5I7IA

Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-crystallized 3-hydroxybenzoate
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
318
structure length
318
Chain Sequence
EVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKPPQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQEYVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIKSAADLNGMKMRGPTRVITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTKAHTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQLWDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEKDWIKSANDRGLDGAMLVKTAKDLISKYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP solute Binding Protein
publication title Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157) in complex with co-purified 4-hydroxybenzoate
rcsb
source organism Uncultured marine bacterium
molecule tags Transport protein
total genus 120
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5i7iA00
2CEXA 2WYKA 4P47A 5IM2A 4N17A 4N8YA 2XWIA 4N91A 4PBQA 2XWOA 4LN5A 2WX9A 2XXKA 4O7MA 4PCDA 3GYYA 4MX6A 4N4UA 2CEYA 4XF5A 4PBHA 4O94A 4NQ8A 4PFBA 4PFIA 4PF8A 2HZKA 4MEVA 4NN3A 4NGUA 2V4CA 4NHBA 4YZZA 4P56A 4OVQA 4PGNA 2PFYA 5CM6A 5IZZA 4OVTA 4DI3D 4P9KA 4UABA 4P3LA 2XWVA 4NG7A 5IGAA 4PDDA 4PAFA 2HZLA 2ZZXA 4YICA 4P1EA 5I7IA 2PFZA 4MNIA 4N6DA 4N8GA 2XWKA 4NX1A 4NF0A 4MMPA 4MNCA 4PC9A 4P1LA 4PF6A 4X8RA 2ZZVA 4PE3A 4P8BA 4MIJA 4MAGA 4PAKA 4NAPA 4OVPA 4PAIA 5I5PA 4MNPA 4PDHA 4O8MA 4OVSA 3U65A 4PETA 4PGPA 2VPNA 4PFRA 5LTCA 2XA5A 4OVRA 3B50A 4OANA 4XEQA 4N15A 4XFEA 2ZZWA 2WYPA 4MHFA 2HPGA 4OA4A 4DI4B 4N6KA 2VPOA 3FXBA 4X04A 4MCOA
chains in the Genus database with same CATH superfamily
3LUYA 3H6UA 5ELVA 4C1TA 1SI0A 4F3GA 2O1MA 1USYE 3KBRA 1FBFA 4QF9A 1MPDA 3BIGA 2UVHA 4KHZE 1XT8A 3MVWA 4R9GA 4R2FA 1B6HA 4LONB 5DYHA 4NEDA 4GF8A 4GWOA 1QVSA 2UVIA 5CMMA 1OQGA 3TCHA 2H4IA 1EYJA 2FBPA 5AA3A 3PGFA 2ZYNA 1BK4A 3U92A 1FPJA 4R9FA 3S2VA 1Z7ME 4NX1A 4U21A 3T96B 3MZBA 4F3BA 3TTLA 5KDTA 2RC8A 2MKZA 4BDRA 4G2ZA 2O68A 1PBQA 2OBGA 3TTMA 4KR5A 3EN3A 5ESYA 2F8DA 2VPNA 3GBAA 1NNFA 3S4UA 1S9TA 4H45A 3IOWA 2HPGA 4RNSA 4U22A 1TXFA 4QRZA 4XKQA 3IOVA 4G77A 3W9WA 1YZ0A 3T9HB 3S9LC 4N91A 3MYUA 3T9UA 2RKMA 4FE8A 3GBBA 3TCGA 4ZZAA 4EQBA 3TUSA 3EHSA 4G4PA 1TFAA 3ROJA 2ABHA 2XXWA 3CIJA 1MXXA 3K2DA 5KCJB 1YAEA 3W15C 2R71A 4TQUQ 3HSTA 2F7AA 2DP8A 1GR2A 1MG1A 3EPEA 1NUYA 4XKRA 3CVGA 3C32A 5FHOA 2HHMA 2R6GE 4NMYA 1GTKA 3TQWA 1NV6A 2G29A 3QIMA 5CM6A 2Y7WA 1FQCA 1FJ6A 1UTBA 3LR1A 2AL5A 2ZYMA 3CG3A 4RJZA 1XOCA 4JBZA 4MF3A 4PDDA 3RY3A 4OMBA 1FCKA 3JZJA 3VLUA 4MNIA 4N8GA 3PTYA 2E0SA 2VP1A 4ZEBA 3UN6A 3B8BA 2QRYA 1VDWA 3CSBA 3QUJA 1B40A 3KG2A 1RDZA 3U94A 4LZ8A 3EKIA 2VOZA 1GGGA 1B5HA 2QS2A 3TEPA 1VR5A 1NL5A 2PT1A 5DT6A 3E13X 4PETA 1VE4A 4OENA 2CZLA 3R26A 4YB7A 1O63A 1WDNA 3MZ9A 4JDFA 3B50A 1EU8A 3WAFA 1LGBC 1MDP1 2WYPA 3N6UA 3K1NA 1H45A 5EQ8A 2CEXA 1YCJA 3PPOA 4N17A 2H98A 1UTBB 2Y5LA 5F1QA 4KCCA 2PX1A 3GYYA 4MX6A 3KN3A 3V8XB 1NV0A 4GD5A 1P1UA 3Q26A 1SVXB 3RT6B 3U8QA 2Q74A 3E9XA 1Y4TA 1H43A 1L5TA 3IR1A 1ATGA 3VLWA 2I4CA 3FGSA 4U23A 4OQOA 2XXTA 3G3HA 3V83A 4TOZA 3GXAA 1FPBA 3RGYA 3HV1A 4QHQA 3FATA 3D4CA 3HN0A 2XD2A 4C0RA 1MY0A 1M5DA 4N6DA 2RC9A 4ISUA 4GLIA 4MMPA 4QBAA 3IJOB 2A5TA 5J16A 3T9VA 4PAIA 1B3FA 4TLMB 3K0VA 1XHYA 1SYHA 4NF6A 4EDPA 3GLBA 2I49A 1PC3A 2Z8DA 1PBPA 3MZ1A 3AXFA 2Y7RA 1B5IA 4POWA 3RLFE 1NNKA 1FBHA 1FBPA 4IGRA 1IMCA 1A55A 1SD3A 2I4BA 5L9MA 5DVJA 4MBPA 5TU0A 3G3GA 1IXHA 2XXQA 3MPLA 3Q28A 3RNNA 2NUVA 4QFLA 3M3KA 1NKXA 1MPCA 4GWXA 1POY1 2PCRA 2L5VA 1B1HA 1FTMA 3SERA 3MSTA 4O7IA 2HFBA 3CFLA 4JVIA 4PFBA 4ESXA 4LZ7A 2XXRA 1MDQA 3C4MA 3VVDA 1AMFA 4BDQA 5CC2A 4IR8A 2DWJA 4ND9A 3V5AA 2OX3A 4H67A 4DDDA 1FPLA 1SBPA 2WBDA 1JW4A 1B4ZA 4XKNA 4I62A 4NF6B 4LUBA 1CE2A 1Q1KA 1K9ZA 3E4RA 2QMXA 3T22A 3HCQA 3IL1B 3FV1A 3U1OA 4I1DA 3H6VA 2RINA 1DOTA 3MPKA 4R74A 5K2YA 5I57A 4GBVA 1MQDA 4RPOA 4EUOA 1KWHA 1LBCA 4MIJA 3LUZA 5EYHA 4H8IA 3MVZA 1OLAA 4O8MA 1ZKBA 3FV2A 3QUFA 1MM7A 3FJGA 1LCFA 3PPPA 1I69A 1HSLA 3PUVE 4KYEA 2X26A 2Q8MA 1YPNA 4GVOA 4ONYA 1SI1A 2Y7IA 3CR9A 1ELJA 3JYRA 3MC2A 4GL8A 3FJ7A 3PUYE 2P3NA 4P0GA 3IB1A 