1IXGA

Phosphate-binding protein mutant with thr 141 replaced by asp (t141d), complexed with phospate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGDSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title A low energy short hydrogen bond in very high resolution structures of protein receptor--phosphate complexes.
pubmed doi rcsb
source organism Escherichia coli
total genus 107
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1996-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ixgA02
3MZ1A 5CBRA 2XX9A 4EDPA 1ANFA 4E0WA 4P11A 2O6AA 3LBSA 5A5XA 1A7LA 4NF4A 4PETA 1MQJA 4GOTA 2H5YA 4QFPA 3K02A 1EU8A 4ESWA 3MW0A 4G68B 3ECRA 3SEUA 4LZ7A 4F31B 3FVGA 2I4CA 4XKPA 3CG3A 5TP9B 5JTYA 5AE4A 4GFRA 4OEVA 5EYFA 1QUIA 3MVZA 3U94A 2ZNTA 3PUVE 4X9TA 5AA4A 2OK2A 5AA2D 4F1UA 1BP5A 1ZMGA 3C32A 2D21A 3VE1B 3S9EA 2ZYOA 2OLBA 4LATA 1Y20A 2HEUA 4IO6A 3TELA 4FJPA 1ZLQA 3HSTA 3O9PA 4YU0A 3OSRA 3MPKA 1B0HA 5AA2A 1SW5A 3VVDA 3H06B 5CMMA 1NH7A 3L6HA 3MVYA 1OVBA 4EXLA 2Z8DA 3K4UA 3O6GA 3CR9A 3MP6A 1JNFA 3MQ9A 4KCDA 5H8NB 4IB2A 4IGRA 3PU5A 3UORA 3TZAA 4EXKA 2PT1A 4UA8A 2Y7PA 3BKIB 1ZBMA 2NXOA 1B2HA 3IR1A 4LUBA 2Z8EA 2Q2AA 2YLNA 5H8FB 3UA8A 2XXPA 4HS7A 4Q0CA 3ODBA 2GHAA 4PFUA 4ELQA 3FIRA 3KN7A 4DLDA 1PBQA 1XVXA 2O68A 2UXAA 2XXWA 1FQCA 1YPNA 1OMPA 1LB9A 1J1NA 4YB7A 3U92A 1FTLA 3KN8A 4DIGA 2QPQA 3C35A 1MXUA 2VD2A 4OHNA 3MZBA 5F1QA 1TFDA 4U22A 4U1OA 1DMBA 4N13A 2I0BA 3MC2A 3PPPA 3SDFA 1B0LA 5BUUA 3TCFA 3MP8A 5M2VA 4Z0IA 2O84X 4F29A 1AMFA 1IITA 3VXCA 1URSA 2QS4A 3FJMA 4QFNA 4WXJA 3N6UA 2VD3A 4NEDA 4HTGA 1FQDA 1MQHA 3FXQA 1NNTA 2O69A 4OXVA 3FATA 3OEKA 2O7UA 2QL3A 1SW2A 2XXXA 4R2BA 5HBCA 3TUSA 5ISUA 5H8QA 2DP8A 4RK9A 1B5HA 5EHSA 3RPWA 3EPEA 4X1BA 1JEUA 5DVFA 1B9JA 2ZYNA 2RCAA 3O6IA 3QK6A 3IOVA 2F78A 3HPIA 3MBPA 4U21A 1UTHA 3W15C 2HCAA 5CMCA 2BJJX 4MLVA 1DTZA 5KDTA 3K6UA 1N3WA 4BDMA 3H6WA 3EF7A 5I2KB 2ZYKA 3EQ1A 1NL5A 1Z7ME 1ZU0A 3ZKKA 3TKDA 3Q28A 2ZMBA 4EQ9A 3EHSA 5KZTA 4G77A 4THIA 1P1OA 1JW4A 2NWJA 2ESNA 1D4NA 2DS9A 4G8HA 4ESXA 4OTEA 1URGA 4DCXA 4NMYA 5I84A 4C1UA 4EQ7A 3RTWB 3H6VA 1MXWA 4X1DA 1LFHA 3PUWE 1LBCA 1QW0A 2OWTA 2O7IA 2ZNUA 3G3HA 5DEXB 4KYEA 1CB6A 2QJEA 5CMBA 3RUMA 2FYIA 5I57B 2UYFA 3C33A 4P0GA 3H03A 4OZ9A 1N0TA 3IB1A 1S7YA 2IA4A 1FTKA 1B3LA 1B32A 2HXWA 3MPLA 4C1TA 3N6TA 2DXYA 5I2NB 4GLIA 4JSDA 4NF8A 1OVTA 2XXRA 3OMBA 4WEDA 1T0KA 4O3CA 1ZTYA 1Q1KA 3TMGA 3PMWA 1HSJA 2XXUA 1SI0A 5ITPA 2VP1A 3FUZA 4O3BA 5L8DA 5I56A 1Y3NA 4TOZA 2OBGA 4DXUA 1UTBA 3GBAA 4R9FA 3T22A 4XTCQ 4LVQA 4QFLA 3FV1A 1OIBA 3IL1B 3EHTA 1N04A 4ZZEA 3HCQA 2O51A 3LSLA 4QRZA 4GL8A 2ALUA 2UVJA 4R75A 3C34A 3TCGA 4G8MA 4HCWA 5L9OA 4H0WA 3DP8A 2UYEA 3OELA 4FEBA 3Q26A 4ZE9A 3TODA 1EZOA 2GFEA 3ZKLA 1RYXA 3C9HA 3A3UA 3FXRA 4ZEFA 4RA1A 4QSDA 4QFKA 4EF2A 2PVUA 3H6TA 1NMUA 4JXIA 1PDAA 3PPRA 3A3CA 1D9VA 4NF6A 4H1XA 4YB5A 1IEJA 5KCJB 4DCYA 3Q27A 4OWDA 1XS5A 3U8QA 4NF5B 1ZJLA 1A55A 4OEUA 4KHZE 1MXYA 2I48A 1MH3A 1UIUA 3B6QA 1FCKA 1SI1A 1VE4A 4U1ZA 3QAXA 2DE4A 1A8EA 1LAXA 3RT8A 1N84A 4YMBA 1POY1 4LA9A 2LAOA 4PE5B 1QKBA 2F7BA 2F7AA 4KPTA 4JB7A 4H5FA 3Q25A 4KR5A 4ZEIA 4X48A 3QIMA 1XT8A 3K0VA 2V93A 4GWOA 1JQFA 1B5IA 1QULA 4RYAA 3KJ7A 1H45A 1XOCA 4JSOA 3TQWA 4PP0A 4BDOA 5FHNA 2VGQA 1MDP1 2PYYA 1JW5A 4TQUQ 1LAGE 2XHDA 3ILTB 4BLAA 4DDDA 1B1XA 2DVCA 2CZLA 2HZKA 4G68A 4KCCA 2A5TB 2R9JA 5JTYB 5CMKA 1B40A 3W9VA 1PB9A 4MH5A 1LSTA 5B70A 2W7YA 5B7DA 4U2RA 3T66A 2RF1A 3MZ9A 4FE8A 4LZ8A 1SBPA 4NWDA 1NNFA 2OWSA 1S9TA 3S2VA 5H8SA 4N07A 1UQWA 4PFTA 3OOAA 1PB7A 1N7WA 2F35A 5AA2B 1P1NA 4DXBA 3MJNA 3K1NA 2GRVA 4GF8A 3TEPA 1TT1A 3U1OA 4I8CA 1FQFA 5HM4B 1Y3QA 1B51A 3K00A 4IO3A 4P0IA 1NNPA 5AA1A 3D4GA 1R1NA 1POTA 3HHGA 3CFZA 3FVKA 4TLMB 1NFTA 2H99A 1YCJA 4GVOA 5H8NA 4PFWA 5DVIA 2AIXA 4IY6A 3KG2A 1I6QA 3N5LA 2V3TA 1EZ9A 4I9DA 3N26A 1ZKBA 2I49A 2V3UA 3BFUA 3FGSA 1MPCA 1AOVA 2FNCA 5H8FA 3LUYA 1B3HA 3JZJA 1FQAA 1B3EA 4F3BA 2QSXA 1MY4A 4OQOA 2PMSA 5JK4A 1ELJA 1I69A 3SEWA 4UACA 3I5OA 3PUZE 1OLCA 1YTVA 1DOTA 4LONB 2V25A 3LSFB 3LR1A 4ZECA 4F3PA 1R9QA 3HN0A 3TDJA 1BLFA 3PMVA 3G3FA 5CI5A 2Q8JA 3MVWA 1LFIA 5IAIA 4BDLA 5ICTA 1VR5A 1QKAA 5FHMA 2PBWA 3G3KA 2RC7A 4ECFA 1B3FA 4R6KA 4YB6A 4MBPA 3PPNA 3JYRA 3PPQA 4R72A 3SEVA 1LFGA 3FXUA 1MY3A 3IOWA 3GBBA 1GTKA 4I62A 3R6UA 5H8HB 2G29A 2ONRA 3D4CA 3QUFA 4RJZA 3WAEA 4POXA 3QUJA 4AB5A 2XXVA 3MAMA 3PPOA 5JEIA 2Y7KA 5DYHA 1EH3A 4OMBA 1JETA 1XC1A 1B3GA 2F5XA 4OETA 5KDTB 1VFEA 4F3SA 4AB6A 1LGBC 1EZPA 3TTRA 3H4ZA 3KOTA 4IY5A 1M5CA 3VVFA 2DQVA 4IO2A 1D9YA 2E1SA 4RY1A 4WEPA 3ONMA 1DTGA 2YJPA 3RQTA 1MH4A 4ELRA 3T93B 1D3KA 5L9MA 4YICA 4H5GA 3E4RA 2FA7A 2IEEA 3KGCA 4ZEBA 3OO6A 2RINA 2HQ0A 4M1VA 4U4XA 3C36A 1IZ1A 3IO6A 2M8CA 2G93A 3CIJA 1SVXB 2DWJA 3FZVA 5L9SA 4H67A 3TQLA 3IK6B 2AYSA 1O64A 4I1DA 4BDNA 2XX8A 4YKKA 3LSXA 4HCYA 3IO4A 3KSXA 5DEXA 1DSNA 2ONSA 1R9LA 5K2YA 1H43A 1TXFA 3KJTA 1VFDA 1US4A 1AIVA 1BIYA 1O7TA 1H44A 2Q89A 4MFIA 3PD9A 2Y7WA 2HAVA 1IUDA 4NF8B 1N3XA 5I2NA 4JWXA 3OXNA 3FJ7A 3T9XB 1RYOA 2I3VA 2THIA 3RNNA 4JWOA 1H3DA 3FVOA 4N6PA 3TFLA 4PQJA 5FHOA 2Y7RA 3C4MA 4G4PA 3KEIA 2XD2A 4KYSA 4AQ4A 3OO9A 4KD5A 3T96B 2REGA 5I56B 1M5DA 4XXUA 1B52A 2REJA 3B6WA 1WODA 4GRKA 1B05A 2D5WA 4H65A 3T9HB 3GLBA 2F36A 4BDQA 4LP2B 4ISUA 5LOMA 5F7VA 3QSLA 2KLFA 3N94A 1QVSA 5I59B 1TFAA 1IIWA 4F39A 1IXCA 3FJGA 4RNSA 2R71A 1MRPA 1Y1ZA 3RY3A 5AA3A 2ZXTA 4OFJA 5I58B 4FIMA 1ZIUA 1L5TA 3KOSA 4F2QA 5CC2A 2F7CA 3VDFA 3PMXA 3K6VA 5TPAA 1AH5A 2DSFA 3K6WA 1URDA 2ZYMA 2DWIA 1OQGA 2RC9A 3LC8A 3B6TA 3CSGA 2XD3A 2H25A 2I6EA 1BKAA 3PD8A 5CM6A 1B58A 3UN6A 4YKPA 2F6GA 3E9XA 3S9NC 1LCTA 1QUJA 1A99A 1YAEA 2B3BA 3V5AA 5KCJA 4ONYA 2ZNSA 4XKRA 2DE2A 3VV5A 3KZGA 4MF3A 2R6GE 2QS1A 1SW1A 4OENA 2F6PA 2WKYA 3HHFA 1H76A 1IXIA 1P1WA 3TTKA 1DPEA 1MY1A 3TTMA 2X26A 1MXXA 3MVXA 3I3VA 4YKJA 4JDFA 1MXVA 3IOTA 4F2OA 4LZ5A 5FTHA 3T9VA 1LB8A 4L17A 2QS2A 5ITOA 1CE2A 4Q5TA 2OCUA 2Q88A 3V83A 5A5XB 4NF4B 4YZZA 5K2XA 4QSCA 5BWJA 4R2FA 2HAUA 2GHBA 2OZZA 1WDNA 1MDQA 4QHQA 3HV1A 3MWBA 3CFXA 2Z8FA 1MM7A 3PGFA 3SEYA 3UIFA 2GH9A 2RC8A 1P1UA 4IGTA 4HW8A 1F9BA 1Y4TA 5TP9A 4JWYA 3FV2A 3WAFA 5AA4B 1FW0A 1OLAA 2A5TA 2B3FA 4ZE8A 2DWHA 3FASA 3IORA 1MXZA 4F19A 3RTFB 1A8FA 3H7MA 1KWHA 2UVIA 1MY0A 1Y4CA 1SD3A 4NWCA 4QFOA 2Y84A 3DLNA 5TU0A 2I0CA 3VLVA 3OENA 4G68C 4Q8RA 2XXQA 3T9UA 3CRBA 2F8DA 3IJXB 4KI0E 1SQYA 2OJTA 3TYHA 5DTBA 3L6GA 3BBRA 4OFLA 2X7QA 1VSOA 2I3WA 3KN3A 3O2AA 1HSEA 4OVJA 1FTMA 1SYIA 4NTLA 4EF1A 4JBZA 2H9BA 4RK2A 1SW4A 1NH8A 3TPAA 1MG1A 3DM0A 3V8XB 3DELB 3CG1A 3K01A 4ELPA 1II5A 4LQ5A 3IB0A 2H4IA 3JV9A 3SETA 1XVYA 3TAJA 1PC3A 2DXRA 4QF9A 4RPOA 1GGGA 3R26A 2Y7IA 1A54A 1HSLA 4ELOA 1AL3A 1I6AA 1MQIA 1NKXA 3P7IA 3S9LC 3USDA 2E0SA 5EHMA 4XKNA 2UVHA 4FAJA 4FATA 2XXHA 1B5JA 3O97A 2UVGA 5HPQA 1I6BA 4YMAA 3GZGA 4G8NA 4MLQA 3RN8A 5J1DA 1GVCA 3C31A 2Z22A 4DE8A 1MQDA 1SDXA 1Z7NE 1OQHA 3PUYE 1TWYA 2QRYA 1GR2A 4H6DA 2RKMA 1A40A 4GL0A 3K1PA 2DVZA 4LQ2A 4R9GA 1MPDA 3O28A 3H6UA 1XHYA 1PBPA 4FORA 2HZLA 2XXYA 4U23A 2RCBA 4OERA 4F1YA 4WKMA 2QMWA 3MUQA 5H8QB 2VOZA 5FTIA 3VLUA 3PUXE 4KFQA 5H8HA 4GQOA 3IAZA 2NVUB 3VVEA 1M5EA 3EN3A 2I58A 3QYTA 1B7UA 4NE4A 3AXFA 1R6ZA 3GXAA 3CSBA 3G3IA 1P99A 1UTHB 3S4UA 4GXSB 2D3IA 3OEMA 4FECA 2DOJA 4OESA 2V84A 4YAHX 5ICQA 1IXHA 3THIA 4KQPA 1B4ZA 2QMXA 3U93A 5I2KA 3UGWA 2ABHA 3S9MC 4ZDMA 4GXAA 2PT2A 3RLFE 1B4HA 5CBSA 2DE3A 4XIGQ 4EQBA 3DP4A 1MY2A 3E13X 4R74A 3RT6B 4OYVA 1LLSA 1Y9UA 3Q29A 1FTJA 3EHUA 4R73A 3SKPA 4OFOA 3OD7A 2Q2CA 1LCFA 2CMOA 3E3KA 1JVYA 3VLWA 4ND9A 1JW1A 3SERA 3H3GA 1LBBA 2DWAA 3VFJA 3SEXA 1MQGA 3K1MA 3UP9A 2YPNA 1MM6A 3FD3A 3G3JA 4KYDA 4F3GA 2Q9TA 5I57A 1JEVA 2P2AA 1B46A 2NUVA 1QUKA 4IO7A 1B7ZA 3M3FA 1LAFE 3HO7A 5DVJA 3W9WA 1US5A 1N7XA 3K2DA 1SYHA 3G3GA 3G7WA 1ATGA 1DPPA 3O29A 3QXMA 4YKIA 3MP1A 3KFMA 3V89B 2AL4A 2A5SA 3PV0E 4DZ1A 4K3FA 1Y3PA 2P0SA 2V3QA 1QJMA 1Q35A 3IB2A 3TCHA 5DT6A 3A09A 4BDRA 4DXCA 3OSQA 1UTBB 1MS7A 4QSEA 1PEBA 1M5BA 2B65A 4U4SA 4RXLA 3R7XA 2AL5A 4GD5A 2XXIA 4XKQA 3IX1A 4H8IA 3UK4A 1B1HA 1USYE 3KBRA 4GIZA 1BTJA 3O66A 2I4BA 3TTLA 4R6YA 3IOUA 3K6XA 4C0RA 3M3LA 2ONKE 2HFBA 3I6VA 4F1VA 2DYXA 2ANJA 2O1MA 1FQBA 1B7HA 1O63A 3ILUB 3U72A 5I59A 1B6HA 1S50A 1NNKA 3TTNA 2XX7A 4IO5A 4R6HA 4RPNA 4F22A 3CI8A 5CRYA 5I58A 1USYH 3RGYA 4PFYA 1Y1MA 1IXGA 2X7PA 4NF6B 2F97A 5TPAB 5ELVA 3FVNA 4O3AA 4H8JA 3DP6A 3SESA 3M8UA 4E0XA 1RKMA 2QS3A 3KSJA 3LSWA 4ZEDA 1IQ7A 4ZS9A 4NF5A 3ZS6A 4M4GA 4ZZAA 1P1QA 1UIVA 1MPBA 1LAHE 4EUOA 1M5FA 2P1SA 3O6HA 2O1LA 1WVJA 4Q30B 2NOOA 1GV8A 3BFTA 3M3KA 4ZEKA 2H98A 4Z7EA 2Z23A 3IJOB 3OO7A 4TLLB 1FQEA 1FTOA 3F11A 2PX1A 3VXBA 2VHAA 1PB8A 1JVXA 1N76A 3OO8A 3B7DA 5IKBA 3CFLA 4POWA 4IO4A 3CVGA 4F18A 3ZSFA 2XXTA 2F34A 4FEDA 4G2ZA
