1IXGA

Phosphate-binding protein mutant with thr 141 replaced by asp (t141d), complexed with phospate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGDSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A low energy short hydrogen bond in very high resolution structures of protein receptor--phosphate complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
total genus 107
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1996-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixgA02
1D3KA 4H1XA 3M3FA 4KYSA 2VD2A 3S2VA 1Q35A 1B58A 1MQIA 1ZLQA 4OZ9A 3A09A 3K6WA 4BDNA 3LC8A 4DLDA 4YMBA 2RCBA 5DVIA 1EZOA 3B7DA 2OBGA 3V89B 4FORA 4F39A 3FVNA 4F29A 3QAXA 4R2FA 4EXLA 4FEDA 3TDJA 1SYIA 1FQDA 4WEPA 4O3BA 4ISUA 3KOSA 4NMYA 1IXHA 1FQEA 2CMOA 4FE8A 1FCKA 2DE4A 1FQBA 3D4GA 5TPAA 4R9GA 1B4HA 1Y1MA 3RN8A 5ICTA 4MH5A 1LB9A 1OVBA 2F34A 2V84A 4P11A 3V5AA 2F5XA 1TFDA 4YB7A 2R6GE 4HS7A 2OK2A 2ZYKA 2GHAA 1F9BA 2F35A 4G4PA 2UVJA 2PBWA 4JDFA 3KEIA 3MZ9A 3ZSFA 3SETA 1LCFA 3T93B 1RKMA 3OXNA 1US5A 1Z7NE 3UK4A 5DT6A 2VHAA 4OQOA 4OEUA 3PPNA 2PMSA 1BTJA 5CMBA 4BDQA 3K1PA 2DP8A 1JW1A 4MLVA 3LUYA 4XXUA 4HCWA 4F22A 5H8QB 3WAFA 3QSLA 3RNNA 1VSOA 3K00A 4FAJA 5H8FA 1UIUA 2F7BA 2XXYA 4PFYA 4OETA 4F3GA 1H43A 1M5BA 3E9XA 1QJMA 1A54A 1MDP1 2QMXA 3K02A 3KG2A 3MPLA 2O7IA 4H8JA 3UORA 3TCHA 1LLSA 3KFMA 5B7DA 5CBSA 3KN8A 4X48A 5J1DA 3MVWA 3B6QA 2QS3A 1UTBA 1GR2A 4N6PA 2O84X 2HZLA 1MH3A 4Q8RA 1T0KA 3MVXA 4IY6A 2F8DA 3ILTB 5JK4A 1JW4A 4KCCA 4R75A 3TYHA 3LBSA 2ANJA 2RKMA 3C33A 4OHNA 4DZ1A 1II5A 1JETA 4RNSA 3OSQA 3M8UA 4PFUA 3MZBA 4RYAA 4YAHX 3PPOA 4R6HA 1J1NA 4Q5TA 2HFBA 3PMWA 4H8IA 3ODBA 1PEBA 2D5WA 2Q9TA 5AA1A 5H8HA 1SBPA 3SEXA 1IUDA 2QS1A 4HW8A 4ZEDA 5F1QA 1AIVA 3HSTA 3WAEA 1HSEA 1I69A 4OFOA 2Q2CA 4JWOA 2PT1A 3KGCA 2AIXA 4QF9A 2DOJA 1OLAA 4IGRA 2I0CA 4I8CA 5ITPA 5KZTA 1ZBMA 4JSDA 4JSOA 1ZTYA 3RT8A 1Q1KA 2X7QA 4NF8A 4ZEKA 3U94A 5AA2A 5LOMA 1OMPA 2KLFA 2NUVA 1BLFA 3HN0A 1MS7A 4FEBA 3BFUA 4KYDA 4GOTA 1B3LA 2ZNSA 3SEYA 1GTKA 3PMXA 3T9VA 2Y7IA 4FATA 1UIVA 1ZJLA 1MXZA 1NNKA 3H6WA 4POWA 2QRYA 3TCFA 5IKBA 1HSLA 2RCAA 3E13X 2X7PA 1TXFA 1LCTA 2DYXA 2GFEA 3GXAA 4M1VA 3T9XB 3TQLA 3U93A 3K6UA 3S9EA 5ELVA 3CG3A 3VXBA 1B9JA 1MY0A 2RINA 3ILUB 3M3KA 5AA4A 1B3EA 2AYSA 3IB0A 5TP9B 5CC2A 4QFLA 1M5CA 1MPCA 1N3XA 1UTBB 4K3FA 5CBRA 1MXYA 4IO6A 3LSFB 3T22A 2FYIA 2RC8A 5FHOA 1PB8A 4GXAA 3VXCA 3RY3A 4RXLA 1EZ9A 5ITOA 2X26A 4OENA 3K0VA 3F11A 4JBZA 4OMBA 5EHSA 3MVYA 2UVIA 3CR9A 3H3GA 5CMKA 1A7LA 3O97A 4MF3A 5I56B 1DPEA 3IOWA 2UXAA 1H76A 3OD7A 3TODA 3CFXA 3Q25A 3H6VA 1QKAA 2FA7A 3C35A 3PD9A 3QIMA 4QHQA 4BDMA 3N6TA 3Q26A 3H06B 2H4IA 3OOAA 1B3HA 3T66A 1LBBA 2VP1A 3CIJA 4TLLB 3H4ZA 2D3IA 2O7UA 4RPOA 3G3KA 4IO7A 1IXGA 3HPIA 4NWDA 3IO6A 3IX1A 5H8NB 4F3PA 2VGQA 2BJJX 3C4MA 4R9FA 3C31A 3FVOA 3FZVA 4KPTA 3BFTA 4YMAA 2UVHA 4EXKA 1QULA 1R1NA 1URSA 3HHFA 1MY3A 3HCQA 3SERA 1I6AA 3QYTA 1MG1A 2ESNA 2XD2A 3MP6A 5L9SA 4QSDA 3TZAA 1MPBA 4Z0IA 4DCYA 1O7TA 4F2QA 1B7HA 3MUQA 1POTA 2AL5A 1ZMGA 3IB2A 2XXHA 3CRBA 3O28A 4QFOA 3EF7A 1ZU0A 3K6VA 1BP5A 2ZYNA 5I59B 1MXWA 3DLNA 2I4CA 4ELQA 3FXUA 2E1SA 4G77A 4ELOA 4NTLA 3K4UA 3PUVE 4XKQA 4GLIA 5I2NA 5H8NA 2DXYA 3TCGA 4AQ4A 1XT8A 1P99A 3OO9A 4EQ9A 1LFGA 1LAXA 2F7CA 4XIGQ 3TPAA 5FTHA 3G3FA 1NL5A 2UYEA 5KDTA 4OESA 1P1UA 4LATA 4LZ8A 2YLNA 3TTMA 3CVGA 2ALUA 5L9MA 2O1LA 3O6IA 3VLWA 2B65A 3GBAA 1XS5A 2P0SA 4TQUQ 3U8QA 1DOTA 2REJA 1H3DA 2Z8DA 1S9TA 3KOTA 1NNPA 2NOOA 2QS4A 4UACA 2RC7A 3MVZA 3TEPA 1IXIA 1M5DA 3U72A 3UP9A 4ELPA 1B4ZA 1XHYA 2ZYOA 4R2BA 1B3FA 3MAMA 5TPAB 3DP6A 1R9QA 1US4A 2Q2AA 4QFKA 5AA4B 3ZKLA 4DXUA 3MW0A 5EHMA 2HEUA 4G68B 3KJTA 4DDDA 2OLBA 5I56A 4FIMA 1Y3QA 2V25A 3KBRA 4I9DA 4ZDMA 2XXXA 3O29A 5FHMA 3U92A 1LAHE 1PBPA 4EQBA 1RYXA 2Y7RA 2NWJA 4DCXA 5I58B 4NF5B 1P1NA 5IAIA 4ELRA 1AOVA 1R9LA 3Q28A 1MY2A 3PPRA 4LZ5A 3VVFA 3Q29A 1ZIUA 3FD3A 3HO7A 1IITA 4G2ZA 4GF8A 3G3HA 4THIA 1Y3NA 3EPEA 4MFIA 4RJZA 5DEXB 4EF1A 3SESA 3KN7A 5I57A 2FNCA 1GV8A 5CM6A 1LFIA 2I48A 3A3CA 2AL4A 3FATA 1FTOA 3N94A 3H6TA 2Z8FA 2G93A 3M3LA 5DTBA 3RT6B 3S9LC 1MQGA 3G3GA 4U4XA 1LB8A 1WDNA 3FXRA 1VFEA 2ABHA 4AB5A 1SI0A 4GL0A 3K1NA 5DVFA 4E0XA 4C0RA 4E0WA 5I57B 5EYFA 1B1XA 4F1UA 1AMFA 3O6GA 3PMVA 1B32A 1B7ZA 3K1MA 4X9TA 5CRYA 1N7WA 4HCYA 1NKXA 3S4UA 2HQ0A 3QXMA 3V8XB 4Q30B 1AL3A 1N3WA 4ESXA 3FV1A 4KHZE 4OTEA 3EHUA 3U1OA 1B5IA 3IJOB 3MC2A 4LVQA 5BUUA 2UVGA 2WKYA 2O6AA 1SVXB 1Y4CA 1H44A 2PVUA 4LP2B 2XHDA 3K2DA 4OYVA 3UIFA 1DPPA 5I2NB 1FTKA 2F6GA 4LQ5A 1EZPA 1TFAA 5ICQA 4NF5A 1CE2A 4C1TA 2I6EA 1MQJA 4LQ2A 1Y3PA 2DWAA 1B6HA 4QSEA 4U2RA 4GWOA 3DELB 1QUIA 3GZGA 3AXFA 4L17A 4XTCQ 4YU0A 3TTNA 1USYE 2H99A 3HV1A 3VLVA 4GVOA 4G8NA 2E0SA 3OO6A 2GHBA 1D9YA 3FJMA 4OVJA 4RY1A 5JEIA 1FTMA 4YKIA 1IIWA 2DE3A 2W7YA 4QSCA 1D4NA 2QSXA 3TELA 2IEEA 1PDAA 1FTJA 4ZEBA 2Y84A 1B5JA 1MXVA 5TU0A 3DP4A 3MPKA 4GXSB 1BIYA 2ZNTA 5AA2D 3FASA 2UYFA 5HBCA 3TMGA 5DEXA 1FQFA 1OQHA 2Z8EA 1P1OA 2V93A 3E3KA 5FTIA 1UTHB 4TLMB 4DXBA 1M5FA 1MY4A 2Q88A 2Z23A 4QRZA 1FW0A 3I5OA 3KJ7A 1B0LA 4DIGA 3FUZA 3O9PA 4H5FA 3W9WA 3VVDA 3OEKA 3G3JA 1PBQA 1D9VA 3PGFA 4IO2A 4OERA 1B0HA 4F2OA 1URGA 1A40A 1QUJA 2HZKA 3L6GA 1URDA 2XXUA 2R9JA 1VR5A 3JZJA 3MBPA 1N04A 3C9HA 2DSFA 3PPQA 3PUWE 1JW5A 4N07A 4YB5A 3VVEA 4OFJA 3PV0E 4ZE9A 1PC3A 2YJPA 2V3TA 2XXIA 3CI8A 3TKDA 3KN3A 1USYH 1XVXA 4IO3A 4EF2A 3FV2A 3IO4A 2NVUB 3VV5A 3QUFA 5DYHA 1EH3A 1FQCA 2XX8A 4ND9A 2ZMBA 3OO7A 5L8DA 2I3WA 3L6HA 2F6PA 4G8HA 1WODA 5I84A 2ZNUA 1SD3A 1EU8A 1YAEA 3HHGA 1KWHA 3EHTA 2HAUA 1JNFA 4GL8A 3G7WA 4DE8A 4NF4B 1OVTA 2XD3A 4JWYA 4R6YA 3DM0A 4F19A 3C34A 2A5TB 4LUBA 2DVCA 4EDPA 4WKMA 3TUSA 5KDTB 3BKIB 3MWBA 5KCJB 5AE4A 3MP8A 1A55A 3FVKA 1B52A 1N84A 2ZYMA 4PETA 2VD3A 1YCJA 1LAGE 4XKNA 4H0WA 5AA2B 1YTVA 2F78A 4R72A 2IA4A 3D4CA 4F18A 1MQHA 3IAZA 1N0TA 1MDQA 1S7YA 3VFJA 1GGGA 4NEDA 3FVGA 4ECFA 1XOCA 3IR1A 4OXVA 4QFNA 3BBRA 2Q89A 4R73A 4IB2A 4YKJA 3DP8A 3RQTA 1I6QA 4G8MA 1P1WA 1FTLA 3OSRA 2I4BA 4OEVA 4X1BA 2CZLA 4NWCA 1I6BA 2THIA 1O64A 3G3IA 2XXWA 1ATGA 3W15C 5CI5A 3N5LA 3R26A 2DQVA 1IZ1A 2QJEA 3IOTA 4KYEA 3MJNA 4IGTA 3KZGA 4XKPA 4BDLA 4KFQA 4NF6B 3H7MA 1B05A 2XXVA 1SI1A 2XXQA 4R6KA 5CMMA 4ZS9A 2DE2A 2Y7KA 4F1YA 4BLAA 4YICA 3TFLA 4IO5A 3I6VA 2DWJA 1TT1A 3O66A 1SW4A 3EQ1A 3V83A 2ONSA 1QVSA 3IOVA 3ONMA 4BDOA 2PX1A 4GD5A 2DWIA 1Z7ME 3A3UA 2O69A 2REGA 1A8EA 1LAFE 3SDFA 1XC1A 1IEJA 1ZKBA 2I0BA 3PUYE 4YZZA 4F1VA 5HM4B 3GBBA 3T9UA 2XX9A 3LR1A 1HSJA 4YKKA 2OWSA 2QS2A 2HXWA 4PQJA 2D21A 4JWXA 2PT2A 1M5EA 4YB6A 2QL3A 4EUOA 4F3SA 3CSGA 3OEMA 5I58A 4OWDA 3ECRA 2ZXTA 1ELJA 3KSXA 4MBPA 3VDFA 1SYHA 5CMCA 1SQYA 4PE5B 3ZS6A 1WVJA 3O2AA 1NMUA 3JV9A 1SW2A 1OQGA 2B3BA 4KI0E 3C32A 3H03A 5H8SA 1P1QA 1H45A 1B3GA 3RUMA 2Y7WA 2F97A 4KQPA 1N7XA 2GH9A 4RK9A 4I1DA 3W9VA 3S9MC 3PD8A 1OIBA 3RPWA 1JVYA 4X1DA 4ZEFA 2PYYA 1L5TA 4ZE8A 3RLFE 4GIZA 1N76A 4U22A 1IXCA 1MM6A 3UGWA 4EQ7A 3ZKKA 4XKRA 1B2HA 4NF4A 5A5XB 4UA8A 2I49A 4AB6A 2M8CA 3FJ7A 3R7XA 2QMWA 1NNTA 1DTGA 2F7AA 2HCAA 3K6XA 4ESWA 1PB9A 2ONKE 4O3AA 4H6DA 1LBCA 3LSXA 3LSLA 3QK6A 1BKAA 4IY5A 5M2VA 3SKPA 4Q0CA 3VE1B 4FJPA 5H8HB 4H67A 3IB1A 2O1MA 4YKPA 4U21A 3T9HB 1XVYA 2Z22A 4U4SA 1NH7A 5FHNA 5JTYB 2Q8JA 4ONYA 4H65A 4F31B 2XXRA 2I58A 2I3VA 4HTGA 4PFWA 2ONRA 4PP0A 4G68C 2OJTA 1MPDA 1B7UA 4RPNA 1AH5A 4ZZAA 1CB6A 2G29A 4LA9A 2LAOA 4U23A 1SW5A 3TTKA 3Q27A 4BDRA 4O3CA 1MY1A 3THIA 3UN6A 3OELA 3IK6B 3H6UA 4WEDA 5TP9A 3T96B 4G68A 4ZECA 1JVXA 3S9NC 2F36A 3B6WA 3FXQA 5B70A 2RC9A 3MQ9A 4NE4A 3SEWA 3CG1A 1DMBA 1LGBC 1MQDA 1YPNA 2Y7PA 3B6TA 2GRVA 1UTHA 4IO4A 3RGYA 1MRPA 2O51A 4FECA 3EN3A 1QUKA 1B46A 2P1SA 2H25A 3CFZA 3TTLA 2DXRA 1NFTA 2DWHA 1MXUA 4U1ZA 3MP1A 5H8FB 5DVJA 4GFRA 2DVZA 3E4RA 1QW0A 2O68A 1SW1A 1JQFA 3IORA 1MM7A 1FQAA 3JYRA 3O6HA 3KSJA 2YPNA 2DS9A 3CFLA 4I62A 1B40A 4JB7A 1NH8A 1VFDA 3RTFB 5ISUA 1A99A 1MXXA 3FGSA 4RA1A 2QPQA 2XXTA 4M4GA 4ZZEA 3QUJA 3EHSA 4GRKA 4DXCA 1R6ZA 1VE4A 1Y9UA 3SEUA 1MH4A 4NF6A 3SEVA 3TTRA 1ANFA 4LONB 1O63A 4GQOA 2B3FA 4POXA 3K01A 3I3VA 3R6UA 1Y4TA 2XX7A 1DSNA 1TWYA 1OLCA 3CSBA 3LSWA 3PPPA 4LZ7A 5I59A 5L9OA 2H5YA 1A8FA 4R74A 5HPQA 2R71A 3TQWA 1SDXA 4KR5A 3UA8A 1POY1 3MZ1A 3OENA 1Y1ZA 2XXPA 2A5TA 2H9BA 4QFPA 3RTWB 3USDA 1S50A 1PB7A 3IOUA 3PUZE 4TOZA 2VOZA 1JEVA 3FIRA 5I2KA 4F3BA 2HAVA 4KD5A 1B51A 4PFTA 1QKBA 5H8QA 3OO8A 3TAJA 3GLBA 5A5XA 2H98A 1NNFA 2V3QA 4OFLA 1B5HA 4Z7EA 2P2AA 2RF1A 1Y20A 3IJXB 4ZEIA 4P0IA 3P7IA 2NXOA 5JTYA 3N26A 1LFHA 4P0GA 3N6UA 1IQ7A 1RYOA 4U1OA 1UQWA 4JXIA 4N13A 4NF8B 5KCJA 3FJGA 1DTZA 5K2XA 4KCDA 2OCUA 3PUXE 4H5GA 5K2YA 2OZZA 3C36A 1GVCA 5BWJA 3IL1B 1LSTA 2OWTA 3OMBA 3VLUA 5AA3A 4WXJA 2A5SA 5I2KB 4C1UA 4RK2A 5F7VA 1B1HA 3PU5A 2V3UA 1JEUA 4MLQA