3VLVA 4EF1A 3O29A 2B4LA 3RTWB 3TODA 3PD8A 4MCOA 1JQFA 4G8NA 3K6VA 4HXVA 4N8YA 4U1OA 5CBRA 1NV4A 3SZPA 4LA9A 1IMEA 1Y4CA 3H6WA 2OZZA 2ANJA 3H3GA 4AQ4A 5CI5A 2I3WA 5K2XA 5EQ7A 2AL4A 2HXWA 2PT2A 4OEVA 5ICQA 2XXIA 3RYDA 1KA0A 3HHGA 4ESWA 5I56B 3S9MC 3HHFA 5EYFA 4P11A 3M3FA 2WEFA 4NE4A 1MS7A 3OEMA 2F5XA 4WEPA 2CZIA 4OZ9A 4ZEDA 1FQAA 3HPIA 1N7XA 4PF6A 4X8RA 2VD2A 3SESA 4F2QA 4RK9A 4AS5A 2V3UA 4WEDA 4WXJA 3ILUB 3H6TA 5H8NA 4PTKA 2Q8JA 5I5PA 2PBWA 3OO6A 4PDHA 4R6HA 2HAVA 1QJMA 4U4SA 1NV2A 4PGPA 2ONRA 2I3VA 1MY3A 2QVVA 1B58A 3IOTA 2ZMBA 2Z8FA 1ZTYA 1FPIA 1FPEA 3R7XA 5JTYA 4XFEA 1I6QA 2ZZWA 1H3DA 2A5SA 4XXUA 1AOVA 2DS9A 3TTRA 3VVEA 4FJPA 1FQEA 4K3FA 3TELA 1US5A 3TAJA 1LBXA 4PFUA 1NNPA 3MP1A 5H8SA 1Y3NA 2UYEA 1M5EA 5I2KB 1FRPA 1MY4A 5DEXB 4O94A 1FPKA 4ELRA 3TPAA 4F19A 1EZPA 4ECFA 2X7PA 1FQBA 3MP8A 4JXIA 3O28A 2BJIA 3IX1A 4P56A 4QFPA 4PGNA 1MY2A 1OVTA 5H8NB 5IZ3A 1O7TA 3Q27A 1M5FA 1Y1MA 4F39A 3DP6A 5ICTA 3O2AA 5FHNA 4NF5B 4R73A 3W9VA 5I7IA 1LEVA 1N7WA 4YAHX 4KXPA 5AA4B 4OXVA 4F2OA 5JTYB 1N04A 1AL3A 3SETA 1DCUA 2NWJA 1DK4A 1S7YA 4IO6A 4OERA 4NAPA 4YB6A 3MBPA 1B0LA 1LFGA 1B3GA 1OMPA 3EQ1A 2Y5KA 2O51A 2AIXA 1Q35A 3KSXA 4GBWA 2KLFA 5KCJA 4KD5A 2D21A 4P0IA 4N81A 2Y7PA 1LFIA 3FVOA 3WAEA 3R6UA 3PU5A 1FQDA 5L8DA 1URGA 1MY1A 3TYHA 1RDXA 1UIVA 4XTCQ 4UACA 1JETA 1Y20A 1EH3A 2RCBA 2XXPA 4X9TA 3LSXA 2WKYA 1LBWA 4U2RA 2XWOA 2F6PA 5I58B 5IZ3B 4F29A 5EQAA 3ZKLA 3KOSA 4JWOA 3IFCA 5JK4A 1NNTA 4OFLA 3PV0E 4MEVA 5AE4A 1RKMA 1DPEA 4NHBA 4DZ1A 4YZZA 2V84A 1NH8A 1QKBA 1UQWA 1IXCA 1PEBA 1MPBA 4QSDA 5IZZA 4DI3D 2BJJX 1RYXA 5TP9B 3VE1B 3VXBA 1IMAA 3PMWA 2XWVA 5KZTA 3L6GA 4GWZA 3G3KA 1MQHA 4HTGA 4I3YA 3IORA 3CHGA 4KQPA 5EHMA 1FPFA 4KYSA 1FPDA 3BKIB 1OIBA 2FHYA 3BFUA 1NV7A 3OENA 3H4ZA 5EYGA 2I6EA 5AA2D 3OO7A 1NV1A 4HS7A 4M1VA 4Z7EA 4LATA 4ZE8A 4OTEA 5ISUA 4N07A 3UORA 3USDA 3ECRA 1FBEA 3A3UA 3F11A 4PFRA 1UIUA 2DDKA 2F7BA 4DXCA 2XHDA 3OMBA 1FTOA 4ZECA 2ZNSA 2VHAA 3G3IA 4GWWA 2WYKA 3E3KA 4AB5A 3N5LA 4HE1A 2CMOA 2NXOA 4O7MA 3QAXA 4F3PA 4QFKA 4PBHA 1FTAA 4EXKA 4O3BA 4PFIA 2F97A 1TFDA 4FIMA 2O84X 4NN3A 4QSCA 5A5LA 1ANFA 1FPGA 1B46A 2Q9TA 2PFYA 1P1WA 4OVTA 1Y3PA 2DE2A 4L17A 4GWSA 1SW2A 5EHSA 1GV8A 2NVUB 2X7QA 2HZLA 2RC7A 2IA4A 1SPIA 1MH4A 4Q8RA 2I48A 2O69A 1DTZA 4ZZEA 4F18A 2RF1A 4OVJA 3T66A 3ILTB 1ZIUA 1BKAA 4HE0A 1P1NA 4MAGA 3MWBA 3H03A 1G0IA 1AIVA 4WKMA 3I5OA 3IB2A 5H8HB 1G0HA 3BBRA 1MRPA 4G8MA 1A8EA 2QS4A 3THIA 3PUZE 3QXMA 1JVXA 4OVRA 4LQ2A 3MJNA 1MXZA 5DTBA 1AH5A 1O64A 5HPQA 2I0CA 1QUIA 2Y7KA 4R6YA 3T1BA 2DQVA 4C1UA 1MXYA 4NF4B 5AA2A 2O7IA 1J1NA 1OVBA 1URSA 4DCXA 4JSOA 1LB9A 2GH9A 4N4UA 3VV5A 1USYH 2CEYA 1LB8A 2V3TA 3TFLA 4IY5A 1KA1A 4RY1A 3CI8A 4PF8A 2HZKA 3OSRA 5ET8A 1IQ7A 5HBCA 1LBBA 3MQ9A 1EYKA 3OSQA 2HEUA 5TPAB 1XVYA 1AWBA 4DXUA 1NI9A 1NV3A 1NUWA 1LSTA 2XXVA 1GVCA 1IITA 4R72A 1R9QA 4EQ7A 4O3AA 3K6XA 3VXCA 3FVGA 4M4GA 2Q2CA 1B32A 2Q88A 3TCFA 5DVIA 5CBSA 3UIFA 2R9JA 4GXAA 4YB5A 1LAFE 2H99A 3B6TA 4JVDA 3C35A 3PUXE 2F78A 5AA2B 3KN8A 5M2VA 4GXSB 1FQFA 1BIYA 3C33A 4Q0CA 3B6WA 2ZNTA 1IMBA 4DE8A 5FBPA 3PD9A 2D5WA 3IJXB 3L6HA 3MAMA 2XXHA 3DP4A 4GFRA 3PUWE 3SKPA 3K1PA 1ZBMA 2VPOA 5T3JA 4F1YA 5I56A 4P47A 4PFYA 3SEVA 2XWIA 2QVRA 2WX9A 4PFTA 3ZKKA 1VFDA 5B70A 1MH3A 1LAXA 4BDNA 3IO4A 2B3FA 2KQZA 1LAGE 4KI0E 1UTHA 2GFEA 4KCDA 5H8QA 3SDFA 3TKDA 2QPQA 4NGUA 1LLSA 3CFZA 4IO2A 3RN8A 1D9QA 2Z22A 2DWHA 1FBDA 2B65A 4RPNA 3MP6A 4OHNA 4UABA 3OO9A 3JV9A 4FEDA 1QW0A 4PAFA 3KFMA 2QFLA 4FECA 2ZZXA 2JJKA 1JW1A 4IO7A 3N6TA 3TQLA 1LFHA 3KJ7A 1PB8A 4JVCA 1QGXA 1TT1A 2DE3A 4P1LA 2F34A 1M5CA 1XI6A 1QKAA 4H65A 4P8BA 5IAIA 3OELA 4I8CA 4G61A 4OETA 1HSJA 4MNPA 1B9JA 4ELQA 5I2KA 1QUJA 5DEXA 3FASA 2CZKA 3MVYA 2VD3A 3KZGA 3TDJA 1MXVA 5AA1A 3H7MA 2W7YA 5BUUA 4YMBA 2PVUA 1JEVA 1SQYA 1UTHB 4LQ5A 5H8QB 4MLQA 3UP9A 3KJTA 4N6KA 3OEKA 3PPQA 1FW0A 4X04A 1FBCA 5LDZA 1IXGA 5CRYA 3EHUA 2FIEA 4OFOA 4NWCA 2XXKA 4NF5A 1H76A 5ET7A 1PDAA 3O66A 3GZGA 5AA4A 1IUDA 4NF8B 4BDOA 5CMKA 5ET6A 4H8JA 2YPNA 3EHTA 2HAUA 4NTLA 1QUKA 1FJ9A 4PQJA 1T0KA 2V4CA 3DLNA 5DW8A 1MQGA 4OVQA 1NV5A 3FVKA 2NOOA 4GL0A 4F1UA 5I84A 3K6WA 3ONMA 3K00A 5IGAA 4GRKA 4H5GA 3IAZA 4GWYA 2H25A 4LP2B 