 4PAIA 2DDKA 1EYJA 4F3PA 4GWXA 4PBHA 2B4MA 3KBZA 2GRVA 4U4SA 4GFRA 3T22A 1FTAA 2F8DA 2WX9A 3BBRA 1N3WA 1NV6A 5FTHA 1CNQA 1OLCA 4MHFA 1EZPA 3Q25A 5CMKA 4PFUA 1B0HA 4OFJA 2VHAA 3UORA 1BLFA 2XD2A 4GL0A 2ESNA 1IMCA 1I6AA 1P1NA 3S9NC 2QS2A 3OELA 4I40A 4N6KA 2MKZA 1IMDA 2UVHA 1Y1MA 3CRBA 3HHGA 5EQ7A 3IJOB 3T9UA 1B05A 1B3EA 3FJGA 5CMMA 3UGWA 4H0WA 3QXMA 2UVIA 3PUWE 4ZEDA 4P1LA 4ECFA 4NAPA 5FHMA 5ICQA 3FJ7A 5IGAA 3HV1A 5IZ3B 4AS5A 3EKIA 2QVUA 3V8XB 3RGYA 2DE3A 5HPQA 1URSA 3TYHA 2VP1A 4IY6A 1OVBA 3KN8A 4X1BA 2NVUB 4ZEKA 2VD3A 5DTBA 4FEBA 1VDWA 3M3KA 4JSOA
chains in the Genus database with same CATH topology
2NWJA 1A54A 4F31B 3H7MA 1FQDA 3W15C 2PBWA 1RYXA 4NWDA 5KCJB 1IXIA 1TWYA 4M4GA 4ZZAA 1MM7A 1UQWA 4YMBA 3ECRA 3GBAA 3K4UA 3K6WA 1UTBB 3G3HA 3SEXA 1N0TA 3E13X 4BDLA 1RKMA 1ATGA 3VVDA 2O69A 2ZXTA 4EDPA 5EHSA 3K1MA 5DEXA 4F1YA 1B40A 2LAOA 5H8SA 1XVXA 4ZS9A 3TTKA 3IOUA 3IB0A 3H6TA 2V84A 1R6ZA 3IOVA 1F9BA 2PT1A 5EYFA 1IITA 4OWDA 1IXCA 1MDQA 4GOTA 1ANFA 1H44A 4OMBA 4DLDA 2IA4A 4NF5B 1CE2A 1D9YA 2Z8FA 1MY0A 4ZE8A 5L9MA 1SW2A 2ALUA 2BJJX 4HCWA 4YB6A 3PPQA 3TZAA 1B4HA 4F3SA 2F6PA 2HZLA 2ONSA 3G3JA 4LVQA 2OLBA 5TP9B 3OO8A 3DLNA 4N07A 1P1WA 2I0BA 4WKMA 2V3TA 4G68A 5HM4B 2XXPA 1EZ9A 2OWSA 3GBBA 3KG2A 2QS1A 3K1NA 3KGCA 4THIA 2HQ0A 2I0CA 2OJTA 1IEJA 1JVXA 1SW5A 5TPAB 5JK4A 4DCYA 4YB7A 3PUYE 2I4BA 2NOOA 4YAHX 1SW1A 3FJMA 4X48A 1FQEA 3PPRA 3BFUA 2DVZA 4ESXA 5ITPA 4OXVA 2YPNA 4FE8A 1R9QA 4C0RA 3FZVA 1XS5A 1URDA 2DVCA 1DPPA 1AIVA 3TKDA 5AA3A 1XOCA 1B5JA 1BTJA 3CSGA 5EHMA 3U72A 3HPIA 1MY2A 1MH4A 3U1OA 2F35A 1UTHB 4R2FA 3VVEA 5TP9A 2B3FA 5F1QA 1MXUA 4PFWA 1Y4CA 1Y4TA 3SERA 3D4CA 4OQOA 4FAJA 4U21A 3MPLA 2O68A 5TU0A 1URGA 3CVGA 4H6DA 4YMAA 3LC8A 2XD3A 3FATA 3EN3A 1FQFA 3OOAA 3OEMA 2Q88A 2HAVA 3TAJA 2W7YA 3T9HB 5LOMA 2GH9A 4HCYA 1JW1A 2Y7KA 4IB2A 3PD8A 4EUOA 3IL1B 2VGQA 2XXVA 1USYH 2H98A 4ZEFA 2I3VA 5H8NB 1MY1A 4YB5A 3IO4A 4DXBA 4H8JA 1MXZA 3FIRA 4WEPA 2GFEA 4H65A 2F78A 4JXIA 4U23A 1VFDA 2HAUA 1SDXA 4JWYA 4GVOA 1B0LA 2ABHA 4ZE9A 1A99A 3KSJA 4F3BA 3K1PA 3T93B 4IO4A 4KYDA 1NH7A 3VLUA 4YZZA 4RNSA 3IOWA 4IO3A 1GR2A 1O7TA 3OXNA 4GD5A 1UIUA 3N6TA 4NF6B 4DXCA 3C33A 5I59B 1S7YA 1MXVA 3LSWA 1MH3A 1JETA 5KDTA 1WDNA 3TCFA 4BDMA 4DIGA 4U1OA 1ZMGA 2QS3A 3KZGA 4MLVA 4F2OA 3N5LA 3TODA 5KZTA 5FHOA 1FTOA 3HN0A 2XXQA 1MS7A 4QF9A 5I57A 1N84A 3FXUA 4ELQA 5CC2A 5CI5A 3TTRA 4HTGA 2A5TA 3KFMA 2B3BA 1A8FA 1LCTA 1P1OA 2DXYA 4AB5A 2XX9A 2V93A 4RY1A 1QUKA 3BKIB 4ESWA 4JB7A 1H45A 3O28A 3IO6A 3MVXA 1I69A 4BLAA 4H67A 2H5YA 5DYHA 4IGTA 3DP4A 3K00A 5I59A 5I2NA 1VR5A 2ONRA 2D5WA 4EXLA 1QVSA 3QAXA 2P1SA 4ONYA 1SD3A 4ND9A 3ZSFA 3PMVA 4H5FA 4EXKA 1MQIA 3BFTA 3C36A 3EHTA 3S2VA 1MRPA 4PFTA 1ZIUA 1Y3NA 4QFLA 2UYFA 1PDAA 1QKBA 2V25A 3IX1A 3I6VA 1B58A 1JW4A 3JZJA 4X1DA 3RPWA 5AA4B 2GHBA 2R6GE 2Y7PA 2OWTA 1QJMA 3RLFE 1LAHE 1EZOA 4I9DA 4F29A 2Y7IA 1MPCA 2ZMBA 4F18A 2FYIA 4YKIA 1VFEA 3I5OA 4HS7A 4OENA 2XXXA 5DVIA 1QW0A 3VXBA 3TUSA 5I56B 3WAFA 2VD2A 5L9OA 4GIZA 4EF2A 3QSLA 3KJ7A 4Z7EA 4IO2A 1Y9UA 4H5GA 5CM6A 2M8CA 3M3LA 3T66A 1A7LA 1B7UA 1M5BA 3AXFA 2ZYMA 5HBCA 1YTVA 2RKMA 2ZNSA 3C32A 4WEDA 1MY3A 5K2YA 2H99A 3RNNA 4U4XA 3F11A 4ISUA 1M5CA 1XT8A 3LSLA 1BKAA 1FCKA 4R2BA 5CMCA 1I6BA 1MY4A 4RJZA 3T9VA 2CZLA 2I6EA 3GXAA 4G68C 4QHQA 4F22A 4ELOA 1DMBA 3MBPA 4XXUA 1VE4A 4R73A 3B6TA 2XXIA 5AA4A 4OETA 3VFJA 2UVGA 3PMXA 1ZJLA 4QFPA 1SVXB 4R6KA 3FV1A 3PV0E 5DVFA 5AA2B 1H76A 2F36A 1GV8A 4I1DA 4O3CA 3MP6A 4K3FA 3MAMA 5FHNA 2D21A 2ZNTA 4PETA 4ELPA 4TLLB 3IB1A 2Q8JA 1VSOA 3QUFA 1QULA 3QK6A 4NF4B 3OO9A 1N3XA 1A55A 1HSJA 1LFHA 4BDQA 3PPNA 4KR5A 2F7BA 3ILUB 4ZEBA 4ELRA 3FVKA 3MUQA 1Q35A 3TTNA 2WKYA 3I3VA 2V3UA 5I58B 3UIFA 1JQFA 4NF8B 5ISUA 3O9PA 2ZYOA 1PB7A 3MW0A 2X7QA 2HXWA 1A8EA 2HEUA 4MF3A 2DS9A 2O51A 3N26A 3M8UA 3OENA 1DTGA 1CB6A 4GXSB 4AQ4A 3IOTA 5KCJA 2NXOA 3UN6A 2ZYNA 1UTBA 1B1HA 3SKPA 2XX8A 2I48A 1LFGA 3KOSA 1TT1A 1GGGA 1B6HA 3RY3A 5A5XB 2Y84A 1SYHA 1Y1ZA 2E1SA 4NF4A 1JEVA 4MLQA 3IAZA 1NKXA 2REGA 4JDFA 1ZTYA 4YKPA 4F2QA 1B4ZA 5AA1A 1JW5A 2Q9TA 1QUJA 1MXXA 4BDOA 3N94A 4QFNA 1D3KA 1B46A 3PUXE 4Z0IA 2QSXA 1LBCA 4NF5A 5M2VA 2H4IA 1J1NA 4GXAA 4M1VA 5AE4A 4FJPA 1B52A 2ONKE 1Y3QA 1LCFA 4LP2B 4G77A 3PU5A 2PVUA 3FVGA 1O63A 3FGSA 1M5DA 2QL3A 4KFQA 3B6QA 3SEYA 4EQBA 1M5EA 3MZ1A 3RTFB 2DWIA 1TXFA 4TOZA 3LUYA 1R1NA 1FW0A 1XVYA 2QMWA 4WXJA 4RK9A 2PMSA 3K0VA 4LQ5A 3E4RA 1QKAA 3H4ZA 5TPAA 2OZZA 3UA8A 3H06B 3SETA 4N13A 4BDRA 5I2KB 3KN7A 3H6VA 4KD5A 1B1XA 4RXLA 3FXQA 4YKKA 3PPPA 3TQWA 2RC7A 3C35A 3CR9A 1I6QA 1WVJA 1POTA 3GZGA 1O64A 3RN8A 3PD9A 4I8CA 3QUJA 4HW8A 3MQ9A 3R26A 4OERA 4XTCQ 4KCCA 1UTHA 3TCHA 5IKBA 4DDDA 3R6UA 1LAFE 1MQDA 3SEUA 2DOJA 1OIBA 4Q0CA 4KPTA 2DE2A 4C1TA 2XHDA 3M3FA 1R9LA 4RA1A 2DWAA 4R6HA 2QPQA 3JYRA 1A40A 3MP8A 4OEUA 2Z8EA 3MWBA 4LZ5A 3MZBA 3M3KA 4XKNA 3GLBA 4MH5A 3OEKA 2THIA 4GF8A 1NMUA 2QMXA 1FQCA 4OFLA 2REJA 4UA8A 3TTLA 4Q8RA 2DXRA 4IGRA 4P0GA 5H8NA 5CBRA 3N6UA 1HSEA 3V83A 2FNCA 4E0WA 4U22A 3G7WA 5L8DA 5FTIA 3K6VA 5H8HB 1MM6A 2DP8A 4PFYA 1FTJA 3SDFA 4DXUA 3RT6B 4I62A 4XIGQ 3MC2A 1EH3A 2O7UA 2Y7RA 2O6AA 1Z7NE 1LB8A 1B5IA 4KYEA 4PQJA 3ILTB 4R9FA 4R75A 3G3FA 4MFIA 4ZECA 4GLIA 4OEVA 4NF6A 4F1UA 4G4PA 1Y20A 3A3UA 1UIVA 1B7ZA 4DCXA 4F3GA 3Q26A 4QFKA 3QIMA 2HZKA 4H8IA 3DM0A 1Z7ME 2XXTA 3TEPA 2Z8DA 1P1QA 3PMWA 1OMPA 2IEEA 5ELVA 3A09A 4U1ZA 1IQ7A 5J1DA 1PB9A 4L17A 4OESA 4DZ1A 3CG1A 3O2AA 3ZKKA 3CG3A 2DWHA 1NL5A 4IO7A 1ZU0A 1GVCA 3S9EA 2UVJA 4POWA 2DE4A 3QYTA 4JSDA 2V3QA 3MZ9A 1OLAA 2KLFA 4U2RA 1MQGA 3Q29A 2DYXA 4OFOA 3CSBA 1N04A 2DWJA 2QS4A 3VLVA 2H25A 3E3KA 1JNFA 3FXRA 3FV2A 3PPOA 3RT8A 2D3IA 4QSEA 1NFTA 4F19A 2O1LA 3IB2A 4JWOA 5I84A 4KQPA 3FVOA 3R7XA 3D4GA 3THIA 3VDFA 4NEDA 4R9GA 1EU8A 5K2XA 3MVYA 4RYAA 3G3IA 2Z23A 5L9SA 2YLNA 3H03A 5DEXB 4LQ2A 1AH5A 3ZS6A 4IY5A 5JTYB 3VV5A 1PC3A 2RF1A 3T96B 5CMBA 4RPNA 1MG1A 2ANJA 3G3GA 3PGFA 1QUIA 3IK6B 4H1XA 4OYVA 2CMOA 3CFZA 4NTLA 3MVZA 4KYSA 3MVWA 2Y7WA 4O3AA 1LAXA 1POY1 4G8NA 2I58A 1N7XA 3HO7A 3EPEA 4GQOA 2H9BA 5IAIA 4IO5A 1SYIA 3HCQA 3MP1A 3SEVA 4XKPA 1B32A 1H43A 4LONB 