1QUJA

Phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRAGGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphate transport
total genus 106
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1995-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qujA02
3PMXA 1FTLA 1B40A 4PETA 1OIBA 2F8DA 4IO6A 3OEKA 4ESXA 3DLNA 4ELOA 2ALUA 3IOVA 1BTJA 1QKBA 5HM4B 4PFWA 1H3DA 1PDAA 3VVEA 1OMPA 4F18A 1ZU0A 2R9JA 3KSJA 4PFTA 1N7WA 4R2FA 3K01A 3U8QA 2DYXA 2RCAA 2AIXA 3U72A 5K2XA 3O6HA 4YKKA 2I3WA 4R2BA 3TEPA 1H76A 2VP1A 2HCAA 2Y84A 5DEXB 1FTMA 4P0IA 3S9MC 4FJPA 3T9XB 3TCFA 1NNFA 2X7QA 4NTLA 5H8FA 4G68B 4GLIA 1A54A 2QS3A 1JQFA 2QPQA 2DWJA 1R6ZA 3FV2A 4P11A 1H45A 3TFLA 4G4PA 3VVDA 1XT8A 4F2QA 4PQJA 4PFYA 4I62A 3MAMA 5HBCA 5AA4B 4YKPA 3T22A 1M5CA 1FQCA 4KYSA 4ZEFA 3K1PA 3VXCA 3UK4A 1BIYA 1P1NA 3SDFA 1VSOA 5I2NB 2VD2A 4AB6A 4FIMA 1POY1 5H8QB 2OBGA 4JSOA 3IR1A 3ODBA 1SW2A 4JWYA 2O84X 1MXYA 4OYVA 3FVOA 3V8XB 1DMBA 3OMBA 4IB2A 2O68A 1T0KA 4GWOA 1OLAA 2P0SA 4E0WA 2F97A 2ZNTA 3CG3A 3K6WA 2Z8DA 2V93A 3T9VA 3S4UA 1UTBA 3KFMA 1Y1ZA 3QK6A 1R9QA 4X48A 4EQ7A 3IJXB 2E1SA 4FEDA 1UIVA 2O1LA 5JK4A 4FAJA 4ZE8A 1IXGA 3UORA 1JW4A 2ONSA 5H8HA 3HHGA 4MLQA 1D3KA 2REGA 3KJTA 1XS5A 3EF7A 5AA2B 3FATA 1B32A 2OK2A 2ANJA 1LBCA 1FQFA 1IXHA 4G2ZA 3C34A 1Y4CA 1SW4A 4F1UA 4TOZA 1ZIUA 4KR5A 2IEEA 4YMAA 3DP6A 3MPKA 3PPPA 3TTKA 3OO6A 1Y1MA 1N7XA 3UIFA 4ZZAA 3TTMA 2WKYA 4BDRA 2HZKA 4WEPA 3U92A 1Y4TA 1MXWA 3UN6A 2DXYA 4PE5B 1Y9UA 1OLCA 1Y3PA 4R73A 1MXVA 4KD5A 5J1DA 2PVUA 4GOTA 1A99A 4F3SA 4QSCA 4PFUA 2VD3A 1A8FA 4OENA 4JWOA 4LVQA 3Q25A 1LAHE 4WXJA 4QFKA 1ZTYA 2OJTA 3FXQA 4H8JA 3SEYA 5A5XB 1GR2A 1BLFA 1QKAA 4LA9A 3SETA 3N94A 4PP0A 1PB8A 5JTYB 5FTHA 5ITPA 5AA2D 3K2DA 2NXOA 4GIZA 3IB2A 2H99A 5I57B 3FJGA 4ZEDA 5ITOA 4EQBA 4JXIA 3MP1A 2YLNA 1TXFA 4ELPA 4UACA 5DEXA 2I0BA 1AH5A 5CMMA 3VLVA 1M5DA 2B65A 4G68A 2DE2A 2V25A 4OWDA 1FTJA 5DVIA 2VGQA 1M5FA 1US5A 1B51A 3H03A 2NOOA 4RK9A 4DIGA 1B1HA 4OFOA 5CM6A 1P99A 3GZGA 3G3JA 5BUUA 4R9FA 5I59B 5DYHA 2ZXTA 3W9WA 3TTRA 2ZYKA 5AA4A 1B7HA 2I48A 3DM0A 4YMBA 1LSTA 2THIA 3KG2A 2HFBA 4HCYA 1B4ZA 4BDLA 1MXZA 2XXIA 3FVKA 2I58A 4QFPA 4NE4A 2DVCA 2DXRA 2UYEA 2R6GE 4NMYA 5I2NA 3THIA 2XXUA 4U23A 3TQLA 3MVWA 1ANFA 1HSEA 5H8QA 3O97A 4LQ5A 1CE2A 1LAGE 1MPCA 3H6TA 3G3HA 2ABHA 1MPBA 3K1MA 5KDTB 1DPPA 3P7IA 3U94A 3O2AA 4RY1A 3PPQA 3MJNA 3TUSA 1XVXA 3LC8A 4IGTA 3MP8A 1MY0A 1NNTA 1MQGA 1EZOA 4ND9A 3QUFA 3PUWE 3PU5A 2V3TA 3FGSA 1EH3A 3OENA 3FVNA 4F3BA 4U1ZA 1JW5A 2A5TB 3RTWB 4MH5A 5LOMA 4POXA 5L9SA 2A5SA 2AL4A 4AB5A 1WDNA 3N6UA 2G93A 4BDOA 3HV1A 1R9LA 3QAXA 2DWAA 2QS2A 3PGFA 4GXSB 3SEXA 3OO9A 3VLUA 4EUOA 3TZAA 5I84A 1IXIA 3MZ9A 4OZ9A 3FD3A 5AA2A 1VFDA 5AA3A 3IX1A 3KN7A 5CMCA 4U1OA 5TU0A 4Z7EA 4P0GA 1B3LA 3WAFA 4JB7A 5KZTA 3GLBA 3B6QA 1SI0A 4DCYA 3CRBA 4OFJA 4R6YA 1MS7A 2I0CA 1B7ZA 2Y7IA 3JYRA 3T9UA 2O7IA 1YCJA 2DP8A 4EXKA 4XKPA 5L9MA 1ZBMA 4ZE9A 4HCWA 4I9DA 2DWIA 1RYXA 2RCBA 3IOTA 4YAHX 3H3GA 1MDP1 5IKBA 3K4UA 3SKPA 3FXUA 4XTCQ 5CBRA 1SW5A 2QMXA 1NL5A 4R75A 3G3KA 3CR9A 1Y3QA 3T96B 2CZLA 2XX8A 4XKQA 3Q26A 2ZYOA 1VR5A 3H6WA 1II5A 3PD8A 2F36A 4NF8B 1Z7NE 4L17A 1B05A 3EQ1A 2F35A 5A5XA 3OOAA 3PUXE 3O66A 2Z23A 5JTYA 2VOZA 2X26A 4ZDMA 5H8NB 3KN8A 3E3KA 2GH9A 4QSEA 1JEUA 3N26A 5I57A 3A3CA 4POWA 1JVYA 5AE4A 3SERA 4GL8A 5ELVA 2QL3A 3MP6A 4GFRA 1URDA 4G8MA 1DTZA 1B3GA 4KQPA 4MFIA 2F78A 3K6VA 3TAJA 5L8DA 3TODA 4BDQA 1IXCA 4LP2B 2DE4A 5I59A 1NMUA 4N6PA 1SI1A 4ZZEA 3FZVA 5DVFA 4EXLA 3RN8A 3LSXA 4QF9A 2QMWA 2PMSA 1IZ1A 3VV5A 4HW8A 4O3CA 4F3PA 1UIUA 2AYSA 3VE1B 2I49A 2H98A 4YU0A 4BLAA 1MPDA 4LZ8A 1ZLQA 5FHNA 4F1YA 4MBPA 4U4XA 4JDFA 3PV0E 4JWXA 2P2AA 3H4ZA 1WODA 3MZ1A 3N6TA 1NNKA 1A55A 3BKIB 3IJOB 2GHBA 1URSA 3KOSA 5KDTA 3T9HB 2ESNA 2UVHA 1PBQA 3VVFA 4O3AA 1EZ9A 4E0XA 2RC9A 3EHTA 3G3FA 4M1VA 3IOUA 5EYFA 1I6QA 1MRPA 1US4A 3ZSFA 2XXWA 1IEJA 4NWDA 4Q0CA 4ZEIA 2A5TA 1O63A 3K02A 3K00A 1AOVA 4DXUA 1Q1KA 4RYAA 3RUMA 1MH4A 2H5YA 1GVCA 2Q8JA 4FEBA 1LAXA 3O29A 3RT6B 3ZKKA 3KZGA 1TWYA 2YPNA 1D9YA 1MQHA 4H5GA 2W7YA 1I6BA 5I56B 1MQJA 3R6UA 4IGRA 4EF2A 4TQUQ 1QULA 3V5AA 4OTEA 1BP5A 1WVJA 4FORA 1NH7A 5FHOA 1B0LA 3CSBA 4ZEBA 4ZECA 3HO7A 1B5IA 3FV1A 1FQDA 2YJPA 3IORA 3BBRA 2XXYA 3RGYA 3LSFB 3RNNA 2O69A 4OERA 4F31B 1B7UA 3R26A 2XXHA 2XXPA 1B1XA 3MBPA 3TELA 1NH8A 2GFEA 2F5XA 2XXRA 2XHDA 4U22A 1P1OA 1FQAA 3TQWA 5ICTA 4NF4B 4G8HA 3TCGA 4NF8A 5DTBA 2D3IA 3DELB 4JBZA 3EN3A 3QYTA 2OZZA 3IO4A 4YKJA 3W15C 2LAOA 3JZJA 1NFTA 3H6VA 5H8NA 3S9EA 3D4CA 2G29A 4F22A 3O9PA 4BDNA 2H4IA 4XKNA 1RKMA 4OEUA 3RTFB 1A8EA 1GV8A 1DPEA 3BFUA 2DOJA 3S2VA 1B3EA 1QUIA 2XD2A 5EHMA 4F19A 4YB7A 5FHMA 3K0VA 3LSLA 2Y7RA 4NWCA 4RA1A 1EZPA 1SDXA 3IB1A 1MM6A 3RT8A 3EPEA 1SQYA 2PT1A 4KCCA 1RYOA 3H06B 4YICA 3QIMA 2Q2CA 1DOTA 3AXFA 1LCTA 1S7YA 1LB9A 3M8UA 4OVJA 4DDDA 4FE8A 1Z7ME 3PPOA 1XHYA 4RPOA 3N5LA 1B3FA 1I6AA 1I69A 4GRKA 1QVSA 4RK2A 4O3BA 3MVYA 4DXBA 1B3HA 2E0SA 4GL0A 2Q9TA 2PX1A 4TLLB 3U1OA 3MUQA 3MPLA 1MY1A 1OQHA 3IL1B 3ILTB 3H6UA 3CIJA 4X1DA 1N76A 5B7DA 4K3FA 1FW0A 2UXAA 3VLWA 1LLSA 3KSXA 3TMGA 3C4MA 3CFLA 2D21A 1ZMGA 4ELQA 3I5OA 2ZMBA 4U2RA 2RC8A 2OLBA 2UVGA 1B5JA 3BFTA 5CC2A 3L6GA 1XVYA 2GHAA 1MY2A 3MWBA 3USDA 1QJMA 3FIRA 4IO4A 1IUDA 4IY5A 2UYFA 2REJA 4GF8A 2ZYMA 3GBBA 4X1BA 3ONMA 4GQOA 1DTGA 4QFLA 2F34A 3UP9A 2Z8EA 3G3IA 3IK6B 3C31A 4IO2A 5I56A 5FTIA 4OMBA 2HAUA 4WEDA 4RJZA 4NEDA 3KN3A 3IB0A 5CBSA 4XXUA 1LFGA 2Y7KA 2NWJA 1PBPA 3Q27A 1MQDA 2Q2AA 5I58B 3IOWA 2XXQA 2F6GA 2HEUA 4DXCA 5CMKA 2OWSA 3WAEA 1P1QA 1Y3NA 5TP9B 4ELRA 4OEVA 2XX7A 1FTOA 1VFEA 3C33A 4I1DA 2I6EA 3O6IA 1P1UA 2DVZA 3LUYA 2O51A 4X9TA 4NF4A 2RC7A 3S9NC 3KJ7A 3MVXA 5ICQA 2ZNUA 4R74A 3IAZA 5L9OA 2RKMA 1BKAA 3HN0A 3EHSA 2V84A 1QUKA 3OEMA 4R9GA 2VHAA 1GGGA 4GVOA 3FUZA 5B70A 3M3FA 4LATA 2XXXA 4KFQA 4H65A 4LZ7A 3MW0A 2O6AA 4Q8RA 4C0RA 4LUBA 4DLDA 3TPAA 3A09A 3LR1A 4C1TA 3GXAA 2Z8FA 4KCDA 2UVJA 1N3XA 3FXRA 3RQTA 1GTKA 1SBPA 5DVJA 5CMBA 4F1VA 3TYHA 1AMFA 3Q28A 3C32A 3O6GA 5I2KB 3HSTA 3OXNA 4EQ9A 1YTVA 4ECFA 1OQGA 4DE8A 1H44A 4N13A 3K1NA 3KEIA 1FQBA 4NF6B 2DSFA 4F3GA 3QUJA 1CB6A 5H8SA 4DZ1A 3C35A 2QS4A 2I4BA 4GD5A 4OESA 3IO6A 3RPWA 2HAVA 3V89B 3T93B 1B5HA 3FJMA 2HXWA 1SYIA 4FATA 1MM7A 3EHUA 3LBSA 3QXMA 4EDPA 4R6KA 1N3WA 4U21A 2BJJX 1QUJA 4H1XA 3I6VA 1S50A 1LB8A 3SEVA 1MY3A 4WKMA 1B6HA 1UTHB 3PD9A 1O7TA 4EF1A 4DCXA 1XOCA 1KWHA 3G3GA 3CSGA 1Y20A 5HPQA 1PEBA 4F2OA 2OCUA 1ZJLA 1JVXA 3H7MA 1B52A 1LAFE 3CVGA 5TPAB 2Q88A 2FYIA 1USYH 1N0TA 4ZS9A 4QHQA 3OELA 1SW1A 4OXVA 5KCJB 3KOTA 3TTNA 4G77A 3W9VA 1YPNA 3JV9A 2QS1A 3SEWA 1UQWA 5I58A 1N04A 2I4CA 3L6HA 3VDFA 3ZS6A 4KI0E 1URGA 3A3UA 2O1MA 3ILUB 3OSQA 2HZLA 5TP9A 1S9TA 3PUZE 3B6TA 2KLFA 2B3BA 1PB7A 2R71A 3PPRA 1SYHA 3DP8A 1DSNA 3RLFE 2RINA 1LCFA 1LFHA 1TT1A 2DWHA 1R1NA 4R72A 1IIWA 2F7AA 3ZKLA 3UA8A 4H67A 1ELJA 2F7CA 1TFAA 4XIGQ 5JEIA 5BWJA 2XX9A 1AIVA 4MF3A 4KPTA 3S9LC 1MY4A 1LBBA 1SVXB 4H0WA 2H25A 1MG1A 3OO8A 1OVTA 3QSLA 2NUVA 5M2VA 4TLMB 4NF5B 4XKRA 1LFIA 3MQ9A 4ISUA 4M4GA 4G68C 4IO5A 4F39A 1B0HA 4LZ5A 4KHZE 4ESWA 3T66A 4QRZA 3MZBA 4C1UA 4UA8A 2DQVA 3E9XA 2OWTA 4H8IA 1JEVA 4ONYA 3SEUA 3ECRA 3VFJA 3O28A 3K6XA 4MLVA 4OQOA 3OSRA 3FVGA 3PUVE 1TFDA 2NVUB 1QW0A 4GXAA 1AL3A 1N84A 3CG1A 5I2KA 3PUYE 3K6UA 1XC1A 3TDJA 5F7VA 2QSXA 2QJEA 5IAIA 2CMOA 3I3VA 1HSJA 5K2YA 4IO7A 2F6PA 4FECA 1OVBA 2DS9A 4NF6A 5DT6A 3G7WA 3V83A 1POTA 3M3KA 1J1NA 1H43A 1YAEA 3C36A 4R6HA 1JW1A 1NNPA 2HQ0A 1D9VA 2PYYA 3HHFA 3UGWA 1NKXA 2XD3A 3PMWA 5F1QA 1FTKA 1ATGA 4N07A 2D5WA 2FA7A 5EHSA 1JNFA 3KGCA 2V3QA 4KYEA 1FCKA 1VE4A 4QFNA 2H9BA 3CFZA 3C9HA 2UVIA 1MXXA 3CI8A 2O7UA 5AA1A 2Z22A 3DP4A 1PB9A 4G8NA 4AQ4A 2PBWA 5CI5A 5H8FB 1UTHA 2Y7WA 4YZZA 4QSDA 3MVZA 3OD7A 4YKIA 2B3FA 2DE3A 1MQIA 3CFXA 5CRYA 4JSDA 5TPAA 1EU8A 1MXUA 4I8CA 1PC3A 1MH3A 4U4SA 3U93A 3Q29A 1L5TA 2XXTA 5KCJA 1SD3A 4IO3A 2I3VA 2P1SA 3R7XA 2X7PA 2XXVA 1Q35A 3PPNA 4ZEKA 3E13X 4H6DA 1MDQA 4OETA 1B4HA 1IITA 1D4NA 3LSWA 1JETA 2ZYNA 1FQEA 2FNCA 1F9BA 2ZNSA 4OHNA 4LONB 2V3UA 1ZKBA 1B9JA 2ONKE 4RNSA 2IA4A 4THIA 2F7BA 5ISUA 4YB6A 1P1WA 4HS7A 1A40A 3KBRA 1B46A 1USYE 1UTBB 3F11A 2Q89A 2M8CA 4Q30B 2GRVA 3E4RA 4OFLA 4IY6A 4RXLA 2AL5A 3FJ7A 3HCQA 3RY3A 3TKDA 2ONRA 4NF5A 4YB5A 5H8HB 3GBAA 3VXBA 1M5BA 1IQ7A 2RF1A 4Q5TA 3B7DA 3PMVA 3D4GA 4KYDA 1A7LA 4RPNA 4QFOA 3HPIA 3M3LA 1B2HA 1LGBC 4LQ2A 3B6WA 3FASA 3SESA 1HSLA 1B58A 1M5EA 4H5FA 2QRYA 4HTGA 4BDMA 3OO7A 4Z0IA 2PT2A 3TTLA 4F29A 3TCHA 2Y7PA 1O64A 3MC2A
