5I7IA

Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-crystallized 3-hydroxybenzoate
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
318
structure length
318
Chain Sequence
EVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKPPQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQEYVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIKSAADLNGMKMRGPTRVITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTKAHTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQLWDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEKDWIKSANDRGLDGAMLVKTAKDLISKYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP solute Binding Protein
publication title Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157) in complex with co-purified 4-hydroxybenzoate
rcsb
source organism Uncultured marine bacterium
total genus 120
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5i7iA00
4PAKA 4PFBA 2HPGA 4P9KA 4NQ8A 4MX6A 2XWOA 4PDDA 4N6KA 3B50A 4NAPA 4N15A 5LTCA 4XEQA 2CEYA 4NX1A 2PFZA 2ZZXA 4PBHA 2XWIA 4LN5A 4PFIA 4N6DA 4YZZA 4OVSA 4OVRA 4PF6A 2ZZVA 2XWVA 4PC9A 2ZZWA 4DI3D 2XXKA 4N8YA 2CEXA 4OVQA 4MNCA 4PDHA 4N4UA 2WYPA 4OA4A 4OANA 4MCOA 4OVTA 4P1LA 3GYYA 4PAIA 4PBQA 2HZLA 2HZKA 4NG7A 4XFEA 4PETA 3FXBA 2V4CA 4DI4B 4N8GA 5I7IA 4MMPA 5I5PA 4MHFA 2VPNA 2WYKA 4PFRA 4NF0A 4X04A 2XA5A 4NN3A 5CM6A 5IM2A 4N17A 4PF8A 4O8MA 4MIJA 4PAFA 4MNIA 2VPOA 4NGUA 4XF5A 2PFYA 4MNPA 4X8RA 4MAGA 2XWKA 4PCDA 2WX9A 4OVPA 4PGPA 4NHBA 4O94A 4O7MA 3U65A 4PGNA 5IGAA 4PE3A 4UABA 4P56A 4MEVA 4N91A 5IZZA 4P1EA 4P8BA 4P47A 4YICA 4P3LA
chains in the Genus database with same CATH superfamily
2XXWA 1FPGA 4R6YA 1ZTYA 2Y5KA 1TFDA 4HXVA 1BIYA 3QIMA 1RDZA 2Y7KA 2REJA 3QXMA 4AS4A 4F1VA 4XIGQ 5AA2B 1MQJA 5LTCA 3OXNA 3G7WA 1IXHA 1XOCA 2CEYA 4GQOA 4HE2A 3HN0A 3RGYA 3TTLA 1SVXB 4ELPA 1MY4A 2XX7A 3MPLA 1IXIA 4LZ7A 3EHUA 4C0RA 3LC8A 4JVCA 2OJTA 2HEUA 1MG1A 3O9PA 4C1TA 2Z8FA 4UACA 2Q2AA 2Q8MA 4I3YA 4YKPA 2B4MA 1MH3A 3MZBA 5I5PA 3RPLA 4DE8A 3C31A 5ET8A 2AIXA 2PMSA 4KYDA 1FBGA 4MNIA 5AA1A 2VPOA 4IB2A 2PFYA 3JYRA 4TLMB 4RJZA 2O1LA 3OOAA 2PVUA 2RCAA 4NWCA 1D9QA 1H45A 4LZ8A 4OEVA 4BDQA 1D9VA 1LFHA 4IGTA 5TP9A 4PFTA 4BDMA 5A5XB 4YICA 1Y4CA 1G0IA 4GD5A 3K6VA 4IO4A 2FVZA 3G3HA 2ZYMA 2Y7PA 3FVGA 3PUZE 1LAFE 3IR1A 3VLVA 3AXFA 4XEQA 1USYH 2W7YA 1FTLA 4BDRA 3QK6A 1NV7A 4MH5A 5H8FA 4GFRA 1MM6A 4YB7A 2QVRA 1DPPA 3A3UA 2AYSA 4PC9A 3N94A 1Z7ME 4R2BA 1N84A 3PU5A 3LUZA 5CMKA 2OWSA 3OSQA 4M1VA 3T96B 4DI3D 3OELA 1QUJA 1L5TA 3FVNA 1Y4TA 1SYHA 3RTFB 1FBFA 4LUBA 4YKIA 4RPOA 4POXA 2HCAA 5TPAB 4EUOA 1LEVA 4NG7A 3KOTA 3B7DA 1EZOA 2RC7A 2WBDA 1NUZA 4MHFA 5AA2D 1LB9A 3MPKA 2WEFA 1EYIA 1PBPA 1MY0A 3LSXA 1NFTA 1XVYA 3E79A 1B58A 1Y3QA 3V83A 4DZ1A 4QFNA 4MIJA 2ZYOA 3UA8A 4JDFA 1B3LA 2ZMBA 4X8RA 5L9MA 1B3GA 4OVPA 5DYHA 4Q0CA 3SEYA 2BJJX 4EDPA 3USDA 4F19A 4N91A 3TCGA 1LFGA 3IOUA 4G2ZA 3JZJA 2OBGA 3K1MA 1OVTA 3OO8A 2DWJA 5IZ3B 2H5YA 2O1MA 3CR9A 1P1NA 2PFZA 1LBCA 2OX3A 1FQAA 1H44A 2R9JA 1PDAA 1BP5A 4ZE9A 3U94A 3TFLA 1MPCA 4JBZA 2B4LA 4HTGA 5KCJA 3T93B 4MNCA 3H6WA 3MP1A 4NE4A 3K2DA 4OA4A 1LBBA 3BBRA 5CMMA 1R9LA 3IAZA 4MLQA 5ITOA 4GX3A 3PPOA 3TTMA 4AQ4A 4KI0E 5ICTA 2CZHA 4N8GA 5I7IA 1LLSA 4ZE8A 5TPAA 4OXVA 4BDLA 3DP4A 5EYHA 3N5LA 3IB2A 3FBPA 3ZS6A 4MBPA 3D4GA 4GLIA 4FAJA 2Q89A 4C1UA 1MRPA 4KCCA 2I6EA 3K0VA 2H98A 4FATA 2VHAA 4F3GA 3EF7A 4PP0A 1ZIUA 5CC2A 1CNQA 3H6VA 4NF4B 4P56A 1JW1A 2FIEA 4AS5A 1PEBA 4EF2A 1VDWA 3FVKA 4XKRA 3F11A 1TXFA 1AOVA 1DK4A 4DIGA 4ZECA 5I56A 2P3NA 3PMVA 1M5CA 1VE4A 2FA7A 2UVGA 4JWOA 4PDDA 3C36A 4QBAA 2F36A 4G77A 2PCRA 4GXSB 3H6UA 3MVYA 1SI1A 3W15C 4PTKA 4LATA 3TTKA 3T0JA 3FJGA 4PBHA 3TAJA 4LN5A 1MPBA 4P11A 1JVXA 5I2NB 2OWZA 2I0BA 1US5A 4PF6A 4EXLA 2XX8A 2XXRA 3UN6A 4BLAA 3G3FA 3MW0A 4OETA 2ONSA 3VE1B 1LCTA 3TELA 5J1DA 1B40A 1HSJA 1USYE 3QSLA 2P2AA 2L5VA 1SD3A 4X9TA 4MMPA 3SEVA 5EYFA 1NV6A 4BDOA 2P1SA 4H8JA 3MQ9A 4NF0A 4DXUA 3T1BA 1SQYA 2F8DA 4X04A 2QPQA 3C35A 5H8HB 2MKZA 4R6HA 4OERA 1B05A 2RKMA 4ZEDA 4O8MA 3UORA 4PAFA 4NF6A 1GVCA 3IOTA 4ZDMA 1IXCA 4QSEA 3E9XA 2Q8JA 1OIBA 1M5BA 3TQLA 2O51A 4XKQA 3KGCA 4DCXA 4ZEFA 2Y7IA 2DE3A 