1QUJA

Phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRAGGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphate transport
total genus 106
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1995-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qujA02
3PMVA 2E1SA 3FUZA 4F2OA 3HV1A 2H25A 2KLFA 1MY3A 3UGWA 2XXWA 3K1NA 5TU0A 3OD7A 3MZBA 4U21A 4NF5A 1B1XA 3W9VA 3U93A 1NNPA 2UVHA 1EU8A 3U94A 2Z22A 3TCHA 4G77A 2LAOA 5JTYB 5CMMA 3UA8A 3EN3A 4EQ7A 1B5HA 1MPCA 1SW4A 3IOUA 2Z8DA 5L8DA 3C33A 1LLSA 1OMPA 3SESA 4ZE9A 3OEMA 1XVXA 3DELB 2XX7A 3CFXA 1H76A 3G3JA 2YPNA 4YKJA 2VP1A 1D4NA 5B7DA 5DEXB 1XVYA 4ISUA 4NTLA 4R9FA 4ELRA 1EZOA 1SYHA 3PPOA 3LSXA 1A99A 3PPPA 3RUMA 1F9BA 4NE4A 1FTMA 5KZTA 1D9VA 5AA2D 3PMXA 4OZ9A 3FXRA 5ITOA 3C9HA 5H8FA 4DXCA 2XD3A 2XXYA 3I3VA 5ISUA 2M8CA 3VLWA 1P1OA 3EHUA 3UORA 1M5CA 1NKXA 1P1NA 3U8QA 1B5JA 2FA7A 4RXLA 3M3FA 3RPWA 1A7LA 5H8QB 3PUVE 1FQCA 1SDXA 5AE4A 3CVGA 4IO5A 4R9GA 5KDTB 1CB6A 3QUJA 4QFPA 1ELJA 1UIUA 4MH5A 5DVFA 1R6ZA 2PX1A 4OFLA 1M5EA 4ELPA 1AH5A 4HCWA 4OFOA 4QFLA 1Y3QA 2XXRA 3N5LA 1CE2A 4YAHX 2DE3A 4G8HA 5KCJA 3FGSA 4XKQA 3TYHA 4QSCA 3IL1B 4JWYA 4WEDA 1N04A 4FECA 1N76A 2OK2A 1JNFA 4GOTA 3TKDA 3MPKA 5CBRA 3MW0A 4X48A 4GXSB 4HS7A 1MXVA 2GH9A 2UVIA 1QUJA 2V25A 3ZKKA 5EHMA 2I4CA 1POY1 3ONMA 3EHTA 1MH3A 4U4SA 4YKKA 3ZS6A 3TELA 3MP6A 3H3GA 4R6YA 4OENA 1H43A 3FVKA 3O97A 2Y7PA 1HSEA 3F11A 3FASA 4YKPA 2WKYA 3PPNA 4H65A 3CIJA 5CMKA 1XOCA 3KBRA 4POXA 2OLBA 3K4UA 2VGQA 3FD3A 4I62A 4F39A 1LGBC 3H4ZA 3LBSA 5CC2A 3IJOB 5I59A 2OCUA 2F36A 4QFNA 1SI0A 3T96B 3RN8A 2VD3A 4R74A 3SEWA 3DP8A 4F19A 1M5DA 1R1NA 4OEVA 3PGFA 4YKIA 4G2ZA 4U1ZA 2UXAA 1FQDA 3IORA 1OVTA 1SW5A 2ZXTA 3IO4A 4X1BA 4F3GA 2QS3A 4P11A 3K02A 3M3KA 1FCKA 1AOVA 3N6TA 4RYAA 4Z0IA 1PB8A 3OENA 4FORA 2DQVA 4IY6A 2HAVA 1Y3PA 4U22A 1EZ9A 4ND9A 3HN0A 1S9TA 1B4HA 2RF1A 3EQ1A 4FAJA 4YMAA 5AA2A 3N6UA 3T66A 3TUSA 5I2KB 3R26A 3GXAA 4MBPA 1ZKBA 4UA8A 4M4GA 3U1OA 4F31B 5AA4B 2D3IA 2OWTA 1IXCA 1B3FA 4EQ9A 2ZYKA 3G3IA 4IGTA 3LSLA 5TPAB 1LAHE 2UVJA 2I58A 1VR5A 4DDDA 2HQ0A 3BBRA 3KZGA 4G68A 4JDFA 2RC9A 5TP9B 4NEDA 4XKPA 2DP8A 3IB2A 3VXBA 1N84A 4EF1A 1B2HA 4LVQA 1SBPA 4Q5TA 2AIXA 2G93A 4LATA 1MY0A 1FTKA 4NF6A 1VE4A 2H98A 2OJTA 4I9DA 1FQEA 4GVOA 2IEEA 1MG1A 3SERA 3N26A 4X1DA 4H67A 3RQTA 2DE2A 4KQPA 2HXWA 2DVZA 3S9EA 4QF9A 4N6PA 4DXUA 3LR1A 3PD9A 3IAZA 1UTHB 1Y3NA 1DTGA 2OBGA 1O64A 3SDFA 2OZZA 5I57B 5M2VA 3TEPA 5FTHA 3KSXA 2NVUB 3CSGA 2Q8JA 1ANFA 4OMBA 3VLVA 5JTYA 4GXAA 4BDRA 4YB6A 3S9MC 1MM6A 2HFBA 3CFZA 2XX8A 4F3PA 3KJ7A 1I69A 1NL5A 2Y7RA 4KD5A 3O28A 2XD2A 3OXNA 1B4ZA 3JZJA 4FJPA 4H6DA 3UN6A 2YLNA 4LQ5A 4THIA 4KYEA 4UACA 2V3QA 1I6AA 3MVYA 1QKAA 3TCGA 1B0LA 3C32A 1LSTA 3O66A 4HTGA 4EQBA 5CBSA 2QL3A 5BUUA 1JW4A 3K01A 2P0SA 4U2RA 4F3BA 5K2YA 3VVDA 3SETA 4R75A 3H7MA 3C36A 3OEKA 4NF8B 3TPAA 4OQOA 3IB0A 5IKBA 2O51A 1TWYA 3O9PA 1IEJA 4KR5A 4H5FA 3ILUB 2PMSA 3B6WA 3W15C 4LP2B 1WDNA 1J1NA 1B0HA 1MPDA 4RA1A 3FJ7A 2Q2AA 1O63A 3S9NC 3IR1A 2H5YA 2F97A 3FXQA 3H06B 2Y84A 3MZ9A 4ZECA 3IX1A 4OERA 1DPPA 3PMWA 4LZ7A 4OWDA 5KDTA 1OQHA 4F29A 2HAUA 4MFIA 1MY2A 1VFDA 1FW0A 4DCXA 3IK6B 4IB2A 3K6UA 3HHFA 3FATA 4YU0A 2UVGA 4XXUA 2O84X 1M5FA 1QKBA 4PQJA 2REGA 3FZVA 1Y4TA 2P1SA 2XXTA 3ODBA 3VFJA 3RGYA 1B5IA 1RYOA 3VDFA 1LCFA 1N0TA 5LOMA 1L5TA 1AMFA 3MVZA 2R6GE 3PUZE 4PFYA 1MPBA 3N94A 4QSEA 4GRKA 5I56A 2DWJA 2I0CA 1IZ1A 1URSA 3V89B 2QS1A 3TFLA 1IXHA 1ZJLA 3OMBA 3C35A 3BFTA 4M1VA 5CI5A 1RKMA 2XXPA 2GHAA 3TODA 4H8IA 2FNCA 2FYIA 1ZTYA 4O3CA 4H5GA 1TT1A 4BLAA 3WAFA 2F7BA 3Q28A 2QS2A 1LFGA 1P1UA 1BIYA 2F6GA 3OOAA 4JWOA 4AB5A 4JSOA 3KN8A 4BDOA 2RINA 2Z8EA 2D21A 2PT1A 4YICA 1USYH 3PD8A 2NWJA 5AA3A 3K1PA 4IO7A 1Q1KA 1GR2A 3MPLA 4E0XA 3MZ1A 4LUBA 3PPQA 4ZEDA 3B6QA 1ZLQA 1EH3A 4R2BA 5ICQA 2AYSA 1USYE 3K6WA 3IOTA 3EF7A 3QIMA 2O7UA 4BDNA 1QUIA 2RKMA 2O68A 3Q25A 1IUDA 3A09A 1A8EA 1MQIA 3O6HA 4HCYA 4YB5A 3MBPA 1R9LA 1SI1A 4NWDA 1PB9A 5HPQA 3KOTA 3TTMA 3THIA 4YMBA 2PT2A 2Y7KA 1US4A 4G4PA 1B3EA 3IO6A 5FHMA 1OLAA 3VLUA 2XXUA 1N3WA 1ZMGA 3MVWA 2XXVA 5F7VA 5I2KA 5I2NB 1KWHA 3PUXE 4FEBA 1MDP1 3TAJA 3DP6A 2UYEA 3RTWB 4H8JA 3K00A 1S7YA 5AA4A 4X9TA 3FVNA 5TPAA 3DLNA 1A8FA 1MXXA 1SYIA 2CMOA 3H6VA 3G3HA 2O69A 4G8MA 3A3UA 3QAXA 1YTVA 2DOJA 3U72A 1MDQA 1OQGA 4QSDA 2PBWA 3OO8A 3UIFA 3OO7A 3TTRA 4H0WA 4NF4A 4IO3A 1MXUA 4L17A 2DS9A 5J1DA 4IO2A 2DXRA 1OVBA 3RTFB 4JB7A 1JW5A 4LQ2A 1BP5A 4QFOA 4GQOA 2QSXA 3KN3A 3TTNA 4GLIA 2A5TA 1NFTA 4F1VA 5HBCA 4KCDA 3QXMA 4GWOA 1B52A 2Z23A 1SD3A 1GTKA 5H8NB 4AB6A 4ESXA 1NNKA 2CZLA 1LFHA 2Z8FA 5JEIA 4YB7A 2RCBA 3GBAA 4AQ4A 5KCJB 3DP4A 4I1DA 1YCJA 4PE5B 3PV0E 1UTBA 4HW8A 3ZSFA 3VXCA 1VFEA 1YPNA 1MXZA 1B7ZA 3V5AA 3O2AA 5A5XA 3M8UA 3SEUA 1MXYA 2VD2A 3TZAA 1QJMA 4F18A 1P99A 1UQWA 3OO6A 3OSRA 3HCQA 4JBZA 4DLDA 1PC3A 3QSLA 2UYFA 5I58A 4U1OA 3RT6B 1Z7ME 3K6XA 4EXKA 5BWJA 3PUYE 3Q27A 3CSBA 1MQJA 4XIGQ 1BKAA 3TCFA 5K2XA 3LUYA 3E4RA 4RY1A 4DIGA 1P1QA 2P2AA 2HCAA 3FIRA 1Y1ZA 3FV2A 1A55A 4GD5A 1PB7A 2I3WA 1LAXA 1LAGE 1TFAA 1B58A 1LBBA 1B51A 4JXIA 1Z7NE 1US5A 5DYHA 1PBQA 3PU5A 5I59B 1O7TA 3K6VA 2DVCA 4FE8A 2RC8A 4OFJA 2NOOA 3VV5A 4ZDMA 4FATA 3IOWA 1SVXB 2V84A 4TLLB 1SQYA 1OIBA 2ZNUA 2XXXA 4TOZA 4BDQA 2I4BA 3JV9A 3HPIA 2QS4A 5L9OA 4C1UA 4WKMA 3Q26A 1URDA 2REJA 3QUFA 4PFUA 5DVJA 3U92A 2PVUA 4G8NA 5DT6A 3VVEA 3SEXA 3E13X 4PP0A 1ZIUA 3T9VA 3L6GA 1T0KA 1OLCA 5DEXA 3RT8A 2B3FA 1PEBA 2DYXA 2XXIA 2DWAA 2ABHA 2E0SA 2D5WA 3D4CA 1B32A 5CMCA 3KN7A 2ZMBA 1TXFA 4G68B 2BJJX 1FTJA 4WXJA 1MQGA 3ZKLA 1IQ7A 1MY1A 2AL4A 1PBPA 4EXLA 2Q9TA 4R72A 3R6UA 2ZNTA 4R6HA 3T93B 4RK2A 4R2FA 3R7XA 4OTEA 5H8QA 1R9QA 2F8DA 3KGCA 4KYSA 5H8HB 3SEYA 3KEIA 4OVJA 4BDMA 2OWSA 4IY5A 3W9WA 3O6IA 4LZ8A 1QW0A 1SW2A 1QUKA 4I8CA 3KG2A 4KFQA 1NMUA 2Q88A 3MQ9A 4ZE8A 1B6HA 3QK6A 1LCTA 3A3CA 3V83A 3I6VA 4F22A 2ZNSA 3TDJA 2XXHA 2PYYA 1JEVA 3PUWE 2ZYMA 1LB9A 4GF8A 1B7HA 1IXIA 4ZZAA 1SW1A 4JSDA 2ANJA 5L9MA 4DZ1A 1LFIA 4DE8A 3RNNA 4EF2A 1JW1A 2DE4A 1II5A 5ICTA 1URGA 2QPQA 2V3TA 3GLBA 1MH4A 3UK4A 2DWHA 4QRZA 2GHBA 2I0BA 2R71A 5I2NA 4OXVA 1DSNA 3SKPA 3S9LC 3O6GA 3S2VA 3RLFE 2F7CA 3FJGA 3UP9A 4BDLA 3IJXB 4RPOA 4ESWA 2Y7WA 5IAIA 3L6HA 3I5OA 5FHNA 2F7AA 2RCAA 4GIZA 4ZZEA 2X7QA 4C0RA 5I84A 1B40A 1B3GA 3MP8A 2ZYOA 1A40A 1B05A 1D9YA 3FJMA 2O6AA 4GL8A 1N3XA 1P1WA 2ALUA 3C31A 2Q2CA 1B7UA 3HO7A 3G7WA 4XTCQ 1GGGA 4LA9A 2R9JA 1H45A 2HZLA 1DOTA 5EYFA 4NF5B 1MS7A 1XT8A 4RJZA 4WEPA 3RY3A 4R73A 4ECFA 5H8NA 1DTZA 2I6EA 3CRBA 4NWCA 3MJNA 3Q29A 1BTJA 3MAMA 3MC2A 1LAFE 5CRYA 4U23A 5DVIA 2ONKE 1ATGA 3B6TA 2Y7IA 2H99A 2VOZA 3H03A 2O1LA 3T9XB 3DM0A 4P0IA 5ELVA 3FVOA 3K0VA 2XXQA 3MVXA 2NUVA 4GL0A 4ELQA 5I56B 4PFWA 4Q30B 2RC7A 4XKRA 1I6QA 3CG1A 2XX9A 4OETA 1QVSA 1B46A 3C34A 4OYVA 4G68C 5TP9A 2ESNA 5ITPA 4IGRA 3OELA 3EPEA 4OEUA 1N7WA 4DXBA 2DSFA 5H8FB 1H44A 2F78A 3G3FA 2F6PA 4LONB 4MLQA 4EUOA 3TTLA 1JVYA 1IIWA 4O3AA 2ZYNA 1NNFA 4TLMB 3H6UA 3K2DA 3BKIB 3QYTA 2QJEA 5DTBA 1Q35A 1JQFA 3M3LA 4TQUQ 3T9UA 1JETA 3H6TA 3CR9A 1BLFA 1DMBA 1MQHA 1B1HA 2H4IA 2ONSA 1FTOA 3TQLA 2I3VA 4QFKA 2A5SA 5AA1A 1WVJA 4ZEBA 1ZBMA 4ELOA 4QHQA 5FHOA 1UTHA 2I48A 4H1XA 5I57A 4RK9A 3MWBA 1NH7A 4JWXA 4NMYA 4F2QA 3G3GA 4FEDA 1POTA 1N7XA 1Y1MA 1JEUA 4XKNA 1PDAA 4Q0CA 3CG3A 3HSTA 1AL3A 3PPRA 3GZGA 3S4UA 2GFEA 1MXWA 4ZEFA 4FIMA 3ILTB 3P7IA 1GV8A 3FV1A 1MRPA 2GRVA 3KJTA 4RNSA 3GBBA 3AXFA 3JYRA 2W7YA 1XC1A 1LB8A 4GFRA 4N07A 3IB1A 3VVFA 4POWA 4U4XA 3MP1A 1IITA 3LSWA 4ONYA 1B9JA 1AIVA 3V8XB 4R6KA 4YZZA 4RPNA 3E9XA 4OHNA 4IO4A 1WODA 4C1TA 1JVXA 2F34A 5EHSA 4KCCA 1Y4CA 4NF8A 1FQBA 3D4GA 1HSJA 3KOSA 4NF4B 4LZ5A 4KPTA 1I6BA 4Q8RA 5HM4B 1Y9UA 1LBCA 5CMBA 2YJPA 2B65A 4ZEKA 2V93A 2DXYA 2QRYA 2XHDA 1MQDA 3B7DA 5F1QA 1XHYA 4OESA 2O7IA 1HSLA 1VSOA 4KHZE 1RYXA 5H8HA 1NH8A 3TTKA 4F1UA 1UIVA 5JK4A 2A5TB 2NXOA 3H6WA 3T22A 1M5BA 3KFMA 3TQWA 1A54A 3ECRA 4P0GA 1MM7A 1NNTA 3O29A 3K1MA 2X7PA 1Y20A 1B3LA 2F5XA 2O1MA 3C4MA 4F3SA 5L9SA 3BFUA 1UTBB 1ZU0A 1B3HA 4KYDA 1FQAA 5AA2B 1MY4A 1FTLA 5A5XB 1QULA 4O3BA 2X26A 4KI0E 3TMGA 2VHAA 2H9BA 1FQFA 4K3FA 3OSQA 4E0WA 3USDA 4MF3A 3G3KA 3MUQA 1S50A 3T9HB 1D3KA 3KSJA 4PFTA 1GVCA 2HZKA 5FTIA 1XS5A 3EHSA 4Z7EA 3OO9A 5I58B 1EZPA 3IOVA 1IXGA 3FXUA 2G29A 4N13A 3VE1B 4IO6A 2AL5A 5H8SA 2HEUA 2QMWA 2F35A 3WAEA 4NF6B 1H3DA 2IA4A 3LC8A 4DCYA 3CI8A 2B3BA 3LSFB 1DPEA 4ZS9A 4EDPA 2THIA 2I49A 3FVGA 2V3UA 3E3KA 2QMXA 4MLVA 3SEVA 2DWIA 5B70A 1TFDA 4PETA 2ONRA 3HHGA 2Q89A 3CFLA 1YAEA 5CM6A 4F1YA 4ZEIA
