5ICTA

Crystal structure of the drosophila glur1a ligand binding domain y792t mutant complex with glutamate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
266
structure length
266
Chain Sequence
GSYDRNHTYIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKGTPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTTDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 1
publication title Novel Functional Properties of Drosophila CNS Glutamate Receptors.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Membrane protein
total genus 85
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2016-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5ictA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5ictA02
2QS3A 3ZSFA 4EF1A 3JZJA 4L17A 5H8SA 3KN8A 3V89B 5CMKA 1DPPA 5I2KB 3GXAA 4LZ7A 4RJZA 3C33A 3IB0A 1MY0A 1H3DA 3SEUA 2NWJA 5H8HB 4EF2A 4LATA 3B6QA 3USDA 2DE4A 4MBPA 4N07A 4UACA 2PYYA 4RY1A 1A8EA 2RC9A 4RYAA 1QJMA 3U93A 4RXLA 4IO7A 2RC8A 3CFXA 3IOTA 1B0HA 4FEBA 4HCYA 3VDFA 1IUDA 5DT6A 4H0WA 1ZTYA 4EQBA 1NNFA 4ZZAA 3TYHA 4ONYA 4LONB 4GL0A 1DPEA 4POXA 4ECFA 1CB6A 2DE3A 3RUMA 5DEXA 4GD5A 4OESA 2VGQA 3GZGA 4RPNA 4BDQA 2H99A 2QS4A 2V3QA 2XD2A 2RKMA 4YKPA 3IL1B 4KPTA 3S9EA 5KCJA 5JK4A 5H8QB 1MPCA 3FV2A 1B0LA 2QS1A 1POTA 4IY6A 2XXPA 4C1TA 2O7UA 3S4UA 4P11A 3WAFA 1LFGA 4KCCA 1LAGE 3MVXA 4G68B 5CI5A 4NF4A 3LSWA 2R71A 3BFTA 2F78A 4ESWA 4PP0A 4H65A 2ONSA 2B3BA 1B3GA 1MY2A 1SI1A 4GF8A 5EHMA 3DM0A 1YAEA 5H8HA 1A99A 2YLNA 5FHOA 3TQWA 2Y7PA 4F39A 1MQHA 3WAEA 2OBGA 5ICQA 2UVIA 3FJGA 3HCQA 1EZ9A 1MM6A 3OO6A 3CRBA 3OOAA 1B3EA 2NUVA 3O9PA 4FORA 4PE5B 2QSXA 3TDJA 3UIFA 3B6TA 1AOVA 3QIMA 4FATA 5AA2A 1PB7A 1P1WA 2B65A 3W15C 2DSFA 4KI0E 3SEXA 1US5A 4IO3A 1LSTA 2ZNUA 3FJMA 5A5XA 4XIGQ 3Q27A 2B3FA 1US4A 4FEDA 3IOWA 1Y20A 1F9BA 2F6PA 4OFOA 3VXBA 4ELOA 4Q0CA 5I2NB 3V8XB 2FYIA 4R73A 2R6GE 3H6WA 4E0WA 1Y3PA 3T9UA 1B3FA 4AB5A 3PUVE 3PUWE 1EZOA 3SEWA 3FVKA 1SYIA 3QXMA 3K2DA 2PBWA 4F29A 2PMSA 2IEEA 3U92A 4EQ7A 2XXXA 3G3HA 5DVIA 4YZZA 1P1UA 3ZS6A 1SVXB 1Y4TA 3TEPA 1B4HA 3CSGA 2F7AA 3VVDA 3GBBA 1T0KA 4K3FA 1B46A 5ICTA 2F6GA 4C0RA 3THIA 1B1XA 1N7XA 1JW4A 4KQPA 5FHNA 4U4XA 3PPPA 2Z22A 4PQJA 1FQBA 3H4ZA 5JTYB 1Q35A 2I3VA 4R6YA 2ZXTA 2RINA 2THIA 4YMBA 2PVUA 3O97A 1R1NA 4DIGA 1B32A 3HN0A 4EDPA 2ESNA 3JYRA 2OZZA 4OETA 4H67A 3RN8A 5DVFA 4QSCA 1MY4A 4JSDA 2PT2A 2DWIA 4FECA 1S9TA 1WODA 3RTFB 2UVHA 1R6ZA 4ELQA 2DYXA 3O28A 4DCYA 3SKPA 3O6GA 3E13X 1DSNA 5I84A 1PBQA 4F3PA 3Q28A 1BTJA 2XXWA 1LBBA 4RK9A 1NH7A 4NMYA 4OWDA 1B5IA 1TFAA 3W9VA 4ZEDA 1YPNA 4IB2A 4OERA 4JXIA 4YMAA 2DWHA 4NF5A 1QULA 5DTBA 1OVBA 2GRVA 4LUBA 3TTRA 1IITA 2Y7RA 3K00A 4YU0A 1N3WA 1PDAA 2NVUB 3M3LA 1NMUA 2WKYA 4JWOA 2R9JA 3MP1A 4EXKA 2P2AA 5AA4A 3OO7A 3H7MA 2ANJA 5B70A 2X26A 2VD2A 1H76A 3IOUA 2D21A 4KYEA 3HPIA 3PPQA 4NF8B 4GL8A 2F36A 4XKRA 3H03A 5J1DA 3FASA 3M3KA 3VFJA 1MXUA 2Q9TA 3CI8A 1SI0A 3IO6A 3MVZA 2OWTA 4I9DA 3FZVA 1B9JA 5TPAB 2VHAA 3CFLA 1M5CA 3IB2A 3OSRA 3U94A 4GOTA 3KN3A 3BKIB 5EHSA 2QL3A 1TXFA 3PPOA 4YKKA 2QMXA 5I58A 1UIUA 3K6VA 2VP1A 2I4BA 1Y1ZA 4H5FA 4RPOA 3CVGA 1MQDA 3TKDA 2YJPA 5IKBA 3PMXA 5ISUA 1AMFA 1LAXA 1Z7ME 3TFLA 2Z8FA 1URGA 5AE4A 5KZTA 1JEVA 3RTWB 4I62A 2Y7IA 2LAOA 5F1QA 4H6DA 3VXCA 4OMBA 4DCXA 4QFNA 4F3GA 4Q8RA 1SW4A 3EPEA 1D4NA 3TTMA 3PU5A 3O29A 5I56B 1B51A 3FD3A 4FJPA 3PUYE 1MQJA 1CE2A 2XXTA 1ZBMA 5L9MA 1OMPA 3T22A 1JVYA 1GTKA 1XOCA 1ANFA 4GWOA 4R75A 4H8IA 2ZNSA 3I5OA 2QRYA 1P99A 3RPWA 3C32A 5I59A 4NF4B 4R6KA 1IXCA 5TPAA 3K01A 4PFUA 2I58A 4F3BA 1VFEA 1ELJA 1DTGA 3KJTA 2HAVA 5EYFA 3HO7A 3MWBA 3B7DA 1MS7A 3E4RA 4BLAA 4FAJA 3G3GA 2G29A 2ZYOA 1ZIUA 1II5A 4RNSA 5CMBA 3SESA 1FQEA 1M5FA 4YKIA 2F97A 2O51A 2QMWA 1Z7NE 3UGWA 3QSLA 2XX7A 1QKBA 2FNCA 2ZMBA 2D3IA 4H5GA 1B40A 2E0SA 4NWCA 4F1VA 4PFWA 4F1UA 3H6UA 5AA2B 3LUYA 1A54A 3MZ1A 1H44A 2ZYMA 4OTEA 3HHFA 4TOZA 4MF3A 3DELB 5A5XB 5I56A 1FTMA 3HSTA 2ONRA 3UA8A 1UTBA 1MXYA 4KD5A 2HQ0A 2QJEA 2XXRA 3P7IA 3QAXA 1ATGA 5I57A 3S9LC 2ZYKA 3BBRA 3QK6A 2ABHA 4WEPA 1LB9A 2A5TA 2HZLA 4F3SA 4EQ9A 3VE1B 3DLNA 3MPLA 4U2RA 4U22A 2DVZA 4TLLB 1Y3NA 4NEDA 2F34A 2VD3A 2XD3A 3G3IA 3MVWA 1O7TA 3TQLA 4IO5A 2O1MA 3U1OA 3VVEA 3MP6A 4U23A 1UTHA 1B05A 3QUJA 4YAHX 3M8UA 4LZ5A 3G3FA 3A3UA 3MZBA 3KN7A 2AIXA 3H6VA 3L6GA 1TT1A 3KGCA 5HM4B 3K4UA 2XXVA 3VLUA 4G4PA 3T96B 3JV9A 3ZKKA 1ZMGA 3IX1A 4O3BA 5BUUA 3R26A 3UORA 2XX9A 2Y7WA 4ZS9A 1AH5A 3T9XB 2F35A 4NF6A 1MPBA 3FV1A 3MC2A 1Y1MA 3IAZA 1UIVA 3EHUA 4ZDMA 4AQ4A 1LCFA 3VVFA 4KHZE 3F11A 1M5BA 1KWHA 3K1MA 2CMOA 1MXXA 4M1VA 1O63A 5AA1A 1ZU0A 3RGYA 2ALUA 4O3AA 3G3JA 1LFIA 3T9VA 1H43A 2Q2AA 5H8NB 3TCGA 4WKMA 2H25A 4BDRA 2AL4A 3DP4A 1JNFA 2P0SA 1SW2A 4G8HA 3K6WA 5BWJA 1H45A 4QFKA 3OSQA 4BDLA 3N6TA 3N5LA 2X7QA 3UK4A 2I49A 4RA1A 5CRYA 3KBRA 1TFDA 3UN6A 1B6HA 4BDMA 4NF5B 3OD7A 3E3KA 1RKMA 2XXYA 4ND9A 3CFZA 2V3TA 1D3KA 4EXLA 2XXIA 2GHAA 4DXBA 2NOOA 1IIWA 1USYE 5AA4B 3S9NC 2D5WA 1JW5A 3PD8A 3M3FA 2O7IA 1I6AA 1SBPA 2HZKA 3RT8A 1R9LA 1PEBA 3K02A 1EZPA 3N26A 3OEMA 2I0CA 2UYEA 4PFTA 4LA9A 3K6XA 2UVJA 3KG2A 5FTHA 3QYTA 4X48A 3MVYA 4QFPA 1I6BA 4KR5A 1BLFA 4TQUQ 1NH8A 1IZ1A 4ZEKA 1FTOA 4KYDA 4DXUA 4C1UA 4NWDA 2V25A 5AA3A 5H8NA 4IGRA 1PB9A 3OMBA 4GIZA 2Y7KA 4H1XA 5I58B 4MLQA 2RCBA 3MUQA 3PPRA 1VR5A 4OYVA 4YB6A 4QF9A 4KYSA 4YICA 1L5TA 2F7BA 3PUXE 1QVSA 2A5SA 4XKQA 1JVXA 5DVJA 2F5XA 5K2XA 1MQGA 4U1ZA 1USYH 5CMCA 4WEDA 3FXUA 1OLAA 4QSDA 3T66A 1DOTA 2P1SA 3MJNA 1OQHA 2V93A 1DMBA 1N3XA 3MAMA 2H98A 1IEJA 4Q30B 2HXWA 5AA2D 3DP6A 4LQ5A 4ZE8A 4ZE9A 3E9XA 1N84A 1MXVA 2I3WA 1XHYA 5LOMA 3ODBA 1MY1A 3FIRA 3TELA 5JEIA 1GV8A 2Z8EA 2Z8DA 5I59B 5L9OA 5M2VA 2HAUA 4MH5A 5ITPA 4XXUA 3FXRA 2UYFA 5L9SA 1RYOA 4F19A 2Z23A 1FTKA 1OLCA 4FE8A 4UA8A 3SDFA 1N76A 1NL5A 2H5YA 4R2BA 1MQIA 4ELRA 4G8NA 1MG1A 2Q8JA 1QW0A 2VOZA 2O84X 1JW1A 2O1LA 1DTZA 1B7ZA 1XS5A 3ECRA 3FVOA 1SD3A 2OCUA 3LSLA 2F7CA 4R72A 3OXNA 3EHSA 4ISUA 2ONKE 3EF7A 1MH4A 2DVCA 3KOTA 1P1OA 1TWYA 1AL3A 2GFEA 3LSFB 3O6HA 3V5AA 3GBAA 4YKJA 4HCWA 1PB8A 3CG1A 3U8QA 2PT1A 2X7PA 3MBPA 1LAHE 1LB8A 4R9GA 3IR1A 1B52A 1D9YA 5TP9A 2I0BA 4GQOA 4X1DA 1UTBB 1P1NA 4HW8A 2Q88A 5H8FA 5I57B 1PC3A 3PPNA 3Q25A 3FGSA 4FIMA 1NKXA 3W9WA 2A5TB 5F7VA 1Y4CA 2H9BA 4F18A 5CMMA 3LSXA 1I6QA 4BDOA 4BDNA 3OEKA 1MRPA 4QRZA 2OJTA 1RYXA 1MY3A 3SEVA 4R2FA 2DXYA 1MXZA 3QUFA 1GR2A 2YPNA 1M5DA 2AL5A 1UTHB 4U1OA 5CBRA 3FJ7A 3A09A 2I4CA 3TPAA 3KSJA 3K1PA 3IO4A 5KDTA 4OFLA 3EN3A 1MDQA 2Y84A 2F8DA 2V84A 1ZKBA 4N13A 4G2ZA 4F31B 5CBSA 3G3KA 1B7UA 2DXRA 4MLVA 1N0TA 3HHGA 3EQ1A 1S7YA 1LLSA 4QHQA 1MPDA 4JWYA 3RNNA 3C31A 4NF6B 3MW0A 4ZEBA 1IXIA 1IQ7A 1NNPA 1N7WA 3L6HA 3AXFA 3HV1A 3UP9A 4OZ9A 3TTKA 2OWSA 3C4MA 4IO2A 3K1NA 3H3GA 3R6UA 1QKAA 1A40A 4DLDA 1FTLA 3O2AA 1B3LA 3D4GA 4R9FA 4R6HA 1Y9UA 1HSLA 3MQ9A 4JDFA 4KCDA 4PETA 1FTJA 4WXJA 1M5EA 3T93B 3IOVA 4YB5A 5DYHA 4GXAA 1BP5A 4OQOA 3N6UA 4QFOA 1FQAA 3DP8A 4F2QA 2RC7A 2DP8A 4O3CA 2H4IA 5I2KA 2NXOA 2GHBA 1BIYA 1LAFE 1FCKA 3PGFA 2REGA 3K6UA 1B58A 2RCAA 4GXSB 5CC2A 2HEUA 1WDNA 3PUZE 4N6PA 2ZNTA 3CR9A 2OLBA 4PFYA 3CSBA 3IORA 1XVYA 1MXWA 3VLVA 4P0IA 1SQYA 3IJOB 3GLBA 4OHNA 3MP8A 4G68C 4XKPA 1YTVA 3TTNA 2I6EA 2KLFA 1SYHA 3H06B 4YB7A 1D9VA 4KFQA 1OIBA 1GVCA 4GFRA 1B1HA 1JETA 1HSEA 4IO4A 3V83A 4ZZEA 1Q1KA 2DS9A 3R7XA 4THIA 1N04A 3MPKA 1URSA 1SDXA 5H8QA 1EH3A 1B4ZA 1URDA 1MM7A 4I1DA 3IK6B 2XXUA 1BKAA 1J1NA 1LBCA 4I8CA 1ZJLA 1VE4A 1VFDA 1ZLQA 4G8MA 2ZYNA 2CZLA 3TCHA 3VV5A 1LGBC 4LP2B 4JSOA 4G68A 1LCTA 2UVGA 4U21A 2REJA 1LFHA 2G93A 3S2VA 2M8CA 3ZKLA 2DWJA 5ITOA 5ELVA 1B5HA 1FQFA 4G77A 2O68A 3TAJA 3FATA 4GRKA 1B2HA 4QSEA 4IO6A 4U4SA 2W7YA 4HTGA 3FVNA 1XT8A 4RK2A 3TTLA 1IXGA 3OO9A 4AB6A 2HCAA 1QUJA 3ONMA 3C9HA 4H8JA 2DE2A 3SETA 3H6TA 5IAIA 4QFLA 5FHMA 3KZGA 3FXQA 3LC8A 4XTCQ 1XVXA 3D4CA 4HS7A 4Z0IA 4ZECA 3SEYA 5K2YA 4XKNA 3KEIA 3PD9A 2DWAA 3PV0E 2FA7A 4M4GA 2Q2CA 3EHTA 3O6IA 3O66A 4LZ8A 5I2NA 1A7LA 4TLMB 2V3UA 4P0GA 4IGTA 3KSXA 1OVTA 4DDDA 2QS2A 2DOJA 3C34A 3FVGA 2BJJX 4GLIA 2O6AA 1PBPA 1FQDA 4OEUA 3ILTB 3OO8A 2UXAA 2IA4A 1A8FA 3I6VA 2XX8A 1NNTA 2PX1A 3BFUA 3G7WA 2XHDA 5B7DA 3TODA 5L8DA 2XXQA 4OVJA 3C36A 4JBZA 4ELPA 3Q29A 1AIVA 4IY5A 3OENA 4GVOA 1JQFA 1NFTA 4DZ1A 1QUKA 5FTIA 4OENA 4JWXA 1UQWA 4Q5TA 2Q89A 3VLWA 1A55A 5TP9B 1S50A 4OXVA 3IB1A 1FW0A 5JTYA 3LR1A 5H8FB 5CM6A 3LBSA 3RT6B 3K0VA 4X9TA 2O69A 3Q26A 1XC1A 3B6WA 4F22A 4R74A 2GH9A 3ILUB 4F2OA 1JEUA 1B3HA 3C35A 1EU8A 1MDP1 4OEVA 3SERA 3I3VA 3PMWA 4F1YA 2RF1A 3S9MC 2OK2A 4POWA 1YCJA 3PMVA 1GGGA 1O64A 2E1SA 5KDTB 1SW1A 2DQVA 4NTLA 1B7HA 2I48A 1HSJA 1SW5A 3N94A 3KJ7A 3FUZA 5HPQA 1FQCA 4EUOA 4ZEFA 4LVQA 3RLFE 2HFBA 1IXHA 1NNKA 1POY1 4E0XA 2XXHA 3U72A 1R9QA 3KOSA 3T9HB 3TZAA 4MFIA 5HBCA 4Z7EA 5DEXB 1VSOA 1WVJA 4NE4A 5TU0A 1QUIA 3KFMA 4OFJA 4X1BA 1B5JA 3TCFA 1I69A 3CG3A 4ZEIA 4DE8A 4NF8A 3RQTA 3MZ9A 3CIJA 3IJXB 4LQ2A 5KCJB 1MH3A 2AYSA 1P1QA 2QPQA 3OELA 3TUSA 4JB7A 3A3CA 1OQGA 4DXCA 1Y3QA 4ESXA 3RY3A 3TMGA
