1QUJA

Phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
321
structure length
321
Chain Sequence
EASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRAGGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphate transport
molecule keywords PHOSPHATE-BINDING PROTEIN
publication title Modulation of a salt link does not affect binding of phosphate to its specific active transport receptor.
pubmed doi rcsb
source organism Escherichia coli
total genus 106
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 1995-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qujA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qujA02
1B7HA 2G93A 5L9SA 3CFLA 4KYSA 4EF2A 3R26A 1PC3A 4Q0CA 2AL5A 1N7XA 4YKIA 2QL3A 3CG1A 3P7IA 3KZGA 5FTHA 3K1MA 4YMAA 4NF6B 1PB8A 3S9EA 4IO3A 2XXWA 2I3VA 3ILUB 4Z7EA 3TZAA 3OD7A 3HN0A 3HCQA 1POTA 2UVHA 4Z0IA 3VVEA 2XXRA 1R6ZA 2XHDA 4QSCA 1AIVA 4XKPA 4FIMA 2DWJA 2UXAA 3FV2A 2Z8FA 3U92A 3U1OA 1MPBA 3RN8A 1WODA 2OBGA 1VFDA 2QSXA 5TU0A 1BTJA 3RY3A 5I57A 4RNSA 2DP8A 1N3WA 3L6GA 2A5SA 1R9QA 2RC8A 4NF5B 4WEDA 4C1UA 3R7XA 4FATA 5CMKA 3MVWA 3FASA 3K4UA 4NF4B 3GZGA 4YZZA 2PBWA 1PB9A 4QFNA 1I6BA 1N04A 3G3FA 3T9UA 4NEDA 4OFJA 1N84A 4FAJA 3MWBA 3DP6A 5I84A 4MBPA 1LBBA 3IAZA 5DTBA 2I6EA 4ZEKA 1H76A 5ICTA 1AL3A 2F6GA 4DCYA 1A54A 1II5A 1O7TA 4GLIA 2XX9A 2Y7RA 2QJEA 1JEUA 4LONB 4N07A 1EZOA 1H3DA 4BLAA 5EHMA 5DYHA 3E9XA 4KYEA 4LQ2A 3W9WA 3G3IA 3GBBA 3AXFA 3ILTB 5DVIA 5JK4A 3HO7A 3VLWA 4QRZA 5I58B 5AA4B 3MW0A 3L6HA 4ZEFA 3DM0A 3UP9A 2D3IA 4R6KA 4IGTA 4G2ZA 3JYRA 3RTFB 4G77A 3IOWA 2ZNSA 3THIA 1IXIA 3FJMA 3RPWA 2XXHA 3CI8A 4G68A 1MQJA 2BJJX 4HTGA 4XKNA 3OOAA 3SEWA 2V84A 4F3BA 3PUYE 4GRKA 4GWOA 4BDRA 3V89B 1PBQA 4QFKA 3U8QA 4K3FA 2Q8JA 5TPAA 4TQUQ 3U93A 1TFAA 4ELRA 4RPNA 2VHAA 1Y1MA 1M5DA 5I56B 1FTKA 1M5FA 3W15C 1CE2A 1UTHA 5AA2A 3PUXE 4U23A 3PMWA 2CZLA 4ZZAA 3KN8A 2P2AA 3CRBA 4QSDA 2OJTA 5A5XA 4MLVA 3B7DA 3PPQA 3IR1A 1DOTA 2V3TA 1Y20A 4R6HA 4ZEDA 1QVSA 3KJ7A 4QF9A 1GVCA 1I6QA 2HAUA 1CB6A 4XKQA 1JVYA 5HPQA 5H8QB 2H5YA 2REJA 4XXUA 3MUQA 2B3BA 3K00A 2OZZA 1ANFA 2ZNUA 5K2XA 3GXAA 2O69A 4OZ9A 3M3FA 1FQDA 1N3XA 4KQPA 4GXAA 1B46A 4GVOA 4OQOA 4ELPA 1LAGE 3ODBA 4PETA 2GH9A 4F1UA 1B4ZA 1I69A 3K2DA 4PP0A 1O63A 2DXYA 4R6YA 3VV5A 3VXCA 3UORA 1SI0A 2VGQA 5HBCA 2V93A 1MM6A 2ALUA 1XVYA 3IOUA 3QXMA 1A55A 3TKDA 4KYDA 2H4IA 3SEXA 3FVOA 1FTLA 3D4GA 1Z7ME 2UVGA 3A09A 5TP9B 1MXUA 3TCFA 4EQBA 3MP6A 2R9JA 4RY1A 5F7VA 3CFZA 3T96B 4ISUA 2I49A 2XXTA 3HV1A 4Q30B 1JW1A 3LC8A 1QUKA 1LAHE 3K1NA 4NF5A 2RF1A 3MZ9A 3QIMA 4TOZA 1IXGA 4OFOA 2RC7A 1A99A 3RLFE 3U72A 1EU8A 1LB9A 1MXVA 3GLBA 1ZIUA 3EHUA 3CIJA 5L9OA 3G3HA 1RYOA 1B9JA 2Y7WA 4JWOA 1VSOA 2B3FA 4ECFA 1B5HA 1SYIA 2FYIA 2GHBA 1MRPA 3FXQA 2F78A 5KCJA 3VVDA 1SBPA 2PT2A 4NWDA 1BIYA 2DWHA 2XXQA 3UGWA 1MY3A 4O3BA 1SW5A 1GTKA 4FE8A 3IJOB 3TTNA 1P1UA 4EXKA 5I58A 3E3KA 