3AXFA

Perrhenate binding to a11c/r153c moda mutant
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
231
structure length
231
Chain Sequence
GKITVFAACSLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVCGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYLKGPQAAEIFKRYGFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Molybdate-binding periplasmic protein
publication title Binding of ReO(4) (-) with an engineered MoO (4) (2-)-binding protein: towards a new approach in radiopharmaceutical applications.
pubmed doi rcsb
total genus 73
structure length 231
sequence length 231
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3axfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3axfA02
3IO4A 4GOTA 2O6AA 1NNTA 1PB9A 4X9TA 2GHBA 4ZEFA 3H4ZA 5EHMA 2DVZA 4BDMA 3VVFA 4KD5A 3D4GA 2VOZA 1XHYA 1FQCA 4QF9A 1JEUA 1LBCA 5HBCA 5DTBA 5L9OA 2D21A 4P0IA 3UA8A 2DOJA 2R6GE 3KG2A 4F2QA 1MM7A 1SW2A 4RJZA 2PYYA 2XXVA 4RA1A 3Q29A 2Z8EA 2RINA 1XVYA 3MVZA 1B0LA 4LUBA 2FYIA 1NNPA 1MH4A 2OWTA 4GIZA 4IO4A 4ELQA 5CMBA 2A5SA 4I1DA 2Q9TA 1OQHA 3B6WA 3PV0E 4U21A 1MQGA 3I6VA 3TFLA 3VE1B 3CFXA 1Z7NE 4QFLA 1MPBA 2XXUA 1PC3A 4PP0A 1SW5A 3N6TA 4X1DA 4DZ1A 4YKJA 4QHQA 2QMXA 1RYXA 1ZLQA 3MZ1A 4WXJA 1QULA 3TYHA 3IR1A 3C4MA 1IXCA 3ZSFA 1NMUA 1LAXA 1I6QA 3E4RA 4G8HA 3OO6A 1IXIA 1HSEA 1ATGA 1GVCA 5A5XA 1H44A 1A8FA 4Q0CA 4ESWA 4GVOA 5AA4A 3OD7A 1OLAA 2PT2A 4F3BA 1MXYA 5CMMA 3SEXA 1JQFA 2UVHA 4QSCA 1ZKBA 4F3SA 1H43A 4LQ2A 3WAEA 2RKMA 4YZZA 4Q30B 3EHUA 4OEUA 2D3IA 2DE2A 2THIA 1JNFA 3DELB 4DXBA 2XX7A 3F11A 3PUVE 3O28A 1YCJA 1SQYA 2UYEA 4EUOA 4OFJA 3EQ1A 5FHNA 4OEVA 3MVYA 3LSLA 4RYAA 2B3FA 3IOVA 4GQOA 4QFNA 1FQBA 1MDQA 4GXSB 3T93B 3HV1A 2O68A 3PD9A 5I2KB 1P99A 3MP6A 4UA8A 3HCQA 4AB5A 4DXUA 3W9VA 4GL0A 3RNNA 1KWHA 2DWHA 3RT8A 3SDFA 3IB2A 3K1PA 3PMWA 2I4BA 4N6PA 2Y7RA 3W15C 1US5A 5H8HB 4N07A 4NF5A 3MAMA 1B2HA 4R6KA 1SD3A 1B4HA 2F97A 3DP6A 1GR2A 4IB2A 1POTA 2X7PA 3OO8A 3HN0A 3JZJA 1LAFE 2G93A 5CBRA 1PBQA 2REJA 2XD3A 1VR5A 2ZMBA 3OXNA 2Y7WA 2RC7A 1R9QA 3SEWA 3IJXB 3SEVA 1LAHE 3MVWA 1SI0A 2F8DA 2RC9A 4ZS9A 4YMBA 4Q8RA 3TTLA 1D9VA 1D9YA 1ZTYA 1N7WA 4GRKA 4X48A 4MH5A 4PFTA 4G2ZA 4IY6A 3O6HA 3UORA 2O7IA 3K02A 4HS7A 2YPNA 1XC1A 5I2NA 3I3VA 4GXAA 4C1UA 3K01A 1B40A 4IO5A 3R7XA 3LBSA 3UIFA 4XTCQ 4JWYA 2LAOA 1Z7ME 2ZNSA 2D5WA 4IGRA 4R9FA 3VVEA 5ELVA 2FA7A 2HAUA 2H5YA 1EH3A 3KFMA 1AIVA 3C33A 1BTJA 1H45A 4EQ7A 4HCYA 3IB0A 1A99A 3O9PA 5L9MA 4ECFA 3C36A 5CM6A 3C35A 4DXCA 3FGSA 4ELPA 4MLQA 3K1NA 4YB6A 1MQJA 4THIA 4LP2B 3A09A 2XX9A 3O66A 1N76A 2PVUA 4XKQA 1QUIA 4LZ7A 1O7TA 3BKIB 4KHZE 3TPAA 4RXLA 2CMOA 1NNFA 1LB8A 3QIMA 5AA2B 4KPTA 4PFWA 5AA3A 2DWJA 3N5LA 3P7IA 1B3FA 3H06B 4YU0A 2QMWA 2P0SA 3MC2A 2A5TA 3H7MA 1LFHA 3VFJA 4G4PA 1IUDA 4GFRA 2PT1A 4MF3A 3OENA 4FORA 4JSOA 3CFZA 5DVFA 3M3KA 3FJGA 3MW0A 3T66A 4POWA 3FV2A 1II5A 1NKXA 4ZEIA 3KEIA 1B51A 1SBPA 1FTOA 3PGFA 4FIMA 4OETA 2ABHA 3TDJA 3O97A 3KBRA 4F1VA 3OSQA 1B05A 3CG1A 4LA9A 3SEUA 5M2VA 5F1QA 1USYH 3L6HA 4DDDA 4BDLA 3MZBA 3I5OA 3DM0A 4ZEBA 3ZS6A 1D4NA 2V3UA 4H0WA 2WKYA 1B0HA 4XKRA 4K3FA 3E13X 1NL5A 4BDRA 1M5CA 3USDA 5LOMA 5I57A 5I58B 2VHAA 3HO7A 5HM4B 3K6WA 4LVQA 3SESA 4XKNA 3CSGA 3RTWB 1POY1 4ZDMA 1B9JA 2ZNTA 4R73A 3C32A 1R9LA 3T22A 4BDNA 3PD8A 2O69A 2O1MA 4GL8A 3RLFE 2DS9A 3ZKLA 1PDAA 4I9DA 4OFLA 4OXVA 1B3LA 1SVXB 1PEBA 1F9BA 2DP8A 1ZMGA 1VSOA 1MY4A 5CMCA 1MPDA 2CZLA 1EU8A 1JVYA 5JK4A 1DTGA 4E0WA 1EZ9A 2Z23A 1SDXA 2Y84A 1MDP1 4ELRA 1Q35A 5B7DA 1GTKA 2DWIA 2W7YA 4AQ4A 3QK6A 4OFOA 2OBGA 1B58A 3VLVA 3UP9A 2A5TB 3G3FA 3N6UA 4G68A 2BJJX 3H6UA 2F78A 3GLBA 1URGA 5K2XA 1NH8A 2UYFA 2Z8DA 2GHAA 3N94A 3FXUA 5JTYA 4Z7EA 4MBPA 3K6VA 2DE3A 2OZZA 3OELA 5ICQA 3MP8A 3QYTA 1B4ZA 4YKKA 3A3UA 3FUZA 3FZVA 3TCHA 1VE4A 1BKAA 2OCUA 4GF8A 1JVXA 5FHOA 2Q2CA 5DEXA 4R6HA 1URDA 1LBBA 4OWDA 3QUJA 3ZKKA 4G8NA 3SERA 3K4UA 3ILTB 2OLBA 2PBWA 2I0BA 3Q25A 1FTMA 1P1UA 4KR5A 4LONB 4Z0IA 2GRVA 2QJEA 5IKBA 1LFGA 3GBAA 1B46A 3VXCA 2NWJA 2HFBA 1O63A 4IO2A 4C0RA 2ONRA 4U1ZA 4FAJA 2P1SA 3OMBA 1MG1A 1MQIA 4IO7A 2Q8JA 1GV8A 1TWYA 3TQWA 4IO3A 4E0XA 2P2AA 4HTGA 2AYSA 1PB7A 1MXWA 5B70A 1USYE 4F3GA 5CRYA 3KOTA 3CRBA 4OHNA 5I57B 1B1XA 3UK4A 4R75A 2I3WA 4M1VA 4KYEA 1FQFA 3O29A 4H5FA 3Q27A 4XIGQ 4PE5B 2XXYA 3IB1A 3FXRA 4NF4A 2XXWA 3TTMA 4DCXA 1B6HA 1JW1A 2UVIA 2UVJA 4WKMA 1N04A 4I8CA 3IAZA 3S2VA 4H6DA 5K2YA 3KOSA 1SI1A 5L8DA 2XXHA 3O6IA 4JWOA 4EQ9A 1XS5A 3D4CA 2F36A 2QRYA 3HHFA 3QUFA 4U1OA 3IO6A 2E0SA 2E1SA 4G68B 4R2BA 4U4SA 3FXQA 3MZ9A 3RQTA 4U2RA 1QJMA 4X1BA 3FJMA 1S9TA 3VDFA 4MLVA 1B32A 2F5XA 4OVJA 1IZ1A 5CC2A 3FVKA 5JTYB 2H25A 4H5GA 1Y3NA 3FVNA 5CI5A 1Y20A 4JWXA 1RYOA 3TODA 3OO7A 3CG3A 4O3BA 1QUKA 4NTLA 3TUSA 1AOVA 3FD3A 2NVUB 3K2DA 2XXIA 3MQ9A 5TP9A 1JEVA 4ND9A 4H65A 3PU5A 4FEDA 1FQAA 1RKMA 1P1WA 1Y3PA 1UTHA 4C1TA 3K6XA 4EXKA 1N0TA 2Z22A 3TTRA 3UGWA 4KCCA 3C34A 4ONYA 4G77A 3CSBA 2QL3A 1UIUA 3G3IA 3B6TA 3OEMA 3A3CA 5A5XB 1N3XA 3FIRA 1B5JA 5AA4B 4RK2A 4PFYA 5KCJA 4QRZA 1R1NA 1XVXA 5CMKA 3DP4A 2H98A 2XXRA 1UTBA 3TCFA 2OK2A 3PUZE 4QSDA 2IEEA 3RT6B 5I59A 5I56A 4NF8A 1Q1KA 3KSJA 4RK9A 2ESNA 1EZOA 4YKIA 3QXMA 4ZE8A 3K00A 3PUYE 3CR9A 1MRPA 5ITOA 1JW4A 1OQGA 4NF4B 1YAEA 2DXRA 1MY0A 5I84A 1JW5A 5ITPA 4O3AA 4P0GA 3PPQA 5H8QA 3Q26A 1I6AA 2AIXA 5JEIA 1ANFA 4OESA 4QFOA 1UIVA 4TLMB 1MM6A 1O64A 2Y7IA 4ZECA 4IGTA 4JDFA 1OMPA 1I6BA 3PMXA 1WVJA 1LAGE 1Y4TA 3SKPA 3TELA 1CE2A 1N84A 2RCBA 3EHTA 1LFIA 3EN3A 2V93A 4F22A 3HHGA 3O2AA 4ZZAA 1H3DA 3THIA 4EXLA 2O7UA 3L6GA 4NF5B 4FJPA 3MPKA 2ZNUA 2ZYNA 1LGBC 2Y7PA 4PETA 1LCFA 3W9WA 1FQEA 2I49A 2VD2A 4GWOA 2IA4A 4BLAA 3MP1A 3C31A 4F29A 3IJOB 4F31B 4U22A 5H8SA 3LSXA 1AL3A 3HPIA 4KI0E 1FQDA 5TP9B 1B3EA 1MY2A 3V5AA 3DLNA 1ZBMA 1OVBA 4H8JA 1MXXA 2XXXA 1UTHB 1D3KA 2F6PA 5AA1A 4R9GA 3GXAA 2YLNA 5FHMA 3PPOA 4QFPA 1MXUA 2DQVA 3QSLA 3CVGA 5I2NB 1IIWA 1DSNA 4G68C 5TU0A 3Q28A 4P11A 2KLFA 4GLIA 1MXZA 2NOOA 1ELJA 3JYRA 1Y4CA 4FECA 3OO9A 1B7HA 1DOTA 5KCJB 4BDQA 2O1LA 2REGA 3R6UA 2Q89A 4EDPA 1UTBB 3BBRA 1Y9UA 4OENA 4NF6A 5I59B 4NF8B 4NEDA 4IO6A 3IOWA 4RPOA 3MUQA 2DYXA 1MQDA 4KQPA 4RNSA 4QFKA 4NMYA 1GGGA 3K6UA 3VLWA 3EHSA 3H3GA 2ANJA 4EQBA 3IOUA 3ODBA 4R72A 3U1OA 1TT1A 4RY1A 3H6WA 3KN8A 5ICTA 1B52A 1I69A 1S7YA 4DCYA 2V3TA 4FE8A 1ZJLA 2F6GA 1TXFA 1B3GA 3VXBA 4TQUQ 1URSA 4F39A 1B5HA 1JETA 3CFLA 5I2KA 3N26A 5DT6A 3M3FA 3IX1A 2OJTA 4WEPA 4JSDA 4R6YA 4PFUA 3K0VA 3EPEA 1QKAA 3T9XB 4I62A 2ZYMA 2ALUA 4KYSA 1MH3A 4MFIA 5F7VA 3QAXA 3PUXE 2F7AA 1SW1A 1M5FA 5FTIA 5HPQA 3S9EA 5H8HA 1AH5A 4JB7A 1VFDA 3PUWE 2QS3A 4POXA 1SYHA 4EF1A 3HSTA 3OOAA 3KGCA 1DPPA 3IK6B 2R9JA 1MPCA 1IEJA 4KFQA 2QS4A 2RC8A 2HEUA 1Y1MA 3TCGA 1ZIUA 5TPAA 3K1MA 3T9HB 2F7BA 2HQ0A 2AL5A 2B3BA 1XT8A 3RGYA 3G3HA 3VLUA 3U8QA 1LB9A 1DTZA 2F34A 4LATA 3OSRA 2XXQA 1FTJA 2I48A 4YB5A 1HSLA 2QSXA 2NUVA 1NNKA 3RPWA 4F19A 3S4UA 1DMBA 1OLCA 1A55A 2XXTA 1Y3QA 3FJ7A 4NF6B 4YICA 4XXUA 1ZU0A 4TLLB 5FTHA 4N13A 3TMGA 3UN6A 3T96B 3CI8A 2X7QA 1BIYA 2OWSA 4F3PA 1S50A 2ZYOA 2M8CA 3M3LA 2YJPA 5KDTA 1M5BA 3S9LC 4FEBA 4ESXA 3G3GA 1FTKA 3T9VA 4BDOA 2V3QA 2F35A 4KCDA 1QUJA 2QPQA 2QS2A 4OYVA 2F7CA 1TFDA 4NWDA 1EZPA 3O6GA 2O51A 4OZ9A 3U72A 1AMFA 2XX8A 1P1QA 4DLDA 4L17A 5H8NA 3LR1A 1FCKA 3C9HA 3H6TA 3KN3A 5AA2A 1FTLA 2ZYKA 4YB7A 1VFEA 1A54A 3FV1A 3TKDA 1UQWA 1QKBA 1MS7A 1A40A 4OMBA 2HAVA 5DVJA 1YPNA 3SEYA 3V83A 2VP1A 2HXWA 1NH7A 4R74A 3TAJA 2I58A 4G8MA 5DVIA 3MVXA 1PB8A 2Z8FA 3U92A 1PBPA 1H76A 2Y7KA 2RF1A 2DVCA 5DEXB 1P1NA 2DXYA 5BUUA 4EF2A 1OIBA 1XOCA 3KSXA 2VGQA 2H99A 5L9SA 2UXAA 1MQHA 3GZGA 1HSJA 2I6EA 3H03A 1LSTA 5TPAB 1LCTA 5AE4A 1N7XA 3RUMA 1DPEA 3EF7A 2PX1A 1SYIA 3U93A 2H4IA 4LZ5A 4AB6A 2VD3A 2H9BA 2UVGA 1FW0A 4M4GA 1P1OA 5IAIA 1MXVA 1T0KA 4PQJA 3SETA 4UACA 4U4XA 3LUYA 4OERA 4O3CA 3RTFB 4HW8A 3FASA 1OVTA 3BFUA 3LSWA 2XD2A 2X26A 4NE4A 3B6QA 1M5EA 5I58A 2ONKE 3R26A 3GBBA 4H67A 3PMVA 2DWAA 3IOTA 4ZE9A 5H8FA 5KDTB 5EYFA 3FVOA 2NXOA 3MWBA 4XKPA 4FATA 1BP5A 3JV9A 3U94A 3G3JA 4F1UA 3MJNA 2GFEA 3PPRA 1IQ7A 2Q2AA 3FATA 4NWCA 4YAHX 2I0CA 4LQ5A 5AA2D 1LLSA 4Q5TA 5H8NB 3V8XB 1IITA 2I3VA 1US4A 4F1YA 3MBPA 5J1DA 1QVSA 3E3KA 4U23A 3E9XA 4DIGA 5KZTA 3DP8A 5CBSA 2HCAA 3KJ7A 2I4CA 1WODA 2ONSA 3G7WA 4ZEKA 2DSFA 1IXHA 4QSEA 3IL1B 2HZLA 3VV5A 3S9NC 5ISUA 3TZAA 2HZKA 3S9MC 4OQOA 4KYDA 3TTNA 4YKPA 3ILUB 3T9UA 1B3HA 4JBZA 3ECRA 3IORA 2AL4A 1TFAA 3MPLA 2ZXTA 2XHDA 4TOZA 1SW4A 2PMSA 3CIJA 3TTKA 2DE4A 3M8UA 1CB6A 4HCWA 4ZZEA 3TEPA 2O84X 1MY3A 3B7DA 4YMAA 4ZEDA 1B1HA 4GD5A 4JXIA 3BFTA 4DE8A 2QS1A 3OEKA 1MY1A 1N3WA 1B7ZA 1BLFA 4F18A 3VVDA 2R71A 4RPNA 3LC8A 3KN7A 3G3KA 2RCAA 4WEDA 3ONMA 5DYHA 4ELOA 3RN8A 1R6ZA 3KJTA 3WAFA 1Y1ZA 4ISUA 1J1NA 4H8IA 1L5TA 3PPPA 3LSFB 1A7LA 1WDNA 4OTEA 2FNCA 4H1XA 3H6VA 4R2FA 4LZ8A 5BWJA 2GH9A 3V89B 5I56B 4F2OA 1YTVA 1QW0A 3AXFA 1B7UA 3TQLA 1IXGA 1A8EA 1M5DA 4IY5A 1B5IA 3KZGA 2Q88A 2V84A 2V25A 5H8FB 1NFTA 2XXPA 3FVGA 3RY3A 5EHSA 2G29A 2B65A 5H8QB 3PPNA
