3AXFA

Perrhenate binding to a11c/r153c moda mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
231
structure length
231
Chain Sequence
GKITVFAACSLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVCGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdate-binding periplasmic protein
publication title Binding of ReO(4) (-) with an engineered MoO (4) (2-)-binding protein: towards a new approach in radiopharmaceutical applications.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 73
structure length 231
sequence length 231
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3axfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3axfA02
3EPEA 4QF9A 4THIA 4R75A 2Y7PA 2VD3A 4LVQA 3RT6B 4XIGQ 3CG1A 3E4RA 3THIA 2YPNA 5CI5A 2HAVA 2F6GA 1R9LA 3MBPA 1B3EA 2CMOA 1MY2A 3PUXE 1Y1ZA 4K3FA 3S9EA 4GL0A 2OBGA 1MY4A 1GR2A 1VR5A 3U92A 4M4GA 3OENA 1R6ZA 2OCUA 1LAHE 3IB0A 4FEDA 2Y7WA 2Q89A 5KZTA 3H7MA 5H8NA 3TEPA 1PB9A 3IO4A 2Y7IA 5FTHA 3MZ9A 1T0KA 1TXFA 2ALUA 1TWYA 2ONKE 3ZSFA 3FIRA 4Q8RA 2PX1A 1JNFA 4BDNA 5I2KB 2A5TA 4KYSA 4DLDA 1QUKA 3QXMA 4ELQA 1ZTYA 4JWYA 4GVOA 2V3UA 3SKPA 2H9BA 3UA8A 1B7HA 3V8XB 2X7QA 3TCHA 2QS4A 3VE1B 2O84X 2THIA 1Z7NE 3SETA 5JTYB 3A3CA 3QUFA 3OO8A 3M3FA 4U23A 1Q1KA 3G3JA 4WEDA 3FD3A 4NF8A 1LLSA 1I6QA 1H43A 4G8HA 1UQWA 1GGGA 4RY1A 4PQJA 1EZOA 1MXYA 3FXRA 3LR1A 3KSXA 4ZEDA 1P1NA 3D4GA 1Y3NA 4IO6A 4Q30B 1XT8A 3R7XA 3OOAA 1TFDA 4FORA 1D9VA 1MM7A 3W9WA 3TKDA 4GXSB 4F1UA 3K02A 4NWDA 4YB7A 4RXLA 2DXYA 3DP8A 2I49A 2HQ0A 5AA4B 1B7ZA 3PUYE 4H5GA 2QL3A 2I0BA 5AA2A 1FQAA 2QPQA 5KCJB 4U1ZA 1I6BA 2E1SA 1LGBC 1VFDA 1M5BA 2Z8FA 1UIUA 1PBPA 3TQWA 3FUZA 2NUVA 4F2OA 3C4MA 4JSOA 4ELRA 4XXUA 3TTNA 3PUZE 4G8NA 3MP1A 5DTBA 3FJGA 1MY3A 4OTEA 3T66A 5I59B 3H6VA 3U72A 4KD5A 4R6KA 2V93A 1YCJA 3S2VA 1B51A 4NF6B 2XD3A 1US5A 2XX7A 1MQIA 1ZBMA 5H8HB 4YKKA 3T93B 4DCXA 4KR5A 3CG3A 1B4ZA 4XKQA 1RKMA 1NNTA 2OLBA 2GHAA 3VLWA 4DXCA 3H4ZA 2O51A 1N3XA 2YLNA 4QSEA 1FQEA 4IO7A 1JW1A 2O1MA 3TPAA 4QRZA 2QRYA 5DVJA 1N84A 1LFHA 3H6WA 4NF4A 4PETA 1O7TA 1ZJLA 2QS3A 4NWCA 5ELVA 4O3BA 5CMMA 4KCDA 3L6HA 4DXBA 2ZNTA 2PT2A 4F22A 5TP9A 4AB5A 5TU0A 1QULA 1SVXB 3EHUA 1N04A 1FCKA 2ZYNA 1OIBA 2XHDA 3C32A 1ZU0A 4G68A 2DWHA 3S9LC 1JW5A 2ABHA 4KI0E 4MH5A 4OESA 3K1MA 1HSJA 4H8JA 2NOOA 1B3FA 3O66A 3DELB 3U94A 5FHMA 4U21A 3M8UA 3PMWA 1SW4A 1MH4A 2QSXA 1WODA 3UORA 4G68C 1HSLA 4R72A 5CM6A 4X1BA 4LUBA 3DP4A 3VVEA 3ODBA 4YKIA 1MDQA 2I3VA 1US4A 4GXAA 4F3BA 2OWTA 2REJA 1EZ9A 2XXUA 5A5XA 1JQFA 1RYXA 4RK9A 5L8DA 2I6EA 2Z8DA 1TT1A 2O7UA 1PC3A 1P99A 3SEVA 2AIXA 3RGYA 3CIJA 1DPPA 1SQYA 5I58B 1B7UA 5M2VA 4NMYA 4XKRA 3TMGA 3O9PA 4P11A 2ZYKA 3MW0A 4E0WA 3LUYA 5ITOA 3TUSA 1JEUA 2GFEA 2DXRA 5L9MA 1H45A 2F34A 2PYYA 1B9JA 1MXWA 3MP8A 4WKMA 1SD3A 3EN3A 3VDFA 4FE8A 4F2QA 1IIWA 3KEIA 3ZS6A 2XXRA 3FVNA 1QUJA 3Q25A 2DVCA 2RKMA 4ZZAA 2HXWA 3RQTA 4ESXA 2ZNUA 3T9UA 5JEIA 3WAFA 5BWJA 4WXJA 3C35A 2PVUA 2B3BA 1GVCA 1YPNA 4YB6A 5I84A 2Q8JA 4QFOA 4YU0A 1OLAA 3O6GA 4EF1A 1WVJA 2GHBA 4H67A 3OO7A 3CFZA 4QFPA 3ZKKA 3MVZA 3O28A 1FQFA 1B40A 1AMFA 2DE4A 3FJMA 3PMVA 4PFWA 1PBQA 3VXCA 4BDLA 4LATA 5I57A 2DWAA 3OEKA 3FASA 1QUIA 2Z23A 3IK6B 3CFXA 3EQ1A 3IL1B 1MPDA 3A3UA 1AH5A 3GBBA 4JWOA 5H8FA 4PFUA 3N94A 4R74A 2M8CA 4LQ5A 4NEDA 1IUDA 2XXIA 2R6GE 2PT1A 5B70A 1FTMA 3R6UA 3Q26A 2A5SA 1Y4CA 3K1NA 4ZEBA 4H65A 4ZDMA 4G2ZA 3HPIA 3TFLA 3JYRA 3HHFA 4BDQA 1B0LA 1A55A 1KWHA 3IR1A 5FHOA 1MPBA 2F6PA 2IA4A 4LZ8A 3RNNA 2OWSA 3VVDA 2OZZA 4EXKA 1TFAA 4R73A 5EHMA 3B6TA 4DE8A 3EHTA 1FQCA 4F3SA 5I2NA 3IORA 2QMWA 3KN8A 2XXYA 4OENA 5FTIA 3TELA 1IXIA 4JSDA 1YTVA 4LZ5A 4RK2A 3O2AA 1MQHA 4U2RA 3R26A 1NMUA 1MXXA 5I2KA 4OEVA 3HN0A 1B5IA 5CRYA 3C9HA 1RYOA 3VLVA 4U22A 5LOMA 5CMKA 3PMXA 2DE2A 4YMBA 2XXTA 1MY1A 1LB9A 4F39A 4EDPA 1DTGA 2D5WA 4DDDA 1FTLA 3KN3A 1JEVA 4JB7A 4GOTA 3OXNA 4TLMB 5JTYA 4RPNA 5J1DA 1N76A 3MAMA 3USDA 1D9YA 1UTHA 1NH7A 2H4IA 4POWA 1EZPA 3MVWA 4RNSA 5L9SA 3RLFE 3BKIB 3KOTA 1B6HA 1AOVA 5HPQA 4ZEIA 3ILUB 5DT6A 4QHQA 3RTFB 1MRPA 1MQGA 3BFUA 3SDFA 2ONRA 3T22A 4PP0A 4H1XA 2NXOA 3RPWA 1XC1A 3MPLA 4RYAA 1B2HA 1L5TA 4FAJA 2DQVA 2HCAA 4OXVA 3LC8A 2B3FA 1B3GA 4Q5TA 2XXQA 1Q35A 1OQGA 1SDXA 4ND9A 1B05A 2RC8A 2FYIA 3G3HA 3P7IA 4XTCQ 2PBWA 5AA4A 2Y7KA 3T96B 1DTZA 2FNCA 2Q2CA 3H6UA 3MQ9A 1O63A 1WDNA 4PE5B 4QSDA 3K4UA 4R9GA 4KYDA 3MPKA 3KJTA 3PUWE 3CVGA 4G8MA 5CBRA 4U4XA 3T9XB 5HM4B 3N26A 4C1UA 2Z8EA 5I59A 5KDTA 2VGQA 5IAIA 5L9OA 3IAZA 1SBPA 2DP8A 2DE3A 4ELPA 1R9QA 1LAXA 1JVXA 4MFIA 5H8HA 1JETA 3V83A 1MQDA 2LAOA 3FGSA 2ZYMA 1XVYA 1MXUA 5JK4A 2E0SA 4YMAA 1LFGA 1N0TA 1H3DA 3KN7A 3SERA 3MWBA 2REGA 5CC2A 2P1SA 1B0HA 4GQOA 4R6HA 3MUQA 2HEUA 2VD2A 5EYFA 3TZAA 1S7YA 3UP9A 2I58A 5DEXB 4X48A 1ATGA 2F8DA 3G7WA 4RJZA 3FVKA 3CRBA 1N3WA 3PPPA 4EUOA 1OVTA 4KYEA 4F1VA 4UA8A 3U93A 4RA1A 4R2FA 3WAEA 3PPRA 4IY6A 4BLAA 4F18A 2UVJA 3K00A 4G4PA 1NL5A 1GTKA 3IO6A 2ONSA 2D21A 2DWJA 1P1OA 5TPAB 3MZBA 4QSCA 2RCAA 1BLFA 4ZECA 3HHGA 3Q27A 2DS9A 3MVXA 2XXHA 3K6XA 3VLUA 4Q0CA 3OO9A 5DYHA 5DVFA 2DWIA 2UYFA 3KZGA 3MC2A 2O7IA 4BDOA 1LFIA 1BKAA 1Y3PA 2X26A 4NE4A 1POTA 3FVGA 1ELJA 5DVIA 3TCFA 3TTMA 4IGRA 2I48A 2DSFA 1LCFA 4IO3A 4X1DA 2XX8A 3H03A 4GIZA 3QUJA 1QKAA 1B1HA 4KCCA 2F7AA 3C31A 3C33A 3JZJA 1FQBA 2Q88A 1SW1A 2V25A 1M5EA 2NWJA 4PFYA 3O29A 2F78A 2RCBA 5K2YA 1B3LA 1Y4TA 4DXUA 2VHAA 1I6AA 4NF5B 4TQUQ 1NNKA 2R71A 5FHNA 2RF1A 1ZLQA 1PEBA 5A5XB 2V84A 1LBBA 1UTBB 4M1VA 4I1DA 3TTRA 5K2XA 1O64A 2ANJA 4UACA 1M5DA 3TODA 3TAJA 1II5A 4ZEFA 2ZXTA 3G3KA 1FTKA 3OSRA 2F36A 4IO4A 3PUVE 3S4UA 4P0IA 4ELOA 4GRKA 3ILTB 3UIFA 1Z7ME 4FATA 2W7YA 3KBRA 3IX1A 4LQ2A 2AL5A 1A8FA 2QS2A 4EXLA 1N7WA 4R6YA 2OJTA 2UVGA 3CR9A 3SEYA 1URSA 3HO7A 2O6AA 2RC9A 4OMBA 2GH9A 4HS7A 4QFKA 4H6DA 4MBPA 3FJ7A 4IO5A 4JWXA 2XX9A 4LP2B 4OFLA 3LBSA 2DYXA 2VOZA 3B7DA 1ANFA 1NFTA 5ISUA 5H8SA 3FV1A 3G3IA 1DPEA 3IJOB 2HZLA 1B1XA 1MPCA 3BBRA 3OELA 2AYSA 1I69A 3PD9A 1LB8A 1MM6A 1PDAA 3G3GA 3RUMA 5I57B 4O3CA 4ESWA 3KJ7A 3F11A 3LSLA 4H0WA 3BFTA 2F7CA 4IY5A 1IXCA 5H8FB 4ZZEA 5I56B 3RN8A 3K2DA 2ZYOA 1CE2A 5H8QB 4GD5A 1IITA 3E9XA 3RTWB 5AA3A 2P0SA 3V5AA 1A8EA 2I3WA 3SESA 3C36A 2HFBA 3VVFA 1A7LA 3IOWA 3S9MC 3W9VA 2RINA 4I62A 1VE4A 4F19A 2AL4A 1P1QA 1URGA 2I4CA 1VFEA 2F7BA 3K0VA 4ECFA 4I8CA 3FXUA 3AXFA 3PV0E 4FIMA 1MG1A 5H8NB 1VSOA 4H8IA 4WEPA 5I2NB 2O1LA 4R2BA 3K6VA 3IOUA 1MQJA 3GBAA 1M5FA 2Q9TA 4GFRA 3LSFB 1URDA 3B6WA 1OLCA 3K01A 3PPQA 2B65A 3ZKLA 2A5TB 4JXIA 1MDP1 2F97A 1SW2A 4IO2A 4F1YA 3KSJA 4C0RA 1OMPA 1A99A 4IGTA 4TOZA 1FW0A 3E3KA 1J1NA 1POY1 1USYE 5ICTA 4F3PA 4OETA 2QJEA 3TTKA 3KOSA 1P1WA 4POXA 1SYHA 4HW8A 3CFLA 3OMBA 3HSTA 4C1TA 3MJNA 4N13A 4NF8B 5CMBA 4LA9A 4LZ7A 2OK2A 1QKBA 1UTHB 3RT8A 3C34A 3M3KA 4FJPA 1MH3A 4XKPA 4YKPA 4OQOA 1H76A 3W15C 4BDRA 4DIGA 4OFOA 4GLIA 4U4SA 4YAHX 4Z7EA 3PD8A 1IQ7A 1SI1A 1BTJA 1AIVA 2FA7A 2Z22A 2DVZA 2WKYA 3I6VA 1JVYA 3PPNA 1M5CA 3B6QA 3D4CA 3FZVA 4N07A 3FATA 1UIVA 1IXGA 3GZGA 3IB2A 4P0GA 1DOTA 1Y9UA 5KCJA 5ITPA 1XS5A 5AA2B 2XXPA 2O69A 1XOCA 3EHSA 4AB6A 1N7XA 2F35A 3RY3A 1YAEA 4JDFA 3LSWA 1LCTA 2P2AA 3HV1A 4OFJA 4OERA 4ISUA 3GXAA 2PMSA 1A54A 4MLVA 4MF3A 3VFJA 2UXAA 2V3TA 4E0XA 3OEMA 3KFMA 3JV9A 4NTLA 1CB6A 3HCQA 4RPOA 3FV2A 3GLBA 4NF6A 1HSEA 1MY0A 5KDTB 2RC7A 1B3HA 4OEUA 3G3FA 2H99A 3SEUA 3VXBA 4MLQA 4N6PA 1MXVA 4KPTA 4AQ4A 1XVXA 4OHNA 3KGCA 4OWDA 4R9FA 1BP5A 1ZKBA 4ZS9A 2Y7RA 4DCYA 3MP6A 1H44A 5HBCA 1B52A 4YZZA 2R9JA 3K1PA 1B58A 1XHYA 3T9VA 1AL3A 1F9BA 1SYIA 2KLFA 1DSNA 1QJMA 3QIMA 1FTJA 2UYEA 5DEXA 2GRVA 3TYHA 3IOVA 3O6HA 4O3AA 3Q29A 5CBSA 1MXZA 3O6IA 2H5YA 4PFTA 4NF4B 3O97A 1PB7A 1NH8A 2Y84A 3IOTA 3U1OA 3UN6A 3Q28A 2ESNA 1A40A 1IEJA 4OVJA 1S9TA 1B5JA 5TP9B 3CSBA 5TPAA 5EHSA 3ONMA 4XKNA 5AA2D 1DMBA 1NNPA 2XXWA 3E13X 2XXXA 1LSTA 4HTGA 4YKJA 3FVOA 4TLLB 4U1OA 5CMCA 3H3GA 4G68B 2ZNSA 4QFLA 4FEBA 2G93A 3MZ1A 3DM0A 3N5LA 1LAGE 1Y20A 4GF8A 5F7VA 1QW0A 4I9DA 3CSGA 3QAXA 1LBCA 3QSLA 2G29A 3KG2A 1NNFA 4F31B 2XXVA 2Q2AA 1D3KA 1GV8A 4Z0IA 3A09A 3TTLA 3K6UA 5F1QA 3I3VA 3OO6A 2H25A 4GWOA 1B32A 3ECRA 2NVUB 4KHZE 2I4BA 1OQHA 3TCGA 1BIYA 4KFQA 1B46A 2ZMBA 3FXQA 3PGFA 5AA1A 3N6TA 3V89B 4HCWA 2BJJX 4NF5A 5IKBA 3H06B 3T9HB 3SEWA 1FTOA 3DLNA 4EQBA 3H6TA 1UTBA 5I58A 3DP6A 3LSXA 3TDJA 2F5XA 4LONB 4G77A 4EQ7A 3U8QA 4F3GA 1SW5A 1IXHA 2CZLA 4IB2A 1SI0A 2IEEA 2DOJA 2UVIA 4QFNA 3IB1A 3OD7A 3PPOA 1Y1MA 4F29A 3L6GA 4ONYA 2VP1A 3CI8A 4YICA 5B7DA 4JBZA 1LAFE 3VV5A 1JW4A 4ZE8A 3QK6A 1USYH 2QMXA 4YB5A 2D3IA 4ZE9A 1PB8A 2HZKA 1NKXA 4GL8A 4OYVA 5AE4A 1ZIUA 3I5OA 3S9NC 3N6UA 1QVSA 2HAUA 1B5HA 3MVYA 3UGWA 2YJPA 1P1UA 4ZEKA 4FECA 4HCYA 3IJXB 1OVBA 5ICQA 4BDMA 3M3LA 3OSQA 2X7PA 4OZ9A 1D4NA 2QS1A 2XD2A 1IZ1A 4L17A 3TQLA 3EF7A 3QYTA 1ZMGA 1B4HA 4X9TA 3SEXA 3UK4A 2O68A 2UVHA 2I0CA 4EF2A 1S50A 2V3QA 1Y3QA 3K6WA 4EQ9A 3PU5A 5BUUA 4H5FA 1R1NA 2H98A 1EU8A 5I56A 1FQDA 1MS7A 4DZ1A 4KQPA 5H8QA 1EH3A