1HSLA 2UXAA 5I56A 2E0SA 4MBPA 2O7IA 2PYYA 2G29A 3KJTA 2DQVA 3CFLA 4BDNA 1XHYA 4G68B 4XKRA 4AB6A 5DVJA 4R74A 4FEDA 4PE5B 2A5SA 1NNKA 3TDJA 4LATA 5AA2D 3HHFA 2I3WA 1PBQA 4R72A 1FQBA 3U93A 5JTYA 2RCAA 4G8HA 1PBPA 3EF7A 1NNPA 1ELJA 1S9TA 3U8QA 1DTZA 1MXYA 2F97A 4YKJA 1FQAA 2HCAA 3FUZA 1AOVA 3VVFA 1B5HA 1B3GA 2AL4A 1LGBC 4G8MA 1B7HA 2PX1A 4YU0A 5DT6A 1TFDA 4G2ZA 3IR1A 3SESA 1OQHA 2X26A 3OMBA 1B9JA 4GWOA 2OK2A 3Q27A 4LUBA 1MDP1 3RQTA 2RINA 3K6UA 2ZNUA 3O6GA 3KBRA 5AA2A 4FIMA 3O29A 4GRKA 5BWJA 1LFIA 3TFLA 4FECA 3PUVE 3LR1A 3DELB 4IO6A 2XXYA 1IXGA 1JEUA 3K02A 3PUZE 4QRZA 2QJEA 3B7DA 3EHUA 1T0KA 4KI0E 4F39A 4O3BA 2F34A 1Y3PA 1OQGA 3OO6A 2HFBA 1SI1A 2F5XA 4TLMB 4KHZE 3RUMA 2FA7A 3KEIA 4NE4A 3ZKLA 4C1UA 1H3DA 4OZ9A 4Q30B 5I58A 3IJXB 2Q89A 1FTMA 3C9HA 3C4MA 3EHSA 1DOTA 3B6WA 4NF8A 3K2DA 5H8QB 1NNTA 4ZDMA 4EF1A 4R6YA 1BP5A 1PEBA 2F7AA 1LAGE 2XXWA 2G93A 4FATA 1PB8A 3P7IA 3FASA 1ZKBA 2DSFA 3IORA 1IUDA 3O6HA 2GHAA 3W9VA 1RYOA 2UYEA 2XX7A 4XKQA 3LSFB 5JEIA 5CBSA 1DSNA 1P1UA 3EQ1A 2F6GA 3C31A 3K6XA 3E9XA 1B3FA 5A5XA 1US4A 1YAEA 3CI8A 1B51A 2XXHA 1P99A 3TPAA 3FD3A 4Q5TA 3S9MC 2OCUA 1NNFA 4QSCA 3KOTA 5KDTB 3V5AA 2AIXA 1DPEA 1YCJA 3LSXA 3O97A 5ICTA 3H6WA 3U92A 3TCGA 3KN3A 4EQ9A 3VE1B 3TMGA 4OTEA 5CRYA 1SBPA 3VLWA 3RTWB 4P0IA 3K01A 1II5A 4OHNA 2F7CA 3OSRA 3TTMA 5H8QA 1LB9A 5I57B 2P2AA 2VOZA 3T9XB 1B3HA 3S9LC 2YJPA 2A5TB 1FTLA 4KCDA 4EQ7A 1YPNA 4NWCA 3CFXA 2QRYA 1D4NA 3O6IA 2Q2AA 1US5A 2NUVA 3FVNA 3JV9A 1USYE 1GTKA 3L6GA 4ZEIA 5BUUA 1AMFA 3OD7A 1OVTA 1BIYA 4PP0A 2XXRA 4JWXA 1ZLQA 4GL8A 5B7DA 1IIWA 3W9WA 2I49A 5I2NB 1ZBMA 4DE8A 4TQUQ 5ITOA 1MPDA 4JBZA 4RPOA 3H3GA 2AL5A 1D9VA 3ODBA 3U94A 3DP6A 3G3KA 3VXCA 5I2KA 3UP9A 1S50A 1LLSA 1TFAA 2RCBA 3CIJA 2R71A 3WAEA 4E0XA 1N76A 3DP8A 2Q2CA 1MQJA 2AYSA 1IZ1A 2P0SA 2X7PA 2OBGA 3C34A 3MJNA 5H8FB 3V89B 2Z22A 4LZ8A 4P11A 4F1VA 3LBSA 2RC9A 3SEWA 1L5TA 3USDA 4X9TA 3ONMA 1SQYA 2R9JA 3S4UA 4YICA 4FORA 2ZYKA 1MQHA 4QFOA 1JVYA 3L6HA 1SW4A 4N6PA 3UK4A 3TQLA 3TELA 1FTKA 1AL3A 2XXUA 2I4CA 1IXHA 4LA9A 2O1MA 1XC1A 1WODA 1Q1KA 4NMYA 3O66A 1MPBA 1B3LA 1N7WA 3HSTA 1NH8A 4POXA 2O84X 1SI0A 1LBBA 4UACA 5B70A 2RC8A 1M5FA 2B65A 3MPKA 5H8HA 2PT2A 1B2HA 4OVJA 4RK2A 5F7VA 3Q28A 5H8FA 1MXWA 3KSXA 4QSDA 3A3CA 3OO7A 1LSTA 1KWHA 4LZ7A 3H6UA 3OSQA 4F3PA 2GRVA 4U4SA 4GFRA 3T22A 2F8DA 3BBRA 1N3WA 5FTHA 1OLCA 1EZPA 3Q25A 5CMKA 4PFUA 1B0HA 4OFJA 2VHAA 3UORA 1BLFA 2XD2A 4GL0A 2ESNA 1P1NA 1I6AA 3S9NC 2QS2A 3OELA 2UVHA 1Y1MA 3CRBA 3HHGA 3IJOB 3T9UA 1B05A 1B3EA 3FJGA 5CMMA 3UGWA 4H0WA 3QXMA 2UVIA 3PUWE 4ZEDA 4ECFA 5FHMA 5ICQA 3FJ7A 3HV1A 3V8XB 3RGYA 2DE3A 5HPQA 1URSA 3TYHA 2VP1A 4IY6A 1OVBA 3KN8A 4X1BA 2NVUB 4ZEKA 2VD3A 5DTBA 4FEBA 4ZZEA 4JSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NWJ A;  1A54 A;  4F31 B;  3H7M A;  1FQD A;  3W15 C;  2PBW A;  1RYX A;  4NWD A;  5KCJ B;  1IXI A;  1TWY A;  4M4G A;  4ZZA A;  1MM7 A;  1UQW A;  4YMB A;  3ECR A;  3GBA A;  3K4U A;  3K6W A;  1UTB B;  3G3H A;  3SEX A;  1N0T A;  3E13 X;  4BDL A;  1RKM A;  1ATG A;  3VVD A;  2O69 A;  2ZXT A;  4EDP A;  5EHS A;  3K1M A;  5DEX A;  4F1Y A;  1B40 A;  2LAO A;  5H8S A;  1XVX A;  4ZS9 A;  3TTK A;  3IOU A;  3IB0 A;  3H6T A;  2V84 A;  1R6Z A;  3IOV A;  1F9B A;  2PT1 A;  5EYF A;  1IIT A;  4OWD A;  1IXC A;  1MDQ A;  4GOT A;  1ANF A;  1H44 A;  4OMB A;  4DLD A;  2IA4 A;  4NF5 B;  1CE2 A;  1D9Y A;  2Z8F A;  1MY0 A;  4ZE8 A;  5L9M A;  1SW2 A;  2ALU A;  2BJJ X;  4HCW A;  4YB6 A;  3PPQ A;  3TZA A;  1B4H A;  4F3S A;  2F6P A;  2HZL A;  2ONS A;  3G3J A;  4LVQ A;  2OLB A;  5TP9 B;  3OO8 A;  3DLN A;  4N07 A;  1P1W A;  2I0B A;  4WKM A;  2V3T A;  4G68 A;  5HM4 B;  2XXP A;  1EZ9 A;  2OWS A;  3GBB A;  3KG2 A;  2QS1 A;  3K1N A;  3KGC A;  4THI A;  2HQ0 A;  2I0C A;  2OJT A;  1IEJ A;  1JVX A;  1SW5 A;  5TPA B;  5JK4 A;  4DCY A;  4YB7 A;  3PUY E;  2I4B A;  2NOO A;  4YAH X;  1SW1 A;  3FJM A;  4X48 A;  1FQE A;  3PPR A;  3BFU A;  2DVZ A;  4ESX A;  5ITP A;  4OXV A;  2YPN A;  4FE8 A;  1R9Q A;  4C0R A;  3FZV A;  1XS5 A;  1URD A;  2DVC A;  1DPP A;  1AIV A;  3TKD A;  5AA3 A;  1XOC A;  1B5J A;  1BTJ A;  3CSG A;  5EHM A;  3U72 A;  3HPI A;  1MY2 A;  1MH4 A;  3U1O A;  2F35 A;  1UTH B;  4R2F A;  3VVE A;  5TP9 A;  2B3F A;  5F1Q A;  1MXU A;  4PFW A;  1Y4C A;  1Y4T A;  3SER A;  3D4C A;  4OQO A;  4FAJ A;  4U21 A;  3MPL A;  2O68 A;  5TU0 A;  1URG A;  3CVG A;  4H6D A;  4YMA A;  3LC8 A;  2XD3 A;  3FAT A;  3EN3 A;  1FQF A;  3OOA A;  3OEM A;  2Q88 A;  2HAV A;  3TAJ A;  2W7Y A;  3T9H B;  5LOM A;  2GH9 A;  4HCY A;  1JW1 A;  2Y7K A;  4IB2 A;  3PD8 A;  4EUO A;  3IL1 B;  2VGQ A;  2XXV A;  1USY H;  2H98 A;  4ZEF A;  2I3V A;  5H8N B;  1MY1 A;  4YB5 A;  3IO4 A;  4DXB A;  4H8J A;  1MXZ A;  3FIR A;  4WEP A;  2GFE A;  4H65 A;  2F78 A;  4JXI A;  4U23 A;  1VFD A;  2HAU A;  1SDX A;  4JWY A;  4GVO A;  1B0L A;  2ABH A;  4ZE9 A;  1A99 A;  3KSJ A;  4F3B A;  3K1P A;  3T93 B;  4IO4 A;  4KYD A;  1NH7 A;  3VLU A;  4YZZ A;  4RNS A;  3IOW A;  4IO3 A;  1GR2 A;  1O7T A;  3OXN A;  4GD5 A;  1UIU A;  3N6T A;  4NF6 B;  4DXC A;  3C33 A;  5I59 B;  1S7Y A;  1MXV A;  3LSW A;  1MH3 A;  1JET A;  5KDT A;  1WDN A;  3TCF A;  4BDM A;  4DIG A;  4U1O A;  1ZMG A;  2QS3 A;  3KZG A;  4MLV A;  4F2O A;  3N5L A;  3TOD A;  5KZT A;  5FHO A;  1FTO A;  3HN0 A;  2XXQ A;  1MS7 A;  4QF9 A;  5I57 A;  1N84 A;  3FXU A;  4ELQ A;  5CC2 A;  5CI5 A;  3TTR A;  4HTG A;  2A5T A;  3KFM A;  2B3B A;  1A8F A;  1LCT A;  1P1O A;  2DXY A;  4AB5 A;  2XX9 A;  2V93 A;  4RY1 A;  1QUK A;  3BKI B;  4ESW A;  4JB7 A;  1H45 A;  3O28 A;  3IO6 A;  3MVX A;  1I69 A;  4BLA A;  4H67 A;  2H5Y A;  5DYH A;  4IGT A;  3DP4 A;  3K00 A;  5I59 A;  5I2N A;  1VR5 A;  2ONR A;  2D5W A;  4EXL A;  1QVS A;  3QAX A;  2P1S A;  4ONY A;  1SD3 A;  4ND9 A;  3ZSF A;  3PMV A;  4H5F A;  4EXK A;  1MQI A;  3BFT A;  3C36 A;  3EHT A;  3S2V A;  1MRP A;  4PFT A;  1ZIU A;  1Y3N A;  4QFL A;  2UYF A;  1PDA A;  1QKB A;  2V25 A;  3IX1 A;  3I6V A;  1B58 A;  1JW4 A;  3JZJ A;  4X1D A;  3RPW A;  5AA4 B;  2GHB A;  2R6G E;  2Y7P A;  2OWT A;  