chains in the Genus database with same CATH superfamily
3PMVA 2E1SA 3FUZA 5ET6A 4F2OA 3HV1A 2H25A 2KLFA 1MY3A 3UGWA 2XXWA 4P1EA 3K1NA 5TU0A 3OD7A 3MZBA 4U21A 4NF5A 1B1XA 3W9VA 3U93A 1NNPA 2UVHA 1EU8A 1QGXA 3U94A 2Z22A 3TCHA 4G77A 2LAOA 5JTYB 5CMMA 3UA8A 3EN3A 4EQ7A 1B5HA 1MPCA 3PTYA 1SW4A 3IOUA 2Z8DA 5L8DA 2V4CA 1EYIA 3C33A 1LLSA 1OMPA 3SESA 1NUWA 4ZE9A 3OEMA 1XVXA 3DELB 2XX7A 3CFXA 1H76A 3G3JA 2YPNA 4YKJA 4P56A 2VP1A 1D4NA 1NV2A 5B7DA 5DEXB 1XVYA 4ISUA 4NTLA 4R9FA 4ELRA 1EZOA 1SYHA 3PPOA 3LSXA 1A99A 3PPPA 3RUMA 1F9BA 4NE4A 4JVIA 1G0IA 1FTMA 5IZ1A 5LTCA 5KZTA 3A29A 1D9VA 5AA2D 3PMXA 4OZ9A 3FXRA 5ITOA 4PFIA 3C9HA 5H8FA 3RPLA 4DXCA 2XD3A 1SPIA 5IGAA 2XXYA 3I3VA 5ISUA 2M8CA 3VLWA 1P1OA 3EHUA 3UORA 1M5CA 3FBPA 1NKXA 1P1NA 3U8QA 1B5JA 2FA7A 4RXLA 3M3FA 3RPWA 1A7LA 5H8QB 3PUVE 4NGUA 1FQCA 5IZZA 1SDXA 1FJ9A 5AE4A 3CVGA 4IO5A 4R9GA 1NV1A 5KDTB 1CB6A 3QUJA 4QFPA 1ELJA 1UIUA 4MH5A 4PGNA 4QBAA 5DVFA 1R6ZA 2PX1A 4OFLA 1M5EA 4ELPA 1AH5A 1NV0A 4HCWA 4OFOA 4QFLA 2PFZA 1Y3QA 2XXRA 3N5LA 1CE2A 4YAHX 2DE3A 4G8HA 5KCJA 3FGSA 4XKQA 4GWWA 3TYHA 4QSCA 3IL1B 1IMAA 4JWYA 2FBPA 4WEDA 1N04A 1LBYA 4FECA 1N76A 2OK2A 1JNFA 4GOTA 4MEVA 3TKDA 3MPKA 5CBRA 3MW0A 1JP4A 4X48A 4GXSB 2ZZXA 4HS7A 1MXVA 2GH9A 2UVIA 4GX3A 1QUJA 2V25A 3ZKKA 5EHMA 2I4CA 4PTKA 2XWKA 1POY1 1EYJA 3ONMA 1FPEA 3EHTA 1MH3A 4U4SA 4YKKA 3ZS6A 3TELA 3MP6A 4GBVA 3H3GA 4R6YA 4OENA 1YYZA 4XF5A 1H43A 3FVKA 3O97A 3SZPA 2Y7PA 1HSEA 3F11A 3FASA 4YKPA 2WKYA 3PPNA 4H65A 3CIJA 3T0JA 5CMKA 1XOCA 3KBRA 4POXA 2OLBA 3K4UA 2VGQA 3FD3A 4I62A 4F39A 1LGBC 5EYGA 3H4ZA 3LBSA 5CC2A 3IJOB 5I59A 5EYHA 2OCUA 2F36A 4QFNA 1SI0A 3T96B 3RN8A 2VD3A 4R74A 3SEWA 3DP8A 4F19A 1M5DA 1R1NA 4OEVA 3PGFA 4YKIA 4G2ZA 4U1ZA 2UXAA 1FQDA 3KBZA 3IORA 3B8BA 1OVTA 5IZ3A 1SW5A 2ZXTA 3IO4A 4X1BA 4F3GA 2QS3A 4P11A 3K02A 3M3KA 1FCKA 1AOVA 3N6TA 4RYAA 4Z0IA 1PB8A 3OENA 4FORA 2DQVA 4IY6A 2HAVA 1Y3PA 4U22A 1EZ9A 4ND9A 1IMDA 3HN0A 1S9TA 1B4HA 2RF1A 3EQ1A 4FAJA 4YMAA 5AA2A 4HE2A 3N6UA 1NV7A 3T66A 3TUSA 4KXPA 5I2KB 2MKZA 3R26A 3GXAA 4MBPA 1ZKBA 4UA8A 4M4GA 3U1OA 4F31B 5AA4B 2D3IA 2OWTA 1IXCA 1B3FA 4EQ9A 2ZYKA 3G3IA 4IGTA 3LSLA 5TPAB 1LAHE 2UVJA 2I58A 1VR5A 4DDDA 1FPDA 2HQ0A 3BBRA 3KZGA 4G68A 4JDFA 4PFRA 2RC9A 5TP9B 5EQAA 4NEDA 4O7MA 4XKPA 2DP8A 4P3LA 3IB2A 4XEQA 3VXBA 1N84A 4NHBA 1NUYA 1FJ6A 4EF1A 1B2HA 4LVQA 4O8MA 1SBPA 4Q5TA 2AIXA 2G93A 4GX4A 4LATA 4DI4B 1MY0A 1FTKA 4NF6A 2CZHA 1VE4A 2H98A 2OJTA 4I9DA 1FQEA 4GVOA 4PDHA 2IEEA 1MG1A 3SERA 3MYUA 3N26A 2WX9A 4X1DA 4H67A 5EQ7A 5EQ8A 1FPIA 3RQTA 5EQ9A 2DE2A 4G61A 4KQPA 2QVVA 2HXWA 2DVZA 1FBDA 3S9EA 1IMEA 4QF9A 4PAIA 4N6PA 4DXUA 3LR1A 3PD9A 1FBEA 1RDXA 3IAZA 1UTHB 1Y3NA 1IMFA 1DTGA 2HPGA 1O64A 2OBGA 3SDFA 2OZZA 5I57B 1D9QA 5M2VA 3TEPA 5FTHA 3KSXA 4H45A 2NVUB 4PBHA 3CSGA 2Q8JA 1ANFA 4OMBA 3VLVA 5JTYA 4GXAA 4BDRA 4YB6A 3S9MC 1MM6A 2HFBA 3CFZA 2XX8A 4F3PA 3KJ7A 1I69A 1KZ8A 4P8BA 1LBVA 1NL5A 2HHMA 2Y7RA 3O28A 4KD5A 2XD2A 4N91A 3OXNA 1B4ZA 3JZJA 4FJPA 4H6DA 3UN6A 1BK4A 2YLNA 4LQ5A 4THIA 4KYEA 4UACA 2V3QA 1I6AA 3MVYA 1QKAA 3TCGA 1B0LA 3C32A 1LSTA 4LN5A 3O66A 4HTGA 4EQBA 5CBSA 2QL3A 5BUUA 1JW4A 3K01A 2P0SA 4U2RA 4F3BA 5K2YA 3VVDA 3SETA 4R75A 3H7MA 1RDZA 5LDZA 3C36A 3OEKA 4NF8B 3TPAA 4OQOA 3IB0A 5IKBA 2O51A 5J16A 1TWYA 2XA5A 3O9PA 1IEJA 4KR5A 4H5FA 3ILUB 2PMSA 3B6WA 3W15C 4LP2B 1WDNA 1J1NA 1B0HA 1MPDA 4RA1A 3FJ7A 2Q2AA 1O63A 3S9NC 3IR1A 2H5YA 2F97A 3FXQA 1KA1A 3H06B 2Y84A 3MZ9A 4ZECA 3IX1A 4OERA 1DPPA 1IMCA 3PMWA 4LZ7A 4MNPA 4OWDA 3D1RA 5KDTA 1OQHA 4OVSA 4F29A 2HAUA 4PC9A 4MFIA 1MY2A 1AWBA 1VFDA 4PAFA 1FW0A 5T3JA 4DCXA 3IK6B 4IB2A 3K6UA 3HHFA 4HE0A 3FATA 4YU0A 2UVGA 4XXUA 2O84X 1M5FA 1QKBA 4GX6A 4PQJA 2REGA 3FZVA 1Y4TA 1EYKA 2P1SA 2XXTA 3ODBA 3VFJA 3RGYA 1B5IA 1RYOA 3VDFA 1LCFA 4I3EA 1N0TA 5LOMA 1L5TA 1AMFA 1FTAA 3MVZA 2R6GE 3PUZE 4PFYA 1MPBA 3N94A 2XWIA 4QSEA 2WYKA 4GRKA 5I56A 2DWJA 2I0CA 1IZ1A 1URSA 4OVTA 3V89B 2QS1A 3TFLA 1IXHA 1ZJLA 3OMBA 3C35A 3BFTA 4M1VA 2DDKA 5CI5A 1RKMA 2XXPA 2GHAA 3TODA 4H8IA 2FNCA 4PCDA 2FYIA 1ZTYA 4O3CA 4H5GA 1TT1A 4BLAA 3WAFA 2F7BA 3Q28A 2QS2A 1LFGA 1P1UA 1BIYA 2F6GA 3OOAA 4JWOA 4AB5A 4JSOA 1FBCA 3KN8A 4BDOA 1NV4A 2RINA 2Z8EA 4NN3A 2D21A 2PT1A 4YICA 1FBGA 1USYH 3PD8A 4P47A 2NWJA 1CNQA 1FBFA 5AA3A 3K1PA 4IO7A 1Q1KA 1GR2A 3MPLA 4N6KA 4E0XA 3MZ1A 4MJOA 4LUBA 3PPQA 4ZEDA 3B6QA 1ZLQA 1EH3A 3E78A 4R2BA 1YZ0A 5ICQA 4P9KA 2AYSA 1USYE 3K6WA 3IOTA 3EF7A 3QIMA 2O7UA 4BDNA 1QUIA 2RKMA 2O68A 3Q25A 1IUDA 3A09A 4OANA 1A8EA 1MQIA 3O6HA 4NX1A 4HCYA 4YB5A 3MBPA 1R9LA 1SI1A 4NWDA 1PB9A 5HPQA 3KOTA 4DI3D 3TTMA 3THIA 4YMBA 2PT2A 2Y7KA 1US4A 4G4PA 1B3EA 3IO6A 4MNIA 5FHMA 1NI9A 1OLAA 4O7IA 1G0HA 3VLUA 1DBZA 2XXUA 1N3WA 1ZMGA 3MVWA 2XXVA 2F3DA 5F7VA 5I2KA 5I2NB 1KWHA 3PUXE 4FEBA 1MDP1 3TAJA 3DP6A 5I7IA 2UYEA 3RTWB 4H8JA 3K00A 1S7YA 5AA4A 4X9TA 3FVNA 4HXVA 5TPAA 3DLNA 1A8FA 1MXXA 1SYIA 2CMOA 3H6VA 3G3HA 2O69A 4G8MA 3A3UA 3QAXA 1YTVA 2DOJA 3U72A 1MDQA 5ET7A 1OQGA 4QSDA 2PBWA 3OO8A 3UIFA 3OO7A 3TTRA 4H0WA 4PE3A 4NF4A 4IO3A 1MXUA 2L5VA 4NG7A 2VT5A 4L17A 2DS9A 2JJKA 5J1DA 4IO2A 2DXRA 1OVBA 3RTFB 4JB7A 3RYDA 1FPBA 1JW5A 4LQ2A 1BP5A 4QFOA 4GQOA 5A5LA 2QSXA 3KN3A 3TTNA 4IR8A 4GLIA 2A5TA 1NFTA 4F1VA 5HBCA 4KCDA 1FPGA 4NAPA 3QXMA 2FHYA 4AS5A 4GWOA 3IFAA 1B52A 2Z23A 1SD3A 1GTKA 5H8NB 4AB6A 4MMPA 4ESXA 1NNKA 2CZLA 1LFHA 2Z8FA 5JEIA 4GBWA 4YB7A 2RCBA 3GBAA 3ISPA 4AQ4A 5KCJB 3DP4A 3BIGA 4I1DA 1YCJA 4PE5B 3PV0E 4PGPA 1UTBA 4HW8A 3ZSFA 3VXCA 1VFEA 1YPNA 3KC1A 1LBZA 1MXZA 1B7ZA 3V5AA 2FIEA 1LBWA 3O2AA 4FBPA 2Q8MA 5A5XA 3M8UA 3SEUA 2KQZA 1MXYA 2VD2A 2F3BA 3TZAA 1QJMA 4F18A 2QVRA 1P99A 1UQWA 3OO6A 4NQ8A 4JVCA 3OSRA 4MX6A 3HCQA 4JBZA 4DLDA 1PC3A 3QSLA 2UYFA 5I58A 2Q74A 2OWZA 4U1OA 3RT6B 1Z7ME 3K6XA 4EXKA 5BWJA 3PUYE 3Q27A 3CSBA 1MQJA 4XIGQ 1BKAA 3TCFA 5K2XA 5ET5A 3LUYA 3E4RA 4RY1A 4DIGA 1P1QA 2P2AA 2HCAA 3FIRA 1Y1ZA 3BIHA 3FV2A 1A55A 4GD5A 1PB7A 2I3WA 1LAXA 1LAGE 1TFAA 1B58A 1LBBA 1B51A 4JXIA 1Z7NE 1US5A 5DYHA 1LBXA 1PBQA 3PU5A 2P3VA 4UABA 2WEFA 5I59B 1O7TA 4I3YA 4N4UA 3K6VA 2DVCA 2QFLA 2PFYA 4FE8A 2RC8A 4OFJA 4GWXA 2NOOA 3VV5A 4ZDMA 4FATA 3IOWA 1SVXB 2V84A 4OVRA 4TLLB 1SQYA 2P3NA 2CEXA 1OIBA 1FRPA 2ZNUA 2XXXA 5IZ3B 4TOZA 4BDQA 2I4BA 3JV9A 3HPIA 2QS4A 5L9OA 2Y5KA 1FPKA 4C1UA 4WKMA 3Q26A 3QMFA 1URDA 3GYYA 2REJA 1DK4A 3QUFA 4PFUA 5DVJA 4MIJA 3U92A 2PVUA 4G8NA 5DT6A 3VVEA 3SEXA 3E13X 4PP0A 1ZIUA 3T9VA 3L6GA 1T0KA 1OLCA 5DEXA 3RT8A 2B3FA 1PEBA 2DYXA 2XXIA 2DWAA 2ABHA 2E0SA 2D5WA 3D4CA 1B32A 5CMCA 3KN7A 2ZMBA 1XI6A 1TXFA 4G68B 2BJJX 2FVZA 1FTJA 4WXJA 1MQGA 3ZKLA 1IQ7A 1MY1A 5IM2A 2AL4A 1PBPA 4N15A 4EXLA 1NV3A 2Q9TA 4R72A 3R6UA 2ZNTA 4R6HA 4OVQA 3T93B 4RK2A 1FPFA 4R2FA 4OTEA 5H8QA 3R7XA 1Q9DA 1R9QA 2F8DA 3KGCA 4KYSA 1FPLA 5H8HB 3SEYA 3KEIA 4OVJA 4BDMA 2OWSA 4IY5A 3W9WA 3O6IA 4LZ8A 1QW0A 1SW2A 1QUKA 4I8CA 3KG2A 4KFQA 1NMUA 2Q88A 3MQ9A 4ZE8A 1B6HA 3QK6A 1LCTA 3A3CA 3V83A 3I6VA 4F22A 2ZNSA 3TDJA 2XXHA 2PYYA 1JEVA 3PUWE 2ZYMA 2XWVA 1LB9A 4GF8A 1B7HA 1IXIA 5ESYA 4ZZAA 2B4LA 1SW1A 4JSDA 2ANJA 5L9MA 2QVUA 4DZ1A 4N6DA 1LFIA 4DE8A 3RNNA 4EF2A 1JW1A 2DE4A 1II5A 5ICTA 1URGA 2QPQA 2V3TA 3GLBA 4N8GA 2R8TA 3E79A 1MH4A 3UK4A 3CHGA 1NUZA 2DWHA 2OX3A 4QRZA 2GHBA 2I0BA 2R71A 5I2NA 4OXVA 1DSNA 3SKPA 3S9LC 3O6GA 3S2VA 3RLFE 2F7CA 1RDYA 1FSAA 3FJGA 3UP9A 4BDLA 3IJXB 4RPOA 4ESWA 2Y7WA 5IAIA 3L6HA 3I5OA 5FHNA 2F7AA 2RCAA 4GIZA 4ZZEA 2X7QA 4C0RA 5I84A 1B40A 1B3GA 2VPNA 3MP8A 2ZYOA 1A40A 1B05A 1K9YA 1D9YA 3FJMA 2O6AA 2WYPA 4GL8A 4MHFA 1N3XA 1P1WA 2ALUA 3C31A 2Q2CA 1YXIA 5I5PA 1B7UA 3HO7A 3G7WA 4XTCQ 1GGGA 4LA9A 2R9JA 1H45A 2HZLA 1DOTA 2VPOA 5EYFA 4NF5B 4PAKA 4QXDA 1MS7A 1XT8A 4RJZA 4WEPA 3RY3A 4R73A 4ECFA 5H8NA 1DTZA 2FIXA 2I6EA 3CRBA 4NWCA 3MJNA 3Q29A 1BTJA 3MAMA 3MC2A 1LAFE 5CRYA 2B4MA 4U23A 5DVIA 2ONKE 1ATGA 3B6TA 2Y7IA 2H99A 2VOZA 3H03A 2O1LA 4GWZA 3T9XB 4AS4A 1VDWA 3DM0A 4P0IA 5ELVA 3FVOA 3K0VA 2XXQA 3MVXA 2NUVA 3LUZA 4GL0A 4ELQA 5I56B 4PFWA 5FBPA 1NV6A 2RC7A 4Q30B 4XKRA 1I6QA 3CG1A 2XX9A 2WBBA 3IFCA 4OETA 1QVSA 1B46A 3C34A 4OYVA 4G68C 5TP9A 2ESNA 5ITPA 4IGRA 3OELA 3EPEA 3NOHA 4OEUA 1N7WA 2CEYA 4DXBA 2DSFA 2HXRA 5H8FB 3RPLB 4PDDA 1H44A 3EKIA 4MNCA 2F78A 3G3FA 2F6PA 4LONB 4MLQA 4EUOA 3TTLA 1JVYA 1IIWA 5ET8A 4O3AA 2ZYNA 