1IXGA

Phosphate-binding protein mutant with thr 141 replaced by asp (t141d), complexed with phospate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGDSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title A low energy short hydrogen bond in very high resolution structures of protein receptor--phosphate complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphate transport
total genus 107
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1996-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixgA02
1B5HA 4ZE9A 1A40A 4MH5A 3OD7A 4Z7EA 3TTKA 1XC1A 3N94A 2I58A 4X1DA 3QUFA 1R9QA 4ZEFA 3A09A 4RY1A 1MXYA 1OQGA 3OMBA 2OLBA 3G3JA 3CRBA 2D3IA 3CI8A 1SBPA 3SESA 2REGA 1MPBA 4KPTA 1OLAA 1PB7A 3QSLA 4YKPA 2DWIA 1B05A 3JZJA 4ZZEA 5M2VA 5EHMA 3B6QA 2I3VA 4NF8A 5IKBA 1QKBA 1USYH 4EF2A 5HBCA 3L6GA 3SERA 3O97A 3O6HA 1AH5A 1PB8A 2X7PA 3PD9A 3S9MC 3OEKA 5I58A 2NVUB 5EYFA 3LSLA 3QUJA 4IGTA 4H0WA 4ELRA 2HXWA 1AMFA 4R6YA 4QSCA 1POY1 2NWJA 4Z0IA 3MJNA 3MWBA 1Q1KA 2OK2A 3Q25A 1BIYA 4KHZE 5TP9A 3C32A 1ZMGA 4BDOA 4N13A 3KZGA 2ESNA 1Y4CA 3S4UA 1B58A 4M4GA 3DLNA 1NH7A 4F31B 3MQ9A 4LA9A 3PD8A 3MC2A 3H6WA 3QXMA 1F9BA 1MM7A 1MDQA 4ELQA 3SEWA 1JNFA 2PVUA 3PMXA 4POXA 3FJGA 4OENA 1B7UA 2I0BA 4GVOA 3MZ9A 1NH8A 1USYE 2VOZA 2Q2AA 1A99A 3U8QA 3IORA 2QPQA 4U4XA 4YKIA 5AA2A 3PMWA 4ELPA 2XXYA 2OBGA 1S7YA 1OVBA 2DVCA 4ESXA 2X7QA 3UORA 3GXAA 4F29A 2ZYNA 1SI1A 3JYRA 2RCBA 1N76A 3KJTA 2Q2CA 3UN6A 3CVGA 1N0TA 3TUSA 1BTJA 4H1XA 2GRVA 4Q30B 3UP9A 2F6GA 1QUIA 1WDNA 3VVDA 3VXCA 3UA8A 3S2VA 1QUJA 2UVIA 3TELA 4G68C 3U94A 3LR1A 2RC9A 3H03A 1XS5A 3O29A 3RN8A 2RINA 2O7UA 4EQBA 5JTYA 3U93A 1FQAA 3IX1A 2HQ0A 4ESWA 4H67A 1JEVA 3T9VA 2FYIA 4NF6A 2V3QA 1VFDA 1IXIA 3S9NC 1MQIA 4G4PA 3FXRA 4GQOA 4QFKA 2P2AA 1ZLQA 3G3FA 4OXVA 3IOVA 4IO6A 1RYXA 2PBWA 3OOAA 5L9SA 2VGQA 1YPNA 1LSTA 1SDXA 3FJ7A 1B4HA 1UTHB 1OMPA 3DM0A 5CMBA 1LAGE 1FW0A 3KGCA 3TQWA 1FQFA 2VHAA 4FEDA 4F22A 2UYEA 1LGBC 1LFGA 1P1NA 3K4UA 1EZPA 4H5FA 4LZ8A 1MM6A 3H6UA 5FHOA 2CMOA 4JSDA 2V3TA 2ZYMA 1LFHA 3FXUA 3EHTA 3OSRA 1LAFE 4E0XA 1PBQA 3FIRA 1MG1A 4KYSA 2ZNSA 4EUOA 2XXXA 3FVKA 3RLFE 1A8EA 1P1OA 1LLSA 4OFJA 2QJEA 3FVOA 4NF4B 1MY3A 3RT8A 2PYYA 3FVNA 4YB7A 2NOOA 3CIJA 4G8HA 5I59A 2DE4A 4K3FA 4XKQA 4R2BA 5FTHA 3Q27A 1IXCA 5CI5A 4RPNA 3ECRA 4ZEIA 4H5GA 2ALUA 3BFUA 3Q29A 2ANJA 3TTNA 4R75A 4NMYA 3MAMA 3T22A 1L5TA 1R6ZA 2Z8FA 4PFTA 2Y84A 5EHSA 3WAFA 1H44A 3UGWA 4Q0CA 3MW0A 1VSOA 1I6QA 1LAHE 4OTEA 3HHGA 5ITPA 2CZLA 1DPPA 1SW5A 1UTBB 3FVGA 3MP8A 4GL8A 2V25A 4PP0A 4OESA 4IO3A 4PFWA 3MVXA 5L8DA 4HW8A 5I57A 2H25A 5LOMA 4PFYA 3MVWA 2B65A 5KCJB 3C31A 2V93A 1MPDA 1MXZA 2A5TB 5ITOA 1SYHA 2OWSA 3FD3A 1YTVA 1S9TA 3MZ1A 3O6GA 4AQ4A 2F34A 2QS1A 3H06B 1O63A 1XOCA 3N6UA 2XXUA 3VXBA 3EF7A 1B3GA 3EHSA 1D4NA 3TEPA 1DMBA 4KFQA 1PBPA 3KBRA 2XX8A 4ONYA 4OWDA 4P0IA 3EHUA 2DP8A 1ZKBA 4OETA 4YMAA 3OO9A 4FJPA 4BDRA 4C1TA 4LQ5A 4YU0A 4NF5B 4F19A 3G3IA 4QF9A 4ND9A 2I48A 4GLIA 2QL3A 1N7XA 4C0RA 2XXIA 4G77A 1TXFA 3IO4A 1PDAA 1FTOA 4QSDA 3FV2A 4R73A 3K0VA 1N3WA 1I6AA 3FJMA 2FA7A 5CM6A 3RPWA 4ZEBA 1Y20A 2RC7A 3JV9A 2E0SA 3FV1A 4R72A 1URGA 3RTFB 1FTMA 4EXLA 5HPQA 3OENA 3KEIA 1IUDA 4G68B 2AL5A 5H8QA 3K1NA 2YPNA 1XVYA 1FQCA 4GRKA 3RNNA 1NNPA 3GZGA 4H6DA 3V5AA 2DVZA 3MBPA 2X26A 2GFEA 3O28A 4OFLA 1MQHA 4FAJA 3K1MA 3FGSA 3W9VA 3M3KA 5I2NB 4JWYA 1SYIA 5I2KA 1IZ1A 4U21A 4G8MA 4XTCQ 5AA2D 3KJ7A 3ZS6A 4QHQA 1D9VA 1HSLA 2Y7KA 3V8XB 2IA4A 4GOTA 1MRPA 3VLWA 4JWXA 4YAHX 1EZ9A 1DPEA 3TFLA 3PV0E 4L17A 3EQ1A 4IGRA 1MQJA 4KYDA 1O7TA 4GXAA 4RK9A 3K6XA 2ABHA 3DP8A 5I56B 1DTGA 1I6BA 3W15C 3DELB 2I4CA 4FEBA 5JEIA 4NF8B 2PMSA 2Q89A 2R6GE 1N3XA 4LONB 4QFOA 5TPAA 1IEJA 4RNSA 1SW4A 4I1DA 2DOJA 2M8CA 1B51A 2QS4A 3H4ZA 1MY1A 1MH3A 1VR5A 1M5CA 1GR2A 2O84X 3KFMA 3D4CA 1B40A 3IB1A 4NTLA 3PPRA 3QYTA 1B4ZA 2ONSA 4ZS9A 2WKYA 3IB0A 4F3BA 4YKKA 2P1SA 2HCAA 2XXQA 4KCCA 3TCHA 4TLLB 2OWTA 2F78A 2XXVA 1MDP1 4OEUA 1T0KA 1WODA 4OFOA 2Y7RA 4YZZA 2OJTA 4DE8A 4YMBA 4JB7A 3W9WA 5IAIA 3KSXA 4N6PA 4UACA 1A55A 4RJZA 4ECFA 1B1HA 3H6VA 3E3KA 2D5WA 4M1VA 3HO7A 1Z7ME 4HCWA 3QAXA 3U72A 4OEVA 4R74A 1IIWA 3TKDA 4DZ1A 4QSEA 4GIZA 1ANFA 5A5XA 2F36A 1QULA 1IQ7A 4GD5A 3M3LA 1N7WA 3OXNA 2YLNA 1R1NA 1OIBA 2XX9A 4I9DA 3SETA 2Z23A 3WAEA 2QS3A 5FHMA 1Q35A 3L6HA 3KN7A 3MPKA 4NWCA 3TTRA 3FUZA 2DXYA 2O1LA 3MP1A 1UTHA 5CMMA 2ZYOA 4JWOA 3N6TA 5JTYB 3I6VA 1B0LA 3GBBA 1P1QA 1NL5A 2W7YA 4XXUA 3CG1A 3V83A 2PT2A 2I0CA 3HPIA 4AB6A 3LBSA 3TYHA 4HTGA 1QUKA 4WEPA 3K6WA 4PFUA 1LB9A 2RKMA 4EF1A 4IY5A 4PE5B 5H8HB 4KQPA 3IR1A 4QRZA 4O3AA 3TQLA 1EH3A 3SEUA 4DCYA 2I6EA 2XXWA 5CC2A 1GV8A 3RQTA 2Z22A 1AIVA 4OERA 4DXCA 4ZECA 3KN8A 4NF4A 1IXHA 3LC8A 3EPEA 3FZVA 1FQEA 3C4MA 3T9XB 3K6UA 2GHBA 2AYSA 4R6HA 1Z7NE 2Z8DA 3QK6A 4JSOA 1LBBA 4EXKA 5BUUA 1SD3A 2ZYKA 3PUWE 3C36A 1WVJA 1B1XA 1GVCA 1JQFA 4H65A 2QRYA 4R6KA 1MY4A 1GTKA 1II5A 4JBZA 2I3WA 1B46A 5BWJA 4KR5A 1YAEA 1QJMA 1N84A 4LP2B 3TPAA 4F1YA 4RXLA 1M5EA 3ZSFA 3SEXA 1DOTA 2DSFA 3PU5A 4R9GA 4FE8A 1FTJA 1P99A 2IEEA 4DXUA 1M5DA 2XXTA 2RC8A 2FNCA 3OEMA 2Q88A 1LFIA 3T66A 2A5TA 4WEDA 3C35A 2XX7A 1XVXA 3T96B 3U92A 3Q28A 2DYXA 3O66A 1D3KA 1NNTA 3VVEA 2HZLA 5HM4B 4Q5TA 4F1UA 3DP6A 4JDFA 3B6TA 3CFLA 1O64A 1US4A 2B3FA 5DT6A 2DQVA 4PQJA 4FATA 4ZDMA 3VV5A 1BP5A 3B6WA 5H8NB 5I57B 5H8SA 2UVJA 4LZ7A 1B3HA 3RY3A 3VE1B 1ZBMA 5KDTB 5DVIA 3MUQA 1NFTA 3H6TA 4TOZA 2E1SA 4OMBA 1B5JA 2ZNTA 4LATA 2O6AA 1LCTA 1OVTA 4KI0E 1OQHA 4NF5A 3TTLA 2XD2A 1JW5A 2R71A 1OLCA 4LQ2A 3CFZA 1LB8A 3ONMA 5AA4B 2ZNUA 3V89B 4BDNA 3SEYA 1AL3A 2VD3A 4ZZAA 1URSA 3ZKKA 3D4GA 3E13X 3GBAA 2RCAA 4P11A 4E0WA 4POWA 4RPOA 1EZOA 2GH9A 1MXVA 3PGFA 4PETA 4EQ7A 2ONKE 5H8FB 4IO7A 3BBRA 3C9HA 3ODBA 4QFLA 4HCYA 4U23A 4IY6A 1YCJA 1ATGA 2I49A 4YB5A 4YB6A 4G68A 4U1OA 1Y4TA 3KOSA 3R26A 5J1DA 5L9MA 3BKIB 4GFRA 4X48A 1IXGA 1SQYA 1QVSA 4JXIA 3RTWB 1S50A 1DTZA 1TFAA 5DEXB 2V3UA 1MQGA 1MY2A 1JVXA 5CBSA 3PMVA 2Y7IA 4U1ZA 3SKPA 3K01A 1JEUA 4R9FA 4F2QA 3PPOA 2O68A 3K6VA 3R6UA 4N07A 3T93B 4I8CA 4MF3A 5I84A 1SW2A 2THIA 5CMCA 3R7XA 3DP4A 2UVHA 1DSNA 3Q26A 3USDA 2XD3A 1M5FA 4X1BA 5AE4A 3MVZA 2PX1A 2DXRA 5I2KB 4FIMA 1SVXB 3E9XA 3U1OA 2HZKA 4GF8A 1B7ZA 3IJXB 4QFNA 2O7IA 4LUBA 3HV1A 1A54A 5I56A 1URDA 2Q9TA 1JW4A 1FQBA 1POTA 3PPPA 2F7AA 5F7VA 2DE2A 2OCUA 4F1VA 4DLDA 1B3FA 4RK2A 3IK6B 2G93A 2ONRA 3M3FA 4GXSB 2B3BA 1PEBA 2P0SA 2F97A 1B32A 1Y9UA 2QMWA 5TU0A 3PPQA 3I5OA 1A8FA 4I62A 4OYVA 5I58B 4H8JA 1N04A 1UIVA 5DVJA 1CB6A 4OHNA 2DWHA 5F1QA 1B52A 3RT6B 4F18A 1AOVA 1A7LA 2F8DA 2UYFA 2UXAA 3SEVA 3RUMA 4ELOA 4BDLA 4MFIA 3K02A 2HFBA 1MQDA 3IJOB 5TPAB 5TP9B 3ILUB 1TFDA 4FECA 4HS7A 5AA3A 2ZMBA 2NUVA 3FATA 3PUXE 5ISUA 1Y3PA 3EN3A 4U22A 2VD2A 4O3CA 1H76A 2H98A 1H45A 1B3LA 1TT1A 1FCKA 1M5BA 3T9HB 3QIMA 3TCGA 4F3SA 2LAOA 4YICA 1NNFA 1RYOA 2BJJX 4F3GA 1ZJLA 4LZ5A 1NKXA 4F3PA 2XHDA 2UVGA 5ICQA 5K2YA 5AA2B 3UIFA 2R9JA 1JETA 3P7IA 3IOWA 4IO5A 3HCQA 3VLVA 3PPNA 5AA1A 3IOTA 3LSXA 4X9TA 4KYEA 3PUVE 1MS7A 2XXPA 1BKAA 5FTIA 2KLFA 2QMXA 5DYHA 3C34A 2F5XA 1CE2A 2H5YA 3AXFA 2DWJA 4NWDA 3A3CA 3IL1B 5KZTA 5ICTA 3OO8A 5FHNA 5JK4A 2O1MA 2HAUA 2GHAA 3UK4A 1MY0A 3OO6A 3G3HA 4DCXA 2Q8JA 3THIA 1VFEA 5A5XB 3KG2A 3RGYA 1SI0A 3O2AA 2Z8EA 3PUYE 4IO4A 3IAZA 3ZKLA 4MBPA 5DVFA 2XXRA 1I69A 3KSJA 4RYAA 1Y1ZA 3M8UA 1B0HA 4XIGQ 3HHFA 4AB5A 1HSJA 4NF6B 5H8HA 2F6PA 5CRYA 3CFXA 3H3GA 2YJPA 4OVJA 1PC3A 3PUZE 1FTLA 4U4SA 1LBCA 3IB2A 4ISUA 3TODA 3O9PA 4IB2A 3LSFB 3FXQA 3KOTA 3T9UA 3I3VA 3TAJA 2H99A 4BLAA 4GL0A 1B3EA 1BLFA 1JVYA 4MLQA 4OZ9A 3IO6A 4DDDA 3KN3A 1P1WA 3MP6A 1ZIUA 4TQUQ 1MXUA 2NXOA 4XKNA 4XKRA 1H3DA 1H43A 4YKJA 4ZE8A 1MXWA 1ZTYA 4BDQA 4RA1A 1XHYA 1Y3QA 1EU8A 4KCDA 1QKAA 3G7WA 3MVYA 4GWOA 4IO2A 1R9LA 2F35A 1FTKA 2RF1A 3VFJA 1UTBA 2REJA 5ELVA 4F39A 3OSQA 1US5A 5I59B 2VP1A 1UIUA 4LVQA 4ZEKA 4DXBA 2QS2A 2HAVA 2I4BA 1MPCA 1VE4A 5CMKA 1P1UA 5K2XA 2Y7PA 4F2OA 5CBRA 5KCJA 1Y1MA 2ZXTA 5DTBA 4QFPA 1KWHA 2F7CA 4KD5A 3SDFA 3MPLA 3CG3A 3S9EA 4R2FA 1TWYA 1XT8A 1RKMA 1B9JA 3OELA 2HEUA 5H8NA 4THIA 1JW1A 2AL4A 4DIGA 1HSEA 3N26A 5KDTA 3MZBA 2DE3A 1B2HA 1Y3NA 3CSGA 1ZU0A 2F7BA 4FORA 4EDPA 1QW0A 1FQDA 4O3BA 1ELJA 3G3GA 4C1UA 4WXJA 1IITA 3B7DA 4NEDA 1NNKA 2V84A 4H8IA 3GLBA 3ILTB 2H4IA 5B70A 3H7MA 3A3UA 4UA8A 2DS9A 2XXHA 5AA4A 1MXXA 1GGGA 1LAXA 3TCFA 3K2DA 3VVFA 5L9OA 4ZEDA 3TDJA 3TZAA 2PT1A 3E4RA 4G8NA 1J1NA 5H8FA 2AIXA 3LSWA 3LUYA 3O6IA 1B7HA 3TMGA 1MH4A 4EQ9A 4Q8RA 3TTMA 4G2ZA 4NE4A 4WKMA 3OO7A 1SW1A 2QSXA 3HN0A 3VDFA 3S9LC 3FASA 2A5SA 3BFTA 2D21A 4U2RA 4BDMA 3N5LA 5B7DA 2O69A 3C33A 1PB9A 2Y7WA 2G29A 3CSBA 3K00A 5DEXA 4MLVA 3F11A 1LCFA 3G3KA 4P0GA 3HSTA 4TLMB 2O51A 3CR9A 3VLUA 1D9YA 2H9BA 5I2NA 3IOUA 3K1PA 4OQOA 2DWAA 1UQWA 4XKPA 1B6HA 1B5IA 1NMUA 5H8QB 2OZZA