chains in the Genus database with same CATH superfamily
2VD2A 4HE1A 1MQIA 4OZ9A 3A09A 5EYGA 4P8BA 4FORA 4F39A 3FVNA 3QAXA 1SYIA 4ISUA 4OANA 2CMOA 1LB9A 2V84A 3IFCA 2F35A 2UVJA 1LCFA 3OXNA 4OQOA 3PPNA 2PMSA 4AS4A 3K1PA 4MLVA 3LUYA 4HCWA 3RNNA 4OETA 2QMXA 1A54A 1LLSA 4X48A 1GR2A 1IMAA 2HZLA 4Q8RA 5JK4A 4IY6A 4KCCA 4R75A 2ANJA 4RNSA 3OSQA 1KA1A 4RYAA 1J1NA 4PGNA 4H8IA 3ODBA 4QXDA 4HW8A 5F1QA 3E78A 2KQZA 3HSTA 1I69A 1FJ6A 4UABA 5B70A 1OLAA 5ITPA 1ZBMA 4JSOA 4ZEKA 4FEBA 3SEYA 1B3LA 1NV5A 1ZJLA 2RCAA 3S9MC 1LCTA 3K6UA 3VXBA 3M3KA 4OVRA 5CBRA 1UTBB 3RPLB 4RXLA 2X26A 4JBZA 3CR9A 5I56B 3OD7A 3H6VA 1QKAA 3QIMA 3N6TA 1B3HA 3T66A 4H46A 4NWDA 3IX1A 4PCDA 3C4MA 4KPTA 1R1NA 1I6AA 3QYTA 5L9SA 2XD2A 4I3EA 4Z0IA 4QFOA 3EF7A 4OVTA 1BP5A 1MXWA 4ELQA 3K4UA 5I2NA 1RDXA 5H8NA 4EQ9A 1LFGA 5KDTA 1P1UA 3TTMA 3CVGA 3O6IA 2P0SA 4TQUQ 1DOTA 3MSTA 4NQ8A 3U72A 5TPAB 1US4A 3ZKLA 3MW0A 1Y3QA 4I9DA 5FHMA 2XWKA 1RYXA 3IFAA 3RYDA 5IAIA 1AOVA 3HO7A 1FPGA 4G2ZA 3EPEA 4NG7A 3KN7A 5I57A 2FNCA 5CM6A 3FATA 3M3LA 5DTBA 2ABHA 4E0WA 3K1NA 5I57B 1B1XA 1AMFA 2QVUA 5CRYA 4HCYA 4GWSA 3S4UA 1DK4A 4KHZE 3MC2A 4LVQA 1SVXB 4OYVA 1FTKA 1TFAA 5ICQA 2I6EA 4QSEA 2DWAA 1NV1A 3DELB 3AXFA 1USYE 3HV1A 2GHBA 3KBZA 1FPKA 3TELA 2IEEA 5TU0A 4EQBA 2Y84A 3MPKA 2ZNTA 5HBCA 3E3KA 2V93A 1M5FA 4QRZA 3PTYA 3KJ7A 4DIGA 3O9PA 1D9VA 4OERA 4IO2A 2HZKA 4PF8A 3L6GA 2XXUA 1VR5A 3JZJA 3MBPA 3PUWE 2DSFA 2YJPA 3RPLA 3KN3A 5DYHA 1EH3A 1FQCA 5I84A 2ZNUA 3G7WA 4DE8A 4JWYA 4R6YA 3DM0A 4F19A 4MJOA 3TUSA 1JP4A 5KDTB 3BKIB 5AE4A 1N84A 4PETA 1YCJA 4H0WA 1FBGA 1MQHA 1S7YA 3VFJA 4NEDA 3T0JA 3FVGA 2Q89A 4R73A 1NV2A 3LV0A 2CZLA 4O7MA 1I6BA 2THIA 1O64A 3G3IA 4PGPA 4XKPA 1B05A 4F1YA 3EQ1A 4N6DA 4P1LA 2WYKA 1Z7ME 2O69A 2REGA 1A8EA 1LAFE 3SDFA 1IEJA 3PUYE 2XX9A 3QMFA 3LR1A 1HSJA 1NV4A 2P3VA 4PQJA 5I58A 4OWDA 3VDFA 4PE5B 3O2AA 5H8SA 3H03A 1H45A 1B3GA 4PAKA 4I1DA 4X1DA 1MM6A 4AB6A 4X8RA 2QMWA 2HCAA 4H6DA 4FJPA 5ET6A 2O1MA 3T9HB 4ONYA 4PFWA 4G68C 2CZIA 4RPNA 4OVQA 2G29A 3TTKA 4U23A 2Q74A 3UN6A 3OELA 4G68A 4MIJA 3S9NC 1KA0A 2F36A 4FBPA 1LGBC 3B6TA 4FECA 1QUKA 2P1SA 2H25A 3TTLA 2DXRA 1NFTA 2DWHA 3MP1A 5H8FB 5DVJA 4GFRA 1QW0A 2O68A 3IORA 3JYRA 3O6HA 2YPNA 1VFDA 1MXXA 3FGSA 2QPQA 1LBXA 1IMFA 1NV0A 3SEVA 4MNPA 1MH4A 4GQOA 3I3VA 1Y4TA 1DSNA 4LZ7A 5L9OA 4I40A 1FBHA 2WEFA 2H9BA 5I2KA 3FIRA 4F3BA 4KD5A 1B51A 2Y5KA 2H98A 4Z7EA 2RF1A 1Y20A 3IJXB 4P0IA 4P0GA 1IQ7A 1RYOA 1DTZA 5EQ9A 3IL1B 1FPFA 2V3UA 4DXBA 4H1XA 3M3FA 4KYSA 3LC8A 3A29A 5DVIA 3B7DA 4N81A 4F29A 4R2FA 4EXLA 3TDJA 3E79A 2BJIA 4O3BA 1IXHA 1FQEA 5TPAA 1B4HA 3RN8A 4MH5A 4P11A 2R6GE 2OK2A 2GHAA 2XXKA 4JDFA 3KEIA 3MZ9A 4O8MA 1Z7NE 4MNCA 2QVRA 2DP8A 4GBWA 1JW1A 4F22A 4PE3A 5H8QB 4O7IA 3QSLA 1VSOA 1UIUA 2F7BA 4PFYA 4F3GA 1H43A 1VDWA 3K02A 5ISUA 5B7DA 3MVWA 2QS3A 1YXIA 3MVXA 2F8DA 3LBSA 2RKMA 3C33A 1JETA 4N17A 3M8UA 4YAHX 3PPOA 1PEBA 1LBWA 2Q9TA 5H8HA 2QS1A 2XA5A 2PFYA 2Q2CA 4DLDA 3KGCA 5KZTA 5EQAA 4MMPA 5AA2A 5LOMA 4NF8A 3B8BA 1BLFA 2ZNSA 3PMXA 3H6WA 3TCFA 5IKBA 1HSLA 2X7PA 1TXFA 2GFEA 3GXAA 2RINA 1B3EA 3IB0A 5TP9B 4QFLA 1N3XA 3GYYA 4GWYA 2FYIA 5FHOA 1EZ9A 4OENA 3ROJA 5CMKA 4MF3A 4GWXA 3TODA 3IOWA 5J16A 4MX6A 3CFXA 3Q25A 4BDMA 3PD9A 4QHQA 5F24A 2VP1A 4TLLB 3HFUA 4RPOA 3G3KA 4IO7A 4PFIA 5IM2A 5H8NB 2VGQA 3C31A 3FZVA 1MG1A 3MP6A 3TZAA 4NAPA 1O7TA 1B7HA 3VE1B 1POTA 3K6VA 2ZYNA 3DLNA 4G77A 4NTLA 3PUVE 2OX3A 4LN5A 4AQ4A 1P99A 4NN3A 1LAXA 4XIGQ 1NL5A 2UYEA 4LATA 2KR0A 5L9MA 2B65A 1XS5A 3U8QA 1H3DA 1S9TA 3KOTA 1NNPA 2QS4A 3MVZA 1IXIA 4ELPA 1B4ZA 1XHYA 4R2BA 3MAMA 3DP6A 4QFKA 2Q2AA 5I56A 3O29A 1PBPA 4PTKA 1MY2A 4LZ5A 1NI9A 3G3HA 5DEXB 4EF1A 2I48A 1FTOA 2Z8FA 3RT6B 4U4XA 1WDNA 3FXRA 4GL0A 4E0XA 4C0RA 4F1UA 3O6GA 1B32A 1N7WA 4Q30B 1N3WA 4ESXA 3U1OA 1B5IA 2WKYA 4LP2B 2FHYA 1DPPA 2F6GA 1CE2A 2WBBA 4LQ2A 1MQJA 1Y3PA 1YZ0A 4YU0A 4GVOA 4G8NA 1D9YA 4OVJA 4QSCA 4PAIA 1PDAA 1FTJA 1FBDA 1B5JA 4GXSB 4PC9A 5AA2D 2ZZXA 2Z8EA 5FTIA 2PCRA 3FUZA 1FBPA 3VVDA 3G3JA 1PBQA 1B0HA 1URDA 1N04A 4YB5A 2FIXA 4PBHA 4OFJA 1PC3A 2XXIA 3CI8A 3TKDA 1USYH 4IO3A 3B50A 3FV2A 5L8DA 2F6PA 2Q8MA 3EHTA 2HAUA 4NF4B 2XD3A 3D1RA 4WKMA 3MP8A 5A5LA 2ZYMA 3D4CA 3IAZA 1XOCA 4YKJA 4GWZA 3BBRA 1P1WA 1FTLA 3OSRA 2I4BA 2XXWA 3W15C 5CI5A 3FBPA 1QGXA 2QJEA 3IOTA 4KYEA 2QFLA 3KZGA 4BDLA 4ZS9A 2XXVA 2Y7KA 1TT1A 3V83A 3IOVA 1QVSA 3ONMA 2PX1A 4GD5A 1ZKBA 5HM4B 4JWXA 4YB6A 3CSGA 3OEMA 4MBPA 1SYHA 2HHMA 1WVJA 3ZS6A 4KI0E 2FIEA 1LBZA 1FBEA 2Y7WA 1N7XA 2GH9A 1OIBA 2OWZA 3RPWA 1JVYA 4GIZA 5A5XB 3NOHA 5DW8A 2M8CA 3R7XA 4JVCA 2F7AA 2PFZA 4ESWA 2ONKE 1LBCA 1FBFA 3LSXA 4IY5A 3SKPA 4Q0CA 3IB1A 4GWUA 5FHNA 4H65A 2XXRA 2XWOA 4H45A 4N8GA 1SW5A 4PDDA 3Q27A 3IK6B 4WEDA 3T96B 3FXQA 3VXCA 1DMBA 1YPNA 2Y7PA 4NHBA 1UTHA 1MRPA 3CFZA 3E4RA 1SW1A 2DS9A 4I62A 1B40A 1NH8A 2GQ1A 1EYIA 4M4GA 3QUJA 2HPGA 1R6ZA 4LONB 2B3FA 3R6UA 3CSBA 2H5YA 4R74A 2R71A 3KC1A 3OENA 2XXPA 2A5TA 3USDA 4PFTA 5H8QA 3GLBA 5A5XA 1NNFA 1G0HA 5JTYA 4JXIA 2HXRA 4NF8B 1EYJA 5K2XA 2OCUA 4H5GA 5K2YA 5BWJA 2OWTA 3VLUA 5AA3A 4WXJA 4C1UA 5F7VA 4GBVA 1Q35A 5H8FA 3K6WA 4BDNA 2RCBA 3V89B 1IMCA 4OA4A 4N15A 4WEPA 3U65A 1KZ8A 2VT5A 4FE8A 1FCKA 1FQBA 4JVIA 5ICTA 2F34A 3V5AA 2F5XA 1TFDA 4YB7A 4HS7A 2ZYKA 4G4PA 3ZSFA 1NV6A 3SETA 3T93B 1US5A 5DT6A 2VHAA 4OEUA 1BTJA 4BDQA 4XXUA 1FPBA 4FAJA 3K00A 1M5BA 3E9XA 3MPLA 1QJMA 4DCYA 3KG2A 1LBVA 3TCHA 3KN8A 3B6QA 1UTBA 2O84X 1T0KA 2P3NA 2F3DA 3ILTB 4OHNA 4DZ1A 1II5A 3MZBA 4R6HA 4DI3D 5AA1A 4Q5TA 2HFBA 3PMWA 4ZEDA 1SBPA 1IUDA 1AIVA 3WAEA 1HSEA 4JWOA 1DBZA 4IGRA 4I8CA 2X7QA 2NUVA 3HN0A 1MS7A 4FATA 1MXZA 2QRYA 3E13X 2DYXA 5ELVA 3CG3A 1B9JA 1MY0A 3ILUB 5AA4A 2AYSA 2FBPA 1SPIA 3LSFB 5ITOA 5EHSA 2UVIA 3H3GA 1A7LA 1DPEA 2UXAA 1H76A 3H06B 2H4IA 5ET7A 1LBBA 2D3IA 2O7UA 3HPIA 3IO6A 4HE0A 2BJJX 4R9FA 1NV7A 3BFTA 4EXKA 1MY3A 3SERA 1LEVA 4QSDA 1NUYA 4F2QA 3MUQA 2AL5A 1ZMGA 2XXHA 3CRBA 5ET5A 5I59B 2V4CA 2E1SA 5IZ3B 4XKQA 4GLIA 2DXYA 3TCGA 1XT8A 3OO9A 3TPAA 5FTHA 4I3YA 1FPDA 5EQ7A 4OESA 4LZ8A 3VLWA 3GBAA 2REJA 2RC7A 3TEPA 4NGUA 3UP9A 1R9QA 1NUZA 1XI6A 5AA4B 2CZHA 2HEUA 4G68B 3KJTA 4DDDA 2OLBA 4FIMA 3KBRA 2V25A 1FPIA 4DCXA 2B4LA 5I58B 5IZ3A 4ELRA 1R9LA 1ZIUA 4GF8A 4THIA 1Y3NA 3SESA 5IZ1A 1LFIA 3A3CA 3T1BA 4N91A 3H6TA 4XEQA 1MQGA 1SI0A 5EYFA 4KXPA 1G0IA 3PMVA 1B7ZA 4X9TA 2XWIA 4MAGA 2FVZA 1AL3A 5ESYA 4OTEA 3EHUA 3IJOB 5BUUA 1IMDA 2UVGA 1Y4CA 5LDZA 2XHDA 4X04A 3UIFA 1EZPA 5I7IA 1B6HA 1IMEA 1QUIA 4XTCQ 3TTNA 2H99A 3VLVA 1FTMA 4YKIA 2DE3A 2W7YA 1D4NA 2WBDA 1INPA 1MXVA 3DP4A 1BIYA 3TMGA 5DEXA 1FQFA 1OQHA 1P1OA 1UTHB 4JVDA 2Z23A 3I5OA 1B0LA 4HE2A 4H5FA 3W9WA 3OEKA 2R9JA 3U94A 3VVEA 3PPQA 4EF2A 4PFRA 3VV5A 4ND9A 4G8HA 1FTAA 1SD3A 1EU8A 1YAEA 3CHGA 1JNFA 2A5TB 2DVCA 4EDPA 5KCJB 2VPOA 1A55A 3FVKA 2VD3A 4XKNA 1LAGE 2CZKA 1N0TA 1MDQA 1GGGA 4ECFA 3DP8A 4OEVA 1D9QA 4X1BA 4NWCA 5I3SA 1ATGA 1IZ1A 3MJNA 4IGTA 4KFQA 2XXQA 4BLAA 3TFLA 3I6VA 2DWJA 1SW4A 4BDOA 2I0BA 3T9UA 4YKKA 4P3LA 2PT2A 4F3SA 2ZXTA 3KC0A 5CMCA 4P56A 1NMUA 1SW2A 1OQGA 2F97A 4KQPA 4RK9A 3W9VA 4PAFA 3PD8A 1L5TA 4ZEFA 4ZE8A 4U22A 2Y5LA 4N4UA 3UGWA 1B2HA 4NF4A 2ZZWA 2I49A 4UA8A 1DTGA 3K6XA 4O3AA 3LSLA 4H67A 4U21A 1NH7A 2Q8JA 5JTYB 4PP0A 2I58A 2L5VA 1MPDA 4O3CA 1MY1A 4ZECA 5TP9A 4XF5A 3MQ9A 3SEWA 3CG1A 3RGYA 2GRVA 4IO4A 3EN3A 1MXUA 4U1ZA 2DVZA 4P1EA 4JB7A 1RDYA 3RTFB 4RA1A 2XXTA 4DXCA 1VE4A 1Y9UA 4NF6A 5HPQA 2DDKA 3TQWA 1SDXA 4KR5A 1POY1 3MZ1A 4QFPA 3RTWB 1S50A 1PB7A 3IOUA 3PUZE 1JEVA 1FPLA 1BK4A 2F3BA 1QKBA 3EKIA 3OO8A 4ZEIA 2NXOA 3N26A 1LFHA 1UQWA 4AS5A 5KCJA 4KCDA 1GVCA 3C36A 1LSTA 5I2KB 4RK2A 2ONRA 1B1HA 4MLQA 1D3KA 3S2VA 1B58A 1ZLQA 4YMBA 4GX4A 1EZOA 2OBGA 1FJ9A 4FEDA 1FQDA 3KOSA 4NMYA 1FSAA 2DE4A 3D4GA 4R9GA 1Y1MA 1OVBA 1F9BA 5IZZA 2PBWA 4MEVA 1RKMA 3UK4A 5CMBA 3WAFA 2XXYA 3FXBA 1MDP1 3UORA 1EYKA 2O7IA 4H8JA 5J1DA 5CBSA 3KFMA 4N6PA 1MH3A 1JW4A 3TYHA 4PFUA 2MKZA 3SEXA 2D5WA 4OFOA 4QF9A 2PT1A 2AIXA 2DOJA 2I0CA 1NV3A 4JSDA 3RT8A 1ZTYA 1Q1KA 5EYHA 5T3JA 1FPEA 1OMPA 2KLFA 3BFUA 4KYDA 4GOTA 1GTKA 3T9VA 2Y7IA 1UIVA 1NNKA 4POWA 2WYPA 3T9XB 3TQLA 