1NNFA 4TLMB 3H6UA 3K2DA 3BKIB 3B50A 3QYTA 2QJEA 5DTBA 1Q35A 1JQFA 3ROJA 4OVPA 3M3LA 4TQUQ 3T9UA 1JETA 3H6TA 3CR9A 1BLFA 1DMBA 1NUXA 1MQHA 1B1HA 2H4IA 2ONSA 1FTOA 3TQLA 2I3VA 4QFKA 2A5SA 5AA1A 1WVJA 4ZEBA 1ZBMA 4ELOA 4QHQA 5FHOA 1UTHA 1INPA 2I48A 4H1XA 5I57A 3MSTA 4RK9A 3MWBA 1NH7A 4JWXA 4NMYA 4F2QA 4X8RA 4GWUA 3G3GA 4FEDA 1POTA 4O94A 1N7XA 4N81A 1Y1MA 1JEUA 4XKNA 1PDAA 4Q0CA 3CG3A 3HSTA 3FXBA 1FPJA 1AL3A 3PPRA 3GZGA 3S4UA 2GFEA 2Y5LA 1MXWA 4ZEFA 4FIMA 3ILTB 3P7IA 1GV8A 3FV1A 1MRPA 2GRVA 3KJTA 4RNSA 4N17A 3GBBA 3AXFA 3JYRA 2W7YA 1XC1A 1LB8A 4GFRA 4I40A 4N07A 3IB1A 5DW8A 3VVFA 4POWA 4U4XA 3MP1A 1IITA 3LSWA 4ONYA 1B9JA 4PFBA 1AIVA 3V8XB 4R6KA 4YZZA 4RPNA 3E9XA 4OHNA 4IO4A 1WODA 4P1LA 4C1TA 1JVXA 2F34A 5EHSA 4KCCA 5I3SA 3U65A 1Y4CA 1NV5A 4NF8A 1FQBA 3D4GA 1HSJA 4PF8A 3KOSA 4NF4B 4LZ5A 4KPTA 1I6BA 4Q8RA 5HM4B 1Y9UA 1LBCA 5CMBA 2YJPA 3HFUA 2B65A 4ZEKA 2V93A 2KR0A 2DXYA 2QRYA 2XHDA 1MQDA 3B7DA 5F1QA 4MCOA 1XHYA 4OESA 2O7IA 4KHZE 1HSLA 1KA0A 1VSOA 2WBDA 1RYXA 4GWYA 1K9ZA 5H8HA 1NH8A 3TTKA 4PBQA 4F1UA 1UIVA 4XFEA 5JK4A 2A5TB 1FBPA 2NXOA 3H6WA 3LV0A 4NF0A 3T22A 1M5BA 3KFMA 4H46A 3TQWA 1A54A 3ECRA 4P0GA 4X04A 3KC0A 2CZKA 1MM7A 1NNTA 3O29A 4MAGA 3K1MA 2X7PA 1Y20A 2PCRA 1B3LA 2F5XA 3T1BA 1FBHA 2O1MA 3C4MA 4F3SA 5L9SA 3BFUA 2ZZWA 1IMBA 1UTBB 1ZU0A 2CZIA 1B3HA 4KYDA 1FQAA 5AA2B 4GWSA 2XXKA 1DCUA 1MY4A 4HE1A 1FTLA 5A5XB 1QULA 4O3BA 5F24A 2X26A 2XWOA 4KI0E 3TMGA 2VHAA 2H9BA 1FQFA 4K3FA 2GQ1A 3OSQA 4E0WA 3USDA 4MF3A 3G3KA 3MUQA 1S50A 3T9HB 1D3KA 3KSJA 4PFTA 1GVCA 2HZKA 5FTIA 1XS5A 3EHSA 4Z7EA 3OO9A 5I58B 1EZPA 3IOVA 1IXGA 3FXUA 2G29A 4N13A 3VE1B 4IO6A 4N8YA 2AL5A 5H8SA 4OA4A 2HEUA 2QMWA 2F35A 3WAEA 4NF6B 1H3DA 2IA4A 3LC8A 4JVDA 4DCYA 3CI8A 2B3BA 3LSFB 1DPEA 4ZS9A 2BJIA 4EDPA 2THIA 2I49A 3FVGA 2V3UA 3E3KA 2QMXA 4MLVA 3SEVA 1LEVA 2DWIA 5B70A 1TFDA 4PETA 2ONRA 3HHGA 2Q89A 3CFLA 4PF6A 1YAEA 5CM6A 4F1YA 2ZZVA 4ZEIA
chains in the Genus database with same CATH topology
3PMVA 2E1SA 3FUZA 4F2OA 3HV1A 2H25A 2KLFA 1MY3A 3UGWA 2XXWA 3K1NA 5TU0A 3OD7A 3MZBA 4U21A 4NF5A 1B1XA 3W9VA 3U93A 1NNPA 2UVHA 1EU8A 3U94A 2Z22A 3TCHA 4G77A 2LAOA 5JTYB 5CMMA 3UA8A 3EN3A 4EQ7A 1B5HA 1MPCA 1SW4A 3IOUA 2Z8DA 5L8DA 3C33A 1LLSA 1OMPA 3SESA 4ZE9A 3OEMA 1XVXA 3DELB 2XX7A 3CFXA 1H76A 3G3JA 2YPNA 4YKJA 2VP1A 1D4NA 5B7DA 5DEXB 1XVYA 4ISUA 4NTLA 4R9FA 4ELRA 1EZOA 1SYHA 3PPOA 3LSXA 1A99A 3PPPA 3RUMA 1F9BA 4NE4A 1FTMA 5KZTA 1D9VA 5AA2D 3PMXA 4OZ9A 3FXRA 5ITOA 3C9HA 5H8FA 4DXCA 2XD3A 2XXYA 3I3VA 5ISUA 2M8CA 3VLWA 1P1OA 3EHUA 3UORA 1M5CA 1NKXA 1P1NA 3U8QA 1B5JA 2FA7A 4RXLA 3M3FA 3RPWA 1A7LA 5H8QB 3PUVE 1FQCA 1SDXA 5AE4A 3CVGA 4IO5A 4R9GA 5KDTB 1CB6A 3QUJA 4QFPA 1ELJA 1UIUA 4MH5A 5DVFA 1R6ZA 2PX1A 4OFLA 1M5EA 4ELPA 1AH5A 4HCWA 4OFOA 4QFLA 1Y3QA 2XXRA 3N5LA 1CE2A 4YAHX 2DE3A 4G8HA 5KCJA 3FGSA 4XKQA 3TYHA 4QSCA 3IL1B 4JWYA 4WEDA 1N04A 4FECA 1N76A 2OK2A 1JNFA 4GOTA 3TKDA 3MPKA 5CBRA 3MW0A 4X48A 4GXSB 4HS7A 1MXVA 2GH9A 2UVIA 1QUJA 2V25A 3ZKKA 5EHMA 2I4CA 1POY1 3ONMA 3EHTA 1MH3A 4U4SA 4YKKA 3ZS6A 3TELA 3MP6A 3H3GA 4R6YA 4OENA 1H43A 3FVKA 3O97A 2Y7PA 1HSEA 3F11A 3FASA 4YKPA 2WKYA 3PPNA 4H65A 3CIJA 5CMKA 1XOCA 3KBRA 4POXA 2OLBA 3K4UA 2VGQA 3FD3A 4I62A 4F39A 1LGBC 3H4ZA 3LBSA 5CC2A 3IJOB 5I59A 2OCUA 2F36A 4QFNA 1SI0A 3T96B 3RN8A 2VD3A 4R74A 3SEWA 3DP8A 4F19A 1M5DA 1R1NA 4OEVA 3PGFA 4YKIA 4G2ZA 4U1ZA 2UXAA 1FQDA 3IORA 1OVTA 1SW5A 2ZXTA 3IO4A 4X1BA 4F3GA 2QS3A 4P11A 3K02A 3M3KA 1FCKA 1AOVA 3N6TA 4RYAA 4Z0IA 1PB8A 3OENA 4FORA 2DQVA 4IY6A 2HAVA 1Y3PA 4U22A 1EZ9A 4ND9A 3HN0A 1S9TA 1B4HA 2RF1A 3EQ1A 4FAJA 4YMAA 5AA2A 3N6UA 3T66A 3TUSA 5I2KB 3R26A 3GXAA 4MBPA 1ZKBA 4UA8A 4M4GA 3U1OA 4F31B 5AA4B 2D3IA 2OWTA 1IXCA 1B3FA 4EQ9A 2ZYKA 3G3IA 4IGTA 3LSLA 5TPAB 1LAHE 2UVJA 2I58A 1VR5A 4DDDA 2HQ0A 3BBRA 3KZGA 4G68A 4JDFA 2RC9A 5TP9B 4NEDA 4XKPA 2DP8A 3IB2A 3VXBA 1N84A 4EF1A 1B2HA 4LVQA 1SBPA 4Q5TA 2AIXA 2G93A 4LATA 1MY0A 1FTKA 4NF6A 1VE4A 2H98A 2OJTA 4I9DA 1FQEA 4GVOA 2IEEA 1MG1A 3SERA 3N26A 4X1DA 4H67A 3RQTA 2DE2A 4KQPA 2HXWA 2DVZA 3S9EA 4QF9A 4N6PA 4DXUA 3LR1A 3PD9A 3IAZA 1UTHB 1Y3NA 1DTGA 2OBGA 1O64A 3SDFA 2OZZA 5I57B 5M2VA 3TEPA 5FTHA 3KSXA 2NVUB 3CSGA 2Q8JA 1ANFA 4OMBA 3VLVA 5JTYA 4GXAA 4BDRA 4YB6A 3S9MC 1MM6A 2HFBA 3CFZA 2XX8A 4F3PA 3KJ7A 1I69A 1NL5A 2Y7RA 4KD5A 3O28A 2XD2A 3OXNA 1B4ZA 3JZJA 4FJPA 4H6DA 3UN6A 2YLNA 4LQ5A 4THIA 4KYEA 4UACA 2V3QA 1I6AA 3MVYA 1QKAA 3TCGA 1B0LA 3C32A 1LSTA 3O66A 4HTGA 4EQBA 5CBSA 2QL3A 5BUUA 1JW4A 3K01A 2P0SA 4U2RA 4F3BA 5K2YA 3VVDA 3SETA 4R75A 3H7MA 3C36A 3OEKA 4NF8B 3TPAA 4OQOA 3IB0A 5IKBA 2O51A 1TWYA 3O9PA 1IEJA 4KR5A 4H5FA 3ILUB 2PMSA 3B6WA 3W15C 4LP2B 1WDNA 1J1NA 1B0HA 1MPDA 4RA1A 3FJ7A 2Q2AA 1O63A 3S9NC 3IR1A 2H5YA 2F97A 3FXQA 3H06B 2Y84A 3MZ9A 4ZECA 3IX1A 4OERA 1DPPA 3PMWA 4LZ7A 4OWDA 5KDTA 1OQHA 4F29A 2HAUA 4MFIA 1MY2A 1VFDA 1FW0A 4DCXA 3IK6B 4IB2A 3K6UA 3HHFA 3FATA 4YU0A 2UVGA 4XXUA 2O84X 1M5FA 1QKBA 4PQJA 2REGA 3FZVA 1Y4TA 2P1SA 2XXTA 3ODBA 3VFJA 3RGYA 1B5IA 1RYOA 3VDFA 1LCFA 1N0TA 5LOMA 1L5TA 1AMFA 3MVZA 2R6GE 3PUZE 4PFYA 1MPBA 3N94A 4QSEA 4GRKA 5I56A 2DWJA 2I0CA 1IZ1A 1URSA 3V89B 2QS1A 3TFLA 1IXHA 1ZJLA 3OMBA 3C35A 3BFTA 4M1VA 5CI5A 1RKMA 2XXPA 2GHAA 3TODA 4H8IA 2FNCA 2FYIA 1ZTYA 4O3CA 4H5GA 1TT1A 4BLAA 3WAFA 2F7BA 3Q28A 2QS2A 1LFGA 1P1UA 1BIYA 2F6GA 3OOAA 4JWOA 4AB5A 4JSOA 3KN8A 4BDOA 2RINA 2Z8EA 2D21A 2PT1A 4YICA 1USYH 3PD8A 2NWJA 5AA3A 3K1PA 4IO7A 1Q1KA 1GR2A 3MPLA 4E0XA 3MZ1A 4LUBA 3PPQA 4ZEDA 3B6QA 1ZLQA 1EH3A 4R2BA 5ICQA 2AYSA 1USYE 3K6WA 3IOTA 3EF7A 3QIMA 2O7UA 4BDNA 1QUIA 2RKMA 2O68A 3Q25A 1IUDA 3A09A 1A8EA 1MQIA 3O6HA 4HCYA 4YB5A 3MBPA 1R9LA 1SI1A 4NWDA 1PB9A 5HPQA 3KOTA 3TTMA 3THIA 4YMBA 2PT2A 2Y7KA 1US4A 4G4PA 1B3EA 3IO6A 5FHMA 1OLAA 3VLUA 2XXUA 1N3WA 1ZMGA 3MVWA 2XXVA 5F7VA 5I2KA 5I2NB 1KWHA 3PUXE 4FEBA 1MDP1 3TAJA 3DP6A 2UYEA 3RTWB 4H8JA 3K00A 1S7YA 5AA4A 4X9TA 3FVNA 5TPAA 3DLNA 1A8FA 1MXXA 1SYIA 2CMOA 3H6VA 3G3HA 2O69A 4G8MA 3A3UA 3QAXA 1YTVA 2DOJA 3U72A 1MDQA 1OQGA 4QSDA 2PBWA 3OO8A 3UIFA 3OO7A 3TTRA 4H0WA 4NF4A 4IO3A 1MXUA 4L17A 2DS9A 5J1DA 4IO2A 2DXRA 1OVBA 3RTFB 4JB7A 1JW5A 4LQ2A 1BP5A 4QFOA 4GQOA 2QSXA 3KN3A 3TTNA 4GLIA 2A5TA 1NFTA 4F1VA 5HBCA 4KCDA 3QXMA 4GWOA 1B52A 2Z23A 1SD3A 1GTKA 5H8NB 4AB6A 4ESXA 1NNKA 2CZLA 1LFHA 2Z8FA 5JEIA 4YB7A 2RCBA 3GBAA 4AQ4A 5KCJB 3DP4A 4I1DA 1YCJA 4PE5B 3PV0E 1UTBA 4HW8A 3ZSFA 3VXCA 1VFEA 1YPNA 1MXZA 1B7ZA 3V5AA 3O2AA 5A5XA 3M8UA 3SEUA 1MXYA 2VD2A 3TZAA 1QJMA 4F18A 1P99A 1UQWA 3OO6A 3OSRA 3HCQA 4JBZA 4DLDA 1PC3A 3QSLA 2UYFA 5I58A 4U1OA 3RT6B 1Z7ME 3K6XA 4EXKA 5BWJA 3PUYE 3Q27A 3CSBA 1MQJA 4XIGQ 1BKAA 3TCFA 5K2XA 3LUYA 3E4RA 4RY1A 4DIGA 1P1QA 2P2AA 2HCAA 3FIRA 1Y1ZA 3FV2A 1A55A 4GD5A 1PB7A 2I3WA 1LAXA 1LAGE 1TFAA 1B58A 1LBBA 1B51A 4JXIA 1Z7NE 1US5A 5DYHA 1PBQA 3PU5A 5I59B 1O7TA 3K6VA 2DVCA 4FE8A 2RC8A 4OFJA 2NOOA 3VV5A 4ZDMA 4FATA 3IOWA 1SVXB 2V84A 4TLLB 1SQYA 1OIBA 2ZNUA 2XXXA 4TOZA 4BDQA 2I4BA 3JV9A 3HPIA 2QS4A 5L9OA 4C1UA 4WKMA 3Q26A 1URDA 2REJA 3QUFA 4PFUA 5DVJA 3U92A 2PVUA 4G8NA 5DT6A 3VVEA 3SEXA 3E13X 4PP0A 1ZIUA 3T9VA 3L6GA 1T0KA 1OLCA 5DEXA 3RT8A 2B3FA 1PEBA 2DYXA 2XXIA 2DWAA 2ABHA 2E0SA 2D5WA 3D4CA 1B32A 5CMCA 3KN7A 2ZMBA 1TXFA 4G68B 2BJJX 1FTJA 4WXJA 1MQGA 3ZKLA 1IQ7A 1MY1A 2AL4A 1PBPA 4EXLA 2Q9TA 4R72A 3R6UA 2ZNTA 4R6HA 3T93B 4RK2A 4R2FA 3R7XA 4OTEA 5H8QA 1R9QA 2F8DA 3KGCA 4KYSA 5H8HB 3SEYA 3KEIA 4OVJA 4BDMA 2OWSA 4IY5A 3W9WA 3O6IA 4LZ8A 1QW0A 1SW2A 1QUKA 4I8CA 3KG2A 4KFQA 1NMUA 2Q88A 3MQ9A 4ZE8A 1B6HA 3QK6A 1LCTA 3A3CA 3V83A 3I6VA 4F22A 2ZNSA 3TDJA 2XXHA 2PYYA 1JEVA 3PUWE 2ZYMA 1LB9A 4GF8A 1B7HA 1IXIA 4ZZAA 1SW1A 4JSDA 2ANJA 5L9MA 4DZ1A 1LFIA 4DE8A 3RNNA 4EF2A 1JW1A 2DE4A 1II5A 5ICTA 1URGA 2QPQA 2V3TA 3GLBA 1MH4A 3UK4A 2DWHA 4QRZA 2GHBA 2I0BA 2R71A 5I2NA 4OXVA 1DSNA 3SKPA 3S9LC 3O6GA 3S2VA 3RLFE 2F7CA 3FJGA 3UP9A 4BDLA 3IJXB 4RPOA 4ESWA 2Y7WA 5IAIA 3L6HA 3I5OA 5FHNA 2F7AA 2RCAA 4GIZA 4ZZEA 2X7QA 4C0RA 5I84A 1B40A 1B3GA 3MP8A 2ZYOA 1A40A 1B05A 1D9YA 3FJMA 2O6AA 4GL8A 1N3XA 1P1WA 2ALUA 3C31A 2Q2CA 1B7UA 3HO7A 3G7WA 4XTCQ 1GGGA 4LA9A 2R9JA 1H45A 2HZLA 1DOTA 5EYFA 4NF5B 1MS7A 1XT8A 4RJZA 4WEPA 3RY3A 4R73A 4ECFA 5H8NA 1DTZA 2I6EA 3CRBA 4NWCA 3MJNA 3Q29A 1BTJA 3MAMA 3MC2A 1LAFE 5CRYA 4U23A 5DVIA 2ONKE 1ATGA 3B6TA 2Y7IA 2H99A 2VOZA 3H03A 2O1LA 3T9XB 3DM0A 4P0IA 5ELVA 3FVOA 3K0VA 2XXQA 