chains in the Genus database with same CATH superfamily
3PMXA 1FTLA 1B40A 4PETA 1OIBA 2F8DA 4IO6A 3OEKA 4ESXA 3DLNA 4ELOA 2ALUA 3IOVA 1BTJA 1QKBA 5HM4B 4PFWA 1H3DA 1PDAA 3VVEA 1OMPA 1NUXA 4F18A 1ZU0A 2R9JA 3KSJA 4PFTA 1N7WA 1NI9A 4R2FA 3K01A 3U8QA 2DYXA 4GX3A 4MNIA 2RCAA 1FPGA 2KR0A 2AIXA 3U72A 5K2XA 3O6HA 4YKKA 2I3WA 4PCDA 4R2BA 3TEPA 1H76A 2VP1A 2F3BA 2HCAA 2Y84A 2OX3A 5DEXB 1FTMA 4P0IA 3S9MC 4FJPA 3T9XB 3TCFA 1NNFA 2X7QA 2Y5LA 4NTLA 5H8FA 4G68B 4GLIA 1A54A 2QS3A 1JQFA 2QPQA 5IZZA 2DWJA 1R6ZA 2WYKA 3FV2A 4P11A 1H45A 3TFLA 4G4PA 3VVDA 1NV6A 1XT8A 4F2QA 4PQJA 4PFYA 4I62A 3MAMA 5HBCA 5AA4B 4YKPA 4PDDA 3T22A 1M5CA 1FQCA 4KYSA 4ZEFA 3K1PA 3VXCA 3U65A 3UK4A 1BIYA 1P1NA 3SDFA 3QMFA 5A5LA 1VSOA 5I2NB 2VD2A 4AB6A 4FIMA 1POY1 5H8QB 2OBGA 4JSOA 3IR1A 3ODBA 1SW2A 4JWYA 3MSTA 2O84X 1MXYA 4N17A 4OYVA 3FVOA 3V8XB 1DMBA 3OMBA 4IB2A 2O68A 1T0KA 4GWOA 1OLAA 2P0SA 4E0WA 2F97A 2ZNTA 3CG3A 3K6WA 2Z8DA 2V93A 3T9VA 3S4UA 3LV0A 1UTBA 3KFMA 1Y1ZA 3QK6A 4MNPA 1QGXA 1CNQA 1IMEA 3HFUA 1R9QA 4X48A 4EQ7A 3IJXB 4I3EA 2E1SA 2R8TA 1UIVA 2O1LA 4FEDA 5JK4A 4FAJA 4ZE8A 1IXGA 3UORA 1JW4A 2ONSA 5H8HA 3HHGA 4MLQA 1D3KA 2REGA 3KJTA 1XS5A 3EF7A 5AA2B 3FATA 1B32A 2OK2A 4NAPA 2ANJA 4MJOA 1LBCA 1FQFA 1IXHA 2XWOA 4N15A 4G2ZA 3C34A 5EYHA 1Y4CA 1SW4A 4PDHA 4F1UA 4TOZA 1ZIUA 2JJKA 4KR5A 2IEEA 4YMAA 3DP6A 3MPKA 2P3VA 3PPPA 3TTKA 1FPEA 3OO6A 1Y1MA 1N7XA 3UIFA 1NV5A 2ZZXA 4ZZAA 3TTMA 2WKYA 3LUZA 4BDRA 1EYJA 5J16A 2HZKA 4WEPA 3U92A 1Y4TA 1MXWA 3UN6A 5DW8A 2DXYA 4PE5B 1Y9UA 5IZ1A 2OWZA 1OLCA 1Y3PA 4MCOA 4R73A 1MXVA 4KD5A 1SPIA 5J1DA 4XFEA 4MAGA 1NUZA 2PVUA 4GOTA 1A99A 4P9KA 4F3SA 4QSCA 4PFUA 2VD3A 4N8GA 1A8FA 4OENA 4JWOA 4LVQA 3Q25A 1LAHE 4WXJA 4P8BA 4QFKA 1ZTYA 2OJTA 3FXQA 4H8JA 2CZHA 3SEYA 5A5XB 1GR2A 1BLFA 3BIGA 1QKAA 4LA9A 3SETA 3N94A 4PP0A 1PB8A 5JTYB 5FTHA 5ITPA 5AA2D 3K2DA 2NXOA 4GIZA 3IB2A 2H99A 5I57B 3FJGA 4ZEDA 5ITOA 4EQBA 4JXIA 3MP1A 2YLNA 1TXFA 4ELPA 4UACA 5DEXA 2I0BA 1AH5A 5CMMA 3MYUA 4N81A 3VLVA 1M5DA 2B65A 5F24A 4G68A 2DE2A 2V25A 4OWDA 2F3DA 4PGPA 1FTJA 5DVIA 2VGQA 1M5FA 1US5A 1B51A 3H03A 2NOOA 4RK9A 4DIGA 1B1HA 4OFOA 5CM6A 1P99A 1RDXA 3GZGA 3G3JA 5BUUA 4R9FA 5I59B 5DYHA 2ZXTA 3W9WA 3TTRA 2Y5KA 2ZYKA 5AA4A 1B7HA 2I48A 4PE3A 3DM0A 3NOHA 1LSTA 4YMBA 2THIA 5ET6A 3KG2A 2HFBA 4HCYA 1B4ZA 1IMAA 4BDLA 1MXZA 4GBWA 2XXIA 3FVKA 2I58A 4QFPA 4NE4A 2DVCA 2DXRA 3IFCA 2UYEA 2R6GE 4NMYA 5I2NA 4O94A 3THIA 2XXUA 4U23A 3TQLA 3MVWA 1ANFA 1HSEA 5H8QA 3O97A 4LQ5A 1CE2A 2CZKA 1LAGE 1MPCA 3H6TA 3G3HA 2ABHA 1MPBA 3K1MA 5KDTB 1DPPA 3P7IA 3U94A 3O2AA 4RY1A 3PPQA 3MJNA 3TUSA 1XVXA 3LC8A 4IGTA 3MP8A 1MY0A 1NNTA 1MQGA 1EZOA 4ND9A 3QUFA 3PUWE 3PU5A 2V3TA 2HPGA 3FGSA 1EH3A 3OENA 3FVNA 4F3BA 4N4UA 4U1ZA 1JW5A 2A5TB 3RTWB 1FJ9A 4MH5A 5LOMA 4POXA 2DDKA 5L9SA 2A5SA 2AL4A 4AB5A 1FPLA 1WDNA 3N6UA 2G93A 4BDOA 3HV1A 1R9LA 1KA1A 3QAXA 2DWAA 2QS2A 3PGFA 4GXSB 3SEXA 3OO9A 3VLUA 4GWYA 4EUOA 1FBDA 3TZAA 5I84A 4H45A 1IXIA 2KQZA 4GBVA 3MZ9A 4OZ9A 3FD3A 5AA2A 1VFDA 5AA3A 3IX1A 3KN7A 5CMCA 4U1OA 4QXDA 5TU0A 4Z7EA 4P0GA 1B3LA 2WBDA 3WAFA 4JB7A 5KZTA 3GLBA 3B6QA 1SI0A 3KBZA 4DCYA 3CRBA 4OFJA 5ET5A 4R6YA 1MS7A 2I0CA 1B7ZA 2Y7IA 3JYRA 3T9UA 2O7IA 4NGUA 5ET7A 1FBPA 1YCJA 2DP8A 4EXKA 4XKPA 5L9MA 1ZBMA 4ZE9A 4PGNA 4HCWA 4I9DA 3ISPA 4OVTA 2DWIA 1RYXA 2RCBA 3IOTA 4YAHX 3H3GA 1MDP1 5IKBA 3K4UA 3SKPA 3FXUA 4XTCQ 5CBRA 1SW5A 2QMXA 1NL5A 4R75A 3G3KA 3CR9A 1Y3QA 3T96B 2CZLA 2XX8A 4XKQA 3Q26A 2ZYOA 1VR5A 3H6WA 1II5A 3PD8A 2F36A 4NF8B 1Z7NE 4L17A 5IGAA 1B05A 3EQ1A 2F35A 5A5XA 2ZZVA 3OOAA 3PUXE 3O66A 2Z23A 5JTYA 2VOZA 2X26A 4ZDMA 5H8NB 3KN8A 3E3KA 2GH9A 4QSEA 1JEUA 3N26A 5I57A 3A3CA 4POWA 1JVYA 5AE4A 3SERA 4GL8A 5ELVA 2QL3A 4X8RA 1G0HA 3MP6A 4GFRA 1URDA 4G8MA 1DTZA 1B3GA 4KQPA 4MFIA 2F78A 3K6VA 3TAJA 5L8DA 3TODA 4OVQA 1IXCA 4LP2B 4BDQA 4X04A 2DE4A 4N6KA 1IMCA 4OANA 1INPA 5I59A 1NMUA 4N6PA 1SI1A 4ZZEA 3FZVA 5DVFA 3LSXA 3RN8A 4EXLA 4QF9A 2QMWA 2PMSA 1FRPA 1IZ1A 3VV5A 2XWVA 5I3SA 4PAKA 5ESYA 4HW8A 4O3CA 4F3PA 1UIUA 2AYSA 3VE1B 2I49A 4GWSA 2H98A 4YU0A 4BLAA 1MPDA 4QBAA 4LZ8A 1ZLQA 5FHNA 4PAFA 4F1YA 4MBPA 4U4XA 4JDFA 3PV0E 4JWXA 5LDZA 2P2AA 3H4ZA 1WODA 3MZ1A 2XXKA 4JVCA 3N6TA 1NNKA 1A55A 3BKIB 5ET8A 3IJOB 2GHBA 1URSA 3KOSA 5KDTA 1FPFA 3T9HB 2ESNA 2UVHA 1PBQA 4N8YA 3VVFA 4O3AA 1EZ9A 4E0XA 3B50A 2RC9A 3EHTA 3G3FA 4M1VA 3IOUA 5EYFA 2Q8MA 1I6QA 1MRPA 1US4A 3ZSFA 2XXWA 1IEJA 4NWDA 4Q0CA 1BK4A 4ZEIA 2A5TA 1O63A 1FJ6A 3K02A 3K00A 1AOVA 1XI6A 2MKZA 5I5PA 4DXUA 1Q1KA 4RYAA 3RUMA 1K9YA 1MH4A 2H5YA 1GVCA 2Q8JA 4FEBA 1LAXA 3O29A 3RT6B 3ZKKA 3KZGA 1TWYA 2YPNA 1D9YA 1MQHA 1FBGA 4H5GA 2W7YA 1I6BA 5I56B 4KXPA 4PBHA 1MQJA 3R6UA 3FXBA 4IGRA 2FIXA 4EF2A 4TQUQ 1QULA 3V5AA 4OTEA 1BP5A 1WVJA 4XEQA 4FORA 1NH7A 5FHOA 5FBPA 1B0LA 3CSBA 4ZEBA 4ZECA 3HO7A 1B5IA 3FV1A 4MIJA 1FQDA 2YJPA 3IORA 2VPNA 3BBRA 2CEXA 1NV0A 2XXYA 1NV4A 3RGYA 3LSFB 2VT5A 3RNNA 2O69A 4OERA 4F31B 1B7UA 3R26A 2XXHA 2XXPA 1B1XA 3MBPA 4PFIA 3TELA 1NH8A 2GFEA 1FSAA 2F5XA 2XXRA 2XHDA 4U22A 1P1OA 1FQAA 3TQWA 5ICTA 4NF4B 4G8HA 3TCGA 4NF8A 5DTBA 4HE0A 2D3IA 3DELB 4JBZA 3EN3A 4NHBA 4MEVA 2HHMA 3QYTA 2OZZA 3IO4A 4YKJA 3W15C 2LAOA 3JZJA 1NFTA 1IMFA 3H6VA 5H8NA 3S9EA 3D4CA 2G29A 4F22A 3O9PA 4BDNA 2H4IA 4XKNA 1RKMA 4OEUA 1FTAA 4OVSA 3RTFB 1A8EA 1GV8A 1DPEA 3BFUA 2DOJA 3S2VA 1B3EA 1QUIA 2XD2A 5EHMA 4F19A 4YB7A 5FHMA 3K0VA 3LSLA 2Y7RA 4NWCA 4RA1A 1EZPA 4XF5A 1SDXA 1VDWA 3IB1A 1MM6A 3RT8A 3EPEA 1SQYA 2PT1A 4KCCA 1RYOA 3H06B 4JVDA 4YICA 3QIMA 2Q2CA 1DOTA 3AXFA 1LCTA 1S7YA 1LB9A 3M8UA 4OVJA 4DDDA 4FE8A 1Z7ME 3PPOA 2QVUA 1XHYA 3BIHA 4RPOA 3N5LA 1B3FA 1I6AA 1I69A 4P3LA 4GRKA 1QVSA 2BJIA 4RK2A 4O3BA 3MVYA 4DXBA 1B3HA 2E0SA 4GL0A 2Q9TA 2PX1A 4TLLB 3U1OA 3MUQA 4PBQA 3RYDA 3MPLA 1MY1A 4GWZA 1OQHA 3IL1B 3ILTB 3H6UA 3CIJA 4X1DA 4AS5A 1N76A 5B7DA 4K3FA 1FW0A 2UXAA 3VLWA 1LLSA 3KSXA 3TMGA 3C4MA 3CFLA 2D21A 1ZMGA 4ELQA 3I5OA 2ZMBA 4U2RA 2RC8A 2OLBA 2UVGA 2WBBA 1DBZA 1B5JA 3BFTA 5CC2A 3L6GA 1XVYA 2GHAA 1MY2A 3MWBA 3USDA 1QJMA 3IFAA 3FIRA 4P56A 4IO4A 1IUDA 4IY5A 2UYFA 4MMPA 2REJA 2L5VA 4GF8A 2ZYMA 3GBBA 4OVPA 4X1BA 3ONMA 4GQOA 1DTGA 4QFLA 4HE1A 3EKIA 2F34A 3UP9A 2Z8EA 3G3IA 3IK6B 3C31A 4IO2A 5I56A 3KC0A 5FTIA 1JP4A 4OMBA 2HAUA 4WEDA 4RJZA 4NEDA 3KN3A 3IB0A 5CBSA 4XXUA 2ZZWA 1LFGA 3CHGA 4MX6A 2Y7KA 2NWJA 1PBPA 3Q27A 3RPLB 1MQDA 2Q2AA 5I58B 4NF0A 3IOWA 2XXQA 2F6GA 2HEUA 4DXCA 3E79A 5CMKA 2OWSA 3WAEA 1P1QA 1Y3NA 5TP9B 4ELRA 4OEVA 2XX7A 1FTOA 1VFEA 4PTKA 4OVRA 3C33A 4I1DA 2I6EA 2V4CA 3O6IA 2XWKA 1P1UA 2DVZA 3LUYA 1Q9DA 2O51A 1FBFA 4X9TA 5EYGA 4NF4A 2RC7A 3S9NC 3KJ7A 3MVXA 5ICQA 2ZNUA 4R74A 3IAZA 5L9OA 4N91A 3T0JA 2RKMA 1BKAA 2WEFA 3HN0A 2FIEA 3EHSA 3FBPA 2V84A 1QUKA 3GYYA 2B4MA 2B4LA 4NG7A 3OEMA 4R9GA 2VHAA 1GGGA 4GVOA 3FUZA 5B70A 3M3FA 4LATA 2XXXA 4KFQA 4H65A 4LZ7A 4LN5A 3T1BA 3A29A 3MW0A 2O6AA 4Q8RA 1NV7A 4C0RA 4LUBA 4DLDA 3TPAA 3A09A 3LR1A 4C1TA 3GXAA 2Z8FA 4KCDA 2UVJA 4PFBA 1N3XA 3FXRA 1FBCA 3RQTA 1GTKA 1AWBA 1SBPA 4P47A 5DVJA 1EYIA 4JVIA 5CMBA 4F1VA 3TYHA 1AMFA 3Q28A 2PCRA 3C32A 3O6GA 5I2KB 1YXIA 2PFZA 3HSTA 3OXNA 4EQ9A 3ROJA 1YTVA 4ECFA 1OQGA 4OA4A 4DE8A 1H44A 4N13A 3K1NA 3KEIA 1FQBA 4NF6B 2DSFA 2QFLA 4F3GA 3QUJA 1CB6A 5H8SA 4DZ1A 3C35A 2QS4A 2I4BA 4GD5A 4OESA 3IO6A 3RPWA 4DI4B 2HAVA 3V89B 3T93B 1B5HA 3FJMA 2HXWA 1SYIA 4FATA 1MM7A 3EHUA 3LBSA 1D9QA 3QXMA 4EDPA 4NQ8A 4R6KA 4O7IA 1N3WA 4PAIA 4U21A 2BJJX 1LBVA 1QUJA 4H1XA 3I6VA 1S50A 1FPDA 1LB8A 3SEVA 4H46A 4GX4A 1MY3A 4WKMA 1B6HA 1UTHB 1FPIA 3PD9A 1O7TA 1FPKA 4EF1A 4DCXA 1XOCA 1KWHA 1NV3A 3G3GA 3CSGA 1Y20A 1YYZA 5HPQA 1PEBA 4F2OA 4GWXA 2OCUA 1IMBA 1ZJLA 1JVXA 4NN3A 3H7MA 1B52A 1LAFE 3E78A 3CVGA 5TPAB 2Q88A 2FYIA 1USYH 1N0TA 4ZS9A 4QHQA 3OELA 1SW1A 4OXVA 1NUYA 5KCJB 3KOTA 3TTNA 4G77A 2CZIA 3W9VA 1YPNA 3JV9A 2QS1A 3RPLA 3SEWA 1UQWA 4DI3D 5I58A 1N04A 2I4CA 3L6HA 3VDFA 3ZS6A 1NUWA 4KI0E 1FBHA 1URGA 3A3UA 2O1MA 3ILUB 3OSQA 2HZLA 5TP9A 1S9TA 3PUZE 3B6TA 5EQ9A 2KLFA 2B3BA 1PB7A 2R71A 4FBPA 3PPRA 1SYHA 3DP8A 1DSNA 3RLFE 2RINA 1G0IA 1LCFA 1LFHA 1FBEA 1TT1A 2DWHA 1R1NA 4R72A 5T3JA 1IIWA 2F7AA 3ZKLA 3UA8A 4H67A 1ELJA 1RDZA 2F7CA 1TFAA 4XIGQ 5JEIA 5BWJA 2XX9A 1AIVA 4MF3A 4KPTA 3S9LC 1MY4A 1LBBA 1SVXB 4H0WA 2H25A 1MG1A 4HXVA 3OO8A 1OVTA 1NV2A 3QSLA 