4UABA 2OK2A 2VD3A 2GFEA 2VOZA 2O84X 4GL0A 3ILTB 4NF4A 2HPGA 2VD2A 4QFKA 4MX6A 2QSXA 4P0GA 3KSJA 1Y9UA 3U1OA 4RXLA 1HSLA 5I59B 5I2KA 1N0TA 5CBRA 1I6QA 3PPPA 2XXUA 3U93A 3S4UA 1DTGA 1FTAA 4MF3A 3M8UA 3RQTA 2OLBA 5EYGA 1NI9A 4H6DA 1MXVA 1QUIA 3W9VA 3U8QA 3LSWA 2Y5LA 2NXOA 4RY1A 5HBCA 3CFXA 3ECRA 3GYYA 1FPEA 3OEKA 3MZ9A 5ET6A 4HE1A 3SDFA 1FW0A 1A7LA 2DYXA 3KOSA 1I69A 4RNSA 2PBWA 1LGBC 3QUJA 1MY1A 2V3UA 4LZ5A 5BWJA 1KZ8A 2CZLA 3HPIA 3SZPA 2E0SA 1NV3A 2F7CA 1FBEA 3U72A 3I5OA 5CM6A 1N7WA 1XS5A 1FBDA 3PPQA 1HSEA 4LA9A 4KQPA 4I1DA 3UIFA 4H45A 5K2XA 4HE0A 3PMXA 3RPLB 1F9BA 4FEBA 5JK4A 1Y1ZA 1FSAA 3CSBA 1BK4A 1MXZA 5EQ8A 2NWJA 1FQBA 3UK4A 4PGPA 3N6TA 5HPQA 3U65A 2NVUB 3OD7A 2ONRA 4QSCA 3VVFA 3OO9A 2A5TA 2ZYKA 3E13X 1O7TA 1URGA 2UVIA 3OO6A 3OMBA 2QS1A 2I49A 5TP9B 1BLFA 1JW4A 1BTJA 3CFLA 3EN3A 3PPNA 4GWSA 5FHMA 2F6PA 4RYAA 3CIJA 3C34A 1DPEA 2QVUA 2ZZXA 3TCFA 2VT5A 5H8QB 3KN8A 1I6BA 1EZPA 3NOHA 3PUVE 5H8FB 3LBSA 4R72A 3KJ7A 4N4UA 5AA4B 4OANA 3H6TA 5K2YA 1KA1A 2Y7WA 3ISPA 2ANJA 5CI5A 1JVYA 4JWXA 4XFEA 1IUDA 5H8NA 1N3WA 3UGWA 3OSRA 4PFRA 1P99A 1AWBA 1TFAA 1FQEA 2QMXA 3CG3A 1URDA 3FASA 2Q88A 2DWIA 4NN3A 2GHAA 4IY6A 2IA4A 4N17A 4THIA 4YB5A 2X7PA 3TKDA 3CVGA 1LAXA 1UIVA 1VFEA 4JXIA 1UTBA 1POY1 1CB6A 1NKXA 4MFIA 4F18A 1AL3A 3HCQA 3KBRA 1NV1A 2A5SA 5ESYA 3SEWA 5B7DA 2CZKA 4R9FA 3RTWB 3G3JA 3RNNA 1A99A 4RPNA 4AB6A 3B6TA 3SESA 3FZVA 4X1DA 4G8MA 3B50A 5FHNA 4E0WA 2FYIA 3LV0A 3M3KA 4U22A 1IMBA 3BIHA 5DTBA 1QVSA 2DP8A 3BFUA 3G3IA 4U4SA 1LAGE 3O97A 5H8QA 3MVXA 1FQCA 4OFLA 4FIMA 4OVQA 4ESXA 5LOMA 4OVJA 1OVBA 3VDFA 1N7XA 4U4XA 4P1LA 5DVIA 3PUYE 3T9HB 4DLDA 5KCJB 1LBZA 4GBVA 5AA4A 1B2HA 3FV1A 4HW8A 3IORA 3MBPA 1DOTA 2Z23A 3IJOB 3MYUA 3KN3A 2ABHA 3HV1A 4GWWA 4LONB 2XA5A 2OWTA 3LR1A 4G8NA 5CMCA 4H1XA 4OFJA 4XTCQ 2V25A 4PFWA 3MJNA 4MNPA 3ZSFA 4GOTA 4F3PA 3C32A 4PE3A 5FHOA 1Y20A 3K4UA 3CRBA 1DCUA 4RA1A 4P3LA 5DEXA 4G4PA 5KDTB 2ALUA 2AL5A 3JV9A 5L8DA 4OTEA 4NAPA 1M5DA 3DLNA 4PE5B 3R6UA 4JWYA 1PB7A 4K3FA 4KPTA 4DXBA 5I56B 1US4A 4DXCA 1QGXA 3C9HA 4EQ7A 3MP6A 3TTRA 4G8HA 4GWYA 4GX4A 4N6DA 2PT1A 3EHSA 4OVSA 2HXRA 3MC2A 4Z7EA 1IMAA 5IZ1A 4QRZA 2CEXA 1INPA 3Q26A 3G3KA 1ZU0A 1A40A 4GF8A 4AB5A 1S7YA 3PUWE 1IZ1A 1O63A 1QUKA 1YCJA 4G61A 3IOWA 5ICQA 1WVJA 3LSLA 2XXYA 4WEPA 4NEDA 3UP9A 3TODA 3TCHA 1CE2A 1FPIA 5DT6A 5FBPA 2DE2A 4POWA 1IMCA 1AIVA 1AH5A 1B9JA 5I57A 5IAIA 2Q9TA 2ZNUA 1GGGA 4IO3A 1WDNA 2UYEA 4ECFA 3A09A 2O68A 4XF5A 3GBAA 1T0KA 1YPNA 3ZKKA 3T22A 4WXJA 4ESWA 1FBCA 1JETA 4PGNA 1MXUA 4LVQA 2R71A 3V5AA 4XKNA 4NF6B 4FEDA 2KQZA 1LFIA 1A8EA 3IK6B 1ATGA 4PAKA 2YPNA 1SW4A 3TPAA 4ND9A 4P9KA 2XWOA 4KXPA 1MM7A 4JB7A 4PQJA 2XXXA 3KJTA 2REGA 5KDTA 2P3VA 3T9UA 4O3CA 1ZMGA 4DDDA 4I8CA 5EQ9A 4F2QA 3ZKLA 1QULA 3SETA 4YMAA 5I2KB 4R73A 4WKMA 2XXKA 4N8YA 2DVZA 2P0SA 3IL1B 1PC3A 2H99A 2Q74A 2DOJA 2QS2A 4O7IA 4RK9A 3Q25A 1MXWA 1ZBMA 1NV5A 4G68A 4NF8A 3ODBA 4TQUQ 4IO6A 4LQ5A 4I40A 1IXGA 4YKKA 3O28A 3IFCA 1OLCA 1P1UA 3SERA 5A5LA 3PUXE 2DS9A 1B6HA 2H25A 4R75A 1Z7NE 4GBWA 1NNTA 5CBSA 5J16A 3IB1A 1H3DA 1P1QA 3IFAA 1WODA 3CFZA 4IGRA 1XVXA 4ZS9A 3FATA 1D4NA 1QW0A 2XX9A 4GWXA 3PTYA 1NNKA 1YZ0A 2HHMA 2XWKA 4NHBA 2F3DA 3K1NA 4OEUA 2HAUA 3K1PA 2O69A 4GIZA 1SW2A 4F3SA 3V89B 3H7MA 1B1XA 1MQHA 3MWBA 1DBZA 2A5TB 3GXAA 2VP1A 2FIXA 1IMDA 1SW1A 2IEEA 3DP6A 5DW8A 4F1UA 2KLFA 3O6IA 2XWIA 4ZEKA 3TMGA 3IOVA 1OQGA 1B5JA 1FBPA 3QMFA 3MVZA 2RCBA 1NH7A 4YAHX 2XXPA 4I3EA 4GL8A 4IR8A 1NH8A 4MLVA 2V93A 4HS7A 4N6PA 4KCDA 5EQ7A 2RC9A 1LB8A 1MDQA 1FRPA 1Q9DA 1FCKA 4XKPA 3IO6A 2HZLA 1IMFA 1LCFA 3S9EA 2F3BA 2GHBA 1B0LA 3IB0A 4ZEIA 1LBVA 1TT1A 2GQ1A 2D21A 1QJMA 2QS3A 2I3WA 2I48A 5H8NB 1MDP1 1PB9A 1N76A 5DVFA 1B3EA 2B3BA 2Z22A 2V84A 4OENA 3IO4A 4R9GA 1MH4A 5TU0A 3K6WA 5AA3A 2WX9A 4KYSA 4O94A 5ELVA 1I6AA 4QSDA 1FJ9A 4EXKA 3OENA 5ISUA 1FPJA 1VSOA 2Q2CA 1UTBB 2G29A 1IQ7A 3TZAA 5F7VA 3KN7A 4PFBA 5AE4A 3BIGA 1K9YA 1NL5A 3VLUA 4H5FA 4H67A 4ZEBA 3D1RA 5I3SA 2LAOA 4N15A 3I6VA 3KC0A 2H4IA 2QS4A 3O6HA 1NNPA 4F2OA 1NV0A 4U2RA 1EYKA 3WAEA 1B46A 2ZZVA 3B6QA 1SYIA 1PB8A 2KR0A 2F7BA 1JNFA 4JVDA 3E3KA 2D5WA 1YYZA 4FBPA 5ET5A 2CZIA 4IO5A 1AMFA 1N3XA 2QL3A 1FTOA 4Q30B 4F31B 2OZZA 