chains in the Genus database with same CATH superfamily
3EPEA 4QF9A 4THIA 4R75A 2Y7PA 2VD3A 4LVQA 3RT6B 4XIGQ 3CG1A 3E4RA 3THIA 2YPNA 5CI5A 2HAVA 2B4LA 2F6GA 1R9LA 1XI6A 3MBPA 1B3EA 2CMOA 3KBZA 5EYGA 1MY2A 3PUXE 1Y1ZA 4K3FA 3S9EA 4GL0A 2OBGA 1MY4A 1GR2A 1VR5A 3U92A 4M4GA 3OENA 1R6ZA 2OCUA 4NQ8A 1LAHE 3IB0A 4FEDA 2Y7WA 2Q89A 5KZTA 1LBXA 2VPOA 3H7MA 5H8NA 3TEPA 1PB9A 3IO4A 2Y7IA 5FTHA 3IFAA 3MZ9A 4GWUA 1T0KA 1TXFA 1QGXA 2ALUA 1Q9DA 1TWYA 2ONKE 3ZSFA 3FIRA 4Q8RA 1NV3A 2PX1A 1JNFA 4BDNA 5I2KB 2A5TA 4KYSA 4DLDA 1QUKA 3QXMA 4ELQA 1ZTYA 4JWYA 5EQAA 4GVOA 2V3UA 4HE1A 3SKPA 2H9BA 3UA8A 1B7HA 3V8XB 2X7QA 3TCHA 2QS4A 3VE1B 1NV7A 1YYZA 2O84X 4PF8A 2THIA 1Z7NE 2FIEA 3SETA 5JTYB 3A3CA 3QUFA 2KR0A 3OO8A 3M3FA 4U23A 5T3JA 1Q1KA 3G3JA 4WEDA 3FD3A 4NF8A 1LLSA 1I6QA 1FPBA 1H43A 4G8HA 1UQWA 1GGGA 5ET7A 4GBWA 4PQJA 4RY1A 1EZOA 1MXYA 3FXRA 3LR1A 4NG7A 3KSXA 4ZEDA 1P1NA 3D4GA 1Y3NA 4IR8A 4IO6A 4Q30B 1XT8A 3R7XA 3OOAA 1TFDA 4FORA 2Y5KA 5IZ3A 1D9VA 1MM7A 3W9WA 3TKDA 1FPFA 4GXSB 4F1UA 3K02A 3T0JA 4NWDA 4XFEA 4YB7A 4RXLA 2DXYA 3DP8A 2I49A 4QXDA 2HQ0A 5AA4B 1B7ZA 3PUYE 4H5GA 2QL3A 2I0BA 4P3LA 5AA2A 1FQAA 5F24A 2QPQA 1NI9A 5KCJB 4U1ZA 1I6BA 2E1SA 1LGBC 1VFDA 1NUXA 3FXBA 1M5BA 2Z8FA 1UIUA 1PBPA 3TQWA 3FUZA 2NUVA 4F2OA 1NV6A 5FBPA 1FBDA 3C4MA 4JSOA 4ELRA 1FBHA 5IM2A 3SZPA 2QVVA 4XXUA 3TTNA 3PUZE 4G8NA 3MP1A 5DTBA 2HXRA 1G0HA 3FJGA 1MY3A 4OTEA 3T66A 5I59B 3H6VA 3U72A 4QBAA 4KD5A 4R6KA 2V93A 1YCJA 3S2VA 1LBZA 1B51A 4NF6B 1KA1A 2XD3A 1US5A 2XX7A 1MQIA 1ZBMA 1KZ8A 5H8HB 4YKKA 3T93B 4DCXA 4KR5A 3CG3A 1B4ZA 4MCOA 4XKQA 2QVRA 1RKMA 1NNTA 2OLBA 2GHAA 3VLWA 4DXCA 3H4ZA 2O51A 1N3XA 3D1RA 2YLNA 1FPIA 2XWIA 4QSEA 1FQEA 2B4MA 4IO7A 1JW1A 4N81A 2O1MA 3TPAA 4QRZA 2QRYA 1CNQA 5DVJA 1N84A 1LFHA 3H6WA 4NF4A 4PETA 1O7TA 1ZJLA 2QS3A 4NWCA 5ELVA 4GWYA 4O3BA 4MMPA 5CMMA 4KCDA 3L6HA 4DXBA 2ZNTA 2PT2A 4F22A 5TP9A 4AB5A 5TU0A 1QULA 1SVXB 3EHUA 4UABA 1N04A 3ISPA 2QVUA 1FCKA 2ZYNA 1OIBA 4GBVA 2XHDA 3C32A 1ZU0A 4G68A 2DWHA 3S9LC 1JW5A 2ABHA 2HPGA 4MIJA 4KI0E 4MJOA 4MH5A 4OVRA 4OESA 3K1MA 1HSJA 3GYYA 3HFUA 4H8JA 3B8BA 2NOOA 5ET8A 5ESYA 1B3FA 3O66A 3DELB 3U94A 5FHMA 4U21A 3M8UA 3PMWA 4OVPA 1SW4A 1MH4A 2QSXA 3ROJA 1WODA 3UORA 1SPIA 4G68C 1HSLA 4R72A 5CM6A 4X1BA 4PTKA 4LUBA 3DP4A 3VVEA 3ODBA 4YKIA 1FBCA 1MDQA 4GWXA 2I3VA 5A5LA 1US4A 2PFZA 4GXAA 4F3BA 2OWTA 2REJA 1EZ9A 2XXUA 5A5XA 1JQFA 1RYXA 4PCDA 4RK9A 2WBDA 5L8DA 2I6EA 2Z8DA 1TT1A 2O7UA 1PC3A 1P99A 3SEVA 2AIXA 3RGYA 3CIJA 1DPPA 1SQYA 5I58B 1B7UA 5M2VA 3A29A 4NMYA 4XKRA 3TMGA 3O9PA 4KXPA 4P11A 2ZYKA 1BK4A 3MW0A 4E0WA 4I3EA 2CEXA 1FTAA 3LUYA 5ITOA 3TUSA 3MSTA 1JEUA 2GFEA 2DXRA 5L9MA 1H45A 2F34A 2OX3A 2PYYA 1B9JA 1MXWA 3MP8A 4WKMA 1SD3A 4PFBA 3EN3A 3VDFA 4FE8A 4F2QA 1IIWA 3KEIA 3ZS6A 2XXRA 3FVNA 1QUJA 3Q25A 4MAGA 2DVCA 2RKMA 4ZZAA 2HXWA 3RQTA 5EQ9A 4ESXA 2ZNUA 3T9UA 1FBGA 5JEIA 3WAFA 5BWJA 4WXJA 3C35A 2PVUA 2B3BA 1GVCA 1YPNA 5EYHA 4YB6A 5I84A 2Q8JA 4QFOA 4YU0A 1OLAA 3O6GA 4EF1A 1WVJA 2GHBA 4H67A 2KQZA 3OO7A 3CFZA 4QFPA 3ZKKA 4DI4B 1NUYA 3MVZA 3O28A 1FQFA 1B40A 1AMFA 2DE4A 3FJMA 3PMVA 4PFWA 1PBQA 3VXCA 4BDLA 1FPLA 1VDWA 4LATA 2V4CA 5I57A 2WYPA 2DWAA 3OEKA 3FASA 1QUIA 4I40A 2Z23A 3NOHA 3IK6B 3CFXA 3EQ1A 3IL1B 1MPDA 3A3UA 1AH5A 3GBBA 4JWOA 5H8FA 1RDZA 1FBEA 4PFUA 3N94A 4R74A 2M8CA 4LQ5A 4NEDA 1IUDA 2XXIA 2R6GE 2PT1A 5B70A 1FTMA 3R6UA 4PDDA 3Q26A 2A5SA 1Y4CA 3K1NA 4ZEBA 4H65A 4ZDMA 4G2ZA 3HPIA 3TFLA 3JYRA 3HHFA 4BDQA 1B0LA 1A55A 1KWHA 3IR1A 5FHOA 3RYDA 1MPBA 1EYIA 2F6PA 2IA4A 4LZ8A 3RNNA 2OWSA 3VVDA 2OZZA 4N15A 4EXKA 1TFAA 4R73A 5EHMA 3B6TA 4DE8A 3EHTA 1FQCA 4F3SA 5I2NA 3IORA 2QMWA 3KN8A 2XXYA 4OENA 5FTIA 3TELA 1IXIA 4P8BA 4JSDA 1YTVA 1LBWA 4LZ5A 4RK2A 3O2AA 1MQHA 4U2RA 3R26A 1NMUA 1FSAA 1MXXA 5I2KA 4OEVA 3HN0A 1IMBA 1B5IA 5CRYA 3C9HA 1RYOA 2FVZA 5IGAA 4N17A 3VLVA 4U22A 5LOMA 5CMKA 4PC9A 3PMXA 2DE2A 4NX1A 4YMBA 2XXTA 1MY1A 1LB9A 4F39A 4EDPA 1DTGA 2D5WA 4DDDA 1FPEA 1FTLA 3KN3A 1JEVA 4N8YA 4JB7A 4GOTA 3OXNA 4TLMB 4AS4A 5JTYA 4RPNA 4G61A 5J1DA 4GX6A 1N76A 3MAMA 3USDA 1D9YA 1UTHA 1NH7A 2H4IA 2Q8MA 4POWA 1EZPA 3MVWA 4RNSA 3U65A 5L9SA 3RLFE 3BKIB 3KOTA 1B6HA 1AOVA 5HPQA 4JVDA 4ZEIA 3ILUB 5DT6A 4QHQA 3RTFB 1MRPA 1MQGA 3BFUA 4HE2A 3SDFA 1K9YA 4GWZA 2ONRA 1LBYA 4PP0A 3T22A 4H1XA 2NXOA 3RPWA 3B50A 1XC1A 1RDXA 3MPLA 4RYAA 1B2HA 1L5TA 4FAJA 2DQVA 2HCAA 2MKZA 4OXVA 1DCUA 3LC8A 2B3FA 1B3GA 4Q5TA 2XXQA 1Q35A 1OQGA 2Y5LA 1SDXA 4ND9A 1B05A 2RC8A 2FYIA 3G3HA 3P7IA 4XTCQ 2PBWA 5AA4A 2Y7KA 3T96B 1DTZA 4X8RA 2FNCA 2Q2CA 3H6UA 3MQ9A 1O63A 1WDNA 4PE5B 4QSDA 3K4UA 4R9GA 4KYDA 3MPKA 3KJTA 3PUWE 3CVGA 4G8MA 5CBRA 4U4XA 3T9XB 5HM4B 3N26A 4C1UA 2Z8EA 5I59A 5KDTA 2VGQA 5IAIA 4NN3A 5L9OA 3IAZA 2PFYA 2PCRA 1SBPA 2DP8A 1NUWA 1NV4A 2DE3A 4ELPA 5LTCA 1R9QA 1LAXA 1JVXA 1NUZA 3EKIA 4MFIA 5H8HA 1JETA 3V83A 1MQDA 2LAOA 3FGSA 2ZYMA 3MYUA 1XVYA 1MXUA 4MNPA 5JK4A 2E0SA 4YMAA 1LFGA 1N0TA 1H3DA 1INPA 3KN7A 3SERA 3MWBA 2REGA 5CC2A 2FBPA 2P1SA 1B0HA 4GQOA 4R6HA 3MUQA 2HEUA 2VD2A 5EYFA 2F3BA 3TZAA 1S7YA 3UP9A 2I58A 5DEXB 4X48A 2XXKA 1ATGA 2F8DA 3G7WA 4RJZA 4X04A 3FVKA 3CRBA 1N3WA 3PPPA 4EUOA 1OVTA 4MHFA 4KYEA 4F1VA 4UA8A 3U93A 4RA1A 4R2FA 3WAEA 4MNIA 3PPRA 4IY6A 4BLAA 4F18A 2UVJA 3K00A 4G4PA 1NL5A 1GTKA 3IO6A 2ONSA 2D21A 5ET5A 2VPNA 2DWJA 1P1OA 5TPAB 3MZBA 4QSCA 2RCAA 1BLFA 4ZECA 3HHGA 3Q27A 2DS9A 3MVXA 2XXHA 3K6XA 3VLUA 4Q0CA 3OO9A 2FHYA 5DYHA 5DVFA 2DWIA 2UYFA 3KZGA 3MC2A 2O7IA 4BDOA 1K9ZA 1D9QA 2OWZA 1LFIA 1BKAA 1FJ6A 1Y3PA 2X26A 4NE4A 2WBBA 1RDYA 1POTA 2R8TA 4P9KA 3FVGA 1ELJA 5DVIA 3TCFA 2WYKA 3TTMA 4NGUA 4IGRA 2I48A 2DSFA 1LCFA 4IO3A 4X1DA 2XX8A 3H03A 4GIZA 3QUJA 1QKAA 1B1HA 4KCCA 2F7AA 3C31A 4OVTA 3C33A 3JZJA 1FQBA 2Q88A 1SW1A 2V25A 1M5EA 2NWJA 4PFYA 3O29A 2F78A 2RCBA 5K2YA 1B3LA 1Y4TA 4DXUA 2VHAA 1I6AA 4NF5B 4TQUQ 1NNKA 2F3DA 2R71A 5FHNA 2RF1A 4NHBA 1ZLQA 3RPLB 1PEBA 5A5XB 2V84A 1LBBA 1UTBB 4M1VA 4I1DA 3TTRA 5K2XA 1O64A 2ANJA 4UACA 1M5DA 3TODA 3TAJA 1II5A 2ZZWA 4ZEFA 2ZXTA 3G3KA 1FTKA 3OSRA 2F36A 4IO4A 5IZZA 3PUVE 4PGNA 3S4UA 4P0IA 4ELOA 4GRKA 3ILTB 3UIFA 2Q74A 1Z7ME 4FATA 2W7YA 3KBRA 3IX1A 4PE3A 4LQ2A 2AL5A 1IMCA 1FPGA 5I5PA 1A8FA 2QS2A 4EXLA 1N7WA 3T1BA 4R6YA 2OJTA 2UVGA 3CR9A 3SEYA 1URSA 3HO7A 2O6AA 2RC9A 4OMBA 5I7IA 2GH9A 4HS7A 4QFKA 4H6DA 4MBPA 2VT5A 3FJ7A 4IO5A 4JWXA 2XX9A 4H45A 4LP2B 3LBSA 4OFLA 2DYXA 2VOZA 3B7DA 4NAPA 1NV5A 1ANFA 4P47A 1NFTA 5ISUA 5H8SA 3FV1A 3G3IA 1DPEA 3IJOB 2HZLA 1B1XA 1MPCA 3BBRA 2L5VA 3OELA 2AYSA 2P3VA 1I69A 3PD9A 1LB8A 4N91A 1MM6A 1PDAA 3G3GA 3RUMA 5I57B 4O3CA 4ESWA 3KJ7A 4P1LA 3F11A 3LSLA 4H0WA 3BFTA 2F7CA 4IY5A 1IXCA 5H8FB 4ZZEA 1FBPA 5I56B 3RN8A 3K2DA 2ZYOA 1CE2A 1FPDA 1IMAA 5H8QB 4GD5A 1IITA 3E9XA 3RTWB 5AA3A 2P0SA 3V5AA 4PFIA 4N4UA 1A8EA 2I3WA 3SESA 3C36A 2HFBA 3VVFA 5IZ1A 1A7LA 3IOWA 3S9MC 3W9VA 4XF5A 2RINA 2XWOA 4I62A 1VE4A 4F19A 2AL4A 1P1QA 1URGA 5J16A 2I4CA 1VFEA 2F7BA 4NF0A 3K0VA 4ECFA 4I8CA 3FXUA 4P1EA 2WEFA 3AXFA 3PV0E 4FIMA 1MG1A 5H8NB 1VSOA 4H8IA 2ZZXA 4WEPA 5I2NB 4GX4A 2O1LA 4R2BA 3K6VA 3IOUA 1MQJA 3GBAA 4PAFA 1M5FA 2Q9TA 4GFRA 4PAKA 3LSFB 1URDA 3B6WA 1OLCA 2XWVA 3K01A 3PPQA 1NV1A 2B65A 3ZKLA 2A5TB 4JXIA 1MDP1 2F97A 5LDZA 1SW2A 3LUZA 4IO2A 4F1YA 3KSJA 4C0RA 1OMPA 3IFCA 1A99A 4IGTA 4TOZA 1FW0A 3E3KA 1J1NA 1POY1 1USYE 5ICTA 4F3PA 4OETA 2QJEA 3TTKA 4N6DA 3KOSA 1P1WA 4POXA 1SYHA 4HW8A 3CFLA 3OMBA 4MEVA 1KA0A 3HSTA 4C1TA 3MJNA 5I3SA 4N13A 1JP4A 1DK4A 4NF8B 1IMFA 3PTYA 5CMBA 4LA9A 4LZ7A 2OK2A 1QKBA 1IMEA 1UTHB 3RT8A 4P56A 3C34A 1FPKA 3M3KA 4FJPA 1MH3A 4XKPA 1EYJA 4YKPA 4OQOA 1H76A 3W15C 4BDRA 4DIGA 1NV0A 4OFOA 4GLIA 4U4SA 4YAHX 4Z7EA 3PD8A 1IQ7A 5IZ3B 4JVCA 1SI1A 1BTJA 1AIVA 2FA7A 2Z22A 2DVZA 2WKYA 3I6VA 1JVYA 3PPNA 1M5CA 3B6QA 3D4CA 3FZVA 4N07A 3FATA 1UIVA 1IXGA 3GZGA 3IB2A 4P0GA 1DOTA 1Y9UA 5KCJA 5ITPA 1XS5A 5AA2B 2XXPA 2O69A 3KC0A 1XOCA 3EHSA 4AB6A 1N7XA 2F35A 3E79A 3RY3A 1YAEA 4JDFA 3LSWA 1LCTA 1AWBA 2P2AA 3HV1A 4OFJA 4OERA 