chains in the Genus database with same CATH superfamily
3MZ1A 5CBRA 2XX9A 4PTKA 4EDPA 1ANFA 4E0WA 4P11A 2O6AA 3LBSA 5A5XA 1A7LA 4NF4A 4PETA 4N6DA 1MQJA 4GOTA 4UABA 2HXRA 3BIHA 2H5YA 3A29A 4QFPA 3K02A 1EU8A 4ESWA 3MW0A 4G68B 3ECRA 3SEUA 4LZ7A 4F31B 3FVGA 2I4CA 4XKPA 3CG3A 5TP9B 5JTYA 5AE4A 4GFRA 4OEVA 5EYFA 1QUIA 3MVZA 3U94A 4GWSA 2ZNTA 3PUVE 4X9TA 5AA4A 2OK2A 5AA2D 4F1UA 1BP5A 1ZMGA 4MNPA 3C32A 2D21A 3VE1B 3S9EA 2ZYOA 2OLBA 4LATA 1Y20A 2HEUA 2F3DA 4IO6A 2FIXA 3TELA 4FJPA 1ZLQA 3HSTA 3O9PA 4YU0A 3OSRA 3MPKA 4H46A 1B0HA 5AA2A 1SW5A 3VVDA 4MEVA 4N4UA 3H06B 2JJKA 5CMMA 1NH7A 3L6HA 3MVYA 3NOHA 1OVBA 4EXLA 2Z8DA 3K4UA 3O6GA 3CR9A 3MP6A 5I7IA 4PDDA 1FPJA 1JNFA 3KC0A 3MQ9A 4KCDA 2QVUA 5H8NB 4IB2A 4IGRA 2Y5KA 3PU5A 3UORA 3TZAA 4N15A 4EXKA 2PT1A 4UA8A 2Y7PA 1FPIA 3BKIB 1ZBMA 1YXIA 2NXOA 1B2HA 3IR1A 4KXPA 4LUBA 2Z8EA 2Q2AA 2YLNA 4GWYA 5H8FB 3FXBA 3UA8A 2XXPA 4HS7A 4Q0CA 3ODBA 2GHAA 4PFUA 4ELQA 3FIRA 3KN7A 4DLDA 1PBQA 1XVXA 2O68A 2UXAA 2XXWA 1FQCA 1YPNA 1OMPA 1LB9A 1QGXA 1J1NA 4YB7A 3U92A 1FTLA 3KN8A 4DIGA 2QPQA 1EYJA 3C35A 1MXUA 4P1EA 2VD2A 2XXKA 4OHNA 3MZBA 5F1QA 1TFDA 4U22A 3KC1A 4U1OA 1DMBA 4N13A 2I0BA 3MC2A 3PPPA 3SDFA 2XWVA 1B0LA 1FBHA 1DK4A 2KQZA 5BUUA 4G61A 3TCFA 3MP8A 5M2VA 4PFIA 2O84X 4Z0IA 4F29A 1AMFA 1IITA 3VXCA 1URSA 2QS4A 3FJMA 4QFNA 4WXJA 3N6UA 2VD3A 4NEDA 4HTGA 4P47A 3MYUA 1FQDA 1MQHA 2BJIA 3FXQA 1NNTA 2O69A 4OXVA 3FATA 3OEKA 2O7UA 2QL3A 1SW2A 1SPIA 2XXXA 5EQAA 5LTCA 1FPDA 4R2BA 5HBCA 3TUSA 1NV3A 5ISUA 5H8QA 2DP8A 4RK9A 1B5HA 5EHSA 3RPWA 2WX9A 3EPEA 4X1BA 1JEUA 5DVFA 1B9JA 2KR0A 2ZYNA 2RCAA 3O6IA 3QK6A 3IOVA 2F78A 3HPIA 3MBPA 4MJOA 4U21A 1UTHA 3W15C 2HCAA 5CMCA 2BJJX 4MLVA 1DTZA 3MSTA 5KDTA 3K6UA 1N3WA 4BDMA 3H6WA 3EF7A 4GX4A 5I2KB 2ZYKA 3EQ1A 1NL5A 1Z7ME 1ZU0A 3ZKKA 3TKDA 3Q28A 2ZMBA 4EQ9A 3EHSA 1YYZA 4NGUA 5KZTA 1NI9A 4G77A 4THIA 1P1OA 1JW4A 2NWJA 2ESNA 1D4NA 3PTYA 4IR8A 2DS9A 1LBZA 4P9KA 2OWZA 4G8HA 4ESXA 4OTEA 1URGA 4DCXA 4NMYA 5I84A 1G0IA 2PCRA 4C1UA 4EQ7A 3RTWB 3H6VA 4XFEA 1MXWA 4X1DA 1LFHA 3PUWE 1LBCA 1QW0A 2OWTA 2O7IA 2ZNUA 5I5PA 3G3HA 5DEXB 4KYEA 1CB6A 2QJEA 5CMBA 5EYGA 3RUMA 2FYIA 5I57B 4NHBA 2UYFA 3C33A 4JVIA 3H03A 4OZ9A 4P0GA 5LDZA 1N0TA 3IB1A 1S7YA 2IA4A 1FTKA 1B3LA 1B32A 2HXWA 3MPLA 4C1TA 3N6TA 2L5VA 2DXYA 4MCOA 5I2NB 4GLIA 2CZIA 4JSDA 4NQ8A 4NF8A 1OVTA 2XXRA 3OMBA 4WEDA 1T0KA 2QFLA 4O3CA 1NUWA 4GWXA 2FBPA 1ZTYA 1Q1KA 3TMGA 3PMWA 1HSJA 2XXUA 1SI0A 3E78A 4GBVA 5ITPA 2VP1A 3FUZA 4O3BA 5IM2A 5L8DA 5I56A 3E79A 1Y3NA 4TOZA 2OBGA 2CZHA 4DXUA 1UTBA 3GBAA 4R9FA 3T22A 4XTCQ 4LVQA 4QFLA 3FV1A 1OIBA 3IL1B 3EHTA 1FPLA 1N04A 4ZZEA 3HCQA 2O51A 3LSLA 4QRZA 4GL8A 2ALUA 2UVJA 4R75A 1IMAA 3C34A 3TCGA 4G8MA 5EQ7A 4HCWA 5L9OA 4H0WA 3DP8A 2UYEA 3OELA 4FEBA 3Q26A 4ZE9A 3TODA 1EZOA 2GFEA 3ZKLA 1XI6A 1RYXA 3C9HA 3A3UA 3FXRA 4ZEFA 4RA1A 4QSDA 4QFKA 4EF2A 2PVUA 4OVTA 3H6TA 1NMUA 3GYYA 4JXIA 1PDAA 3PPRA 3A3CA 1D9VA 4NF6A 4H1XA 4PC9A 2XWOA 4OVSA 1FTAA 4YB5A 1IEJA 1VDWA 4PCDA 5KCJB 4DCYA 3Q27A 4OWDA 1XS5A 3U8QA 4NF5B 1ZJLA 1A55A 1YZ0A 4OEUA 4KHZE 1MXYA 2I48A 1MH3A 1UIUA 2B4LA 3B6QA 1FCKA 1SI1A 1VE4A 4U1ZA 3QAXA 4OVQA 5ESYA 3HFUA 2ZZXA 2DE4A 1A8EA 1LAXA 3RT8A 1N84A 4YMBA 1POY1 4LA9A 2LAOA 4PE5B 1FSAA 2GQ1A 1QKBA 2F7BA 2F7AA 4KPTA 4JB7A 4H5FA 3Q25A 5ET7A 4N91A 4MNCA 4KR5A 2WBBA 4ZEIA 4X48A 3QIMA 1XT8A 3K0VA 2V93A 4GWOA 1JQFA 1BK4A 1B5IA 1QULA 4LN5A 4RYAA 3KJ7A 1H45A 1XOCA 4JSOA 3TQWA 1CNQA 4PP0A 4BDOA 5FHNA 2VGQA 2XWIA 1MDP1 2PYYA 1JW5A 4TQUQ 1LAGE 2XHDA 3ILTB 4BLAA 4DDDA 1B1XA 2DVCA 2CZLA 2HZKA 4GWUA 4G68A 4KCCA 2A5TB 2R9JA 5JTYB 5CMKA 2XA5A 1B40A 3W9VA 1PB9A 4MH5A 1LSTA 2PFZA 5B70A 2W7YA 4MAGA 5B7DA 1RDXA 4U2RA 3T66A 2RF1A 2CEXA 3MZ9A 4FE8A 1FPBA 4LZ8A 1SBPA 4NWDA 1NNFA 2OWSA 1S9TA 4GWZA 3S2VA 5H8SA 4N07A 1UQWA 4PFTA 3OOAA 1PB7A 1N7WA 3RPLB 2HHMA 2F35A 2WBDA 5AA2B 1P1NA 4DXBA 3MJNA 3K1NA 1FBEA 2GRVA 4PFBA 4GF8A 1FPEA 3TEPA 1TT1A 1NUXA 3U1OA 4I8CA 1FQFA 5HM4B 1Y3QA 1B51A 3K00A 4IO3A 4P0IA 1NNPA 5AA1A 3IFAA 3D4GA 4GBWA 1R1NA 1POTA 3HHGA 3CFZA 3FVKA 4QBAA 4TLMB 2DDKA 1NFTA 2H99A 1YCJA 4GVOA 5H8NA 4PFWA 4PBHA 5DVIA 2AIXA 4IY6A 3KG2A 1I6QA 3N5LA 2V3TA 3CHGA 1EZ9A 4I9DA 3N26A 1ZKBA 2I49A 2V3UA 3BFUA 3FGSA 1MPCA 1AOVA 2FNCA 5H8FA 1G0HA 3LUYA 1B3HA 2ZZVA 3JZJA 1FQAA 1B3EA 4F3BA 4P1LA 2QSXA 1MY4A 4OQOA 2PMSA 5JK4A 1NV5A 1ELJA 1I69A 3SEWA 4UACA 3I5OA 3PUZE 1OLCA 1YTVA 2VPOA 1DOTA 4LONB 2V25A 3LSFB 3LR1A 4ZECA 4F3PA 1R9QA 3HN0A 3TDJA 1BLFA 3PMVA 3G3FA 1NV6A 5CI5A 2Q8JA 3MVWA 1LFIA 5IAIA 4BDLA 5ICTA 1VR5A 1QKAA 5FHMA 2PBWA 1RDZA 4O8MA 2RC7A 3G3KA 4ECFA 1B3FA 4R6KA 3B8BA 2QVRA 4YB6A 1NV0A 4MBPA 3PPNA 3JYRA 3PPQA 4R72A 5EQ9A 3SEVA 1LFGA 3FXUA 1MY3A 3IOWA 3GBBA 1GTKA 4I62A 3R6UA 5H8HB 2G29A 2ONRA 3D4CA 4PFRA 1FPKA 3QUFA 4RJZA 3WAEA 4POXA 3QUJA 4AB5A 2XXVA 3MAMA 5T3JA 3PPOA 3QMFA 5JEIA 2Y7KA 5DYHA 4PAKA 1EH3A 4OMBA 3D1RA 1JETA 1XC1A 1B3GA 2F5XA 4OETA 5KDTB 1VFEA 4F3SA 4AB6A 1LGBC 4I3YA 1EZPA 3TTRA 3H4ZA 3KOTA 4IY5A 1M5CA 3VVFA 2DQVA 1IMDA 4IO2A 1D9YA 2E1SA 4RY1A 4WEPA 5A5LA 3ONMA 1DTGA 2YJPA 3RQTA 1MH4A 4ELRA 3T93B 1LBVA 5EYHA 1D3KA 5L9MA 4YICA 4H5GA 3E4RA 2FA7A 2IEEA 2ZZWA 3KGCA 4ZEBA 3OO6A 5IZZA 2RINA 1IMCA 2HQ0A 4M1VA 4U4XA 3C36A 1IZ1A 3IO6A 2M8CA 2Q74A 2G93A 3CIJA 1SVXB 2DWJA 4NX1A 3FZVA 5L9SA 4H67A 2VT5A 3TQLA 3IK6B 2AYSA 1O64A 4I1DA 4BDNA 1FPFA 2XX8A 4YKKA 3LSXA 4HCYA 3IO4A 1FBCA 3KSXA 5DEXA 1DSNA 4N17A 2ONSA 1R9LA 5K2YA 3FBPA 1H43A 1TXFA 3KJTA 1VFDA 1US4A 1AIVA 1BIYA 1O7TA 1H44A 2Q89A 4MFIA 3PD9A 2Y7WA 2HAVA 1IUDA 4NF8B 1N3XA 5I2NA 5J16A 4PF6A 3ROJA 4JWXA 4MX6A 3OXNA 3FJ7A 3T9XB 1RYOA 2I3VA 2THIA 3RNNA 4JWOA 1H3DA 3FVOA 4N6PA 3TFLA 4PQJA 5FHOA 2Y7RA 3C4MA 4G4PA 3KEIA 2XD2A 4KYSA 4AQ4A 3OO9A 4KD5A 3T96B 2REGA 5I56B 1M5DA 4XXUA 1B52A 2REJA 2HPGA 3B6WA 1WODA 4GRKA 4H45A 1B05A 4GWWA 2D5WA 5IZ3B 4H65A 4HXVA 3T9HB 3GLBA 2F36A 4BDQA 4LP2B 2PFYA 4ISUA 1K9ZA 5LOMA 5F7VA 3QSLA 2KLFA 3N94A 1QVSA 5I59B 2MKZA 1TFAA 1IIWA 4F39A 4X04A 1IXCA 3FJGA 4RNSA 2R71A 1MRPA 1Y1ZA 3RY3A 5AA3A 2ZXTA 4OFJA 5I58B 4FIMA 1ZIUA 4O7IA 3T1BA 1L5TA 3KOSA 4F2QA 5CC2A 2F7CA 1FRPA 4MHFA 3VDFA 3PMXA 3K6VA 5TPAA 1AH5A 2DSFA 3K6WA 1URDA 2ZYMA 2DWIA 1OQGA 2RC9A 1NV2A 3LC8A 3B6TA 3CSGA 2XD3A 2H25A 2I6EA 1BKAA 3PD8A 5CM6A 1B58A 3UN6A 4YKPA 2F6GA 3E9XA 3S9NC 1LCTA 1QUJA 4PGNA 1A99A 1YAEA 2B3BA 3V5AA 5KCJA 4ONYA 2ZNSA 4XKRA 2DE2A 1EYIA 3VV5A 3KZGA 4JVDA 3ISPA 4NAPA 4MF3A 2R6GE 4GX6A 2QS1A 1SW1A 4OENA 4XEQA 2F6PA 2WKYA 3HHFA 1H76A 1IXIA 1P1WA 3TTKA 1DPEA 1MY1A 3TTMA 4MMPA 2X26A 1FJ6A 1MXXA 3MVXA 1FJ9A 3I3VA 4YKJA 4JDFA 1MXVA 3IOTA 4F2OA 4LZ5A 4I3EA 5FTHA 3T9VA 1LB8A 4L17A 4JVCA 2QS2A 4NG7A 5ITOA 1CE2A 4Q5TA 2OCUA 2Q88A 3V83A 5A5XB 4NF4B 4YZZA 5K2XA 4QSCA 2WYPA 5BWJA 4R2FA 2HAUA 2GHBA 2OZZA 1WDNA 1MDQA 4QHQA 3HV1A 3MWBA 1NV4A 3CFXA 2Z8FA 1MM7A 3PGFA 3SEYA 3UIFA 2GH9A 2RC8A 1P1UA 1KA0A 4PAFA 4IGTA 4HW8A 1F9BA 1Y4TA 5TP9A 4JWYA 3FV2A 3WAFA 5AA4B 1FW0A 1OLAA 1IMBA 2FHYA 3KBZA 2A5TA 2B3FA 4ZE8A 2DWHA 3FASA 3IORA 2XWKA 3IFCA 1MXZA 4F19A 2F3BA 3RTFB 1RDYA 1FBPA 1NV7A 1A8FA 3H7MA 1KWHA 2UVIA 1MY0A 1Y4CA 1SD3A 1D9QA 4NWCA 4QFOA 3B50A 2Y84A 3DLNA 4OANA 3LUZA 5TU0A 2I0CA 3VLVA 3OENA 4G68C 4HE0A 4Q8RA 2XXQA 1NV1A 3T9UA 3EKIA 3CRBA 2F8DA 3IJXB 4KI0E 1SQYA 2OJTA 3RPLA 1FBDA 3TYHA 4HE2A 5DTBA 3L6GA 3BBRA 4OFLA 5IGAA 2X7QA 1VSOA 2I3WA 3KN3A 3O2AA 1HSEA 4OVJA 1FTMA 1SYIA 4NTLA 4EF1A 4JBZA 4PAIA 2H9BA 4RK2A 1SW4A 1NH8A 5ET6A 3TPAA 1MG1A 3DM0A 3V8XB 3DELB 3CG1A 3K01A 4ELPA 1II5A 4LQ5A 3IB0A 2H4IA 3JV9A 1KA1A 3SETA 1XVYA 4FBPA 3TAJA 4O7MA 1PC3A 2DXRA 4QF9A 4RPOA 4NF0A 1GGGA 3R26A 5IZ1A 4OA4A 2Y7IA 1A54A 1HSLA 4ELOA 1AL3A 1I6AA 1MQIA 1NKXA 3P7IA 3S9LC 4GX3A 3USDA 2E0SA 5EHMA 4XKNA 2UVHA 4FAJA 3LV0A 4FATA 2XXHA 1B5JA 3O97A 2UVGA 5HPQA 1I6BA 4YMAA 3GZGA 4G8NA 4X8RA 4MLQA 1DBZA 2FIEA 3RN8A 4AS5A 5J1DA 1GVCA 3C31A 2WEFA 2Z22A 4DE8A 1MQDA 5ET5A 1LBYA 1SDXA 1Z7NE 1OQHA 3PUYE 1TWYA 2QRYA 4PGPA 1GR2A 4H6DA 4N6KA 2RKMA 1A40A 4GL0A 3K1PA 2DVZA 4LQ2A 4PDHA 4R9GA 1DCUA 1MPDA 3O28A 3H6UA 1XHYA 1PBPA 4FORA 2HZLA 2B4MA 