2I58A 2QRYA 4GVOA 2DWAA 3FXBA 2V4CA 3EPEA 4H0WA 2XXIA 3FUZA 1SBPA 1D9YA 4GXAA 3QYTA 4QXDA 2R6GE 1FPFA 3HHFA 5B70A 1RDYA 1MPDA 3GZGA 3KFMA 1URSA 2I0CA 4QFOA 2DWHA 1VR5A 3H4ZA 1NUYA 1H76A 3RT6B 2QMWA 1NUXA 2QVVA 2THIA 1FPKA 3M3LA 4NTLA 5EHSA 4KYEA 1A55A 4XXUA 2AL4A 1OLAA 1MQIA 5IZZA 4P1EA 4P8BA 4GRKA 3MSTA 3I3VA 3S9MC 4U1OA 1EZ9A 1Y3PA 2Z8EA 4QFPA 2QFLA 2WKYA 5F24A 3T9XB 1B0HA 4N6KA 5DEXB 1FPBA 4FORA 4NX1A 4JSDA 2M8CA 4Q5TA 4X48A 5FTHA 1JP4A 4TLLB 1ZKBA 4PFIA 3THIA 5I58A 2XD2A 4BDNA 3HFUA 2H9BA 2ZZWA 4HCWA 1FJ6A 4OWDA 3T9VA 4JVIA 3LSFB 4PFUA 5ITPA 4PDHA 4M4GA 1SI0A 1B7HA 5JEIA 3N6UA 3V8XB 2YLNA 3RT8A 3FVOA 2GH9A 3H03A 3FD3A 1XC1A 3SKPA 2FHYA 2VPNA 3PPRA 5EQAA 1MQDA 3PD9A 5F1QA 1RYXA 3FGSA 3ONMA 1IEJA 4LQ2A 3QUFA 1J1NA 3SEXA 1A8FA 4F3BA 3MVWA 4ONYA 1B5IA 2RF1A 1NMUA 1RYOA 5CMBA 1JQFA 1LBWA 1SW5A 1UQWA 5I57B 2Y84A 5IKBA 3KC1A 2PX1A 5FTIA 2F78A 2I3VA 2Z8DA 3IX1A 1Q35A 5IGAA 2V3QA 4OYVA 1OMPA 1Y1MA 4L17A 3KSXA 5JTYB 5AA2A 4P47A 3DELB 3T66A 4OFOA 4P0IA 3E4RA 4KD5A 5CRYA 2DSFA 5KZTA 1II5A 2XD3A 4WEDA 4X1BA 3CG1A 4ELRA 2O7IA 3TTNA 2F7AA 4H46A 1QKBA 1FPLA 1RKMA 2PYYA 3BFTA 3GLBA 1KWHA 1SDXA 2ONKE 2XHDA 1FTMA 2V3TA 4U23A 4F22A 3FJMA 2DXYA 2FBPA 2PT2A 1VFDA 2YJPA 4DCYA 2ZXTA 1EU8A 1NUWA 3Q27A 3KG2A 1ANFA 4MCOA 3SEUA 4GX6A 1P1WA 4N13A 4PBQA 4E0XA 2ZYNA 1JEVA 3Q28A 2O6AA 4G68C 1O64A 2WYKA 2UVJA 4G68B 4NF8B 2DDKA 1GTKA 2B65A 1B4HA 2F35A 3O29A 3PD8A 2O7UA 4N81A 3B8BA 4NGUA 3K02A 5A5XA 3ILUB 4R74A 4MAGA 4OMBA 5H8SA 1ELJA 4N07A 1LBYA 1XI6A 1FBHA 4OHNA 1NNFA 5L9OA 4MEVA 2F6GA 1B1HA 4R6KA 3CSGA 2D3IA 1GV8A 2XXQA 4YB6A 4NF5B 4EQ9A 4KHZE 5JTYA 2BJIA 2NOOA 4IO7A 1ZJLA 3RY3A 4YU0A 4ZZAA 3O2AA 3MUQA 2DQVA 3O66A 1XT8A 3A3CA 2DVCA 4FE8A 2Y7RA 4F29A 4OVRA 3VXCA 1UIUA 1Y3NA 2F5XA 1BKAA 1S50A 1SPIA 2HXWA 2XXTA 3H3GA 3S9LC 1DMBA 2QJEA 2B3FA 2DXRA 4ZZEA 4OVTA 2F34A 4PAIA 3BKIB 1NV4A 5BUUA 3HHGA 4OZ9A 1UTHB 2UXAA 4OQOA 1GR2A 3VVEA 1D3KA 3IJXB 5I84A 2HQ0A 4NMYA 3B6WA 4IY5A 1IMEA 5M2VA 1IIWA 4MJOA 1B52A 5HM4B 3MAMA 3CI8A 1FPDA 3OEMA 4HCYA 4F1YA 1JEUA 3K00A 4JSOA 3A29A 2FNCA 2HFBA 1QKAA 3C4MA 4IO2A 2RC8A 3PV0E 3RPWA 1B5HA 3EQ1A 1M5FA 4UA8A 3VV5A 4O7MA 3N26A 4R2FA 1RDXA 2I4BA 4GWOA 1YAEA 2WBBA 5IZ3A 1MS7A 1N04A 1LSTA 3P7IA 3GBBA 4H5GA 3Q29A 4PFYA 1MY3A 3FXRA 1B7ZA 3KBZA 1B3HA 1OQHA 3R7XA 1MXYA 4O3AA 3QAXA 3DP8A 4NF5A 4U21A 3VFJA 1ZLQA 1R1NA 3PGFA 3FIRA 3W9WA 2JJKA 1R6ZA 4ELQA 4YZZA 4KR5A 1IITA 5L9SA 2XXHA 3L6HA 2XWVA 3FJ7A 1P1OA 1EH3A 2F97A 1NV2A 1XHYA 2OCUA 3H06B 4QFLA 1K9ZA 4EQBA 4Q8RA 3RN8A 1MQGA 3G3GA 1POTA 2ZNSA 2HZKA 1MY2A 3TUSA 4H65A 3RLFE 2DE4A 4KFQA 1B3FA 3OO7A 4GWUA 1UTHA 3RYDA 3KZGA 3PMWA 3EKIA 3S2VA 1B7UA 4H8IA 5IM2A 4U1ZA 1H43A 1EYJA 3VXBA 1G0HA 2X26A 3TYHA 1FQDA 5EHMA 3TQWA 2E1SA 3VLWA 4QHQA 3FXQA 3HO7A 1TWYA 1B51A 3TDJA 2XXVA 3FXUA 3RUMA 4GWZA 1R9QA 1Q1KA 4QF9A 1DSNA 4RK2A 4NWDA 4NQ8A 2X7QA 2G93A 3R26A 2UVHA 1PBQA 3S9NC 5T3JA 5I2NA 2RINA 1M5EA 3U92A 1LBXA 2HAVA 2UYFA 4LP2B 4YMBA 3K6XA 3KEIA 1LAHE 3ROJA 4O3BA 3VVDA 1JW5A 3K01A 2GRVA 3DM0A 4ISUA 4Z0IA 3E78A 1MXXA 4EF1A 5I58B 2WYPA 2VGQA 3M3FA 3WAFA 4F39A 1S9TA 3FV2A 3C33A 4OESA 5DVJA 5H8HA 4PETA 4DI4B 4FECA 4ELOA 3D4CA 1FTKA 3EHTA 2R8TA 3CHGA 1YXIA 5LDZA 3TEPA 4FJPA 5ET7A 4TOZA 2ZNTA 1YTVA 2NUVA 2CMOA 1DTZA 4PF8A 4I62A 3MP8A 1KA0A 4I9DA 3HSTA 3K6UA 1A54A 1B32A 2I4CA 1FQFA 4PCDA 3O6GA 4YKJA 3LUYA 1FTJA 3MZ1A 1B4ZA 2ESNA 5I59A 3L6GA
chains in the Genus database with same CATH topology
1FPGA 4PAKA 2Y5KA 2HPGA 4P9KA 4HXVA 4MX6A 2XWOA 1RDZA 4AS4A 4KXPA 4F1VA 2P3VA 4H46A 5LTCA 1FPLA 2CEYA 4HE2A 5EQ9A 1FTAA 2FBPA 5EYGA 1NI9A 2XXKA 4N8YA 2DVZA 3W9VA 4JVCA 2Q74A 4O7IA 2Y5LA 1NUWA 4MCOA 1NV5A 4GX6A 2Q8MA 3GYYA 4I3YA 4PBQA 4I40A 1FPEA 2B4MA 5ET6A 3IFCA 4HE1A 5A5LA 5I5PA 2WYKA 4GBWA 3RPLA 2DDKA 5J16A 1KZ8A 3SZPA 3IFAA 1NV3A 5ET8A 1FBEA 5CM6A 1FBDA 4N81A 4H45A 1FBGA 4MNIA 2VPOA 4GWXA 4HE0A 3B8BA 4NGUA 3RPLB 5JK4A 1FSAA 2PFYA 1BK4A 3PTYA 1YZ0A 4MAGA 5EQ8A 1LBYA 2HHMA 2XWKA 1XI6A 1FBHA 4PGPA 4NHBA 2F3DA 1D9QA 3U65A 4MEVA 4YICA 1G0IA 2FVZA 2BJIA 1DBZA 2FIXA 1IMDA 4XEQA 4GWSA 4F1UA 5DW8A 1NV7A 2QVUA 2ZZXA 2XWIA 2VT5A 2QVRA 4OVRA 4PC9A 2F5XA 1FBPA 3QMFA 