3MVXA 2NUVA 4GL0A 4ELQA 5I56B 4PFWA 4Q30B 2RC7A 4XKRA 1I6QA 3CG1A 2XX9A 4OETA 1QVSA 1B46A 3C34A 4OYVA 4G68C 5TP9A 2ESNA 5ITPA 4IGRA 3OELA 3EPEA 4OEUA 1N7WA 4DXBA 2DSFA 5H8FB 1H44A 2F78A 3G3FA 2F6PA 4LONB 4MLQA 4EUOA 3TTLA 1JVYA 1IIWA 4O3AA 2ZYNA 1NNFA 4TLMB 3H6UA 3K2DA 3BKIB 3QYTA 2QJEA 5DTBA 1Q35A 1JQFA 3M3LA 4TQUQ 3T9UA 1JETA 3H6TA 3CR9A 1BLFA 1DMBA 1MQHA 1B1HA 2H4IA 2ONSA 1FTOA 3TQLA 2I3VA 4QFKA 2A5SA 5AA1A 1WVJA 4ZEBA 1ZBMA 4ELOA 4QHQA 5FHOA 1UTHA 2I48A 4H1XA 5I57A 4RK9A 3MWBA 1NH7A 4JWXA 4NMYA 4F2QA 3G3GA 4FEDA 1POTA 1N7XA 1Y1MA 1JEUA 4XKNA 1PDAA 4Q0CA 3CG3A 3HSTA 1AL3A 3PPRA 3GZGA 3S4UA 2GFEA 1MXWA 4ZEFA 4FIMA 3ILTB 3P7IA 1GV8A 3FV1A 1MRPA 2GRVA 3KJTA 4RNSA 3GBBA 3AXFA 3JYRA 2W7YA 1XC1A 1LB8A 4GFRA 4N07A 3IB1A 3VVFA 4POWA 4U4XA 3MP1A 1IITA 3LSWA 4ONYA 1B9JA 1AIVA 3V8XB 4R6KA 4YZZA 4RPNA 3E9XA 4OHNA 4IO4A 1WODA 4C1TA 1JVXA 2F34A 5EHSA 4KCCA 1Y4CA 4NF8A 1FQBA 3D4GA 1HSJA 3KOSA 4NF4B 4LZ5A 4KPTA 1I6BA 4Q8RA 5HM4B 1Y9UA 1LBCA 5CMBA 2YJPA 2B65A 4ZEKA 2V93A 2DXYA 2QRYA 2XHDA 1MQDA 3B7DA 5F1QA 1XHYA 4OESA 2O7IA 1HSLA 1VSOA 4KHZE 1RYXA 5H8HA 1NH8A 3TTKA 4F1UA 1UIVA 5JK4A 2A5TB 2NXOA 3H6WA 3T22A 1M5BA 3KFMA 3TQWA 1A54A 3ECRA 4P0GA 1MM7A 1NNTA 3O29A 3K1MA 2X7PA 1Y20A 1B3LA 2F5XA 2O1MA 3C4MA 4F3SA 5L9SA 3BFUA 1UTBB 1ZU0A 1B3HA 4KYDA 1FQAA 5AA2B 1MY4A 1FTLA 5A5XB 1QULA 4O3BA 2X26A 4KI0E 3TMGA 2VHAA 2H9BA 1FQFA 4K3FA 3OSQA 4E0WA 3USDA 4MF3A 3G3KA 3MUQA 1S50A 3T9HB 1D3KA 3KSJA 4PFTA 1GVCA 2HZKA 5FTIA 1XS5A 3EHSA 4Z7EA 3OO9A 5I58B 1EZPA 3IOVA 1IXGA 3FXUA 2G29A 4N13A 3VE1B 4IO6A 2AL5A 5H8SA 2HEUA 2QMWA 2F35A 3WAEA 4NF6B 1H3DA 2IA4A 3LC8A 4DCYA 3CI8A 2B3BA 3LSFB 1DPEA 4ZS9A 4EDPA 2THIA 2I49A 3FVGA 2V3UA 3E3KA 2QMXA 4MLVA 3SEVA 2DWIA 5B70A 1TFDA 4PETA 2ONRA 3HHGA 2Q89A 3CFLA 1YAEA 5CM6A 4F1YA 4ZEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMV A;  2E1S A;  3FUZ A;  4F2O A;  3HV1 A;  2H25 A;  2KLF A;  1MY3 A;  3UGW A;  2XXW A;  3K1N A;  5TU0 A;  3OD7 A;  3MZB A;  4U21 A;  4NF5 A;  1B1X A;  3W9V A;  3U93 A;  1NNP A;  2UVH A;  1EU8 A;  3U94 A;  2Z22 A;  3TCH A;  4G77 A;  2LAO A;  5JTY B;  5CMM A;  3UA8 A;  3EN3 A;  4EQ7 A;  1B5H A;  1MPC A;  1SW4 A;  3IOU A;  2Z8D A;  5L8D A;  3C33 A;  1LLS A;  1OMP A;  3SES A;  4ZE9 A;  3OEM A;  1XVX A;  3DEL B;  2XX7 A;  3CFX A;  1H76 A;  3G3J A;  2YPN A;  4YKJ A;  2VP1 A;  1D4N A;  5B7D A;  5DEX B;  1XVY A;  4ISU A;  4NTL A;  4R9F A;  4ELR A;  1EZO A;  1SYH A;  3PPO A;  3LSX A;  1A99 A;  3PPP A;  3RUM A;  1F9B A;  4NE4 A;  1FTM A;  5KZT A;  1D9V A;  5AA2 D;  3PMX A;  4OZ9 A;  3FXR A;  5ITO A;  3C9H A;  5H8F A;  4DXC A;  2XD3 A;  2XXY A;  3I3V A;  5ISU A;  2M8C A;  3VLW A;  1P1O A;  3EHU A;  3UOR A;  1M5C A;  1NKX A;  1P1N A;  3U8Q A;  1B5J A;  2FA7 A;  4RXL A;  3M3F A;  3RPW A;  1A7L A;  5H8Q B;  3PUV E;  1FQC A;  1SDX A;  5AE4 A;  3CVG A;  4IO5 A;  4R9G A;  5KDT B;  1CB6 A;  3QUJ A;  4QFP A;  1ELJ A;  1UIU A;  4MH5 A;  5DVF A;  1R6Z A;  2PX1 A;  4OFL A;  1M5E A;  4ELP A;  1AH5 A;  4HCW A;  4OFO A;  4QFL A;  1Y3Q A;  2XXR A;  3N5L A;  1CE2 A;  4YAH X;  2DE3 A;  4G8H A;  5KCJ A;  3FGS A;  4XKQ A;  3TYH A;  4QSC A;  3IL1 B;  4JWY A;  4WED A;  1N04 A;  4FEC A;  1N76 A;  2OK2 A;  1JNF A;  4GOT A;  3TKD A;  3MPK A;  5CBR A;  3MW0 A;  4X48 A;  4GXS B;  4HS7 A;  1MXV A;  2GH9 A;  2UVI A;  1QUJ A;  2V25 A;  3ZKK A;  5EHM A;  2I4C A;  1POY 1;  3ONM A;  3EHT A;  1MH3 A;  4U4S A;  4YKK A;  3ZS6 A;  3TEL A;  3MP6 A;  3H3G A;  4R6Y A;  4OEN A;  1H43 A;  3FVK A;  3O97 A;  2Y7P A;  1HSE A;  3F11 A;  3FAS A;  4YKP A;  2WKY A;  3PPN A;  4H65 A;  3CIJ A;  5CMK A;  1XOC A;  3KBR A;  4POX A;  2OLB A;  3K4U A;  2VGQ A;  3FD3 A;  4I62 A;  4F39 A;  1LGB C;  3H4Z A;  3LBS A;  5CC2 A;  3IJO B;  5I59 A;  2OCU A;  2F36 A;  4QFN A;  1SI0 A;  3T96 B;  3RN8 A;  2VD3 A;  4R74 A;  3SEW A;  3DP8 A;  4F19 A;  1M5D A;  1R1N A;  4OEV A;  3PGF A;  4YKI A;  4G2Z A;  4U1Z A;  2UXA A;  1FQD A;  3IOR A;  1OVT A;  1SW5 A;  2ZXT A;  3IO4 A;  4X1B A;  4F3G A;  2QS3 A;  4P11 A;  3K02 A;  3M3K A;  1FCK A;  1AOV A;  3N6T A;  4RYA A;  4Z0I A;  1PB8 A;  3OEN A;  4FOR A;  2DQV A;  4IY6 A;  2HAV A;  1Y3P A;  4U22 A;  1EZ9 A;  4ND9 A;  3HN0 A;  1S9T A;  1B4H A;  2RF1 A;  3EQ1 A;  4FAJ A;  4YMA A;  5AA2 A;  3N6U A;  3T66 A;  3TUS A;  5I2K B;  3R26 A;  3GXA A;  4MBP A;  1ZKB A;  4UA8 A;  4M4G A;  3U1O A;  4F31 B;  5AA4 B;  2D3I A;  2OWT A;  1IXC A;  1B3F A;  4EQ9 A;  2ZYK A;  3G3I A;  4IGT A;  3LSL A;  5TPA B;  1LAH E;  2UVJ A;  2I58 A;  1VR5 A;  4DDD A;  2HQ0 A;  3BBR A;  3KZG A;  4G68 A;  4JDF A;  2RC9 A;  5TP9 B;  4NED A;  4XKP A;  2DP8 A;  3IB2 A;  3VXB A;  1N84 A;  4EF1 A;  1B2H A;  4LVQ A;  1SBP A;  4Q5T A;  2AIX A;  2G93 A;  4LAT A;  1MY0 A;  1FTK A;  4NF6 A;  1VE4 A;  2H98 A;  2OJT A;  4I9D A;  1FQE A;  4GVO A;  2IEE A;  1MG1 A;  3SER A;  3N26 A;  4X1D A;  4H67 A;  3RQT A;  2DE2 A;  4KQP A;  2HXW A;  2DVZ A;  3S9E A;  4QF9 A;  4N6P A;  4DXU A;  3LR1 A;  3PD9 A;  3IAZ A;  1UTH B;  1Y3N A;  1DTG A;  2OBG A;  1O64 A;  3SDF A;  2OZZ A;  5I57 B;  5M2V A;  3TEP A;  5FTH A;  3KSX A;  2NVU B;  3CSG A;  2Q8J A;  1ANF A;  4OMB A;  3VLV A;  5JTY A;  4GXA A;  4BDR A;  4YB6 A;  3S9M C;  1MM6 A;  2HFB A;  3CFZ A;  2XX8 A;  4F3P A;  3KJ7 A;  1I69 A;  1NL5 A;  2Y7R A;  4KD5 A;  3O28 A;  2XD2 A;  3OXN A;  1B4Z A;  3JZJ A;  4FJP A;  4H6D A;  3UN6 A;  2YLN A;  4LQ5 A;  4THI A;  4KYE A;  4UAC A;  2V3Q A;  1I6A A;  3MVY A;  1QKA A;  3TCG A;  1B0L A;  3C32 A;  1LST A;  3O66 A;  4HTG A;  4EQB A;  5CBS A;  2QL3 A;  5BUU A;  1JW4 A;  3K01 A;  2P0S A;  4U2R A;  4F3B A;  5K2Y A;  3VVD A;  3SET A;  4R75 A;  3H7M A;  3C36 A;  3OEK A;  4NF8 B;  3TPA A;  4OQO A;  3IB0 A;  5IKB A;  2O51 A;  1TWY A;  3O9P A;  1IEJ A;  4KR5 A;  4H5F A;  3ILU B;  2PMS A;  3B6W A;  3W15 C;  4LP2 B;  1WDN A;  1J1N A;  1B0H A;  1MPD A;  4RA1 A;  3FJ7 A;  2Q2A A;  1O63 A;  3S9N C;  3IR1 A;  2H5Y A;  2F97 A;  3FXQ A;  3H06 B;  2Y84 A;  3MZ9 A;  4ZEC A;  3IX1 A;  4OER A;  1DPP A;  3PMW A;  4LZ7 A;  4OWD A;  5KDT A;  1OQH A;  4F29 A;  2HAU A;  4MFI A;  1MY2 A;  1VFD A;  1FW0 A;  4DCX A;  3IK6 B;  4IB2 A;  3K6U A;  3HHF A;  3FAT A;  4YU0 A;  2UVG A;  4XXU A;  2O84 X;  1M5F A;  1QKB A;  4PQJ A;  2REG A;  3FZV A;  1Y4T A;  2P1S A;  2XXT A;  3ODB A;  3VFJ A;  3RGY A;  1B5I A;  1RYO A;  3VDF A;  1LCF A;  1N0T A;  5LOM A;  1L5T A;  1AMF A;  3MVZ A;  2R6G E;  3PUZ E;  4PFY A;  1MPB A;  3N94 A;  4QSE A;  4GRK A;  5I56 A;  2DWJ A;  2I0C A;  1IZ1 A;  1URS A;  3V89 B;  2QS1 A;  3TFL A;  1IXH A;  1ZJL A;  3OMB A;  3C35 A;  3BFT A;  4M1V A;  5CI5 A;  1RKM A;  2XXP A;  2GHA A;  3TOD A;  4H8I A;  2FNC A;  2FYI A;  1ZTY A;  4O3C A;  4H5G A;  1TT1 A;  4BLA A;  3WAF A;  2F7B A;  3Q28 A;  2QS2 A;  1LFG A;  1P1U A;  1BIY A;  2F6G A;  3OOA A;  4JWO A;  4AB5 A;  4JSO A;  3KN8 A;  4BDO A;  2RIN A;  2Z8E A;  2D21 A;  2PT1 A;  4YIC A;  1USY H;  3PD8 A;  2NWJ A;  5AA3 A;  3K1P A;  4IO7 A;  1Q1K A;  1GR2 A;  3MPL A;  4E0X A;  3MZ1 A;  4LUB A;  3PPQ A;  4ZED A;  3B6Q A;  1ZLQ A;  1EH3 A;  4R2B A;  5ICQ A;  2AYS A;  1USY E;  3K6W A;  3IOT A;  3EF7 A;  3QIM A;  2O7U A;  4BDN A;  1QUI A;  2RKM A;  2O68 A;  3Q25 A;  1IUD A;  3A09 A;  1A8E A;  1MQI A;  3O6H A;  4HCY A;  4YB5 A;  3MBP A;  1R9L A;  1SI1 A;  4NWD A;  1PB9 A;  5HPQ A;  3KOT A;  3TTM A;  3THI A;  4YMB A;  2PT2 A;  2Y7K A;  1US4 A;  4G4P A;  1B3E A;  3IO6 A;  5FHM A;  1OLA A;  3VLU A;  2XXU A;  1N3W A;  1ZMG A;  3MVW A;  2XXV A;  5F7V A;  5I2K A;  5I2N B;  1KWH A;  3PUX E;  4FEB A;  1MDP 1;  3TAJ A;  3DP6 A;  2UYE A;  3RTW B;  4H8J A;  3K00 A;  1S7Y A;  5AA4 A;  4X9T A;  3FVN A;  5TPA A;  3DLN A;  1A8F A;  1MXX A;  1SYI A;  2CMO A;  3H6V A;  3G3H A;  2O69 A;  4G8M A;  3A3U A;  3QAX A;  1YTV A;  2DOJ A;  3U72 A;  1MDQ A;  1OQG A;  4QSD A;  2PBW A;  3OO8 A;  3UIF A;  3OO7 A;  3TTR A;  4H0W A;  4NF4 A;  4IO3 A;  1MXU A;  4L17 A;  2DS9 A;  5J1D A;  4IO2 A;  2DXR A;  1OVB A;  3RTF B;  4JB7 A;  1JW5 A;  4LQ2 A;  1BP5 A;  4QFO A;  4GQO A;  2QSX A;  3KN3 A;  3TTN A;  4GLI A;  2A5T A;  1NFT A;  4F1V A;  5HBC A;  4KCD A;  3QXM A;  4GWO A;  1B52 A;  2Z23 A;  1SD3 A;  1GTK A;  5H8N B;  4AB6 A;  4ESX A;  1NNK A;  2CZL A;  1LFH A;  2Z8F A;  5JEI A;  4YB7 A;  2RCB