5ICTA

Crystal structure of the drosophila glur1a ligand binding domain y792t mutant complex with glutamate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
266
structure length
266
Chain Sequence
GSYDRNHTYIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKGTPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTTDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor 1
publication title Novel Functional Properties of Drosophila CNS Glutamate Receptors.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 85
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2016-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5ictA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5ictA02
3N6TA 3C31A 1VFEA 4RJZA 4JWOA 3KZGA 1NMUA 2HEUA 3PUVE 1IXHA 1XVXA 5I56B 2GFEA 1LAFE 2V3TA 4QFOA 4QFPA 2DQVA 4DDDA 3M3LA 3JZJA 3RLFE 1M5BA 1ZMGA 2NUVA 2XX7A 3DELB 2P0SA 4NF6A 5DVJA 2REJA 1N7XA 2X7PA 4XKPA 3KOSA 4ELQA 3N6UA 2VGQA 3KJTA 1S9TA 2O51A 4KCDA 1USYH 3DM0A 1OVBA 4DXCA 1TT1A 1B7HA 2A5TA 2I6EA 2O7UA 1H44A 4IO7A 1R9LA 3O9PA 3MP6A 3K1PA 1MY4A 5DEXA 3OO9A 1PB8A 3G3HA 3K1MA 3UORA 4OTEA 1B5HA 5L9OA 5I58B 3DP6A 5EHSA 2UYEA 2RC8A 5ICTA 3BBRA 3FASA 3PUZE 3FUZA 3H4ZA 3OEMA 3PPNA 4H67A 4FIMA 3TMGA 4YMAA 2D3IA 4X48A 4EF2A 4GVOA 5CC2A 2OBGA 3U93A 3O6GA 1SYHA 4R2FA 1QW0A 4U22A 3MC2A 5L9SA 3S9EA 4JXIA 1XHYA 1R9QA 1XVYA 3M3FA 2F78A 3QAXA 1UIUA 2I58A 3TCFA 3TYHA 1F9BA 4G4PA 3KN7A 3MP1A 2HCAA 4FORA 3QUJA 3IX1A 3TFLA 1VR5A 3OSRA 3M8UA 4F18A 1B5IA 3EQ1A 5H8NB 3IJOB 3PMWA 4PFWA 3MZBA 3I3VA 3D4CA 3DLNA 4EUOA 4IO5A 1AIVA 4LZ8A 2V93A 3H6WA 4G68C 1H43A 1IXGA 5HM4B 4EQBA 1JNFA 2I49A 2UVGA 1IIWA 4DZ1A 2QS3A 2DYXA 4H5GA 4ISUA 4G77A 5I59A 3ZS6A 1OLAA 1LLSA 1LCFA 2Y7IA 1MDP1 3BFTA 4YMBA 4EQ7A 3G3KA 4I9DA 4GQOA 1TXFA 1D9VA 2RC7A 4DXUA 2Y7PA 3IB1A 2DSFA 3S9LC 1AMFA 2RINA 1PDAA 1B3LA 1HSLA 4ECFA 1AL3A 2PVUA 4L17A 3MW0A 2DOJA 3E3KA 5AE4A 1A8FA 1A8EA 3SKPA 3W9WA 4N13A 1NKXA 3UGWA 1MM7A 1GGGA 3PUWE 4OFJA 3BKIB 3T66A 2O69A 2RC9A 4KPTA 4FAJA 1NNKA 2UVJA 1IITA 3IO4A 2I4CA 3TELA 5LOMA 1N04A 5L9MA 2X7QA 4C1TA 3FXUA 1O7TA 3B7DA 3PD8A 3TPAA 1VSOA 4OEVA 5TU0A 2P2AA 2ESNA 5FHNA 4ZS9A 5ITOA 4M4GA 2XHDA 3TTNA 4AQ4A 1WVJA 2OWTA 1NNPA 1I6BA 3VVEA 1P1QA 4OVJA 1PB7A 3FGSA 4YB7A 4JSDA 4LZ5A 2FNCA 3M3KA 4ZEDA 1J1NA 1URGA 4EXLA 3KBRA 1TWYA 3JYRA 3OOAA 4YKKA 1ZTYA 3QK6A 3FXRA 3ONMA 3K02A 3RNNA 3I6VA 2F35A 4ELPA 3L6HA 3VXCA 4MLVA 3Q28A 1SW1A 4NF5A 4FEDA 1D3KA 4TLMB 3CFXA 1B3GA 4G68A 3TCHA 2QPQA 2XXRA 1VE4A 1M5CA 3A3CA 1MY2A 3QXMA 1A40A 4NMYA 4Q5TA 2DXRA 3S9MC 2NXOA 3T9XB 1N3WA 1I69A 3E9XA 4HTGA 3W9VA 3PUXE 2HAUA 3K2DA 2QL3A 3PMVA 1MXYA 3RT6B 1D4NA 1H76A 3VDFA 1SW5A 2DXYA 3MVYA 2Q9TA 2ZNTA 3RT8A 2NWJA 1A7LA 3VLWA 1LAHE 4Z0IA 1D9YA 4GL8A 3ECRA 3CVGA 3MVWA 5CBSA 1USYE 1DPEA 4NTLA 4X9TA 2ZYNA 2I0BA 5M2VA 2IA4A 4HCYA 2I4BA 4R74A 2R9JA 1L5TA 2QMWA 2UVIA 1NNFA 3K00A 4KFQA 2HZLA 3SEWA 4MH5A 4U21A 1MPCA 4DXBA 3MQ9A 5I2NA 5J1DA 3S9NC 1ATGA 4BDRA 5FTIA 4KI0E 1UTHA 4PFTA 3MP8A 4QF9A 4H65A 4LQ5A 2RCBA 3TZAA 3Q25A 5ICQA 3OEKA 1LFIA 4GD5A 1URSA 2GRVA 4R9GA 3VLVA 1IUDA 2Q89A 1JW5A 3MVXA 4JSOA 1US5A 3O97A 5I56A 2YJPA 2PX1A 3FV1A 2ONRA 4LZ7A 4ZECA 5H8QA 2PT2A 1Y9UA 1IXIA 1JVYA 2O6AA 4RYAA 1MXXA 3CSBA 4PP0A 2Z8EA 4XIGQ 5K2XA 2Z8DA 1OVTA 2OK2A 3TQLA 1S7YA 1P1OA 1QULA 1MXZA 4BDOA 4PFYA 2KLFA 2F36A 1R1NA 1Y3QA 3ZSFA 3TTRA 2Y7WA 1UTBA 4MLQA 2XXHA 2H98A 3H6VA 1XS5A 2XXYA 3OELA 3FZVA 1XT8A 2YLNA 1EH3A 4NF4B 3UP9A 2ONKE 1TFDA 4X1DA 1H45A 5A5XB 3K1NA 3MZ9A 4G8HA 2H25A 2Y7KA 2VP1A 2DS9A 3HHGA 3MZ1A 5AA2D 2H9BA 3N26A 3ODBA 5JK4A 3T9HB 4KD5A 1ZJLA 2F7BA 4QFLA 4KHZE 4KR5A 5L8DA 1B3FA 4QHQA 3FATA 1Y20A 2OCUA 3TDJA 1LAGE 1NH8A 4GL0A 4YU0A 4Q8RA 4OZ9A 1B58A 2H5YA 2GH9A 4GLIA 3B6WA 4DIGA 2DWHA 3LSLA 5KZTA 1US4A 1B0LA 3CG3A 4R6KA 2HXWA 3DP8A 5DEXB 1M5DA 1PBPA 3TTMA 1IXCA 1N84A 1MDQA 1FQCA 4O3BA 3Q26A 3H03A 4EQ9A 3E4RA 4OQOA 3TQWA 4GIZA 4F19A 3D4GA 4PE5B 2D21A 3KJ7A 2VOZA 1PEBA 4TQUQ 5ISUA 3CSGA 4KYDA 3TEPA 4F3PA 1MY3A 2B3BA 3O29A 1MRPA 4FJPA 3SERA 2XXIA 3HCQA 3C4MA 3VE1B 4OERA 4RK2A 5CMBA 4LA9A 2AL5A 5ELVA 4KYSA 3JV9A 4F29A 1A99A 3K0VA 1MS7A 3PGFA 5BWJA 5DTBA 3FJMA 2QMXA 2RKMA 3ZKLA 4F1UA 3SEYA 1JW1A 5JEIA 4THIA 1JETA 4P0IA 1MXUA 4BDMA 1MQDA 2PYYA 1NL5A 4FECA 3G3JA 4POXA 3N5LA 3RY3A 1VFDA 3KSJA 4GOTA 4F2OA 3IJXB 2PT1A 4IB2A 4YKIA 5TP9A 2F5XA 3EF7A 2CZLA 1B05A 1WODA 2PBWA 2ZMBA 3R26A 3IOWA 2ZYOA 1CB6A 5IAIA 2ZXTA 2BJJX 5AA2A 4WKMA 3IORA 4HCWA 1QKBA 4IGTA 3SEVA 4U2RA 3SEXA 4UACA 3LUYA 4FEBA 3N94A 2RCAA 1EZOA 3WAEA 4BLAA 5H8HA 4LQ2A 4O3AA 1MG1A 2I3VA 3CR9A 1JQFA 1FQEA 2W7YA 3FD3A 5I59B 3FJ7A 2XXWA 2XD2A 3H06B 4JWXA 3U72A 1MQHA 4QFNA 3EN3A 1TFAA 4OETA 2XXTA 3IO6A 4JDFA 5CI5A 2O68A 4BDQA 4ESXA 4F31B 4Z7EA 3SESA 4YB5A 3IL1B 1BP5A 3IOVA 3DP4A 4P0GA 2XXXA 4EXKA 1Y4CA 2DE4A 1OLCA 3H6TA 4G2ZA 4F39A 5DYHA 1POTA 3G3IA 3IK6B 2O7IA 3FJGA 3EHTA 4R9FA 4LP2B 4OFOA 3K6XA 4ELRA 2ZYMA 1GV8A 4OFLA 1GTKA 5I2KB 4XXUA 1ZBMA 3T22A 4X1BA 3RTFB 5CMCA 3MWBA 1N76A 4R6YA 4RPOA 1BIYA 3MPLA 1M5EA 1SW4A 5H8SA 2F7CA 1P1NA 3PPQA 4LATA 3B6QA 3K6WA 1MXVA 3ILUB 3CIJA 4WEDA 5EHMA 1NH7A 1IEJA 3K01A 4U4XA 3LSXA 1O64A 3H3GA 3OENA 4PQJA 4JB7A 2O84X 1R6ZA 1P99A 4Q30B 3HSTA 4LONB 3E13X 2G29A 5KDTB 4KYEA 4ESWA 2XX8A 1URDA 3EPEA 4WEPA 1B1XA 4H5FA 2F97A 1MQIA 2QS2A 2HQ0A 1JW4A 3GLBA 4IO6A 1LB8A 5AA1A 1MPBA 4QFKA 1Z7NE 4ZZEA 3F11A 4ZEBA 4IY6A 4E0XA 3KN8A 4NF8B 4JBZA 1NNTA 3V89B 3I5OA 3T93B 1FTMA 3Q29A 2Y7RA 2F34A 4PETA 2ZYKA 1DOTA 4PFUA 1LGBC 4NF5B 1RKMA 2Q88A 2LAOA 2O1MA 4KQPA 5CRYA 1S50A 4G68B 4M1VA 1B1HA 2V3QA 2ANJA 1FQAA 3PPRA 4NEDA 4GF8A 2VHAA 2AIXA 1B40A 1O63A 2RF1A 4AB6A 1CE2A 1BLFA 1B4ZA 2UXAA 1I6AA 3VFJA 5CMKA 3LC8A 4LVQA 3G3FA 2HAVA 3TKDA 5I57A 5H8FA 4XKNA 4YKPA 3MJNA 4IO3A 4G8MA 3MBPA 3ILTB 2UYFA 3GXAA 1B46A 3O6IA 1SBPA 2E1SA 4F22A 1AOVA 3PPPA 1T0KA 4OESA 2ABHA 4OEUA 5TPAA 4RY1A 4DCXA 3H7MA 4MFIA 2V25A 2THIA 2F6PA 1Z7ME 3U92A 4IY5A 5AA4B 5I2NB 2Y84A 3BFUA 3V5AA 3OO8A 4GRKA 1OMPA 5JTYB 2PMSA 1UTHB 4EF1A 4ND9A 3FV2A 1Y1ZA 3UK4A 4F2QA 4YAHX 5KCJB 3CRBA 3K4UA 3S2VA 3LR1A 3CFLA 2DVZA 2QSXA 3PUYE 4H8IA 3OXNA 2Q8JA 2XXPA 4OWDA 1YAEA 4TLLB 4ZEIA 2OJTA 3TTKA 4U1ZA 1JEVA 4ONYA 2NVUB 1SD3A 1FTKA 4YKJA 4NF4A 4C0RA 2R6GE 3KN3A 1MY1A 5A5XA 5H8QB 4YICA 2ONSA 3SDFA 3R7XA 4ELOA 4H8JA 3PV0E 2CMOA 5HBCA 1RYOA 3KSXA 3W15C 3OMBA 5ITPA 3FXQA 2DE2A 2D5WA 3C9HA 1IZ1A 5DT6A 3PU5A 1B4HA 4NF6B 2GHAA 1UIVA 1LBBA 3RPWA 1UTBB 2I3WA 4GWOA 1FTJA 1HSEA 2DWIA 4H1XA 3R6UA 5I58A 4DCYA 3O66A 3FVKA 3C35A 1P1WA 3EHUA 2HZKA 1LSTA 2Z8FA 2OLBA 2YPNA 3O2AA 4GXAA 1EZ9A 1FQBA 4C1UA 2A5TB 1JEUA 3CG1A 4AB5A 3RUMA 4OENA 2F6GA 4YB6A 1LFHA 3PPOA 4N07A 3TUSA 3MPKA 4ZE9A 1B0HA 1SYIA 1FTLA 1II5A 3SEUA 1B3HA 2R71A 2Q2CA 3A3UA 1FQDA 3HN0A 3VV5A 1DPPA 2OZZA 2G93A 4F1VA 3C36A 3QSLA 4LUBA 4DLDA 5IKBA 3VVDA 1QUJA 4F1YA 5EYFA 3UA8A 3SETA 2NOOA 2F8DA 1PBQA 4XTCQ 3K6UA 4U4SA 5FHMA 4RPNA 2FA7A 4IO2A 4MF3A 1KWHA 4GXSB 1SW2A 1DSNA 4R75A 2DWJA 1QKAA 5H8NA 1MM6A 1BKAA 4F3SA 3IB2A 3TTLA 1YCJA 3K6VA 1ANFA 1B32A 2XXVA 1Y3PA 5BUUA 2Q2AA 1WDNA 2XD3A 1EU8A 1FTOA 4NWCA 2H99A 3B6TA 3MVZA 1DTZA 1MPDA 3L6GA 3QYTA 1PC3A 3QUFA 3KOTA 4P11A 1B5JA 4RA1A 1XOCA 1B3EA 1SI0A 4NWDA 2B3FA 3HO7A 1DMBA 4WXJA 3AXFA 2FYIA 3KEIA 2QS4A 1N3XA 4ZE8A 4OXVA 3LSWA 2DVCA 2ZNUA 4H6DA 3U1OA 1ELJA 4POWA 1MY0A 3LSFB 3S4UA 2IEEA 5TP9B 4F3BA 4QRZA 1FCKA 1QUKA 5FTHA 1MH3A 1QUIA 1H3DA 3QIMA 1LBCA 4KCCA 1B7ZA 2QRYA 5CBRA 1AH5A 4DE8A 5AA2B 4JWYA 3HPIA 3P7IA 4ZZAA 2XX9A 1B52A 1ZKBA 4MBPA 4QSCA 1LCTA 1Q35A 5DVFA 3PMXA 4TOZA 2F7AA 2I0CA 2HFBA 4N6PA 3TODA 3IR1A 4FE8A 3USDA 2O1LA 4EDPA 3V83A 3HHFA 5H8HB 5HPQA 3H6UA 3OD7A 1HSJA 3FIRA 1LFGA 2V3UA 3IOTA 1B7UA 3MUQA 3KFMA 1MQGA 3WAFA 3U8QA 4I1DA 3IOUA 4RK9A 3A09A 1EZPA 5I2KA 3GBAA 2E0SA 1GVCA 3T96B 2UVHA 1NFTA 2VD3A 2AL4A 3OO6A 3C34A 3G3GA 3ZKKA 5CM6A 1LAXA 1Y1MA 1OIBA 4I8CA 4ZEFA 4U1OA 4ZEKA 1XC1A 1BTJA 4HS7A 3T9VA 3MAMA 3G7WA 1I6QA 3O6HA 3RTWB 1A54A 3C32A 1QJMA 5KDTA 3FVOA 4U23A 1ZIUA 3Q27A 4F3GA 3KGCA 3FVGA 4XKRA 2ALUA 4RNSA 1YPNA 4I62A 3U94A 3LBSA 2OWSA 4YZZA 3C33A 2GHBA 1B9JA 2XXQA 2ZNSA 4IGRA 4NE4A 4UA8A 5F1QA 4FATA 1SI1A 4NF8A 1ZU0A 1MQJA 5FHOA 3VVFA 3VLUA 1SVXB 4BDNA 3UIFA 5DVIA 2A5SA 4OYVA 1Y4TA 4R72A 4IO4A 1N7WA 1B6HA 1OQGA 3RN8A 4XKQA 1FQFA 2QJEA 1LB9A 2DWAA 4GFRA 1YTVA 2Z23A 5B7DA 3PD9A 1IQ7A 1Q1KA 3RQTA 3TAJA 4G8NA 1Y3NA 2X26A 1A55A 1B51A 2XXUA 4O3CA 2QS1A 1PB9A 4OMBA 3IAZA 3GBBA 3V8XB 2M8CA 1B2HA 1SQYA 4OHNA 1M5FA 1QVSA 4R2BA 1GR2A 5CMMA 2DP8A 2DE3A 1POY1 3TCGA 2I48A 1UQWA 1P1UA 4ZDMA 2V84A 1JVXA 1ZLQA 3O28A 4HW8A 4Q0CA 1SDXA 3IB0A 2B65A 1OQHA 5I57B 5B70A 3VXBA 1MH4A 3OSQA 5AA4A 3THIA 5H8FB 2AYSA 2Z22A 4QSDA 4BDLA 5K2YA 5JTYA 5AA3A 2REGA 3FVNA 5F7VA 3EHSA 1MXWA 2H4IA 3UN6A 5KCJA 3CFZA 4QSEA 5I84A 1FW0A 4R73A 3RGYA 1DTGA 3OO7A 3CI8A 2P1SA 1RYXA 2VD2A 4E0WA 3GZGA 4RXLA 4H0WA 3KG2A 4R6HA 3HV1A 5TPAB 1N0TA 2WKYA 4K3FA 3T9UA