4ISUA 3GXAA 2PMSA 2CZHA 1A54A 4MLVA 3QMFA 4MF3A 3VFJA 2UXAA 1NV2A 2V3TA 4E0XA 4O8MA 3OEMA 3KFMA 4O7MA 3JV9A 4GWSA 4NTLA 1EYKA 1YXIA 1CB6A 3HCQA 4RPOA 3FV2A 3GLBA 4NF6A 1HSEA 1MY0A 5KDTB 2RC7A 1B3HA 4OANA 4OEUA 4H46A 3G3FA 2H99A 3SEUA 3VXBA 3KC1A 4MLQA 4N6PA 1MXVA 4KPTA 4AQ4A 1XVXA 4OHNA 2XA5A 3KGCA 4OWDA 4R9FA 1BP5A 4GX3A 1ZKBA 4ZS9A 2Y7RA 4DCYA 3MP6A 1H44A 5HBCA 1B52A 5DW8A 1FPJA 4PFRA 4YZZA 2R9JA 3K1PA 1B58A 1XHYA 3T9VA 1AL3A 1F9BA 1SYIA 2KLFA 1DSNA 1QJMA 3QIMA 1FTJA 2UYEA 5DEXA 2GRVA 3TYHA 2BJIA 3IOVA 3O6HA 4O3AA 2CEYA 3Q29A 5CBSA 1MXZA 3O6IA 2H5YA 4PFTA 4NF4B 3O97A 1PB7A 1NH8A 4OA4A 2Y84A 3IOTA 3U1OA 3UN6A 3Q28A 2ESNA 1A40A 1IEJA 4OVJA 1S9TA 1B5JA 5TP9B 3CSBA 5TPAA 4PGPA 5EHSA 3ONMA 4XKNA 4N6KA 5AA2D 1DMBA 1NNPA 2XXWA 3E13X 2XXXA 1LSTA 4HTGA 1FJ9A 4YKJA 3FVOA 4TLLB 4U1OA 5CMCA 3H3GA 4G68B 1IMDA 2ZNSA 4QFLA 4FEBA 2G93A 4LN5A 3MZ1A 3DM0A 3N5LA 1LAGE 1Y20A 4GF8A 5F7VA 1QW0A 4I9DA 3CSGA 3QAXA 1LBCA 2GQ1A 3QSLA 2WX9A 4OVQA 2G29A 3KG2A 1NNFA 4F31B 2XXVA 4PAIA 2Q2AA 1D3KA 1GV8A 4Z0IA 3FBPA 3A09A 3TTLA 1LEVA 3E78A 2ZZVA 3K6UA 5ET6A 5F1QA 3I3VA 3OO6A 2H25A 4GWOA 5EQ8A 1B32A 3ECRA 2NVUB 2CZKA 4KHZE 2I4BA 1OQHA 3TCGA 1BIYA 4KFQA 1B46A 2ZMBA 3FXQA 3PGFA 5AA1A 3N6TA 3V89B 4HCWA 1DBZA 2BJJX 4NF5A 5IKBA 3H06B 3T9HB 3SEWA 3LV0A 1FRPA 1FTOA 1YZ0A 3DLNA 1LBVA 3RPLA 4EQBA 3H6TA 2QFLA 1UTBA 5I58A 4DI3D 3DP6A 2CZIA 3LSXA 3TDJA 2F5XA 4LONB 4G77A 4EQ7A 3U8QA 4F3GA 4MNCA 1SW5A 1IXHA 2FIXA 2JJKA 2CZLA 4IB2A 2DDKA 4HE0A 1SI0A 3BIHA 2IEEA 2DOJA 2UVIA 5EQ7A 4QFNA 4XEQA 3IB1A 3OD7A 3PPOA 4HXVA 1Y1MA 4F29A 3L6GA 4O94A 4ONYA 4JVIA 2VP1A 4GWWA 3CI8A 4YICA 1G0IA 5B7DA 1FBFA 1LAFE 4JBZA 3VV5A 1JW4A 4ZE8A 3QK6A 1USYH 4N8GA 2QMXA 4FBPA 4YB5A 4PBQA 2D3IA 4ZE9A 1PB8A 2HZKA 2HHMA 1NKXA 4GL8A 4OYVA 5AE4A 1ZIUA 3I5OA 3S9NC 3N6UA 1QVSA 2HAUA 1B5HA 3MVYA 3UGWA 2YJPA 1P1UA 4ZEKA 4FECA 4HCYA 3IJXB 1OVBA 4O7IA 5ICQA 4BDMA 3M3LA 2XWKA 4OVSA 3OSQA 2X7PA 4OZ9A 1D4NA 2QS1A 2XD2A 1IZ1A 4L17A 3TQLA 3EF7A 3QYTA 1ZMGA 2P3NA 1B4HA 4X9TA 3CHGA 3SEXA 3UK4A 2O68A 2UVHA 2I0CA 4EF2A 1S50A 2V3QA 1Y3QA 4PF6A 3K6WA 4EQ9A 4PDHA 3PU5A 5BUUA 3BIGA 4H5FA 4PBHA 1R1NA 2H98A 1EU8A 5I56A 4I3YA 1FQDA 1MS7A 4DZ1A 4AS5A 4KQPA 4MX6A 5H8QA 1EH3A
chains in the Genus database with same CATH topology
3EPEA 4QF9A 4THIA 4R75A 2Y7PA 2VD3A 4LVQA 3RT6B 4XIGQ 3CG1A 3E4RA 3THIA 2YPNA 5CI5A 2HAVA 2F6GA 1R9LA 3MBPA 1B3EA 2CMOA 1MY2A 3PUXE 1Y1ZA 4K3FA 3S9EA 4GL0A 2OBGA 1MY4A 1GR2A 1VR5A 3U92A 4M4GA 3OENA 1R6ZA 2OCUA 1LAHE 3IB0A 4FEDA 2Y7WA 2Q89A 5KZTA 3H7MA 5H8NA 3TEPA 1PB9A 3IO4A 2Y7IA 5FTHA 3MZ9A 1T0KA 1TXFA 2ALUA 1TWYA 2ONKE 3ZSFA 3FIRA 4Q8RA 2PX1A 1JNFA 4BDNA 5I2KB 2A5TA 4KYSA 4DLDA 1QUKA 3QXMA 4ELQA 1ZTYA 4JWYA 4GVOA 2V3UA 3SKPA 2H9BA 3UA8A 1B7HA 3V8XB 2X7QA 3TCHA 2QS4A 3VE1B 2O84X 2THIA 1Z7NE 3SETA 5JTYB 3A3CA 3QUFA 3OO8A 3M3FA 4U23A 1Q1KA 3G3JA 4WEDA 3FD3A 4NF8A 1LLSA 1I6QA 1H43A 4G8HA 1UQWA 1GGGA 4RY1A 4PQJA 1EZOA 1MXYA 3FXRA 3LR1A 3KSXA 4ZEDA 1P1NA 3D4GA 1Y3NA 4IO6A 4Q30B 1XT8A 3R7XA 3OOAA 1TFDA 4FORA 1D9VA 1MM7A 3W9WA 3TKDA 4GXSB 4F1UA 3K02A 4NWDA 4YB7A 4RXLA 2DXYA 3DP8A 2I49A 2HQ0A 5AA4B 1B7ZA 3PUYE 4H5GA 2QL3A 2I0BA 5AA2A 1FQAA 2QPQA 5KCJB 4U1ZA 1I6BA 2E1SA 1LGBC 1VFDA 1M5BA 2Z8FA 1UIUA 1PBPA 3TQWA 3FUZA 2NUVA 4F2OA 3C4MA 4JSOA 4ELRA 4XXUA 3TTNA 3PUZE 4G8NA 3MP1A 5DTBA 3FJGA 1MY3A 4OTEA 3T66A 5I59B 3H6VA 3U72A 4KD5A 4R6KA 2V93A 1YCJA 3S2VA 1B51A 4NF6B 2XD3A 1US5A 2XX7A 1MQIA 1ZBMA 5H8HB 4YKKA 3T93B 4DCXA 4KR5A 3CG3A 1B4ZA 4XKQA 1RKMA 1NNTA 2OLBA 2GHAA 3VLWA 4DXCA 3H4ZA 2O51A 1N3XA 2YLNA 4QSEA 1FQEA 4IO7A 1JW1A 2O1MA 3TPAA 4QRZA 2QRYA 5DVJA 1N84A 1LFHA 3H6WA 4NF4A 4PETA 1O7TA 1ZJLA 2QS3A 4NWCA 5ELVA 4O3BA 5CMMA 4KCDA 3L6HA 4DXBA 2ZNTA 2PT2A 4F22A 5TP9A 4AB5A 5TU0A 1QULA 1SVXB 3EHUA 1N04A 1FCKA 2ZYNA 1OIBA 2XHDA 3C32A 1ZU0A 4G68A 2DWHA 3S9LC 1JW5A 2ABHA 4KI0E 4MH5A 4OESA 3K1MA 1HSJA 4H8JA 2NOOA 1B3FA 3O66A 3DELB 3U94A 5FHMA 4U21A 3M8UA 3PMWA 1SW4A 1MH4A 2QSXA 1WODA 3UORA 4G68C 1HSLA 4R72A 5CM6A 4X1BA 4LUBA 3DP4A 3VVEA 3ODBA 4YKIA 1MDQA 2I3VA 1US4A 4GXAA 4F3BA 2OWTA 2REJA 1EZ9A 2XXUA 5A5XA 1JQFA 1RYXA 4RK9A 5L8DA 2I6EA 2Z8DA 1TT1A 2O7UA 1PC3A 1P99A 3SEVA 2AIXA 3RGYA 3CIJA 1DPPA 1SQYA 5I58B 1B7UA 5M2VA 4NMYA 4XKRA 3TMGA 3O9PA 4P11A 2ZYKA 3MW0A 4E0WA 3LUYA 5ITOA 3TUSA 1JEUA 2GFEA 2DXRA 5L9MA 1H45A 2F34A 2PYYA 1B9JA 1MXWA 3MP8A 4WKMA 1SD3A 3EN3A 3VDFA 4FE8A 4F2QA 1IIWA 3KEIA 3ZS6A 2XXRA 3FVNA 1QUJA 3Q25A 2DVCA 2RKMA 4ZZAA 2HXWA 3RQTA 4ESXA 2ZNUA 3T9UA 5JEIA 3WAFA 5BWJA 4WXJA 3C35A 2PVUA 2B3BA 1GVCA 1YPNA 4YB6A 5I84A 2Q8JA 4QFOA 4YU0A 1OLAA 3O6GA 4EF1A 1WVJA 2GHBA 4H67A 3OO7A 3CFZA 4QFPA 3ZKKA 3MVZA 3O28A 1FQFA 1B40A 1AMFA 2DE4A 3FJMA 3PMVA 4PFWA 1PBQA 3VXCA 4BDLA 4LATA 5I57A 2DWAA 3OEKA 3FASA 1QUIA 2Z23A 3IK6B 3CFXA 3EQ1A 3IL1B 1MPDA 3A3UA 1AH5A 3GBBA 4JWOA 5H8FA 4PFUA 3N94A 4R74A 2M8CA 4LQ5A 4NEDA 1IUDA 2XXIA 2R6GE 2PT1A 5B70A 1FTMA 3R6UA 3Q26A 2A5SA 1Y4CA 3K1NA 4ZEBA 4H65A 4ZDMA 4G2ZA 3HPIA 3TFLA 3JYRA 3HHFA 4BDQA 1B0LA 1A55A 1KWHA 3IR1A 5FHOA 1MPBA 2F6PA 2IA4A 4LZ8A 3RNNA 2OWSA 3VVDA 2OZZA 4EXKA 1TFAA 4R73A 5EHMA 3B6TA 4DE8A 3EHTA 1FQCA 4F3SA 5I2NA 3IORA 2QMWA 3KN8A 2XXYA 4OENA 5FTIA 3TELA 1IXIA 4JSDA 1YTVA 4LZ5A 4RK2A 3O2AA 1MQHA 4U2RA 3R26A 1NMUA 1MXXA 5I2KA 4OEVA 3HN0A 1B5IA 5CRYA 3C9HA 1RYOA 3VLVA 4U22A 5LOMA 5CMKA 3PMXA 2DE2A 4YMBA 2XXTA 1MY1A 1LB9A 4F39A 4EDPA 1DTGA 2D5WA 4DDDA 1FTLA 3KN3A 1JEVA 4JB7A 4GOTA 3OXNA 4TLMB 5JTYA 4RPNA 5J1DA 1N76A 3MAMA 3USDA 1D9YA 1UTHA 1NH7A 2H4IA 4POWA 1EZPA 3MVWA 4RNSA 5L9SA 3RLFE 3BKIB 3KOTA 1B6HA 1AOVA 5HPQA 4ZEIA 3ILUB 5DT6A 4QHQA 3RTFB 1MRPA 1MQGA 3BFUA 3SDFA 2ONRA 3T22A 4PP0A 4H1XA 2NXOA 3RPWA 1XC1A 3MPLA 4RYAA 1B2HA 1L5TA 4FAJA 2DQVA 2HCAA 4OXVA 3LC8A 2B3FA 1B3GA 4Q5TA 2XXQA 1Q35A 1OQGA 1SDXA 4ND9A 1B05A 2RC8A 2FYIA 3G3HA 3P7IA 4XTCQ 2PBWA 5AA4A 2Y7KA 3T96B 1DTZA 2FNCA 2Q2CA 3H6UA 3MQ9A 1O63A 1WDNA 4PE5B 4QSDA 3K4UA 4R9GA 4KYDA 3MPKA 3KJTA 3PUWE 3CVGA 4G8MA 5CBRA 4U4XA 3T9XB 5HM4B 3N26A 4C1UA 2Z8EA 5I59A 5KDTA 2VGQA 5IAIA 5L9OA 3IAZA 1SBPA 2DP8A 2DE3A 4ELPA 1R9QA 1LAXA 1JVXA 4MFIA 5H8HA 1JETA 3V83A 1MQDA 2LAOA 3FGSA 2ZYMA 1XVYA 1MXUA 5JK4A 2E0SA 4YMAA 1LFGA 1N0TA 1H3DA 3KN7A 3SERA 3MWBA 2REGA 5CC2A 2P1SA 1B0HA 4GQOA 4R6HA 3MUQA 2HEUA 2VD2A 5EYFA 3TZAA 1S7YA 3UP9A 2I58A 5DEXB 4X48A 1ATGA 2F8DA 3G7WA 4RJZA 3FVKA 3CRBA 1N3WA 3PPPA 4EUOA 1OVTA 4KYEA 4F1VA 4UA8A 3U93A 4RA1A 4R2FA 3WAEA 3PPRA 4IY6A 4BLAA 4F18A 2UVJA 3K00A 4G4PA 1NL5A 1GTKA 3IO6A 2ONSA 2D21A 2DWJA 1P1OA 5TPAB 3MZBA 4QSCA 2RCAA 1BLFA 4ZECA 3HHGA 3Q27A 2DS9A 3MVXA 2XXHA 3K6XA 3VLUA 4Q0CA 3OO9A 5DYHA 5DVFA 2DWIA 2UYFA 3KZGA 3MC2A 2O7IA 4BDOA 1LFIA 1BKAA 1Y3PA 2X26A 4NE4A 1POTA 3FVGA 1ELJA 5DVIA 3TCFA 3TTMA 4IGRA 2I48A 2DSFA 1LCFA 4IO3A 4X1DA 2XX8A 3H03A 4GIZA 3QUJA 1QKAA 1B1HA 4KCCA 2F7AA 3C31A 3C33A 3JZJA 1FQBA 2Q88A 1SW1A 2V25A 1M5EA 2NWJA 4PFYA 3O29A 2F78A 2RCBA 5K2YA 1B3LA 1Y4TA 4DXUA 2VHAA 1I6AA 4NF5B 4TQUQ 1NNKA 2R71A 5FHNA 2RF1A 1ZLQA 1PEBA 5A5XB 2V84A 1LBBA 1UTBB 4M1VA 4I1DA 3TTRA 5K2XA 1O64A 2ANJA 4UACA 1M5DA 3TODA 3TAJA 1II5A 4ZEFA 2ZXTA 3G3KA 1FTKA 3OSRA 2F36A 4IO4A 3PUVE 3S4UA 4P0IA 4ELOA 4GRKA 3ILTB 3UIFA 1Z7ME 4FATA 2W7YA 3KBRA 3IX1A 4LQ2A 2AL5A 1A8FA 2QS2A 4EXLA 1N7WA 4R6YA 2OJTA 2UVGA 3CR9A 3SEYA 1URSA 3HO7A 2O6AA 2RC9A 4OMBA 2GH9A 4HS7A 4QFKA 4H6DA 4MBPA 3FJ7A 4IO5A 4JWXA 2XX9A 4LP2B 4OFLA 3LBSA 2DYXA 2VOZA 3B7DA 1ANFA 1NFTA 5ISUA 5H8SA 3FV1A 3G3IA 1DPEA 3IJOB 2HZLA 1B1XA 1MPCA 3BBRA 3OELA 2AYSA 1I69A 3PD9A 1LB8A 1MM6A 1PDAA 3G3GA 3RUMA 5I57B 4O3CA 4ESWA 3KJ7A 3F11A 3LSLA 4H0WA 3BFTA 2F7CA 4IY5A 1IXCA 5H8FB 4ZZEA 5I56B 3RN8A 3K2DA 2ZYOA 1CE2A 5H8QB 4GD5A 1IITA 3E9XA 3RTWB 5AA3A 2P0SA 3V5AA 1A8EA 2I3WA 3SESA 3C36A 2HFBA 3VVFA 1A7LA 3IOWA 3S9MC 3W9VA 2RINA 4I62A 1VE4A 4F19A 2AL4A 1P1QA 1URGA 2I4CA 1VFEA 2F7BA 3K0VA 4ECFA 4I8CA 3FXUA 3AXFA 3PV0E 4FIMA 1MG1A 5H8NB 1VSOA 4H8IA 4WEPA 5I2NB 2O1LA 4R2BA 3K6VA 3IOUA 1MQJA 3GBAA 1M5FA 2Q9TA 4GFRA 3LSFB 1URDA 3B6WA 1OLCA 3K01A 3PPQA 2B65A 3ZKLA 2A5TB 4JXIA 1MDP1 2F97A 1SW2A 4IO2A 4F1YA 3KSJA 4C0RA 1OMPA 1A99A 4IGTA 4TOZA 1FW0A 3E3KA 1J1NA 1POY1 1USYE 5ICTA 4F3PA 4OETA 2QJEA 3TTKA 3KOSA 1P1WA 4POXA 1SYHA 4HW8A 3CFLA 3OMBA 3HSTA 4C1TA 3MJNA 4N13A 4NF8B 5CMBA 4LA9A 4LZ7A 2OK2A 1QKBA 1UTHB 3RT8A 3C34A 3M3KA 4FJPA 1MH3A 4XKPA 4YKPA 4OQOA 1H76A 3W15C 4BDRA 4DIGA 4OFOA 4GLIA 