2XXYA 1FBGA 4U23A 2RCBA 4OERA 4F1YA 4WKMA 2QMWA 3MUQA 5H8QB 2VOZA 5FTIA 3VLUA 3PUXE 4KFQA 5H8HA 4GQOA 3IAZA 2NVUB 3T0JA 3VVEA 1M5EA 3EN3A 4PE3A 1INPA 2I58A 3QYTA 4P3LA 1B7UA 4NE4A 3AXFA 1R6ZA 3GXAA 2QVVA 3CSBA 3G3IA 1P99A 1UTHB 3S4UA 4GXSB 4OVRA 1FBFA 2D3IA 3OEMA 4FECA 2DOJA 4OESA 2V84A 4YAHX 5ICQA 1IXHA 3THIA 4MIJA 4KQPA 1B4ZA 2QMXA 3U93A 5I2KA 3UGWA 2ABHA 3S9MC 4ZDMA 4GXAA 4N81A 2PT2A 3RLFE 5EQ8A 1B4HA 5CBSA 2DE3A 4XIGQ 4EQBA 1EYKA 4P8BA 3DP4A 1MY2A 3E13X 4R74A 3RT6B 5F24A 4OYVA 1LLSA 1Y9UA 3Q29A 1FTJA 3EHUA 4R73A 3SKPA 4OFOA 3OD7A 1NUZA 2Q2CA 1LCFA 2CMOA 3E3KA 4DI3D 1JVYA 3VLWA 4ND9A 1JW1A 3SERA 3H3GA 4QXDA 1LBBA 2DWAA 4HE1A 3VFJA 3SEXA 4PBQA 1MQGA 3K1MA 3UP9A 1Q9DA 2YPNA 4I40A 1IMFA 1MM6A 3FD3A 3G3JA 4KYDA 4F3GA 2Q9TA 5I57A 3U65A 5DW8A 1JEVA 2P2AA 1B46A 2NUVA 1QUKA 4IO7A 1B7ZA 3M3FA 1LAFE 3HO7A 2CZKA 5DVJA 3W9WA 1US5A 1N7XA 3K2DA 1SYHA 4PF8A 3G3GA 3G7WA 1ATGA 4N8YA 1DPPA 3O29A 3QXMA 1K9YA 4YKIA 3MP1A 3KFMA 3V89B 2AL4A 2A5SA 3PV0E 4DZ1A 4K3FA 1Y3PA 2P0SA 4MNIA 4NN3A 2V3QA 1QJMA 1Q35A 3IB2A 3TCHA 5DT6A 3A09A 4BDRA 1JP4A 4P56A 4DXCA 2V4CA 3OSQA 1UTBB 1MS7A 4QSEA 1PEBA 1LEVA 4DI4B 1M5BA 2B65A 4U4SA 4RXLA 3R7XA 2AL5A 4GD5A 1AWBA 2XXIA 4XKQA 3IX1A 4H8IA 3UK4A 1B1HA 1USYE 3KBRA 4GIZA 1BTJA 3O66A 2I4BA 5IZ3A 3TTLA 4R6YA 3IOUA 3K6XA 4C0RA 3M3LA 2R8TA 2ONKE 2HFBA 3I6VA 4XF5A 3BIGA 1LBWA 4F1VA 2OX3A 2DYXA 2ANJA 2VPNA 2O1MA 1FQBA 1B7HA 1NUYA 1O63A 3ILUB 3U72A 1KZ8A 5I59A 1B6HA 1S50A 1NNKA 3TTNA 2XX7A 4IO5A 1FPGA 4R6HA 4RPNA 1IMEA 4F22A 3CI8A 5CRYA 5I58A 1USYH 2Y5LA 3RGYA 4PFYA 5FBPA 1Y1MA 3SZPA 1IXGA 2X7PA 4NF6B 2F97A 4OVPA 5TPAB 5ELVA 3FVNA 4O3AA 4H8JA 3DP6A 3SESA 3M8UA 4E0XA 2CEYA 1RKMA 5ET8A 2QS3A 3KSJA 3LSWA 2FVZA 4ZEDA 1IQ7A 4ZS9A 3RYDA 4NF5A 3ZS6A 4M4GA 4N8GA 4ZZAA 1P1QA 1LBXA 1UIVA 1MPBA 1LAHE 4EUOA 1M5FA 2P1SA 3O6HA 2O1LA 1WVJA 4Q30B 2NOOA 1GV8A 3BFTA 3M3KA 4ZEKA 2H98A 4Z7EA 2Z23A 3IJOB 3OO7A 4TLLB 1FQEA 4O94A 1FTOA 2P3NA 2P3VA 2Q8MA 3F11A 5I3SA 2PX1A 3VXBA 2VHAA 1PB8A 2WYKA 1JVXA 1N76A 4AS4A 3OO8A 3B7DA 5IKBA 3CFLA 4POWA 4IO4A 3CVGA 4F18A 3ZSFA 2XXTA 2F34A 4FEDA 4G2ZA
chains in the Genus database with same CATH topology
3MZ1A 5CBRA 2XX9A 4EDPA 1ANFA 4E0WA 4P11A 2O6AA 3LBSA 5A5XA 1A7LA 4NF4A 4PETA 1MQJA 4GOTA 2H5YA 4QFPA 3K02A 1EU8A 4ESWA 3MW0A 4G68B 3ECRA 3SEUA 4LZ7A 4F31B 3FVGA 2I4CA 4XKPA 3CG3A 5TP9B 5JTYA 5AE4A 4GFRA 4OEVA 5EYFA 1QUIA 3MVZA 3U94A 2ZNTA 3PUVE 4X9TA 5AA4A 2OK2A 5AA2D 4F1UA 1BP5A 1ZMGA 3C32A 2D21A 3VE1B 3S9EA 2ZYOA 2OLBA 4LATA 1Y20A 2HEUA 4IO6A 3TELA 4FJPA 1ZLQA 3HSTA 3O9PA 4YU0A 3OSRA 3MPKA 1B0HA 5AA2A 1SW5A 3VVDA 3H06B 5CMMA 1NH7A 3L6HA 3MVYA 1OVBA 4EXLA 2Z8DA 3K4UA 3O6GA 3CR9A 3MP6A 1JNFA 3MQ9A 4KCDA 5H8NB 4IB2A 4IGRA 3PU5A 3UORA 3TZAA 4EXKA 2PT1A 4UA8A 2Y7PA 3BKIB 1ZBMA 2NXOA 1B2HA 3IR1A 4LUBA 2Z8EA 2Q2AA 2YLNA 5H8FB 3UA8A 2XXPA 4HS7A 4Q0CA 3ODBA 2GHAA 4PFUA 4ELQA 3FIRA 3KN7A 4DLDA 1PBQA 1XVXA 2O68A 2UXAA 2XXWA 1FQCA 1YPNA 1OMPA 1LB9A 1J1NA 4YB7A 3U92A 1FTLA 3KN8A 4DIGA 2QPQA 3C35A 1MXUA 2VD2A 4OHNA 3MZBA 5F1QA 1TFDA 4U22A 4U1OA 1DMBA 4N13A 2I0BA 3MC2A 3PPPA 3SDFA 1B0LA 5BUUA 3TCFA 3MP8A 5M2VA 4Z0IA 2O84X 4F29A 1AMFA 1IITA 3VXCA 1URSA 2QS4A 3FJMA 4QFNA 4WXJA 3N6UA 2VD3A 4NEDA 4HTGA 1FQDA 1MQHA 3FXQA 1NNTA 2O69A 4OXVA 3FATA 3OEKA 2O7UA 2QL3A 1SW2A 2XXXA 4R2BA 5HBCA 3TUSA 5ISUA 5H8QA 2DP8A 4RK9A 1B5HA 5EHSA 3RPWA 3EPEA 4X1BA 1JEUA 5DVFA 1B9JA 2ZYNA 2RCAA 3O6IA 3QK6A 3IOVA 2F78A 3HPIA 3MBPA 4U21A 1UTHA 3W15C 2HCAA 5CMCA 2BJJX 4MLVA 1DTZA 5KDTA 3K6UA 1N3WA 4BDMA 3H6WA 3EF7A 5I2KB 2ZYKA 3EQ1A 1NL5A 1Z7ME 1ZU0A 3ZKKA 3TKDA 3Q28A 2ZMBA 4EQ9A 3EHSA 5KZTA 4G77A 4THIA 1P1OA 1JW4A 2NWJA 2ESNA 1D4NA 2DS9A 4G8HA 4ESXA 4OTEA 1URGA 4DCXA 4NMYA 5I84A 4C1UA 4EQ7A 3RTWB 3H6VA 1MXWA 4X1DA 1LFHA 3PUWE 1LBCA 1QW0A 2OWTA 2O7IA 2ZNUA 3G3HA 5DEXB 4KYEA 1CB6A 2QJEA 5CMBA 3RUMA 2FYIA 5I57B 2UYFA 3C33A 4P0GA 3H03A 4OZ9A 1N0TA 3IB1A 1S7YA 2IA4A 1FTKA 1B3LA 1B32A 2HXWA 3MPLA 4C1TA 3N6TA 2DXYA 5I2NB 4GLIA 4JSDA 4NF8A 1OVTA 2XXRA 3OMBA 4WEDA 1T0KA 4O3CA 1ZTYA 1Q1KA 3TMGA 3PMWA 1HSJA 2XXUA 1SI0A 5ITPA 2VP1A 3FUZA 4O3BA 5L8DA 5I56A 1Y3NA 4TOZA 2OBGA 4DXUA 1UTBA 3GBAA 4R9FA 3T22A 4XTCQ 4LVQA 4QFLA 3FV1A 1OIBA 3IL1B 3EHTA 1N04A 4ZZEA 3HCQA 2O51A 3LSLA 4QRZA 4GL8A 2ALUA 2UVJA 4R75A 3C34A 3TCGA 4G8MA 4HCWA 5L9OA 4H0WA 3DP8A 2UYEA 3OELA 4FEBA 3Q26A 4ZE9A 3TODA 1EZOA 2GFEA 3ZKLA 1RYXA 3C9HA 3A3UA 3FXRA 4ZEFA 4RA1A 4QSDA 4QFKA 4EF2A 2PVUA 3H6TA 1NMUA 4JXIA 1PDAA 3PPRA 3A3CA 1D9VA 4NF6A 4H1XA 4YB5A 1IEJA 5KCJB 4DCYA 3Q27A 4OWDA 1XS5A 3U8QA 4NF5B 1ZJLA 1A55A 4OEUA 4KHZE 1MXYA 2I48A 1MH3A 1UIUA 3B6QA 1FCKA 1SI1A 1VE4A 4U1ZA 3QAXA 2DE4A 1A8EA 1LAXA 3RT8A 1N84A 4YMBA 1POY1 4LA9A 2LAOA 4PE5B 1QKBA 2F7BA 2F7AA 4KPTA 4JB7A 4H5FA 3Q25A 4KR5A 4ZEIA 4X48A 3QIMA 1XT8A 3K0VA 2V93A 4GWOA 1JQFA 1B5IA 1QULA 4RYAA 3KJ7A 1H45A 1XOCA 4JSOA 3TQWA 4PP0A 4BDOA 5FHNA 2VGQA 1MDP1 2PYYA 1JW5A 4TQUQ 1LAGE 2XHDA 3ILTB 4BLAA 4DDDA 1B1XA 2DVCA 2CZLA 2HZKA 4G68A 4KCCA 2A5TB 2R9JA 5JTYB 5CMKA 1B40A 3W9VA 1PB9A 4MH5A 1LSTA 5B70A 2W7YA 5B7DA 4U2RA 3T66A 2RF1A 3MZ9A 4FE8A 4LZ8A 1SBPA 4NWDA 1NNFA 2OWSA 1S9TA 3S2VA 5H8SA 4N07A 1UQWA 4PFTA 3OOAA 1PB7A 1N7WA 2F35A 5AA2B 1P1NA 4DXBA 3MJNA 3K1NA 2GRVA 4GF8A 3TEPA 1TT1A 3U1OA 4I8CA 1FQFA 5HM4B 1Y3QA 1B51A 3K00A 4IO3A 4P0IA 1NNPA 5AA1A 3D4GA 1R1NA 1POTA 3HHGA 3CFZA 3FVKA 4TLMB 1NFTA 2H99A 1YCJA 4GVOA 5H8NA 4PFWA 5DVIA 2AIXA 4IY6A 3KG2A 1I6QA 3N5LA 2V3TA 1EZ9A 4I9DA 3N26A 1ZKBA 2I49A 2V3UA 3BFUA 3FGSA 1MPCA 1AOVA 2FNCA 5H8FA 3LUYA 1B3HA 3JZJA 1FQAA 1B3EA 4F3BA 2QSXA 1MY4A 4OQOA 2PMSA 5JK4A 1ELJA 1I69A 3SEWA 4UACA 3I5OA 3PUZE 1OLCA 1YTVA 1DOTA 4LONB 2V25A 3LSFB 3LR1A 4ZECA 4F3PA 1R9QA 3HN0A 3TDJA 1BLFA 3PMVA 3G3FA 5CI5A 2Q8JA 3MVWA 1LFIA 5IAIA 4BDLA 5ICTA 1VR5A 1QKAA 5FHMA 2PBWA 3G3KA 2RC7A 4ECFA 1B3FA 4R6KA 4YB6A 4MBPA 3PPNA 3JYRA 3PPQA 4R72A 3SEVA 1LFGA 3FXUA 1MY3A 3IOWA 3GBBA 1GTKA 4I62A 3R6UA 5H8HB 2G29A 2ONRA 3D4CA 3QUFA 4RJZA 3WAEA 4POXA 3QUJA 4AB5A 2XXVA 3MAMA 3PPOA 5JEIA 2Y7KA 5DYHA 1EH3A 4OMBA 1JETA 1XC1A 1B3GA 2F5XA 4OETA 5KDTB 1VFEA 4F3SA 4AB6A 1LGBC 1EZPA 3TTRA 3H4ZA 3KOTA 4IY5A 1M5CA 3VVFA 2DQVA 4IO2A 1D9YA 2E1SA 4RY1A 4WEPA 3ONMA 1DTGA 2YJPA 3RQTA 1MH4A 4ELRA 3T93B 1D3KA 5L9MA 4YICA 4H5GA 3E4RA 2FA7A 2IEEA 3KGCA 4ZEBA 3OO6A 2RINA 2HQ0A 4M1VA 4U4XA 3C36A 1IZ1A 3IO6A 2M8CA 2G93A 3CIJA 1SVXB 2DWJA 3FZVA 5L9SA 4H67A 3TQLA 3IK6B 2AYSA 1O64A 4I1DA 4BDNA 2XX8A 4YKKA 3LSXA 4HCYA 3IO4A 3KSXA 5DEXA 1DSNA 2ONSA 1R9LA 5K2YA 1H43A 1TXFA 3KJTA 1VFDA 1US4A 1AIVA 1BIYA 1O7TA 1H44A 2Q89A 4MFIA 3PD9A 2Y7WA 2HAVA 1IUDA 4NF8B 1N3XA 5I2NA 4JWXA 3OXNA 3FJ7A 3T9XB 1RYOA 2I3VA 2THIA 3RNNA 4JWOA 1H3DA 3FVOA 4N6PA 3TFLA 4PQJA 5FHOA 2Y7RA 3C4MA 4G4PA 3KEIA 2XD2A 4KYSA 4AQ4A 3OO9A 4KD5A 3T96B 2REGA 5I56B 1M5DA 4XXUA 1B52A 2REJA 3B6WA 1WODA 4GRKA 1B05A 2D5WA 4H65A 3T9HB 3GLBA 2F36A 4BDQA 4LP2B 4ISUA 5LOMA 5F7VA 3QSLA 2KLFA 3N94A 1QVSA 5I59B 1TFAA 1IIWA 4F39A 1IXCA 3FJGA 4RNSA 2R71A 1MRPA 1Y1ZA 3RY3A 5AA3A 2ZXTA 4OFJA 5I58B 4FIMA 1ZIUA 1L5TA 3KOSA 4F2QA 5CC2A 2F7CA 3VDFA 3PMXA 3K6VA 5TPAA 1AH5A 2DSFA 3K6WA 1URDA 2ZYMA 2DWIA 1OQGA 2RC9A 3LC8A 3B6TA 3CSGA 2XD3A 2H25A 2I6EA 1BKAA 3PD8A 5CM6A 1B58A 3UN6A 4YKPA 2F6GA 3E9XA 3S9NC 1LCTA 1QUJA 1A99A 1YAEA 2B3BA 3V5AA 5KCJA 4ONYA 2ZNSA 4XKRA 2DE2A 3VV5A 3KZGA 4MF3A 2R6GE 2QS1A 1SW1A 4OENA 2F6PA 2WKYA 3HHFA 1H76A 1IXIA 1P1WA 3TTKA 1DPEA 1MY1A 3TTMA 2X26A 1MXXA 3MVXA 3I3VA 4YKJA 4JDFA 1MXVA 3IOTA 4F2OA 4LZ5A 5FTHA 3T9VA 1LB8A 4L17A 2QS2A 5ITOA 1CE2A 4Q5TA 2OCUA 2Q88A 3V83A 5A5XB 4NF4B 4YZZA 5K2XA 4QSCA 5BWJA 4R2FA 2HAUA 2GHBA 2OZZA 1WDNA 1MDQA 4QHQA 3HV1A 3MWBA 3CFXA 2Z8FA 1MM7A 3PGFA 3SEYA 3UIFA 2GH9A 2RC8A 1P1UA 4IGTA 4HW8A 1F9BA 1Y4TA 5TP9A 4JWYA 3FV2A 3WAFA 5AA4B 1FW0A 1OLAA 2A5TA 2B3FA 4ZE8A 2DWHA 3FASA 3IORA 1MXZA 4F19A 3RTFB 1A8FA 3H7MA 1KWHA 2UVIA 1MY0A 1Y4CA 1SD3A 4NWCA 4QFOA 2Y84A 3DLNA 5TU0A 2I0CA 3VLVA 3OENA 4G68C 4Q8RA 2XXQA 3T9UA 3CRBA 2F8DA 3IJXB 4KI0E 1SQYA 2OJTA 3TYHA 5DTBA 3L6GA 3BBRA 4OFLA 2X7QA 1VSOA 2I3WA 3KN3A 3O2AA 1HSEA 4OVJA 1FTMA 1SYIA 4NTLA 4EF1A 4JBZA 2H9BA 4RK2A 1SW4A 1NH8A 3TPAA 1MG1A 3DM0A 3V8XB 3DELB 3CG1A 3K01A 4ELPA 1II5A 4LQ5A 3IB0A 2H4IA 3JV9A 3SETA 1XVYA 3TAJA 1PC3A 2DXRA 4QF9A 4RPOA 1GGGA 3R26A 2Y7IA 1A54A 1HSLA 4ELOA 1AL3A 1I6AA 1MQIA 1NKXA 3P7IA 3S9LC 3USDA 2E0SA 5EHMA 4XKNA 2UVHA 