chains in the Genus database with same CATH superfamily
2QS3A 3ZSFA 4EF1A 3JZJA 4L17A 5H8SA 4XEQA 3KN8A 3V89B 5CMKA 1DPPA 5I2KB 3GXAA 4LZ7A 4RJZA 3C33A 3IB0A 2B4MA 1MY0A 1H3DA 3SEUA 2NWJA 5H8HB 4EF2A 4LATA 3B6QA 3USDA 2DE4A 4MBPA 4N07A 4UACA 2PYYA 4RY1A 2R8TA 1A8EA 2RC9A 4RYAA 5ET8A 1QJMA 3U93A 4RXLA 4IO7A 2RC8A 2CZIA 1FPEA 3CFXA 3IOTA 2JJKA 1B0HA 4FEBA 4HCYA 3VDFA 4I3EA 1IUDA 5DT6A 4H0WA 1ZTYA 4MJOA 4EQBA 1NNFA 4ZZAA 3TYHA 4ONYA 4LONB 4GL0A 1DPEA 4POXA 1DCUA 1FPJA 4ECFA 1CB6A 2DE3A 1QGXA 4PGPA 3RUMA 5DEXA 4GD5A 4OESA 2VGQA 2FHYA 3GZGA 4RPNA 4BDQA 2H99A 2QS4A 2V3QA 2XD2A 2RKMA 4YKPA 3IL1B 4KPTA 3S9EA 5KCJA 5F24A 3PTYA 5JK4A 5H8QB 1MPCA 3FV2A 4OVQA 4PGNA 4N6DA 1IMCA 1B0LA 4GBVA 2QS1A 1POTA 4IY6A 2XXPA 4C1TA 1FBFA 5ESYA 2O7UA 1FSAA 3RYDA 3S4UA 4P11A 3WAFA 3KC0A 1LFGA 4KCCA 2HXRA 1LAGE 3MVXA 4G68B 5CI5A 4NF4A 1LEVA 3LSWA 1NV7A 3T1BA 2R71A 2L5VA 2F78A 3BFTA 4ESWA 4PP0A 4H65A 2ONSA 2B3BA 1B3GA 1MY2A 1SI1A 4GF8A 5EHMA 3DM0A 1YAEA 5H8HA 1A99A 2YLNA 4I3YA 5FHOA 1FPIA 3TQWA 2Y7PA 2KR0A 4F39A 1MQHA 3WAEA 2OBGA 5ICQA 4N8YA 2UVIA 3FJGA 3HCQA 1EZ9A 1MM6A 3OO6A 3CRBA 3OOAA 5EQ8A 1B3EA 2NUVA 3O9PA 4FORA 4PE5B 2QSXA 3TDJA 3UIFA 3B6TA 1AOVA 5I7IA 3QIMA 4FATA 5AA2A 1PB7A 1P1WA 2B65A 3W15C 2DSFA 4KI0E 3SEXA 1US5A 2WYKA 4IO3A 1LSTA 2ZNUA 2VPOA 3FJMA 3LV0A 5A5XA 4XIGQ 3Q27A 1YYZA 2B3FA 1US4A 4FEDA 3IOWA 1Y20A 1F9BA 2HPGA 2F6PA 4OFOA 3VXBA 4ELOA 4Q0CA 5I2NB 3V8XB 2FYIA 3FBPA 4R73A 2R6GE 3H6WA 4E0WA 1Y3PA 3T9UA 1B3FA 4O8MA 5DW8A 4AB5A 3PUVE 3PUWE 1EZOA 3SEWA 3FVKA 1SYIA 1DBZA 1K9YA 3QXMA 2PCRA 3K2DA 2PBWA 4F29A 2PMSA 2IEEA 3U92A 4EQ7A 2XXXA 4PAIA 3G3HA 5DVIA 3MYUA 4YZZA 1P1UA 3ZS6A 1SVXB 1Y4TA 3TEPA 1B4HA 3CSGA 2F7AA 3VVDA 3GBBA 1T0KA 4K3FA 1B46A 5ICTA 2F6GA 3B8BA 3THIA 4C0RA 1B1XA 1N7XA 1JW4A 4KQPA 5FHNA 4U4XA 4N17A 3PPPA 2Z22A 4PQJA 1FQBA 2HHMA 3H4ZA 5JTYB 1Q35A 2I3VA 4R6YA 2ZXTA 2RINA 2THIA 4YMBA 2PVUA 3O97A 1R1NA 4DIGA 4PAFA 1B32A 1FBPA 3HN0A 4EDPA 2ESNA 2PFZA 3JYRA 2OZZA 4OETA 4H67A 3RN8A 5DVFA 4QSCA 1MY4A 1KZ8A 4JSDA 2PT2A 2DWIA 4FECA 4X8RA 4GX6A 1S9TA 1WODA 3RTFB 2UVHA 1R6ZA 4ELQA 2DYXA 3O28A 4DCYA 3SKPA 3O6GA 3E13X 1DSNA 5I84A 1PBQA 4F3PA 3Q28A 1BTJA 2VPNA 2XXWA 1LBBA 4RK9A 4P3LA 1NH7A 4NMYA 4OWDA 1B5IA 1TFAA 3W9VA 4ZEDA 1YPNA 4IB2A 4OERA 4JXIA 4YMAA 2DWHA 1IMEA 4NF5A 1QULA 5DTBA 1OVBA 2GRVA 4QBAA 4LUBA 2CEYA 3TTRA 1IITA 2Y7RA 3K00A 4YU0A 1N3WA 1PDAA 2NVUB 3M3LA 1NMUA 2WKYA 4JWOA 2R9JA 3MP1A 4EXKA 2P2AA 5AA4A 3OO7A 3H7MA 2ANJA 5B70A 2X26A 2VD2A 2WX9A 1H76A 3IOUA 4GBWA 2D21A 4NGUA 4KYEA 3HPIA 4GX3A 3PPQA 4NF8B 4GL8A 2F36A 4XKRA 2FIEA 1KA0A 3H03A 1FRPA 5J1DA 3FASA 3M3KA 4P47A 3VFJA 1MXUA 2Q9TA 4MIJA 3CI8A 1SI0A 3IO6A 3MVZA 2OWTA 4I9DA 3FZVA 1B9JA 5TPAB 2VHAA 3CFLA 1M5CA 3IB2A 3OSRA 3U94A 4GOTA 3KN3A 3BKIB 5EHSA 2QL3A 4HE1A 1TXFA 3PPOA 4YKKA 2QMXA 5I58A 1UIUA 2CZHA 3K6VA 2VP1A 2I4BA 1Y1ZA 3E78A 4H5FA 4RPOA 3CVGA 1MQDA 1NUWA 3TKDA 2YJPA 5IKBA 3PMXA 5ISUA 1AMFA 1LAXA 1Z7ME 3TFLA 2Z8FA 1URGA 4N91A 5AE4A 5KZTA 1JEVA 3RTWB 4I62A 2Y7IA 2LAOA 5F1QA 4H6DA 3VXCA 4OMBA 4DCXA 4QFNA 5EQ7A 4F3GA 2P3NA 2ZZXA 1DK4A 4Q8RA 1SW4A 3EPEA 1D4NA 3TTMA 3PU5A 1AWBA 1LBWA 5IZ1A 3O29A 5I56B 1B51A 5ET5A 1RDYA 3FD3A 4FJPA 3PUYE 1MQJA 1CE2A 3B50A 2XXTA 1FPLA 1YZ0A 1ZBMA 5L9MA 1OMPA 3T22A 1JVYA 1GTKA 1IMDA 1XOCA 1ANFA 4GWOA 4R75A 4H8IA 2ZNSA 3I5OA 2QRYA 1P99A 3RPWA 3C32A 5I59A 4NHBA 4NF4B 4R6KA 1IXCA 5TPAA 3K01A 4PFUA 2I58A 4F3BA 1VFEA 1ELJA 1DTGA 3KJTA 2HAVA 5EYFA 3HO7A 3MWBA 3B7DA 1MS7A 3E4RA 4BLAA 4FAJA 3NOHA 3G3GA 2G29A 2ZYOA 1ZIUA 1II5A 2Y5LA 4O7IA 4RNSA 5CMBA 3SESA 1FQEA 1M5FA 4YKIA 2F97A 2O51A 2QMWA 1Z7NE 3UGWA 4N4UA 3QSLA 4AS4A 2XX7A 1QKBA 2FNCA 3A29A 2ZMBA 4MAGA 2D3IA 1KA1A 4H5GA 1B40A 2E0SA 3KBZA 4P9KA 4NWCA 4PFRA 4F1VA 4PFWA 4F1UA 3H6UA 5AA2B 2OX3A 4DI4B 3LUYA 3MZ1A 1A54A 2XWKA 1H44A 2ZYMA 4OTEA 4N15A 3HHFA 4TOZA 4MF3A 3DELB 3MSTA 5A5XB 5I56A 2QVRA 1FTMA 1VDWA 3HSTA 2ONRA 3UA8A 4XFEA 1UTBA 1MXYA 4KD5A 2HQ0A 2QJEA 2XXRA 3P7IA 3QAXA 1ATGA 5I57A 3S9LC 2ZYKA 3BBRA 3QK6A 2ABHA 4WEPA 1LB9A 2A5TA 2HZLA 4F3SA 4EQ9A 3VE1B 3DLNA 3MPLA 4U2RA 4PE3A 4U22A 2DVZA 4TLLB 2XWVA 1Y3NA 4NEDA 4PF6A 2F34A 2VD3A 1LBYA 2XD3A 3G3IA 3MVWA 1O7TA 3TQLA 4IO5A 2O1MA 4H46A 3U1OA 3VVEA 3MP6A 4U23A 1UTHA 1B05A 3QUJA 4YAHX 3M8UA 4LZ5A 3G3FA 3A3UA 3MZBA 1G0IA 3KN7A 2AIXA 3H6VA 3L6GA 1TT1A 3CHGA 3KGCA 5HM4B 3K4UA 2XXVA 3VLUA 4G4PA 3T96B 3JV9A 2QVUA 3ZKKA 1ZMGA 3BIHA 3IX1A 4O3BA 5BUUA 3R26A 3UORA 2XX9A 2Y7WA 4ZS9A 1AH5A 4GX4A 3T9XB 2F35A 4NF6A 1MPBA 3FV1A 3MC2A 1Y1MA 3IAZA 1UIVA 3FXBA 3EHUA 4ZDMA 2P3VA 4AQ4A 4MHFA 1LCFA 3VVFA 4KHZE 3F11A 1M5BA 1KWHA 3K1MA 4O7MA 2CMOA 1MXXA 4M1VA 1O63A 5AA1A 1YXIA 4PAKA 1ZU0A 4H45A 3RGYA 2ALUA 4O3AA 3G3JA 4N81A 1LFIA 3T9VA 1H43A 2Q2AA 5H8NB 3TCGA 4WKMA 2H25A 4BDRA 5T3JA 2AL4A 2WYPA 3DP4A 1JNFA 2P0SA 3IFAA 1SW2A 4G8HA 3K6WA 5BWJA 1H45A 4QFKA 3OSQA 4BDLA 3N6TA 3N5LA 2X7QA 3UK4A 2I49A 4RA1A 2QVVA 5CRYA 3KBRA 2Y5KA 1TFDA 2XWOA 2CEXA 3UN6A 1B6HA 4BDMA 4NF5B 3OD7A 4GWZA 3E3KA 1RKMA 2XXYA 4ND9A 4DI3D 3CFZA 2V3TA 1D3KA 4EXLA 2XXIA 2GHAA 4DXBA 2NOOA 1IIWA 1USYE 5AA4B 3S9NC 2D5WA 1JW5A 3PD8A 3M3FA 2O7IA 1I6AA 1SBPA 2HZKA 4P1LA 3RT8A 3T0JA 1R9LA 1PEBA 3K02A 3EKIA 4IR8A 1EZPA 3N26A 3OEMA 2I0CA 2UYEA 4PFTA 4LA9A 4GWUA 4NAPA 3K6XA 2UVJA 3KG2A 4MNPA 5FTHA 3QYTA 4X48A 3MVYA 4PC9A 4NF0A 4QFPA 1I6BA 4KR5A 1BLFA 4TQUQ 4GWWA 4JVCA 1NH8A 1IZ1A 4ZEKA 1FTOA 4KYDA 4DXUA 4C1UA 2BJIA 4NWDA 2V25A 5AA3A 5H8NA 4IGRA 1PB9A 3OMBA 4GIZA 1NUYA 2Y7KA 5EYHA 4H1XA 5I58B 4MLQA 1Q9DA 2RCBA 3MUQA 3PPRA 1VR5A 4OYVA 4YB6A 4QF9A 4KYSA 4YICA 3U65A 1L5TA 2KQZA 2F7BA 3PUXE 1QVSA 2A5SA 4XKQA 1JVXA 5DVJA 2F5XA 5K2XA 1MQGA 4U1ZA 5IM2A 1USYH 5CMCA 4WEDA 3FXUA 4NQ8A 1OLAA 4QSDA 3T66A 1DOTA 2P1SA 2F3DA 3MJNA 1OQHA 2V93A 1DMBA 1N3XA 3MAMA 2PFYA 2H98A 3GYYA 1IEJA 4Q30B 2HXWA 5AA2D 1NV4A 3DP6A 4LQ5A 4ZE8A 3KC1A 4MNIA 4ZE9A 3E9XA 1N84A 1MXVA 2I3WA 1XHYA 1IMBA 1FPBA 4O94A 4GWSA 5LOMA 1NV2A 3ODBA 2XXKA 1MY1A 3FIRA 1FPDA 3TELA 5JEIA 1GV8A 2Z8EA 2Z8DA 5I59B 5L9OA 5M2VA 2HAUA 3QMFA 5LTCA 4MH5A 5ITPA 4XXUA 3FXRA 2UYFA 5L9SA 1RYOA 4F19A 2WBBA 5EQ9A 2Q74A 2Z23A 3IFCA 1FTKA 1OLCA 4FE8A 5A5LA 4UA8A 3SDFA 4OA4A 5EQAA 1N76A 1NL5A 2H5YA 4R2BA 5ET7A 1MQIA 4ELRA 4G8NA 1MG1A 2Q8JA 1QW0A 2VOZA 2O84X 1JW1A 5IZ3A 2O1LA 1NV5A 1LBZA 1DTZA 1B7ZA 1XS5A 3ECRA 3FVOA 1SD3A 2OCUA 3LSLA 2F7CA 4R72A 3OXNA 3EHSA 4ISUA 2ONKE 3EF7A 1MH4A 2DVCA 2Q8MA 4OVSA 3KOTA 1P1OA 1TWYA 1JP4A 1FPGA 1AL3A 2GFEA 3LSFB 3O6HA 3V5AA 3GBAA 4YKJA 4X04A 4HCWA 1PB8A 3CG1A 3U8QA 2PT1A 2X7PA 5I5PA 3MBPA 1LAHE 1LB8A 4R9GA 3IR1A 4MX6A 1B52A 1D9YA 2ZZWA 5IGAA 5TP9A 2I0BA 4GQOA 4X1DA 1UTBB 1P1NA 4HW8A 3D1RA 2Q88A 4P56A 5H8FA 5I57B 1PC3A 3PPNA 3Q25A 3FGSA 4FIMA 1NKXA 2A5TB 5F7VA 4PDDA 1Y4CA 3W9WA 2H9BA 4F18A 5CMMA 3LSXA 1I6QA 3ROJA 1D9QA 4BDOA 4BDNA 3OEKA 1MRPA 4QRZA 2OJTA 1RYXA 1MY3A 3SEVA 4R2FA 1NV6A 2DXYA 1MXZA 3QUFA 1GR2A 4MEVA 2YPNA 4HE2A 1M5DA 2AL5A 1UTHB 4U1OA 5CBRA 3RPLA 3FJ7A 3A09A 4NN3A 2I4CA 3TPAA 1RDZA 3KSJA 4PDHA 3K1PA 3IO4A 1FBHA 5KDTA 1IMFA 1NI9A 4OFLA 3EN3A 1MDQA 2Y84A 2XWIA 2F8DA 2V84A 1ZKBA 4N13A 4G2ZA 2B4LA 4F31B 5CBSA 2QFLA 3G3KA 1B7UA 2DXRA 4MLVA 1N0TA 3HHGA 3ISPA 3EQ1A 5I3SA 1S7YA 2DDKA 4HXVA 4N6KA 1LLSA 4QHQA 1MPDA 4JWYA 4KXPA 3RNNA 3C31A 4NF6B 4XF5A 3MW0A 4ZEBA 1IXIA 1IQ7A 1NNPA 1N7WA 3L6HA 3AXFA 4MCOA 3HV1A 3UP9A 5ET6A 4OZ9A 3TTKA 2OWSA 3C4MA 4IO2A 3K1NA 3H3GA 3R6UA 1QKAA 1A40A 4DLDA 1FTLA 3O2AA 1B3LA 3D4GA 4R9FA 4R6HA 1Y9UA 1HSLA 1NV1A 3MQ9A 3LUZA 4JDFA 4KCDA 4PETA 1FTJA 4WXJA 1M5EA 3T93B 3IOVA 4YB5A 5DYHA 4GXAA 1BP5A 4OQOA 3N6UA 4QFOA 1FQAA 3DP8A 4F2QA 2RC7A 2DP8A 1SPIA 4O3CA 2H4IA 5I2KA 2NXOA 2GHBA 1BIYA 2WEFA 1LAFE 1FCKA 3PGFA 2REGA 3K6UA 1B58A 2RCAA 4GXSB 5CC2A 2HEUA 1WDNA 3PUZE 4N6PA 2ZNTA 3CR9A 2OLBA 4PFYA 4OVPA 3CSBA 3IORA 1XVYA 1MXWA 3VLVA 4P0IA 1SQYA 3IJOB 3GLBA 4OHNA 3BIGA 3MP8A 