3SEWA 3K01A 2Z23A 1DMBA 4R75A 2DE4A 1N0TA 4KYDA 5B7DA 4GQOA 1DPPA 1B5JA 4NF0A 2OJTA 3PPNA 1B7HA 4MJOA 1FSAA 3ZS6A 5I58A 4EXLA 1POTA 4OVPA 4N6PA 1XVXA 4JWYA 4H46A 3OOAA 4HCWA 2AYSA 4Q5TA 3B6QA 4DIGA 5LTCA 4RYAA 3FJMA 4U4XA 4TLLB 1H44A 4XEQA 1N3WA 4ELOA 1JP4A 2F7CA 5TP9A 1TWYA 3LSLA 3U72A 1Y3QA 1URDA 1YYZA 2ZNUA 1EZ9A 2CZHA 1IMDA 3SEXA 2O6AA 2F35A 3FUZA 3I6VA 4NWDA 1EZOA 3ZSFA 4GX6A 5H8FB 1US4A 1IMFA 4I9DA 1I6BA 1B3HA 3K6UA 3T9XB 2QMWA 4XKPA 1VSOA 3KC1A 4ZEFA 3FXRA 3IFAA 3MVXA 3TTNA 2G93A 1WODA 3D1RA 4MFIA 3KN7A 4I40A 2E1SA 4Q30B 1DBZA 2ZYOA 5EQ9A 1LAHE 3OO8A 3EF7A 2V25A 4ZDMA 2RCAA 2D3IA 1NUZA 1KZ8A 2ESNA 4O3CA 3FXQA 2H9BA 2LAOA 1DSNA 4MNCA 3K4UA 3LBSA 1I6AA 4MH5A 4IO5A 4JB7A 2REJA 3KGCA 3IK6B 4H5FA 4G68A 4QFNA 3H06B 4OVSA 1IZ1A 4KFQA 3E78A 2Q2AA 1FTLA 5I59A 1A7LA 4GWUA 1F9BA 4OANA 3G3JA 3RTFB 4MHFA 4DI4B 1HSEA 1MXWA 2QVUA 3ISPA 4PP0A 3N26A 4THIA 5KDTB 1N3XA 2HXRA 3O9PA 2FYIA 3RQTA 2DVCA 4X48A 3S9NC 4Z0IA 2QS3A 2ONKE 2KR0A 3C34A 2XX8A 2DXRA 3NOHA 4GX4A 2PMSA 4YKKA 2VGQA 4R6KA 5F7VA 1B3LA 3VDFA 4E0XA 1N76A 4G68C 5H8HA 4HW8A 1BLFA 3LSFB 3CG1A 4FATA 1OQHA 2B3BA 4G68B 1K9YA 4H6DA 1B2HA 2ALUA 2F6GA 1SW1A 2XX9A 5I59B 3QYTA 3CRBA 1IIWA 3RT8A 3S9EA 3A3CA 2OWZA 2OK2A 1JVYA 4NF4A 1LBVA 5F24A 1B51A 2DWIA 4PAKA 3IO6A 2V93A 4QFOA 2DVZA 3O6GA 3RUMA 1JNFA 3VVFA 3E79A 4YKPA 2DXYA 4YMAA 1P99A 3QK6A 5A5XA 1D9VA 2P3VA 3ODBA 5FTHA 1B7ZA 2THIA 1MM6A 4LZ5A 1ZLQA 4N15A 1B4HA 1A40A 1BP5A 3M8UA 5TPAA 3I3VA 4FAJA 3A29A 1RYOA 1SW5A 1QULA 4ZEIA 4ZS9A 1JEUA 4U1ZA 4RA1A 3LSWA 4DLDA 1P1QA 5L9SA 2XXUA 4IO4A 2GHAA 1FTJA 2HCAA 2DSFA 2FIXA 4BLAA 3FIRA 5ET5A 4YKJA 4IB2A 1S50A 3TZAA 3KSJA 3BIHA 2O1LA 1B52A 2DWAA 3K02A 1IEJA 4ZE9A 4OESA 1A8FA 3UGWA 2OCUA 3B7DA 5ITOA 1CNQA 3O97A 4P3LA 3SEYA 3P7IA 1B0HA 4FORA 5A5XB 4F31B 1YXIA 4P1EA 2PFZA 1R1NA 2XX7A 1FBGA 1OLCA 5J1DA 2UVJA 1NMUA 2DOJA 2GQ1A 3DELB 2ZZVA 4PE3A 2I58A 2F3BA 5I2NA 4UA8A 3A09A 1LCTA 2VT5A 3KBZA 2V3QA 1NFTA 2FVZA 1JW5A 2IEEA 3TTKA 1Q9DA 4ELPA 5HM4B 1LBYA 3OXNA 2F36A 2I0BA 4FEBA 3N94A 1B1XA 1PB9A 4YU0A 2H5YA 3SEUA 2FNCA 2B4MA 3UA8A 4OA4A 5CMBA 2QL3A 2OLBA 3CSGA 2GHBA 3RPWA 4KPTA 1Z7NE 2A5TB 4LN5A 2GRVA 2P0SA 1D4NA 3RPLA 2YJPA 4POXA 3KC0A 4H1XA 1PB7A 4NQ8A 3FVNA 3VFJA 4IO3A 4GIZA 1WVJA 4N13A 3FZVA 1FTKA 4JSDA 3BFTA 4XIGQ 1EYIA 2QJEA 5I2NB 2Z8EA 4QSEA 3G3FA 4DXBA 1CB6A 3KEIA 4HE2A 4P9KA 5ITPA 5BWJA 2QSXA 4F1VA 1SW4A 4I3EA 2FA7A 3Q25A 2OWTA 3CFXA 4RK2A 3O6HA 1Y1ZA 4X1DA 3TMGA 5FTIA 4BDLA 2P2AA 3PPRA 4H0WA 4PC9A 3V89B 3D4GA 1B3EA 5LOMA 4E0WA 2R8TA 2ZXTA 3IB0A 1D9YA 2WBBA 3HFUA 1Y9UA 1D3KA 3LV0A 1II5A 1XC1A 3FD3A 4F3SA 1M5BA 4NF8A 3RPLB 3Q29A 4ZEKA 5DVFA 4IY6A 4R2BA 4EQ9A 2XA5A 2O7UA 2M8CA 1P1OA 4YKIA 2HQ0A 2UYFA 3DM0A 2XD3A 3KOTA 3IOUA 2F3DA 2XXYA 1YTVA 5I57B 4OWDA 3G7WA 3O6IA 2ZYKA 5IM2A 2P1SA 3C9HA 4PBQA 1BTJA 2DYXA 1A99A 1SDXA 3QMFA 1N84A 4PCDA 2Y84A 1ZMGA 2ONSA 4JWXA 1MQIA 5JEIA 1ZU0A 4OEUA 1INPA 4XF5A 4PE5B 1B7UA 2QS1A 3LC8A 2OWSA 1NH7A 1ZJLA 1IXIA 3OD7A 4MLVA 1RDYA 4G8HA 3C36A 1B05A 4HCYA 4AB6A 4BDMA 2XXXA 3MW0A 4PFWA 3T93B 4F22A 4OYVA 4NG7A 3PMXA 1LBZA 5L9OA 5FHMA 2Q89A 4OFJA 1VFEA 4X1BA 3QSLA 2UXAA 4YICA 3DP8A 2UVGA 3M3LA 4QXDA 2XWKA 4AS4A 5I3SA 4EF2A 3K1MA 5IKBA 1XS5A 4DCYA 2REGA 4GX3A 3PMVA 2PYYA 3HO7A 4LVQA 5H8FA 1SYIA 5CMCA 4IGTA 3T0JA 3FXUA 1DTGA 3U65A 4GOTA 1NUXA 1A54A 1R9LA 1MXUA 2YLNA 3UK4A 1MQJA 3MUQA 4FBPA 3U93A 1R6ZA 3FBPA 4RXLA 3C31A 3FXBA 5IZ1A
chains in the Genus database with same CATH topology
3T1BA 4HXVA 4N8YA 2HXRA 1NV4A 1FBFA 3SZPA 4N4UA 1IMEA 3BIGA 2KR0A 2CEYA 3NOHA 4GX4A 1KA1A 5EQ7A 4PF8A 2HZKA 5ET8A 1EYKA 1AWBA 3RYDA 1KA0A 1NI9A 1NV3A 1NUWA 1K9YA 1EYJA 2FBPA 2WEFA 1BK4A 1FPJA 2F5XA 2CZIA 4NX1A 2OWZA 1LBVA 4PF6A 4X8RA 5F24A 4JVDA 4AS5A 4PAKA 2MKZA 2DVZA 4PTKA 5I5PA 4PDHA 3E79A 5ESYA 1IMBA 2P3VA 1NV2A 5FBPA 4PGPA 2VPNA 2QVVA 1FPIA 1FPEA 4N15A 4XFEA 2ZZWA 4H45A 2HPGA 3A29A 5T3JA 2VPOA 4P47A 3W9WA 1YZ0A 1LBXA 2XWIA 4N91A 3MYUA 2QVRA 2WX9A 3ROJA 1FRPA 4O94A 2FIXA 2KQZA 1FPKA 5ET5A 4F19A 1NUYA 2QPQA 4NGUA 2HHMA 2BJIA 3BIHA 4P56A 1D9QA 4PGNA 1NV6A 5CM6A 1FBDA 1FJ6A 5IZ3A 1CNQA 4UABA 4P3LA 4PDDA 4PAFA 2QFLA 2ZZXA 1YXIA 3W9VA 2JJKA 