3U93A 4M1VA 3S9EA 1K9YA 1NUWA 4P47A 5CC2A 3SZPA 1M5CA 1MPCA 4K3FA 1MXYA 4IO6A 3T22A 2RC8A 1PB8A 4GXAA 3RY3A 4OMBA 3K0VA 3F11A 3MVYA 2R8TA 3O97A 2FA7A 3C35A 3Q26A 3OOAA 3CIJA 3H4ZA 1IXGA 4F3PA 3FVOA 4YMAA 2UVHA 1QULA 1URSA 3HHFA 1YYZA 3HCQA 2ESNA 2XWVA 1MPBA 3IB2A 3O28A 4IR8A 4QBAA 1ZU0A 2I4CA 3FXUA 4ELOA 1NUXA 2F7CA 3G3FA 2YLNA 2ALUA 2O1LA 2Z8DA 2NOOA 4UACA 1M5DA 2VPNA 2ZYOA 4NF0A 1B3FA 4GX6A 4DXUA 5EHMA 4ZDMA 2XXXA 3U92A 1LAHE 2Y7RA 2NWJA 4PFBA 4NF5B 1Q9DA 1P1NA 4N6KA 3BIHA 3Q28A 3PPRA 3Q29A 3FD3A 1IITA 4MFIA 4RJZA 1GV8A 1RDZA 1LBYA 2AL4A 3N94A 3S9LC 2G93A 3G3GA 1LB8A 1VFEA 4AB5A 5DVFA 3K1MA 1NKXA 2HQ0A 3QXMA 3V8XB 3FV1A 2O6AA 1H44A 4PBQA 2PVUA 3K2DA 3ISPA 2CEYA 5I2NB 4LQ5A 4MHFA 4NF5A 4C1TA 4U2RA 4GWOA 4L17A 3GZGA 2E0SA 3OO6A 1AWBA 3FJMA 4RY1A 1FRPA 5LTCA 5JEIA 1IIWA 2QSXA 4ZEBA 3FASA 2UYFA 4TLMB 2Q88A 1MY4A 5I5PA 1FW0A 3PGFA 4F2OA 1URGA 1A40A 1QUJA 3LUZA 4N07A 3C9HA 1JW5A 3PV0E 4ZE9A 2V3TA 4GWWA 1XVXA 3IO4A 2NVUB 3QUFA 2XX8A 2ZMBA 3OO7A 2I3WA 3L6HA 1WODA 4GX3A 3HHGA 1KWHA 2CEXA 4GL8A 1OVTA 3C34A 4LUBA 3MWBA 1B52A 4P9KA 5AA2B 1YTVA 2F78A 4R72A 4NX1A 2IA4A 4F18A 3IR1A 4OXVA 1DCUA 4QFNA 3RQTA 4IB2A 1I6QA 4G8MA 4PF6A 3N5LA 3R26A 2DQVA 4NF6B 3H7MA 4R6KA 1SI1A 5CMMA 2DE2A 4G61A 4YICA 4IO5A 3BIGA 3O66A 2ONSA 5EQ8A 4OVSA 1FPJA 5ET8A 2DWIA 3A3UA 2B4MA 1XC1A 4F1VA 4YZZA 3GBBA 4MNIA 4OVPA 2OWSA 2QS2A 2HXWA 2D21A 4EUOA 1M5EA 2QL3A 3ECRA 1ELJA 3KSXA 1SQYA 4HXVA 3JV9A 2B3BA 3C32A 1P1QA 3RUMA 3MYUA 4XFEA 2PYYA 3RLFE 1N76A 1IXCA 4EQ7A 3ZKKA 4XKRA 4MCOA 3FJ7A 1NNTA 1PB9A 3QK6A 1BKAA 5M2VA 5H8HB 4YKPA 1XVYA 2Z22A 4U4SA 4F31B 4HTGA 2I3VA 2OJTA 1B7UA 4ZZAA 1AH5A 1CB6A 4LA9A 2LAOA 4BDRA 2WX9A 3THIA 3H6UA 1JVXA 3B6WA 2RC9A 4NE4A 5IGAA 1MQDA 3VVFA 2O51A 1B46A 1K9ZA 1FBCA 1JQFA 1MM7A 1FQAA 3KSJA 3CFLA 2QVVA 1A99A 1CNQA 4ZZEA 3EHSA 4GRKA 4O94A 3SEUA 3TTRA 1ANFA 1O63A 4POXA 3K01A 2XX7A 1TWYA 1OLCA 3LSWA 3PPPA 5I59A 1A8FA 5FBPA 3UA8A 4N8YA 1Y1ZA 4TOZA 2VOZA 2HAVA 2ZZVA 3TAJA 4OFLA 2V3QA 1B5HA 2P2AA 3P7IA 3N6UA 4U1OA 4PDHA 4N13A 4DI4B 3FJGA 3PUXE 1IMBA 2OZZA 2JJKA 3OMBA 2A5SA 3PU5A 1JEUA
chains in the Genus database with same CATH topology
1D3KA 4H1XA 3M3FA 4KYSA 2VD2A 3S2VA 1Q35A 1B58A 1MQIA 1ZLQA 4OZ9A 3A09A 3K6WA 4BDNA 3LC8A 4DLDA 4YMBA 2RCBA 5DVIA 1EZOA 3B7DA 2OBGA 3V89B 4FORA 4F39A 3FVNA 4F29A 3QAXA 4R2FA 4EXLA 4FEDA 3TDJA 1SYIA 1FQDA 4WEPA 4O3BA 4ISUA 3KOSA 4NMYA 1IXHA 1FQEA 2CMOA 4FE8A 1FCKA 2DE4A 1FQBA 3D4GA 5TPAA 4R9GA 1B4HA 1Y1MA 3RN8A 5ICTA 4MH5A 1LB9A 1OVBA 2F34A 2V84A 4P11A 3V5AA 2F5XA 1TFDA 4YB7A 2R6GE 4HS7A 2OK2A 2ZYKA 2GHAA 1F9BA 2F35A 4G4PA 2UVJA 2PBWA 4JDFA 3KEIA 3MZ9A 3ZSFA 3SETA 1LCFA 3T93B 1RKMA 3OXNA 1US5A 1Z7NE 3UK4A 5DT6A 2VHAA 4OQOA 4OEUA 3PPNA 2PMSA 1BTJA 5CMBA 4BDQA 3K1PA 2DP8A 1JW1A 4MLVA 3LUYA 4XXUA 4HCWA 4F22A 5H8QB 3WAFA 3QSLA 3RNNA 1VSOA 3K00A 4FAJA 5H8FA 1UIUA 2F7BA 2XXYA 4PFYA 4OETA 4F3GA 1H43A 1M5BA 3E9XA 1QJMA 1A54A 1MDP1 2QMXA 3K02A 3KG2A 3MPLA 2O7IA 4H8JA 3UORA 3TCHA 1LLSA 3KFMA 5B7DA 5CBSA 3KN8A 4X48A 5J1DA 3MVWA 3B6QA 2QS3A 1UTBA 1GR2A 4N6PA 2O84X 2HZLA 1MH3A 4Q8RA 1T0KA 3MVXA 4IY6A 2F8DA 3ILTB 5JK4A 1JW4A 4KCCA 4R75A 3TYHA 3LBSA 2ANJA 2RKMA 3C33A 4OHNA 4DZ1A 1II5A 1JETA 4RNSA 3OSQA 3M8UA 4PFUA 3MZBA 4RYAA 4YAHX 3PPOA 4R6HA 1J1NA 4Q5TA 2HFBA 3PMWA 4H8IA 3ODBA 1PEBA 2D5WA 2Q9TA 5AA1A 5H8HA 1SBPA 3SEXA 1IUDA 2QS1A 4HW8A 4ZEDA 5F1QA 1AIVA 3HSTA 3WAEA 1HSEA 1I69A 4OFOA 2Q2CA 4JWOA 2PT1A 3KGCA 2AIXA 4QF9A 2DOJA 1OLAA 4IGRA 2I0CA 4I8CA 5ITPA 5KZTA 1ZBMA 4JSDA 4JSOA 1ZTYA 3RT8A 1Q1KA 2X7QA 4NF8A 4ZEKA 3U94A 5AA2A 5LOMA 1OMPA 2KLFA 2NUVA 1BLFA 3HN0A 1MS7A 4FEBA 3BFUA 4KYDA 4GOTA 1B3LA 2ZNSA 3SEYA 1GTKA 3PMXA 3T9VA 2Y7IA 4FATA 1UIVA 1ZJLA 1MXZA 1NNKA 3H6WA 4POWA 2QRYA 3TCFA 5IKBA 1HSLA 2RCAA 3E13X 2X7PA 1TXFA 1LCTA 2DYXA 2GFEA 3GXAA 4M1VA 3T9XB 3TQLA 3U93A 3K6UA 3S9EA 5ELVA 3CG3A 3VXBA 1B9JA 1MY0A 2RINA 3ILUB 3M3KA 5AA4A 1B3EA 2AYSA 3IB0A 5TP9B 5CC2A 4QFLA 1M5CA 1MPCA 1N3XA 1UTBB 4K3FA 5CBRA 1MXYA 4IO6A 3LSFB 3T22A 2FYIA 2RC8A 5FHOA 1PB8A 4GXAA 3VXCA 3RY3A 4RXLA 1EZ9A 5ITOA 2X26A 4OENA 3K0VA 3F11A 4JBZA 4OMBA 5EHSA 3MVYA 2UVIA 3CR9A 3H3GA 5CMKA 1A7LA 3O97A 4MF3A 5I56B 1DPEA 3IOWA 2UXAA 1H76A 3OD7A 3TODA 3CFXA 3Q25A 3H6VA 1QKAA 2FA7A 3C35A 3PD9A 3QIMA 4QHQA 4BDMA 3N6TA 3Q26A 3H06B 2H4IA 3OOAA 1B3HA 3T66A 1LBBA 2VP1A 3CIJA 4TLLB 3H4ZA 2D3IA 2O7UA 4RPOA 3G3KA 4IO7A 1IXGA 3HPIA 4NWDA 3IO6A 3IX1A 5H8NB 4F3PA 2VGQA 2BJJX 3C4MA 4R9FA 3C31A 3FVOA 3FZVA 4KPTA 3BFTA 4YMAA 2UVHA 4EXKA 1QULA 1R1NA 1URSA 3HHFA 1MY3A 3HCQA 3SERA 1I6AA 3QYTA 1MG1A 2ESNA 2XD2A 3MP6A 5L9SA 4QSDA 3TZAA 1MPBA 4Z0IA 4DCYA 1O7TA 4F2QA 1B7HA 3MUQA 1POTA 2AL5A 1ZMGA 3IB2A 2XXHA 3CRBA 3O28A 4QFOA 3EF7A 1ZU0A 3K6VA 1BP5A 2ZYNA 5I59B 1MXWA 3DLNA 2I4CA 4ELQA 3FXUA 2E1SA 4G77A 4ELOA 4NTLA 3K4UA 3PUVE 4XKQA 4GLIA 5I2NA 5H8NA 2DXYA 3TCGA 4AQ4A 1XT8A 1P99A 3OO9A 4EQ9A 1LFGA 1LAXA 2F7CA 4XIGQ 3TPAA 5FTHA 3G3FA 1NL5A 2UYEA 5KDTA 4OESA 1P1UA 4LATA 4LZ8A 2YLNA 3TTMA 3CVGA 2ALUA 5L9MA 2O1LA 3O6IA 3VLWA 2B65A 3GBAA 1XS5A 2P0SA 4TQUQ 3U8QA 1DOTA 2REJA 1H3DA 2Z8DA 1S9TA 3KOTA 1NNPA 2NOOA 2QS4A 4UACA 2RC7A 3MVZA 3TEPA 1IXIA 1M5DA 3U72A 3UP9A 4ELPA 1B4ZA 1XHYA 2ZYOA 4R2BA 1B3FA 3MAMA 5TPAB 3DP6A 1R9QA 1US4A 2Q2AA 4QFKA 5AA4B 3ZKLA 4DXUA 3MW0A 5EHMA 2HEUA 4G68B 3KJTA 4DDDA 2OLBA 5I56A 4FIMA 1Y3QA 2V25A 3KBRA 4I9DA 4ZDMA 2XXXA 3O29A 5FHMA 3U92A 1LAHE 1PBPA 4EQBA 1RYXA 2Y7RA 2NWJA 4DCXA 5I58B 4NF5B 1P1NA 5IAIA 4ELRA 1AOVA 1R9LA 3Q28A 1MY2A 3PPRA 4LZ5A 3VVFA 3Q29A 1ZIUA 3FD3A 3HO7A 1IITA 4G2ZA 4GF8A 3G3HA 4THIA 1Y3NA 3EPEA 4MFIA 4RJZA 5DEXB 4EF1A 3SESA 3KN7A 5I57A 2FNCA 1GV8A 5CM6A 1LFIA 2I48A 3A3CA 2AL4A 3FATA 1FTOA 3N94A 3H6TA 2Z8FA 2G93A 3M3LA 5DTBA 3RT6B 3S9LC 1MQGA 3G3GA 4U4XA 1LB8A 1WDNA 3FXRA 1VFEA 2ABHA 4AB5A 1SI0A 4GL0A 3K1NA 5DVFA 4E0XA 4C0RA 4E0WA 5I57B 5EYFA 1B1XA 4F1UA 1AMFA 3O6GA 3PMVA 1B32A 1B7ZA 3K1MA 4X9TA 5CRYA 1N7WA 4HCYA 1NKXA 3S4UA 2HQ0A 3QXMA 3V8XB 4Q30B 1AL3A 1N3WA 4ESXA 3FV1A 4KHZE 4OTEA 3EHUA 3U1OA 1B5IA 3IJOB 3MC2A 4LVQA 5BUUA 2UVGA 2WKYA 2O6AA 1SVXB 1Y4CA 1H44A 2PVUA 4LP2B 2XHDA 3K2DA 4OYVA 3UIFA 1DPPA 5I2NB 1FTKA 2F6GA 4LQ5A 1EZPA 1TFAA 5ICQA 4NF5A 1CE2A 4C1TA 2I6EA 1MQJA 4LQ2A 1Y3PA 2DWAA 1B6HA 4QSEA 4U2RA 4GWOA 3DELB 1QUIA 3GZGA 3AXFA 4L17A 4XTCQ 4YU0A 3TTNA 1USYE 2H99A 3HV1A 3VLVA 4GVOA 4G8NA 2E0SA 3OO6A 2GHBA 1D9YA 3FJMA 4OVJA 4RY1A 5JEIA 1FTMA 4YKIA 1IIWA 2DE3A 2W7YA 4QSCA 1D4NA 2QSXA 3TELA 2IEEA 1PDAA 1FTJA 4ZEBA 2Y84A 1B5JA 1MXVA 5TU0A 3DP4A 3MPKA 4GXSB 1BIYA 2ZNTA 5AA2D 3FASA 2UYFA 5HBCA 3TMGA 5DEXA 1FQFA 1OQHA 2Z8EA 1P1OA 2V93A 3E3KA 5FTIA 1UTHB 4TLMB 4DXBA 1M5FA 1MY4A 2Q88A 2Z23A 4QRZA 1FW0A 3I5OA 3KJ7A 1B0LA 4DIGA 3FUZA 3O9PA 4H5FA 3W9WA 3VVDA 3OEKA 3G3JA 1PBQA 1D9VA 3PGFA 4IO2A 4OERA 1B0HA 4F2OA 1URGA 1A40A 1QUJA 2HZKA 3L6GA 1URDA 2XXUA 2R9JA 1VR5A 3JZJA 3MBPA 1N04A 3C9HA 2DSFA 3PPQA 3PUWE 1JW5A 4N07A 4YB5A 3VVEA 4OFJA 3PV0E 4ZE9A 1PC3A 2YJPA 2V3TA 2XXIA 3CI8A 3TKDA 3KN3A 1USYH 1XVXA 4IO3A 4EF2A 3FV2A 3IO4A 2NVUB 3VV5A 3QUFA 5DYHA 1EH3A 1FQCA 2XX8A 4ND9A 2ZMBA 3OO7A 5L8DA 2I3WA 3L6HA 2F6PA 4G8HA 1WODA 5I84A 2ZNUA 1SD3A 1EU8A 1YAEA 3HHGA 1KWHA 3EHTA 2HAUA 1JNFA 4GL8A 3G7WA 4DE8A 4NF4B 1OVTA 2XD3A 4JWYA 4R6YA 3DM0A 4F19A 3C34A 2A5TB 4LUBA 2DVCA 4EDPA 4WKMA 3TUSA 5KDTB 3BKIB 3MWBA 5KCJB 5AE4A 3MP8A 1A55A 3FVKA 1B52A 1N84A 2ZYMA 4PETA 2VD3A 1YCJA 1LAGE 4XKNA 4H0WA 5AA2B 1YTVA 2F78A 4R72A 2IA4A 3D4CA 4F18A 1MQHA 3IAZA 1N0TA 1MDQA 1S7YA 3VFJA 1GGGA 4NEDA 3FVGA 4ECFA 1XOCA 3IR1A 4OXVA 4QFNA 3BBRA 2Q89A 4R73A 4IB2A 4YKJA 3DP8A 3RQTA 1I6QA 4G8MA 1P1WA 1FTLA 3OSRA 2I4BA 4OEVA 4X1BA 2CZLA 4NWCA 1I6BA 2THIA 1O64A 3G3IA 2XXWA 1ATGA 3W15C 5CI5A 3N5LA 3R26A 2DQVA 1IZ1A 2QJEA 3IOTA 4KYEA 3MJNA 4IGTA 3KZGA 4XKPA 4BDLA 4KFQA 4NF6B 3H7MA 1B05A 2XXVA 1SI1A 2XXQA 4R6KA 5CMMA 4ZS9A 2DE2A 2Y7KA 4F1YA 4BLAA 4YICA 3TFLA 4IO5A 3I6VA 2DWJA 1TT1A 3O66A 1SW4A 3EQ1A 3V83A 2ONSA 1QVSA 3IOVA 3ONMA 4BDOA 2PX1A 4GD5A 2DWIA 1Z7ME 3A3UA 2O69A 2REGA 1A8EA 1LAFE 3SDFA 1XC1A 1IEJA 1ZKBA 2I0BA 3PUYE 4YZZA 4F1VA 5HM4B 3GBBA 3T9UA 2XX9A 3LR1A 1HSJA 4YKKA 2OWSA 2QS2A 2HXWA 4PQJA 2D21A 4JWXA 2PT2A 1M5EA 4YB6A 2QL3A 4EUOA 4F3SA 3CSGA 3OEMA 5I58A 4OWDA 3ECRA 2ZXTA 1ELJA 3KSXA 4MBPA 3VDFA 1SYHA 5CMCA 1SQYA 4PE5B 3ZS6A 1WVJA 3O2AA 1NMUA 3JV9A 1SW2A 1OQGA 2B3BA 4KI0E 3C32A 3H03A 5H8SA 1P1QA 1H45A 