chains in the Genus database with same CATH superfamily
1FBCA 3IO4A 4GOTA 2O6AA 1NNTA 1PB9A 4X9TA 2GHBA 4ZEFA 3H4ZA 5EHMA 1NV6A 2DVZA 4BDMA 3VVFA 4KD5A 3D4GA 2VOZA 5IZ3A 2ZZVA 1XHYA 1FQCA 4QF9A 1JEUA 1LBCA 5HBCA 5DTBA 5L9OA 2D21A 4P0IA 1IMBA 1LBZA 3UA8A 2DOJA 2R6GE 3KG2A 4F2QA 1LBYA 1MM7A 1SW2A 4RJZA 2PYYA 2XXVA 4RA1A 3Q29A 2Z8EA 2RINA 1XVYA 3MVZA 1B0LA 1IMCA 4LUBA 2FYIA 1NNPA 1MH4A 2OWTA 4GIZA 4IO4A 4ELQA 5CMBA 2A5SA 4I1DA 2Q9TA 2WBDA 1OQHA 3B6WA 3PV0E 4U21A 1MQGA 3I6VA 4X04A 3TFLA 3VE1B 3CFXA 1Z7NE 4QFLA 1MPBA 2XXUA 1QGXA 1PC3A 4PP0A 1SW5A 3N6TA 4X1DA 4DZ1A 3ISPA 2QVUA 2V4CA 4O7IA 4YKJA 4QHQA 2QMXA 1RYXA 1ZLQA 3MZ1A 4WXJA 1QULA 3TYHA 3IR1A 2CZHA 3C4MA 1IXCA 3ZSFA 1NMUA 3QMFA 1LAXA 1I6QA 2OWZA 3E4RA 3B8BA 2FBPA 4G8HA 4N15A 3OO6A 4MNCA 1IXIA 1HSEA 1ATGA 1GVCA 5A5XA 1H44A 1A8FA 4Q0CA 4ESWA 4GVOA 5AA4A 3OD7A 1OLAA 2PT2A 3IFCA 4F3BA 1MXYA 2CEXA 5CMMA 3SEXA 3CHGA 3HFUA 1JQFA 2UVHA 4QSCA 4NAPA 1ZKBA 4F3SA 4P1EA 1H43A 1RDYA 4LQ2A 3WAEA 2RKMA 4OVRA 4YZZA 4Q30B 3EHUA 4OEUA 1EYJA 2D3IA 2DE2A 2THIA 2ZZWA 1JNFA 3DELB 4DXBA 2XX7A 3F11A 3PUVE 3O28A 3KC1A 2CZIA 1YCJA 1FBHA 1SQYA 2UYEA 4EUOA 4OFJA 3ROJA 3EQ1A 5FHNA 4OEVA 3MVYA 3LSLA 4RYAA 2B3FA 3IOVA 4GQOA 4QFNA 1FQBA 1MDQA 4GXSB 3T93B 3HV1A 2O68A 3PD9A 5IZ3B 5I2KB 1P99A 3MP6A 4UA8A 3HCQA 4AB5A 2DDKA 4DXUA 3W9VA 4GL0A 3RNNA 1KWHA 3IFAA 5ESYA 2DWHA 3RT8A 3SDFA 3IB2A 3K1PA 3PMWA 2I4BA 4N6PA 2Y7RA 3W15C 1US5A 5H8HB 4N07A 4PFIA 2VPOA 4NF5A 3MAMA 1B2HA 4R6KA 1SD3A 1B4HA 2F97A 3DP6A 1GR2A 4IB2A 1POTA 2X7PA 3OO8A 5ET5A 3HN0A 3JZJA 1LAFE 4QBAA 2G93A 5CBRA 1PBQA 2REJA 2XD3A 5I5PA 1VR5A 2ZMBA 3OXNA 4GWWA 2Y7WA 2RC7A 1R9QA 4MMPA 3SEWA 3IJXB 3SEVA 1LAHE 3MVWA 1SI0A 2F8DA 2RC9A 4ZS9A 4YMBA 4Q8RA 3TTLA 1D9VA 4PFRA 2F3BA 2QVVA 1D9YA 1ZTYA 1N7WA 3T0JA 4GRKA 4PGPA 4X48A 4MH5A 2P3VA 4PFTA 4G2ZA 4IY6A 1EYKA 3O6HA 3UORA 2O7IA 3K02A 4HS7A 2ZZXA 2YPNA 1XC1A 5I2NA 4N6DA 3I3VA 4GXAA 4C1UA 3K01A 1B40A 4PBQA 4IO5A 3R7XA 1RDZA 3LBSA 3UIFA 4XTCQ 4JWYA 2LAOA 1G0HA 1Z7ME 2ZNSA 4GBWA 2D5WA 4IGRA 4HE0A 4R9FA 3VVEA 5ELVA 2FA7A 2HAUA 2H5YA 1EH3A 3KFMA 1FBPA 1AIVA 3C33A 1BTJA 1H45A 4EQ7A 4I3YA 4HCYA 3IB0A 4N81A 1A99A 3O9PA 5L9MA 4ECFA 3C36A 5CM6A 3C35A 4DXCA 1SPIA 3FGSA 4ELPA 4MLQA 3K1NA 4YB6A 1MQJA 4N17A 4THIA 4LP2B 3A09A 2XX9A 3O66A 1N76A 1FPBA 2PVUA 5EYGA 4XKQA 1QUIA 4LZ7A 1FSAA 1O7TA 3BKIB 4KHZE 3TPAA 4RXLA 4N4UA 2CMOA 1NNFA 1LB8A 3QIMA 5AA2B 4KPTA 4PFWA 5AA3A 2DWJA 3N5LA 3P7IA 1B3FA 3H06B 4YU0A 2QMWA 2P0SA 1KZ8A 3MC2A 2A5TA 3PTYA 4KXPA 3H7MA 1LFHA 3VFJA 1JP4A 4G4PA 1IUDA 4GFRA 2PT1A 4MF3A 3OENA 4FORA 4JSOA 3CFZA 5DVFA 2XWVA 3M3KA 3FJGA 3MW0A 3T66A 4POWA 3FV2A 1II5A 1NKXA 4N91A 4ZEIA 4HE2A 4XFEA 4AS5A 3KEIA 4PF6A 1B51A 1SBPA 1FTOA 3PGFA 4FIMA 4OETA 2ABHA 1RDXA 2Y5LA 3TDJA 3O97A 3KBRA 4F1VA 3OSQA 1B05A 3CG1A 4NQ8A 4LA9A 3SEUA 5M2VA 5F1QA 1USYH 3L6HA 4DDDA 4BDLA 3MZBA 4PAIA 3I5OA 3DM0A 4ZEBA 3ZS6A 1D4NA 2V3UA 4H0WA 2F3DA 2WKYA 1B0HA 4XKRA 4K3FA 3E13X 4P47A 1NL5A 4BDRA 1YZ0A 3E78A 1M5CA 3USDA 5LOMA 5I57A 4NF0A 3GYYA 5ET8A 5I58B 1IMAA 2VHAA 2QVRA 3HO7A 5HM4B 4N8YA 3K6WA 4LVQA 3SESA 1INPA 4XKNA 2FIEA 3CSGA 3RTWB 1IMDA 1POY1 4ZDMA 1FPIA 1B9JA 2ZNTA 4R73A 3C32A 1R9LA 3T22A 4BDNA 3PD8A 2O69A 2O1MA 4GL8A 3RLFE 2DS9A 1LBVA 3ZKLA 4OXVA 1PDAA 4I9DA 4OFLA 1B3LA 1SVXB 1PEBA 1F9BA 2DP8A 2WEFA 1ZMGA 1VSOA 1MY4A 5CMCA 1MPDA 2CZLA 1EU8A 1JVYA 5JK4A 4PE3A 1DTGA 2Z23A 1EZ9A 4E0WA 1SDXA 1KA1A 2Y84A 1MDP1 4ELRA 1Q35A 5B7DA 1GTKA 2DWIA 2W7YA 4AQ4A 1FTAA 3QK6A 4OFOA 2OBGA 1B58A 3VLVA 3UP9A 2A5TB 3G3FA 3N6UA 4G68A 2BJJX 1NV4A 3H6UA 2F78A 3GLBA 1URGA 5K2XA 1NH8A 5ET6A 2UYFA 2Z8DA 2BJIA 2GHAA 3N94A 3FXUA 5JTYA 4Z7EA 4MBPA 3K6VA 2DE3A 2OZZA 3OELA 5ICQA 3MP8A 3QYTA 1B4ZA 4YKKA 3A3UA 3FUZA 3FZVA 3TCHA 1G0IA 4DI3D 1VE4A 1BKAA 2OCUA 4GF8A 1JVXA 5FHOA 5IGAA 2Q2CA 2XWKA 5DEXA 1FJ9A 4R6HA 1URDA 1LBBA 4OWDA 3QUJA 3ZKKA 4G8NA 4GWYA 3KBZA 3SERA 3K4UA 3ILTB 2OLBA 2PBWA 2I0BA 3Q25A 1FTMA 1P1UA 1AWBA 4KR5A 4LONB 4Z0IA 2HXRA 2GRVA 2QJEA 5IKBA 1LFGA 3GBAA 1B46A 3VXCA 2NWJA 2HFBA 1O63A 1FJ6A 4IO2A 4C0RA 2ONRA 4U1ZA 4FAJA 2P1SA 3OMBA 4OANA 4LN5A 1MG1A 3BIHA 1MQIA 4IO7A 2Q8JA 2QFLA 1GV8A 1TWYA 3TQWA 1YYZA 4IO3A 4E0XA 2P2AA 4HTGA 2AYSA 1PB7A 4H45A 1MXWA 5B70A 1USYE 2FVZA 4F3GA 5CRYA 3KOTA 1FBEA 4I3EA 1BK4A 3CRBA 4OHNA 5I57B 4N6KA 1B1XA 3UK4A 4XEQA 4DI4B 4R75A 2I3WA 4M1VA 4PAFA 1DBZA 4KYEA 2HPGA 1FQFA 3O29A 4H5FA 3Q27A 4XIGQ 4PE5B 2XXYA 2B4LA 3IB1A 4P8BA 2FHYA 3FXRA 4NF4A 2XXWA 3TTMA 4DCXA 1B6HA 1JW1A 2UVIA 2P3NA 2UVJA 2B4MA 4WKMA 4P56A 1N04A 4I8CA 3IAZA 3S2VA 2VPNA 4H6DA 5K2YA 3KOSA 1SI1A 5L8DA 2XXHA 3O6IA 4JWOA 4EQ9A 1XS5A 3D4CA 2F36A 2QRYA 4GWZA 3HHFA 3QUFA 4U1OA 4R2BA 3IO6A 2E0SA 2E1SA 2WX9A 4G68B 4U4SA 3FXQA 3MZ9A 3RQTA 4U2RA 1NV2A 1QJMA 4X1BA 3FJMA 1S9TA 2PFZA 4MLVA 3VDFA 1B32A 2F5XA 4OVJA 1IZ1A 5CC2A 3FVKA 5JTYB 2H25A 4H5GA 1Y3NA 3FVNA 5CI5A 1NV5A 2CEYA 1Y20A 1LBWA 4JWXA 1RYOA 3TODA 3OO7A 4GWSA 3CG3A 4PGNA 4O3BA 4P3LA 1QUKA 4NTLA 3TUSA 4P9KA 1AOVA 3FD3A 2NVUB 1YXIA 3K2DA 2XXIA 3MQ9A 5TP9A 1JEVA 4ND9A 4H65A 3PU5A 4FEDA 4GBVA 1FQAA 1RKMA 1P1WA 3U65A 1Y3PA 1UTHA 4C1TA 3K6XA 4EXKA 1N0TA 2Z22A 3TTRA 3UGWA 4KCCA 3C34A 4ONYA 4G77A 3CSBA 2QL3A 1UIUA 3G3IA 3B6TA 3OEMA 3A3CA 1LBXA 5A5XB 1N3XA 3FIRA 1B5JA 4NX1A 5AA4B 4RK2A 4PFYA 5KCJA 4QRZA 1R1NA 2VT5A 1XVXA 4MAGA 5CMKA 3DP4A 2H98A 2XXRA 1UTBA 2CZKA 3TCFA 2OK2A 3PUZE 4QSDA 2IEEA 3RT6B 5I59A 5I56A 4NF8A 1Q1KA 3KSJA 2FIXA 2JJKA 4RK9A 2ESNA 1EZOA 4O7MA 4YKIA 3QXMA 4ZE8A 3K00A 1VDWA 3PUYE 3CR9A 1NUZA 5EYHA 1MRPA 4PC9A 5ITOA 1JW4A 1OQGA 2XA5A 4NF4B 1YAEA 2DXRA 1MY0A 5I84A 1JW5A 5ITPA 4O3AA 1EYIA 4P0GA 3PPQA 5H8QA 3Q26A 1I6AA 2AIXA 5JEIA 1ANFA 4OESA 4QFOA 5LDZA 1UIVA 4TLMB 1MM6A 1O64A 2Y7IA 4ZECA 4IGTA 4JDFA 1OMPA 1I6BA 3PMXA 4I40A 1WVJA 1LAGE 1Y4TA 3SKPA 3TELA 1CE2A 1CNQA 1N84A 2RCBA 3EHTA 1LFIA 3EN3A 2V93A 4F22A 3HHGA 3O2AA 4ZZAA 1H3DA 1FPFA 4MHFA 3THIA 2XXKA 4EXLA 2O7UA 3L6GA 4NF5B 4FJPA 3MPKA 2ZNUA 2ZYNA 1LGBC 2Y7PA 4GX6A 2WYPA 4PETA 1LCFA 3W9WA 1FQEA 2KQZA 2I49A 2VD2A 4GWOA 2IA4A 3RPLA 4BLAA 4OVTA 3MP1A 3C31A 4GWUA 3IJOB 4F29A 4F31B 4U22A 5H8SA 1FBDA 2HHMA 3LSXA 2KR0A 1AL3A 3HPIA 4PDDA 3NOHA 2Q8MA 4KI0E 1FQDA 5TP9B 1B3EA 1MY2A 3V5AA 3DLNA 1ZBMA 1OVBA 4H8JA 1MXXA 2XXXA 1UTHB 1D3KA 2F6PA 5EQ7A 5AA1A 4R9GA 3GXAA 2YLNA 5FHMA 3FXBA 3PPOA 4QFPA 2Q74A 1MXUA 2DQVA 3QSLA 3CVGA 5I2NB 1IIWA 1DSNA 4G68C 5TU0A 3Q28A 4P11A 2KLFA 4GLIA 1MXZA 2NOOA 1ELJA 4P1LA 3JYRA 1NUWA 1Y4CA 4FECA 3OO9A 1B7HA 1DOTA 1FPJA 5KCJB 1XI6A 4BDQA 2O1LA 2REGA 3R6UA 4PDHA 2Q89A 4EDPA 1UTBB 3BBRA 1Y9UA 4OA4A 4OENA 4NF6A 5I59B 4NF8B 4NEDA 4IO6A 3IOWA 4RPOA 3MUQA 2DYXA 1MQDA 4KQPA 4RNSA 4QFKA 4NMYA 1GGGA 3K6UA 3VLWA 3EHSA 3H3GA 2ANJA 4EQBA 3IOUA 3ODBA 4R72A 3U1OA 1FBFA 1TT1A 4RY1A 3H6WA 3KN8A 5ICTA 1B52A 4HXVA 1I69A 2PCRA 1S7YA 1IMEA 4DCYA 2V3TA 3D1RA 4FE8A 1ZJLA 2F6GA 1TXFA 1B3GA 3VXBA 4TQUQ 4X8RA 1URSA 4F39A 1B5HA 1JETA 3CFLA 4PBHA 5I2KA 3N26A 5DT6A 3M3FA 3IX1A 2OJTA 4WEPA 4JSDA 1NV1A 4R6YA 4PFUA 3K0VA 3EPEA 1NUXA 1QKAA 3T9XB 4I62A 2ZYMA 2ALUA 4KYSA 1MH3A 3B50A 4MFIA 5F7VA 3QAXA 3PUXE 2F7AA 1SW1A 1M5FA 5FTIA 5HPQA 3S9EA 5H8HA 3RPLB 1AH5A 4JB7A 1VFDA 3PUWE 2QS3A 5J16A 4POXA 1SYHA 4NG7A 4EF1A 3HSTA 4XF5A 3OOAA 3KGCA 1DPPA 3IK6B 2R9JA 1FPDA 1MPCA 1IEJA 4KFQA 2QS4A 2RC8A 2HEUA 1Y1MA 4MNIA 3TCGA 4FBPA 5EQAA 1ZIUA 5TPAA 3K1MA 2PFYA 4MEVA 3T9HB 2F7BA 4O8MA 2HQ0A 2AL5A 2B3BA 1XT8A 4NHBA 2L5VA 3E79A 3RGYA 3G3HA 3VLUA 3U8QA 1LB9A 4PTKA 1DTZA 2F34A 4LATA 3OSRA 2XXQA 4GX4A 1FTJA 2I48A 4YB5A 3EKIA 1HSLA 2QSXA 2NUVA 1NNKA 3SZPA 4MIJA 3RPWA 4F19A 3S4UA 5FBPA 1DMBA 1OLCA 1A55A 2XXTA 1Y3QA 4QXDA 5I3SA 4OVQA 3FJ7A 3LV0A 4NF6B 4YICA 4XXUA 4IR8A 1ZU0A 4TLLB 5FTHA 4N13A 1FPEA 3TMGA 3UN6A 1NV3A 3T96B 3CI8A 2X7QA 1BIYA 2OWSA 4F3PA 1S50A 2ZYOA 2M8CA 3M3LA 2YJPA 5KDTA 1M5BA 3S9LC 4FEBA 4ESXA 3G3GA 1FTKA 4H46A 3T9VA 4BDOA 2V3QA 2F35A 