1QJM A;  3RLF E;  1LAH E;  1EZO A;  4I9D A;  4F29 A;  2Y7I A;  1MPC A;  2ZMB A;  4F18 A;  2FYI A;  4YKI A;  1VFE A;  3I5O A;  4HS7 A;  4OEN A;  2XXX A;  5DVI A;  1QW0 A;  3VXB A;  3TUS A;  5I56 B;  3WAF A;  2VD2 A;  5L9O A;  4GIZ A;  4EF2 A;  3QSL A;  3KJ7 A;  4Z7E A;  4IO2 A;  1Y9U A;  4H5G A;  5CM6 A;  2M8C A;  3M3L A;  3T66 A;  1A7L A;  1B7U A;  1M5B A;  3AXF A;  2ZYM A;  5HBC A;  1YTV A;  2RKM A;  2ZNS A;  3C32 A;  4WED A;  1MY3 A;  5K2Y A;  2H99 A;  3RNN A;  4U4X A;  3F11 A;  4ISU A;  1M5C A;  1XT8 A;  3LSL A;  1BKA A;  1FCK A;  4R2B A;  5CMC A;  1I6B A;  1MY4 A;  4RJZ A;  3T9V A;  2CZL A;  2I6E A;  3GXA A;  4G68 C;  4QHQ A;  4F22 A;  4ELO A;  1DMB A;  3MBP A;  4XXU A;  1VE4 A;  4R73 A;  3B6T A;  2XXI A;  5AA4 A;  4OET A;  3VFJ A;  2UVG A;  3PMX A;  1ZJL A;  4QFP A;  1SVX B;  4R6K A;  3FV1 A;  3PV0 E;  5DVF A;  5AA2 B;  1H76 A;  2F36 A;  1GV8 A;  4I1D A;  4O3C A;  3MP6 A;  4K3F A;  3MAM A;  5FHN A;  2D21 A;  2ZNT A;  4PET A;  4ELP A;  4TLL B;  3IB1 A;  2Q8J A;  1VSO A;  3QUF A;  1QUL A;  3QK6 A;  4NF4 B;  3OO9 A;  1N3X A;  1A55 A;  1HSJ A;  1LFH A;  4BDQ A;  3PPN A;  4KR5 A;  2F7B A;  3ILU B;  4ZEB A;  4ELR A;  3FVK A;  3MUQ A;  1Q35 A;  3TTN A;  2WKY A;  3I3V A;  2V3U A;  5I58 B;  3UIF A;  1JQF A;  4NF8 B;  5ISU A;  3O9P A;  2ZYO A;  1PB7 A;  3MW0 A;  2X7Q A;  2HXW A;  1A8E A;  2HEU A;  4MF3 A;  2DS9 A;  2O51 A;  3N26 A;  3M8U A;  3OEN A;  1DTG A;  1CB6 A;  4GXS B;  4AQ4 A;  3IOT A;  5KCJ A;  2NXO A;  3UN6 A;  2ZYN A;  1UTB A;  1B1H A;  3SKP A;  2XX8 A;  2I48 A;  1LFG A;  3KOS A;  1TT1 A;  1GGG A;  1B6H A;  3RY3 A;  5A5X B;  2Y84 A;  1SYH A;  1Y1Z A;  2E1S A;  4NF4 A;  1JEV A;  4MLQ A;  3IAZ A;  1NKX A;  2REG A;  4JDF A;  1ZTY A;  4YKP A;  4F2Q A;  1B4Z A;  5AA1 A;  1JW5 A;  2Q9T A;  1QUJ A;  1MXX A;  4BDO A;  3N94 A;  4QFN A;  1D3K A;  1B46 A;  3PUX E;  4Z0I A;  2QSX A;  1LBC A;  4NF5 A;  5M2V A;  2H4I A;  1J1N A;  4GXA A;  4M1V A;  5AE4 A;  4FJP A;  1B52 A;  2ONK E;  1Y3Q A;  1LCF A;  4LP2 B;  4G77 A;  3PU5 A;  2PVU A;  3FVG A;  1O63 A;  3FGS A;  1M5D A;  2QL3 A;  4KFQ A;  3B6Q A;  3SEY A;  4EQB A;  1M5E A;  3MZ1 A;  3RTF B;  2DWI A;  1TXF A;  4TOZ A;  3LUY A;  1R1N A;  1FW0 A;  1XVY A;  2QMW A;  4WXJ A;  4RK9 A;  2PMS A;  3K0V A;  4LQ5 A;  3E4R A;  1QKA A;  3H4Z A;  5TPA A;  2OZZ A;  3UA8 A;  3H06 B;  3SET A;  4N13 A;  4BDR A;  5I2K B;  3KN7 A;  3H6V A;  4KD5 A;  1B1X A;  4RXL A;  3FXQ A;  4YKK A;  3PPP A;  3TQW A;  2RC7 A;  3C35 A;  3CR9 A;  1I6Q A;  1WVJ A;  1POT A;  3GZG A;  1O64 A;  3RN8 A;  3PD9 A;  4I8C A;  3QUJ A;  4HW8 A;  3MQ9 A;  3R26 A;  4OER A;  4XTC Q;  4KCC A;  1UTH A;  3TCH A;  5IKB A;  4DDD A;  3R6U A;  1LAF E;  1MQD A;  3SEU A;  2DOJ A;  1OIB A;  4Q0C A;  4KPT A;  2DE2 A;  4C1T A;  2XHD A;  3M3F A;  1R9L A;  4RA1 A;  2DWA A;  4R6H A;  2QPQ A;  3JYR A;  1A40 A;  3MP8 A;  4OEU A;  2Z8E A;  3MWB A;  4LZ5 A;  3MZB A;  3M3K A;  4XKN A;  3GLB A;  4MH5 A;  3OEK A;  2THI A;  4GF8 A;  1NMU A;  2QMX A;  1FQC A;  4OFL A;  2REJ A;  4UA8 A;  3TTL A;  4Q8R A;  2DXR A;  4IGR A;  4P0G A;  5H8N A;  5CBR A;  3N6U A;  1HSE A;  3V83 A;  2FNC A;  4E0W A;  4U22 A;  3G7W A;  5L8D A;  5FTI A;  3K6V A;  5H8H B;  1MM6 A;  2DP8 A;  4PFY A;  1FTJ A;  3SDF A;  4DXU A;  3RT6 B;  4I62 A;  4XIG Q;  3MC2 A;  1EH3 A;  2O7U A;  2Y7R A;  2O6A A;  1Z7N E;  1LB8 A;  1B5I A;  4KYE A;  4PQJ A;  3ILT B;  4R9F A;  4R75 A;  3G3F A;  4MFI A;  4ZEC A;  4GLI A;  4OEV A;  4NF6 A;  4F1U A;  4G4P A;  1Y20 A;  3A3U A;  1UIV A;  1B7Z A;  4DCX A;  4F3G A;  3Q26 A;  4QFK A;  3QIM A;  2HZK A;  4H8I A;  3DM0 A;  1Z7M E;  2XXT A;  3TEP A;  2Z8D A;  1P1Q A;  3PMW A;  1OMP A;  2IEE A;  5ELV A;  3A09 A;  4U1Z A;  1IQ7 A;  5J1D A;  1PB9 A;  4L17 A;  4OES A;  4DZ1 A;  3CG1 A;  3O2A A;  3ZKK A;  3CG3 A;  2DWH A;  1NL5 A;  4IO7 A;  1ZU0 A;  1GVC A;  3S9E A;  2UVJ A;  4POW A;  2DE4 A;  3QYT A;  4JSD A;  2V3Q A;  3MZ9 A;  1OLA A;  2KLF A;  4U2R A;  1MQG A;  3Q29 A;  2DYX A;  4OFO A;  3CSB A;  1N04 A;  2DWJ A;  2QS4 A;  3VLV A;  2H25 A;  3E3K A;  1JNF A;  3FXR A;  3FV2 A;  3PPO A;  3RT8 A;  2D3I A;  4QSE A;  1NFT A;  4F19 A;  2O1L A;  3IB2 A;  4JWO A;  5I84 A;  4KQP A;  3FVO A;  3R7X A;  3D4G A;  3THI A;  3VDF A;  4NED A;  4R9G A;  1EU8 A;  5K2X A;  3MVY A;  4RYA A;  3G3I A;  2Z23 A;  5L9S A;  2YLN A;  3H03 A;  5DEX B;  4LQ2 A;  1AH5 A;  3ZS6 A;  4IY5 A;  5JTY B;  3VV5 A;  1PC3 A;  2RF1 A;  3T96 B;  5CMB A;  4RPN A;  1MG1 A;  2ANJ A;  3G3G A;  3PGF A;  1QUI A;  3IK6 B;  4H1X A;  4OYV A;  2CMO A;  3CFZ A;  4NTL A;  3MVZ A;  4KYS A;  3MVW A;  2Y7W A;  4O3A A;  1LAX A;  1POY 1;  4G8N A;  2I58 A;  1N7X A;  3HO7 A;  3EPE A;  4GQO A;  2H9B A;  5IAI A;  4IO5 A;  1SYI A;  3HCQ A;  3MP1 A;  3SEV A;  4XKP A;  1B32 A;  1H43 A;  4LON B;  1HSL A;  2UXA A;  5I56 A;  2E0S A;  4MBP A;  2O7I A;  2PYY A;  2G29 A;  3KJT A;  2DQV A;  3CFL A;  4BDN A;  1XHY A;  4G68 B;  4XKR A;  4AB6 A;  5DVJ A;  4R74 A;  4FED A;  4PE5 B;  2A5S A;  1NNK A;  3TDJ A;  4LAT A;  5AA2 D;  3HHF A;  2I3W A;  1PBQ A;  4R72 A;  1FQB A;  3U93 A;  5JTY A;  2RCA A;  4G8H A;  1PBP A;  3EF7 A;  1NNP A;  1ELJ A;  1S9T A;  3U8Q A;  1DTZ A;  1MXY A;  2F97 A;  4YKJ A;  1FQA A;  2HCA A;  3FUZ A;  1AOV A;  3VVF A;  1B5H A;  1B3G A;  2AL4 A;  1LGB C;  4G8M A;  1B7H A;  2PX1 A;  4YU0 A;  5DT6 A;  1TFD A;  4G2Z A;  3IR1 A;  3SES A;  1OQH A;  2X26 A;  3OMB A;  1B9J A;  4GWO A;  2OK2 A;  3Q27 A;  4LUB A;  1MDP 1;  3RQT A;  2RIN A;  3K6U A;  2ZNU A;  3O6G A;  3KBR A;  5AA2 A;  4FIM A;  3O29 A;  4GRK A;  5BWJ A;  1LFI A;  3TFL A;  4FEC A;  3PUV E;  3LR1 A;  3DEL B;  4IO6 A;  2XXY A;  1IXG A;  1JEU A;  3K02 A;  3PUZ E;  4QRZ A;  2QJE A;  3B7D A;  3EHU A;  1T0K A;  4KI0 E;  4F39 A;  4O3B A;  2F34 A;  1Y3P A;  1OQG A;  3OO6 A;  2HFB A;  1SI1 A;  2F5X A;  4TLM B;  4KHZ E;  3RUM A;  2FA7 A;  3KEI A;  4NE4 A;  3ZKL A;  4C1U A;  1H3D A;  4OZ9 A;  4Q30 B;  5I58 A;  3IJX B;  2Q89 A;  1FTM A;  3C9H A;  3C4M A;  3EHS A;  1DOT A;  3B6W A;  