A;  3GBA A;  4AQ4 A;  5KCJ B;  3DP4 A;  4I1D A;  1YCJ A;  4PE5 B;  3PV0 E;  1UTB A;  4HW8 A;  3ZSF A;  3VXC A;  1VFE A;  1YPN A;  1MXZ A;  1B7Z A;  3V5A A;  3O2A A;  5A5X A;  3M8U A;  3SEU A;  1MXY A;  2VD2 A;  3TZA A;  1QJM A;  4F18 A;  1P99 A;  1UQW A;  3OO6 A;  3OSR A;  3HCQ A;  4JBZ A;  4DLD A;  1PC3 A;  3QSL A;  2UYF A;  5I58 A;  4U1O A;  3RT6 B;  1Z7M E;  3K6X A;  4EXK A;  5BWJ A;  3PUY E;  3Q27 A;  3CSB A;  1MQJ A;  4XIG Q;  1BKA A;  3TCF A;  5K2X A;  3LUY A;  3E4R A;  4RY1 A;  4DIG A;  1P1Q A;  2P2A A;  2HCA A;  3FIR A;  1Y1Z A;  3FV2 A;  1A55 A;  4GD5 A;  1PB7 A;  2I3W A;  1LAX A;  1LAG E;  1TFA A;  1B58 A;  1LBB A;  1B51 A;  4JXI A;  1Z7N E;  1US5 A;  5DYH A;  1PBQ A;  3PU5 A;  5I59 B;  1O7T A;  3K6V A;  2DVC A;  4FE8 A;  2RC8 A;  4OFJ A;  2NOO A;  3VV5 A;  4ZDM A;  4FAT A;  3IOW A;  1SVX B;  2V84 A;  4TLL B;  1SQY A;  1OIB A;  2ZNU A;  2XXX A;  4TOZ A;  4BDQ A;  2I4B A;  3JV9 A;  3HPI A;  2QS4 A;  5L9O A;  4C1U A;  4WKM A;  3Q26 A;  1URD A;  2REJ A;  3QUF A;  4PFU A;  5DVJ A;  3U92 A;  2PVU A;  4G8N A;  5DT6 A;  3VVE A;  3SEX A;  3E13 X;  4PP0 A;  1ZIU A;  3T9V A;  3L6G A;  1T0K A;  1OLC A;  5DEX A;  3RT8 A;  2B3F A;  1PEB A;  2DYX A;  2XXI A;  2DWA A;  2ABH A;  2E0S A;  2D5W A;  3D4C A;  1B32 A;  5CMC A;  3KN7 A;  2ZMB A;  1TXF A;  4G68 B;  2BJJ X;  1FTJ A;  4WXJ A;  1MQG A;  3ZKL A;  1IQ7 A;  1MY1 A;  2AL4 A;  1PBP A;  4EXL A;  2Q9T A;  4R72 A;  3R6U A;  2ZNT A;  4R6H A;  3T93 B;  4RK2 A;  4R2F A;  3R7X A;  4OTE A;  5H8Q A;  1R9Q A;  2F8D A;  3KGC A;  4KYS A;  5H8H B;  3SEY A;  3KEI A;  4OVJ A;  4BDM A;  2OWS A;  4IY5 A;  3W9W A;  3O6I A;  4LZ8 A;  1QW0 A;  1SW2 A;  1QUK A;  4I8C A;  3KG2 A;  4KFQ A;  1NMU A;  2Q88 A;  3MQ9 A;  4ZE8 A;  1B6H A;  3QK6 A;  1LCT A;  3A3C A;  3V83 A;  3I6V A;  4F22 A;  2ZNS A;  3TDJ A;  2XXH A;  2PYY A;  1JEV A;  3PUW E;  2ZYM A;  1LB9 A;  4GF8 A;  1B7H A;  1IXI A;  4ZZA A;  1SW1 A;  4JSD A;  2ANJ A;  5L9M A;  4DZ1 A;  1LFI A;  4DE8 A;  3RNN A;  4EF2 A;  1JW1 A;  2DE4 A;  1II5 A;  5ICT A;  1URG A;  2QPQ A;  2V3T A;  3GLB A;  1MH4 A;  3UK4 A;  2DWH A;  4QRZ A;  2GHB A;  2I0B A;  2R71 A;  5I2N A;  4OXV A;  1DSN A;  3SKP A;  3S9L C;  3O6G A;  3S2V A;  3RLF E;  2F7C A;  3FJG A;  3UP9 A;  4BDL A;  3IJX B;  4RPO A;  4ESW A;  2Y7W A;  5IAI A;  3L6H A;  3I5O A;  5FHN A;  2F7A A;  2RCA A;  4GIZ A;  4ZZE A;  2X7Q A;  4C0R A;  5I84 A;  1B40 A;  1B3G A;  3MP8 A;  2ZYO A;  1A40 A;  1B05 A;  1D9Y A;  3FJM A;  2O6A A;  4GL8 A;  1N3X A;  1P1W A;  2ALU A;  3C31 A;  2Q2C A;  1B7U A;  3HO7 A;  3G7W A;  4XTC Q;  1GGG A;  4LA9 A;  2R9J A;  1H45 A;  2HZL A;  1DOT A;  5EYF A;  4NF5 B;  1MS7 A;  1XT8 A;  4RJZ A;  4WEP A;  3RY3 A;  4R73 A;  4ECF A;  5H8N A;  1DTZ A;  2I6E A;  3CRB A;  4NWC A;  3MJN A;  3Q29 A;  1BTJ A;  3MAM A;  3MC2 A;  1LAF E;  5CRY A;  4U23 A;  5DVI A;  2ONK E;  1ATG A;  3B6T A;  2Y7I A;  2H99 A;  2VOZ A;  3H03 A;  2O1L A;  3T9X B;  3DM0 A;  4P0I A;  5ELV A;  3FVO A;  3K0V A;  2XXQ A;  3MVX A;  2NUV A;  4GL0 A;  4ELQ A;  5I56 B;  4PFW A;  4Q30 B;  2RC7 A;  4XKR A;  1I6Q A;  3CG1 A;  2XX9 A;  4OET A;  1QVS A;  1B46 A;  3C34 A;  4OYV A;  4G68 C;  5TP9 A;  2ESN A;  5ITP A;  4IGR A;  3OEL A;  3EPE A;  4OEU A;  1N7W A;  4DXB A;  2DSF A;  5H8F B;  1H44 A;  2F78 A;  3G3F A;  2F6P A;  4LON B;  4MLQ A;  4EUO A;  3TTL A;  1JVY A;  1IIW A;  4O3A A;  2ZYN A;  1NNF A;  4TLM B;  3H6U A;  3K2D A;  3BKI B;  3QYT A;  2QJE A;  5DTB A;  1Q35 A;  1JQF A;  3M3L A;  4TQU Q;  3T9U A;  1JET A;  3H6T A;  3CR9 A;  1BLF A;  1DMB A;  1MQH A;  1B1H A;  2H4I A;  2ONS A;  1FTO A;  3TQL A;  2I3V A;  4QFK A;  2A5S A;  5AA1 A;  1WVJ A;  4ZEB A;  1ZBM A;  4ELO A;  4QHQ A;  5FHO A;  1UTH A;  2I48 A;  4H1X A;  5I57 A;  4RK9 A;  3MWB A;  1NH7 A;  4JWX A;  4NMY A;  4F2Q A;  3G3G A;  4FED A;  1POT A;  1N7X A;  1Y1M A;  1JEU A;  4XKN A;  1PDA A;  4Q0C A;  3CG3 A;  3HST A;  1AL3 A;  3PPR A;  3GZG A;  3S4U A;  2GFE A;  1MXW A;  4ZEF A;  4FIM A;  3ILT B;  3P7I A;  1GV8 A;  3FV1 A;  1MRP A;  2GRV A;  3KJT A;  4RNS A;  3GBB A;  3AXF A;  3JYR A;  2W7Y A;  1XC1 A;  1LB8 A;  4GFR A;  4N07 A;  3IB1 A;  3VVF A;  4POW A;  4U4X A;  3MP1 A;  1IIT A;  3LSW A;  4ONY A;  1B9J A;  1AIV A;  3V8X B;  4R6K A;  4YZZ A;  4RPN A;  3E9X A;  4OHN A;  4IO4 A;  1WOD A;  4C1T A;  1JVX A;  2F34 A;  5EHS A;  4KCC A;  1Y4C A;  4NF8 A;  1FQB A;  3D4G A;  1HSJ A;  3KOS A;  4NF4 B;  4LZ5 A;  4KPT A;  1I6B A;  4Q8R A;  5HM4 B;  1Y9U A;  1LBC A;  5CMB A;  2YJP A;  2B65 A;  4ZEK A;  2V93 A;  2DXY A;  2QRY A;  2XHD A;  1MQD A;  3B7D A;  5F1Q A;  1XHY A;  4OES A;  2O7I A;  1HSL A;  1VSO A;  4KHZ E;  1RYX A;  5H8H A;  1NH8 A;  3TTK A;  4F1U A;  1UIV A;  5JK4 A;  2A5T B;  2NXO A;  3H6W A;  3T22 A;  1M5B A;  3KFM A;  3TQW A;  1A54 A;  3ECR A;  4P0G A;  1MM7 A;  1NNT A;  3O29 A;  3K1M A;  2X7P A;  1Y20 A;  1B3L A;  2F5X A;  2O1M A;  3C4M A;  4F3S A;  5L9S A;  3BFU A;  1UTB B;  1ZU0 A;  1B3H A;  4KYD A;  1FQA A;  5AA2 B;  1MY4 A;  1FTL A;  5A5X B;  1QUL A;  4O3B A;  2X26 A;  4KI0 E;  3TMG A;  2VHA A;  2H9B A;  1FQF A;  4K3F A;  3OSQ A;  4E0W A;  3USD A;  4MF3 A;  3G3K A;  3MUQ A;  1S50 A;  3T9H B;  1D3K A;  3KSJ A;  4PFT A;  1GVC A;  2HZK A;  5FTI A;  1XS5 A;  3EHS A;  4Z7E A;  3OO9 A;  5I58 B;  1EZP A;  3IOV A;  1IXG A;  3FXU A;  2G29 A;  4N13 A;  3VE1 B;  4IO6 A;  2AL5 A;  5H8S A;  2HEU A;  2QMW A;  2F35 A;  3WAE A;  4NF6 B;  1H3D A;  2IA4 A;  3LC8 A;  4DCY A;  3CI8 A;  2B3B A;  3LSF B;  1DPE A;  4ZS9 A;  4EDP A;  2THI A;  2I49 A;  3FVG A;  2V3U A;  3E3K A;  2QMX A;  4MLV A;  3SEV A;  2DWI A;  5B70 A;  1TFD A;  4PET A;  2ONR A;  3HHG A;  2Q89 A;  3CFL A;  1YAE A;  5CM6 A;  4F1Y A;  4ZEI A; 
#chains in the Genus database with same CATH topology
 3PMV A;  2E1S A;  3FUZ A;  5ET6 A;  4F2O A;  3HV1 A;  2H25 A;  2KLF A;  1MY3 A;  3UGW A;  2XXW A;  4P1E A;  3K1N A;  5TU0 A;  3OD7 A;  3MZB A;  4U21 A;  4NF5 A;  1B1X A;  3W9V A;  3U93 A;  1NNP A;  2UVH A;  1EU8 A;  1QGX A;  3U94 A;  2Z22 A;  3TCH A;  4G77 A;  2LAO A;  5JTY B;  5CMM A;  3UA8 A;  3EN3 A;  4EQ7 A;  1B5H A;  1MPC A;  3PTY A;  1SW4 A;  3IOU A;  2Z8D A;  5L8D A;  2V4C A;  1EYI A;  3C33 A;  1LLS A;  1OMP A;  3SES A;  1NUW A;  4ZE9 A;  3OEM A;  1XVX A;  3DEL B;  2XX7 A;  3CFX A;  1H76 A;  3G3J A;  2YPN A;  4YKJ A;  4P56 A;  2VP1 A;  1D4N A;  1NV2 A;  5B7D A;  5DEX B;  1XVY A;  4ISU A;  4NTL A;  4R9F A;  4ELR A;  1EZO A;  1SYH A;  3PPO A;  3LSX A;  1A99 A;  3PPP A;  3RUM A;  1F9B A;  4NE4 A;  4JVI A;  1G0I A;  1FTM A;  5IZ1 A;  5LTC A;  5KZT A;  3A29 A;  1D9V A;  5AA2 D;  3PMX A;  4OZ9 A;  3FXR A;  5ITO A;  4PFI A;  3C9H A;  5H8F A;  3RPL A;  4DXC A;  2XD3 A;  1SPI A;  5IGA A;  2XXY A;  3I3V A;  5ISU A;  2M8C A;  3VLW A;  1P1O A;  3EHU A;  3UOR A;  1M5C A;  3FBP A;  1NKX A;  1P1N A;  3U8Q A;  1B5J A;  2FA7 A;  4RXL A;  3M3F A;  3RPW A;  1A7L A;  5H8Q B;  3PUV E;  4NGU A;  1FQC A;  5IZZ A;  1SDX A;  1FJ9 A;  5AE4 A;  3CVG A;  4IO5 A;  4R9G A;  1NV1 A;  5KDT B;  1CB6 A;  3QUJ A;  4QFP A;  1ELJ A;  1UIU A;  4MH5 A;  4PGN A;  4QBA A;  5DVF A;  1R6Z A;  2PX1 A;  4OFL A;  1M5E A;  4ELP A;  1AH5 A;  1NV0 A;  4HCW A;  4OFO A;  4QFL A;  2PFZ A;  1Y3Q A;  2XXR A;  3N5L A;  1CE2 A;  4YAH X;  2DE3 A;  4G8H A;  5KCJ A;  3FGS A;  4XKQ A;  4GWW A;  3TYH A;  4QSC A;  3IL1 B;  1IMA A;  4JWY A;  2FBP A;  4WED A;  1N04 A;  1LBY A;  4FEC A;  1N76 A;  2OK2 A;  1JNF A;  4GOT A;  4MEV A;  3TKD A;  3MPK A;  5CBR A;  3MW0 A;  1JP4 A;  4X48 A;  4GXS B;  2ZZX A;  4HS7 A;  1MXV A;  2GH9 A;  2UVI A;  4GX3 A;  1QUJ A;  2V25 A;  3ZKK A;  5EHM A;  2I4C A;  4PTK A;  2XWK A;  1POY 1;  1EYJ A;  3ONM A;  1FPE A;  3EHT A;  1MH3 A;  4U4S A;  4YKK A;  3ZS6 A;  3TEL A;  3MP6 A;  4GBV A;  3H3G A;  4R6Y A;  4OEN A;  1YYZ A;  4XF5 A;  1H43 A;  3FVK A;  3O97 A;  3SZP A;  2Y7P A;  1HSE A;  3F11 A;  3FAS A;  4YKP A;  2WKY A;  3PPN A;  4H65 A;  3CIJ A;  3T0J A;  5CMK A;  1XOC A;  3KBR A;  4POX A;  2OLB A;  3K4U A;  2VGQ A;  3FD3 A;  4I62 A;  4F39 A;  1LGB C;  5EYG A;  3H4Z A;  3LBS A;  5CC2 A;  3IJO B;  5I59 A;  5EYH A;  2OCU A;  2F36 A;  4QFN A;  1SI0 A;  3T96 B;  3RN8 A;  2VD3 A;  4R74 A;  3SEW A;  3DP8 A;  4F19 A;  1M5D A;  1R1N A;  4OEV A;  