1B3GA 3RUMA 2Y7WA 2F97A 4KQPA 1N7XA 2GH9A 4RK9A 4I1DA 3W9VA 3S9MC 3PD8A 1OIBA 3RPWA 1JVYA 4X1DA 4ZEFA 2PYYA 1L5TA 4ZE8A 3RLFE 4GIZA 1N76A 4U22A 1IXCA 1MM6A 3UGWA 4EQ7A 3ZKKA 4XKRA 1B2HA 4NF4A 5A5XB 4UA8A 2I49A 4AB6A 2M8CA 3FJ7A 3R7XA 2QMWA 1NNTA 1DTGA 2F7AA 2HCAA 3K6XA 4ESWA 1PB9A 2ONKE 4O3AA 4H6DA 1LBCA 3LSXA 3LSLA 3QK6A 1BKAA 4IY5A 5M2VA 3SKPA 4Q0CA 3VE1B 4FJPA 5H8HB 4H67A 3IB1A 2O1MA 4YKPA 4U21A 3T9HB 1XVYA 2Z22A 4U4SA 1NH7A 5FHNA 5JTYB 2Q8JA 4ONYA 4H65A 4F31B 2XXRA 2I58A 2I3VA 4HTGA 4PFWA 2ONRA 4PP0A 4G68C 2OJTA 1MPDA 1B7UA 4RPNA 1AH5A 4ZZAA 1CB6A 2G29A 4LA9A 2LAOA 4U23A 1SW5A 3TTKA 3Q27A 4BDRA 4O3CA 1MY1A 3THIA 3UN6A 3OELA 3IK6B 3H6UA 4WEDA 5TP9A 3T96B 4G68A 4ZECA 1JVXA 3S9NC 2F36A 3B6WA 3FXQA 5B70A 2RC9A 3MQ9A 4NE4A 3SEWA 3CG1A 1DMBA 1LGBC 1MQDA 1YPNA 2Y7PA 3B6TA 2GRVA 1UTHA 4IO4A 3RGYA 1MRPA 2O51A 4FECA 3EN3A 1QUKA 1B46A 2P1SA 2H25A 3CFZA 3TTLA 2DXRA 1NFTA 2DWHA 1MXUA 4U1ZA 3MP1A 5H8FB 5DVJA 4GFRA 2DVZA 3E4RA 1QW0A 2O68A 1SW1A 1JQFA 3IORA 1MM7A 1FQAA 3JYRA 3O6HA 3KSJA 2YPNA 2DS9A 3CFLA 4I62A 1B40A 4JB7A 1NH8A 1VFDA 3RTFB 5ISUA 1A99A 1MXXA 3FGSA 4RA1A 2QPQA 2XXTA 4M4GA 4ZZEA 3QUJA 3EHSA 4GRKA 4DXCA 1R6ZA 1VE4A 1Y9UA 3SEUA 1MH4A 4NF6A 3SEVA 3TTRA 1ANFA 4LONB 1O63A 4GQOA 2B3FA 4POXA 3K01A 3I3VA 3R6UA 1Y4TA 2XX7A 1DSNA 1TWYA 1OLCA 3CSBA 3LSWA 3PPPA 4LZ7A 5I59A 5L9OA 2H5YA 1A8FA 4R74A 5HPQA 2R71A 3TQWA 1SDXA 4KR5A 3UA8A 1POY1 3MZ1A 3OENA 1Y1ZA 2XXPA 2A5TA 2H9BA 4QFPA 3RTWB 3USDA 1S50A 1PB7A 3IOUA 3PUZE 4TOZA 2VOZA 1JEVA 3FIRA 5I2KA 4F3BA 2HAVA 4KD5A 1B51A 4PFTA 1QKBA 5H8QA 3OO8A 3TAJA 3GLBA 5A5XA 2H98A 1NNFA 2V3QA 4OFLA 1B5HA 4Z7EA 2P2AA 2RF1A 1Y20A 3IJXB 4ZEIA 4P0IA 3P7IA 2NXOA 5JTYA 3N26A 1LFHA 4P0GA 3N6UA 1IQ7A 1RYOA 4U1OA 1UQWA 4JXIA 4N13A 4NF8B 5KCJA 3FJGA 1DTZA 5K2XA 4KCDA 2OCUA 3PUXE 4H5GA 5K2YA 2OZZA 3C36A 1GVCA 5BWJA 3IL1B 1LSTA 2OWTA 3OMBA 3VLUA 5AA3A 4WXJA 2A5SA 5I2KB 4C1UA 4RK2A 5F7VA 1B1HA 3PU5A 2V3UA 1JEUA 4MLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3K A;  4H1X A;  3M3F A;  4KYS A;  2VD2 A;  3S2V A;  1Q35 A;  1B58 A;  1MQI A;  1ZLQ A;  4OZ9 A;  3A09 A;  3K6W A;  4BDN A;  3LC8 A;  4DLD A;  4YMB A;  2RCB A;  5DVI A;  1EZO A;  3B7D A;  2OBG A;  3V89 B;  4FOR A;  4F39 A;  3FVN A;  4F29 A;  3QAX A;  4R2F A;  4EXL A;  4FED A;  3TDJ A;  1SYI A;  1FQD A;  4WEP A;  4O3B A;  4ISU A;  3KOS A;  4NMY A;  1IXH A;  1FQE A;  2CMO A;  4FE8 A;  1FCK A;  2DE4 A;  1FQB A;  3D4G A;  5TPA A;  4R9G A;  1B4H A;  1Y1M A;  3RN8 A;  5ICT A;  4MH5 A;  1LB9 A;  1OVB A;  2F34 A;  2V84 A;  4P11 A;  3V5A A;  2F5X A;  1TFD A;  4YB7 A;  2R6G E;  4HS7 A;  2OK2 A;  2ZYK A;  2GHA A;  1F9B A;  2F35 A;  4G4P A;  2UVJ A;  2PBW A;  4JDF A;  3KEI A;  3MZ9 A;  3ZSF A;  3SET A;  1LCF A;  3T93 B;  1RKM A;  3OXN A;  1US5 A;  1Z7N E;  3UK4 A;  5DT6 A;  2VHA A;  4OQO A;  4OEU A;  3PPN A;  2PMS A;  1BTJ A;  5CMB A;  4BDQ A;  3K1P A;  2DP8 A;  1JW1 A;  4MLV A;  3LUY A;  4XXU A;  4HCW A;  4F22 A;  5H8Q B;  3WAF A;  3QSL A;  3RNN A;  1VSO A;  3K00 A;  4FAJ A;  5H8F A;  1UIU A;  2F7B A;  2XXY A;  4PFY A;  4OET A;  4F3G A;  1H43 A;  1M5B A;  3E9X A;  1QJM A;  1A54 A;  1MDP 1;  2QMX A;  3K02 A;  3KG2 A;  3MPL A;  2O7I A;  4H8J A;  3UOR A;  3TCH A;  1LLS A;  3KFM A;  5B7D A;  5CBS A;  3KN8 A;  4X48 A;  5J1D A;  3MVW A;  3B6Q A;  2QS3 A;  1UTB A;  1GR2 A;  4N6P A;  2O84 X;  2HZL A;  1MH3 A;  4Q8R A;  1T0K A;  3MVX A;  4IY6 A;  2F8D A;  3ILT B;  5JK4 A;  1JW4 A;  4KCC A;  4R75 A;  3TYH A;  3LBS A;  2ANJ A;  2RKM A;  3C33 A;  4OHN A;  4DZ1 A;  1II5 A;  1JET A;  4RNS A;  3OSQ A;  3M8U A;  4PFU A;  3MZB A;  4RYA A;  4YAH X;  3PPO A;  4R6H A;  1J1N A;  4Q5T A;  2HFB A;  3PMW A;  4H8I A;  3ODB A;  1PEB A;  2D5W A;  2Q9T A;  5AA1 A;  5H8H A;  1SBP A;  3SEX A;  1IUD A;  2QS1 A;  4HW8 A;  4ZED A;  5F1Q A;  1AIV A;  3HST A;  3WAE A;  1HSE A;  1I69 A;  4OFO A;  2Q2C A;  4JWO A;  2PT1 A;  3KGC A;  2AIX A;  4QF9 A;  2DOJ A;  1OLA A;  4IGR A;  2I0C A;  4I8C A;  5ITP A;  5KZT A;  1ZBM A;  4JSD A;  4JSO A;  1ZTY A;  3RT8 A;  1Q1K A;  2X7Q A;  4NF8 A;  4ZEK A;  3U94 A;  5AA2 A;  5LOM A;  1OMP A;  2KLF A;  2NUV A;  1BLF A;  3HN0 A;  1MS7 A;  4FEB A;  3BFU A;  4KYD A;  4GOT A;  1B3L A;  2ZNS A;  3SEY A;  1GTK A;  3PMX A;  3T9V A;  2Y7I A;  4FAT A;  1UIV A;  1ZJL A;  1MXZ A;  1NNK A;  3H6W A;  4POW A;  2QRY A;  3TCF A;  5IKB A;  1HSL A;  2RCA A;  3E13 X;  2X7P A;  1TXF A;  1LCT A;  2DYX A;  2GFE A;  3GXA A;  4M1V A;  3T9X B;  3TQL A;  3U93 A;  3K6U A;  3S9E A;  5ELV A;  3CG3 A;  3VXB A;  1B9J A;  1MY0 A;  2RIN A;  3ILU B;  3M3K A;  5AA4 A;  1B3E A;  2AYS A;  3IB0 A;  5TP9 B;  5CC2 A;  4QFL A;  1M5C A;  1MPC A;  1N3X A;  1UTB B;  4K3F A;  5CBR A;  1MXY A;  4IO6 A;  3LSF B;  3T22 A;  2FYI A;  2RC8 A;  5FHO A;  1PB8 A;  4GXA A;  3VXC A;  3RY3 A;  4RXL A;  1EZ9 A;  5ITO A;  2X26 A;  4OEN A;  3K0V A;  3F11 A;  4JBZ A;  4OMB A;  5EHS A;  3MVY A;  2UVI A;  3CR9 A;  3H3G A;  5CMK A;  1A7L A;  3O97 A;  4MF3 A;  5I56 B;  1DPE A;  3IOW A;  2UXA A;  1H76 A;  3OD7 A;  3TOD A;  3CFX A;  3Q25 A;  3H6V A;  1QKA A;  2FA7 A;  3C35 A;  3PD9 A;  3QIM A;  4QHQ A;  4BDM A;  3N6T A;  3Q26 A;  3H06 B;  2H4I A;  3OOA A;  1B3H A;  3T66 A;  1LBB A;  2VP1 A;  3CIJ A;  4TLL B;  3H4Z A;  2D3I A;  2O7U A;  4RPO A;  3G3K A;  4IO7 A;  1IXG A;  3HPI A;  4NWD A;  3IO6 A;  3IX1 A;  5H8N B;  4F3P A;  2VGQ A;  2BJJ X;  3C4M A;  4R9F A;  3C31 A;  3FVO A;  3FZV A;  4KPT A;  3BFT A;  4YMA A;  2UVH A;  4EXK A;  1QUL A;  1R1N A;  1URS A;  3HHF A;  1MY3 A;  3HCQ A;  3SER A;  1I6A A;  3QYT A;  1MG1 A;  2ESN A;  2XD2 A;  3MP6 A;  5L9S A;  4QSD A;  3TZA A;  1MPB A;  4Z0I A;  4DCY A;  1O7T A;  4F2Q A;  1B7H A;  3MUQ A;  1POT A;  2AL5 A;  1ZMG A;  3IB2 A;  2XXH A;  3CRB A;  3O28 A;  4QFO A;  3EF7 A;  1ZU0 A;  3K6V A;  1BP5 A;  2ZYN A;  5I59 B;  1MXW A;  3DLN A;  2I4C A;  4ELQ A;  3FXU A;  2E1S A;  4G77 A;  4ELO A;  4NTL A;  3K4U A;  3PUV E;  4XKQ A;  4GLI A;  5I2N A;  5H8N A;  2DXY A;  3TCG A;  4AQ4 A;  1XT8 A;  1P99 A;  3OO9 A;  4EQ9 A;  1LFG A;  1LAX A;  2F7C A;  4XIG Q;  3TPA A;  5FTH A;  3G3F A;  1NL5 A;  2UYE A;  5KDT A;  4OES A;  1P1U A;  4LAT A;  4LZ8 A;  2YLN A;  3TTM A;  3CVG A;  2ALU A;  5L9M A;  2O1L A;  3O6I A;  3VLW A;  2B65 A;  3GBA A;  1XS5 A;  2P0S A;  4TQU Q;  3U8Q A;  1DOT A;  2REJ A;  1H3D A;  2Z8D A;  1S9T A;  3KOT A;  1NNP A;  2NOO A;  2QS4 A;  4UAC A;  2RC7 A;  3MVZ A;  3TEP A;  1IXI A;  1M5D A;  3U72 A;  3UP9 A;  4ELP A;  1B4Z A;  1XHY A;  2ZYO A;  4R2B A;  1B3F A;  3MAM A;  5TPA B;  3DP6 A;  1R9Q A;  1US4 A;  2Q2A A;  4QFK A;  5AA4 B;  3ZKL A;  4DXU A;  3MW0 A;  5EHM A;  2HEU A;  4G68 B;  3KJT A;  4DDD A;  2OLB A;  5I56 A;  4FIM A;  1Y3Q A;  2V25 A;  3KBR A;  4I9D A;  4ZDM A;  2XXX A;  3O29 A;  5FHM A;  3U92 A;  1LAH E;  1PBP A;  4EQB A;  1RYX A;  2Y7R A;  2NWJ A;  4DCX A;  5I58 B;  4NF5 B;  1P1N A;  5IAI A;  4ELR A;  1AOV A;  1R9L A;  3Q28 A;  1MY2 A;  3PPR A;  4LZ5 A;  3VVF A;  3Q29 A;  1ZIU A;  3FD3 A;  3HO7 A;  1IIT A;  4G2Z A;  4GF8 A;  3G3H A;  4THI A;  1Y3N A;  3EPE A;  4MFI A;  4RJZ A;  5DEX B;  4EF1 A;  3SES A;  3KN7 A;  5I57 A;  2FNC A;  1GV8 A;  5CM6 A;  1LFI A;  2I48 A;  3A3C A;  2AL4 A;  3FAT A;  1FTO A;  3N94 A;  3H6T A;  2Z8F A;  2G93 A;  3M3L A;  5DTB A;  3RT6 B;  3S9L C;  1MQG A;  3G3G A;  4U4X A;  1LB8 A;  1WDN A;  3FXR A;  1VFE A;  2ABH A;  4AB5 A;  1SI0 A;  4GL0 A;  3K1N A;  5DVF A;  4E0X A;  4C0R A;  4E0W A;  5I57 B;  5EYF A;  1B1X A;  4F1U A;  1AMF A;  3O6G A;  3PMV A;  1B32 A;  1B7Z A;  3K1M A;  4X9T A;  5CRY A;  1N7W A;  4HCY A;  1NKX A;  3S4U A;  2HQ0 A;  3QXM A;  3V8X B;  4Q30 B;  1AL3 A;  1N3W A;  4ESX A;  3FV1 A;  4KHZ E;  4OTE A;  3EHU A;  3U1O A;  1B5I A;  3IJO B;  3MC2 A;  4LVQ A;  5BUU A;  2UVG A;  2WKY A;  2O6A A;  1SVX B;  1Y4C A;  1H44 A;  2PVU A;  4LP2 B;  2XHD A;  3K2D A;  4OYV A;  3UIF A;  1DPP A;  5I2N B;  1FTK A;  2F6G A;  4LQ5 A;  1EZP A;  1TFA A;  5ICQ A;  4NF5 A;  1CE2 A;  4C1T A;  2I6E A;  1MQJ A;  4LQ2 A;  1Y3P A;  2DWA A;  1B6H A;  4QSE A;  4U2R A;  4GWO A;  3DEL B;  1QUI A;  3GZG A;  3AXF A;  4L17 A;  4XTC Q;  4YU0 A;  3TTN A;  1USY E;  2H99 A;  3HV1 A;  3VLV A;  4GVO A;  4G8N A;  2E0S A;  3OO6 A;  2GHB A;  1D9Y A;  3FJM A;  4OVJ A;  4RY1 A;  5JEI A;  1FTM