chains in the Genus database with same CATH superfamily
1B5HA 4ZE9A 1A40A 4MH5A 3OD7A 2WYKA 2BJIA 4Z7EA 3TTKA 4NHBA 1XC1A 2QVUA 3N94A 2I58A 4X1DA 3QUFA 1R9QA 4ZEFA 3A09A 4RY1A 1MXYA 1OQGA 4O7MA 3OMBA 2OLBA 3G3JA 2Q8MA 1FBCA 3CRBA 2D3IA 4OVRA 3CI8A 3BIGA 3ISPA 1SBPA 3SESA 2REGA 1MPBA 4KPTA 1OLAA 1PB7A 3QSLA 4YKPA 2DWIA 1B05A 3JZJA 5EQ8A 4ZZEA 5M2VA 5EHMA 3B6QA 2I3VA 4NF8A 5IM2A 5IKBA 1QKBA 1USYH 4EF2A 5HBCA 3L6GA 3SERA 3O97A 3O6HA 1AH5A 1PB8A 2X7PA 3PD9A 4I40A 3S9MC 3OEKA 5I58A 2NVUB 5EYFA 1SPIA 2PFZA 3LSLA 3QUJA 4IGTA 4H0WA 4ELRA 2HXWA 4GX3A 1AMFA 4R6YA 4QSCA 1POY1 2NWJA 4Z0IA 3MJNA 2KR0A 3MWBA 1Q1KA 1IMBA 2OK2A 3Q25A 1BIYA 4KHZE 2R8TA 5TP9A 3C32A 1ZMGA 4BDOA 1FPGA 4N13A 3KZGA 4N6DA 2ESNA 1Y4CA 3S4UA 1B58A 1EYJA 4M4GA 3DLNA 1NH7A 4F31B 3MQ9A 5ESYA 4LA9A 3EKIA 3PD8A 3MC2A 3H6WA 2V4CA 3QXMA 1F9BA 1MM7A 1MDQA 4ELQA 3SEWA 1JNFA 2PVUA 3PMXA 4POXA 3FJGA 4OENA 1B7UA 2I0BA 4GVOA 3MZ9A 5F24A 1NH8A 1USYE 2VOZA 2Q2AA 1A99A 3U8QA 1QGXA 3IORA 2QPQA 4U4XA 4YKIA 5AA2A 3PMWA 3MYUA 4ELPA 2XXYA 2OBGA 1S7YA 1OVBA 2DVCA 2QFLA 4ESXA 2X7QA 3UORA 3GXAA 4F29A 2ZYNA 1SI1A 3JYRA 2RCBA 1N76A 3KJTA 2Q2CA 2CEYA 1Q9DA 4PAKA 3QMFA 3UN6A 3CVGA 4MNPA 1N0TA 3FXBA 5A5LA 1INPA 1FPJA 3TUSA 2OWZA 1BTJA 4H1XA 2GRVA 5EQ9A 4Q30B 3UP9A 2F6GA 3LUZA 1QUIA 1WDNA 3VVDA 2XWOA 3VXCA 3UA8A 3S2VA 1QUJA 2UVIA 3TELA 4G68C 3U94A 3LR1A 2RC9A 3H03A 1XS5A 4NGUA 4XFEA 3O29A 3RN8A 2RINA 2O7UA 4EQBA 5JTYA 3U93A 1FQAA 3HFUA 3IX1A 2HQ0A 4ESWA 4PGNA 4GBVA 4H67A 1JEVA 3T9VA 4JVIA 1FPFA 2FYIA 4NF6A 2V3QA 2P3NA 1VFDA 1IXIA 3S9NC 1AWBA 1MQIA 4IR8A 4G4PA 3FXRA 4GQOA 4QFKA 2P2AA 4PDHA 1ZLQA 3G3FA 1NV3A 4LN5A 4OXVA 3IOVA 4IO6A 1FBEA 1RYXA 2PBWA 1IMDA 3OOAA 5L9SA 2VGQA 1YPNA 1LSTA 1SDXA 3FJ7A 1B4HA 1UTHB 4N4UA 3E79A 1KA0A 1OMPA 3DM0A 5CMBA 1LAGE 1FW0A 4MAGA 3KGCA 3TQWA 1FQFA 2VHAA 4FEDA 4PFIA 2UYEA 4F22A 1LGBC 1LFGA 3B8BA 1P1NA 3K4UA 3T1BA 2CZHA 1EZPA 4H5FA 4LZ8A 2WBBA 1MM6A 3H6UA 5FHOA 2CMOA 4JSDA 2V3TA 2ZYMA 1LFHA 3FXUA 3EHTA 3OSRA 1LAFE 4E0XA 1PBQA 3FIRA 1MG1A 4KYSA 2ZNSA 2Y5LA 2GQ1A 4EUOA 2XXXA 3FVKA 3RLFE 1DBZA 1A8EA 1P1OA 1LLSA 4OFJA 2QJEA 3FVOA 4NF4B 1MY3A 5DW8A 3RT8A 2PYYA 3FVNA 4YB7A 4PAIA 2NOOA 1FJ6A 3CIJA 5EYGA 4G8HA 5I59A 1YZ0A 2DE4A 4K3FA 4XKQA 4R2BA 5FTHA 3Q27A 1IXCA 5CI5A 4RPNA 3ECRA 4ZEIA 4H5GA 2ALUA 3BFUA 3Q29A 2ANJA 2XWKA 3TTNA 4R75A 4NMYA 3MAMA 3T22A 1R6ZA 4PFTA 2Z8FA 1L5TA 2Y84A 5EHSA 3WAFA 1H44A 3UGWA 4Q0CA 3MW0A 1VSOA 1I6QA 1LAHE 2L5VA 4OTEA 3HHGA 5ITPA 2CZLA 1DPPA 1SW5A 1UTBB 3FVGA 3MP8A 4GL8A 2V25A 4PP0A 4OESA 3GYYA 4IO3A 4PFWA 3MVXA 5L8DA 3FBPA 4HW8A 5I57A 2H25A 5LOMA 4PFYA 2VT5A 3MVWA 5I5PA 2B65A 4MIJA 5KCJB 3C31A 2V93A 1MPDA 1MXZA 2A5TB 5ITOA 1SYHA 2OWSA 3FD3A 1YTVA 1S9TA 3MZ1A 4GWZA 3O6GA 4AQ4A 2F34A 2QS1A 3H06B 1O63A 1IMAA 1XOCA 3N6UA 4G61A 2XXUA 3VXBA 3EF7A 1B3GA 3EHSA 1D4NA 3TEPA 1DMBA 4KFQA 1PBPA 3KBRA 2XX8A 3IFCA 1IMEA 4ONYA 4OWDA 4P0IA 3EHUA 2DP8A 1ZKBA 4OETA 4YMAA 3OO9A 4FJPA 4GX6A 4BDRA 4C1TA 4LQ5A 4YU0A 4MNCA 4NF5B 4F19A 3G3IA 1NV1A 3PTYA 4PF8A 4QF9A 4ND9A 1DK4A 2I48A 4GLIA 2QL3A 3BIHA 1N7XA 2XXIA 4G77A 4C0RA 2VPOA 1TXFA 3IO4A 1PDAA 1FTOA 4QSDA 3FV2A 4R73A 3K0VA 1N3WA 1I6AA 3FJMA 2FHYA 2FA7A 5CM6A 3RPWA 4ZEBA 1Y20A 2RC7A 1FRPA 3JV9A 2E0SA 3FV1A 1K9YA 4R72A 1URGA 3RTFB 2B4LA 1FTMA 4EXLA 5HPQA 3OENA 3KEIA 1IUDA 4G68B 2AL5A 5H8QA 3K1NA 2YPNA 1FPDA 5EQAA 1XVYA 1FQCA 4GRKA 3RNNA 1NNPA 3GZGA 1FBPA 4H6DA 4HXVA 3V5AA 2DVZA 4PDDA 3MBPA 2X26A 2GFEA 3O28A 4OFLA 1MQHA 4FAJA 3K1MA 3FGSA 3W9VA 3M3KA 1NUXA 5I2NB 3D1RA 4JWYA 1SYIA 5I2KA 1IZ1A 4XF5A 4U21A 4G8MA 4XTCQ 5AA2D 3KJ7A 3ZS6A 4QHQA 1D9VA 4P47A 4O7IA 1HSLA 2Y7KA 3V8XB 1G0HA 1KA1A 2IA4A 5T3JA 4GOTA 2Q74A 1MRPA 3VLWA 4KXPA 4JWXA 4YAHX 5I3SA 1EZ9A 1DPEA 3TFLA 1IMFA 2CZIA 3PV0E 4L17A 1YYZA 2Y5KA 3EQ1A 4IGRA 1MQJA 2PFYA 4KYDA 1O7TA 4GXAA 4RK9A 3K6XA 2ABHA 1CNQA 3DP8A 5I56B 1FBDA 1DTGA 1I6BA 3W15C 3DELB 3A29A 2I4CA 4GBWA 4FEBA 5JEIA 4NF8B 2PMSA 2Q89A 2R6GE 1N3XA 4LONB 4QFOA 5TPAA 1IEJA 3E78A 4RNSA 1SW4A 4AS5A 4I1DA 2DOJA 2M8CA 1B51A 2QS4A 3H4ZA 1MY1A 1MH3A 1VR5A 1M5CA 1GR2A 5IZ1A 2O84X 3KFMA 1FBGA 3D4CA 1B40A 3IB1A 4NTLA 3PPRA 3QYTA 1B4ZA 2ONSA 4ZS9A 2WKYA 3IB0A 4F3BA 4YKKA 1NV5A 2P1SA 2HCAA 2XXQA 4KCCA 3TCHA 4TLLB 4N15A 2OWTA 2F78A 2XXVA 1MDP1 4MEVA 1NUYA 4OEUA 1T0KA 1WODA 4OFOA 2Y7RA 4P56A 4YZZA 2OJTA 2VPNA 4DE8A 4YMBA 4JB7A 3W9WA 5FBPA 1FPBA 2F3DA 5IAIA 3KSXA 4N6PA 4GWWA 4UACA 1A55A 4RJZA 4ECFA 1B1HA 3H6VA 3E3KA 2D5WA 4M1VA 3HO7A 1Z7ME 4HCWA 4GWSA 3QAXA 3U72A 4OEVA 4R74A 1IIWA 3TKDA 4DZ1A 4N8GA 4QSEA 4GIZA 1ANFA 5A5XA 2F36A 1FBHA 1QULA 1IQ7A 4GD5A 3M3LA 1N7WA 3OXNA 4NX1A 2YLNA 1R1NA 1OIBA 2XX9A 4I9DA 1VDWA 3SETA 2Z23A 3WAEA 2QS3A 5FHMA 1LBVA 1LBXA 1Q35A 3L6HA 3KN7A 3MPKA 4NWCA 2B4MA 3TTRA 3FUZA 2DXYA 2O1LA 3MP1A 1UTHA 5CMMA 2ZYOA 4JWOA 3N6TA 5JTYB 3I6VA 1B0LA 3GBBA 1P1QA 1NL5A 2W7YA 4XXUA 3CG1A 3V83A 2PT2A 2I0CA 3U65A 1NV6A 3HPIA 2WYPA 4OA4A 4GWYA 4AB6A 3LBSA 3TYHA 1BK4A 4HTGA 1QUKA 4WEPA 3K6WA 4PFUA 1LB9A 2RKMA 2FVZA 4PCDA 4N17A 4EF1A 4IY5A 4PE5B 5H8HB 4KQPA 3IR1A 4QRZA 1FSAA 4O3AA 3TQLA 1EH3A 3SEUA 4DCYA 2I6EA 2XXWA 5CC2A 1GV8A 3RQTA 2Z22A 1AIVA 3NOHA 4OERA 4DXCA 5IZ3B 4ZECA 3KN8A 4N91A 4NAPA 4MMPA 2DDKA 3MSTA 4NF4A 1IXHA 3LC8A 3EPEA 3FZVA 1FQEA 3C4MA 4P1EA 3T9XB 3K6UA 2GHBA 2AYSA 4R6HA 5I7IA 1Z7NE 2Z8DA 3QK6A 4JSOA 1LBBA 4EXKA 4NQ8A 5BUUA 1SD3A 2ZYKA 3PUWE 3C36A 1WVJA 1B1XA 3KC0A 4PBQA 1GVCA 1JQFA 4H65A 2QRYA 4R6KA 1MY4A 2WBDA 1GTKA 1II5A 4JBZA 2WEFA 2I3WA 1B46A 5BWJA 4KR5A 1YAEA 1QJMA 1N84A 4LP2B 3TPAA 4F1YA 4RXLA 1M5EA 3ZSFA 3SEXA 1DOTA 4X04A 2DSFA 1K9ZA 3PU5A 3LV0A 4R9GA 4FE8A 1FTJA 1NI9A 1P99A 4PBHA 2IEEA 4DXUA 1M5DA 2XXTA 2RC8A 2FNCA 3OEMA 2Q88A 1LFIA 3T66A 2A5TA 4WEDA 3C35A 2XX7A 1FPEA 1XVXA 3T96B 3U92A 3Q28A 2DYXA 3O66A 1D3KA 1NNTA 3VVEA 2HZLA 5HM4B 4Q5TA 4F1UA 3DP6A 4JDFA 3B6TA 3CFLA 1O64A 1US4A 2B3FA 4NF0A 5DT6A 2DQVA 4I3EA 1LBZA 4PQJA 4FATA 4ZDMA 3VV5A 1BP5A 3B6WA 5H8NB 5I57B 5H8SA 2UVJA 4LZ7A 4OANA 1B3HA 3RY3A 3VE1B 2P3VA 1FPLA 1ZBMA 5KDTB 1KZ8A 5DVIA 3MUQA 1NFTA 3H6TA 4TOZA 2E1SA 4OMBA 1B5JA 2ZNTA 4FBPA 4LATA 4XEQA 4PFRA 1RDZA 2O6AA 1LCTA 1OVTA 4KI0E 1OQHA 4NF5A 3TTLA 4JVCA 2XD2A 1JW5A 2R71A 1OLCA 4LQ2A 3CFZA 1LB8A 3ONMA 5AA4B 2ZNUA 3V89B 4BDNA 3SEYA 1AL3A 2VD3A 4ZZAA 1URSA 3D4GA 3E13X 3ZKKA 3GBAA 2RCAA 4P11A 4E0WA 4POWA 4RPOA 1EZOA 2GH9A 1MXVA 3PGFA 4PETA 4EQ7A 2WX9A 2ONKE 5H8FB 4IO7A 3BBRA 4DI3D 3C9HA 5ET6A 3ODBA 4QFLA 4HCYA 4U23A 2ZZWA 1YCJA 4IY6A 1ATGA 2I49A 4YB5A 1FJ9A 4YB6A 4G68A 4U1OA 1Y4TA 3KOSA 3R26A 5J1DA 4HE0A 5L9MA 3BKIB 4GFRA 4X48A 4PAFA 1IXGA 4OVSA 4OVPA 1SQYA 1QVSA 4JXIA 3RTWB 1S50A 1DTZA 1TFAA 5DEXB 2V3UA 4P1LA 1MQGA 1MY2A 3RPLB 1JVXA 3KC1A 3PMVA 5CBSA 2Y7IA 4U1ZA 3SKPA 3K01A 1JEUA 4R9FA 4F2QA 3PPOA 2O68A 4O8MA 3K6VA 5LDZA 4P9KA 3R6UA 4N07A 3T93B 4I8CA 4PFBA 4MX6A 2ZZVA 4MF3A 2ZZXA 5I84A 1SW2A 2THIA 5CMCA 3R7XA 3DP4A 1FTAA 1LBWA 2UVHA 1FBFA 4OVTA 1DSNA 3Q26A 1FPKA 3USDA 2XD3A 1M5FA 4X1BA 2XXKA 5AE4A 1XI6A 3MVZA 2PX1A 2DXRA 1FPIA 5I2KB 4FIMA 1SVXB 3E9XA 3U1OA 2HZKA 4GF8A 1B7ZA 2QVVA 3IJXB 4QFNA 2O7IA 4LUBA 3HV1A 1A54A 5I56A 1URDA 2Q9TA 1JW4A 1FQBA 1POTA 1LEVA 3PPPA 2F7AA 5F7VA 3ROJA 4MNIA 1NV7A 2DE2A 2OCUA 4F1VA 4DLDA 1B3FA 4RK2A 3IK6B 2G93A 2ONRA 1RDYA 3M3FA 4GXSB 2B3BA 1PEBA 2P0SA 1D9QA 2F97A 1B32A 1Y9UA 2CZKA 2QMWA 5TU0A 3PPQA 3I5OA 1A8FA 3T0JA 4I62A 4OYVA 5I58B 4H8JA 1N04A 2XWIA 1UIVA 5DVJA 1CB6A 4OHNA 2DWHA 5F1QA 1B52A 4MJOA 3RT6B 4N8YA 4F18A 1AOVA 1A7LA 2CEXA 2F8DA 2UYFA 4N6KA 2UXAA 3SEVA 3RUMA 4ELOA 4BDLA 4MFIA 3K02A 2HFBA 1MQDA 3IJOB 5TPAB 4P8BA 5TP9B 3ILUB 1TFDA 4FECA 4HS7A 5AA3A 2ZMBA 2NUVA 3FATA 3PUXE 5ISUA 1Y3PA 3EN3A 1NV4A 4U22A 2VD2A 4O3CA 1H76A 2F3BA 2H98A 1DCUA 1H45A 1B3LA 1TT1A 4QXDA 1FCKA 1IMCA 5LTCA 1M5BA 3T9HB 3QIMA 3TCGA 4F3SA 2LAOA 4YICA 1NNFA 1RYOA 2BJJX 4F3GA 1EYKA 1ZJLA 4LZ5A 3SZPA 1NKXA 4F3PA 2XHDA 4H46A 4AS4A 2UVGA 5ICQA 5K2YA 5AA2B 1NUZA 3UIFA 2R9JA 4PC9A 1JETA 2XWVA 3P7IA 3IOWA 4IO5A 4GX4A 3HCQA 3VLVA 3PPNA 5AA1A 3IOTA 3LSXA 4X9TA 4KYEA 3PUVE 1MS7A 