3PGF A;  4YKI A;  4G2Z A;  4U1Z A;  2UXA A;  1FQD A;  3KBZ A;  3IOR A;  3B8B A;  1OVT A;  5IZ3 A;  1SW5 A;  2ZXT A;  3IO4 A;  4X1B A;  4F3G A;  2QS3 A;  4P11 A;  3K02 A;  3M3K A;  1FCK A;  1AOV A;  3N6T A;  4RYA A;  4Z0I A;  1PB8 A;  3OEN A;  4FOR A;  2DQV A;  4IY6 A;  2HAV A;  1Y3P A;  4U22 A;  1EZ9 A;  4ND9 A;  1IMD A;  3HN0 A;  1S9T A;  1B4H A;  2RF1 A;  3EQ1 A;  4FAJ A;  4YMA A;  5AA2 A;  4HE2 A;  3N6U A;  1NV7 A;  3T66 A;  3TUS A;  4KXP A;  5I2K B;  2MKZ A;  3R26 A;  3GXA A;  4MBP A;  1ZKB A;  4UA8 A;  4M4G A;  3U1O A;  4F31 B;  5AA4 B;  2D3I A;  2OWT A;  1IXC A;  1B3F A;  4EQ9 A;  2ZYK A;  3G3I A;  4IGT A;  3LSL A;  5TPA B;  1LAH E;  2UVJ A;  2I58 A;  1VR5 A;  4DDD A;  1FPD A;  2HQ0 A;  3BBR A;  3KZG A;  4G68 A;  4JDF A;  4PFR A;  2RC9 A;  5TP9 B;  5EQA A;  4NED A;  4O7M A;  4XKP A;  2DP8 A;  4P3L A;  3IB2 A;  4XEQ A;  3VXB A;  1N84 A;  4NHB A;  1NUY A;  1FJ6 A;  4EF1 A;  1B2H A;  4LVQ A;  4O8M A;  1SBP A;  4Q5T A;  2AIX A;  2G93 A;  4GX4 A;  4LAT A;  4DI4 B;  1MY0 A;  1FTK A;  4NF6 A;  2CZH A;  1VE4 A;  2H98 A;  2OJT A;  4I9D A;  1FQE A;  4GVO A;  4PDH A;  2IEE A;  1MG1 A;  3SER A;  3MYU A;  3N26 A;  2WX9 A;  4X1D A;  4H67 A;  5EQ7 A;  5EQ8 A;  1FPI A;  3RQT A;  5EQ9 A;  2DE2 A;  4G61 A;  4KQP A;  2QVV A;  2HXW A;  2DVZ A;  1FBD A;  3S9E A;  1IME A;  4QF9 A;  4PAI A;  4N6P A;  4DXU A;  3LR1 A;  3PD9 A;  1FBE A;  1RDX A;  3IAZ A;  1UTH B;  1Y3N A;  1IMF A;  1DTG A;  2HPG A;  1O64 A;  2OBG A;  3SDF A;  2OZZ A;  5I57 B;  1D9Q A;  5M2V A;  3TEP A;  5FTH A;  3KSX A;  4H45 A;  2NVU B;  4PBH A;  3CSG A;  2Q8J A;  1ANF A;  4OMB A;  3VLV A;  5JTY A;  4GXA A;  4BDR A;  4YB6 A;  3S9M C;  1MM6 A;  2HFB A;  3CFZ A;  2XX8 A;  4F3P A;  3KJ7 A;  1I69 A;  1KZ8 A;  4P8B A;  1LBV A;  1NL5 A;  2HHM A;  2Y7R A;  3O28 A;  4KD5 A;  2XD2 A;  4N91 A;  3OXN A;  1B4Z A;  3JZJ A;  4FJP A;  4H6D A;  3UN6 A;  1BK4 A;  2YLN A;  4LQ5 A;  4THI A;  4KYE A;  4UAC A;  2V3Q A;  1I6A A;  3MVY A;  1QKA A;  3TCG A;  1B0L A;  3C32 A;  1LST A;  4LN5 A;  3O66 A;  4HTG A;  4EQB A;  5CBS A;  2QL3 A;  5BUU A;  1JW4 A;  3K01 A;  2P0S A;  4U2R A;  4F3B A;  5K2Y A;  3VVD A;  3SET A;  4R75 A;  3H7M A;  1RDZ A;  5LDZ A;  3C36 A;  3OEK A;  4NF8 B;  3TPA A;  4OQO A;  3IB0 A;  5IKB A;  2O51 A;  5J16 A;  1TWY A;  2XA5 A;  3O9P A;  1IEJ A;  4KR5 A;  4H5F A;  3ILU B;  2PMS A;  3B6W A;  3W15 C;  4LP2 B;  1WDN A;  1J1N A;  1B0H A;  1MPD A;  4RA1 A;  3FJ7 A;  2Q2A A;  1O63 A;  3S9N C;  3IR1 A;  2H5Y A;  2F97 A;  3FXQ A;  1KA1 A;  3H06 B;  2Y84 A;  3MZ9 A;  4ZEC A;  3IX1 A;  4OER A;  1DPP A;  1IMC A;  3PMW A;  4LZ7 A;  4MNP A;  4OWD A;  3D1R A;  5KDT A;  1OQH A;  4OVS A;  4F29 A;  2HAU A;  4PC9 A;  4MFI A;  1MY2 A;  1AWB A;  1VFD A;  4PAF A;  1FW0 A;  5T3J A;  4DCX A;  3IK6 B;  4IB2 A;  3K6U A;  3HHF A;  4HE0 A;  3FAT A;  4YU0 A;  2UVG A;  4XXU A;  2O84 X;  1M5F A;  1QKB A;  4GX6 A;  4PQJ A;  2REG A;  3FZV A;  1Y4T A;  1EYK A;  2P1S A;  2XXT A;  3ODB A;  3VFJ A;  3RGY A;  1B5I A;  1RYO A;  3VDF A;  1LCF A;  4I3E A;  1N0T A;  5LOM A;  1L5T A;  1AMF A;  1FTA A;  3MVZ A;  2R6G E;  3PUZ E;  4PFY A;  1MPB A;  3N94 A;  2XWI A;  4QSE A;  2WYK A;  4GRK A;  5I56 A;  2DWJ A;  2I0C A;  1IZ1 A;  1URS A;  4OVT A;  3V89 B;  2QS1 A;  3TFL A;  1IXH A;  1ZJL A;  3OMB A;  3C35 A;  3BFT A;  4M1V A;  2DDK A;  5CI5 A;  1RKM A;  2XXP A;  2GHA A;  3TOD A;  4H8I A;  2FNC A;  4PCD A;  2FYI A;  1ZTY A;  4O3C A;  4H5G A;  1TT1 A;  4BLA A;  3WAF A;  2F7B A;  3Q28 A;  2QS2 A;  1LFG A;  1P1U A;  1BIY A;  2F6G A;  3OOA A;  4JWO A;  4AB5 A;  4JSO A;  1FBC A;  3KN8 A;  4BDO A;  1NV4 A;  2RIN A;  2Z8E A;  4NN3 A;  2D21 A;  2PT1 A;  4YIC A;  1FBG A;  1USY H;  3PD8 A;  4P47 A;  2NWJ A;  1CNQ A;  1FBF A;  5AA3 A;  3K1P A;  4IO7 A;  1Q1K A;  1GR2 A;  3MPL A;  4N6K A;  4E0X A;  3MZ1 A;  4MJO A;  4LUB A;  3PPQ A;  4ZED A;  3B6Q A;  1ZLQ A;  1EH3 A;  3E78 A;  4R2B A;  1YZ0 A;  5ICQ A;  4P9K A;  2AYS A;  1USY E;  3K6W A;  3IOT A;  3EF7 A;  3QIM A;  2O7U A;  4BDN A;  1QUI A;  2RKM A;  2O68 A;  3Q25 A;  1IUD A;  3A09 A;  4OAN A;  1A8E A;  1MQI A;  3O6H A;  4NX1 A;  4HCY A;  4YB5 A;  3MBP A;  1R9L A;  1SI1 A;  4NWD A;  1PB9 A;  5HPQ A;  3KOT A;  4DI3 D;  3TTM A;  3THI A;  4YMB A;  2PT2 A;  2Y7K A;  1US4 A;  4G4P A;  1B3E A;  3IO6 A;  4MNI A;  5FHM A;  1NI9 A;  1OLA A;  4O7I A;  1G0H A;  3VLU A;  1DBZ A;  2XXU A;  1N3W A;  1ZMG A;  3MVW A;  2XXV A;  2F3D A;  5F7V A;  5I2K A;  5I2N B;  1KWH A;  3PUX E;  4FEB A;  1MDP 1;  3TAJ A;  3DP6 A;  5I7I A;  2UYE A;  3RTW B;  4H8J A;  3K00 A;  1S7Y A;  5AA4 A;  4X9T A;  3FVN A;  4HXV A;  5TPA A;  3DLN A;  1A8F A;  1MXX A;  1SYI A;  2CMO A;  3H6V A;  3G3H A;  2O69 A;  4G8M A;  3A3U A;  3QAX A;  1YTV A;  2DOJ A;  3U72 A;  1MDQ A;  5ET7 A;  1OQG A;  4QSD A;  2PBW A;  3OO8 A;  3UIF A;  3OO7 A;  3TTR A;  4H0W A;  4PE3 A;  4NF4 A;  4IO3 A;  1MXU A;  2L5V A;  4NG7 A;  2VT5 A;  4L17 A;  2DS9 A;  2JJK A;  5J1D A;  4IO2 A;  2DXR A;  1OVB A;  3RTF B;  4JB7 A;  3RYD A;  1FPB A;  1JW5 A;  4LQ2 A;  1BP5 A;  4QFO A;  4GQO A;  5A5L A;  2QSX A;  3KN3 A;  3TTN A;  4IR8 A;  4GLI A;  2A5T A;  1NFT A;  4F1V A;  5HBC A;  4KCD A;  1FPG A;  4NAP A;  3QXM A;  2FHY A;  4AS5 A;  4GWO A;  3IFA A;  1B52 A;  2Z23 A;  1SD3 A;  1GTK A;  5H8N B;  4AB6 A;  4MMP A;  4ESX A;  1NNK A;  2CZL A;  1LFH A;  2Z8F A;  5JEI A;  4GBW A;  4YB7 A;  2RCB A;  3GBA A;  3ISP A;  4AQ4 A;  5KCJ B;  3DP4 A;  3BIG A;  4I1D A;  1YCJ A;  4PE5 B;  3PV0 E;  4PGP A;  1UTB A;  4HW8 A;  3ZSF A;  3VXC A;  1VFE A;  1YPN A;  3KC1 A;  1LBZ A;  1MXZ A;  1B7Z A;  3V5A A;  2FIE A;  1LBW A;  3O2A A;  4FBP A;  2Q8M A;  5A5X A;  3M8U A;  3SEU A;  2KQZ A;  1MXY A;  2VD2 A;  2F3B A;  3TZA A;  1QJM A;  4F18 A;  2QVR A;  1P99 A;  1UQW A;  3OO6 A;  4NQ8 A;  4JVC A;  3OSR A;  4MX6 A;  3HCQ A;  4JBZ A;  4DLD A;  1PC3 A;  3QSL A;  2UYF A;  5I58 A;  2Q74 A;  2OWZ A;  4U1O A;  3RT6 B;  1Z7M E;  3K6X A;  4EXK A;  5BWJ A;  3PUY E;  3Q27 A;  3CSB A;  1MQJ A;  4XIG Q;  1BKA A;  3TCF A;  5K2X A;  5ET5 A;  3LUY A;  3E4R A;  4RY1 A;  4DIG A;  1P1Q A;  2P2A A;  2HCA A;  3FIR A;  1Y1Z A;  3BIH A;  3FV2 A;  1A55 A;  4GD5 A;  1PB7 A;  2I3W A;  1LAX A;  1LAG E;  1TFA A;  1B58 A;  1LBB A;  1B51 A;  4JXI A;  1Z7N E;  1US5 A;  5DYH A;  1LBX A;  1PBQ A;  3PU5 A;  2P3V A;  4UAB A;  2WEF A;  5I59 B;  1O7T A;  4I3Y A;  4N4U A;  3K6V A;  2DVC A;  2QFL A;  2PFY A;  4FE8 A;  2RC8 A;  4OFJ A;  4GWX A;  2NOO A;  3VV5 A;  4ZDM A;  4FAT A;  3IOW A;  1SVX B;  2V84 A;  4OVR A;  4TLL B;  1SQY A;  2P3N A;  2CEX A;  1OIB A;  1FRP A;  2ZNU A;  2XXX A;  5IZ3 B;  4TOZ A;  4BDQ A;  2I4B A;  3JV9 A;  3HPI A;  2QS4 A;  5L9O A;  2Y5K A;  1FPK A;  4C1U A;  4WKM A;  3Q26 A;  3QMF A;  1URD A;  3GYY A;  2REJ A;  1DK4 A;  3QUF A;  4PFU A;  5DVJ A;  4MIJ A;  3U92 A;  2PVU A;  4G8N A;  5DT6 A;  3VVE A;  3SEX A;  3E13 X;  4PP0 A;  1ZIU A;  3T9V A;  3L6G A;  1T0K A;  1OLC A;  5DEX A;  3RT8 A;  2B3F A;  1PEB A;  2DYX A;  2XXI A;  2DWA A;  2ABH A;  2E0S A;  2D5W A;  3D4C A;  1B32 A;  5CMC A;  3KN7 A;  2ZMB A;  1XI6 A;  1TXF A;  4G68 B;  2BJJ X;  2FVZ A;  1FTJ A;  4WXJ A;  1MQG A;  3ZKL A;  1IQ7 A;  1MY1 A;  5IM2 A;  2AL4 A;  1PBP A;  4N15 A;  4EXL A;  1NV3 A;  2Q9T A;  4R72 A;  3R6U A;  2ZNT A;  4R6H A;  4OVQ A;  3T93 B;  4RK2 A;  1FPF A;  4R2F A;  4OTE A;  5H8Q A;  3R7X A;  1Q9D A;  1R9Q A;  2F8D A;  3KGC A;  4KYS A;  1FPL A;  5H8H B;  3SEY A;  3KEI A;  4OVJ A;  4BDM A;  2OWS A;  4IY5 A;  3W9W A;  3O6I A;  4LZ8 A;  1QW0 A;  1SW2 A;  1QUK A;  4I8C A;  3KG2 A;  4KFQ A;  1NMU A;  2Q88 A;  3MQ9 A;  4ZE8 A;  1B6H A;  3QK6 A;  1LCT A;  3A3C A;  3V83 A;  3I6V A;  4F22 A;  2ZNS A;  3TDJ A;  2XXH A;  2PYY A;  1JEV A;  3PUW E;  2ZYM A;  2XWV A;  1LB9 A;  4GF8 A;  1B7H A;  1IXI A;  5ESY A;  4ZZA A;  2B4L A;  1SW1 A;  4JSD A;  2ANJ A;  5L9M A;  2QVU A;  4DZ1 A;  4N6D A;  1LFI A;  4DE8 A;  3RNN A;  4EF2 A;  1JW1 A;  2DE4 A;  1II5 A;  5ICT A;  1URG A;  2QPQ A;  2V3T A;  3GLB A;  4N8G A;  2R8T A;  3E79 A;  1MH4 A;  3UK4 A;  3CHG A;  1NUZ A;  2DWH A;  2OX3 A;  4QRZ A;  2GHB A;  2I0B A;  2R71 A;  5I2N A;  4OXV A;  1DSN A;  3SKP A;  3S9L C;  3O6G A;  3S2V A;  3RLF E;  2F7C A;  1RDY A;  1FSA A;  3FJG A;  3UP9 