4U4SA 4YAHX 4Z7EA 3PD8A 1IQ7A 1SI1A 1BTJA 1AIVA 2FA7A 2Z22A 2DVZA 2WKYA 3I6VA 1JVYA 3PPNA 1M5CA 3B6QA 3D4CA 3FZVA 4N07A 3FATA 1UIVA 1IXGA 3GZGA 3IB2A 4P0GA 1DOTA 1Y9UA 5KCJA 5ITPA 1XS5A 5AA2B 2XXPA 2O69A 1XOCA 3EHSA 4AB6A 1N7XA 2F35A 3RY3A 1YAEA 4JDFA 3LSWA 1LCTA 2P2AA 3HV1A 4OFJA 4OERA 4ISUA 3GXAA 2PMSA 1A54A 4MLVA 4MF3A 3VFJA 2UXAA 2V3TA 4E0XA 3OEMA 3KFMA 3JV9A 4NTLA 1CB6A 3HCQA 4RPOA 3FV2A 3GLBA 4NF6A 1HSEA 1MY0A 5KDTB 2RC7A 1B3HA 4OEUA 3G3FA 2H99A 3SEUA 3VXBA 4MLQA 4N6PA 1MXVA 4KPTA 4AQ4A 1XVXA 4OHNA 3KGCA 4OWDA 4R9FA 1BP5A 1ZKBA 4ZS9A 2Y7RA 4DCYA 3MP6A 1H44A 5HBCA 1B52A 4YZZA 2R9JA 3K1PA 1B58A 1XHYA 3T9VA 1AL3A 1F9BA 1SYIA 2KLFA 1DSNA 1QJMA 3QIMA 1FTJA 2UYEA 5DEXA 2GRVA 3TYHA 3IOVA 3O6HA 4O3AA 3Q29A 5CBSA 1MXZA 3O6IA 2H5YA 4PFTA 4NF4B 3O97A 1PB7A 1NH8A 2Y84A 3IOTA 3U1OA 3UN6A 3Q28A 2ESNA 1A40A 1IEJA 4OVJA 1S9TA 1B5JA 5TP9B 3CSBA 5TPAA 5EHSA 3ONMA 4XKNA 5AA2D 1DMBA 1NNPA 2XXWA 3E13X 2XXXA 1LSTA 4HTGA 4YKJA 3FVOA 4TLLB 4U1OA 5CMCA 3H3GA 4G68B 2ZNSA 4QFLA 4FEBA 2G93A 3MZ1A 3DM0A 3N5LA 1LAGE 1Y20A 4GF8A 5F7VA 1QW0A 4I9DA 3CSGA 3QAXA 1LBCA 3QSLA 2G29A 3KG2A 1NNFA 4F31B 2XXVA 2Q2AA 1D3KA 1GV8A 4Z0IA 3A09A 3TTLA 3K6UA 5F1QA 3I3VA 3OO6A 2H25A 4GWOA 1B32A 3ECRA 2NVUB 4KHZE 2I4BA 1OQHA 3TCGA 1BIYA 4KFQA 1B46A 2ZMBA 3FXQA 3PGFA 5AA1A 3N6TA 3V89B 4HCWA 2BJJX 4NF5A 5IKBA 3H06B 3T9HB 3SEWA 1FTOA 3DLNA 4EQBA 3H6TA 1UTBA 5I58A 3DP6A 3LSXA 3TDJA 2F5XA 4LONB 4G77A 4EQ7A 3U8QA 4F3GA 1SW5A 1IXHA 2CZLA 4IB2A 1SI0A 2IEEA 2DOJA 2UVIA 4QFNA 3IB1A 3OD7A 3PPOA 1Y1MA 4F29A 3L6GA 4ONYA 2VP1A 3CI8A 4YICA 5B7DA 4JBZA 1LAFE 3VV5A 1JW4A 4ZE8A 3QK6A 1USYH 2QMXA 4YB5A 2D3IA 4ZE9A 1PB8A 2HZKA 1NKXA 4GL8A 4OYVA 5AE4A 1ZIUA 3I5OA 3S9NC 3N6UA 1QVSA 2HAUA 1B5HA 3MVYA 3UGWA 2YJPA 1P1UA 4ZEKA 4FECA 4HCYA 3IJXB 1OVBA 5ICQA 4BDMA 3M3LA 3OSQA 2X7PA 4OZ9A 1D4NA 2QS1A 2XD2A 1IZ1A 4L17A 3TQLA 3EF7A 3QYTA 1ZMGA 1B4HA 4X9TA 3SEXA 3UK4A 2O68A 2UVHA 2I0CA 4EF2A 1S50A 2V3QA 1Y3QA 3K6WA 4EQ9A 3PU5A 5BUUA 4H5FA 1R1NA 2H98A 1EU8A 5I56A 1FQDA 1MS7A 4DZ1A 4KQPA 5H8QA 1EH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPE A;  4QF9 A;  4THI A;  4R75 A;  2Y7P A;  2VD3 A;  4LVQ A;  3RT6 B;  4XIG Q;  3CG1 A;  3E4R A;  3THI A;  2YPN A;  5CI5 A;  2HAV A;  2F6G A;  1R9L A;  3MBP A;  1B3E A;  2CMO A;  1MY2 A;  3PUX E;  1Y1Z A;  4K3F A;  3S9E A;  4GL0 A;  2OBG A;  1MY4 A;  1GR2 A;  1VR5 A;  3U92 A;  4M4G A;  3OEN A;  1R6Z A;  2OCU A;  1LAH E;  3IB0 A;  4FED A;  2Y7W A;  2Q89 A;  5KZT A;  3H7M A;  5H8N A;  3TEP A;  1PB9 A;  3IO4 A;  2Y7I A;  5FTH A;  3MZ9 A;  1T0K A;  1TXF A;  2ALU A;  1TWY A;  2ONK E;  3ZSF A;  3FIR A;  4Q8R A;  2PX1 A;  1JNF A;  4BDN A;  5I2K B;  2A5T A;  4KYS A;  4DLD A;  1QUK A;  3QXM A;  4ELQ A;  1ZTY A;  4JWY A;  4GVO A;  2V3U A;  3SKP A;  2H9B A;  3UA8 A;  1B7H A;  3V8X B;  2X7Q A;  3TCH A;  2QS4 A;  3VE1 B;  2O84 X;  2THI A;  1Z7N E;  3SET A;  5JTY B;  3A3C A;  3QUF A;  3OO8 A;  3M3F A;  4U23 A;  1Q1K A;  3G3J A;  4WED A;  3FD3 A;  4NF8 A;  1LLS A;  1I6Q A;  1H43 A;  4G8H A;  1UQW A;  1GGG A;  4RY1 A;  4PQJ A;  1EZO A;  1MXY A;  3FXR A;  3LR1 A;  3KSX A;  4ZED A;  1P1N A;  3D4G A;  1Y3N A;  4IO6 A;  4Q30 B;  1XT8 A;  3R7X A;  3OOA A;  1TFD A;  4FOR A;  1D9V A;  1MM7 A;  3W9W A;  3TKD A;  4GXS B;  4F1U A;  3K02 A;  4NWD A;  4YB7 A;  4RXL A;  2DXY A;  3DP8 A;  2I49 A;  2HQ0 A;  5AA4 B;  1B7Z A;  3PUY E;  4H5G A;  2QL3 A;  2I0B A;  5AA2 A;  1FQA A;  2QPQ A;  5KCJ B;  4U1Z A;  1I6B A;  2E1S A;  1LGB C;  1VFD A;  1M5B A;  2Z8F A;  1UIU A;  1PBP A;  3TQW A;  3FUZ A;  2NUV A;  4F2O A;  3C4M A;  4JSO A;  4ELR A;  4XXU A;  3TTN A;  3PUZ E;  4G8N A;  3MP1 A;  5DTB A;  3FJG A;  1MY3 A;  4OTE A;  3T66 A;  5I59 B;  3H6V A;  3U72 A;  4KD5 A;  4R6K A;  2V93 A;  1YCJ A;  3S2V A;  1B51 A;  4NF6 B;  2XD3 A;  1US5 A;  2XX7 A;  1MQI A;  1ZBM A;  5H8H B;  4YKK A;  3T93 B;  4DCX A;  4KR5 A;  3CG3 A;  1B4Z A;  4XKQ A;  1RKM A;  1NNT A;  2OLB A;  2GHA A;  3VLW A;  4DXC A;  3H4Z A;  2O51 A;  1N3X A;  2YLN A;  4QSE A;  1FQE A;  4IO7 A;  1JW1 A;  2O1M A;  3TPA A;  4QRZ A;  2QRY A;  5DVJ A;  1N84 A;  1LFH A;  3H6W A;  4NF4 A;  4PET A;  1O7T A;  1ZJL A;  2QS3 A;  4NWC A;  5ELV A;  4O3B A;  5CMM A;  4KCD A;  3L6H A;  4DXB A;  2ZNT A;  2PT2 A;  4F22 A;  5TP9 A;  4AB5 A;  5TU0 A;  1QUL A;  1SVX B;  3EHU A;  1N04 A;  1FCK A;  2ZYN A;  1OIB A;  2XHD A;  3C32 A;  1ZU0 A;  4G68 A;  2DWH A;  3S9L C;  1JW5 A;  2ABH A;  4KI0 E;  4MH5 A;  4OES A;  3K1M A;  1HSJ A;  4H8J A;  2NOO A;  1B3F A;  3O66 A;  3DEL B;  3U94 A;  5FHM A;  4U21 A;  3M8U A;  3PMW A;  1SW4 A;  1MH4 A;  2QSX A;  1WOD A;  3UOR A;  4G68 C;  1HSL A;  4R72 A;  5CM6 A;  4X1B A;  4LUB A;  3DP4 A;  3VVE A;  3ODB A;  4YKI A;  1MDQ A;  2I3V A;  1US4 A;  4GXA A;  4F3B A;  2OWT A;  2REJ A;  1EZ9 A;  2XXU A;  5A5X A;  1JQF A;  1RYX A;  4RK9 A;  5L8D A;  2I6E A;  2Z8D A;  1TT1 A;  2O7U A;  1PC3 A;  1P99 A;  3SEV A;  2AIX A;  3RGY A;  3CIJ A;  1DPP A;  1SQY A;  5I58 B;  1B7U A;  5M2V A;  4NMY A;  4XKR A;  3TMG A;  3O9P A;  4P11 A;  2ZYK A;  3MW0 A;  4E0W A;  3LUY A;  5ITO A;  3TUS A;  1JEU A;  2GFE A;  2DXR A;  5L9M A;  1H45 A;  2F34 A;  2PYY A;  1B9J A;  1MXW A;  3MP8 A;  4WKM A;  1SD3 A;  3EN3 A;  3VDF A;  4FE8 A;  4F2Q A;  1IIW A;  3KEI A;  3ZS6 A;  2XXR A;  3FVN A;  1QUJ A;  3Q25 A;  2DVC A;  2RKM A;  4ZZA A;  2HXW A;  3RQT A;  4ESX A;  2ZNU A;  3T9U A;  5JEI A;  3WAF A;  5BWJ A;  4WXJ A;  3C35 A;  2PVU A;  2B3B A;  1GVC A;  1YPN A;  4YB6 A;  5I84 A;  2Q8J A;  4QFO A;  4YU0 A;  1OLA A;  3O6G A;  4EF1 A;  1WVJ A;  2GHB A;  4H67 A;  3OO7 A;  3CFZ A;  4QFP A;  3ZKK A;  3MVZ A;  3O28 A;  1FQF A;  1B40 A;  1AMF A;  2DE4 A;  3FJM A;  3PMV A;  4PFW A;  1PBQ A;  3VXC A;  4BDL A;  4LAT A;  5I57 A;  2DWA A;  3OEK A;  3FAS A;  1QUI A;  2Z23 A;  3IK6 B;  3CFX A;  3EQ1 A;  3IL1 B;  1MPD A;  3A3U A;  1AH5 A;  3GBB A;  4JWO A;  5H8F A;  4PFU A;  3N94 A;  4R74 A;  2M8C A;  4LQ5 A;  4NED A;  1IUD A;  2XXI A;  2R6G E;  2PT1 A;  5B70 A;  1FTM A;  3R6U A;  3Q26 A;  2A5S A;  1Y4C A;  3K1N A;  4ZEB A;  4H65 A;  4ZDM A;  4G2Z A;  3HPI A;  3TFL A;  3JYR A;  3HHF A;  4BDQ A;  1B0L A;  1A55 A;  1KWH A;  3IR1 A;  5FHO A;  1MPB A;  2F6P A;  2IA4 A;  4LZ8 A;  3RNN A;  2OWS A;  3VVD A;  2OZZ A;  4EXK A;  1TFA A;  4R73 A;  5EHM A;  3B6T A;  4DE8 A;  3EHT A;  1FQC A;  4F3S A;  5I2N A;  3IOR A;  2QMW A;  3KN8 A;  2XXY A;  4OEN A;  5FTI A;  3TEL A;  1IXI A;  4JSD A;  1YTV A;  4LZ5 A;  4RK2 A;  3O2A A;  1MQH A;  4U2R A;  3R26 A;  1NMU A;  1MXX A;  5I2K A;  4OEV A;  3HN0 A;  1B5I A;  5CRY A;  3C9H A;  1RYO A;  3VLV A;  4U22 A;  5LOM A;  5CMK A;  3PMX A;  2DE2 A;  4YMB A;  2XXT A;  1MY1 A;  1LB9 A;  4F39 A;  4EDP A;  1DTG A;  2D5W A;  4DDD A;  1FTL A;  3KN3 A;  1JEV A;  4JB7 A;  4GOT A;  3OXN A;  4TLM B;  5JTY A;  4RPN A;  5J1D A;  1N76 A;  3MAM A;  3USD A;  1D9Y A;  1UTH A;  1NH7 A;  2H4I A;  4POW A;  1EZP A;  3MVW A;  4RNS A;  5L9S A;  3RLF E;  3BKI B;  3KOT A;  1B6H A;  1AOV A;  5HPQ A;  4ZEI A;  3ILU B;  5DT6 A;  4QHQ A;  3RTF B;  1MRP A;  1MQG A;  3BFU A;  3SDF A;  2ONR A;  3T22 A;  4PP0 A;  4H1X A;  2NXO A;  3RPW A;  1XC1 A;  3MPL A;  4RYA A;  1B2H A;  1L5T A;  4FAJ A;  2DQV A;  2HCA A;  4OXV A;  3LC8 A;  2B3F A;  1B3G A;  4Q5T A;  2XXQ A;  1Q35 A;  1OQG A;  1SDX A;  4ND9 A;  1B05 A;  2RC8 A;  2FYI A;  3G3H A;  3P7I A;  4XTC Q;  2PBW A;  5AA4 A;  2Y7K A;  3T96 B;  1DTZ A;  2FNC A;  2Q2C A;  3H6U A;  3MQ9 A;  1O63 A;  1WDN A;  4PE5 B;  4QSD A;  3K4U A;  4R9G A;  4KYD A;  3MPK A;  3KJT A;  3PUW E;  3CVG A;  4G8M A;  5CBR A;  4U4X A;  3T9X B;  5HM4 B;  3N26 A;  4C1U A;  2Z8E A;  5I59 A;  5KDT A;  2VGQ A;  5IAI A;  5L9O A;  3IAZ A;  1SBP A;  2DP8 A;  2DE3 A;  4ELP A;  1R9Q A;  1LAX A;  1JVX A;  4MFI A;  5H8H A;  1JET A;  3V83 A;  1MQD A;  2LAO A;  3FGS A;  2ZYM A;  1XVY A;  1MXU A;  5JK4 A;  2E0S A;  4YMA A;  1LFG A;  1N0T A;  1H3D A;  3KN7 A;  3SER A;  3MWB A;  2REG A;  5CC2 A;  2P1S A;  1B0H A;  4GQO A;  4R6H A;  3MUQ A;  2HEU A;  2VD2 A;  5EYF A;  3TZA A;  1S7Y A;  3UP9 A;  2I58 A;  5DEX B;  4X48 A;  1ATG A;  2F8D A;  3G7W A;  4RJZ A;  3FVK A;  3CRB A;  1N3W A;  3PPP A;  4EUO A;  1OVT A;  4KYE A;  4F1V A;  4UA8 A;  3U93 A;  4RA1 A;  4R2F A;  3WAE A;  3PPR A;  4IY6 A;  4BLA A;  4F18 A;  2UVJ A;  