A;  4YKI A;  1IIW A;  2DE3 A;  2W7Y A;  4QSC A;  1D4N A;  2QSX A;  3TEL A;  2IEE A;  1PDA A;  1FTJ A;  4ZEB A;  2Y84 A;  1B5J A;  1MXV A;  5TU0 A;  3DP4 A;  3MPK A;  4GXS B;  1BIY A;  2ZNT A;  5AA2 D;  3FAS A;  2UYF A;  5HBC A;  3TMG A;  5DEX A;  1FQF A;  1OQH A;  2Z8E A;  1P1O A;  2V93 A;  3E3K A;  5FTI A;  1UTH B;  4TLM B;  4DXB A;  1M5F A;  1MY4 A;  2Q88 A;  2Z23 A;  4QRZ A;  1FW0 A;  3I5O A;  3KJ7 A;  1B0L A;  4DIG A;  3FUZ A;  3O9P A;  4H5F A;  3W9W A;  3VVD A;  3OEK A;  3G3J A;  1PBQ A;  1D9V A;  3PGF A;  4IO2 A;  4OER A;  1B0H A;  4F2O A;  1URG A;  1A40 A;  1QUJ A;  2HZK A;  3L6G A;  1URD A;  2XXU A;  2R9J A;  1VR5 A;  3JZJ A;  3MBP A;  1N04 A;  3C9H A;  2DSF A;  3PPQ A;  3PUW E;  1JW5 A;  4N07 A;  4YB5 A;  3VVE A;  4OFJ A;  3PV0 E;  4ZE9 A;  1PC3 A;  2YJP A;  2V3T A;  2XXI A;  3CI8 A;  3TKD A;  3KN3 A;  1USY H;  1XVX A;  4IO3 A;  4EF2 A;  3FV2 A;  3IO4 A;  2NVU B;  3VV5 A;  3QUF A;  5DYH A;  1EH3 A;  1FQC A;  2XX8 A;  4ND9 A;  2ZMB A;  3OO7 A;  5L8D A;  2I3W A;  3L6H A;  2F6P A;  4G8H A;  1WOD A;  5I84 A;  2ZNU A;  1SD3 A;  1EU8 A;  1YAE A;  3HHG A;  1KWH A;  3EHT A;  2HAU A;  1JNF A;  4GL8 A;  3G7W A;  4DE8 A;  4NF4 B;  1OVT A;  2XD3 A;  4JWY A;  4R6Y A;  3DM0 A;  4F19 A;  3C34 A;  2A5T B;  4LUB A;  2DVC A;  4EDP A;  4WKM A;  3TUS A;  5KDT B;  3BKI B;  3MWB A;  5KCJ B;  5AE4 A;  3MP8 A;  1A55 A;  3FVK A;  1B52 A;  1N84 A;  2ZYM A;  4PET A;  2VD3 A;  1YCJ A;  1LAG E;  4XKN A;  4H0W A;  5AA2 B;  1YTV A;  2F78 A;  4R72 A;  2IA4 A;  3D4C A;  4F18 A;  1MQH A;  3IAZ A;  1N0T A;  1MDQ A;  1S7Y A;  3VFJ A;  1GGG A;  4NED A;  3FVG A;  4ECF A;  1XOC A;  3IR1 A;  4OXV A;  4QFN A;  3BBR A;  2Q89 A;  4R73 A;  4IB2 A;  4YKJ A;  3DP8 A;  3RQT A;  1I6Q A;  4G8M A;  1P1W A;  1FTL A;  3OSR A;  2I4B A;  4OEV A;  4X1B A;  2CZL A;  4NWC A;  1I6B A;  2THI A;  1O64 A;  3G3I A;  2XXW A;  1ATG A;  3W15 C;  5CI5 A;  3N5L A;  3R26 A;  2DQV A;  1IZ1 A;  2QJE A;  3IOT A;  4KYE A;  3MJN A;  4IGT A;  3KZG A;  4XKP A;  4BDL A;  4KFQ A;  4NF6 B;  3H7M A;  1B05 A;  2XXV A;  1SI1 A;  2XXQ A;  4R6K A;  5CMM A;  4ZS9 A;  2DE2 A;  2Y7K A;  4F1Y A;  4BLA A;  4YIC A;  3TFL A;  4IO5 A;  3I6V A;  2DWJ A;  1TT1 A;  3O66 A;  1SW4 A;  3EQ1 A;  3V83 A;  2ONS A;  1QVS A;  3IOV A;  3ONM A;  4BDO A;  2PX1 A;  4GD5 A;  2DWI A;  1Z7M E;  3A3U A;  2O69 A;  2REG A;  1A8E A;  1LAF E;  3SDF A;  1XC1 A;  1IEJ A;  1ZKB A;  2I0B A;  3PUY E;  4YZZ A;  4F1V A;  5HM4 B;  3GBB A;  3T9U A;  2XX9 A;  3LR1 A;  1HSJ A;  4YKK A;  2OWS A;  2QS2 A;  2HXW A;  4PQJ A;  2D21 A;  4JWX A;  2PT2 A;  1M5E A;  4YB6 A;  2QL3 A;  4EUO A;  4F3S A;  3CSG A;  3OEM A;  5I58 A;  4OWD A;  3ECR A;  2ZXT A;  1ELJ A;  3KSX A;  4MBP A;  3VDF A;  1SYH A;  5CMC A;  1SQY A;  4PE5 B;  3ZS6 A;  1WVJ A;  3O2A A;  1NMU A;  3JV9 A;  1SW2 A;  1OQG A;  2B3B A;  4KI0 E;  3C32 A;  3H03 A;  5H8S A;  1P1Q A;  1H45 A;  1B3G A;  3RUM A;  2Y7W A;  2F97 A;  4KQP A;  1N7X A;  2GH9 A;  4RK9 A;  4I1D A;  3W9V A;  3S9M C;  3PD8 A;  1OIB A;  3RPW A;  1JVY A;  4X1D A;  4ZEF A;  2PYY A;  1L5T A;  4ZE8 A;  3RLF E;  4GIZ A;  1N76 A;  4U22 A;  1IXC A;  1MM6 A;  3UGW A;  4EQ7 A;  3ZKK A;  4XKR A;  1B2H A;  4NF4 A;  5A5X B;  4UA8 A;  2I49 A;  4AB6 A;  2M8C A;  3FJ7 A;  3R7X A;  2QMW A;  1NNT A;  1DTG A;  2F7A A;  2HCA A;  3K6X A;  4ESW A;  1PB9 A;  2ONK E;  4O3A A;  4H6D A;  1LBC A;  3LSX A;  3LSL A;  3QK6 A;  1BKA A;  4IY5 A;  5M2V A;  3SKP A;  4Q0C A;  3VE1 B;  4FJP A;  5H8H B;  4H67 A;  3IB1 A;  2O1M A;  4YKP A;  4U21 A;  3T9H B;  1XVY A;  2Z22 A;  4U4S A;  1NH7 A;  5FHN A;  5JTY B;  2Q8J A;  4ONY A;  4H65 A;  4F31 B;  2XXR A;  2I58 A;  2I3V A;  4HTG A;  4PFW A;  2ONR A;  4PP0 A;  4G68 C;  2OJT A;  1MPD A;  1B7U A;  4RPN A;  1AH5 A;  4ZZA A;  1CB6 A;  2G29 A;  4LA9 A;  2LAO A;  4U23 A;  1SW5 A;  3TTK A;  3Q27 A;  4BDR A;  4O3C A;  1MY1 A;  3THI A;  3UN6 A;  3OEL A;  3IK6 B;  3H6U A;  4WED A;  5TP9 A;  3T96 B;  4G68 A;  4ZEC A;  1JVX A;  3S9N C;  2F36 A;  3B6W A;  3FXQ A;  5B70 A;  2RC9 A;  3MQ9 A;  4NE4 A;  3SEW A;  3CG1 A;  1DMB A;  1LGB C;  1MQD A;  1YPN A;  2Y7P A;  3B6T A;  2GRV A;  1UTH A;  4IO4 A;  3RGY A;  1MRP A;  2O51 A;  4FEC A;  3EN3 A;  1QUK A;  1B46 A;  2P1S A;  2H25 A;  3CFZ A;  3TTL A;  2DXR A;  1NFT A;  2DWH A;  1MXU A;  4U1Z A;  3MP1 A;  5H8F B;  5DVJ A;  4GFR A;  2DVZ A;  3E4R A;  1QW0 A;  2O68 A;  1SW1 A;  1JQF A;  3IOR A;  1MM7 A;  1FQA A;  3JYR A;  3O6H A;  3KSJ A;  2YPN A;  2DS9 A;  3CFL A;  4I62 A;  1B40 A;  4JB7 A;  1NH8 A;  1VFD A;  3RTF B;  5ISU A;  1A99 A;  1MXX A;  3FGS A;  4RA1 A;  2QPQ A;  2XXT A;  4M4G A;  4ZZE A;  3QUJ A;  3EHS A;  4GRK A;  4DXC A;  1R6Z A;  1VE4 A;  1Y9U A;  3SEU A;  1MH4 A;  4NF6 A;  3SEV A;  3TTR A;  1ANF A;  4LON B;  1O63 A;  4GQO A;  2B3F A;  4POX A;  3K01 A;  3I3V A;  3R6U A;  1Y4T A;  2XX7 A;  1DSN A;  1TWY A;  1OLC A;  3CSB A;  3LSW A;  3PPP A;  4LZ7 A;  5I59 A;  5L9O A;  2H5Y A;  1A8F A;  4R74 A;  5HPQ A;  2R71 A;  3TQW A;  1SDX A;  4KR5 A;  3UA8 A;  1POY 1;  3MZ1 A;  3OEN A;  1Y1Z A;  2XXP A;  2A5T A;  2H9B A;  4QFP A;  3RTW B;  3USD A;  1S50 A;  1PB7 A;  3IOU A;  3PUZ E;  4TOZ A;  2VOZ A;  1JEV A;  3FIR A;  5I2K A;  4F3B A;  2HAV A;  4KD5 A;  1B51 A;  4PFT A;  1QKB A;  5H8Q A;  3OO8 A;  3TAJ A;  3GLB A;  5A5X A;  2H98 A;  1NNF A;  2V3Q A;  4OFL A;  1B5H A;  4Z7E A;  2P2A A;  2RF1 A;  1Y20 A;  3IJX B;  4ZEI A;  4P0I A;  3P7I A;  2NXO A;  5JTY A;  3N26 A;  1LFH A;  4P0G A;  3N6U A;  1IQ7 A;  1RYO A;  4U1O A;  1UQW A;  4JXI A;  4N13 A;  4NF8 B;  5KCJ A;  3FJG A;  1DTZ A;  5K2X A;  4KCD A;  2OCU A;  3PUX E;  4H5G A;  5K2Y A;  2OZZ A;  3C36 A;  1GVC A;  5BWJ A;  3IL1 B;  1LST A;  2OWT A;  3OMB A;  3VLU A;  5AA3 A;  4WXJ A;  2A5S A;  5I2K B;  4C1U A;  4RK2 A;  5F7V A;  1B1H A;  3PU5 A;  2V3U A;  1JEU A;  4MLQ A; 
#chains in the Genus database with same CATH topology
 2VD2 A;  4HE1 A;  1MQI A;  4OZ9 A;  3A09 A;  5EYG A;  4P8B A;  4FOR A;  4F39 A;  3FVN A;  3QAX A;  1SYI A;  4ISU A;  4OAN A;  2CMO A;  1LB9 A;  2V84 A;  3IFC A;  2F35 A;  2UVJ A;  1LCF A;  3OXN A;  4OQO A;  3PPN A;  2PMS A;  4AS4 A;  3K1P A;  4MLV A;  3LUY A;  4HCW A;  3RNN A;  4OET A;  2QMX A;  1A54 A;  1LLS A;  4X48 A;  1GR2 A;  1IMA A;  2HZL A;  4Q8R A;  5JK4 A;  4IY6 A;  4KCC A;  4R75 A;  2ANJ A;  4RNS A;  3OSQ A;  1KA1 A;  4RYA A;  1J1N A;  4PGN A;  4H8I A;  3ODB A;  4QXD A;  4HW8 A;  5F1Q A;  3E78 A;  2KQZ A;  3HST A;  1I69 A;  1FJ6 A;  4UAB A;  5B70 A;  1OLA A;  5ITP A;  1ZBM A;  4JSO A;  4ZEK A;  4FEB A;  3SEY A;  1B3L A;  1NV5 A;  1ZJL A;  2RCA A;  3S9M C;  1LCT A;  3K6U A;  3VXB A;  3M3K A;  4OVR A;  5CBR A;  1UTB B;  3RPL B;  4RXL A;  2X26 A;  4JBZ A;  3CR9 A;  5I56 B;  3OD7 A;  3H6V A;  1QKA A;  3QIM A;  3N6T A;  1B3H A;  3T66 A;  4H46 A;  4NWD A;  3IX1 A;  4PCD A;  3C4M A;  4KPT A;  1R1N A;  1I6A A;  3QYT A;  5L9S A;  2XD2 A;  4I3E A;  4Z0I A;  4QFO A;  3EF7 A;  4OVT A;  1BP5 A;  1MXW A;  4ELQ A;  3K4U A;  5I2N A;  1RDX A;  5H8N A;  4EQ9 A;  1LFG A;  5KDT A;  1P1U A;  3TTM A;  3CVG A;  3O6I A;  2P0S A;  4TQU Q;  1DOT A;  3MST A;  4NQ8 A;  3U72 A;  5TPA B;  1US4 A;  3ZKL A;  3MW0 A;  1Y3Q A;  4I9D A;  5FHM A;  2XWK A;  1RYX A;  3IFA A;  3RYD A;  5IAI A;  1AOV A;  3HO7 A;  1FPG A;  4G2Z A;  3EPE A;  4NG7 A;  3KN7 A;  5I57 A;  2FNC A;  5CM6 A;  3FAT A;  3M3L A;  5DTB A;  2ABH A;  4E0W A;  3K1N A;  5I57 B;  1B1X A;  1AMF A;  2QVU A;  5CRY A;  4HCY A;  4GWS A;  3S4U A;  1DK4 A;  4KHZ E;  3MC2 A;  4LVQ A;  1SVX B;  4OYV A;  1FTK A;  1TFA A;  5ICQ A;  2I6E A;  4QSE A;  2DWA A;  1NV1 A;  3DEL B;  3AXF A;  1USY E;  3HV1 A;  2GHB A;  3KBZ A;  1FPK A;  3TEL A;  2IEE A;  5TU0 A;  4EQB A;  2Y84 A;  3MPK A;  2ZNT A;  5HBC A;  3E3K A;  2V93 A;  1M5F A;  4QRZ A;  3PTY A;  3KJ7 A;  4DIG A;  3O9P A;  1D9V A;  4OER A;  4IO2 A;  2HZK A;  4PF8 A;  3L6G A;  2XXU A;  1VR5 A;  3JZJ A;  3MBP A;  3PUW E;  2DSF A;  2YJP A;  3RPL A;  3KN3 A;  5DYH A;  1EH3 A;  1FQC A;  5I84 A;  2ZNU A;  3G7W A;  4DE8 A;  4JWY A;  4R6Y A;  3DM0 A;  4F19 A;  4MJO A;  3TUS A;  1JP4 A;  5KDT B;  3BKI B;  5AE4 A;  1N84 A;  4PET A;  1YCJ A;  4H0W A;  1FBG A;  1MQH A;  1S7Y A;  3VFJ A;  4NED A;  3T0J A;  3FVG A;  2Q89 A;  4R73 A;  1NV2 A;  3LV0 A;  2CZL A;  4O7M