3NOHA 3LUZA 1SPIA 4I3EA 4M1VA 4DI3D 4IR8A 4N4UA 5EQ7A 4OANA 1FBFA 4OVTA 1KA1A 3ISPA 4PAIA 1FRPA 1Q9DA 1NV4A 2HZLA 1IMFA 1LEVA 4NG7A 4XFEA 2F3BA 2WBDA 1NUZA 1IMEA 1LBVA 4MHFA 2GQ1A 4PFRA 2WEFA 1AWBA 4MJOA 1EYIA 3E79A 4NN3A 1FPDA 4N17A 4HCYA 4MIJA 3A29A 4X8RA 4F18A 2WX9A 4OVPA 4O94A 4O7MA 1RDXA 1FJ9A 1NV1A 5ESYA 4F19A 2CZKA 4N91A 1FPJA 2WBBA 5IZ3A 4PFBA 3BIGA 1K9YA 3KBZA 3D1RA 5I3SA 5IZ3B 3B50A 4N15A 3KC0A 2PFZA 3LV0A 1IMBA 2OX3A 3W9WA 1NV0A 2JJKA 1EYKA 4YZZA 3BIHA 2ZZVA 2XWVA 2KR0A 4JVDA 1YYZA 2B4LA 4FBPA 5ET5A 2CZIA 1NV2A 4OVQA 4MNCA 1K9ZA 4OA4A 4P1LA 4GX3A 2HZKA 1LBZA 3FXBA 2V4CA 4GBVA 2CZHA 4N8GA 5I7IA 2DE4A 4QXDA 4GWUA 5EYHA 3FBPA 1FPFA 3MYUA 3RYDA 3EKIA 4GWWA 1RDYA 2XA5A 5IM2A 1EYJA 1G0HA 1NUYA 1NUXA 2QVVA 4MNPA 1FPKA 1CNQA 4PE3A 4P56A 2FIEA 4AS5A 5IZZA 4P1EA 4P8BA 1VDWA 3MSTA 4GWZA 1DCUA 4P3LA 1DK4A 4NQ8A 2P3NA 2QFLA 5T3JA 5F24A 4PDDA 4QBAA 4N6KA 4NAPA 2PCRA 1LBXA 1FPBA 4PTKA 4NX1A 3T0JA 4PBHA 1QGXA 1JP4A 4LN5A 4PFIA 4GWYA 4GX4A 4N6DA 2OWZA 4OVSA 2HXRA 4PF6A 3ROJA 1IMAA 3HFUA 5IZ1A 2ZZWA 4HCWA 1FJ6A 4JVIA 2CEXA 1INPA 4PDHA 3E78A 5J1DA 2WYPA 4G61A 4PETA 2L5VA 4DI4B 4X9TA 4MMPA 1FPIA 2R8TA 1NV6A 3CHGA 2FHYA 1YXIA 2VPNA 5FBPA 5EQAA 5LDZA 4NF0A 3T1BA 2DE2A 1IMCA 4X04A 2QPQA 5ET7A 2MKZA 2Q9TA 4PF8A 4O8MA 4PAFA 1LBWA 4XF5A 1KA0A 3KC1A 4PCDA 1FBCA 4PGNA 5IGAA 2DE3A 2V3QA 4UABA 2KQZA 4P47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAK A;  4PFB A;  2HPG A;  4P9K A;  4NQ8 A;  4MX6 A;  2XWO A;  4PDD A;  4N6K A;  3B50 A;  4NAP A;  4N15 A;  5LTC A;  4XEQ A;  2CEY A;  4NX1 A;  2PFZ A;  2ZZX A;  4PBH A;  2XWI A;  4LN5 A;  4PFI A;  4N6D A;  4YZZ A;  4OVS A;  4OVR A;  4PF6 A;  2ZZV A;  2XWV A;  4PC9 A;  2ZZW A;  4DI3 D;  2XXK A;  4N8Y A;  2CEX A;  4OVQ A;  4MNC A;  4PDH A;  4N4U A;  2WYP A;  4OA4 A;  4OAN A;  4MCO A;  4OVT A;  4P1L A;  3GYY A;  4PAI A;  4PBQ A;  2HZL A;  2HZK A;  4NG7 A;  4XFE A;  4PET A;  3FXB A;  2V4C A;  4DI4 B;  4N8G A;  5I7I A;  4MMP A;  5I5P A;  4MHF A;  2VPN A;  2WYK A;  4PFR A;  4NF0 A;  4X04 A;  2XA5 A;  4NN3 A;  5CM6 A;  5IM2 A;  4N17 A;  4PF8 A;  4O8M A;  4MIJ A;  4PAF A;  4MNI A;  2VPO A;  4NGU A;  4XF5 A;  2PFY A;  4MNP A;  4X8R A;  4MAG A;  2XWK A;  4PCD A;  2WX9 A;  4OVP A;  4PGP A;  4NHB A;  4O94 A;  4O7M A;  3U65 A;  4PGN A;  5IGA A;  4PE3 A;  4UAB A;  4P56 A;  4MEV A;  4N91 A;  5IZZ A;  4P1E A;  4P8B A;  4P47 A;  4YIC A;  4P3L A; 
#chains in the Genus database with same CATH topology
 2XXW A;  1FPG A;  4R6Y A;  1ZTY A;  2Y5K A;  1TFD A;  4HXV A;  1BIY A;  3QIM A;  1RDZ A;  2Y7K A;  2REJ A;  3QXM A;  4AS4 A;  4F1V A;  4XIG Q;  5AA2 B;  1MQJ A;  5LTC A;  3OXN A;  3G7W A;  1IXH A;  1XOC A;  2CEY A;  4GQO A;  4HE2 A;  3HN0 A;  3RGY A;  3TTL A;  1SVX B;  4ELP A;  1MY4 A;  2XX7 A;  3MPL A;  1IXI A;  4LZ7 A;  3EHU A;  4C0R A;  3LC8 A;  4JVC A;  2OJT A;  2HEU A;  1MG1 A;  3O9P A;  4C1T A;  2Z8F A;  4UAC A;  2Q2A A;  2Q8M A;  4I3Y A;  4YKP A;  2B4M A;  1MH3 A;  3MZB A;  5I5P A;  3RPL A;  4DE8 A;  3C31 A;  5ET8 A;  2AIX A;  2PMS A;  4KYD A;  1FBG A;  4MNI A;  5AA1 A;  2VPO A;  4IB2 A;  2PFY A;  3JYR A;  4TLM B;  4RJZ A;  2O1L A;  3OOA A;  2PVU A;  2RCA A;  4NWC A;  1D9Q A;  1H45 A;  4LZ8 A;  4OEV A;  4BDQ A;  1D9V A;  1LFH A;  4IGT A;  5TP9 A;  4PFT A;  4BDM A;  5A5X B;  4YIC A;  1Y4C A;  1G0I A;  4GD5 A;  3K6V A;  4IO4 A;  2FVZ A;  3G3H A;  2ZYM A;  2Y7P A;  3FVG A;  3PUZ E;  1LAF E;  3IR1 A;  3VLV A;  3AXF A;  4XEQ A;  1USY H;  2W7Y A;  1FTL A;  4BDR A;  3QK6 A;  1NV7 A;  4MH5 A;  5H8F A;  4GFR A;  1MM6 A;  4YB7 A;  2QVR A;  1DPP A;  3A3U A;  2AYS A;  4PC9 A;  3N94 A;  1Z7M E;  4R2B A;  1N84 A;  3PU5 A;  3LUZ A;  5CMK A;  2OWS A;  3OSQ A;  4M1V A;  3T96 B;  4DI3 D;  3OEL A;  1QUJ A;  1L5T A;  3FVN A;  1Y4T A;  1SYH A;  3RTF B;  1FBF A;  4LUB A;  4YKI A;  4RPO A;  4POX A;  2HCA A;  5TPA B;  4EUO A;  1LEV A;  4NG7 A;  3KOT A;  3B7D A;  1EZO A;  2RC7 A;  2WBD A;  1NUZ A;  4MHF A;  5AA2 D;  1LB9 A;  3MPK A;  2WEF A;  1EYI A;  1PBP A;  1MY0 A;  3LSX A;  1NFT A;  1XVY A;  3E79 A;  1B58 A;  1Y3Q A;  3V83 A;  4DZ1 A;  4QFN A;  4MIJ A;  2ZYO A;  3UA8 