chains in the Genus database with same CATH superfamily
3N6TA 3C31A 1VFEA 4RJZA 3A29A 4JWOA 3KZGA 1NMUA 2HEUA 3PUVE 1IXHA 1XVXA 5I56B 4NQ8A 2GFEA 1FPBA 1LAFE 2V3TA 4QFOA 4QFPA 2DQVA 4DDDA 3M3LA 3JZJA 3RLFE 1M5BA 1ZMGA 2NUVA 2XX7A 3DELB 2P0SA 4NF6A 4PE3A 5DVJA 2REJA 1EYIA 1N7XA 1LBZA 2X7PA 4XKPA 3KOSA 4ELQA 3N6UA 2VGQA 3KJTA 1S9TA 2O51A 4O7IA 3FXBA 4KCDA 1USYH 3DM0A 1OVBA 2CEYA 4DXCA 1TT1A 1B7HA 2A5TA 2I6EA 2O7UA 1H44A 4IO7A 1R9LA 2R8TA 3O9PA 3MP6A 3PTYA 3K1PA 1MY4A 4XF5A 5DEXA 3OO9A 1PB8A 4MEVA 2B4LA 3G3HA 3K1MA 3UORA 4OTEA 3KC0A 1B5HA 5L9OA 5I58B 3DP6A 5LTCA 2XXKA 5EHSA 2UYEA 2RC8A 5ICTA 3BBRA 3FASA 1LBXA 3PUZE 3FUZA 3H4ZA 1IMBA 3OEMA 4IR8A 3PPNA 4JVDA 4H67A 4FIMA 3TMGA 4YMAA 2D3IA 4X48A 3BIGA 4EF2A 4GVOA 5CC2A 2OBGA 3U93A 3O6GA 2WBBA 4GX6A 4NF0A 1SYHA 4R2FA 1QW0A 4U22A 3MC2A 5L9SA 3S9EA 4JXIA 1XHYA 4XFEA 1R9QA 1XVYA 3M3FA 2F78A 1JP4A 3QAXA 1UIUA 3IFCA 2I58A 3TCFA 3TYHA 1F9BA 1FPIA 4G4PA 3KN7A 3MP1A 2HCAA 4FORA 3QUJA 4MMPA 3IX1A 3TFLA 1VR5A 3OSRA 3E78A 3M8UA 4F18A 1B5IA 3EQ1A 5H8NB 1DCUA 3IJOB 3PMWA 1NV2A 4PFWA 3MZBA 3I3VA 3D4CA 3DLNA 4EUOA 4IO5A 3NOHA 1AIVA 4LZ8A 2V93A 3H6WA 4G68C 1H43A 1IXGA 5HM4B 4EQBA 1JNFA 2I49A 2UVGA 1IIWA 4DZ1A 2QS3A 1KA0A 2DYXA 4H5GA 4ISUA 4G77A 2V4CA 5I59A 3ZS6A 1OLAA 1LLSA 1LCFA 2Y7IA 4MJOA 1MDP1 3BFTA 3G3KA 4I9DA 4EQ7A 4YMBA 4GWSA 2CZKA 4GQOA 1TXFA 1D9VA 2RC7A 2CEXA 4DXUA 2Y7PA 3IB1A 2DSFA 3S9LC 1FPKA 1XI6A 1AMFA 2RINA 1PDAA 4PFIA 1B3LA 5T3JA 2VPNA 1HSLA 4ECFA 1AL3A 2PVUA 4QBAA 4L17A 3SZPA 3MW0A 2DOJA 3E3KA 5AE4A 1A8FA 1A8EA 3SKPA 4N13A 3CHGA 1NKXA 3W9WA 3UGWA 1MM7A 1FJ9A 4PGNA 1GGGA 3PUWE 4OFJA 3B8BA 3BKIB 3T66A 2O69A 2RC9A 4KPTA 5ET7A 4FAJA 4I40A 1NNKA 2UVJA 4P1LA 1IITA 3IO4A 2I4CA 3TELA 5LOMA 1N04A 4MNCA 5L9MA 2X7QA 4C1TA 3FXUA 1O7TA 5ESYA 1K9ZA 3B7DA 3PD8A 3TPAA 1VSOA 4OEVA 4G61A 5TU0A 2P2AA 2ESNA 5FHNA 4ZS9A 5ITOA 4M4GA 2XHDA 3TTNA 1KA1A 4AQ4A 3FBPA 1WVJA 4O8MA 2OWTA 1NNPA 3ISPA 1I6BA 3VVEA 1P1QA 4OVJA 1PB7A 3FGSA 4YB7A 4JSDA 4LZ5A 2FNCA 3M3KA 3RPLA 4ZEDA 1J1NA 1URGA 4EXLA 1NUWA 1FBCA 3KBRA 1TWYA 3JYRA 3OOAA 4YKKA 1ZTYA 3QK6A 2P3NA 3FXRA 3ONMA 3K02A 3RNNA 3I6VA 2F35A 4ELPA 3L6HA 4N15A 3VXCA 4MLVA 3Q28A 4OANA 1SW1A 4NF5A 4FEDA 1D3KA 4TLMB 3CFXA 1B3GA 4G68A 3TCHA 2QPQA 2HHMA 1K9YA 2XXRA 1VE4A 1M5CA 3A3CA 1MY2A 3QXMA 1A40A 4NMYA 4Q5TA 1FBEA 1FPLA 2DXRA 3S9MC 3D1RA 2NXOA 3T9XB 1N3WA 1I69A 3E9XA 4HTGA 3W9VA 3PUXE 2HAUA 3K2DA 2QL3A 3PMVA 1MXYA 3RT6B 1D4NA 1H76A 1NUYA 2FIXA 3VDFA 1SW5A 2DXYA 3MVYA 2Q9TA 2ZNTA 3RT8A 2NWJA 2KQZA 1A7LA 3VLWA 1LAHE 4Z0IA 5DW8A 1D9YA 1NI9A 4GL8A 3ECRA 3CVGA 1FRPA 3KC1A 3MVWA 4MNIA 5CBSA 1USYE 2HPGA 1DPEA 4NTLA 4X9TA 2ZYNA 2I0BA 5M2VA 2IA4A 4HCYA 2I4BA 4R74A 2R9JA 2XWVA 1L5TA 2QMWA 1FTAA 2UVIA 1NNFA 3K00A 4KFQA 2HZLA 2PFZA 3SEWA 4DI4B 4MH5A 4U21A 1MPCA 4DXBA 3MQ9A 5I2NA 1FBGA 5J1DA 3S9NC 1ATGA 4BDRA 5FTIA 4KI0E 1UTHA 4PFTA 3MP8A 3B50A 3MSTA 4QF9A 4H65A 4N6KA 1DBZA 4LQ5A 2RCBA 3TZAA 3Q25A 2OWZA 3E79A 5ICQA 3OEKA 1LFIA 4GD5A 1URSA 2GRVA 4R9GA 4PAFA 3VLVA 1IUDA 2Q89A 1JW5A 3MVXA 4JSOA 1US5A 3O97A 5I56A 2YJPA 2PX1A 3FV1A 2ONRA 4LZ7A 4ZECA 4PF8A 5H8QA 2PT2A 1Y9UA 1IXIA 1JVYA 2O6AA 4RYAA 1MXXA 3CSBA 4PP0A 4NN3A 5EQ9A 2Z8EA 4XIGQ 5K2XA 2Z8DA 1OVTA 2OK2A 3TQLA 1S7YA 1P1OA 1RDZA 1QULA 1VDWA 2DDKA 1MXZA 4BDOA 4PFYA 2KLFA 2F36A 1R1NA 1Y3QA 5IM2A 4P3LA 4I3EA 3ZSFA 3TTRA 2Y7WA 1UTBA 4MLQA 2XXHA 2H98A 5EQAA 2F3BA 3H6VA 1XS5A 2XXYA 3OELA 3FZVA 1XT8A 2YLNA 1EH3A 1IMEA 4NF4B 3UP9A 2ONKE 1TFDA 4X1DA 1H45A 5A5XB 3K1NA 3MZ9A 4G8HA 2H25A 2Y7KA 2VP1A 2DS9A 3HHGA 3U65A 3MZ1A 5AA2D 1FPGA 2H9BA 3N26A 3ODBA 5JK4A 1IMDA 3T9HB 4KD5A 1ZJLA 2F7BA 4QFLA 4KHZE 4KR5A 5L8DA 1B3FA 2P3VA 4QHQA 3FATA 4HXVA 1Y20A 2OCUA 1EYKA 1LAGE 3TDJA 1NH8A 4GL0A 2OX3A 4YU0A 4Q8RA 4OZ9A 1B58A 2H5YA 2GH9A 4GLIA 3B6WA 4DIGA 2DWHA 3LSLA 5KZTA 4GWUA 1US4A 1B0LA 3CG3A 4R6KA 2HXWA 3DP8A 5DEXB 1FPEA 1M5DA 1PBPA 3TTMA 1IXCA 1N84A 1MDQA 1FQCA 4O3BA 3Q26A 1G0IA 3H03A 4EQ9A 3E4RA 4OQOA 3TQWA 4GIZA 4F19A 3D4GA 2F3DA 4PE5B 2D21A 2PFYA 1RDXA 3KJ7A 4KXPA 4P9KA 2VOZA 1PEBA 4TQUQ 5ISUA 3CSGA 2FIEA 4KYDA 3TEPA 4F3PA 1MY3A 2B3BA 3O29A 4PDDA 1MRPA 4PAKA 4FJPA 4NHBA 3SERA 2XXIA 2QVRA 3HCQA 3C4MA 3VE1B 4OERA 4RK2A 5CMBA 4LA9A 2AL5A 5ELVA 1FPDA 4KYSA 3JV9A 4F29A 2Y5LA 2XWIA 3KBZA 1A99A 3K0VA 1MS7A 3PGFA 1YZ0A 2ZZVA 5ET6A 5BWJA 5DTBA 3MYUA 3FJMA 2QMXA 2RKMA 3ZKLA 4F1UA 3SEYA 1JW1A 5JEIA 4THIA 1JETA 4P0IA 1MXUA 4BDMA 1MQDA 4N8GA 2PYYA 1NL5A 4FECA 3G3JA 4POXA 3N5LA 3RY3A 2Y5KA 1VFDA 3KSJA 4GOTA 4F2OA 3IJXB 2PT1A 4IB2A 4YKIA 5TP9A 2F5XA 3EF7A 2CZLA 1FJ6A 1B05A 1WODA 2PBWA 2ZMBA 3R26A 3IOWA 2ZYOA 1CB6A 4OVTA 5IAIA 4N6DA 2XWKA 2ZXTA 2BJJX 5AA2A 4WKMA 3IORA 4HCWA 2VPOA 1QKBA 5J16A 1QGXA 4IGTA 1BK4A 3SEVA 4U2RA 3SEXA 4PBQA 4UACA 3LUYA 4FEBA 3N94A 2RCAA 1EZOA 3WAEA 4BLAA 5H8HA 4LQ2A 4O3AA 1NV6A 3QMFA 1MG1A 2I3VA 3CR9A 1JQFA 1FQEA 2W7YA 2WYKA 4GWWA 3FD3A 5I59B 3FJ7A 2XXWA 2XD2A 3H06B 4JWXA 3U72A 1MQHA 4QFNA 3EN3A 1TFAA 4OETA 2XXTA 3IO6A 4JDFA 5CI5A 2O68A 4BDQA 4ESXA 4F31B 3BIHA 4Z7EA 3SESA 4YB5A 3IL1B 4PGPA 1BP5A 3IOVA 3DP4A 4P0GA 2XXXA 4EXKA 1Y4CA 2DE4A 1OLCA 3HFUA 3H6TA 4NG7A 4G2ZA 1YYZA 4F39A 5DYHA 1POTA 3G3IA 5IGAA 3IK6B 1LBVA 2O7IA 3FJGA 3EHTA 4R9FA 4LP2B 4OFOA 3K6XA 4ELRA 4GBWA 2ZYMA 1GV8A 4OFLA 2MKZA 1IMCA 2Q74A 5I7IA 1GTKA 5I2KB 4XXUA 1ZBMA 3T22A 4X1BA 3RTFB 5CMCA 2GQ1A 3MWBA 1N76A 2ZZXA 4R6YA 4RPOA 1BIYA 3MPLA 1M5EA 1SW4A 5H8SA 4MX6A 4XEQA 2F7CA 4P8BA 1P1NA 3PPQA 4LATA 3B6QA 3K6WA 1MXVA 3ILUB 3CIJA 4WEDA 2HXRA 5EHMA 1IEJA 1NH7A 3K01A 4U4XA 3LSXA 1O64A 3H3GA 3OENA 4PQJA 4JB7A 2O84X 1R6ZA 1G0HA 1P99A 4Q30B 3HSTA 4LONB 4MCOA 3E13X 2G29A 5I3SA 4PTKA 5KDTB 4KYEA 3LUZA 3RPLB 4ESWA 2WX9A 2XX8A 1URDA 3EPEA 4WEPA 1B1XA 4H5FA 1EYJA 4P1EA 2F97A 1MQIA 4N4UA 2QS2A 2HQ0A 1JW4A 3GLBA 4IO6A 1LB8A 5AA1A 1MPBA 4QFKA 1Z7NE 5F24A 4ZZEA 3F11A 4ZEBA 4IY6A 4E0XA 3KN8A 4NF8B 4JBZA 1NNTA 3V89B 3I5OA 3T93B 1FTMA 3Q29A 2Y7RA 2F34A 4PETA 2ZYKA 1DOTA 4PFUA 1LGBC 4NF5B 1RKMA 1FPJA 2Q88A 2LAOA 2O1MA 4KQPA 1AWBA 5CRYA 1S50A 4G68B 4M1VA 1B1HA 2V3QA 2ANJA 1FQAA 3PPRA 4NEDA 4GF8A 2VHAA 1NUZA 2AIXA 4O94A 1B40A 1O63A 4NX1A 2RF1A 4AB6A 1CE2A 1BLFA 1B4ZA 1FBFA 2UXAA 1I6AA 4NGUA 3VFJA 4PFRA 5CMKA 3LC8A 4LVQA 3G3FA 1CNQA 2HAVA 3TKDA 5I57A 5H8FA 4PF6A 1NV3A 4XKNA 4YKPA 3MJNA 4IO3A 4NAPA 4G8MA 3MBPA 3ILTB 2UYFA 1FBHA 3GXAA 1NV1A 1B46A 3O6IA 1SBPA 2E1SA 4F22A 2Q8MA 1AOVA 3PPPA 1T0KA 4OESA 2ABHA 4OEUA 5TPAA 5EYGA 4RY1A 4DCXA 1D9QA 3H7MA 4MFIA 4QXDA 2V25A 2THIA 2F6PA 1Z7ME 5IZ3B 3U92A 4GX4A 4IY5A 5EQ7A 4MHFA 5AA4B 5I2NB 2CZHA 1FBDA 2Y84A 3BFUA 3V5AA 3OO8A 4GRKA 1OMPA 5JTYB 2PMSA 1UTHB 4EF1A 4ND9A 3FV2A 1Y1ZA 4I3YA 3UK4A 4F2QA 4YAHX 5KCJB 3CRBA 3K4UA 3S2VA 3T0JA 3LR1A 3CFLA 2DVZA 2QSXA 3PUYE 4H8IA 3OXNA 2Q8JA 2XXPA 4OWDA 1YAEA 4TLLB 4ZEIA 1IMAA 2OJTA 3TTKA 4U1ZA 1JEVA 4ONYA 2NVUB 1SD3A 4PDHA 1FTKA 4YKJA 4NF4A 4C0RA 2R6GE 3KN3A 1MY1A 5A5XA 5H8QB 2FBPA 4MNPA 4YICA 2ONSA 3SDFA 3R7XA 4ELOA 4H8JA 3PV0E 2CMOA 4OVPA 5HBCA 1RYOA 3KSXA 3W15C 3OMBA 5ITPA 4PFBA 3FXQA 2DE2A 2D5WA 2XA5A 2FHYA 3C9HA 1IZ1A 5DT6A 2BJIA 1NV0A 3PU5A 1B4HA 4NF6B 2GHAA 1UIVA 1LBBA 3RPWA 4N8YA 2B4MA 3IFAA 1UTBB 4JVIA 2I3WA 4GWOA 1FTJA 1HSEA 2FVZA 2DWIA 4H1XA 3R6UA 5I58A 3O66A 4DCYA 3FVKA 5ET8A 3C35A 1P1WA 3EHUA 5IZ1A 2HZKA 1LSTA 2Z8FA 2OLBA 2YPNA 3O2AA 4GXAA 1EZ9A 4AS4A 1FQBA 4C1UA 1LBWA 2A5TB 1JEUA 3CG1A 4AB5A 1FSAA 2VT5A 3RUMA 4OENA 2F6GA 4YB6A 1LFHA 3PPOA 1INPA 3ROJA 1IMFA 4N07A 3TUSA 3MPKA 4ZE9A 1B0HA 1SYIA 1FTLA 1II5A 3SEUA 4X8RA 1B3HA 2R71A 2Q2CA 3A3UA 5I5PA 1FQDA 3HN0A 3VV5A 1DPPA 4OA4A 1NV4A 2OZZA 1LEVA 2G93A 4F1VA 4PBHA 4H46A 3C36A 3EKIA 3QSLA 4LUBA 4DLDA 5IKBA 3VVDA 1QUJA 4F1YA 5EYFA 3UA8A 3SETA 2NOOA 2F8DA 1PBQA 2XWOA 4XTCQ 3K6UA 4U4SA 5FHMA 4RPNA 2FA7A 4IO2A 1RDYA 4MF3A 1KWHA 4GXSB 1SW2A 1DSNA 4R75A 2DWJA 1QKAA 5H8NA 1MM6A 1BKAA 4F3SA 3IB2A 3TTLA 1YCJA 3K6VA 4N81A 1ANFA 1KZ8A 