2NUVA 5M2VA 3KC1A 4TLMB 4NF5B 4XKRA 1LFIA 3MQ9A 4ISUA 4M4GA 4G68C 4IO5A 4F39A 2HXRA 1B0HA 4LZ5A 5I7IA 4KHZE 4ESWA 1FPBA 3T66A 4N6DA 1FPJA 4QRZA 3PTYA 3MZBA 4MNCA 4C1UA 4UA8A 2DQVA 3E9XA 2OWTA 4H8IA 1JEVA 4ONYA 3SEUA 3ECRA 3VFJA 3O28A 3K6XA 3SZPA 4MLVA 4OQOA 2FBPA 5IZ3B 3OSRA 3FVGA 1LEVA 3PUVE 1TFDA 2NVUB 1QW0A 4GXAA 4IR8A 1AL3A 1N84A 3CG1A 5I2KA 3PUYE 3K6UA 1XC1A 3TDJA 5F7VA 2QSXA 5EQAA 2QJEA 5IAIA 2CMOA 4GWUA 3I3VA 1HSJA 5K2YA 4IO7A 2F6PA 1KZ8A 4FECA 4GWWA 4NF6A 1OVBA 2DS9A 5DT6A 1KA0A 3G7WA 3V83A 1POTA 3M3KA 1J1NA 1H43A 1YAEA 2QVRA 3C36A 4R6HA 1JW1A 1NNPA 2PFYA 2HQ0A 1D9VA 2PYYA 4MHFA 3HHFA 3UGWA 1NKXA 2XD3A 3PMWA 5F1QA 2WYPA 1FTKA 4PC9A 1ATGA 4N07A 4O7MA 2D5WA 2FA7A 5EHSA 1JNFA 3KGCA 2V3QA 4KYEA 1FCKA 1VE4A 4QFNA 2WX9A 2H9BA 1LBXA 2XWIA 4PF8A 3CFZA 3C9HA 2UVIA 1MXXA 3CI8A 2O7UA 5AA1A 2Z22A 3DP4A 1PB9A 4G8NA 4AQ4A 2PBWA 5CI5A 5H8FB 1UTHA 2Y7WA 4YZZA 4QSDA 3MVZA 3OD7A 4YKIA 4PFRA 2B3FA 2DE3A 1MQIA 3B8BA 3CFXA 5CRYA 4JSDA 5TPAA 1EU8A 1MXUA 4I8CA 1PC3A 1K9ZA 1MH3A 4U4SA 3U93A 4PF6A 3Q29A 1L5TA 2XXTA 2CEYA 5KCJA 1SD3A 1EYKA 4IO3A 2I3VA 1RDYA 2P1SA 3R7XA 2X7PA 2XXVA 1Q35A 3PPNA 4ZEKA 3E13X 4H6DA 5EQ7A 4AS4A 1IMDA 1MDQA 4OETA 3D1RA 1B4HA 1IITA 1D4NA 1LBWA 3LSWA 1JETA 4HE2A 2ZYNA 1FQEA 1DCUA 2FNCA 1F9BA 2ZNSA 4UABA 4OHNA 1LBYA 4LONB 2QVVA 2V3UA 1ZKBA 1B9JA 2ONKE 4RNSA 2IA4A 4THIA 2F7BA 5ISUA 4YB6A 1P1WA 4HS7A 1A40A 2FHYA 3KBRA 1B46A 1YZ0A 5LTCA 2GQ1A 1USYE 1UTBB 3F11A 2Q89A 2M8CA 4Q30B 2GRVA 3E4RA 4OFLA 4IY6A 4GX6A 4RXLA 2P3NA 2AL5A 3FJ7A 3HCQA 3RY3A 3TKDA 4I3YA 2ONRA 4NF5A 4YB5A 5H8HB 2XA5A 3GBAA 1DK4A 3VXBA 1M5BA 2FVZA 1IQ7A 2RF1A 4Q5TA 3B7DA 3PMVA 4RPNA 2VPOA 1A7LA 3D4GA 4KYDA 4NX1A 4QFOA 4G61A 3HPIA 3M3LA 1B2HA 1LGBC 4LQ2A 3B6WA 3FASA 4I40A 3SESA 5IM2A 1LBZA 1HSLA 1B58A 1M5EA 4H5FA 2QRYA 4HTGA 5IZ3A 4BDMA 3OO7A 4P1LA 1NV1A 4Z0IA 2PT2A 2Q74A 3TTLA 4O8MA 5EQ8A 4F29A 3TCHA 2Y7PA 4P1EA 1O64A 3MC2A
chains in the Genus database with same CATH topology
3PMXA 1FTLA 1B40A 4PETA 1OIBA 2F8DA 4IO6A 3OEKA 4ESXA 3DLNA 4ELOA 2ALUA 3IOVA 1BTJA 1QKBA 5HM4B 4PFWA 1H3DA 1PDAA 3VVEA 1OMPA 4F18A 1ZU0A 2R9JA 3KSJA 4PFTA 1N7WA 4R2FA 3K01A 3U8QA 2DYXA 2RCAA 2AIXA 3U72A 5K2XA 3O6HA 4YKKA 2I3WA 4R2BA 3TEPA 1H76A 2VP1A 2HCAA 2Y84A 5DEXB 1FTMA 4P0IA 3S9MC 4FJPA 3T9XB 3TCFA 1NNFA 2X7QA 4NTLA 5H8FA 4G68B 4GLIA 1A54A 2QS3A 1JQFA 2QPQA 2DWJA 1R6ZA 3FV2A 4P11A 1H45A 3TFLA 4G4PA 3VVDA 1XT8A 4F2QA 4PQJA 4PFYA 4I62A 3MAMA 5HBCA 5AA4B 4YKPA 3T22A 1M5CA 1FQCA 4KYSA 4ZEFA 3K1PA 3VXCA 3UK4A 1BIYA 1P1NA 3SDFA 1VSOA 5I2NB 2VD2A 4AB6A 4FIMA 1POY1 5H8QB 2OBGA 4JSOA 3IR1A 3ODBA 1SW2A 4JWYA 2O84X 1MXYA 4OYVA 3FVOA 3V8XB 1DMBA 3OMBA 4IB2A 2O68A 1T0KA 4GWOA 1OLAA 2P0SA 4E0WA 2F97A 2ZNTA 3CG3A 3K6WA 2Z8DA 2V93A 3T9VA 3S4UA 1UTBA 3KFMA 1Y1ZA 3QK6A 1R9QA 4X48A 4EQ7A 3IJXB 2E1SA 4FEDA 1UIVA 2O1LA 5JK4A 4FAJA 4ZE8A 1IXGA 3UORA 1JW4A 2ONSA 5H8HA 3HHGA 4MLQA 1D3KA 2REGA 3KJTA 1XS5A 3EF7A 5AA2B 3FATA 1B32A 2OK2A 2ANJA 1LBCA 1FQFA 1IXHA 4G2ZA 3C34A 1Y4CA 1SW4A 4F1UA 4TOZA 1ZIUA 4KR5A 2IEEA 4YMAA 3DP6A 3MPKA 3PPPA 3TTKA 3OO6A 1Y1MA 1N7XA 3UIFA 4ZZAA 3TTMA 2WKYA 4BDRA 2HZKA 4WEPA 3U92A 1Y4TA 1MXWA 3UN6A 2DXYA 4PE5B 1Y9UA 1OLCA 1Y3PA 4R73A 1MXVA 4KD5A 5J1DA 2PVUA 4GOTA 1A99A 4F3SA 4QSCA 4PFUA 2VD3A 1A8FA 4OENA 4JWOA 4LVQA 3Q25A 1LAHE 4WXJA 4QFKA 1ZTYA 2OJTA 3FXQA 4H8JA 3SEYA 5A5XB 1GR2A 1BLFA 1QKAA 4LA9A 3SETA 3N94A 4PP0A 1PB8A 5JTYB 5FTHA 5ITPA 5AA2D 3K2DA 2NXOA 4GIZA 3IB2A 2H99A 5I57B 3FJGA 4ZEDA 5ITOA 4EQBA 4JXIA 3MP1A 2YLNA 1TXFA 4ELPA 4UACA 5DEXA 2I0BA 1AH5A 5CMMA 3VLVA 1M5DA 2B65A 4G68A 2DE2A 2V25A 4OWDA 1FTJA 5DVIA 2VGQA 1M5FA 1US5A 1B51A 3H03A 2NOOA 4RK9A 4DIGA 1B1HA 4OFOA 5CM6A 1P99A 3GZGA 3G3JA 5BUUA 4R9FA 5I59B 5DYHA 2ZXTA 3W9WA 3TTRA 2ZYKA 5AA4A 1B7HA 2I48A 3DM0A 4YMBA 1LSTA 2THIA 3KG2A 2HFBA 4HCYA 1B4ZA 4BDLA 1MXZA 2XXIA 3FVKA 2I58A 4QFPA 4NE4A 2DVCA 2DXRA 2UYEA 2R6GE 4NMYA 5I2NA 3THIA 2XXUA 4U23A 3TQLA 3MVWA 1ANFA 1HSEA 5H8QA 3O97A 4LQ5A 1CE2A 1LAGE 1MPCA 3H6TA 3G3HA 2ABHA 1MPBA 3K1MA 5KDTB 1DPPA 3P7IA 3U94A 3O2AA 4RY1A 3PPQA 3MJNA 3TUSA 1XVXA 3LC8A 4IGTA 3MP8A 1MY0A 1NNTA 1MQGA 1EZOA 4ND9A 3QUFA 3PUWE 3PU5A 2V3TA 3FGSA 1EH3A 3OENA 3FVNA 4F3BA 4U1ZA 1JW5A 2A5TB 3RTWB 4MH5A 5LOMA 4POXA 5L9SA 2A5SA 2AL4A 4AB5A 1WDNA 3N6UA 2G93A 4BDOA 3HV1A 1R9LA 3QAXA 2DWAA 2QS2A 3PGFA 4GXSB 3SEXA 3OO9A 3VLUA 4EUOA 3TZAA 5I84A 1IXIA 3MZ9A 4OZ9A 3FD3A 5AA2A 1VFDA 5AA3A 3IX1A 3KN7A 5CMCA 4U1OA 5TU0A 4Z7EA 4P0GA 1B3LA 3WAFA 4JB7A 5KZTA 3GLBA 3B6QA 1SI0A 4DCYA 3CRBA 4OFJA 4R6YA 1MS7A 2I0CA 1B7ZA 2Y7IA 3JYRA 3T9UA 2O7IA 1YCJA 2DP8A 4EXKA 4XKPA 5L9MA 1ZBMA 4ZE9A 4HCWA 4I9DA 2DWIA 1RYXA 2RCBA 3IOTA 4YAHX 3H3GA 1MDP1 5IKBA 3K4UA 3SKPA 3FXUA 4XTCQ 5CBRA 1SW5A 2QMXA 1NL5A 4R75A 3G3KA 3CR9A 1Y3QA 3T96B 2CZLA 2XX8A 4XKQA 3Q26A 2ZYOA 1VR5A 3H6WA 1II5A 3PD8A 2F36A 4NF8B 1Z7NE 4L17A 1B05A 3EQ1A 2F35A 5A5XA 3OOAA 3PUXE 3O66A 2Z23A 5JTYA 2VOZA 2X26A 4ZDMA 5H8NB 3KN8A 3E3KA 2GH9A 4QSEA 1JEUA 3N26A 5I57A 3A3CA 4POWA 1JVYA 5AE4A 3SERA 4GL8A 5ELVA 2QL3A 3MP6A 4GFRA 1URDA 4G8MA 1DTZA 1B3GA 4KQPA 4MFIA 2F78A 3K6VA 3TAJA 5L8DA 3TODA 4BDQA 1IXCA 4LP2B 2DE4A 5I59A 1NMUA 4N6PA 1SI1A 4ZZEA 3FZVA 5DVFA 4EXLA 3RN8A 3LSXA 4QF9A 2QMWA 2PMSA 1IZ1A 3VV5A 4HW8A 4O3CA 4F3PA 1UIUA 2AYSA 3VE1B 2I49A 2H98A 4YU0A 4BLAA 1MPDA 4LZ8A 1ZLQA 5FHNA 4F1YA 4MBPA 4U4XA 4JDFA 3PV0E 4JWXA 2P2AA 3H4ZA 1WODA 3MZ1A 3N6TA 1NNKA 1A55A 3BKIB 3IJOB 2GHBA 1URSA 3KOSA 5KDTA 3T9HB 2ESNA 2UVHA 1PBQA 3VVFA 4O3AA 1EZ9A 4E0XA 2RC9A 3EHTA 3G3FA 4M1VA 3IOUA 5EYFA 1I6QA 1MRPA 1US4A 3ZSFA 2XXWA 1IEJA 4NWDA 4Q0CA 4ZEIA 2A5TA 1O63A 3K02A 3K00A 1AOVA 4DXUA 1Q1KA 4RYAA 3RUMA 1MH4A 2H5YA 1GVCA 2Q8JA 4FEBA 1LAXA 3O29A 3RT6B 3ZKKA 3KZGA 1TWYA 2YPNA 1D9YA 1MQHA 4H5GA 2W7YA 1I6BA 5I56B 1MQJA 3R6UA 4IGRA 4EF2A 4TQUQ 1QULA 3V5AA 4OTEA 1BP5A 1WVJA 4FORA 1NH7A 5FHOA 1B0LA 3CSBA 4ZEBA 4ZECA 3HO7A 1B5IA 3FV1A 1FQDA 2YJPA 3IORA 3BBRA 2XXYA 3RGYA 3LSFB 3RNNA 2O69A 4OERA 4F31B 1B7UA 3R26A 2XXHA 2XXPA 1B1XA 3MBPA 3TELA 1NH8A 2GFEA 2F5XA 2XXRA 2XHDA 4U22A 1P1OA 1FQAA 3TQWA 5ICTA 4NF4B 4G8HA 3TCGA 4NF8A 5DTBA 2D3IA 3DELB 4JBZA 3EN3A 3QYTA 2OZZA 3IO4A 4YKJA 3W15C 2LAOA 3JZJA 1NFTA 3H6VA 5H8NA 3S9EA 3D4CA 2G29A 4F22A 3O9PA 4BDNA 2H4IA 4XKNA 1RKMA 4OEUA 3RTFB 1A8EA 1GV8A 1DPEA 3BFUA 2DOJA 3S2VA 1B3EA 1QUIA 2XD2A 5EHMA 4F19A 4YB7A 5FHMA 3K0VA 3LSLA 2Y7RA 4NWCA 4RA1A 1EZPA 1SDXA 3IB1A 1MM6A 3RT8A 3EPEA 1SQYA 2PT1A 4KCCA 1RYOA 3H06B 4YICA 3QIMA 2Q2CA 1DOTA 3AXFA 1LCTA 1S7YA 1LB9A 3M8UA 4OVJA 4DDDA 4FE8A 1Z7ME 3PPOA 1XHYA 4RPOA 3N5LA 1B3FA 1I6AA 1I69A 4GRKA 1QVSA 4RK2A 4O3BA 3MVYA 4DXBA 1B3HA 2E0SA 4GL0A 2Q9TA 2PX1A 4TLLB 3U1OA 3MUQA 3MPLA 1MY1A 1OQHA 3IL1B 3ILTB 3H6UA 3CIJA 4X1DA 1N76A 5B7DA 4K3FA 1FW0A 2UXAA 3VLWA 1LLSA 3KSXA 3TMGA 3C4MA 3CFLA 2D21A 1ZMGA 4ELQA 3I5OA 2ZMBA 4U2RA 2RC8A 2OLBA 2UVGA 1B5JA 3BFTA 5CC2A 3L6GA 1XVYA 2GHAA 1MY2A 3MWBA 3USDA 1QJMA 3FIRA 4IO4A 1IUDA 4IY5A 2UYFA 2REJA 4GF8A 2ZYMA 3GBBA 4X1BA 3ONMA 4GQOA 1DTGA 4QFLA 2F34A 3UP9A 2Z8EA 3G3IA 3IK6B 3C31A 4IO2A 5I56A 5FTIA 4OMBA 2HAUA 4WEDA 4RJZA 4NEDA 3KN3A 3IB0A 5CBSA 4XXUA 1LFGA 2Y7KA 2NWJA 1PBPA 3Q27A 1MQDA 2Q2AA 5I58B 3IOWA 2XXQA 2F6GA 2HEUA 4DXCA 5CMKA 2OWSA 3WAEA 1P1QA 1Y3NA 5TP9B 4ELRA 4OEVA 2XX7A 1FTOA 1VFEA 3C33A 4I1DA 2I6EA 3O6IA 1P1UA 2DVZA 3LUYA 2O51A 4X9TA 4NF4A 2RC7A 3S9NC 3KJ7A 3MVXA 5ICQA 2ZNUA 4R74A 3IAZA 5L9OA 2RKMA 1BKAA 3HN0A 3EHSA 2V84A 1QUKA 3OEMA 4R9GA 2VHAA 1GGGA 4GVOA 3FUZA 5B70A 3M3FA 4LATA 2XXXA 4KFQA 4H65A 4LZ7A 3MW0A 2O6AA 4Q8RA 4C0RA 4LUBA 4DLDA 3TPAA 3A09A 3LR1A 4C1TA 3GXAA 2Z8FA 4KCDA 2UVJA 1N3XA 3FXRA 3RQTA 1GTKA 1SBPA 5DVJA 5CMBA 4F1VA 3TYHA 1AMFA 3Q28A 3C32A 3O6GA 5I2KB 3HSTA 3OXNA 4EQ9A 1YTVA 4ECFA 1OQGA 4DE8A 1H44A 4N13A 3K1NA 3KEIA 1FQBA 4NF6B 2DSFA 4F3GA 3QUJA 1CB6A 5H8SA 4DZ1A 3C35A 2QS4A 2I4BA 4GD5A 4OESA 3IO6A 3RPWA 2HAVA 3V89B 3T93B 1B5HA 3FJMA 2HXWA 1SYIA 4FATA 1MM7A 3EHUA 3LBSA 3QXMA 4EDPA 4R6KA 1N3WA 4U21A 2BJJX 1QUJA 4H1XA 3I6VA 1S50A 1LB8A 3SEVA 1MY3A 4WKMA 1B6HA 1UTHB 3PD9A 1O7TA 4EF1A 4DCXA 1XOCA 1KWHA 3G3GA 3CSGA 1Y20A 5HPQA 1PEBA 4F2OA 2OCUA 1ZJLA 1JVXA 3H7MA 1B52A 1LAFE 3CVGA 5TPAB 2Q88A 2FYIA 1USYH 1N0TA 4ZS9A 4QHQA 3OELA 1SW1A 4OXVA 5KCJB 3KOTA 3TTNA 4G77A 3W9VA 1YPNA 3JV9A 2QS1A 3SEWA 1UQWA 5I58A 1N04A 2I4CA 3L6HA 3VDFA 3ZS6A 4KI0E 1URGA 