3K00 A;  4G4P A;  1NL5 A;  1GTK A;  3IO6 A;  2ONS A;  2D21 A;  2DWJ A;  1P1O A;  5TPA B;  3MZB A;  4QSC A;  2RCA A;  1BLF A;  4ZEC A;  3HHG A;  3Q27 A;  2DS9 A;  3MVX A;  2XXH A;  3K6X A;  3VLU A;  4Q0C A;  3OO9 A;  5DYH A;  5DVF A;  2DWI A;  2UYF A;  3KZG A;  3MC2 A;  2O7I A;  4BDO A;  1LFI A;  1BKA A;  1Y3P A;  2X26 A;  4NE4 A;  1POT A;  3FVG A;  1ELJ A;  5DVI A;  3TCF A;  3TTM A;  4IGR A;  2I48 A;  2DSF A;  1LCF A;  4IO3 A;  4X1D A;  2XX8 A;  3H03 A;  4GIZ A;  3QUJ A;  1QKA A;  1B1H A;  4KCC A;  2F7A A;  3C31 A;  3C33 A;  3JZJ A;  1FQB A;  2Q88 A;  1SW1 A;  2V25 A;  1M5E A;  2NWJ A;  4PFY A;  3O29 A;  2F78 A;  2RCB A;  5K2Y A;  1B3L A;  1Y4T A;  4DXU A;  2VHA A;  1I6A A;  4NF5 B;  4TQU Q;  1NNK A;  2R71 A;  5FHN A;  2RF1 A;  1ZLQ A;  1PEB A;  5A5X B;  2V84 A;  1LBB A;  1UTB B;  4M1V A;  4I1D A;  3TTR A;  5K2X A;  1O64 A;  2ANJ A;  4UAC A;  1M5D A;  3TOD A;  3TAJ A;  1II5 A;  4ZEF A;  2ZXT A;  3G3K A;  1FTK A;  3OSR A;  2F36 A;  4IO4 A;  3PUV E;  3S4U A;  4P0I A;  4ELO A;  4GRK A;  3ILT B;  3UIF A;  1Z7M E;  4FAT A;  2W7Y A;  3KBR A;  3IX1 A;  4LQ2 A;  2AL5 A;  1A8F A;  2QS2 A;  4EXL A;  1N7W A;  4R6Y A;  2OJT A;  2UVG A;  3CR9 A;  3SEY A;  1URS A;  3HO7 A;  2O6A A;  2RC9 A;  4OMB A;  2GH9 A;  4HS7 A;  4QFK A;  4H6D A;  4MBP A;  3FJ7 A;  4IO5 A;  4JWX A;  2XX9 A;  4LP2 B;  4OFL A;  3LBS A;  2DYX A;  2VOZ A;  3B7D A;  1ANF A;  1NFT A;  5ISU A;  5H8S A;  3FV1 A;  3G3I A;  1DPE A;  3IJO B;  2HZL A;  1B1X A;  1MPC A;  3BBR A;  3OEL A;  2AYS A;  1I69 A;  3PD9 A;  1LB8 A;  1MM6 A;  1PDA A;  3G3G A;  3RUM A;  5I57 B;  4O3C A;  4ESW A;  3KJ7 A;  3F11 A;  3LSL A;  4H0W A;  3BFT A;  2F7C A;  4IY5 A;  1IXC A;  5H8F B;  4ZZE A;  5I56 B;  3RN8 A;  3K2D A;  2ZYO A;  1CE2 A;  5H8Q B;  4GD5 A;  1IIT A;  3E9X A;  3RTW B;  5AA3 A;  2P0S A;  3V5A A;  1A8E A;  2I3W A;  3SES A;  3C36 A;  2HFB A;  3VVF A;  1A7L A;  3IOW A;  3S9M C;  3W9V A;  2RIN A;  4I62 A;  1VE4 A;  4F19 A;  2AL4 A;  1P1Q A;  1URG A;  2I4C A;  1VFE A;  2F7B A;  3K0V A;  4ECF A;  4I8C A;  3FXU A;  3AXF A;  3PV0 E;  4FIM A;  1MG1 A;  5H8N B;  1VSO A;  4H8I A;  4WEP A;  5I2N B;  2O1L A;  4R2B A;  3K6V A;  3IOU A;  1MQJ A;  3GBA A;  1M5F A;  2Q9T A;  4GFR A;  3LSF B;  1URD A;  3B6W A;  1OLC A;  3K01 A;  3PPQ A;  2B65 A;  3ZKL A;  2A5T B;  4JXI A;  1MDP 1;  2F97 A;  1SW2 A;  4IO2 A;  4F1Y A;  3KSJ A;  4C0R A;  1OMP A;  1A99 A;  4IGT A;  4TOZ A;  1FW0 A;  3E3K A;  1J1N A;  1POY 1;  1USY E;  5ICT A;  4F3P A;  4OET A;  2QJE A;  3TTK A;  3KOS A;  1P1W A;  4POX A;  1SYH A;  4HW8 A;  3CFL A;  3OMB A;  3HST A;  4C1T A;  3MJN A;  4N13 A;  4NF8 B;  5CMB A;  4LA9 A;  4LZ7 A;  2OK2 A;  1QKB A;  1UTH B;  3RT8 A;  3C34 A;  3M3K A;  4FJP A;  1MH3 A;  4XKP A;  4YKP A;  4OQO A;  1H76 A;  3W15 C;  4BDR A;  4DIG A;  4OFO A;  4GLI A;  4U4S A;  4YAH X;  4Z7E A;  3PD8 A;  1IQ7 A;  1SI1 A;  1BTJ A;  1AIV A;  2FA7 A;  2Z22 A;  2DVZ A;  2WKY A;  3I6V A;  1JVY A;  3PPN A;  1M5C A;  3B6Q A;  3D4C A;  3FZV A;  4N07 A;  3FAT A;  1UIV A;  1IXG A;  3GZG A;  3IB2 A;  4P0G A;  1DOT A;  1Y9U A;  5KCJ A;  5ITP A;  1XS5 A;  5AA2 B;  2XXP A;  2O69 A;  1XOC A;  3EHS A;  4AB6 A;  1N7X A;  2F35 A;  3RY3 A;  1YAE A;  4JDF A;  3LSW A;  1LCT A;  2P2A A;  3HV1 A;  4OFJ A;  4OER A;  4ISU A;  3GXA A;  2PMS A;  1A54 A;  4MLV A;  4MF3 A;  3VFJ A;  2UXA A;  2V3T A;  4E0X A;  3OEM A;  3KFM A;  3JV9 A;  4NTL A;  1CB6 A;  3HCQ A;  4RPO A;  3FV2 A;  3GLB A;  4NF6 A;  1HSE A;  1MY0 A;  5KDT B;  2RC7 A;  1B3H A;  4OEU A;  3G3F A;  2H99 A;  3SEU A;  3VXB A;  4MLQ A;  4N6P A;  1MXV A;  4KPT A;  4AQ4 A;  1XVX A;  4OHN A;  3KGC A;  4OWD A;  4R9F A;  1BP5 A;  1ZKB A;  4ZS9 A;  2Y7R A;  4DCY A;  3MP6 A;  1H44 A;  5HBC A;  1B52 A;  4YZZ A;  2R9J A;  3K1P A;  1B58 A;  1XHY A;  3T9V A;  1AL3 A;  1F9B A;  1SYI A;  2KLF A;  1DSN A;  1QJM A;  3QIM A;  1FTJ A;  2UYE A;  5DEX A;  2GRV A;  3TYH A;  3IOV A;  3O6H A;  4O3A A;  3Q29 A;  5CBS A;  1MXZ A;  3O6I A;  2H5Y A;  4PFT A;  4NF4 B;  3O97 A;  1PB7 A;  1NH8 A;  2Y84 A;  3IOT A;  3U1O A;  3UN6 A;  3Q28 A;  2ESN A;  1A40 A;  1IEJ A;  4OVJ A;  1S9T A;  1B5J A;  5TP9 B;  3CSB A;  5TPA A;  5EHS A;  3ONM A;  4XKN A;  5AA2 D;  1DMB A;  1NNP A;  2XXW A;  3E13 X;  2XXX A;  1LST A;  4HTG A;  4YKJ A;  3FVO A;  4TLL B;  4U1O A;  5CMC A;  3H3G A;  4G68 B;  2ZNS A;  4QFL A;  4FEB A;  2G93 A;  3MZ1 A;  3DM0 A;  3N5L A;  1LAG E;  1Y20 A;  4GF8 A;  5F7V A;  1QW0 A;  4I9D A;  3CSG A;  3QAX A;  1LBC A;  3QSL A;  2G29 A;  3KG2 A;  1NNF A;  4F31 B;  2XXV A;  2Q2A A;  1D3K A;  1GV8 A;  4Z0I A;  3A09 A;  3TTL A;  3K6U A;  5F1Q A;  3I3V A;  3OO6 A;  2H25 A;  4GWO A;  1B32 A;  3ECR A;  2NVU B;  4KHZ E;  2I4B A;  1OQH A;  3TCG A;  1BIY A;  4KFQ A;  1B46 A;  2ZMB A;  3FXQ A;  3PGF A;  5AA1 A;  3N6T A;  3V89 B;  4HCW A;  2BJJ X;  4NF5 A;  5IKB A;  3H06 B;  3T9H B;  3SEW A;  1FTO A;  3DLN A;  4EQB A;  3H6T A;  1UTB A;  5I58 A;  3DP6 A;  3LSX A;  3TDJ A;  2F5X A;  4LON B;  4G77 A;  4EQ7 A;  3U8Q A;  4F3G A;  1SW5 A;  1IXH A;  2CZL A;  4IB2 A;  1SI0 A;  2IEE A;  2DOJ A;  2UVI A;  4QFN A;  3IB1 A;  3OD7 A;  3PPO A;  1Y1M A;  4F29 A;  3L6G A;  4ONY A;  2VP1 A;  3CI8 A;  4YIC A;  5B7D A;  4JBZ A;  1LAF E;  3VV5 A;  1JW4 A;  4ZE8 A;  3QK6 A;  1USY H;  2QMX A;  4YB5 A;  2D3I A;  4ZE9 A;  1PB8 A;  2HZK A;  1NKX A;  4GL8 A;  4OYV A;  5AE4 A;  1ZIU A;  3I5O A;  3S9N C;  3N6U A;  1QVS A;  2HAU A;  1B5H A;  3MVY A;  3UGW A;  2YJP A;  1P1U A;  4ZEK A;  4FEC A;  4HCY A;  3IJX B;  1OVB A;  5ICQ A;  4BDM A;  3M3L A;  3OSQ A;  2X7P A;  4OZ9 A;  1D4N A;  2QS1 A;  2XD2 A;  1IZ1 A;  4L17 A;  3TQL A;  3EF7 A;  3QYT A;  1ZMG A;  1B4H A;  4X9T A;  3SEX A;  3UK4 A;  2O68 A;  2UVH A;  2I0C A;  4EF2 A;  1S50 A;  2V3Q A;  1Y3Q A;  3K6W A;  4EQ9 A;  3PU5 A;  5BUU A;  4H5F A;  1R1N A;  2H98 A;  1EU8 A;  5I56 A;  1FQD A;  1MS7 A;  4DZ1 A;  4KQP A;  5H8Q A;  1EH3 A; 
#chains in the Genus database with same CATH topology
 3EPE A;  4QF9 A;  4THI A;  4R75 A;  2Y7P A;  2VD3 A;  4LVQ A;  3RT6 B;  4XIG Q;  3CG1 A;  3E4R A;  3THI A;  2YPN A;  5CI5 A;  2HAV A;  2B4L A;  2F6G A;  1R9L A;  1XI6 A;  3MBP A;  1B3E A;  2CMO A;  3KBZ A;  5EYG A;  1MY2 A;  3PUX E;  1Y1Z A;  4K3F A;  3S9E A;  4GL0 A;  2OBG A;  1MY4 A;  1GR2 A;  1VR5 A;  3U92 A;  4M4G A;  3OEN A;  1R6Z A;  2OCU A;  4NQ8 A;  1LAH E;  3IB0 A;  4FED A;  2Y7W A;  2Q89 A;  5KZT A;  1LBX A;  2VPO A;  3H7M A;  5H8N A;  3TEP A;  1PB9 A;  3IO4 A;  2Y7I A;  5FTH A;  3IFA A;  3MZ9 A;  4GWU A;  1T0K A;  1TXF A;  1QGX A;  2ALU A;  1Q9D A;  1TWY A;  2ONK E;  3ZSF A;  3FIR A;  4Q8R A;  1NV3 A;  2PX1 A;  1JNF A;  4BDN A;  5I2K B;  2A5T A;  4KYS A;  4DLD A;  1QUK A;  3QXM A;  4ELQ A;  1ZTY A;  4JWY A;  5EQA A;  4GVO A;  2V3U A;  4HE1 A;  3SKP A;  2H9B A;  3UA8 A;  1B7H A;  3V8X B;  2X7Q A;  3TCH A;  2QS4 A;  3VE1 B;  1NV7 A;  1YYZ A;  2O84 X;  4PF8 A;  2THI A;  1Z7N E;  2FIE A;  3SET A;  5JTY B;  3A3C A;  3QUF A;  2KR0 A;  3OO8 A;  3M3F A;  4U23 A;  5T3J A;  1Q1K A;  3G3J A;  4WED A;  3FD3 A;  4NF8 A;  1LLS A;  1I6Q A;  1FPB A;  1H43 A;  4G8H A;  1UQW A;  1GGG A;  5ET7 A;  4GBW A;  4PQJ A;  4RY1 A;  1EZO A;  1MXY A;  3FXR A;  3LR1 A;  4NG7 A;  3KSX A;  4ZED A;  1P1N A;  3D4G A;  1Y3N A;  4IR8 A;  4IO6 A;  4Q30 B;  1XT8 A;  3R7X A;  3OOA A;  1TFD A;  4FOR A;  2Y5K A;  5IZ3 A;  1D9V A;  1MM7 A;  3W9W A;  3TKD A;  1FPF A;  4GXS B;  4F1U A;  3K02 A;  3T0J A;  4NWD A;  4XFE A;  4YB7 A;  4RXL A;  2DXY A;  3DP8 A;  2I49 A;  4QXD A;  2HQ0 A;  5AA4 B;  1B7Z A;  3PUY E;  4H5G A;  2QL3 A;  2I0B A;  4P3L A;  5AA2 A;  1FQA A;  5F24 A;  2QPQ A;  1NI9 A;  5KCJ B;  4U1Z A;  1I6B A;  2E1S A;  1LGB C;  1VFD A;  1NUX A;  3FXB A;  1M5B A;  2Z8F A;  1UIU A;  1PBP A;  3TQW A;  3FUZ A;  2NUV A;  4F2O A;  1NV6 A;  5FBP A;  1FBD A;  3C4M A;  4JSO A;  4ELR A;  1FBH A;  5IM2 A;  3SZP A;  2QVV A;  4XXU A;  3TTN A;  3PUZ E;  4G8N A;  3MP1 A;  5DTB A;  2HXR A;  1G0H A;  3FJG A;  1MY3 A;  4OTE A;  3T66 A;  5I59 B;  3H6V A;  3U72 A;  4QBA A;  4KD5 A;  4R6K A;  2V93 A;  1YCJ A;  3S2V A;  1LBZ A;  1B51 A;  4NF6 B;  1KA1 A;  2XD3 A;  1US5 A;  2XX7 A;  1MQI A;  1ZBM A;  1KZ8 A;  5H8H B;  4YKK A;  3T93 B;  4DCX A;  4KR5 A;  3CG3 A;  1B4Z A;  4MCO A;  4XKQ A;  2QVR A;  1RKM A;  1NNT A;  