4G68C 4MNCA 4GWXA 4XKPA 1YTVA 3TTNA 2I6EA 1NV0A 2KLFA 1SYHA 3H06B 4YB7A 4OANA 1D9VA 4KFQA 1OIBA 1GVCA 4GFRA 1B1HA 1JETA 1HSEA 4IO4A 4JVIA 3V83A 4OVRA 4ZZEA 1EYJA 1Q1KA 4AS5A 1CNQA 2DS9A 3R7XA 4THIA 1FBDA 1N04A 3MPKA 1URSA 1SDXA 5H8QA 1EH3A 1B4ZA 1URDA 1MM7A 4I1DA 3IK6B 2XXUA 1BKAA 1J1NA 1LBCA 4I8CA 1ZJLA 1VE4A 4LN5A 1VFDA 1ZLQA 4G8MA 2ZYNA 2CZLA 3TCHA 3VV5A 1LGBC 4LP2B 4PTKA 4JSOA 4G68A 2F3BA 1LCTA 2UVGA 4HE0A 2GQ1A 1NV3A 4U21A 2REJA 4PF8A 1LFHA 2G93A 3S2VA 2M8CA 1NUZA 3ZKLA 2DWJA 5ITOA 5ELVA 1B5HA 1FQFA 4G77A 2O68A 3TAJA 3FATA 2XA5A 4GRKA 1B2HA 4QSEA 4IO6A 4U4SA 2W7YA 4HTGA 3FVNA 1LBVA 1XT8A 4RK2A 3TTLA 4PCDA 1IXGA 1G0HA 3OO9A 4P1EA 1EYIA 1BK4A 2FVZA 4AB6A 2HCAA 1QUJA 2ZZVA 3ONMA 3C9HA 4H8JA 1RDXA 2DE2A 3SETA 3H6TA 5IAIA 4QFLA 5FHMA 3KZGA 3FXQA 3LC8A 4XTCQ 1XVXA 4OVTA 3D4CA 4HS7A 4Z0IA 4ZECA 3SEYA 5K2YA 4XKNA 3KEIA 3PD9A 3HFUA 2DWAA 3PV0E 2FA7A 4M4GA 1FPFA 2Q2CA 3EHTA 3O6IA 3O66A 4LZ8A 5I2NA 1A7LA 4TLMB 5IZZA 5IZ3B 2V3UA 4P0GA 4IGTA 3KSXA 1OVTA 4DDDA 2QS2A 2DOJA 3C34A 4G61A 3FVGA 2BJJX 4PBHA 4GLIA 2O6AA 1PBPA 3E79A 1FQDA 4OEUA 3ILTB 3OO8A 2UXAA 1FTAA 1XI6A 2IA4A 1A8FA 3I6VA 2XX8A 1NNTA 2PX1A 1FJ9A 3BFUA 3G7WA 2XHDA 5B7DA 3TODA 5L8DA 2XXQA 4PBQA 4OVJA 3C36A 4JBZA 4ELPA 1FJ6A 5FBPA 3Q29A 1AIVA 5J16A 4IY5A 3OENA 4GVOA 1JQFA 1NFTA 4DZ1A 1QUKA 1K9ZA 5FTIA 4OENA 4JWXA 1UQWA 4Q5TA 2Q89A 2MKZA 3VLWA 1A55A 5TP9B 1FBGA 1S50A 4OXVA 3IB1A 1FW0A 5JTYA 2FBPA 3LR1A 5EYGA 5H8FB 5CM6A 3LBSA 3RT6B 3K0VA 4X9TA 2O69A 1FBCA 3Q26A 1XC1A 4I40A 3B6WA 4F22A 4R74A 4FBPA 2GH9A 1FBEA 3ILUB 4F2OA 1JEUA 1B3HA 3C35A 1EU8A 1LBXA 1MDP1 4OEVA 4MMPA 3RPLB 3SERA 5LDZA 3I3VA 3PMWA 4QXDA 4F1YA 2RF1A 3S9MC 4NG7A 2OK2A 4POWA 1YCJA 3PMVA 1GGGA 1O64A 2E1SA 1NUXA 5KDTB 1SW1A 2DQVA 4P8BA 4NTLA 1B7HA 2I48A 1INPA 1HSJA 2CZKA 1EYKA 1SW5A 4UABA 4GWYA 3N94A 3KJ7A 3FUZA 5HPQA 1FQCA 4EUOA 4ZEFA 4LVQA 3RLFE 2HFBA 3SZPA 1IXHA 1NNKA 1POY1 4E0XA 2XXHA 4PFBA 2V4CA 3U72A 1R9QA 3KOSA 3T9HB 3TZAA 4MFIA 5HBCA 4Z7EA 5DEXB 1VSOA 1WVJA 4NE4A 5TU0A 1QUIA 3KFMA 4OFJA 4X1BA 1B5JA 1IMAA 3TCFA 1I69A 3CG3A 4ZEIA 1FPKA 4DE8A 4NF8A 3RQTA 3MZ9A 3CIJA 2OWZA 4N8GA 3IJXB 4LQ2A 5KCJB 1MH3A 2AYSA 2VT5A 1P1QA 2QPQA 4NX1A 4PFIA 3OELA 3TUSA 4JB7A 3A3CA 1OQGA 2FIXA 2WBDA 4DXCA 1Y3QA 4ESXA 3RY3A 3TMGA 4JVDA
chains in the Genus database with same CATH topology
2QS3A 3ZSFA 4EF1A 3JZJA 4L17A 5H8SA 3KN8A 3V89B 5CMKA 1DPPA 5I2KB 3GXAA 4LZ7A 4RJZA 3C33A 3IB0A 1MY0A 1H3DA 3SEUA 2NWJA 5H8HB 4EF2A 4LATA 3B6QA 3USDA 2DE4A 4MBPA 4N07A 4UACA 2PYYA 4RY1A 1A8EA 2RC9A 4RYAA 1QJMA 3U93A 4RXLA 4IO7A 2RC8A 3CFXA 3IOTA 1B0HA 4FEBA 4HCYA 3VDFA 1IUDA 5DT6A 4H0WA 1ZTYA 4EQBA 1NNFA 4ZZAA 3TYHA 4ONYA 4LONB 4GL0A 1DPEA 4POXA 4ECFA 1CB6A 2DE3A 3RUMA 5DEXA 4GD5A 4OESA 2VGQA 3GZGA 4RPNA 4BDQA 2H99A 2QS4A 2V3QA 2XD2A 2RKMA 4YKPA 3IL1B 4KPTA 3S9EA 5KCJA 5JK4A 5H8QB 1MPCA 3FV2A 1B0LA 2QS1A 1POTA 4IY6A 2XXPA 4C1TA 2O7UA 3S4UA 4P11A 3WAFA 1LFGA 4KCCA 1LAGE 3MVXA 4G68B 5CI5A 4NF4A 3LSWA 2R71A 3BFTA 2F78A 4ESWA 4PP0A 4H65A 2ONSA 2B3BA 1B3GA 1MY2A 1SI1A 4GF8A 5EHMA 3DM0A 1YAEA 5H8HA 1A99A 2YLNA 5FHOA 3TQWA 2Y7PA 4F39A 1MQHA 3WAEA 2OBGA 5ICQA 2UVIA 3FJGA 3HCQA 1EZ9A 1MM6A 3OO6A 3CRBA 3OOAA 1B3EA 2NUVA 3O9PA 4FORA 4PE5B 2QSXA 3TDJA 3UIFA 3B6TA 1AOVA 3QIMA 4FATA 5AA2A 1PB7A 1P1WA 2B65A 3W15C 2DSFA 4KI0E 3SEXA 1US5A 4IO3A 1LSTA 2ZNUA 3FJMA 5A5XA 4XIGQ 3Q27A 2B3FA 1US4A 4FEDA 3IOWA 1Y20A 1F9BA 2F6PA 4OFOA 3VXBA 4ELOA 4Q0CA 5I2NB 3V8XB 2FYIA 4R73A 2R6GE 3H6WA 4E0WA 1Y3PA 3T9UA 1B3FA 4AB5A 3PUVE 3PUWE 1EZOA 3SEWA 3FVKA 1SYIA 3QXMA 3K2DA 2PBWA 4F29A 2PMSA 2IEEA 3U92A 4EQ7A 2XXXA 3G3HA 5DVIA 4YZZA 1P1UA 3ZS6A 1SVXB 1Y4TA 3TEPA 1B4HA 3CSGA 2F7AA 3VVDA 3GBBA 1T0KA 4K3FA 1B46A 5ICTA 2F6GA 4C0RA 3THIA 1B1XA 1N7XA 1JW4A 4KQPA 5FHNA 4U4XA 3PPPA 2Z22A 4PQJA 1FQBA 3H4ZA 5JTYB 1Q35A 2I3VA 4R6YA 2ZXTA 2RINA 2THIA 4YMBA 2PVUA 3O97A 1R1NA 4DIGA 1B32A 3HN0A 4EDPA 2ESNA 3JYRA 2OZZA 4OETA 4H67A 3RN8A 5DVFA 4QSCA 1MY4A 4JSDA 2PT2A 2DWIA 4FECA 1S9TA 1WODA 3RTFB 2UVHA 1R6ZA 4ELQA 2DYXA 3O28A 4DCYA 3SKPA 3O6GA 3E13X 1DSNA 5I84A 1PBQA 4F3PA 3Q28A 1BTJA 2XXWA 1LBBA 4RK9A 1NH7A 4NMYA 4OWDA 1B5IA 1TFAA 3W9VA 4ZEDA 1YPNA 4IB2A 4OERA 4JXIA 4YMAA 2DWHA 4NF5A 1QULA 5DTBA 1OVBA 2GRVA 4LUBA 3TTRA 1IITA 2Y7RA 3K00A 4YU0A 1N3WA 1PDAA 2NVUB 3M3LA 1NMUA 2WKYA 4JWOA 2R9JA 3MP1A 4EXKA 2P2AA 5AA4A 3OO7A 3H7MA 2ANJA 5B70A 2X26A 2VD2A 1H76A 3IOUA 2D21A 4KYEA 3HPIA 3PPQA 4NF8B 4GL8A 2F36A 4XKRA 3H03A 5J1DA 3FASA 3M3KA 3VFJA 1MXUA 2Q9TA 3CI8A 1SI0A 3IO6A 3MVZA 2OWTA 4I9DA 3FZVA 1B9JA 5TPAB 2VHAA 3CFLA 1M5CA 3IB2A 3OSRA 3U94A 4GOTA 3KN3A 3BKIB 5EHSA 2QL3A 1TXFA 3PPOA 4YKKA 2QMXA 5I58A 1UIUA 3K6VA 2VP1A 2I4BA 1Y1ZA 4H5FA 4RPOA 3CVGA 1MQDA 3TKDA 2YJPA 5IKBA 3PMXA 5ISUA 1AMFA 1LAXA 1Z7ME 3TFLA 2Z8FA 1URGA 5AE4A 5KZTA 1JEVA 3RTWB 4I62A 2Y7IA 2LAOA 5F1QA 4H6DA 3VXCA 4OMBA 4DCXA 4QFNA 4F3GA 4Q8RA 1SW4A 3EPEA 1D4NA 3TTMA 3PU5A 3O29A 5I56B 1B51A 3FD3A 4FJPA 3PUYE 1MQJA 1CE2A 2XXTA 1ZBMA 5L9MA 1OMPA 3T22A 1JVYA 1GTKA 1XOCA 1ANFA 4GWOA 4R75A 4H8IA 2ZNSA 3I5OA 2QRYA 1P99A 3RPWA 3C32A 5I59A 4NF4B 4R6KA 1IXCA 5TPAA 3K01A 4PFUA 2I58A 4F3BA 1VFEA 1ELJA 1DTGA 3KJTA 2HAVA 5EYFA 3HO7A 3MWBA 3B7DA 1MS7A 3E4RA 4BLAA 4FAJA 3G3GA 2G29A 2ZYOA 1ZIUA 1II5A 4RNSA 5CMBA 3SESA 1FQEA 1M5FA 4YKIA 2F97A 2O51A 2QMWA 1Z7NE 3UGWA 3QSLA 2XX7A 1QKBA 2FNCA 2ZMBA 2D3IA 4H5GA 1B40A 2E0SA 4NWCA 4F1VA 4PFWA 4F1UA 3H6UA 5AA2B 3LUYA 1A54A 3MZ1A 1H44A 2ZYMA 4OTEA 3HHFA 4TOZA 4MF3A 3DELB 5A5XB 5I56A 1FTMA 3HSTA 2ONRA 3UA8A 1UTBA 1MXYA 4KD5A 2HQ0A 2QJEA 2XXRA 3P7IA 3QAXA 1ATGA 5I57A 3S9LC 2ZYKA 3BBRA 3QK6A 2ABHA 4WEPA 1LB9A 2A5TA 2HZLA 4F3SA 4EQ9A 3VE1B 3DLNA 3MPLA 4U2RA 4U22A 2DVZA 4TLLB 1Y3NA 4NEDA 2F34A 2VD3A 2XD3A 3G3IA 3MVWA 1O7TA 3TQLA 4IO5A 2O1MA 3U1OA 3VVEA 3MP6A 4U23A 1UTHA 1B05A 3QUJA 4YAHX 3M8UA 4LZ5A 3G3FA 3A3UA 3MZBA 3KN7A 2AIXA 3H6VA 3L6GA 1TT1A 3KGCA 5HM4B 3K4UA 2XXVA 3VLUA 4G4PA 3T96B 3JV9A 3ZKKA 1ZMGA 3IX1A 4O3BA 5BUUA 3R26A 3UORA 2XX9A 2Y7WA 4ZS9A 1AH5A 3T9XB 2F35A 4NF6A 1MPBA 3FV1A 3MC2A 1Y1MA 3IAZA 1UIVA 3EHUA 4ZDMA 4AQ4A 1LCFA 3VVFA 4KHZE 3F11A 1M5BA 1KWHA 3K1MA 2CMOA 1MXXA 4M1VA 1O63A 5AA1A 1ZU0A 3RGYA 2ALUA 4O3AA 3G3JA 1LFIA 3T9VA 1H43A 2Q2AA 5H8NB 3TCGA 4WKMA 2H25A 4BDRA 2AL4A 3DP4A 1JNFA 2P0SA 1SW2A 4G8HA 3K6WA 5BWJA 1H45A 4QFKA 3OSQA 4BDLA 3N6TA 3N5LA 2X7QA 3UK4A 2I49A 4RA1A 5CRYA 3KBRA 1TFDA 3UN6A 1B6HA 4BDMA 4NF5B 3OD7A 3E3KA 1RKMA 2XXYA 4ND9A 3CFZA 2V3TA 1D3KA 4EXLA 2XXIA 2GHAA 4DXBA 2NOOA 1IIWA 1USYE 5AA4B 3S9NC 2D5WA 1JW5A 3PD8A 3M3FA 2O7IA 1I6AA 1SBPA 2HZKA 3RT8A 1R9LA 1PEBA 3K02A 1EZPA 3N26A 3OEMA 2I0CA 2UYEA 4PFTA 4LA9A 3K6XA 2UVJA 3KG2A 5FTHA 3QYTA 4X48A 3MVYA 4QFPA 1I6BA 4KR5A 1BLFA 4TQUQ 1NH8A 1IZ1A 4ZEKA 1FTOA 4KYDA 4DXUA 4C1UA 4NWDA 2V25A 5AA3A 5H8NA 4IGRA 1PB9A 3OMBA 4GIZA 2Y7KA 4H1XA 5I58B 4MLQA 2RCBA 3MUQA 3PPRA 1VR5A 4OYVA 4YB6A 4QF9A 4KYSA 4YICA 1L5TA 2F7BA 3PUXE 1QVSA 2A5SA 4XKQA 1JVXA 5DVJA 2F5XA 5K2XA 1MQGA 4U1ZA 1USYH 5CMCA 4WEDA 3FXUA 1OLAA 4QSDA 3T66A 1DOTA 2P1SA 3MJNA 1OQHA 2V93A 1DMBA 1N3XA 3MAMA 2H98A 1IEJA 4Q30B 2HXWA 5AA2D 3DP6A 4LQ5A 4ZE8A 4ZE9A 3E9XA 1N84A 1MXVA 2I3WA 1XHYA 5LOMA 3ODBA 1MY1A 3FIRA 3TELA 5JEIA 1GV8A 2Z8EA 2Z8DA 5I59B 5L9OA 5M2VA 2HAUA 4MH5A 5ITPA 4XXUA 3FXRA 2UYFA 5L9SA 1RYOA 4F19A 2Z23A 1FTKA 1OLCA 4FE8A 4UA8A 3SDFA 1N76A 1NL5A 2H5YA 4R2BA 1MQIA 4ELRA 4G8NA 1MG1A 2Q8JA 1QW0A 2VOZA 2O84X 1JW1A 2O1LA 1DTZA 1B7ZA 1XS5A 3ECRA 3FVOA 1SD3A 2OCUA 3LSLA 2F7CA 4R72A 3OXNA 3EHSA 4ISUA 2ONKE 3EF7A 1MH4A 2DVCA 3KOTA 1P1OA 1TWYA 1AL3A 2GFEA 3LSFB 3O6HA 3V5AA 3GBAA 4YKJA 4HCWA 1PB8A 3CG1A 3U8QA 2PT1A 2X7PA 3MBPA 1LAHE 1LB8A 4R9GA 3IR1A 1B52A 1D9YA 5TP9A 2I0BA 4GQOA 4X1DA 1UTBB 1P1NA 4HW8A 2Q88A 5H8FA 5I57B 1PC3A 3PPNA 3Q25A 3FGSA 4FIMA 1NKXA 3W9WA 2A5TB 5F7VA 1Y4CA 2H9BA 4F18A 5CMMA 3LSXA 1I6QA 4BDOA 4BDNA 3OEKA 1MRPA 4QRZA 2OJTA 1RYXA 1MY3A 3SEVA 4R2FA 2DXYA 1MXZA 3QUFA 1GR2A 2YPNA 1M5DA 2AL5A 1UTHB 4U1OA 5CBRA 3FJ7A 3A09A 2I4CA 3TPAA 3KSJA 3K1PA 3IO4A 5KDTA 4OFLA 3EN3A 1MDQA 2Y84A 2F8DA 2V84A 1ZKBA 4N13A 4G2ZA 4F31B 5CBSA 3G3KA 1B7UA 2DXRA 4MLVA 1N0TA 3HHGA 3EQ1A 1S7YA 1LLSA 4QHQA 1MPDA 4JWYA 3RNNA 3C31A 4NF6B 3MW0A 4ZEBA 1IXIA 1IQ7A 1NNPA 1N7WA 3L6HA 3AXFA 3HV1A 3UP9A 4OZ9A 3TTKA 2OWSA 3C4MA 4IO2A 3K1NA 3H3GA 3R6UA 1QKAA 1A40A 4DLDA 1FTLA 3O2AA 1B3LA 3D4GA 4R9FA 4R6HA 1Y9UA 1HSLA 3MQ9A 4JDFA 4KCDA 4PETA 1FTJA 