3A3UA 2O1MA 3ILUB 3OSQA 2HZLA 5TP9A 1S9TA 3PUZE 3B6TA 2KLFA 2B3BA 1PB7A 2R71A 3PPRA 1SYHA 3DP8A 1DSNA 3RLFE 2RINA 1LCFA 1LFHA 1TT1A 2DWHA 1R1NA 4R72A 1IIWA 2F7AA 3ZKLA 3UA8A 4H67A 1ELJA 2F7CA 1TFAA 4XIGQ 5JEIA 5BWJA 2XX9A 1AIVA 4MF3A 4KPTA 3S9LC 1MY4A 1LBBA 1SVXB 4H0WA 2H25A 1MG1A 3OO8A 1OVTA 3QSLA 2NUVA 5M2VA 4TLMB 4NF5B 4XKRA 1LFIA 3MQ9A 4ISUA 4M4GA 4G68C 4IO5A 4F39A 1B0HA 4LZ5A 4KHZE 4ESWA 3T66A 4QRZA 3MZBA 4C1UA 4UA8A 2DQVA 3E9XA 2OWTA 4H8IA 1JEVA 4ONYA 3SEUA 3ECRA 3VFJA 3O28A 3K6XA 4MLVA 4OQOA 3OSRA 3FVGA 3PUVE 1TFDA 2NVUB 1QW0A 4GXAA 1AL3A 1N84A 3CG1A 5I2KA 3PUYE 3K6UA 1XC1A 3TDJA 5F7VA 2QSXA 2QJEA 5IAIA 2CMOA 3I3VA 1HSJA 5K2YA 4IO7A 2F6PA 4FECA 1OVBA 2DS9A 4NF6A 5DT6A 3G7WA 3V83A 1POTA 3M3KA 1J1NA 1H43A 1YAEA 3C36A 4R6HA 1JW1A 1NNPA 2HQ0A 1D9VA 2PYYA 3HHFA 3UGWA 1NKXA 2XD3A 3PMWA 5F1QA 1FTKA 1ATGA 4N07A 2D5WA 2FA7A 5EHSA 1JNFA 3KGCA 2V3QA 4KYEA 1FCKA 1VE4A 4QFNA 2H9BA 3CFZA 3C9HA 2UVIA 1MXXA 3CI8A 2O7UA 5AA1A 2Z22A 3DP4A 1PB9A 4G8NA 4AQ4A 2PBWA 5CI5A 5H8FB 1UTHA 2Y7WA 4YZZA 4QSDA 3MVZA 3OD7A 4YKIA 2B3FA 2DE3A 1MQIA 3CFXA 5CRYA 4JSDA 5TPAA 1EU8A 1MXUA 4I8CA 1PC3A 1MH3A 4U4SA 3U93A 3Q29A 1L5TA 2XXTA 5KCJA 1SD3A 4IO3A 2I3VA 2P1SA 3R7XA 2X7PA 2XXVA 1Q35A 3PPNA 4ZEKA 3E13X 4H6DA 1MDQA 4OETA 1B4HA 1IITA 1D4NA 3LSWA 1JETA 2ZYNA 1FQEA 2FNCA 1F9BA 2ZNSA 4OHNA 4LONB 2V3UA 1ZKBA 1B9JA 2ONKE 4RNSA 2IA4A 4THIA 2F7BA 5ISUA 4YB6A 1P1WA 4HS7A 1A40A 3KBRA 1B46A 1USYE 1UTBB 3F11A 2Q89A 2M8CA 4Q30B 2GRVA 3E4RA 4OFLA 4IY6A 4RXLA 2AL5A 3FJ7A 3HCQA 3RY3A 3TKDA 2ONRA 4NF5A 4YB5A 5H8HB 3GBAA 3VXBA 1M5BA 1IQ7A 2RF1A 4Q5TA 3B7DA 3PMVA 3D4GA 4KYDA 1A7LA 4RPNA 4QFOA 3HPIA 3M3LA 1B2HA 1LGBC 4LQ2A 3B6WA 3FASA 3SESA 1HSLA 1B58A 1M5EA 4H5FA 2QRYA 4HTGA 4BDMA 3OO7A 4Z0IA 2PT2A 3TTLA 4F29A 3TCHA 2Y7PA 1O64A 3MC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMX A;  1FTL A;  1B40 A;  4PET A;  1OIB A;  2F8D A;  4IO6 A;  3OEK A;  4ESX A;  3DLN A;  4ELO A;  2ALU A;  3IOV A;  1BTJ A;  1QKB A;  5HM4 B;  4PFW A;  1H3D A;  1PDA A;  3VVE A;  1OMP A;  4F18 A;  1ZU0 A;  2R9J A;  3KSJ A;  4PFT A;  1N7W A;  4R2F A;  3K01 A;  3U8Q A;  2DYX A;  2RCA A;  2AIX A;  3U72 A;  5K2X A;  3O6H A;  4YKK A;  2I3W A;  4R2B A;  3TEP A;  1H76 A;  2VP1 A;  2HCA A;  2Y84 A;  5DEX B;  1FTM A;  4P0I A;  3S9M C;  4FJP A;  3T9X B;  3TCF A;  1NNF A;  2X7Q A;  4NTL A;  5H8F A;  4G68 B;  4GLI A;  1A54 A;  2QS3 A;  1JQF A;  2QPQ A;  2DWJ A;  1R6Z A;  3FV2 A;  4P11 A;  1H45 A;  3TFL A;  4G4P A;  3VVD A;  1XT8 A;  4F2Q A;  4PQJ A;  4PFY A;  4I62 A;  3MAM A;  5HBC A;  5AA4 B;  4YKP A;  3T22 A;  1M5C A;  1FQC A;  4KYS A;  4ZEF A;  3K1P A;  3VXC A;  3UK4 A;  1BIY A;  1P1N A;  3SDF A;  1VSO A;  5I2N B;  2VD2 A;  4AB6 A;  4FIM A;  1POY 1;  5H8Q B;  2OBG A;  4JSO A;  3IR1 A;  3ODB A;  1SW2 A;  4JWY A;  2O84 X;  1MXY A;  4OYV A;  3FVO A;  3V8X B;  1DMB A;  3OMB A;  4IB2 A;  2O68 A;  1T0K A;  4GWO A;  1OLA A;  2P0S A;  4E0W A;  2F97 A;  2ZNT A;  3CG3 A;  3K6W A;  2Z8D A;  2V93 A;  3T9V A;  3S4U A;  1UTB A;  3KFM A;  1Y1Z A;  3QK6 A;  1R9Q A;  4X48 A;  4EQ7 A;  3IJX B;  2E1S A;  4FED A;  1UIV A;  2O1L A;  5JK4 A;  4FAJ A;  4ZE8 A;  1IXG A;  3UOR A;  1JW4 A;  2ONS A;  5H8H A;  3HHG A;  4MLQ A;  1D3K A;  2REG A;  3KJT A;  1XS5 A;  3EF7 A;  5AA2 B;  3FAT A;  1B32 A;  2OK2 A;  2ANJ A;  1LBC A;  1FQF A;  1IXH A;  4G2Z A;  3C34 A;  1Y4C A;  1SW4 A;  4F1U A;  4TOZ A;  1ZIU A;  4KR5 A;  2IEE A;  4YMA A;  3DP6 A;  3MPK A;  3PPP A;  3TTK A;  3OO6 A;  1Y1M A;  1N7X A;  3UIF A;  4ZZA A;  3TTM A;  2WKY A;  4BDR A;  2HZK A;  4WEP A;  3U92 A;  1Y4T A;  1MXW A;  3UN6 A;  2DXY A;  4PE5 B;  1Y9U A;  1OLC A;  1Y3P A;  4R73 A;  1MXV A;  4KD5 A;  5J1D A;  2PVU A;  4GOT A;  1A99 A;  4F3S A;  4QSC A;  4PFU A;  2VD3 A;  1A8F A;  4OEN A;  4JWO A;  4LVQ A;  3Q25 A;  1LAH E;  4WXJ A;  4QFK A;  1ZTY A;  2OJT A;  3FXQ A;  4H8J A;  3SEY A;  5A5X B;  1GR2 A;  1BLF A;  1QKA A;  4LA9 A;  3SET A;  3N94 A;  4PP0 A;  1PB8 A;  5JTY B;  5FTH A;  5ITP A;  5AA2 D;  3K2D A;  2NXO A;  4GIZ A;  3IB2 A;  2H99 A;  5I57 B;  3FJG A;  4ZED A;  5ITO A;  4EQB A;  4JXI A;  3MP1 A;  2YLN A;  1TXF A;  4ELP A;  4UAC A;  5DEX A;  2I0B A;  1AH5 A;  5CMM A;  3VLV A;  1M5D A;  2B65 A;  4G68 A;  2DE2 A;  2V25 A;  4OWD A;  1FTJ A;  5DVI A;  2VGQ A;  1M5F A;  1US5 A;  1B51 A;  3H03 A;  2NOO A;  4RK9 A;  4DIG A;  1B1H A;  4OFO A;  5CM6 A;  1P99 A;  3GZG A;  3G3J A;  5BUU A;  4R9F A;  5I59 B;  5DYH A;  2ZXT A;  3W9W A;  3TTR A;  2ZYK A;  5AA4 A;  1B7H A;  2I48 A;  3DM0 A;  4YMB A;  1LST A;  2THI A;  3KG2 A;  2HFB A;  4HCY A;  1B4Z A;  4BDL A;  1MXZ A;  2XXI A;  3FVK A;  2I58 A;  4QFP A;  4NE4 A;  2DVC A;  2DXR A;  2UYE A;  2R6G E;  4NMY A;  5I2N A;  3THI A;  2XXU A;  4U23 A;  3TQL A;  3MVW A;  1ANF A;  1HSE A;  5H8Q A;  3O97 A;  4LQ5 A;  1CE2 A;  1LAG E;  1MPC A;  3H6T A;  3G3H A;  2ABH A;  1MPB A;  3K1M A;  5KDT B;  1DPP A;  3P7I A;  3U94 A;  3O2A A;  4RY1 A;  3PPQ A;  3MJN A;  3TUS A;  1XVX A;  3LC8 A;  4IGT A;  3MP8 A;  1MY0 A;  1NNT A;  1MQG A;  1EZO A;  4ND9 A;  3QUF A;  3PUW E;  3PU5 A;  2V3T A;  3FGS A;  1EH3 A;  3OEN A;  3FVN A;  4F3B A;  4U1Z A;  1JW5 A;  2A5T B;  3RTW B;  4MH5 A;  5LOM A;  4POX A;  5L9S A;  2A5S A;  2AL4 A;  4AB5 A;  1WDN A;  3N6U A;  2G93 A;  4BDO A;  3HV1 A;  1R9L A;  3QAX A;  2DWA A;  2QS2 A;  3PGF A;  4GXS B;  3SEX A;  3OO9 A;  3VLU A;  4EUO A;  3TZA A;  5I84 A;  1IXI A;  3MZ9 A;  4OZ9 A;  3FD3 A;  5AA2 A;  1VFD A;  5AA3 A;  3IX1 A;  3KN7 A;  5CMC A;  4U1O A;  5TU0 A;  4Z7E A;  4P0G A;  1B3L A;  3WAF A;  4JB7 A;  5KZT A;  3GLB A;  3B6Q A;  1SI0 A;  4DCY A;  3CRB A;  4OFJ A;  4R6Y A;  1MS7 A;  2I0C A;  1B7Z A;  2Y7I A;  3JYR A;  3T9U A;  2O7I A;  1YCJ A;  2DP8 A;  4EXK A;  4XKP A;  5L9M A;  1ZBM A;  4ZE9 A;  4HCW A;  4I9D A;  2DWI A;  1RYX A;  2RCB A;  3IOT A;  4YAH X;  3H3G A;  1MDP 1;  5IKB A;  3K4U A;  3SKP A;  3FXU A;  4XTC Q;  5CBR A;  1SW5 A;  2QMX A;  1NL5 A;  4R75 A;  3G3K A;  3CR9 A;  1Y3Q A;  3T96 B;  2CZL A;  2XX8 A;  4XKQ A;  3Q26 A;  2ZYO A;  1VR5 A;  3H6W A;  1II5 A;  3PD8 A;  2F36 A;  4NF8 B;  1Z7N E;  4L17 A;  1B05 A;  3EQ1 A;  2F35 A;  5A5X A;  3OOA A;  3PUX E;  3O66 A;  2Z23 A;  5JTY A;  2VOZ A;  2X26 A;  4ZDM A;  5H8N B;  3KN8 A;  3E3K A;  2GH9 A;  4QSE A;  1JEU A;  3N26 A;  5I57 A;  3A3C A;  4POW A;  1JVY A;  5AE4 A;  3SER A;  4GL8 A;  5ELV A;  2QL3 A;  3MP6 A;  4GFR A;  1URD A;  4G8M A;  1DTZ A;  1B3G A;  4KQP A;  4MFI A;  2F78 A;  3K6V A;  3TAJ A;  5L8D A;  3TOD A;  4BDQ A;  1IXC A;  4LP2 B;  2DE4 A;  5I59 A;  1NMU A;  4N6P A;  1SI1 A;  4ZZE A;  3FZV A;  5DVF A;  4EXL A;  3RN8 A;  3LSX A;  4QF9 A;  2QMW A;  2PMS A;  1IZ1 A;  3VV5 A;  4HW8 A;  4O3C A;  4F3P A;  1UIU A;  2AYS A;  3VE1 B;  2I49 A;  2H98 A;  4YU0 A;  4BLA A;  1MPD A;  4LZ8 A;  1ZLQ A;  5FHN A;  4F1Y A;  4MBP A;  4U4X A;  4JDF A;  3PV0 E;  4JWX A;  2P2A A;  3H4Z A;  1WOD A;  3MZ1 A;  3N6T A;  1NNK A;  1A55 A;  3BKI B;  3IJO B;  2GHB A;  1URS A;  3KOS A;  5KDT A;  3T9H B;  2ESN A;  2UVH A;  1PBQ A;  3VVF A;  4O3A A;  1EZ9 A;  4E0X A;  2RC9 A;  3EHT A;  3G3F A;  4M1V A;  3IOU A;  5EYF A;  1I6Q A;  1MRP A;  1US4 A;  3ZSF A;  2XXW A;  1IEJ A;  4NWD A;  4Q0C A;  4ZEI A;  2A5T A;  1O63 A;  3K02 A;  3K00 A;  1AOV A;  4DXU A;  1Q1K A;  4RYA A;  3RUM A;  1MH4 A;  2H5Y A;  1GVC A;  2Q8J A;  4FEB A;  1LAX A;  3O29 A;  3RT6 B;  3ZKK A;  3KZG A;  1TWY A;  2YPN A;  1D9Y A;  1MQH A;  4H5G A;  2W7Y A;  1I6B A;  5I56 B;  1MQJ A;  3R6U A;  4IGR A;  4EF2 A;  4TQU Q;  1QUL A;  3V5A A;  4OTE A;  1BP5 A;  1WVJ A;  4FOR A;  1NH7 A;  5FHO A;  1B0L A;  3CSB A;  4ZEB A;  4ZEC A;  3HO7 A;  1B5I A;  3FV1 A;  1FQD A;  2YJP A;  3IOR A;  3BBR A;  2XXY A;  3RGY A;  3LSF B;  3RNN A;  2O69 A;  4OER A;  4F31 B;  1B7U A;  3R26 A;  2XXH A;  2XXP A;  1B1X A;  3MBP A;  3TEL A;  1NH8 A;  2GFE A;  2F5X A;  2XXR A;  2XHD A;  4U22 A;  1P1O A;  1FQA A;  3TQW A;  5ICT A;  4NF4 B;  4G8H A;  3TCG A;  4NF8 A;  5DTB A;  2D3I A;  3DEL B;  4JBZ A;  3EN3 A;  3QYT A;  2OZZ A;  3IO4 A;  4YKJ A;  3W15 C;  2LAO A;  3JZJ A;  1NFT A;  3H6V A;  5H8N A;  3S9E A;  3D4C A;  2G29 A;  4F22 A;  3O9P A;  4BDN A;  2H4I A;  4XKN A;  1RKM A;  4OEU A;  3RTF B;  1A8E A;  1GV8 A;  1DPE A;  3BFU