2XXPA 1BKAA 5FTIA 1G0IA 2KLFA 2QMXA 2HXRA 5DYHA 3C34A 2F5XA 1CE2A 2H5YA 3AXFA 2DWJA 4NWDA 3A3CA 3IL1B 5KZTA 5ICTA 3OO8A 5FHNA 5JK4A 2O1MA 2HAUA 3CHGA 2GHAA 5EYHA 3UK4A 3KBZA 1MY0A 3OO6A 3G3HA 4DCXA 2Q8JA 3THIA 1VFEA 5A5XB 3KG2A 3RGYA 1SI0A 3O2AA 2Z8EA 4UABA 3PUYE 4IO4A 3IAZA 3ZKLA 4MBPA 2HPGA 5DVFA 2JJKA 2XXRA 2PCRA 1I69A 3KSJA 1NV0A 2QVRA 4RYAA 1Y1ZA 3M8UA 1B0HA 4XIGQ 3HHFA 1HSJA 4AB5A 4NF6B 5H8HA 2F6PA 5CRYA 3CFXA 4GWUA 3H3GA 2YJPA 4OVJA 1PC3A 4N81A 4MCOA 3PUZE 1FTLA 4U4SA 1LBCA 3IB2A 4ISUA 5IZ3A 3TODA 3O9PA 4IB2A 2HHMA 3LSFB 3FXQA 3KOTA 3T9UA 4NN3A 2FBPA 3I3VA 1NV2A 3TAJA 2MKZA 2H99A 4BLAA 4GL0A 1B3EA 1BLFA 1JVYA 4MLQA 4OZ9A 3IO6A 4DDDA 4GWXA 3KN3A 4PF6A 1P1WA 3MP6A 1EYIA 1ZIUA 4TQUQ 1MXUA 2NXOA 4XKNA 2FIXA 4XKRA 5ET8A 1H3DA 1H43A 4P3LA 4JVDA 4YKJA 1JP4A 4ZE8A 1MXWA 1ZTYA 4BDQA 4OVQA 4RA1A 1XHYA 1Y3QA 1EU8A 4KCDA 1QKAA 3G7WA 3MVYA 4PE3A 4GWOA 4IO2A 1R9LA 2F35A 1FTKA 2RF1A 3VFJA 1UTBA 2REJA 5ELVA 4O94A 4F39A 3OSQA 1YXIA 1US5A 5I59B 2VP1A 1UIUA 4LVQA 4ZEKA 4DXBA 2QS2A 2HAVA 2I4BA 1MPCA 1VE4A 5CMKA 1P1UA 5K2XA 2Y7PA 4F2OA 2FIEA 5CBRA 5KCJA 1Y1MA 2ZXTA 5DTBA 4QFPA 4PTKA 1KWHA 2F7CA 4KD5A 3SDFA 5ET5A 3MPLA 3CG3A 3S9EA 4R2FA 1TWYA 1XT8A 1RKMA 2XA5A 1B9JA 4QBAA 3OELA 2HEUA 5H8NA 4THIA 1JW1A 2AL4A 4DIGA 4HE1A 1HSEA 3N26A 5KDTA 3MZBA 2DE3A 1B2HA 1Y3NA 5IGAA 4MHFA 3CSGA 1ZU0A 2F7BA 4FORA 4EDPA 1QW0A 1RDXA 3IFAA 1FQDA 5J16A 4O3BA 1ELJA 3G3GA 4C1UA 4WXJA 1IITA 3B7DA 4NEDA 1NNKA 2V84A 4H8IA 3GLBA 3ILTB 2H4IA 1LBYA 5B70A 3H7MA 3A3UA 4UA8A 2DS9A 2XXHA 5AA4A 1MXXA 1GGGA 1LAXA 4NG7A 3TCFA 5IZZA 3K2DA 3VVFA 5L9OA 4ZEDA 3TDJA 3TZAA 2PT1A 3E4RA 4G8NA 1J1NA 5H8FA 2AIXA 3LSWA 3LUYA 3O6IA 3RYDA 5ET7A 1B7HA 3TMGA 1MH4A 4EQ9A 4Q8RA 3TTMA 4G2ZA 4NE4A 4WKMA 3OO7A 1SW1A 2OX3A 2QSXA 4PGPA 3HN0A 3VDFA 3S9LC 4DI4B 3FASA 2A5SA 3BFTA 2D21A 4U2RA 4BDMA 3N5LA 5B7DA 2O69A 3C33A 1PB9A 2Y7WA 2G29A 3CSBA 3K00A 5DEXA 4MLVA 3F11A 1LCFA 3G3KA 4P0GA 3RPLA 3HSTA 4I3YA 2KQZA 4TLMB 2O51A 5EQ7A 3CR9A 3VLUA 1D9YA 4X8RA 2H9BA 5I2NA 4H45A 3IOUA 3K1PA 4OQOA 2DWAA 1UQWA 4XKPA 1B6HA 1NUWA 3B50A 1B5IA 1NMUA 4HE2A 5H8QB 2OZZA
chains in the Genus database with same CATH topology
1B5HA 4ZE9A 1A40A 4MH5A 3OD7A 4Z7EA 3TTKA 1XC1A 3N94A 2I58A 4X1DA 3QUFA 1R9QA 4ZEFA 3A09A 4RY1A 1MXYA 1OQGA 3OMBA 2OLBA 3G3JA 3CRBA 2D3IA 3CI8A 1SBPA 3SESA 2REGA 1MPBA 4KPTA 1OLAA 1PB7A 3QSLA 4YKPA 2DWIA 1B05A 3JZJA 4ZZEA 5M2VA 5EHMA 3B6QA 2I3VA 4NF8A 5IKBA 1QKBA 1USYH 4EF2A 5HBCA 3L6GA 3SERA 3O97A 3O6HA 1AH5A 1PB8A 2X7PA 3PD9A 3S9MC 3OEKA 5I58A 2NVUB 5EYFA 3LSLA 3QUJA 4IGTA 4H0WA 4ELRA 2HXWA 1AMFA 4R6YA 4QSCA 1POY1 2NWJA 4Z0IA 3MJNA 3MWBA 1Q1KA 2OK2A 3Q25A 1BIYA 4KHZE 5TP9A 3C32A 1ZMGA 4BDOA 4N13A 3KZGA 2ESNA 1Y4CA 3S4UA 1B58A 4M4GA 3DLNA 1NH7A 4F31B 3MQ9A 4LA9A 3PD8A 3MC2A 3H6WA 3QXMA 1F9BA 1MM7A 1MDQA 4ELQA 3SEWA 1JNFA 2PVUA 3PMXA 4POXA 3FJGA 4OENA 1B7UA 2I0BA 4GVOA 3MZ9A 1NH8A 1USYE 2VOZA 2Q2AA 1A99A 3U8QA 3IORA 2QPQA 4U4XA 4YKIA 5AA2A 3PMWA 4ELPA 2XXYA 2OBGA 1S7YA 1OVBA 2DVCA 4ESXA 2X7QA 3UORA 3GXAA 4F29A 2ZYNA 1SI1A 3JYRA 2RCBA 1N76A 3KJTA 2Q2CA 3UN6A 3CVGA 1N0TA 3TUSA 1BTJA 4H1XA 2GRVA 4Q30B 3UP9A 2F6GA 1QUIA 1WDNA 3VVDA 3VXCA 3UA8A 3S2VA 1QUJA 2UVIA 3TELA 4G68C 3U94A 3LR1A 2RC9A 3H03A 1XS5A 3O29A 3RN8A 2RINA 2O7UA 4EQBA 5JTYA 3U93A 1FQAA 3IX1A 2HQ0A 4ESWA 4H67A 1JEVA 3T9VA 2FYIA 4NF6A 2V3QA 1VFDA 1IXIA 3S9NC 1MQIA 4G4PA 3FXRA 4GQOA 4QFKA 2P2AA 1ZLQA 3G3FA 4OXVA 3IOVA 4IO6A 1RYXA 2PBWA 3OOAA 5L9SA 2VGQA 1YPNA 1LSTA 1SDXA 3FJ7A 1B4HA 1UTHB 1OMPA 3DM0A 5CMBA 1LAGE 1FW0A 3KGCA 3TQWA 1FQFA 2VHAA 4FEDA 4F22A 2UYEA 1LGBC 1LFGA 1P1NA 3K4UA 1EZPA 4H5FA 4LZ8A 1MM6A 3H6UA 5FHOA 2CMOA 4JSDA 2V3TA 2ZYMA 1LFHA 3FXUA 3EHTA 3OSRA 1LAFE 4E0XA 1PBQA 3FIRA 1MG1A 4KYSA 2ZNSA 4EUOA 2XXXA 3FVKA 3RLFE 1A8EA 1P1OA 1LLSA 4OFJA 2QJEA 3FVOA 4NF4B 1MY3A 3RT8A 2PYYA 3FVNA 4YB7A 2NOOA 3CIJA 4G8HA 5I59A 2DE4A 4K3FA 4XKQA 4R2BA 5FTHA 3Q27A 1IXCA 5CI5A 4RPNA 3ECRA 4ZEIA 4H5GA 2ALUA 3BFUA 3Q29A 2ANJA 3TTNA 4R75A 4NMYA 3MAMA 3T22A 1L5TA 1R6ZA 2Z8FA 4PFTA 2Y84A 5EHSA 3WAFA 1H44A 3UGWA 4Q0CA 3MW0A 1VSOA 1I6QA 1LAHE 4OTEA 3HHGA 5ITPA 2CZLA 1DPPA 1SW5A 1UTBB 3FVGA 3MP8A 4GL8A 2V25A 4PP0A 4OESA 4IO3A 4PFWA 3MVXA 5L8DA 4HW8A 5I57A 2H25A 5LOMA 4PFYA 3MVWA 2B65A 5KCJB 3C31A 2V93A 1MPDA 1MXZA 2A5TB 5ITOA 1SYHA 2OWSA 3FD3A 1YTVA 1S9TA 3MZ1A 3O6GA 4AQ4A 2F34A 2QS1A 3H06B 1O63A 1XOCA 3N6UA 2XXUA 3VXBA 3EF7A 1B3GA 3EHSA 1D4NA 3TEPA 1DMBA 4KFQA 1PBPA 3KBRA 2XX8A 4ONYA 4OWDA 4P0IA 3EHUA 2DP8A 1ZKBA 4OETA 4YMAA 3OO9A 4FJPA 4BDRA 4C1TA 4LQ5A 4YU0A 4NF5B 4F19A 3G3IA 4QF9A 4ND9A 2I48A 4GLIA 2QL3A 1N7XA 4C0RA 2XXIA 4G77A 1TXFA 3IO4A 1PDAA 1FTOA 4QSDA 3FV2A 4R73A 3K0VA 1N3WA 1I6AA 3FJMA 2FA7A 5CM6A 3RPWA 4ZEBA 1Y20A 2RC7A 3JV9A 2E0SA 3FV1A 4R72A 1URGA 3RTFB 1FTMA 4EXLA 5HPQA 3OENA 3KEIA 1IUDA 4G68B 2AL5A 5H8QA 3K1NA 2YPNA 1XVYA 1FQCA 4GRKA 3RNNA 1NNPA 3GZGA 4H6DA 3V5AA 2DVZA 3MBPA 2X26A 2GFEA 3O28A 4OFLA 1MQHA 4FAJA 3K1MA 3FGSA 3W9VA 3M3KA 5I2NB 4JWYA 1SYIA 5I2KA 1IZ1A 4U21A 4G8MA 4XTCQ 5AA2D 3KJ7A 3ZS6A 4QHQA 1D9VA 1HSLA 2Y7KA 3V8XB 2IA4A 4GOTA 1MRPA 3VLWA 4JWXA 4YAHX 1EZ9A 1DPEA 3TFLA 3PV0E 4L17A 3EQ1A 4IGRA 1MQJA 4KYDA 1O7TA 4GXAA 4RK9A 3K6XA 2ABHA 3DP8A 5I56B 1DTGA 1I6BA 3W15C 3DELB 2I4CA 4FEBA 5JEIA 4NF8B 2PMSA 2Q89A 2R6GE 1N3XA 4LONB 4QFOA 5TPAA 1IEJA 4RNSA 1SW4A 4I1DA 2DOJA 2M8CA 1B51A 2QS4A 3H4ZA 1MY1A 1MH3A 1VR5A 1M5CA 1GR2A 2O84X 3KFMA 3D4CA 1B40A 3IB1A 4NTLA 3PPRA 3QYTA 1B4ZA 2ONSA 4ZS9A 2WKYA 3IB0A 4F3BA 4YKKA 2P1SA 2HCAA 2XXQA 4KCCA 3TCHA 4TLLB 2OWTA 2F78A 2XXVA 1MDP1 4OEUA 1T0KA 1WODA 4OFOA 2Y7RA 4YZZA 2OJTA 4DE8A 4YMBA 4JB7A 3W9WA 5IAIA 3KSXA 4N6PA 4UACA 1A55A 4RJZA 4ECFA 1B1HA 3H6VA 3E3KA 2D5WA 4M1VA 3HO7A 1Z7ME 4HCWA 3QAXA 3U72A 4OEVA 4R74A 1IIWA 3TKDA 4DZ1A 4QSEA 4GIZA 1ANFA 5A5XA 2F36A 1QULA 1IQ7A 4GD5A 3M3LA 1N7WA 3OXNA 2YLNA 1R1NA 1OIBA 2XX9A 4I9DA 3SETA 2Z23A 3WAEA 2QS3A 5FHMA 1Q35A 3L6HA 3KN7A 3MPKA 4NWCA 3TTRA 3FUZA 2DXYA 2O1LA 3MP1A 1UTHA 5CMMA 2ZYOA 4JWOA 3N6TA 5JTYB 3I6VA 1B0LA 3GBBA 1P1QA 1NL5A 2W7YA 4XXUA 3CG1A 3V83A 2PT2A 2I0CA 3HPIA 4AB6A 3LBSA 3TYHA 4HTGA 1QUKA 4WEPA 3K6WA 4PFUA 1LB9A 2RKMA 4EF1A 4IY5A 4PE5B 5H8HB 4KQPA 3IR1A 4QRZA 4O3AA 3TQLA 1EH3A 3SEUA 4DCYA 2I6EA 2XXWA 5CC2A 1GV8A 3RQTA 2Z22A 1AIVA 4OERA 4DXCA 4ZECA 3KN8A 4NF4A 1IXHA 3LC8A 3EPEA 3FZVA 1FQEA 3C4MA 3T9XB 3K6UA 2GHBA 2AYSA 4R6HA 1Z7NE 2Z8DA 3QK6A 4JSOA 1LBBA 4EXKA 5BUUA 1SD3A 2ZYKA 3PUWE 3C36A 1WVJA 1B1XA 1GVCA 1JQFA 4H65A 2QRYA 4R6KA 1MY4A 1GTKA 1II5A 4JBZA 2I3WA 1B46A 5BWJA 4KR5A 1YAEA 1QJMA 1N84A 4LP2B 3TPAA 4F1YA 4RXLA 1M5EA 3ZSFA 3SEXA 1DOTA 2DSFA 3PU5A 4R9GA 4FE8A 1FTJA 1P99A 2IEEA 4DXUA 1M5DA 2XXTA 2RC8A 2FNCA 3OEMA 2Q88A 1LFIA 3T66A 2A5TA 4WEDA 3C35A 2XX7A 1XVXA 3T96B 3U92A 3Q28A 2DYXA 3O66A 1D3KA 1NNTA 3VVEA 2HZLA 5HM4B 4Q5TA 4F1UA 3DP6A 4JDFA 3B6TA 3CFLA 1O64A 1US4A 2B3FA 5DT6A 2DQVA 4PQJA 4FATA 4ZDMA 3VV5A 1BP5A 3B6WA 5H8NB 5I57B 5H8SA 2UVJA 4LZ7A 1B3HA 3RY3A 3VE1B 1ZBMA 5KDTB 5DVIA 3MUQA 1NFTA 3H6TA 4TOZA 2E1SA 4OMBA 1B5JA 2ZNTA 4LATA 2O6AA 1LCTA 1OVTA 4KI0E 1OQHA 4NF5A 3TTLA 2XD2A 1JW5A 2R71A 1OLCA 4LQ2A 3CFZA 1LB8A 3ONMA 5AA4B 2ZNUA 3V89B 4BDNA 3SEYA 1AL3A 2VD3A 4ZZAA 1URSA 3ZKKA 3D4GA 3E13X 3GBAA 2RCAA 4P11A 4E0WA 4POWA 4RPOA 1EZOA 2GH9A 1MXVA 3PGFA 4PETA 4EQ7A 2ONKE 5H8FB 4IO7A 3BBRA 3C9HA 3ODBA 4QFLA 4HCYA 4U23A 4IY6A 1YCJA 1ATGA 2I49A 4YB5A 4YB6A 4G68A 4U1OA 1Y4TA 3KOSA 3R26A 5J1DA 5L9MA 3BKIB 4GFRA 4X48A 1IXGA 1SQYA 1QVSA 4JXIA 3RTWB 1S50A 1DTZA 1TFAA 5DEXB 2V3UA 1MQGA 1MY2A 1JVXA 5CBSA 3PMVA 2Y7IA 4U1ZA 3SKPA 3K01A 1JEUA 4R9FA 4F2QA 3PPOA 2O68A 3K6VA 3R6UA 4N07A 3T93B 4I8CA 4MF3A 5I84A 1SW2A 2THIA 5CMCA 3R7XA 3DP4A 2UVHA 1DSNA 3Q26A 3USDA 2XD3A 1M5FA 4X1BA 5AE4A 3MVZA 2PX1A 2DXRA 5I2KB 4FIMA 1SVXB 3E9XA 3U1OA 2HZKA 4GF8A 1B7ZA 3IJXB 4QFNA 2O7IA 4LUBA 3HV1A 1A54A 5I56A 1URDA 2Q9TA 1JW4A 1FQBA 1POTA 3PPPA 2F7AA 5F7VA 2DE2A 2OCUA 4F1VA 4DLDA 1B3FA 4RK2A 3IK6B 2G93A 2ONRA 3M3FA 4GXSB 2B3BA 1PEBA 2P0SA 2F97A 1B32A 1Y9UA 2QMWA 5TU0A 3PPQA 3I5OA 1A8FA 4I62A 4OYVA 5I58B 4H8JA 1N04A 1UIVA 5DVJA 1CB6A 4OHNA 2DWHA 5F1QA 1B52A 3RT6B 4F18A 1AOVA 1A7LA 2F8DA 2UYFA 2UXAA 3SEVA 3RUMA 4ELOA 4BDLA 4MFIA 3K02A 2HFBA 1MQDA 3IJOB 5TPAB 5TP9B 3ILUB 1TFDA 4FECA 4HS7A 5AA3A 2ZMBA 2NUVA 3FATA 3PUXE 5ISUA 1Y3PA 3EN3A 4U22A 2VD2A 4O3CA 1H76A 2H98A 1H45A 1B3LA 1TT1A 