2OLB A;  2GHA A;  3VLW A;  4DXC A;  3H4Z A;  2O51 A;  1N3X A;  3D1R A;  2YLN A;  1FPI A;  2XWI A;  4QSE A;  1FQE A;  2B4M A;  4IO7 A;  1JW1 A;  4N81 A;  2O1M A;  3TPA A;  4QRZ A;  2QRY A;  1CNQ A;  5DVJ A;  1N84 A;  1LFH A;  3H6W A;  4NF4 A;  4PET A;  1O7T A;  1ZJL A;  2QS3 A;  4NWC A;  5ELV A;  4GWY A;  4O3B A;  4MMP A;  5CMM A;  4KCD A;  3L6H A;  4DXB A;  2ZNT A;  2PT2 A;  4F22 A;  5TP9 A;  4AB5 A;  5TU0 A;  1QUL A;  1SVX B;  3EHU A;  4UAB A;  1N04 A;  3ISP A;  2QVU A;  1FCK A;  2ZYN A;  1OIB A;  4GBV A;  2XHD A;  3C32 A;  1ZU0 A;  4G68 A;  2DWH A;  3S9L C;  1JW5 A;  2ABH A;  2HPG A;  4MIJ A;  4KI0 E;  4MJO A;  4MH5 A;  4OVR A;  4OES A;  3K1M A;  1HSJ A;  3GYY A;  3HFU A;  4H8J A;  3B8B A;  2NOO A;  5ET8 A;  5ESY A;  1B3F A;  3O66 A;  3DEL B;  3U94 A;  5FHM A;  4U21 A;  3M8U A;  3PMW A;  4OVP A;  1SW4 A;  1MH4 A;  2QSX A;  3ROJ A;  1WOD A;  3UOR A;  1SPI A;  4G68 C;  1HSL A;  4R72 A;  5CM6 A;  4X1B A;  4PTK A;  4LUB A;  3DP4 A;  3VVE A;  3ODB A;  4YKI A;  1FBC A;  1MDQ A;  4GWX A;  2I3V A;  5A5L A;  1US4 A;  2PFZ A;  4GXA A;  4F3B A;  2OWT A;  2REJ A;  1EZ9 A;  2XXU A;  5A5X A;  1JQF A;  1RYX A;  4PCD A;  4RK9 A;  2WBD A;  5L8D A;  2I6E A;  2Z8D A;  1TT1 A;  2O7U A;  1PC3 A;  1P99 A;  3SEV A;  2AIX A;  3RGY A;  3CIJ A;  1DPP A;  1SQY A;  5I58 B;  1B7U A;  5M2V A;  3A29 A;  4NMY A;  4XKR A;  3TMG A;  3O9P A;  4KXP A;  4P11 A;  2ZYK A;  1BK4 A;  3MW0 A;  4E0W A;  4I3E A;  2CEX A;  1FTA A;  3LUY A;  5ITO A;  3TUS A;  3MST A;  1JEU A;  2GFE A;  2DXR A;  5L9M A;  1H45 A;  2F34 A;  2OX3 A;  2PYY A;  1B9J A;  1MXW A;  3MP8 A;  4WKM A;  1SD3 A;  4PFB A;  3EN3 A;  3VDF A;  4FE8 A;  4F2Q A;  1IIW A;  3KEI A;  3ZS6 A;  2XXR A;  3FVN A;  1QUJ A;  3Q25 A;  4MAG A;  2DVC A;  2RKM A;  4ZZA A;  2HXW A;  3RQT A;  5EQ9 A;  4ESX A;  2ZNU A;  3T9U A;  1FBG A;  5JEI A;  3WAF A;  5BWJ A;  4WXJ A;  3C35 A;  2PVU A;  2B3B A;  1GVC A;  1YPN A;  5EYH A;  4YB6 A;  5I84 A;  2Q8J A;  4QFO A;  4YU0 A;  1OLA A;  3O6G A;  4EF1 A;  1WVJ A;  2GHB A;  4H67 A;  2KQZ A;  3OO7 A;  3CFZ A;  4QFP A;  3ZKK A;  4DI4 B;  1NUY A;  3MVZ A;  3O28 A;  1FQF A;  1B40 A;  1AMF A;  2DE4 A;  3FJM A;  3PMV A;  4PFW A;  1PBQ A;  3VXC A;  4BDL A;  1FPL A;  1VDW A;  4LAT A;  2V4C A;  5I57 A;  2WYP A;  2DWA A;  3OEK A;  3FAS A;  1QUI A;  4I40 A;  2Z23 A;  3NOH A;  3IK6 B;  3CFX A;  3EQ1 A;  3IL1 B;  1MPD A;  3A3U A;  1AH5 A;  3GBB A;  4JWO A;  5H8F A;  1RDZ A;  1FBE A;  4PFU A;  3N94 A;  4R74 A;  2M8C A;  4LQ5 A;  4NED A;  1IUD A;  2XXI A;  2R6G E;  2PT1 A;  5B70 A;  1FTM A;  3R6U A;  4PDD A;  3Q26 A;  2A5S A;  1Y4C A;  3K1N A;  4ZEB A;  4H65 A;  4ZDM A;  4G2Z A;  3HPI A;  3TFL A;  3JYR A;  3HHF A;  4BDQ A;  1B0L A;  1A55 A;  1KWH A;  3IR1 A;  5FHO A;  3RYD A;  1MPB A;  1EYI A;  2F6P A;  2IA4 A;  4LZ8 A;  3RNN A;  2OWS A;  3VVD A;  2OZZ A;  4N15 A;  4EXK A;  1TFA A;  4R73 A;  5EHM A;  3B6T A;  4DE8 A;  3EHT A;  1FQC A;  4F3S A;  5I2N A;  3IOR A;  2QMW A;  3KN8 A;  2XXY A;  4OEN A;  5FTI A;  3TEL A;  1IXI A;  4P8B A;  4JSD A;  1YTV A;  1LBW A;  4LZ5 A;  4RK2 A;  3O2A A;  1MQH A;  4U2R A;  3R26 A;  1NMU A;  1FSA A;  1MXX A;  5I2K A;  4OEV A;  3HN0 A;  1IMB A;  1B5I A;  5CRY A;  3C9H A;  1RYO A;  2FVZ A;  5IGA A;  4N17 A;  3VLV A;  4U22 A;  5LOM A;  5CMK A;  4PC9 A;  3PMX A;  2DE2 A;  4NX1 A;  4YMB A;  2XXT A;  1MY1 A;  1LB9 A;  4F39 A;  4EDP A;  1DTG A;  2D5W A;  4DDD A;  1FPE A;  1FTL A;  3KN3 A;  1JEV A;  4N8Y A;  4JB7 A;  4GOT A;  3OXN A;  4TLM B;  4AS4 A;  5JTY A;  4RPN A;  4G61 A;  5J1D A;  4GX6 A;  1N76 A;  3MAM A;  3USD A;  1D9Y A;  1UTH A;  1NH7 A;  2H4I A;  2Q8M A;  4POW A;  1EZP A;  3MVW A;  4RNS A;  3U65 A;  5L9S A;  3RLF E;  3BKI B;  3KOT A;  1B6H A;  1AOV A;  5HPQ A;  4JVD A;  4ZEI A;  3ILU B;  5DT6 A;  4QHQ A;  3RTF B;  1MRP A;  1MQG A;  3BFU A;  4HE2 A;  3SDF A;  1K9Y A;  4GWZ A;  2ONR A;  1LBY A;  4PP0 A;  3T22 A;  4H1X A;  2NXO A;  3RPW A;  3B50 A;  1XC1 A;  1RDX A;  3MPL A;  4RYA A;  1B2H A;  1L5T A;  4FAJ A;  2DQV A;  2HCA A;  2MKZ A;  4OXV A;  1DCU A;  3LC8 A;  2B3F A;  1B3G A;  4Q5T A;  2XXQ A;  1Q35 A;  1OQG A;  2Y5L A;  1SDX A;  4ND9 A;  1B05 A;  2RC8 A;  2FYI A;  3G3H A;  3P7I A;  4XTC Q;  2PBW A;  5AA4 A;  2Y7K A;  3T96 B;  1DTZ A;  4X8R A;  2FNC A;  2Q2C A;  3H6U A;  3MQ9 A;  1O63 A;  1WDN A;  4PE5 B;  4QSD A;  3K4U A;  4R9G A;  4KYD A;  3MPK A;  3KJT A;  3PUW E;  3CVG A;  4G8M A;  5CBR A;  4U4X A;  3T9X B;  5HM4 B;  3N26 A;  4C1U A;  2Z8E A;  5I59 A;  5KDT A;  2VGQ A;  5IAI A;  4NN3 A;  5L9O A;  3IAZ A;  2PFY A;  2PCR A;  1SBP A;  2DP8 A;  1NUW A;  1NV4 A;  2DE3 A;  4ELP A;  5LTC A;  1R9Q A;  1LAX A;  1JVX A;  1NUZ A;  3EKI A;  4MFI A;  5H8H A;  1JET A;  3V83 A;  1MQD A;  2LAO A;  3FGS A;  2ZYM A;  3MYU A;  1XVY A;  1MXU A;  4MNP A;  5JK4 A;  2E0S A;  4YMA A;  1LFG A;  1N0T A;  1H3D A;  1INP A;  3KN7 A;  3SER A;  3MWB A;  2REG A;  5CC2 A;  2FBP A;  2P1S A;  1B0H A;  4GQO A;  4R6H A;  3MUQ A;  2HEU A;  2VD2 A;  5EYF A;  2F3B A;  3TZA A;  1S7Y A;  3UP9 A;  2I58 A;  5DEX B;  4X48 A;  2XXK A;  1ATG A;  2F8D A;  3G7W A;  4RJZ A;  4X04 A;  3FVK A;  3CRB A;  1N3W A;  3PPP A;  4EUO A;  1OVT A;  4MHF A;  4KYE A;  4F1V A;  4UA8 A;  3U93 A;  4RA1 A;  4R2F A;  3WAE A;  4MNI A;  3PPR A;  4IY6 A;  4BLA A;  4F18 A;  2UVJ A;  3K00 A;  4G4P A;  1NL5 A;  1GTK A;  3IO6 A;  2ONS A;  2D21 A;  5ET5 A;  2VPN A;  2DWJ A;  1P1O A;  5TPA B;  3MZB A;  4QSC A;  2RCA A;  1BLF A;  4ZEC A;  3HHG A;  3Q27 A;  2DS9 A;  3MVX A;  2XXH A;  3K6X A;  3VLU A;  4Q0C A;  3OO9 A;  2FHY A;  5DYH A;  5DVF A;  2DWI A;  2UYF A;  3KZG A;  3MC2 A;  2O7I A;  4BDO A;  1K9Z A;  1D9Q A;  2OWZ A;  1LFI A;  1BKA A;  1FJ6 A;  1Y3P A;  2X26 A;  4NE4 A;  2WBB A;  1RDY A;  1POT A;  2R8T A;  4P9K A;  3FVG A;  1ELJ A;  5DVI A;  3TCF A;  2WYK A;  3TTM A;  4NGU A;  4IGR A;  2I48 A;  2DSF A;  1LCF A;  4IO3 A;  4X1D A;  2XX8 A;  3H03 A;  4GIZ A;  3QUJ A;  1QKA A;  1B1H A;  4KCC A;  2F7A A;  3C31 A;  4OVT A;  3C33 A;  3JZJ A;  1FQB A;  2Q88 A;  1SW1 A;  2V25 A;  1M5E A;  2NWJ A;  4PFY A;  3O29 A;  2F78 A;  2RCB A;  5K2Y A;  1B3L A;  1Y4T A;  4DXU A;  2VHA A;  1I6A A;  4NF5 B;  4TQU Q;  1NNK A;  2F3D A;  2R71 A;  5FHN A;  2RF1 A;  4NHB A;  1ZLQ A;  3RPL B;  1PEB A;  5A5X B;  2V84 A;  1LBB A;  1UTB B;  4M1V A;  4I1D A;  3TTR A;  5K2X A;  1O64 A;  2ANJ A;  4UAC A;  1M5D A;  3TOD A;  3TAJ A;  1II5 A;  2ZZW A;  4ZEF A;  2ZXT A;  3G3K A;  1FTK A;  3OSR A;  2F36 A;  4IO4 A;  5IZZ A;  3PUV E;  4PGN A;  3S4U A;  4P0I A;  4ELO A;  4GRK A;  3ILT B;  3UIF A;  2Q74 A;  1Z7M E;  4FAT A;  2W7Y A;  3KBR A;  3IX1 A;  4PE3 A;  4LQ2 A;  2AL5 A;  1IMC A;  1FPG A;  5I5P A;  1A8F A;  2QS2 A;  4EXL A;  1N7W A;  3T1B A;  4R6Y A;  2OJT A;  2UVG A;  3CR9 A;  3SEY A;  1URS A;  3HO7 A;  2O6A A;  2RC9 A;  4OMB A;  5I7I A;  2GH9 A;  4HS7 A;  4QFK A;  4H6D A;  4MBP A;  2VT5 A;  3FJ7 A;  4IO5 A;  4JWX A;  2XX9 A;  4H45 A;  4LP2 B;  3LBS A;  4OFL A;  2DYX A;  2VOZ A;  3B7D A;  4NAP A;  1NV5 A;  1ANF A;  4P47 A;  1NFT A;  5ISU A;  5H8S A;  3FV1 A;  3G3I A;  1DPE A;  3IJO B;  2HZL A;  1B1X A;  1MPC A;  3BBR A;  2L5V A;  3OEL A;  2AYS A;  2P3V A;  1I69 A;  3PD9 A;  1LB8 A;  4N91 A;  1MM6 A;  1PDA A;  3G3G A;  3RUM A;  5I57 B;  4O3C A;  4ESW A;  3KJ7 A;  4P1L A;  3F11 A;  3LSL A;  4H0W A;  3BFT A;  2F7C A;  4IY5 A;  1IXC A;  5H8F B;  4ZZE A;  1FBP A;  5I56 B;  3RN8 A;  3K2D A;  2ZYO A;  1CE2 A;  1FPD A;  1IMA A;  5H8Q B;  4GD5 A;  1IIT A;  3E9X A;  3RTW B;  5AA3 A;  2P0S A;  3V5A A;  4PFI A;  4N4U A;  1A8E A;  2I3W A;  3SES A;  3C36 A;  2HFB A;  3VVF A;  5IZ1 A;  1A7L A;  3IOW A;  3S9M C;  3W9V A;  4XF5 A;  2RIN A;  2XWO A;  4I62 A;  1VE4 A;  4F19 A;  2AL4 A;  1P1Q A;  1URG A;  5J16 A;  2I4C A;  1VFE A;  2F7B A;  4NF0 A;  3K0V A;  4ECF A;  4I8C A;  3FXU A;  4P1E A;  2WEF A;  3AXF A;  3PV0 E;  4FIM A;  1MG1 A;  5H8N B;  1VSO A;  4H8I A;  2ZZX A;  4WEP A;  5I2N B;  4GX4 A;  2O1L A;  4R2B A;  3K6V A;  3IOU A;  1MQJ A;  3GBA A;  4PAF A;  1M5F A;  2Q9T A;  4GFR A;  4PAK A;  3LSF B;  1URD A;  3B6W A;  1OLC A;  2XWV A;  3K01 A;  3PPQ A;  1NV1 A;  2B65 A;  3ZKL A;  2A5T B;  4JXI A;  1MDP 1;  2F97 A;  5LDZ A;  1SW2 A;  3LUZ A;  4IO2 A;  4F1Y A;  3KSJ A;  4C0R A;  1OMP A;  3IFC A;  1A99 A;  