A;  2DOJ A;  3S2V A;  1B3E A;  1QUI A;  2XD2 A;  5EHM A;  4F19 A;  4YB7 A;  5FHM A;  3K0V A;  3LSL A;  2Y7R A;  4NWC A;  4RA1 A;  1EZP A;  1SDX A;  3IB1 A;  1MM6 A;  3RT8 A;  3EPE A;  1SQY A;  2PT1 A;  4KCC A;  1RYO A;  3H06 B;  4YIC A;  3QIM A;  2Q2C A;  1DOT A;  3AXF A;  1LCT A;  1S7Y A;  1LB9 A;  3M8U A;  4OVJ A;  4DDD A;  4FE8 A;  1Z7M E;  3PPO A;  1XHY A;  4RPO A;  3N5L A;  1B3F A;  1I6A A;  1I69 A;  4GRK A;  1QVS A;  4RK2 A;  4O3B A;  3MVY A;  4DXB A;  1B3H A;  2E0S A;  4GL0 A;  2Q9T A;  2PX1 A;  4TLL B;  3U1O A;  3MUQ A;  3MPL A;  1MY1 A;  1OQH A;  3IL1 B;  3ILT B;  3H6U A;  3CIJ A;  4X1D A;  1N76 A;  5B7D A;  4K3F A;  1FW0 A;  2UXA A;  3VLW A;  1LLS A;  3KSX A;  3TMG A;  3C4M A;  3CFL A;  2D21 A;  1ZMG A;  4ELQ A;  3I5O A;  2ZMB A;  4U2R A;  2RC8 A;  2OLB A;  2UVG A;  1B5J A;  3BFT A;  5CC2 A;  3L6G A;  1XVY A;  2GHA A;  1MY2 A;  3MWB A;  3USD A;  1QJM A;  3FIR A;  4IO4 A;  1IUD A;  4IY5 A;  2UYF A;  2REJ A;  4GF8 A;  2ZYM A;  3GBB A;  4X1B A;  3ONM A;  4GQO A;  1DTG A;  4QFL A;  2F34 A;  3UP9 A;  2Z8E A;  3G3I A;  3IK6 B;  3C31 A;  4IO2 A;  5I56 A;  5FTI A;  4OMB A;  2HAU A;  4WED A;  4RJZ A;  4NED A;  3KN3 A;  3IB0 A;  5CBS A;  4XXU A;  1LFG A;  2Y7K A;  2NWJ A;  1PBP A;  3Q27 A;  1MQD A;  2Q2A A;  5I58 B;  3IOW A;  2XXQ A;  2F6G A;  2HEU A;  4DXC A;  5CMK A;  2OWS A;  3WAE A;  1P1Q A;  1Y3N A;  5TP9 B;  4ELR A;  4OEV A;  2XX7 A;  1FTO A;  1VFE A;  3C33 A;  4I1D A;  2I6E A;  3O6I A;  1P1U A;  2DVZ A;  3LUY A;  2O51 A;  4X9T A;  4NF4 A;  2RC7 A;  3S9N C;  3KJ7 A;  3MVX A;  5ICQ A;  2ZNU A;  4R74 A;  3IAZ A;  5L9O A;  2RKM A;  1BKA A;  3HN0 A;  3EHS A;  2V84 A;  1QUK A;  3OEM A;  4R9G A;  2VHA A;  1GGG A;  4GVO A;  3FUZ A;  5B70 A;  3M3F A;  4LAT A;  2XXX A;  4KFQ A;  4H65 A;  4LZ7 A;  3MW0 A;  2O6A A;  4Q8R A;  4C0R A;  4LUB A;  4DLD A;  3TPA A;  3A09 A;  3LR1 A;  4C1T A;  3GXA A;  2Z8F A;  4KCD A;  2UVJ A;  1N3X A;  3FXR A;  3RQT A;  1GTK A;  1SBP A;  5DVJ A;  5CMB A;  4F1V A;  3TYH A;  1AMF A;  3Q28 A;  3C32 A;  3O6G A;  5I2K B;  3HST A;  3OXN A;  4EQ9 A;  1YTV A;  4ECF A;  1OQG A;  4DE8 A;  1H44 A;  4N13 A;  3K1N A;  3KEI A;  1FQB A;  4NF6 B;  2DSF A;  4F3G A;  3QUJ A;  1CB6 A;  5H8S A;  4DZ1 A;  3C35 A;  2QS4 A;  2I4B A;  4GD5 A;  4OES A;  3IO6 A;  3RPW A;  2HAV A;  3V89 B;  3T93 B;  1B5H A;  3FJM A;  2HXW A;  1SYI A;  4FAT A;  1MM7 A;  3EHU A;  3LBS A;  3QXM A;  4EDP A;  4R6K A;  1N3W A;  4U21 A;  2BJJ X;  1QUJ A;  4H1X A;  3I6V A;  1S50 A;  1LB8 A;  3SEV A;  1MY3 A;  4WKM A;  1B6H A;  1UTH B;  3PD9 A;  1O7T A;  4EF1 A;  4DCX A;  1XOC A;  1KWH A;  3G3G A;  3CSG A;  1Y20 A;  5HPQ A;  1PEB A;  4F2O A;  2OCU A;  1ZJL A;  1JVX A;  3H7M A;  1B52 A;  1LAF E;  3CVG A;  5TPA B;  2Q88 A;  2FYI A;  1USY H;  1N0T A;  4ZS9 A;  4QHQ A;  3OEL A;  1SW1 A;  4OXV A;  5KCJ B;  3KOT A;  3TTN A;  4G77 A;  3W9V A;  1YPN A;  3JV9 A;  2QS1 A;  3SEW A;  1UQW A;  5I58 A;  1N04 A;  2I4C A;  3L6H A;  3VDF A;  3ZS6 A;  4KI0 E;  1URG A;  3A3U A;  2O1M A;  3ILU B;  3OSQ A;  2HZL A;  5TP9 A;  1S9T A;  3PUZ E;  3B6T A;  2KLF A;  2B3B A;  1PB7 A;  2R71 A;  3PPR A;  1SYH A;  3DP8 A;  1DSN A;  3RLF E;  2RIN A;  1LCF A;  1LFH A;  1TT1 A;  2DWH A;  1R1N A;  4R72 A;  1IIW A;  2F7A A;  3ZKL A;  3UA8 A;  4H67 A;  1ELJ A;  2F7C A;  1TFA A;  4XIG Q;  5JEI A;  5BWJ A;  2XX9 A;  1AIV A;  4MF3 A;  4KPT A;  3S9L C;  1MY4 A;  1LBB A;  1SVX B;  4H0W A;  2H25 A;  1MG1 A;  3OO8 A;  1OVT A;  3QSL A;  2NUV A;  5M2V A;  4TLM B;  4NF5 B;  4XKR A;  1LFI A;  3MQ9 A;  4ISU A;  4M4G A;  4G68 C;  4IO5 A;  4F39 A;  1B0H A;  4LZ5 A;  4KHZ E;  4ESW A;  3T66 A;  4QRZ A;  3MZB A;  4C1U A;  4UA8 A;  2DQV A;  3E9X A;  2OWT A;  4H8I A;  1JEV A;  4ONY A;  3SEU A;  3ECR A;  3VFJ A;  3O28 A;  3K6X A;  4MLV A;  4OQO A;  3OSR A;  3FVG A;  3PUV E;  1TFD A;  2NVU B;  1QW0 A;  4GXA A;  1AL3 A;  1N84 A;  3CG1 A;  5I2K A;  3PUY E;  3K6U A;  1XC1 A;  3TDJ A;  5F7V A;  2QSX A;  2QJE A;  5IAI A;  2CMO A;  3I3V A;  1HSJ A;  5K2Y A;  4IO7 A;  2F6P A;  4FEC A;  1OVB A;  2DS9 A;  4NF6 A;  5DT6 A;  3G7W A;  3V83 A;  1POT A;  3M3K A;  1J1N A;  1H43 A;  1YAE A;  3C36 A;  4R6H A;  1JW1 A;  1NNP A;  2HQ0 A;  1D9V A;  2PYY A;  3HHF A;  3UGW A;  1NKX A;  2XD3 A;  3PMW A;  5F1Q A;  1FTK A;  1ATG A;  4N07 A;  2D5W A;  2FA7 A;  5EHS A;  1JNF A;  3KGC A;  2V3Q A;  4KYE A;  1FCK A;  1VE4 A;  4QFN A;  2H9B A;  3CFZ A;  3C9H A;  2UVI A;  1MXX A;  3CI8 A;  2O7U A;  5AA1 A;  2Z22 A;  3DP4 A;  1PB9 A;  4G8N A;  4AQ4 A;  2PBW A;  5CI5 A;  5H8F B;  1UTH A;  2Y7W A;  4YZZ A;  4QSD A;  3MVZ A;  3OD7 A;  4YKI A;  2B3F A;  2DE3 A;  1MQI A;  3CFX A;  5CRY A;  4JSD A;  5TPA A;  1EU8 A;  1MXU A;  4I8C A;  1PC3 A;  1MH3 A;  4U4S A;  3U93 A;  3Q29 A;  1L5T A;  2XXT A;  5KCJ A;  1SD3 A;  4IO3 A;  2I3V A;  2P1S A;  3R7X A;  2X7P A;  2XXV A;  1Q35 A;  3PPN A;  4ZEK A;  3E13 X;  4H6D A;  1MDQ A;  4OET A;  1B4H A;  1IIT A;  1D4N A;  3LSW A;  1JET A;  2ZYN A;  1FQE A;  2FNC A;  1F9B A;  2ZNS A;  4OHN A;  4LON B;  2V3U A;  1ZKB A;  1B9J A;  2ONK E;  4RNS A;  2IA4 A;  4THI A;  2F7B A;  5ISU A;  4YB6 A;  1P1W A;  4HS7 A;  1A40 A;  3KBR A;  1B46 A;  1USY E;  1UTB B;  3F11 A;  2Q89 A;  2M8C A;  4Q30 B;  2GRV A;  3E4R A;  4OFL A;  4IY6 A;  4RXL A;  2AL5 A;  3FJ7 A;  3HCQ A;  3RY3 A;  3TKD A;  2ONR A;  4NF5 A;  4YB5 A;  5H8H B;  3GBA A;  3VXB A;  1M5B A;  1IQ7 A;  2RF1 A;  4Q5T A;  3B7D A;  3PMV A;  3D4G A;  4KYD A;  1A7L A;  4RPN A;  4QFO A;  3HPI A;  3M3L A;  1B2H A;  1LGB C;  4LQ2 A;  3B6W A;  3FAS A;  3SES A;  1HSL A;  1B58 A;  1M5E A;  4H5F A;  2QRY A;  4HTG A;  4BDM A;  3OO7 A;  4Z0I A;  2PT2 A;  3TTL A;  4F29 A;  3TCH A;  2Y7P A;  1O64 A;  3MC2 A; 
#chains in the Genus database with same CATH topology
 3PMX A;  1FTL A;  1B40 A;  4PET A;  1OIB A;  2F8D A;  4IO6 A;  3OEK A;  4ESX A;  3DLN A;  4ELO A;  2ALU A;  3IOV A;  1BTJ A;  1QKB A;  5HM4 B;  4PFW A;  1H3D A;  1PDA A;  3VVE A;  1OMP A;  1NUX A;  4F18 A;  1ZU0 A;  2R9J A;  3KSJ A;  4PFT A;  1N7W A;  1NI9 A;  4R2F A;  3K01 A;  3U8Q A;  2DYX A;  4GX3 A;  4MNI A;  2RCA A;  1FPG A;  2KR0 A;  2AIX A;  3U72 A;  5K2X A;  3O6H A;  4YKK A;  2I3W A;  4PCD A;  4R2B A;  3TEP A;  1H76 A;  2VP1 A;  2F3B A;  2HCA A;  2Y84 A;  2OX3 A;  5DEX B;  1FTM A;  4P0I A;  3S9M C;  4FJP A;  3T9X B;  3TCF A;  1NNF A;  2X7Q A;  2Y5L A;  4NTL A;  5H8F A;  4G68 B;  4GLI A;  1A54 A;  2QS3 A;  1JQF A;  2QPQ A;  5IZZ A;  2DWJ A;  1R6Z A;  2WYK A;  3FV2 A;  4P11 A;  1H45 A;  3TFL A;  4G4P A;  3VVD A;  1NV6 A;  1XT8 A;  4F2Q A;  4PQJ A;  4PFY A;  4I62 A;  3MAM A;  5HBC A;  5AA4 B;  4YKP A;  4PDD A;  3T22 A;  1M5C A;  1FQC A;  4KYS A;  4ZEF A;  3K1P A;  3VXC A;  3U65 A;  3UK4 A;  1BIY A;  1P1N A;  3SDF A;  3QMF A;  5A5L A;  1VSO A;  5I2N B;  2VD2 A;  4AB6 A;  4FIM A;  1POY 1;  5H8Q B;  2OBG A;  4JSO A;  3IR1 A;  3ODB A;  1SW2 A;  4JWY A;  3MST A;  2O84 X;  1MXY A;  4N17 A;  4OYV A;  3FVO A;  3V8X B;  1DMB A;  3OMB A;  4IB2 A;  2O68 A;  1T0K A;  4GWO A;  1OLA A;  2P0S A;  4E0W A;  2F97 A;  2ZNT A;  3CG3 A;  3K6W A;  2Z8D A;  2V93 A;  3T9V A;  3S4U A;  3LV0 A;  1UTB A;  3KFM A;  1Y1Z A;  3QK6 A;  4MNP A;  1QGX A;  1CNQ A;  1IME A;  3HFU A;  1R9Q A;  4X48 A;  4EQ7 A;  3IJX B;  4I3E A;  2E1S A;  2R8T A;  1UIV A;  2O1L A;  4FED A;  5JK4 A;  4FAJ A;  4ZE8 A;  1IXG A;  3UOR A;  1JW4 A;  2ONS A;  5H8H A;  3HHG A;  4MLQ A;  1D3K A;  2REG A;  3KJT A;  1XS5 A;  3EF7 A;  5AA2 B;  3FAT A;  1B32 A;  2OK2 A;  4NAP A;  2ANJ A;  4MJO A;  1LBC A;  1FQF A;  1IXH A;  2XWO A;  4N15 A;  4G2Z A;  3C34 A;  5EYH A;  1Y4C A;  1SW4 A;  4PDH A;  4F1U A;  4TOZ A;  1ZIU A;  2JJK A;  4KR5 A;  2IEE A;  4YMA A;  3DP6 A;  3MPK A;  2P3V A;  3PPP A;  3TTK A;  1FPE A;  3OO6 A;  1Y1M A;  1N7X A;  3UIF A;  1NV5 A;  2ZZX A;  4ZZA A;  3TTM A;  2WKY A;  3LUZ A;  4BDR A;  1EYJ A;  5J16 A;  2HZK A;  4WEP A;  3U92 A;  1Y4T A;  1MXW A;  3UN6 A;  5DW8 A;  2DXY A;  4PE5 B;  1Y9U A;  5IZ1 A;  2OWZ A;  1OLC A;  1Y3P A;  4MCO A;  4R73 A;  1MXV A;  4KD5 A;  1SPI A;  5J1D A;  4XFE A;  4MAG A;  1NUZ A;  2PVU A;  4GOT A;  1A99 A;  4P9K A;  4F3S A;  4QSC A;  4PFU A;  2VD3 A;  4N8G A;  1A8F A;  4OEN A;  4JWO A;  4LVQ A;  3Q25 A;  1LAH E;  4WXJ A;  