1B32A 2XXVA 1Y3PA 5BUUA 2Q2AA 1WDNA 2XD3A 2WBDA 1EU8A 1FTOA 4UABA 4OVRA 5FBPA 4NWCA 2H99A 3B6TA 4PAIA 3MVZA 1DTZA 1MPDA 3L6GA 3QYTA 1PC3A 3QUFA 3KOTA 4X04A 4P11A 1B5JA 4RA1A 1XOCA 1B3EA 1SI0A 4N91A 4NWDA 2B3FA 3HO7A 1DMBA 4WXJA 3AXFA 2FYIA 3KEIA 2QS4A 4N17A 1DK4A 1N3XA 4ZE8A 4OXVA 3LSWA 2DVCA 2ZNUA 2QVUA 4H6DA 3U1OA 1ELJA 2WYPA 4H45A 4GX3A 4POWA 1MY0A 3LSFB 3S4UA 2IEEA 4O7MA 5TP9B 4F3BA 4QRZA 1FCKA 1QUKA 1FBPA 5FTHA 1MH3A 1QUIA 1H3DA 2L5VA 3QIMA 1LBCA 4KCCA 2QFLA 1B7ZA 2QRYA 5CBRA 1AH5A 4DE8A 5AA2B 1NUXA 4JWYA 3HPIA 3P7IA 4ZZAA 2CZIA 2XX9A 1B52A 1ZKBA 4MBPA 4QSCA 1LCTA 4FBPA 1Q35A 4PCDA 5DVFA 3PMXA 4TOZA 2F7AA 2I0CA 2HFBA 4N6PA 5EQ8A 3TODA 3IR1A 4FE8A 3USDA 2O1LA 4EDPA 3V83A 3HHFA 5H8HB 5HPQA 3H6UA 3OD7A 4GWXA 1HSJA 1Q9DA 3FIRA 1LFGA 2V3UA 3IOTA 1B7UA 3MUQA 3KFMA 1MQGA 3WAFA 3U8QA 2JJKA 3IOUA 4I1DA 5A5LA 4RK9A 3A09A 4PC9A 3GYYA 5I2KA 3GBAA 1EZPA 2E0SA 2ZZWA 1GVCA 3T96B 2UVHA 1NFTA 2VD3A 2AL4A 1SPIA 3OO6A 3C34A 3G3GA 3ZKKA 5CM6A 1LAXA 1Y1MA 1OIBA 4I8CA 4GBVA 4ZEFA 4U1OA 4ZEKA 1XC1A 1BTJA 4HS7A 4AS5A 3T9VA 3MAMA 3G7WA 1I6QA 3O6HA 1LBYA 3RTWB 1A54A 3C32A 1QJMA 5KDTA 5LDZA 3FVOA 4U23A 1ZIUA 1NV7A 3T1BA 3Q27A 4F3GA 3KGCA 3FVGA 1NV5A 4XKRA 2ALUA 4RNSA 1YPNA 4I62A 3U94A 3LBSA 2OWSA 4YZZA 3C33A 4OVQA 2GHBA 5ET5A 1B9JA 3RYDA 2XXQA 2ZNSA 4IGRA 4NE4A 4UA8A 5F1QA 4FATA 1SI1A 4NF8A 1ZU0A 1MQJA 5FHOA 4HE0A 3VVFA 3VLUA 1SVXB 4BDNA 3UIFA 5DVIA 2A5SA 4HE1A 4OYVA 1Y4TA 4R72A 4IO4A 1N7WA 5EYHA 1B6HA 1OQGA 3RN8A 4XKQA 1FQFA 2QJEA 1LB9A 2QVVA 2DWAA 4GFRA 1YTVA 2Z23A 5B7DA 3PD9A 1IQ7A 1Q1KA 3RQTA 3TAJA 4LN5A 4G8NA 1Y3NA 2X26A 1A55A 1B51A 2XXUA 2PCRA 4O3CA 2QS1A 1PB9A 4OMBA 3IAZA 3GBBA 3V8XB 2M8CA 1B2HA 1SQYA 4OHNA 1M5FA 4P56A 4R2BA 1QVSA 4JVCA 1GR2A 5CMMA 2DP8A 2DE3A 1POY1 3TCGA 2WEFA 4MIJA 2I48A 1UQWA 1P1UA 4HE2A 4ZDMA 2V84A 1JVXA 4GWYA 1ZLQA 3O28A 4MAGA 4HW8A 4OVSA 4Q0CA 1SDXA 3IB0A 5IZ3A 2B65A 1OQHA 1FPFA 5I57B 5B70A 3VXBA 1MH4A 3OSQA 5AA4A 3THIA 5H8FB 2AYSA 2Z22A 4QSDA 4BDLA 5K2YA 5JTYA 3LV0A 4GWZA 1YXIA 5AA3A 2REGA 3FVNA 5F7VA 3EHSA 1MXWA 2H4IA 3UN6A 4P47A 5KCJA 3CFZA 4QSEA 5I84A 2KR0A 1FW0A 4R73A 3RGYA 5IZZA 1DTGA 3OO7A 4DI3D 3CI8A 2P1SA 1RYXA 2VD2A 4E0WA 3GZGA 4RXLA 4H0WA 3KG2A 4R6HA 3HV1A 5TPAB 1N0TA 2WKYA 4K3FA 3T9UA
chains in the Genus database with same CATH topology
3N6TA 3C31A 1VFEA 4RJZA 4JWOA 3KZGA 1NMUA 2HEUA 3PUVE 1IXHA 1XVXA 5I56B 2GFEA 1LAFE 2V3TA 4QFOA 4QFPA 2DQVA 4DDDA 3M3LA 3JZJA 3RLFE 1M5BA 1ZMGA 2NUVA 2XX7A 3DELB 2P0SA 4NF6A 5DVJA 2REJA 1N7XA 2X7PA 4XKPA 3KOSA 4ELQA 3N6UA 2VGQA 3KJTA 1S9TA 2O51A 4KCDA 1USYH 3DM0A 1OVBA 4DXCA 1TT1A 1B7HA 2A5TA 2I6EA 2O7UA 1H44A 4IO7A 1R9LA 3O9PA 3MP6A 3K1PA 1MY4A 5DEXA 3OO9A 1PB8A 3G3HA 3K1MA 3UORA 4OTEA 1B5HA 5L9OA 5I58B 3DP6A 5EHSA 2UYEA 2RC8A 5ICTA 3BBRA 3FASA 3PUZE 3FUZA 3H4ZA 3OEMA 3PPNA 4H67A 4FIMA 3TMGA 4YMAA 2D3IA 4X48A 4EF2A 4GVOA 5CC2A 2OBGA 3U93A 3O6GA 1SYHA 4R2FA 1QW0A 4U22A 3MC2A 5L9SA 3S9EA 4JXIA 1XHYA 1R9QA 1XVYA 3M3FA 2F78A 3QAXA 1UIUA 2I58A 3TCFA 3TYHA 1F9BA 4G4PA 3KN7A 3MP1A 2HCAA 4FORA 3QUJA 3IX1A 3TFLA 1VR5A 3OSRA 3M8UA 4F18A 1B5IA 3EQ1A 5H8NB 3IJOB 3PMWA 4PFWA 3MZBA 3I3VA 3D4CA 3DLNA 4EUOA 4IO5A 1AIVA 4LZ8A 2V93A 3H6WA 4G68C 1H43A 1IXGA 5HM4B 4EQBA 1JNFA 2I49A 2UVGA 1IIWA 4DZ1A 2QS3A 2DYXA 4H5GA 4ISUA 4G77A 5I59A 3ZS6A 1OLAA 1LLSA 1LCFA 2Y7IA 1MDP1 3BFTA 4YMBA 4EQ7A 3G3KA 4I9DA 4GQOA 1TXFA 1D9VA 2RC7A 4DXUA 2Y7PA 3IB1A 2DSFA 3S9LC 1AMFA 2RINA 1PDAA 1B3LA 1HSLA 4ECFA 1AL3A 2PVUA 4L17A 3MW0A 2DOJA 3E3KA 5AE4A 1A8FA 1A8EA 3SKPA 3W9WA 4N13A 1NKXA 3UGWA 1MM7A 1GGGA 3PUWE 4OFJA 3BKIB 3T66A 2O69A 2RC9A 4KPTA 4FAJA 1NNKA 2UVJA 1IITA 3IO4A 2I4CA 3TELA 5LOMA 1N04A 5L9MA 2X7QA 4C1TA 3FXUA 1O7TA 3B7DA 3PD8A 3TPAA 1VSOA 4OEVA 5TU0A 2P2AA 2ESNA 5FHNA 4ZS9A 5ITOA 4M4GA 2XHDA 3TTNA 4AQ4A 1WVJA 2OWTA 1NNPA 1I6BA 3VVEA 1P1QA 4OVJA 1PB7A 3FGSA 4YB7A 4JSDA 4LZ5A 2FNCA 3M3KA 4ZEDA 1J1NA 1URGA 4EXLA 3KBRA 1TWYA 3JYRA 3OOAA 4YKKA 1ZTYA 3QK6A 3FXRA 3ONMA 3K02A 3RNNA 3I6VA 2F35A 4ELPA 3L6HA 3VXCA 4MLVA 3Q28A 1SW1A 4NF5A 4FEDA 1D3KA 4TLMB 3CFXA 1B3GA 4G68A 3TCHA 2QPQA 2XXRA 1VE4A 1M5CA 3A3CA 1MY2A 3QXMA 1A40A 4NMYA 4Q5TA 2DXRA 3S9MC 2NXOA 3T9XB 1N3WA 1I69A 3E9XA 4HTGA 3W9VA 3PUXE 2HAUA 3K2DA 2QL3A 3PMVA 1MXYA 3RT6B 1D4NA 1H76A 3VDFA 1SW5A 2DXYA 3MVYA 2Q9TA 2ZNTA 3RT8A 2NWJA 1A7LA 3VLWA 1LAHE 4Z0IA 1D9YA 4GL8A 3ECRA 3CVGA 3MVWA 5CBSA 1USYE 1DPEA 4NTLA 4X9TA 2ZYNA 2I0BA 5M2VA 2IA4A 4HCYA 2I4BA 4R74A 2R9JA 1L5TA 2QMWA 2UVIA 1NNFA 3K00A 4KFQA 2HZLA 3SEWA 4MH5A 4U21A 1MPCA 4DXBA 3MQ9A 5I2NA 5J1DA 3S9NC 1ATGA 4BDRA 5FTIA 4KI0E 1UTHA 4PFTA 3MP8A 4QF9A 4H65A 4LQ5A 2RCBA 3TZAA 3Q25A 5ICQA 3OEKA 1LFIA 4GD5A 1URSA 2GRVA 4R9GA 3VLVA 1IUDA 2Q89A 1JW5A 3MVXA 4JSOA 1US5A 3O97A 5I56A 2YJPA 2PX1A 3FV1A 2ONRA 4LZ7A 4ZECA 5H8QA 2PT2A 1Y9UA 1IXIA 1JVYA 2O6AA 4RYAA 1MXXA 3CSBA 4PP0A 2Z8EA 4XIGQ 5K2XA 2Z8DA 1OVTA 2OK2A 3TQLA 1S7YA 1P1OA 1QULA 1MXZA 4BDOA 4PFYA 2KLFA 2F36A 1R1NA 1Y3QA 3ZSFA 3TTRA 2Y7WA 1UTBA 4MLQA 2XXHA 2H98A 3H6VA 1XS5A 2XXYA 3OELA 3FZVA 1XT8A 2YLNA 1EH3A 4NF4B 3UP9A 2ONKE 1TFDA 4X1DA 1H45A 5A5XB 3K1NA 3MZ9A 4G8HA 2H25A 2Y7KA 2VP1A 2DS9A 3HHGA 3MZ1A 5AA2D 2H9BA 3N26A 3ODBA 5JK4A 3T9HB 4KD5A 1ZJLA 2F7BA 4QFLA 4KHZE 4KR5A 5L8DA 1B3FA 4QHQA 3FATA 1Y20A 2OCUA 3TDJA 1LAGE 1NH8A 4GL0A 4YU0A 4Q8RA 4OZ9A 1B58A 2H5YA 2GH9A 4GLIA 3B6WA 4DIGA 2DWHA 3LSLA 5KZTA 1US4A 1B0LA 3CG3A 4R6KA 2HXWA 3DP8A 5DEXB 1M5DA 1PBPA 3TTMA 1IXCA 1N84A 1MDQA 1FQCA 4O3BA 3Q26A 3H03A 4EQ9A 3E4RA 4OQOA 3TQWA 4GIZA 4F19A 3D4GA 4PE5B 2D21A 3KJ7A 2VOZA 1PEBA 4TQUQ 5ISUA 3CSGA 4KYDA 3TEPA 4F3PA 1MY3A 2B3BA 3O29A 1MRPA 4FJPA 3SERA 2XXIA 3HCQA 3C4MA 3VE1B 4OERA 4RK2A 5CMBA 4LA9A 2AL5A 5ELVA 4KYSA 3JV9A 4F29A 1A99A 3K0VA 1MS7A 3PGFA 5BWJA 5DTBA 3FJMA 2QMXA 2RKMA 3ZKLA 4F1UA 3SEYA 1JW1A 5JEIA 4THIA 1JETA 4P0IA 1MXUA 4BDMA 1MQDA 2PYYA 1NL5A 4FECA 3G3JA 4POXA 3N5LA 3RY3A 1VFDA 3KSJA 4GOTA 4F2OA 3IJXB 2PT1A 4IB2A 4YKIA 5TP9A 2F5XA 3EF7A 2CZLA 1B05A 1WODA 2PBWA 2ZMBA 3R26A 3IOWA 2ZYOA 1CB6A 5IAIA 2ZXTA 2BJJX 5AA2A 4WKMA 3IORA 4HCWA 1QKBA 4IGTA 3SEVA 4U2RA 3SEXA 4UACA 3LUYA 4FEBA 3N94A 2RCAA 1EZOA 3WAEA 4BLAA 5H8HA 4LQ2A 4O3AA 1MG1A 2I3VA 3CR9A 1JQFA 1FQEA 2W7YA 3FD3A 5I59B 3FJ7A 2XXWA 2XD2A 3H06B 4JWXA 3U72A 1MQHA 4QFNA 3EN3A 1TFAA 4OETA 2XXTA 3IO6A 4JDFA 5CI5A 2O68A 4BDQA 4ESXA 4F31B 4Z7EA 3SESA 4YB5A 3IL1B 1BP5A 3IOVA 3DP4A 4P0GA 2XXXA 4EXKA 1Y4CA 2DE4A 1OLCA 3H6TA 4G2ZA 4F39A 5DYHA 1POTA 3G3IA 3IK6B 2O7IA 3FJGA 3EHTA 4R9FA 4LP2B 4OFOA 3K6XA 4ELRA 2ZYMA 1GV8A 4OFLA 1GTKA 5I2KB 4XXUA 1ZBMA 3T22A 4X1BA 3RTFB 5CMCA 3MWBA 1N76A 4R6YA 4RPOA 1BIYA 3MPLA 1M5EA 1SW4A 5H8SA 2F7CA 1P1NA 3PPQA 4LATA 3B6QA 3K6WA 1MXVA 3ILUB 3CIJA 4WEDA 5EHMA 1NH7A 1IEJA 3K01A 4U4XA 3LSXA 1O64A 3H3GA 3OENA 4PQJA 4JB7A 2O84X 1R6ZA 1P99A 4Q30B 3HSTA 4LONB 3E13X 2G29A 5KDTB 4KYEA 4ESWA 2XX8A 1URDA 3EPEA 4WEPA 1B1XA 4H5FA 2F97A 1MQIA 2QS2A 2HQ0A 1JW4A 3GLBA 4IO6A 1LB8A 5AA1A 1MPBA 4QFKA 1Z7NE 4ZZEA 3F11A 4ZEBA 4IY6A 4E0XA 3KN8A 4NF8B 4JBZA 1NNTA 3V89B 3I5OA 3T93B 1FTMA 3Q29A 2Y7RA 2F34A 4PETA 2ZYKA 1DOTA 4PFUA 1LGBC 4NF5B 1RKMA 2Q88A 2LAOA 2O1MA 4KQPA 5CRYA 1S50A 4G68B 4M1VA 1B1HA 2V3QA 2ANJA 1FQAA 3PPRA 4NEDA 4GF8A 2VHAA 2AIXA 1B40A 1O63A 2RF1A 4AB6A 1CE2A 1BLFA 1B4ZA 2UXAA 1I6AA 3VFJA 5CMKA 3LC8A 4LVQA 3G3FA 2HAVA 3TKDA 5I57A 5H8FA 4XKNA 4YKPA 3MJNA 4IO3A 4G8MA 3MBPA 3ILTB 2UYFA 3GXAA 1B46A 3O6IA 1SBPA 2E1SA 4F22A 1AOVA 3PPPA 1T0KA 4OESA 2ABHA 4OEUA 5TPAA 4RY1A 4DCXA 3H7MA 4MFIA 2V25A 2THIA 2F6PA 1Z7ME 3U92A 4IY5A 5AA4B 5I2NB 2Y84A 3BFUA 3V5AA 3OO8A 4GRKA 1OMPA 5JTYB 2PMSA 1UTHB 4EF1A 4ND9A 3FV2A 1Y1ZA 3UK4A 4F2QA 4YAHX 5KCJB 3CRBA 3K4UA 3S2VA 3LR1A 3CFLA 2DVZA 2QSXA 3PUYE 4H8IA 3OXNA 2Q8JA 2XXPA 4OWDA 1YAEA 4TLLB 4ZEIA 2OJTA 3TTKA 4U1ZA 1JEVA 4ONYA 2NVUB 1SD3A 1FTKA 4YKJA 4NF4A 4C0RA 2R6GE 3KN3A 1MY1A 5A5XA 5H8QB 4YICA 2ONSA 3SDFA 3R7XA 4ELOA 4H8JA 3PV0E 2CMOA 5HBCA 1RYOA 3KSXA 3W15C 3OMBA 5ITPA 3FXQA 2DE2A 2D5WA 3C9HA 1IZ1A 5DT6A 3PU5A 1B4HA 4NF6B 2GHAA 1UIVA 1LBBA 3RPWA 1UTBB 2I3WA 4GWOA 1FTJA 1HSEA 2DWIA 4H1XA 3R6UA 5I58A 4DCYA 3O66A 3FVKA 3C35A 1P1WA 3EHUA 2HZKA 1LSTA 2Z8FA 2OLBA 2YPNA 3O2AA 4GXAA 1EZ9A 1FQBA 4C1UA 2A5TB 1JEUA 3CG1A 4AB5A 3RUMA 4OENA 2F6GA 4YB6A 1LFHA 3PPOA 4N07A 3TUSA 3MPKA 4ZE9A 1B0HA 1SYIA 1FTLA 1II5A 3SEUA 1B3HA 2R71A 2Q2CA 3A3UA 1FQDA 3HN0A 3VV5A 1DPPA 2OZZA 2G93A 4F1VA 3C36A 