4NF8 A;  3K2D A;  5H8Q B;  1NNT A;  4ZDM A;  4EF1 A;  4R6Y A;  1BP5 A;  1PEB A;  2F7A A;  1LAG E;  2XXW A;  2G93 A;  4FAT A;  1PB8 A;  3P7I A;  3FAS A;  1ZKB A;  2DSF A;  3IOR A;  1IUD A;  3O6H A;  2GHA A;  3W9V A;  1RYO A;  2UYE A;  2XX7 A;  4XKQ A;  3LSF B;  5JEI A;  5CBS A;  1DSN A;  1P1U A;  3EQ1 A;  2F6G A;  3C31 A;  3K6X A;  3E9X A;  1B3F A;  5A5X A;  1US4 A;  1YAE A;  3CI8 A;  1B51 A;  2XXH A;  1P99 A;  3TPA A;  3FD3 A;  4Q5T A;  3S9M C;  2OCU A;  1NNF A;  4QSC A;  3KOT A;  5KDT B;  3V5A A;  2AIX A;  1DPE A;  1YCJ A;  3LSX A;  3O97 A;  5ICT A;  3H6W A;  3U92 A;  3TCG A;  3KN3 A;  4EQ9 A;  3VE1 B;  3TMG A;  4OTE A;  5CRY A;  1SBP A;  3VLW A;  3RTW B;  4P0I A;  3K01 A;  1II5 A;  4OHN A;  2F7C A;  3OSR A;  3TTM A;  5H8Q A;  1LB9 A;  5I57 B;  2P2A A;  2VOZ A;  3T9X B;  1B3H A;  3S9L C;  2YJP A;  2A5T B;  1FTL A;  4KCD A;  4EQ7 A;  1YPN A;  4NWC A;  3CFX A;  2QRY A;  1D4N A;  3O6I A;  2Q2A A;  1US5 A;  2NUV A;  3FVN A;  3JV9 A;  1USY E;  1GTK A;  3L6G A;  4ZEI A;  5BUU A;  1AMF A;  3OD7 A;  1OVT A;  1BIY A;  4PP0 A;  2XXR A;  4JWX A;  1ZLQ A;  4GL8 A;  5B7D A;  1IIW A;  3W9W A;  2I49 A;  5I2N B;  1ZBM A;  4DE8 A;  4TQU Q;  5ITO A;  1MPD A;  4JBZ A;  4RPO A;  3H3G A;  2AL5 A;  1D9V A;  3ODB A;  3U94 A;  3DP6 A;  3G3K A;  3VXC A;  5I2K A;  3UP9 A;  1S50 A;  1LLS A;  1TFA A;  2RCB A;  3CIJ A;  2R71 A;  3WAE A;  4E0X A;  1N76 A;  3DP8 A;  2Q2C A;  1MQJ A;  2AYS A;  1IZ1 A;  2P0S A;  2X7P A;  2OBG A;  3C34 A;  3MJN A;  5H8F B;  3V89 B;  2Z22 A;  4LZ8 A;  4P11 A;  4F1V A;  3LBS A;  2RC9 A;  3SEW A;  1L5T A;  3USD A;  4X9T A;  3ONM A;  1SQY A;  2R9J A;  3S4U A;  4YIC A;  4FOR A;  2ZYK A;  1MQH A;  4QFO A;  1JVY A;  3L6H A;  1SW4 A;  4N6P A;  3UK4 A;  3TQL A;  3TEL A;  1FTK A;  1AL3 A;  2XXU A;  2I4C A;  1IXH A;  4LA9 A;  2O1M A;  1XC1 A;  1WOD A;  1Q1K A;  4NMY A;  3O66 A;  1MPB A;  1B3L A;  1N7W A;  3HST A;  1NH8 A;  4POX A;  2O84 X;  1SI0 A;  1LBB A;  4UAC A;  5B70 A;  2RC8 A;  1M5F A;  2B65 A;  3MPK A;  5H8H A;  2PT2 A;  1B2H A;  4OVJ A;  4RK2 A;  5F7V A;  3Q28 A;  5H8F A;  1MXW A;  3KSX A;  4QSD A;  3A3C A;  3OO7 A;  1LST A;  1KWH A;  4LZ7 A;  3H6U A;  3OSQ A;  4F3P A;  2GRV A;  4U4S A;  4GFR A;  3T22 A;  2F8D A;  3BBR A;  1N3W A;  5FTH A;  1OLC A;  1EZP A;  3Q25 A;  5CMK A;  4PFU A;  1B0H A;  4OFJ A;  2VHA A;  3UOR A;  1BLF A;  2XD2 A;  4GL0 A;  2ESN A;  1P1N A;  1I6A A;  3S9N C;  2QS2 A;  3OEL A;  2UVH A;  1Y1M A;  3CRB A;  3HHG A;  3IJO B;  3T9U A;  1B05 A;  1B3E A;  3FJG A;  5CMM A;  3UGW A;  4H0W A;  3QXM A;  2UVI A;  3PUW E;  4ZED A;  4ECF A;  5FHM A;  5ICQ A;  3FJ7 A;  3HV1 A;  3V8X B;  3RGY A;  2DE3 A;  5HPQ A;  1URS A;  3TYH A;  2VP1 A;  4IY6 A;  1OVB A;  3KN8 A;  4X1B A;  2NVU B;  4ZEK A;  2VD3 A;  5DTB A;  4FEB A;  4ZZE A;  4JSO A; 
#chains in the Genus database with same CATH topology
 4LN5 A;  2NWJ A;  1A54 A;  4F31 B;  5EQ9 A;  3H7M A;  1FQD A;  3B50 A;  2PBW A;  2Y5L A;  5ESY A;  3W15 C;  1RYX A;  4NWD A;  5KCJ B;  3MST A;  1IXI A;  1TWY A;  4M4G A;  4ZZA A;  1MM7 A;  1UQW A;  4N8Y A;  4YMB A;  3ECR A;  3GBA A;  3K4U A;  3K6W A;  1UTB B;  1FPB A;  3G3H A;  3SEX A;  3RPL B;  1N0T A;  3E13 X;  5J16 A;  4BDL A;  1RKM A;  4P1E A;  1ATG A;  4PAK A;  3VVD A;  1LBV A;  4PGP A;  2O69 A;  4O7I A;  2P3V A;  2ZXT A;  4EDP A;  5EHS A;  3K1M A;  5DEX A;  4N15 A;  4F1Y A;  5I7I A;  1B40 A;  2LAO A;  5H8S A;  2PFZ A;  1XVX A;  4ZS9 A;  3TTK A;  3IOU A;  3IB0 A;  3H6T A;  2V84 A;  1R6Z A;  4PFB A;  3IOV A;  1F9B A;  2PT1 A;  5EYF A;  1IIT A;  3E78 A;  4OWD A;  1IXC A;  1MDQ A;  4GOT A;  1ANF A;  1H44 A;  4OMB A;  4DLD A;  2OX3 A;  2IA4 A;  4NF5 B;  1CE2 A;  1D9Y A;  2Z8F A;  1MY0 A;  4ZE8 A;  5L9M A;  1SW2 A;  2ALU A;  2HXR A;  2BJJ X;  4HCW A;  4YB6 A;  3PPQ A;  3TZA A;  1B4H A;  1QGX A;  4F3S A;  2F6P A;  2HZL A;  4N81 A;  2ZZW A;  2ONS A;  3G3J A;  4LVQ A;  1FBF A;  2OLB A;  5TP9 B;  3OO8 A;  3DLN A;  2FHY A;  4N07 A;  1FPG A;  1P1W A;  2I0B A;  4WKM A;  1FSA A;  4N6D A;  2V3T A;  4G68 A;  5HM4 B;  1FPI A;  2XXP A;  1EZ9 A;  2OWS A;  3GBB A;  3KG2 A;  2QS1 A;  4NGU A;  3K1N A;  3KGC A;  4THI A;  2HQ0 A;  2I0C A;  2OJT A;  1IEJ A;  1AWB A;  1JVX A;  1SW5 A;  5TPA B;  5JK4 A;  4DCY A;  4YB7 A;  3PUY E;  2I4B A;  2NOO A;  4YAH X;  1SW1 A;  2BJI A;  3FJM A;  2XWO A;  4X48 A;  1FQE A;  3PPR A;  1NUZ A;  3BFU A;  2DVZ A;  1FBD A;  4ESX A;  5ITP A;  4OXV A;  2YPN A;  4FE8 A;  4GX6 A;  1R9Q A;  1NV3 A;  4C0R A;  3FZV A;  1XS5 A;  2P3N A;  1URD A;  2DVC A;  1DPP A;  1AIV A;  3TKD A;  5AA3 A;  1XOC A;  1B5J A;  1BTJ A;  3CSG A;  4MNP A;  5EHM A;  3U72 A;  3HPI A;  1MY2 A;  1MH4 A;  2FIE A;  3U1O A;  2F35 A;  1UTH B;  4R2F A;  3VVE A;  5TP9 A;  2B3F A;  5F1Q A;  1MXU A;  4PFW A;  1Y4C A;  1Y4T A;  3SER A;  3D4C A;  4OQO A;  4FAJ A;  4U21 A;  1NV5 A;  3MPL A;  2O68 A;  5TU0 A;  1URG A;  3CVG A;  4H6D A;  4YMA A;  3LC8 A;  2XD3 A;  3FAT A;  3EN3 A;  1FQF A;  3OOA A;  3OEM A;  2Q88 A;  2HAV A;  4PC9 A;  3TAJ A;  2W7Y A;  3T9H B;  5LOM A;  5ET8 A;  2GH9 A;  4HCY A;  1JW1 A;  2Y7K A;  4IB2 A;  3PD8 A;  4EUO A;  3IL1 B;  2XWI A;  2VGQ A;  1NUY A;  2XXV A;  1USY H;  2H98 A;  4ZEF A;  2I3V A;  5H8N B;  2XWV A;  1MY1 A;  4YB5 A;  3QMF A;  3IO4 A;  4DXB A;  4H8J A;  1MXZ A;  3FIR A;  4WEP A;  2GFE A;  4H65 A;  2F78 A;  4JXI A;  4U23 A;  3PTY A;  1VFD A;  2HAU A;  4MNC A;  1SDX A;  4JWY A;  4GVO A;  1B0L A;  2ABH A;  4ZE9 A;  1A99 A;  3KSJ A;  4F3B A;  3K1P A;  3T93 B;  1NV7 A;  4IO4 A;  5DW8 A;  4UAB A;  4KYD A;  1NH7 A;  3VLU A;  2Q74 A;  4YZZ A;  4RNS A;  3IOW A;  4IO3 A;  1GR2 A;  1O7T A;  3OXN A;  4GD5 A;  1UIU A;  3N6T A;  4X8R A;  1LBW A;  4NF6 B;  1FBG A;  1NUW A;  4DXC A;  3C33 A;  5I59 B;  5F24 A;  1S7Y A;  1MXV A;  3LSW A;  1MH3 A;  1JET A;  5KDT A;  1WDN A;  3TCF A;  4BDM A;  4DIG A;  4PDD A;  4U1O A;  1ZMG A;  2QS3 A;  3KZG A;  4MLV A;  4F2O A;  3N5L A;  3TOD A;  5KZT A;  5FHO A;  1FTO A;  5I5P A;  4PGN A;  4PFI A;  3HN0 A;  2XXQ A;  1MS7 A;  4QF9 A;  4PFR A;  5I57 A;  1N84 A;  3FXU A;  4ELQ A;  5CC2 A;  5CI5 A;  3TTR A;  2V4C A;  4HTG A;  2A5T A;  3KFM A;  2B3B A;  1A8F A;  1LCT A;  1P1O A;  2DXY A;  4AB5 A;  2XX9 A;  2V93 A;  4RY1 A;  1QUK A;  3BKI B;  4ESW A;  4JB7 A;  1H45 A;  1KA1 A;  3IO6 A;  3O28 A;  3MVX A;  1I69 A;  4BLA A;  4X04 A;  4H67 A;  2H5Y A;  5DYH A;  4IGT A;  3DP4 A;  3K00 A;  5I59 A;  5I2N A;  1VR5 A;  2ONR A;  3SZP A;  4PF8 A;  2D5W A;  4EXL A;  1QVS A;  3QAX A;  2P1S A;  4ONY A;  4MMP A;  1IMB A;  4O7M A;  1SD3 A;  4ND9 A;  3ZSF A;  3PMV A;  4H5F A;  4EXK A;  3T0J A;  1MQI A;  3BFT A;  3C36 A;  3EHT A;  2Y5K A;  3S2V A;  1MRP A;  4PFT A;  1ZIU A;  4MIJ A;  1Y3N A;  4QFL A;  2UYF A;  1PDA A;  1QKB A;  4GBV A;  2V25 A;  3IX1 A;  5LTC A;  3I6V A;  1D9Q A;  3BIG A;  1B58 A;  1JW4 A;  1RDX A;  3JZJ A;  4X1D A;  3RPW A;  5AA4 B;  2GHB A;  2R6G E;  2Y7P A;  2OWT A;  4PAF A;  1QJM A;  3RLF E;  1LAH E;  1EZO A;  5IZ1 A;  4I9D A;  1SPI A;  4F29 A;  2Y7I A;  1MPC A;  2ZMB A;  4F18 A;  2FYI A;  4MNI A;  4YKI A;  1VFE A;  3I5O A;  4HS7 A;  4PCD A;  4OEN A;  1G0H A;  4P3L A;  2XXX A;  5DVI A;  1QW0 A;  1BK4 A;  1RDZ A;  3VXB A;  3TUS A;  5I56 B;  1NV1 A;  3WAF A;  2VD2 A;  2ZZX A;  4MX6 A;  4PTK A;  5L9O A;  4GIZ A;  4EF2 A;  1FPL A;  3QSL A;  3KJ7 A;  4Z7E A;  4IO2 A;  1Y9U A;  4H5G A;  5CM6 A;  2M8C A;  3M3L A;  3T66 A;  1A7L A;  1B7U A;  1M5B A;  5EYG A;  3AXF A;  3BIH A;  4NF0 A;  2ZYM A;  5HBC A;  1YTV A;  4O94 A;  2RKM A;  4PDH A;  2ZNS A;  3C32 A;  4WED A;  1MY3 A;  5K2Y A;  2H99 A;  3RNN A;  4U4X A;  3F11 A;  4ISU A;  1M5C A;  5FBP A;  1XT8 A;  3LSL A;  1BKA A;  1FCK A;  4R2B A;  5CMC A;  1I6B A;  1MY4 A;  4RJZ A;  3T9V A;  2CZL A;  2I6E A;  3GXA A;  4G68 C;  4QHQ A;  4F22 A;  4ELO A;  1DMB A;  3MBP A;  4GWW A;  4XXU A;  1VE4 A;  4R73 A;  3B6T A;  2XXI A;  5AA4 A;  4OET A;  3VFJ A;  2UVG A;  3PMX A;  1ZJL A;  4QFP A;  1SVX B;  4R6K A;  3FV1 A;  3PV0 E;  5DVF A;  5AA2 B;  1H76 A;  2F36 A;  1NV4 A;  1GV8 A;  2QFL A;  4I1D A;  4O3C A;  3MP6 A;  4K3F A;  3MAM A;  5FHN A;  2D21 A;  4PF6 A;  2ZNT A;  4PET A;  4ELP A;  4TLL B;  2VPN A;  3IB1 A;  2Q8J A;  2R8T A;  1VSO A;  3QUF A;  1QUL A;  3QK6 A;  4NF4 B;  3OO9 A;  1N3X A;  1A55 A;  1HSJ A;  1LFH A;  4BDQ A;  3PPN A;  5IZ3 A;  4KR5 A;  2F7B A;  4O8M A;  3ILU B;  2QVR A;  4OA4 A;  4ZEB A;  1FBH A;  4ELR A;  3FVK A;  3MUQ A;  1Q35 A;  1DK4 A;  3TTN A;  2HHM A;  2WKY A;  3I3V A;  2V3U A;  4N8G A;  5I58 B;  1IMA A;  1KA0 A;  3UIF A;  4QXD A;  1YXI A;  1JQF A;  4NF8 B;  5ISU A;  3O9P A;  2ZYO A;  1PB7 A;  3MW0 A;  4AS4 A;  2X7Q A;  2HXW A;  1A8E A;  2HEU A;  4MF3 A;  2DS9 A;  2QVV A;  2O51 A;  1G0I A;  3N26 A;  3M8U A;  3OEN A;  1DTG A;  1CB6 A;  4GXS B;  4AQ4 A;  3IOT A;  5KCJ A;  2NXO A;  3UN6 A;  2ZYN A;  1UTB A;  1B1H A;  3RPL A;  3SKP A;  2XX8 A;  2I48 A;  1LFG A;  3KOS A;  1TT1 A;  1GGG A;  2CEX A;  1B6H A;  4GX4 A;  3RY3 A;  5A5X B;  2Y84 A;  1SYH A;  1Y1Z A;  2E1S A;  4NF4 A;  1JEV A;  4MLQ A;  3IAZ A;  4N17 A;  1NKX A;  2REG A;  4JDF A;  1ZTY A;  4YKP A;  4F2Q A;  1B4Z A;  5AA1 A;  1JW5 A;  2Q9T A;  1QUJ A;  1MXX A;  4BDO A;  3N94 A;  4QFN A;  1D3K A;  1B46 A;  3PUX E;  4Z0I A;  2QSX A;  4P9K A;  1LBC A;  1Q9D A;  2CZH A;  4NF5 A;  2VPO A;  5M2V A;  2H4I A;  5T3J A;  1J1N A;  3A29 A;  4GXA A;  2FIX A;  4M1V A;  5AE4 A;  2JJK A;  1B52 A;  4FJP A;  2ONK E;  1FJ9 A;  1Y3Q A;  1LCF A;  4LP2 B;  4G77 A;  3PU5 A;  3FBP A;  2PVU A;  2WYP A;  3FVG A;  1O63 A;  3FGS A;  1K9Y A;  1JP4 A;  1M5D A;  3FXB A;  2QL3 A;  4KFQ A;  3B6Q A;  3SEY A;  1M5E A;  3MZ1 A;  4EQB A;  2DWI A;  1TXF A;  3RTF B;  4TOZ A;  3LUY A;  1R1N A;  4HE1 A;  1FW0 A;  1XVY A;  2FBP A;  2QMW A;  4WXJ A;  4RK9 A;  2PMS A;  5ET5 A;  2XWK A;  3K0V A;  4LQ5 A;  3E4R A;  1QKA A;  3H4Z A;  5TPA A;  2OZZ A;  3UA8 A;  3H06 B;  3SET A;  5ET7 A;  4P47 A;  4N13 A;  4BDR A;  4N91 A;  5IM2 A;  1EYI A;  5I2K B;  3KN7 A;  3H6V A;  4KD5 A;  1B1X A;  4RXL A;  3FXQ A;  2F3D A;  4YKK A;  3PPP A;  3TQW A;  2RC7 A;  3C35 A;  3CR9 A;  1I6Q A;  1WVJ A;  1POT A;  3GZG A;  4JVI A;  1O64 A;  4PBQ A;  3RN8 A;  1FPJ A;  3PD9 A;  4I8C A;  3QUJ A;  1KZ8 A;  4HW8 A;  3MQ9 A;  3R26 A;  4OER A;  4H46 A;  4XTC Q;  4KCC A;  4GWY A;  1UTH A;  3TCH A;  5IKB A;  4DDD A;  1FPF A;  3R6U A;  1LAF E;  1MQD A;  3SEU A;  2DOJ A;  1OIB A;  4Q0C A;  4KPT A;  2DE2 A;  4C1T A;  2OWZ A;  2XHD A;  3M3F A;  1R9L A;  4RA1 A;  2DWA A;  3E79 A;  4R6H A;  2QPQ A;  3JYR A;  1A40 A;  3MP8 A;  4OEU A;  2Z8E A;  3MWB A;  4LZ5 A;  3MZB A;  4XKN A;  3GLB A;  1XI6 A;  4MH5 A;  2PCR A;  2WYK A;  3OEK A;  2THI A;  1NI9 A;  4GF8 A;  1NMU A;  2QMX A;  1FQC A;  4OFL A;  2KQZ A;  4HE0 A;  2REJ A;  4UA8 A;  3TTL A;  4Q8R A;  2DXR A;  4IGR A;  4P0G A;  5H8N A;  5CBR A;  3N6U A;  3D1R A;  1HSE A;  3V83 A;  2FNC A;  4E0W A;  4U22 A;  3G7W A;  5L8D A;  5FTI A;  5EQ8 A;  3K6V A;  5H8H B;  1MM6 A;  2DP8 A;  4PFY A;  1FTJ A;  3SDF A;  4DXU A;  3RT6 B;  4I62 A;  4XIG Q;  3MC2 A;  1EH3 A;  2O7U A;  2Y7R A;  2O6A A;  1Z7N E;  1LB8 A;  1B5I A;  2KR0 A;  4KYE A;  4PQJ A;  3ILT B;  2F3B A;  4R9F A;  1FPK A;  4R75 A;  3G3F A;  4MFI A;  4ZEC A;  4GLI A;  4OEV A;  4NF6 A;  4F1U A;  4G4P A;  1Y20 A;  1FJ6 A;  3A3U A;  1INP A;  1UIV A;  1B7Z A;  4DCX A;  5ET6 A;  4F3G A;  3Q26 A;  4QFK A;  3QIM A;  2VT5 A;  2HZK A;  4H8I A;  3DM0 A;  1Z7M E;  2XXT A;  3TEP A;  2Z8D A;  1P1Q A;  1IME A;  3PMW A;  1OMP A;  2IEE A;  5ELV A;  1FRP A;  3A09 A;  4U1Z A;  1IQ7 A;  1IMF A;  5J1D A;  1PB9 A;  4L17 A;  4XF5 A;  4OES A;  4DZ1 A;  3CG1 A;  3O2A A;  2GQ1 A;  3ZKK A;  3CG3 A;  2DWH A;  3KC0 A;  1NL5 A;  4IO7 A;  1ZU0 A;  1GVC A;  3S9E A;  2UVJ A;  4POW A;  2DE4 A;  3QYT A;  4JSD A;  4NHB A;  2V3Q A;  3MZ9 A;  1OLA A;  2KLF A;  4U2R A;  1MQG A;  3IFA A;  3Q29 A;  2DYX A;  4MCO A;  4OFO A;  3CSB A;  1N04 A;  2DWJ A;  2QS4 A;  3VLV A;  2H25 A;  3E3K A;  1JNF A;  3FXR A;  3FV2 A;  3PPO A;  3RT8 A;  1FBC A;  2D3I A;  4QSE A;  1NFT