5AA4A 4DIGA 1FTMA 4R2BA 1JNFA 5AA2B 3OELA 1SW2A 3EN3A 1MXWA 3H4ZA 4N13A 3HPIA 3VXBA 1F9BA 1PEBA 2YLNA 3MC2A 2R71A 3SEUA 1P1WA 2I4BA 3B6QA 5H8HB 1B6HA 1Y1ZA 1MG1A 4AB6A 5FHOA 2HEUA 3O2AA 3M8UA 3TTKA 3KN3A 1GR2A 3MVYA 1MXXA 2UYFA 4TLMB 2ZYMA 3WAFA 2Z22A 2QMWA 5ITOA 4JWXA 2DYXA 4YMBA 1B51A 1URGA 3B6WA 3U94A 3SEYA 3TTRA 3EF7A 4O3AA 1B5JA 2X26A 2O1LA 4KI0E 5I56A 4ZEIA 1MY4A 2RC9A 3CSGA 4DXBA 2M8CA 4JWYA 2V25A 2F34A 4JDFA 2NWJA 3K6XA 3FZVA 2DQVA 1Y4TA 2R6GE 5KZTA 3CFXA 3QSLA 2A5TB 2HQ0A 2XD3A 2THIA 5JEIA 3T9HB 3O66A 2REGA 4HCYA 5M2VA 4R9GA 1EZ9A 4ZECA 1Y3PA 1P99A 1B0LA 4WXJA 5CRYA 1SI1A 4PFWA 2CMOA 5DEXA 2F36A 3T9VA 1GV8A 3OO9A 1B3FA 2RCBA 3CVGA 4R74A 2FA7A 5CI5A 4JB7A 3SDFA 4OXVA 5H8QA 1HSEA 3RUMA 2XXXA 4IB2A 2XXIA 3TPAA 2Y84A 4TLLB 5ITPA 1QUIA 3E4RA 3RGYA 1D4NA 3D4CA 2I3WA 1H44A 1UTBB 5L9MA 3TQLA 4OEVA 1ELJA 1HSJA 2ONRA 5ICQA 3C32A 3EQ1A 4WEPA 1FTOA 4MLQA 4LQ5A 5KDTB 2GFEA 3JV9A 4DLDA 3IJXB 4MH5A 5IAIA 2UVIA 1JQFA 4AB5A 3TTLA 2DXRA 1DPEA 1FQFA 5HM4B 4ONYA 2QS2A 5KCJB 5H8SA 4UACA 5TP9A 4XKRA 1TXFA 1YTVA 1P1NA 2I0CA 4H67A 5BUUA 1MDQA 1B3HA 4G8NA 3K1PA 1Q35A 4YKPA 3S9LC 5FTIA 3VLVA 3WAEA 3PU5A 2F7BA 3MQ9A 1MH4A 3IB0A 1DTGA 3FUZA 3VVFA 1MPCA 1NKXA 4YKJA 4FECA 3S9NC 4JBZA 3H06B 3MZBA 5ELVA 3I6VA 4LZ7A 3IL1B 3A3UA 5CC2A 4QHQA 1XS5A 3G3GA 5FHNA 1B0HA 3VDFA 2O1MA 3HHFA 2ONKE 1B5IA 2OWSA 1N76A 5CMMA 4R2FA 1TFDA 4E0WA 3T22A 1QULA 4PE5B 3PGFA 1N7WA 3S2VA 1ZKBA 2PVUA 1Q1KA 2PYYA 4P0GA 4RYAA 3EPEA 3BBRA 4KCCA 1NNKA 3V83A 3PPOA 2ABHA 4N6PA 4U4SA 4OHNA 3N5LA 4QFOA 3UA8A 1XT8A 3C33A 4KCDA 5JTYB 4EF1A 3CSBA 4GXSB 2VP1A 3N6TA 2HXWA 1SD3A 1B2HA 3T93B 3I3VA 3K6WA 3LSWA 4YB7A 3K0VA 1D9YA 1B7ZA 4X9TA 1QKAA 4UA8A 3CR9A 3R6UA 4GIZA 3QUFA 4OERA 2OCUA 1IQ7A 2YPNA 2DVZA 4FEBA 3ZKKA 1JW5A 2O7IA 1OIBA 4OENA 4JXIA 2DE2A 5CMBA 4YICA 3QK6A 5H8HA 1EZPA 2XX7A 2Q88A 2HCAA 4KHZE 1AOVA 5BWJA 2LAOA 3H6TA 4NF8B 2B65A 1MXZA 2YJPA 2AYSA 4DDDA 3KSJA 1QJMA 1B4HA 5DEXB 3K02A 2DVCA 4ZZEA 5I59A 1LAFE 3FD3A 5CMCA 5DVFA 1US4A 1DPPA 3QUJA 1MH3A 1SYHA 1OVBA 3PV0E 1USYH 2Q9TA 4XIGQ 3MPLA 1FQEA 3OEMA 1IEJA 1SDXA 1XHYA 1JW4A 4R73A 3IOVA 4EXLA 1Y9UA 2NVUB 1LCTA 4F3SA 2IEEA 2VD3A 3C35A 5I2NB 2VOZA 5DVJA 4IY6A 3PMXA 3FGSA 1OQHA 1MQHA 2P1SA 1SQYA 1LLSA 3IX1A 2A5TA 4GL8A 3MAMA 2E1SA 2WKYA 1NH7A 1H43A 1B32A 3CG3A 1MQIA 1Y4CA 2ANJA 3KFMA 2ZNTA 4ZE9A 4ZE8A 4POXA 2Z23A 1SW4A 5K2YA 4OESA 3OSRA 4ESWA 1A8EA 3IK6B 4Q8RA 1OLCA 4H5FA 4FJPA 2O6AA 2XXPA 1B05A 1TT1A 4F22A 3IB2A 3IORA 3KOSA 1UTBA 2Z8DA 3MVXA 4LZ8A 3O6IA 3FXRA 4P11A 5KDTA 1MQGA 3Q27A 3BKIB 1P1QA 2IA4A 2W7YA 4LP2B 5H8NB 4H8IA 4I62A 4ZS9A 4EQ7A 4OETA 3MP8A 4U4XA 2XXUA 2Q89A 3HHGA 3S9MC 2E0SA 2OWTA 2ESNA 2F35A 2ZYOA 2NXOA 4RXLA 5I2KB 1YAEA 1D9VA 4U22A 5B7DA 4G68C 1AH5A 4X1DA 2DS9A 1Z7NE 3LUYA 3PD9A 1VR5A 1OVTA 4NWCA 1R1NA 1UQWA 4M4GA 4E0XA 3O97A 3I5OA 1B52A 3O6HA 4X48A 1SW1A 1OLAA 3PD8A 2P0SA 1MM7A 