1FCKA 1M5BA 3T9HB 3QIMA 3TCGA 4F3SA 2LAOA 4YICA 1NNFA 1RYOA 2BJJX 4F3GA 1ZJLA 4LZ5A 1NKXA 4F3PA 2XHDA 2UVGA 5ICQA 5K2YA 5AA2B 3UIFA 2R9JA 1JETA 3P7IA 3IOWA 4IO5A 3HCQA 3VLVA 3PPNA 5AA1A 3IOTA 3LSXA 4X9TA 4KYEA 3PUVE 1MS7A 2XXPA 1BKAA 5FTIA 2KLFA 2QMXA 5DYHA 3C34A 2F5XA 1CE2A 2H5YA 3AXFA 2DWJA 4NWDA 3A3CA 3IL1B 5KZTA 5ICTA 3OO8A 5FHNA 5JK4A 2O1MA 2HAUA 2GHAA 3UK4A 1MY0A 3OO6A 3G3HA 4DCXA 2Q8JA 3THIA 1VFEA 5A5XB 3KG2A 3RGYA 1SI0A 3O2AA 2Z8EA 3PUYE 4IO4A 3IAZA 3ZKLA 4MBPA 5DVFA 2XXRA 1I69A 3KSJA 4RYAA 1Y1ZA 3M8UA 1B0HA 4XIGQ 3HHFA 4AB5A 1HSJA 4NF6B 5H8HA 2F6PA 5CRYA 3CFXA 3H3GA 2YJPA 4OVJA 1PC3A 3PUZE 1FTLA 4U4SA 1LBCA 3IB2A 4ISUA 3TODA 3O9PA 4IB2A 3LSFB 3FXQA 3KOTA 3T9UA 3I3VA 3TAJA 2H99A 4BLAA 4GL0A 1B3EA 1BLFA 1JVYA 4MLQA 4OZ9A 3IO6A 4DDDA 3KN3A 1P1WA 3MP6A 1ZIUA 4TQUQ 1MXUA 2NXOA 4XKNA 4XKRA 1H3DA 1H43A 4YKJA 4ZE8A 1MXWA 1ZTYA 4BDQA 4RA1A 1XHYA 1Y3QA 1EU8A 4KCDA 1QKAA 3G7WA 3MVYA 4GWOA 4IO2A 1R9LA 2F35A 1FTKA 2RF1A 3VFJA 1UTBA 2REJA 5ELVA 4F39A 3OSQA 1US5A 5I59B 2VP1A 1UIUA 4LVQA 4ZEKA 4DXBA 2QS2A 2HAVA 2I4BA 1MPCA 1VE4A 5CMKA 1P1UA 5K2XA 2Y7PA 4F2OA 5CBRA 5KCJA 1Y1MA 2ZXTA 5DTBA 4QFPA 1KWHA 2F7CA 4KD5A 3SDFA 3MPLA 3CG3A 3S9EA 4R2FA 1TWYA 1XT8A 1RKMA 1B9JA 3OELA 2HEUA 5H8NA 4THIA 1JW1A 2AL4A 4DIGA 1HSEA 3N26A 5KDTA 3MZBA 2DE3A 1B2HA 1Y3NA 3CSGA 1ZU0A 2F7BA 4FORA 4EDPA 1QW0A 1FQDA 4O3BA 1ELJA 3G3GA 4C1UA 4WXJA 1IITA 3B7DA 4NEDA 1NNKA 2V84A 4H8IA 3GLBA 3ILTB 2H4IA 5B70A 3H7MA 3A3UA 4UA8A 2DS9A 2XXHA 5AA4A 1MXXA 1GGGA 1LAXA 3TCFA 3K2DA 3VVFA 5L9OA 4ZEDA 3TDJA 3TZAA 2PT1A 3E4RA 4G8NA 1J1NA 5H8FA 2AIXA 3LSWA 3LUYA 3O6IA 1B7HA 3TMGA 1MH4A 4EQ9A 4Q8RA 3TTMA 4G2ZA 4NE4A 4WKMA 3OO7A 1SW1A 2QSXA 3HN0A 3VDFA 3S9LC 3FASA 2A5SA 3BFTA 2D21A 4U2RA 4BDMA 3N5LA 5B7DA 2O69A 3C33A 1PB9A 2Y7WA 2G29A 3CSBA 3K00A 5DEXA 4MLVA 3F11A 1LCFA 3G3KA 4P0GA 3HSTA 4TLMB 2O51A 3CR9A 3VLUA 1D9YA 2H9BA 5I2NA 3IOUA 3K1PA 4OQOA 2DWAA 1UQWA 4XKPA 1B6HA 1B5IA 1NMUA 5H8QB 2OZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B5H A;  4ZE9 A;  1A40 A;  4MH5 A;  3OD7 A;  4Z7E A;  3TTK A;  1XC1 A;  3N94 A;  2I58 A;  4X1D A;  3QUF A;  1R9Q A;  4ZEF A;  3A09 A;  4RY1 A;  1MXY A;  1OQG A;  3OMB A;  2OLB A;  3G3J A;  3CRB A;  2D3I A;  3CI8 A;  1SBP A;  3SES A;  2REG A;  1MPB A;  4KPT A;  1OLA A;  1PB7 A;  3QSL A;  4YKP A;  2DWI A;  1B05 A;  3JZJ A;  4ZZE A;  5M2V A;  5EHM A;  3B6Q A;  2I3V A;  4NF8 A;  5IKB A;  1QKB A;  1USY H;  4EF2 A;  5HBC A;  3L6G A;  3SER A;  3O97 A;  3O6H A;  1AH5 A;  1PB8 A;  2X7P A;  3PD9 A;  3S9M C;  3OEK A;  5I58 A;  2NVU B;  5EYF A;  3LSL A;  3QUJ A;  4IGT A;  4H0W A;  4ELR A;  2HXW A;  1AMF A;  4R6Y A;  4QSC A;  1POY 1;  2NWJ A;  4Z0I A;  3MJN A;  3MWB A;  1Q1K A;  2OK2 A;  3Q25 A;  1BIY A;  4KHZ E;  5TP9 A;  3C32 A;  1ZMG A;  4BDO A;  4N13 A;  3KZG A;  2ESN A;  1Y4C A;  3S4U A;  1B58 A;  4M4G A;  3DLN A;  1NH7 A;  4F31 B;  3MQ9 A;  4LA9 A;  3PD8 A;  3MC2 A;  3H6W A;  3QXM A;  1F9B A;  1MM7 A;  1MDQ A;  4ELQ A;  3SEW A;  1JNF A;  2PVU A;  3PMX A;  4POX A;  3FJG A;  4OEN A;  1B7U A;  2I0B A;  4GVO A;  3MZ9 A;  1NH8 A;  1USY E;  2VOZ A;  2Q2A A;  1A99 A;  3U8Q A;  3IOR A;  2QPQ A;  4U4X A;  4YKI A;  5AA2 A;  3PMW A;  4ELP A;  2XXY A;  2OBG A;  1S7Y A;  1OVB A;  2DVC A;  4ESX A;  2X7Q A;  3UOR A;  3GXA A;  4F29 A;  2ZYN A;  1SI1 A;  3JYR A;  2RCB A;  1N76 A;  3KJT A;  2Q2C A;  3UN6 A;  3CVG A;  1N0T A;  3TUS A;  1BTJ A;  4H1X A;  2GRV A;  4Q30 B;  3UP9 A;  2F6G A;  1QUI A;  1WDN A;  3VVD A;  3VXC A;  3UA8 A;  3S2V A;  1QUJ A;  2UVI A;  3TEL A;  4G68 C;  3U94 A;  3LR1 A;  2RC9 A;  3H03 A;  1XS5 A;  3O29 A;  3RN8 A;  2RIN A;  2O7U A;  4EQB A;  5JTY A;  3U93 A;  1FQA A;  3IX1 A;  2HQ0 A;  4ESW A;  4H67 A;  1JEV A;  3T9V A;  2FYI A;  4NF6 A;  2V3Q A;  1VFD A;  1IXI A;  3S9N C;  1MQI A;  4G4P A;  3FXR A;  4GQO A;  4QFK A;  2P2A A;  1ZLQ A;  3G3F A;  4OXV A;  3IOV A;  4IO6 A;  1RYX A;  2PBW A;  3OOA A;  5L9S A;  2VGQ A;  1YPN A;  1LST A;  1SDX A;  3FJ7 A;  1B4H A;  1UTH B;  1OMP A;  3DM0 A;  5CMB A;  1LAG E;  1FW0 A;  3KGC A;  3TQW A;  1FQF A;  2VHA A;  4FED A;  4F22 A;  2UYE A;  1LGB C;  1LFG A;  1P1N A;  3K4U A;  1EZP A;  4H5F A;  4LZ8 A;  1MM6 A;  3H6U A;  5FHO A;  2CMO A;  4JSD A;  2V3T A;  2ZYM A;  1LFH A;  3FXU A;  3EHT A;  3OSR A;  1LAF E;  4E0X A;  1PBQ A;  3FIR A;  1MG1 A;  4KYS A;  2ZNS A;  4EUO A;  2XXX A;  3FVK A;  3RLF E;  1A8E A;  1P1O A;  1LLS A;  4OFJ A;  2QJE A;  3FVO A;  4NF4 B;  1MY3 A;  3RT8 A;  2PYY A;  3FVN A;  4YB7 A;  2NOO A;  3CIJ A;  4G8H A;  5I59 A;  2DE4 A;  4K3F A;  4XKQ A;  4R2B A;  5FTH A;  3Q27 A;  1IXC A;  5CI5 A;  4RPN A;  3ECR A;  4ZEI A;  4H5G A;  2ALU A;  3BFU A;  3Q29 A;  2ANJ A;  3TTN A;  4R75 A;  4NMY A;  3MAM A;  3T22 A;  1L5T A;  1R6Z A;  2Z8F A;  4PFT A;  2Y84 A;  5EHS A;  3WAF A;  1H44 A;  3UGW A;  4Q0C A;  3MW0 A;  1VSO A;  1I6Q A;  1LAH E;  4OTE A;  3HHG A;  5ITP A;  2CZL A;  1DPP A;  1SW5 A;  1UTB B;  3FVG A;  3MP8 A;  4GL8 A;  2V25 A;  4PP0 A;  4OES A;  4IO3 A;  4PFW A;  3MVX A;  5L8D A;  4HW8 A;  5I57 A;  2H25 A;  5LOM A;  4PFY A;  3MVW A;  2B65 A;  5KCJ B;  3C31 A;  2V93 A;  1MPD A;  1MXZ A;  2A5T B;  5ITO A;  1SYH A;  2OWS A;  3FD3 A;  1YTV A;  1S9T A;  3MZ1 A;  3O6G A;  4AQ4 A;  2F34 A;  2QS1 A;  3H06 B;  1O63 A;  1XOC A;  3N6U A;  2XXU A;  3VXB A;  3EF7 A;  1B3G A;  3EHS A;  1D4N A;  3TEP A;  1DMB A;  4KFQ A;  1PBP A;  3KBR A;  2XX8 A;  4ONY A;  4OWD A;  4P0I A;  3EHU A;  2DP8 A;  1ZKB A;  4OET A;  4YMA A;  3OO9 A;  4FJP A;  4BDR A;  4C1T A;  4LQ5 A;  4YU0 A;  4NF5 B;  4F19 A;  3G3I A;  4QF9 A;  4ND9 A;  2I48 A;  4GLI A;  2QL3 A;  1N7X A;  4C0R A;  2XXI A;  4G77 A;  1TXF A;  3IO4 A;  1PDA A;  1FTO A;  4QSD A;  3FV2 A;  4R73 A;  3K0V A;  1N3W A;  1I6A A;  3FJM A;  2FA7 A;  5CM6 A;  3RPW A;  4ZEB A;  1Y20 A;  2RC7 A;  3JV9 A;  2E0S A;  3FV1 A;  4R72 A;  1URG A;  3RTF B;  1FTM A;  4EXL A;  5HPQ A;  3OEN A;  3KEI A;  1IUD A;  4G68 B;  2AL5 A;  5H8Q A;  3K1N A;  2YPN A;  1XVY A;  1FQC A;  4GRK A;  3RNN A;  1NNP A;  3GZG A;  4H6D A;  3V5A A;  2DVZ A;  3MBP A;  2X26 A;  2GFE A;  3O28 A;  4OFL A;  1MQH A;  4FAJ A;  3K1M A;  3FGS A;  3W9V A;  3M3K A;  5I2N B;  4JWY A;  1SYI A;  5I2K A;  1IZ1 A;  4U21 A;  4G8M A;  4XTC Q;  5AA2 D;  3KJ7 A;  3ZS6 A;  4QHQ A;  1D9V A;  1HSL A;  2Y7K A;  3V8X B;  2IA4 A;  4GOT A;  1MRP A;  3VLW A;  4JWX A;  4YAH X;  1EZ9 A;  1DPE A;  3TFL A;  3PV0 E;  4L17 A;  3EQ1 A;  4IGR A;  1MQJ A;  4KYD A;  1O7T A;  4GXA A;  4RK9 A;  3K6X A;  2ABH A;  3DP8 A;  5I56 B;  1DTG A;  1I6B A;  3W15 C;  3DEL B;  2I4C A;  4FEB A;  5JEI A;  4NF8 B;  2PMS A;  2Q89 A;  2R6G E;  1N3X A;  4LON B;  4QFO A;  5TPA A;  1IEJ A;  4RNS A;  1SW4 A;  4I1D A;  2DOJ A;  2M8C A;  1B51 A;  2QS4 A;  3H4Z A;  1MY1 A;  1MH3 A;  1VR5 A;  1M5C A;  1GR2 A;  2O84 X;  3KFM A;  3D4C A;  1B40 A;  3IB1 A;  4NTL A;  3PPR A;  3QYT A;  1B4Z A;  2ONS A;  4ZS9 A;  2WKY A;  3IB0 A;  4F3B A;  4YKK A;  2P1S A;  2HCA A;  2XXQ A;  4KCC A;  3TCH A;  4TLL B;  2OWT A;  2F78 A;  2XXV A;  1MDP 1;  4OEU A;  1T0K A;  1WOD A;  4OFO A;  2Y7R A;  4YZZ A;  2OJT A;  4DE8 A;  4YMB A;  4JB7 A;  3W9W A;  5IAI A;  3KSX A;  4N6P A;  4UAC A;  1A55 A;  4RJZ A;  4ECF A;  1B1H A;  3H6V A;  3E3K A;  2D5W A;  4M1V A;  3HO7 A;  1Z7M E;  4HCW A;  3QAX A;  3U72 A;  4OEV A;  4R74 A;  1IIW A;  3TKD A;  4DZ1 A;  4QSE A;  4GIZ A;  1ANF A;  5A5X A;  2F36 A;  1QUL A;  1IQ7 A;  4GD5 A;  3M3L A;  1N7W A;  3OXN A;  2YLN A;  1R1N A;  1OIB A;  2XX9 A;  4I9D A;  3SET A;  2Z23 A;  3WAE A;  2QS3 A;  5FHM A;  1Q35 A;  3L6H A;  3KN7 A;  3MPK A;  4NWC A;  3TTR A;  3FUZ A;  2DXY A;  2O1L A;  3MP1 A;  1UTH A;  5CMM A;  2ZYO A;  4JWO A;  3N6T A;  5JTY B;  3I6V A;  1B0L A;  3GBB A;  1P1Q A;  1NL5 A;  2W7Y A;  4XXU A;  3CG1 A;  3V83 A;  2PT2 A;  2I0C A;  3HPI A;  4AB6 A;  3LBS A;  3TYH A;  4HTG A;  1QUK A;  4WEP A;  3K6W A;  4PFU A;  1LB9 A;  2RKM A;  4EF1 A;  4IY5 A;  4PE5 B;  5H8H B;  4KQP A;  3IR1 A;  4QRZ A;  4O3A A;  3TQL A;  1EH3 A;  3SEU A;  4DCY A;  2I6E A;  2XXW A;  5CC2 A;  1GV8 A;  3RQT A;  2Z22 A;  1AIV A;  4OER A;  4DXC A;  4ZEC A;  3KN8 A;  4NF4 A;  1IXH A;  3LC8 A;  3EPE A;  3FZV A;  1FQE A;  3C4M A;  3T9X B;  3K6U A;  2GHB A;  2AYS A;  4R6H A;  1Z7N E;  2Z8D A;  3QK6 A;  4JSO