4KCDA 1NV7A 1QUJA 2QPQA 2QS2A 4OYVA 2F7CA 1TFDA 4NWDA 1EZPA 3O6GA 2O51A 4OZ9A 3U72A 1AMFA 2XX8A 4MNPA 1P1QA 4DLDA 4L17A 5EQ9A 5H8NA 3LR1A 1FCKA 3C9HA 3H6TA 3KN3A 2Y5KA 5AA2A 1FTLA 5IM2A 2ZYKA 4YB7A 1VFEA 1A54A 3FV1A 3TKDA 1UQWA 1QKBA 1MS7A 1A40A 3BIGA 4OMBA 2HAVA 5DVJA 1YPNA 3SEYA 3V83A 1FRPA 2VP1A 2HXWA 1NH7A 2GQ1A 4R74A 3TAJA 2I58A 4G8MA 4JVDA 5DVIA 3MVXA 1PB8A 4UABA 2Z8FA 4PAKA 3U92A 1NUYA 1H76A 1PBPA 2Y7KA 2RF1A 2DVCA 5DEXB 1P1NA 2DXYA 5BUUA 3KC0A 4EF2A 1OIBA 1XOCA 3KSXA 4GX3A 2WYKA 2VGQA 5F24A 2H99A 5EQ8A 1NV0A 5L9SA 4OVSA 2UXAA 1MQHA 3GZGA 1HSJA 2I6EA 3H03A 1LSTA 5TPAB 1LCTA 5AE4A 1N7XA 3RUMA 1DPEA 1LEVA 3EF7A 2PX1A 1SYIA 4PFBA 3U93A 2H4IA 4LZ5A 4AB6A 2VD3A 2H9BA 2UVGA 1FW0A 5IZZA 1K9ZA 1DK4A 1K9YA 4M4GA 1P1OA 5IAIA 1MXVA 1T0KA 4PQJA 3SETA 4UACA 4U4XA 3LUYA 4OERA 4HE1A 4O3CA 3RTFB 4HW8A 3FASA 5I7IA 1OVTA 3BFUA 3LSWA 2XD2A 2X26A 4NE4A 3B6QA 4MJOA 1M5EA 5I58A 2ONKE 3R26A 3GBBA 4H67A 4MCOA 3PMVA 2OX3A 2DWAA 3IOTA 4ZE9A 2R8TA 4MX6A 5H8FA 3MSTA 5KDTB 5EYFA 5ET7A 3FVOA 2NXOA 3MWBA 1FPGA 1Q9DA 4XKPA 4FATA 1FBGA 1BP5A 1FPLA 3RYDA 3JV9A 3U94A 3G3JA 4F1UA 3MJNA 1KA0A 2GFEA 3PPRA 1DCUA 1IQ7A 2Q2AA 3MYUA 3FATA 4NWCA 4YAHX 2I0CA 4LQ5A 5AA2D 1LLSA 4Q5TA 2XWIA 1FPKA 5H8NB 3V8XB 1IITA 2I3VA 1US4A 4F1YA 3MBPA 5J1DA 1QVSA 3E3KA 4U23A 4N8GA 4NGUA 3E9XA 4GWXA 4DIGA 5KZTA 3DP8A 4G61A 1NI9A 5CBSA 2HCAA 3KJ7A 2I4CA 5A5LA 1WODA 4O94A 2ONSA 3G7WA 4ZEKA 2DSFA 4NN3A 1IXHA 3T1BA 1D9QA 4JVCA 4QSEA 3IL1B 2HZLA 3VV5A 3S9NC 5ISUA 3TZAA 4JVIA 2HZKA 3S9MC 4OQOA 4KYDA 4OVPA 3TTNA 4YKPA 3ILUB 3T9UA 1B3HA 4JBZA 3ECRA 3IORA 2AL4A 1TFAA 3MPLA 2ZXTA 2WBBA 3A29A 2XHDA 4TOZA 1SW4A 5T3JA 2PMSA 3CIJA 3TTKA 2DE4A 3M8UA 1CB6A 4HCWA 4ZZEA 3TEPA 5IZ1A 2O84X 1MY3A 3B7DA 4YMAA 4ZEDA 1B1HA 4GD5A 4JXIA 3BFTA 4DE8A 2QS1A 3OEKA 1MY1A 1N3WA 1B7ZA 1BLFA 2MKZA 4F18A 3VVDA 2R71A 4RPNA 3LC8A 3KN7A 3G3KA 2RCAA 4WEDA 3ONMA 5DYHA 4ELOA 3RN8A 1R6ZA 3KJTA 5DW8A 1IMFA 3WAFA 1Y1ZA 4ISUA 4AS4A 1J1NA 3LUZA 4H8IA 1L5TA 3PPPA 3LSFB 1A7LA 1WDNA 4OTEA 2FNCA 4H1XA 4PF8A 3H6VA 4R2FA 4LZ8A 5BWJA 2GH9A 3V89B 5I56B 4F2OA 1YTVA 1QW0A 2XWOA 3AXFA 1B7UA 3TQLA 1IXGA 1A8EA 1M5DA 4IY5A 1B5IA 5LTCA 3KZGA 4PCDA 2Q88A 2V84A 2V25A 5H8FB 1NFTA 2XXPA 3FVGA 3RY3A 5EHSA 2G29A 2B65A 3FBPA 5H8QB 3PPNA
chains in the Genus database with same CATH topology
3IO4A 4GOTA 2O6AA 1NNTA 1PB9A 4X9TA 2GHBA 4ZEFA 3H4ZA 5EHMA 2DVZA 4BDMA 3VVFA 4KD5A 3D4GA 2VOZA 1XHYA 1FQCA 4QF9A 1JEUA 1LBCA 5HBCA 5DTBA 5L9OA 2D21A 4P0IA 3UA8A 2DOJA 2R6GE 3KG2A 4F2QA 1MM7A 1SW2A 4RJZA 2PYYA 2XXVA 4RA1A 3Q29A 2Z8EA 2RINA 1XVYA 3MVZA 1B0LA 4LUBA 2FYIA 1NNPA 1MH4A 2OWTA 4GIZA 4IO4A 4ELQA 5CMBA 2A5SA 4I1DA 2Q9TA 1OQHA 3B6WA 3PV0E 4U21A 1MQGA 3I6VA 3TFLA 3VE1B 3CFXA 1Z7NE 4QFLA 1MPBA 2XXUA 1PC3A 4PP0A 1SW5A 3N6TA 4X1DA 4DZ1A 4YKJA 4QHQA 2QMXA 1RYXA 1ZLQA 3MZ1A 4WXJA 1QULA 3TYHA 3IR1A 3C4MA 1IXCA 3ZSFA 1NMUA 1LAXA 1I6QA 3E4RA 4G8HA 3OO6A 1IXIA 1HSEA 1ATGA 1GVCA 5A5XA 1H44A 1A8FA 4Q0CA 4ESWA 4GVOA 5AA4A 3OD7A 1OLAA 2PT2A 4F3BA 1MXYA 5CMMA 3SEXA 1JQFA 2UVHA 4QSCA 1ZKBA 4F3SA 1H43A 4LQ2A 3WAEA 2RKMA 4YZZA 4Q30B 3EHUA 4OEUA 2D3IA 2DE2A 2THIA 1JNFA 3DELB 4DXBA 2XX7A 3F11A 3PUVE 3O28A 1YCJA 1SQYA 2UYEA 4EUOA 4OFJA 3EQ1A 5FHNA 4OEVA 3MVYA 3LSLA 4RYAA 2B3FA 3IOVA 4GQOA 4QFNA 1FQBA 1MDQA 4GXSB 3T93B 3HV1A 2O68A 3PD9A 5I2KB 1P99A 3MP6A 4UA8A 3HCQA 4AB5A 4DXUA 3W9VA 4GL0A 3RNNA 1KWHA 2DWHA 3RT8A 3SDFA 3IB2A 3K1PA 3PMWA 2I4BA 4N6PA 2Y7RA 3W15C 1US5A 5H8HB 4N07A 4NF5A 3MAMA 1B2HA 4R6KA 1SD3A 1B4HA 2F97A 3DP6A 1GR2A 4IB2A 1POTA 2X7PA 3OO8A 3HN0A 3JZJA 1LAFE 2G93A 5CBRA 1PBQA 2REJA 2XD3A 1VR5A 2ZMBA 3OXNA 2Y7WA 2RC7A 1R9QA 3SEWA 3IJXB 3SEVA 1LAHE 3MVWA 1SI0A 2F8DA 2RC9A 4ZS9A 4YMBA 4Q8RA 3TTLA 1D9VA 1D9YA 1ZTYA 1N7WA 4GRKA 4X48A 4MH5A 4PFTA 4G2ZA 4IY6A 3O6HA 3UORA 2O7IA 3K02A 4HS7A 2YPNA 1XC1A 5I2NA 3I3VA 4GXAA 4C1UA 3K01A 1B40A 4IO5A 3R7XA 3LBSA 3UIFA 4XTCQ 4JWYA 2LAOA 1Z7ME 2ZNSA 2D5WA 4IGRA 4R9FA 3VVEA 5ELVA 2FA7A 2HAUA 2H5YA 1EH3A 3KFMA 1AIVA 3C33A 1BTJA 1H45A 4EQ7A 4HCYA 3IB0A 1A99A 3O9PA 5L9MA 4ECFA 3C36A 5CM6A 3C35A 4DXCA 3FGSA 4ELPA 4MLQA 3K1NA 4YB6A 1MQJA 4THIA 4LP2B 3A09A 2XX9A 3O66A 1N76A 2PVUA 4XKQA 1QUIA 4LZ7A 1O7TA 3BKIB 4KHZE 3TPAA 4RXLA 2CMOA 1NNFA 1LB8A 3QIMA 5AA2B 4KPTA 4PFWA 5AA3A 2DWJA 3N5LA 3P7IA 1B3FA 3H06B 4YU0A 2QMWA 2P0SA 3MC2A 2A5TA 3H7MA 1LFHA 3VFJA 4G4PA 1IUDA 4GFRA 2PT1A 4MF3A 3OENA 4FORA 4JSOA 3CFZA 5DVFA 3M3KA 3FJGA 3MW0A 3T66A 4POWA 3FV2A 1II5A 1NKXA 4ZEIA 3KEIA 1B51A 1SBPA 1FTOA 3PGFA 4FIMA 4OETA 2ABHA 3TDJA 3O97A 3KBRA 4F1VA 3OSQA 1B05A 3CG1A 4LA9A 3SEUA 5M2VA 5F1QA 1USYH 3L6HA 4DDDA 4BDLA 3MZBA 3I5OA 3DM0A 4ZEBA 3ZS6A 1D4NA 2V3UA 4H0WA 2WKYA 1B0HA 4XKRA 4K3FA 3E13X 1NL5A 4BDRA 1M5CA 3USDA 5LOMA 5I57A 5I58B 2VHAA 3HO7A 5HM4B 3K6WA 4LVQA 3SESA 4XKNA 3CSGA 3RTWB 1POY1 4ZDMA 1B9JA 2ZNTA 4R73A 3C32A 1R9LA 3T22A 4BDNA 3PD8A 2O69A 2O1MA 4GL8A 3RLFE 2DS9A 3ZKLA 1PDAA 4I9DA 4OFLA 4OXVA 1B3LA 1SVXB 1PEBA 1F9BA 2DP8A 1ZMGA 1VSOA 1MY4A 5CMCA 1MPDA 2CZLA 1EU8A 1JVYA 5JK4A 1DTGA 4E0WA 1EZ9A 2Z23A 1SDXA 2Y84A 1MDP1 4ELRA 1Q35A 5B7DA 1GTKA 2DWIA 2W7YA 4AQ4A 3QK6A 4OFOA 2OBGA 1B58A 3VLVA 3UP9A 2A5TB 3G3FA 3N6UA 4G68A 2BJJX 3H6UA 2F78A 3GLBA 1URGA 5K2XA 1NH8A 2UYFA 2Z8DA 2GHAA 3N94A 3FXUA 5JTYA 4Z7EA 4MBPA 3K6VA 2DE3A 2OZZA 3OELA 5ICQA 3MP8A 3QYTA 1B4ZA 4YKKA 3A3UA 3FUZA 3FZVA 3TCHA 1VE4A 1BKAA 2OCUA 4GF8A 1JVXA 5FHOA 2Q2CA 5DEXA 4R6HA 1URDA 1LBBA 4OWDA 3QUJA 3ZKKA 4G8NA 3SERA 3K4UA 3ILTB 2OLBA 2PBWA 2I0BA 3Q25A 1FTMA 1P1UA 4KR5A 4LONB 4Z0IA 2GRVA 2QJEA 5IKBA 1LFGA 3GBAA 1B46A 3VXCA 2NWJA 2HFBA 1O63A 4IO2A 4C0RA 2ONRA 4U1ZA 4FAJA 2P1SA 3OMBA 1MG1A 1MQIA 4IO7A 2Q8JA 1GV8A 1TWYA 3TQWA 4IO3A 4E0XA 2P2AA 4HTGA 2AYSA 1PB7A 1MXWA 5B70A 1USYE 4F3GA 5CRYA 3KOTA 3CRBA 4OHNA 5I57B 1B1XA 3UK4A 4R75A 2I3WA 4M1VA 4KYEA 1FQFA 3O29A 4H5FA 3Q27A 4XIGQ 4PE5B 2XXYA 3IB1A 3FXRA 4NF4A 2XXWA 3TTMA 4DCXA 1B6HA 1JW1A 2UVIA 2UVJA 4WKMA 1N04A 4I8CA 3IAZA 3S2VA 4H6DA 5K2YA 3KOSA 1SI1A 5L8DA 2XXHA 3O6IA 4JWOA 4EQ9A 1XS5A 3D4CA 2F36A 2QRYA 3HHFA 3QUFA 4U1OA 3IO6A 2E0SA 2E1SA 4G68B 4R2BA 4U4SA 3FXQA 3MZ9A 3RQTA 4U2RA 1QJMA 4X1BA 3FJMA 1S9TA 3VDFA 4MLVA 1B32A 2F5XA 4OVJA 1IZ1A 5CC2A 3FVKA 5JTYB 2H25A 4H5GA 1Y3NA 3FVNA 5CI5A 1Y20A 4JWXA 1RYOA 3TODA 3OO7A 3CG3A 4O3BA 1QUKA 4NTLA 3TUSA 1AOVA 3FD3A 2NVUB 3K2DA 2XXIA 3MQ9A 5TP9A 1JEVA 4ND9A 4H65A 3PU5A 4FEDA 1FQAA 1RKMA 1P1WA 1Y3PA 1UTHA 4C1TA 3K6XA 4EXKA 1N0TA 2Z22A 3TTRA 3UGWA 4KCCA 3C34A 4ONYA 4G77A 3CSBA 2QL3A 1UIUA 3G3IA 3B6TA 3OEMA 3A3CA 5A5XB 1N3XA 3FIRA 1B5JA 5AA4B 4RK2A 4PFYA 5KCJA 4QRZA 1R1NA 1XVXA 5CMKA 3DP4A 2H98A 2XXRA 1UTBA 3TCFA 2OK2A 3PUZE 4QSDA 2IEEA 3RT6B 5I59A 5I56A 4NF8A 1Q1KA 3KSJA 4RK9A 2ESNA 1EZOA 4YKIA 3QXMA 4ZE8A 3K00A 3PUYE 3CR9A 1MRPA 5ITOA 1JW4A 1OQGA 4NF4B 1YAEA 2DXRA 1MY0A 5I84A 1JW5A 5ITPA 4O3AA 4P0GA 3PPQA 5H8QA 3Q26A 1I6AA 2AIXA 5JEIA 1ANFA 4OESA 4QFOA 1UIVA 4TLMB 1MM6A 1O64A 2Y7IA 4ZECA 4IGTA 4JDFA 1OMPA 1I6BA 3PMXA 1WVJA 1LAGE 1Y4TA 3SKPA 3TELA 1CE2A 1N84A 2RCBA 3EHTA 1LFIA 3EN3A 2V93A 4F22A 3HHGA 3O2AA 4ZZAA 1H3DA 3THIA 4EXLA 2O7UA 3L6GA 4NF5B 4FJPA 3MPKA 2ZNUA 2ZYNA 1LGBC 2Y7PA 4PETA 1LCFA 3W9WA 1FQEA 2I49A 2VD2A 4GWOA 2IA4A 4BLAA 3MP1A 3C31A 4F29A 3IJOB 4F31B 4U22A 5H8SA 3LSXA 1AL3A 3HPIA 4KI0E 1FQDA 5TP9B 1B3EA 1MY2A 3V5AA 3DLNA 1ZBMA 1OVBA 4H8JA 1MXXA 2XXXA 1UTHB 1D3KA 2F6PA 5AA1A 4R9GA 3GXAA 2YLNA 5FHMA 3PPOA 4QFPA 1MXUA 2DQVA 3QSLA 3CVGA 5I2NB 1IIWA 1DSNA 4G68C 5TU0A 3Q28A 4P11A 2KLFA 4GLIA 1MXZA 2NOOA 1ELJA 3JYRA 1Y4CA 4FECA 3OO9A 1B7HA 1DOTA 5KCJB 4BDQA 2O1LA 2REGA 3R6UA 2Q89A 4EDPA 1UTBB 3BBRA 1Y9UA 4OENA 4NF6A 5I59B 4NF8B 4NEDA 4IO6A 3IOWA 4RPOA 3MUQA 2DYXA 1MQDA 4KQPA 4RNSA 4QFKA 4NMYA 1GGGA 3K6UA 3VLWA 3EHSA 3H3GA 2ANJA 4EQBA 3IOUA 3ODBA 4R72A 3U1OA 1TT1A 4RY1A 3H6WA 3KN8A 5ICTA 1B52A 1I69A 1S7YA 4DCYA 2V3TA 4FE8A 1ZJLA 2F6GA 1TXFA 1B3GA 3VXBA 4TQUQ 1URSA 4F39A 1B5HA 1JETA 3CFLA 5I2KA 3N26A 5DT6A 3M3FA 3IX1A 2OJTA 4WEPA 4JSDA 4R6YA 4PFUA 3K0VA 3EPEA 1QKAA 3T9XB 4I62A 2ZYMA 2ALUA 4KYSA 1MH3A 4MFIA 5F7VA 3QAXA 3PUXE 2F7AA 1SW1A 1M5FA 5FTIA 5HPQA 3S9EA 5H8HA 1AH5A 4JB7A 1VFDA 3PUWE 2QS3A 4POXA 1SYHA 4EF1A 3HSTA 3OOAA 3KGCA 1DPPA 3IK6B 2R9JA 1MPCA 1IEJA 4KFQA 2QS4A 2RC8A 2HEUA 1Y1MA 3TCGA 1ZIUA 5TPAA 3K1MA 3T9HB 2F7BA 2HQ0A 2AL5A 2B3BA 1XT8A 3RGYA 3G3HA 3VLUA 3U8QA 1LB9A 1DTZA 2F34A 4LATA 3OSRA 2XXQA 1FTJA 2I48A 4YB5A 