4WXJA 1M5EA 3T93B 3IOVA 4YB5A 5DYHA 4GXAA 1BP5A 4OQOA 3N6UA 4QFOA 1FQAA 3DP8A 4F2QA 2RC7A 2DP8A 4O3CA 2H4IA 5I2KA 2NXOA 2GHBA 1BIYA 1LAFE 1FCKA 3PGFA 2REGA 3K6UA 1B58A 2RCAA 4GXSB 5CC2A 2HEUA 1WDNA 3PUZE 4N6PA 2ZNTA 3CR9A 2OLBA 4PFYA 3CSBA 3IORA 1XVYA 1MXWA 3VLVA 4P0IA 1SQYA 3IJOB 3GLBA 4OHNA 3MP8A 4G68C 4XKPA 1YTVA 3TTNA 2I6EA 2KLFA 1SYHA 3H06B 4YB7A 1D9VA 4KFQA 1OIBA 1GVCA 4GFRA 1B1HA 1JETA 1HSEA 4IO4A 3V83A 4ZZEA 1Q1KA 2DS9A 3R7XA 4THIA 1N04A 3MPKA 1URSA 1SDXA 5H8QA 1EH3A 1B4ZA 1URDA 1MM7A 4I1DA 3IK6B 2XXUA 1BKAA 1J1NA 1LBCA 4I8CA 1ZJLA 1VE4A 1VFDA 1ZLQA 4G8MA 2ZYNA 2CZLA 3TCHA 3VV5A 1LGBC 4LP2B 4JSOA 4G68A 1LCTA 2UVGA 4U21A 2REJA 1LFHA 2G93A 3S2VA 2M8CA 3ZKLA 2DWJA 5ITOA 5ELVA 1B5HA 1FQFA 4G77A 2O68A 3TAJA 3FATA 4GRKA 1B2HA 4QSEA 4IO6A 4U4SA 2W7YA 4HTGA 3FVNA 1XT8A 4RK2A 3TTLA 1IXGA 3OO9A 4AB6A 2HCAA 1QUJA 3ONMA 3C9HA 4H8JA 2DE2A 3SETA 3H6TA 5IAIA 4QFLA 5FHMA 3KZGA 3FXQA 3LC8A 4XTCQ 1XVXA 3D4CA 4HS7A 4Z0IA 4ZECA 3SEYA 5K2YA 4XKNA 3KEIA 3PD9A 2DWAA 3PV0E 2FA7A 4M4GA 2Q2CA 3EHTA 3O6IA 3O66A 4LZ8A 5I2NA 1A7LA 4TLMB 2V3UA 4P0GA 4IGTA 3KSXA 1OVTA 4DDDA 2QS2A 2DOJA 3C34A 3FVGA 2BJJX 4GLIA 2O6AA 1PBPA 1FQDA 4OEUA 3ILTB 3OO8A 2UXAA 2IA4A 1A8FA 3I6VA 2XX8A 1NNTA 2PX1A 3BFUA 3G7WA 2XHDA 5B7DA 3TODA 5L8DA 2XXQA 4OVJA 3C36A 4JBZA 4ELPA 3Q29A 1AIVA 4IY5A 3OENA 4GVOA 1JQFA 1NFTA 4DZ1A 1QUKA 5FTIA 4OENA 4JWXA 1UQWA 4Q5TA 2Q89A 3VLWA 1A55A 5TP9B 1S50A 4OXVA 3IB1A 1FW0A 5JTYA 3LR1A 5H8FB 5CM6A 3LBSA 3RT6B 3K0VA 4X9TA 2O69A 3Q26A 1XC1A 3B6WA 4F22A 4R74A 2GH9A 3ILUB 4F2OA 1JEUA 1B3HA 3C35A 1EU8A 1MDP1 4OEVA 3SERA 3I3VA 3PMWA 4F1YA 2RF1A 3S9MC 2OK2A 4POWA 1YCJA 3PMVA 1GGGA 1O64A 2E1SA 5KDTB 1SW1A 2DQVA 4NTLA 1B7HA 2I48A 1HSJA 1SW5A 3N94A 3KJ7A 3FUZA 5HPQA 1FQCA 4EUOA 4ZEFA 4LVQA 3RLFE 2HFBA 1IXHA 1NNKA 1POY1 4E0XA 2XXHA 3U72A 1R9QA 3KOSA 3T9HB 3TZAA 4MFIA 5HBCA 4Z7EA 5DEXB 1VSOA 1WVJA 4NE4A 5TU0A 1QUIA 3KFMA 4OFJA 4X1BA 1B5JA 3TCFA 1I69A 3CG3A 4ZEIA 4DE8A 4NF8A 3RQTA 3MZ9A 3CIJA 3IJXB 4LQ2A 5KCJB 1MH3A 2AYSA 1P1QA 2QPQA 3OELA 3TUSA 4JB7A 3A3CA 1OQGA 4DXCA 1Y3QA 4ESXA 3RY3A 3TMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QS3 A;  3ZSF A;  4EF1 A;  3JZJ A;  4L17 A;  5H8S A;  3KN8 A;  3V89 B;  5CMK A;  1DPP A;  5I2K B;  3GXA A;  4LZ7 A;  4RJZ A;  3C33 A;  3IB0 A;  1MY0 A;  1H3D A;  3SEU A;  2NWJ A;  5H8H B;  4EF2 A;  4LAT A;  3B6Q A;  3USD A;  2DE4 A;  4MBP A;  4N07 A;  4UAC A;  2PYY A;  4RY1 A;  1A8E A;  2RC9 A;  4RYA A;  1QJM A;  3U93 A;  4RXL A;  4IO7 A;  2RC8 A;  3CFX A;  3IOT A;  1B0H A;  4FEB A;  4HCY A;  3VDF A;  1IUD A;  5DT6 A;  4H0W A;  1ZTY A;  4EQB A;  1NNF A;  4ZZA A;  3TYH A;  4ONY A;  4LON B;  4GL0 A;  1DPE A;  4POX A;  4ECF A;  1CB6 A;  2DE3 A;  3RUM A;  5DEX A;  4GD5 A;  4OES A;  2VGQ A;  3GZG A;  4RPN A;  4BDQ A;  2H99 A;  2QS4 A;  2V3Q A;  2XD2 A;  2RKM A;  4YKP A;  3IL1 B;  4KPT A;  3S9E A;  5KCJ A;  5JK4 A;  5H8Q B;  1MPC A;  3FV2 A;  1B0L A;  2QS1 A;  1POT A;  4IY6 A;  2XXP A;  4C1T A;  2O7U A;  3S4U A;  4P11 A;  3WAF A;  1LFG A;  4KCC A;  1LAG E;  3MVX A;  4G68 B;  5CI5 A;  4NF4 A;  3LSW A;  2R71 A;  3BFT A;  2F78 A;  4ESW A;  4PP0 A;  4H65 A;  2ONS A;  2B3B A;  1B3G A;  1MY2 A;  1SI1 A;  4GF8 A;  5EHM A;  3DM0 A;  1YAE A;  5H8H A;  1A99 A;  2YLN A;  5FHO A;  3TQW A;  2Y7P A;  4F39 A;  1MQH A;  3WAE A;  2OBG A;  5ICQ A;  2UVI A;  3FJG A;  3HCQ A;  1EZ9 A;  1MM6 A;  3OO6 A;  3CRB A;  3OOA A;  1B3E A;  2NUV A;  3O9P A;  4FOR A;  4PE5 B;  2QSX A;  3TDJ A;  3UIF A;  3B6T A;  1AOV A;  3QIM A;  4FAT A;  5AA2 A;  1PB7 A;  1P1W A;  2B65 A;  3W15 C;  2DSF A;  4KI0 E;  3SEX A;  1US5 A;  4IO3 A;  1LST A;  2ZNU A;  3FJM A;  5A5X A;  4XIG Q;  3Q27 A;  2B3F A;  1US4 A;  4FED A;  3IOW A;  1Y20 A;  1F9B A;  2F6P A;  4OFO A;  3VXB A;  4ELO A;  4Q0C A;  5I2N B;  3V8X B;  2FYI A;  4R73 A;  2R6G E;  3H6W A;  4E0W A;  1Y3P A;  3T9U A;  1B3F A;  4AB5 A;  3PUV E;  3PUW E;  1EZO A;  3SEW A;  3FVK A;  1SYI A;  3QXM A;  3K2D A;  2PBW A;  4F29 A;  2PMS A;  2IEE A;  3U92 A;  4EQ7 A;  2XXX A;  3G3H A;  5DVI A;  4YZZ A;  1P1U A;  3ZS6 A;  1SVX B;  1Y4T A;  3TEP A;  1B4H A;  3CSG A;  2F7A A;  3VVD A;  3GBB A;  1T0K A;  4K3F A;  1B46 A;  5ICT A;  2F6G A;  4C0R A;  3THI A;  1B1X A;  1N7X A;  1JW4 A;  4KQP A;  5FHN A;  4U4X A;  3PPP A;  2Z22 A;  4PQJ A;  1FQB A;  3H4Z A;  5JTY B;  1Q35 A;  2I3V A;  4R6Y A;  2ZXT A;  2RIN A;  2THI A;  4YMB A;  2PVU A;  3O97 A;  1R1N A;  4DIG A;  1B32 A;  3HN0 A;  4EDP A;  2ESN A;  3JYR A;  2OZZ A;  4OET A;  4H67 A;  3RN8 A;  5DVF A;  4QSC A;  1MY4 A;  4JSD A;  2PT2 A;  2DWI A;  4FEC A;  1S9T A;  1WOD A;  3RTF B;  2UVH A;  1R6Z A;  4ELQ A;  2DYX A;  3O28 A;  4DCY A;  3SKP A;  3O6G A;  3E13 X;  1DSN A;  5I84 A;  1PBQ A;  4F3P A;  3Q28 A;  1BTJ A;  2XXW A;  1LBB A;  4RK9 A;  1NH7 A;  4NMY A;  4OWD A;  1B5I A;  1TFA A;  3W9V A;  4ZED A;  1YPN A;  4IB2 A;  4OER A;  4JXI A;  4YMA A;  2DWH A;  4NF5 A;  1QUL A;  5DTB A;  1OVB A;  2GRV A;  4LUB A;  3TTR A;  1IIT A;  2Y7R A;  3K00 A;  4YU0 A;  1N3W A;  1PDA A;  2NVU B;  3M3L A;  1NMU A;  2WKY A;  4JWO A;  2R9J A;  3MP1 A;  4EXK A;  2P2A A;  5AA4 A;  3OO7 A;  3H7M A;  2ANJ A;  5B70 A;  2X26 A;  2VD2 A;  1H76 A;  3IOU A;  2D21 A;  4KYE A;  3HPI A;  3PPQ A;  4NF8 B;  4GL8 A;  2F36 A;  4XKR A;  3H03 A;  5J1D A;  3FAS A;  3M3K A;  3VFJ A;  1MXU A;  2Q9T A;  3CI8 A;  1SI0 A;  3IO6 A;  3MVZ A;  2OWT A;  4I9D A;  3FZV A;  1B9J A;  5TPA B;  2VHA A;  3CFL A;  1M5C A;  3IB2 A;  3OSR A;  3U94 A;  4GOT A;  3KN3 A;  3BKI B;  5EHS A;  2QL3 A;  1TXF A;  3PPO A;  4YKK A;  2QMX A;  5I58 A;  1UIU A;  3K6V A;  2VP1 A;  2I4B A;  1Y1Z A;  4H5F A;  4RPO A;  3CVG A;  1MQD A;  3TKD A;  2YJP A;  5IKB A;  3PMX A;  5ISU A;  1AMF A;  1LAX A;  1Z7M E;  3TFL A;  2Z8F A;  1URG A;  5AE4 A;  5KZT A;  1JEV A;  3RTW B;  4I62 A;  2Y7I A;  2LAO A;  5F1Q A;  4H6D A;  3VXC A;  4OMB A;  4DCX A;  4QFN A;  4F3G A;  4Q8R A;  1SW4 A;  3EPE A;  1D4N A;  3TTM A;  3PU5 A;  3O29 A;  5I56 B;  1B51 A;  3FD3 A;  4FJP A;  3PUY E;  1MQJ A;  1CE2 A;  2XXT A;  1ZBM A;  5L9M A;  1OMP A;  3T22 A;  1JVY A;  1GTK A;  1XOC A;  1ANF A;  4GWO A;  4R75 A;  4H8I A;  2ZNS A;  3I5O A;  2QRY A;  1P99 A;  3RPW A;  3C32 A;  5I59 A;  4NF4 B;  4R6K A;  1IXC A;  5TPA A;  3K01 A;  4PFU A;  2I58 A;  4F3B A;  1VFE A;  1ELJ A;  1DTG A;  3KJT A;  2HAV A;  5EYF A;  3HO7 A;  3MWB A;  3B7D A;  1MS7 A;  3E4R A;  4BLA A;  4FAJ A;  3G3G A;  2G29 A;  2ZYO A;  1ZIU A;  1II5 A;  4RNS A;  5CMB A;  3SES A;  1FQE A;  1M5F A;  4YKI A;  2F97 A;  2O51 A;  2QMW A;  1Z7N E;  3UGW A;  3QSL A;  2XX7 A;  1QKB A;  2FNC A;  2ZMB A;  2D3I A;  4H5G A;  1B40 A;  2E0S A;  4NWC A;  4F1V A;  4PFW A;  4F1U A;  3H6U A;  5AA2 B;  3LUY A;  1A54 A;  3MZ1 A;  1H44 A;  2ZYM A;  4OTE A;  3HHF A;  4TOZ A;  4MF3 A;  3DEL B;  5A5X B;  5I56 A;  1FTM A;  3HST A;  2ONR A;  3UA8 A;  1UTB A;  1MXY A;  4KD5 A;  2HQ0 A;  2QJE A;  2XXR A;  3P7I A;  3QAX A;  1ATG A;  5I57 A;  3S9L C;  2ZYK A;  3BBR A;  3QK6 A;  2ABH A;  4WEP A;  1LB9 A;  2A5T A;  2HZL A;  4F3S A;  4EQ9 A;  3VE1 B;  3DLN A;  3MPL A;  4U2R A;  4U22 A;  2DVZ A;  4TLL B;  1Y3N A;  4NED A;  2F34 A;  2VD3 A;  2XD3 A;  3G3I A;  3MVW A;  1O7T A;  3TQL A;  4IO5 A;  2O1M A;  3U1O A;  3VVE A;  3MP6 A;  4U23 A;  1UTH A;  1B05 A;  3QUJ A;  4YAH X;  3M8U A;  4LZ5 A;  3G3F A;  3A3U A;  3MZB A;  3KN7 A;  2AIX A;  3H6V A;  3L6G A;  1TT1 A;  3KGC A;  5HM4 B;  3K4U A;  2XXV A;  3VLU A;  4G4P A;  3T96 B;  3JV9 A;  3ZKK A;  1ZMG A;  3IX1 A;  4O3B A;  5BUU A;  3R26 A;  3UOR A;  2XX9 A;  2Y7W A;  4ZS9 A;  1AH5 A;  3T9X B;  2F35 A;  4NF6 A;  1MPB A;  3FV1 A;  3MC2 A;  1Y1M A;  3IAZ A;  1UIV A;  3EHU A;  4ZDM A;  4AQ4 A;  1LCF A;  3VVF A;  4KHZ E;  3F11 A;  1M5B A;  1KWH A;  3K1M A;  2CMO A;  1MXX A;  4M1V A;  1O63 A;  5AA1 A;  1ZU0 A;  3RGY A;  2ALU A;  4O3A A;  3G3J A;  1LFI A;  3T9V A;  1H43 A;  2Q2A A;  5H8N B;  3TCG A;  4WKM A;  2H25 A;  4BDR A;  2AL4 A;  3DP4 A;  1JNF A;  2P0S A;  1SW2 A;  4G8H A;  3K6W A;  5BWJ A;  1H45 A;  4QFK A;  3OSQ A;  4BDL A;  3N6T A;  3N5L A;  2X7Q A;  3UK4 A;  2I49 A;  4RA1 A;  5CRY A;  3KBR A;  1TFD A;  3UN6 A;  1B6H A;  4BDM A;  4NF5 B;  3OD7 A;  3E3K A;  1RKM A;  2XXY A;  4ND9 A;  3CFZ A;  2V3T A;  1D3K A;  4EXL A;  2XXI A;  2GHA A;  4DXB A;  2NOO A;  