4P1EA 5I7IA 2PFZA 4MNIA 1LEVA 1FBGA 4N8GA 4KXPA 3PTYA 4JVCA 5J1DA 3B8BA 1QGXA 1VDWA 2GQ1A 2DE3A 4P1LA 2ZZVA 1DCUA 1DK4A 1XI6A 1RDZA 4PE3A 4P8BA 2F3BA 4NAPA 3EKIA 3KBZA 2VT5A 2Y5KA 2V3QA 4G61A 2FVZA 4MNPA 4GBWA 1Q9DA 2CZKA 4PETA 4N81A 1LBYA 3B50A 1RDXA 2WYPA 2B4MA 4OA4A 4N6KA 5EQ8A 4X04A 2CEXA 1FBCA 4X9TA 5LDZA 2FIEA 1LBWA 4N17A 2XWOA 4LN5A 2Y5LA 2XXKA 5IZ3B 5EQAA 3GYYA 4MX6A 4MCOA 3RPLA 5ET7A 3KC0A 1NV0A 2Q74A 3IFCA 5ET6A 5JK4A 4NQ8A 4MEVA 1FJ9A 2V4CA 1EYIA 4NHBA 5DW8A 4YZZA 4OVQA 1NV5A 5IZZA 4DI3D 4F1UA 4HE2A 4P9KA 1IMAA 1FPBA 2XWVA 5IGAA 4GWZA 4GWYA 4F1VA 4I3EA 4I3YA 2DE4A 3CHGA 4N6DA 1FPFA 1FPDA 4NF0A 2FHYA 4MMPA 4PC9A 4QBAA 5J16A 1NV7A 4MJOA 1FSAA 2R8TA 5EYGA 4OVPA 2WBBA 4PAIA 1NV1A 3HFUA 4M1VA 3LV0A 4H46A 4HCWA 3RPLB 1FBEA 4PFRA 5LTCA 2XA5A 2DDKA 1FBHA 4XEQA 1FBPA 1IMCA 1JP4A 2F3DA 4GWWA 2WYKA 4HE1A 1YYZA 5IM2A 4PBQA 2CZHA 1IMDA 3QMFA 4O7MA 4PCDA 4GX6A 4GWXA 1INPA 2PCRA 1IMFA 4XF5A 4PBHA 2L5VA 1FTAA 3MSTA 4O7IA 4JVIA 4PFBA 4PFIA 3KC1A 4NN3A 5A5LA 1RDYA 1FPGA 3IFAA 4HCYA 2Q9TA 3D1RA 2PFYA 4IR8A 4OVTA 2OX3A 2DE2A 1FPLA 4GWSA 2WBDA 4I40A 1DBZA 4NG7A 5EQ9A 1LBZA 1K9ZA 2HZLA 4YICA 1NUZA 1KZ8A 1SPIA 4QXDA 2XWKA 4AS4A 4F18A 4GBVA 5I3SA 4MNCA 4HE0A 4MIJA 4MAGA 4GX3A 3LUZA 5EYHA 1G0IA 3T0JA 4O8MA 4OVSA 1G0HA 3U65A 1NUXA 3E78A 4GWUA 2Q8MA 4OVRA 4FBPA 4OANA 2P3NA 4MHFA 4DI4B 3FBPA 2QVUA 2B4LA 3FXBA 3ISPA 5IZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CEX A;  2WYK A;  4P47 A;  5IM2 A;  4N17 A;  4N8Y A;  2XWI A;  4N91 A;  4PBQ A;  2XWO A;  4LN5 A;  2WX9 A;  2XXK A;  4O7M A;  4PCD A;  3GYY A;  4MX6 A;  4N4U A;  2CEY A;  4XF5 A;  4PBH A;  4O94 A;  4NQ8 A;  4PFB A;  4PFI A;  4PF8 A;  2HZK A;  4MEV A;  4NN3 A;  4NGU A;  2V4C A;  4NHB A;  4YZZ A;  4P56 A;  4OVQ A;  4PGN A;  2PFY A;  5CM6 A;  5IZZ A;  4OVT A;  4DI3 D;  4P9K A;  4UAB A;  4P3L A;  2XWV A;  4NG7 A;  5IGA A;  4PDD A;  4PAF A;  2HZL A;  2ZZX A;  4YIC A;  4P1E A;  5I7I A;  2PFZ A;  4MNI A;  4N6D A;  4N8G A;  2XWK A;  4NX1 A;  4NF0 A;  4MMP A;  4MNC A;  4PC9 A;  4P1L A;  4PF6 A;  4X8R A;  2ZZV A;  4PE3 A;  4P8B A;  4MIJ A;  4MAG A;  4PAK A;  4NAP A;  4OVP A;  4PAI A;  5I5P A;  4MNP A;  4PDH A;  4O8M A;  4OVS A;  3U65 A;  4PET A;  4PGP A;  2VPN A;  4PFR A;  5LTC A;  2XA5 A;  4OVR A;  3B50 A;  4OAN A;  4XEQ A;  4N15 A;  4XFE A;  2ZZW A;  2WYP A;  4MHF A;  2HPG A;  4OA4 A;  4DI4 B;  4N6K A;  2VPO A;  3FXB A;  4X04 A;  4MCO A; 
#chains in the Genus database with same CATH topology
 3LUY A;  3H6U A;  5ELV A;  4C1T A;  1SI0 A;  4F3G A;  2O1M A;  1USY E;  3KBR A;  1FBF A;  4QF9 A;  1MPD A;  3BIG A;  2UVH A;  4KHZ E;  1XT8 A;  3MVW A;  4R9G A;  4R2F A;  1B6H A;  4LON B;  5DYH A;  4NED A;  4GF8 A;  4GWO A;  1QVS A;  2UVI A;  5CMM A;  1OQG A;  3TCH A;  2H4I A;  1EYJ A;  2FBP A;  5AA3 A;  3PGF A;  2ZYN A;  1BK4 A;  3U92 A;  1FPJ A;  4R9F A;  3S2V A;  1Z7M E;  4NX1 A;  4U21 A;  3T96 B;  3MZB A;  4F3B A;  3TTL A;  5KDT A;  2RC8 A;  2MKZ A;  4BDR A;  4G2Z A;  2O68 A;  1PBQ A;  2OBG A;  3TTM A;  4KR5 A;  3EN3 A;  5ESY A;  2F8D A;  2VPN A;  3GBA A;  1NNF A;  3S4U A;  1S9T A;  4H45 A;  3IOW A;  2HPG A;  4RNS A;  4U22 A;  1TXF A;  4QRZ A;  4XKQ A;  3IOV A;  4G77 A;  3W9W A;  1YZ0 A;  3T9H B;  3S9L C;  4N91 A;  3MYU A;  3T9U A;  2RKM A;  4FE8 A;  3GBB A;  3TCG A;  4ZZA A;  4EQB A;  3TUS A;  3EHS A;  4G4P A;  1TFA A;  3ROJ A;  2ABH A;  2XXW A;  3CIJ A;  1MXX A;  3K2D A;  5KCJ B;  1YAE A;  3W15 C;  2R71 A;  4TQU Q;  3HST A;  2F7A A;  2DP8 A;  1GR2 A;  1MG1 A;  3EPE A;  1NUY A;  4XKR A;  3CVG A;  3C32 A;  5FHO A;  2HHM A;  2R6G E;  4NMY A;  1GTK A;  3TQW A;  1NV6 A;  2G29 A;  3QIM A;  5CM6 A;  2Y7W A;  1FQC A;  1FJ6 A;  1UTB A;  3LR1 A;  2AL5 A;  2ZYM A;  3CG3 A;  4RJZ A;  1XOC A;  4JBZ A;  4MF3 A;  4PDD A;  3RY3 A;  4OMB A;  1FCK A;  3JZJ A;  3VLU A;  4MNI A;  4N8G A;  3PTY A;  2E0S A;  2VP1 A;  4ZEB A;  3UN6 A;  3B8B A;  2QRY A;  1VDW A;  3CSB A;  3QUJ A;  1B40 A;  3KG2 A;  1RDZ A;  3U94 A;  4LZ8 A;  3EKI A;  2VOZ A;  1GGG A;  1B5H A;  2QS2 A;  3TEP A;  1VR5 A;  1NL5 A;  2PT1 A;  5DT6 A;  3E13 X;  4PET A;  1VE4 A;  4OEN A;  2CZL A;  