A;  1LBB A;  4EXK A;  5BUU A;  1SD3 A;  2ZYK A;  3PUW E;  3C36 A;  1WVJ A;  1B1X A;  1GVC A;  1JQF A;  4H65 A;  2QRY A;  4R6K A;  1MY4 A;  1GTK A;  1II5 A;  4JBZ A;  2I3W A;  1B46 A;  5BWJ A;  4KR5 A;  1YAE A;  1QJM A;  1N84 A;  4LP2 B;  3TPA A;  4F1Y A;  4RXL A;  1M5E A;  3ZSF A;  3SEX A;  1DOT A;  2DSF A;  3PU5 A;  4R9G A;  4FE8 A;  1FTJ A;  1P99 A;  2IEE A;  4DXU A;  1M5D A;  2XXT A;  2RC8 A;  2FNC A;  3OEM A;  2Q88 A;  1LFI A;  3T66 A;  2A5T A;  4WED A;  3C35 A;  2XX7 A;  1XVX A;  3T96 B;  3U92 A;  3Q28 A;  2DYX A;  3O66 A;  1D3K A;  1NNT A;  3VVE A;  2HZL A;  5HM4 B;  4Q5T A;  4F1U A;  3DP6 A;  4JDF A;  3B6T A;  3CFL A;  1O64 A;  1US4 A;  2B3F A;  5DT6 A;  2DQV A;  4PQJ A;  4FAT A;  4ZDM A;  3VV5 A;  1BP5 A;  3B6W A;  5H8N B;  5I57 B;  5H8S A;  2UVJ A;  4LZ7 A;  1B3H A;  3RY3 A;  3VE1 B;  1ZBM A;  5KDT B;  5DVI A;  3MUQ A;  1NFT A;  3H6T A;  4TOZ A;  2E1S A;  4OMB A;  1B5J A;  2ZNT A;  4LAT A;  2O6A A;  1LCT A;  1OVT A;  4KI0 E;  1OQH A;  4NF5 A;  3TTL A;  2XD2 A;  1JW5 A;  2R71 A;  1OLC A;  4LQ2 A;  3CFZ A;  1LB8 A;  3ONM A;  5AA4 B;  2ZNU A;  3V89 B;  4BDN A;  3SEY A;  1AL3 A;  2VD3 A;  4ZZA A;  1URS A;  3ZKK A;  3D4G A;  3E13 X;  3GBA A;  2RCA A;  4P11 A;  4E0W A;  4POW A;  4RPO A;  1EZO A;  2GH9 A;  1MXV A;  3PGF A;  4PET A;  4EQ7 A;  2ONK E;  5H8F B;  4IO7 A;  3BBR A;  3C9H A;  3ODB A;  4QFL A;  4HCY A;  4U23 A;  4IY6 A;  1YCJ A;  1ATG A;  2I49 A;  4YB5 A;  4YB6 A;  4G68 A;  4U1O A;  1Y4T A;  3KOS A;  3R26 A;  5J1D A;  5L9M A;  3BKI B;  4GFR A;  4X48 A;  1IXG A;  1SQY A;  1QVS A;  4JXI A;  3RTW B;  1S50 A;  1DTZ A;  1TFA A;  5DEX B;  2V3U A;  1MQG A;  1MY2 A;  1JVX A;  5CBS A;  3PMV A;  2Y7I A;  4U1Z A;  3SKP A;  3K01 A;  1JEU A;  4R9F A;  4F2Q A;  3PPO A;  2O68 A;  3K6V A;  3R6U A;  4N07 A;  3T93 B;  4I8C A;  4MF3 A;  5I84 A;  1SW2 A;  2THI A;  5CMC A;  3R7X A;  3DP4 A;  2UVH A;  1DSN A;  3Q26 A;  3USD A;  2XD3 A;  1M5F A;  4X1B A;  5AE4 A;  3MVZ A;  2PX1 A;  2DXR A;  5I2K B;  4FIM A;  1SVX B;  3E9X A;  3U1O A;  2HZK A;  4GF8 A;  1B7Z A;  3IJX B;  4QFN A;  2O7I A;  4LUB A;  3HV1 A;  1A54 A;  5I56 A;  1URD A;  2Q9T A;  1JW4 A;  1FQB A;  1POT A;  3PPP A;  2F7A A;  5F7V A;  2DE2 A;  2OCU A;  4F1V A;  4DLD A;  1B3F A;  4RK2 A;  3IK6 B;  2G93 A;  2ONR A;  3M3F A;  4GXS B;  2B3B A;  1PEB A;  2P0S A;  2F97 A;  1B32 A;  1Y9U A;  2QMW A;  5TU0 A;  3PPQ A;  3I5O A;  1A8F A;  4I62 A;  4OYV A;  5I58 B;  4H8J A;  1N04 A;  1UIV A;  5DVJ A;  1CB6 A;  4OHN A;  2DWH A;  5F1Q A;  1B52 A;  3RT6 B;  4F18 A;  1AOV A;  1A7L A;  2F8D A;  2UYF A;  2UXA A;  3SEV A;  3RUM A;  4ELO A;  4BDL A;  4MFI A;  3K02 A;  2HFB A;  1MQD A;  3IJO B;  5TPA B;  5TP9 B;  3ILU B;  1TFD A;  4FEC A;  4HS7 A;  5AA3 A;  2ZMB A;  2NUV A;  3FAT A;  3PUX E;  5ISU A;  1Y3P A;  3EN3 A;  4U22 A;  2VD2 A;  4O3C A;  1H76 A;  2H98 A;  1H45 A;  1B3L A;  1TT1 A;  1FCK A;  1M5B A;  3T9H B;  3QIM A;  3TCG A;  4F3S A;  2LAO A;  4YIC A;  1NNF A;  1RYO A;  2BJJ X;  4F3G A;  1ZJL A;  4LZ5 A;  1NKX A;  4F3P A;  2XHD A;  2UVG A;  5ICQ A;  5K2Y A;  5AA2 B;  3UIF A;  2R9J A;  1JET A;  3P7I A;  3IOW A;  4IO5 A;  3HCQ A;  3VLV A;  3PPN A;  5AA1 A;  3IOT A;  3LSX A;  4X9T A;  4KYE A;  3PUV E;  1MS7 A;  2XXP A;  1BKA A;  5FTI A;  2KLF A;  2QMX A;  5DYH A;  3C34 A;  2F5X A;  1CE2 A;  2H5Y A;  3AXF A;  2DWJ A;  4NWD A;  3A3C A;  3IL1 B;  5KZT A;  5ICT A;  3OO8 A;  5FHN A;  5JK4 A;  2O1M A;  2HAU A;  2GHA A;  3UK4 A;  1MY0 A;  3OO6 A;  3G3H A;  4DCX A;  2Q8J A;  3THI A;  1VFE A;  5A5X B;  3KG2 A;  3RGY A;  1SI0 A;  3O2A A;  2Z8E A;  3PUY E;  4IO4 A;  3IAZ A;  3ZKL A;  4MBP A;  5DVF A;  2XXR A;  1I69 A;  3KSJ A;  4RYA A;  1Y1Z A;  3M8U A;  1B0H A;  4XIG Q;  3HHF A;  4AB5 A;  1HSJ A;  4NF6 B;  5H8H A;  2F6P A;  5CRY A;  3CFX A;  3H3G A;  2YJP A;  4OVJ A;  1PC3 A;  3PUZ E;  1FTL A;  4U4S A;  1LBC A;  3IB2 A;  4ISU A;  3TOD A;  3O9P A;  4IB2 A;  3LSF B;  3FXQ A;  3KOT A;  3T9U A;  3I3V A;  3TAJ A;  2H99 A;  4BLA A;  4GL0 A;  1B3E A;  1BLF A;  1JVY A;  4MLQ A;  4OZ9 A;  3IO6 A;  4DDD A;  3KN3 A;  1P1W A;  3MP6 A;  1ZIU A;  4TQU Q;  1MXU A;  2NXO A;  4XKN A;  4XKR A;  1H3D A;  1H43 A;  4YKJ A;  4ZE8 A;  1MXW A;  1ZTY A;  4BDQ A;  4RA1 A;  1XHY A;  1Y3Q A;  1EU8 A;  4KCD A;  1QKA A;  3G7W A;  3MVY A;  4GWO A;  4IO2 A;  1R9L A;  2F35 A;  1FTK A;  2RF1 A;  3VFJ A;  1UTB A;  2REJ A;  5ELV A;  4F39 A;  3OSQ A;  1US5 A;  5I59 B;  2VP1 A;  1UIU A;  4LVQ A;  4ZEK A;  4DXB A;  2QS2 A;  2HAV A;  2I4B A;  1MPC A;  1VE4 A;  5CMK A;  1P1U A;  5K2X A;  2Y7P A;  4F2O A;  5CBR A;  5KCJ A;  1Y1M A;  2ZXT A;  5DTB A;  4QFP A;  1KWH A;  2F7C A;  4KD5 A;  3SDF A;  3MPL A;  3CG3 A;  3S9E A;  4R2F A;  1TWY A;  1XT8 A;  1RKM A;  1B9J A;  3OEL A;  2HEU A;  5H8N A;  4THI A;  1JW1 A;  2AL4 A;  4DIG A;  1HSE A;  3N26 A;  5KDT A;  3MZB A;  2DE3 A;  1B2H A;  1Y3N A;  3CSG A;  1ZU0 A;  2F7B A;  4FOR A;  4EDP A;  1QW0 A;  1FQD A;  4O3B A;  1ELJ A;  3G3G A;  4C1U A;  4WXJ A;  1IIT A;  3B7D A;  4NED A;  1NNK A;  2V84 A;  4H8I A;  3GLB A;  3ILT B;  2H4I A;  5B70 A;  3H7M A;  3A3U A;  4UA8 A;  2DS9 A;  2XXH A;  5AA4 A;  1MXX A;  1GGG A;  1LAX A;  3TCF A;  3K2D A;  3VVF A;  5L9O A;  4ZED A;  3TDJ A;  3TZA A;  2PT1 A;  3E4R A;  4G8N A;  1J1N A;  5H8F A;  2AIX A;  3LSW A;  3LUY A;  3O6I A;  1B7H A;  3TMG A;  1MH4 A;  4EQ9 A;  4Q8R A;  3TTM A;  4G2Z A;  4NE4 A;  4WKM A;  3OO7 A;  1SW1 A;  2QSX A;  3HN0 A;  3VDF A;  3S9L C;  3FAS A;  2A5S A;  3BFT A;  2D21 A;  4U2R A;  4BDM A;  3N5L A;  5B7D A;  2O69 A;  3C33 A;  1PB9 A;  2Y7W A;  2G29 A;  3CSB A;  3K00 A;  5DEX A;  4MLV A;  3F11 A;  1LCF A;  3G3K A;  4P0G A;  3HST A;  4TLM B;  2O51 A;  3CR9 A;  3VLU A;  1D9Y A;  2H9B A;  5I2N A;  3IOU A;  3K1P A;  4OQO A;  2DWA A;  1UQW A;  4XKP A;  1B6H A;  1B5I A;  1NMU A;  5H8Q B;  2OZZ A; 
#chains in the Genus database with same CATH topology
 1B5H A;  4ZE9 A;  1A40 A;  4MH5 A;  3OD7 A;  2WYK A;  2BJI A;  4Z7E A;  3TTK A;  4NHB A;  1XC1 A;  2QVU A;  3N94 A;  2I58 A;  4X1D A;  3QUF A;  1R9Q A;  4ZEF A;  3A09 A;  4RY1 A;  1MXY A;  1OQG A;  4O7M A;  3OMB A;  2OLB A;  3G3J A;  2Q8M A;  1FBC A;  3CRB A;  2D3I A;  4OVR A;  3CI8 A;  3BIG A;  3ISP A;  1SBP A;  3SES A;  2REG A;  1MPB A;  4KPT A;  1OLA A;  1PB7 A;  3QSL A;  4YKP A;  2DWI A;  1B05 A;  3JZJ A;  5EQ8 A;  4ZZE A;  5M2V A;  5EHM A;  3B6Q A;  2I3V A;  4NF8 A;  5IM2 A;  5IKB A;  1QKB A;  1USY H;  4EF2 A;  5HBC A;  3L6G A;  3SER A;  3O97 A;  3O6H A;  1AH5 A;  1PB8 A;  2X7P A;  3PD9 A;  4I40 A;  3S9M C;  3OEK A;  5I58 A;  2NVU B;  5EYF A;  1SPI A;  2PFZ A;  3LSL A;  3QUJ A;  4IGT A;  4H0W A;  4ELR A;  2HXW A;  4GX3 A;  1AMF A;  4R6Y A;  4QSC A;  1POY 1;  2NWJ A;  4Z0I A;  3MJN A;  2KR0 A;  3MWB A;  1Q1K A;  1IMB A;  2OK2 A;  3Q25 A;  1BIY A;  4KHZ E;  2R8T A;  5TP9 A;  3C32 A;  1ZMG A;  4BDO A;  1FPG A;  4N13 A;  3KZG A;  4N6D A;  2ESN A;  1Y4C A;  3S4U A;  1B58 A;  1EYJ A;  4M4G A;  3DLN A;  1NH7 A;  4F31 B;  3MQ9 A;  5ESY A;  4LA9 A;  3EKI A;  3PD8 A;  3MC2 A;  3H6W A;  2V4C A;  3QXM A;  1F9B A;  1MM7 A;  1MDQ A;  4ELQ A;  3SEW A;  1JNF A;  2PVU A;  3PMX A;  4POX A;  3FJG A;  4OEN A;  1B7U A;  2I0B A;  4GVO A;  3MZ9 A;  5F24 A;  1NH8 A;  1USY E;  2VOZ A;  2Q2A A;  1A99 A;  3U8Q A;  1QGX A;  3IOR A;  2QPQ A;  4U4X A;  4YKI A;  5AA2 A;  3PMW A;  3MYU A;  4ELP A;  2XXY A;  2OBG A;  1S7Y A;  1OVB A;  2DVC A;  2QFL A;  4ESX A;  2X7Q A;  3UOR A;  3GXA A;  4F29 A;  2ZYN A;  1SI1 A;  3JYR A;  2RCB A;  1N76 A;  3KJT A;  2Q2C A;  2CEY A;  1Q9D A;  4PAK A;  3QMF A;  3UN6 A;  3CVG A;  4MNP A;  1N0T A;  3FXB A;  5A5L A;  1INP A;  1FPJ A;  3TUS A;  2OWZ A;  1BTJ A;  4H1X A;  2GRV A;  5EQ9 A;  4Q30 B;  3UP9 A;  2F6G A;  3LUZ A;  1QUI A;  1WDN A;  3VVD A;  2XWO A;  3VXC A;  3UA8 A;  3S2V A;  1QUJ A;  2UVI A;  3TEL A;  4G68 C;  3U94 A;  3LR1 A;  2RC9 A;  3H03 A;  1XS5 A;  4NGU A;  4XFE A;  3O29 A;  3RN8 A;  2RIN A;  2O7U A;  4EQB A;  5JTY A;  3U93 A;  1FQA A;  3HFU A;  3IX1 A;  2HQ0 A;  4ESW A;  4PGN A;  4GBV A;  4H67 A;  1JEV A;  3T9V A;  4JVI A;  1FPF A;  2FYI A;  4NF6 A;  2V3Q A;  2P3N A;  1VFD A;  1IXI A;  3S9N C;  1AWB A;  1MQI A;  4IR8 A;  4G4P A;  3FXR A;  4GQO A;  4QFK A;  2P2A A;  4PDH A;  1ZLQ A;  3G3F A;  1NV3 