1IIW A;  1USY E;  5AA4 B;  3S9N C;  2D5W A;  1JW5 A;  3PD8 A;  3M3F A;  2O7I A;  1I6A A;  1SBP A;  2HZK A;  3RT8 A;  1R9L A;  1PEB A;  3K02 A;  1EZP A;  3N26 A;  3OEM A;  2I0C A;  2UYE A;  4PFT A;  4LA9 A;  3K6X A;  2UVJ A;  3KG2 A;  5FTH A;  3QYT A;  4X48 A;  3MVY A;  4QFP A;  1I6B A;  4KR5 A;  1BLF A;  4TQU Q;  1NH8 A;  1IZ1 A;  4ZEK A;  1FTO A;  4KYD A;  4DXU A;  4C1U A;  4NWD A;  2V25 A;  5AA3 A;  5H8N A;  4IGR A;  1PB9 A;  3OMB A;  4GIZ A;  2Y7K A;  4H1X A;  5I58 B;  4MLQ A;  2RCB A;  3MUQ A;  3PPR A;  1VR5 A;  4OYV A;  4YB6 A;  4QF9 A;  4KYS A;  4YIC A;  1L5T A;  2F7B A;  3PUX E;  1QVS A;  2A5S A;  4XKQ A;  1JVX A;  5DVJ A;  2F5X A;  5K2X A;  1MQG A;  4U1Z A;  1USY H;  5CMC A;  4WED A;  3FXU A;  1OLA A;  4QSD A;  3T66 A;  1DOT A;  2P1S A;  3MJN A;  1OQH A;  2V93 A;  1DMB A;  1N3X A;  3MAM A;  2H98 A;  1IEJ A;  4Q30 B;  2HXW A;  5AA2 D;  3DP6 A;  4LQ5 A;  4ZE8 A;  4ZE9 A;  3E9X A;  1N84 A;  1MXV A;  2I3W A;  1XHY A;  5LOM A;  3ODB A;  1MY1 A;  3FIR A;  3TEL A;  5JEI A;  1GV8 A;  2Z8E A;  2Z8D A;  5I59 B;  5L9O A;  5M2V A;  2HAU A;  4MH5 A;  5ITP A;  4XXU A;  3FXR A;  2UYF A;  5L9S A;  1RYO A;  4F19 A;  2Z23 A;  1FTK A;  1OLC A;  4FE8 A;  4UA8 A;  3SDF A;  1N76 A;  1NL5 A;  2H5Y A;  4R2B A;  1MQI A;  4ELR A;  4G8N A;  1MG1 A;  2Q8J A;  1QW0 A;  2VOZ A;  2O84 X;  1JW1 A;  2O1L A;  1DTZ A;  1B7Z A;  1XS5 A;  3ECR A;  3FVO A;  1SD3 A;  2OCU A;  3LSL A;  2F7C A;  4R72 A;  3OXN A;  3EHS A;  4ISU A;  2ONK E;  3EF7 A;  1MH4 A;  2DVC A;  3KOT A;  1P1O A;  1TWY A;  1AL3 A;  2GFE A;  3LSF B;  3O6H A;  3V5A A;  3GBA A;  4YKJ A;  4HCW A;  1PB8 A;  3CG1 A;  3U8Q A;  2PT1 A;  2X7P A;  3MBP A;  1LAH E;  1LB8 A;  4R9G A;  3IR1 A;  1B52 A;  1D9Y A;  5TP9 A;  2I0B A;  4GQO A;  4X1D A;  1UTB B;  1P1N A;  4HW8 A;  2Q88 A;  5H8F A;  5I57 B;  1PC3 A;  3PPN A;  3Q25 A;  3FGS A;  4FIM A;  1NKX A;  3W9W A;  2A5T B;  5F7V A;  1Y4C A;  2H9B A;  4F18 A;  5CMM A;  3LSX A;  1I6Q A;  4BDO A;  4BDN A;  3OEK A;  1MRP A;  4QRZ A;  2OJT A;  1RYX A;  1MY3 A;  3SEV A;  4R2F A;  2DXY A;  1MXZ A;  3QUF A;  1GR2 A;  2YPN A;  1M5D A;  2AL5 A;  1UTH B;  4U1O A;  5CBR A;  3FJ7 A;  3A09 A;  2I4C A;  3TPA A;  3KSJ A;  3K1P A;  3IO4 A;  5KDT A;  4OFL A;  3EN3 A;  1MDQ A;  2Y84 A;  2F8D A;  2V84 A;  1ZKB A;  4N13 A;  4G2Z A;  4F31 B;  5CBS A;  3G3K A;  1B7U A;  2DXR A;  4MLV A;  1N0T A;  3HHG A;  3EQ1 A;  1S7Y A;  1LLS A;  4QHQ A;  1MPD A;  4JWY A;  3RNN A;  3C31 A;  4NF6 B;  3MW0 A;  4ZEB A;  1IXI A;  1IQ7 A;  1NNP A;  1N7W A;  3L6H A;  3AXF A;  3HV1 A;  3UP9 A;  4OZ9 A;  3TTK A;  2OWS A;  3C4M A;  4IO2 A;  3K1N A;  3H3G A;  3R6U A;  1QKA A;  1A40 A;  4DLD A;  1FTL A;  3O2A A;  1B3L A;  3D4G A;  4R9F A;  4R6H A;  1Y9U A;  1HSL A;  3MQ9 A;  4JDF A;  4KCD A;  4PET A;  1FTJ A;  4WXJ A;  1M5E A;  3T93 B;  3IOV A;  4YB5 A;  5DYH A;  4GXA A;  1BP5 A;  4OQO A;  3N6U A;  4QFO A;  1FQA A;  3DP8 A;  4F2Q A;  2RC7 A;  2DP8 A;  4O3C A;  2H4I A;  5I2K A;  2NXO A;  2GHB A;  1BIY A;  1LAF E;  1FCK A;  3PGF A;  2REG A;  3K6U A;  1B58 A;  2RCA A;  4GXS B;  5CC2 A;  2HEU A;  1WDN A;  3PUZ E;  4N6P A;  2ZNT A;  3CR9 A;  2OLB A;  4PFY A;  3CSB A;  3IOR A;  1XVY A;  1MXW A;  3VLV A;  4P0I A;  1SQY A;  3IJO B;  3GLB A;  4OHN A;  3MP8 A;  4G68 C;  4XKP A;  1YTV A;  3TTN A;  2I6E A;  2KLF A;  1SYH A;  3H06 B;  4YB7 A;  1D9V A;  4KFQ A;  1OIB A;  1GVC A;  4GFR A;  1B1H A;  1JET A;  1HSE A;  4IO4 A;  3V83 A;  4ZZE A;  1Q1K A;  2DS9 A;  3R7X A;  4THI A;  1N04 A;  3MPK A;  1URS A;  1SDX A;  5H8Q A;  1EH3 A;  1B4Z A;  1URD A;  1MM7 A;  4I1D A;  3IK6 B;  2XXU A;  1BKA A;  1J1N A;  1LBC A;  4I8C A;  1ZJL A;  1VE4 A;  1VFD A;  1ZLQ A;  4G8M A;  2ZYN A;  2CZL A;  3TCH A;  3VV5 A;  1LGB C;  4LP2 B;  4JSO A;  4G68 A;  1LCT A;  2UVG A;  4U21 A;  2REJ A;  1LFH A;  2G93 A;  3S2V A;  2M8C A;  3ZKL A;  2DWJ A;  5ITO A;  5ELV A;  1B5H A;  1FQF A;  4G77 A;  2O68 A;  3TAJ A;  3FAT A;  4GRK A;  1B2H A;  4QSE A;  4IO6 A;  4U4S A;  2W7Y A;  4HTG A;  3FVN A;  1XT8 A;  4RK2 A;  3TTL A;  1IXG A;  3OO9 A;  4AB6 A;  2HCA A;  1QUJ A;  3ONM A;  3C9H A;  4H8J A;  2DE2 A;  3SET A;  3H6T A;  5IAI A;  4QFL A;  5FHM A;  3KZG A;  3FXQ A;  3LC8 A;  4XTC Q;  1XVX A;  3D4C A;  4HS7 A;  4Z0I A;  4ZEC A;  3SEY A;  5K2Y A;  4XKN A;  3KEI A;  3PD9 A;  2DWA A;  3PV0 E;  2FA7 A;  4M4G A;  2Q2C A;  3EHT A;  3O6I A;  3O66 A;  4LZ8 A;  5I2N A;  1A7L A;  4TLM B;  2V3U A;  4P0G A;  4IGT A;  3KSX A;  1OVT A;  4DDD A;  2QS2 A;  2DOJ A;  3C34 A;  3FVG A;  2BJJ X;  4GLI A;  2O6A A;  1PBP A;  1FQD A;  4OEU A;  3ILT B;  3OO8 A;  2UXA A;  2IA4 A;  1A8F A;  3I6V A;  2XX8 A;  1NNT A;  2PX1 A;  3BFU A;  3G7W A;  2XHD A;  5B7D A;  3TOD A;  5L8D A;  2XXQ A;  4OVJ A;  3C36 A;  4JBZ A;  4ELP A;  3Q29 A;  1AIV A;  4IY5 A;  3OEN A;  4GVO A;  1JQF A;  1NFT A;  4DZ1 A;  1QUK A;  5FTI A;  4OEN A;  4JWX A;  1UQW A;  4Q5T A;  2Q89 A;  3VLW A;  1A55 A;  5TP9 B;  1S50 A;  4OXV A;  3IB1 A;  1FW0 A;  5JTY A;  3LR1 A;  5H8F B;  5CM6 A;  3LBS A;  3RT6 B;  3K0V A;  4X9T A;  2O69 A;  3Q26 A;  1XC1 A;  3B6W A;  4F22 A;  4R74 A;  2GH9 A;  3ILU B;  4F2O A;  1JEU A;  1B3H A;  3C35 A;  1EU8 A;  1MDP 1;  4OEV A;  3SER A;  3I3V A;  3PMW A;  4F1Y A;  2RF1 A;  3S9M C;  2OK2 A;  4POW A;  1YCJ A;  3PMV A;  1GGG A;  1O64 A;  2E1S A;  5KDT B;  1SW1 A;  2DQV A;  4NTL A;  1B7H A;  2I48 A;  1HSJ A;  1SW5 A;  3N94 A;  3KJ7 A;  3FUZ A;  5HPQ A;  1FQC A;  4EUO A;  4ZEF A;  4LVQ A;  3RLF E;  2HFB A;  1IXH A;  1NNK A;  1POY 1;  4E0X A;  2XXH A;  3U72 A;  1R9Q A;  3KOS A;  3T9H B;  3TZA A;  4MFI A;  5HBC A;  4Z7E A;  5DEX B;  1VSO A;  1WVJ A;  4NE4 A;  5TU0 A;  1QUI A;  3KFM A;  4OFJ A;  4X1B A;  1B5J A;  3TCF A;  1I69 A;  3CG3 A;  4ZEI A;  4DE8 A;  4NF8 A;  3RQT A;  3MZ9 A;  3CIJ A;  3IJX B;  4LQ2 A;  5KCJ B;  1MH3 A;  2AYS A;  1P1Q A;  2QPQ A;  3OEL A;  3TUS A;  4JB7 A;  3A3C A;  1OQG A;  4DXC A;  1Y3Q A;  4ESX A;  3RY3 A;  3TMG A; 
#chains in the Genus database with same CATH topology
 2QS3 A;  3ZSF A;  4EF1 A;  3JZJ A;  4L17 A;  5H8S A;  4XEQ A;  3KN8 A;  3V89 B;  5CMK A;  1DPP A;  5I2K B;  3GXA A;  4LZ7 A;  4RJZ A;  3C33 A;  3IB0 A;  2B4M A;  1MY0 A;  1H3D A;  3SEU A;  2NWJ A;  5H8H B;  4EF2 A;  4LAT A;  3B6Q A;  3USD A;  2DE4 A;  4MBP A;  4N07 A;  4UAC A;  2PYY A;  4RY1 A;  2R8T A;  1A8E A;  2RC9 A;  4RYA A;  5ET8 A;  1QJM A;  3U93 A;  4RXL A;  4IO7 A;  2RC8 A;  2CZI A;  1FPE A;  3CFX A;  3IOT A;  2JJK A;  1B0H A;  4FEB A;  4HCY A;  3VDF A;  4I3E A;  1IUD A;  5DT6 A;  4H0W A;  1ZTY A;  4MJO A;  4EQB A;  1NNF A;  4ZZA A;  3TYH A;  4ONY A;  4LON B;  4GL0 A;  1DPE A;  4POX A;  1DCU A;  1FPJ A;  4ECF A;  1CB6 A;  2DE3 A;  1QGX A;  4PGP A;  3RUM A;  5DEX A;  4GD5 A;  4OES A;  2VGQ A;  2FHY A;  3GZG A;  4RPN A;  4BDQ A;  2H99 A;  2QS4 A;  2V3Q A;  2XD2 A;  2RKM A;  4YKP A;  3IL1 B;  4KPT A;  3S9E A;  5KCJ A;  5F24 A;  3PTY A;  5JK4 A;  5H8Q B;  1MPC A;  3FV2 A;  4OVQ A;  4PGN A;  4N6D A;  1IMC A;  1B0L A;  4GBV A;  2QS1 A;  1POT A;  4IY6 A;  2XXP A;  4C1T A;  1FBF A;  5ESY A;  2O7U A;  1FSA A;  3RYD A;  3S4U A;  4P11 A;  3WAF A;  3KC0 A;  1LFG A;  4KCC A;  2HXR A;  1LAG E;  3MVX A;  4G68 B;  5CI5 A;  4NF4 A;  1LEV A;  3LSW A;  1NV7 A;  3T1B A;  2R71 A;  2L5V A;  2F78 A;  3BFT A;  4ESW A;  4PP0 A;  4H65 A;  2ONS A;  2B3B A;  1B3G A;  1MY2 A;  1SI1 A;  4GF8 A;  5EHM A;  3DM0 A;  1YAE A;  5H8H A;  1A99 A;  2YLN A;  4I3Y A;  5FHO A;  1FPI A;  3TQW A;  2Y7P A;  2KR0 A;  4F39 A;  1MQH A;  3WAE A;  2OBG A;  5ICQ A;  4N8Y A;  2UVI A;  3FJG A;  3HCQ A;  1EZ9 A;  1MM6 A;  3OO6 A;  3CRB A;  3OOA A;  5EQ8 A;  1B3E A;  2NUV A;  3O9P A;  4FOR A;  4PE5 B;  2QSX A;  3TDJ A;  3UIF A;  3B6T A;  1AOV A;  5I7I A;  3QIM A;  4FAT A;  5AA2 A;  1PB7 A;  1P1W A;  2B65 A;  3W15 C;  2DSF A;  4KI0 E;  3SEX A;  1US5 A;  2WYK A;  4IO3 A;  1LST A;  2ZNU A;  2VPO A;  3FJM A;  3LV0 A;  5A5X A;  4XIG Q;  3Q27 A;  1YYZ A;  2B3F A;  1US4 A;  4FED A;  3IOW A;  1Y20 A;  1F9B A;  2HPG A;  2F6P A;  4OFO A;  3VXB A;  4ELO A;  4Q0C A;  5I2N B;  3V8X B;  2FYI A;  3FBP A;  4R73 A;  2R6G E;  3H6W A;  4E0W A;  1Y3P A;  3T9U A;  1B3F A;  4O8M A;  5DW8 A;  4AB5 A;  3PUV E;  3PUW E;  1EZO A;  3SEW A;  3FVK A;  1SYI A;  1DBZ A;  1K9Y A;  3QXM A;  2PCR A;  3K2D A;  2PBW A;  