3QSLA 4LUBA 4DLDA 5IKBA 3VVDA 1QUJA 4F1YA 5EYFA 3UA8A 3SETA 2NOOA 2F8DA 1PBQA 4XTCQ 3K6UA 4U4SA 5FHMA 4RPNA 2FA7A 4IO2A 4MF3A 1KWHA 4GXSB 1SW2A 1DSNA 4R75A 2DWJA 1QKAA 5H8NA 1MM6A 1BKAA 4F3SA 3IB2A 3TTLA 1YCJA 3K6VA 1ANFA 1B32A 2XXVA 1Y3PA 5BUUA 2Q2AA 1WDNA 2XD3A 1EU8A 1FTOA 4NWCA 2H99A 3B6TA 3MVZA 1DTZA 1MPDA 3L6GA 3QYTA 1PC3A 3QUFA 3KOTA 4P11A 1B5JA 4RA1A 1XOCA 1B3EA 1SI0A 4NWDA 2B3FA 3HO7A 1DMBA 4WXJA 3AXFA 2FYIA 3KEIA 2QS4A 1N3XA 4ZE8A 4OXVA 3LSWA 2DVCA 2ZNUA 4H6DA 3U1OA 1ELJA 4POWA 1MY0A 3LSFB 3S4UA 2IEEA 5TP9B 4F3BA 4QRZA 1FCKA 1QUKA 5FTHA 1MH3A 1QUIA 1H3DA 3QIMA 1LBCA 4KCCA 1B7ZA 2QRYA 5CBRA 1AH5A 4DE8A 5AA2B 4JWYA 3HPIA 3P7IA 4ZZAA 2XX9A 1B52A 1ZKBA 4MBPA 4QSCA 1LCTA 1Q35A 5DVFA 3PMXA 4TOZA 2F7AA 2I0CA 2HFBA 4N6PA 3TODA 3IR1A 4FE8A 3USDA 2O1LA 4EDPA 3V83A 3HHFA 5H8HB 5HPQA 3H6UA 3OD7A 1HSJA 3FIRA 1LFGA 2V3UA 3IOTA 1B7UA 3MUQA 3KFMA 1MQGA 3WAFA 3U8QA 4I1DA 3IOUA 4RK9A 3A09A 1EZPA 5I2KA 3GBAA 2E0SA 1GVCA 3T96B 2UVHA 1NFTA 2VD3A 2AL4A 3OO6A 3C34A 3G3GA 3ZKKA 5CM6A 1LAXA 1Y1MA 1OIBA 4I8CA 4ZEFA 4U1OA 4ZEKA 1XC1A 1BTJA 4HS7A 3T9VA 3MAMA 3G7WA 1I6QA 3O6HA 3RTWB 1A54A 3C32A 1QJMA 5KDTA 3FVOA 4U23A 1ZIUA 3Q27A 4F3GA 3KGCA 3FVGA 4XKRA 2ALUA 4RNSA 1YPNA 4I62A 3U94A 3LBSA 2OWSA 4YZZA 3C33A 2GHBA 1B9JA 2XXQA 2ZNSA 4IGRA 4NE4A 4UA8A 5F1QA 4FATA 1SI1A 4NF8A 1ZU0A 1MQJA 5FHOA 3VVFA 3VLUA 1SVXB 4BDNA 3UIFA 5DVIA 2A5SA 4OYVA 1Y4TA 4R72A 4IO4A 1N7WA 1B6HA 1OQGA 3RN8A 4XKQA 1FQFA 2QJEA 1LB9A 2DWAA 4GFRA 1YTVA 2Z23A 5B7DA 3PD9A 1IQ7A 1Q1KA 3RQTA 3TAJA 4G8NA 1Y3NA 2X26A 1A55A 1B51A 2XXUA 4O3CA 2QS1A 1PB9A 4OMBA 3IAZA 3GBBA 3V8XB 2M8CA 1B2HA 1SQYA 4OHNA 1M5FA 1QVSA 4R2BA 1GR2A 5CMMA 2DP8A 2DE3A 1POY1 3TCGA 2I48A 1UQWA 1P1UA 4ZDMA 2V84A 1JVXA 1ZLQA 3O28A 4HW8A 4Q0CA 1SDXA 3IB0A 2B65A 1OQHA 5I57B 5B70A 3VXBA 1MH4A 3OSQA 5AA4A 3THIA 5H8FB 2AYSA 2Z22A 4QSDA 4BDLA 5K2YA 5JTYA 5AA3A 2REGA 3FVNA 5F7VA 3EHSA 1MXWA 2H4IA 3UN6A 5KCJA 3CFZA 4QSEA 5I84A 1FW0A 4R73A 3RGYA 1DTGA 3OO7A 3CI8A 2P1SA 1RYXA 2VD2A 4E0WA 3GZGA 4RXLA 4H0WA 3KG2A 4R6HA 3HV1A 5TPAB 1N0TA 2WKYA 4K3FA 3T9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N6T A;  3C31 A;  1VFE A;  4RJZ A;  4JWO A;  3KZG A;  1NMU A;  2HEU A;  3PUV E;  1IXH A;  1XVX A;  5I56 B;  2GFE A;  1LAF E;  2V3T A;  4QFO A;  4QFP A;  2DQV A;  4DDD A;  3M3L A;  3JZJ A;  3RLF E;  1M5B A;  1ZMG A;  2NUV A;  2XX7 A;  3DEL B;  2P0S A;  4NF6 A;  5DVJ A;  2REJ A;  1N7X A;  2X7P A;  4XKP A;  3KOS A;  4ELQ A;  3N6U A;  2VGQ A;  3KJT A;  1S9T A;  2O51 A;  4KCD A;  1USY H;  3DM0 A;  1OVB A;  4DXC A;  1TT1 A;  1B7H A;  2A5T A;  2I6E A;  2O7U A;  1H44 A;  4IO7 A;  1R9L A;  3O9P A;  3MP6 A;  3K1P A;  1MY4 A;  5DEX A;  3OO9 A;  1PB8 A;  3G3H A;  3K1M A;  3UOR A;  4OTE A;  1B5H A;  5L9O A;  5I58 B;  3DP6 A;  5EHS A;  2UYE A;  2RC8 A;  5ICT A;  3BBR A;  3FAS A;  3PUZ E;  3FUZ A;  3H4Z A;  3OEM A;  3PPN A;  4H67 A;  4FIM A;  3TMG A;  4YMA A;  2D3I A;  4X48 A;  4EF2 A;  4GVO A;  5CC2 A;  2OBG A;  3U93 A;  3O6G A;  1SYH A;  4R2F A;  1QW0 A;  4U22 A;  3MC2 A;  5L9S A;  3S9E A;  4JXI A;  1XHY A;  1R9Q A;  1XVY A;  3M3F A;  2F78 A;  3QAX A;  1UIU A;  2I58 A;  3TCF A;  3TYH A;  1F9B A;  4G4P A;  3KN7 A;  3MP1 A;  2HCA A;  4FOR A;  3QUJ A;  3IX1 A;  3TFL A;  1VR5 A;  3OSR A;  3M8U A;  4F18 A;  1B5I A;  3EQ1 A;  5H8N B;  3IJO B;  3PMW A;  4PFW A;  3MZB A;  3I3V A;  3D4C A;  3DLN A;  4EUO A;  4IO5 A;  1AIV A;  4LZ8 A;  2V93 A;  3H6W A;  4G68 C;  1H43 A;  1IXG A;  5HM4 B;  4EQB A;  1JNF A;  2I49 A;  2UVG A;  1IIW A;  4DZ1 A;  2QS3 A;  2DYX A;  4H5G A;  4ISU A;  4G77 A;  5I59 A;  3ZS6 A;  1OLA A;  1LLS A;  1LCF A;  2Y7I A;  1MDP 1;  3BFT A;  4YMB A;  4EQ7 A;  3G3K A;  4I9D A;  4GQO A;  1TXF A;  1D9V A;  2RC7 A;  4DXU A;  2Y7P A;  3IB1 A;  2DSF A;  3S9L C;  1AMF A;  2RIN A;  1PDA A;  1B3L A;  1HSL A;  4ECF A;  1AL3 A;  2PVU A;  4L17 A;  3MW0 A;  2DOJ A;  3E3K A;  5AE4 A;  1A8F A;  1A8E A;  3SKP A;  3W9W A;  4N13 A;  1NKX A;  3UGW A;  1MM7 A;  1GGG A;  3PUW E;  4OFJ A;  3BKI B;  3T66 A;  2O69 A;  2RC9 A;  4KPT A;  4FAJ A;  1NNK A;  2UVJ A;  1IIT A;  3IO4 A;  2I4C A;  3TEL A;  5LOM A;  1N04 A;  5L9M A;  2X7Q A;  4C1T A;  3FXU A;  1O7T A;  3B7D A;  3PD8 A;  3TPA A;  1VSO A;  4OEV A;  5TU0 A;  2P2A A;  2ESN A;  5FHN A;  4ZS9 A;  5ITO A;  4M4G A;  2XHD A;  3TTN A;  4AQ4 A;  1WVJ A;  2OWT A;  1NNP A;  1I6B A;  3VVE A;  1P1Q A;  4OVJ A;  1PB7 A;  3FGS A;  4YB7 A;  4JSD A;  4LZ5 A;  2FNC A;  3M3K A;  4ZED A;  1J1N A;  1URG A;  4EXL A;  3KBR A;  1TWY A;  3JYR A;  3OOA A;  4YKK A;  1ZTY A;  3QK6 A;  3FXR A;  3ONM A;  3K02 A;  3RNN A;  3I6V A;  2F35 A;  4ELP A;  3L6H A;  3VXC A;  4MLV A;  3Q28 A;  1SW1 A;  4NF5 A;  4FED A;  1D3K A;  4TLM B;  3CFX A;  1B3G A;  4G68 A;  3TCH A;  2QPQ A;  2XXR A;  1VE4 A;  1M5C A;  3A3C A;  1MY2 A;  3QXM A;  1A40 A;  4NMY A;  4Q5T A;  2DXR A;  3S9M C;  2NXO A;  3T9X B;  1N3W A;  1I69 A;  3E9X A;  4HTG A;  3W9V A;  3PUX E;  2HAU A;  3K2D A;  2QL3 A;  3PMV A;  1MXY A;  3RT6 B;  1D4N A;  1H76 A;  3VDF A;  1SW5 A;  2DXY A;  3MVY A;  2Q9T A;  2ZNT A;  3RT8 A;  2NWJ A;  1A7L A;  3VLW A;  1LAH E;  4Z0I A;  1D9Y A;  4GL8 A;  3ECR A;  3CVG A;  3MVW A;  5CBS A;  1USY E;  1DPE A;  4NTL A;  4X9T A;  2ZYN A;  2I0B A;  5M2V A;  2IA4 A;  4HCY A;  2I4B A;  4R74 A;  2R9J A;  1L5T A;  2QMW A;  2UVI A;  1NNF A;  3K00 A;  4KFQ A;  2HZL A;  3SEW A;  4MH5 A;  4U21 A;  1MPC A;  4DXB A;  3MQ9 A;  5I2N A;  5J1D A;  3S9N C;  1ATG A;  4BDR A;  5FTI A;  4KI0 E;  1UTH A;  4PFT A;  3MP8 A;  4QF9 A;  4H65 A;  4LQ5 A;  2RCB A;  3TZA A;  3Q25 A;  5ICQ A;  3OEK A;  1LFI A;  4GD5 A;  1URS A;  2GRV A;  4R9G A;  3VLV A;  1IUD A;  2Q89 A;  1JW5 A;  3MVX A;  4JSO A;  1US5 A;  3O97 A;  5I56 A;  2YJP A;  2PX1 A;  3FV1 A;  2ONR A;  4LZ7 A;  4ZEC A;  5H8Q A;  2PT2 A;  1Y9U A;  1IXI A;  1JVY A;  2O6A A;  4RYA A;  1MXX A;  3CSB A;  4PP0 A;  2Z8E A;  4XIG Q;  5K2X A;  2Z8D A;  1OVT A;  2OK2 A;  3TQL A;  1S7Y A;  1P1O A;  1QUL A;  1MXZ A;  4BDO A;  4PFY A;  2KLF A;  2F36 A;  1R1N A;  1Y3Q A;  3ZSF A;  3TTR A;  2Y7W A;  1UTB A;  4MLQ A;  2XXH A;  2H98 A;  3H6V A;  1XS5 A;  2XXY A;  3OEL A;  3FZV A;  1XT8 A;  2YLN A;  1EH3 A;  4NF4 B;  3UP9 A;  2ONK E;  1TFD A;  4X1D A;  1H45 A;  5A5X B;  3K1N A;  3MZ9 A;  4G8H A;  2H25 A;  2Y7K A;  2VP1 A;  2DS9 A;  3HHG A;  3MZ1 A;  5AA2 D;  2H9B A;  3N26 A;  3ODB A;  5JK4 A;  3T9H B;  4KD5 A;  1ZJL A;  2F7B A;  4QFL A;  4KHZ E;  4KR5 A;  5L8D A;  1B3F A;  4QHQ A;  3FAT A;  1Y20 A;  2OCU A;  3TDJ A;  1LAG E;  1NH8 A;  4GL0 A;  4YU0 A;  4Q8R A;  4OZ9 A;  1B58 A;  2H5Y A;  2GH9 A;  4GLI A;  3B6W A;  4DIG A;  2DWH A;  3LSL A;  5KZT A;  1US4 A;  1B0L A;  3CG3 A;  4R6K A;  2HXW A;  3DP8 A;  5DEX B;  1M5D A;  1PBP A;  3TTM A;  1IXC A;  1N84 A;  1MDQ A;  1FQC A;  4O3B A;  3Q26 A;  3H03 A;  4EQ9 A;  3E4R A;  4OQO A;  3TQW A;  4GIZ A;  4F19 A;  3D4G A;  4PE5 B;  2D21 A;  3KJ7 A;  2VOZ A;  1PEB A;  4TQU Q;  5ISU A;  3CSG A;  4KYD A;  3TEP A;  4F3P A;  1MY3 A;  2B3B A;  3O29 A;  1MRP A;  4FJP A;  3SER A;  2XXI A;  3HCQ A;  3C4M A;  3VE1 B;  4OER A;  4RK2 A;  5CMB A;  4LA9 A;  2AL5 A;  5ELV A;  4KYS A;  3JV9 A;  4F29 A;  1A99 A;  3K0V A;  1MS7 A;  3PGF A;  5BWJ A;  5DTB A;  3FJM A;  2QMX A;  2RKM A;  3ZKL A;  4F1U A;  3SEY A;  1JW1 A;  5JEI A;  4THI A;  1JET A;  4P0I A;  1MXU A;  4BDM A;  1MQD A;  2PYY A;  1NL5 A;  4FEC A;  3G3J A;  4POX A;  3N5L A;  3RY3 A;  1VFD A;  3KSJ A;  4GOT A;  4F2O A;  3IJX B;  2PT1 A;  4IB2 A;  4YKI A;  5TP9 A;  2F5X A;  3EF7 A;  2CZL A;  1B05 A;  1WOD A;  2PBW A;  2ZMB A;  3R26 A;  3IOW A;  2ZYO A;  1CB6 A;  5IAI A;  2ZXT A;  2BJJ X;  5AA2 A;  4WKM A;  3IOR A;  4HCW A;  1QKB A;  4IGT A;  3SEV A;  4U2R A;  3SEX A;  4UAC A;  3LUY A;  4FEB A;  3N94 A;  2RCA A;  1EZO A;  3WAE A;  4BLA A;  5H8H A;  4LQ2 A;  4O3A A;  1MG1 A;  2I3V A;  3CR9 A;  1JQF A;  1FQE A;  2W7Y A;  3FD3 A;  5I59 B;  3FJ7 A;  2XXW A;  2XD2 A;  3H06 B;  4JWX A;  3U72 A;  1MQH A;  4QFN A;  3EN3 A;  1TFA A;  4OET A;  2XXT A;  3IO6 A;  4JDF A;  5CI5 A;  2O68 A;  4BDQ A;  4ESX A;  4F31 B;  4Z7E A;  3SES A;  4YB5 A;  3IL1 B;  1BP5 A;  3IOV A;  3DP4 A;  4P0G A;  2XXX A;  4EXK A;  1Y4C A;  2DE4 A;  1OLC A;  3H6T A;  4G2Z A;  4F39 A;  5DYH A;  1POT A;  3G3I A;  3IK6 B;  2O7I A;  3FJG A;  3EHT