4P8B A;  4QFK A;  1ZTY A;  2OJT A;  3FXQ A;  4H8J A;  2CZH A;  3SEY A;  5A5X B;  1GR2 A;  1BLF A;  3BIG A;  1QKA A;  4LA9 A;  3SET A;  3N94 A;  4PP0 A;  1PB8 A;  5JTY B;  5FTH A;  5ITP A;  5AA2 D;  3K2D A;  2NXO A;  4GIZ A;  3IB2 A;  2H99 A;  5I57 B;  3FJG A;  4ZED A;  5ITO A;  4EQB A;  4JXI A;  3MP1 A;  2YLN A;  1TXF A;  4ELP A;  4UAC A;  5DEX A;  2I0B A;  1AH5 A;  5CMM A;  3MYU A;  4N81 A;  3VLV A;  1M5D A;  2B65 A;  5F24 A;  4G68 A;  2DE2 A;  2V25 A;  4OWD A;  2F3D A;  4PGP A;  1FTJ A;  5DVI A;  2VGQ A;  1M5F A;  1US5 A;  1B51 A;  3H03 A;  2NOO A;  4RK9 A;  4DIG A;  1B1H A;  4OFO A;  5CM6 A;  1P99 A;  1RDX A;  3GZG A;  3G3J A;  5BUU A;  4R9F A;  5I59 B;  5DYH A;  2ZXT A;  3W9W A;  3TTR A;  2Y5K A;  2ZYK A;  5AA4 A;  1B7H A;  2I48 A;  4PE3 A;  3DM0 A;  3NOH A;  1LST A;  4YMB A;  2THI A;  5ET6 A;  3KG2 A;  2HFB A;  4HCY A;  1B4Z A;  1IMA A;  4BDL A;  1MXZ A;  4GBW A;  2XXI A;  3FVK A;  2I58 A;  4QFP A;  4NE4 A;  2DVC A;  2DXR A;  3IFC A;  2UYE A;  2R6G E;  4NMY A;  5I2N A;  4O94 A;  3THI A;  2XXU A;  4U23 A;  3TQL A;  3MVW A;  1ANF A;  1HSE A;  5H8Q A;  3O97 A;  4LQ5 A;  1CE2 A;  2CZK A;  1LAG E;  1MPC A;  3H6T A;  3G3H A;  2ABH A;  1MPB A;  3K1M A;  5KDT B;  1DPP A;  3P7I A;  3U94 A;  3O2A A;  4RY1 A;  3PPQ A;  3MJN A;  3TUS A;  1XVX A;  3LC8 A;  4IGT A;  3MP8 A;  1MY0 A;  1NNT A;  1MQG A;  1EZO A;  4ND9 A;  3QUF A;  3PUW E;  3PU5 A;  2V3T A;  2HPG A;  3FGS A;  1EH3 A;  3OEN A;  3FVN A;  4F3B A;  4N4U A;  4U1Z A;  1JW5 A;  2A5T B;  3RTW B;  1FJ9 A;  4MH5 A;  5LOM A;  4POX A;  2DDK A;  5L9S A;  2A5S A;  2AL4 A;  4AB5 A;  1FPL A;  1WDN A;  3N6U A;  2G93 A;  4BDO A;  3HV1 A;  1R9L A;  1KA1 A;  3QAX A;  2DWA A;  2QS2 A;  3PGF A;  4GXS B;  3SEX A;  3OO9 A;  3VLU A;  4GWY A;  4EUO A;  1FBD A;  3TZA A;  5I84 A;  4H45 A;  1IXI A;  2KQZ A;  4GBV A;  3MZ9 A;  4OZ9 A;  3FD3 A;  5AA2 A;  1VFD A;  5AA3 A;  3IX1 A;  3KN7 A;  5CMC A;  4U1O A;  4QXD A;  5TU0 A;  4Z7E A;  4P0G A;  1B3L A;  2WBD A;  3WAF A;  4JB7 A;  5KZT A;  3GLB A;  3B6Q A;  1SI0 A;  3KBZ A;  4DCY A;  3CRB A;  4OFJ A;  5ET5 A;  4R6Y A;  1MS7 A;  2I0C A;  1B7Z A;  2Y7I A;  3JYR A;  3T9U A;  2O7I A;  4NGU A;  5ET7 A;  1FBP A;  1YCJ A;  2DP8 A;  4EXK A;  4XKP A;  5L9M A;  1ZBM A;  4ZE9 A;  4PGN A;  4HCW A;  4I9D A;  3ISP A;  4OVT A;  2DWI A;  1RYX A;  2RCB A;  3IOT A;  4YAH X;  3H3G A;  1MDP 1;  5IKB A;  3K4U A;  3SKP A;  3FXU A;  4XTC Q;  5CBR A;  1SW5 A;  2QMX A;  1NL5 A;  4R75 A;  3G3K A;  3CR9 A;  1Y3Q A;  3T96 B;  2CZL A;  2XX8 A;  4XKQ A;  3Q26 A;  2ZYO A;  1VR5 A;  3H6W A;  1II5 A;  3PD8 A;  2F36 A;  4NF8 B;  1Z7N E;  4L17 A;  5IGA A;  1B05 A;  3EQ1 A;  2F35 A;  5A5X A;  2ZZV A;  3OOA A;  3PUX E;  3O66 A;  2Z23 A;  5JTY A;  2VOZ A;  2X26 A;  4ZDM A;  5H8N B;  3KN8 A;  3E3K A;  2GH9 A;  4QSE A;  1JEU A;  3N26 A;  5I57 A;  3A3C A;  4POW A;  1JVY A;  5AE4 A;  3SER A;  4GL8 A;  5ELV A;  2QL3 A;  4X8R A;  1G0H A;  3MP6 A;  4GFR A;  1URD A;  4G8M A;  1DTZ A;  1B3G A;  4KQP A;  4MFI A;  2F78 A;  3K6V A;  3TAJ A;  5L8D A;  3TOD A;  4OVQ A;  1IXC A;  4LP2 B;  4BDQ A;  4X04 A;  2DE4 A;  4N6K A;  1IMC A;  4OAN A;  1INP A;  5I59 A;  1NMU A;  4N6P A;  1SI1 A;  4ZZE A;  3FZV A;  5DVF A;  3LSX A;  3RN8 A;  4EXL A;  4QF9 A;  2QMW A;  2PMS A;  1FRP A;  1IZ1 A;  3VV5 A;  2XWV A;  5I3S A;  4PAK A;  5ESY A;  4HW8 A;  4O3C A;  4F3P A;  1UIU A;  2AYS A;  3VE1 B;  2I49 A;  4GWS A;  2H98 A;  4YU0 A;  4BLA A;  1MPD A;  4QBA A;  4LZ8 A;  1ZLQ A;  5FHN A;  4PAF A;  4F1Y A;  4MBP A;  4U4X A;  4JDF A;  3PV0 E;  4JWX A;  5LDZ A;  2P2A A;  3H4Z A;  1WOD A;  3MZ1 A;  2XXK A;  4JVC A;  3N6T A;  1NNK A;  1A55 A;  3BKI B;  5ET8 A;  3IJO B;  2GHB A;  1URS A;  3KOS A;  5KDT A;  1FPF A;  3T9H B;  2ESN A;  2UVH A;  1PBQ A;  4N8Y A;  3VVF A;  4O3A A;  1EZ9 A;  4E0X A;  3B50 A;  2RC9 A;  3EHT A;  3G3F A;  4M1V A;  3IOU A;  5EYF A;  2Q8M A;  1I6Q A;  1MRP A;  1US4 A;  3ZSF A;  2XXW A;  1IEJ A;  4NWD A;  4Q0C A;  1BK4 A;  4ZEI A;  2A5T A;  1O63 A;  1FJ6 A;  3K02 A;  3K00 A;  1AOV A;  1XI6 A;  2MKZ A;  5I5P A;  4DXU A;  1Q1K A;  4RYA A;  3RUM A;  1K9Y A;  1MH4 A;  2H5Y A;  1GVC A;  2Q8J A;  4FEB A;  1LAX A;  3O29 A;  3RT6 B;  3ZKK A;  3KZG A;  1TWY A;  2YPN A;  1D9Y A;  1MQH A;  1FBG A;  4H5G A;  2W7Y A;  1I6B A;  5I56 B;  4KXP A;  4PBH A;  1MQJ A;  3R6U A;  3FXB A;  4IGR A;  2FIX A;  4EF2 A;  4TQU Q;  1QUL A;  3V5A A;  4OTE A;  1BP5 A;  1WVJ A;  4XEQ A;  4FOR A;  1NH7 A;  5FHO A;  5FBP A;  1B0L A;  3CSB A;  4ZEB A;  4ZEC A;  3HO7 A;  1B5I A;  3FV1 A;  4MIJ A;  1FQD A;  2YJP A;  3IOR A;  2VPN A;  3BBR A;  2CEX A;  1NV0 A;  2XXY A;  1NV4 A;  3RGY A;  3LSF B;  2VT5 A;  3RNN A;  2O69 A;  4OER A;  4F31 B;  1B7U A;  3R26 A;  2XXH A;  2XXP A;  1B1X A;  3MBP A;  4PFI A;  3TEL A;  1NH8 A;  2GFE A;  1FSA A;  2F5X A;  2XXR A;  2XHD A;  4U22 A;  1P1O A;  1FQA A;  3TQW A;  5ICT A;  4NF4 B;  4G8H A;  3TCG A;  4NF8 A;  5DTB A;  4HE0 A;  2D3I A;  3DEL B;  4JBZ A;  3EN3 A;  4NHB A;  4MEV A;  2HHM A;  3QYT A;  2OZZ A;  3IO4 A;  4YKJ A;  3W15 C;  2LAO A;  3JZJ A;  1NFT A;  1IMF A;  3H6V A;  5H8N A;  3S9E A;  3D4C A;  2G29 A;  4F22 A;  3O9P A;  4BDN A;  2H4I A;  4XKN A;  1RKM A;  4OEU A;  1FTA A;  4OVS A;  3RTF B;  1A8E A;  1GV8 A;  1DPE A;  3BFU A;  2DOJ A;  3S2V A;  1B3E A;  1QUI A;  2XD2 A;  5EHM A;  4F19 A;  4YB7 A;  5FHM A;  3K0V A;  3LSL A;  2Y7R A;  4NWC A;  4RA1 A;  1EZP A;  4XF5 A;  1SDX A;  1VDW A;  3IB1 A;  1MM6 A;  3RT8 A;  3EPE A;  1SQY A;  2PT1 A;  4KCC A;  1RYO A;  3H06 B;  4JVD A;  4YIC A;  3QIM A;  2Q2C A;  1DOT A;  3AXF A;  1LCT A;  1S7Y A;  1LB9 A;  3M8U A;  4OVJ A;  4DDD A;  4FE8 A;  1Z7M E;  3PPO A;  2QVU A;  1XHY A;  3BIH A;  4RPO A;  3N5L A;  1B3F A;  1I6A A;  1I69 A;  4P3L A;  4GRK A;  1QVS A;  2BJI A;  4RK2 A;  4O3B A;  3MVY A;  4DXB A;  1B3H A;  2E0S A;  4GL0 A;  2Q9T A;  2PX1 A;  4TLL B;  3U1O A;  3MUQ A;  4PBQ A;  3RYD A;  3MPL A;  1MY1 A;  4GWZ A;  1OQH A;  3IL1 B;  3ILT B;  3H6U A;  3CIJ A;  4X1D A;  4AS5 A;  1N76 A;  5B7D A;  4K3F A;  1FW0 A;  2UXA A;  3VLW A;  1LLS A;  3KSX A;  3TMG A;  3C4M A;  3CFL A;  2D21 A;  1ZMG A;  4ELQ A;  3I5O A;  2ZMB A;  4U2R A;  2RC8 A;  2OLB A;  2UVG A;  2WBB A;  1DBZ A;  1B5J A;  3BFT A;  5CC2 A;  3L6G A;  1XVY A;  2GHA A;  1MY2 A;  3MWB A;  3USD A;  1QJM A;  3IFA A;  3FIR A;  4P56 A;  4IO4 A;  1IUD A;  4IY5 A;  2UYF A;  4MMP A;  2REJ A;  2L5V A;  4GF8 A;  2ZYM A;  3GBB A;  4OVP A;  4X1B A;  3ONM A;  4GQO A;  1DTG A;  4QFL A;  4HE1 A;  3EKI A;  2F34 A;  3UP9 A;  2Z8E A;  3G3I A;  3IK6 B;  3C31 A;  4IO2 A;  5I56 A;  3KC0 A;  5FTI A;  1JP4 A;  4OMB A;  2HAU A;  4WED A;  4RJZ A;  4NED A;  3KN3 A;  3IB0 A;  5CBS A;  4XXU A;  2ZZW A;  1LFG A;  3CHG A;  4MX6 A;  2Y7K A;  2NWJ A;  1PBP A;  3Q27 A;  3RPL B;  1MQD A;  2Q2A A;  5I58 B;  4NF0 A;  3IOW A;  2XXQ A;  2F6G A;  2HEU A;  4DXC A;  3E79 A;  5CMK A;  2OWS A;  3WAE A;  1P1Q A;  1Y3N A;  5TP9 B;  4ELR A;  4OEV A;  2XX7 A;  1FTO A;  1VFE A;  4PTK A;  4OVR A;  3C33 A;  4I1D A;  2I6E A;  2V4C A;  3O6I A;  2XWK A;  1P1U A;  2DVZ A;  3LUY A;  1Q9D A;  2O51 A;  1FBF A;  4X9T A;  5EYG A;  4NF4 A;  2RC7 A;  3S9N C;  3KJ7 A;  3MVX A;  5ICQ A;  2ZNU A;  4R74 A;  3IAZ A;  5L9O A;  4N91 A;  3T0J A;  2RKM A;  1BKA A;  2WEF A;  3HN0 A;  2FIE A;  3EHS A;  3FBP A;  2V84 A;  1QUK A;  3GYY A;  2B4M A;  2B4L A;  4NG7 A;  3OEM A;  4R9G A;  2VHA A;  1GGG A;  4GVO A;  3FUZ A;  5B70 A;  3M3F A;  4LAT A;  2XXX A;  4KFQ A;  4H65 A;  4LZ7 A;  4LN5 A;  3T1B A;  3A29 A;  3MW0 A;  2O6A A;  4Q8R A;  1NV7 A;  4C0R A;  4LUB A;  4DLD A;  3TPA A;  3A09 A;  3LR1 A;  4C1T A;  3GXA A;  2Z8F A;  4KCD A;  2UVJ A;  4PFB A;  1N3X A;  3FXR A;  1FBC A;  3RQT A;  1GTK A;  1AWB A;  1SBP A;  4P47 A;  5DVJ A;  1EYI A;  4JVI A;  5CMB A;  4F1V A;  3TYH A;  1AMF A;  3Q28 A;  2PCR A;  3C32 A;  3O6G A;  5I2K B;  1YXI A;  2PFZ A;  3HST A;  3OXN A;  4EQ9 A;  3ROJ A;  1YTV A;  4ECF A;  1OQG A;  4OA4 A;  4DE8 A;  1H44 A;  4N13 A;  3K1N A;  3KEI A;  1FQB A;  4NF6 B;  2DSF A;  2QFL A;  4F3G A;  3QUJ A;  1CB6 A;  5H8S A;  4DZ1 A;  3C35 A;  2QS4 A;  2I4B A;  4GD5 A;  4OES A;  3IO6 A;  3RPW A;  4DI4 B;  2HAV A;  3V89 B;  3T93 B;  1B5H A;  3FJM A;  2HXW A;  1SYI