A;  4JDF A;  1B3L A;  2ZMB A;  4X8R A;  5L9M A;  1B3G A;  4OVP A;  5DYH A;  4Q0C A;  3SEY A;  2BJJ X;  4EDP A;  3USD A;  4F19 A;  4N91 A;  3TCG A;  1LFG A;  3IOU A;  4G2Z A;  3JZJ A;  2OBG A;  3K1M A;  1OVT A;  3OO8 A;  2DWJ A;  5IZ3 B;  2H5Y A;  2O1M A;  3CR9 A;  1P1N A;  2PFZ A;  1LBC A;  2OX3 A;  1FQA A;  1H44 A;  2R9J A;  1PDA A;  1BP5 A;  4ZE9 A;  3U94 A;  3TFL A;  1MPC A;  4JBZ A;  2B4L A;  4HTG A;  5KCJ A;  3T93 B;  4MNC A;  3H6W A;  3MP1 A;  4NE4 A;  3K2D A;  4OA4 A;  1LBB A;  3BBR A;  5CMM A;  1R9L A;  3IAZ A;  4MLQ A;  5ITO A;  4GX3 A;  3PPO A;  3TTM A;  4AQ4 A;  4KI0 E;  5ICT A;  2CZH A;  4N8G A;  5I7I A;  1LLS A;  4ZE8 A;  5TPA A;  4OXV A;  4BDL A;  3DP4 A;  5EYH A;  3N5L A;  3IB2 A;  3FBP A;  3ZS6 A;  4MBP A;  3D4G A;  4GLI A;  4FAJ A;  2Q89 A;  4C1U A;  1MRP A;  4KCC A;  2I6E A;  3K0V A;  2H98 A;  4FAT A;  2VHA A;  4F3G A;  3EF7 A;  4PP0 A;  1ZIU A;  5CC2 A;  1CNQ A;  3H6V A;  4NF4 B;  4P56 A;  1JW1 A;  2FIE A;  4AS5 A;  1PEB A;  4EF2 A;  1VDW A;  3FVK A;  4XKR A;  3F11 A;  1TXF A;  1AOV A;  1DK4 A;  4DIG A;  4ZEC A;  5I56 A;  2P3N A;  3PMV A;  1M5C A;  1VE4 A;  2FA7 A;  2UVG A;  4JWO A;  4PDD A;  3C36 A;  4QBA A;  2F36 A;  4G77 A;  2PCR A;  4GXS B;  3H6U A;  3MVY A;  1SI1 A;  3W15 C;  4PTK A;  4LAT A;  3TTK A;  3T0J A;  3FJG A;  4PBH A;  3TAJ A;  4LN5 A;  1MPB A;  4P11 A;  1JVX A;  5I2N B;  2OWZ A;  2I0B A;  1US5 A;  4PF6 A;  4EXL A;  2XX8 A;  2XXR A;  3UN6 A;  4BLA A;  3G3F A;  3MW0 A;  4OET A;  2ONS A;  3VE1 B;  1LCT A;  3TEL A;  5J1D A;  1B40 A;  1HSJ A;  1USY E;  3QSL A;  2P2A A;  2L5V A;  1SD3 A;  4X9T A;  4MMP A;  3SEV A;  5EYF A;  1NV6 A;  4BDO A;  2P1S A;  4H8J A;  3MQ9 A;  4NF0 A;  4DXU A;  3T1B A;  1SQY A;  2F8D A;  4X04 A;  2QPQ A;  3C35 A;  5H8H B;  2MKZ A;  4R6H A;  4OER A;  1B05 A;  2RKM A;  4ZED A;  4O8M A;  3UOR A;  4PAF A;  4NF6 A;  1GVC A;  3IOT A;  4ZDM A;  1IXC A;  4QSE A;  3E9X A;  2Q8J A;  1OIB A;  1M5B A;  3TQL A;  2O51 A;  4XKQ A;  3KGC A;  4DCX A;  4ZEF A;  2Y7I A;  2DE3 A;  4UAB A;  2OK2 A;  2VD3 A;  2GFE A;  2VOZ A;  2O84 X;  4GL0 A;  3ILT B;  4NF4 A;  2HPG A;  2VD2 A;  4QFK A;  4MX6 A;  2QSX A;  4P0G A;  3KSJ A;  1Y9U A;  3U1O A;  4RXL A;  1HSL A;  5I59 B;  5I2K A;  1N0T A;  5CBR A;  1I6Q A;  3PPP A;  2XXU A;  3U93 A;  3S4U A;  1DTG A;  1FTA A;  4MF3 A;  3M8U A;  3RQT A;  2OLB A;  5EYG A;  1NI9 A;  4H6D A;  1MXV A;  1QUI A;  3W9V A;  3U8Q A;  3LSW A;  2Y5L A;  2NXO A;  4RY1 A;  5HBC A;  3CFX A;  3ECR A;  3GYY A;  1FPE A;  3OEK A;  3MZ9 A;  5ET6 A;  4HE1 A;  3SDF A;  1FW0 A;  1A7L A;  2DYX A;  3KOS A;  1I69 A;  4RNS A;  2PBW A;  1LGB C;  3QUJ A;  1MY1 A;  2V3U A;  4LZ5 A;  5BWJ A;  1KZ8 A;  2CZL A;  3HPI A;  3SZP A;  2E0S A;  1NV3 A;  2F7C A;  1FBE A;  3U72 A;  3I5O A;  5CM6 A;  1N7W A;  1XS5 A;  1FBD A;  3PPQ A;  1HSE A;  4LA9 A;  4KQP A;  4I1D A;  3UIF A;  4H45 A;  5K2X A;  4HE0 A;  3PMX A;  3RPL B;  1F9B A;  4FEB A;  5JK4 A;  1Y1Z A;  1FSA A;  3CSB A;  1BK4 A;  1MXZ A;  5EQ8 A;  2NWJ A;  1FQB A;  3UK4 A;  4PGP A;  3N6T A;  5HPQ A;  3U65 A;  2NVU B;  3OD7 A;  2ONR A;  4QSC A;  3VVF A;  3OO9 A;  2A5T A;  2ZYK A;  3E13 X;  1O7T A;  1URG A;  2UVI A;  3OO6 A;  3OMB A;  2QS1 A;  2I49 A;  5TP9 B;  1BLF A;  1JW4 A;  1BTJ A;  3CFL A;  3EN3 A;  3PPN A;  4GWS A;  5FHM A;  2F6P A;  4RYA A;  3CIJ A;  3C34 A;  1DPE A;  2QVU A;  2ZZX A;  3TCF A;  2VT5 A;  5H8Q B;  3KN8 A;  1I6B A;  1EZP A;  3NOH A;  3PUV E;  5H8F B;  3LBS A;  4R72 A;  3KJ7 A;  4N4U A;  5AA4 B;  4OAN A;  3H6T A;  5K2Y A;  1KA1 A;  2Y7W A;  3ISP A;  2ANJ A;  5CI5 A;  1JVY A;  4JWX A;  4XFE A;  1IUD A;  5H8N A;  1N3W A;  3UGW A;  3OSR A;  4PFR A;  1P99 A;  1AWB A;  1TFA A;  1FQE A;  2QMX A;  3CG3 A;  1URD A;  3FAS A;  2Q88 A;  2DWI A;  4NN3 A;  2GHA A;  4IY6 A;  2IA4 A;  4N17 A;  4THI A;  4YB5 A;  2X7P A;  3TKD A;  3CVG A;  1LAX A;  1UIV A;  1VFE A;  4JXI A;  1UTB A;  1POY 1;  1CB6 A;  1NKX A;  4MFI A;  4F18 A;  1AL3 A;  3HCQ A;  3KBR A;  1NV1 A;  2A5S A;  5ESY A;  3SEW A;  5B7D A;  2CZK A;  4R9F A;  3RTW B;  3G3J A;  3RNN A;  1A99 A;  4RPN A;  4AB6 A;  3B6T A;  3SES A;  