A;  4R9F A;  4LP2 B;  4OFO A;  3K6X A;  4ELR A;  2ZYM A;  1GV8 A;  4OFL A;  1GTK A;  5I2K B;  4XXU A;  1ZBM A;  3T22 A;  4X1B A;  3RTF B;  5CMC A;  3MWB A;  1N76 A;  4R6Y A;  4RPO A;  1BIY A;  3MPL A;  1M5E A;  1SW4 A;  5H8S A;  2F7C A;  1P1N A;  3PPQ A;  4LAT A;  3B6Q A;  3K6W A;  1MXV A;  3ILU B;  3CIJ A;  4WED A;  5EHM A;  1NH7 A;  1IEJ A;  3K01 A;  4U4X A;  3LSX A;  1O64 A;  3H3G A;  3OEN A;  4PQJ A;  4JB7 A;  2O84 X;  1R6Z A;  1P99 A;  4Q30 B;  3HST A;  4LON B;  3E13 X;  2G29 A;  5KDT B;  4KYE A;  4ESW A;  2XX8 A;  1URD A;  3EPE A;  4WEP A;  1B1X A;  4H5F A;  2F97 A;  1MQI A;  2QS2 A;  2HQ0 A;  1JW4 A;  3GLB A;  4IO6 A;  1LB8 A;  5AA1 A;  1MPB A;  4QFK A;  1Z7N E;  4ZZE A;  3F11 A;  4ZEB A;  4IY6 A;  4E0X A;  3KN8 A;  4NF8 B;  4JBZ A;  1NNT A;  3V89 B;  3I5O A;  3T93 B;  1FTM A;  3Q29 A;  2Y7R A;  2F34 A;  4PET A;  2ZYK A;  1DOT A;  4PFU A;  1LGB C;  4NF5 B;  1RKM A;  2Q88 A;  2LAO A;  2O1M A;  4KQP A;  5CRY A;  1S50 A;  4G68 B;  4M1V A;  1B1H A;  2V3Q A;  2ANJ A;  1FQA A;  3PPR A;  4NED A;  4GF8 A;  2VHA A;  2AIX A;  1B40 A;  1O63 A;  2RF1 A;  4AB6 A;  1CE2 A;  1BLF A;  1B4Z A;  2UXA A;  1I6A A;  3VFJ A;  5CMK A;  3LC8 A;  4LVQ A;  3G3F A;  2HAV A;  3TKD A;  5I57 A;  5H8F A;  4XKN A;  4YKP A;  3MJN A;  4IO3 A;  4G8M A;  3MBP A;  3ILT B;  2UYF A;  3GXA A;  1B46 A;  3O6I A;  1SBP A;  2E1S A;  4F22 A;  1AOV A;  3PPP A;  1T0K A;  4OES A;  2ABH A;  4OEU A;  5TPA A;  4RY1 A;  4DCX A;  3H7M A;  4MFI A;  2V25 A;  2THI A;  2F6P A;  1Z7M E;  3U92 A;  4IY5 A;  5AA4 B;  5I2N B;  2Y84 A;  3BFU A;  3V5A A;  3OO8 A;  4GRK A;  1OMP A;  5JTY B;  2PMS A;  1UTH B;  4EF1 A;  4ND9 A;  3FV2 A;  1Y1Z A;  3UK4 A;  4F2Q A;  4YAH X;  5KCJ B;  3CRB A;  3K4U A;  3S2V A;  3LR1 A;  3CFL A;  2DVZ A;  2QSX A;  3PUY E;  4H8I A;  3OXN A;  2Q8J A;  2XXP A;  4OWD A;  1YAE A;  4TLL B;  4ZEI A;  2OJT A;  3TTK A;  4U1Z A;  1JEV A;  4ONY A;  2NVU B;  1SD3 A;  1FTK A;  4YKJ A;  4NF4 A;  4C0R A;  2R6G E;  3KN3 A;  1MY1 A;  5A5X A;  5H8Q B;  4YIC A;  2ONS A;  3SDF A;  3R7X A;  4ELO A;  4H8J A;  3PV0 E;  2CMO A;  5HBC A;  1RYO A;  3KSX A;  3W15 C;  3OMB A;  5ITP A;  3FXQ A;  2DE2 A;  2D5W A;  3C9H A;  1IZ1 A;  5DT6 A;  3PU5 A;  1B4H A;  4NF6 B;  2GHA A;  1UIV A;  1LBB A;  3RPW A;  1UTB B;  2I3W A;  4GWO A;  1FTJ A;  1HSE A;  2DWI A;  4H1X A;  3R6U A;  5I58 A;  4DCY A;  3O66 A;  3FVK A;  3C35 A;  1P1W A;  3EHU A;  2HZK A;  1LST A;  2Z8F A;  2OLB A;  2YPN A;  3O2A A;  4GXA A;  1EZ9 A;  1FQB A;  4C1U A;  2A5T B;  1JEU A;  3CG1 A;  4AB5 A;  3RUM A;  4OEN A;  2F6G A;  4YB6 A;  1LFH A;  3PPO A;  4N07 A;  3TUS A;  3MPK A;  4ZE9 A;  1B0H A;  1SYI A;  1FTL A;  1II5 A;  3SEU A;  1B3H A;  2R71 A;  2Q2C A;  3A3U A;  1FQD A;  3HN0 A;  3VV5 A;  1DPP A;  2OZZ A;  2G93 A;  4F1V A;  3C36 A;  3QSL A;  4LUB A;  4DLD A;  5IKB A;  3VVD A;  1QUJ A;  4F1Y A;  5EYF A;  3UA8 A;  3SET A;  2NOO A;  2F8D A;  1PBQ A;  4XTC Q;  3K6U A;  4U4S A;  5FHM A;  4RPN A;  2FA7 A;  4IO2 A;  4MF3 A;  1KWH A;  4GXS B;  1SW2 A;  1DSN A;  4R75 A;  2DWJ A;  1QKA A;  5H8N A;  1MM6 A;  1BKA A;  4F3S A;  3IB2 A;  3TTL A;  1YCJ A;  3K6V A;  1ANF A;  1B32 A;  2XXV A;  1Y3P A;  5BUU A;  2Q2A A;  1WDN A;  2XD3 A;  1EU8 A;  1FTO A;  4NWC A;  2H99 A;  3B6T A;  3MVZ A;  1DTZ A;  1MPD A;  3L6G A;  3QYT A;  1PC3 A;  3QUF A;  3KOT A;  4P11 A;  1B5J A;  4RA1 A;  1XOC A;  1B3E A;  1SI0 A;  4NWD A;  2B3F A;  3HO7 A;  1DMB A;  4WXJ A;  3AXF A;  2FYI A;  3KEI A;  2QS4 A;  1N3X A;  4ZE8 A;  4OXV A;  3LSW A;  2DVC A;  2ZNU A;  4H6D A;  3U1O A;  1ELJ A;  4POW A;  1MY0 A;  3LSF B;  3S4U A;  2IEE A;  5TP9 B;  4F3B A;  4QRZ A;  1FCK A;  1QUK A;  5FTH A;  1MH3 A;  1QUI A;  1H3D A;  3QIM A;  1LBC A;  4KCC A;  1B7Z A;  2QRY A;  5CBR A;  1AH5 A;  4DE8 A;  5AA2 B;  4JWY A;  3HPI A;  3P7I A;  4ZZA A;  2XX9 A;  1B52 A;  1ZKB A;  4MBP A;  4QSC A;  1LCT A;  1Q35 A;  5DVF A;  3PMX A;  4TOZ A;  2F7A A;  2I0C A;  2HFB A;  4N6P A;  3TOD A;  3IR1 A;  4FE8 A;  3USD A;  2O1L A;  4EDP A;  3V83 A;  3HHF A;  5H8H B;  5HPQ A;  3H6U A;  3OD7 A;  1HSJ A;  3FIR A;  1LFG A;  2V3U A;  3IOT A;  1B7U A;  3MUQ A;  3KFM A;  1MQG A;  3WAF A;  3U8Q A;  4I1D A;  3IOU A;  4RK9 A;  3A09 A;  1EZP A;  5I2K A;  3GBA A;  2E0S A;  1GVC A;  3T96 B;  2UVH A;  1NFT A;  2VD3 A;  2AL4 A;  3OO6 A;  3C34 A;  3G3G A;  3ZKK A;  5CM6 A;  1LAX A;  1Y1M A;  1OIB A;  4I8C A;  4ZEF A;  4U1O A;  4ZEK A;  1XC1 A;  1BTJ A;  4HS7 A;  3T9V A;  3MAM A;  3G7W A;  1I6Q A;  3O6H A;  3RTW B;  1A54 A;  3C32 A;  1QJM A;  5KDT A;  3FVO A;  4U23 A;  1ZIU A;  3Q27 A;  4F3G A;  3KGC A;  3FVG A;  4XKR A;  2ALU A;  4RNS A;  1YPN A;  4I62 A;  3U94 A;  3LBS A;  2OWS A;  4YZZ A;  3C33 A;  2GHB A;  1B9J A;  2XXQ A;  2ZNS A;  4IGR A;  4NE4 A;  4UA8 A;  5F1Q A;  4FAT A;  1SI1 A;  4NF8 A;  1ZU0 A;  1MQJ A;  5FHO A;  3VVF A;  3VLU A;  1SVX B;  4BDN A;  3UIF A;  5DVI A;  2A5S A;  4OYV A;  1Y4T A;  4R72 A;  4IO4 A;  1N7W A;  1B6H A;  1OQG A;  3RN8 A;  4XKQ A;  1FQF A;  2QJE A;  1LB9 A;  2DWA A;  4GFR A;  1YTV A;  2Z23 A;  5B7D A;  3PD9 A;  1IQ7 A;  1Q1K A;  3RQT A;  3TAJ A;  4G8N A;  1Y3N A;  2X26 A;  1A55 A;  1B51 A;  2XXU A;  4O3C A;  2QS1 A;  1PB9 A;  4OMB A;  3IAZ A;  3GBB A;  3V8X B;  2M8C A;  1B2H A;  1SQY A;  4OHN A;  1M5F A;  1QVS A;  4R2B A;  1GR2 A;  5CMM A;  2DP8 A;  2DE3 A;  1POY 1;  3TCG A;  2I48 A;  1UQW A;  1P1U A;  4ZDM A;  2V84 A;  1JVX A;  1ZLQ A;  3O28 A;  4HW8 A;  4Q0C A;  1SDX A;  3IB0 A;  2B65 A;  1OQH A;  5I57 B;  5B70 A;  3VXB A;  1MH4 A;  3OSQ A;  5AA4 A;  3THI A;  5H8F B;  2AYS A;  2Z22 A;  4QSD A;  4BDL A;  5K2Y A;  5JTY A;  5AA3 A;  2REG A;  3FVN A;  5F7V A;  3EHS A;  1MXW A;  2H4I A;  3UN6 A;  5KCJ A;  3CFZ A;  4QSE A;  5I84 A;  1FW0 A;  4R73 A;  3RGY A;  1DTG A;  3OO7 A;  3CI8 A;  2P1S A;  1RYX A;  2VD2 A;  4E0W A;  3GZG A;  4RXL A;  4H0W A;  3KG2 A;  4R6H A;  3HV1 A;  5TPA B;  1N0T A;  2WKY A;  4K3F A;  3T9U A; 
#chains in the Genus database with same CATH topology
 3N6T A;  3C31 A;  1VFE A;  4RJZ A;  3A29 A;  4JWO A;  3KZG A;  1NMU A;  2HEU A;  3PUV E;  1IXH A;  1XVX A;  5I56 B;  4NQ8 A;  2GFE A;  1FPB A;  1LAF E;  2V3T A;  4QFO A;  4QFP A;  2DQV A;  4DDD A;  3M3L A;  3JZJ A;  3RLF E;  1M5B A;  1ZMG A;  2NUV A;  2XX7 A;  3DEL B;  2P0S A;  4NF6 A;  4PE3 A;  5DVJ A;  2REJ A;  1EYI A;  1N7X A;  1LBZ A;  2X7P A;  4XKP A;  3KOS A;  4ELQ A;  3N6U A;  2VGQ A;  3KJT A;  1S9T A;  2O51 A;  4O7I A;  3FXB A;  4KCD A;  1USY H;  3DM0 A;  1OVB A;  2CEY A;  4DXC A;  1TT1 A;  1B7H A;  2A5T A;  2I6E A;  2O7U A;  1H44 A;  4IO7 A;  1R9L A;  2R8T A;  3O9P A;  3MP6 A;  3PTY A;  3K1P A;  1MY4 A;  4XF5 A;  5DEX A;  3OO9 A;  1PB8 A;  4MEV A;  2B4L A;  3G3H A;  3K1M A;  3UOR A;  4OTE A;  3KC0 A;  1B5H A;  5L9O A;  5I58 B;  3DP6 A;  5LTC A;  2XXK A;  5EHS A;  2UYE A;  2RC8 A;  5ICT A;  3BBR A;  3FAS A;  1LBX A;  3PUZ E;  3FUZ A;  3H4Z A;  1IMB A;  3OEM A;  4IR8 A;  3PPN A;  4JVD A;  4H67 A;  4FIM A;  3TMG A;  4YMA A;  2D3I A;  4X48 A;  3BIG A;  4EF2 A;  4GVO A;  5CC2 A;  2OBG A;  3U93 A;  3O6G A;  2WBB A;  4GX6 A;  4NF0 A;  1SYH A;  4R2F A;  1QW0 A;  4U22 A;  3MC2 A;  5L9S A;  3S9E A;  4JXI A;  1XHY A;  4XFE A;  1R9Q A;  1XVY A;  3M3F A;  2F78 A;  1JP4 A;  3QAX A;  1UIU A;  3IFC A;  2I58 A;  3TCF A;  3TYH A;  1F9B A;  1FPI A;  4G4P A;  3KN7 A;  3MP1 A;  2HCA A;  4FOR A;  3QUJ A;  4MMP A;  3IX1 A;  3TFL A;  1VR5 A;  3OSR A;  3E78 A;  3M8U A;  4F18 A;  1B5I A;  3EQ1 A;  5H8N B;  1DCU A;  3IJO B;  3PMW A;  1NV2 A;  4PFW A;  3MZB A;  3I3V A;  3D4C A;  3DLN A;  4EUO A;  4IO5 A;  3NOH A;  1AIV A;  4LZ8 A;  2V93 A;  3H6W A;  4G68 C;  1H43 A;  1IXG A;  5HM4 B;  4EQB A;  1JNF A;  2I49 A;  2UVG A;  1IIW A;  4DZ1 A;  2QS3 A;  1KA0 A;  2DYX A;  4H5G A;  4ISU A;  4G77 A;  2V4C A;  5I59 A;  3ZS6 A;  1OLA A;  1LLS A;  1LCF A;  2Y7I A;  4MJO A;  1MDP 1;  3BFT A;  3G3K A;  4I9D A;  4EQ7 A;  4YMB A;  4GWS A;  2CZK A;  4GQO A;  1TXF A;  1D9V A;  2RC7 A;  2CEX A;  4DXU A;  2Y7P A;  3IB1 A;  2DSF A;  3S9L C;  1FPK A;  1XI6 A;  1AMF A;  2RIN A;  1PDA A;  4PFI A;  1B3L A;  5T3J A;  2VPN A;  1HSL A;  4ECF A;  1AL3 A;  2PVU A;  4QBA A;  4L17 A;  3SZP A;  3MW0 A;  2DOJ A;  3E3K A;  5AE4 A;  1A8F A;  1A8E A;  3SKP A;  4N13 A;  3CHG A;  1NKX A;  3W9W A;  3UGW A;  