4IGT A;  4TOZ A;  1FW0 A;  3E3K A;  1J1N A;  1POY 1;  1USY E;  5ICT A;  4F3P A;  4OET A;  2QJE A;  3TTK A;  4N6D A;  3KOS A;  1P1W A;  4POX A;  1SYH A;  4HW8 A;  3CFL A;  3OMB A;  4MEV A;  1KA0 A;  3HST A;  4C1T A;  3MJN A;  5I3S A;  4N13 A;  1JP4 A;  1DK4 A;  4NF8 B;  1IMF A;  3PTY A;  5CMB A;  4LA9 A;  4LZ7 A;  2OK2 A;  1QKB A;  1IME A;  1UTH B;  3RT8 A;  4P56 A;  3C34 A;  1FPK A;  3M3K A;  4FJP A;  1MH3 A;  4XKP A;  1EYJ A;  4YKP A;  4OQO A;  1H76 A;  3W15 C;  4BDR A;  4DIG A;  1NV0 A;  4OFO A;  4GLI A;  4U4S A;  4YAH X;  4Z7E A;  3PD8 A;  1IQ7 A;  5IZ3 B;  4JVC A;  1SI1 A;  1BTJ A;  1AIV A;  2FA7 A;  2Z22 A;  2DVZ A;  2WKY A;  3I6V A;  1JVY A;  3PPN A;  1M5C A;  3B6Q A;  3D4C A;  3FZV A;  4N07 A;  3FAT A;  1UIV A;  1IXG A;  3GZG A;  3IB2 A;  4P0G A;  1DOT A;  1Y9U A;  5KCJ A;  5ITP A;  1XS5 A;  5AA2 B;  2XXP A;  2O69 A;  3KC0 A;  1XOC A;  3EHS A;  4AB6 A;  1N7X A;  2F35 A;  3E79 A;  3RY3 A;  1YAE A;  4JDF A;  3LSW A;  1LCT A;  1AWB A;  2P2A A;  3HV1 A;  4OFJ A;  4OER A;  4ISU A;  3GXA A;  2PMS A;  2CZH A;  1A54 A;  4MLV A;  3QMF A;  4MF3 A;  3VFJ A;  2UXA A;  1NV2 A;  2V3T A;  4E0X A;  4O8M A;  3OEM A;  3KFM A;  4O7M A;  3JV9 A;  4GWS A;  4NTL A;  1EYK A;  1YXI A;  1CB6 A;  3HCQ A;  4RPO A;  3FV2 A;  3GLB A;  4NF6 A;  1HSE A;  1MY0 A;  5KDT B;  2RC7 A;  1B3H A;  4OAN A;  4OEU A;  4H46 A;  3G3F A;  2H99 A;  3SEU A;  3VXB A;  3KC1 A;  4MLQ A;  4N6P A;  1MXV A;  4KPT A;  4AQ4 A;  1XVX A;  4OHN A;  2XA5 A;  3KGC A;  4OWD A;  4R9F A;  1BP5 A;  4GX3 A;  1ZKB A;  4ZS9 A;  2Y7R A;  4DCY A;  3MP6 A;  1H44 A;  5HBC A;  1B52 A;  5DW8 A;  1FPJ A;  4PFR A;  4YZZ A;  2R9J A;  3K1P A;  1B58 A;  1XHY A;  3T9V A;  1AL3 A;  1F9B A;  1SYI A;  2KLF A;  1DSN A;  1QJM A;  3QIM A;  1FTJ A;  2UYE A;  5DEX A;  2GRV A;  3TYH A;  2BJI A;  3IOV A;  3O6H A;  4O3A A;  2CEY A;  3Q29 A;  5CBS A;  1MXZ A;  3O6I A;  2H5Y A;  4PFT A;  4NF4 B;  3O97 A;  1PB7 A;  1NH8 A;  4OA4 A;  2Y84 A;  3IOT A;  3U1O A;  3UN6 A;  3Q28 A;  2ESN A;  1A40 A;  1IEJ A;  4OVJ A;  1S9T A;  1B5J A;  5TP9 B;  3CSB A;  5TPA A;  4PGP A;  5EHS A;  3ONM A;  4XKN A;  4N6K A;  5AA2 D;  1DMB A;  1NNP A;  2XXW A;  3E13 X;  2XXX A;  1LST A;  4HTG A;  1FJ9 A;  4YKJ A;  3FVO A;  4TLL B;  4U1O A;  5CMC A;  3H3G A;  4G68 B;  1IMD A;  2ZNS A;  4QFL A;  4FEB A;  2G93 A;  4LN5 A;  3MZ1 A;  3DM0 A;  3N5L A;  1LAG E;  1Y20 A;  4GF8 A;  5F7V A;  1QW0 A;  4I9D A;  3CSG A;  3QAX A;  1LBC A;  2GQ1 A;  3QSL A;  2WX9 A;  4OVQ A;  2G29 A;  3KG2 A;  1NNF A;  4F31 B;  2XXV A;  4PAI A;  2Q2A A;  1D3K A;  1GV8 A;  4Z0I A;  3FBP A;  3A09 A;  3TTL A;  1LEV A;  3E78 A;  2ZZV A;  3K6U A;  5ET6 A;  5F1Q A;  3I3V A;  3OO6 A;  2H25 A;  4GWO A;  5EQ8 A;  1B32 A;  3ECR A;  2NVU B;  2CZK A;  4KHZ E;  2I4B A;  1OQH A;  3TCG A;  1BIY A;  4KFQ A;  1B46 A;  2ZMB A;  3FXQ A;  3PGF A;  5AA1 A;  3N6T A;  3V89 B;  4HCW A;  1DBZ A;  2BJJ X;  4NF5 A;  5IKB A;  3H06 B;  3T9H B;  3SEW A;  3LV0 A;  1FRP A;  1FTO A;  1YZ0 A;  3DLN A;  1LBV A;  3RPL A;  4EQB A;  3H6T A;  2QFL A;  1UTB A;  5I58 A;  4DI3 D;  3DP6 A;  2CZI A;  3LSX A;  3TDJ A;  2F5X A;  4LON B;  4G77 A;  4EQ7 A;  3U8Q A;  4F3G A;  4MNC A;  1SW5 A;  1IXH A;  2FIX A;  2JJK A;  2CZL A;  4IB2 A;  2DDK A;  4HE0 A;  1SI0 A;  3BIH A;  2IEE A;  2DOJ A;  2UVI A;  5EQ7 A;  4QFN A;  4XEQ A;  3IB1 A;  3OD7 A;  3PPO A;  4HXV A;  1Y1M A;  4F29 A;  3L6G A;  4O94 A;  4ONY A;  4JVI A;  2VP1 A;  4GWW A;  3CI8 A;  4YIC A;  1G0I A;  5B7D A;  1FBF A;  1LAF E;  4JBZ A;  3VV5 A;  1JW4 A;  4ZE8 A;  3QK6 A;  1USY H;  4N8G A;  2QMX A;  4FBP A;  4YB5 A;  4PBQ A;  2D3I A;  4ZE9 A;  1PB8 A;  2HZK A;  2HHM A;  1NKX A;  4GL8 A;  4OYV A;  5AE4 A;  1ZIU A;  3I5O A;  3S9N C;  3N6U A;  1QVS A;  2HAU A;  1B5H A;  3MVY A;  3UGW A;  2YJP A;  1P1U A;  4ZEK A;  4FEC A;  4HCY A;  3IJX B;  1OVB A;  4O7I A;  5ICQ A;  4BDM A;  3M3L A;  2XWK A;  4OVS A;  3OSQ A;  2X7P A;  4OZ9 A;  1D4N A;  2QS1 A;  2XD2 A;  1IZ1 A;  4L17 A;  3TQL A;  3EF7 A;  3QYT A;  1ZMG A;  2P3N A;  1B4H A;  4X9T A;  3CHG A;  3SEX A;  3UK4 A;  2O68 A;  2UVH A;  2I0C A;  4EF2 A;  1S50 A;  2V3Q A;  1Y3Q A;  4PF6 A;  3K6W A;  4EQ9 A;  4PDH A;  3PU5 A;  5BUU A;  3BIG A;  4H5F A;  4PBH A;  1R1N A;  2H98 A;  1EU8 A;  5I56 A;  4I3Y A;  1FQD A;  1MS7 A;  4DZ1 A;  4AS5 A;  4KQP A;  4MX6 A;  5H8Q A;  1EH3 A; 
#chains in the Genus database with same CATH homology
 3EPE A;  4QF9 A;  4THI A;  4R75 A;  2Y7P A;  2VD3 A;  4LVQ A;  3RT6 B;  4XIG Q;  3CG1 A;  3E4R A;  3THI A;  2YPN A;  5CI5 A;  2HAV A;  2F6G A;  1R9L A;  3MBP A;  1B3E A;  2CMO A;  1MY2 A;  3PUX E;  1Y1Z A;  4K3F A;  3S9E A;  4GL0 A;  2OBG A;  1MY4 A;  1GR2 A;  1VR5 A;  3U92 A;  4M4G A;  3OEN A;  1R6Z A;  2OCU A;  1LAH E;  3IB0 A;  4FED A;  2Y7W A;  2Q89 A;  5KZT A;  3H7M A;  5H8N A;  3TEP A;  1PB9 A;  3IO4 A;  2Y7I A;  5FTH A;  3MZ9 A;  1T0K A;  1TXF A;  2ALU A;  1TWY A;  2ONK E;  3ZSF A;  3FIR A;  4Q8R A;  2PX1 A;  1JNF A;  4BDN A;  5I2K B;  2A5T A;  4KYS A;  4DLD A;  1QUK A;  3QXM A;  4ELQ A;  1ZTY A;  4JWY A;  4GVO A;  2V3U A;  3SKP A;  2H9B A;  3UA8 A;  1B7H A;  3V8X B;  2X7Q A;  3TCH A;  2QS4 A;  3VE1 B;  2O84 X;  2THI A;  1Z7N E;  3SET A;  5JTY B;  3A3C A;  3QUF A;  3OO8 A;  3M3F A;  4U23 A;  1Q1K A;  3G3J A;  4WED A;  3FD3 A;  4NF8 A;  1LLS A;  1I6Q A;  1H43 A;  4G8H A;  1UQW A;  1GGG A;  4RY1 A;  4PQJ A;  1EZO A;  1MXY A;  3FXR A;  3LR1 A;  3KSX A;  4ZED A;  1P1N A;  3D4G A;  1Y3N A;  4IO6 A;  4Q30 B;  1XT8 A;  3R7X A;  3OOA A;  1TFD A;  4FOR A;  1D9V A;  1MM7 A;  3W9W A;  3TKD A;  4GXS B;  4F1U A;  3K02 A;  4NWD A;  4YB7 A;  4RXL A;  2DXY A;  3DP8 A;  2I49 A;  2HQ0 A;  5AA4 B;  1B7Z A;  3PUY E;  4H5G A;  2QL3 A;  2I0B A;  5AA2 A;  1FQA A;  2QPQ A;  5KCJ B;  4U1Z A;  1I6B A;  2E1S A;  1LGB C;  1VFD A;  1M5B A;  2Z8F A;  1UIU A;  1PBP A;  3TQW A;  3FUZ A;  2NUV A;  4F2O A;  3C4M A;  4JSO A;  4ELR A;  4XXU A;  3TTN A;  3PUZ E;  4G8N A;  3MP1 A;  5DTB A;  3FJG A;  1MY3 A;  4OTE A;  3T66 A;  5I59 B;  3H6V A;  3U72 A;  4KD5 A;  4R6K A;  2V93 A;  1YCJ A;  3S2V A;  1B51 A;  4NF6 B;  2XD3 A;  1US5 A;  2XX7 A;  1MQI A;  1ZBM A;  5H8H B;  4YKK A;  3T93 B;  4DCX A;  4KR5 A;  3CG3 A;  1B4Z A;  4XKQ A;  1RKM A;  1NNT A;  2OLB A;  2GHA A;  3VLW A;  4DXC A;  3H4Z A;  2O51 A;  1N3X A;  2YLN A;  4QSE A;  1FQE A;  4IO7 A;  1JW1 A;  2O1M A;  3TPA A;  4QRZ A;  2QRY A;  5DVJ A;  1N84 A;  1LFH A;  3H6W A;  4NF4 A;  4PET A;  1O7T A;  1ZJL A;  2QS3 A;  4NWC A;  5ELV A;  4O3B A;  5CMM A;  4KCD A;  3L6H A;  4DXB A;  2ZNT A;  2PT2 A;  4F22 A;  5TP9 A;  4AB5 A;  5TU0 A;  1QUL A;  1SVX B;  3EHU A;  1N04 A;  1FCK A;  2ZYN A;  1OIB A;  2XHD A;  3C32 A;  1ZU0 A;  4G68 A;  2DWH A;  3S9L C;  1JW5 A;  2ABH A;  4KI0 E;  4MH5 A;  4OES A;  3K1M A;  1HSJ A;  4H8J A;  2NOO A;  1B3F A;  3O66 A;  3DEL B;  3U94 A;  5FHM A;  4U21 A;  3M8U A;  3PMW A;  1SW4 A;  1MH4 A;  2QSX A;  1WOD A;  3UOR A;  4G68 C;  1HSL A;  4R72 A;  5CM6 A;  4X1B A;  4LUB A;  3DP4 A;  3VVE A;  3ODB A;  4YKI A;  1MDQ A;  2I3V A;  1US4 A;  4GXA A;  4F3B A;  2OWT A;  2REJ A;  1EZ9 A;  2XXU A;  5A5X A;  1JQF A;  1RYX A;  4RK9 A;  5L8D A;  2I6E A;  2Z8D A;  1TT1 A;  2O7U A;  1PC3 A;  1P99 A;  3SEV A;  2AIX A;  3RGY A;  3CIJ A;  1DPP A;  1SQY A;  5I58 B;  1B7U A;  5M2V A;  4NMY A;  4XKR A;  3TMG A;  3O9P A;  4P11 A;  2ZYK A;  3MW0 A;  4E0W A;  3LUY A;  5ITO A;  3TUS A;  1JEU A;  2GFE A;  2DXR A;  5L9M A;  1H45 A;  2F34 A;  2PYY A;  1B9J A;  1MXW A;  3MP8 A;  4WKM A;  1SD3 A;  3EN3 A;  3VDF A;  4FE8 A;  4F2Q A;  1IIW A;  3KEI A;  3ZS6 A;  2XXR A;  3FVN A;  1QUJ A;  3Q25 A;  2DVC A;  2RKM A;  4ZZA A;  2HXW A;  3RQT A;  4ESX A;  2ZNU A;  3T9U A;  5JEI A;  3WAF A;  5BWJ A;  4WXJ A;  3C35 A;  2PVU A;  2B3B A;  1GVC A;  1YPN A;  4YB6 A;  5I84 A;  2Q8J A;  4QFO A;  4YU0 A;  1OLA A;  3O6G A;  4EF1 A;  1WVJ A;  2GHB A;  4H67 A;  3OO7 A;  3CFZ A;  4QFP A;  3ZKK A;  3MVZ A;  3O28 A;  1FQF A;  1B40 A;  1AMF A;  2DE4 A;  3FJM A;  3PMV A;  4PFW A;  1PBQ A;  3VXC A;  4BDL A;  4LAT A;  5I57 A;  2DWA A;  3OEK A;  3FAS A;  1QUI A;  2Z23 A;  3IK6 B;  3CFX A;  3EQ1 A;  3IL1 B;  1MPD A;  3A3U A;  1AH5 A;  3GBB A;  4JWO A;  5H8F A;  4PFU A;  3N94 A;  4R74 A;  2M8C A;  4LQ5 A;  4NED A;  1IUD A;  2XXI A;  2R6G