A;  4BDL A;  3IJX B;  4RPO A;  4ESW A;  2Y7W A;  5IAI A;  3L6H A;  3I5O A;  5FHN A;  2F7A A;  2RCA A;  4GIZ A;  4ZZE A;  2X7Q A;  4C0R A;  5I84 A;  1B40 A;  1B3G A;  2VPN A;  3MP8 A;  2ZYO A;  1A40 A;  1B05 A;  1K9Y A;  1D9Y A;  3FJM A;  2O6A A;  2WYP A;  4GL8 A;  4MHF A;  1N3X A;  1P1W A;  2ALU A;  3C31 A;  2Q2C A;  1YXI A;  5I5P A;  1B7U A;  3HO7 A;  3G7W A;  4XTC Q;  1GGG A;  4LA9 A;  2R9J A;  1H45 A;  2HZL A;  1DOT A;  2VPO A;  5EYF A;  4NF5 B;  4PAK A;  4QXD A;  1MS7 A;  1XT8 A;  4RJZ A;  4WEP A;  3RY3 A;  4R73 A;  4ECF A;  5H8N A;  1DTZ A;  2FIX A;  2I6E A;  3CRB A;  4NWC A;  3MJN A;  3Q29 A;  1BTJ A;  3MAM A;  3MC2 A;  1LAF E;  5CRY A;  2B4M A;  4U23 A;  5DVI A;  2ONK E;  1ATG A;  3B6T A;  2Y7I A;  2H99 A;  2VOZ A;  3H03 A;  2O1L A;  4GWZ A;  3T9X B;  4AS4 A;  1VDW A;  3DM0 A;  4P0I A;  5ELV A;  3FVO A;  3K0V A;  2XXQ A;  3MVX A;  2NUV A;  3LUZ A;  4GL0 A;  4ELQ A;  5I56 B;  4PFW A;  5FBP A;  1NV6 A;  2RC7 A;  4Q30 B;  4XKR A;  1I6Q A;  3CG1 A;  2XX9 A;  2WBB A;  3IFC A;  4OET A;  1QVS A;  1B46 A;  3C34 A;  4OYV A;  4G68 C;  5TP9 A;  2ESN A;  5ITP A;  4IGR A;  3OEL A;  3EPE A;  3NOH A;  4OEU A;  1N7W A;  2CEY A;  4DXB A;  2DSF A;  2HXR A;  5H8F B;  3RPL B;  4PDD A;  1H44 A;  3EKI A;  4MNC A;  2F78 A;  3G3F A;  2F6P A;  4LON B;  4MLQ A;  4EUO A;  3TTL A;  1JVY A;  1IIW A;  5ET8 A;  4O3A A;  2ZYN A;  1NNF A;  4TLM B;  3H6U A;  3K2D A;  3BKI B;  3B50 A;  3QYT A;  2QJE A;  5DTB A;  1Q35 A;  1JQF A;  3ROJ A;  4OVP A;  3M3L A;  4TQU Q;  3T9U A;  1JET A;  3H6T A;  3CR9 A;  1BLF A;  1DMB A;  1NUX A;  1MQH A;  1B1H A;  2H4I A;  2ONS A;  1FTO A;  3TQL A;  2I3V A;  4QFK A;  2A5S A;  5AA1 A;  1WVJ A;  4ZEB A;  1ZBM A;  4ELO A;  4QHQ A;  5FHO A;  1UTH A;  1INP A;  2I48 A;  4H1X A;  5I57 A;  3MST A;  4RK9 A;  3MWB A;  1NH7 A;  4JWX A;  4NMY A;  4F2Q A;  4X8R A;  4GWU A;  3G3G A;  4FED A;  1POT A;  4O94 A;  1N7X A;  4N81 A;  1Y1M A;  1JEU A;  4XKN A;  1PDA A;  4Q0C A;  3CG3 A;  3HST A;  3FXB A;  1FPJ A;  1AL3 A;  3PPR A;  3GZG A;  3S4U A;  2GFE A;  2Y5L A;  1MXW A;  4ZEF A;  4FIM A;  3ILT B;  3P7I A;  1GV8 A;  3FV1 A;  1MRP A;  2GRV A;  3KJT A;  4RNS A;  4N17 A;  3GBB A;  3AXF A;  3JYR A;  2W7Y A;  1XC1 A;  1LB8 A;  4GFR A;  4I40 A;  4N07 A;  3IB1 A;  5DW8 A;  3VVF A;  4POW A;  4U4X A;  3MP1 A;  1IIT A;  3LSW A;  4ONY A;  1B9J A;  4PFB A;  1AIV A;  3V8X B;  4R6K A;  4YZZ A;  4RPN A;  3E9X A;  4OHN A;  4IO4 A;  1WOD A;  4P1L A;  4C1T A;  1JVX A;  2F34 A;  5EHS A;  4KCC A;  5I3S A;  3U65 A;  1Y4C A;  1NV5 A;  4NF8 A;  1FQB A;  3D4G A;  1HSJ A;  4PF8 A;  3KOS A;  4NF4 B;  4LZ5 A;  4KPT A;  1I6B A;  4Q8R A;  5HM4 B;  1Y9U A;  1LBC A;  5CMB A;  2YJP A;  3HFU A;  2B65 A;  4ZEK A;  2V93 A;  2KR0 A;  2DXY A;  2QRY A;  2XHD A;  1MQD A;  3B7D A;  5F1Q A;  4MCO A;  1XHY A;  4OES A;  2O7I A;  4KHZ E;  1HSL A;  1KA0 A;  1VSO A;  2WBD A;  1RYX A;  4GWY A;  1K9Z A;  5H8H A;  1NH8 A;  3TTK A;  4PBQ A;  4F1U A;  1UIV A;  4XFE A;  5JK4 A;  2A5T B;  1FBP A;  2NXO A;  3H6W A;  3LV0 A;  4NF0 A;  3T22 A;  1M5B A;  3KFM A;  4H46 A;  3TQW A;  1A54 A;  3ECR A;  4P0G A;  4X04 A;  3KC0 A;  2CZK A;  1MM7 A;  1NNT A;  3O29 A;  4MAG A;  3K1M A;  2X7P A;  1Y20 A;  2PCR A;  1B3L A;  2F5X A;  3T1B A;  1FBH A;  2O1M A;  3C4M A;  4F3S A;  5L9S A;  3BFU A;  2ZZW A;  1IMB A;  1UTB B;  1ZU0 A;  2CZI A;  1B3H A;  4KYD A;  1FQA A;  5AA2 B;  4GWS A;  2XXK A;  1DCU A;  1MY4 A;  4HE1 A;  1FTL A;  5A5X B;  1QUL A;  4O3B A;  5F24 A;  2X26 A;  2XWO A;  4KI0 E;  3TMG A;  2VHA A;  2H9B A;  1FQF A;  4K3F A;  2GQ1 A;  3OSQ A;  4E0W A;  3USD A;  4MF3 A;  3G3K A;  3MUQ A;  1S50 A;  3T9H B;  1D3K A;  3KSJ A;  4PFT A;  1GVC A;  2HZK A;  5FTI A;  1XS5 A;  3EHS A;  4Z7E A;  3OO9 A;  5I58 B;  1EZP A;  3IOV A;  1IXG A;  3FXU A;  2G29 A;  4N13 A;  3VE1 B;  4IO6 A;  4N8Y A;  2AL5 A;  5H8S A;  4OA4 A;  2HEU A;  2QMW A;  2F35 A;  3WAE A;  4NF6 B;  1H3D A;  2IA4 A;  3LC8 A;  4JVD A;  4DCY A;  3CI8 A;  2B3B A;  3LSF B;  1DPE A;  4ZS9 A;  2BJI A;  4EDP A;  2THI A;  2I49 A;  3FVG A;  2V3U A;  3E3K A;  2QMX A;  4MLV A;  3SEV A;  1LEV A;  2DWI A;  5B70 A;  1TFD A;  4PET A;  2ONR A;  3HHG A;  2Q89 A;  3CFL A;  4PF6 A;  1YAE A;  5CM6 A;  4F1Y A;  2ZZV A;  4ZEI A; 
#chains in the Genus database with same CATH homology
 3PMV A;  2E1S A;  3FUZ A;  4F2O A;  3HV1 A;  2H25 A;  2KLF A;  1MY3 A;  3UGW A;  2XXW A;  3K1N A;  5TU0 A;  3OD7 A;  3MZB A;  4U21 A;  4NF5 A;  1B1X A;  3W9V A;  3U93 A;  1NNP A;  2UVH A;  1EU8 A;  3U94 A;  2Z22 A;  3TCH A;  4G77 A;  2LAO A;  5JTY B;  5CMM A;  3UA8 A;  3EN3 A;  4EQ7 A;  1B5H A;  1MPC A;  1SW4 A;  3IOU A;  2Z8D A;  5L8D A;  3C33 A;  1LLS A;  1OMP A;  3SES A;  4ZE9 A;  3OEM A;  1XVX A;  3DEL B;  2XX7 A;  3CFX A;  1H76 A;  3G3J A;  2YPN A;  4YKJ A;  2VP1 A;  1D4N A;  5B7D A;  5DEX B;  1XVY A;  4ISU A;  4NTL A;  4R9F A;  4ELR A;  1EZO A;  1SYH A;  3PPO A;  3LSX A;  1A99 A;  3PPP A;  3RUM A;  1F9B A;  4NE4 A;  1FTM A;  5KZT A;  1D9V A;  5AA2 D;  3PMX A;  4OZ9 A;  3FXR A;  5ITO A;  3C9H A;  5H8F A;  4DXC A;  2XD3 A;  2XXY A;  3I3V A;  5ISU A;  2M8C A;  3VLW A;  1P1O A;  3EHU A;  3UOR A;  1M5C A;  1NKX A;  1P1N A;  3U8Q A;  1B5J A;  2FA7 A;  4RXL A;  3M3F A;  3RPW A;  1A7L A;  5H8Q B;  3PUV E;  1FQC A;  1SDX A;  5AE4 A;  3CVG A;  4IO5 A;  4R9G A;  5KDT B;  1CB6 A;  3QUJ A;  4QFP A;  1ELJ A;  1UIU A;  4MH5 A;  5DVF A;  1R6Z A;  2PX1 A;  4OFL A;  1M5E A;  4ELP A;  1AH5 A;  4HCW A;  4OFO A;  4QFL A;  1Y3Q A;  2XXR A;  3N5L A;  1CE2 A;  4YAH X;  2DE3 A;  4G8H A;  5KCJ A;  3FGS A;  4XKQ A;  3TYH A;  4QSC A;  3IL1 B;  4JWY A;  4WED A;  1N04 A;  4FEC A;  1N76 A;  2OK2 A;  1JNF A;  4GOT A;  3TKD A;  3MPK A;  5CBR A;  3MW0 A;  4X48 A;  4GXS B;  4HS7 A;  1MXV A;  2GH9 A;  2UVI A;  1QUJ A;  2V25 A;  3ZKK A;  5EHM A;  2I4C A;  1POY 1;  3ONM A;  3EHT A;  1MH3 A;  4U4S A;  4YKK A;  3ZS6 A;  3TEL A;  3MP6 A;  3H3G A;  4R6Y A;  4OEN A;  1H43 A;  3FVK A;  3O97 A;  2Y7P A;  1HSE A;  3F11 A;  3FAS A;  4YKP A;  2WKY A;  3PPN A;  4H65 A;  3CIJ A;  5CMK A;  1XOC A;  3KBR A;  4POX A;  2OLB A;  3K4U A;  2VGQ A;  3FD3 A;  4I62 A;  4F39 A;  1LGB C;  3H4Z A;  3LBS A;  5CC2 A;  3IJO B;  5I59 A;  2OCU A;  2F36 A;  4QFN A;  1SI0 A;  3T96 B;  3RN8 A;  2VD3 A;  4R74 A;  3SEW A;  3DP8 A;  4F19 A;  1M5D A;  1R1N A;  4OEV A;  3PGF A;  4YKI A;  4G2Z A;  4U1Z A;  2UXA A;  1FQD A;  3IOR A;  1OVT A;  1SW5 A;  2ZXT A;  3IO4 A;  4X1B A;  4F3G A;  2QS3 A;  4P11 A;  3K02 A;  3M3K A;  1FCK A;  1AOV A;  3N6T A;  4RYA A;  4Z0I A;  1PB8 A;  3OEN A;  4FOR A;  2DQV A;  4IY6 A;  2HAV A;  1Y3P A;  4U22 A;  1EZ9 A;  4ND9 A;  3HN0 A;  1S9T A;  1B4H A;  2RF1 A;  3EQ1 A;  4FAJ A;  4YMA A;  5AA2 A;  3N6U A;  3T66 A;  3TUS A;  5I2K B;  3R26 A;  3GXA A;  4MBP A;  1ZKB A;  4UA8 A;  4M4G A;  3U1O A;  4F31 B;  5AA4 B;  2D3I A;  2OWT A;  1IXC A;  1B3F A;  4EQ9 A;  2ZYK A;  3G3I A;  4IGT A;  3LSL A;  5TPA B;  1LAH E;  2UVJ A;  2I58 A;  1VR5 A;  4DDD A;  2HQ0 A;  3BBR A;  3KZG A;  4G68 A;  4JDF A;  2RC9 A;  5TP9 B;  4NED A;  4XKP A;  2DP8 A;  3IB2 A;  3VXB A;  1N84 A;  4EF1 A;  1B2H A;  4LVQ A;  1SBP A;  4Q5T A;  2AIX A;  2G93 A;  4LAT A;  1MY0 A;  1FTK A;  4NF6 A;  1VE4 A;  2H98 A;  2OJT A;  4I9D A;  1FQE A;  4GVO A;  2IEE A;  1MG1 A;  3SER A;  3N26 A;  4X1D A;  4H67 A;  3RQT A;  2DE2 A;  4KQP A;  2HXW A;  2DVZ A;  3S9E A;  4QF9 A;  4N6P A;  4DXU A;  3LR1 A;  3PD9 A;  3IAZ A;  1UTH B;  1Y3N A;  1DTG A;  2OBG A;  1O64 A;  3SDF A;  2OZZ A;  5I57 B;  5M2V A;  3TEP A;  5FTH A;  3KSX A;  2NVU B;  3CSG A;  2Q8J A;  1ANF A;  4OMB A;  3VLV A;  5JTY A;  4GXA A;  4BDR A;  4YB6 A;  3S9M C;  1MM6 A;  2HFB A;  3CFZ A;  2XX8 A;  4F3P A;  3KJ7 A;  1I69 A;  1NL5 A;  2Y7R A;  4KD5 A;  3O28 A;  2XD2 A;  3OXN A;  1B4Z A;  3JZJ A;  4FJP A;  4H6D A;  3UN6 A;  2YLN A;  4LQ5 A;  4THI A;  4KYE A;  4UAC A;  2V3Q A;  1I6A A;  3MVY A;  1QKA A;  3TCG A;  1B0L A;  3C32 A;  1LST A;  3O66 A;  4HTG A;  4EQB A;  5CBS A;  2QL3 A;  5BUU A;  1JW4 A;  3K01 A;  2P0S A;  4U2R A;  4F3B A;  5K2Y A;  3VVD A;  3SET A;  4R75 A;  3H7M A;  3C36 A;  3OEK A;  4NF8 B;  3TPA A;  4OQO A;  3IB0 A;  5IKB A;  2O51 A;  1TWY A;  3O9P A;  1IEJ A;  4KR5 A;  4H5F A;  3ILU B;  