4FAJA 4FATA 2XXHA 1B5JA 3O97A 2UVGA 5HPQA 1I6BA 4YMAA 3GZGA 4G8NA 4MLQA 3RN8A 5J1DA 1GVCA 3C31A 2Z22A 4DE8A 1MQDA 1SDXA 1Z7NE 1OQHA 3PUYE 1TWYA 2QRYA 1GR2A 4H6DA 2RKMA 1A40A 4GL0A 3K1PA 2DVZA 4LQ2A 4R9GA 1MPDA 3O28A 3H6UA 1XHYA 1PBPA 4FORA 2HZLA 2XXYA 4U23A 2RCBA 4OERA 4F1YA 4WKMA 2QMWA 3MUQA 5H8QB 2VOZA 5FTIA 3VLUA 3PUXE 4KFQA 5H8HA 4GQOA 3IAZA 2NVUB 3VVEA 1M5EA 3EN3A 2I58A 3QYTA 1B7UA 4NE4A 3AXFA 1R6ZA 3GXAA 3CSBA 3G3IA 1P99A 1UTHB 3S4UA 4GXSB 2D3IA 3OEMA 4FECA 2DOJA 4OESA 2V84A 4YAHX 5ICQA 1IXHA 3THIA 4KQPA 1B4ZA 2QMXA 3U93A 5I2KA 3UGWA 2ABHA 3S9MC 4ZDMA 4GXAA 2PT2A 3RLFE 1B4HA 5CBSA 2DE3A 4XIGQ 4EQBA 3DP4A 1MY2A 3E13X 4R74A 3RT6B 4OYVA 1LLSA 1Y9UA 3Q29A 1FTJA 3EHUA 4R73A 3SKPA 4OFOA 3OD7A 2Q2CA 1LCFA 2CMOA 3E3KA 1JVYA 3VLWA 4ND9A 1JW1A 3SERA 3H3GA 1LBBA 2DWAA 3VFJA 3SEXA 1MQGA 3K1MA 3UP9A 2YPNA 1MM6A 3FD3A 3G3JA 4KYDA 4F3GA 2Q9TA 5I57A 1JEVA 2P2AA 1B46A 2NUVA 1QUKA 4IO7A 1B7ZA 3M3FA 1LAFE 3HO7A 5DVJA 3W9WA 1US5A 1N7XA 3K2DA 1SYHA 3G3GA 3G7WA 1ATGA 1DPPA 3O29A 3QXMA 4YKIA 3MP1A 3KFMA 3V89B 2AL4A 2A5SA 3PV0E 4DZ1A 4K3FA 1Y3PA 2P0SA 2V3QA 1QJMA 1Q35A 3IB2A 3TCHA 5DT6A 3A09A 4BDRA 4DXCA 3OSQA 1UTBB 1MS7A 4QSEA 1PEBA 1M5BA 2B65A 4U4SA 4RXLA 3R7XA 2AL5A 4GD5A 2XXIA 4XKQA 3IX1A 4H8IA 3UK4A 1B1HA 1USYE 3KBRA 4GIZA 1BTJA 3O66A 2I4BA 3TTLA 4R6YA 3IOUA 3K6XA 4C0RA 3M3LA 2ONKE 2HFBA 3I6VA 4F1VA 2DYXA 2ANJA 2O1MA 1FQBA 1B7HA 1O63A 3ILUB 3U72A 5I59A 1B6HA 1S50A 1NNKA 3TTNA 2XX7A 4IO5A 4R6HA 4RPNA 4F22A 3CI8A 5CRYA 5I58A 1USYH 3RGYA 4PFYA 1Y1MA 1IXGA 2X7PA 4NF6B 2F97A 5TPAB 5ELVA 3FVNA 4O3AA 4H8JA 3DP6A 3SESA 3M8UA 4E0XA 1RKMA 2QS3A 3KSJA 3LSWA 4ZEDA 1IQ7A 4ZS9A 4NF5A 3ZS6A 4M4GA 4ZZAA 1P1QA 1UIVA 1MPBA 1LAHE 4EUOA 1M5FA 2P1SA 3O6HA 2O1LA 1WVJA 4Q30B 2NOOA 1GV8A 3BFTA 3M3KA 4ZEKA 2H98A 4Z7EA 2Z23A 3IJOB 3OO7A 4TLLB 1FQEA 1FTOA 3F11A 2PX1A 3VXBA 2VHAA 1PB8A 1JVXA 1N76A 3OO8A 3B7DA 5IKBA 3CFLA 4POWA 4IO4A 3CVGA 4F18A 3ZSFA 2XXTA 2F34A 4FEDA 4G2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ1 A;  5CBR A;  2XX9 A;  4EDP A;  1ANF A;  4E0W A;  4P11 A;  2O6A A;  3LBS A;  5A5X A;  1A7L A;  4NF4 A;  4PET A;  1MQJ A;  4GOT A;  2H5Y A;  4QFP A;  3K02 A;  1EU8 A;  4ESW A;  3MW0 A;  4G68 B;  3ECR A;  3SEU A;  4LZ7 A;  4F31 B;  3FVG A;  2I4C A;  4XKP A;  3CG3 A;  5TP9 B;  5JTY A;  5AE4 A;  4GFR A;  4OEV A;  5EYF A;  1QUI A;  3MVZ A;  3U94 A;  2ZNT A;  3PUV E;  4X9T A;  5AA4 A;  2OK2 A;  5AA2 D;  4F1U A;  1BP5 A;  1ZMG A;  3C32 A;  2D21 A;  3VE1 B;  3S9E A;  2ZYO A;  2OLB A;  4LAT A;  1Y20 A;  2HEU A;  4IO6 A;  3TEL A;  4FJP A;  1ZLQ A;  3HST A;  3O9P A;  4YU0 A;  3OSR A;  3MPK A;  1B0H A;  5AA2 A;  1SW5 A;  3VVD A;  3H06 B;  5CMM A;  1NH7 A;  3L6H A;  3MVY A;  1OVB A;  4EXL A;  2Z8D A;  3K4U A;  3O6G A;  3CR9 A;  3MP6 A;  1JNF A;  3MQ9 A;  4KCD A;  5H8N B;  4IB2 A;  4IGR A;  3PU5 A;  3UOR A;  3TZA A;  4EXK A;  2PT1 A;  4UA8 A;  2Y7P A;  3BKI B;  1ZBM A;  2NXO A;  1B2H A;  3IR1 A;  4LUB A;  2Z8E A;  2Q2A A;  2YLN A;  5H8F B;  3UA8 A;  2XXP A;  4HS7 A;  4Q0C A;  3ODB A;  2GHA A;  4PFU A;  4ELQ A;  3FIR A;  3KN7 A;  4DLD A;  1PBQ A;  1XVX A;  2O68 A;  2UXA A;  2XXW A;  1FQC A;  1YPN A;  1OMP A;  1LB9 A;  1J1N A;  4YB7 A;  3U92 A;  1FTL A;  3KN8 A;  4DIG A;  2QPQ A;  3C35 A;  1MXU A;  2VD2 A;  4OHN A;  3MZB A;  5F1Q A;  1TFD A;  4U22 A;  4U1O A;  1DMB A;  4N13 A;  2I0B A;  3MC2 A;  3PPP A;  3SDF A;  1B0L A;  5BUU A;  3TCF A;  3MP8 A;  5M2V A;  4Z0I A;  2O84 X;  4F29 A;  1AMF A;  1IIT A;  3VXC A;  1URS A;  2QS4 A;  3FJM A;  4QFN A;  4WXJ A;  3N6U A;  2VD3 A;  4NED A;  4HTG A;  1FQD A;  1MQH A;  3FXQ A;  1NNT A;  2O69 A;  4OXV A;  3FAT A;  3OEK A;  2O7U A;  2QL3 A;  1SW2 A;  2XXX A;  4R2B A;  5HBC A;  3TUS A;  5ISU A;  5H8Q A;  2DP8 A;  4RK9 A;  1B5H A;  5EHS A;  3RPW A;  3EPE A;  4X1B A;  1JEU A;  5DVF A;  1B9J A;  2ZYN A;  2RCA A;  3O6I A;  3QK6 A;  3IOV A;  2F78 A;  3HPI A;  3MBP A;  4U21 A;  1UTH A;  3W15 C;  2HCA A;  5CMC A;  2BJJ X;  4MLV A;  1DTZ A;  5KDT A;  3K6U A;  1N3W A;  4BDM A;  3H6W A;  3EF7 A;  5I2K B;  2ZYK A;  3EQ1 A;  1NL5 A;  1Z7M E;  1ZU0 A;  3ZKK A;  3TKD A;  3Q28 A;  2ZMB A;  4EQ9 A;  3EHS A;  5KZT A;  4G77 A;  4THI A;  1P1O A;  1JW4 A;  2NWJ A;  2ESN A;  1D4N A;  2DS9 A;  4G8H A;  4ESX A;  4OTE A;  1URG A;  4DCX A;  4NMY A;  5I84 A;  4C1U A;  4EQ7 A;  3RTW B;  3H6V A;  1MXW A;  4X1D A;  1LFH A;  3PUW E;  1LBC A;  1QW0 A;  2OWT A;  2O7I A;  2ZNU A;  3G3H A;  5DEX B;  4KYE A;  1CB6 A;  2QJE A;  5CMB A;  3RUM A;  2FYI A;  5I57 B;  2UYF A;  3C33 A;  4P0G A;  3H03 A;  4OZ9 A;  1N0T A;  3IB1 A;  1S7Y A;  2IA4 A;  1FTK A;  1B3L A;  1B32 A;  2HXW A;  3MPL A;  4C1T A;  3N6T A;  2DXY A;  5I2N B;  4GLI A;  4JSD A;  4NF8 A;  1OVT A;  2XXR A;  3OMB A;  4WED A;  1T0K A;  4O3C A;  1ZTY A;  1Q1K A;  3TMG A;  3PMW A;  1HSJ A;  2XXU A;  1SI0 A;  5ITP A;  2VP1 A;  3FUZ A;  4O3B A;  5L8D A;  5I56 A;  1Y3N A;  4TOZ A;  2OBG A;  4DXU A;  1UTB A;  3GBA A;  4R9F A;  3T22 A;  4XTC Q;  4LVQ A;  4QFL A;  3FV1 A;  1OIB A;  3IL1 B;  3EHT A;  1N04 A;  4ZZE A;  3HCQ A;  2O51 A;  3LSL A;  4QRZ A;  4GL8 A;  2ALU A;  2UVJ A;  4R75 A;  3C34 A;  3TCG A;  4G8M A;  4HCW A;  5L9O A;  4H0W A;  3DP8 A;  2UYE A;  3OEL A;  4FEB A;  3Q26 A;  4ZE9 A;  3TOD A;  1EZO A;  2GFE A;  3ZKL A;  1RYX A;  3C9H A;  3A3U A;  3FXR A;  4ZEF A;  4RA1 A;  4QSD A;  4QFK A;  4EF2 A;  2PVU A;  3H6T A;  1NMU A;  4JXI A;  1PDA A;  3PPR A;  3A3C A;  1D9V A;  4NF6 A;  4H1X A;  4YB5 A;  1IEJ A;  5KCJ B;  4DCY A;  3Q27 A;  4OWD A;  1XS5 A;  3U8Q A;  4NF5 B;  1ZJL A;  1A55 A;  4OEU A;  4KHZ E;  1MXY A;  2I48 A;  1MH3 A;  1UIU A;  3B6Q A;  1FCK A;  1SI1 A;  1VE4 A;  4U1Z A;  3QAX A;  2DE4 A;  1A8E A;  1LAX A;  3RT8 A;  1N84 A;  4YMB A;  1POY 1;  4LA9 A;  2LAO A;  4PE5 B;  1QKB A;  2F7B A;  2F7A A;  4KPT A;  4JB7 A;  4H5F A;  3Q25 A;  4KR5 A;  4ZEI A;  4X48 A;  3QIM A;  1XT8 A;  3K0V A;  2V93 A;  4GWO A;  1JQF A;  1B5I A;  1QUL A;  4RYA A;  3KJ7 A;  1H45 A;  1XOC A;  4JSO A;  3TQW A;  4PP0 A;  4BDO A;  5FHN A;  2VGQ A;  1MDP 1;  2PYY A;  1JW5 A;  4TQU Q;  1LAG E;  2XHD A;  3ILT B;  4BLA A;  4DDD A;  1B1X A;  2DVC A;  2CZL A;  2HZK A;  4G68 A;  4KCC A;  2A5T B;  2R9J A;  5JTY B;  5CMK A;  1B40 A;  3W9V A;  1PB9 A;  4MH5 A;  1LST A;  5B70 A;  2W7Y A;  5B7D A;  4U2R A;  3T66 A;  2RF1 A;  3MZ9 A;  4FE8 A;  4LZ8 A;  1SBP A;  4NWD A;  1NNF A;  2OWS A;  1S9T A;  3S2V A;  5H8S A;  4N07 A;  1UQW A;  4PFT A;  3OOA A;  1PB7 A;  1N7W A;  2F35 A;  5AA2 B;  1P1N A;  4DXB A;  3MJN A;  3K1N A;  2GRV A;  4GF8 A;  3TEP A;  1TT1 A;  3U1O A;  4I8C A;  1FQF A;  5HM4 B;  1Y3Q A;  1B51 A;  3K00 A;  4IO3 A;  4P0I A;  1NNP A;  5AA1 A;  3D4G A;  1R1N A;  1POT A;  3HHG A;  3CFZ A;  3FVK A;  4TLM B;  1NFT A;  2H99 A;  1YCJ A;  4GVO A;  5H8N A;  4PFW A;  5DVI A;  2AIX A;  4IY6 A;  3KG2 A;  1I6Q A;  3N5L A;  2V3T A;  1EZ9 A;  4I9D A;  3N26 A;  1ZKB A;  2I49 A;  2V3U A;  3BFU A;  3FGS A;  1MPC A;  1AOV A;  2FNC A;  5H8F A;  3LUY A;  1B3H A;  3JZJ A;  1FQA A;  1B3E A;  4F3B A;  2QSX A;  1MY4 A;  4OQO A;  2PMS A;  5JK4 A;  1ELJ A;  1I69 A;  3SEW A;  4UAC A;  3I5O A;  3PUZ E;  1OLC A;  1YTV A;  1DOT A;  4LON B;  2V25 A;  3LSF B;  3LR1 A;  4ZEC A;  4F3P A;  1R9Q A;  3HN0 A;  3TDJ A;  1BLF A;  3PMV A;  3G3F A;  5CI5 A;  2Q8J A;  3MVW A;  1LFI A;  5IAI A;  4BDL A;  5ICT A;  1VR5 A;  1QKA A;  5FHM A;  2PBW A;  3G3K A;  2RC7 A;  4ECF A;  1B3F A;  4R6K A;  4YB6 A;  4MBP A;  3PPN A;  3JYR A;  3PPQ A;  4R72 A;  3SEV A;  1LFG A;  3FXU A;  1MY3 A;  3IOW A;  3GBB A;  1GTK A;  4I62 A;  3R6U A;  5H8H B;  2G29 A;  2ONR A;  3D4C A;  3QUF A;  4RJZ A;  3WAE A;  4POX A;  3QUJ A;  4AB5 A;  2XXV A;  3MAM A;  3PPO A;  5JEI A;  2Y7K A;  5DYH A;  1EH3 A;  4OMB A;  1JET A;  1XC1 A;  1B3G A;  2F5X A;  4OET A;  5KDT B;  1VFE A;  4F3S A;  4AB6 A;  1LGB C;  1EZP A;  3TTR A;  3H4Z A;  3KOT A;  4IY5 A;  1M5C A;  3VVF A;  2DQV A;  4IO2 A;  1D9Y A;  2E1S A;  4RY1 A;  4WEP A;  3ONM A;  1DTG A;  2YJP A;  3RQT A;  1MH4 A;  4ELR A;  3T93 B;  1D3K A;  5L9M A;  4YIC A;  4H5G A;  3E4R A;  2FA7 A;  2IEE A;  3KGC A;  4ZEB A;  3OO6 A;  2RIN A;  2HQ0 A;  4M1V A;  4U4X A;  3C36 A;  1IZ1 A;  3IO6 A;  2M8C A;  2G93 A;  3CIJ A;  1SVX B;  2DWJ A;  3FZV A;  5L9S A;  4H67 A;  3TQL A;  3IK6 B;  2AYS A;  1O64 A;  4I1D A;  4BDN A;  2XX8 A;  4YKK A;  3LSX A;  4HCY A;  3IO4 A;  3KSX A;  5DEX A;  1DSN A;  2ONS A;  1R9L A;  5K2Y A;  1H43 A;  1TXF A;  3KJT A;  1VFD A;  1US4 A;  1AIV A;  1BIY A;  1O7T A;  1H44 A;  2Q89 A;  4MFI A;  3PD9 A;  2Y7W A;  2HAV A;  1IUD A;  4NF8 B;  1N3X A;  5I2N A;  4JWX A;  3OXN A;  3FJ7 A;  3T9X B;  1RYO A;  2I3V A;  2THI A;  3RNN A;  4JWO A;  1H3D A;  3FVO A;  4N6P A;  3TFL A;  4PQJ A;  5FHO A;  2Y7R A;  3C4M A;  4G4P A;  3KEI A;  2XD2 A;  4KYS A;  4AQ4 A;  3OO9 A;  4KD5 A;  3T96 B;  2REG A;  5I56 B;  1M5D A;  4XXU A;  1B52 A;  2REJ A;  3B6W A;  1WOD A;  4GRK A;  1B05 A;  2D5W A;  4H65 A;  3T9H B;  3GLB A;  2F36 A;  4BDQ A;  4LP2 B;  4ISU A;  5LOM A;  5F7V A;  3QSL A;  2KLF A;  3N94 A;  1QVS A;  5I59 B;  1TFA A;  1IIW A;  4F39 A;  1IXC A;  3FJG A;  4RNS A;  2R71 A;  1MRP A;  1Y1Z A;  3RY3 A;  5AA3 A;  2ZXT A;  4OFJ A;  5I58 B;  4FIM A;  1ZIU A;  1L5T A;  3KOS A;  4F2Q A;  5CC2 A;  2F7C A;  3VDF A;  3PMX A;  3K6V A;  5TPA A;  1AH5 A;  2DSF A;  3K6W A;  1URD A;  2ZYM A;  2DWI A;  1OQG A;  2RC9 A;  3LC8 A;  3B6T A;  3CSG A;  2XD3 A;  2H25 A;  2I6E A;  1BKA A;  3PD8 A;  5CM6 A;  1B58 A;  3UN6 A;  4YKP A;  2F6G A;  3E9X A;  3S9N C;  1LCT A;  1QUJ A;  1A99 A;  1YAE A;  2B3B A;  3V5A A;  5KCJ A;  4ONY A;  2ZNS A;  4XKR A;  2DE2 A;  3VV5 A;  3KZG A;  4MF3 A;  2R6G E;  2QS1 A;  1SW1 A;  4OEN A;  2F6P A;  2WKY A;  3HHF A;  1H76 A;  1IXI A;  1P1W A;  3TTK A;  1DPE A;  1MY1 A;  3TTM A;  2X26 A;  1MXX A;  3MVX A;  3I3V A;  4YKJ A;  4JDF A;  1MXV A;  3IOT A;  4F2O A;  4LZ5 A;  5FTH A;  3T9V A;  1LB8 A;  4L17 A;  2QS2 A;  5ITO A;  1CE2 A;  4Q5T A;  2OCU A;  2Q88 A;  3V83 A;  5A5X B;  4NF4 B;  4YZZ A;  5K2X A;  4QSC A;  5BWJ A;  4R2F A;  2HAU A;  2GHB A;  2OZZ A;  1WDN A;  1MDQ A;  4QHQ A;  3HV1 A;  3MWB A;  3CFX A;  2Z8F A;  1MM7 A;  3PGF A;  3SEY A;  3UIF A;  2GH9 A;  2RC8 A;  1P1U A;  4IGT A;  4HW8 A;  1F9B A;  1Y4T A;  5TP9 A;  4JWY A;  3FV2 A;  3WAF A;  5AA4 B;  1FW0 A;  1OLA A;  2A5T A;  2B3F A;  4ZE8 A;  2DWH A;  3FAS A;  3IOR A;  1MXZ A;  4F19 A;  3RTF B;  1A8F A;  3H7M A;  1KWH A;  2UVI A;  1MY0 A;  1Y4C A;  1SD3 A;  4NWC A;  4QFO A;  2Y84 A;  3DLN A;  5TU0 A;  2I0C A;  3VLV A;  3OEN A;  4G68 C;  4Q8R A;  2XXQ A;  3T9U A;  3CRB A;  2F8D A;  3IJX B;  4KI0 E;  1SQY A;  2OJT A;  3TYH A;  5DTB A;  3L6G A;  3BBR A;  4OFL A;  2X7Q A;  1VSO A;  2I3W A;  3KN3 A;  3O2A A;  1HSE A;  4OVJ A;  1FTM A;  1SYI A;  4NTL A;  4EF1 A;  4JBZ A;  2H9B A;  4RK2 A;  1SW4 A;  1NH8 A;  3TPA A;  1MG1 A;  3DM0 A;  3V8X B;  3DEL B;  3CG1 A;  3K01 A;  4ELP A;  1II5 A;  4LQ5 A;  3IB0 A;  2H4I A;  3JV9 A;  3SET A;  1XVY A;  3TAJ A;  1PC3 A;  2DXR A;  4QF9 A;  4RPO A;  1GGG A;  3R26 A;  2Y7I A;  1A54 A;  1HSL A;  4ELO A;  1AL3 A;  1I6A A;  1MQI A;  1NKX A;  3P7I A;  3S9L C;  3USD A;  2E0S A;  5EHM A;  4XKN A;  2UVH A;  4FAJ A;  4FAT A;  2XXH A;  1B5J A;  3O97 A;  2UVG A;  5HPQ A;  1I6B A;  4YMA A;  3GZG A;  4G8N A;  4MLQ A;  3RN8 A;  5J1D A;  1GVC A;  3C31 A;  2Z22 A;  4DE8 A;  1MQD A;  1SDX A;  1Z7N E;  1OQH A;  3PUY E;  1TWY A;  2QRY A;  1GR2 A;  4H6D A;  2RKM A;  1A40 A;  4GL0 A;  3K1P A;  2DVZ A;  4LQ2 A;  4R9G A;  1MPD A;  3O28 A;  3H6U A;  1XHY A;  1PBP A;  4FOR A;  2HZL A;  2XXY A;  4U23 A;  2RCB A;  4OER A;  4F1Y A;  4WKM A;  2QMW A;  3MUQ A;  5H8Q B;  2VOZ A;  5FTI A;  3VLU A;  3PUX E;  4KFQ A;  5H8H A;  4GQO A;  3IAZ A;  2NVU B;  3VVE A;  1M5E A;  3EN3 A;  2I58 A;  3QYT A;  1B7U A;  4NE4 A;  3AXF A;  1R6Z A;  3GXA A;  3CSB A;  3G3I A;  1P99 A;  1UTH B;  3S4U A;  4GXS B;  2D3I A;  3OEM A;  4FEC A;  2DOJ A;  4OES A;  2V84 A;  4YAH X;  5ICQ A;  1IXH A;  3THI A;  4KQP A;  1B4Z A;  2QMX A;  3U93 A;  5I2K A;  3UGW A;  2ABH A;  3S9M C;  4ZDM A;  4GXA A;  2PT2 A;  3RLF E;  1B4H A;  5CBS A;  2DE3 A;  4XIG Q;  4EQB A;  3DP4 A;  1MY2 A;  3E13 X;  4R74 A;  3RT6 B;  4OYV A;  1LLS A;  1Y9U A;  3Q29 A;  1FTJ A;  3EHU A;  4R73 A;  3SKP A;  4OFO A;  3OD7 A;  2Q2C A;  1LCF A;  2CMO A;  3E3K A;  1JVY A;  3VLW A;  4ND9 A;  1JW1 A;  3SER A;  3H3G A;  1LBB A;  2DWA A;  3VFJ A;  3SEX A;  1MQG A;  3K1M A;  3UP9 A;  2YPN A;  1MM6 A;  3FD3 A;  3G3J A;  4KYD A;  4F3G A;  2Q9T A;  5I57 A;  1JEV A;  2P2A A;  1B46 A;  2NUV A;  1QUK A;  4IO7 A;  1B7Z A;  3M3F A;  1LAF E;  3HO7 A;  5DVJ A;  3W9W A;  1US5 A;  1N7X A;  3K2D A;  1SYH A;  3G3G A;  3G7W A;  1ATG A;  1DPP A;  3O29 A;  3QXM A;  4YKI A;  3MP1 A;  3KFM A;  3V89 B;  2AL4 A;  2A5S A;  3PV0 E;  4DZ1 A;  4K3F A;  1Y3P A;  2P0S A;  2V3Q A;  1QJM A;  1Q35 A;  3IB2 A;  3TCH A;  5DT6 A;  3A09 A;  4BDR A;  4DXC A;  3OSQ A;  1UTB B;  1MS7 A;  4QSE A;  1PEB A;  1M5B A;  2B65 A;  4U4S A;  4RXL A;  3R7X A;  2AL5 A;  4GD5 A;  2XXI A;  4XKQ A;  3IX1 A;  4H8I A;  3UK4 A;  1B1H A;  1USY E;  3KBR A;  4GIZ A;  1BTJ A;  3O66 A;  2I4B A;  3TTL A;  4R6Y A;  3IOU A;  3K6X A;  4C0R A;  3M3L A;  2ONK E;  2HFB A;  3I6V A;  4F1V A;  2DYX A;  2ANJ A;  2O1M A;  1FQB A;  1B7H A;  1O63 A;  3ILU B;  3U72 A;  5I59 A;  1B6H A;  1S50 A;  1NNK A;  3TTN A;  2XX7 A;  4IO5 A;  4R6H A;  4RPN A;  4F22 A;  3CI8 A;  5CRY A;  5I58 A;  1USY H;  3RGY A;  4PFY A;  1Y1M A;  1IXG A;  2X7P A;  4NF6 B;  2F97 A;  5TPA B;  5ELV A;  3FVN A;  4O3A A;  4H8J A;  3DP6 A;  3SES A;  3M8U A;  4E0X A;  1RKM A;  2QS3 A;  3KSJ A;  3LSW A;  4ZED A;  1IQ7 A;  4ZS9 A;  4NF5 A;  3ZS6 A;  4M4G A;  4ZZA A;  1P1Q A;  1UIV A;  1MPB A;  1LAH E;  4EUO A;  1M5F A;  2P1S A;  3O6H A;  2O1L A;  1WVJ A;  4Q30 B;  2NOO A;  1GV8 A;  3BFT A;  3M3K A;  4ZEK A;  2H98 A;  4Z7E A;  2Z23 A;  3IJO B;  3OO7 A;  4TLL B;  1FQE A;  1FTO A;  3F11 A;  2PX1 A;  3VXB A;  2VHA A;  1PB8 A;  1JVX A;  1N76 A;  3OO8 A;  3B7D A;  5IKB A;  3CFL A;  4POW A;  4IO4 A;  3CVG A;  4F18 A;  3ZSF A;  2XXT A;  2F34 A;  4FED A;  4G2Z A; 
#chains in the Genus database with same CATH topology
 3MZ1 A;  5CBR A;  2XX9 A;  4PTK A;  4EDP A;  1ANF A;  4E0W A;  4P11 A;  2O6A A;  3LBS A;  5A5X A;  1A7L A;  4NF4 A;  4PET A;  4N6D A;  1MQJ A;  4GOT A;  4UAB A;  2HXR A;  3BIH A;  2H5Y A;  3A29 A;  4QFP A;  3K02 A;  1EU8 A;  4ESW A;  3MW0 A;  4G68 B;  3ECR A;  3SEU A;  4LZ7 A;  4F31 B;  3FVG A;  2I4C A;  4XKP A;  3CG3 A;  5TP9 B;  5JTY A;  5AE4 A;  4GFR A;  4OEV A;  5EYF A;  1QUI A;  3MVZ A;  3U94 A;  4GWS A;  2ZNT A;  3PUV E;  4X9T A;  5AA4 A;  2OK2 A;  5AA2 D;  4F1U A;  1BP5 A;  1ZMG A;  4MNP A;  3C32 A;  2D21 A;  3VE1 B;  3S9E A;  2ZYO A;  2OLB A;  4LAT A;  1Y20 A;  2HEU A;  2F3D A;  4IO6 A;  2FIX A;  3TEL A;  4FJP A;  1ZLQ A;  3HST A;  3O9P A;  4YU0 A;  3OSR A;  3MPK A;  4H46 A;  1B0H A;  5AA2 A;  1SW5 A;  3VVD A;  4MEV A;  4N4U A;  3H06 B;  2JJK A;  5CMM A;  1NH7 A;  3L6H A;  3MVY A;  3NOH A;  1OVB A;  4EXL A;  2Z8D A;  3K4U A;  3O6G A;  3CR9 A;  3MP6 A;  5I7I A;  4PDD A;  1FPJ A;  1JNF A;  3KC0 A;  3MQ9 A;  4KCD A;  2QVU A;  5H8N B;  4IB2 A;  4IGR A;  2Y5K A;  3PU5 A;  3UOR A;  3TZA A;  4N15 A;  4EXK A;  2PT1 A;  4UA8 A;  2Y7P A;  1FPI A;  3BKI B;  1ZBM A;  1YXI A;  2NXO A;  1B2H A;  3IR1 A;  4KXP A;  4LUB A;  2Z8E A;  2Q2A A;  2YLN A;  4GWY A;  5H8F B;  3FXB A;  3UA8 A;  2XXP A;  4HS7 A;  4Q0C A;  3ODB A;  2GHA A;  4PFU A;  4ELQ A;  3FIR A;  3KN7 A;  4DLD A;  1PBQ A;  1XVX A;  2O68 A;  2UXA A;  2XXW A;  1FQC A;  1YPN A;  1OMP A;  1LB9 A;  1QGX A;  1J1N A;  4YB7 A;  3U92 A;  1FTL A;  3KN8 A;  4DIG A;  2QPQ A;  1EYJ A;  3C35 A;  1MXU A;  4P1E A;  2VD2 A;  2XXK A;  4OHN A;  3MZB A;  5F1Q A;  1TFD A;  4U22 A;  3KC1 A;  4U1O A;  1DMB A;  4N13 A;  2I0B A;  3MC2 A;  3PPP A;  3SDF A;  2XWV A;  1B0L A;  1FBH A;  1DK4 A;  2KQZ A;  5BUU A;  4G61 A;  3TCF A;  3MP8 A;  5M2V A;  4PFI A;  2O84 X;  4Z0I A;  4F29 A;  1AMF A;  1IIT A;  3VXC A;  1URS A;  2QS4 A;  3FJM A;  4QFN A;  4WXJ A;  3N6U A;  2VD3 A;  4NED A;  4HTG A;  4P47 A;  3MYU A;  1FQD A;  1MQH A;  2BJI A;  3FXQ A;  1NNT A;  2O69 A;  4OXV A;  3FAT A;  3OEK A;  2O7U A;  2QL3 A;  1SW2 A;  1SPI A;  2XXX A;  5EQA A;  5LTC A;  1FPD A;  4R2B A;  5HBC A;  3TUS A;  1NV3 A;  5ISU A;  5H8Q A;  2DP8 A;  4RK9 A;  1B5H A;  5EHS A;  3RPW A;  2WX9 A;  3EPE A;  4X1B A;  1JEU A;  5DVF A;  1B9J A;  2KR0 A;  2ZYN A;  2RCA A;  3O6I A;  3QK6 A;  3IOV A;  2F78 A;  3HPI A;  3MBP A;  4MJO A;  