3FZV A;  4X1D A;  4G8M A;  3B50 A;  5FHN A;  4E0W A;  2FYI A;  3LV0 A;  3M3K A;  4U22 A;  1IMB A;  3BIH A;  5DTB A;  1QVS A;  2DP8 A;  3BFU A;  3G3I A;  4U4S A;  1LAG E;  3O97 A;  5H8Q A;  3MVX A;  1FQC A;  4OFL A;  4FIM A;  4OVQ A;  4ESX A;  5LOM A;  4OVJ A;  1OVB A;  3VDF A;  1N7X A;  4U4X A;  4P1L A;  5DVI A;  3PUY E;  3T9H B;  4DLD A;  5KCJ B;  1LBZ A;  4GBV A;  5AA4 A;  1B2H A;  3FV1 A;  4HW8 A;  3IOR A;  3MBP A;  1DOT A;  2Z23 A;  3IJO B;  3MYU A;  3KN3 A;  2ABH A;  3HV1 A;  4GWW A;  4LON B;  2XA5 A;  2OWT A;  3LR1 A;  4G8N A;  5CMC A;  4H1X A;  4OFJ A;  4XTC Q;  2V25 A;  4PFW A;  3MJN A;  4MNP A;  3ZSF A;  4GOT A;  4F3P A;  3C32 A;  4PE3 A;  5FHO A;  1Y20 A;  3K4U A;  3CRB A;  1DCU A;  4RA1 A;  4P3L A;  5DEX A;  4G4P A;  5KDT B;  2ALU A;  2AL5 A;  3JV9 A;  5L8D A;  4OTE A;  4NAP A;  1M5D A;  3DLN A;  4PE5 B;  3R6U A;  4JWY A;  1PB7 A;  4K3F A;  4KPT A;  4DXB A;  5I56 B;  1US4 A;  4DXC A;  1QGX A;  3C9H A;  4EQ7 A;  3MP6 A;  3TTR A;  4G8H A;  4GWY A;  4GX4 A;  4N6D A;  2PT1 A;  3EHS A;  4OVS A;  2HXR A;  3MC2 A;  4Z7E A;  1IMA A;  5IZ1 A;  4QRZ A;  2CEX A;  1INP A;  3Q26 A;  3G3K A;  1ZU0 A;  1A40 A;  4GF8 A;  4AB5 A;  1S7Y A;  3PUW E;  1IZ1 A;  1O63 A;  1QUK A;  1YCJ A;  4G61 A;  3IOW A;  5ICQ A;  1WVJ A;  3LSL A;  2XXY A;  4WEP A;  4NED A;  3UP9 A;  3TOD A;  3TCH A;  1CE2 A;  1FPI A;  5DT6 A;  5FBP A;  2DE2 A;  4POW A;  1IMC A;  1AIV A;  1AH5 A;  1B9J A;  5I57 A;  5IAI A;  2Q9T A;  2ZNU A;  1GGG A;  4IO3 A;  1WDN A;  2UYE A;  4ECF A;  3A09 A;  2O68 A;  4XF5 A;  3GBA A;  1T0K A;  1YPN A;  3ZKK A;  3T22 A;  4WXJ A;  4ESW A;  1FBC A;  1JET A;  4PGN A;  1MXU A;  4LVQ A;  2R71 A;  3V5A A;  4XKN A;  4NF6 B;  4FED A;  2KQZ A;  1LFI A;  1A8E A;  3IK6 B;  1ATG A;  4PAK A;  2YPN A;  1SW4 A;  3TPA A;  4ND9 A;  4P9K A;  2XWO A;  4KXP A;  1MM7 A;  4JB7 A;  4PQJ A;  2XXX A;  3KJT A;  2REG A;  5KDT A;  2P3V A;  3T9U A;  4O3C A;  1ZMG A;  4DDD A;  4I8C A;  5EQ9 A;  4F2Q A;  3ZKL A;  1QUL A;  3SET A;  4YMA A;  5I2K B;  4R73 A;  4WKM A;  2XXK A;  4N8Y A;  2DVZ A;  2P0S A;  3IL1 B;  1PC3 A;  2H99 A;  2Q74 A;  2DOJ A;  2QS2 A;  4O7I A;  4RK9 A;  3Q25 A;  1MXW A;  1ZBM A;  1NV5 A;  4G68 A;  4NF8 A;  3ODB A;  4TQU Q;  4IO6 A;  4LQ5 A;  4I40 A;  1IXG A;  4YKK A;  3O28 A;  3IFC A;  1OLC A;  1P1U A;  3SER A;  5A5L A;  3PUX E;  2DS9 A;  1B6H A;  2H25 A;  4R75 A;  1Z7N E;  4GBW A;  1NNT A;  5CBS A;  5J16 A;  3IB1 A;  1H3D A;  1P1Q A;  3IFA A;  1WOD A;  3CFZ A;  4IGR A;  1XVX A;  4ZS9 A;  3FAT A;  1D4N A;  1QW0 A;  2XX9 A;  4GWX A;  3PTY A;  1NNK A;  1YZ0 A;  2HHM A;  2XWK A;  4NHB A;  2F3D A;  3K1N A;  4OEU A;  2HAU A;  3K1P A;  2O69 A;  4GIZ A;  1SW2 A;  4F3S A;  3V89 B;  3H7M A;  1B1X A;  1MQH A;  3MWB A;  1DBZ A;  2A5T B;  3GXA A;  2VP1 A;  2FIX A;  1IMD A;  1SW1 A;  2IEE A;  3DP6 A;  5DW8 A;  4F1U A;  2KLF A;  3O6I A;  2XWI A;  4ZEK A;  3TMG A;  3IOV A;  1OQG A;  1B5J A;  1FBP A;  3QMF A;  3MVZ A;  2RCB A;  1NH7 A;  4YAH X;  2XXP A;  4I3E A;  4GL8 A;  4IR8 A;  1NH8 A;  4MLV A;  2V93 A;  4HS7 A;  4N6P A;  4KCD A;  5EQ7 A;  2RC9 A;  1LB8 A;  1MDQ A;  1FRP A;  1Q9D A;  1FCK A;  4XKP A;  3IO6 A;  2HZL A;  1IMF A;  1LCF A;  3S9E A;  2F3B A;  2GHB A;  1B0L A;  3IB0 A;  4ZEI A;  1LBV A;  1TT1 A;  2GQ1 A;  2D21 A;  1QJM A;  2QS3 A;  2I3W A;  2I48 A;  5H8N B;  1MDP 1;  1PB9 A;  1N76 A;  5DVF A;  1B3E A;  2B3B A;  2Z22 A;  2V84 A;  4OEN A;  3IO4 A;  4R9G A;  1MH4 A;  5TU0 A;  3K6W A;  5AA3 A;  2WX9 A;  4KYS A;  4O94 A;  5ELV A;  1I6A A;  4QSD A;  1FJ9 A;  4EXK A;  3OEN A;  5ISU A;  1FPJ A;  1VSO A;  2Q2C A;  1UTB B;  2G29 A;  1IQ7 A;  3TZA A;  5F7V A;  3KN7 A;  4PFB A;  5AE4 A;  3BIG A;  1K9Y A;  1NL5 A;  3VLU A;  4H5F A;  4H67 A;  4ZEB A;  3D1R A;  5I3S A;  2LAO A;  4N15 A;  3I6V A;  3KC0 A;  2H4I A;  2QS4 A;  3O6H A;  1NNP A;  4F2O A;  1NV0 A;  4U2R A;  1EYK A;  3WAE A;  1B46 A;  2ZZV A;  3B6Q A;  1SYI A;  1PB8 A;  2KR0 A;  2F7B A;  1JNF A;  4JVD A;  3E3K A;  2D5W A;  1YYZ A;  4FBP A;  5ET5 A;  2CZI A;  4IO5 A;  1AMF A;  1N3X A;  2QL3 A;  1FTO A;  4Q30 B;  4F31 B;  2OZZ A;  2I58 A;  2QRY