3R26 A;  4YB7 A;  1O63 A;  1WDN A;  3MZ9 A;  4JDF A;  3B50 A;  1EU8 A;  3WAF A;  1LGB C;  1MDP 1;  2WYP A;  3N6U A;  3K1N A;  1H45 A;  5EQ8 A;  2CEX A;  1YCJ A;  3PPO A;  4N17 A;  2H98 A;  1UTB B;  2Y5L A;  5F1Q A;  4KCC A;  2PX1 A;  3GYY A;  4MX6 A;  3KN3 A;  3V8X B;  1NV0 A;  4GD5 A;  1P1U A;  3Q26 A;  1SVX B;  3RT6 B;  3U8Q A;  2Q74 A;  3E9X A;  1Y4T A;  1H43 A;  1L5T A;  3IR1 A;  1ATG A;  3VLW A;  2I4C A;  3FGS A;  4U23 A;  4OQO A;  2XXT A;  3G3H A;  3V83 A;  4TOZ A;  3GXA A;  1FPB A;  3RGY A;  3HV1 A;  4QHQ A;  3FAT A;  3D4C A;  3HN0 A;  2XD2 A;  4C0R A;  1MY0 A;  1M5D A;  4N6D A;  2RC9 A;  4ISU A;  4GLI A;  4MMP A;  4QBA A;  3IJO B;  2A5T A;  5J16 A;  3T9V A;  4PAI A;  1B3F A;  4TLM B;  3K0V A;  1XHY A;  1SYH A;  4NF6 A;  4EDP A;  3GLB A;  2I49 A;  1PC3 A;  2Z8D A;  1PBP A;  3MZ1 A;  3AXF A;  2Y7R A;  1B5I A;  4POW A;  3RLF E;  1NNK A;  1FBH A;  1FBP A;  4IGR A;  1IMC A;  1A55 A;  1SD3 A;  2I4B A;  5L9M A;  5DVJ A;  4MBP A;  5TU0 A;  3G3G A;  1IXH A;  2XXQ A;  3MPL A;  3Q28 A;  3RNN A;  2NUV A;  4QFL A;  3M3K A;  1NKX A;  1MPC A;  4GWX A;  1POY 1;  2PCR A;  2L5V A;  1B1H A;  1FTM A;  3SER A;  3MST A;  4O7I A;  2HFB A;  3CFL A;  4JVI A;  4PFB A;  4ESX A;  4LZ7 A;  2XXR A;  1MDQ A;  3C4M A;  3VVD A;  1AMF A;  4BDQ A;  5CC2 A;  4IR8 A;  2DWJ A;  4ND9 A;  3V5A A;  2OX3 A;  4H67 A;  4DDD A;  1FPL A;  1SBP A;  2WBD A;  1JW4 A;  1B4Z A;  4XKN A;  4I62 A;  4NF6 B;  4LUB A;  1CE2 A;  1Q1K A;  1K9Z A;  3E4R A;  2QMX A;  3T22 A;  3HCQ A;  3IL1 B;  3FV1 A;  3U1O A;  4I1D A;  3H6V A;  2RIN A;  1DOT A;  3MPK A;  4R74 A;  5K2Y A;  5I57 A;  4GBV A;  1MQD A;  4RPO A;  4EUO A;  1KWH A;  1LBC A;  4MIJ A;  3LUZ A;  5EYH A;  4H8I A;  3MVZ A;  1OLA A;  4O8M A;  1ZKB A;  3FV2 A;  3QUF A;  1MM7 A;  3FJG A;  1LCF A;  3PPP A;  1I69 A;  1HSL A;  3PUV E;  4KYE A;  2X26 A;  2Q8M A;  1YPN A;  4GVO A;  4ONY A;  1SI1 A;  2Y7I A;  3CR9 A;  1ELJ A;  3JYR A;  3MC2 A;  4GL8 A;  3FJ7 A;  3PUY E;  2P3N A;  4P0G A;  3IB1 A;  3VLV A;  4EF1 A;  3O29 A;  2B4L A;  3RTW B;  3TOD A;  3PD8 A;  4MCO A;  1JQF A;  4G8N A;  3K6V A;  4HXV A;  4N8Y A;  4U1O A;  5CBR A;  1NV4 A;  3SZP A;  4LA9 A;  1IME A;  1Y4C A;  3H6W A;  2OZZ A;  2ANJ A;  3H3G A;  4AQ4 A;  5CI5 A;  2I3W A;  5K2X A;  5EQ7 A;  2AL4 A;  2HXW A;  2PT2 A;  4OEV A;  5ICQ A;  2XXI A;  3RYD A;  1KA0 A;  3HHG A;  4ESW A;  5I56 B;  3S9M C;  3HHF A;  5EYF A;  4P11 A;  3M3F A;  2WEF A;  4NE4 A;  1MS7 A;  3OEM A;  2F5X A;  4WEP A;  2CZI A;  4OZ9 A;  4ZED A;  1FQA A;  3HPI A;  1N7X A;  4PF6 A;  4X8R A;  2VD2 A;  3SES A;  4F2Q A;  4RK9 A;  4AS5 A;  2V3U A;  4WED A;  4WXJ A;  3ILU B;  3H6T A;  5H8N A;  4PTK A;  2Q8J A;  5I5P A;  2PBW A;  3OO6 A;  4PDH A;  4R6H A;  2HAV A;  1QJM A;  4U4S A;  1NV2 A;  4PGP A;  2ONR A;  2I3V A;  1MY3 A;  2QVV A;  1B58 A;  3IOT A;  2ZMB A;  2Z8F A;  1ZTY A;  1FPI A;  1FPE A;  3R7X A;  5JTY A;  4XFE A;  1I6Q A;  2ZZW A;  1H3D A;  2A5S A;  4XXU A;  1AOV A;  2DS9 A;  3TTR A;  3VVE A;  4FJP A;  1FQE A;  4K3F A;  3TEL A;  1US5 A;  3TAJ A;  1LBX A;  4PFU A;  1NNP A;  3MP1 A;  5H8S A;  1Y3N A;  2UYE A;  1M5E A;  5I2K B;  1FRP A;  1MY4 A;  5DEX B;  4O94 A;  1FPK A;  4ELR A;  3TPA A;  4F19 A;  1EZP A;  4ECF A;  2X7P A;  1FQB A;  3MP8 A;  4JXI A;  3O28 A;  2BJI A;  3IX1 A;  4P56 A;  4QFP A;  4PGN A;  1MY2 A;  1OVT A;  5H8N B;  5IZ3 A;  1O7T A;  3Q27 A;  1M5F A;  1Y1M A;  4F39 A;  3DP6 A;  5ICT A;  3O2A A;  5FHN A;  4NF5 B;  4R73 A;  3W9V A;  5I7I A;  1LEV A;  1N7W A;  4YAH X;  4KXP A;  5AA4 B;  4OXV A;  4F2O A;  5JTY B;  1N04 A;  1AL3 A;  3SET A;  1DCU A;  2NWJ A;  1DK4 A;  1S7Y A;  4IO6 A;  4OER A;  4NAP A;  4YB6 A;  3MBP A;  1B0L A;  1LFG A;  1B3G A;  1OMP A;  3EQ1 A;  2Y5K A;  2O51 A;  2AIX A;  1Q35 A;  3KSX A;  4GBW A;  2KLF A;  5KCJ A;  4KD5 A;  2D21 A;  4P0I A;  4N81 A;  2Y7P A;  1LFI A;  3FVO A;  3WAE A;  3R6U A;  3PU5 A;  1FQD A;  5L8D A;  1URG A;  1MY1 A;  3TYH A;  1RDX A;  1UIV A;  4XTC Q;  4UAC A;  1JET A;  1Y20 A;  1EH3 A;  2RCB A;  2XXP A;  4X9T A;  3LSX A;  2WKY A;  1LBW A;  4U2R A;  2XWO A;  2F6P A;  5I58 B;  5IZ3 B;  4F29 A;  