4F29 A;  2PMS A;  2IEE A;  3U92 A;  4EQ7 A;  2XXX A;  4PAI A;  3G3H A;  5DVI A;  3MYU A;  4YZZ A;  1P1U A;  3ZS6 A;  1SVX B;  1Y4T A;  3TEP A;  1B4H A;  3CSG A;  2F7A A;  3VVD A;  3GBB A;  1T0K A;  4K3F A;  1B46 A;  5ICT A;  2F6G A;  3B8B A;  3THI A;  4C0R A;  1B1X A;  1N7X A;  1JW4 A;  4KQP A;  5FHN A;  4U4X A;  4N17 A;  3PPP A;  2Z22 A;  4PQJ A;  1FQB A;  2HHM A;  3H4Z A;  5JTY B;  1Q35 A;  2I3V A;  4R6Y A;  2ZXT A;  2RIN A;  2THI A;  4YMB A;  2PVU A;  3O97 A;  1R1N A;  4DIG A;  4PAF A;  1B32 A;  1FBP A;  3HN0 A;  4EDP A;  2ESN A;  2PFZ A;  3JYR A;  2OZZ A;  4OET A;  4H67 A;  3RN8 A;  5DVF A;  4QSC A;  1MY4 A;  1KZ8 A;  4JSD A;  2PT2 A;  2DWI A;  4FEC A;  4X8R A;  4GX6 A;  1S9T A;  1WOD A;  3RTF B;  2UVH A;  1R6Z A;  4ELQ A;  2DYX A;  3O28 A;  4DCY A;  3SKP A;  3O6G A;  3E13 X;  1DSN A;  5I84 A;  1PBQ A;  4F3P A;  3Q28 A;  1BTJ A;  2VPN A;  2XXW A;  1LBB A;  4RK9 A;  4P3L A;  1NH7 A;  4NMY A;  4OWD A;  1B5I A;  1TFA A;  3W9V A;  4ZED A;  1YPN A;  4IB2 A;  4OER A;  4JXI A;  4YMA A;  2DWH A;  1IME A;  4NF5 A;  1QUL A;  5DTB A;  1OVB A;  2GRV A;  4QBA A;  4LUB A;  2CEY A;  3TTR A;  1IIT A;  2Y7R A;  3K00 A;  4YU0 A;  1N3W A;  1PDA A;  2NVU B;  3M3L A;  1NMU A;  2WKY A;  4JWO A;  2R9J A;  3MP1 A;  4EXK A;  2P2A A;  5AA4 A;  3OO7 A;  3H7M A;  2ANJ A;  5B70 A;  2X26 A;  2VD2 A;  2WX9 A;  1H76 A;  3IOU A;  4GBW A;  2D21 A;  4NGU A;  4KYE A;  3HPI A;  4GX3 A;  3PPQ A;  4NF8 B;  4GL8 A;  2F36 A;  4XKR A;  2FIE A;  1KA0 A;  3H03 A;  1FRP A;  5J1D A;  3FAS A;  3M3K A;  4P47 A;  3VFJ A;  1MXU A;  2Q9T A;  4MIJ A;  3CI8 A;  1SI0 A;  3IO6 A;  3MVZ A;  2OWT A;  4I9D A;  3FZV A;  1B9J A;  5TPA B;  2VHA A;  3CFL A;  1M5C A;  3IB2 A;  3OSR A;  3U94 A;  4GOT A;  3KN3 A;  3BKI B;  5EHS A;  2QL3 A;  4HE1 A;  1TXF A;  3PPO A;  4YKK A;  2QMX A;  5I58 A;  1UIU A;  2CZH A;  3K6V A;  2VP1 A;  2I4B A;  1Y1Z A;  3E78 A;  4H5F A;  4RPO A;  3CVG A;  1MQD A;  1NUW A;  3TKD A;  2YJP A;  5IKB A;  3PMX A;  5ISU A;  1AMF A;  1LAX A;  1Z7M E;  3TFL A;  2Z8F A;  1URG A;  4N91 A;  5AE4 A;  5KZT A;  1JEV A;  3RTW B;  4I62 A;  2Y7I A;  2LAO A;  5F1Q A;  4H6D A;  3VXC A;  4OMB A;  4DCX A;  4QFN A;  5EQ7 A;  4F3G A;  2P3N A;  2ZZX A;  1DK4 A;  4Q8R A;  1SW4 A;  3EPE A;  1D4N A;  3TTM A;  3PU5 A;  1AWB A;  1LBW A;  5IZ1 A;  3O29 A;  5I56 B;  1B51 A;  5ET5 A;  1RDY A;  3FD3 A;  4FJP A;  3PUY E;  1MQJ A;  1CE2 A;  3B50 A;  2XXT A;  1FPL A;  1YZ0 A;  1ZBM A;  5L9M A;  1OMP A;  3T22 A;  1JVY A;  1GTK A;  1IMD A;  1XOC A;  1ANF A;  4GWO A;  4R75 A;  4H8I A;  2ZNS A;  3I5O A;  2QRY A;  1P99 A;  3RPW A;  3C32 A;  5I59 A;  4NHB A;  4NF4 B;  4R6K A;  1IXC A;  5TPA A;  3K01 A;  4PFU A;  2I58 A;  4F3B A;  1VFE A;  1ELJ A;  1DTG A;  3KJT A;  2HAV A;  5EYF A;  3HO7 A;  3MWB A;  3B7D A;  1MS7 A;  3E4R A;  4BLA A;  4FAJ A;  3NOH A;  3G3G A;  2G29 A;  2ZYO A;  1ZIU A;  1II5 A;  2Y5L A;  4O7I A;  4RNS A;  5CMB A;  3SES A;  1FQE A;  1M5F A;  4YKI A;  2F97 A;  2O51 A;  2QMW A;  1Z7N E;  3UGW A;  4N4U A;  3QSL A;  4AS4 A;  2XX7 A;  1QKB A;  2FNC A;  3A29 A;  2ZMB A;  4MAG A;  2D3I A;  1KA1 A;  4H5G A;  1B40 A;  2E0S A;  3KBZ A;  4P9K A;  4NWC A;  4PFR A;  4F1V A;  4PFW A;  4F1U A;  3H6U A;  5AA2 B;  2OX3 A;  4DI4 B;  3LUY A;  3MZ1 A;  1A54 A;  2XWK A;  1H44 A;  2ZYM A;  4OTE A;  4N15 A;  3HHF A;  4TOZ A;  4MF3 A;  3DEL B;  3MST A;  5A5X B;  5I56 A;  2QVR A;  1FTM A;  1VDW A;  3HST A;  2ONR A;  3UA8 A;  4XFE A;  1UTB A;  1MXY A;  4KD5 A;  2HQ0 A;  2QJE A;  2XXR A;  3P7I A;  3QAX A;  1ATG A;  5I57 A;  3S9L C;  2ZYK A;  3BBR A;  3QK6 A;  2ABH A;  4WEP A;  1LB9 A;  2A5T A;  2HZL A;  4F3S A;  4EQ9 A;  3VE1 B;  3DLN A;  3MPL A;  4U2R A;  4PE3 A;  4U22 A;  2DVZ A;  4TLL B;  2XWV A;  1Y3N A;  4NED A;  4PF6 A;  2F34 A;  2VD3 A;  1LBY A;  2XD3 A;  3G3I A;  3MVW A;  1O7T A;  3TQL A;  4IO5 A;  2O1M A;  4H46 A;  3U1O A;  3VVE A;  3MP6 A;  4U23 A;  1UTH A;  1B05 A;  3QUJ A;  4YAH X;  3M8U A;  4LZ5 A;  3G3F A;  3A3U A;  3MZB A;  1G0I A;  3KN7 A;  2AIX A;  3H6V A;  3L6G A;  1TT1 A;  3CHG A;  3KGC A;  5HM4 B;  3K4U A;  2XXV A;  3VLU A;  4G4P A;  3T96 B;  3JV9 A;  2QVU A;  3ZKK A;  1ZMG A;  3BIH A;  3IX1 A;  4O3B A;  5BUU A;  3R26 A;  3UOR A;  2XX9 A;  2Y7W A;  4ZS9 A;  1AH5 A;  4GX4 A;  3T9X B;  2F35 A;  4NF6 A;  1MPB A;  3FV1 A;  3MC2 A;  1Y1M A;  3IAZ A;  1UIV A;  3FXB A;  3EHU A;  4ZDM A;  2P3V A;  4AQ4 A;  4MHF A;  1LCF A;  3VVF A;  4KHZ E;  3F11 A;  1M5B A;  1KWH A;  3K1M A;  4O7M A;  2CMO A;  1MXX A;  4M1V A;  1O63 A;  5AA1 A;  1YXI A;  4PAK A;  1ZU0 A;  4H45 A;  3RGY A;  2ALU A;  4O3A A;  3G3J A;  4N81 A;  1LFI A;  3T9V A;  1H43 A;  2Q2A A;  5H8N B;  3TCG A;  4WKM A;  2H25 A;  4BDR A;  5T3J A;  2AL4 A;  2WYP A;  3DP4 A;  1JNF A;  2P0S A;  3IFA A;  1SW2 A;  4G8H A;  3K6W A;  5BWJ A;  1H45 A;  4QFK A;  3OSQ A;  4BDL A;  3N6T A;  3N5L A;  2X7Q A;  3UK4 A;  2I49 A;  4RA1 A;  2QVV A;  5CRY A;  3KBR A;  2Y5K A;  1TFD A;  2XWO A;  2CEX A;  3UN6 A;  1B6H A;  4BDM A;  4NF5 B;  3OD7 A;  4GWZ A;  3E3K A;  1RKM A;  2XXY A;  4ND9 A;  4DI3 D;  3CFZ A;  2V3T A;  1D3K A;  4EXL A;  2XXI A;  2GHA A;  4DXB A;  2NOO A;  1IIW A;  1USY E;  5AA4 B;  3S9N C;  2D5W A;  1JW5 A;  3PD8 A;  3M3F A;  2O7I A;  1I6A A;  1SBP A;  2HZK A;  4P1L A;  3RT8 A;  3T0J A;  1R9L A;  1PEB A;  3K02 A;  3EKI A;  4IR8 A;  1EZP A;  3N26 A;  3OEM A;  2I0C A;  2UYE A;  4PFT A;  4LA9 A;  4GWU A;  4NAP A;  3K6X A;  2UVJ A;  3KG2 A;  4MNP A;  5FTH A;  3QYT A;  4X48 A;  3MVY A;  4PC9 A;  4NF0 A;  4QFP A;  1I6B A;  4KR5 A;  1BLF A;  4TQU Q;  4GWW A;  4JVC A;  1NH8 A;  1IZ1 A;  4ZEK A;  1FTO A;  4KYD A;  4DXU A;  4C1U A;  2BJI A;  4NWD A;  2V25 A;  5AA3 A;  5H8N A;  4IGR A;  1PB9 A;  3OMB A;  4GIZ A;  1NUY A;  2Y7K A;  5EYH A;  4H1X A;  5I58 B;  4MLQ A;  1Q9D A;  2RCB A;  3MUQ A;  3PPR A;  1VR5 A;  4OYV A;  4YB6 A;  4QF9 A;  4KYS A;  4YIC A;  3U65 A;  1L5T A;  2KQZ A;  2F7B A;  3PUX E;  1QVS A;  2A5S A;  4XKQ A;  1JVX A;  5DVJ A;  2F5X A;  5K2X A;  1MQG A;  4U1Z A;  5IM2 A;  1USY H;  5CMC A;  4WED A;  3FXU A;  4NQ8 A;  1OLA A;  4QSD A;  3T66 A;  1DOT A;  2P1S A;  2F3D A;  3MJN A;  1OQH A;  2V93 A;  1DMB A;  1N3X A;  3MAM A;  2PFY A;  2H98 A;  3GYY A;  1IEJ A;  4Q30 B;  2HXW A;  5AA2 D;  1NV4 A;  3DP6 A;  4LQ5 A;  4ZE8 A;  3KC1 A;  4MNI A;  4ZE9 A;  3E9X A;  1N84 A;  1MXV A;  2I3W A;  1XHY A;  1IMB A;  1FPB A;  4O94 A;  4GWS A;  5LOM A;  1NV2 A;  3ODB A;  2XXK A;  1MY1 A;  3FIR A;  1FPD A;  3TEL A;  5JEI A;  1GV8 A;  2Z8E A;  2Z8D A;  5I59 B;  5L9O A;  5M2V A;  2HAU A;  3QMF A;  5LTC A;  4MH5 A;  5ITP A;  4XXU A;  3FXR A;  2UYF A;  5L9S A;  1RYO A;  4F19 A;  2WBB A;  5EQ9 A;  2Q74 A;  2Z23 A;  3IFC A;  1FTK A;  1OLC A;  4FE8 A;  5A5L A;  4UA8 A;  3SDF A;  4OA4 A;  5EQA A;  1N76 A;  1NL5 A;  2H5Y A;  4R2B A;  5ET7 A;  1MQI A;  4ELR A;  4G8N A;  1MG1 A;  2Q8J A;  1QW0 A;  2VOZ A;  2O84 X;  1JW1 A;  5IZ3 A;  2O1L A;  1NV5 A;  1LBZ A;  1DTZ A;  1B7Z A;  1XS5 A;  3ECR A;  3FVO A;  1SD3 A;  2OCU A;  3LSL A;  2F7C A;  4R72 A;  3OXN A;  3EHS A;  4ISU A;  2ONK E;  3EF7 A;  1MH4 A;  2DVC A;  2Q8M A;  4OVS A;  3KOT A;  1P1O A;  1TWY A;  1JP4 A;  1FPG A;  1AL3 A;  2GFE A;  3LSF B;  3O6H A;  3V5A A;  3GBA A;  4YKJ A;  4X04 A;  4HCW A;  1PB8 A;  3CG1 A;  3U8Q A;  2PT1 A;  2X7P A;  5I5P A;  3MBP A;  1LAH E;  1LB8 A;  4R9G A;  3IR1 A;  4MX6 A;  1B52 A;  1D9Y A;  2ZZW A;  5IGA A;  5TP9 A;  2I0B A;  4GQO A;  4X1D A;  1UTB B;  1P1N A;  4HW8 A;  3D1R A;  2Q88 A;  4P56 A;  5H8F A;  5I57 B;  1PC3 A;  3PPN A;  3Q25 A;  3FGS A;  4FIM A;  1NKX A;  2A5T B;  5F7V A;  4PDD A;  1Y4C A;  3W9W A;  2H9B A;  4F18 A;  5CMM A;  3LSX A;  1I6Q A;  3ROJ A;  1D9Q A;  4BDO A;  4BDN A;  3OEK A;  1MRP A;  4QRZ A;  2OJT A;  1RYX A;  1MY3 A;  3SEV A;  4R2F A;  1NV6 A;  2DXY A;  1MXZ A;  3QUF A;  1GR2 A;  4MEV A;  2YPN A;  4HE2 A;  1M5D A;  2AL5 A;  1UTH B;  4U1O A;  5CBR A;  3RPL A;  3FJ7 A;  3A09 A;  4NN3 A;  2I4C A;  3TPA A;  1RDZ A;  3KSJ A;  4PDH A;  3K1P A;  3IO4 A;  1FBH A;  5KDT A;  1IMF A;  1NI9 A;  4OFL A;  3EN3 A;  1MDQ A;  2Y84 A;  2XWI A;  2F8D A;  2V84 A;  1ZKB A;  4N13 A;  4G2Z A;  2B4L A;  4F31 B;  5CBS A;  2QFL A;  3G3K A;  1B7U A;  2DXR A;  4MLV A;  1N0T A;  3HHG A;  3ISP A;  3EQ1 A;  5I3S A;  1S7Y A;  2DDK A;  