A;  4LN5 A;  4OXV A;  3IOV A;  4IO6 A;  1FBE A;  1RYX A;  2PBW A;  1IMD A;  3OOA A;  5L9S A;  2VGQ A;  1YPN A;  1LST A;  1SDX A;  3FJ7 A;  1B4H A;  1UTH B;  4N4U A;  3E79 A;  1KA0 A;  1OMP A;  3DM0 A;  5CMB A;  1LAG E;  1FW0 A;  4MAG A;  3KGC A;  3TQW A;  1FQF A;  2VHA A;  4FED A;  4PFI A;  2UYE A;  4F22 A;  1LGB C;  1LFG A;  3B8B A;  1P1N A;  3K4U A;  3T1B A;  2CZH A;  1EZP A;  4H5F A;  4LZ8 A;  2WBB A;  1MM6 A;  3H6U A;  5FHO A;  2CMO A;  4JSD A;  2V3T A;  2ZYM A;  1LFH A;  3FXU A;  3EHT A;  3OSR A;  1LAF E;  4E0X A;  1PBQ A;  3FIR A;  1MG1 A;  4KYS A;  2ZNS A;  2Y5L A;  2GQ1 A;  4EUO A;  2XXX A;  3FVK A;  3RLF E;  1DBZ A;  1A8E A;  1P1O A;  1LLS A;  4OFJ A;  2QJE A;  3FVO A;  4NF4 B;  1MY3 A;  5DW8 A;  3RT8 A;  2PYY A;  3FVN A;  4YB7 A;  4PAI A;  2NOO A;  1FJ6 A;  3CIJ A;  5EYG A;  4G8H A;  5I59 A;  1YZ0 A;  2DE4 A;  4K3F A;  4XKQ A;  4R2B A;  5FTH A;  3Q27 A;  1IXC A;  5CI5 A;  4RPN A;  3ECR A;  4ZEI A;  4H5G A;  2ALU A;  3BFU A;  3Q29 A;  2ANJ A;  2XWK A;  3TTN A;  4R75 A;  4NMY A;  3MAM A;  3T22 A;  1R6Z A;  4PFT A;  2Z8F A;  1L5T A;  2Y84 A;  5EHS A;  3WAF A;  1H44 A;  3UGW A;  4Q0C A;  3MW0 A;  1VSO A;  1I6Q A;  1LAH E;  2L5V A;  4OTE A;  3HHG A;  5ITP A;  2CZL A;  1DPP A;  1SW5 A;  1UTB B;  3FVG A;  3MP8 A;  4GL8 A;  2V25 A;  4PP0 A;  4OES A;  3GYY A;  4IO3 A;  4PFW A;  3MVX A;  5L8D A;  3FBP A;  4HW8 A;  5I57 A;  2H25 A;  5LOM A;  4PFY A;  2VT5 A;  3MVW A;  5I5P A;  2B65 A;  4MIJ A;  5KCJ B;  3C31 A;  2V93 A;  1MPD A;  1MXZ A;  2A5T B;  5ITO A;  1SYH A;  2OWS A;  3FD3 A;  1YTV A;  1S9T A;  3MZ1 A;  4GWZ A;  3O6G A;  4AQ4 A;  2F34 A;  2QS1 A;  3H06 B;  1O63 A;  1IMA A;  1XOC A;  3N6U A;  4G61 A;  2XXU A;  3VXB A;  3EF7 A;  1B3G A;  3EHS A;  1D4N A;  3TEP A;  1DMB A;  4KFQ A;  1PBP A;  3KBR A;  2XX8 A;  3IFC A;  1IME A;  4ONY A;  4OWD A;  4P0I A;  3EHU A;  2DP8 A;  1ZKB A;  4OET A;  4YMA A;  3OO9 A;  4FJP A;  4GX6 A;  4BDR A;  4C1T A;  4LQ5 A;  4YU0 A;  4MNC A;  4NF5 B;  4F19 A;  3G3I A;  1NV1 A;  3PTY A;  4PF8 A;  4QF9 A;  4ND9 A;  1DK4 A;  2I48 A;  4GLI A;  2QL3 A;  3BIH A;  1N7X A;  2XXI A;  4G77 A;  4C0R A;  2VPO A;  1TXF A;  3IO4 A;  1PDA A;  1FTO A;  4QSD A;  3FV2 A;  4R73 A;  3K0V A;  1N3W A;  1I6A A;  3FJM A;  2FHY A;  2FA7 A;  5CM6 A;  3RPW A;  4ZEB A;  1Y20 A;  2RC7 A;  1FRP A;  3JV9 A;  2E0S A;  3FV1 A;  1K9Y A;  4R72 A;  1URG A;  3RTF B;  2B4L A;  1FTM A;  4EXL A;  5HPQ A;  3OEN A;  3KEI A;  1IUD A;  4G68 B;  2AL5 A;  5H8Q A;  3K1N A;  2YPN A;  1FPD A;  5EQA A;  1XVY A;  1FQC A;  4GRK A;  3RNN A;  1NNP A;  3GZG A;  1FBP A;  4H6D A;  4HXV A;  3V5A A;  2DVZ A;  4PDD A;  3MBP A;  2X26 A;  2GFE A;  3O28 A;  4OFL A;  1MQH A;  4FAJ A;  3K1M A;  3FGS A;  3W9V A;  3M3K A;  1NUX A;  5I2N B;  3D1R A;  4JWY A;  1SYI A;  5I2K A;  1IZ1 A;  4XF5 A;  4U21 A;  4G8M A;  4XTC Q;  5AA2 D;  3KJ7 A;  3ZS6 A;  4QHQ A;  1D9V A;  4P47 A;  4O7I A;  1HSL A;  2Y7K A;  3V8X B;  1G0H A;  1KA1 A;  2IA4 A;  5T3J A;  4GOT A;  2Q74 A;  1MRP A;  3VLW A;  4KXP A;  4JWX A;  4YAH X;  5I3S A;  1EZ9 A;  1DPE A;  3TFL A;  1IMF A;  2CZI A;  3PV0 E;  4L17 A;  1YYZ A;  2Y5K A;  3EQ1 A;  4IGR A;  1MQJ A;  2PFY A;  4KYD A;  1O7T A;  4GXA A;  4RK9 A;  3K6X A;  2ABH A;  1CNQ A;  3DP8 A;  5I56 B;  1FBD A;  1DTG A;  1I6B A;  3W15 C;  3DEL B;  3A29 A;  2I4C A;  4GBW A;  4FEB A;  5JEI A;  4NF8 B;  2PMS A;  2Q89 A;  2R6G E;  1N3X A;  4LON B;  4QFO A;  5TPA A;  1IEJ A;  3E78 A;  4RNS A;  1SW4 A;  4AS5 A;  4I1D A;  2DOJ A;  2M8C A;  1B51 A;  2QS4 A;  3H4Z A;  1MY1 A;  1MH3 A;  1VR5 A;  1M5C A;  1GR2 A;  5IZ1 A;  2O84 X;  3KFM A;  1FBG A;  3D4C A;  1B40 A;  3IB1 A;  4NTL A;  3PPR A;  3QYT A;  1B4Z A;  2ONS A;  4ZS9 A;  2WKY A;  3IB0 A;  4F3B A;  4YKK A;  1NV5 A;  2P1S A;  2HCA A;  2XXQ A;  4KCC A;  3TCH A;  4TLL B;  4N15 A;  2OWT A;  2F78 A;  2XXV A;  1MDP 1;  4MEV A;  1NUY A;  4OEU A;  1T0K A;  1WOD A;  4OFO A;  2Y7R A;  4P56 A;  4YZZ A;  2OJT A;  2VPN A;  4DE8 A;  4YMB A;  4JB7 A;  3W9W A;  5FBP A;  1FPB A;  2F3D A;  5IAI A;  3KSX A;  4N6P A;  4GWW A;  4UAC A;  1A55 A;  4RJZ A;  4ECF A;  1B1H A;  3H6V A;  3E3K A;  2D5W A;  4M1V A;  3HO7 A;  1Z7M E;  4HCW A;  4GWS A;  3QAX A;  3U72 A;  4OEV A;  4R74 A;  1IIW A;  3TKD A;  4DZ1 A;  4N8G A;  4QSE A;  4GIZ A;  1ANF A;  5A5X A;  2F36 A;  1FBH A;  1QUL A;  1IQ7 A;  4GD5 A;  3M3L A;  1N7W A;  3OXN A;  4NX1 A;  2YLN A;  1R1N A;  1OIB A;  2XX9 A;  4I9D A;  1VDW A;  3SET A;  2Z23 A;  3WAE A;  2QS3 A;  5FHM A;  1LBV A;  1LBX A;  1Q35 A;  3L6H A;  3KN7 A;  3MPK A;  4NWC A;  2B4M A;  3TTR A;  3FUZ A;  2DXY A;  2O1L A;  3MP1 A;  1UTH A;  5CMM A;  2ZYO A;  4JWO A;  3N6T A;  5JTY B;  3I6V A;  1B0L A;  3GBB A;  1P1Q A;  1NL5 A;  2W7Y A;  4XXU A;  3CG1 A;  3V83 A;  2PT2 A;  2I0C A;  3U65 A;  1NV6 A;  3HPI A;  2WYP A;  4OA4 A;  4GWY A;  4AB6 A;  3LBS A;  3TYH A;  1BK4 A;  4HTG A;  1QUK A;  4WEP A;  3K6W A;  4PFU A;  1LB9 A;  2RKM A;  2FVZ A;  4PCD A;  4N17 A;  4EF1 A;  4IY5 A;  4PE5 B;  5H8H B;  4KQP A;  3IR1 A;  4QRZ A;  1FSA A;  4O3A A;  3TQL A;  1EH3 A;  3SEU A;  4DCY A;  2I6E A;  2XXW A;  5CC2 A;  1GV8 A;  3RQT A;  2Z22 A;  1AIV A;  3NOH A;  4OER A;  4DXC A;  5IZ3 B;  4ZEC A;  3KN8 A;  4N91 A;  4NAP A;  4MMP A;  2DDK A;  3MST A;  4NF4 A;  1IXH A;  3LC8 A;  3EPE A;  3FZV A;  1FQE A;  3C4M A;  4P1E A;  3T9X B;  3K6U A;  2GHB A;  2AYS A;  4R6H A;  5I7I A;  1Z7N E;  2Z8D A;  3QK6 A;  4JSO A;  1LBB A;  4EXK A;  4NQ8 A;  5BUU A;  1SD3 A;  2ZYK A;  3PUW E;  3C36 A;  1WVJ A;  1B1X A;  3KC0 A;  4PBQ A;  1GVC A;  1JQF A;  4H65 A;  2QRY A;  4R6K A;  1MY4 A;  2WBD A;  1GTK A;  1II5 A;  4JBZ A;  2WEF A;  2I3W A;  1B46 A;  5BWJ A;  4KR5 A;  1YAE A;  1QJM A;  1N84 A;  4LP2 B;  3TPA A;  4F1Y A;  4RXL A;  1M5E A;  3ZSF A;  3SEX A;  1DOT A;  4X04 A;  2DSF A;  1K9Z A;  3PU5 A;  3LV0 A;  4R9G A;  4FE8 A;  1FTJ A;  1NI9 A;  1P99 A;  4PBH A;  2IEE A;  4DXU A;  1M5D A;  2XXT A;  2RC8 A;  2FNC A;  3OEM A;  2Q88 A;  1LFI A;  3T66 A;  2A5T A;  4WED A;  3C35 A;  2XX7 A;  1FPE A;  1XVX A;  3T96 B;  3U92 A;  3Q28 A;  2DYX A;  3O66 A;  1D3K A;  1NNT A;  3VVE A;  2HZL A;  5HM4 B;  4Q5T A;  4F1U A;  3DP6 A;  4JDF A;  3B6T A;  3CFL A;  1O64 A;  1US4 A;  2B3F A;  4NF0 A;  5DT6 A;  2DQV A;  4I3E A;  1LBZ A;  4PQJ A;  4FAT A;  4ZDM A;  3VV5 A;  1BP5 A;  3B6W A;  5H8N B;  5I57 B;  5H8S A;  2UVJ A;  4LZ7 A;  4OAN A;  1B3H A;  3RY3 A;  3VE1 B;  2P3V A;  1FPL A;  1ZBM A;  5KDT B;  1KZ8 A;  5DVI A;  3MUQ A;  1NFT A;  3H6T A;  4TOZ A;  2E1S A;  4OMB A;  1B5J A;  2ZNT A;  4FBP A;  4LAT A;  4XEQ A;  4PFR A;  1RDZ A;  2O6A A;  1LCT A;  1OVT A;  4KI0 E;  1OQH A;  4NF5 A;  3TTL A;  4JVC A;  2XD2 A;  1JW5 A;  2R71 A;  1OLC A;  4LQ2 A;  3CFZ A;  1LB8 A;  3ONM A;  5AA4 B;  2ZNU A;  3V89 B;  4BDN A;  3SEY A;  1AL3 A;  2VD3 A;  4ZZA A;  1URS A;  3D4G A;  3E13 X;  3ZKK A;  3GBA A;  2RCA A;  4P11 A;  4E0W A;  4POW A;  4RPO A;  1EZO A;  2GH9 A;  1MXV A;  3PGF A;  4PET A;  4EQ7 A;  2WX9 A;  2ONK E;  5H8F B;  4IO7 A;  3BBR A;  4DI3 D;  3C9H A;  5ET6 A;  3ODB A;  4QFL A;  4HCY A;  4U23 A;  2ZZW A;  1YCJ A;  4IY6 A;  1ATG A;  2I49 A;  4YB5 A;  1FJ9 A;  4YB6 A;  4G68 A;  4U1O A;  1Y4T A;  3KOS A;  3R26 A;  5J1D A;  4HE0 A;  5L9M A;  3BKI B;  4GFR A;  4X48 A;  4PAF A;  1IXG A;  4OVS A;  4OVP A;  1SQY A;  1QVS A;  4JXI A;  3RTW B;  1S50 A;  1DTZ A;  1TFA A;  5DEX B;  2V3U A;  4P1L A;  1MQG A;  1MY2 A;  3RPL B;  1JVX A;  3KC1 A;  3PMV A;  5CBS A;  2Y7I A;  4U1Z A;  3SKP A;  3K01 A;  1JEU A;  4R9F A;  4F2Q A;  3PPO A;  2O68 A;  4O8M A;  3K6V A;  5LDZ A;  4P9K A;  3R6U A;  4N07 A;  3T93 B;  4I8C A;  4PFB A;  4MX6 A;  2ZZV A;  4MF3 A;  2ZZX A;  5I84 A;  1SW2 A;  2THI A;  5CMC A;  3R7X A;  3DP4 A;  1FTA A;  1LBW A;  2UVH A;  1FBF A;  4OVT A;  1DSN A;  3Q26 A;  1FPK A;  3USD A;  2XD3 A;  1M5F A;  4X1B A;  2XXK A;  5AE4 A;  1XI6 A;  3MVZ A;  2PX1 A;  2DXR A;  1FPI A;  5I2K B;  4FIM A;  1SVX B;  3E9X A;  3U1O A;  2HZK A;  4GF8 A;  1B7Z A;  2QVV A;  3IJX B;  4QFN A;  2O7I A;  4LUB A;  3HV1 A;  1A54 A;  5I56 A;  1URD A;  2Q9T A;  1JW4 A;  1FQB A;  1POT A;  1LEV A;  3PPP A;  2F7A A;  5F7V A;  3ROJ A;  4MNI A;  1NV7 A;  2DE2 A;  2OCU A;  4F1V A;  4DLD A;  1B3F A;  4RK2 A;  3IK6 B;  2G93 A;  2ONR A;  1RDY