E;  2PT1 A;  5B70 A;  1FTM A;  3R6U A;  3Q26 A;  2A5S A;  1Y4C A;  3K1N A;  4ZEB A;  4H65 A;  4ZDM A;  4G2Z A;  3HPI A;  3TFL A;  3JYR A;  3HHF A;  4BDQ A;  1B0L A;  1A55 A;  1KWH A;  3IR1 A;  5FHO A;  1MPB A;  2F6P A;  2IA4 A;  4LZ8 A;  3RNN A;  2OWS A;  3VVD A;  2OZZ A;  4EXK A;  1TFA A;  4R73 A;  5EHM A;  3B6T A;  4DE8 A;  3EHT A;  1FQC A;  4F3S A;  5I2N A;  3IOR A;  2QMW A;  3KN8 A;  2XXY A;  4OEN A;  5FTI A;  3TEL A;  1IXI A;  4JSD A;  1YTV A;  4LZ5 A;  4RK2 A;  3O2A A;  1MQH A;  4U2R A;  3R26 A;  1NMU A;  1MXX A;  5I2K A;  4OEV A;  3HN0 A;  1B5I A;  5CRY A;  3C9H A;  1RYO A;  3VLV A;  4U22 A;  5LOM A;  5CMK A;  3PMX A;  2DE2 A;  4YMB A;  2XXT A;  1MY1 A;  1LB9 A;  4F39 A;  4EDP A;  1DTG A;  2D5W A;  4DDD A;  1FTL A;  3KN3 A;  1JEV A;  4JB7 A;  4GOT A;  3OXN A;  4TLM B;  5JTY A;  4RPN A;  5J1D A;  1N76 A;  3MAM A;  3USD A;  1D9Y A;  1UTH A;  1NH7 A;  2H4I A;  4POW A;  1EZP A;  3MVW A;  4RNS A;  5L9S A;  3RLF E;  3BKI B;  3KOT A;  1B6H A;  1AOV A;  5HPQ A;  4ZEI A;  3ILU B;  5DT6 A;  4QHQ A;  3RTF B;  1MRP A;  1MQG A;  3BFU A;  3SDF A;  2ONR A;  3T22 A;  4PP0 A;  4H1X A;  2NXO A;  3RPW A;  1XC1 A;  3MPL A;  4RYA A;  1B2H A;  1L5T A;  4FAJ A;  2DQV A;  2HCA A;  4OXV A;  3LC8 A;  2B3F A;  1B3G A;  4Q5T A;  2XXQ A;  1Q35 A;  1OQG A;  1SDX A;  4ND9 A;  1B05 A;  2RC8 A;  2FYI A;  3G3H A;  3P7I A;  4XTC Q;  2PBW A;  5AA4 A;  2Y7K A;  3T96 B;  1DTZ A;  2FNC A;  2Q2C A;  3H6U A;  3MQ9 A;  1O63 A;  1WDN A;  4PE5 B;  4QSD A;  3K4U A;  4R9G A;  4KYD A;  3MPK A;  3KJT A;  3PUW E;  3CVG A;  4G8M A;  5CBR A;  4U4X A;  3T9X B;  5HM4 B;  3N26 A;  4C1U A;  2Z8E A;  5I59 A;  5KDT A;  2VGQ A;  5IAI A;  5L9O A;  3IAZ A;  1SBP A;  2DP8 A;  2DE3 A;  4ELP A;  1R9Q A;  1LAX A;  1JVX A;  4MFI A;  5H8H A;  1JET A;  3V83 A;  1MQD A;  2LAO A;  3FGS A;  2ZYM A;  1XVY A;  1MXU A;  5JK4 A;  2E0S A;  4YMA A;  1LFG A;  1N0T A;  1H3D A;  3KN7 A;  3SER A;  3MWB A;  2REG A;  5CC2 A;  2P1S A;  1B0H A;  4GQO A;  4R6H A;  3MUQ A;  2HEU A;  2VD2 A;  5EYF A;  3TZA A;  1S7Y A;  3UP9 A;  2I58 A;  5DEX B;  4X48 A;  1ATG A;  2F8D A;  3G7W A;  4RJZ A;  3FVK A;  3CRB A;  1N3W A;  3PPP A;  4EUO A;  1OVT A;  4KYE A;  4F1V A;  4UA8 A;  3U93 A;  4RA1 A;  4R2F A;  3WAE A;  3PPR A;  4IY6 A;  4BLA A;  4F18 A;  2UVJ A;  3K00 A;  4G4P A;  1NL5 A;  1GTK A;  3IO6 A;  2ONS A;  2D21 A;  2DWJ A;  1P1O A;  5TPA B;  3MZB A;  4QSC A;  2RCA A;  1BLF A;  4ZEC A;  3HHG A;  3Q27 A;  2DS9 A;  3MVX A;  2XXH A;  3K6X A;  3VLU A;  4Q0C A;  3OO9 A;  5DYH A;  5DVF A;  2DWI A;  2UYF A;  3KZG A;  3MC2 A;  2O7I A;  4BDO A;  1LFI A;  1BKA A;  1Y3P A;  2X26 A;  4NE4 A;  1POT A;  3FVG A;  1ELJ A;  5DVI A;  3TCF A;  3TTM A;  4IGR A;  2I48 A;  2DSF A;  1LCF A;  4IO3 A;  4X1D A;  2XX8 A;  3H03 A;  4GIZ A;  3QUJ A;  1QKA A;  1B1H A;  4KCC A;  2F7A A;  3C31 A;  3C33 A;  3JZJ A;  1FQB A;  2Q88 A;  1SW1 A;  2V25 A;  1M5E A;  2NWJ A;  4PFY A;  3O29 A;  2F78 A;  2RCB A;  5K2Y A;  1B3L A;  1Y4T A;  4DXU A;  2VHA A;  1I6A A;  4NF5 B;  4TQU Q;  1NNK A;  2R71 A;  5FHN A;  2RF1 A;  1ZLQ A;  1PEB A;  5A5X B;  2V84 A;  1LBB A;  1UTB B;  4M1V A;  4I1D A;  3TTR A;  5K2X A;  1O64 A;  2ANJ A;  4UAC A;  1M5D A;  3TOD A;  3TAJ A;  1II5 A;  4ZEF A;  2ZXT A;  3G3K A;  1FTK A;  3OSR A;  2F36 A;  4IO4 A;  3PUV E;  3S4U A;  4P0I A;  4ELO A;  4GRK A;  3ILT B;  3UIF A;  1Z7M E;  4FAT A;  2W7Y A;  3KBR A;  3IX1 A;  4LQ2 A;  2AL5 A;  1A8F A;  2QS2 A;  4EXL A;  1N7W A;  4R6Y A;  2OJT A;  2UVG A;  3CR9 A;  3SEY A;  1URS A;  3HO7 A;  2O6A A;  2RC9 A;  4OMB A;  2GH9 A;  4HS7 A;  4QFK A;  4H6D A;  4MBP A;  3FJ7 A;  4IO5 A;  4JWX A;  2XX9 A;  4LP2 B;  4OFL A;  3LBS A;  2DYX A;  2VOZ A;  3B7D A;  1ANF A;  1NFT A;  5ISU A;  5H8S A;  3FV1 A;  3G3I A;  1DPE A;  3IJO B;  2HZL A;  1B1X A;  1MPC A;  3BBR A;  3OEL A;  2AYS A;  1I69 A;  3PD9 A;  1LB8 A;  1MM6 A;  1PDA A;  3G3G A;  3RUM A;  5I57 B;  4O3C A;  4ESW A;  3KJ7 A;  3F11 A;  3LSL A;  4H0W A;  3BFT A;  2F7C A;  4IY5 A;  1IXC A;  5H8F B;  4ZZE A;  5I56 B;  3RN8 A;  3K2D A;  2ZYO A;  1CE2 A;  5H8Q B;  4GD5 A;  1IIT A;  3E9X A;  3RTW B;  5AA3 A;  2P0S A;  3V5A A;  1A8E A;  2I3W A;  3SES A;  3C36 A;  2HFB A;  3VVF A;  1A7L A;  3IOW A;  3S9M C;  3W9V A;  2RIN A;  4I62 A;  1VE4 A;  4F19 A;  2AL4 A;  1P1Q A;  1URG A;  2I4C A;  1VFE A;  2F7B A;  3K0V A;  4ECF A;  4I8C A;  3FXU A;  3AXF A;  3PV0 E;  4FIM A;  1MG1 A;  5H8N B;  1VSO A;  4H8I A;  4WEP A;  5I2N B;  2O1L A;  4R2B A;  3K6V A;  3IOU A;  1MQJ A;  3GBA A;  1M5F A;  2Q9T A;  4GFR A;  3LSF B;  1URD A;  3B6W A;  1OLC A;  3K01 A;  3PPQ A;  2B65 A;  3ZKL A;  2A5T B;  4JXI A;  1MDP 1;  2F97 A;  1SW2 A;  4IO2 A;  4F1Y A;  3KSJ A;  4C0R A;  1OMP A;  1A99 A;  4IGT A;  4TOZ A;  1FW0 A;  3E3K A;  1J1N A;  1POY 1;  1USY E;  5ICT A;  4F3P A;  4OET A;  2QJE A;  3TTK A;  3KOS A;  1P1W A;  4POX A;  1SYH A;  4HW8 A;  3CFL A;  3OMB A;  3HST A;  4C1T A;  3MJN A;  4N13 A;  4NF8 B;  5CMB A;  4LA9 A;  4LZ7 A;  2OK2 A;  1QKB A;  1UTH B;  3RT8 A;  3C34 A;  3M3K A;  4FJP A;  1MH3 A;  4XKP A;  4YKP A;  4OQO A;  1H76 A;  3W15 C;  4BDR A;  4DIG A;  4OFO A;  4GLI A;  4U4S A;  4YAH X;  4Z7E A;  3PD8 A;  1IQ7 A;  1SI1 A;  1BTJ A;  1AIV A;  2FA7 A;  2Z22 A;  2DVZ A;  2WKY A;  3I6V A;  1JVY A;  3PPN A;  1M5C A;  3B6Q A;  3D4C A;  3FZV A;  4N07 A;  3FAT A;  1UIV A;  1IXG A;  3GZG A;  3IB2 A;  4P0G A;  1DOT A;  1Y9U A;  5KCJ A;  5ITP A;  1XS5 A;  5AA2 B;  2XXP A;  2O69 A;  1XOC A;  3EHS A;  4AB6 A;  1N7X A;  2F35 A;  3RY3 A;  1YAE A;  4JDF A;  3LSW A;  1LCT A;  2P2A A;  3HV1 A;  4OFJ A;  4OER A;  4ISU A;  3GXA A;  2PMS A;  1A54 A;  4MLV A;  4MF3 A;  3VFJ A;  2UXA A;  2V3T A;  4E0X A;  3OEM A;  3KFM A;  3JV9 A;  4NTL A;  1CB6 A;  3HCQ A;  4RPO A;  3FV2 A;  3GLB A;  4NF6 A;  1HSE A;  1MY0 A;  5KDT B;  2RC7 A;  1B3H A;  4OEU A;  3G3F A;  2H99 A;  3SEU A;  3VXB A;  4MLQ A;  4N6P A;  1MXV A;  4KPT A;  4AQ4 A;  1XVX A;  4OHN A;  3KGC A;  4OWD A;  4R9F A;  1BP5 A;  1ZKB A;  4ZS9 A;  2Y7R A;  4DCY A;  3MP6 A;  1H44 A;  5HBC A;  1B52 A;  4YZZ A;  2R9J A;  3K1P A;  1B58 A;  1XHY A;  3T9V A;  1AL3 A;  1F9B A;  1SYI A;  2KLF A;  1DSN A;  1QJM A;  3QIM A;  1FTJ A;  2UYE A;  5DEX A;  2GRV A;  3TYH A;  3IOV A;  3O6H A;  4O3A A;  3Q29 A;  5CBS A;  1MXZ A;  3O6I A;  2H5Y A;  4PFT A;  4NF4 B;  3O97 A;  1PB7 A;  1NH8 A;  2Y84 A;  3IOT A;  3U1O A;  3UN6 A;  3Q28 A;  2ESN A;  1A40 A;  1IEJ A;  4OVJ A;  1S9T A;  1B5J A;  5TP9 B;  3CSB A;  5TPA A;  5EHS A;  3ONM A;  4XKN A;  5AA2 D;  1DMB A;  1NNP A;  2XXW A;  3E13 X;  2XXX A;  1LST A;  4HTG A;  4YKJ A;  3FVO A;  4TLL B;  4U1O A;  5CMC A;  3H3G A;  4G68 B;  2ZNS A;  4QFL A;  4FEB A;  2G93 A;  3MZ1 A;  3DM0 A;  3N5L A;  1LAG E;  1Y20 A;  4GF8 A;  5F7V A;  1QW0 A;  4I9D A;  3CSG A;  3QAX A;  1LBC A;  3QSL A;  2G29 A;  3KG2 A;  1NNF A;  4F31 B;  2XXV A;  2Q2A A;  1D3K A;  1GV8 A;  4Z0I A;  3A09 A;  3TTL A;  3K6U A;  5F1Q A;  3I3V A;  3OO6 A;  2H25 A;  4GWO A;  1B32 A;  3ECR A;  2NVU B;  4KHZ E;  2I4B A;  1OQH A;  3TCG A;  1BIY A;  4KFQ A;  1B46 A;  2ZMB A;  3FXQ A;  3PGF A;  5AA1 A;  3N6T A;  3V89 B;  4HCW A;  2BJJ X;  4NF5 A;  5IKB A;  3H06 B;  3T9H B;  3SEW A;  1FTO A;  3DLN A;  4EQB A;  3H6T A;  1UTB A;  5I58 A;  3DP6 A;  3LSX A;  3TDJ A;  2F5X A;  4LON B;  4G77 A;  4EQ7 A;  3U8Q A;  4F3G A;  1SW5 A;  1IXH A;  2CZL A;  4IB2 A;  1SI0 A;  2IEE A;  2DOJ A;  2UVI A;  4QFN A;  3IB1 A;  3OD7 A;  3PPO A;  1Y1M A;  4F29 A;  3L6G A;  4ONY A;  2VP1 A;  3CI8 A;  4YIC A;  5B7D A;  4JBZ A;  1LAF E;  3VV5 A;  1JW4 A;  4ZE8 A;  3QK6 A;  1USY H;  2QMX A;  4YB5 A;  2D3I A;  4ZE9 A;  1PB8 A;  2HZK A;  1NKX A;  4GL8 A;  4OYV A;  5AE4 A;  1ZIU A;  3I5O A;  3S9N C;  3N6U A;  1QVS A;  2HAU A;  1B5H A;  3MVY A;  3UGW A;  2YJP A;  1P1U A;  4ZEK A;  4FEC A;  4HCY A;  3IJX B;  1OVB A;  5ICQ A;  4BDM A;  3M3L A;  3OSQ A;  2X7P A;  4OZ9 A;  1D4N A;  2QS1 A;  2XD2 A;  1IZ1 A;  4L17 A;  3TQL A;  3EF7 A;  3QYT A;  1ZMG A;  1B4H A;  4X9T A;  3SEX A;  3UK4 A;  2O68 A;  2UVH A;  2I0C A;  4EF2 A;  1S50 A;  2V3Q A;  1Y3Q A;  3K6W A;  4EQ9 A;  3PU5 A;  5BUU A;  4H5F A;  1R1N A;  2H98 A;  1EU8 A;  5I56 A;  1FQD A;  1MS7 A;  4DZ1 A;  4KQP A;  5H8Q A;  1EH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...