4U21 A;  1UTH A;  3W15 C;  2HCA A;  5CMC A;  2BJJ X;  4MLV A;  1DTZ A;  3MST A;  5KDT A;  3K6U A;  1N3W A;  4BDM A;  3H6W A;  3EF7 A;  4GX4 A;  5I2K B;  2ZYK A;  3EQ1 A;  1NL5 A;  1Z7M E;  1ZU0 A;  3ZKK A;  3TKD A;  3Q28 A;  2ZMB A;  4EQ9 A;  3EHS A;  1YYZ A;  4NGU A;  5KZT A;  1NI9 A;  4G77 A;  4THI A;  1P1O A;  1JW4 A;  2NWJ A;  2ESN A;  1D4N A;  3PTY A;  4IR8 A;  2DS9 A;  1LBZ A;  4P9K A;  2OWZ A;  4G8H A;  4ESX A;  4OTE A;  1URG A;  4DCX A;  4NMY A;  5I84 A;  1G0I A;  2PCR A;  4C1U A;  4EQ7 A;  3RTW B;  3H6V A;  4XFE A;  1MXW A;  4X1D A;  1LFH A;  3PUW E;  1LBC A;  1QW0 A;  2OWT A;  2O7I A;  2ZNU A;  5I5P A;  3G3H A;  5DEX B;  4KYE A;  1CB6 A;  2QJE A;  5CMB A;  5EYG A;  3RUM A;  2FYI A;  5I57 B;  4NHB A;  2UYF A;  3C33 A;  4JVI A;  3H03 A;  4OZ9 A;  4P0G A;  5LDZ A;  1N0T A;  3IB1 A;  1S7Y A;  2IA4 A;  1FTK A;  1B3L A;  1B32 A;  2HXW A;  3MPL A;  4C1T A;  3N6T A;  2L5V A;  2DXY A;  4MCO A;  5I2N B;  4GLI A;  2CZI A;  4JSD A;  4NQ8 A;  4NF8 A;  1OVT A;  2XXR A;  3OMB A;  4WED A;  1T0K A;  2QFL A;  4O3C A;  1NUW A;  4GWX A;  2FBP A;  1ZTY A;  1Q1K A;  3TMG A;  3PMW A;  1HSJ A;  2XXU A;  1SI0 A;  3E78 A;  4GBV A;  5ITP A;  2VP1 A;  3FUZ A;  4O3B A;  5IM2 A;  5L8D A;  5I56 A;  3E79 A;  1Y3N A;  4TOZ A;  2OBG A;  2CZH A;  4DXU A;  1UTB A;  3GBA A;  4R9F A;  3T22 A;  4XTC Q;  4LVQ A;  4QFL A;  3FV1 A;  1OIB A;  3IL1 B;  3EHT A;  1FPL A;  1N04 A;  4ZZE A;  3HCQ A;  2O51 A;  3LSL A;  4QRZ A;  4GL8 A;  2ALU A;  2UVJ A;  4R75 A;  1IMA A;  3C34 A;  3TCG A;  4G8M A;  5EQ7 A;  4HCW A;  5L9O A;  4H0W A;  3DP8 A;  2UYE A;  3OEL A;  4FEB A;  3Q26 A;  4ZE9 A;  3TOD A;  1EZO A;  2GFE A;  3ZKL A;  1XI6 A;  1RYX A;  3C9H A;  3A3U A;  3FXR A;  4ZEF A;  4RA1 A;  4QSD A;  4QFK A;  4EF2 A;  2PVU A;  4OVT A;  3H6T A;  1NMU A;  3GYY A;  4JXI A;  1PDA A;  3PPR A;  3A3C A;  1D9V A;  4NF6 A;  4H1X A;  4PC9 A;  2XWO A;  4OVS A;  1FTA A;  4YB5 A;  1IEJ A;  1VDW A;  4PCD A;  5KCJ B;  4DCY A;  3Q27 A;  4OWD A;  1XS5 A;  3U8Q A;  4NF5 B;  1ZJL A;  1A55 A;  1YZ0 A;  4OEU A;  4KHZ E;  1MXY A;  2I48 A;  1MH3 A;  1UIU A;  2B4L A;  3B6Q A;  1FCK A;  1SI1 A;  1VE4 A;  4U1Z A;  3QAX A;  4OVQ A;  5ESY A;  3HFU A;  2ZZX A;  2DE4 A;  1A8E A;  1LAX A;  3RT8 A;  1N84 A;  4YMB A;  1POY 1;  4LA9 A;  2LAO A;  4PE5 B;  1FSA A;  2GQ1 A;  1QKB A;  2F7B A;  2F7A A;  4KPT A;  4JB7 A;  4H5F A;  3Q25 A;  5ET7 A;  4N91 A;  4MNC A;  4KR5 A;  2WBB A;  4ZEI A;  4X48 A;  3QIM A;  1XT8 A;  3K0V A;  2V93 A;  4GWO A;  1JQF A;  1BK4 A;  1B5I A;  1QUL A;  4LN5 A;  4RYA A;  3KJ7 A;  1H45 A;  1XOC A;  4JSO A;  3TQW A;  1CNQ A;  4PP0 A;  4BDO A;  5FHN A;  2VGQ A;  2XWI A;  1MDP 1;  2PYY A;  1JW5 A;  4TQU Q;  1LAG E;  2XHD A;  3ILT B;  4BLA A;  4DDD A;  1B1X A;  2DVC A;  2CZL A;  2HZK A;  4GWU A;  4G68 A;  4KCC A;  2A5T B;  2R9J A;  5JTY B;  5CMK A;  2XA5 A;  1B40 A;  3W9V A;  1PB9 A;  4MH5 A;  1LST A;  2PFZ A;  5B70 A;  2W7Y A;  4MAG A;  5B7D A;  1RDX A;  4U2R A;  3T66 A;  2RF1 A;  2CEX A;  3MZ9 A;  4FE8 A;  1FPB A;  4LZ8 A;  1SBP A;  4NWD A;  1NNF A;  2OWS A;  1S9T A;  4GWZ A;  3S2V A;  5H8S A;  4N07 A;  1UQW A;  4PFT A;  3OOA A;  1PB7 A;  1N7W A;  3RPL B;  2HHM A;  2F35 A;  2WBD A;  5AA2 B;  1P1N A;  4DXB A;  3MJN A;  3K1N A;  1FBE A;  2GRV A;  4PFB A;  4GF8 A;  1FPE A;  3TEP A;  1TT1 A;  1NUX A;  3U1O A;  4I8C A;  1FQF A;  5HM4 B;  1Y3Q A;  1B51 A;  3K00 A;  4IO3 A;  4P0I A;  1NNP A;  5AA1 A;  3IFA A;  3D4G A;  4GBW A;  1R1N A;  1POT A;  3HHG A;  3CFZ A;  3FVK A;  4QBA A;  4TLM B;  2DDK A;  1NFT A;  2H99 A;  1YCJ A;  4GVO A;  5H8N A;  4PFW A;  4PBH A;  5DVI A;  2AIX A;  4IY6 A;  3KG2 A;  1I6Q A;  3N5L A;  2V3T A;  3CHG A;  1EZ9 A;  4I9D A;  3N26 A;  1ZKB A;  2I49 A;  2V3U A;  3BFU A;  3FGS A;  1MPC A;  1AOV A;  2FNC A;  5H8F A;  1G0H A;  3LUY A;  1B3H A;  2ZZV A;  3JZJ A;  1FQA A;  1B3E A;  4F3B A;  4P1L A;  2QSX A;  1MY4 A;  4OQO A;  2PMS A;  5JK4 A;  1NV5 A;  1ELJ A;  1I69 A;  3SEW A;  4UAC A;  3I5O A;  3PUZ E;  1OLC A;  1YTV A;  2VPO A;  1DOT A;  4LON B;  2V25 A;  3LSF B;  3LR1 A;  4ZEC A;  4F3P A;  1R9Q A;  3HN0 A;  3TDJ A;  1BLF A;  3PMV A;  3G3F A;  1NV6 A;  5CI5 A;  2Q8J A;  3MVW A;  1LFI A;  5IAI A;  4BDL A;  5ICT A;  1VR5 A;  1QKA A;  5FHM A;  2PBW A;  1RDZ A;  4O8M A;  2RC7 A;  3G3K A;  4ECF A;  1B3F A;  4R6K A;  3B8B A;  2QVR A;  4YB6 A;  1NV0 A;  4MBP A;  3PPN A;  3JYR A;  3PPQ A;  4R72 A;  5EQ9 A;  3SEV A;  1LFG A;  3FXU A;  1MY3 A;  3IOW A;  3GBB A;  1GTK A;  4I62 A;  3R6U A;  5H8H B;  2G29 A;  2ONR A;  3D4C A;  4PFR A;  1FPK A;  3QUF A;  4RJZ A;  3WAE A;  4POX A;  3QUJ A;  4AB5 A;  2XXV A;  3MAM A;  5T3J A;  3PPO A;  3QMF A;  5JEI A;  2Y7K A;  5DYH A;  4PAK A;  1EH3 A;  4OMB A;  3D1R A;  1JET A;  1XC1 A;  1B3G A;  2F5X A;  4OET A;  5KDT B;  1VFE A;  4F3S A;  4AB6 A;  1LGB C;  4I3Y A;  1EZP A;  3TTR A;  3H4Z A;  3KOT A;  4IY5 A;  1M5C A;  3VVF A;  2DQV A;  1IMD A;  4IO2 A;  1D9Y A;  2E1S A;  4RY1 A;  4WEP A;  5A5L A;  3ONM A;  1DTG A;  2YJP A;  3RQT A;  1MH4 A;  4ELR A;  3T93 B;  1LBV A;  5EYH A;  1D3K A;  5L9M A;  4YIC A;  4H5G A;  3E4R A;  2FA7 A;  2IEE A;  2ZZW A;  3KGC A;  4ZEB A;  3OO6 A;  5IZZ A;  2RIN A;  1IMC A;  2HQ0 A;  4M1V A;  4U4X A;  3C36 A;  1IZ1 A;  3IO6 A;  2M8C A;  2Q74 A;  2G93 A;  3CIJ A;  1SVX B;  2DWJ A;  4NX1 A;  3FZV A;  5L9S A;  4H67 A;  2VT5 A;  3TQL A;  3IK6 B;  2AYS A;  1O64 A;  4I1D A;  4BDN A;  1FPF A;  2XX8 A;  4YKK A;  3LSX A;  4HCY A;  3IO4 A;  1FBC A;  3KSX A;  5DEX A;  1DSN A;  4N17 A;  2ONS A;  1R9L A;  5K2Y A;  3FBP A;  1H43 A;  1TXF A;  3KJT A;  1VFD A;  1US4 A;  1AIV A;  1BIY A;  1O7T A;  1H44 A;  2Q89 A;  4MFI A;  3PD9 A;  2Y7W A;  2HAV A;  1IUD A;  4NF8 B;  1N3X A;  5I2N A;  5J16 A;  4PF6 A;  3ROJ A;  4JWX A;  4MX6 A;  3OXN A;  3FJ7 A;  3T9X B;  1RYO A;  2I3V A;  2THI A;  3RNN A;  4JWO A;  1H3D A;  3FVO A;  4N6P A;  3TFL A;  4PQJ A;  5FHO A;  2Y7R A;  3C4M A;  4G4P A;  3KEI A;  2XD2 A;  4KYS A;  4AQ4 A;  3OO9 A;  4KD5 A;  3T96 B;  2REG A;  5I56 B;  1M5D A;  4XXU A;  1B52 A;  2REJ A;  2HPG A;  3B6W A;  1WOD A;  4GRK A;  4H45 A;  1B05 A;  4GWW A;  2D5W A;  5IZ3 B;  4H65 A;  4HXV A;  3T9H B;  3GLB A;  2F36 A;  4BDQ A;  4LP2 B;  2PFY A;  4ISU A;  1K9Z A;  5LOM A;  5F7V A;  3QSL A;  2KLF A;  3N94 A;  1QVS A;  5I59 B;  2MKZ A;  1TFA A;  1IIW A;  4F39 A;  4X04 A;  1IXC A;  3FJG A;  4RNS A;  2R71 A;  1MRP A;  1Y1Z A;  3RY3 A;  5AA3 A;  2ZXT A;  4OFJ A;  5I58 B;  4FIM A;  1ZIU A;  4O7I A;  3T1B A;  1L5T A;  3KOS A;  4F2Q A;  5CC2 A;  2F7C A;  1FRP A;  4MHF A;  3VDF A;  3PMX A;  3K6V A;  5TPA A;  1AH5 A;  2DSF A;  3K6W A;  1URD A;  2ZYM A;  2DWI A;  1OQG A;  2RC9 A;  1NV2 A;  3LC8 A;  3B6T A;  3CSG A;  2XD3 A;  2H25 A;  2I6E A;  1BKA A;  3PD8 A;  5CM6 A;  1B58 A;  3UN6 A;  4YKP A;  2F6G A;  3E9X A;  3S9N C;  1LCT A;  1QUJ A;  4PGN A;  1A99 A;  1YAE A;  2B3B A;  3V5A A;  5KCJ A;  4ONY A;  2ZNS A;  4XKR A;  2DE2 A;  1EYI A;  3VV5 A;  3KZG A;  4JVD A;  3ISP A;  4NAP A;  4MF3 A;  2R6G E;  4GX6 A;  2QS1 A;  1SW1 A;  4OEN A;  4XEQ A;  2F6P A;  2WKY A;  3HHF A;  1H76 A;  1IXI A;  1P1W A;  3TTK A;  1DPE A;  1MY1 A;  3TTM A;  4MMP A;  2X26 A;  1FJ6 A;  1MXX A;  3MVX A;  1FJ9 A;  3I3V A;  4YKJ A;  4JDF A;  1MXV A;  3IOT A;  4F2O A;  4LZ5 A;  4I3E A;  5FTH A;  3T9V A;  1LB8 A;  4L17 A;  4JVC A;  2QS2 A;  4NG7 A;  5ITO A;  1CE2 A;  4Q5T A;  2OCU A;  2Q88 A;  3V83 A;  5A5X B;  4NF4 B;  4YZZ A;  5K2X A;  4QSC A;  2WYP A;  5BWJ A;  4R2F A;  2HAU A;  2GHB A;  2OZZ A;  1WDN A;  1MDQ A;  4QHQ A;  3HV1 A;  3MWB A;  1NV4 A;  3CFX A;  2Z8F A;  1MM7 A;  3PGF A;  3SEY A;  3UIF A;  2GH9 A;  2RC8 A;  1P1U A;  1KA0 A;  4PAF A;  4IGT A;  4HW8 A;  1F9B A;  1Y4T A;  5TP9 A;  4JWY A;  3FV2 A;  3WAF A;  5AA4 B;  1FW0 A;  1OLA A;  1IMB A;  2FHY A;  3KBZ A;  2A5T A;  2B3F A;  4ZE8 A;  2DWH A;  3FAS A;  3IOR A;  2XWK A;  3IFC A;  1MXZ A;  4F19 A;  2F3B A;  3RTF B;  1RDY A;  1FBP A;  1NV7 A;  1A8F A;  3H7M A;  1KWH A;  2UVI A;  1MY0 A;  1Y4C A;  1SD3 A;  1D9Q A;  4NWC A;  4QFO A;  3B50 A;  2Y84 A;  3DLN A;  4OAN A;  3LUZ A;  5TU0 A;  2I0C A;  3VLV A;  3OEN A;  4G68 C;  4HE0 A;  4Q8R A;  2XXQ A;  1NV1 A;  3T9U A;  3EKI A;  3CRB A;  2F8D A;  3IJX B;  4KI0 E;  1SQY A;  2OJT A;  3RPL A;  