1ZU0A 2V3UA 4AQ4A 5H8FB 2O7UA 2F5XA 3FV1A 1IXHA 3KGCA 1MXYA 1NNPA 5I59B 1PB7A 1I6AA 1MY1A 1YPNA 3DLNA 3OEKA 4QFLA 2UVJA 1VFEA 2XXYA 3N6UA 1LGBC 2H9BA 1NNFA 2PT1A 3G7WA 5ISUA 1XOCA 2ONSA 1L5TA 1FTJA 4GOTA 5JTYA 4PQJA 4R75A 4HCWA 1A40A 2X7QA 1US5A 4PFTA 1YCJA 2XD2A 2HZKA 4F1YA 4IY5A 2H25A 1DMBA 4RJZA 1ZJLA 1MQDA 1OMPA 4EUOA 4FORA 3EHTA 2F7CA 2RKMA 3USDA 4IO5A 3OMBA 4H1XA 3OSQA 3TUSA 4ZEBA 4F39A 4NF8A 1D3KA 1MDP1 1T0KA 1BP5A 4U21A 1WVJA 4PFUA 2I0BA 2X7PA 3MVZA 3C9HA 3TODA 3ZS6A 2HZLA 3IO6A 3C36A 4NMYA 1A8FA 4OMBA 2Y7IA 1KWHA 1POY1 4KR5A 3MPKA 3O9PA 1RKMA 4G8MA 4HW8A 1NMUA 4GL0A 4YB5A 3PPRA 1UIUA 5I2NA 4L17A 3E13X 4RK9A 2DE3A 1GGGA 2DE4A 4GD5A 4U2RA 3T9XB 3PPPA 4WKMA 3RT8A 4U1OA 1QKBA 2DOJA 4U1ZA 3OO7A 1NFTA 1ZMGA 3GBAA 4OEUA 2PMSA 2AL4A 4THIA 3RTWB 2RINA 2KLFA 1N0TA 3PUZE 1TWYA 2VD2A 2F8DA 4IO7A 1ATGA 4EDPA 5AA2D 4HS7A 2AIXA 1LBCA 2I48A 3O28A 1O64A 4MFIA 3TCHA 3KEIA 4BDOA 1S7YA 2F7AA 3H7MA 4NE4A 4BDNA 1LFGA 4H8JA 4IO6A 2V3QA 3C31A 2O84X 2ZMBA 1XVXA 4YKKA 3T66A 3O6GA 4ZDMA 3ECRA 2F6PA 2G29A 4ND9A 2QRYA 3FATA 3M3KA 1BKAA 4I8CA 5F1QA 1AMFA 4I9DA 3VE1B 4KD5A 2XXVA 3H03A 5CM6A 5H8NA 3H3GA 3K6UA 3TEPA 4F18A 4NTLA 5DT6A 1MS7A 1MPDA 3LBSA 2PX1A 3KSXA 1IZ1A 4F31B 3RNNA 1URSA 4LZ5A 2Z8EA 1LFHA 1S9TA 2QS3A 3SERA 5I2KA 1FCKA 3B6TA 3C4MA 3EHSA 1IXCA 4F29A 3DP8A 2QMXA 1B1XA 4RK2A 1IITA 1B40A 1MY0A 2HAVA 2GHAA 3G3JA 4IO2A 5L8DA 3N94A 5B70A 1S50A 1LSTA 1JVXA 1B3EA 3BFUA 4OTEA 4DXUA 3Q25A 3Q26A 4GFRA 3QYTA 4G4PA 1URDA 1ZBMA 4R9FA 1MY2A 3HSTA 4IGRA 4DZ1A 5H8FA 4LATA 3K01A 3VLUA 4P0IA 4F3PA 1OQGA 3KG2A 1B1HA 3Q29A 3O29A 1BLFA 5AA3A 4XTCQ 5AE4A 4C1TA 3FJ7A 4DCXA 1QUJA 1NNTA 5I57B 4LA9A 1EH3A 3OXNA 3KJTA 5EHSA 4BDMA 2ZYNA 1R9LA 3TCGA 2H98A 1NL5A 2FNCA 2DWAA 3SESA 4LUBA 3SKPA 3N26A 3PPNA 4BDLA 3BFTA 2OK2A 2D21A 1LCFA 1WDNA 4YU0A 2Y7KA 1LB8A 3V8XB 4F2QA 3LSLA 3ZKLA 3TELA 4FEDA 4NF6A 3KN7A 5AA1A 4DE8A 4EQ9A 4H5GA 4OYVA 3FXUA 3M3LA 3SETA 3UK4A 2DSFA 1FQAA 5LOMA 1M5EA 1B3LA 4R72A 1LAXA 3OO6A 3F11A 3OO8A 4IO4A 2Q2CA 2DWIA 4MF3A 4QFPA 3DELB 1B7UA 1Y3NA 3G3KA 1H45A 1NH8A 4OFLA 2XX8A 4C0RA 3FVKA 4YAHX 1JETA 3MZ1A 4GF8A 4POWA 4ELOA 3H6VA 3PUWE 3FVGA 3TYHA 3H6WA 1M5CA 3A3CA 1B3GA 1FQBA 1ZLQA 1P1OA 2H99A 4F1VA 3DP4A 4QSEA 3UN6A 1HSLA 2Y7PA 3OENA 3IB1A 3UIFA 4M1VA 4H6DA 3FVNA 3K6VA 3TFLA 4NF4A 4KFQA 1RYXA 3FJGA 1IIWA 3KOTA 3TMGA 2I4CA 1PBPA 1XC1A 4Q5TA 4G68B 2UYEA 5CBSA 3IOTA 5IKBA 2GRVA 2NOOA 1JEVA 2QS1A 5EYFA 2QPQA 1DSNA 5CBRA 1DTZA 3PMVA 4OVJA 3QAXA 4RA1A 4YB6A 4BDQA 2HFBA 2QS4A 1USYE 1SVXB 2O51A 5TPAB 3RT6B 4LVQA 4DXCA 2ZXTA 4F2OA 3MBPA 3FIRA 5J1DA 3TTMA 3TQWA 4G8HA 3C34A 4O3CA 3LSXA 2OLBA 4KPTA 4F19A 4RPOA 1Y3QA 1FW0A 2D5WA 3TDJA 3KBRA 4OWDA 3MP1A 3S4UA 2F97A 3H6UA 4X1BA 3ZSFA 1UTHB 4PFYA 1PDAA 2ZYKA 3VFJA 3MJNA 4JSOA 3RQTA 2I58A 3JZJA 3PUVE 2O68A 4H0WA 2Q2AA 2NUVA 1ZTYA 1VE4A 5A5XB 3W9VA 1J1NA 4ELQA 1B58A 1A7LA 2RCAA 4ESXA 3TAJA 3LR1A 3SEVA 4H65A 1M5BA 4I1DA 1FQCA 3Q28A 3LSFB 1LFIA 4F3GA 1UIVA 3V5AA 4GQOA 3IO4A 1QW0A 4JSDA 5FHMA 1IUDA 3ONMA