A;  1I6B A;  2THI A;  1O64 A;  3G3I A;  4PGP A;  4XKP A;  1B05 A;  4F1Y A;  3EQ1 A;  4N6D A;  4P1L A;  2WYK A;  1Z7M E;  2O69 A;  2REG A;  1A8E A;  1LAF E;  3SDF A;  1IEJ A;  3PUY E;  2XX9 A;  3QMF A;  3LR1 A;  1HSJ A;  1NV4 A;  2P3V A;  4PQJ A;  5I58 A;  4OWD A;  3VDF A;  4PE5 B;  3O2A A;  5H8S A;  3H03 A;  1H45 A;  1B3G A;  4PAK A;  4I1D A;  4X1D A;  1MM6 A;  4AB6 A;  4X8R A;  2QMW A;  2HCA A;  4H6D A;  4FJP A;  5ET6 A;  2O1M A;  3T9H B;  4ONY A;  4PFW A;  4G68 C;  2CZI A;  4RPN A;  4OVQ A;  2G29 A;  3TTK A;  4U23 A;  2Q74 A;  3UN6 A;  3OEL A;  4G68 A;  4MIJ A;  3S9N C;  1KA0 A;  2F36 A;  4FBP A;  1LGB C;  3B6T A;  4FEC A;  1QUK A;  2P1S A;  2H25 A;  3TTL A;  2DXR A;  1NFT A;  2DWH A;  3MP1 A;  5H8F B;  5DVJ A;  4GFR A;  1QW0 A;  2O68 A;  3IOR A;  3JYR A;  3O6H A;  2YPN A;  1VFD A;  1MXX A;  3FGS A;  2QPQ A;  1LBX A;  1IMF A;  1NV0 A;  3SEV A;  4MNP A;  1MH4 A;  4GQO A;  3I3V A;  1Y4T A;  1DSN A;  4LZ7 A;  5L9O A;  4I40 A;  1FBH A;  2WEF A;  2H9B A;  5I2K A;  3FIR A;  4F3B A;  4KD5 A;  1B51 A;  2Y5K A;  2H98 A;  4Z7E A;  2RF1 A;  1Y20 A;  3IJX B;  4P0I A;  4P0G A;  1IQ7 A;  1RYO A;  1DTZ A;  5EQ9 A;  3IL1 B;  1FPF A;  2V3U A;  4DXB A;  4H1X A;  3M3F A;  4KYS A;  3LC8 A;  3A29 A;  5DVI A;  3B7D A;  4N81 A;  4F29 A;  4R2F A;  4EXL A;  3TDJ A;  3E79 A;  2BJI A;  4O3B A;  1IXH A;  1FQE A;  5TPA A;  1B4H A;  3RN8 A;  4MH5 A;  4P11 A;  2R6G E;  2OK2 A;  2GHA A;  2XXK A;  4JDF A;  3KEI A;  3MZ9 A;  4O8M A;  1Z7N E;  4MNC A;  2QVR A;  2DP8 A;  4GBW A;  1JW1 A;  4F22 A;  4PE3 A;  5H8Q B;  4O7I A;  3QSL A;  1VSO A;  1UIU A;  2F7B A;  4PFY A;  4F3G A;  1H43 A;  1VDW A;  3K02 A;  5ISU A;  5B7D A;  3MVW A;  2QS3 A;  1YXI A;  3MVX A;  2F8D A;  3LBS A;  2RKM A;  3C33 A;  1JET A;  4N17 A;  3M8U A;  4YAH X;  3PPO A;  1PEB A;  1LBW A;  2Q9T A;  5H8H A;  2QS1 A;  2XA5 A;  2PFY A;  2Q2C A;  4DLD A;  3KGC A;  5KZT A;  5EQA A;  4MMP A;  5AA2 A;  5LOM A;  4NF8 A;  3B8B A;  1BLF A;  2ZNS A;  3PMX A;  3H6W A;  3TCF A;  5IKB A;  1HSL A;  2X7P A;  1TXF A;  2GFE A;  3GXA A;  2RIN A;  1B3E A;  3IB0 A;  5TP9 B;  4QFL A;  1N3X A;  3GYY A;  4GWY A;  2FYI A;  5FHO A;  1EZ9 A;  4OEN A;  3ROJ A;  5CMK A;  4MF3 A;  4GWX A;  3TOD A;  3IOW A;  5J16 A;  4MX6 A;  3CFX A;  3Q25 A;  4BDM A;  3PD9 A;  4QHQ A;  5F24 A;  2VP1 A;  4TLL B;  3HFU A;  4RPO A;  3G3K A;  4IO7 A;  4PFI A;  5IM2 A;  5H8N B;  2VGQ A;  3C31 A;  3FZV A;  1MG1 A;  3MP6 A;  3TZA A;  4NAP A;  1O7T A;  1B7H A;  3VE1 B;  1POT A;  3K6V A;  2ZYN A;  3DLN A;  4G77 A;  4NTL A;  3PUV E;  2OX3 A;  4LN5 A;  4AQ4 A;  1P99 A;  4NN3 A;  1LAX A;  4XIG Q;  1NL5 A;  2UYE A;  4LAT A;  2KR0 A;  5L9M A;  2B65 A;  1XS5 A;  3U8Q A;  1H3D A;  1S9T A;  3KOT A;  1NNP A;  2QS4 A;  3MVZ A;  1IXI A;  4ELP A;  1B4Z A;  1XHY A;  4R2B A;  3MAM A;  3DP6 A;  4QFK A;  2Q2A A;  5I56 A;  3O29 A;  1PBP A;  4PTK A;  1MY2 A;  4LZ5 A;  1NI9 A;  3G3H A;  5DEX B;  4EF1 A;  2I48 A;  1FTO A;  2Z8F A;  3RT6 B;  4U4X A;  1WDN A;  3FXR A;  4GL0 A;  4E0X A;  4C0R A;  4F1U A;  3O6G A;  1B32 A;  1N7W A;  4Q30 B;  1N3W A;  4ESX A;  3U1O A;  1B5I A;  2WKY A;  4LP2 B;  2FHY A;  1DPP A;  2F6G A;  1CE2 A;  2WBB A;  4LQ2 A;  1MQJ A;  1Y3P A;  1YZ0 A;  4YU0 A;  4GVO A;  4G8N A;  1D9Y A;  4OVJ A;  4QSC A;  4PAI A;  1PDA A;  1FTJ A;  1FBD A;  1B5J A;  4GXS B;  4PC9 A;  5AA2 D;  2ZZX A;  2Z8E A;  5FTI A;  2PCR A;  3FUZ A;  1FBP A;  3VVD A;  3G3J A;  1PBQ A;  1B0H A;  1URD A;  1N04 A;  4YB5 A;  2FIX A;  4PBH A;  4OFJ A;  1PC3 A;  2XXI A;  3CI8 A;  3TKD A;  1USY H;  4IO3 A;  3B50 A;  3FV2 A;  5L8D A;  2F6P A;  2Q8M A;  3EHT A;  2HAU A;  4NF4 B;  2XD3 A;  3D1R A;  4WKM A;  3MP8 A;  5A5L A;  2ZYM A;  3D4C A;  3IAZ A;  1XOC A;  4YKJ A;  4GWZ A;  3BBR A;  1P1W A;  1FTL A;  3OSR A;  2I4B A;  2XXW A;  3W15 C;  5CI5 A;  3FBP A;  1QGX A;  2QJE A;  3IOT A;  4KYE A;  2QFL A;  3KZG A;  4BDL A;  4ZS9 A;  2XXV A;  2Y7K A;  1TT1 A;  3V83 A;  3IOV A;  1QVS A;  3ONM A;  2PX1 A;  4GD5 A;  1ZKB A;  5HM4 B;  4JWX A;  4YB6 A;  3CSG A;  3OEM A;  4MBP A;  1SYH A;  2HHM A;  1WVJ A;  3ZS6 A;  4KI0 E;  2FIE A;  1LBZ A;  1FBE A;  2Y7W A;  1N7X A;  2GH9 A;  1OIB A;  2OWZ A;  3RPW A;  1JVY A;  4GIZ A;  5A5X B;  3NOH A;  5DW8 A;  2M8C A;  3R7X A;  4JVC A;  2F7A A;  2PFZ A;  4ESW A;  2ONK E;  1LBC A;  1FBF A;  3LSX A;  4IY5 A;  3SKP A;  4Q0C A;  3IB1 A;  4GWU A;  5FHN A;  4H65 A;  2XXR A;  2XWO A;  4H45 A;  4N8G A;  1SW5 A;  4PDD A;  3Q27 A;  3IK6 B;  4WED A;  3T96 B;  3FXQ A;  3VXC A;  1DMB A;  1YPN A;  2Y7P A;  4NHB A;  1UTH A;  1MRP A;  3CFZ A;  3E4R A;  1SW1 A;  2DS9 A;  4I62 A;  1B40 A;  1NH8 A;  2GQ1 A;  1EYI A;  4M4G A;  3QUJ A;  2HPG A;  1R6Z A;  4LON B;  2B3F A;  3R6U A;  3CSB A;  2H5Y A;  4R74 A;  2R71 A;  3KC1 A;  3OEN A;  2XXP A;  2A5T A;  3USD A;  4PFT A;  5H8Q A;  3GLB A;  5A5X A;  1NNF A;  1G0H A;  5JTY A;  4JXI A;  2HXR A;  4NF8 B;  1EYJ A;  5K2X A;  2OCU A;  4H5G A;  5K2Y A;  5BWJ A;  2OWT A;  3VLU A;  5AA3 A;  4WXJ A;  4C1U A;  5F7V A;  4GBV A;  1Q35 A;  5H8F A;  3K6W A;  4BDN A;  2RCB A;  3V89 B;  1IMC A;  4OA4 A;  4N15 A;  4WEP A;  3U65 A;  1KZ8 A;  2VT5 A;  4FE8 A;  1FCK A;  1FQB A;  4JVI A;  5ICT A;  2F34 A;  3V5A A;  2F5X A;  1TFD A;  4YB7 A;  4HS7 A;  2ZYK A;  4G4P A;  3ZSF A;  1NV6 A;  3SET A;  3T93 B;  1US5 A;  5DT6 A;  2VHA A;  4OEU A;  1BTJ A;  4BDQ A;  4XXU A;  1FPB A;  4FAJ A;  3K00 A;  1M5B A;  3E9X A;  3MPL A;  1QJM A;  4DCY A;  3KG2 A;  1LBV A;  3TCH A;  3KN8 A;  3B6Q A;  1UTB A;  2O84 X;  1T0K A;  2P3N A;  2F3D A;  3ILT B;  4OHN A;  4DZ1 A;  1II5 A;  3MZB A;  4R6H A;  4DI3 D;  5AA1 A;  4Q5T A;  2HFB A;  3PMW A;  4ZED A;  1SBP A;  1IUD A;  1AIV A;  3WAE A;  1HSE A;  4JWO A;  1DBZ A;  4IGR A;  4I8C A;  2X7Q A;  2NUV A;  3HN0 A;  1MS7 A;  4FAT A;  1MXZ A;  2QRY A;  3E13 X;  2DYX A;  5ELV A;  3CG3 A;  1B9J A;  1MY0 A;  3ILU B;  5AA4 A;  2AYS A;  2FBP A;  1SPI A;  3LSF B;  5ITO A;  5EHS A;  2UVI A;  3H3G A;  1A7L A;  1DPE A;  2UXA A;  1H76 A;  3H06 B;  2H4I A;  5ET7 A;  1LBB A;  2D3I A;  2O7U A;  3HPI A;  3IO6 A;  4HE0 A;  2BJJ X;  4R9F A;  1NV7 A;  3BFT A;  4EXK A;  1MY3 A;  3SER A;  1LEV A;  4QSD A;  1NUY A;  4F2Q A;  3MUQ A;  2AL5 A;  1ZMG A;  2XXH A;  3CRB A;  5ET5 A;  5I59 B;  2V4C A;  2E1S A;  5IZ3 B;  4XKQ A;  4GLI A;  2DXY A;  3TCG A;  1XT8 A;  3OO9 A;  3TPA A;  5FTH A;  4I3Y A;  1FPD A;  5EQ7 A;  4OES A;  4LZ8 A;  3VLW A;  3GBA A;  2REJ A;  2RC7 A;  3TEP A;  4NGU A;  3UP9 A;  1R9Q A;  1NUZ A;  1XI6 A;  5AA4 B;  2CZH A;  2HEU A;  4G68 B;  3KJT A;  4DDD A;  2OLB A;  4FIM A;  3KBR A;  2V25 A;  1FPI A;  4DCX A;  2B4L A;  5I58 B;  5IZ3 A;  4ELR A;  1R9L A;  1ZIU A;  4GF8 A;  4THI A;  1Y3N A;  3SES A;  5IZ1 A;  1LFI A;  3A3C A;  3T1B A;  4N91 A;  3H6T A;  4XEQ A;  1MQG A;  1SI0 A;  5EYF A;  4KXP A;  1G0I A;  3PMV A;  1B7Z A;  4X9T A;  2XWI A;  4MAG A;  2FVZ A;  1AL3 A;  5ESY A;  4OTE A;  3EHU A;  3IJO B;  5BUU A;  1IMD A;  2UVG A;  1Y4C A;  5LDZ A;  2XHD A;  4X04 A;  3UIF A;  1EZP A;  5I7I A;  1B6H A;  1IME A;  1QUI A;  4XTC Q;  3TTN A;  2H99 A;  3VLV A;  1FTM A;  4YKI A;  2DE3 A;  2W7Y A;  1D4N A;  2WBD A;  1INP A;  1MXV A;  3DP4 A;  1BIY A;  3TMG A;  5DEX A;  1FQF A;  1OQH A;  1P1O A;  1UTH B;  4JVD A;  2Z23 A;  3I5O A;  1B0L A;  4HE2 A;  4H5F A;  3W9W A;  3OEK A;  2R9J A;  3U94 A;  3VVE A;  3PPQ A;  4EF2 A;  4PFR A;  3VV5 A;  4ND9 A;  4G8H A;  1FTA A;  1SD3 A;  1EU8 A;  1YAE A;  3CHG A;  1JNF A;  2A5T B;  2DVC A;  4EDP A;  5KCJ B;  2VPO A;  1A55 A;  3FVK A;  2VD3 A;  4XKN A;  1LAG E;  2CZK A;  1N0T A;  1MDQ A;  1GGG A;  4ECF A;  3DP8 A;  4OEV A;  1D9Q A;  4X1B A;  4NWC A;  5I3S A;  1ATG A;  1IZ1 A;  3MJN A;  4IGT A;  4KFQ A;  2XXQ A;  4BLA A;  3TFL A;  3I6V A;  2DWJ A;  1SW4 A;  4BDO A;  2I0B A;  3T9U A;  4YKK A;  4P3L A;  2PT2 A;  4F3S A;  2ZXT A;  3KC0 A;  5CMC A;  4P56 A;  1NMU A;  1SW2 A;  1OQG A;  2F97 A;  4KQP A;  4RK9 A;  3W9V A;  4PAF A;  3PD8 A;  1L5T A;  4ZEF A;  4ZE8 A;  4U22 A;  2Y5L A;  4N4U A;  3UGW A;  1B2H A;  4NF4 A;  2ZZW A;  2I49 A;  4UA8 A;  1DTG A;  3K6X A;  4O3A A;  3LSL A;  4H67 A;  4U21 A;  1NH7 A;  2Q8J A;  5JTY B;  4PP0 A;  2I58 A;  2L5V A;  1MPD A;  4O3C A;  1MY1 A;  4ZEC A;  5TP9 A;  4XF5 A;  3MQ9 A;  3SEW A;  3CG1 A;  3RGY A;  