1FBD A;  3TYH A;  4HE2 A;  5DTB A;  3L6G A;  3BBR A;  4OFL A;  5IGA A;  2X7Q A;  1VSO A;  2I3W A;  3KN3 A;  3O2A A;  1HSE A;  4OVJ A;  1FTM A;  1SYI A;  4NTL A;  4EF1 A;  4JBZ A;  4PAI A;  2H9B A;  4RK2 A;  1SW4 A;  1NH8 A;  5ET6 A;  3TPA A;  1MG1 A;  3DM0 A;  3V8X B;  3DEL B;  3CG1 A;  3K01 A;  4ELP A;  1II5 A;  4LQ5 A;  3IB0 A;  2H4I A;  3JV9 A;  1KA1 A;  3SET A;  1XVY A;  4FBP A;  3TAJ A;  4O7M A;  1PC3 A;  2DXR A;  4QF9 A;  4RPO A;  4NF0 A;  1GGG A;  3R26 A;  5IZ1 A;  4OA4 A;  2Y7I A;  1A54 A;  1HSL A;  4ELO A;  1AL3 A;  1I6A A;  1MQI A;  1NKX A;  3P7I A;  3S9L C;  4GX3 A;  3USD A;  2E0S A;  5EHM A;  4XKN A;  2UVH A;  4FAJ A;  3LV0 A;  4FAT A;  2XXH A;  1B5J A;  3O97 A;  2UVG A;  5HPQ A;  1I6B A;  4YMA A;  3GZG A;  4G8N A;  4X8R A;  4MLQ A;  1DBZ A;  2FIE A;  3RN8 A;  4AS5 A;  5J1D A;  1GVC A;  3C31 A;  2WEF A;  2Z22 A;  4DE8 A;  1MQD A;  5ET5 A;  1LBY A;  1SDX A;  1Z7N E;  1OQH A;  3PUY E;  1TWY A;  2QRY A;  4PGP A;  1GR2 A;  4H6D A;  4N6K A;  2RKM A;  1A40 A;  4GL0 A;  3K1P A;  2DVZ A;  4LQ2 A;  4PDH A;  4R9G A;  1DCU A;  1MPD A;  3O28 A;  3H6U A;  1XHY A;  1PBP A;  4FOR A;  2HZL A;  2B4M A;  2XXY A;  1FBG A;  4U23 A;  2RCB A;  4OER A;  4F1Y A;  4WKM A;  2QMW A;  3MUQ A;  5H8Q B;  2VOZ A;  5FTI A;  3VLU A;  3PUX E;  4KFQ A;  5H8H A;  4GQO A;  3IAZ A;  2NVU B;  3T0J A;  3VVE A;  1M5E A;  3EN3 A;  4PE3 A;  1INP A;  2I58 A;  3QYT A;  4P3L A;  1B7U A;  4NE4 A;  3AXF A;  1R6Z A;  3GXA A;  2QVV A;  3CSB A;  3G3I A;  1P99 A;  1UTH B;  3S4U A;  4GXS B;  4OVR A;  1FBF A;  2D3I A;  3OEM A;  4FEC A;  2DOJ A;  4OES A;  2V84 A;  4YAH X;  5ICQ A;  1IXH A;  3THI A;  4MIJ A;  4KQP A;  1B4Z A;  2QMX A;  3U93 A;  5I2K A;  3UGW A;  2ABH A;  3S9M C;  4ZDM A;  4GXA A;  4N81 A;  2PT2 A;  3RLF E;  5EQ8 A;  1B4H A;  5CBS A;  2DE3 A;  4XIG Q;  4EQB A;  1EYK A;  4P8B A;  3DP4 A;  1MY2 A;  3E13 X;  4R74 A;  3RT6 B;  5F24 A;  4OYV A;  1LLS A;  1Y9U A;  3Q29 A;  1FTJ A;  3EHU A;  4R73 A;  3SKP A;  4OFO A;  3OD7 A;  1NUZ A;  2Q2C A;  1LCF A;  2CMO A;  3E3K A;  4DI3 D;  1JVY A;  3VLW A;  4ND9 A;  1JW1 A;  3SER A;  3H3G A;  4QXD A;  1LBB A;  2DWA A;  4HE1 A;  3VFJ A;  3SEX A;  4PBQ A;  1MQG A;  3K1M A;  3UP9 A;  1Q9D A;  2YPN A;  4I40 A;  1IMF A;  1MM6 A;  3FD3 A;  3G3J A;  4KYD A;  4F3G A;  2Q9T A;  5I57 A;  3U65 A;  5DW8 A;  1JEV A;  2P2A A;  1B46 A;  2NUV A;  1QUK A;  4IO7 A;  1B7Z A;  3M3F A;  1LAF E;  3HO7 A;  2CZK A;  5DVJ A;  3W9W A;  1US5 A;  1N7X A;  3K2D A;  1SYH A;  4PF8 A;  3G3G A;  3G7W A;  1ATG A;  4N8Y A;  1DPP A;  3O29 A;  3QXM A;  1K9Y A;  4YKI A;  3MP1 A;  3KFM A;  3V89 B;  2AL4 A;  2A5S A;  3PV0 E;  4DZ1 A;  4K3F A;  1Y3P A;  2P0S A;  4MNI A;  4NN3 A;  2V3Q A;  1QJM A;  1Q35 A;  3IB2 A;  3TCH A;  5DT6 A;  3A09 A;  4BDR A;  1JP4 A;  4P56 A;  4DXC A;  2V4C A;  3OSQ A;  1UTB B;  1MS7 A;  4QSE A;  1PEB A;  1LEV A;  4DI4 B;  1M5B A;  2B65 A;  4U4S A;  4RXL A;  3R7X A;  2AL5 A;  4GD5 A;  1AWB A;  2XXI A;  4XKQ A;  3IX1 A;  4H8I A;  3UK4 A;  1B1H A;  1USY E;  3KBR A;  4GIZ A;  1BTJ A;  3O66 A;  2I4B A;  5IZ3 A;  3TTL A;  4R6Y A;  3IOU A;  3K6X A;  4C0R A;  3M3L A;  2R8T A;  2ONK E;  2HFB A;  3I6V A;  4XF5 A;  3BIG A;  1LBW A;  4F1V A;  2OX3 A;  2DYX A;  2ANJ A;  2VPN A;  2O1M A;  1FQB A;  1B7H A;  1NUY A;  1O63 A;  3ILU B;  3U72 A;  1KZ8 A;  5I59 A;  1B6H A;  1S50 A;  1NNK A;  3TTN A;  2XX7 A;  4IO5 A;  1FPG A;  4R6H A;  4RPN A;  1IME A;  4F22 A;  3CI8 A;  5CRY A;  5I58 A;  1USY H;  2Y5L A;  3RGY A;  4PFY A;  5FBP A;  1Y1M A;  3SZP A;  1IXG A;  2X7P A;  4NF6 B;  2F97 A;  4OVP A;  5TPA B;  5ELV A;  3FVN A;  4O3A A;  4H8J A;  3DP6 A;  3SES A;  3M8U A;  4E0X A;  2CEY A;  1RKM A;  5ET8 A;  2QS3 A;  3KSJ A;  3LSW A;  2FVZ A;  4ZED A;  1IQ7 A;  4ZS9 A;  3RYD A;  4NF5 A;  3ZS6 A;  4M4G A;  4N8G A;  4ZZA A;  1P1Q A;  1LBX A;  1UIV A;  1MPB A;  1LAH E;  4EUO A;  1M5F A;  2P1S A;  3O6H A;  2O1L A;  1WVJ A;  4Q30 B;  2NOO A;  1GV8 A;  3BFT A;  3M3K A;  4ZEK A;  2H98 A;  4Z7E A;  2Z23 A;  3IJO B;  3OO7 A;  4TLL B;  1FQE A;  4O94 A;  1FTO A;  2P3N A;  2P3V A;  2Q8M A;  3F11 A;  5I3S A;  2PX1 A;  3VXB A;  2VHA A;  1PB8 A;  2WYK A;  1JVX A;  1N76 A;  4AS4 A;  3OO8 A;  3B7D A;  5IKB A;  3CFL A;  4POW A;  4IO4 A;  3CVG A;  4F18 A;  3ZSF A;  2XXT A;  2F34 A;  4FED A;  4G2Z A; 
#chains in the Genus database with same CATH homology
 3MZ1 A;  5CBR A;  2XX9 A;  4EDP A;  1ANF A;  4E0W A;  4P11 A;  2O6A A;  3LBS A;  5A5X A;  1A7L A;  4NF4 A;  4PET A;  1MQJ A;  4GOT A;  2H5Y A;  4QFP A;  3K02 A;  1EU8 A;  4ESW A;  3MW0 A;  4G68 B;  3ECR A;  3SEU A;  4LZ7 A;  4F31 B;  3FVG A;  2I4C A;  4XKP A;  3CG3 A;  5TP9 B;  5JTY A;  5AE4 A;  4GFR A;  4OEV A;  5EYF A;  1QUI A;  3MVZ A;  3U94 A;  2ZNT A;  3PUV E;  4X9T A;  5AA4 A;  2OK2 A;  5AA2 D;  4F1U A;  1BP5 A;  1ZMG A;  3C32 A;  2D21 A;  3VE1 B;  3S9E A;  2ZYO A;  2OLB A;  4LAT A;  1Y20 A;  2HEU A;  4IO6 A;  3TEL A;  4FJP A;  1ZLQ A;  3HST A;  3O9P A;  4YU0 A;  3OSR A;  3MPK A;  1B0H A;  5AA2 A;  1SW5 A;  3VVD A;  3H06 B;  5CMM A;  1NH7 A;  3L6H A;  3MVY A;  1OVB A;  4EXL A;  2Z8D A;  3K4U A;  3O6G A;  3CR9 A;  3MP6 A;  1JNF A;  3MQ9 A;  4KCD A;  5H8N B;  4IB2 A;  4IGR A;  3PU5 A;  3UOR A;  3TZA A;  4EXK A;  2PT1 A;  4UA8 A;  2Y7P A;  3BKI B;  1ZBM A;  2NXO A;  1B2H A;  3IR1 A;  4LUB A;  2Z8E A;  2Q2A A;  2YLN A;  5H8F B;  3UA8 A;  2XXP A;  4HS7 A;  4Q0C A;  3ODB A;  2GHA A;  4PFU A;  4ELQ A;  3FIR A;  3KN7 A;  4DLD A;  1PBQ A;  1XVX A;  2O68 A;  2UXA A;  2XXW A;  1FQC A;  1YPN A;  1OMP A;  1LB9 A;  1J1N A;  4YB7 A;  3U92 A;  1FTL A;  3KN8 A;  4DIG A;  2QPQ A;  3C35 A;  1MXU A;  2VD2 A;  4OHN A;  3MZB A;  5F1Q A;  1TFD A;  4U22 A;  4U1O A;  1DMB A;  4N13 A;  2I0B A;  3MC2 A;  3PPP A;  3SDF A;  1B0L A;  5BUU A;  3TCF A;  3MP8 A;  5M2V A;  4Z0I A;  2O84 X;  4F29 A;  1AMF A;  1IIT A;  3VXC A;  1URS A;  2QS4 A;  3FJM A;  4QFN A;  4WXJ A;  3N6U A;  2VD3 A;  4NED A;  4HTG A;  1FQD A;  1MQH A;  3FXQ A;  1NNT A;  2O69 A;  4OXV A;  3FAT A;  3OEK A;  2O7U A;  2QL3 A;  1SW2 A;  2XXX A;  4R2B A;  5HBC A;  3TUS A;  5ISU A;  5H8Q A;  2DP8 A;  4RK9 A;  1B5H A;  5EHS A;  3RPW A;  3EPE A;  4X1B A;  1JEU A;  5DVF A;  1B9J A;  2ZYN A;  2RCA A;  3O6I A;  3QK6 A;  3IOV A;  2F78 A;  3HPI A;  3MBP A;  4U21 A;  1UTH A;  3W15 C;  2HCA A;  5CMC A;  2BJJ X;  4MLV A;  1DTZ A;  5KDT A;  3K6U A;  1N3W A;  4BDM A;  3H6W A;  3EF7 A;  5I2K B;  2ZYK A;  3EQ1 A;  1NL5 A;  1Z7M E;  1ZU0 A;  3ZKK A;  3TKD A;  3Q28 A;  2ZMB A;  4EQ9 A;  3EHS A;  5KZT A;  4G77 A;  4THI A;  1P1O A;  1JW4 A;  2NWJ A;  2ESN A;  1D4N A;  2DS9 A;  4G8H A;  4ESX A;  4OTE A;  1URG A;  4DCX A;  4NMY A;  5I84 A;  4C1U A;  4EQ7 A;  3RTW B;  3H6V A;  1MXW A;  4X1D A;  1LFH A;  3PUW E;  1LBC A;  1QW0 A;  2OWT A;  2O7I A;  2ZNU A;  3G3H A;  5DEX B;  4KYE A;  1CB6 A;  2QJE A;  5CMB A;  3RUM A;  2FYI A;  5I57 B;  2UYF A;  3C33 A;  4P0G A;  3H03 A;  4OZ9 A;  1N0T A;  3IB1 A;  1S7Y A;  2IA4 A;  1FTK A;  1B3L A;  1B32 A;  2HXW A;  3MPL A;  4C1T A;  3N6T A;  2DXY A;  5I2N B;  4GLI A;  4JSD A;  4NF8 A;  1OVT A;  2XXR A;  3OMB A;  4WED A;  1T0K A;  4O3C A;  1ZTY A;  1Q1K A;  3TMG A;  3PMW A;  1HSJ A;  2XXU A;  1SI0 A;  5ITP A;  2VP1 A;  3FUZ A;  4O3B A;  5L8D A;  5I56 A;  1Y3N A;  4TOZ A;  2OBG A;  4DXU A;  1UTB A;  3GBA A;  4R9F A;  3T22 A;  4XTC Q;  4LVQ A;  4QFL A;  3FV1 A;  1OIB A;  3IL1 B;  3EHT A;  1N04 A;  4ZZE A;  3HCQ A;  2O51 A;  3LSL A;  4QRZ A;  4GL8 A;  2ALU A;  2UVJ A;  4R75 A;  3C34 A;  3TCG A;  4G8M A;  4HCW A;  5L9O A;  4H0W A;  3DP8 A;  2UYE A;  3OEL A;  4FEB A;  3Q26 A;  4ZE9 A;  3TOD A;  1EZO A;  2GFE A;  3ZKL A;  1RYX A;  3C9H A;  3A3U A;  3FXR A;  4ZEF A;  4RA1 A;  4QSD A;  4QFK A;  4EF2 A;  2PVU A;  3H6T A;  1NMU A;  4JXI A;  1PDA A;  3PPR A;  3A3C A;  1D9V A;  4NF6 A;  4H1X A;  4YB5 A;  1IEJ A;  5KCJ B;  4DCY A;  3Q27 A;  4OWD A;  1XS5 A;  3U8Q A;  4NF5 B;  1ZJL A;  1A55 A;  4OEU A;  4KHZ E;  1MXY A;  2I48 A;  1MH3 A;  1UIU A;  3B6Q A;  1FCK A;  1SI1 A;  1VE4 A;  4U1Z A;  3QAX A;  2DE4 A;  1A8E A;  1LAX A;  3RT8 A;  1N84 A;  4YMB A;  1POY 1;  4LA9 A;  2LAO A;  4PE5 B;  1QKB A;  2F7B A;  2F7A A;  4KPT A;  4JB7 A;  4H5F A;  3Q25 A;  4KR5 A;  4ZEI A;  4X48 A;  3QIM A;  1XT8 A;  3K0V