1MM7 A;  1FJ9 A;  4PGN A;  1GGG A;  3PUW E;  4OFJ A;  3B8B A;  3BKI B;  3T66 A;  2O69 A;  2RC9 A;  4KPT A;  5ET7 A;  4FAJ A;  4I40 A;  1NNK A;  2UVJ A;  4P1L A;  1IIT A;  3IO4 A;  2I4C A;  3TEL A;  5LOM A;  1N04 A;  4MNC A;  5L9M A;  2X7Q A;  4C1T A;  3FXU A;  1O7T A;  5ESY A;  1K9Z A;  3B7D A;  3PD8 A;  3TPA A;  1VSO A;  4OEV A;  4G61 A;  5TU0 A;  2P2A A;  2ESN A;  5FHN A;  4ZS9 A;  5ITO A;  4M4G A;  2XHD A;  3TTN A;  1KA1 A;  4AQ4 A;  3FBP A;  1WVJ A;  4O8M A;  2OWT A;  1NNP A;  3ISP A;  1I6B A;  3VVE A;  1P1Q A;  4OVJ A;  1PB7 A;  3FGS A;  4YB7 A;  4JSD A;  4LZ5 A;  2FNC A;  3M3K A;  3RPL A;  4ZED A;  1J1N A;  1URG A;  4EXL A;  1NUW A;  1FBC A;  3KBR A;  1TWY A;  3JYR A;  3OOA A;  4YKK A;  1ZTY A;  3QK6 A;  2P3N A;  3FXR A;  3ONM A;  3K02 A;  3RNN A;  3I6V A;  2F35 A;  4ELP A;  3L6H A;  4N15 A;  3VXC A;  4MLV A;  3Q28 A;  4OAN A;  1SW1 A;  4NF5 A;  4FED A;  1D3K A;  4TLM B;  3CFX A;  1B3G A;  4G68 A;  3TCH A;  2QPQ A;  2HHM A;  1K9Y A;  2XXR A;  1VE4 A;  1M5C A;  3A3C A;  1MY2 A;  3QXM A;  1A40 A;  4NMY A;  4Q5T A;  1FBE A;  1FPL A;  2DXR A;  3S9M C;  3D1R A;  2NXO A;  3T9X B;  1N3W A;  1I69 A;  3E9X A;  4HTG A;  3W9V A;  3PUX E;  2HAU A;  3K2D A;  2QL3 A;  3PMV A;  1MXY A;  3RT6 B;  1D4N A;  1H76 A;  1NUY A;  2FIX A;  3VDF A;  1SW5 A;  2DXY A;  3MVY A;  2Q9T A;  2ZNT A;  3RT8 A;  2NWJ A;  2KQZ A;  1A7L A;  3VLW A;  1LAH E;  4Z0I A;  5DW8 A;  1D9Y A;  1NI9 A;  4GL8 A;  3ECR A;  3CVG A;  1FRP A;  3KC1 A;  3MVW A;  4MNI A;  5CBS A;  1USY E;  2HPG A;  1DPE A;  4NTL A;  4X9T A;  2ZYN A;  2I0B A;  5M2V A;  2IA4 A;  4HCY A;  2I4B A;  4R74 A;  2R9J A;  2XWV A;  1L5T A;  2QMW A;  1FTA A;  2UVI A;  1NNF A;  3K00 A;  4KFQ A;  2HZL A;  2PFZ A;  3SEW A;  4DI4 B;  4MH5 A;  4U21 A;  1MPC A;  4DXB A;  3MQ9 A;  5I2N A;  1FBG A;  5J1D A;  3S9N C;  1ATG A;  4BDR A;  5FTI A;  4KI0 E;  1UTH A;  4PFT A;  3MP8 A;  3B50 A;  3MST A;  4QF9 A;  4H65 A;  4N6K A;  1DBZ A;  4LQ5 A;  2RCB A;  3TZA A;  3Q25 A;  2OWZ A;  3E79 A;  5ICQ A;  3OEK A;  1LFI A;  4GD5 A;  1URS A;  2GRV A;  4R9G A;  4PAF A;  3VLV A;  1IUD A;  2Q89 A;  1JW5 A;  3MVX A;  4JSO A;  1US5 A;  3O97 A;  5I56 A;  2YJP A;  2PX1 A;  3FV1 A;  2ONR A;  4LZ7 A;  4ZEC A;  4PF8 A;  5H8Q A;  2PT2 A;  1Y9U A;  1IXI A;  1JVY A;  2O6A A;  4RYA A;  1MXX A;  3CSB A;  4PP0 A;  4NN3 A;  5EQ9 A;  2Z8E A;  4XIG Q;  5K2X A;  2Z8D A;  1OVT A;  2OK2 A;  3TQL A;  1S7Y A;  1P1O A;  1RDZ A;  1QUL A;  1VDW A;  2DDK A;  1MXZ A;  4BDO A;  4PFY A;  2KLF A;  2F36 A;  1R1N A;  1Y3Q A;  5IM2 A;  4P3L A;  4I3E A;  3ZSF A;  3TTR A;  2Y7W A;  1UTB A;  4MLQ A;  2XXH A;  2H98 A;  5EQA A;  2F3B A;  3H6V A;  1XS5 A;  2XXY A;  3OEL A;  3FZV A;  1XT8 A;  2YLN A;  1EH3 A;  1IME A;  4NF4 B;  3UP9 A;  2ONK E;  1TFD A;  4X1D A;  1H45 A;  5A5X B;  3K1N A;  3MZ9 A;  4G8H A;  2H25 A;  2Y7K A;  2VP1 A;  2DS9 A;  3HHG A;  3U65 A;  3MZ1 A;  5AA2 D;  1FPG A;  2H9B A;  3N26 A;  3ODB A;  5JK4 A;  1IMD A;  3T9H B;  4KD5 A;  1ZJL A;  2F7B A;  4QFL A;  4KHZ E;  4KR5 A;  5L8D A;  1B3F A;  2P3V A;  4QHQ A;  3FAT A;  4HXV A;  1Y20 A;  2OCU A;  1EYK A;  1LAG E;  3TDJ A;  1NH8 A;  4GL0 A;  2OX3 A;  4YU0 A;  4Q8R A;  4OZ9 A;  1B58 A;  2H5Y A;  2GH9 A;  4GLI A;  3B6W A;  4DIG A;  2DWH A;  3LSL A;  5KZT A;  4GWU A;  1US4 A;  1B0L A;  3CG3 A;  4R6K A;  2HXW A;  3DP8 A;  5DEX B;  1FPE A;  1M5D A;  1PBP A;  3TTM A;  1IXC A;  1N84 A;  1MDQ A;  1FQC A;  4O3B A;  3Q26 A;  1G0I A;  3H03 A;  4EQ9 A;  3E4R A;  4OQO A;  3TQW A;  4GIZ A;  4F19 A;  3D4G A;  2F3D A;  4PE5 B;  2D21 A;  2PFY A;  1RDX A;  3KJ7 A;  4KXP A;  4P9K A;  2VOZ A;  1PEB A;  4TQU Q;  5ISU A;  3CSG A;  2FIE A;  4KYD A;  3TEP A;  4F3P A;  1MY3 A;  2B3B A;  3O29 A;  4PDD A;  1MRP A;  4PAK A;  4FJP A;  4NHB A;  3SER A;  2XXI A;  2QVR A;  3HCQ A;  3C4M A;  3VE1 B;  4OER A;  4RK2 A;  5CMB A;  4LA9 A;  2AL5 A;  5ELV A;  1FPD A;  4KYS A;  3JV9 A;  4F29 A;  2Y5L A;  2XWI A;  3KBZ A;  1A99 A;  3K0V A;  1MS7 A;  3PGF A;  1YZ0 A;  2ZZV A;  5ET6 A;  5BWJ A;  5DTB A;  3MYU A;  3FJM A;  2QMX A;  2RKM A;  3ZKL A;  4F1U A;  3SEY A;  1JW1 A;  5JEI A;  4THI A;  1JET A;  4P0I A;  1MXU A;  4BDM A;  1MQD A;  4N8G A;  2PYY A;  1NL5 A;  4FEC A;  3G3J A;  4POX A;  3N5L A;  3RY3 A;  2Y5K A;  1VFD A;  3KSJ A;  4GOT A;  4F2O A;  3IJX B;  2PT1 A;  4IB2 A;  4YKI A;  5TP9 A;  2F5X A;  3EF7 A;  2CZL A;  1FJ6 A;  1B05 A;  1WOD A;  2PBW A;  2ZMB A;  3R26 A;  3IOW A;  2ZYO A;  1CB6 A;  4OVT A;  5IAI A;  4N6D A;  2XWK A;  2ZXT A;  2BJJ X;  5AA2 A;  4WKM A;  3IOR A;  4HCW A;  2VPO A;  1QKB A;  5J16 A;  1QGX A;  4IGT A;  1BK4 A;  3SEV A;  4U2R A;  3SEX A;  4PBQ A;  4UAC A;  3LUY A;  4FEB A;  3N94 A;  2RCA A;  1EZO A;  3WAE A;  4BLA A;  5H8H A;  4LQ2 A;  4O3A A;  1NV6 A;  3QMF A;  1MG1 A;  2I3V A;  3CR9 A;  1JQF A;  1FQE A;  2W7Y A;  2WYK A;  4GWW A;  3FD3 A;  5I59 B;  3FJ7 A;  2XXW A;  2XD2 A;  3H06 B;  4JWX A;  3U72 A;  1MQH A;  4QFN A;  3EN3 A;  1TFA A;  4OET A;  2XXT A;  3IO6 A;  4JDF A;  5CI5 A;  2O68 A;  4BDQ A;  4ESX A;  4F31 B;  3BIH A;  4Z7E A;  3SES A;  4YB5 A;  3IL1 B;  4PGP A;  1BP5 A;  3IOV A;  3DP4 A;  4P0G A;  2XXX A;  4EXK A;  1Y4C A;  2DE4 A;  1OLC A;  3HFU A;  3H6T A;  4NG7 A;  4G2Z A;  1YYZ A;  4F39 A;  5DYH A;  1POT A;  3G3I A;  5IGA A;  3IK6 B;  1LBV A;  2O7I A;  3FJG A;  3EHT A;  4R9F A;  4LP2 B;  4OFO A;  3K6X A;  4ELR A;  4GBW A;  2ZYM A;  1GV8 A;  4OFL A;  2MKZ A;  1IMC A;  2Q74 A;  5I7I A;  1GTK A;  5I2K B;  4XXU A;  1ZBM A;  3T22 A;  4X1B A;  3RTF B;  5CMC A;  2GQ1 A;  3MWB A;  1N76 A;  2ZZX A;  4R6Y A;  4RPO A;  1BIY A;  3MPL A;  1M5E A;  1SW4 A;  5H8S A;  4MX6 A;  4XEQ A;  2F7C A;  4P8B A;  1P1N A;  3PPQ A;  4LAT A;  3B6Q A;  3K6W A;  1MXV A;  3ILU B;  3CIJ A;  4WED A;  2HXR A;  5EHM A;  1IEJ A;  1NH7 A;  3K01 A;  4U4X A;  3LSX A;  1O64 A;  3H3G A;  3OEN A;  4PQJ A;  4JB7 A;  2O84 X;  1R6Z A;  1G0H A;  1P99 A;  4Q30 B;  3HST A;  4LON B;  4MCO A;  3E13 X;  2G29 A;  5I3S A;  4PTK A;  5KDT B;  4KYE A;  3LUZ A;  3RPL B;  4ESW A;  2WX9 A;  2XX8 A;  1URD A;  3EPE A;  4WEP A;  1B1X A;  4H5F A;  1EYJ A;  4P1E A;  2F97 A;  1MQI A;  4N4U A;  2QS2 A;  2HQ0 A;  1JW4 A;  3GLB A;  4IO6 A;  1LB8 A;  5AA1 A;  1MPB A;  4QFK A;  1Z7N E;  5F24 A;  4ZZE A;  3F11 A;  4ZEB A;  4IY6 A;  4E0X A;  3KN8 A;  4NF8 B;  4JBZ A;  1NNT A;  3V89 B;  3I5O A;  3T93 B;  1FTM A;  3Q29 A;  2Y7R A;  2F34 A;  4PET A;  2ZYK A;  1DOT A;  4PFU A;  1LGB C;  4NF5 B;  1RKM A;  1FPJ A;  2Q88 A;  2LAO A;  2O1M A;  4KQP A;  1AWB A;  5CRY A;  1S50 A;  4G68 B;  4M1V A;  1B1H A;  2V3Q A;  2ANJ A;  1FQA A;  3PPR A;  4NED A;  4GF8 A;  2VHA A;  1NUZ A;  2AIX A;  4O94 A;  1B40 A;  1O63 A;  4NX1 A;  2RF1 A;  4AB6 A;  1CE2 A;  1BLF A;  1B4Z A;  1FBF A;  2UXA A;  1I6A A;  4NGU A;  3VFJ A;  4PFR A;  5CMK A;  3LC8 A;  4LVQ A;  3G3F A;  1CNQ A;  2HAV A;  3TKD A;  5I57 A;  5H8F A;  4PF6 A;  1NV3 A;  4XKN A;  4YKP A;  3MJN A;  4IO3 A;  4NAP A;  4G8M A;  3MBP A;  3ILT B;  2UYF A;  1FBH A;  3GXA A;  1NV1 A;  1B46 A;  3O6I A;  1SBP A;  2E1S A;  4F22 A;  2Q8M A;  1AOV A;  3PPP A;  1T0K A;  4OES A;  2ABH A;  4OEU A;  5TPA A;  5EYG A;  4RY1 A;  4DCX A;  1D9Q A;  3H7M A;  4MFI A;  4QXD A;  2V25 A;  2THI A;  2F6P A;  1Z7M E;  5IZ3 B;  3U92 A;  4GX4 A;  4IY5 A;  5EQ7 A;  4MHF A;  5AA4 B;  5I2N B;  2CZH A;  1FBD A;  2Y84 A;  3BFU A;  3V5A A;  3OO8 A;  4GRK A;  1OMP A;  5JTY B;  2PMS A;  1UTH B;  4EF1 A;  4ND9 A;  3FV2 A;  1Y1Z A;  4I3Y A;  3UK4 A;  4F2Q A;  4YAH X;  5KCJ B;  3CRB A;  3K4U A;  3S2V A;  3T0J A;  3LR1 A;  3CFL A;  2DVZ A;  2QSX A;  3PUY E;  4H8I A;  3OXN A;  2Q8J A;  2XXP A;  4OWD A;  1YAE A;  4TLL B;  4ZEI A;  1IMA A;  2OJT A;  3TTK A;  4U1Z A;  1JEV A;  4ONY A;  2NVU B;  1SD3 A;  4PDH A;  1FTK A;  4YKJ A;  4NF4 A;  4C0R A;  2R6G E;  3KN3 A;  1MY1 A;  5A5X A;  5H8Q B;  2FBP A;  4MNP A;  4YIC A;  2ONS A;  3SDF A;  3R7X A;  4ELO A;  4H8J A;  3PV0 E;  2CMO A;  4OVP A;  5HBC A;  1RYO A;  3KSX A;  3W15 C;  3OMB A;  5ITP A;  4PFB A;  3FXQ A;  2DE2 A;  2D5W A;  2XA5 A;  2FHY A;  3C9H A;  1IZ1 A;  5DT6 A;  2BJI A;  1NV0 A;  3PU5 A;  1B4H A;  4NF6 B;  2GHA A;  1UIV A;  1LBB A;  3RPW A;  4N8Y A;  2B4M A;  3IFA A;  1UTB B;  4JVI A;  2I3W A;  4GWO A;  1FTJ A;  1HSE A;  2FVZ A;  2DWI A;  4H1X A;  3R6U