chains in the Genus database with same CATH superfamily
1B7HA 2G93A 5L9SA 3CFLA 4KYSA 4EF2A 1FBEA 3R26A 4PAIA 1PC3A 4Q0CA 1RDZA 2AL5A 1N7XA 4YKIA 2QL3A 3CG1A 1FBGA 3P7IA 3KZGA 5FTHA 3K1MA 4OVQA 4YMAA 1YZ0A 4NF6B 1PB8A 3S9EA 4IO3A 2XXWA 2I3VA 3ILUB 4Z7EA 3TZAA 3OD7A 3HN0A 2XXKA 1XI6A 3HCQA 1POTA 2UVHA 4Z0IA 1AWBA 3VVEA 4JVDA 2XXRA 5ESYA 1R6ZA 2XHDA 4QSCA 1AIVA 4XKPA 4FIMA 2DWJA 2UXAA 3FV2A 2Z8FA 3U92A 3U1OA 1MPBA 3RN8A 1WODA 2OBGA 1VFDA 2QSXA 5TU0A 1BTJA 3RY3A 5I57A 4RNSA 2DP8A 1N3WA 3L6GA 2A5SA 1R9QA 2RC8A 4NF5B 4WEDA 4P9KA 4C1UA 3R7XA 4FATA 4FBPA 5CMKA 2Y5LA 3MVWA 3FASA 2CEYA 4GBVA 3K4UA 4NF4B 3GZGA 4YZZA 2PBWA 1FTAA 1PB9A 4QFNA 1I6BA 1N04A 3G3FA 3T9UA 4NEDA 4OFJA 1N84A 4FAJA 3MWBA 3DP6A 5I84A 4MBPA 1LBBA 3IAZA 5DTBA 1KA1A 2I6EA 4ZEKA 1H76A 5ICTA 1AL3A 2F6GA 4DCYA 1A54A 5ET5A 1II5A 1O7TA 4GLIA 1LBZA 2XX9A 2Y7RA 2QJEA 1JEUA 4LONB 4N07A 1EZOA 1H3DA 4BLAA 5EHMA 5DYHA 3HFUA 3E9XA 5EQ7A 4KYEA 4LQ2A 3W9WA 3G3IA 3GBBA 3AXFA 3ILTB 5DVIA 2F3BA 5JK4A 3HO7A 3VLWA 4QRZA 5I58B 5AA4B 2HPGA 3MW0A 3L6HA 4ZEFA 3DM0A 3UP9A 3CHGA 2D3IA 4R6KA 2B4LA 4IGTA 4G2ZA 4PTKA 3JYRA 3RTFB 4G77A 3IOWA 2ZNSA 4P47A 3THIA 1IXIA 3FJMA 1YXIA 3RPWA 2XXHA 3CI8A 4O7IA 3SZPA 4G68A 1MQJA 2BJJX 4HTGA 4PBHA 4I3YA 4XKNA 3OOAA 1EYJA 3SEWA 2V84A 4F3BA 3PUYE 4GRKA 4GWOA 2B4MA 4BDRA 3V89B 1PBQA 4QFKA 4GWYA 3U8QA 4K3FA 2Q8JA 4MX6A 5TPAA 5A5LA 4TQUQ 4HE2A 3U93A 1TFAA 2V4CA 5IZ1A 2FBPA 4ELRA 4RPNA 2VHAA 1Y1MA 5ET8A 1M5DA 5I56B 1FTKA 1M5FA 3W15C 1CE2A 4MJOA 1UTHA 5AA2A 3PUXE 4U23A 3PMWA 1FPBA 2CZLA 4ZZAA 3KN8A 2P2AA 3CRBA 4GWWA 4QSDA 4N15A 2OJTA 5A5XA 4MLVA 4NF0A 3B7DA 3PPQA 3IR1A 1NUXA 1DOTA 2V3TA 1Y20A 4R6HA 4ZEDA 1QVSA 4N17A 3KJ7A 4DI4B 4QF9A 1GVCA 2L5VA 1I6QA 1IMAA 2HAUA 1CB6A 4XKQA 1JVYA 5HPQA 5H8QB 2H5YA 2REJA 4XXUA 1K9YA 1EYKA 2B3BA 3MUQA 4PFRA 1QGXA 3K00A 2OZZA 1ANFA 2ZNUA 5K2XA 3GXAA 2O69A 4OZ9A 3M3FA 1FQDA 1N3XA 2BJIA 5IZ3B 4KQPA 4GXAA 1B46A 4GVOA 3LV0A 4OQOA 3B50A 4ELPA 1LAGE 3ODBA 4PETA 2GH9A 4F1UA 1B4ZA 1I69A 3K2DA 4PP0A 1O63A 2DXYA 2CZIA 4R6YA 3VV5A 3VXCA 3UORA 1SI0A 2PCRA 2VGQA 5HBCA 2V93A 1MM6A 2ALUA 1XVYA 5EYHA 3IOUA 3QXMA 1A55A 2Q74A 4KYDA 3TKDA 2H4IA 3SEXA 3FVOA 3ROJA 1FTLA 3D4GA 1Z7ME 2UVGA 3A09A 5TP9B 1MXUA 3TCFA 4EQBA 3MP6A 3E78A 4OVTA 2Q8MA 2R9JA 4RY1A 4N8GA 5ET7A 2XWVA 5F7VA 3CFZA 3T96B 4ISUA 2I49A 2XXTA 3HV1A 4Q30B 1NV2A 1JW1A 3LC8A 1QUKA 1LAHE 3K1NA 4NF5A 2RF1A 3MZ9A 3QIMA 4TOZA 1IXGA 3EKIA 4OFOA 2RC7A 1A99A 3RLFE 4HE1A 3QMFA 1FPKA 2HHMA 3U72A 4MMPA 1FSAA 1EU8A 1LB9A 4O7MA 4GWUA 1SPIA 5I7IA 1MXVA 4I3EA 3GLBA 1FPIA 1ZIUA 3EHUA 4AS5A 3CIJA 1FPLA 5L9OA 3G3HA 1RYOA 1B9JA 2Y7WA 4JWOA 1VSOA 2B3FA 4O8MA 4ECFA 1B5HA 1SYIA 2FYIA 4MCOA 1FBPA 2GHBA 1MRPA 2R8TA 3FXQA 2F78A 5KCJA 3VVDA 1SBPA 2PT2A 4NWDA 1BIYA 2DWHA 1LBYA 2P3VA 2XXQA 3RPLA 3UGWA 1MY3A 4O3BA 3MSTA 1FPEA 4JVCA 1SW5A 2QVUA 1GTKA 4FE8A 3E79A 3IJOB 3TTNA 1P1UA 4EXKA 2OWZA 5I58A 3E3KA 5AA4A 4DIGA 1FTMA 4R2BA 4OANA 1JNFA 5AA2B 5IGAA 3OELA 1SW2A 3EN3A 1MXWA 3H4ZA 4N13A 3HPIA 3VXBA 1F9BA 1PEBA 2FVZA 2YLNA 3MC2A 2R71A 3SEUA 1P1WA 4GWZA 2I4BA 3B6QA 5H8HB 4KXPA 1B6HA 1Y1ZA 2QFLA 1MG1A 4AB6A 2OX3A 5FHOA 2HEUA 3O2AA 3M8UA 3TTKA 3KN3A 1GR2A 3MVYA 1MXXA 2UYFA 4PGPA 4TLMB 2ZYMA 4PGNA 3WAFA 2Z22A 3PTYA 4JVIA 2QMWA 5ITOA 4JWXA 2DYXA 4YMBA 1B51A 1URGA 3B6WA 3U94A 3SEYA 3TTRA 3EF7A 4O3AA 1B5JA 2X26A 2O1LA 4KI0E 5I56A 5LDZA 4ZEIA 1MY4A 2RC9A 3CSGA 4DXBA 2M8CA 2ZZVA 4JWYA 4GX4A 1G0HA 2V25A 2F34A 4JDFA 2NWJA 3K6XA 4QBAA 2P3NA 3FZVA 2DQVA 1Y4TA 2R6GE 5KZTA 3CFXA 1FBFA 3QSLA 2A5TB 2HQ0A 2XD3A 2THIA 5JEIA 3T9HB 3O66A 2REGA 1NV4A 4HCYA 5M2VA 4R9GA 1EZ9A 4ZECA 2MKZA 1Y3PA 1P99A 1B0LA 4WXJA 4P56A 5CRYA 1SI1A 4PFWA 2CMOA 5DEXA 2F36A 3T9VA 1GV8A 3OO9A 1B3FA 2RCBA 3CVGA 4R74A 3FXBA 2FA7A 5CI5A 4JB7A 3SDFA 4OXVA 5H8QA 1HSEA 3RUMA 2XXXA 4IB2A 1KZ8A 2XXIA 3TPAA 2Y84A 4TLLB 5ITPA 1QUIA 3E4RA 3RGYA 5IZ3A 4NG7A 1D4NA 3D4CA 2I3WA 1H44A 1UTBB 2CZHA 4UABA 5L9MA 1FPGA 1FBCA 4X8RA 3TQLA 4OEVA 1ELJA 1HSJA 2ONRA 5ICQA 3C32A 3EQ1A 4WEPA 1FTOA 4MLQA 4X04A 4LQ5A 5KDTB 4NX1A 2GFEA 3JV9A 4DLDA 3IJXB 4MH5A 5IAIA 4G61A 2UVIA 1JQFA 4AB5A 3TTLA 2DXRA 1DPEA 1FQFA 5HM4B 5ET6A 4ONYA 2QS2A 5KCJB 5H8SA 4UACA 3RYDA 5TP9A 4XKRA 1TXFA 1YTVA 3RPLB 1P1NA 2I0CA 4H67A 5BUUA 1MDQA 1B3HA 5T3JA 4G8NA 3K1PA 1Q35A 4YKPA 3S9LC 2WBBA 5FTIA 3VLVA 3WAEA 1IMFA 2F7BA 3PU5A 4PAFA 4PCDA 3MQ9A 1FPDA 1MH4A 3IB0A 2FHYA 1DTGA 4H45A 3FUZA 3VVFA 1MPCA 1NKXA 4YKJA 4FECA 3FBPA 3S9NC 4JBZA 3H06B 1LBVA 3MZBA 5ELVA 3I6VA 4LZ7A 3IL1B 3A3UA 5CC2A 4QHQA 2XA5A 1XS5A 4NN3A 3G3GA 5FHNA 1B0HA 3VDFA 2O1MA 3HHFA 2ONKE 1B5IA 2OWSA 4AS4A 1N76A 5CMMA 4R2FA 1TFDA 4E0WA 3T22A 1QULA 4PE5B 3PGFA 1N7WA 3S2VA 1ZKBA 2PVUA 1Q1KA 2PYYA 4P0GA 4RYAA 3EPEA 3BBRA 4KCCA 1NNKA 1NV3A 3PPOA 3V83A 2ABHA 1NUZA 4N6PA 4U4SA 4OHNA 3U65A 3N5LA 4QFOA 3UA8A 1XT8A 3C33A 3IFCA 4KCDA 5JTYB 4EF1A 3CSBA 4GXSB 2VP1A 3N6TA 2HXWA 1SD3A 1FBDA 4XFEA 1B2HA 2FIEA 3T93B 3I3VA 3K6WA 3LSWA 4HXVA 4YB7A 3K0VA 1D9YA 1B7ZA 4X9TA 1QKAA 4UA8A 3CR9A 5IM2A 3R6UA 4GIZA 3QUFA 4OERA 2OCUA 1IQ7A 2YPNA 2DVZA 3D1RA 4FEBA 1G0IA 1NV7A 3ZKKA 1JW5A 2O7IA 3KC1A 1OIBA 4OENA 4JXIA 2DE2A 5CMBA 4YICA 3QK6A 5H8HA 1EZPA 2XX7A 2Q88A 2HCAA 4KHZE 1AOVA 5BWJA 2LAOA 4HE0A 3H6TA 1NV0A 4NF8B 2B65A 1MXZA 2YJPA 2AYSA 2JJKA 4DDDA 3KSJA 1QJMA 1B4HA 5DEXB 3K02A 2DVCA 4ZZEA 5I59A 1LAFE 3FD3A 1IMCA 5CMCA 5DVFA 1US4A 1DPPA 3QUJA 1MH3A 1SYHA 1OVBA 3PV0E 1USYH 2Q9TA 4XIGQ 3MPLA 1FQEA 3OEMA 1IEJA 1SDXA 1XHYA 1JW4A 4PF8A 4R73A 3IOVA 4EXLA 4GBWA 1Y9UA 2NVUB 1LCTA 1IMBA 4F3SA 2IEEA 2VD3A 3C35A 5I2NB 2VOZA 1EYIA 5DVJA 4IY6A 3PMXA 4PDHA 3FGSA 1OQHA 1MQHA 2P1SA 1SQYA 1LLSA 1NUYA 3IX1A 2A5TA 4GL8A 3MAMA 