1HSLA 2QSXA 2NUVA 1NNKA 3RPWA 4F19A 3S4UA 1DMBA 1OLCA 1A55A 2XXTA 1Y3QA 3FJ7A 4NF6B 4YICA 4XXUA 1ZU0A 4TLLB 5FTHA 4N13A 3TMGA 3UN6A 3T96B 3CI8A 2X7QA 1BIYA 2OWSA 4F3PA 1S50A 2ZYOA 2M8CA 3M3LA 2YJPA 5KDTA 1M5BA 3S9LC 4FEBA 4ESXA 3G3GA 1FTKA 3T9VA 4BDOA 2V3QA 2F35A 4KCDA 1QUJA 2QPQA 2QS2A 4OYVA 2F7CA 1TFDA 4NWDA 1EZPA 3O6GA 2O51A 4OZ9A 3U72A 1AMFA 2XX8A 1P1QA 4DLDA 4L17A 5H8NA 3LR1A 1FCKA 3C9HA 3H6TA 3KN3A 5AA2A 1FTLA 2ZYKA 4YB7A 1VFEA 1A54A 3FV1A 3TKDA 1UQWA 1QKBA 1MS7A 1A40A 4OMBA 2HAVA 5DVJA 1YPNA 3SEYA 3V83A 2VP1A 2HXWA 1NH7A 4R74A 3TAJA 2I58A 4G8MA 5DVIA 3MVXA 1PB8A 2Z8FA 3U92A 1PBPA 1H76A 2Y7KA 2RF1A 2DVCA 5DEXB 1P1NA 2DXYA 5BUUA 4EF2A 1OIBA 1XOCA 3KSXA 2VGQA 2H99A 5L9SA 2UXAA 1MQHA 3GZGA 1HSJA 2I6EA 3H03A 1LSTA 5TPAB 1LCTA 5AE4A 1N7XA 3RUMA 1DPEA 3EF7A 2PX1A 1SYIA 3U93A 2H4IA 4LZ5A 4AB6A 2VD3A 2H9BA 2UVGA 1FW0A 4M4GA 1P1OA 5IAIA 1MXVA 1T0KA 4PQJA 3SETA 4UACA 4U4XA 3LUYA 4OERA 4O3CA 3RTFB 4HW8A 3FASA 1OVTA 3BFUA 3LSWA 2XD2A 2X26A 4NE4A 3B6QA 1M5EA 5I58A 2ONKE 3R26A 3GBBA 4H67A 3PMVA 2DWAA 3IOTA 4ZE9A 5H8FA 5KDTB 5EYFA 3FVOA 2NXOA 3MWBA 4XKPA 4FATA 1BP5A 3JV9A 3U94A 3G3JA 4F1UA 3MJNA 2GFEA 3PPRA 1IQ7A 2Q2AA 3FATA 4NWCA 4YAHX 2I0CA 4LQ5A 5AA2D 1LLSA 4Q5TA 5H8NB 3V8XB 1IITA 2I3VA 1US4A 4F1YA 3MBPA 5J1DA 1QVSA 3E3KA 4U23A 3E9XA 4DIGA 5KZTA 3DP8A 5CBSA 2HCAA 3KJ7A 2I4CA 1WODA 2ONSA 3G7WA 4ZEKA 2DSFA 1IXHA 4QSEA 3IL1B 2HZLA 3VV5A 3S9NC 5ISUA 3TZAA 2HZKA 3S9MC 4OQOA 4KYDA 3TTNA 4YKPA 3ILUB 3T9UA 1B3HA 4JBZA 3ECRA 3IORA 2AL4A 1TFAA 3MPLA 2ZXTA 2XHDA 4TOZA 1SW4A 2PMSA 3CIJA 3TTKA 2DE4A 3M8UA 1CB6A 4HCWA 4ZZEA 3TEPA 2O84X 1MY3A 3B7DA 4YMAA 4ZEDA 1B1HA 4GD5A 4JXIA 3BFTA 4DE8A 2QS1A 3OEKA 1MY1A 1N3WA 1B7ZA 1BLFA 4F18A 3VVDA 2R71A 4RPNA 3LC8A 3KN7A 3G3KA 2RCAA 4WEDA 3ONMA 5DYHA 4ELOA 3RN8A 1R6ZA 3KJTA 3WAFA 1Y1ZA 4ISUA 1J1NA 4H8IA 1L5TA 3PPPA 3LSFB 1A7LA 1WDNA 4OTEA 2FNCA 4H1XA 3H6VA 4R2FA 4LZ8A 5BWJA 2GH9A 3V89B 5I56B 4F2OA 1YTVA 1QW0A 3AXFA 1B7UA 3TQLA 1IXGA 1A8EA 1M5DA 4IY5A 1B5IA 3KZGA 2Q88A 2V84A 2V25A 5H8FB 1NFTA 2XXPA 3FVGA 3RY3A 5EHSA 2G29A 2B65A 5H8QB 3PPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IO4 A;  4GOT A;  2O6A A;  1NNT A;  1PB9 A;  4X9T A;  2GHB A;  4ZEF A;  3H4Z A;  5EHM A;  2DVZ A;  4BDM A;  3VVF A;  4KD5 A;  3D4G A;  2VOZ A;  1XHY A;  1FQC A;  4QF9 A;  1JEU A;  1LBC A;  5HBC A;  5DTB A;  5L9O A;  2D21 A;  4P0I A;  3UA8 A;  2DOJ A;  2R6G E;  3KG2 A;  4F2Q A;  1MM7 A;  1SW2 A;  4RJZ A;  2PYY A;  2XXV A;  4RA1 A;  3Q29 A;  2Z8E A;  2RIN A;  1XVY A;  3MVZ A;  1B0L A;  4LUB A;  2FYI A;  1NNP A;  1MH4 A;  2OWT A;  4GIZ A;  4IO4 A;  4ELQ A;  5CMB A;  2A5S A;  4I1D A;  2Q9T A;  1OQH A;  3B6W A;  3PV0 E;  4U21 A;  1MQG A;  3I6V A;  3TFL A;  3VE1 B;  3CFX A;  1Z7N E;  4QFL A;  1MPB A;  2XXU A;  1PC3 A;  4PP0 A;  1SW5 A;  3N6T A;  4X1D A;  4DZ1 A;  4YKJ A;  4QHQ A;  2QMX A;  1RYX A;  1ZLQ A;  3MZ1 A;  4WXJ A;  1QUL A;  3TYH A;  3IR1 A;  3C4M A;  1IXC A;  3ZSF A;  1NMU A;  1LAX A;  1I6Q A;  3E4R A;  4G8H A;  3OO6 A;  1IXI A;  1HSE A;  1ATG A;  1GVC A;  5A5X A;  1H44 A;  1A8F A;  4Q0C A;  4ESW A;  4GVO A;  5AA4 A;  3OD7 A;  1OLA A;  2PT2 A;  4F3B A;  1MXY A;  5CMM A;  3SEX A;  1JQF A;  2UVH A;  4QSC A;  1ZKB A;  4F3S A;  1H43 A;  4LQ2 A;  3WAE A;  2RKM A;  4YZZ A;  4Q30 B;  3EHU A;  4OEU A;  2D3I A;  2DE2 A;  2THI A;  1JNF A;  3DEL B;  4DXB A;  2XX7 A;  3F11 A;  3PUV E;  3O28 A;  1YCJ A;  1SQY A;  2UYE A;  4EUO A;  4OFJ A;  3EQ1 A;  5FHN A;  4OEV A;  3MVY A;  3LSL A;  4RYA A;  2B3F A;  3IOV A;  4GQO A;  4QFN A;  1FQB A;  1MDQ A;  4GXS B;  3T93 B;  3HV1 A;  2O68 A;  3PD9 A;  5I2K B;  1P99 A;  3MP6 A;  4UA8 A;  3HCQ A;  4AB5 A;  4DXU A;  3W9V A;  4GL0 A;  3RNN A;  1KWH A;  2DWH A;  3RT8 A;  3SDF A;  3IB2 A;  3K1P A;  3PMW A;  2I4B A;  4N6P A;  2Y7R A;  3W15 C;  1US5 A;  5H8H B;  4N07 A;  4NF5 A;  3MAM A;  1B2H A;  4R6K A;  1SD3 A;  1B4H A;  2F97 A;  3DP6 A;  1GR2 A;  4IB2 A;  1POT A;  2X7P A;  3OO8 A;  3HN0 A;  3JZJ A;  1LAF E;  2G93 A;  5CBR A;  1PBQ A;  2REJ A;  2XD3 A;  1VR5 A;  2ZMB A;  3OXN A;  2Y7W A;  2RC7 A;  1R9Q A;  3SEW A;  3IJX B;  3SEV A;  1LAH E;  3MVW A;  1SI0 A;  2F8D A;  2RC9 A;  4ZS9 A;  4YMB A;  4Q8R A;  3TTL A;  1D9V A;  1D9Y A;  1ZTY A;  1N7W A;  4GRK A;  4X48 A;  4MH5 A;  4PFT A;  4G2Z A;  4IY6 A;  3O6H A;  3UOR A;  2O7I A;  3K02 A;  4HS7 A;  2YPN A;  1XC1 A;  5I2N A;  3I3V A;  4GXA A;  4C1U A;  3K01 A;  1B40 A;  4IO5 A;  3R7X A;  3LBS A;  3UIF A;  4XTC Q;  4JWY A;  2LAO A;  1Z7M E;  2ZNS A;  2D5W A;  4IGR A;  4R9F A;  3VVE A;  5ELV A;  2FA7 A;  2HAU A;  2H5Y A;  1EH3 A;  3KFM A;  1AIV A;  3C33 A;  1BTJ A;  1H45 A;  4EQ7 A;  4HCY A;  3IB0 A;  1A99 A;  3O9P A;  5L9M A;  4ECF A;  3C36 A;  5CM6 A;  3C35 A;  4DXC A;  3FGS A;  4ELP A;  4MLQ A;  3K1N A;  4YB6 A;  1MQJ A;  4THI A;  4LP2 B;  3A09 A;  2XX9 A;  3O66 A;  1N76 A;  2PVU A;  4XKQ A;  1QUI A;  4LZ7 A;  1O7T A;  3BKI B;  4KHZ E;  3TPA A;  4RXL A;  2CMO A;  1NNF A;  1LB8 A;  3QIM A;  5AA2 B;  4KPT A;  4PFW A;  5AA3 A;  2DWJ A;  3N5L A;  3P7I A;  1B3F A;  3H06 B;  4YU0 A;  2QMW A;  2P0S A;  3MC2 A;  2A5T A;  3H7M A;  1LFH A;  3VFJ A;  4G4P A;  1IUD A;  4GFR A;  2PT1 A;  4MF3 A;  3OEN A;  4FOR A;  4JSO A;  3CFZ A;  5DVF A;  3M3K A;  3FJG A;  3MW0 A;  3T66 A;  4POW A;  3FV2 A;  1II5 A;  1NKX A;  4ZEI A;  3KEI A;  1B51 A;  1SBP A;  1FTO A;  3PGF A;  4FIM A;  4OET A;  2ABH A;  3TDJ A;  3O97 A;  3KBR A;  4F1V A;  3OSQ A;  1B05 A;  3CG1 A;  4LA9 A;  3SEU A;  5M2V A;  5F1Q A;  1USY H;  3L6H A;  4DDD A;  4BDL A;  3MZB A;  3I5O A;  3DM0 A;  4ZEB A;  3ZS6 A;  1D4N A;  2V3U A;  4H0W A;  2WKY A;  1B0H A;  4XKR A;  4K3F A;  3E13 X;  1NL5 A;  4BDR A;  1M5C A;  3USD A;  5LOM A;  5I57 A;  5I58 B;  2VHA A;  3HO7 A;  5HM4 B;  3K6W A;  4LVQ A;  3SES A;  4XKN A;  3CSG A;  3RTW B;  1POY 1;  4ZDM A;  1B9J A;  2ZNT A;  4R73 A;  3C32 A;  1R9L A;  3T22 A;  4BDN A;  3PD8 A;  2O69 A;  2O1M A;  4GL8 A;  3RLF E;  2DS9 A;  3ZKL A;  1PDA A;  4I9D A;  4OFL A;  4OXV A;  1B3L A;  1SVX B;  1PEB A;  1F9B A;  2DP8 A;  1ZMG A;  1VSO A;  1MY4 A;  5CMC A;  1MPD A;  2CZL A;  1EU8 A;  1JVY A;  5JK4 A;  1DTG A;  4E0W A;  1EZ9 A;  2Z23 A;  1SDX A;  2Y84 A;  1MDP 1;  4ELR A;  1Q35 A;  5B7D A;  1GTK A;  2DWI A;  2W7Y A;  4AQ4 A;  3QK6 A;  4OFO A;  2OBG A;  1B58 A;  3VLV A;  3UP9 A;  2A5T B;  3G3F A;  3N6U A;  4G68 A;  2BJJ X;  3H6U A;  2F78 A;  3GLB A;  1URG A;  5K2X A;  1NH8 A;  2UYF A;  2Z8D A;  2GHA A;  3N94 A;  3FXU A;  5JTY A;  4Z7E A;  4MBP A;  3K6V A;  2DE3 A;  2OZZ A;  3OEL A;  5ICQ A;  3MP8 A;  3QYT A;  1B4Z A;  4YKK A;  3A3U A;  3FUZ A;  3FZV A;  3TCH A;  1VE4 A;  1BKA A;  2OCU A;  4GF8 A;  1JVX A;  5FHO A;  2Q2C A;  5DEX A;  4R6H A;  1URD A;  1LBB A;  4OWD A;  3QUJ A;  3ZKK A;  4G8N A;  3SER A;  3K4U A;  3ILT B;  2OLB A;  2PBW A;  2I0B A;  3Q25 A;  1FTM A;  1P1U A;  4KR5 A;  4LON B;  4Z0I A;  2GRV A;  2QJE A;  5IKB A;  1LFG A;  3GBA A;  1B46 A;  3VXC A;  2NWJ A;  2HFB A;  1O63 A;  4IO2 A;  4C0R A;  2ONR A;  4U1Z A;  4FAJ A;  2P1S A;  3OMB A;  1MG1 A;  1MQI A;  4IO7 A;  2Q8J A;  1GV8 A;  1TWY A;  3TQW A;  4IO3 A;  4E0X A;  2P2A A;  4HTG A;  2AYS A;  1PB7 A;  1MXW A;  5B70 A;  1USY E;  4F3G A;  5CRY A;  3KOT A;  3CRB A;  4OHN A;  5I57 B;  1B1X A;  3UK4 A;  4R75 A;  2I3W A;  4M1V A;  4KYE A;  1FQF A;  3O29 A;  4H5F A;  3Q27 A;  4XIG Q;  4PE5 B;  2XXY A;  3IB1 A;  3FXR A;  4NF4 A;  2XXW A;  3TTM A;  4DCX A;  1B6H A;  1JW1 A;  2UVI A;  2UVJ A;  4WKM A;  1N04 A;  4I8C A;  3IAZ A;  3S2V A;  4H6D A;  5K2Y A;  3KOS A;  1SI1 A;  5L8D A;  2XXH A;  3O6I A;  4JWO A;  4EQ9 A;  1XS5 A;  3D4C A;  2F36 A;  2QRY A;  3HHF A;  3QUF A;  4U1O A;  3IO6 A;  2E0S A;  2E1S A;  4G68 B;  4R2B A;  4U4S A;  3FXQ A;  3MZ9 A;  3RQT A;  4U2R A;  1QJM A;  4X1B A;  3FJM A;  1S9T A;  3VDF A;  4MLV A;  1B32 A;  2F5X A;  4OVJ A;  1IZ1 A;  5CC2 A;  3FVK A;  5JTY B;  2H25 A;  4H5G A;  1Y3N A;  3FVN A;  5CI5 A;  1Y20 A;  4JWX A;  1RYO A;  3TOD A;  3OO7 A;  3CG3 A;  4O3B A;  1QUK A;  4NTL A;  3TUS A;  1AOV A;  3FD3 A;  2NVU B;  3K2D A;  2XXI A;  3MQ9 A;  5TP9 A;  1JEV A;  4ND9 A;  4H65 A;  3PU5 A;  4FED A;  1FQA A;  1RKM A;  1P1W A;  1Y3P A;  1UTH A;  4C1T A;  3K6X A;  4EXK A;  1N0T A;  2Z22 A;  3TTR A;  3UGW A;  4KCC A;  3C34 A;  4ONY A;  4G77 A;  3CSB A;  