A;  4F19 A;  2O1L A;  3IB2 A;  4JWO A;  5I84 A;  4KQP A;  3FVO A;  4I3E A;  3R7X A;  3D4G A;  3THI A;  3VDF A;  4NED A;  4R9G A;  1EU8 A;  4OVT A;  5K2X A;  3MVY A;  4RYA A;  3G3I A;  1FBE A;  1K9Z A;  2Z23 A;  5L9S A;  2YLN A;  3H03 A;  4DI4 B;  3NOH A;  5DEX B;  4LQ2 A;  1AH5 A;  3ZS6 A;  4IY5 A;  5JTY B;  4QBA A;  3VV5 A;  1PC3 A;  2RF1 A;  3T96 B;  5CMB A;  5LDZ A;  2CZK A;  4RPN A;  1MG1 A;  2ANJ A;  3G3G A;  3PGF A;  4MAG A;  1QUI A;  3IK6 B;  4H1X A;  4OYV A;  4H45 A;  2CMO A;  3CFZ A;  4NTL A;  3MVZ A;  4KYS A;  5EYH A;  3MVW A;  2Y7W A;  4O3A A;  1LAX A;  1POY 1;  4GWZ A;  4G8N A;  2I58 A;  4HXV A;  2WBB A;  1N7X A;  3HO7 A;  3GYY A;  3EPE A;  4GQO A;  2H9B A;  5IAI A;  4IO5 A;  3ROJ A;  1SYI A;  3HCQ A;  3MP1 A;  3SEV A;  4XKP A;  2XA5 A;  1B32 A;  1H43 A;  4LON B;  1HSL A;  2UXA A;  1NV2 A;  5I56 A;  2E0S A;  4MBP A;  2O7I A;  2PYY A;  1FBP A;  2G29 A;  1DCU A;  3KJT A;  4GBW A;  2DQV A;  3CFL A;  4BDN A;  1XHY A;  4G68 B;  4XKR A;  4OVS A;  4AB6 A;  5DVJ A;  4R74 A;  4FED A;  4PE5 B;  4P56 A;  2A5S A;  1NNK A;  3TDJ A;  4LAT A;  5AA2 D;  3HHF A;  1LEV A;  2I3W A;  1PBQ A;  4R72 A;  1FQB A;  3U93 A;  5JTY A;  2RCA A;  4G8H A;  1PBP A;  3EF7 A;  4GWU A;  1NNP A;  1ELJ A;  1S9T A;  3U8Q A;  1DTZ A;  1MXY A;  2F97 A;  4YKJ A;  1NV0 A;  1FQA A;  2HCA A;  3FUZ A;  1AOV A;  3VVF A;  1B5H A;  1B3G A;  2AL4 A;  1LGB C;  4G8M A;  1B7H A;  2PX1 A;  3KC1 A;  4YU0 A;  5DT6 A;  1TFD A;  4G2Z A;  2PFY A;  3IR1 A;  3SES A;  1OQH A;  2X26 A;  3OMB A;  1B9J A;  4GWO A;  2OK2 A;  3Q27 A;  4HE2 A;  4LUB A;  1MDP 1;  3RQT A;  2RIN A;  3K6U A;  2ZNU A;  3O6G A;  3KBR A;  4NX1 A;  5AA2 A;  4FIM A;  2FVZ A;  3O29 A;  4GRK A;  5BWJ A;  1LFI A;  3TFL A;  3ISP A;  4FEC A;  3PUV E;  3LR1 A;  3DEL B;  4IO6 A;  2XXY A;  1IXG A;  1JEU A;  3K02 A;  2WEF A;  3PUZ E;  4QRZ A;  2QJE A;  4ZZE A;  3B7D A;  3EHU A;  1T0K A;  4KI0 E;  4F39 A;  4O3B A;  2F34 A;  1Y3P A;  1OQG A;  3OO6 A;  2HFB A;  1SI1 A;  4OVQ A;  2F5X A;  4TLM B;  4KHZ E;  3RUM A;  4N4U A;  2FA7 A;  3KEI A;  4NE4 A;  3ZKL A;  4C1U A;  1H3D A;  4OZ9 A;  4IR8 A;  4Q30 B;  5I58 A;  3IJX B;  2Q89 A;  1FTM A;  3C9H A;  3C4M A;  3EHS A;  1DOT A;  3B6W A;  4NF8 A;  3K2D A;  5H8Q B;  1NNT A;  4ZDM A;  4EF1 A;  4R6Y A;  4OAN A;  1BP5 A;  1PEB A;  5IZZ A;  4XFE A;  2F7A A;  1LAG E;  2XXW A;  1LBY A;  2G93 A;  4FAT A;  1PB8 A;  3P7I A;  3FAS A;  1ZKB A;  2DSF A;  3IOR A;  4PE3 A;  1IUD A;  1FPD A;  3O6H A;  2GHA A;  3W9V A;  1RYO A;  4JVC A;  2UYE A;  5EQA A;  4XEQ A;  4FBP A;  2XX7 A;  4XKQ A;  3MYU A;  3LSF B;  5JEI A;  5CBS A;  1DSN A;  1P1U A;  3EQ1 A;  4JVD A;  1DBZ A;  2F6G A;  3C31 A;  3K6X A;  3E9X A;  1B3F A;  4P8B A;  5A5X A;  1YYZ A;  1US4 A;  1YAE A;  3CI8 A;  1B51 A;  2XXH A;  1FPE A;  1P99 A;  3TPA A;  3FD3 A;  4Q5T A;  3S9M C;  2OCU A;  1NNF A;  4QSC A;  3KOT A;  5KDT B;  3V5A A;  2AIX A;  2CZI A;  1DPE A;  3T1B A;  1YCJ A;  3LSX A;  3O97 A;  5ICT A;  3H6W A;  3U92 A;  3TCG A;  3KN3 A;  4EQ9 A;  3VE1 B;  3TMG A;  4OTE A;  3IFC A;  5CRY A;  1SBP A;  3VLW A;  3RTW B;  4P0I A;  3K01 A;  1II5 A;  4OHN A;  2F7C A;  3OSR A;  3TTM A;  1LBZ A;  5H8Q A;  3LUZ A;  4DI3 D;  1LB9 A;  5I57 B;  2P2A A;  2VOZ A;  3T9X B;  1B3H A;  3S9L C;  1RDY A;  2YJP A;  2A5T B;  1FTL A;  2HPG A;  4KCD A;  4OVR A;  4EQ7 A;  1YPN A;  4NWC A;  3CFX A;  1LBX A;  2QRY A;  1D4N A;  3O6I A;  2Q2A A;  1US5 A;  2NUV A;  3FVN A;  3JV9 A;  1USY E;  1GTK A;  3L6G A;  4ZEI A;  1NUX A;  5BUU A;  3B8B A;  1AMF A;  3OD7 A;  4KXP A;  1OVT A;  2WBD A;  1BIY A;  4PP0 A;  4NN3 A;  2XXR A;  4JWX A;  1ZLQ A;  4GL8 A;  5B7D A;  1IIW A;  3W9W A;  2I49 A;  5I2N B;  1ZBM A;  4DE8 A;  4TQU Q;  5ITO A;  5I3S A;  4GWS A;  1MPD A;  4JBZ A;  4RPO A;  3H3G A;  2AL5 A;  1D9V A;  3ODB A;  3U94 A;  3DP6 A;  3G3K A;  3VXC A;  5I2K A;  3UP9 A;  1S50 A;  1EYK A;  1LLS A;  1TFA A;  2RCB A;  3CIJ A;  2R71 A;  3WAE A;  4E0X A;  1N76 A;  3DP8 A;  2Q2C A;  1MQJ A;  2AYS A;  1IZ1 A;  2P0S A;  2X7P A;  2OBG A;  3C34 A;  2XXK A;  3MJN A;  4NG7 A;  5H8F B;  3V89 B;  2Z22 A;  4LZ8 A;  4GX3 A;  4P11 A;  4F1V A;  3LBS A;  4I3Y A;  3RYD A;  3U65 A;  2RC9 A;  3SEW A;  1L5T A;  4NQ8 A;  3USD A;  2CEY A;  2B4L A;  4OVP A;  4X9T A;  3ONM A;  1SQY A;  2L5V A;  2R9J A;  3S4U A;  4YIC A;  1YZ0 A;  4FOR A;  2ZYK A;  4MJO A;  1MQH A;  4QFO A;  1JVY A;  3L6H A;  1SW4 A;  4N6P A;  3LV0 A;  3UK4 A;  3TQL A;  3TEL A;  1FTK A;  1AL3 A;  2XXU A;  2I4C A;  1IXH A;  4LA9 A;  2O1M A;  1XC1 A;  1WOD A;  1Q1K A;  2ZZV A;  4NMY A;  2Q8M A;  3O66 A;  1MPB A;  1B3L A;  1N7W A;  4MEV A;  3HST A;  1NH8 A;  4POX A;  2O84 X;  5A5L A;  1SI0 A;  1LBB A;  3CHG A;  4UAC A;  5B70 A;  2RC8 A;  1M5F A;  2B65 A;  3MPK A;  5H8H A;  2PT2 A;  1B2H A;  4OVJ A;  4RK2 A;  5F7V A;  3Q28 A;  5H8F A;  1MXW A;  3KSX A;  4QSD A;  3HFU A;  3A3C A;  3OO7 A;  4G61 A;  1LST A;  1KWH A;  4LZ7 A;  3H6U A;  3OSQ A;  4PAI A;  2DDK A;  1EYJ A;  4F3P A;  4GWX A;  4PBH A;  2B4M A;  3KBZ A;  2GRV A;  4U4S A;  4GFR A;  3T22 A;  1FTA A;  2F8D A;  2WX9 A;  3BBR A;  1N3W A;  1NV6 A;  5FTH A;  1CNQ A;  1OLC A;  4MHF A;  1EZP A;  3Q25 A;  5CMK A;  4PFU A;  1B0H A;  4OFJ A;  2VHA A;  3UOR A;  1BLF A;  2XD2 A;  4GL0 A;  2ESN A;  1IMC A;  1I6A A;  1P1N A;  3S9N C;  2QS2 A;  3OEL A;  4I40 A;  4N6K A;  2MKZ A;  1IMD A;  2UVH A;  1Y1M A;  3CRB A;  3HHG A;  5EQ7 A;  3IJO B;  3T9U A;  1B05 A;  1B3E A;  3FJG A;  5CMM A;  3UGW A;  4H0W A;  3QXM A;  2UVI A;  3PUW E;  4ZED A;  4P1L A;  4ECF A;  4NAP A;  5FHM A;  5ICQ A;  3FJ7 A;  5IGA A;  3HV1 A;  5IZ3 B;  4AS5 A;  3EKI A;  2QVU A;  3V8X B;  3RGY A;  2DE3 A;  5HPQ A;  1URS A;  3TYH A;  2VP1 A;  4IY6 A;  1OVB A;  3KN8 A;  4X1B A;  2NVU B;  4ZEK A;  2VD3 A;  5DTB A;  4FEB A;  1VDW A;  3M3K A;  4JSO A; 
#chains in the Genus database with same CATH homology
 2NWJ A;  1A54 A;  4F31 B;  3H7M A;  1FQD A;  3W15 C;  2PBW A;  1RYX A;  4NWD A;  5KCJ B;  1IXI A;  1TWY A;  4M4G A;  4ZZA A;  1MM7 A;  1UQW A;  4YMB A;  3ECR A;  3GBA A;  3K4U A;  3K6W A;  1UTB B;  3G3H A;  3SEX A;  1N0T A;  3E13 X;  4BDL A;  1RKM A;  1ATG A;  3VVD A;  2O69 A;  2ZXT A;  4EDP A;  5EHS A;  3K1M A;  5DEX A;  4F1Y A;  1B40 A;  2LAO A;  5H8S A;  1XVX A;  4ZS9 A;  3TTK A;  3IOU A;  3IB0 A;  3H6T A;  2V84 A;  1R6Z A;  3IOV A;  1F9B A;  2PT1 A;  5EYF A;  1IIT A;  4OWD A;  1IXC A;  1MDQ A;  4GOT A;  1ANF A;  1H44 A;  4OMB A;  4DLD A;  2IA4 A;  4NF5 B;  1CE2 A;  1D9Y A;  2Z8F A;  1MY0 A;  4ZE8 A;  5L9M A;  1SW2 A;  2ALU A;  2BJJ X;  4HCW A;  4YB6 A;  3PPQ A;  3TZA A;  1B4H A;  4F3S A;  2F6P A;  2HZL A;  2ONS A;  3G3J A;  4LVQ A;  2OLB A;  5TP9 B;  3OO8 A;  3DLN A;  4N07 A;  1P1W A;  2I0B A;  4WKM A;  2V3T A;  4G68 A;  5HM4 B;  2XXP A;  1EZ9 A;  2OWS A;  3GBB A;  3KG2 A;  2QS1 A;  3K1N A;  3KGC A;  4THI A;  2HQ0 A;  2I0C A;  2OJT A;  1IEJ A;  1JVX A;  1SW5 A;  5TPA B;  5JK4 A;  4DCY A;  4YB7 A;  3PUY E;  2I4B A;  2NOO A;  4YAH X;  1SW1 A;  3FJM A;  4X48 A;  1FQE A;  3PPR A;  3BFU A;  2DVZ A;  4ESX A;  5ITP A;  4OXV A;  2YPN A;  4FE8 A;  1R9Q A;  4C0R A;  3FZV A;  1XS5 A;  1URD A;  2DVC A;  1DPP A;  1AIV A;  3TKD A;  5AA3 A;  1XOC A;  1B5J A;  1BTJ A;  3CSG A;  5EHM A;  3U72 A;  3HPI A;  1MY2 A;  1MH4 A;  3U1O A;  2F35 A;  1UTH B;  4R2F A;  3VVE A;  5TP9 A;  2B3F A;  5F1Q A;  1MXU A;  4PFW A;  1Y4C A;  1Y4T A;  3SER A;  3D4C A;  4OQO A;  4FAJ A;  4U21 A;  3MPL A;  2O68 A;  5TU0 A;  1URG A;  3CVG A;  4H6D A;  4YMA A;  3LC8 A;  2XD3 A;  3FAT A;  3EN3 A;  1FQF A;  3OOA A;  3OEM A;  2Q88 A;  2HAV A;  3TAJ A;  2W7Y A;  3T9H B;  5LOM A;  2GH9 A;  4HCY A;  1JW1 A;  2Y7K A;  4IB2 A;  3PD8 A;  4EUO A;  3IL1 B;  2VGQ A;  2XXV A;  1USY H;  2H98 A;  4ZEF A;  2I3V A;  5H8N B;  1MY1 A;  4YB5 A;  3IO4 A;  4DXB A;  4H8J A;  1MXZ A;  3FIR A;  4WEP A;  2GFE A;  4H65 A;  2F78 A;  4JXI A;  4U23 A;  1VFD A;  2HAU A;  1SDX A;  4JWY A;  4GVO A;  1B0L A;  2ABH A;  4ZE9 A;  1A99 A;  3KSJ A;  4F3B A;  3K1P A;  3T93 B;  4IO4 A;  4KYD A;  1NH7 A;  3VLU A;  4YZZ A;  4RNS A;  3IOW A;  4IO3 A;  1GR2 A;  1O7T A;  3OXN A;  4GD5 A;  1UIU A;  3N6T A;  4NF6 B;  4DXC A;  3C33 A;  5I59 B;  1S7Y A;  1MXV A;  3LSW A;  1MH3 A;  1JET A;  5KDT A;  1WDN A;  3TCF A;  4BDM A;  4DIG A;  4U1O A;  1ZMG A;  2QS3 A;  3KZG A;  4MLV A;  4F2O A;  3N5L A;  3TOD A;  5KZT A;  5FHO A;  1FTO A;  3HN0 A;  2XXQ A;  1MS7 A;  4QF9 A;  5I57 A;  1N84 A;  3FXU A;  4ELQ A;  5CC2 A;  5CI5 A;  3TTR A;  4HTG A;  2A5T A;  3KFM A;  2B3B A;  1A8F A;  1LCT A;  1P1O A;  2DXY A;  4AB5 A;  2XX9 A;  2V93 A;  4RY1 A;  1QUK A;  3BKI B;  4ESW A;  4JB7 A;  1H45 A;  3O28 A;  3IO6 A;  3MVX A;  1I69 A;  4BLA A;  4H67 A;  2H5Y A;  5DYH A;  4IGT A;  3DP4 A;  3K00 A;  5I59 A;  5I2N A;  1VR5 A;  2ONR A;  2D5W A;  4EXL A;  1QVS A;  3QAX A;  2P1S A;  4ONY A;  1SD3 A;  4ND9 A;  3ZSF A;  3PMV A;  4H5F A;  4EXK A;  1MQI A;  3BFT A;  3C36 A;  3EHT A;  3S2V A;  1MRP A;  4PFT A;  1ZIU A;  1Y3N A;  4QFL A;  2UYF A;  1PDA A;  1QKB A;  2V25 A;  3IX1 A;  3I6V A;  1B58 A;  1JW4 A;  3JZJ A;  4X1D A;  3RPW A;  5AA4 B;  2GHB A;  2R6G E;  2Y7P A;  2OWT A;  1QJM A;  3RLF E;  1LAH E;  1EZO A;  4I9D A;  4F29 A;  2Y7I A;  1MPC A;  2ZMB A;  4F18 A;  2FYI A;  4YKI A;  1VFE A;  3I5O A;  4HS7 A;  4OEN A;  2XXX A;  5DVI A;  1QW0 A;  3VXB A;  3TUS A;  5I56 B;  3WAF A;  2VD2 A;  5L9O A;  4GIZ A;  4EF2 A;  3QSL A;  3KJ7 A;  4Z7E A;  4IO2 A;  1Y9U A;  4H5G A;  5CM6 A;  2M8C A;  3M3L A;  3T66 A;  1A7L A;  1B7U A;  1M5B A;  3AXF A;  2ZYM A;  5HBC A;  1YTV A;  2RKM A;  2ZNS A;  3C32 A;  4WED A;  1MY3 A;  5K2Y A;  2H99 A;  3RNN A;  4U4X A;  3F11 A;  4ISU A;  1M5C A;  1XT8 A;  3LSL A;  1BKA A;  1FCK A;  4R2B A;  5CMC A;  1I6B A;  1MY4 A;  4RJZ A;  3T9V A;  2CZL A;  2I6E A;  3GXA A;  4G68 C;  4QHQ A;  4F22 A;  4ELO A;  1DMB A;  3MBP A;  4XXU A;  1VE4 A;  4R73 A;  3B6T A;  2XXI A;  5AA4 A;  4OET A;  3VFJ A;  2UVG A;  3PMX A;  1ZJL A;  4QFP A;  1SVX B;  4R6K A;  3FV1 A;  3PV0 E;  5DVF A;  5AA2 B;  1H76 A;  2F36 A;  1GV8 A;  4I1D A;  4O3C A;  3MP6 A;  4K3F A;  3MAM A;  5FHN A;  2D21 A;  2ZNT A;  4PET A;  4ELP A;  4TLL B;  3IB1 A;  2Q8J A;  1VSO A;  3QUF A;  1QUL A;  3QK6 A;  4NF4 B;  3OO9 A;  1N3X A;  1A55 A;  1HSJ A;  1LFH A;  4BDQ A;  3PPN A;  4KR5 A;  2F7B A;  3ILU B;  4ZEB A;  4ELR A;  3FVK A;  3MUQ A;  1Q35 A;  3TTN A;  2WKY A;  3I3V A;  2V3U A;  5I58 B;  3UIF A;  1JQF A;  4NF8 B;  5ISU A;  3O9P A;  2ZYO A;  1PB7 A;  3MW0 A;  2X7Q A;  2HXW A;  1A8E A;  2HEU A;  4MF3 A;  2DS9 A;  2O51 A;  3N26 A;  3M8U A;  3OEN A;  1DTG A;  1CB6 A;  4GXS B;  4AQ4 A;  3IOT A;  5KCJ A;  2NXO A;  3UN6 A;  2ZYN A;  1UTB A;  1B1H A;  3SKP A;  2XX8 A;  2I48 A;  1LFG A;  3KOS A;  1TT1 A;  1GGG A;  1B6H A;  3RY3 A;  5A5X B;  2Y84 A;  1SYH A;  1Y1Z A;  2E1S A;  4NF4 A;  1JEV A;  4MLQ A;  3IAZ A;  1NKX A;  2REG A;  4JDF A;  1ZTY A;  4YKP A;  4F2Q A;  1B4Z A;  5AA1 A;  1JW5 A;  2Q9T A;  1QUJ A;  1MXX A;  4BDO A;  3N94 A;  4QFN A;  1D3K A;  1B46 A;  3PUX E;  4Z0I A;  2QSX A;  1LBC A;  4NF5 A;  5M2V A;  2H4I A;  1J1N A;  4GXA A;  4M1V A;  5AE4 A;  4FJP A;  1B52 A;  2ONK E;  1Y3Q A;  1LCF A;  4LP2 B;  4G77 A;  3PU5 A;  2PVU A;  3FVG A;  1O63 A;  3FGS A;  1M5D A;  2QL3 A;  4KFQ A;  3B6Q A;  3SEY A;  4EQB A;  1M5E A;  3MZ1 A;  3RTF B;  2DWI A;  1TXF A;  4TOZ A;  3LUY A;  1R1N A;  1FW0 A;  1XVY A;  2QMW A;  4WXJ A;  4RK9 A;  2PMS A;  3K0V A;  4LQ5 A;  3E4R A;  1QKA A;  3H4Z A;  5TPA A;  2OZZ A;  3UA8 A;  3H06 B;  3SET A;  4N13 A;  4BDR A;  5I2K B;  3KN7 A;  3H6V A;  4KD5 A;  1B1X A;  4RXL A;  3FXQ A;  4YKK A;  3PPP A;  3TQW A;  2RC7 A;  3C35 A;  3CR9 A;  1I6Q A;  1WVJ A;  1POT A;  3GZG A;  1O64 A;  3RN8 A;  3PD9 A;  4I8C A;  3QUJ A;  4HW8 A;  3MQ9 A;  3R26 A;  4OER A;  4XTC Q;  4KCC A;  1UTH A;  3TCH A;  5IKB A;  4DDD A;  3R6U A;  1LAF E;  1MQD A;  3SEU A;  2DOJ A;  1OIB A;  4Q0C A;  4KPT A;  2DE2 A;  4C1T A;  2XHD A;  3M3F A;  1R9L A;  4RA1 A;  2DWA A;  4R6H A;  2QPQ A;  3JYR A;  1A40 A;  3MP8 