2E1SA 2WKYA 1NH7A 1H43A 1B32A 3CG3A 1MQIA 1Y4CA 2ANJA 3KFMA 1FPFA 1JP4A 2ZNTA 4ZE9A 1INPA 4ZE8A 4POXA 3BIHA 2Z23A 1K9ZA 1SW4A 5K2YA 4OESA 4OVSA 3OSRA 1YYZA 4ESWA 1A8EA 3IK6B 4Q8RA 1OLCA 4PFBA 4H5FA 4FJPA 2O6AA 2XXPA 4NGUA 1B05A 1TT1A 4F22A 3IB2A 3IORA 3KOSA 1UTBA 5EYGA 2Z8DA 4N81A 3MVXA 4LZ8A 3O6IA 3FXRA 4P11A 5KDTA 3T0JA 1LBWA 1MQGA 3Q27A 3BKIB 1P1QA 2IA4A 2W7YA 4LP2B 5H8NB 4H8IA 4I62A 4ZS9A 4EQ7A 4OETA 3MP8A 4U4XA 2XXUA 4P3LA 2Q89A 3HHGA 4MAGA 3S9MC 2E0SA 2OWTA 2ESNA 4DI3D 2F35A 2ZYOA 2NXOA 4RXLA 5I2KB 1YAEA 1D9VA 4U22A 5B7DA 1NV5A 4G68C 1AH5A 4X1DA 2DS9A 1Z7NE 3LUYA 3PD9A 1VR5A 1OVTA 1IMEA 4NWCA 1R1NA 1UQWA 4MIJA 4M4GA 4E0XA 4XEQA 3O97A 5F24A 3I5OA 1B52A 3O6HA 4X48A 1SW1A 1OLAA 3PD8A 2P0SA 1MM7A 1ZU0A 2V3UA 1LEVA 4AQ4A 5H8FB 2O7UA 2F5XA 3FV1A 1IXHA 4N6KA 3KGCA 4I40A 1MXYA 1NNPA 5I59B 1PB7A 1I6AA 4MEVA 1D9QA 1MY1A 1NV1A 4QFLA 1YPNA 3DLNA 3OEKA 4MNIA 4H46A 2UVJA 1VFEA 2XXYA 3N6UA 1LGBC 2H9BA 1NNFA 2PT1A 3G7WA 5ISUA 1XOCA 2ONSA 1L5TA 1FTJA 4GOTA 5JTYA 4PQJA 4R75A 4HCWA 1A40A 3KBZA 2X7QA 1FJ9A 1US5A 4PFTA 2VPNA 1YCJA 2XD2A 2HZKA 4F1YA 1NI9A 4IY5A 2H25A 1DMBA 4RJZA 1FBHA 1ZJLA 1MQDA 2WYKA 4MNCA 1OMPA 4EUOA 4FORA 5J16A 3EHTA 1DBZA 2F7CA 2RKMA 4QXDA 3USDA 4IO5A 3OMBA 4H1XA 3OSQA 3TUSA 4ZEBA 4F39A 4NF8A 1D3KA 1MDP1 5LTCA 1T0KA 1BP5A 4U21A 1WVJA 4PFUA 2I0BA 2X7PA 3MVZA 3C9HA 3TODA 3ZS6A 2HZLA 3IO6A 3C36A 4NMYA 1A8FA 4N6DA 4OMBA 2Y7IA 1KWHA 1POY1 4KR5A 3MPKA 3O9PA 4NHBA 1RKMA 4G8MA 4HW8A 1NMUA 2KQZA 4GL0A 4YB5A 1KA0A 3PPRA 1UIUA 5I2NA 4L17A 3E13X 4RK9A 2DE3A 1GGGA 2DE4A 4GD5A 4U2RA 3T9XB 3PPPA 4WKMA 3RT8A 4U1OA 1QKBA 2DOJA 4U1ZA 3OO7A 1NFTA 4PBQA 1ZMGA 3GBAA 4OEUA 2PMSA 2AL4A 4THIA 2VT5A 4PE3A 3RTWB 1FJ6A 2RINA 2KLFA 1N0TA 3PUZE 4N8YA 4NAPA 1TWYA 2VD2A 2F8DA 2DDKA 4IO7A 1ATGA 4EDPA 5AA2D 4HS7A 2AIXA 1LBCA 2I48A 3O28A 2CZKA 1O64A 4MFIA 3TCHA 3KEIA 4BDOA 3ISPA 4OA4A 5DW8A 1S7YA 2F7AA 3H7MA 4NE4A 4BDNA 1LFGA 4H8JA 4IO6A 2V3QA 3C31A 2WYPA 2O84X 2ZMBA 1XVXA 4YKKA 3T66A 3O6GA 2Y5KA 4ZDMA 1Q9DA 3ECRA 2F6PA 2G29A 4ND9A 2QRYA 3FATA 4OVPA 5EQ8A 2ZZWA 3M3KA 1BKAA 4I8CA 5F1QA 1AMFA 4I9DA 3VE1B 4KD5A 2XXVA 3H03A 5CM6A 5H8NA 3H3GA 3K6UA 3TEPA 4F18A 4NTLA 5DT6A 3B8BA 1MS7A 5FBPA 1MPDA 3LBSA 4P8BA 2PX1A 3KSXA 4IR8A 1IZ1A 4F31B 3RNNA 1URSA 4LZ5A 2Z8EA 1LFHA 4N4UA 5IZZA 1S9TA 2QS3A 3SERA 5I2KA 1FCKA 5I3SA 3B6TA 3C4MA 1FPJA 3EHSA 1IXCA 4F29A 5EQ9A 3DP8A 2QMXA 1B1XA 3NOHA 4RK2A 1IITA 1B40A 1MY0A 2HAVA 2GHAA 3G3JA 4IO2A 5L8DA 3N94A 5B70A 4LN5A 1S50A 1LSTA 1JVXA 1B3EA 3BFUA 4OTEA 4DXUA 3Q25A 2XWOA 3Q26A 1NV6A 3BIGA 4GFRA 3QYTA 4G4PA 1URDA 1ZBMA 4MNPA 4R9FA 1MY2A 3HSTA 4GWXA 4IGRA 1LBXA 4DZ1A 5H8FA 4LATA 2WX9A 3K01A 3VLUA 4P0IA 4MHFA 4F3PA 1DK4A 2ZZXA 1OQGA 3KG2A 1B1HA 3Q29A 3O29A 1BLFA 5AA3A 4XTCQ 5AE4A 1BK4A 4C1TA 3FJ7A 4DCXA 1QUJA 1RDYA 1NNTA 4O94A 5I57B 4LA9A 1EH3A 3OXNA 3KJTA 5EHSA 4BDMA 2ZYNA 3KC0A 1R9LA 3TCGA 