5EQA A;  3ZKL A;  3KOS A;  4JWO A;  3IFC A;  5JK4 A;  1NNT A;  4OFL A;  3PV0 E;  4MEV A;  5AE4 A;  1RKM A;  1DPE A;  4NHB A;  4DZ1 A;  4YZZ A;  2V84 A;  1NH8 A;  1QKB A;  1UQW A;  1IXC A;  1PEB A;  1MPB A;  4QSD A;  5IZZ A;  4DI3 D;  2BJJ X;  1RYX A;  5TP9 B;  3VE1 B;  3VXB A;  1IMA A;  3PMW A;  2XWV A;  5KZT A;  3L6G A;  4GWZ A;  3G3K A;  1MQH A;  4HTG A;  4I3Y A;  3IOR A;  3CHG A;  4KQP A;  5EHM A;  1FPF A;  4KYS A;  1FPD A;  3BKI B;  1OIB A;  2FHY A;  3BFU A;  1NV7 A;  3OEN A;  3H4Z A;  5EYG A;  2I6E A;  5AA2 D;  3OO7 A;  1NV1 A;  4HS7 A;  4M1V A;  4Z7E A;  4LAT A;  4ZE8 A;  4OTE A;  5ISU A;  4N07 A;  3UOR A;  3USD A;  3ECR A;  1FBE A;  3A3U A;  3F11 A;  4PFR A;  1UIU A;  2DDK A;  2F7B A;  4DXC A;  2XHD A;  3OMB A;  1FTO A;  4ZEC A;  2ZNS A;  2VHA A;  3G3I A;  4GWW A;  2WYK A;  3E3K A;  4AB5 A;  3N5L A;  4HE1 A;  2CMO A;  2NXO A;  4O7M A;  3QAX A;  4F3P A;  4QFK A;  4PBH A;  1FTA A;  4EXK A;  4O3B A;  4PFI A;  2F97 A;  1TFD A;  4FIM A;  2O84 X;  4NN3 A;  4QSC A;  5A5L A;  1ANF A;  1FPG A;  1B46 A;  2Q9T A;  2PFY A;  1P1W A;  4OVT A;  1Y3P A;  2DE2 A;  4L17 A;  4GWS A;  1SW2 A;  5EHS A;  1GV8 A;  2NVU B;  2X7Q A;  2HZL A;  2RC7 A;  2IA4 A;  1SPI A;  1MH4 A;  4Q8R A;  2I48 A;  2O69 A;  1DTZ A;  4ZZE A;  4F18 A;  2RF1 A;  4OVJ A;  3T66 A;  3ILT B;  1ZIU A;  1BKA A;  4HE0 A;  1P1N A;  4MAG A;  3MWB A;  3H03 A;  1G0I A;  1AIV A;  4WKM A;  3I5O A;  3IB2 A;  5H8H B;  1G0H A;  3BBR A;  1MRP A;  4G8M A;  1A8E A;  2QS4 A;  3THI A;  3PUZ E;  3QXM A;  1JVX A;  4OVR A;  4LQ2 A;  3MJN A;  1MXZ A;  5DTB A;  1AH5 A;  1O64 A;  5HPQ A;  2I0C A;  1QUI A;  2Y7K A;  4R6Y A;  3T1B A;  2DQV A;  4C1U A;  1MXY A;  4NF4 B;  5AA2 A;  2O7I A;  1J1N A;  1OVB A;  1URS A;  4DCX A;  4JSO A;  1LB9 A;  2GH9 A;  4N4U A;  3VV5 A;  1USY H;  2CEY A;  1LB8 A;  2V3T A;  3TFL A;  4IY5 A;  1KA1 A;  4RY1 A;  3CI8 A;  4PF8 A;  2HZK A;  3OSR A;  5ET8 A;  1IQ7 A;  5HBC A;  1LBB A;  3MQ9 A;  1EYK A;  3OSQ A;  2HEU A;  5TPA B;  1XVY A;  1AWB A;  4DXU A;  1NI9 A;  1NV3 A;  1NUW A;  1LST A;  2XXV A;  1GVC A;  1IIT A;  4R72 A;  1R9Q A;  4EQ7 A;  4O3A A;  3K6X A;  3VXC A;  3FVG A;  4M4G A;  2Q2C A;  1B32 A;  2Q88 A;  3TCF A;  5DVI A;  5CBS A;  3UIF A;  2R9J A;  4GXA A;  4YB5 A;  1LAF E;  2H99 A;  3B6T A;  4JVD A;  3C35 A;  3PUX E;  2F78 A;  5AA2 B;  3KN8 A;  5M2V A;  4GXS B;  1FQF A;  1BIY A;  3C33 A;  4Q0C A;  3B6W A;  2ZNT A;  1IMB A;  4DE8 A;  5FBP A;  3PD9 A;  2D5W A;  3IJX B;  3L6H A;  3MAM A;  2XXH A;  3DP4 A;  4GFR A;  3PUW E;  3SKP A;  3K1P A;  1ZBM A;  2VPO A;  5T3J A;  4F1Y A;  5I56 A;  4P47 A;  4PFY A;  3SEV A;  2XWI A;  2QVR A;  2WX9 A;  4PFT A;  3ZKK A;  1VFD A;  5B70 A;  1MH3 A;  1LAX A;  4BDN A;  3IO4 A;  2B3F A;  2KQZ A;  1LAG E;  4KI0 E;  1UTH A;  2GFE A;  4KCD A;  5H8Q A;  3SDF A;  3TKD A;  2QPQ A;  4NGU A;  1LLS A;  3CFZ A;  4IO2 A;  3RN8 A;  1D9Q A;  2Z22 A;  2DWH A;  1FBD A;  2B65 A;  4RPN A;  3MP6 A;  4OHN A;  4UAB A;  3OO9 A;  3JV9 A;  4FED A;  1QW0 A;  4PAF A;  3KFM A;  2QFL A;  4FEC A;  2ZZX A;  2JJK A;  1JW1 A;  4IO7 A;  3N6T A;  3TQL A;  1LFH A;  3KJ7 A;  1PB8 A;  4JVC A;  1QGX A;  1TT1 A;  2DE3 A;  4P1L A;  2F34 A;  1M5C A;  1XI6 A;  1QKA A;  4H65 A;  4P8B A;  5IAI A;  3OEL A;  4I8C A;  4G61 A;  4OET A;  1HSJ A;  4MNP A;  1B9J A;  4ELQ A;  5I2K A;  1QUJ A;  5DEX A;  3FAS A;  2CZK A;  3MVY A;  2VD3 A;  3KZG A;  3TDJ A;  1MXV A;  5AA1 A;  3H7M A;  2W7Y A;  5BUU A;  4YMB A;  2PVU A;  1JEV A;  1SQY A;  1UTH B;  4LQ5 A;  5H8Q B;  4MLQ A;  3UP9 A;  3KJT A;  4N6K A;  3OEK A;  3PPQ A;  1FW0 A;  4X04 A;  1FBC A;  5LDZ A;  1IXG A;  5CRY A;  3EHU A;  2FIE A;  4OFO A;  4NWC A;  2XXK A;  4NF5 A;  1H76 A;  5ET7 A;  1PDA A;  3O66 A;  3GZG A;  5AA4 A;  1IUD A;  4NF8 B;  4BDO A;  5CMK A;  5ET6 A;  4H8J A;  2YPN A;  3EHT A;  2HAU A;  4NTL A;  1QUK A;  1FJ9 A;  4PQJ A;  1T0K A;  2V4C A;  3DLN A;  5DW8 A;  1MQG A;  4OVQ A;  1NV5 A;  3FVK A;  2NOO A;  4GL0 A;  4F1U A;  5I84 A;  3K6W A;  3ONM A;  3K00 A;  5IGA A;  4GRK A;  4H5G A;  3IAZ A;  4GWY A;  2H25 A;  4LP2 B;  3SEW A;  3K01 A;  2Z23 A;  1DMB A;  4R75 