2QL3 A;  1UIU A;  3G3I A;  3B6T A;  3OEM A;  3A3C A;  5A5X B;  1N3X A;  3FIR A;  1B5J A;  5AA4 B;  4RK2 A;  4PFY A;  5KCJ A;  4QRZ A;  1R1N A;  1XVX A;  5CMK A;  3DP4 A;  2H98 A;  2XXR A;  1UTB A;  3TCF A;  2OK2 A;  3PUZ E;  4QSD A;  2IEE A;  3RT6 B;  5I59 A;  5I56 A;  4NF8 A;  1Q1K A;  3KSJ A;  4RK9 A;  2ESN A;  1EZO A;  4YKI A;  3QXM A;  4ZE8 A;  3K00 A;  3PUY E;  3CR9 A;  1MRP A;  5ITO A;  1JW4 A;  1OQG A;  4NF4 B;  1YAE A;  2DXR A;  1MY0 A;  5I84 A;  1JW5 A;  5ITP A;  4O3A A;  4P0G A;  3PPQ A;  5H8Q A;  3Q26 A;  1I6A A;  2AIX A;  5JEI A;  1ANF A;  4OES A;  4QFO A;  1UIV A;  4TLM B;  1MM6 A;  1O64 A;  2Y7I A;  4ZEC A;  4IGT A;  4JDF A;  1OMP A;  1I6B A;  3PMX A;  1WVJ A;  1LAG E;  1Y4T A;  3SKP A;  3TEL A;  1CE2 A;  1N84 A;  2RCB A;  3EHT A;  1LFI A;  3EN3 A;  2V93 A;  4F22 A;  3HHG A;  3O2A A;  4ZZA A;  1H3D A;  3THI A;  4EXL A;  2O7U A;  3L6G A;  4NF5 B;  4FJP A;  3MPK A;  2ZNU A;  2ZYN A;  1LGB C;  2Y7P A;  4PET A;  1LCF A;  3W9W A;  1FQE A;  2I49 A;  2VD2 A;  4GWO A;  2IA4 A;  4BLA A;  3MP1 A;  3C31 A;  4F29 A;  3IJO B;  4F31 B;  4U22 A;  5H8S A;  3LSX A;  1AL3 A;  3HPI A;  4KI0 E;  1FQD A;  5TP9 B;  1B3E A;  1MY2 A;  3V5A A;  3DLN A;  1ZBM A;  1OVB A;  4H8J A;  1MXX A;  2XXX A;  1UTH B;  1D3K A;  2F6P A;  5AA1 A;  4R9G A;  3GXA A;  2YLN A;  5FHM A;  3PPO A;  4QFP A;  1MXU A;  2DQV A;  3QSL A;  3CVG A;  5I2N B;  1IIW A;  1DSN A;  4G68 C;  5TU0 A;  3Q28 A;  4P11 A;  2KLF A;  4GLI A;  1MXZ A;  2NOO A;  1ELJ A;  3JYR A;  1Y4C A;  4FEC A;  3OO9 A;  1B7H A;  1DOT A;  5KCJ B;  4BDQ A;  2O1L A;  2REG A;  3R6U A;  2Q89 A;  4EDP A;  1UTB B;  3BBR A;  1Y9U A;  4OEN A;  4NF6 A;  5I59 B;  4NF8 B;  4NED A;  4IO6 A;  3IOW A;  4RPO A;  3MUQ A;  2DYX A;  1MQD A;  4KQP A;  4RNS A;  4QFK A;  4NMY A;  1GGG A;  3K6U A;  3VLW A;  3EHS A;  3H3G A;  2ANJ A;  4EQB A;  3IOU A;  3ODB A;  4R72 A;  3U1O A;  1TT1 A;  4RY1 A;  3H6W A;  3KN8 A;  5ICT A;  1B52 A;  1I69 A;  1S7Y A;  4DCY A;  2V3T A;  4FE8 A;  1ZJL A;  2F6G A;  1TXF A;  1B3G A;  3VXB A;  4TQU Q;  1URS A;  4F39 A;  1B5H A;  1JET A;  3CFL A;  5I2K A;  3N26 A;  5DT6 A;  3M3F A;  3IX1 A;  2OJT A;  4WEP A;  4JSD A;  4R6Y A;  4PFU A;  3K0V A;  3EPE A;  1QKA A;  3T9X B;  4I62 A;  2ZYM A;  2ALU A;  4KYS A;  1MH3 A;  4MFI A;  5F7V A;  3QAX A;  3PUX E;  2F7A A;  1SW1 A;  1M5F A;  5FTI A;  5HPQ A;  3S9E A;  5H8H A;  1AH5 A;  4JB7 A;  1VFD A;  3PUW E;  2QS3 A;  4POX A;  1SYH A;  4EF1 A;  3HST A;  3OOA A;  3KGC A;  1DPP A;  3IK6 B;  2R9J A;  1MPC A;  1IEJ A;  4KFQ A;  2QS4 A;  2RC8 A;  2HEU A;  1Y1M A;  3TCG A;  1ZIU A;  5TPA A;  3K1M A;  3T9H B;  2F7B A;  2HQ0 A;  2AL5 A;  2B3B A;  1XT8 A;  3RGY A;  3G3H A;  3VLU A;  3U8Q A;  1LB9 A;  1DTZ A;  2F34 A;  4LAT A;  3OSR A;  2XXQ A;  1FTJ A;  2I48 A;  4YB5 A;  1HSL A;  2QSX A;  2NUV A;  1NNK A;  3RPW A;  4F19 A;  3S4U A;  1DMB A;  1OLC A;  1A55 A;  2XXT A;  1Y3Q A;  3FJ7 A;  4NF6 B;  4YIC A;  4XXU A;  1ZU0 A;  4TLL B;  5FTH A;  4N13 A;  3TMG A;  3UN6 A;  3T96 B;  3CI8 A;  2X7Q A;  1BIY A;  2OWS A;  4F3P A;  1S50 A;  2ZYO A;  2M8C A;  3M3L A;  2YJP A;  5KDT A;  1M5B A;  3S9L C;  4FEB A;  4ESX A;  3G3G A;  1FTK A;  3T9V A;  4BDO A;  2V3Q A;  2F35 A;  4KCD A;  1QUJ A;  2QPQ A;  2QS2 A;  4OYV A;  2F7C A;  1TFD A;  4NWD A;  1EZP A;  3O6G A;  2O51 A;  4OZ9 A;  3U72 A;  1AMF A;  2XX8 A;  1P1Q A;  4DLD A;  4L17 A;  5H8N A;  3LR1 A;  1FCK A;  3C9H A;  3H6T A;  3KN3 A;  5AA2 A;  1FTL A;  2ZYK A;  4YB7 A;  1VFE A;  1A54 A;  3FV1 A;  3TKD A;  1UQW A;  1QKB A;  1MS7 A;  1A40 A;  4OMB A;  2HAV A;  5DVJ A;  1YPN A;  3SEY A;  3V83 A;  2VP1 A;  2HXW A;  1NH7 A;  4R74 A;  3TAJ A;  2I58 A;  4G8M A;  5DVI A;  3MVX A;  1PB8 A;  2Z8F A;  3U92 A;  1PBP A;  1H76 A;  2Y7K A;  2RF1 A;  2DVC A;  5DEX B;  1P1N A;  2DXY A;  5BUU A;  4EF2 A;  1OIB A;  1XOC A;  3KSX A;  2VGQ A;  2H99 A;  5L9S A;  2UXA A;  1MQH A;  3GZG A;  1HSJ A;  2I6E A;  3H03 A;  1LST A;  5TPA B;  1LCT A;  5AE4 A;  1N7X A;  3RUM A;  1DPE A;  3EF7 A;  2PX1 A;  1SYI A;  3U93 A;  2H4I A;  4LZ5 A;  4AB6 A;  2VD3 A;  2H9B A;  2UVG A;  1FW0 A;  4M4G A;  1P1O A;  5IAI A;  1MXV A;  1T0K A;  4PQJ A;  3SET A;  4UAC A;  4U4X A;  3LUY A;  4OER A;  4O3C A;  3RTF B;  4HW8 A;  3FAS A;  1OVT A;  3BFU A;  3LSW A;  2XD2 A;  2X26 A;  4NE4 A;  3B6Q A;  1M5E A;  5I58 A;  2ONK E;  3R26 A;  3GBB A;  4H67 A;  3PMV A;  2DWA A;  3IOT A;  4ZE9 A;  5H8F A;  5KDT B;  5EYF A;  3FVO A;  2NXO A;  3MWB A;  4XKP A;  4FAT A;  1BP5 A;  3JV9 A;  3U94 A;  3G3J A;  4F1U A;  3MJN A;  2GFE A;  3PPR A;  1IQ7 A;  2Q2A A;  3FAT A;  4NWC A;  4YAH X;  2I0C A;  4LQ5 A;  5AA2 D;  1LLS A;  4Q5T A;  5H8N B;  3V8X B;  1IIT A;  2I3V A;  1US4 A;  4F1Y A;  3MBP A;  5J1D A;  1QVS A;  3E3K A;  4U23 A;  3E9X A;  4DIG A;  5KZT A;  3DP8 A;  5CBS A;  2HCA A;  3KJ7 A;  2I4C A;  1WOD A;  2ONS A;  3G7W A;  4ZEK A;  2DSF A;  1IXH A;  4QSE A;  3IL1 B;  2HZL A;  3VV5 A;  3S9N C;  5ISU A;  3TZA A;  2HZK A;  3S9M C;  4OQO A;  4KYD A;  3TTN A;  4YKP A;  3ILU B;  3T9U A;  1B3H A;  4JBZ A;  3ECR A;  3IOR A;  2AL4 A;  1TFA A;  3MPL A;  2ZXT A;  2XHD A;  4TOZ A;  1SW4 A;  2PMS A;  3CIJ A;  3TTK A;  2DE4 A;  3M8U A;  1CB6 A;  4HCW A;  4ZZE A;  3TEP A;  2O84 X;  1MY3 A;  3B7D A;  4YMA A;  4ZED A;  1B1H A;  4GD5 A;  4JXI A;  3BFT A;  4DE8 A;  2QS1 A;  3OEK A;  1MY1 A;  1N3W A;  1B7Z A;  1BLF A;  4F18 A;  3VVD A;  2R71 A;  4RPN A;  3LC8 A;  3KN7 A;  3G3K A;  2RCA A;  4WED A;  3ONM A;  5DYH A;  4ELO A;  3RN8 A;  1R6Z A;  3KJT A;  3WAF A;  1Y1Z A;  4ISU A;  1J1N A;  4H8I A;  1L5T A;  3PPP A;  3LSF B;  1A7L A;  1WDN A;  4OTE A;  2FNC A;  4H1X A;  3H6V A;  4R2F A;  4LZ8 A;  5BWJ A;  2GH9 A;  3V89 B;  5I56 B;  4F2O A;  1YTV A;  1QW0 A;  3AXF A;  1B7U A;  3TQL A;  1IXG A;  1A8E A;  1M5D A;  4IY5 A;  1B5I A;  3KZG A;  2Q88 A;  2V84 A;  2V25 A;  5H8F B;  1NFT A;  2XXP A;  3FVG A;  3RY3 A;  5EHS A;  2G29 A;  2B65 A;  5H8Q B;  3PPN A; 
#chains in the Genus database with same CATH topology
 1FBC A;  3IO4 A;  4GOT A;  2O6A A;  1NNT A;  1PB9 A;  4X9T A;  2GHB A;  4ZEF A;  3H4Z A;  5EHM A;  1NV6 A;  2DVZ A;  4BDM A;  3VVF A;  4KD5 A;  3D4G A;  2VOZ A;  5IZ3 A;  2ZZV A;  1XHY A;  1FQC A;  4QF9 A;  1JEU A;  1LBC A;  5HBC A;  5DTB A;  5L9O A;  2D21 A;  4P0I A;  1IMB A;  1LBZ A;  3UA8 A;  2DOJ A;  2R6G E;  3KG2 A;  4F2Q A;  1LBY A;  1MM7 A;  1SW2 A;  4RJZ A;  2PYY A;  2XXV A;  4RA1 A;  3Q29 A;  2Z8E A;  2RIN A;  1XVY A;  3MVZ A;  1B0L A;  1IMC A;  4LUB A;  2FYI A;  1NNP A;  1MH4 A;  2OWT A;  4GIZ A;  4IO4 A;  4ELQ A;  5CMB A;  2A5S A;  4I1D A;  2Q9T A;  2WBD A;  1OQH A;  3B6W A;  3PV0 E;  4U21 A;  1MQG A;  3I6V A;  4X04 A;  3TFL A;  3VE1 B;  3CFX A;  1Z7N E;  4QFL A;  1MPB A;  2XXU A;  1QGX A;  1PC3 A;  4PP0 A;  1SW5 A;  3N6T A;  4X1D A;  4DZ1 A;  3ISP A;  2QVU A;  2V4C A;  4O7I A;  4YKJ A;  4QHQ A;  2QMX A;  1RYX A;  1ZLQ A;  3MZ1 A;  4WXJ A;  1QUL A;  3TYH A;  3IR1 A;  2CZH A;  3C4M A;  1IXC A;  3ZSF A;  1NMU A;  3QMF A;  1LAX A;  1I6Q A;  2OWZ A;  3E4R A;  3B8B A;  2FBP A;  4G8H A;  4N15 A;  3OO6 A;  4MNC A;  1IXI A;  1HSE A;  1ATG A;  1GVC A;  5A5X A;  1H44 A;  1A8F A;  4Q0C A;  4ESW A;  4GVO A;  5AA4 A;  3OD7 A;  1OLA A;  2PT2 A;  3IFC A;  4F3B A;  1MXY A;  2CEX A;  5CMM A;  3SEX A;  3CHG A;  3HFU A;  1JQF A;  2UVH A;  4QSC A;  4NAP A;  1ZKB A;  4F3S A;  4P1E A;  1H43 A;  1RDY A;  4LQ2 A;  3WAE A;  2RKM A;  4OVR A;  4YZZ A;  4Q30 B;  3EHU A;  4OEU A;  1EYJ A;  2D3I A;  2DE2 A;  2THI A;  2ZZW A;  1JNF A;  3DEL B;  4DXB A;  2XX7 A;  3F11 A;  3PUV E;  3O28 A;  3KC1 A;  2CZI A;  1YCJ A;  1FBH A;  1SQY A;  2UYE A;  4EUO A;  4OFJ A;  3ROJ A;  3EQ1 A;  5FHN A;  4OEV A;  3MVY A;  3LSL A;  4RYA A;  2B3F A;  3IOV A;  4GQO A;  4QFN A;  1FQB A;  1MDQ A;  4GXS B;  3T93 B;  3HV1 A;  2O68 A;  3PD9 A;  5IZ3 B;  5I2K B;  1P99 A;  3MP6 A;  4UA8 A;  3HCQ A;  4AB5 A;  2DDK A;  4DXU A;  3W9V A;  4GL0 A;  3RNN A;  1KWH A;  3IFA A;  5ESY A;  2DWH A;  3RT8 A;  3SDF A;  3IB2 A;  3K1P A;  3PMW A;  2I4B A;  4N6P A;  2Y7R A;  3W15 C;  1US5 A;  5H8H B;  4N07 A;  4PFI A;  2VPO A;  4NF5 A;  3MAM A;  1B2H A;  4R6K A;  1SD3 A;  1B4H A;  2F97 A;  3DP6 A;  1GR2 A;  4IB2 A;  1POT A;  2X7P A;  3OO8 A;  5ET5 A;  3HN0 A;  3JZJ A;  1LAF E;  4QBA A;  2G93 A;  5CBR A;  1PBQ A;  2REJ A;  2XD3 A;  5I5P A;  1VR5 A;  2ZMB A;  3OXN A;  4GWW A;  2Y7W A;  2RC7 A;  1R9Q A;  4MMP A;  3SEW A;  3IJX B;  3SEV A;  1LAH E;  3MVW A;  1SI0 A;  2F8D A;  2RC9 A;  4ZS9 A;  4YMB A;  4Q8R A;  3TTL A;  1D9V A;  4PFR A;  2F3B A;  2QVV A;  1D9Y A;  1ZTY A;  1N7W A;  3T0J A;  4GRK A;  4PGP A;  4X48 A;  4MH5 A;  2P3V A;  4PFT A;  4G2Z A;  4IY6 A;  1EYK A;  3O6H A;  3UOR A;  2O7I A;  3K02 A;  4HS7 A;  2ZZX A;  2YPN A;  1XC1 A;  5I2N A;  4N6D A;  3I3V A;  4GXA A;  4C1U A;  3K01 A;  1B40 A;  4PBQ A;  4IO5 A;  3R7X A;  1RDZ A;  3LBS A;  3UIF A;  4XTC Q;  4JWY A;  2LAO A;  1G0H A;  1Z7M E;  2ZNS A;  4GBW A;  2D5W A;  4IGR A;  4HE0 A;  4R9F A;  3VVE A;  5ELV A;  2FA7 A;  2HAU A;  2H5Y A;  1EH3 A;  3KFM A;  1FBP A;  1AIV A;  3C33 A;  1BTJ A;  1H45 A;  4EQ7 A;  4I3Y A;  4HCY A;  3IB0 A;  4N81 A;  1A99 A;  3O9P A;  5L9M A;  4ECF A;  3C36 A;  5CM6 A;  3C35 A;  4DXC A;  1SPI A;  3FGS A;  4ELP A;  4MLQ A;  3K1N A;  4YB6 A;  1MQJ A;  4N17 A;  4THI A;  4LP2 B;  3A09 A;  2XX9 A;  3O66 A;  1N76 A;  1FPB A;  2PVU A;  5EYG A;  4XKQ A;  1QUI A;  4LZ7 A;  1FSA A;  1O7T A;  3BKI B;  4KHZ E;  3TPA A;  4RXL A;  4N4U A;  2CMO A;  1NNF A;  1LB8 A;  3QIM A;  5AA2 B;  4KPT A;  4PFW A;  5AA3 A;  2DWJ A;  3N5L A;  3P7I A;  1B3F A;  3H06 B;  4YU0 A;  2QMW A;  2P0S A;  1KZ8 A;  3MC2 A;  2A5T A;  3PTY A;  4KXP A;  3H7M A;  1LFH A;  3VFJ A;  1JP4 A;  4G4P A;  1IUD A;  4GFR A;  2PT1 A;  4MF3 A;  3OEN A;  4FOR A;  4JSO A;  3CFZ A;  5DVF A;  2XWV A;  3M3K A;  3FJG A;  3MW0 A;  3T66 A;  4POW A;  3FV2 A;  1II5 A;  1NKX A;  4N91 A;  4ZEI A;  4HE2 A;  4XFE A;  4AS5 A;  3KEI A;  4PF6 A;  1B51 A;  1SBP A;  1FTO A;  3PGF A;  4FIM A;  4OET A;  2ABH A;  1RDX A;  2Y5L A;  3TDJ A;  3O97 A;  3KBR A;  4F1V A;  3OSQ A;  1B05 A;  3CG1 A;  4NQ8 A;  4LA9 A;  3SEU A;  5M2V A;  5F1Q A;  1USY H;  3L6H A;  4DDD A;  4BDL A;  3MZB A;  4PAI A;  3I5O A;  3DM0 A;  4ZEB A;  3ZS6 A;  1D4N A;  2V3U A;  4H0W A;  2F3D A;  2WKY A;  1B0H A;  4XKR A;  4K3F A;  3E13 X;  4P47 A;  1NL5 A;  4BDR A;  1YZ0 A;  3E78 A;  1M5C A;  3USD A;  5LOM A;  5I57 A;  4NF0 A;  3GYY A;  5ET8 A;  5I58 B;  1IMA A;  2VHA A;  2QVR A;  3HO7 A;  5HM4 B;  4N8Y A;  3K6W A;  4LVQ A;  3SES A;  1INP A;  4XKN A;  2FIE A;  3CSG A;  3RTW B;  1IMD A;  1POY 1;  4ZDM A;  1FPI A;  1B9J A;  2ZNT A;  4R73 A;  3C32 A;  1R9L A;  3T22 A;  4BDN A;  3PD8 A;  2O69 A;  2O1M A;  4GL8 A;  3RLF E;  2DS9 A;  1LBV A;  3ZKL A;  4OXV A;  1PDA A;  4I9D A;  4OFL A;  1B3L A;  1SVX B;  1PEB A;  1F9B A;  2DP8 A;  2WEF A;  1ZMG A;  1VSO A;  1MY4 A;  5CMC A;  1MPD A;  2CZL A;  1EU8 A;  1JVY A;  5JK4 A;  4PE3 A;  1DTG A;  2Z23 A;  1EZ9 A;  4E0W A;  1SDX A;  1KA1 A;  2Y84 A;  1MDP 1;  4ELR A;  1Q35 A;  5B7D A;  1GTK A;  2DWI A;  2W7Y A;  4AQ4 A;  1FTA A;  3QK6 A;  4OFO A;  2OBG A;  1B58 A;  3VLV A;  3UP9 A;  2A5T B;  3G3F A;  3N6U A;  4G68 A;  2BJJ X;  1NV4 A;  3H6U A;  2F78 A;  3GLB A;  1URG A;  5K2X A;  1NH8 A;  5ET6 A;  2UYF A;  2Z8D A;  2BJI A;  2GHA A;  3N94 A;  3FXU A;  5JTY A;  4Z7E A;  4MBP A;  3K6V A;  2DE3 A;  2OZZ A;  3OEL A;  5ICQ A;  3MP8 A;  3QYT A;  1B4Z A;  4YKK A;  3A3U A;  3FUZ A;  3FZV A;  3TCH A;  1G0I A;  4DI3 D;  1VE4 A;  1BKA A;  2OCU A;  4GF8 A;  1JVX A;  5FHO A;  5IGA A;  2Q2C A;  2XWK A;  5DEX A;  1FJ9 A;  4R6H A;  1URD A;  1LBB A;  4OWD A;  3QUJ A;  3ZKK A;  4G8N A;  4GWY A;  3KBZ A;  3SER A;  3K4U A;  3ILT B;  2OLB A;  2PBW A;  2I0B A;  3Q25 A;  1FTM A;  1P1U A;  1AWB A;  4KR5 A;  4LON B;  4Z0I A;  2HXR A;  2GRV A;  2QJE A;  5IKB A;  1LFG A;  3GBA A;  1B46 A;  3VXC A;  2NWJ A;  2HFB A;  1O63 A;  1FJ6 A;  4IO2 A;  4C0R A;  2ONR A;  4U1Z A;  4FAJ A;  2P1S A;  3OMB A;  4OAN A;  4LN5 A;  1MG1 A;  3BIH A;  1MQI A;  4IO7 A;  2Q8J A;  2QFL A;  1GV8 A;  1TWY A;  3TQW A;  1YYZ A;  4IO3 A;  4E0X A;  2P2A A;  4HTG A;  2AYS A;  1PB7 A;  4H45 A;  1MXW A;  5B70 A;  1USY E;  2FVZ A;  4F3G A;  5CRY A;  3KOT A;  1FBE A;  4I3E A;  1BK4 A;  3CRB A;  4OHN A;  5I57 B;  4N6K A;  1B1X A;  3UK4 A;  4XEQ A;  4DI4 B;  4R75 A;  2I3W A;  4M1V A;  4PAF A;  1DBZ A;  4KYE A;  2HPG A;  1FQF A;  3O29 A;  4H5F A;  3Q27 A;  4XIG Q;  4PE5 B;  2XXY A;  2B4L A;  3IB1 A;  4P8B A;  2FHY A;  3FXR A;  4NF4 A;  2XXW A;  3TTM A;  4DCX A;  1B6H A;  1JW1 A;  2UVI A;  2P3N A;  2UVJ A;  2B4M A;  4WKM A;  4P56 A;  1N04 A;  4I8C A;  3IAZ A;  3S2V A;  2VPN A;  4H6D A;  5K2Y A;  3KOS A;  1SI1 A;  5L8D A;  2XXH A;  3O6I A;  4JWO A;  4EQ9 A;  1XS5 A;  3D4C A;  2F36 A;  2QRY A;  4GWZ A;  3HHF A;  3QUF A;  4U1O A;  4R2B A;  3IO6 A;  2E0S A;  2E1S A;  2WX9 A;  4G68 B;  4U4S A;  3FXQ A;  3MZ9 A;  3RQT A;  4U2R A;  1NV2 A;  1QJM A;  4X1B A;  3FJM A;  1S9T A;  2PFZ A;  4MLV A;  3VDF A;  1B32 A;  2F5X A;  4OVJ A;  1IZ1 A;  5CC2 A;  3FVK A;  5JTY B;  2H25 A;  4H5G A;  1Y3N A;  3FVN A;  5CI5 A;  1NV5 A;  2CEY A;  1Y20 A;  1LBW A;  4JWX A;  1RYO A;  3TOD A;  3OO7 A;  4GWS A;  3CG3 A;  4PGN A;  4O3B A;  4P3L A;  1QUK A;  4NTL A;  3TUS A;  4P9K A;  1AOV A;  3FD3 A;  2NVU B;  1YXI A;  3K2D A;  2XXI A;  3MQ9 A;  5TP9 A;  1JEV A;  4ND9 A;  4H65 A;  3PU5 A;  4FED A;  4GBV A;  1FQA A;  1RKM A;  1P1W A;  3U65 A;  1Y3P A;  1UTH A;  4C1T A;  3K6X A;  4EXK A;  1N0T A;  2Z22 A;  3TTR A;  3UGW A;  4KCC A;  3C34 A;  4ONY A;  4G77 A;  3CSB A;  2QL3 A;  1UIU A;  3G3I A;  3B6T A;  3OEM A;  3A3C A;  1LBX A;  5A5X B;  1N3X A;  3FIR A;  1B5J A;  4NX1 A;  5AA4 B;  4RK2 A;  4PFY A;  5KCJ A;  4QRZ A;  1R1N A;  2VT5 A;  1XVX A;  4MAG A;  5CMK A;  3DP4 A;  2H98 A;  2XXR A;  1UTB A;  2CZK A;  3TCF A;  2OK2 A;  3PUZ E;  4QSD A;  2IEE A;  3RT6 B;  5I59 A;  5I56 A;  4NF8 A;  1Q1K A;  3KSJ A;  2FIX A;  2JJK A;  4RK9 A;  2ESN A;  1EZO A;  4O7M A;  4YKI A;  3QXM A;  4ZE8 A;  3K00 A;  1VDW A;  3PUY E;  3CR9 A;  1NUZ A;  5EYH A;  1MRP A;  4PC9 A;  5ITO A;  1JW4 A;  1OQG A;  2XA5 A;  4NF4 B;  1YAE A;  2DXR A;  1MY0 A;  5I84 A;  1JW5 A;  5ITP A;  4O3A A;  1EYI A;  4P0G A;  3PPQ A;  5H8Q A;  3Q26 A;  1I6A A;  2AIX A;  5JEI A;  1ANF A;  4OES A;  4QFO A;  5LDZ A;  1UIV A;  4TLM B;  1MM6 A;  1O64 A;  2Y7I A;  4ZEC A;  4IGT A;  4JDF A;  1OMP A;  1I6B A;  3PMX A;  4I40 A;  1WVJ A;  1LAG E;  1Y4T A;  3SKP A;  3TEL A;  1CE2 A;  1CNQ A;  1N84 A;  2RCB A;  3EHT A;  1LFI A;  3EN3 A;  2V93 A;  4F22 A;  3HHG A;  3O2A A;  4ZZA A;  1H3D A;  1FPF A;  4MHF A;  3THI A;  2XXK A;  4EXL A;  2O7U A;  3L6G A;  4NF5 B;  4FJP A;  3MPK A;  2ZNU A;  2ZYN A;  1LGB C;  2Y7P A;  4GX6 A;  2WYP A;  4PET A;  1LCF A;  3W9W A;  1FQE A;  2KQZ A;  2I49 A;  2VD2 A;  4GWO A;  2IA4 A;  3RPL A;  4BLA A;  4OVT A;  3MP1 A;  3C31 A;  4GWU A;  3IJO B;  4F29 A;  4F31 B;  4U22 A;  5H8S A;  1FBD A;  2HHM A;  3LSX A;  2KR0 A;  1AL3 A;  3HPI A;  4PDD A;  3NOH A;  2Q8M A;  4KI0 E;  1FQD A;  5TP9 B;  1B3E A;  1MY2 A;  3V5A A;  3DLN A;  1ZBM A;  1OVB A;  4H8J A;  1MXX A;  2XXX A;  1UTH B;  1D3K A;  2F6P A;  5EQ7 A;  5AA1 A;  4R9G A;  3GXA A;  2YLN A;  5FHM A;  3FXB A;  3PPO A;  4QFP A;  2Q74 A;  1MXU A;  2DQV A;  3QSL A;  3CVG A;  5I2N B;  1IIW A;  1DSN A;  4G68 C;  5TU0 A;  3Q28 A;  4P11 A;  2KLF A;  4GLI A;  1MXZ A;  2NOO A;  1ELJ A;  4P1L A;  3JYR A;  1NUW A;  1Y4C A;  4FEC A;  3OO9 A;  1B7H A;  1DOT A;  1FPJ A;  5KCJ B;  1XI6 A;  4BDQ A;  2O1L A;  2REG A;  3R6U A;  4PDH A;  2Q89 A;  4EDP A;  1UTB B;  3BBR A;  1Y9U A;  4OA4 A;  4OEN A;  4NF6 A;  5I59 B;  4NF8 B;  4NED A;  4IO6 A;  3IOW A;  4RPO A;  3MUQ A;  2DYX A;  1MQD A;  4KQP A;  4RNS A;  4QFK A;  4NMY A;  1GGG A;  3K6U A;  3VLW A;  3EHS A;  3H3G A;  2ANJ A;  4EQB A;  3IOU A;  3ODB A;  4R72 A;  3U1O A;  1FBF A;  1TT1 A;  4RY1 A;  3H6W A;  3KN8 A;  5ICT A;  1B52 A;  4HXV A;  1I69 A;  2PCR A;  1S7Y A;  1IME A;  4DCY A;  2V3T A;  3D1R A;  4FE8 A;  1ZJL A;  2F6G A;  1TXF A;  1B3G A;  3VXB A;  4TQU Q;  4X8R A;  1URS A;  4F39 A;  1B5H A;  1JET A;  3CFL A;  4PBH A;  5I2K A;  3N26 A;  5DT6 A;  3M3F A;  3IX1 A;  2OJT A;  4WEP A;  4JSD A;  1NV1 A;  4R6Y A;  4PFU A;  3K0V A;  3EPE A;  1NUX A;  1QKA A;  3T9X B;  4I62 A;  2ZYM A;  2ALU A;  4KYS A;  1MH3 A;  3B50 A;  4MFI A;  5F7V A;  3QAX A;  3PUX E;  2F7A A;  1SW1 A;  1M5F A;  5FTI A;  5HPQ A;  3S9E A;  5H8H A;  3RPL B;  1AH5 A;  4JB7 A;  1VFD A;  3PUW E;  2QS3 A;  5J16 A;  4POX A;  1SYH A;  4NG7 A;  4EF1 A;  3HST