A;  3M3F A;  4GXS B;  2B3B A;  1PEB A;  2P0S A;  1D9Q A;  2F97 A;  1B32 A;  1Y9U A;  2CZK A;  2QMW A;  5TU0 A;  3PPQ A;  3I5O A;  1A8F A;  3T0J A;  4I62 A;  4OYV A;  5I58 B;  4H8J A;  1N04 A;  2XWI A;  1UIV A;  5DVJ A;  1CB6 A;  4OHN A;  2DWH A;  5F1Q A;  1B52 A;  4MJO A;  3RT6 B;  4N8Y A;  4F18 A;  1AOV A;  1A7L A;  2CEX A;  2F8D A;  2UYF A;  4N6K A;  2UXA A;  3SEV A;  3RUM A;  4ELO A;  4BDL A;  4MFI A;  3K02 A;  2HFB A;  1MQD A;  3IJO B;  5TPA B;  4P8B A;  5TP9 B;  3ILU B;  1TFD A;  4FEC A;  4HS7 A;  5AA3 A;  2ZMB A;  2NUV A;  3FAT A;  3PUX E;  5ISU A;  1Y3P A;  3EN3 A;  1NV4 A;  4U22 A;  2VD2 A;  4O3C A;  1H76 A;  2F3B A;  2H98 A;  1DCU A;  1H45 A;  1B3L A;  1TT1 A;  4QXD A;  1FCK A;  1IMC A;  5LTC A;  1M5B A;  3T9H B;  3QIM A;  3TCG A;  4F3S A;  2LAO A;  4YIC A;  1NNF A;  1RYO A;  2BJJ X;  4F3G A;  1EYK A;  1ZJL A;  4LZ5 A;  3SZP A;  1NKX A;  4F3P A;  2XHD A;  4H46 A;  4AS4 A;  2UVG A;  5ICQ A;  5K2Y A;  5AA2 B;  1NUZ A;  3UIF A;  2R9J A;  4PC9 A;  1JET A;  2XWV A;  3P7I A;  3IOW A;  4IO5 A;  4GX4 A;  3HCQ A;  3VLV A;  3PPN A;  5AA1 A;  3IOT A;  3LSX A;  4X9T A;  4KYE A;  3PUV E;  1MS7 A;  2XXP A;  1BKA A;  5FTI A;  1G0I A;  2KLF A;  2QMX A;  2HXR A;  5DYH A;  3C34 A;  2F5X A;  1CE2 A;  2H5Y A;  3AXF A;  2DWJ A;  4NWD A;  3A3C A;  3IL1 B;  5KZT A;  5ICT A;  3OO8 A;  5FHN A;  5JK4 A;  2O1M A;  2HAU A;  3CHG A;  2GHA A;  5EYH A;  3UK4 A;  3KBZ A;  1MY0 A;  3OO6 A;  3G3H A;  4DCX A;  2Q8J A;  3THI A;  1VFE A;  5A5X B;  3KG2 A;  3RGY A;  1SI0 A;  3O2A A;  2Z8E A;  4UAB A;  3PUY E;  4IO4 A;  3IAZ A;  3ZKL A;  4MBP A;  2HPG A;  5DVF A;  2JJK A;  2XXR A;  2PCR A;  1I69 A;  3KSJ A;  1NV0 A;  2QVR A;  4RYA A;  1Y1Z A;  3M8U A;  1B0H A;  4XIG Q;  3HHF A;  1HSJ A;  4AB5 A;  4NF6 B;  5H8H A;  2F6P A;  5CRY A;  3CFX A;  4GWU A;  3H3G A;  2YJP A;  4OVJ A;  1PC3 A;  4N81 A;  4MCO A;  3PUZ E;  1FTL A;  4U4S A;  1LBC A;  3IB2 A;  4ISU A;  5IZ3 A;  3TOD A;  3O9P A;  4IB2 A;  2HHM A;  3LSF B;  3FXQ A;  3KOT A;  3T9U A;  4NN3 A;  2FBP A;  3I3V A;  1NV2 A;  3TAJ A;  2MKZ A;  2H99 A;  4BLA A;  4GL0 A;  1B3E A;  1BLF A;  1JVY A;  4MLQ A;  4OZ9 A;  3IO6 A;  4DDD A;  4GWX A;  3KN3 A;  4PF6 A;  1P1W A;  3MP6 A;  1EYI A;  1ZIU A;  4TQU Q;  1MXU A;  2NXO A;  4XKN A;  2FIX A;  4XKR A;  5ET8 A;  1H3D A;  1H43 A;  4P3L A;  4JVD A;  4YKJ A;  1JP4 A;  4ZE8 A;  1MXW A;  1ZTY A;  4BDQ A;  4OVQ A;  4RA1 A;  1XHY A;  1Y3Q A;  1EU8 A;  4KCD A;  1QKA A;  3G7W A;  3MVY A;  4PE3 A;  4GWO A;  4IO2 A;  1R9L A;  2F35 A;  1FTK A;  2RF1 A;  3VFJ A;  1UTB A;  2REJ A;  5ELV A;  4O94 A;  4F39 A;  3OSQ A;  1YXI A;  1US5 A;  5I59 B;  2VP1 A;  1UIU A;  4LVQ A;  4ZEK A;  4DXB A;  2QS2 A;  2HAV A;  2I4B A;  1MPC A;  1VE4 A;  5CMK A;  1P1U A;  5K2X A;  2Y7P A;  4F2O A;  2FIE A;  5CBR A;  5KCJ A;  1Y1M A;  2ZXT A;  5DTB A;  4QFP A;  4PTK A;  1KWH A;  2F7C A;  4KD5 A;  3SDF A;  5ET5 A;  3MPL A;  3CG3 A;  3S9E A;  4R2F A;  1TWY A;  1XT8 A;  1RKM A;  2XA5 A;  1B9J A;  4QBA A;  3OEL A;  2HEU A;  5H8N A;  4THI A;  1JW1 A;  2AL4 A;  4DIG A;  4HE1 A;  1HSE A;  3N26 A;  5KDT A;  3MZB A;  2DE3 A;  1B2H A;  1Y3N A;  5IGA A;  4MHF A;  3CSG A;  1ZU0 A;  2F7B A;  4FOR A;  4EDP A;  1QW0 A;  1RDX A;  3IFA A;  1FQD A;  5J16 A;  4O3B A;  1ELJ A;  3G3G A;  4C1U A;  4WXJ A;  1IIT A;  3B7D A;  4NED A;  1NNK A;  2V84 A;  4H8I A;  3GLB A;  3ILT B;  2H4I A;  1LBY A;  5B70 A;  3H7M A;  3A3U A;  4UA8 A;  2DS9 A;  2XXH A;  5AA4 A;  1MXX A;  1GGG A;  1LAX A;  4NG7 A;  3TCF A;  5IZZ A;  3K2D A;  3VVF A;  5L9O A;  4ZED A;  3TDJ A;  3TZA A;  2PT1 A;  3E4R A;  4G8N A;  1J1N A;  5H8F A;  2AIX A;  3LSW A;  3LUY A;  3O6I A;  3RYD A;  5ET7 A;  1B7H A;  3TMG A;  1MH4 A;  4EQ9 A;  4Q8R A;  3TTM A;  4G2Z A;  4NE4 A;  4WKM A;  3OO7 A;  1SW1 A;  2OX3 A;  2QSX A;  4PGP A;  3HN0 A;  3VDF A;  3S9L C;  4DI4 B;  3FAS A;  2A5S A;  3BFT A;  2D21 A;  4U2R A;  4BDM A;  3N5L A;  5B7D A;  2O69 A;  3C33 A;  1PB9 A;  2Y7W A;  2G29 A;  3CSB A;  3K00 A;  5DEX A;  4MLV A;  3F11 A;  1LCF A;  3G3K A;  4P0G A;  3RPL A;  3HST A;  4I3Y A;  2KQZ A;  4TLM B;  2O51 A;  5EQ7 A;  3CR9 A;  3VLU A;  1D9Y A;  4X8R A;  2H9B A;  5I2N A;  4H45 A;  3IOU A;  3K1P A;  4OQO A;  2DWA A;  1UQW A;  4XKP A;  1B6H A;  1NUW A;  3B50 A;  1B5I A;  1NMU A;  4HE2 A;  5H8Q B;  2OZZ A; 
#chains in the Genus database with same CATH homology
 1B5H A;  4ZE9 A;  1A40 A;  4MH5 A;  3OD7 A;  4Z7E A;  3TTK A;  1XC1 A;  3N94 A;  2I58 A;  4X1D A;  3QUF A;  1R9Q A;  4ZEF A;  3A09 A;  4RY1 A;  1MXY A;  1OQG A;  3OMB A;  2OLB A;  3G3J A;  3CRB A;  2D3I A;  3CI8 A;  1SBP A;  3SES A;  2REG A;  1MPB A;  4KPT A;  1OLA A;  1PB7 A;  3QSL A;  4YKP A;  2DWI A;  1B05 A;  3JZJ A;  4ZZE A;  5M2V A;  5EHM A;  3B6Q A;  2I3V A;  4NF8 A;  5IKB A;  1QKB A;  1USY H;  4EF2 A;  5HBC A;  3L6G A;  3SER A;  3O97 A;  3O6H A;  1AH5 A;  1PB8 A;  2X7P A;  3PD9 A;  3S9M C;  3OEK A;  5I58 A;  2NVU B;  5EYF A;  3LSL A;  3QUJ A;  4IGT A;  4H0W A;  4ELR A;  2HXW A;  1AMF A;  4R6Y A;  4QSC A;  1POY 1;  2NWJ A;  4Z0I A;  3MJN A;  3MWB A;  1Q1K A;  2OK2 A;  3Q25 A;  1BIY A;  4KHZ E;  5TP9 A;  3C32 A;  1ZMG A;  4BDO A;  4N13 A;  3KZG A;  2ESN A;  1Y4C A;  3S4U A;  1B58 A;  4M4G A;  3DLN A;  1NH7 A;  4F31 B;  3MQ9 A;  4LA9 A;  3PD8 A;  3MC2 A;  3H6W A;  3QXM A;  1F9B A;  1MM7 A;  1MDQ A;  4ELQ A;  3SEW A;  1JNF A;  2PVU A;  3PMX A;  4POX A;  3FJG A;  4OEN A;  1B7U A;  2I0B A;  4GVO A;  3MZ9 A;  1NH8 A;  1USY E;  2VOZ A;  2Q2A A;  1A99 A;  3U8Q A;  3IOR A;  2QPQ A;  4U4X A;  4YKI A;  5AA2 A;  3PMW A;  4ELP A;  2XXY A;  2OBG A;  1S7Y A;  1OVB A;  2DVC A;  4ESX A;  2X7Q A;  3UOR A;  3GXA A;  4F29 A;  2ZYN A;  1SI1 A;  3JYR A;  2RCB A;  1N76 A;  3KJT A;  2Q2C A;  3UN6 A;  3CVG A;  1N0T A;  3TUS A;  1BTJ A;  4H1X A;  2GRV A;  4Q30 B;  3UP9 A;  2F6G A;  1QUI A;  1WDN A;  3VVD A;  3VXC A;  3UA8 A;  3S2V A;  1QUJ A;  2UVI A;  3TEL A;  4G68 C;  3U94 A;  3LR1 A;  2RC9 A;  3H03 A;  1XS5 A;  3O29 A;  3RN8 A;  2RIN A;  2O7U A;  4EQB A;  5JTY A;  3U93 A;  1FQA A;  3IX1 A;  2HQ0 A;  4ESW A;  4H67 A;  1JEV A;  3T9V A;  2FYI A;  4NF6 A;  2V3Q A;  1VFD A;  1IXI A;  3S9N C;  1MQI A;  4G4P A;  3FXR A;  4GQO A;  4QFK A;  2P2A A;  1ZLQ A;  3G3F A;  4OXV A;  3IOV A;  4IO6 A;  1RYX A;  2PBW A;  3OOA A;  5L9S A;  2VGQ A;  1YPN A;  1LST A;  1SDX A;  3FJ7 A;  1B4H A;  1UTH B;  1OMP A;  3DM0 A;  5CMB A;  1LAG E;  1FW0 A;  3KGC A;  3TQW A;  1FQF A;  2VHA A;  4FED A;  4F22 A;  2UYE A;  1LGB C;  1LFG A;  1P1N A;  3K4U A;  1EZP A;  4H5F A;  4LZ8 A;  1MM6 A;  3H6U A;  5FHO A;  2CMO A;  4JSD A;  2V3T A;  2ZYM A;  1LFH A;  3FXU A;  3EHT A;  3OSR A;  1LAF E;  4E0X A;  1PBQ A;  3FIR A;  1MG1 A;  4KYS A;  2ZNS A;  4EUO A;  2XXX A;  3FVK A;  3RLF E;  1A8E A;  1P1O A;  1LLS A;  4OFJ A;  2QJE A;  3FVO A;  4NF4 B;  1MY3 A;  3RT8 A;  2PYY A;  3FVN A;  4YB7 A;  2NOO A;  3CIJ A;  4G8H A;  5I59 A;  2DE4 A;  4K3F A;  4XKQ A;  4R2B A;  5FTH A;  3Q27 A;  1IXC A;  5CI5 A;  4RPN A;  3ECR A;  4ZEI A;  4H5G A;  2ALU A;  3BFU A;  3Q29 A;  2ANJ A;  3TTN A;  4R75 A;  4NMY A;  3MAM A;  3T22 A;  1L5T A;  1R6Z A;  2Z8F A;  4PFT A;  2Y84 A;  5EHS A;  3WAF A;  1H44 A;  3UGW A;  4Q0C A;  3MW0 A;  1VSO A;  1I6Q A;  1LAH E;  4OTE A;  3HHG A;  5ITP A;  2CZL A;  1DPP A;  1SW5 A;  1UTB B;  3FVG A;  3MP8 A;  4GL8 A;  2V25 A;  4PP0 A;  4OES A;  4IO3 A;  4PFW A;  3MVX A;  5L8D A;  4HW8 A;  5I57 A;  2H25 A;  5LOM A;  4PFY A;  3MVW A;  2B65 A;  5KCJ B;  3C31 A;  2V93 A;  1MPD A;  1MXZ A;  2A5T B;  5ITO A;  1SYH A;  2OWS A;  3FD3 A;  1YTV A;  1S9T A;  3MZ1 A;  3O6G A;  4AQ4 A;  2F34 A;  2QS1 A;  3H06 B;  1O63 A;  1XOC A;  3N6U A;  2XXU A;  3VXB A;  3EF7 A;  1B3G A;  3EHS A;  1D4N A;  3TEP A;  1DMB A;  4KFQ A;  1PBP A;  3KBR A;  2XX8 A;  4ONY A;  4OWD A;  4P0I A;  3EHU A;  2DP8 A;  1ZKB A;  4OET A;  4YMA A;  3OO9 A;  4FJP A;  4BDR A;  4C1T A;  4LQ5 A;  4YU0 A;  4NF5 B;  4F19 A;  3G3I A;  4QF9 A;  4ND9 A;  2I48 A;  4GLI A;  2QL3 A;  1N7X A;  4C0R A;  2XXI A;  4G77 A;  1TXF A;  3IO4 A;  1PDA A;  1FTO A;  4QSD A;  3FV2 A;  4R73 A;  3K0V A;  1N3W A;  1I6A A;  3FJM A;  2FA7 A;  5CM6 A;  3RPW A;  4ZEB A;  1Y20 A;  2RC7 A;  3JV9 A;  2E0S A;  3FV1 A;  4R72 A;  1URG A;  3RTF B;  1FTM A;  4EXL A;  5HPQ A;  3OEN A;  3KEI A;  1IUD A;  4G68 B;  2AL5 A;  5H8Q A;  3K1N A;  2YPN A;  1XVY A;  1FQC A;  4GRK A;  3RNN A;  1NNP A;  3GZG A;  4H6D A;  3V5A A;  2DVZ A;  3MBP A;  2X26 A;  2GFE A;  3O28 A;  4OFL A;  1MQH A;  4FAJ A;  3K1M A;  3FGS A;  3W9V A;  3M3K A;  5I2N B;  4JWY A;  1SYI A;  5I2K A;  1IZ1 A;  4U21 A;  4G8M A;  4XTC Q;  5AA2 D;  3KJ7 A;  3ZS6 A;  4QHQ A;  1D9V A;  1HSL A;  2Y7K A;  3V8X B;  2IA4 A;  4GOT A;  1MRP A;  3VLW A;  4JWX A;  4YAH X;  1EZ9 A;  1DPE A;  3TFL A;  3PV0 E;  4L17 A;  3EQ1 A;  4IGR A;  1MQJ A;  4KYD A;  1O7T A;  4GXA A;  4RK9 A;  3K6X A;  2ABH A;  3DP8 A;  5I56 B;  1DTG A;  1I6B A;  3W15 C;  3DEL B;  2I4C A;  4FEB A;  5JEI A;  4NF8 B;  2PMS A;  2Q89 A;  2R6G E;  1N3X A;  4LON B;  4QFO A;  5TPA A;  1IEJ A;  4RNS A;  1SW4 A;  4I1D A;  2DOJ A;  2M8C A;  1B51 A;  2QS4 A;  3H4Z A;  1MY1 A;  1MH3 A;  1VR5 A;  1M5C A;  1GR2 A;  2O84 X;  3KFM A;  3D4C A;  1B40 A;  3IB1 A;  4NTL A;  3PPR A;  3QYT A;  1B4Z A;  2ONS A;  4ZS9 A;  2WKY A;  3IB0 A;  4F3B A;  4YKK A;  2P1S A;  2HCA A;  2XXQ A;  4KCC A;  3TCH A;  4TLL B;  2OWT A;  2F78 A;  2XXV A;  1MDP 1;  4OEU A;  1T0K A;  1WOD A;  4OFO A;  2Y7R A;  4YZZ A;  2OJT A;  4DE8 A;  4YMB A;  4JB7 A;  3W9W A;  5IAI A;  3KSX A;  4N6P A;  4UAC A;  1A55 A;  4RJZ A;  4ECF A;  1B1H A;  3H6V A;  3E3K A;  2D5W A;  4M1V A;  3HO7 A;  1Z7M E;  4HCW A;  3QAX A;  3U72 A;  4OEV A;  4R74 A;  1IIW A;  3TKD A;  4DZ1 A;  4QSE A;  4GIZ A;  1ANF A;  5A5X A;  2F36 A;  1QUL A;  1IQ7 A;  4GD5 A;  3M3L A;  1N7W A;  3OXN A;  2YLN A;  1R1N A;  1OIB A;  2XX9 A;  4I9D A;  3SET A;  2Z23 A;  3WAE A;  2QS3 A;  5FHM A;  1Q35 A;  3L6H A;  3KN7 A;  3MPK A;  4NWC A;  3TTR A;  3FUZ A;  2DXY A;  2O1L A;  3MP1 A;  1UTH A;  5CMM A;  2ZYO A;  4JWO A;  3N6T A;  5JTY B;  3I6V A;  1B0L A;  3GBB A;  1P1Q A;  1NL5 A;  2W7Y A;  4XXU A;  3CG1 A;  3V83 A;  2PT2 A;  2I0C A;  3HPI A;  4AB6 A;  3LBS A;  3TYH A;  4HTG A;  1QUK A;  4WEP A;  3K6W A;  4PFU A;  1LB9 A;  2RKM A;  4EF1 A;  4IY5 A;  4PE5 B;  5H8H B;  4KQP A;  3IR1 A;  4QRZ A;  4O3A A;  3TQL A;  1EH3 A;  3SEU A;  4DCY A;  2I6E A;  2XXW A;  5CC2 A;  1GV8 A;  3RQT A;  2Z22 A;  1AIV A;  4OER A;  4DXC A;  4ZEC A;  3KN8 A;  4NF4 A;  1IXH A;  3LC8 A;  3EPE A;  3FZV A;  1FQE A;  3C4M A;  3T9X B;  3K6U A;  2GHB A;  2AYS A;  4R6H A;  1Z7N E;  2Z8D A;  3QK6 A;  4JSO A;  1LBB A;  4EXK A;  5BUU A;  1SD3 A;  2ZYK A;  3PUW E;  3C36 A;  1WVJ A;  1B1X A;  1GVC A;  1JQF A;  4H65 A;  2QRY A;  4R6K A;  1MY4 A;  1GTK A;  1II5 A;  4JBZ A;  2I3W A;  1B46 A;  5BWJ A;  4KR5 A;  1YAE A;  1QJM A;  1N84 A;  4LP2 B;  3TPA A;  4F1Y A;  4RXL A;  1M5E A;  3ZSF A;  3SEX A;  1DOT A;  2DSF A;  3PU5 A;  4R9G A;  4FE8 A;  1FTJ A;  1P99 A;  2IEE A;  4DXU A;  1M5D A;  2XXT A;  2RC8 A;  2FNC A;  3OEM A;  2Q88 A;  1LFI A;  3T66 A;  2A5T A;  4WED A;  3C35 A;  2XX7 A;  1XVX A;  3T96 B;  3U92 A;  3Q28 A;  2DYX A;  3O66 A;  1D3K A;  1NNT A;  3VVE A;  2HZL A;  5HM4 B;  4Q5T A;  4F1U A;  3DP6 A;  4JDF A;  3B6T A;  3CFL A;  1O64 A;  1US4 A;  2B3F A;  5DT6 A;  2DQV A;  4PQJ A;  4FAT A;  4ZDM A;  3VV5 A;  1BP5 A;  3B6W A;  5H8N B;  5I57 B;  5H8S A;  2UVJ A;  4LZ7 A;  1B3H A;  3RY3 A;  3VE1 B;  1ZBM A;  5KDT B;  5DVI A;  3MUQ A;  1NFT A;  3H6T A;  4TOZ A;  2E1S A;  4OMB A;  1B5J A;  2ZNT A;  4LAT A;  2O6A A;  1LCT A;  1OVT A;  4KI0 E;  1OQH A;  4NF5 A;  3TTL A;  2XD2 A;  1JW5 A;  2R71 A;  1OLC A;  4LQ2 A;  3CFZ A;  1LB8 A;  3ONM A;  5AA4 B;  2ZNU A;  3V89 B;  4BDN A;  3SEY A;  1AL3 A;  2VD3 A;  4ZZA A;  1URS A;  3ZKK A;  3D4G A;  3E13 X;  3GBA A;  2RCA A;  4P11 A;  4E0W A;  4POW A;  4RPO A;  1EZO A;  2GH9 A;  1MXV A;  3PGF A;  4PET A;  4EQ7 A;  2ONK E;  5H8F B;  4IO7 A;  3BBR A;  3C9H A;  3ODB A;  4QFL A;  4HCY A;  4U23 A;  4IY6 A;  1YCJ A;  1ATG A;  2I49 A;  4YB5 A;  4YB6 A;  4G68 A;  4U1O A;  1Y4T A;  3KOS A;  3R26 A;  5J1D A;  5L9M A;  3BKI B;  4GFR A;  4X48 A;  1IXG A;  1SQY A;  1QVS A;  4JXI A;  3RTW B;  1S50 A;  1DTZ A;  1TFA A;  5DEX B;  2V3U A;  1MQG A;  1MY2 A;  1JVX A;  5CBS A;  3PMV A;  2Y7I A;  4U1Z A;  3SKP A;  3K01 A;  1JEU A;  4R9F A;  4F2Q A;  3PPO A;  2O68 A;  3K6V A;  3R6U A;  4N07 A;  3T93 B;  4I8C A;  4MF3 A;  5I84 A;  1SW2 A;  2THI A;  5CMC A;  3R7X A;  3DP4 A;  2UVH A;  1DSN A;  3Q26 A;  3USD A;  2XD3 A;  1M5F A;  4X1B A;  5AE4 A;  3MVZ A;  2PX1 A;  2DXR A;  5I2K B;  4FIM A;  1SVX B;  3E9X A;  3U1O A;  2HZK A;  4GF8 A;  1B7Z A;  3IJX B;  4QFN A;  2O7I A;  4LUB A;  3HV1 A;  1A54 A;  5I56 A;  1URD A;  2Q9T A;  1JW4 A;  1FQB A;  1POT A;  3PPP A;  2F7A A;  5F7V A;  2DE2 A;  2OCU A;  4F1V A;  4DLD A;  1B3F A;  4RK2 A;  3IK6 B;  2G93 A;  2ONR A;  3M3F A;  4GXS B;  2B3B A;  1PEB A;  2P0S A;  2F97 A;  1B32 A;  1Y9U A;  2QMW A;  5TU0 A;  3PPQ A;  3I5O A;  1A8F A;  4I62 A;  4OYV A;  5I58 B;  4H8J A;  1N04 A;  1UIV A;  5DVJ A;  1CB6 A;  4OHN A;  2DWH A;  5F1Q A;  1B52 A;  3RT6 B;  4F18 A;  1AOV A;  1A7L A;  2F8D A;  2UYF A;  2UXA A;  3SEV A;  3RUM A;  4ELO A;  4BDL A;  4MFI A;  3K02 A;  2HFB A;  1MQD A;  3IJO B;  5TPA B;  5TP9 B;  3ILU B;  1TFD A;  4FEC A;  4HS7 A;  5AA3 A;  2ZMB A;  2NUV A;  3FAT A;  3PUX E;  5ISU A;  1Y3P A;  3EN3 A;  4U22 A;  2VD2 A;  4O3C A;  1H76 A;  2H98 A;  1H45 A;  1B3L A;  1TT1 A;  1FCK A;  1M5B A;  3T9H B;  3QIM A;  3TCG A;  4F3S A;  2LAO A;  4YIC A;  1NNF A;  1RYO A;  2BJJ X;  4F3G A;  1ZJL A;  4LZ5 A;  1NKX A;  4F3P A;  2XHD A;  2UVG A;  5ICQ A;  5K2Y A;  5AA2 B;  3UIF A;  2R9J A;  1JET A;  3P7I A;  3IOW A;  4IO5 A;  3HCQ A;  3VLV A;  3PPN A;  5AA1 A;  3IOT A;  3LSX A;  4X9T A;  4KYE A;  3PUV E;  1MS7 A;  2XXP A;  1BKA A;  5FTI A;  2KLF A;  2QMX A;  5DYH A;  3C34 A;  2F5X A;  1CE2 A;  2H5Y A;  3AXF A;  2DWJ A;  4NWD A;  3A3C A;  3IL1 B;  5KZT A;  5ICT A;  3OO8 A;  5FHN A;  5JK4 A;  2O1M A;  2HAU A;  2GHA A;  3UK4 A;  1MY0 A;  3OO6 A;  3G3H A;  4DCX A;  2Q8J A;  3THI A;  1VFE A;  5A5X B;  3KG2 A;  3RGY A;  1SI0 A;  3O2A A;  2Z8E A;  3PUY E;  4IO4 A;  3IAZ A;  3ZKL A;  4MBP A;  5DVF A;  2XXR A;  1I69 A;  3KSJ A;  4RYA A;  1Y1Z A;  3M8U A;  1B0H A;  4XIG Q;  3HHF A;  4AB5 A;  1HSJ A;  4NF6 B;  5H8H A;  2F6P A;  5CRY A;  3CFX A;  3H3G A;  2YJP A;  4OVJ A;  1PC3 A;  3PUZ E;  1FTL A;  4U4S A;  1LBC A;  3IB2 A;  4ISU A;  3TOD A;  3O9P A;  4IB2 A;  3LSF B;  3FXQ A;  3KOT A;  3T9U A;  3I3V A;  3TAJ A;  2H99 A;  4BLA A;  4GL0 A;  1B3E A;  1BLF A;  1JVY A;  4MLQ A;  4OZ9 A;  3IO6 A;  4DDD A;  3KN3 A;  1P1W A;  3MP6 A;  1ZIU A;  4TQU Q;  1MXU A;  2NXO A;  4XKN A;  4XKR A;  1H3D A;  1H43 A;  4YKJ A;  4ZE8 A;  1MXW A;  1ZTY A;  4BDQ A;  4RA1 A;  1XHY A;  1Y3Q A;  1EU8 A;  4KCD A;  1QKA A;  3G7W A;  3MVY A;  4GWO A;  4IO2 A;  1R9L A;  2F35 A;  1FTK A;  2RF1 A;  3VFJ A;  1UTB A;  2REJ A;  5ELV A;  4F39 A;  3OSQ A;  1US5 A;  5I59 B;  2VP1 A;  1UIU A;  4LVQ A;  4ZEK A;  4DXB A;  2QS2 A;  2HAV A;  2I4B A;  1MPC A;  1VE4 A;  5CMK A;  1P1U A;  5K2X A;  2Y7P A;  4F2O A;  5CBR A;  5KCJ A;  1Y1M A;  2ZXT A;  5DTB A;  4QFP A;  1KWH A;  2F7C A;  4KD5 A;  3SDF A;  3MPL A;  3CG3 A;  3S9E A;  4R2F A;  1TWY A;  1XT8 A;  1RKM A;  1B9J A;  3OEL A;  2HEU A;  5H8N A;  4THI A;  1JW1 A;  2AL4 A;  4DIG A;  1HSE A;  3N26 A;  5KDT A;  3MZB A;  2DE3 A;  1B2H A;  1Y3N A;  3CSG A;  1ZU0 A;  2F7B A;  4FOR A;  4EDP A;  1QW0 A;  1FQD A;  4O3B A;  1ELJ A;  3G3G A;  4C1U A;  4WXJ A;  1IIT A;  3B7D A;  4NED A;  1NNK A;  2V84 A;  4H8I A;  3GLB A;  3ILT B;  2H4I A;  5B70 A;  3H7M A;  3A3U A;  4UA8 A;  2DS9 A;  2XXH A;  5AA4 A;  1MXX A;  1GGG A;  1LAX A;  3TCF A;  3K2D A;  3VVF A;  5L9O A;  4ZED A;  3TDJ A;  3TZA A;  2PT1 A;  3E4R A;  4G8N A;  1J1N A;  5H8F A;  2AIX A;  3LSW A;  3LUY A;  3O6I A;  1B7H A;  3TMG A;  1MH4 A;  4EQ9 A;  4Q8R A;  3TTM A;  4G2Z A;  4NE4 A;  4WKM A;  3OO7 A;  1SW1 A;  2QSX A;  3HN0 A;  3VDF A;  3S9L C;  3FAS A;  2A5S A;  3BFT A;  2D21 A;  4U2R A;  4BDM A;  3N5L A;  5B7D A;  2O69 A;  3C33 A;  1PB9 A;  2Y7W A;  2G29 A;  3CSB A;  3K00 A;  5DEX A;  4MLV A;  3F11 A;  1LCF A;  3G3K A;  4P0G A;  3HST A;  4TLM B;  2O51 A;  3CR9 A;  3VLU A;  1D9Y A;  2H9B A;  5I2N A;  3IOU A;  3K1P A;  4OQO A;  2DWA A;  1UQW A;  4XKP A;  1B6H A;  1B5I A;  1NMU A;  5H8Q B;  2OZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...