4HXV A;  4N6K A;  1LLS A;  4QHQ A;  1MPD A;  4JWY A;  4KXP A;  3RNN A;  3C31 A;  4NF6 B;  4XF5 A;  3MW0 A;  4ZEB A;  1IXI A;  1IQ7 A;  1NNP A;  1N7W A;  3L6H A;  3AXF A;  4MCO A;  3HV1 A;  3UP9 A;  5ET6 A;  4OZ9 A;  3TTK A;  2OWS A;  3C4M A;  4IO2 A;  3K1N A;  3H3G A;  3R6U A;  1QKA A;  1A40 A;  4DLD A;  1FTL A;  3O2A A;  1B3L A;  3D4G A;  4R9F A;  4R6H A;  1Y9U A;  1HSL A;  1NV1 A;  3MQ9 A;  3LUZ A;  4JDF A;  4KCD A;  4PET A;  1FTJ A;  4WXJ A;  1M5E A;  3T93 B;  3IOV A;  4YB5 A;  5DYH A;  4GXA A;  1BP5 A;  4OQO A;  3N6U A;  4QFO A;  1FQA A;  3DP8 A;  4F2Q A;  2RC7 A;  2DP8 A;  1SPI A;  4O3C A;  2H4I A;  5I2K A;  2NXO A;  2GHB A;  1BIY A;  2WEF A;  1LAF E;  1FCK A;  3PGF A;  2REG A;  3K6U A;  1B58 A;  2RCA A;  4GXS B;  5CC2 A;  2HEU A;  1WDN A;  3PUZ E;  4N6P A;  2ZNT A;  3CR9 A;  2OLB A;  4PFY A;  4OVP A;  3CSB A;  3IOR A;  1XVY A;  1MXW A;  3VLV A;  4P0I A;  1SQY A;  3IJO B;  3GLB A;  4OHN A;  3BIG A;  3MP8 A;  4G68 C;  4MNC A;  4GWX A;  4XKP A;  1YTV A;  3TTN A;  2I6E A;  1NV0 A;  2KLF A;  1SYH A;  3H06 B;  4YB7 A;  4OAN A;  1D9V A;  4KFQ A;  1OIB A;  1GVC A;  4GFR A;  1B1H A;  1JET A;  1HSE A;  4IO4 A;  4JVI A;  3V83 A;  4OVR A;  4ZZE A;  1EYJ A;  1Q1K A;  4AS5 A;  1CNQ A;  2DS9 A;  3R7X A;  4THI A;  1FBD A;  1N04 A;  3MPK A;  1URS A;  1SDX A;  5H8Q A;  1EH3 A;  1B4Z A;  1URD A;  1MM7 A;  4I1D A;  3IK6 B;  2XXU A;  1BKA A;  1J1N A;  1LBC A;  4I8C A;  1ZJL A;  1VE4 A;  4LN5 A;  1VFD A;  1ZLQ A;  4G8M A;  2ZYN A;  2CZL A;  3TCH A;  3VV5 A;  1LGB C;  4LP2 B;  4PTK A;  4JSO A;  4G68 A;  2F3B A;  1LCT A;  2UVG A;  4HE0 A;  2GQ1 A;  1NV3 A;  4U21 A;  2REJ A;  4PF8 A;  1LFH A;  2G93 A;  3S2V A;  2M8C A;  1NUZ A;  3ZKL A;  2DWJ A;  5ITO A;  5ELV A;  1B5H A;  1FQF A;  4G77 A;  2O68 A;  3TAJ A;  3FAT A;  2XA5 A;  4GRK A;  1B2H A;  4QSE A;  4IO6 A;  4U4S A;  2W7Y A;  4HTG A;  3FVN A;  1LBV A;  1XT8 A;  4RK2 A;  3TTL A;  4PCD A;  1IXG A;  1G0H A;  3OO9 A;  4P1E A;  1EYI A;  1BK4 A;  2FVZ A;  4AB6 A;  2HCA A;  1QUJ A;  2ZZV A;  3ONM A;  3C9H A;  4H8J A;  1RDX A;  2DE2 A;  3SET A;  3H6T A;  5IAI A;  4QFL A;  5FHM A;  3KZG A;  3FXQ A;  3LC8 A;  4XTC Q;  1XVX A;  4OVT A;  3D4C A;  4HS7 A;  4Z0I A;  4ZEC A;  3SEY A;  5K2Y A;  4XKN A;  3KEI A;  3PD9 A;  3HFU A;  2DWA A;  3PV0 E;  2FA7 A;  4M4G A;  1FPF A;  2Q2C A;  3EHT A;  3O6I A;  3O66 A;  4LZ8 A;  5I2N A;  1A7L A;  4TLM B;  5IZZ A;  5IZ3 B;  2V3U A;  4P0G A;  4IGT A;  3KSX A;  1OVT A;  4DDD A;  2QS2 A;  2DOJ A;  3C34 A;  4G61 A;  3FVG A;  2BJJ X;  4PBH A;  4GLI A;  2O6A A;  1PBP A;  3E79 A;  1FQD A;  4OEU A;  3ILT B;  3OO8 A;  2UXA A;  1FTA A;  1XI6 A;  2IA4 A;  1A8F A;  3I6V A;  2XX8 A;  1NNT A;  2PX1 A;  1FJ9 A;  3BFU A;  3G7W A;  2XHD A;  5B7D A;  3TOD A;  5L8D A;  2XXQ A;  4PBQ A;  4OVJ A;  3C36 A;  4JBZ A;  4ELP A;  1FJ6 A;  5FBP A;  3Q29 A;  1AIV A;  5J16 A;  4IY5 A;  3OEN A;  4GVO A;  1JQF A;  1NFT A;  4DZ1 A;  1QUK A;  1K9Z A;  5FTI A;  4OEN A;  4JWX A;  1UQW A;  4Q5T A;  2Q89 A;  2MKZ A;  3VLW A;  1A55 A;  5TP9 B;  1FBG A;  1S50 A;  4OXV A;  3IB1 A;  1FW0 A;  5JTY A;  2FBP A;  3LR1 A;  5EYG A;  5H8F B;  5CM6 A;  3LBS A;  3RT6 B;  3K0V A;  4X9T A;  2O69 A;  1FBC A;  3Q26 A;  1XC1 A;  4I40 A;  3B6W A;  4F22 A;  4R74 A;  4FBP A;  2GH9 A;  1FBE A;  3ILU B;  4F2O A;  1JEU A;  1B3H A;  3C35 A;  1EU8 A;  1LBX A;  1MDP 1;  4OEV A;  4MMP A;  3RPL B;  3SER A;  5LDZ A;  3I3V A;  3PMW A;  4QXD A;  4F1Y A;  2RF1 A;  3S9M C;  4NG7 A;  2OK2 A;  4POW A;  1YCJ A;  3PMV A;  1GGG A;  1O64 A;  2E1S A;  1NUX A;  5KDT B;  1SW1 A;  2DQV A;  4P8B A;  4NTL A;  1B7H A;  2I48 A;  1INP A;  1HSJ A;  2CZK A;  1EYK A;  1SW5 A;  4UAB A;  4GWY A;  3N94 A;  3KJ7 A;  3FUZ A;  5HPQ A;  1FQC A;  4EUO A;  4ZEF A;  4LVQ A;  3RLF E;  2HFB A;  3SZP A;  1IXH A;  1NNK A;  1POY 1;  4E0X A;  2XXH A;  4PFB A;  2V4C A;  3U72 A;  1R9Q A;  3KOS A;  3T9H B;  3TZA A;  4MFI A;  5HBC A;  4Z7E A;  5DEX B;  1VSO A;  1WVJ A;  4NE4 A;  5TU0 A;  1QUI A;  3KFM A;  4OFJ A;  4X1B A;  1B5J A;  1IMA A;  3TCF A;  1I69 A;  3CG3 A;  4ZEI A;  1FPK A;  4DE8 A;  4NF8 A;  3RQT A;  3MZ9 A;  3CIJ A;  2OWZ A;  4N8G A;  3IJX B;  4LQ2 A;  5KCJ B;  1MH3 A;  2AYS A;  2VT5 A;  1P1Q A;  2QPQ A;  4NX1 A;  4PFI A;  3OEL A;  3TUS A;  4JB7 A;  3A3C A;  1OQG A;  2FIX A;  2WBD A;  4DXC A;  1Y3Q A;  4ESX A;  3RY3 A;  3TMG A;  4JVD A; 
#chains in the Genus database with same CATH homology
 2QS3 A;  3ZSF A;  4EF1 A;  3JZJ A;  4L17 A;  5H8S A;  3KN8 A;  3V89 B;  5CMK A;  1DPP A;  5I2K B;  3GXA A;  4LZ7 A;  4RJZ A;  3C33 A;  3IB0 A;  1MY0 A;  1H3D A;  3SEU A;  2NWJ A;  5H8H B;  4EF2 A;  4LAT A;  3B6Q A;  3USD A;  2DE4 A;  4MBP A;  4N07 A;  4UAC A;  2PYY A;  4RY1 A;  1A8E A;  2RC9 A;  4RYA A;  1QJM A;  3U93 A;  4RXL A;  4IO7 A;  2RC8 A;  3CFX A;  3IOT A;  1B0H A;  4FEB A;  4HCY A;  3VDF A;  1IUD A;  5DT6 A;  4H0W A;  1ZTY A;  4EQB A;  1NNF A;  4ZZA A;  3TYH A;  4ONY A;  4LON B;  4GL0 A;  1DPE A;  4POX A;  4ECF A;  1CB6 A;  2DE3 A;  3RUM A;  5DEX A;  4GD5 A;  4OES A;  2VGQ A;  3GZG A;  4RPN A;  4BDQ A;  2H99 A;  2QS4 A;  2V3Q A;  2XD2 A;  2RKM A;  4YKP A;  3IL1 B;  4KPT A;  3S9E A;  5KCJ A;  5JK4 A;  5H8Q B;  1MPC A;  3FV2 A;  1B0L A;  2QS1 A;  1POT A;  4IY6 A;  2XXP A;  4C1T A;  2O7U A;  3S4U A;  4P11 A;  3WAF A;  1LFG A;  4KCC A;  1LAG E;  3MVX A;  4G68 B;  5CI5 A;  4NF4 A;  3LSW A;  2R71 A;  3BFT A;  2F78 A;  4ESW A;  4PP0 A;  4H65 A;  2ONS A;  2B3B A;  1B3G A;  1MY2 A;  1SI1 A;  4GF8 A;  5EHM A;  3DM0 A;  1YAE A;  5H8H A;  1A99 A;  2YLN A;  5FHO A;  3TQW A;  2Y7P A;  4F39 A;  1MQH A;  3WAE A;  2OBG A;  5ICQ A;  2UVI A;  3FJG A;  3HCQ A;  1EZ9 A;  1MM6 A;  3OO6 A;  3CRB A;  3OOA A;  1B3E A;  2NUV A;  3O9P A;  4FOR A;  4PE5 B;  2QSX A;  3TDJ A;  3UIF A;  3B6T A;  1AOV A;  3QIM A;  4FAT A;  5AA2 A;  1PB7 A;  1P1W A;  2B65 A;  3W15 C;  2DSF A;  4KI0 E;  3SEX A;  1US5 A;  4IO3 A;  1LST A;  2ZNU A;  3FJM A;  5A5X A;  4XIG Q;  3Q27 A;  2B3F A;  1US4 A;  4FED A;  3IOW A;  1Y20 A;  1F9B A;  2F6P A;  4OFO A;  3VXB A;  4ELO A;  4Q0C A;  5I2N B;  3V8X B;  2FYI A;  4R73 A;  2R6G E;  3H6W A;  4E0W A;  1Y3P A;  3T9U A;  1B3F A;  4AB5 A;  3PUV E;  3PUW E;  1EZO A;  3SEW A;  3FVK A;  1SYI A;  3QXM A;  3K2D A;  2PBW A;  4F29 A;  2PMS A;  2IEE A;  3U92 A;  4EQ7 A;  2XXX A;  3G3H A;  5DVI A;  4YZZ A;  1P1U A;  3ZS6 A;  1SVX B;  1Y4T A;  3TEP A;  1B4H A;  3CSG A;  2F7A A;  3VVD A;  3GBB A;  1T0K A;  4K3F A;  1B46 A;  5ICT A;  2F6G A;  4C0R A;  3THI A;  1B1X A;  1N7X A;  1JW4 A;  4KQP A;  5FHN A;  4U4X A;  3PPP A;  2Z22 A;  4PQJ A;  1FQB A;  3H4Z A;  5JTY B;  1Q35 A;  2I3V A;  4R6Y A;  2ZXT A;  2RIN A;  2THI A;  4YMB A;  2PVU A;  3O97 A;  1R1N A;  4DIG A;  1B32 A;  3HN0 A;  4EDP A;  2ESN A;  3JYR A;  2OZZ A;  4OET A;  4H67 A;  3RN8 A;  5DVF A;  4QSC A;  1MY4 A;  4JSD A;  2PT2 A;  2DWI A;  4FEC A;  1S9T A;  1WOD A;  3RTF B;  2UVH A;  1R6Z A;  4ELQ A;  2DYX A;  3O28 A;  4DCY A;  3SKP A;  3O6G A;  3E13 X;  1DSN A;  5I84 A;  1PBQ A;  4F3P A;  3Q28 A;  1BTJ A;  2XXW A;  1LBB A;  4RK9 A;  1NH7 A;  4NMY A;  4OWD A;  1B5I A;  1TFA A;  3W9V A;  4ZED A;  1YPN A;  4IB2 A;  4OER A;  4JXI A;  4YMA A;  2DWH A;  4NF5 A;  1QUL A;  5DTB A;  1OVB A;  2GRV A;  4LUB A;  3TTR A;  1IIT A;  2Y7R A;  3K00 A;  4YU0 A;  1N3W A;  1PDA A;  2NVU B;  3M3L A;  1NMU A;  2WKY A;  4JWO A;  2R9J A;  3MP1 A;  4EXK A;  2P2A A;  5AA4 A;  3OO7 A;  3H7M A;  2ANJ A;  5B70 A;  2X26 A;  2VD2 A;  1H76 A;  3IOU A;  2D21 A;  4KYE A;  3HPI A;  3PPQ A;  4NF8 B;  4GL8 A;  2F36 A;  4XKR A;  3H03 A;  5J1D A;  3FAS A;  3M3K A;  3VFJ A;  1MXU A;  2Q9T A;  3CI8 A;  1SI0 A;  3IO6 A;  3MVZ A;  2OWT A;  4I9D A;  3FZV A;  1B9J A;  5TPA B;  2VHA A;  3CFL A;  1M5C A;  3IB2 A;  3OSR A;  3U94 A;  4GOT A;  3KN3 A;  3BKI B;  5EHS A;  2QL3 A;  1TXF A;  3PPO A;  4YKK A;  2QMX A;  5I58 A;  1UIU A;  3K6V A;  2VP1 A;  2I4B A;  1Y1Z A;  4H5F A;  4RPO A;  3CVG A;  1MQD A;  3TKD A;  2YJP A;  5IKB A;  3PMX A;  5ISU A;  1AMF A;  1LAX A;  1Z7M E;  3TFL A;  2Z8F A;  1URG A;  5AE4 A;  5KZT A;  1JEV A;  3RTW B;  4I62 A;  2Y7I A;  2LAO A;  5F1Q A;  4H6D A;  3VXC A;  4OMB A;  4DCX A;  4QFN A;  4F3G A;  4Q8R A;  1SW4 A;  3EPE A;  1D4N A;  3TTM A;  3PU5 A;  3O29 A;  5I56 B;  1B51 A;  3FD3 A;  4FJP