A;  2DE4 A;  1N0T A;  4KYD A;  5B7D A;  4GQO A;  1DPP A;  1B5J A;  4NF0 A;  2OJT A;  3PPN A;  1B7H A;  4MJO A;  1FSA A;  3ZS6 A;  5I58 A;  4EXL A;  1POT A;  4OVP A;  4N6P A;  1XVX A;  4JWY A;  4H46 A;  3OOA A;  4HCW A;  2AYS A;  4Q5T A;  3B6Q A;  4DIG A;  5LTC A;  4RYA A;  3FJM A;  4U4X A;  4TLL B;  1H44 A;  4XEQ A;  1N3W A;  4ELO A;  1JP4 A;  2F7C A;  5TP9 A;  1TWY A;  3LSL A;  3U72 A;  1Y3Q A;  1URD A;  1YYZ A;  2ZNU A;  1EZ9 A;  2CZH A;  1IMD A;  3SEX A;  2O6A A;  2F35 A;  3FUZ A;  3I6V A;  4NWD A;  1EZO A;  3ZSF A;  4GX6 A;  5H8F B;  1US4 A;  1IMF A;  4I9D A;  1I6B A;  1B3H A;  3K6U A;  3T9X B;  2QMW A;  4XKP A;  1VSO A;  3KC1 A;  4ZEF A;  3FXR A;  3IFA A;  3MVX A;  3TTN A;  2G93 A;  1WOD A;  3D1R A;  4MFI A;  3KN7 A;  4I40 A;  2E1S A;  4Q30 B;  1DBZ A;  2ZYO A;  5EQ9 A;  1LAH E;  3OO8 A;  3EF7 A;  2V25 A;  4ZDM A;  2RCA A;  2D3I A;  1NUZ A;  1KZ8 A;  2ESN A;  4O3C A;  3FXQ A;  2H9B A;  2LAO A;  1DSN A;  4MNC A;  3K4U A;  3LBS A;  1I6A A;  4MH5 A;  4IO5 A;  4JB7 A;  2REJ A;  3KGC A;  3IK6 B;  4H5F A;  4G68 A;  4QFN A;  3H06 B;  4OVS A;  1IZ1 A;  4KFQ A;  3E78 A;  2Q2A A;  1FTL A;  5I59 A;  1A7L A;  4GWU A;  1F9B A;  4OAN A;  3G3J A;  3RTF B;  4MHF A;  4DI4 B;  1HSE A;  1MXW A;  2QVU A;  3ISP A;  4PP0 A;  3N26 A;  4THI A;  5KDT B;  1N3X A;  2HXR A;  3O9P A;  2FYI A;  3RQT A;  2DVC A;  4X48 A;  3S9N C;  4Z0I A;  2QS3 A;  2ONK E;  2KR0 A;  3C34 A;  2XX8 A;  2DXR A;  3NOH A;  4GX4 A;  2PMS A;  4YKK A;  2VGQ A;  4R6K A;  5F7V A;  1B3L A;  3VDF A;  4E0X A;  1N76 A;  4G68 C;  5H8H A;  4HW8 A;  1BLF A;  3LSF B;  3CG1 A;  4FAT A;  1OQH A;  2B3B A;  4G68 B;  1K9Y A;  4H6D A;  1B2H A;  2ALU A;  2F6G A;  1SW1 A;  2XX9 A;  5I59 B;  3QYT A;  3CRB A;  1IIW A;  3RT8 A;  3S9E A;  3A3C A;  2OWZ A;  2OK2 A;  1JVY A;  4NF4 A;  1LBV A;  5F24 A;  1B51 A;  2DWI A;  4PAK A;  3IO6 A;  2V93 A;  4QFO A;  2DVZ A;  3O6G A;  3RUM A;  1JNF A;  3VVF A;  3E79 A;  4YKP A;  2DXY A;  4YMA A;  1P99 A;  3QK6 A;  5A5X A;  1D9V A;  2P3V A;  3ODB A;  5FTH A;  1B7Z A;  2THI A;  1MM6 A;  4LZ5 A;  1ZLQ A;  4N15 A;  1B4H A;  1A40 A;  1BP5 A;  3M8U A;  5TPA A;  3I3V A;  4FAJ A;  3A29 A;  1RYO A;  1SW5 A;  1QUL A;  4ZEI A;  4ZS9 A;  1JEU A;  4U1Z A;  4RA1 A;  3LSW A;  4DLD A;  1P1Q A;  5L9S A;  2XXU A;  4IO4 A;  2GHA A;  1FTJ A;  2HCA A;  2DSF A;  2FIX A;  4BLA A;  3FIR A;  5ET5 A;  4YKJ A;  4IB2 A;  1S50 A;  3TZA A;  3KSJ A;  3BIH A;  2O1L A;  1B52 A;  2DWA A;  3K02 A;  1IEJ A;  4ZE9 A;  4OES A;  1A8F A;  3UGW A;  2OCU A;  3B7D A;  5ITO A;  1CNQ A;  3O97 A;  4P3L A;  3SEY A;  3P7I A;  1B0H A;  4FOR A;  5A5X B;  4F31 B;  1YXI A;  4P1E A;  2PFZ A;  1R1N A;  2XX7 A;  1FBG A;  1OLC A;  5J1D A;  2UVJ A;  1NMU A;  2DOJ A;  2GQ1 A;  3DEL B;  2ZZV A;  4PE3 A;  2I58 A;  2F3B A;  5I2N A;  4UA8 A;  3A09 A;  1LCT A;  2VT5 A;  3KBZ A;  2V3Q A;  1NFT A;  2FVZ A;  1JW5 A;  2IEE A;  3TTK A;  1Q9D A;  4ELP A;  5HM4 B;  1LBY A;  3OXN A;  2F36 A;  2I0B A;  4FEB A;  3N94 A;  1B1X A;  1PB9 A;  4YU0 A;  2H5Y A;  3SEU A;  2FNC A;  2B4M A;  3UA8 A;  4OA4 A;  5CMB A;  2QL3 A;  2OLB A;  3CSG A;  2GHB A;  3RPW A;  4KPT A;  1Z7N E;  2A5T B;  4LN5 A;  2GRV A;  2P0S A;  1D4N A;  3RPL A;  2YJP A;  4POX A;  3KC0 A;  4H1X A;  1PB7 A;  4NQ8 A;  3FVN A;  3VFJ A;  4IO3 A;  4GIZ A;  1WVJ A;  4N13 A;  3FZV A;  1FTK A;  4JSD A;  3BFT A;  4XIG Q;  1EYI A;  2QJE A;  5I2N B;  2Z8E A;  4QSE A;  3G3F A;  4DXB A;  1CB6 A;  3KEI A;  4HE2 A;  4P9K A;  5ITP A;  5BWJ A;  2QSX A;  4F1V A;  1SW4 A;  4I3E A;  2FA7 A;  3Q25 A;  2OWT A;  3CFX A;  4RK2 A;  3O6H A;  1Y1Z A;  4X1D A;  3TMG A;  5FTI A;  4BDL A;  2P2A A;  3PPR A;  4H0W A;  4PC9 A;  3V89 B;  3D4G A;  1B3E A;  5LOM A;  4E0W A;  2R8T A;  2ZXT A;  3IB0 A;  1D9Y A;  2WBB A;  3HFU A;  1Y9U A;  1D3K A;  3LV0 A;  1II5 A;  1XC1 A;  3FD3 A;  4F3S A;  1M5B A;  4NF8 A;  3RPL B;  3Q29 A;  4ZEK A;  5DVF A;  4IY6 A;  4R2B A;  4EQ9 A;  2XA5 A;  2O7U A;  2M8C A;  1P1O A;  4YKI A;  2HQ0 A;  2UYF A;  3DM0 A;  2XD3 A;  3KOT A;  3IOU A;  2F3D A;  2XXY A;  1YTV A;  5I57 B;  4OWD A;  3G7W A;  3O6I A;  2ZYK A;  5IM2 A;  2P1S