A;  4GVO A;  2DWA A;  3FXB A;  2V4C A;  3EPE A;  4H0W A;  2XXI A;  3FUZ A;  1SBP A;  1D9Y A;  4GXA A;  3QYT A;  4QXD A;  2R6G E;  1FPF A;  3HHF A;  5B70 A;  1RDY A;  1MPD A;  3GZG A;  3KFM A;  1URS A;  2I0C A;  4QFO A;  2DWH A;  1VR5 A;  3H4Z A;  1NUY A;  1H76 A;  3RT6 B;  2QMW A;  1NUX A;  2QVV A;  2THI A;  1FPK A;  3M3L A;  4NTL A;  5EHS A;  4KYE A;  1A55 A;  4XXU A;  2AL4 A;  1OLA A;  1MQI A;  5IZZ A;  4P1E A;  4P8B A;  4GRK A;  3MST A;  3I3V A;  3S9M C;  4U1O A;  1EZ9 A;  1Y3P A;  2Z8E A;  4QFP A;  2QFL A;  2WKY A;  5F24 A;  3T9X B;  1B0H A;  4N6K A;  5DEX B;  1FPB A;  4FOR A;  4NX1 A;  4JSD A;  2M8C A;  4Q5T A;  4X48 A;  5FTH A;  1JP4 A;  4TLL B;  1ZKB A;  4PFI A;  3THI A;  5I58 A;  2XD2 A;  4BDN A;  3HFU A;  2H9B A;  2ZZW A;  4HCW A;  1FJ6 A;  4OWD A;  3T9V A;  4JVI A;  3LSF B;  4PFU A;  5ITP A;  4PDH A;  4M4G A;  1SI0 A;  1B7H A;  5JEI A;  3N6U A;  3V8X B;  2YLN A;  3RT8 A;  3FVO A;  2GH9 A;  3H03 A;  3FD3 A;  1XC1 A;  3SKP A;  2FHY A;  2VPN A;  3PPR A;  5EQA A;  1MQD A;  3PD9 A;  5F1Q A;  1RYX A;  3FGS A;  3ONM A;  1IEJ A;  4LQ2 A;  3QUF A;  1J1N A;  3SEX A;  1A8F A;  4F3B A;  3MVW A;  4ONY A;  1B5I A;  2RF1 A;  1NMU A;  1RYO A;  5CMB A;  1JQF A;  1LBW A;  1SW5 A;  1UQW A;  5I57 B;  2Y84 A;  5IKB A;  3KC1 A;  2PX1 A;  5FTI A;  2F78 A;  2I3V A;  2Z8D A;  3IX1 A;  1Q35 A;  5IGA A;  2V3Q A;  4OYV A;  1OMP A;  1Y1M A;  4L17 A;  3KSX A;  5JTY B;  5AA2 A;  4P47 A;  3DEL B;  3T66 A;  4OFO A;  4P0I A;  3E4R A;  4KD5 A;  5CRY A;  2DSF A;  5KZT A;  1II5 A;  2XD3 A;  4WED A;  4X1B A;  3CG1 A;  4ELR A;  2O7I A;  3TTN A;  2F7A A;  4H46 A;  1QKB A;  1FPL A;  1RKM A;  2PYY A;  3BFT A;  3GLB A;  1KWH A;  1SDX A;  2ONK E;  2XHD A;  1FTM A;  2V3T A;  4U23 A;  4F22 A;  3FJM A;  2DXY A;  2FBP A;  2PT2 A;  1VFD A;  2YJP A;  4DCY A;  2ZXT A;  1EU8 A;  1NUW A;  3Q27 A;  3KG2 A;  1ANF A;  4MCO A;  3SEU A;  4GX6 A;  1P1W A;  4N13 A;  4PBQ A;  4E0X A;  2ZYN A;  1JEV A;  3Q28 A;  2O6A A;  4G68 C;  1O64 A;  2WYK A;  2UVJ A;  4G68 B;  4NF8 B;  2DDK A;  1GTK A;  2B65 A;  1B4H A;  2F35 A;  3O29 A;  3PD8 A;  2O7U A;  4N81 A;  3B8B A;  4NGU A;  3K02 A;  5A5X A;  3ILU B;  4R74 A;  4MAG A;  4OMB A;  5H8S A;  1ELJ A;  4N07 A;  1LBY A;  1XI6 A;  1FBH A;  4OHN A;  1NNF A;  5L9O A;  4MEV A;  2F6G A;  1B1H A;  4R6K A;  3CSG A;  2D3I A;  1GV8 A;  2XXQ A;  4YB6 A;  4NF5 B;  4EQ9 A;  4KHZ E;  5JTY A;  2BJI A;  2NOO A;  4IO7 A;  1ZJL A;  3RY3 A;  4YU0 A;  4ZZA A;  3O2A A;  3MUQ A;  2DQV A;  3O66 A;  1XT8 A;  3A3C A;  2DVC A;  4FE8 A;  2Y7R A;  4F29 A;  4OVR A;  3VXC A;  1UIU A;  1Y3N A;  2F5X A;  1BKA A;  1S50 A;  1SPI A;  2HXW A;  2XXT A;  3H3G A;  3S9L C;  1DMB A;  2QJE A;  2B3F A;  2DXR A;  4ZZE A;  4OVT A;  2F34 A;  4PAI A;  3BKI B;  1NV4 A;  5BUU A;  3HHG A;  4OZ9 A;  1UTH B;  2UXA A;  4OQO A;  1GR2 A;  3VVE A;  1D3K A;  3IJX B;  5I84 A;  2HQ0 A;  4NMY A;  3B6W A;  4IY5 A;  1IME A;  5M2V A;  1IIW A;  4MJO A;  1B52 A;  5HM4 B;  3MAM A;  3CI8 A;  1FPD A;  3OEM A;  4HCY A;  4F1Y A;  1JEU A;  3K00 A;  4JSO A;  3A29 A;  2FNC A;  2HFB A;  1QKA A;  3C4M A;  4IO2 A;  2RC8 A;  3PV0 E;  3RPW A;  1B5H A;  3EQ1 A;  1M5F A;  4UA8 A;  3VV5 A;  4O7M A;  3N26 A;  4R2F A;  1RDX A;  2I4B A;  4GWO A;  1YAE A;  2WBB A;  5IZ3 A;  1MS7 A;  1N04 A;  1LST A;  3P7I A;  3GBB A;  4H5G A;  3Q29 A;  4PFY A;  1MY3 A;  3FXR A;  1B7Z A;  3KBZ A;  1B3H A;  1OQH A;  3R7X A;  1MXY A;  4O3A A;  3QAX A;  3DP8 A;  4NF5 A;  4U21 A;  3VFJ A;  1ZLQ A;  1R1N A;  3PGF A;  3FIR A;  3W9W A;  2JJK A;  1R6Z A;  4ELQ A;  4YZZ A;  4KR5 A;  1IIT A;  5L9S A;  2XXH A;  3L6H A;  2XWV A;  3FJ7 A;  1P1O A;  1EH3 A;  2F97 A;  1NV2 A;  1XHY A;  2OCU A;  3H06 B;  4QFL A;  1K9Z A;  4EQB A;  4Q8R A;  3RN8 A;  1MQG A;  3G3G A;  1POT A;  2ZNS A;  2HZK A;  1MY2 A;  3TUS A;  4H65 A;  3RLF E;  2DE4 A;  4KFQ A;  1B3F A;  3OO7 A;  4GWU A;  1UTH A;  3RYD A;  3KZG A;  3PMW A;  3EKI A;  3S2V A;  1B7U A;  4H8I A;  5IM2 A;  4U1Z A;  1H43 A;  1EYJ A;  3VXB A;  1G0H A;  2X26 A;  3TYH A;  1FQD A;  5EHM A;  3TQW A;  2E1S A;  3VLW A;  4QHQ A;  3FXQ A;  3HO7 A;  1TWY A;  