A;  3PUY E;  1MQJ A;  1CE2 A;  2XXT A;  1ZBM A;  5L9M A;  1OMP A;  3T22 A;  1JVY A;  1GTK A;  1XOC A;  1ANF A;  4GWO A;  4R75 A;  4H8I A;  2ZNS A;  3I5O A;  2QRY A;  1P99 A;  3RPW A;  3C32 A;  5I59 A;  4NF4 B;  4R6K A;  1IXC A;  5TPA A;  3K01 A;  4PFU A;  2I58 A;  4F3B A;  1VFE A;  1ELJ A;  1DTG A;  3KJT A;  2HAV A;  5EYF A;  3HO7 A;  3MWB A;  3B7D A;  1MS7 A;  3E4R A;  4BLA A;  4FAJ A;  3G3G A;  2G29 A;  2ZYO A;  1ZIU A;  1II5 A;  4RNS A;  5CMB A;  3SES A;  1FQE A;  1M5F A;  4YKI A;  2F97 A;  2O51 A;  2QMW A;  1Z7N E;  3UGW A;  3QSL A;  2XX7 A;  1QKB A;  2FNC A;  2ZMB A;  2D3I A;  4H5G A;  1B40 A;  2E0S A;  4NWC A;  4F1V A;  4PFW A;  4F1U A;  3H6U A;  5AA2 B;  3LUY A;  1A54 A;  3MZ1 A;  1H44 A;  2ZYM A;  4OTE A;  3HHF A;  4TOZ A;  4MF3 A;  3DEL B;  5A5X B;  5I56 A;  1FTM A;  3HST A;  2ONR A;  3UA8 A;  1UTB A;  1MXY A;  4KD5 A;  2HQ0 A;  2QJE A;  2XXR A;  3P7I A;  3QAX A;  1ATG A;  5I57 A;  3S9L C;  2ZYK A;  3BBR A;  3QK6 A;  2ABH A;  4WEP A;  1LB9 A;  2A5T A;  2HZL A;  4F3S A;  4EQ9 A;  3VE1 B;  3DLN A;  3MPL A;  4U2R A;  4U22 A;  2DVZ A;  4TLL B;  1Y3N A;  4NED A;  2F34 A;  2VD3 A;  2XD3 A;  3G3I A;  3MVW A;  1O7T A;  3TQL A;  4IO5 A;  2O1M A;  3U1O A;  3VVE A;  3MP6 A;  4U23 A;  1UTH A;  1B05 A;  3QUJ A;  4YAH X;  3M8U A;  4LZ5 A;  3G3F A;  3A3U A;  3MZB A;  3KN7 A;  2AIX A;  3H6V A;  3L6G A;  1TT1 A;  3KGC A;  5HM4 B;  3K4U A;  2XXV A;  3VLU A;  4G4P A;  3T96 B;  3JV9 A;  3ZKK A;  1ZMG A;  3IX1 A;  4O3B A;  5BUU A;  3R26 A;  3UOR A;  2XX9 A;  2Y7W A;  4ZS9 A;  1AH5 A;  3T9X B;  2F35 A;  4NF6 A;  1MPB A;  3FV1 A;  3MC2 A;  1Y1M A;  3IAZ A;  1UIV A;  3EHU A;  4ZDM A;  4AQ4 A;  1LCF A;  3VVF A;  4KHZ E;  3F11 A;  1M5B A;  1KWH A;  3K1M A;  2CMO A;  1MXX A;  4M1V A;  1O63 A;  5AA1 A;  1ZU0 A;  3RGY A;  2ALU A;  4O3A A;  3G3J A;  1LFI A;  3T9V A;  1H43 A;  2Q2A A;  5H8N B;  3TCG A;  4WKM A;  2H25 A;  4BDR A;  2AL4 A;  3DP4 A;  1JNF A;  2P0S A;  1SW2 A;  4G8H A;  3K6W A;  5BWJ A;  1H45 A;  4QFK A;  3OSQ A;  4BDL A;  3N6T A;  3N5L A;  2X7Q A;  3UK4 A;  2I49 A;  4RA1 A;  5CRY A;  3KBR A;  1TFD A;  3UN6 A;  1B6H A;  4BDM A;  4NF5 B;  3OD7 A;  3E3K A;  1RKM A;  2XXY A;  4ND9 A;  3CFZ A;  2V3T A;  1D3K A;  4EXL A;  2XXI A;  2GHA A;  4DXB A;  2NOO A;  1IIW A;  1USY E;  5AA4 B;  3S9N C;  2D5W A;  1JW5 A;  3PD8 A;  3M3F A;  2O7I A;  1I6A A;  1SBP A;  2HZK A;  3RT8 A;  1R9L A;  1PEB A;  3K02 A;  1EZP A;  3N26 A;  3OEM A;  2I0C A;  2UYE A;  4PFT A;  4LA9 A;  3K6X A;  2UVJ A;  3KG2 A;  5FTH A;  3QYT A;  4X48 A;  3MVY A;  4QFP A;  1I6B A;  4KR5 A;  1BLF A;  4TQU Q;  1NH8 A;  1IZ1 A;  4ZEK A;  1FTO A;  4KYD A;  4DXU A;  4C1U A;  4NWD A;  2V25 A;  5AA3 A;  5H8N A;  4IGR A;  1PB9 A;  3OMB A;  4GIZ A;  2Y7K A;  4H1X A;  5I58 B;  4MLQ A;  2RCB A;  3MUQ A;  3PPR A;  1VR5 A;  4OYV A;  4YB6 A;  4QF9 A;  4KYS A;  4YIC A;  1L5T A;  2F7B A;  3PUX E;  1QVS A;  2A5S A;  4XKQ A;  1JVX A;  5DVJ A;  2F5X A;  5K2X A;  1MQG A;  4U1Z A;  1USY H;  5CMC A;  4WED A;  3FXU A;  1OLA A;  4QSD A;  3T66 A;  1DOT A;  2P1S A;  3MJN A;  1OQH A;  2V93 A;  1DMB A;  1N3X A;  3MAM A;  2H98 A;  1IEJ A;  4Q30 B;  2HXW A;  5AA2 D;  3DP6 A;  4LQ5 A;  4ZE8 A;  4ZE9 A;  3E9X A;  1N84 A;  1MXV A;  2I3W A;  1XHY A;  5LOM A;  3ODB A;  1MY1 A;  3FIR A;  3TEL A;  5JEI A;  1GV8 A;  2Z8E A;  2Z8D A;  5I59 B;  5L9O A;  5M2V A;  2HAU A;  4MH5 A;  5ITP A;  4XXU A;  3FXR A;  2UYF A;  5L9S A;  1RYO A;  4F19 A;  2Z23 A;  1FTK A;  1OLC A;  4FE8 A;  4UA8 A;  3SDF A;  1N76 A;  1NL5 A;  2H5Y A;  4R2B A;  1MQI A;  4ELR A;  4G8N A;  1MG1 A;  2Q8J A;  1QW0 A;  2VOZ A;  2O84 X;  1JW1 A;  2O1L A;  1DTZ A;  1B7Z A;  1XS5 A;  3ECR A;  3FVO A;  1SD3 A;  2OCU A;  3LSL A;  2F7C A;  4R72 A;  3OXN A;  3EHS A;  4ISU A;  2ONK E;  3EF7 A;  1MH4 A;  2DVC A;  3KOT A;  1P1O A;  1TWY A;  1AL3 A;  2GFE A;  3LSF B;  3O6H A;  3V5A A;  3GBA A;  4YKJ A;  4HCW A;  1PB8 A;  3CG1 A;  3U8Q A;  2PT1 A;  2X7P A;  3MBP A;  1LAH E;  1LB8 A;  4R9G A;  3IR1 A;  1B52 A;  1D9Y A;  5TP9 A;  2I0B A;  4GQO A;  4X1D A;  1UTB B;  1P1N A;  4HW8 A;  2Q88 A;  5H8F A;  5I57 B;  1PC3 A;  3PPN A;  3Q25 A;  3FGS A;  4FIM A;  1NKX A;  3W9W A;  2A5T B;  5F7V A;  1Y4C A;  2H9B A;  4F18 A;  5CMM A;  3LSX A;  1I6Q A;  4BDO A;  4BDN A;  3OEK A;  1MRP A;  4QRZ A;  2OJT A;  1RYX A;  1MY3 A;  3SEV A;  4R2F A;  2DXY A;  1MXZ A;  3QUF A;  1GR2 A;  2YPN A;  1M5D A;  2AL5 A;  1UTH B;  4U1O A;  5CBR A;  3FJ7 A;  3A09 A;  2I4C A;  3TPA A;  3KSJ A;  3K1P A;  3IO4 A;  5KDT A;  4OFL A;  3EN3 A;  1MDQ A;  2Y84 A;  2F8D A;  2V84 A;  1ZKB A;  4N13 A;  4G2Z A;  4F31 B;  5CBS A;  3G3K A;  1B7U A;  2DXR A;  4MLV A;  1N0T A;  3HHG A;  3EQ1 A;  1S7Y A;  1LLS A;  4QHQ A;  1MPD A;  4JWY A;  3RNN A;  3C31 A;  4NF6 B;  3MW0 A;  4ZEB A;  1IXI A;  1IQ7 A;  1NNP A;  1N7W A;  3L6H A;  3AXF A;  3HV1 A;  3UP9 A;  4OZ9 A;  3TTK A;  2OWS A;  3C4M A;  4IO2 A;  3K1N A;  3H3G A;  3R6U A;  1QKA A;  1A40 A;  4DLD A;  1FTL A;  3O2A A;  1B3L A;  3D4G A;  4R9F A;  4R6H A;  1Y9U A;  1HSL A;  3MQ9 A;  4JDF A;  4KCD A;  4PET A;  1FTJ A;  4WXJ A;  1M5E A;  3T93 B;  3IOV A;  4YB5 A;  5DYH A;  4GXA A;  1BP5 A;  4OQO A;  3N6U A;  4QFO A;  1FQA A;  3DP8 A;  4F2Q A;  2RC7 A;  2DP8 A;  4O3C A;  2H4I A;  5I2K A;  2NXO A;  2GHB A;  1BIY A;  1LAF E;  1FCK A;  3PGF A;  2REG A;  3K6U A;  1B58 A;  2RCA A;  4GXS B;  5CC2 A;  2HEU A;  1WDN A;  3PUZ E;  4N6P A;  2ZNT A;  3CR9 A;  2OLB A;  4PFY A;  3CSB A;  3IOR A;  1XVY A;  1MXW A;  3VLV A;  4P0I A;  1SQY A;  3IJO B;  3GLB A;  4OHN A;  3MP8 A;  4G68 C;  4XKP A;  1YTV A;  3TTN A;  2I6E A;  2KLF A;  1SYH A;  3H06 B;  4YB7 A;  1D9V A;  4KFQ A;  1OIB A;  1GVC A;  4GFR A;  1B1H A;  1JET A;  1HSE A;  4IO4 A;  3V83 A;  4ZZE A;  1Q1K A;  2DS9 A;  3R7X A;  4THI A;  1N04 A;  3MPK A;  1URS A;  1SDX A;  5H8Q A;  1EH3 A;  1B4Z A;  1URD A;  1MM7 A;  4I1D A;  3IK6 B;  2XXU A;  1BKA A;  1J1N A;  1LBC A;  4I8C A;  1ZJL A;  1VE4 A;  1VFD A;  1ZLQ A;  4G8M A;  2ZYN A;  2CZL A;  3TCH A;  3VV5 A;  1LGB C;  4LP2 B;  4JSO A;  4G68 A;  1LCT A;  2UVG A;  4U21 A;  2REJ A;  1LFH A;  2G93 A;  3S2V A;  2M8C A;  3ZKL A;  2DWJ A;  5ITO A;  5ELV A;  1B5H A;  1FQF A;  4G77 A;  2O68 A;  3TAJ A;  3FAT A;  4GRK A;  1B2H A;  4QSE A;  4IO6 A;  4U4S A;  2W7Y A;  4HTG A;  3FVN A;  1XT8 A;  4RK2 A;  3TTL A;  1IXG A;  3OO9 A;  4AB6 A;  2HCA A;  1QUJ A;  3ONM A;  3C9H A;  4H8J A;  2DE2 A;  3SET A;  3H6T A;  5IAI A;  4QFL A;  5FHM A;  3KZG A;  3FXQ A;  3LC8 A;  4XTC Q;  1XVX A;  3D4C A;  4HS7 A;  4Z0I A;  4ZEC A;  3SEY A;  5K2Y A;  4XKN A;  3KEI A;  3PD9 A;  2DWA A;  3PV0 E;  2FA7 A;  4M4G A;  2Q2C A;  3EHT A;  3O6I A;  3O66 A;  4LZ8 A;  5I2N A;  1A7L A;  4TLM B;  2V3U A;  4P0G A;  4IGT A;  3KSX A;  1OVT A;  4DDD A;  2QS2 A;  2DOJ A;  3C34 A;  3FVG A;  2BJJ X;  4GLI A;  2O6A A;  1PBP A;  1FQD A;  4OEU A;  3ILT B;  3OO8 A;  2UXA A;  2IA4 A;  1A8F A;  3I6V A;  2XX8 A;  1NNT A;  2PX1 A;  3BFU A;  3G7W A;  2XHD A;  5B7D A;  3TOD A;  5L8D A;  2XXQ A;  4OVJ A;  3C36 A;  4JBZ A;  4ELP A;  3Q29 A;  1AIV A;  4IY5 A;  3OEN A;  4GVO A;  1JQF A;  1NFT A;  4DZ1 A;  1QUK A;  5FTI A;  4OEN A;  4JWX A;  1UQW A;  4Q5T A;  2Q89 A;  3VLW A;  1A55 A;  5TP9 B;  1S50 A;  4OXV A;  3IB1 A;  1FW0 A;  5JTY A;  3LR1 A;  5H8F B;  5CM6 A;  3LBS A;  3RT6 B;  3K0V A;  4X9T A;  2O69 A;  3Q26 A;  1XC1 A;  3B6W A;  4F22 A;  4R74 A;  2GH9 A;  3ILU B;  4F2O A;  1JEU A;  1B3H A;  3C35 A;  1EU8 A;  1MDP 1;  4OEV A;  3SER A;  3I3V A;  3PMW A;  4F1Y A;  2RF1 A;  3S9M C;  2OK2 A;  4POW A;  1YCJ A;  3PMV A;  1GGG A;  1O64 A;  2E1S A;  5KDT B;  1SW1 A;  2DQV A;  4NTL A;  1B7H A;  2I48 A;  1HSJ A;  1SW5 A;  3N94 A;  3KJ7 A;  3FUZ A;  5HPQ A;  1FQC A;  4EUO A;  4ZEF A;  4LVQ A;  3RLF E;  2HFB A;  1IXH A;  1NNK A;  1POY 1;  4E0X A;  2XXH A;  3U72 A;  1R9Q A;  3KOS A;  3T9H B;  3TZA A;  4MFI A;  5HBC A;  4Z7E A;  5DEX B;  1VSO A;  1WVJ A;  4NE4 A;  5TU0 A;  1QUI A;  3KFM A;  4OFJ A;  4X1B A;  1B5J A;  3TCF A;  1I69 A;  3CG3 A;  4ZEI A;  4DE8 A;  4NF8 A;  3RQT A;  3MZ9 A;  3CIJ A;  3IJX B;  4LQ2 A;  5KCJ B;  1MH3 A;  2AYS A;  1P1Q A;  2QPQ A;  3OEL A;  3TUS A;  4JB7 A;  3A3C A;  1OQG A;  4DXC A;  1Y3Q A;  4ESX A;  3RY3 A;  3TMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...