2PMS A;  3B6W A;  3W15 C;  4LP2 B;  1WDN A;  1J1N A;  1B0H A;  1MPD A;  4RA1 A;  3FJ7 A;  2Q2A A;  1O63 A;  3S9N C;  3IR1 A;  2H5Y A;  2F97 A;  3FXQ A;  3H06 B;  2Y84 A;  3MZ9 A;  4ZEC A;  3IX1 A;  4OER A;  1DPP A;  3PMW A;  4LZ7 A;  4OWD A;  5KDT A;  1OQH A;  4F29 A;  2HAU A;  4MFI A;  1MY2 A;  1VFD A;  1FW0 A;  4DCX A;  3IK6 B;  4IB2 A;  3K6U A;  3HHF A;  3FAT A;  4YU0 A;  2UVG A;  4XXU A;  2O84 X;  1M5F A;  1QKB A;  4PQJ A;  2REG A;  3FZV A;  1Y4T A;  2P1S A;  2XXT A;  3ODB A;  3VFJ A;  3RGY A;  1B5I A;  1RYO A;  3VDF A;  1LCF A;  1N0T A;  5LOM A;  1L5T A;  1AMF A;  3MVZ A;  2R6G E;  3PUZ E;  4PFY A;  1MPB A;  3N94 A;  4QSE A;  4GRK A;  5I56 A;  2DWJ A;  2I0C A;  1IZ1 A;  1URS A;  3V89 B;  2QS1 A;  3TFL A;  1IXH A;  1ZJL A;  3OMB A;  3C35 A;  3BFT A;  4M1V A;  5CI5 A;  1RKM A;  2XXP A;  2GHA A;  3TOD A;  4H8I A;  2FNC A;  2FYI A;  1ZTY A;  4O3C A;  4H5G A;  1TT1 A;  4BLA A;  3WAF A;  2F7B A;  3Q28 A;  2QS2 A;  1LFG A;  1P1U A;  1BIY A;  2F6G A;  3OOA A;  4JWO A;  4AB5 A;  4JSO A;  3KN8 A;  4BDO A;  2RIN A;  2Z8E A;  2D21 A;  2PT1 A;  4YIC A;  1USY H;  3PD8 A;  2NWJ A;  5AA3 A;  3K1P A;  4IO7 A;  1Q1K A;  1GR2 A;  3MPL A;  4E0X A;  3MZ1 A;  4LUB A;  3PPQ A;  4ZED A;  3B6Q A;  1ZLQ A;  1EH3 A;  4R2B A;  5ICQ A;  2AYS A;  1USY E;  3K6W A;  3IOT A;  3EF7 A;  3QIM A;  2O7U A;  4BDN A;  1QUI A;  2RKM A;  2O68 A;  3Q25 A;  1IUD A;  3A09 A;  1A8E A;  1MQI A;  3O6H A;  4HCY A;  4YB5 A;  3MBP A;  1R9L A;  1SI1 A;  4NWD A;  1PB9 A;  5HPQ A;  3KOT A;  3TTM A;  3THI A;  4YMB A;  2PT2 A;  2Y7K A;  1US4 A;  4G4P A;  1B3E A;  3IO6 A;  5FHM A;  1OLA A;  3VLU A;  2XXU A;  1N3W A;  1ZMG A;  3MVW A;  2XXV A;  5F7V A;  5I2K A;  5I2N B;  1KWH A;  3PUX E;  4FEB A;  1MDP 1;  3TAJ A;  3DP6 A;  2UYE A;  3RTW B;  4H8J A;  3K00 A;  1S7Y A;  5AA4 A;  4X9T A;  3FVN A;  5TPA A;  3DLN A;  1A8F A;  1MXX A;  1SYI A;  2CMO A;  3H6V A;  3G3H A;  2O69 A;  4G8M A;  3A3U A;  3QAX A;  1YTV A;  2DOJ A;  3U72 A;  1MDQ A;  1OQG A;  4QSD A;  2PBW A;  3OO8 A;  3UIF A;  3OO7 A;  3TTR A;  4H0W A;  4NF4 A;  4IO3 A;  1MXU A;  4L17 A;  2DS9 A;  5J1D A;  4IO2 A;  2DXR A;  1OVB A;  3RTF B;  4JB7 A;  1JW5 A;  4LQ2 A;  1BP5 A;  4QFO A;  4GQO A;  2QSX A;  3KN3 A;  3TTN A;  4GLI A;  2A5T A;  1NFT A;  4F1V A;  5HBC A;  4KCD A;  3QXM A;  4GWO A;  1B52 A;  2Z23 A;  1SD3 A;  1GTK A;  5H8N B;  4AB6 A;  4ESX A;  1NNK A;  2CZL A;  1LFH A;  2Z8F A;  5JEI A;  4YB7 A;  2RCB A;  3GBA A;  4AQ4 A;  5KCJ B;  3DP4 A;  4I1D A;  1YCJ A;  4PE5 B;  3PV0 E;  1UTB A;  4HW8 A;  3ZSF A;  3VXC A;  1VFE A;  1YPN A;  1MXZ A;  1B7Z A;  3V5A A;  3O2A A;  5A5X A;  3M8U A;  3SEU A;  1MXY A;  2VD2 A;  3TZA A;  1QJM A;  4F18 A;  1P99 A;  1UQW A;  3OO6 A;  3OSR A;  3HCQ A;  4JBZ A;  4DLD A;  1PC3 A;  3QSL A;  2UYF A;  5I58 A;  4U1O A;  3RT6 B;  1Z7M E;  3K6X A;  4EXK A;  5BWJ A;  3PUY E;  3Q27 A;  3CSB A;  1MQJ A;  4XIG Q;  1BKA A;  3TCF A;  5K2X A;  3LUY A;  3E4R A;  4RY1 A;  4DIG A;  1P1Q A;  2P2A A;  2HCA A;  3FIR A;  1Y1Z A;  3FV2 A;  1A55 A;  4GD5 A;  1PB7 A;  2I3W A;  1LAX A;  1LAG E;  1TFA A;  1B58 A;  1LBB A;  1B51 A;  4JXI A;  1Z7N E;  1US5 A;  5DYH A;  1PBQ A;  3PU5 A;  5I59 B;  1O7T A;  3K6V A;  2DVC A;  4FE8 A;  2RC8 A;  4OFJ A;  2NOO A;  3VV5 A;  4ZDM A;  4FAT A;  3IOW A;  1SVX B;  2V84 A;  4TLL B;  1SQY A;  1OIB A;  2ZNU A;  2XXX A;  4TOZ A;  4BDQ A;  2I4B A;  3JV9 A;  3HPI A;  2QS4 A;  5L9O A;  4C1U A;  4WKM A;  3Q26 A;  1URD A;  2REJ A;  3QUF A;  4PFU A;  5DVJ A;  3U92 A;  2PVU A;  4G8N A;  5DT6 A;  3VVE A;  3SEX A;  3E13 X;  4PP0 A;  1ZIU A;  3T9V A;  3L6G A;  1T0K A;  1OLC A;  5DEX A;  3RT8 A;  2B3F A;  1PEB A;  2DYX A;  2XXI A;  2DWA A;  2ABH A;  2E0S A;  2D5W A;  3D4C A;  1B32 A;  5CMC A;  3KN7 A;  2ZMB A;  1TXF A;  4G68 B;  2BJJ X;  1FTJ A;  4WXJ A;  1MQG A;  3ZKL A;  1IQ7 A;  1MY1 A;  2AL4 A;  1PBP A;  4EXL A;  2Q9T A;  4R72 A;  3R6U A;  2ZNT A;  4R6H A;  3T93 B;  4RK2 A;  4R2F A;  3R7X A;  4OTE A;  5H8Q A;  1R9Q A;  2F8D A;  3KGC A;  4KYS A;  5H8H B;  3SEY A;  3KEI A;  4OVJ A;  4BDM A;  2OWS A;  4IY5 A;  3W9W A;  3O6I A;  4LZ8 A;  1QW0 A;  1SW2 A;  1QUK A;  4I8C A;  3KG2 A;  4KFQ A;  1NMU A;  2Q88 A;  3MQ9 A;  4ZE8 A;  1B6H A;  3QK6 A;  1LCT A;  3A3C A;  3V83 A;  3I6V A;  4F22 A;  2ZNS A;  3TDJ A;  2XXH A;  2PYY A;  1JEV A;  3PUW E;  2ZYM A;  1LB9 A;  4GF8 A;  1B7H A;  1IXI A;  4ZZA A;  1SW1 A;  4JSD A;  2ANJ A;  5L9M A;  4DZ1 A;  1LFI A;  4DE8 A;  3RNN A;  4EF2 A;  1JW1 A;  2DE4 A;  1II5 A;  5ICT A;  1URG A;  2QPQ A;  2V3T A;  3GLB A;  1MH4 A;  3UK4 A;  2DWH A;  4QRZ A;  2GHB A;  2I0B A;  2R71 A;  5I2N A;  4OXV A;  1DSN A;  3SKP A;  3S9L C;  3O6G A;  3S2V A;  3RLF E;  2F7C A;  3FJG A;  3UP9 A;  4BDL A;  3IJX B;  4RPO A;  4ESW A;  2Y7W A;  5IAI A;  3L6H A;  3I5O A;  5FHN A;  2F7A A;  2RCA A;  4GIZ A;  4ZZE A;  2X7Q A;  4C0R A;  5I84 A;  1B40 A;  1B3G A;  3MP8 A;  2ZYO A;  1A40 A;  1B05 A;  1D9Y A;  3FJM A;  2O6A A;  4GL8 A;  1N3X A;  1P1W A;  2ALU A;  3C31 A;  2Q2C A;  1B7U A;  3HO7 A;  3G7W A;  4XTC Q;  1GGG A;  4LA9 A;  2R9J A;  1H45 A;  2HZL A;  1DOT A;  5EYF A;  4NF5 B;  1MS7 A;  1XT8 A;  4RJZ A;  4WEP A;  3RY3 A;  4R73 A;  4ECF A;  5H8N A;  1DTZ A;  2I6E A;  3CRB A;  4NWC A;  3MJN A;  3Q29 A;  1BTJ A;  3MAM A;  3MC2 A;  1LAF E;  5CRY A;  4U23 A;  5DVI A;  2ONK E;  1ATG A;  3B6T A;  2Y7I A;  2H99 A;  2VOZ A;  3H03 A;  2O1L A;  3T9X B;  3DM0 A;  4P0I A;  5ELV A;  3FVO A;  3K0V A;  2XXQ A;  3MVX A;  2NUV A;  4GL0 A;  4ELQ A;  5I56 B;  4PFW A;  4Q30 B;  2RC7 A;  4XKR A;  1I6Q A;  3CG1 A;  2XX9 A;  4OET A;  1QVS A;  1B46 A;  3C34 A;  4OYV A;  4G68 C;  5TP9 A;  2ESN A;  5ITP A;  4IGR A;  3OEL A;  3EPE A;  4OEU A;  1N7W A;  4DXB A;  2DSF A;  5H8F B;  1H44 A;  2F78 A;  3G3F A;  2F6P A;  4LON B;  4MLQ A;  4EUO A;  3TTL A;  1JVY A;  1IIW A;  4O3A A;  2ZYN A;  1NNF A;  4TLM B;  3H6U A;  3K2D A;  3BKI B;  3QYT A;  2QJE A;  5DTB A;  1Q35 A;  1JQF A;  3M3L A;  4TQU Q;  3T9U A;  1JET A;  3H6T A;  3CR9 A;  1BLF A;  1DMB A;  1MQH A;  1B1H A;  2H4I A;  2ONS A;  1FTO A;  3TQL A;  2I3V A;  4QFK A;  2A5S A;  5AA1 A;  1WVJ A;  4ZEB A;  1ZBM A;  4ELO A;  4QHQ A;  5FHO A;  1UTH A;  2I48 A;  4H1X A;  5I57 A;  4RK9 A;  3MWB A;  1NH7 A;  4JWX A;  4NMY A;  4F2Q A;  3G3G A;  4FED A;  1POT A;  1N7X A;  1Y1M A;  1JEU A;  4XKN A;  1PDA A;  4Q0C A;  3CG3 A;  3HST A;  1AL3 A;  3PPR A;  3GZG A;  3S4U A;  2GFE A;  1MXW A;  4ZEF A;  4FIM A;  3ILT B;  3P7I A;  1GV8 A;  3FV1 A;  1MRP A;  2GRV A;  3KJT A;  4RNS A;  3GBB A;  3AXF A;  3JYR A;  2W7Y A;  1XC1 A;  1LB8 A;  4GFR A;  4N07 A;  3IB1 A;  3VVF A;  4POW A;  4U4X A;  3MP1 A;  1IIT A;  3LSW A;  4ONY A;  1B9J A;  1AIV A;  3V8X B;  4R6K A;  4YZZ A;  4RPN A;  3E9X A;  4OHN A;  4IO4 A;  1WOD A;  4C1T A;  1JVX A;  2F34 A;  5EHS A;  4KCC A;  1Y4C A;  4NF8 A;  1FQB A;  3D4G A;  1HSJ A;  3KOS A;  4NF4 B;  4LZ5 A;  4KPT A;  1I6B A;  4Q8R A;  5HM4 B;  1Y9U A;  1LBC A;  5CMB A;  2YJP A;  2B65 A;  4ZEK A;  2V93 A;  2DXY A;  2QRY A;  2XHD A;  1MQD A;  3B7D A;  5F1Q A;  1XHY A;  4OES A;  2O7I A;  1HSL A;  1VSO A;  4KHZ E;  1RYX A;  5H8H A;  1NH8 A;  3TTK A;  4F1U A;  1UIV A;  5JK4 A;  2A5T B;  2NXO A;  3H6W A;  3T22 A;  1M5B A;  3KFM A;  3TQW A;  1A54 A;  3ECR A;  4P0G A;  1MM7 A;  1NNT A;  3O29 A;  3K1M A;  2X7P A;  1Y20 A;  1B3L A;  2F5X A;  2O1M A;  3C4M A;  4F3S A;  5L9S A;  3BFU A;  1UTB B;  1ZU0 A;  1B3H A;  4KYD A;  1FQA A;  5AA2 B;  1MY4 A;  1FTL A;  5A5X B;  1QUL A;  4O3B A;  2X26 A;  4KI0 E;  3TMG A;  2VHA A;  2H9B A;  1FQF A;  4K3F A;  3OSQ A;  4E0W A;  3USD A;  4MF3 A;  3G3K A;  3MUQ A;  1S50 A;  3T9H B;  1D3K A;  3KSJ A;  4PFT A;  1GVC A;  2HZK A;  5FTI A;  1XS5 A;  3EHS A;  4Z7E A;  3OO9 A;  5I58 B;  1EZP A;  3IOV A;  1IXG A;  3FXU A;  2G29 A;  4N13 A;  3VE1 B;  4IO6 A;  2AL5 A;  5H8S A;  2HEU A;  2QMW A;  2F35 A;  3WAE A;  4NF6 B;  1H3D A;  2IA4 A;  3LC8 A;  4DCY A;  3CI8 A;  2B3B A;  3LSF B;  1DPE A;  4ZS9 A;  4EDP A;  2THI A;  2I49 A;  3FVG A;  2V3U A;  3E3K A;  2QMX A;  4MLV A;  3SEV A;  2DWI A;  5B70 A;  1TFD A;  4PET A;  2ONR A;  3HHG A;  2Q89 A;  3CFL A;  1YAE A;  5CM6 A;  4F1Y A;  4ZEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...