2GRV A;  4IO4 A;  3EN3 A;  1MXU A;  4U1Z A;  2DVZ A;  4P1E A;  4JB7 A;  1RDY A;  3RTF B;  4RA1 A;  2XXT A;  4DXC A;  1VE4 A;  1Y9U A;  4NF6 A;  5HPQ A;  2DDK A;  3TQW A;  1SDX A;  4KR5 A;  1POY 1;  3MZ1 A;  4QFP A;  3RTW B;  1S50 A;  1PB7 A;  3IOU A;  3PUZ E;  1JEV A;  1FPL A;  1BK4 A;  2F3B A;  1QKB A;  3EKI A;  3OO8 A;  4ZEI A;  2NXO A;  3N26 A;  1LFH A;  1UQW A;  4AS5 A;  5KCJ A;  4KCD A;  1GVC A;  3C36 A;  1LST A;  5I2K B;  4RK2 A;  2ONR A;  1B1H A;  4MLQ A;  1D3K A;  3S2V A;  1B58 A;  1ZLQ A;  4YMB A;  4GX4 A;  1EZO A;  2OBG A;  1FJ9 A;  4FED A;  1FQD A;  3KOS A;  4NMY A;  1FSA A;  2DE4 A;  3D4G A;  4R9G A;  1Y1M A;  1OVB A;  1F9B A;  5IZZ A;  2PBW A;  4MEV A;  1RKM A;  3UK4 A;  5CMB A;  3WAF A;  2XXY A;  3FXB A;  1MDP 1;  3UOR A;  1EYK A;  2O7I A;  4H8J A;  5J1D A;  5CBS A;  3KFM A;  4N6P A;  1MH3 A;  1JW4 A;  3TYH A;  4PFU A;  2MKZ A;  3SEX A;  2D5W A;  4OFO A;  4QF9 A;  2PT1 A;  2AIX A;  2DOJ A;  2I0C A;  1NV3 A;  4JSD A;  3RT8 A;  1ZTY A;  1Q1K A;  5EYH A;  5T3J A;  1FPE A;  1OMP A;  2KLF A;  3BFU A;  4KYD A;  4GOT A;  1GTK A;  3T9V A;  2Y7I A;  1UIV A;  1NNK A;  4POW A;  2WYP A;  3T9X B;  3TQL A;  3U93 A;  4M1V A;  3S9E A;  1K9Y A;  1NUW A;  4P47 A;  5CC2 A;  3SZP A;  1M5C A;  1MPC A;  4K3F A;  1MXY A;  4IO6 A;  3T22 A;  2RC8 A;  1PB8 A;  4GXA A;  3RY3 A;  4OMB A;  3K0V A;  3F11 A;  3MVY A;  2R8T A;  3O97 A;  2FA7 A;  3C35 A;  3Q26 A;  3OOA A;  3CIJ A;  3H4Z A;  1IXG A;  4F3P A;  3FVO A;  4YMA A;  2UVH A;  1QUL A;  1URS A;  3HHF A;  1YYZ A;  3HCQ A;  2ESN A;  2XWV A;  1MPB A;  3IB2 A;  3O28 A;  4IR8 A;  4QBA A;  1ZU0 A;  2I4C A;  3FXU A;  4ELO A;  1NUX A;  2F7C A;  3G3F A;  2YLN A;  2ALU A;  2O1L A;  2Z8D A;  2NOO A;  4UAC A;  1M5D A;  2VPN A;  2ZYO A;  4NF0 A;  1B3F A;  4GX6 A;  4DXU A;  5EHM A;  4ZDM A;  2XXX A;  3U92 A;  1LAH E;  2Y7R A;  2NWJ A;  4PFB A;  4NF5 B;  1Q9D A;  1P1N A;  4N6K A;  3BIH A;  3Q28 A;  3PPR A;  3Q29 A;  3FD3 A;  1IIT A;  4MFI A;  4RJZ A;  1GV8 A;  1RDZ A;  1LBY A;  2AL4 A;  3N94 A;  3S9L C;  2G93 A;  3G3G A;  1LB8 A;  1VFE A;  4AB5 A;  5DVF A;  3K1M A;  1NKX A;  2HQ0 A;  3QXM A;  3V8X B;  3FV1 A;  2O6A A;  1H44 A;  4PBQ A;  2PVU A;  3K2D A;  3ISP A;  2CEY A;  5I2N B;  4LQ5 A;  4MHF A;  4NF5 A;  4C1T A;  4U2R A;  4GWO A;  4L17 A;  3GZG A;  2E0S A;  3OO6 A;  1AWB A;  3FJM A;  4RY1 A;  1FRP A;  5LTC A;  5JEI A;  1IIW A;  2QSX A;  4ZEB A;  3FAS A;  2UYF A;  4TLM B;  2Q88 A;  1MY4 A;  5I5P A;  1FW0 A;  3PGF A;  4F2O A;  1URG A;  1A40 A;  1QUJ A;  3LUZ A;  4N07 A;  3C9H A;  1JW5 A;  3PV0 E;  4ZE9 A;  2V3T A;  4GWW A;  1XVX A;  3IO4 A;  2NVU B;  3QUF A;  2XX8 A;  2ZMB A;  3OO7 A;  2I3W A;  3L6H A;  1WOD A;  4GX3 A;  3HHG A;  1KWH A;  2CEX A;  4GL8 A;  1OVT A;  3C34 A;  4LUB A;  3MWB A;  1B52 A;  4P9K A;  5AA2 B;  1YTV A;  2F78 A;  4R72 A;  4NX1 A;  2IA4 A;  4F18 A;  3IR1 A;  4OXV A;  1DCU A;  4QFN A;  3RQT A;  4IB2 A;  1I6Q A;  4G8M A;  4PF6 A;  3N5L A;  3R26 A;  2DQV A;  4NF6 B;  3H7M A;  4R6K A;  1SI1 A;  5CMM A;  2DE2 A;  4G61 A;  4YIC A;  4IO5 A;  3BIG A;  3O66 A;  2ONS A;  5EQ8 A;  4OVS A;  1FPJ A;  5ET8 A;  2DWI A;  3A3U A;  2B4M A;  1XC1 A;  4F1V A;  4YZZ A;  3GBB A;  4MNI A;  4OVP A;  2OWS A;  2QS2 A;  2HXW A;  2D21 A;  4EUO A;  1M5E A;  2QL3 A;  3ECR A;  1ELJ A;  3KSX A;  1SQY A;  4HXV A;  3JV9 A;  2B3B A;  3C32 A;  1P1Q A;  3RUM A;  3MYU A;  4XFE A;  2PYY A;  3RLF E;  1N76 A;  1IXC A;  4EQ7 A;  3ZKK A;  4XKR A;  4MCO A;  3FJ7 A;  1NNT A;  1PB9 A;  3QK6 A;  1BKA A;  5M2V A;  5H8H B;  4YKP A;  1XVY A;  2Z22 A;  4U4S A;  4F31 B;  4HTG A;  2I3V A;  2OJT A;  1B7U A;  4ZZA A;  1AH5 A;  1CB6 A;  4LA9 A;  2LAO A;  4BDR A;  2WX9 A;  3THI A;  3H6U A;  1JVX A;  3B6W A;  2RC9 A;  4NE4 A;  5IGA A;  1MQD A;  3VVF A;  2O51 A;  1B46 A;  1K9Z A;  1FBC A;  1JQF A;  1MM7 A;  1FQA A;  3KSJ A;  3CFL A;  2QVV A;  1A99 A;  1CNQ A;  4ZZE A;  3EHS A;  4GRK A;  4O94 A;  3SEU A;  3TTR A;  1ANF A;  1O63 A;  4POX A;  3K01 A;  2XX7 A;  1TWY A;  1OLC A;  3LSW A;  3PPP A;  5I59 A;  1A8F A;  5FBP A;  3UA8 A;  4N8Y A;  1Y1Z A;  4TOZ A;  2VOZ A;  2HAV A;  2ZZV A;  3TAJ A;  4OFL A;  2V3Q A;  1B5H A;  2P2A A;  3P7I A;  3N6U A;  4U1O A;  4PDH A;  4N13 A;  4DI4 B;  3FJG A;  3PUX E;  1IMB A;  2OZZ A;  2JJK A;  3OMB A;  2A5S A;  3PU5 A;  1JEU A; 
#chains in the Genus database with same CATH homology
 1D3K A;  4H1X A;  3M3F A;  4KYS A;  2VD2 A;  3S2V A;  1Q35 A;  1B58 A;  1MQI A;  1ZLQ A;  4OZ9 A;  3A09 A;  3K6W A;  4BDN A;  3LC8 A;  4DLD A;  4YMB A;  2RCB A;  5DVI A;  1EZO A;  3B7D A;  2OBG A;  3V89 B;  4FOR A;  4F39 A;  3FVN A;  4F29 A;  3QAX A;  4R2F A;  4EXL A;  4FED A;  3TDJ A;  1SYI A;  1FQD A;  4WEP A;  4O3B A;  4ISU A;  3KOS A;  4NMY A;  1IXH A;  1FQE A;  2CMO A;  4FE8 A;  1FCK A;  2DE4 A;  1FQB A;  3D4G A;  5TPA A;  4R9G A;  1B4H A;  1Y1M A;  3RN8 A;  5ICT A;  4MH5 A;  1LB9 A;  1OVB A;  2F34 A;  2V84 A;  4P11 A;  3V5A A;  2F5X A;  1TFD A;  4YB7 A;  2R6G E;  4HS7 A;  2OK2 A;  2ZYK A;  2GHA A;  1F9B A;  2F35 A;  4G4P A;  2UVJ A;  2PBW A;  4JDF A;  3KEI A;  3MZ9 A;  3ZSF A;  3SET A;  1LCF A;  3T93 B;  1RKM A;  3OXN A;  1US5 A;  1Z7N E;  3UK4 A;  5DT6 A;  2VHA A;  4OQO A;  4OEU A;  3PPN A;  2PMS A;  1BTJ A;  5CMB A;  4BDQ A;  3K1P A;  2DP8 A;  1JW1 A;  4MLV A;  3LUY A;  4XXU A;  4HCW A;  4F22 A;  5H8Q B;  3WAF A;  3QSL A;  3RNN A;  1VSO A;  3K00 A;  4FAJ A;  5H8F A;  1UIU A;  2F7B A;  2XXY A;  4PFY A;  4OET A;  4F3G A;  1H43 A;  1M5B A;  3E9X A;  1QJM A;  1A54 A;  1MDP 1;  2QMX A;  3K02 A;  3KG2 A;  3MPL A;  2O7I A;  4H8J A;  3UOR A;  3TCH A;  1LLS A;  3KFM A;  5B7D A;  5CBS A;  3KN8 A;  4X48 A;  5J1D A;  3MVW A;  3B6Q A;  2QS3 A;  1UTB A;  1GR2 A;  4N6P A;  2O84 X;  2HZL A;  1MH3 A;  4Q8R A;  1T0K A;  3MVX A;  4IY6 A;  2F8D A;  3ILT B;  5JK4 A;  1JW4 A;  4KCC A;  4R75 A;  3TYH A;  3LBS A;  2ANJ A;  2RKM A;  3C33 A;  4OHN A;  4DZ1 A;  1II5 A;  1JET A;  4RNS A;  3OSQ A;  3M8U A;  4PFU A;  3MZB A;  4RYA A;  4YAH X;  3PPO A;  4R6H A;  1J1N A;  4Q5T A;  2HFB A;  3PMW A;  4H8I A;  3ODB A;  1PEB A;  2D5W A;  2Q9T A;  5AA1 A;  5H8H A;  1SBP A;  3SEX A;  1IUD A;  2QS1 A;  4HW8 A;  4ZED A;  5F1Q A;  1AIV A;  3HST A;  3WAE A;  1HSE A;  1I69 A;  4OFO A;  2Q2C A;  4JWO A;  2PT1 A;  3KGC A;  2AIX A;  4QF9 A;  2DOJ A;  1OLA A;  4IGR A;  2I0C A;  4I8C A;  5ITP A;  5KZT A;  1ZBM A;  4JSD A;  4JSO A;  1ZTY A;  3RT8 A;  1Q1K A;  2X7Q A;  4NF8 A;  4ZEK A;  3U94 A;  5AA2 A;  5LOM A;  1OMP A;  2KLF A;  2NUV A;  1BLF A;  3HN0 A;  1MS7 A;  4FEB A;  3BFU A;  4KYD A;  4GOT A;  1B3L A;  2ZNS A;  3SEY A;  1GTK A;  3PMX A;  3T9V A;  2Y7I A;  4FAT A;  1UIV A;  1ZJL A;  1MXZ A;  1NNK A;  3H6W A;  4POW A;  2QRY A;  3TCF A;  5IKB A;  1HSL A;  2RCA A;  3E13 X;  2X7P A;  1TXF A;  1LCT A;  2DYX A;  2GFE A;  3GXA A;  4M1V A;  3T9X B;  3TQL A;  3U93 A;  3K6U A;  3S9E A;  5ELV A;  3CG3 A;  3VXB A;  1B9J A;  1MY0 A;  2RIN A;  3ILU B;  3M3K A;  5AA4 A;  1B3E A;  2AYS A;  3IB0 A;  5TP9 B;  5CC2 A;  4QFL A;  1M5C A;  1MPC A;  1N3X A;  1UTB B;  4K3F A;  5CBR A;  1MXY A;  4IO6 A;  3LSF B;  3T22 A;  2FYI A;  2RC8 A;  5FHO A;  1PB8 A;  4GXA A;  3VXC A;  3RY3 A;  4RXL A;  1EZ9 A;  5ITO A;  2X26 A;  4OEN A;  3K0V A;  3F11 A;  4JBZ A;  4OMB A;  5EHS A;  3MVY A;  2UVI A;  3CR9 A;  3H3G A;  5CMK A;  1A7L A;  3O97 A;  4MF3 A;  5I56 B;  1DPE A;  3IOW A;  2UXA A;  1H76 A;  3OD7 A;  3TOD A;  3CFX A;  3Q25 A;  3H6V A;  1QKA A;  2FA7 A;  3C35 A;  3PD9 A;  3QIM A;  4QHQ A;  4BDM A;  3N6T A;  3Q26 A;  3H06 B;  2H4I A;  3OOA A;  1B3H A;  3T66 A;  1LBB A;  2VP1 A;  3CIJ A;  4TLL B;  3H4Z A;  2D3I A;  2O7U A;  4RPO A;  3G3K A;  4IO7 A;  1IXG A;  3HPI A;  4NWD A;  3IO6 A;  3IX1 A;  5H8N B;  4F3P A;  2VGQ A;  2BJJ X;  3C4M A;  4R9F A;  3C31 A;  3FVO A;  3FZV A;  4KPT A;  3BFT A;  4YMA A;  2UVH A;  4EXK A;  1QUL A;  1R1N A;  1URS A;  3HHF A;  1MY3 A;  3HCQ A;  3SER A;  1I6A A;  3QYT A;  1MG1 A;  2ESN A;  2XD2 A;  3MP6 A;  5L9S A;  4QSD A;  3TZA A;  1MPB A;  4Z0I A;  4DCY A;  1O7T A;  4F2Q A;  1B7H A;  3MUQ A;  1POT A;  2AL5 A;  1ZMG A;  3IB2 A;  2XXH A;  3CRB A;  3O28 A;  4QFO A;  3EF7 A;  1ZU0 A;  3K6V A;  1BP5 A;  2ZYN A;  5I59 B;  1MXW A;  3DLN A;  2I4C A;  4ELQ A;  3FXU A;  2E1S A;  4G77 A;  