A;  4XF5 A;  3OOA A;  3KGC A;  1DPP A;  3IK6 B;  2R9J A;  1FPD A;  1MPC A;  1IEJ A;  4KFQ A;  2QS4 A;  2RC8 A;  2HEU A;  1Y1M A;  4MNI A;  3TCG A;  4FBP A;  5EQA A;  1ZIU A;  5TPA A;  3K1M A;  2PFY A;  4MEV A;  3T9H B;  2F7B A;  4O8M A;  2HQ0 A;  2AL5 A;  2B3B A;  1XT8 A;  4NHB A;  2L5V A;  3E79 A;  3RGY A;  3G3H A;  3VLU A;  3U8Q A;  1LB9 A;  4PTK A;  1DTZ A;  2F34 A;  4LAT A;  3OSR A;  2XXQ A;  4GX4 A;  1FTJ A;  2I48 A;  4YB5 A;  3EKI A;  1HSL A;  2QSX A;  2NUV A;  1NNK A;  3SZP A;  4MIJ A;  3RPW A;  4F19 A;  3S4U A;  5FBP A;  1DMB A;  1OLC A;  1A55 A;  2XXT A;  1Y3Q A;  4QXD A;  5I3S A;  4OVQ A;  3FJ7 A;  3LV0 A;  4NF6 B;  4YIC A;  4XXU A;  4IR8 A;  1ZU0 A;  4TLL B;  5FTH A;  4N13 A;  1FPE A;  3TMG A;  3UN6 A;  1NV3 A;  3T96 B;  3CI8 A;  2X7Q A;  1BIY A;  2OWS A;  4F3P A;  1S50 A;  2ZYO A;  2M8C A;  3M3L A;  2YJP A;  5KDT A;  1M5B A;  3S9L C;  4FEB A;  4ESX A;  3G3G A;  1FTK A;  4H46 A;  3T9V A;  4BDO A;  2V3Q A;  2F35 A;  4KCD A;  1NV7 A;  1QUJ A;  2QPQ A;  2QS2 A;  4OYV A;  2F7C A;  1TFD A;  4NWD A;  1EZP A;  3O6G A;  2O51 A;  4OZ9 A;  3U72 A;  1AMF A;  2XX8 A;  4MNP A;  1P1Q A;  4DLD A;  4L17 A;  5EQ9 A;  5H8N A;  3LR1 A;  1FCK A;  3C9H A;  3H6T A;  3KN3 A;  2Y5K A;  5AA2 A;  1FTL A;  5IM2 A;  2ZYK A;  4YB7 A;  1VFE A;  1A54 A;  3FV1 A;  3TKD A;  1UQW A;  1QKB A;  1MS7 A;  1A40 A;  3BIG A;  4OMB A;  2HAV A;  5DVJ A;  1YPN A;  3SEY A;  3V83 A;  1FRP A;  2VP1 A;  2HXW A;  1NH7 A;  2GQ1 A;  4R74 A;  3TAJ A;  2I58 A;  4G8M A;  4JVD A;  5DVI A;  3MVX A;  1PB8 A;  4UAB A;  2Z8F A;  4PAK A;  3U92 A;  1NUY A;  1H76 A;  1PBP A;  2Y7K A;  2RF1 A;  2DVC A;  5DEX B;  1P1N A;  2DXY A;  5BUU A;  3KC0 A;  4EF2 A;  1OIB A;  1XOC A;  3KSX A;  4GX3 A;  2WYK A;  2VGQ A;  5F24 A;  2H99 A;  5EQ8 A;  1NV0 A;  5L9S A;  4OVS A;  2UXA A;  1MQH A;  3GZG A;  1HSJ A;  2I6E A;  3H03 A;  1LST A;  5TPA B;  1LCT A;  5AE4 A;  1N7X A;  3RUM A;  1DPE A;  1LEV A;  3EF7 A;  2PX1 A;  1SYI A;  4PFB A;  3U93 A;  2H4I A;  4LZ5 A;  4AB6 A;  2VD3 A;  2H9B A;  2UVG A;  1FW0 A;  5IZZ A;  1K9Z A;  1DK4 A;  1K9Y A;  4M4G A;  1P1O A;  5IAI A;  1MXV A;  1T0K A;  4PQJ A;  3SET A;  4UAC A;  4U4X A;  3LUY A;  4OER A;  4HE1 A;  4O3C A;  3RTF B;  4HW8 A;  3FAS A;  5I7I A;  1OVT A;  3BFU A;  3LSW A;  2XD2 A;  2X26 A;  4NE4 A;  3B6Q A;  4MJO A;  1M5E A;  5I58 A;  2ONK E;  3R26 A;  3GBB A;  4H67 A;  4MCO A;  3PMV A;  2OX3 A;  2DWA A;  3IOT A;  4ZE9 A;  2R8T A;  4MX6 A;  5H8F A;  3MST A;  5KDT B;  5EYF A;  5ET7 A;  3FVO A;  2NXO A;  3MWB A;  1FPG A;  1Q9D A;  4XKP A;  4FAT A;  1FBG A;  1BP5 A;  1FPL A;  3RYD A;  3JV9 A;  3U94 A;  3G3J A;  4F1U A;  3MJN A;  1KA0 A;  2GFE A;  3PPR A;  1DCU A;  1IQ7 A;  2Q2A A;  3MYU A;  3FAT A;  4NWC A;  4YAH X;  2I0C A;  4LQ5 A;  5AA2 D;  1LLS A;  4Q5T A;  2XWI A;  1FPK A;  5H8N B;  3V8X B;  1IIT A;  2I3V A;  1US4 A;  4F1Y A;  3MBP A;  5J1D A;  1QVS A;  3E3K A;  4U23 A;  4N8G A;  4NGU A;  3E9X A;  4GWX A;  4DIG A;  5KZT A;  3DP8 A;  4G61 A;  1NI9 A;  5CBS A;  2HCA A;  3KJ7 A;  2I4C A;  5A5L A;  1WOD A;  4O94 A;  2ONS A;  3G7W A;  4ZEK A;  2DSF A;  4NN3 A;  1IXH A;  3T1B A;  1D9Q A;  4JVC A;  4QSE A;  3IL1 B;  2HZL A;  3VV5 A;  3S9N C;  5ISU A;  3TZA A;  4JVI A;  2HZK A;  3S9M C;  4OQO A;  4KYD A;  4OVP A;  3TTN A;  4YKP A;  3ILU B;  3T9U A;  1B3H A;  4JBZ A;  3ECR A;  3IOR A;  2AL4 A;  1TFA A;  3MPL A;  2ZXT A;  2WBB A;  3A29 A;  2XHD A;  4TOZ A;  1SW4 A;  5T3J A;  2PMS A;  3CIJ A;  3TTK A;  2DE4 A;  3M8U A;  1CB6 A;  4HCW A;  4ZZE A;  3TEP A;  5IZ1 A;  2O84 X;  1MY3 A;  3B7D A;  4YMA A;  4ZED A;  1B1H A;  4GD5 A;  4JXI A;  3BFT A;  4DE8 A;  2QS1 A;  3OEK A;  1MY1 A;  1N3W A;  1B7Z A;  1BLF A;  2MKZ A;  4F18 A;  3VVD A;  2R71 A;  4RPN A;  3LC8 A;  3KN7 A;  3G3K A;  2RCA A;  4WED A;  3ONM A;  5DYH A;  4ELO A;  3RN8 A;  1R6Z A;  3KJT A;  5DW8 A;  1IMF A;  3WAF A;  1Y1Z A;  4ISU A;  4AS4 A;  1J1N A;  3LUZ A;  4H8I A;  1L5T A;  3PPP A;  3LSF B;  1A7L A;  1WDN A;  4OTE A;  2FNC A;  4H1X A;  4PF8 A;  3H6V A;  4R2F A;  4LZ8 A;  5BWJ A;  2GH9 A;  3V89 B;  5I56 B;  4F2O A;  1YTV A;  1QW0 A;  2XWO A;  3AXF A;  1B7U A;  3TQL A;  1IXG A;  1A8E A;  1M5D A;  4IY5 A;  1B5I A;  5LTC A;  3KZG A;  4PCD A;  2Q88 A;  2V84 A;  2V25 A;  5H8F B;  1NFT A;  2XXP A;  3FVG A;  3RY3 A;  5EHS A;  2G29 A;  2B65 A;  3FBP A;  5H8Q B;  3PPN A; 
#chains in the Genus database with same CATH homology
 3IO4 A;  4GOT A;  2O6A A;  1NNT A;  1PB9 A;  4X9T A;  2GHB A;  4ZEF A;  3H4Z A;  5EHM A;  2DVZ A;  4BDM A;  3VVF A;  4KD5 A;  3D4G A;  2VOZ A;  1XHY A;  1FQC A;  4QF9 A;  1JEU A;  1LBC A;  5HBC A;  5DTB A;  5L9O A;  2D21 A;  4P0I A;  3UA8 A;  2DOJ A;  2R6G E;  3KG2 A;  4F2Q A;  1MM7 A;  1SW2 A;  4RJZ A;  2PYY A;  2XXV A;  4RA1 A;  3Q29 A;  2Z8E A;  2RIN A;  1XVY A;  3MVZ A;  1B0L A;  4LUB A;  2FYI A;  1NNP A;  1MH4 A;  2OWT A;  4GIZ A;  4IO4 A;  4ELQ A;  5CMB A;  2A5S A;  4I1D A;  2Q9T A;  1OQH A;  3B6W A;  3PV0 E;  4U21 A;  1MQG A;  3I6V A;  3TFL A;  3VE1 B;  3CFX A;  1Z7N E;  4QFL A;  1MPB A;  2XXU A;  1PC3 A;  4PP0 A;  1SW5 A;  3N6T A;  4X1D A;  4DZ1 A;  4YKJ A;  4QHQ A;  2QMX A;  1RYX A;  1ZLQ A;  3MZ1 A;  4WXJ A;  1QUL A;  3TYH A;  3IR1 A;  3C4M A;  1IXC A;  3ZSF A;  1NMU A;  1LAX A;  1I6Q A;  3E4R A;  4G8H A;  3OO6 A;  1IXI A;  1HSE A;  1ATG A;  1GVC A;  5A5X A;  1H44 A;  1A8F A;  4Q0C A;  4ESW A;  4GVO A;  5AA4 A;  3OD7 A;  1OLA A;  2PT2 A;  4F3B A;  1MXY A;  5CMM A;  3SEX A;  1JQF A;  2UVH A;  4QSC A;  1ZKB A;  4F3S A;  1H43 A;  4LQ2 A;  3WAE A;  2RKM A;  4YZZ A;  4Q30 B;  3EHU A;  4OEU A;  2D3I A;  2DE2 A;  2THI A;  1JNF A;  3DEL B;  4DXB A;  2XX7 A;  3F11 A;  3PUV E;  3O28 A;  1YCJ A;  1SQY A;  2UYE A;  4EUO A;  4OFJ A;  3EQ1 A;  5FHN A;  4OEV A;  3MVY A;  3LSL A;  4RYA A;  2B3F A;  3IOV A;  4GQO A;  4QFN A;  1FQB A;  1MDQ A;  4GXS B;  3T93 B;  3HV1 A;  2O68 A;  3PD9 A;  5I2K B;  1P99 A;  3MP6 A;  4UA8 A;  3HCQ A;  4AB5 A;  4DXU A;  3W9V A;  4GL0 A;  3RNN A;  1KWH A;  2DWH A;  3RT8 A;  3SDF A;  3IB2 A;  3K1P A;  3PMW A;  2I4B A;  4N6P A;  2Y7R A;  3W15 C;  1US5 A;  5H8H B;  4N07 A;  4NF5 A;  3MAM A;  1B2H A;  4R6K A;  1SD3 A;  1B4H A;  2F97 A;  3DP6 A;  1GR2 A;  4IB2 A;  1POT A;  2X7P A;  3OO8 A;  3HN0 A;  3JZJ A;  1LAF E;  2G93 A;  5CBR A;  1PBQ A;  2REJ A;  2XD3 A;  1VR5 A;  2ZMB A;  3OXN A;  2Y7W A;  2RC7 A;  1R9Q A;  3SEW A;  3IJX B;  3SEV A;  1LAH E;  3MVW A;  1SI0 A;  2F8D A;  2RC9 A;  4ZS9 A;  4YMB A;  4Q8R A;  3TTL A;  1D9V A;  1D9Y A;  1ZTY A;  1N7W A;  4GRK A;  4X48 A;  4MH5 A;  4PFT A;  4G2Z A;  4IY6 A;  3O6H A;  3UOR A;  2O7I A;  3K02 A;  4HS7 A;  2YPN A;  1XC1 A;  5I2N A;  3I3V A;  4GXA A;  4C1U A;  3K01 A;  1B40 A;  4IO5 A;  3R7X A;  3LBS A;  3UIF A;  4XTC Q;  4JWY A;  2LAO A;  1Z7M E;  2ZNS A;  2D5W A;  4IGR A;  4R9F A;  3VVE A;  5ELV A;  2FA7 A;  2HAU A;  2H5Y A;  1EH3 A;  3KFM A;  1AIV A;  3C33 A;  1BTJ A;  1H45 A;  4EQ7 A;  4HCY A;  3IB0 A;  1A99 A;  3O9P A;  5L9M A;  4ECF A;  3C36 A;  5CM6 A;  3C35 A;  4DXC A;  3FGS A;  4ELP A;  4MLQ A;  3K1N A;  4YB6 A;  1MQJ A;  4THI A;  4LP2 B;  3A09 A;  2XX9 A;  3O66 A;  1N76 A;  2PVU A;  4XKQ A;  1QUI A;  4LZ7 A;  1O7T A;  3BKI B;  4KHZ E;  3TPA A;  4RXL A;  2CMO A;  1NNF A;  1LB8 A;  3QIM A;  5AA2 B;  4KPT A;  4PFW A;  5AA3 A;  2DWJ A;  3N5L A;  3P7I A;  1B3F A;  3H06 B;  4YU0 A;  2QMW A;  2P0S A;  3MC2 A;  2A5T A;  3H7M A;  1LFH A;  3VFJ A;  4G4P A;  1IUD A;  4GFR A;  2PT1 A;  4MF3 A;  3OEN A;  4FOR A;  4JSO A;  3CFZ A;  5DVF A;  3M3K A;  3FJG A;  3MW0 A;  3T66 A;  4POW A;  3FV2 A;  1II5 A;  1NKX A;  4ZEI A;  3KEI A;  1B51 A;  1SBP A;  1FTO A;  3PGF A;  4FIM A;  4OET A;  2ABH A;  3TDJ A;  3O97 A;  3KBR A;  4F1V A;  3OSQ A;  1B05 A;  3CG1 A;  4LA9 A;  3SEU A;  5M2V A;  5F1Q A;  1USY H;  3L6H A;  4DDD A;  4BDL A;  3MZB A;  3I5O A;  3DM0 A;  4ZEB A;  3ZS6 A;  1D4N A;  2V3U A;  4H0W A;  2WKY A;  1B0H A;  4XKR A;  4K3F A;  3E13 X;  1NL5 A;  4BDR A;  1M5C A;  3USD A;  5LOM A;  5I57 A;  5I58 B;  2VHA A;  3HO7 A;  5HM4 B;  3K6W A;  4LVQ A;  3SES A;  4XKN A;  3CSG A;  3RTW B;  1POY 1;  4ZDM A;  1B9J A;  2ZNT A;  4R73 A;  3C32 A;  1R9L A;  3T22 A;  4BDN A;  3PD8 A;  2O69 A;  2O1M A;  4GL8 A;  3RLF E;  2DS9 A;  3ZKL A;  1PDA A;  4I9D A;  4OFL A;  4OXV A;  