A;  4FAT A;  1MM7 A;  3EHU A;  3LBS A;  1D9Q A;  3QXM A;  4EDP A;  4NQ8 A;  4R6K A;  4O7I A;  1N3W A;  4PAI A;  4U21 A;  2BJJ X;  1LBV A;  1QUJ A;  4H1X A;  3I6V A;  1S50 A;  1FPD A;  1LB8 A;  3SEV A;  4H46 A;  4GX4 A;  1MY3 A;  4WKM A;  1B6H A;  1UTH B;  1FPI A;  3PD9 A;  1O7T A;  1FPK A;  4EF1 A;  4DCX A;  1XOC A;  1KWH A;  1NV3 A;  3G3G A;  3CSG A;  1Y20 A;  1YYZ A;  5HPQ A;  1PEB A;  4F2O A;  4GWX A;  2OCU A;  1IMB A;  1ZJL A;  1JVX A;  4NN3 A;  3H7M A;  1B52 A;  1LAF E;  3E78 A;  3CVG A;  5TPA B;  2Q88 A;  2FYI A;  1USY H;  1N0T A;  4ZS9 A;  4QHQ A;  3OEL A;  1SW1 A;  4OXV A;  1NUY A;  5KCJ B;  3KOT A;  3TTN A;  4G77 A;  2CZI A;  3W9V A;  1YPN A;  3JV9 A;  2QS1 A;  3RPL A;  3SEW A;  1UQW A;  4DI3 D;  5I58 A;  1N04 A;  2I4C A;  3L6H A;  3VDF A;  3ZS6 A;  1NUW A;  4KI0 E;  1FBH A;  1URG A;  3A3U A;  2O1M A;  3ILU B;  3OSQ A;  2HZL A;  5TP9 A;  1S9T A;  3PUZ E;  3B6T A;  5EQ9 A;  2KLF A;  2B3B A;  1PB7 A;  2R71 A;  4FBP A;  3PPR A;  1SYH A;  3DP8 A;  1DSN A;  3RLF E;  2RIN A;  1G0I A;  1LCF A;  1LFH A;  1FBE A;  1TT1 A;  2DWH A;  1R1N A;  4R72 A;  5T3J A;  1IIW A;  2F7A A;  3ZKL A;  3UA8 A;  4H67 A;  1ELJ A;  1RDZ A;  2F7C A;  1TFA A;  4XIG Q;  5JEI A;  5BWJ A;  2XX9 A;  1AIV A;  4MF3 A;  4KPT A;  3S9L C;  1MY4 A;  1LBB A;  1SVX B;  4H0W A;  2H25 A;  1MG1 A;  4HXV A;  3OO8 A;  1OVT A;  1NV2 A;  3QSL A;  2NUV A;  5M2V A;  3KC1 A;  4TLM B;  4NF5 B;  4XKR A;  1LFI A;  3MQ9 A;  4ISU A;  4M4G A;  4G68 C;  4IO5 A;  4F39 A;  2HXR A;  1B0H A;  4LZ5 A;  5I7I A;  4KHZ E;  4ESW A;  1FPB A;  3T66 A;  4N6D A;  1FPJ A;  4QRZ A;  3PTY A;  3MZB A;  4MNC A;  4C1U A;  4UA8 A;  2DQV A;  3E9X A;  2OWT A;  4H8I A;  1JEV A;  4ONY A;  3SEU A;  3ECR A;  3VFJ A;  3O28 A;  3K6X A;  3SZP A;  4MLV A;  4OQO A;  2FBP A;  5IZ3 B;  3OSR A;  3FVG A;  1LEV A;  3PUV E;  1TFD A;  2NVU B;  1QW0 A;  4GXA A;  4IR8 A;  1AL3 A;  1N84 A;  3CG1 A;  5I2K A;  3PUY E;  3K6U A;  1XC1 A;  3TDJ A;  5F7V A;  2QSX A;  5EQA A;  2QJE A;  5IAI A;  2CMO A;  4GWU A;  3I3V A;  1HSJ A;  5K2Y A;  4IO7 A;  2F6P A;  1KZ8 A;  4FEC A;  4GWW A;  4NF6 A;  1OVB A;  2DS9 A;  5DT6 A;  1KA0 A;  3G7W A;  3V83 A;  1POT A;  3M3K A;  1J1N A;  1H43 A;  1YAE A;  2QVR A;  3C36 A;  4R6H A;  1JW1 A;  1NNP A;  2PFY A;  2HQ0 A;  1D9V A;  2PYY A;  4MHF A;  3HHF A;  3UGW A;  1NKX A;  2XD3 A;  3PMW A;  5F1Q A;  2WYP A;  1FTK A;  4PC9 A;  1ATG A;  4N07 A;  4O7M A;  2D5W A;  2FA7 A;  5EHS A;  1JNF A;  3KGC A;  2V3Q A;  4KYE A;  1FCK A;  1VE4 A;  4QFN A;  2WX9 A;  2H9B A;  1LBX A;  2XWI A;  4PF8 A;  3CFZ A;  3C9H A;  2UVI A;  1MXX A;  3CI8 A;  2O7U A;  5AA1 A;  2Z22 A;  3DP4 A;  1PB9 A;  4G8N A;  4AQ4 A;  2PBW A;  5CI5 A;  5H8F B;  1UTH A;  2Y7W A;  4YZZ A;  4QSD A;  3MVZ A;  3OD7 A;  4YKI A;  4PFR A;  2B3F A;  2DE3 A;  1MQI A;  3B8B A;  3CFX A;  5CRY A;  4JSD A;  5TPA A;  1EU8 A;  1MXU A;  4I8C A;  1PC3 A;  1K9Z A;  1MH3 A;  4U4S A;  3U93 A;  4PF6 A;  3Q29 A;  1L5T A;  2XXT A;  2CEY A;  5KCJ A;  1SD3 A;  1EYK A;  4IO3 A;  2I3V A;  1RDY A;  2P1S A;  3R7X A;  2X7P A;  2XXV A;  1Q35 A;  3PPN A;  4ZEK A;  3E13 X;  4H6D A;  5EQ7 A;  4AS4 A;  1IMD A;  1MDQ A;  4OET A;  3D1R A;  1B4H A;  1IIT A;  1D4N A;  1LBW A;  3LSW A;  1JET A;  4HE2 A;  2ZYN A;  1FQE A;  1DCU A;  2FNC A;  1F9B A;  2ZNS A;  4UAB A;  4OHN A;  1LBY A;  4LON B;  2QVV A;  2V3U A;  1ZKB A;  1B9J A;  2ONK E;  4RNS A;  2IA4 A;  4THI A;  2F7B A;  5ISU A;  4YB6 A;  1P1W A;  4HS7 A;  1A40 A;  2FHY A;  3KBR A;  1B46 A;  1YZ0 A;  5LTC A;  2GQ1 A;  1USY E;  1UTB B;  3F11 A;  2Q89 A;  2M8C A;  4Q30 B;  2GRV A;  3E4R A;  4OFL A;  4IY6 A;  4GX6 A;  4RXL A;  2P3N A;  2AL5 A;  3FJ7 A;  3HCQ A;  3RY3 A;  3TKD A;  4I3Y A;  2ONR A;  4NF5 A;  4YB5 A;  5H8H B;  2XA5 A;  3GBA A;  1DK4 A;  3VXB A;  1M5B A;  2FVZ A;  1IQ7 A;  2RF1 A;  4Q5T A;  3B7D A;  3PMV A;  4RPN A;  2VPO A;  1A7L A;  3D4G A;  4KYD A;  4NX1 A;  4QFO A;  4G61 A;  3HPI A;  3M3L A;  1B2H A;  1LGB C;  4LQ2 A;  3B6W A;  3FAS A;  4I40 A;  3SES A;  5IM2 A;  1LBZ A;  1HSL A;  1B58 A;  1M5E A;  4H5F A;  2QRY A;  4HTG A;  5IZ3 A;  4BDM A;  3OO7 A;  4P1L A;  1NV1 A;  4Z0I A;  2PT2 A;  2Q74 A;  3TTL A;  4O8M A;  5EQ8 A;  4F29 A;  3TCH A;  2Y7P A;  4P1E A;  1O64 A;  3MC2 A; 
#chains in the Genus database with same CATH homology
 3PMX A;  1FTL A;  1B40 A;  4PET A;  1OIB A;  2F8D A;  4IO6 A;  3OEK A;  4ESX A;  3DLN A;  4ELO A;  2ALU A;  3IOV A;  1BTJ A;  1QKB A;  5HM4 B;  4PFW A;  1H3D A;  1PDA A;  3VVE A;  1OMP A;  4F18 A;  1ZU0 A;  2R9J A;  3KSJ A;  4PFT A;  1N7W A;  4R2F A;  3K01 A;  3U8Q A;  2DYX A;  2RCA A;  2AIX A;  3U72 A;  5K2X A;  3O6H A;  4YKK A;  2I3W A;  4R2B A;  3TEP A;  1H76 A;  2VP1 A;  2HCA A;  2Y84 A;  5DEX B;  1FTM A;  4P0I A;  3S9M C;  4FJP A;  3T9X B;  3TCF A;  1NNF A;  2X7Q A;  4NTL A;  5H8F A;  4G68 B;  4GLI A;  1A54 A;  2QS3 A;  1JQF A;  2QPQ A;  2DWJ A;  1R6Z A;  3FV2 A;  4P11 A;  1H45 A;  3TFL A;  4G4P A;  3VVD A;  1XT8 A;  4F2Q A;  4PQJ A;  4PFY A;  4I62 A;  3MAM A;  5HBC A;  5AA4 B;  4YKP A;  3T22 A;  1M5C A;  1FQC A;  4KYS A;  4ZEF A;  3K1P A;  3VXC A;  3UK4 A;  1BIY A;  1P1N A;  3SDF A;  1VSO A;  5I2N B;  2VD2 A;  4AB6 A;  4FIM A;  1POY 1;  5H8Q B;  2OBG A;  4JSO A;  3IR1 A;  3ODB A;  1SW2 A;  4JWY A;  2O84 X;  1MXY A;  4OYV A;  3FVO A;  3V8X B;  1DMB A;  3OMB A;  4IB2 A;  2O68 A;  1T0K A;  4GWO A;  1OLA A;  2P0S A;  4E0W A;  2F97 A;  2ZNT A;  3CG3 A;  3K6W A;  2Z8D A;  2V93 A;  3T9V A;  3S4U A;  1UTB A;  3KFM A;  1Y1Z A;  3QK6 A;  1R9Q A;  4X48 A;  4EQ7 A;  3IJX B;  2E1S A;  4FED A;  1UIV A;  2O1L A;  5JK4 A;  4FAJ A;  4ZE8 A;  1IXG A;  3UOR A;  1JW4 A;  2ONS A;  5H8H A;  3HHG A;  4MLQ A;  1D3K A;  2REG A;  3KJT A;  1XS5 A;  3EF7 A;  5AA2 B;  3FAT A;  1B32 A;  2OK2 A;  2ANJ A;  1LBC A;  1FQF A;  1IXH A;  4G2Z A;  3C34 A;  1Y4C A;  1SW4 A;  4F1U A;  4TOZ A;  1ZIU A;  4KR5 A;  2IEE A;  4YMA A;  3DP6 A;  3MPK A;  3PPP A;  3TTK A;  3OO6 A;  1Y1M A;  1N7X A;  3UIF A;  4ZZA A;  3TTM A;  2WKY A;  4BDR A;  2HZK A;  4WEP A;  3U92 A;  1Y4T A;  1MXW A;  3UN6 A;  2DXY A;  4PE5 B;  1Y9U A;  1OLC A;  1Y3P A;  4R73 A;  1MXV A;  4KD5 A;  5J1D A;  2PVU A;  4GOT A;  1A99 A;  4F3S A;  4QSC A;  4PFU A;  2VD3 A;  1A8F A;  4OEN A;  4JWO A;  4LVQ A;  3Q25 A;  1LAH E;  4WXJ A;  4QFK A;  1ZTY A;  2OJT A;  3FXQ A;  4H8J A;  3SEY A;  5A5X B;  1GR2 A;  1BLF A;  1QKA A;  4LA9 A;  3SET A;  3N94 A;  4PP0 A;  1PB8 A;  5JTY B;  5FTH A;  5ITP A;  5AA2 D;  3K2D A;  2NXO A;  4GIZ A;  3IB2 A;  2H99 A;  5I57 B;  3FJG A;  4ZED A;  5ITO A;  4EQB A;  4JXI A;  3MP1 A;  2YLN A;  1TXF A;  4ELP A;  4UAC A;  5DEX A;  2I0B A;  1AH5 A;  5CMM A;  3VLV A;  1M5D A;  2B65 A;  4G68 A;  2DE2 A;  2V25 A;  4OWD A;  1FTJ A;  5DVI A;  2VGQ A;  1M5F A;  1US5 A;  1B51 A;  3H03 A;  2NOO A;  4RK9 A;  4DIG A;  1B1H A;  4OFO A;  5CM6 A;  1P99 A;  3GZG A;  3G3J A;  5BUU A;  4R9F A;  5I59 B;  5DYH A;  2ZXT A;  3W9W A;  3TTR A;  2ZYK A;  5AA4 A;  1B7H A;  2I48 A;  3DM0 A;  4YMB A;  1LST A;  2THI A;  3KG2 A;  2HFB A;  4HCY A;  1B4Z A;  4BDL A;  1MXZ A;  2XXI A;  3FVK A;  2I58 A;  4QFP A;  4NE4 A;  2DVC A;  2DXR A;  2UYE A;  2R6G E;  4NMY A;  5I2N A;  3THI A;  2XXU A;  4U23 A;  3TQL A;  3MVW A;  1ANF A;  1HSE A;  5H8Q A;  3O97 A;  4LQ5 A;  1CE2 A;  1LAG E;  1MPC A;  3H6T A;  3G3H A;  2ABH A;  1MPB A;  3K1M A;  5KDT B;  1DPP A;  3P7I A;  3U94 A;  3O2A A;  4RY1 A;  3PPQ A;  3MJN A;  3TUS A;  1XVX A;  3LC8 A;  4IGT A;  3MP8 A;  1MY0 A;  1NNT A;  1MQG A;  1EZO A;  4ND9 A;  3QUF A;  3PUW E;  3PU5 A;  2V3T A;  3FGS A;  1EH3 A;  3OEN A;  3FVN A;  4F3B A;  4U1Z A;  1JW5 A;  2A5T B;  3RTW B;  4MH5 A;  5LOM A;  4POX A;  5L9S A;  2A5S A;  2AL4 A;  4AB5 A;  1WDN A;  3N6U A;  2G93 A;  4BDO A;  3HV1 A;  1R9L A;  3QAX A;  2DWA A;  2QS2 A;  3PGF A;  4GXS B;  3SEX A;  3OO9 A;  3VLU A;  4EUO A;  3TZA A;  5I84 A;  1IXI A;  3MZ9 A;  4OZ9 A;  3FD3 A;  5AA2 A;  1VFD A;  5AA3 A;  3IX1 A;  3KN7 A;  5CMC A;  4U1O A;  5TU0 A;  4Z7E A;  4P0G A;  1B3L A;  3WAF A;  4JB7 A;  5KZT A;  3GLB A;  3B6Q A;  1SI0 A;  4DCY A;  3CRB A;  4OFJ A;  4R6Y A;  1MS7 A;  2I0C A;  1B7Z A;  2Y7I A;  3JYR A;  3T9U A;  2O7I A;  1YCJ A;  2DP8 A;  4EXK A;  4XKP A;  5L9M A;  1ZBM A;  