2H98A 4P1EA 1NL5A 2FNCA 2DWAA 2XWKA 4OVRA 3SESA 4LUBA 4PAKA 3SKPA 3N26A 3PPNA 2WEFA 2CEXA 4BDLA 3BFTA 2OK2A 4PF6A 2D21A 1LCFA 1WDNA 4N91A 4YU0A 2Y7KA 1LB8A 3V8XB 4F2QA 2XWIA 3LSLA 3ZKLA 3TELA 4FEDA 4NF6A 3KN7A 5AA1A 4DE8A 4EQ9A 4H5GA 4OYVA 3FXUA 3M3LA 3SETA 3UK4A 2DSFA 1FQAA 5LOMA 1M5EA 1B3LA 4R72A 1LAXA 3OO6A 3F11A 3OO8A 4IO4A 2Q2CA 2DWIA 4MF3A 4P1LA 1FRPA 4QFPA 3DELB 1B7UA 1Y3NA 3G3KA 1H45A 2FIXA 1NH8A 4GWSA 4OFLA 3T1BA 2XX8A 4C0RA 3FVKA 4YAHX 1JETA 3MZ1A 1CNQA 2HXRA 4GF8A 4POWA 4ELOA 2VPOA 3H6VA 3PUWE 3FVGA 3TYHA 3H6WA 1M5CA 3A3CA 1B3GA 3GYYA 1FQBA 1ZLQA 1P1OA 2QVVA 2H99A 4F1VA 3DP4A 4QSEA 3UN6A 1HSLA 2KR0A 2Y7PA 3OENA 3IB1A 3UIFA 4M1VA 4H6DA 3FVNA 3K6VA 3TFLA 4NF4A 4KFQA 1RYXA 3FJGA 1IIWA 3KOTA 3TMGA 2I4CA 1PBPA 1XC1A 4Q5TA 4G68B 2UYEA 5CBSA 3IOTA 5IKBA 2GRVA 2NOOA 1JEVA 2QS1A 5EYFA 2QPQA 3IFAA 2PFZA 1DSNA 5CBRA 1DTZA 3PMVA 4OVJA 3QAXA 4RA1A 4YB6A 4BDQA 2HFBA 2QS4A 1USYE 1SVXB 2O51A 5TPAB 3RT6B 4LVQA 4DXCA 4XF5A 2ZXTA 2QVRA 4F2OA 3MBPA 3FIRA 1RDXA 5J1DA 3TTMA 3TQWA 4G8HA 3C34A 4O3CA 3LSXA 2OLBA 4KPTA 5I5PA 4F19A 4RPOA 1Y3QA 1FW0A 2D5WA 3TDJA 3KBRA 4OWDA 3MP1A 3S4UA 2F97A 3H6UA 1IMDA 4X1BA 3ZSFA 1UTHB 4PFYA 1PDAA 4PC9A 2ZYKA 2PFYA 3VFJA 3MJNA 1VDWA 4JSOA 2WBDA 3A29A 1DCUA 3RQTA 2I58A 3JZJA 2F3DA 2GQ1A 3PUVE 2O68A 4H0WA 4PDDA 4NQ8A 2Q2AA 2NUVA 1ZTYA 1VE4A 3LUZA 5A5XB 3W9VA 1J1NA 5EQAA 4ELQA 1B58A 1A7LA 2RCAA 4PFIA 4ESXA 3TAJA 3LR1A 3SEVA 4H65A 1M5BA 4I1DA 1NUWA 1FQCA 3Q28A 3LSFB 1LFIA 4F3GA 1UIVA 4GX3A 3V5AA 4GQOA 3MYUA 3IO4A 4GX6A 1QW0A 4JSDA 5FHMA 1IUDA 3ONMA
chains in the Genus database with same CATH topology
1B7HA 2G93A 5L9SA 3CFLA 4KYSA 4EF2A 3R26A 1PC3A 4Q0CA 2AL5A 1N7XA 4YKIA 2QL3A 3CG1A 3P7IA 3KZGA 5FTHA 3K1MA 4YMAA 4NF6B 1PB8A 3S9EA 4IO3A 2XXWA 2I3VA 3ILUB 4Z7EA 3TZAA 3OD7A 3HN0A 3HCQA 1POTA 2UVHA 4Z0IA 3VVEA 2XXRA 1R6ZA 2XHDA 4QSCA 1AIVA 4XKPA 4FIMA 2DWJA 2UXAA 3FV2A 2Z8FA 3U92A 3U1OA 1MPBA 3RN8A 1WODA 2OBGA 1VFDA 2QSXA 5TU0A 1BTJA 3RY3A 5I57A 4RNSA 2DP8A 1N3WA 3L6GA 2A5SA 1R9QA 2RC8A 4NF5B 4WEDA 4C1UA 3R7XA 4FATA 5CMKA 3MVWA 3FASA 3K4UA 4NF4B 3GZGA 4YZZA 2PBWA 1PB9A 4QFNA 1I6BA 1N04A 3G3FA 3T9UA 4NEDA 4OFJA 1N84A 4FAJA 3MWBA 3DP6A 5I84A 4MBPA 1LBBA 3IAZA 5DTBA 2I6EA 4ZEKA 1H76A 5ICTA 1AL3A 2F6GA 4DCYA 1A54A 1II5A 1O7TA 4GLIA 2XX9A 2Y7RA 2QJEA 1JEUA 4LONB 4N07A 1EZOA 1H3DA 4BLAA 5EHMA 5DYHA 3E9XA 4KYEA 4LQ2A 3W9WA 3G3IA 3GBBA 3AXFA 3ILTB 5DVIA 5JK4A 3HO7A 3VLWA 4QRZA 5I58B 5AA4B 3MW0A 3L6HA 4ZEFA 3DM0A 3UP9A 2D3IA 4R6KA 4IGTA 4G2ZA 3JYRA 3RTFB 4G77A 3IOWA 2ZNSA 3THIA 1IXIA 3FJMA 3RPWA 2XXHA 3CI8A 4G68A 1MQJA 2BJJX 4HTGA 4XKNA 3OOAA 3SEWA 2V84A 4F3BA 3PUYE 4GRKA 4GWOA 4BDRA 3V89B 1PBQA 4QFKA 3U8QA 4K3FA 2Q8JA 5TPAA 4TQUQ 3U93A 1TFAA 4ELRA 4RPNA 2VHAA 1Y1MA 1M5DA 5I56B 1FTKA 1M5FA 3W15C 1CE2A 1UTHA 5AA2A 3PUXE 4U23A 3PMWA 2CZLA 4ZZAA 3KN8A 2P2AA 3CRBA 4QSDA 2OJTA 5A5XA 4MLVA 