A;  2V93 A;  4GWO A;  1JQF A;  1B5I A;  1QUL A;  4RYA A;  3KJ7 A;  1H45 A;  1XOC A;  4JSO A;  3TQW A;  4PP0 A;  4BDO A;  5FHN A;  2VGQ A;  1MDP 1;  2PYY A;  1JW5 A;  4TQU Q;  1LAG E;  2XHD A;  3ILT B;  4BLA A;  4DDD A;  1B1X A;  2DVC A;  2CZL A;  2HZK A;  4G68 A;  4KCC A;  2A5T B;  2R9J A;  5JTY B;  5CMK A;  1B40 A;  3W9V A;  1PB9 A;  4MH5 A;  1LST A;  5B70 A;  2W7Y A;  5B7D A;  4U2R A;  3T66 A;  2RF1 A;  3MZ9 A;  4FE8 A;  4LZ8 A;  1SBP A;  4NWD A;  1NNF A;  2OWS A;  1S9T A;  3S2V A;  5H8S A;  4N07 A;  1UQW A;  4PFT A;  3OOA A;  1PB7 A;  1N7W A;  2F35 A;  5AA2 B;  1P1N A;  4DXB A;  3MJN A;  3K1N A;  2GRV A;  4GF8 A;  3TEP A;  1TT1 A;  3U1O A;  4I8C A;  1FQF A;  5HM4 B;  1Y3Q A;  1B51 A;  3K00 A;  4IO3 A;  4P0I A;  1NNP A;  5AA1 A;  3D4G A;  1R1N A;  1POT A;  3HHG A;  3CFZ A;  3FVK A;  4TLM B;  1NFT A;  2H99 A;  1YCJ A;  4GVO A;  5H8N A;  4PFW A;  5DVI A;  2AIX A;  4IY6 A;  3KG2 A;  1I6Q A;  3N5L A;  2V3T A;  1EZ9 A;  4I9D A;  3N26 A;  1ZKB A;  2I49 A;  2V3U A;  3BFU A;  3FGS A;  1MPC A;  1AOV A;  2FNC A;  5H8F A;  3LUY A;  1B3H A;  3JZJ A;  1FQA A;  1B3E A;  4F3B A;  2QSX A;  1MY4 A;  4OQO A;  2PMS A;  5JK4 A;  1ELJ A;  1I69 A;  3SEW A;  4UAC A;  3I5O A;  3PUZ E;  1OLC A;  1YTV A;  1DOT A;  4LON B;  2V25 A;  3LSF B;  3LR1 A;  4ZEC A;  4F3P A;  1R9Q A;  3HN0 A;  3TDJ A;  1BLF A;  3PMV A;  3G3F A;  5CI5 A;  2Q8J A;  3MVW A;  1LFI A;  5IAI A;  4BDL A;  5ICT A;  1VR5 A;  1QKA A;  5FHM A;  2PBW A;  3G3K A;  2RC7 A;  4ECF A;  1B3F A;  4R6K A;  4YB6 A;  4MBP A;  3PPN A;  3JYR A;  3PPQ A;  4R72 A;  3SEV A;  1LFG A;  3FXU A;  1MY3 A;  3IOW A;  3GBB A;  1GTK A;  4I62 A;  3R6U A;  5H8H B;  2G29 A;  2ONR A;  3D4C A;  3QUF A;  4RJZ A;  3WAE A;  4POX A;  3QUJ A;  4AB5 A;  2XXV A;  3MAM A;  3PPO A;  5JEI A;  2Y7K A;  5DYH A;  1EH3 A;  4OMB A;  1JET A;  1XC1 A;  1B3G A;  2F5X A;  4OET A;  5KDT B;  1VFE A;  4F3S A;  4AB6 A;  1LGB C;  1EZP A;  3TTR A;  3H4Z A;  3KOT A;  4IY5 A;  1M5C A;  3VVF A;  2DQV A;  4IO2 A;  1D9Y A;  2E1S A;  4RY1 A;  4WEP A;  3ONM A;  1DTG A;  2YJP A;  3RQT A;  1MH4 A;  4ELR A;  3T93 B;  1D3K A;  5L9M A;  4YIC A;  4H5G A;  3E4R A;  2FA7 A;  2IEE A;  3KGC A;  4ZEB A;  3OO6 A;  2RIN A;  2HQ0 A;  4M1V A;  4U4X A;  3C36 A;  1IZ1 A;  3IO6 A;  2M8C A;  2G93 A;  3CIJ A;  1SVX B;  2DWJ A;  3FZV A;  5L9S A;  4H67 A;  3TQL A;  3IK6 B;  2AYS A;  1O64 A;  4I1D A;  4BDN A;  2XX8 A;  4YKK A;  3LSX A;  4HCY A;  3IO4 A;  3KSX A;  5DEX A;  1DSN A;  2ONS A;  1R9L A;  5K2Y A;  1H43 A;  1TXF A;  3KJT A;  1VFD A;  1US4 A;  1AIV A;  1BIY A;  1O7T A;  1H44 A;  2Q89 A;  4MFI A;  3PD9 A;  2Y7W A;  2HAV A;  1IUD A;  4NF8 B;  1N3X A;  5I2N A;  4JWX A;  3OXN A;  3FJ7 A;  3T9X B;  1RYO A;  2I3V A;  2THI A;  3RNN A;  4JWO A;  1H3D A;  3FVO A;  4N6P A;  3TFL A;  4PQJ A;  5FHO A;  2Y7R A;  3C4M A;  4G4P A;  3KEI A;  2XD2 A;  4KYS A;  4AQ4 A;  3OO9 A;  4KD5 A;  3T96 B;  2REG A;  5I56 B;  1M5D A;  4XXU A;  1B52 A;  2REJ A;  3B6W A;  1WOD A;  4GRK A;  1B05 A;  2D5W A;  4H65 A;  3T9H B;  3GLB A;  2F36 A;  4BDQ A;  4LP2 B;  4ISU A;  5LOM A;  5F7V A;  3QSL A;  2KLF A;  3N94 A;  1QVS A;  5I59 B;  1TFA A;  1IIW A;  4F39 A;  1IXC A;  3FJG A;  4RNS A;  2R71 A;  1MRP A;  1Y1Z A;  3RY3 A;  5AA3 A;  2ZXT A;  4OFJ A;  5I58 B;  4FIM A;  1ZIU A;  1L5T A;  3KOS A;  4F2Q A;  5CC2 A;  2F7C A;  3VDF A;  3PMX A;  3K6V A;  5TPA A;  1AH5 A;  2DSF A;  3K6W A;  1URD A;  2ZYM A;  2DWI A;  1OQG A;  2RC9 A;  3LC8 A;  3B6T A;  3CSG A;  2XD3 A;  2H25 A;  2I6E A;  1BKA A;  3PD8 A;  5CM6 A;  1B58 A;  3UN6 A;  4YKP A;  2F6G A;  3E9X A;  3S9N C;  1LCT A;  1QUJ A;  1A99 A;  1YAE A;  2B3B A;  3V5A A;  5KCJ A;  4ONY A;  2ZNS A;  4XKR A;  2DE2 A;  3VV5 A;  3KZG A;  4MF3 A;  2R6G E;  2QS1 A;  1SW1 A;  4OEN A;  2F6P A;  2WKY A;  3HHF A;  1H76 A;  1IXI A;  1P1W A;  3TTK A;  1DPE A;  1MY1 A;  3TTM A;  2X26 A;  1MXX A;  3MVX A;  3I3V A;  4YKJ A;  4JDF A;  1MXV A;  3IOT A;  4F2O A;  4LZ5 A;  5FTH A;  3T9V A;  1LB8 A;  4L17 A;  2QS2 A;  5ITO A;  1CE2 A;  4Q5T A;  2OCU A;  2Q88 A;  3V83 A;  5A5X B;  4NF4 B;  4YZZ A;  5K2X A;  4QSC A;  5BWJ A;  4R2F A;  2HAU A;  2GHB A;  2OZZ A;  1WDN A;  1MDQ A;  4QHQ A;  3HV1 A;  3MWB A;  3CFX A;  2Z8F A;  1MM7 A;  3PGF A;  3SEY A;  3UIF A;  2GH9 A;  2RC8 A;  1P1U A;  4IGT A;  4HW8 A;  1F9B A;  1Y4T A;  5TP9 A;  4JWY A;  3FV2 A;  3WAF A;  5AA4 B;  1FW0 A;  1OLA A;  2A5T A;  2B3F A;  4ZE8 A;  2DWH A;  3FAS A;  3IOR A;  1MXZ A;  4F19 A;  3RTF B;  1A8F A;  3H7M A;  1KWH A;  2UVI A;  1MY0 A;  1Y4C A;  1SD3 A;  4NWC A;  4QFO A;  2Y84 A;  3DLN A;  5TU0 A;  2I0C A;  3VLV A;  3OEN A;  4G68 C;  4Q8R A;  2XXQ A;  3T9U A;  3CRB A;  2F8D A;  3IJX B;  4KI0 E;  1SQY A;  2OJT A;  3TYH A;  5DTB A;  3L6G A;  3BBR A;  4OFL A;  2X7Q A;  1VSO A;  2I3W A;  3KN3 A;  3O2A A;  1HSE A;  4OVJ A;  1FTM A;  1SYI A;  4NTL A;  4EF1 A;  4JBZ A;  2H9B A;  4RK2 A;  1SW4 A;  1NH8 A;  3TPA A;  1MG1 A;  3DM0 A;  3V8X B;  3DEL B;  3CG1 A;  3K01 A;  4ELP A;  1II5 A;  4LQ5 A;  3IB0 A;  2H4I A;  3JV9 A;  3SET A;  1XVY A;  3TAJ A;  1PC3 A;  2DXR A;  4QF9 A;  4RPO A;  1GGG A;  3R26 A;  2Y7I A;  1A54 A;  1HSL A;  4ELO A;  1AL3 A;  1I6A A;  1MQI A;  1NKX A;  3P7I A;  3S9L C;  3USD A;  2E0S A;  5EHM A;  4XKN A;  2UVH A;  4FAJ A;  4FAT A;  2XXH A;  1B5J A;  3O97 A;  2UVG A;  5HPQ A;  1I6B A;  4YMA A;  3GZG A;  4G8N A;  4MLQ A;  3RN8 A;  5J1D A;  1GVC A;  3C31 A;  2Z22 A;  4DE8 A;  1MQD A;  1SDX A;  1Z7N E;  1OQH A;  3PUY E;  1TWY A;  2QRY A;  1GR2 A;  4H6D A;  2RKM A;  1A40 A;  4GL0 A;  3K1P A;  2DVZ A;  4LQ2 A;  4R9G A;  1MPD A;  3O28 A;  3H6U A;  1XHY A;  1PBP A;  4FOR A;  2HZL A;  2XXY A;  4U23 A;  2RCB A;  4OER A;  4F1Y A;  4WKM A;  2QMW A;  3MUQ A;  5H8Q B;  2VOZ A;  5FTI A;  3VLU A;  3PUX E;  4KFQ A;  5H8H A;  4GQO A;  3IAZ A;  2NVU B;  3VVE A;  1M5E A;  3EN3 A;  2I58 A;  3QYT A;  1B7U A;  4NE4 A;  3AXF A;  1R6Z A;  3GXA A;  3CSB A;  3G3I A;  1P99 A;  1UTH B;  3S4U A;  4GXS B;  2D3I A;  3OEM A;  4FEC A;  2DOJ A;  4OES A;  2V84 A;  4YAH X;  5ICQ A;  1IXH A;  3THI A;  4KQP A;  1B4Z A;  2QMX A;  3U93 A;  5I2K A;  3UGW A;  2ABH A;  3S9M C;  4ZDM A;  4GXA A;  2PT2 A;  3RLF E;  1B4H A;  5CBS A;  2DE3 A;  4XIG Q;  4EQB A;  3DP4 A;  1MY2 A;  3E13 X;  4R74 A;  3RT6 B;  4OYV A;  1LLS A;  1Y9U A;  3Q29 A;  1FTJ A;  3EHU A;  4R73 A;  3SKP A;  4OFO A;  3OD7 A;  2Q2C A;  1LCF A;  2CMO A;  3E3K A;  1JVY A;  3VLW A;  4ND9 A;  1JW1 A;  3SER A;  3H3G A;  1LBB A;  2DWA A;  3VFJ A;  3SEX A;  1MQG A;  3K1M A;  3UP9 A;  2YPN A;  1MM6 A;  3FD3 A;  3G3J A;  4KYD A;  4F3G A;  2Q9T A;  5I57 A;  1JEV A;  2P2A A;  1B46 A;  2NUV A;  1QUK A;  4IO7 A;  1B7Z A;  3M3F A;  1LAF E;  3HO7 A;  5DVJ A;  3W9W A;  1US5 A;  1N7X A;  3K2D A;  1SYH A;  3G3G A;  3G7W A;  1ATG A;  1DPP A;  3O29 A;  3QXM A;  4YKI A;  3MP1 A;  3KFM A;  3V89 B;  2AL4 A;  2A5S A;  3PV0 E;  4DZ1 A;  4K3F A;  1Y3P A;  2P0S A;  2V3Q A;  1QJM A;  1Q35 A;  3IB2 A;  3TCH A;  5DT6 A;  3A09 A;  4BDR A;  4DXC A;  3OSQ A;  1UTB B;  1MS7 A;  4QSE A;  1PEB A;  1M5B A;  2B65 A;  4U4S A;  4RXL A;  3R7X A;  2AL5 A;  4GD5 A;  2XXI A;  4XKQ A;  3IX1 A;  4H8I A;  3UK4 A;  1B1H A;  1USY E;  3KBR A;  4GIZ A;  1BTJ A;  3O66 A;  2I4B A;  3TTL A;  4R6Y A;  3IOU A;  3K6X A;  4C0R A;  3M3L A;  2ONK E;  2HFB A;  3I6V A;  4F1V A;  2DYX A;  2ANJ A;  2O1M A;  1FQB A;  1B7H A;  1O63 A;  3ILU B;  3U72 A;  5I59 A;  1B6H A;  1S50 A;  1NNK A;  3TTN A;  2XX7 A;  4IO5 A;  4R6H A;  4RPN A;  4F22 A;  3CI8 A;  5CRY A;  5I58 A;  1USY H;  3RGY A;  4PFY A;  1Y1M A;  1IXG A;  2X7P A;  4NF6 B;  2F97 A;  5TPA B;  5ELV A;  3FVN A;  4O3A A;  4H8J A;  3DP6 A;  3SES A;  3M8U A;  4E0X A;  1RKM A;  2QS3 A;  3KSJ A;  3LSW A;  4ZED A;  1IQ7 A;  4ZS9 A;  4NF5 A;  3ZS6 A;  4M4G A;  4ZZA A;  1P1Q A;  1UIV A;  1MPB A;  1LAH E;  4EUO A;  1M5F A;  2P1S A;  3O6H A;  2O1L A;  1WVJ A;  4Q30 B;  2NOO A;  1GV8 A;  3BFT A;  3M3K A;  4ZEK A;  2H98 A;  4Z7E A;  2Z23 A;  3IJO B;  3OO7 A;  4TLL B;  1FQE A;  1FTO A;  3F11 A;  2PX1 A;  3VXB A;  2VHA A;  1PB8 A;  1JVX A;  1N76 A;  3OO8 A;  3B7D A;  5IKB A;  3CFL A;  4POW A;  4IO4 A;  3CVG A;  4F18 A;  3ZSF A;  2XXT A;  2F34 A;  4FED A;  4G2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...