A;  5I58 A;  3O66 A;  4DCY A;  3FVK A;  5ET8 A;  3C35 A;  1P1W A;  3EHU A;  5IZ1 A;  2HZK A;  1LST A;  2Z8F A;  2OLB A;  2YPN A;  3O2A A;  4GXA A;  1EZ9 A;  4AS4 A;  1FQB A;  4C1U A;  1LBW A;  2A5T B;  1JEU A;  3CG1 A;  4AB5 A;  1FSA A;  2VT5 A;  3RUM A;  4OEN A;  2F6G A;  4YB6 A;  1LFH A;  3PPO A;  1INP A;  3ROJ A;  1IMF A;  4N07 A;  3TUS A;  3MPK A;  4ZE9 A;  1B0H A;  1SYI A;  1FTL A;  1II5 A;  3SEU A;  4X8R A;  1B3H A;  2R71 A;  2Q2C A;  3A3U A;  5I5P A;  1FQD A;  3HN0 A;  3VV5 A;  1DPP A;  4OA4 A;  1NV4 A;  2OZZ A;  1LEV A;  2G93 A;  4F1V A;  4PBH A;  4H46 A;  3C36 A;  3EKI A;  3QSL A;  4LUB A;  4DLD A;  5IKB A;  3VVD A;  1QUJ A;  4F1Y A;  5EYF A;  3UA8 A;  3SET A;  2NOO A;  2F8D A;  1PBQ A;  2XWO A;  4XTC Q;  3K6U A;  4U4S A;  5FHM A;  4RPN A;  2FA7 A;  4IO2 A;  1RDY A;  4MF3 A;  1KWH A;  4GXS B;  1SW2 A;  1DSN A;  4R75 A;  2DWJ A;  1QKA A;  5H8N A;  1MM6 A;  1BKA A;  4F3S A;  3IB2 A;  3TTL A;  1YCJ A;  3K6V A;  4N81 A;  1ANF A;  1KZ8 A;  1B32 A;  2XXV A;  1Y3P A;  5BUU A;  2Q2A A;  1WDN A;  2XD3 A;  2WBD A;  1EU8 A;  1FTO A;  4UAB A;  4OVR A;  5FBP A;  4NWC A;  2H99 A;  3B6T A;  4PAI A;  3MVZ A;  1DTZ A;  1MPD A;  3L6G A;  3QYT A;  1PC3 A;  3QUF A;  3KOT A;  4X04 A;  4P11 A;  1B5J A;  4RA1 A;  1XOC A;  1B3E A;  1SI0 A;  4N91 A;  4NWD A;  2B3F A;  3HO7 A;  1DMB A;  4WXJ A;  3AXF A;  2FYI A;  3KEI A;  2QS4 A;  4N17 A;  1DK4 A;  1N3X A;  4ZE8 A;  4OXV A;  3LSW A;  2DVC A;  2ZNU A;  2QVU A;  4H6D A;  3U1O A;  1ELJ A;  2WYP A;  4H45 A;  4GX3 A;  4POW A;  1MY0 A;  3LSF B;  3S4U A;  2IEE A;  4O7M A;  5TP9 B;  4F3B A;  4QRZ A;  1FCK A;  1QUK A;  1FBP A;  5FTH A;  1MH3 A;  1QUI A;  1H3D A;  2L5V A;  3QIM A;  1LBC A;  4KCC A;  2QFL A;  1B7Z A;  2QRY A;  5CBR A;  1AH5 A;  4DE8 A;  5AA2 B;  1NUX A;  4JWY A;  3HPI A;  3P7I A;  4ZZA A;  2CZI A;  2XX9 A;  1B52 A;  1ZKB A;  4MBP A;  4QSC A;  1LCT A;  4FBP A;  1Q35 A;  4PCD A;  5DVF A;  3PMX A;  4TOZ A;  2F7A A;  2I0C A;  2HFB A;  4N6P A;  5EQ8 A;  3TOD A;  3IR1 A;  4FE8 A;  3USD A;  2O1L A;  4EDP A;  3V83 A;  3HHF A;  5H8H B;  5HPQ A;  3H6U A;  3OD7 A;  4GWX A;  1HSJ A;  1Q9D A;  3FIR A;  1LFG A;  2V3U A;  3IOT A;  1B7U A;  3MUQ A;  3KFM A;  1MQG A;  3WAF A;  3U8Q A;  2JJK A;  3IOU A;  4I1D A;  5A5L A;  4RK9 A;  3A09 A;  4PC9 A;  3GYY A;  5I2K A;  3GBA A;  1EZP A;  2E0S A;  2ZZW A;  1GVC A;  3T96 B;  2UVH A;  1NFT A;  2VD3 A;  2AL4 A;  1SPI A;  3OO6 A;  3C34 A;  3G3G A;  3ZKK A;  5CM6 A;  1LAX A;  1Y1M A;  1OIB A;  4I8C A;  4GBV A;  4ZEF A;  4U1O A;  4ZEK A;  1XC1 A;  1BTJ A;  4HS7 A;  4AS5 A;  3T9V A;  3MAM A;  3G7W A;  1I6Q A;  3O6H A;  1LBY A;  3RTW B;  1A54 A;  3C32 A;  1QJM A;  5KDT A;  5LDZ A;  3FVO A;  4U23 A;  1ZIU A;  1NV7 A;  3T1B A;  3Q27 A;  4F3G A;  3KGC A;  3FVG A;  1NV5 A;  4XKR A;  2ALU A;  4RNS A;  1YPN A;  4I62 A;  3U94 A;  3LBS A;  2OWS A;  4YZZ A;  3C33 A;  4OVQ A;  2GHB A;  5ET5 A;  1B9J A;  3RYD A;  2XXQ A;  2ZNS A;  4IGR A;  4NE4 A;  4UA8 A;  5F1Q A;  4FAT A;  1SI1 A;  4NF8 A;  1ZU0 A;  1MQJ A;  5FHO A;  4HE0 A;  3VVF A;  3VLU A;  1SVX B;  4BDN A;  3UIF A;  5DVI A;  2A5S A;  4HE1 A;  4OYV A;  1Y4T A;  4R72 A;  4IO4 A;  1N7W A;  5EYH A;  1B6H A;  1OQG A;  3RN8 A;  4XKQ A;  1FQF A;  2QJE A;  1LB9 A;  2QVV A;  2DWA A;  4GFR A;  1YTV A;  2Z23 A;  5B7D A;  3PD9 A;  1IQ7 A;  1Q1K A;  3RQT A;  3TAJ A;  4LN5 A;  4G8N A;  1Y3N A;  2X26 A;  1A55 A;  1B51 A;  2XXU A;  2PCR A;  4O3C A;  2QS1 A;  1PB9 A;  4OMB A;  3IAZ A;  3GBB A;  3V8X B;  2M8C A;  1B2H A;  1SQY A;  4OHN A;  1M5F A;  4P56 A;  4R2B A;  1QVS A;  4JVC A;  1GR2 A;  5CMM A;  2DP8 A;  2DE3 A;  1POY 1;  3TCG A;  2WEF A;  4MIJ A;  2I48 A;  1UQW A;  1P1U A;  4HE2 A;  4ZDM A;  2V84 A;  1JVX A;  4GWY A;  1ZLQ A;  3O28 A;  4MAG A;  4HW8 A;  4OVS A;  4Q0C A;  1SDX A;  3IB0 A;  5IZ3 A;  2B65 A;  1OQH A;  1FPF A;  5I57 B;  5B70 A;  3VXB A;  1MH4 A;  3OSQ A;  5AA4 A;  3THI A;  5H8F B;  2AYS A;  2Z22 A;  4QSD A;  4BDL A;  5K2Y A;  5JTY A;  3LV0 A;  4GWZ A;  1YXI A;  5AA3 A;  2REG A;  3FVN A;  5F7V A;  3EHS A;  1MXW A;  2H4I A;  3UN6 A;  4P47 A;  5KCJ A;  3CFZ A;  4QSE A;  5I84 A;  2KR0 A;  1FW0 A;  4R73 A;  3RGY A;  5IZZ A;  1DTG A;  3OO7 A;  4DI3 D;  3CI8 A;  2P1S A;  1RYX A;  2VD2 A;  4E0W A;  3GZG A;  4RXL A;  4H0W A;  3KG2 A;  4R6H A;  3HV1 A;  5TPA B;  1N0T A;  2WKY A;  4K3F A;  3T9U A; 
#chains in the Genus database with same CATH homology
 3N6T A;  3C31 A;  1VFE A;  4RJZ A;  4JWO A;  3KZG A;  1NMU A;  2HEU A;  3PUV E;  1IXH A;  1XVX A;  5I56 B;  2GFE A;  1LAF E;  2V3T A;  4QFO A;  4QFP A;  2DQV A;  4DDD A;  3M3L A;  3JZJ A;  3RLF E;  1M5B A;  1ZMG A;  2NUV A;  2XX7 A;  3DEL B;  2P0S A;  4NF6 A;  5DVJ A;  2REJ A;  1N7X A;  2X7P A;  4XKP A;  3KOS A;  4ELQ A;  3N6U A;  2VGQ A;  3KJT A;  1S9T A;  2O51 A;  4KCD A;  1USY H;  3DM0 A;  1OVB A;  4DXC A;  1TT1 A;  1B7H A;  2A5T A;  2I6E A;  2O7U A;  1H44 A;  4IO7 A;  1R9L A;  3O9P A;  3MP6 A;  3K1P A;  1MY4 A;  5DEX A;  3OO9 A;  1PB8 A;  3G3H A;  3K1M A;  3UOR A;  4OTE A;  1B5H A;  5L9O A;  5I58 B;  3DP6 A;  5EHS A;  2UYE A;  2RC8 A;  5ICT A;  3BBR A;  3FAS A;  3PUZ E;  3FUZ A;  3H4Z A;  3OEM A;  3PPN A;  4H67 A;  4FIM A;  3TMG A;  4YMA A;  2D3I A;  4X48 A;  4EF2 A;  4GVO A;  5CC2 A;  2OBG A;  3U93 A;  3O6G A;  1SYH A;  4R2F A;  1QW0 A;  4U22 A;  3MC2 A;  5L9S A;  3S9E A;  4JXI A;  1XHY A;  1R9Q A;  1XVY A;  3M3F A;  2F78 A;  3QAX A;  1UIU A;  2I58 A;  3TCF A;  3TYH A;  1F9B A;  4G4P A;  3KN7 A;  3MP1 A;  2HCA A;  4FOR A;  3QUJ A;  3IX1 A;  3TFL A;  1VR5 A;  3OSR A;  3M8U A;  4F18 A;  1B5I A;  3EQ1 A;  5H8N B;  3IJO B;  3PMW A;  4PFW A;  3MZB A;  3I3V A;  3D4C A;  3DLN A;  4EUO A;  4IO5 A;  1AIV A;  4LZ8 A;  2V93 A;  3H6W A;  4G68 C;  1H43 A;  1IXG A;  5HM4 B;  4EQB A;  1JNF A;  2I49 A;  2UVG A;  1IIW A;  4DZ1 A;  2QS3 A;  2DYX A;  4H5G A;  4ISU A;  4G77 A;  5I59 A;  3ZS6 A;  1OLA A;  1LLS A;  1LCF A;  2Y7I A;  1MDP 1;  3BFT A;  4YMB A;  4EQ7 A;  3G3K A;  4I9D A;  4GQO A;  1TXF A;  1D9V A;  2RC7 A;  4DXU A;  2Y7P A;  3IB1 A;  2DSF A;  3S9L C;  1AMF A;  2RIN A;  1PDA A;  1B3L A;  1HSL A;  4ECF A;  1AL3 A;  2PVU A;  4L17 A;  3MW0 A;  2DOJ A;  3E3K A;  5AE4 A;  1A8F A;  1A8E A;  3SKP A;  3W9W A;  4N13 A;  1NKX A;  3UGW A;  1MM7 A;  1GGG A;  3PUW E;  4OFJ A;  3BKI B;  3T66 A;  2O69 A;  2RC9 A;  4KPT A;  4FAJ A;  1NNK A;  2UVJ A;  1IIT A;  3IO4 A;  2I4C A;  3TEL A;  5LOM A;  1N04 A;  5L9M A;  2X7Q A;  4C1T A;  3FXU A;  1O7T A;  3B7D A;  3PD8 A;  3TPA A;  1VSO A;  4OEV A;  5TU0 A;  2P2A A;  2ESN A;  5FHN A;  4ZS9 A;  5ITO A;  4M4G A;  2XHD A;  3TTN A;  4AQ4 A;  1WVJ A;  2OWT A;  1NNP A;  1I6B A;  3VVE A;  1P1Q A;  4OVJ A;  1PB7 A;  3FGS A;  4YB7 A;  4JSD A;  4LZ5 A;  2FNC A;  3M3K A;  4ZED A;  1J1N A;  1URG A;  4EXL A;  3KBR A;  1TWY A;  3JYR A;  3OOA A;  4YKK A;  1ZTY A;  3QK6 A;  3FXR A;  3ONM A;  3K02 A;  3RNN A;  3I6V A;  2F35 A;  4ELP A;  3L6H A;  3VXC A;  4MLV A;  3Q28 A;  1SW1 A;  4NF5 A;  4FED A;  1D3K A;  4TLM B;  3CFX A;  1B3G A;  4G68 A;  3TCH A;  2QPQ A;  2XXR A;  1VE4 A;  1M5C A;  3A3C A;  1MY2 A;  3QXM A;  1A40 A;  4NMY A;  4Q5T A;  2DXR A;  3S9M C;  2NXO A;  3T9X B;  1N3W A;  1I69 A;  3E9X A;  4HTG A;  3W9V A;  3PUX E;  2HAU A;  3K2D A;  2QL3 A;  3PMV A;  1MXY A;  3RT6 B;  1D4N A;  1H76 A;  3VDF A;  1SW5 A;  2DXY A;  3MVY A;  2Q9T A;  2ZNT A;  3RT8 A;  2NWJ A;  1A7L A;  3VLW A;  1LAH E;  4Z0I A;  1D9Y A;  4GL8 A;  3ECR A;  3CVG A;  3MVW A;  5CBS A;  1USY E;  1DPE A;  4NTL A;  4X9T A;  2ZYN A;  2I0B A;  5M2V A;  2IA4 A;  4HCY A;  2I4B A;  4R74 A;  2R9J A;  1L5T A;  2QMW A;  2UVI A;  1NNF A;  3K00 A;  4KFQ A;  2HZL A;  3SEW A;  4MH5 A;  4U21 A;  1MPC A;  4DXB A;  3MQ9 A;  5I2N A;  5J1D A;  3S9N C;  1ATG A;  4BDR A;  5FTI A;  4KI0 E;  1UTH A;  4PFT A;  3MP8 A;  4QF9 A;  4H65 A;  4LQ5 A;  2RCB A;  3TZA A;  3Q25 A;  5ICQ A;  3OEK A;  1LFI A;  4GD5 A;  1URS A;  2GRV A;  4R9G A;  3VLV A;  1IUD A;  2Q89 A;  1JW5 A;  3MVX A;  4JSO A;  1US5 A;  3O97 A;  5I56 A;  2YJP A;  2PX1 A;  3FV1 A;  2ONR A;  4LZ7 A;  4ZEC A;  5H8Q A;  2PT2 A;  1Y9U A;  1IXI A;  1JVY A;  2O6A A;  4RYA A;  1MXX A;  3CSB A;  4PP0 A;  2Z8E A;  4XIG Q;  5K2X A;  2Z8D A;  1OVT A;  2OK2 A;  3TQL A;  1S7Y A;  1P1O A;  1QUL A;  1MXZ A;  4BDO A;  