1B51 A;  3TDJ A;  2XXV A;  3FXU A;  3RUM A;  4GWZ A;  1R9Q A;  1Q1K A;  4QF9 A;  1DSN A;  4RK2 A;  4NWD A;  4NQ8 A;  2X7Q A;  2G93 A;  3R26 A;  2UVH A;  1PBQ A;  3S9N C;  5T3J A;  5I2N A;  2RIN A;  1M5E A;  3U92 A;  1LBX A;  2HAV A;  2UYF A;  4LP2 B;  4YMB A;  3K6X A;  3KEI A;  1LAH E;  3ROJ A;  4O3B A;  3VVD A;  1JW5 A;  3K01 A;  2GRV A;  3DM0 A;  4ISU A;  4Z0I A;  3E78 A;  1MXX A;  4EF1 A;  5I58 B;  2WYP A;  2VGQ A;  3M3F A;  3WAF A;  4F39 A;  1S9T A;  3FV2 A;  3C33 A;  4OES A;  5DVJ A;  5H8H A;  4PET A;  4DI4 B;  4FEC A;  4ELO A;  3D4C A;  1FTK A;  3EHT A;  2R8T A;  3CHG A;  1YXI A;  5LDZ A;  3TEP A;  4FJP A;  5ET7 A;  4TOZ A;  2ZNT A;  1YTV A;  2NUV A;  2CMO A;  1DTZ A;  4PF8 A;  4I62 A;  3MP8 A;  1KA0 A;  4I9D A;  3HST A;  3K6U A;  1A54 A;  1B32 A;  2I4C A;  1FQF A;  4PCD A;  3O6G A;  4YKJ A;  3LUY A;  1FTJ A;  3MZ1 A;  1B4Z A;  2ESN A;  5I59 A;  3L6G A; 
#chains in the Genus database with same CATH homology
 1FPG A;  4PAK A;  2Y5K A;  2HPG A;  4P9K A;  4HXV A;  4MX6 A;  2XWO A;  1RDZ A;  4AS4 A;  4KXP A;  4F1V A;  2P3V A;  4H46 A;  5LTC A;  1FPL A;  2CEY A;  4HE2 A;  5EQ9 A;  1FTA A;  2FBP A;  5EYG A;  1NI9 A;  2XXK A;  4N8Y A;  2DVZ A;  3W9V A;  4JVC A;  2Q74 A;  4O7I A;  2Y5L A;  1NUW A;  4MCO A;  1NV5 A;  4GX6 A;  2Q8M A;  3GYY A;  4I3Y A;  4PBQ A;  4I40 A;  1FPE A;  2B4M A;  5ET6 A;  3IFC A;  4HE1 A;  5A5L A;  5I5P A;  2WYK A;  4GBW A;  3RPL A;  2DDK A;  5J16 A;  1KZ8 A;  3SZP A;  3IFA A;  1NV3 A;  5ET8 A;  1FBE A;  5CM6 A;  1FBD A;  4N81 A;  4H45 A;  1FBG A;  4MNI A;  2VPO A;  4GWX A;  4HE0 A;  3B8B A;  4NGU A;  3RPL B;  5JK4 A;  1FSA A;  2PFY A;  1BK4 A;  3PTY A;  1YZ0 A;  4MAG A;  5EQ8 A;  1LBY A;  2HHM A;  2XWK A;  1XI6 A;  1FBH A;  4PGP A;  4NHB A;  2F3D A;  1D9Q A;  3U65 A;  4MEV A;  4YIC A;  1G0I A;  2FVZ A;  2BJI A;  1DBZ A;  2FIX A;  1IMD A;  4XEQ A;  4GWS A;  4F1U A;  5DW8 A;  1NV7 A;  2QVU A;  2ZZX A;  2XWI A;  2VT5 A;  2QVR A;  4OVR A;  4PC9 A;  2F5X A;  1FBP A;  3QMF A;  3NOH A;  3LUZ A;  1SPI A;  4I3E A;  4M1V A;  4DI3 D;  4IR8 A;  4N4U A;  5EQ7 A;  4OAN A;  1FBF A;  4OVT A;  1KA1 A;  3ISP A;  4PAI A;  1FRP A;  1Q9D A;  1NV4 A;  2HZL A;  1IMF A;  1LEV A;  4NG7 A;  4XFE A;  2F3B A;  2WBD A;  1NUZ A;  1IME A;  1LBV A;  4MHF A;  2GQ1 A;  4PFR A;  2WEF A;  1AWB A;  4MJO A;  1EYI A;  3E79 A;  4NN3 A;  1FPD A;  4N17 A;  4HCY A;  4MIJ A;  3A29 A;  4X8R A;  4F18 A;  2WX9 A;  4OVP A;  4O94 A;  4O7M A;  1RDX A;  1FJ9 A;  1NV1 A;  5ESY A;  4F19 A;  2CZK A;  4N91 A;  1FPJ A;  2WBB A;  5IZ3 A;  4PFB A;  3BIG A;  1K9Y A;  3KBZ A;  3D1R A;  5I3S A;  5IZ3 B;  3B50 A;  4N15 A;  3KC0 A;  2PFZ A;  3LV0 A;  1IMB A;  2OX3 A;  3W9W A;  1NV0 A;  2JJK A;  1EYK A;  4YZZ A;  3BIH A;  2ZZV A;  2XWV A;  2KR0 A;  4JVD A;  1YYZ A;  2B4L A;  4FBP A;  5ET5 A;  2CZI A;  1NV2 A;  4OVQ A;  4MNC A;  1K9Z A;  4OA4 A;  4P1L A;  4GX3 A;  2HZK A;  1LBZ A;  3FXB A;  2V4C A;  4GBV A;  2CZH A;  4N8G A;  5I7I A;  2DE4 A;  4QXD A;  4GWU A;  5EYH A;  3FBP A;  1FPF A;  3MYU A;  3RYD A;  3EKI A;  4GWW A;  1RDY A;  2XA5 A;  5IM2 A;  1EYJ A;  1G0H A;  1NUY A;  1NUX A;  2QVV A;  4MNP A;  1FPK A;  1CNQ A;  4PE3 A;  4P56 A;  2FIE A;  4AS5 A;  5IZZ A;  4P1E A;  4P8B A;  1VDW A;  3MST A;  4GWZ A;  1DCU A;  4P3L A;  1DK4 A;  4NQ8 A;  2P3N A;  2QFL A;  5T3J A;  5F24 A;  4PDD A;  4QBA A;  4N6K A;  4NAP A;  2PCR A;  1LBX A;  1FPB A;  4PTK A;  4NX1 A;  3T0J A;  4PBH A;  1QGX A;  1JP4 A;  4LN5 A;  4PFI A;  4GWY A;  4GX4 A;  4N6D A;  2OWZ A;  4OVS A;  2HXR A;  4PF6 A;  3ROJ A;  1IMA A;  3HFU A;  5IZ1 A;  2ZZW A;  4HCW A;  1FJ6 A;  4JVI A;  2CEX A;  1INP A;  4PDH A;  3E78 A;  5J1D A;  2WYP A;  4G61 A;  4PET A;  2L5V A;  4DI4 B;  4X9T A;  4MMP A;  1FPI A;  2R8T A;  1NV6 A;  3CHG A;  2FHY A;  1YXI A;  2VPN A;  5FBP A;  5EQA A;  5LDZ A;  4NF0 A;  3T1B A;  2DE2 A;  1IMC A;  4X04 A;  2QPQ A;  5ET7 A;  2MKZ A;  2Q9T A;  4PF8 A;  4O8M A;  4PAF A;  1LBW A;  4XF5 A;  1KA0 A;  3KC1 A;  4PCD A;  1FBC A;  4PGN A;  5IGA A;  2DE3 A;  2V3Q A;  4UAB A;  2KQZ A;  4P47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...