A;  3C9H A;  4PBQ A;  1BTJ A;  2DYX A;  1A99 A;  1SDX A;  3QMF A;  1N84 A;  4PCD A;  2Y84 A;  1ZMG A;  2ONS A;  4JWX A;  1MQI A;  5JEI A;  1ZU0 A;  4OEU A;  1INP A;  4XF5 A;  4PE5 B;  1B7U A;  2QS1 A;  3LC8 A;  2OWS A;  1NH7 A;  1ZJL A;  1IXI A;  3OD7 A;  4MLV A;  1RDY A;  4G8H A;  3C36 A;  1B05 A;  4HCY A;  4AB6 A;  4BDM A;  2XXX A;  3MW0 A;  4PFW A;  3T93 B;  4F22 A;  4OYV A;  4NG7 A;  3PMX A;  1LBZ A;  5L9O A;  5FHM A;  2Q89 A;  4OFJ A;  1VFE A;  4X1B A;  3QSL A;  2UXA A;  4YIC A;  3DP8 A;  2UVG A;  3M3L A;  4QXD A;  2XWK A;  4AS4 A;  5I3S A;  4EF2 A;  3K1M A;  5IKB A;  1XS5 A;  4DCY A;  2REG A;  4GX3 A;  3PMV A;  2PYY A;  3HO7 A;  4LVQ A;  5H8F A;  1SYI A;  5CMC A;  4IGT A;  3T0J A;  3FXU A;  1DTG A;  3U65 A;  4GOT A;  1NUX A;  1A54 A;  1R9L A;  1MXU A;  2YLN A;  3UK4 A;  1MQJ A;  3MUQ A;  4FBP A;  3U93 A;  1R6Z A;  3FBP A;  4RXL A;  3C31 A;  3FXB A;  5IZ1 A; 
#chains in the Genus database with same CATH homology
 3T1B A;  4HXV A;  4N8Y A;  2HXR A;  1NV4 A;  1FBF A;  3SZP A;  4N4U A;  1IME A;  3BIG A;  2KR0 A;  2CEY A;  3NOH A;  4GX4 A;  1KA1 A;  5EQ7 A;  4PF8 A;  2HZK A;  5ET8 A;  1EYK A;  1AWB A;  3RYD A;  1KA0 A;  1NI9 A;  1NV3 A;  1NUW A;  1K9Y A;  1EYJ A;  2FBP A;  2WEF A;  1BK4 A;  1FPJ A;  2F5X A;  2CZI A;  4NX1 A;  2OWZ A;  1LBV A;  4PF6 A;  4X8R A;  5F24 A;  4JVD A;  4AS5 A;  4PAK A;  2MKZ A;  2DVZ A;  4PTK A;  5I5P A;  4PDH A;  3E79 A;  5ESY A;  1IMB A;  2P3V A;  1NV2 A;  5FBP A;  4PGP A;  2VPN A;  2QVV A;  1FPI A;  1FPE A;  4N15 A;  4XFE A;  2ZZW A;  4H45 A;  2HPG A;  3A29 A;  5T3J A;  2VPO A;  4P47 A;  3W9W A;  1YZ0 A;  1LBX A;  2XWI A;  4N91 A;  3MYU A;  2QVR A;  2WX9 A;  3ROJ A;  1FRP A;  4O94 A;  2FIX A;  2KQZ A;  1FPK A;  5ET5 A;  4F19 A;  1NUY A;  2QPQ A;  4NGU A;  2HHM A;  2BJI A;  3BIH A;  4P56 A;  1D9Q A;  4PGN A;  1NV6 A;  5CM6 A;  1FBD A;  1FJ6 A;  5IZ3 A;  1CNQ A;  4UAB A;  4P3L A;  4PDD A;  4PAF A;  2QFL A;  2ZZX A;  1YXI A;  3W9V A;  2JJK A;  4P1E A;  5I7I A;  2PFZ A;  4MNI A;  1LEV A;  1FBG A;  4N8G A;  4KXP A;  3PTY A;  4JVC A;  5J1D A;  3B8B A;  1QGX A;  1VDW A;  2GQ1 A;  2DE3 A;  4P1L A;  2ZZV A;  1DCU A;  1DK4 A;  1XI6 A;  1RDZ A;  4PE3 A;  4P8B A;  2F3B A;  4NAP A;  3EKI A;  3KBZ A;  2VT5 A;  2Y5K A;  2V3Q A;  4G61 A;  2FVZ A;  4MNP A;  4GBW A;  1Q9D A;  2CZK A;  4PET A;  4N81 A;  1LBY A;  3B50 A;  1RDX A;  2WYP A;  2B4M A;  4OA4 A;  4N6K A;  5EQ8 A;  4X04 A;  2CEX A;  1FBC A;  4X9T A;  5LDZ A;  2FIE A;  1LBW A;  4N17 A;  2XWO A;  4LN5 A;  2Y5L A;  2XXK A;  5IZ3 B;  5EQA A;  3GYY A;  4MX6 A;  4MCO A;  3RPL A;  5ET7 A;  3KC0 A;  1NV0 A;  2Q74 A;  3IFC A;  5ET6 A;  5JK4 A;  4NQ8 A;  4MEV A;  1FJ9 A;  2V4C A;  1EYI A;  4NHB A;  5DW8 A;  4YZZ A;  4OVQ A;  1NV5 A;  5IZZ A;  4DI3 D;  4F1U A;  4HE2 A;  4P9K A;  1IMA A;  1FPB A;  2XWV A;  5IGA A;  4GWZ A;  4GWY A;  4F1V A;  4I3E A;  4I3Y A;  2DE4 A;  3CHG A;  4N6D A;  1FPF A;  1FPD A;  4NF0 A;  2FHY A;  4MMP A;  4PC9 A;  4QBA A;  5J16 A;  1NV7 A;  4MJO A;  1FSA A;  2R8T A;  5EYG A;  4OVP A;  2WBB A;  4PAI A;  1NV1 A;  3HFU A;  4M1V A;  3LV0 A;  4H46 A;  4HCW A;  3RPL B;  1FBE A;  4PFR A;  5LTC A;  2XA5 A;  2DDK A;  1FBH A;  4XEQ A;  1FBP A;  1IMC A;  1JP4 A;  2F3D A;  4GWW A;  2WYK A;  4HE1 A;  1YYZ A;  5IM2 A;  4PBQ A;  2CZH A;  1IMD A;  3QMF A;  4O7M A;  4PCD A;  4GX6 A;  4GWX A;  1INP A;  2PCR A;  1IMF A;  4XF5 A;  4PBH A;  2L5V A;  1FTA A;  3MST A;  4O7I A;  4JVI A;  4PFB A;  4PFI A;  3KC1 A;  4NN3 A;  5A5L A;  1RDY A;  1FPG A;  3IFA A;  4HCY A;  2Q9T A;  3D1R A;  2PFY A;  4IR8 A;  4OVT A;  2OX3 A;  2DE2 A;  1FPL A;  4GWS A;  2WBD A;  4I40 A;  1DBZ A;  4NG7 A;  5EQ9 A;  1LBZ A;  1K9Z A;  2HZL A;  4YIC A;  1NUZ A;  1KZ8 A;  1SPI A;  4QXD A;  2XWK A;  4AS4 A;  4F18 A;  4GBV A;  5I3S A;  4MNC A;  4HE0 A;  4MIJ A;  4MAG A;  4GX3 A;  3LUZ A;  5EYH A;  1G0I A;  3T0J A;  4O8M A;  4OVS A;  1G0H A;  3U65 A;  1NUX A;  3E78 A;  4GWU A;  2Q8M A;  4OVR A;  4FBP A;  4OAN A;  2P3N A;  4MHF A;  4DI4 B;  3FBP A;  2QVU A;  2B4L A;  3FXB A;  3ISP A;  5IZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...