4ZE9 A;  4HCW A;  4I9D A;  2DWI A;  1RYX A;  2RCB A;  3IOT A;  4YAH X;  3H3G A;  1MDP 1;  5IKB A;  3K4U A;  3SKP A;  3FXU A;  4XTC Q;  5CBR A;  1SW5 A;  2QMX A;  1NL5 A;  4R75 A;  3G3K A;  3CR9 A;  1Y3Q A;  3T96 B;  2CZL A;  2XX8 A;  4XKQ A;  3Q26 A;  2ZYO A;  1VR5 A;  3H6W A;  1II5 A;  3PD8 A;  2F36 A;  4NF8 B;  1Z7N E;  4L17 A;  1B05 A;  3EQ1 A;  2F35 A;  5A5X A;  3OOA A;  3PUX E;  3O66 A;  2Z23 A;  5JTY A;  2VOZ A;  2X26 A;  4ZDM A;  5H8N B;  3KN8 A;  3E3K A;  2GH9 A;  4QSE A;  1JEU A;  3N26 A;  5I57 A;  3A3C A;  4POW A;  1JVY A;  5AE4 A;  3SER A;  4GL8 A;  5ELV A;  2QL3 A;  3MP6 A;  4GFR A;  1URD A;  4G8M A;  1DTZ A;  1B3G A;  4KQP A;  4MFI A;  2F78 A;  3K6V A;  3TAJ A;  5L8D A;  3TOD A;  4BDQ A;  1IXC A;  4LP2 B;  2DE4 A;  5I59 A;  1NMU A;  4N6P A;  1SI1 A;  4ZZE A;  3FZV A;  5DVF A;  4EXL A;  3RN8 A;  3LSX A;  4QF9 A;  2QMW A;  2PMS A;  1IZ1 A;  3VV5 A;  4HW8 A;  4O3C A;  4F3P A;  1UIU A;  2AYS A;  3VE1 B;  2I49 A;  2H98 A;  4YU0 A;  4BLA A;  1MPD A;  4LZ8 A;  1ZLQ A;  5FHN A;  4F1Y A;  4MBP A;  4U4X A;  4JDF A;  3PV0 E;  4JWX A;  2P2A A;  3H4Z A;  1WOD A;  3MZ1 A;  3N6T A;  1NNK A;  1A55 A;  3BKI B;  3IJO B;  2GHB A;  1URS A;  3KOS A;  5KDT A;  3T9H B;  2ESN A;  2UVH A;  1PBQ A;  3VVF A;  4O3A A;  1EZ9 A;  4E0X A;  2RC9 A;  3EHT A;  3G3F A;  4M1V A;  3IOU A;  5EYF A;  1I6Q A;  1MRP A;  1US4 A;  3ZSF A;  2XXW A;  1IEJ A;  4NWD A;  4Q0C A;  4ZEI A;  2A5T A;  1O63 A;  3K02 A;  3K00 A;  1AOV A;  4DXU A;  1Q1K A;  4RYA A;  3RUM A;  1MH4 A;  2H5Y A;  1GVC A;  2Q8J A;  4FEB A;  1LAX A;  3O29 A;  3RT6 B;  3ZKK A;  3KZG A;  1TWY A;  2YPN A;  1D9Y A;  1MQH A;  4H5G A;  2W7Y A;  1I6B A;  5I56 B;  1MQJ A;  3R6U A;  4IGR A;  4EF2 A;  4TQU Q;  1QUL A;  3V5A A;  4OTE A;  1BP5 A;  1WVJ A;  4FOR A;  1NH7 A;  5FHO A;  1B0L A;  3CSB A;  4ZEB A;  4ZEC A;  3HO7 A;  1B5I A;  3FV1 A;  1FQD A;  2YJP A;  3IOR A;  3BBR A;  2XXY A;  3RGY A;  3LSF B;  3RNN A;  2O69 A;  4OER A;  4F31 B;  1B7U A;  3R26 A;  2XXH A;  2XXP A;  1B1X A;  3MBP A;  3TEL A;  1NH8 A;  2GFE A;  2F5X A;  2XXR A;  2XHD A;  4U22 A;  1P1O A;  1FQA A;  3TQW A;  5ICT A;  4NF4 B;  4G8H A;  3TCG A;  4NF8 A;  5DTB A;  2D3I A;  3DEL B;  4JBZ A;  3EN3 A;  3QYT A;  2OZZ A;  3IO4 A;  4YKJ A;  3W15 C;  2LAO A;  3JZJ A;  1NFT A;  3H6V A;  5H8N A;  3S9E A;  3D4C A;  2G29 A;  4F22 A;  3O9P A;  4BDN A;  2H4I A;  4XKN A;  1RKM A;  4OEU A;  3RTF B;  1A8E A;  1GV8 A;  1DPE A;  3BFU A;  2DOJ A;  3S2V A;  1B3E A;  1QUI A;  2XD2 A;  5EHM A;  4F19 A;  4YB7 A;  5FHM A;  3K0V A;  3LSL A;  2Y7R A;  4NWC A;  4RA1 A;  1EZP A;  1SDX A;  3IB1 A;  1MM6 A;  3RT8 A;  3EPE A;  1SQY A;  2PT1 A;  4KCC A;  1RYO A;  3H06 B;  4YIC A;  3QIM A;  2Q2C A;  1DOT A;  3AXF A;  1LCT A;  1S7Y A;  1LB9 A;  3M8U A;  4OVJ A;  4DDD A;  4FE8 A;  1Z7M E;  3PPO A;  1XHY A;  4RPO A;  3N5L A;  1B3F A;  1I6A A;  1I69 A;  4GRK A;  1QVS A;  4RK2 A;  4O3B A;  3MVY A;  4DXB A;  1B3H A;  2E0S A;  4GL0 A;  2Q9T A;  2PX1 A;  4TLL B;  3U1O A;  3MUQ A;  3MPL A;  1MY1 A;  1OQH A;  3IL1 B;  3ILT B;  3H6U A;  3CIJ A;  4X1D A;  1N76 A;  5B7D A;  4K3F A;  1FW0 A;  2UXA A;  3VLW A;  1LLS A;  3KSX A;  3TMG A;  3C4M A;  3CFL A;  2D21 A;  1ZMG A;  4ELQ A;  3I5O A;  2ZMB A;  4U2R A;  2RC8 A;  2OLB A;  2UVG A;  1B5J A;  3BFT A;  5CC2 A;  3L6G A;  1XVY A;  2GHA A;  1MY2 A;  3MWB A;  3USD A;  1QJM A;  3FIR A;  4IO4 A;  1IUD A;  4IY5 A;  2UYF A;  2REJ A;  4GF8 A;  2ZYM A;  3GBB A;  4X1B A;  3ONM A;  4GQO A;  1DTG A;  4QFL A;  2F34 A;  3UP9 A;  2Z8E A;  3G3I A;  3IK6 B;  3C31 A;  4IO2 A;  5I56 A;  5FTI A;  4OMB A;  2HAU A;  4WED A;  4RJZ A;  4NED A;  3KN3 A;  3IB0 A;  5CBS A;  4XXU A;  1LFG A;  2Y7K A;  2NWJ A;  1PBP A;  3Q27 A;  1MQD A;  2Q2A A;  5I58 B;  3IOW A;  2XXQ A;  2F6G A;  2HEU A;  4DXC A;  5CMK A;  2OWS A;  3WAE A;  1P1Q A;  1Y3N A;  5TP9 B;  4ELR A;  4OEV A;  2XX7 A;  1FTO A;  1VFE A;  3C33 A;  4I1D A;  2I6E A;  3O6I A;  1P1U A;  2DVZ A;  3LUY A;  2O51 A;  4X9T A;  4NF4 A;  2RC7 A;  3S9N C;  3KJ7 A;  3MVX A;  5ICQ A;  2ZNU A;  4R74 A;  3IAZ A;  5L9O A;  2RKM A;  1BKA A;  3HN0 A;  3EHS A;  2V84 A;  1QUK A;  3OEM A;  4R9G A;  2VHA A;  1GGG A;  4GVO A;  3FUZ A;  5B70 A;  3M3F A;  4LAT A;  2XXX A;  4KFQ A;  4H65 A;  4LZ7 A;  3MW0 A;  2O6A A;  4Q8R A;  4C0R A;  4LUB A;  4DLD A;  3TPA A;  3A09 A;  3LR1 A;  4C1T A;  3GXA A;  2Z8F A;  4KCD A;  2UVJ A;  1N3X A;  3FXR A;  3RQT A;  1GTK A;  1SBP A;  5DVJ A;  5CMB A;  4F1V A;  3TYH A;  1AMF A;  3Q28 A;  3C32 A;  3O6G A;  5I2K B;  3HST A;  3OXN A;  4EQ9 A;  1YTV A;  4ECF A;  1OQG A;  4DE8 A;  1H44 A;  4N13 A;  3K1N A;  3KEI A;  1FQB A;  4NF6 B;  2DSF A;  4F3G A;  3QUJ A;  1CB6 A;  5H8S A;  4DZ1 A;  3C35 A;  2QS4 A;  2I4B A;  4GD5 A;  4OES A;  3IO6 A;  3RPW A;  2HAV A;  3V89 B;  3T93 B;  1B5H A;  3FJM A;  2HXW A;  1SYI A;  4FAT A;  1MM7 A;  3EHU A;  3LBS A;  3QXM A;  4EDP A;  4R6K A;  1N3W A;  4U21 A;  2BJJ X;  1QUJ A;  4H1X A;  3I6V A;  1S50 A;  1LB8 A;  3SEV A;  1MY3 A;  4WKM A;  1B6H A;  1UTH B;  3PD9 A;  1O7T A;  4EF1 A;  4DCX A;  1XOC A;  1KWH A;  3G3G A;  3CSG A;  1Y20 A;  5HPQ A;  1PEB A;  4F2O A;  2OCU A;  1ZJL A;  1JVX A;  3H7M A;  1B52 A;  1LAF E;  3CVG A;  5TPA B;  2Q88 A;  2FYI A;  1USY H;  1N0T A;  4ZS9 A;  4QHQ A;  3OEL A;  1SW1 A;  4OXV A;  5KCJ B;  3KOT A;  3TTN A;  4G77 A;  3W9V A;  1YPN A;  3JV9 A;  2QS1 A;  3SEW A;  1UQW A;  5I58 A;  1N04 A;  2I4C A;  3L6H A;  3VDF A;  3ZS6 A;  4KI0 E;  1URG A;  3A3U A;  2O1M A;  3ILU B;  3OSQ A;  2HZL A;  5TP9 A;  1S9T A;  3PUZ E;  3B6T A;  2KLF A;  2B3B A;  1PB7 A;  2R71 A;  3PPR A;  1SYH A;  3DP8 A;  1DSN A;  3RLF E;  2RIN A;  1LCF A;  1LFH A;  1TT1 A;  2DWH A;  1R1N A;  4R72 A;  1IIW A;  2F7A A;  3ZKL A;  3UA8 A;  4H67 A;  1ELJ A;  2F7C A;  1TFA A;  4XIG Q;  5JEI A;  5BWJ A;  2XX9 A;  1AIV A;  4MF3 A;  4KPT A;  3S9L C;  1MY4 A;  1LBB A;  1SVX B;  4H0W A;  2H25 A;  1MG1 A;  3OO8 A;  1OVT A;  3QSL A;  2NUV A;  5M2V A;  4TLM B;  4NF5 B;  4XKR A;  1LFI A;  3MQ9 A;  4ISU A;  4M4G A;  4G68 C;  4IO5 A;  4F39 A;  1B0H A;  4LZ5 A;  4KHZ E;  4ESW A;  3T66 A;  4QRZ A;  3MZB A;  4C1U A;  4UA8 A;  2DQV A;  3E9X A;  2OWT A;  4H8I A;  1JEV A;  4ONY A;  3SEU A;  3ECR A;  3VFJ A;  3O28 A;  3K6X A;  4MLV A;  4OQO A;  3OSR A;  3FVG A;  3PUV E;  1TFD A;  2NVU B;  1QW0 A;  4GXA A;  1AL3 A;  1N84 A;  3CG1 A;  5I2K A;  3PUY E;  3K6U A;  1XC1 A;  3TDJ A;  5F7V A;  2QSX A;  2QJE A;  5IAI A;  2CMO A;  3I3V A;  1HSJ A;  5K2Y A;  4IO7 A;  2F6P A;  4FEC A;  1OVB A;  2DS9 A;  4NF6 A;  5DT6 A;  3G7W A;  3V83 A;  1POT A;  3M3K A;  1J1N A;  1H43 A;  1YAE A;  3C36 A;  4R6H A;  1JW1 A;  1NNP A;  2HQ0 A;  1D9V A;  2PYY A;  3HHF A;  3UGW A;  1NKX A;  2XD3 A;  3PMW A;  5F1Q A;  1FTK A;  1ATG A;  4N07 A;  2D5W A;  2FA7 A;  5EHS A;  1JNF A;  3KGC A;  2V3Q A;  4KYE A;  1FCK A;  1VE4 A;  4QFN A;  2H9B A;  3CFZ A;  3C9H A;  2UVI A;  1MXX A;  3CI8 A;  2O7U A;  5AA1 A;  2Z22 A;  3DP4 A;  1PB9 A;  4G8N A;  4AQ4 A;  2PBW A;  5CI5 A;  5H8F B;  1UTH A;  2Y7W A;  4YZZ A;  4QSD A;  3MVZ A;  3OD7 A;  4YKI A;  2B3F A;  2DE3 A;  1MQI A;  3CFX A;  5CRY A;  4JSD A;  5TPA A;  1EU8 A;  1MXU A;  4I8C A;  1PC3 A;  1MH3 A;  4U4S A;  3U93 A;  3Q29 A;  1L5T A;  2XXT A;  5KCJ A;  1SD3 A;  4IO3 A;  2I3V A;  2P1S A;  3R7X A;  2X7P A;  2XXV A;  1Q35 A;  3PPN A;  4ZEK A;  3E13 X;  4H6D A;  1MDQ A;  4OET A;  1B4H A;  1IIT A;  1D4N A;  3LSW A;  1JET A;  2ZYN A;  1FQE A;  2FNC A;  1F9B A;  2ZNS A;  4OHN A;  4LON B;  2V3U A;  1ZKB A;  1B9J A;  2ONK E;  4RNS A;  2IA4 A;  4THI A;  2F7B A;  5ISU A;  4YB6 A;  1P1W A;  4HS7 A;  1A40 A;  3KBR A;  1B46 A;  1USY E;  1UTB B;  3F11 A;  2Q89 A;  2M8C A;  4Q30 B;  2GRV A;  3E4R A;  4OFL A;  4IY6 A;  4RXL A;  2AL5 A;  3FJ7 A;  3HCQ A;  3RY3 A;  3TKD A;  2ONR A;  4NF5 A;  4YB5 A;  5H8H B;  3GBA A;  3VXB A;  1M5B A;  1IQ7 A;  2RF1 A;  4Q5T A;  3B7D A;  3PMV A;  3D4G A;  4KYD A;  1A7L A;  4RPN A;  4QFO A;  3HPI A;  3M3L A;  1B2H A;  1LGB C;  4LQ2 A;  3B6W A;  3FAS A;  3SES A;  1HSL A;  1B58 A;  1M5E A;  4H5F A;  2QRY A;  4HTG A;  4BDM A;  3OO7 A;  4Z0I A;  2PT2 A;  3TTL A;  4F29 A;  3TCH A;  2Y7P A;  1O64 A;  3MC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...