1B3L A;  1SVX B;  1PEB A;  1F9B A;  2DP8 A;  1ZMG A;  1VSO A;  1MY4 A;  5CMC A;  1MPD A;  2CZL A;  1EU8 A;  1JVY A;  5JK4 A;  1DTG A;  4E0W A;  1EZ9 A;  2Z23 A;  1SDX A;  2Y84 A;  1MDP 1;  4ELR A;  1Q35 A;  5B7D A;  1GTK A;  2DWI A;  2W7Y A;  4AQ4 A;  3QK6 A;  4OFO A;  2OBG A;  1B58 A;  3VLV A;  3UP9 A;  2A5T B;  3G3F A;  3N6U A;  4G68 A;  2BJJ X;  3H6U A;  2F78 A;  3GLB A;  1URG A;  5K2X A;  1NH8 A;  2UYF A;  2Z8D A;  2GHA A;  3N94 A;  3FXU A;  5JTY A;  4Z7E A;  4MBP A;  3K6V A;  2DE3 A;  2OZZ A;  3OEL A;  5ICQ A;  3MP8 A;  3QYT A;  1B4Z A;  4YKK A;  3A3U A;  3FUZ A;  3FZV A;  3TCH A;  1VE4 A;  1BKA A;  2OCU A;  4GF8 A;  1JVX A;  5FHO A;  2Q2C A;  5DEX A;  4R6H A;  1URD A;  1LBB A;  4OWD A;  3QUJ A;  3ZKK A;  4G8N A;  3SER A;  3K4U A;  3ILT B;  2OLB A;  2PBW A;  2I0B A;  3Q25 A;  1FTM A;  1P1U A;  4KR5 A;  4LON B;  4Z0I A;  2GRV A;  2QJE A;  5IKB A;  1LFG A;  3GBA A;  1B46 A;  3VXC A;  2NWJ A;  2HFB A;  1O63 A;  4IO2 A;  4C0R A;  2ONR A;  4U1Z A;  4FAJ A;  2P1S A;  3OMB A;  1MG1 A;  1MQI A;  4IO7 A;  2Q8J A;  1GV8 A;  1TWY A;  3TQW A;  4IO3 A;  4E0X A;  2P2A A;  4HTG A;  2AYS A;  1PB7 A;  1MXW A;  5B70 A;  1USY E;  4F3G A;  5CRY A;  3KOT A;  3CRB A;  4OHN A;  5I57 B;  1B1X A;  3UK4 A;  4R75 A;  2I3W A;  4M1V A;  4KYE A;  1FQF A;  3O29 A;  4H5F A;  3Q27 A;  4XIG Q;  4PE5 B;  2XXY A;  3IB1 A;  3FXR A;  4NF4 A;  2XXW A;  3TTM A;  4DCX A;  1B6H A;  1JW1 A;  2UVI A;  2UVJ A;  4WKM A;  1N04 A;  4I8C A;  3IAZ A;  3S2V A;  4H6D A;  5K2Y A;  3KOS A;  1SI1 A;  5L8D A;  2XXH A;  3O6I A;  4JWO A;  4EQ9 A;  1XS5 A;  3D4C A;  2F36 A;  2QRY A;  3HHF A;  3QUF A;  4U1O A;  3IO6 A;  2E0S A;  2E1S A;  4G68 B;  4R2B A;  4U4S A;  3FXQ A;  3MZ9 A;  3RQT A;  4U2R A;  1QJM A;  4X1B A;  3FJM A;  1S9T A;  3VDF A;  4MLV A;  1B32 A;  2F5X A;  4OVJ A;  1IZ1 A;  5CC2 A;  3FVK A;  5JTY B;  2H25 A;  4H5G A;  1Y3N A;  3FVN A;  5CI5 A;  1Y20 A;  4JWX A;  1RYO A;  3TOD A;  3OO7 A;  3CG3 A;  4O3B A;  1QUK A;  4NTL A;  3TUS A;  1AOV A;  3FD3 A;  2NVU B;  3K2D A;  2XXI A;  3MQ9 A;  5TP9 A;  1JEV A;  4ND9 A;  4H65 A;  3PU5 A;  4FED A;  1FQA A;  1RKM A;  1P1W A;  1Y3P A;  1UTH A;  4C1T A;  3K6X A;  4EXK A;  1N0T A;  2Z22 A;  3TTR A;  3UGW A;  4KCC A;  3C34 A;  4ONY A;  4G77 A;  3CSB A;  2QL3 A;  1UIU A;  3G3I A;  3B6T A;  3OEM A;  3A3C A;  5A5X B;  1N3X A;  3FIR A;  1B5J A;  5AA4 B;  4RK2 A;  4PFY A;  5KCJ A;  4QRZ A;  1R1N A;  1XVX A;  5CMK A;  3DP4 A;  2H98 A;  2XXR A;  1UTB A;  3TCF A;  2OK2 A;  3PUZ E;  4QSD A;  2IEE A;  3RT6 B;  5I59 A;  5I56 A;  4NF8 A;  1Q1K A;  3KSJ A;  4RK9 A;  2ESN A;  1EZO A;  4YKI A;  3QXM A;  4ZE8 A;  3K00 A;  3PUY E;  3CR9 A;  1MRP A;  5ITO A;  1JW4 A;  1OQG A;  4NF4 B;  1YAE A;  2DXR A;  1MY0 A;  5I84 A;  1JW5 A;  5ITP A;  4O3A A;  4P0G A;  3PPQ A;  5H8Q A;  3Q26 A;  1I6A A;  2AIX A;  5JEI A;  1ANF A;  4OES A;  4QFO A;  1UIV A;  4TLM B;  1MM6 A;  1O64 A;  2Y7I A;  4ZEC A;  4IGT A;  4JDF A;  1OMP A;  1I6B A;  3PMX A;  1WVJ A;  1LAG E;  1Y4T A;  3SKP A;  3TEL A;  1CE2 A;  1N84 A;  2RCB A;  3EHT A;  1LFI A;  3EN3 A;  2V93 A;  4F22 A;  3HHG A;  3O2A A;  4ZZA A;  1H3D A;  3THI A;  4EXL A;  2O7U A;  3L6G A;  4NF5 B;  4FJP A;  3MPK A;  2ZNU A;  2ZYN A;  1LGB C;  2Y7P A;  4PET A;  1LCF A;  3W9W A;  1FQE A;  2I49 A;  2VD2 A;  4GWO A;  2IA4 A;  4BLA A;  3MP1 A;  3C31 A;  4F29 A;  3IJO B;  4F31 B;  4U22 A;  5H8S A;  3LSX A;  1AL3 A;  3HPI A;  4KI0 E;  1FQD A;  5TP9 B;  1B3E A;  1MY2 A;  3V5A A;  3DLN A;  1ZBM A;  1OVB A;  4H8J A;  1MXX A;  2XXX A;  1UTH B;  1D3K A;  2F6P A;  5AA1 A;  4R9G A;  3GXA A;  2YLN A;  5FHM A;  3PPO A;  4QFP A;  1MXU A;  2DQV A;  3QSL A;  3CVG A;  5I2N B;  1IIW A;  1DSN A;  4G68 C;  5TU0 A;  3Q28 A;  4P11 A;  2KLF A;  4GLI A;  1MXZ A;  2NOO A;  1ELJ A;  3JYR A;  1Y4C A;  4FEC A;  3OO9 A;  1B7H A;  1DOT A;  5KCJ B;  4BDQ A;  2O1L A;  2REG A;  3R6U A;  2Q89 A;  4EDP A;  1UTB B;  3BBR A;  1Y9U A;  4OEN A;  4NF6 A;  5I59 B;  4NF8 B;  4NED A;  4IO6 A;  3IOW A;  4RPO A;  3MUQ A;  2DYX A;  1MQD A;  4KQP A;  4RNS A;  4QFK A;  4NMY A;  1GGG A;  3K6U A;  3VLW A;  3EHS A;  3H3G A;  2ANJ A;  4EQB A;  3IOU A;  3ODB A;  4R72 A;  3U1O A;  1TT1 A;  4RY1 A;  3H6W A;  3KN8 A;  5ICT A;  1B52 A;  1I69 A;  1S7Y A;  4DCY A;  2V3T A;  4FE8 A;  1ZJL A;  2F6G A;  1TXF A;  1B3G A;  3VXB A;  4TQU Q;  1URS A;  4F39 A;  1B5H A;  1JET A;  3CFL A;  5I2K A;  3N26 A;  5DT6 A;  3M3F A;  3IX1 A;  2OJT A;  4WEP A;  4JSD A;  4R6Y A;  4PFU A;  3K0V A;  3EPE A;  1QKA A;  3T9X B;  4I62 A;  2ZYM A;  2ALU A;  4KYS A;  1MH3 A;  4MFI A;  5F7V A;  3QAX A;  3PUX E;  2F7A A;  1SW1 A;  1M5F A;  5FTI A;  5HPQ A;  3S9E A;  5H8H A;  1AH5 A;  4JB7 A;  1VFD A;  3PUW E;  2QS3 A;  4POX A;  1SYH A;  4EF1 A;  3HST A;  3OOA A;  3KGC A;  1DPP A;  3IK6 B;  2R9J A;  1MPC A;  1IEJ A;  4KFQ A;  2QS4 A;  2RC8 A;  2HEU A;  1Y1M A;  3TCG A;  1ZIU A;  5TPA A;  3K1M A;  3T9H B;  2F7B A;  2HQ0 A;  2AL5 A;  2B3B A;  1XT8 A;  3RGY A;  3G3H A;  3VLU A;  3U8Q A;  1LB9 A;  1DTZ A;  2F34 A;  4LAT A;  3OSR A;  2XXQ A;  1FTJ A;  2I48 A;  4YB5 A;  1HSL A;  2QSX A;  2NUV A;  1NNK A;  3RPW A;  4F19 A;  3S4U A;  1DMB A;  1OLC A;  1A55 A;  2XXT A;  1Y3Q A;  3FJ7 A;  4NF6 B;  4YIC A;  4XXU A;  1ZU0 A;  4TLL B;  5FTH A;  4N13 A;  3TMG A;  3UN6 A;  3T96 B;  3CI8 A;  2X7Q A;  1BIY A;  2OWS A;  4F3P A;  1S50 A;  2ZYO A;  2M8C A;  3M3L A;  2YJP A;  5KDT A;  1M5B A;  3S9L C;  4FEB A;  4ESX A;  3G3G A;  1FTK A;  3T9V A;  4BDO A;  2V3Q A;  2F35 A;  4KCD A;  1QUJ A;  2QPQ A;  2QS2 A;  4OYV A;  2F7C A;  1TFD A;  4NWD A;  1EZP A;  3O6G A;  2O51 A;  4OZ9 A;  3U72 A;  1AMF A;  2XX8 A;  1P1Q A;  4DLD A;  4L17 A;  5H8N A;  3LR1 A;  1FCK A;  3C9H A;  3H6T A;  3KN3 A;  5AA2 A;  1FTL A;  2ZYK A;  4YB7 A;  1VFE A;  1A54 A;  3FV1 A;  3TKD A;  1UQW A;  1QKB A;  1MS7 A;  1A40 A;  4OMB A;  2HAV A;  5DVJ A;  1YPN A;  3SEY A;  3V83 A;  2VP1 A;  2HXW A;  1NH7 A;  4R74 A;  3TAJ A;  2I58 A;  4G8M A;  5DVI A;  3MVX A;  1PB8 A;  2Z8F A;  3U92 A;  1PBP A;  1H76 A;  2Y7K A;  2RF1 A;  2DVC A;  5DEX B;  1P1N A;  2DXY A;  5BUU A;  4EF2 A;  1OIB A;  1XOC A;  3KSX A;  2VGQ A;  2H99 A;  5L9S A;  2UXA A;  1MQH A;  3GZG A;  1HSJ A;  2I6E A;  3H03 A;  1LST A;  5TPA B;  1LCT A;  5AE4 A;  1N7X A;  3RUM A;  1DPE A;  3EF7 A;  2PX1 A;  1SYI A;  3U93 A;  2H4I A;  4LZ5 A;  4AB6 A;  2VD3 A;  2H9B A;  2UVG A;  1FW0 A;  4M4G A;  1P1O A;  5IAI A;  1MXV A;  1T0K A;  4PQJ A;  3SET A;  4UAC A;  4U4X A;  3LUY A;  4OER A;  4O3C A;  3RTF B;  4HW8 A;  3FAS A;  1OVT A;  3BFU A;  3LSW A;  2XD2 A;  2X26 A;  4NE4 A;  3B6Q A;  1M5E A;  5I58 A;  2ONK E;  3R26 A;  3GBB A;  4H67 A;  3PMV A;  2DWA A;  3IOT A;  4ZE9 A;  5H8F A;  5KDT B;  5EYF A;  3FVO A;  2NXO A;  3MWB A;  4XKP A;  4FAT A;  1BP5 A;  3JV9 A;  3U94 A;  3G3J A;  4F1U A;  3MJN A;  2GFE A;  3PPR A;  1IQ7 A;  2Q2A A;  3FAT A;  4NWC A;  4YAH X;  2I0C A;  4LQ5 A;  5AA2 D;  1LLS A;  4Q5T A;  5H8N B;  3V8X B;  1IIT A;  2I3V A;  1US4 A;  4F1Y A;  3MBP A;  5J1D A;  1QVS A;  3E3K A;  4U23 A;  3E9X A;  4DIG A;  5KZT A;  3DP8 A;  5CBS A;  2HCA A;  3KJ7 A;  2I4C A;  1WOD A;  2ONS A;  3G7W A;  4ZEK A;  2DSF A;  1IXH A;  4QSE A;  3IL1 B;  2HZL A;  3VV5 A;  3S9N C;  5ISU A;  3TZA A;  2HZK A;  3S9M C;  4OQO A;  4KYD A;  3TTN A;  4YKP A;  3ILU B;  3T9U A;  1B3H A;  4JBZ A;  3ECR A;  3IOR A;  2AL4 A;  1TFA A;  3MPL A;  2ZXT A;  2XHD A;  4TOZ A;  1SW4 A;  2PMS A;  3CIJ A;  3TTK A;  2DE4 A;  3M8U A;  1CB6 A;  4HCW A;  4ZZE A;  3TEP A;  2O84 X;  1MY3 A;  3B7D A;  4YMA A;  4ZED A;  1B1H A;  4GD5 A;  4JXI A;  3BFT A;  4DE8 A;  2QS1 A;  3OEK A;  1MY1 A;  1N3W A;  1B7Z A;  1BLF A;  4F18 A;  3VVD A;  2R71 A;  4RPN A;  3LC8 A;  3KN7 A;  3G3K A;  2RCA A;  4WED A;  3ONM A;  5DYH A;  4ELO A;  3RN8 A;  1R6Z A;  3KJT A;  3WAF A;  1Y1Z A;  4ISU A;  1J1N A;  4H8I A;  1L5T A;  3PPP A;  3LSF B;  1A7L A;  1WDN A;  4OTE A;  2FNC A;  4H1X A;  3H6V A;  4R2F A;  4LZ8 A;  5BWJ A;  2GH9 A;  3V89 B;  5I56 B;  4F2O A;  1YTV A;  1QW0 A;  3AXF A;  1B7U A;  3TQL A;  1IXG A;  1A8E A;  1M5D A;  4IY5 A;  1B5I A;  3KZG A;  2Q88 A;  2V84 A;  2V25 A;  5H8F B;  1NFT A;  2XXP A;  3FVG A;  3RY3 A;  5EHS A;  2G29 A;  2B65 A;  5H8Q B;  3PPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...