4ELO A;  4NTL A;  3K4U A;  3PUV E;  4XKQ A;  4GLI A;  5I2N A;  5H8N A;  2DXY A;  3TCG A;  4AQ4 A;  1XT8 A;  1P99 A;  3OO9 A;  4EQ9 A;  1LFG A;  1LAX A;  2F7C A;  4XIG Q;  3TPA A;  5FTH A;  3G3F A;  1NL5 A;  2UYE A;  5KDT A;  4OES A;  1P1U A;  4LAT A;  4LZ8 A;  2YLN A;  3TTM A;  3CVG A;  2ALU A;  5L9M A;  2O1L A;  3O6I A;  3VLW A;  2B65 A;  3GBA A;  1XS5 A;  2P0S A;  4TQU Q;  3U8Q A;  1DOT A;  2REJ A;  1H3D A;  2Z8D A;  1S9T A;  3KOT A;  1NNP A;  2NOO A;  2QS4 A;  4UAC A;  2RC7 A;  3MVZ A;  3TEP A;  1IXI A;  1M5D A;  3U72 A;  3UP9 A;  4ELP A;  1B4Z A;  1XHY A;  2ZYO A;  4R2B A;  1B3F A;  3MAM A;  5TPA B;  3DP6 A;  1R9Q A;  1US4 A;  2Q2A A;  4QFK A;  5AA4 B;  3ZKL A;  4DXU A;  3MW0 A;  5EHM A;  2HEU A;  4G68 B;  3KJT A;  4DDD A;  2OLB A;  5I56 A;  4FIM A;  1Y3Q A;  2V25 A;  3KBR A;  4I9D A;  4ZDM A;  2XXX A;  3O29 A;  5FHM A;  3U92 A;  1LAH E;  1PBP A;  4EQB A;  1RYX A;  2Y7R A;  2NWJ A;  4DCX A;  5I58 B;  4NF5 B;  1P1N A;  5IAI A;  4ELR A;  1AOV A;  1R9L A;  3Q28 A;  1MY2 A;  3PPR A;  4LZ5 A;  3VVF A;  3Q29 A;  1ZIU A;  3FD3 A;  3HO7 A;  1IIT A;  4G2Z A;  4GF8 A;  3G3H A;  4THI A;  1Y3N A;  3EPE A;  4MFI A;  4RJZ A;  5DEX B;  4EF1 A;  3SES A;  3KN7 A;  5I57 A;  2FNC A;  1GV8 A;  5CM6 A;  1LFI A;  2I48 A;  3A3C A;  2AL4 A;  3FAT A;  1FTO A;  3N94 A;  3H6T A;  2Z8F A;  2G93 A;  3M3L A;  5DTB A;  3RT6 B;  3S9L C;  1MQG A;  3G3G A;  4U4X A;  1LB8 A;  1WDN A;  3FXR A;  1VFE A;  2ABH A;  4AB5 A;  1SI0 A;  4GL0 A;  3K1N A;  5DVF A;  4E0X A;  4C0R A;  4E0W A;  5I57 B;  5EYF A;  1B1X A;  4F1U A;  1AMF A;  3O6G A;  3PMV A;  1B32 A;  1B7Z A;  3K1M A;  4X9T A;  5CRY A;  1N7W A;  4HCY A;  1NKX A;  3S4U A;  2HQ0 A;  3QXM A;  3V8X B;  4Q30 B;  1AL3 A;  1N3W A;  4ESX A;  3FV1 A;  4KHZ E;  4OTE A;  3EHU A;  3U1O A;  1B5I A;  3IJO B;  3MC2 A;  4LVQ A;  5BUU A;  2UVG A;  2WKY A;  2O6A A;  1SVX B;  1Y4C A;  1H44 A;  2PVU A;  4LP2 B;  2XHD A;  3K2D A;  4OYV A;  3UIF A;  1DPP A;  5I2N B;  1FTK A;  2F6G A;  4LQ5 A;  1EZP A;  1TFA A;  5ICQ A;  4NF5 A;  1CE2 A;  4C1T A;  2I6E A;  1MQJ A;  4LQ2 A;  1Y3P A;  2DWA A;  1B6H A;  4QSE A;  4U2R A;  4GWO A;  3DEL B;  1QUI A;  3GZG A;  3AXF A;  4L17 A;  4XTC Q;  4YU0 A;  3TTN A;  1USY E;  2H99 A;  3HV1 A;  3VLV A;  4GVO A;  4G8N A;  2E0S A;  3OO6 A;  2GHB A;  1D9Y A;  3FJM A;  4OVJ A;  4RY1 A;  5JEI A;  1FTM A;  4YKI A;  1IIW A;  2DE3 A;  2W7Y A;  4QSC A;  1D4N A;  2QSX A;  3TEL A;  2IEE A;  1PDA A;  1FTJ A;  4ZEB A;  2Y84 A;  1B5J A;  1MXV A;  5TU0 A;  3DP4 A;  3MPK A;  4GXS B;  1BIY A;  2ZNT A;  5AA2 D;  3FAS A;  2UYF A;  5HBC A;  3TMG A;  5DEX A;  1FQF A;  1OQH A;  2Z8E A;  1P1O A;  2V93 A;  3E3K A;  5FTI A;  1UTH B;  4TLM B;  4DXB A;  1M5F A;  1MY4 A;  2Q88 A;  2Z23 A;  4QRZ A;  1FW0 A;  3I5O A;  3KJ7 A;  1B0L A;  4DIG A;  3FUZ A;  3O9P A;  4H5F A;  3W9W A;  3VVD A;  3OEK A;  3G3J A;  1PBQ A;  1D9V A;  3PGF A;  4IO2 A;  4OER A;  1B0H A;  4F2O A;  1URG A;  1A40 A;  1QUJ A;  2HZK A;  3L6G A;  1URD A;  2XXU A;  2R9J A;  1VR5 A;  3JZJ A;  3MBP A;  1N04 A;  3C9H A;  2DSF A;  3PPQ A;  3PUW E;  1JW5 A;  4N07 A;  4YB5 A;  3VVE A;  4OFJ A;  3PV0 E;  4ZE9 A;  1PC3 A;  2YJP A;  2V3T A;  2XXI A;  3CI8 A;  3TKD A;  3KN3 A;  1USY H;  1XVX A;  4IO3 A;  4EF2 A;  3FV2 A;  3IO4 A;  2NVU B;  3VV5 A;  3QUF A;  5DYH A;  1EH3 A;  1FQC A;  2XX8 A;  4ND9 A;  2ZMB A;  3OO7 A;  5L8D A;  2I3W A;  3L6H A;  2F6P A;  4G8H A;  1WOD A;  5I84 A;  2ZNU A;  1SD3 A;  1EU8 A;  1YAE A;  3HHG A;  1KWH A;  3EHT A;  2HAU A;  1JNF A;  4GL8 A;  3G7W A;  4DE8 A;  4NF4 B;  1OVT A;  2XD3 A;  4JWY A;  4R6Y A;  3DM0 A;  4F19 A;  3C34 A;  2A5T B;  4LUB A;  2DVC A;  4EDP A;  4WKM A;  3TUS A;  5KDT B;  3BKI B;  3MWB A;  5KCJ B;  5AE4 A;  3MP8 A;  1A55 A;  3FVK A;  1B52 A;  1N84 A;  2ZYM A;  4PET A;  2VD3 A;  1YCJ A;  1LAG E;  4XKN A;  4H0W A;  5AA2 B;  1YTV A;  2F78 A;  4R72 A;  2IA4 A;  3D4C A;  4F18 A;  1MQH A;  3IAZ A;  1N0T A;  1MDQ A;  1S7Y A;  3VFJ A;  1GGG A;  4NED A;  3FVG A;  4ECF A;  1XOC A;  3IR1 A;  4OXV A;  4QFN A;  3BBR A;  2Q89 A;  4R73 A;  4IB2 A;  4YKJ A;  3DP8 A;  3RQT A;  1I6Q A;  4G8M A;  1P1W A;  1FTL A;  3OSR A;  2I4B A;  4OEV A;  4X1B A;  2CZL A;  4NWC A;  1I6B A;  2THI A;  1O64 A;  3G3I A;  2XXW A;  1ATG A;  3W15 C;  5CI5 A;  3N5L A;  3R26 A;  2DQV A;  1IZ1 A;  2QJE A;  3IOT A;  4KYE A;  3MJN A;  4IGT A;  3KZG A;  4XKP A;  4BDL A;  4KFQ A;  4NF6 B;  3H7M A;  1B05 A;  2XXV A;  1SI1 A;  2XXQ A;  4R6K A;  5CMM A;  4ZS9 A;  2DE2 A;  2Y7K A;  4F1Y A;  4BLA A;  4YIC A;  3TFL A;  4IO5 A;  3I6V A;  2DWJ A;  1TT1 A;  3O66 A;  1SW4 A;  3EQ1 A;  3V83 A;  2ONS A;  1QVS A;  3IOV A;  3ONM A;  4BDO A;  2PX1 A;  4GD5 A;  2DWI A;  1Z7M E;  3A3U A;  2O69 A;  2REG A;  1A8E A;  1LAF E;  3SDF A;  1XC1 A;  1IEJ A;  1ZKB A;  2I0B A;  3PUY E;  4YZZ A;  4F1V A;  5HM4 B;  3GBB A;  3T9U A;  2XX9 A;  3LR1 A;  1HSJ A;  4YKK A;  2OWS A;  2QS2 A;  2HXW A;  4PQJ A;  2D21 A;  4JWX A;  2PT2 A;  1M5E A;  4YB6 A;  2QL3 A;  4EUO A;  4F3S A;  3CSG A;  3OEM A;  5I58 A;  4OWD A;  3ECR A;  2ZXT A;  1ELJ A;  3KSX A;  4MBP A;  3VDF A;  1SYH A;  5CMC A;  1SQY A;  4PE5 B;  3ZS6 A;  1WVJ A;  3O2A A;  1NMU A;  3JV9 A;  1SW2 A;  1OQG A;  2B3B A;  4KI0 E;  3C32 A;  3H03 A;  5H8S A;  1P1Q A;  1H45 A;  1B3G A;  3RUM A;  2Y7W A;  2F97 A;  4KQP A;  1N7X A;  2GH9 A;  4RK9 A;  4I1D A;  3W9V A;  3S9M C;  3PD8 A;  1OIB A;  3RPW A;  1JVY A;  4X1D A;  4ZEF A;  2PYY A;  1L5T A;  4ZE8 A;  3RLF E;  4GIZ A;  1N76 A;  4U22 A;  1IXC A;  1MM6 A;  3UGW A;  4EQ7 A;  3ZKK A;  4XKR A;  1B2H A;  4NF4 A;  5A5X B;  4UA8 A;  2I49 A;  4AB6 A;  2M8C A;  3FJ7 A;  3R7X A;  2QMW A;  1NNT A;  1DTG A;  2F7A A;  2HCA A;  3K6X A;  4ESW A;  1PB9 A;  2ONK E;  4O3A A;  4H6D A;  1LBC A;  3LSX A;  3LSL A;  3QK6 A;  1BKA A;  4IY5 A;  5M2V A;  3SKP A;  4Q0C A;  3VE1 B;  4FJP A;  5H8H B;  4H67 A;  3IB1 A;  2O1M A;  4YKP A;  4U21 A;  3T9H B;  1XVY A;  2Z22 A;  4U4S A;  1NH7 A;  5FHN A;  5JTY B;  2Q8J A;  4ONY A;  4H65 A;  4F31 B;  2XXR A;  2I58 A;  2I3V A;  4HTG A;  4PFW A;  2ONR A;  4PP0 A;  4G68 C;  2OJT A;  1MPD A;  1B7U A;  4RPN A;  1AH5 A;  4ZZA A;  1CB6 A;  2G29 A;  4LA9 A;  2LAO A;  4U23 A;  1SW5 A;  3TTK A;  3Q27 A;  4BDR A;  4O3C A;  1MY1 A;  3THI A;  3UN6 A;  3OEL A;  3IK6 B;  3H6U A;  4WED A;  5TP9 A;  3T96 B;  4G68 A;  4ZEC A;  1JVX A;  3S9N C;  2F36 A;  3B6W A;  3FXQ A;  5B70 A;  2RC9 A;  3MQ9 A;  4NE4 A;  3SEW A;  3CG1 A;  1DMB A;  1LGB C;  1MQD A;  1YPN A;  2Y7P A;  3B6T A;  2GRV A;  1UTH A;  4IO4 A;  3RGY A;  1MRP A;  2O51 A;  4FEC A;  3EN3 A;  1QUK A;  1B46 A;  2P1S A;  2H25 A;  3CFZ A;  3TTL A;  2DXR A;  1NFT A;  2DWH A;  1MXU A;  4U1Z A;  3MP1 A;  5H8F B;  5DVJ A;  4GFR A;  2DVZ A;  3E4R A;  1QW0 A;  2O68 A;  1SW1 A;  1JQF A;  3IOR A;  1MM7 A;  1FQA A;  3JYR A;  3O6H A;  3KSJ A;  2YPN A;  2DS9 A;  3CFL A;  4I62 A;  1B40 A;  4JB7 A;  1NH8 A;  1VFD A;  3RTF B;  5ISU A;  1A99 A;  1MXX A;  3FGS A;  4RA1 A;  2QPQ A;  2XXT A;  4M4G A;  4ZZE A;  3QUJ A;  3EHS A;  4GRK A;  4DXC A;  1R6Z A;  1VE4 A;  1Y9U A;  3SEU A;  1MH4 A;  4NF6 A;  3SEV A;  3TTR A;  1ANF A;  4LON B;  1O63 A;  4GQO A;  2B3F A;  4POX A;  3K01 A;  3I3V A;  3R6U A;  1Y4T A;  2XX7 A;  1DSN A;  1TWY A;  1OLC A;  3CSB A;  3LSW A;  3PPP A;  4LZ7 A;  5I59 A;  5L9O A;  2H5Y A;  1A8F A;  4R74 A;  5HPQ A;  2R71 A;  3TQW A;  1SDX A;  4KR5 A;  3UA8 A;  1POY 1;  3MZ1 A;  3OEN A;  1Y1Z A;  2XXP A;  2A5T A;  2H9B A;  4QFP A;  3RTW B;  3USD A;  1S50 A;  1PB7 A;  3IOU A;  3PUZ E;  4TOZ A;  2VOZ A;  1JEV A;  3FIR A;  5I2K A;  4F3B A;  2HAV A;  4KD5 A;  1B51 A;  4PFT A;  1QKB A;  5H8Q A;  3OO8 A;  3TAJ A;  3GLB A;  5A5X A;  2H98 A;  1NNF A;  2V3Q A;  4OFL A;  1B5H A;  4Z7E A;  2P2A A;  2RF1 A;  1Y20 A;  3IJX B;  4ZEI A;  4P0I A;  3P7I A;  2NXO A;  5JTY A;  3N26 A;  1LFH A;  4P0G A;  3N6U A;  1IQ7 A;  1RYO A;  4U1O A;  1UQW A;  4JXI A;  4N13 A;  4NF8 B;  5KCJ A;  3FJG A;  1DTZ A;  5K2X A;  4KCD A;  2OCU A;  3PUX E;  4H5G A;  5K2Y A;  2OZZ A;  3C36 A;  1GVC A;  5BWJ A;  3IL1 B;  1LST A;  2OWT A;  3OMB A;  3VLU A;  5AA3 A;  4WXJ A;  2A5S A;  5I2K B;  4C1U A;  4RK2 A;  5F7V A;  1B1H A;  3PU5 A;  2V3U A;  1JEU A;  4MLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...