A;  4OEU A;  2Z8E A;  3MWB A;  4LZ5 A;  3MZB A;  3M3K A;  4XKN A;  3GLB A;  4MH5 A;  3OEK A;  2THI A;  4GF8 A;  1NMU A;  2QMX A;  1FQC A;  4OFL A;  2REJ A;  4UA8 A;  3TTL A;  4Q8R A;  2DXR A;  4IGR A;  4P0G A;  5H8N A;  5CBR A;  3N6U A;  1HSE A;  3V83 A;  2FNC A;  4E0W A;  4U22 A;  3G7W A;  5L8D A;  5FTI A;  3K6V A;  5H8H B;  1MM6 A;  2DP8 A;  4PFY A;  1FTJ A;  3SDF A;  4DXU A;  3RT6 B;  4I62 A;  4XIG Q;  3MC2 A;  1EH3 A;  2O7U A;  2Y7R A;  2O6A A;  1Z7N E;  1LB8 A;  1B5I A;  4KYE A;  4PQJ A;  3ILT B;  4R9F A;  4R75 A;  3G3F A;  4MFI A;  4ZEC A;  4GLI A;  4OEV A;  4NF6 A;  4F1U A;  4G4P A;  1Y20 A;  3A3U A;  1UIV A;  1B7Z A;  4DCX A;  4F3G A;  3Q26 A;  4QFK A;  3QIM A;  2HZK A;  4H8I A;  3DM0 A;  1Z7M E;  2XXT A;  3TEP A;  2Z8D A;  1P1Q A;  3PMW A;  1OMP A;  2IEE A;  5ELV A;  3A09 A;  4U1Z A;  1IQ7 A;  5J1D A;  1PB9 A;  4L17 A;  4OES A;  4DZ1 A;  3CG1 A;  3O2A A;  3ZKK A;  3CG3 A;  2DWH A;  1NL5 A;  4IO7 A;  1ZU0 A;  1GVC A;  3S9E A;  2UVJ A;  4POW A;  2DE4 A;  3QYT A;  4JSD A;  2V3Q A;  3MZ9 A;  1OLA A;  2KLF A;  4U2R A;  1MQG A;  3Q29 A;  2DYX A;  4OFO A;  3CSB A;  1N04 A;  2DWJ A;  2QS4 A;  3VLV A;  2H25 A;  3E3K A;  1JNF A;  3FXR A;  3FV2 A;  3PPO A;  3RT8 A;  2D3I A;  4QSE A;  1NFT A;  4F19 A;  2O1L A;  3IB2 A;  4JWO A;  5I84 A;  4KQP A;  3FVO A;  3R7X A;  3D4G A;  3THI A;  3VDF A;  4NED A;  4R9G A;  1EU8 A;  5K2X A;  3MVY A;  4RYA A;  3G3I A;  2Z23 A;  5L9S A;  2YLN A;  3H03 A;  5DEX B;  4LQ2 A;  1AH5 A;  3ZS6 A;  4IY5 A;  5JTY B;  3VV5 A;  1PC3 A;  2RF1 A;  3T96 B;  5CMB A;  4RPN A;  1MG1 A;  2ANJ A;  3G3G A;  3PGF A;  1QUI A;  3IK6 B;  4H1X A;  4OYV A;  2CMO A;  3CFZ A;  4NTL A;  3MVZ A;  4KYS A;  3MVW A;  2Y7W A;  4O3A A;  1LAX A;  1POY 1;  4G8N A;  2I58 A;  1N7X A;  3HO7 A;  3EPE A;  4GQO A;  2H9B A;  5IAI A;  4IO5 A;  1SYI A;  3HCQ A;  3MP1 A;  3SEV A;  4XKP A;  1B32 A;  1H43 A;  4LON B;  1HSL A;  2UXA A;  5I56 A;  2E0S A;  4MBP A;  2O7I A;  2PYY A;  2G29 A;  3KJT A;  2DQV A;  3CFL A;  4BDN A;  1XHY A;  4G68 B;  4XKR A;  4AB6 A;  5DVJ A;  4R74 A;  4FED A;  4PE5 B;  2A5S A;  1NNK A;  3TDJ A;  4LAT A;  5AA2 D;  3HHF A;  2I3W A;  1PBQ A;  4R72 A;  1FQB A;  3U93 A;  5JTY A;  2RCA A;  4G8H A;  1PBP A;  3EF7 A;  1NNP A;  1ELJ A;  1S9T A;  3U8Q A;  1DTZ A;  1MXY A;  2F97 A;  4YKJ A;  1FQA A;  2HCA A;  3FUZ A;  1AOV A;  3VVF A;  1B5H A;  1B3G A;  2AL4 A;  1LGB C;  4G8M A;  1B7H A;  2PX1 A;  4YU0 A;  5DT6 A;  1TFD A;  4G2Z A;  3IR1 A;  3SES A;  1OQH A;  2X26 A;  3OMB A;  1B9J A;  4GWO A;  2OK2 A;  3Q27 A;  4LUB A;  1MDP 1;  3RQT A;  2RIN A;  3K6U A;  2ZNU A;  3O6G A;  3KBR A;  5AA2 A;  4FIM A;  3O29 A;  4GRK A;  5BWJ A;  1LFI A;  3TFL A;  4FEC A;  3PUV E;  3LR1 A;  3DEL B;  4IO6 A;  2XXY A;  1IXG A;  1JEU A;  3K02 A;  3PUZ E;  4QRZ A;  2QJE A;  3B7D A;  3EHU A;  1T0K A;  4KI0 E;  4F39 A;  4O3B A;  2F34 A;  1Y3P A;  1OQG A;  3OO6 A;  2HFB A;  1SI1 A;  2F5X A;  4TLM B;  4KHZ E;  3RUM A;  2FA7 A;  3KEI A;  4NE4 A;  3ZKL A;  4C1U A;  1H3D A;  4OZ9 A;  4Q30 B;  5I58 A;  3IJX B;  2Q89 A;  1FTM A;  3C9H A;  3C4M A;  3EHS A;  1DOT A;  3B6W A;  4NF8 A;  3K2D A;  5H8Q B;  1NNT A;  4ZDM A;  4EF1 A;  4R6Y A;  1BP5 A;  1PEB A;  2F7A A;  1LAG E;  2XXW A;  2G93 A;  4FAT A;  1PB8 A;  3P7I A;  3FAS A;  1ZKB A;  2DSF A;  3IOR A;  1IUD A;  3O6H A;  2GHA A;  3W9V A;  1RYO A;  2UYE A;  2XX7 A;  4XKQ A;  3LSF B;  5JEI A;  5CBS A;  1DSN A;  1P1U A;  3EQ1 A;  2F6G A;  3C31 A;  3K6X A;  3E9X A;  1B3F A;  5A5X A;  1US4 A;  1YAE A;  3CI8 A;  1B51 A;  2XXH A;  1P99 A;  3TPA A;  3FD3 A;  4Q5T A;  3S9M C;  2OCU A;  1NNF A;  4QSC A;  3KOT A;  5KDT B;  3V5A A;  2AIX A;  1DPE A;  1YCJ A;  3LSX A;  3O97 A;  5ICT A;  3H6W A;  3U92 A;  3TCG A;  3KN3 A;  4EQ9 A;  3VE1 B;  3TMG A;  4OTE A;  5CRY A;  1SBP A;  3VLW A;  3RTW B;  4P0I A;  3K01 A;  1II5 A;  4OHN A;  2F7C A;  3OSR A;  3TTM A;  5H8Q A;  1LB9 A;  5I57 B;  2P2A A;  2VOZ A;  3T9X B;  1B3H A;  3S9L C;  2YJP A;  2A5T B;  1FTL A;  4KCD A;  4EQ7 A;  1YPN A;  4NWC A;  3CFX A;  2QRY A;  1D4N A;  3O6I A;  2Q2A A;  1US5 A;  2NUV A;  3FVN A;  3JV9 A;  1USY E;  1GTK A;  3L6G A;  4ZEI A;  5BUU A;  1AMF A;  3OD7 A;  1OVT A;  1BIY A;  4PP0 A;  2XXR A;  4JWX A;  1ZLQ A;  4GL8 A;  5B7D A;  1IIW A;  3W9W A;  2I49 A;  5I2N B;  1ZBM A;  4DE8 A;  4TQU Q;  5ITO A;  1MPD A;  4JBZ A;  4RPO A;  3H3G A;  2AL5 A;  1D9V A;  3ODB A;  3U94 A;  3DP6 A;  3G3K A;  3VXC A;  5I2K A;  3UP9 A;  1S50 A;  1LLS A;  1TFA A;  2RCB A;  3CIJ A;  2R71 A;  3WAE A;  4E0X A;  1N76 A;  3DP8 A;  2Q2C A;  1MQJ A;  2AYS A;  1IZ1 A;  2P0S A;  2X7P A;  2OBG A;  3C34 A;  3MJN A;  5H8F B;  3V89 B;  2Z22 A;  4LZ8 A;  4P11 A;  4F1V A;  3LBS A;  2RC9 A;  3SEW A;  1L5T A;  3USD A;  4X9T A;  3ONM A;  1SQY A;  2R9J A;  3S4U A;  4YIC A;  4FOR A;  2ZYK A;  1MQH A;  4QFO A;  1JVY A;  3L6H A;  1SW4 A;  4N6P A;  3UK4 A;  3TQL A;  3TEL A;  1FTK A;  1AL3 A;  2XXU A;  2I4C A;  1IXH A;  4LA9 A;  2O1M A;  1XC1 A;  1WOD A;  1Q1K A;  4NMY A;  3O66 A;  1MPB A;  1B3L A;  1N7W A;  3HST A;  1NH8 A;  4POX A;  2O84 X;  1SI0 A;  1LBB A;  4UAC A;  5B70 A;  2RC8 A;  1M5F A;  2B65 A;  3MPK A;  5H8H A;  2PT2 A;  1B2H A;  4OVJ A;  4RK2 A;  5F7V A;  3Q28 A;  5H8F A;  1MXW A;  3KSX A;  4QSD A;  3A3C A;  3OO7 A;  1LST A;  1KWH A;  4LZ7 A;  3H6U A;  3OSQ A;  4F3P A;  2GRV A;  4U4S A;  4GFR A;  3T22 A;  2F8D A;  3BBR A;  1N3W A;  5FTH A;  1OLC A;  1EZP A;  3Q25 A;  5CMK A;  4PFU A;  1B0H A;  4OFJ A;  2VHA A;  3UOR A;  1BLF A;  2XD2 A;  4GL0 A;  2ESN A;  1P1N A;  1I6A A;  3S9N C;  2QS2 A;  3OEL A;  2UVH A;  1Y1M A;  3CRB A;  3HHG A;  3IJO B;  3T9U A;  1B05 A;  1B3E A;  3FJG A;  5CMM A;  3UGW A;  4H0W A;  3QXM A;  2UVI A;  3PUW E;  4ZED A;  4ECF A;  5FHM A;  5ICQ A;  3FJ7 A;  3HV1 A;  3V8X B;  3RGY A;  2DE3 A;  5HPQ A;  1URS A;  3TYH A;  2VP1 A;  4IY6 A;  1OVB A;  3KN8 A;  4X1B A;  2NVU B;  4ZEK A;  2VD3 A;  5DTB A;  4FEB A;  4ZZE A;  4JSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...