4PFY A;  2KLF A;  2F36 A;  1R1N A;  1Y3Q A;  3ZSF A;  3TTR A;  2Y7W A;  1UTB A;  4MLQ A;  2XXH A;  2H98 A;  3H6V A;  1XS5 A;  2XXY A;  3OEL A;  3FZV A;  1XT8 A;  2YLN A;  1EH3 A;  4NF4 B;  3UP9 A;  2ONK E;  1TFD A;  4X1D A;  1H45 A;  5A5X B;  3K1N A;  3MZ9 A;  4G8H A;  2H25 A;  2Y7K A;  2VP1 A;  2DS9 A;  3HHG A;  3MZ1 A;  5AA2 D;  2H9B A;  3N26 A;  3ODB A;  5JK4 A;  3T9H B;  4KD5 A;  1ZJL A;  2F7B A;  4QFL A;  4KHZ E;  4KR5 A;  5L8D A;  1B3F A;  4QHQ A;  3FAT A;  1Y20 A;  2OCU A;  3TDJ A;  1LAG E;  1NH8 A;  4GL0 A;  4YU0 A;  4Q8R A;  4OZ9 A;  1B58 A;  2H5Y A;  2GH9 A;  4GLI A;  3B6W A;  4DIG A;  2DWH A;  3LSL A;  5KZT A;  1US4 A;  1B0L A;  3CG3 A;  4R6K A;  2HXW A;  3DP8 A;  5DEX B;  1M5D A;  1PBP A;  3TTM A;  1IXC A;  1N84 A;  1MDQ A;  1FQC A;  4O3B A;  3Q26 A;  3H03 A;  4EQ9 A;  3E4R A;  4OQO A;  3TQW A;  4GIZ A;  4F19 A;  3D4G A;  4PE5 B;  2D21 A;  3KJ7 A;  2VOZ A;  1PEB A;  4TQU Q;  5ISU A;  3CSG A;  4KYD A;  3TEP A;  4F3P A;  1MY3 A;  2B3B A;  3O29 A;  1MRP A;  4FJP A;  3SER A;  2XXI A;  3HCQ A;  3C4M A;  3VE1 B;  4OER A;  4RK2 A;  5CMB A;  4LA9 A;  2AL5 A;  5ELV A;  4KYS A;  3JV9 A;  4F29 A;  1A99 A;  3K0V A;  1MS7 A;  3PGF A;  5BWJ A;  5DTB A;  3FJM A;  2QMX A;  2RKM A;  3ZKL A;  4F1U A;  3SEY A;  1JW1 A;  5JEI A;  4THI A;  1JET A;  4P0I A;  1MXU A;  4BDM A;  1MQD A;  2PYY A;  1NL5 A;  4FEC A;  3G3J A;  4POX A;  3N5L A;  3RY3 A;  1VFD A;  3KSJ A;  4GOT A;  4F2O A;  3IJX B;  2PT1 A;  4IB2 A;  4YKI A;  5TP9 A;  2F5X A;  3EF7 A;  2CZL A;  1B05 A;  1WOD A;  2PBW A;  2ZMB A;  3R26 A;  3IOW A;  2ZYO A;  1CB6 A;  5IAI A;  2ZXT A;  2BJJ X;  5AA2 A;  4WKM A;  3IOR A;  4HCW A;  1QKB A;  4IGT A;  3SEV A;  4U2R A;  3SEX A;  4UAC A;  3LUY A;  4FEB A;  3N94 A;  2RCA A;  1EZO A;  3WAE A;  4BLA A;  5H8H A;  4LQ2 A;  4O3A A;  1MG1 A;  2I3V A;  3CR9 A;  1JQF A;  1FQE A;  2W7Y A;  3FD3 A;  5I59 B;  3FJ7 A;  2XXW A;  2XD2 A;  3H06 B;  4JWX A;  3U72 A;  1MQH A;  4QFN A;  3EN3 A;  1TFA A;  4OET A;  2XXT A;  3IO6 A;  4JDF A;  5CI5 A;  2O68 A;  4BDQ A;  4ESX A;  4F31 B;  4Z7E A;  3SES A;  4YB5 A;  3IL1 B;  1BP5 A;  3IOV A;  3DP4 A;  4P0G A;  2XXX A;  4EXK A;  1Y4C A;  2DE4 A;  1OLC A;  3H6T A;  4G2Z A;  4F39 A;  5DYH A;  1POT A;  3G3I A;  3IK6 B;  2O7I A;  3FJG A;  3EHT A;  4R9F A;  4LP2 B;  4OFO A;  3K6X A;  4ELR A;  2ZYM A;  1GV8 A;  4OFL A;  1GTK A;  5I2K B;  4XXU A;  1ZBM A;  3T22 A;  4X1B A;  3RTF B;  5CMC A;  3MWB A;  1N76 A;  4R6Y A;  4RPO A;  1BIY A;  3MPL A;  1M5E A;  1SW4 A;  5H8S A;  2F7C A;  1P1N A;  3PPQ A;  4LAT A;  3B6Q A;  3K6W A;  1MXV A;  3ILU B;  3CIJ A;  4WED A;  5EHM A;  1NH7 A;  1IEJ A;  3K01 A;  4U4X A;  3LSX A;  1O64 A;  3H3G A;  3OEN A;  4PQJ A;  4JB7 A;  2O84 X;  1R6Z A;  1P99 A;  4Q30 B;  3HST A;  4LON B;  3E13 X;  2G29 A;  5KDT B;  4KYE A;  4ESW A;  2XX8 A;  1URD A;  3EPE A;  4WEP A;  1B1X A;  4H5F A;  2F97 A;  1MQI A;  2QS2 A;  2HQ0 A;  1JW4 A;  3GLB A;  4IO6 A;  1LB8 A;  5AA1 A;  1MPB A;  4QFK A;  1Z7N E;  4ZZE A;  3F11 A;  4ZEB A;  4IY6 A;  4E0X A;  3KN8 A;  4NF8 B;  4JBZ A;  1NNT A;  3V89 B;  3I5O A;  3T93 B;  1FTM A;  3Q29 A;  2Y7R A;  2F34 A;  4PET A;  2ZYK A;  1DOT A;  4PFU A;  1LGB C;  4NF5 B;  1RKM A;  2Q88 A;  2LAO A;  2O1M A;  4KQP A;  5CRY A;  1S50 A;  4G68 B;  4M1V A;  1B1H A;  2V3Q A;  2ANJ A;  1FQA A;  3PPR A;  4NED A;  4GF8 A;  2VHA A;  2AIX A;  1B40 A;  1O63 A;  2RF1 A;  4AB6 A;  1CE2 A;  1BLF A;  1B4Z A;  2UXA A;  1I6A A;  3VFJ A;  5CMK A;  3LC8 A;  4LVQ A;  3G3F A;  2HAV A;  3TKD A;  5I57 A;  5H8F A;  4XKN A;  4YKP A;  3MJN A;  4IO3 A;  4G8M A;  3MBP A;  3ILT B;  2UYF A;  3GXA A;  1B46 A;  3O6I A;  1SBP A;  2E1S A;  4F22 A;  1AOV A;  3PPP A;  1T0K A;  4OES A;  2ABH A;  4OEU A;  5TPA A;  4RY1 A;  4DCX A;  3H7M A;  4MFI A;  2V25 A;  2THI A;  2F6P A;  1Z7M E;  3U92 A;  4IY5 A;  5AA4 B;  5I2N B;  2Y84 A;  3BFU A;  3V5A A;  3OO8 A;  4GRK A;  1OMP A;  5JTY B;  2PMS A;  1UTH B;  4EF1 A;  4ND9 A;  3FV2 A;  1Y1Z A;  3UK4 A;  4F2Q A;  4YAH X;  5KCJ B;  3CRB A;  3K4U A;  3S2V A;  3LR1 A;  3CFL A;  2DVZ A;  2QSX A;  3PUY E;  4H8I A;  3OXN A;  2Q8J A;  2XXP A;  4OWD A;  1YAE A;  4TLL B;  4ZEI A;  2OJT A;  3TTK A;  4U1Z A;  1JEV A;  4ONY A;  2NVU B;  1SD3 A;  1FTK A;  4YKJ A;  4NF4 A;  4C0R A;  2R6G E;  3KN3 A;  1MY1 A;  5A5X A;  5H8Q B;  4YIC A;  2ONS A;  3SDF A;  3R7X A;  4ELO A;  4H8J A;  3PV0 E;  2CMO A;  5HBC A;  1RYO A;  3KSX A;  3W15 C;  3OMB A;  5ITP A;  3FXQ A;  2DE2 A;  2D5W A;  3C9H A;  1IZ1 A;  5DT6 A;  3PU5 A;  1B4H A;  4NF6 B;  2GHA A;  1UIV A;  1LBB A;  3RPW A;  1UTB B;  2I3W A;  4GWO A;  1FTJ A;  1HSE A;  2DWI A;  4H1X A;  3R6U A;  5I58 A;  4DCY A;  3O66 A;  3FVK A;  3C35 A;  1P1W A;  3EHU A;  2HZK A;  1LST A;  2Z8F A;  2OLB A;  2YPN A;  3O2A A;  4GXA A;  1EZ9 A;  1FQB A;  4C1U A;  2A5T B;  1JEU A;  3CG1 A;  4AB5 A;  3RUM A;  4OEN A;  2F6G A;  4YB6 A;  1LFH A;  3PPO A;  4N07 A;  3TUS A;  3MPK A;  4ZE9 A;  1B0H A;  1SYI A;  1FTL A;  1II5 A;  3SEU A;  1B3H A;  2R71 A;  2Q2C A;  3A3U A;  1FQD A;  3HN0 A;  3VV5 A;  1DPP A;  2OZZ A;  2G93 A;  4F1V A;  3C36 A;  3QSL A;  4LUB A;  4DLD A;  5IKB A;  3VVD A;  1QUJ A;  4F1Y A;  5EYF A;  3UA8 A;  3SET A;  2NOO A;  2F8D A;  1PBQ A;  4XTC Q;  3K6U A;  4U4S A;  5FHM A;  4RPN A;  2FA7 A;  4IO2 A;  4MF3 A;  1KWH A;  4GXS B;  1SW2 A;  1DSN A;  4R75 A;  2DWJ A;  1QKA A;  5H8N A;  1MM6 A;  1BKA A;  4F3S A;  3IB2 A;  3TTL A;  1YCJ A;  3K6V A;  1ANF A;  1B32 A;  2XXV A;  1Y3P A;  5BUU A;  2Q2A A;  1WDN A;  2XD3 A;  1EU8 A;  1FTO A;  4NWC A;  2H99 A;  3B6T A;  3MVZ A;  1DTZ A;  1MPD A;  3L6G A;  3QYT A;  1PC3 A;  3QUF A;  3KOT A;  4P11 A;  1B5J A;  4RA1 A;  1XOC A;  1B3E A;  1SI0 A;  4NWD A;  2B3F A;  3HO7 A;  1DMB A;  4WXJ A;  3AXF A;  2FYI A;  3KEI A;  2QS4 A;  1N3X A;  4ZE8 A;  4OXV A;  3LSW A;  2DVC A;  2ZNU A;  4H6D A;  3U1O A;  1ELJ A;  4POW A;  1MY0 A;  3LSF B;  3S4U A;  2IEE A;  5TP9 B;  4F3B A;  4QRZ A;  1FCK A;  1QUK A;  5FTH A;  1MH3 A;  1QUI A;  1H3D A;  3QIM A;  1LBC A;  4KCC A;  1B7Z A;  2QRY A;  5CBR A;  1AH5 A;  4DE8 A;  5AA2 B;  4JWY A;  3HPI A;  3P7I A;  4ZZA A;  2XX9 A;  1B52 A;  1ZKB A;  4MBP A;  4QSC A;  1LCT A;  1Q35 A;  5DVF A;  3PMX A;  4TOZ A;  2F7A A;  2I0C A;  2HFB A;  4N6P A;  3TOD A;  3IR1 A;  4FE8 A;  3USD A;  2O1L A;  4EDP A;  3V83 A;  3HHF A;  5H8H B;  5HPQ A;  3H6U A;  3OD7 A;  1HSJ A;  3FIR A;  1LFG A;  2V3U A;  3IOT A;  1B7U A;  3MUQ A;  3KFM A;  1MQG A;  3WAF A;  3U8Q A;  4I1D A;  3IOU A;  4RK9 A;  3A09 A;  1EZP A;  5I2K A;  3GBA A;  2E0S A;  1GVC A;  3T96 B;  2UVH A;  1NFT A;  2VD3 A;  2AL4 A;  3OO6 A;  3C34 A;  3G3G A;  3ZKK A;  5CM6 A;  1LAX A;  1Y1M A;  1OIB A;  4I8C A;  4ZEF A;  4U1O A;  4ZEK A;  1XC1 A;  1BTJ A;  4HS7 A;  3T9V A;  3MAM A;  3G7W A;  1I6Q A;  3O6H A;  3RTW B;  1A54 A;  3C32 A;  1QJM A;  5KDT A;  3FVO A;  4U23 A;  1ZIU A;  3Q27 A;  4F3G A;  3KGC A;  3FVG A;  4XKR A;  2ALU A;  4RNS A;  1YPN A;  4I62 A;  3U94 A;  3LBS A;  2OWS A;  4YZZ A;  3C33 A;  2GHB A;  1B9J A;  2XXQ A;  2ZNS A;  4IGR A;  4NE4 A;  4UA8 A;  5F1Q A;  4FAT A;  1SI1 A;  4NF8 A;  1ZU0 A;  1MQJ A;  5FHO A;  3VVF A;  3VLU A;  1SVX B;  4BDN A;  3UIF A;  5DVI A;  2A5S A;  4OYV A;  1Y4T A;  4R72 A;  4IO4 A;  1N7W A;  1B6H A;  1OQG A;  3RN8 A;  4XKQ A;  1FQF A;  2QJE A;  1LB9 A;  2DWA A;  4GFR A;  1YTV A;  2Z23 A;  5B7D A;  3PD9 A;  1IQ7 A;  1Q1K A;  3RQT A;  3TAJ A;  4G8N A;  1Y3N A;  2X26 A;  1A55 A;  1B51 A;  2XXU A;  4O3C A;  2QS1 A;  1PB9 A;  4OMB A;  3IAZ A;  3GBB A;  3V8X B;  2M8C A;  1B2H A;  1SQY A;  4OHN A;  1M5F A;  1QVS A;  4R2B A;  1GR2 A;  5CMM A;  2DP8 A;  2DE3 A;  1POY 1;  3TCG A;  2I48 A;  1UQW A;  1P1U A;  4ZDM A;  2V84 A;  1JVX A;  1ZLQ A;  3O28 A;  4HW8 A;  4Q0C A;  1SDX A;  3IB0 A;  2B65 A;  1OQH A;  5I57 B;  5B70 A;  3VXB A;  1MH4 A;  3OSQ A;  5AA4 A;  3THI A;  5H8F B;  2AYS A;  2Z22 A;  4QSD A;  4BDL A;  5K2Y A;  5JTY A;  5AA3 A;  2REG A;  3FVN A;  5F7V A;  3EHS A;  1MXW A;  2H4I A;  3UN6 A;  5KCJ A;  3CFZ A;  4QSE A;  5I84 A;  1FW0 A;  4R73 A;  3RGY A;  1DTG A;  3OO7 A;  3CI8 A;  2P1S A;  1RYX A;  2VD2 A;  4E0W A;  3GZG A;  4RXL A;  4H0W A;  3KG2 A;  4R6H A;  3HV1 A;  5TPA B;  1N0T A;  2WKY A;  4K3F A;  3T9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...