3B7DA 3PPQA 3IR1A 1DOTA 2V3TA 1Y20A 4R6HA 4ZEDA 1QVSA 3KJ7A 4QF9A 1GVCA 1I6QA 2HAUA 1CB6A 4XKQA 1JVYA 5HPQA 5H8QB 2H5YA 2REJA 4XXUA 3MUQA 2B3BA 3K00A 2OZZA 1ANFA 2ZNUA 5K2XA 3GXAA 2O69A 4OZ9A 3M3FA 1FQDA 1N3XA 4KQPA 4GXAA 1B46A 4GVOA 4OQOA 4ELPA 1LAGE 3ODBA 4PETA 2GH9A 4F1UA 1B4ZA 1I69A 3K2DA 4PP0A 1O63A 2DXYA 4R6YA 3VV5A 3VXCA 3UORA 1SI0A 2VGQA 5HBCA 2V93A 1MM6A 2ALUA 1XVYA 3IOUA 3QXMA 1A55A 3TKDA 4KYDA 2H4IA 3SEXA 3FVOA 1FTLA 3D4GA 1Z7ME 2UVGA 3A09A 5TP9B 1MXUA 3TCFA 4EQBA 3MP6A 2R9JA 4RY1A 5F7VA 3CFZA 3T96B 4ISUA 2I49A 2XXTA 3HV1A 4Q30B 1JW1A 3LC8A 1QUKA 1LAHE 3K1NA 4NF5A 2RF1A 3MZ9A 3QIMA 4TOZA 1IXGA 4OFOA 2RC7A 1A99A 3RLFE 3U72A 1EU8A 1LB9A 1MXVA 3GLBA 1ZIUA 3EHUA 3CIJA 5L9OA 3G3HA 1RYOA 1B9JA 2Y7WA 4JWOA 1VSOA 2B3FA 4ECFA 1B5HA 1SYIA 2FYIA 2GHBA 1MRPA 3FXQA 2F78A 5KCJA 3VVDA 1SBPA 2PT2A 4NWDA 1BIYA 2DWHA 2XXQA 3UGWA 1MY3A 4O3BA 1SW5A 1GTKA 4FE8A 3IJOB 3TTNA 1P1UA 4EXKA 5I58A 3E3KA 5AA4A 4DIGA 1FTMA 4R2BA 1JNFA 5AA2B 3OELA 1SW2A 3EN3A 1MXWA 3H4ZA 4N13A 3HPIA 3VXBA 1F9BA 1PEBA 2YLNA 3MC2A 2R71A 3SEUA 1P1WA 2I4BA 3B6QA 5H8HB 1B6HA 1Y1ZA 1MG1A 4AB6A 5FHOA 2HEUA 3O2AA 3M8UA 3TTKA 3KN3A 1GR2A 3MVYA 1MXXA 2UYFA 4TLMB 2ZYMA 3WAFA 2Z22A 2QMWA 5ITOA 4JWXA 2DYXA 4YMBA 1B51A 1URGA 3B6WA 3U94A 3SEYA 3TTRA 3EF7A 4O3AA 1B5JA 2X26A 2O1LA 4KI0E 5I56A 4ZEIA 1MY4A 2RC9A 3CSGA 4DXBA 2M8CA 4JWYA 2V25A 2F34A 4JDFA 2NWJA 3K6XA 3FZVA 2DQVA 1Y4TA 2R6GE 5KZTA 3CFXA 3QSLA 2A5TB 2HQ0A 2XD3A 2THIA 5JEIA 3T9HB 3O66A 2REGA 4HCYA 5M2VA 4R9GA 1EZ9A 4ZECA 1Y3PA 1P99A 1B0LA 4WXJA 5CRYA 1SI1A 4PFWA 2CMOA 5DEXA 2F36A 3T9VA 1GV8A 3OO9A 1B3FA 2RCBA 3CVGA 4R74A 2FA7A 5CI5A 4JB7A 3SDFA 4OXVA 5H8QA 1HSEA 3RUMA 2XXXA 4IB2A 2XXIA 3TPAA 2Y84A 4TLLB 5ITPA 1QUIA 3E4RA 3RGYA 1D4NA 3D4CA 2I3WA 1H44A 1UTBB 5L9MA 3TQLA 4OEVA 1ELJA 1HSJA 2ONRA 5ICQA 3C32A 3EQ1A 4WEPA 1FTOA 4MLQA 4LQ5A 5KDTB 2GFEA 3JV9A 4DLDA 3IJXB 4MH5A 5IAIA 2UVIA 1JQFA 4AB5A 3TTLA 2DXRA 1DPEA 1FQFA 5HM4B 4ONYA 2QS2A 5KCJB 5H8SA 4UACA 5TP9A 4XKRA 1TXFA 1YTVA 1P1NA 2I0CA 4H67A 5BUUA 1MDQA 1B3HA 4G8NA 3K1PA 1Q35A 4YKPA 3S9LC 5FTIA 3VLVA 3WAEA 3PU5A 2F7BA 3MQ9A 1MH4A 3IB0A 1DTGA 3FUZA 3VVFA 1MPCA 1NKXA 4YKJA 4FECA 3S9NC 4JBZA 3H06B 3MZBA 5ELVA 3I6VA 4LZ7A 3IL1B 3A3UA 5CC2A 4QHQA 1XS5A 3G3GA 5FHNA 1B0HA 3VDFA 2O1MA 3HHFA 2ONKE 1B5IA 2OWSA 1N76A 5CMMA 4R2FA 1TFDA 4E0WA 3T22A 1QULA 4PE5B 3PGFA 1N7WA 3S2VA 1ZKBA 2PVUA 1Q1KA 2PYYA 4P0GA 4RYAA 3EPEA 3BBRA 4KCCA 1NNKA 3V83A 3PPOA 2ABHA 4N6PA 4U4SA 4OHNA 3N5LA 4QFOA 3UA8A 1XT8A 3C33A 4KCDA 5JTYB 4EF1A 3CSBA 4GXSB 2VP1A 3N6TA 2HXWA 1SD3A 1B2HA 3T93B 3I3VA 3K6WA 3LSWA 4YB7A 3K0VA 1D9YA 1B7ZA 4X9TA 1QKAA 4UA8A 3CR9A 3R6UA 4GIZA 3QUFA 4OERA 2OCUA 1IQ7A 2YPNA 2DVZA 4FEBA 3ZKKA 1JW5A 2O7IA 1OIBA 4OENA 4JXIA 2DE2A 5CMBA 4YICA 3QK6A 5H8HA 1EZPA 2XX7A 2Q88A 2HCAA 4KHZE 1AOVA 5BWJA 2LAOA 3H6TA 4NF8B 2B65A 1MXZA 2YJPA 2AYSA 4DDDA 3KSJA 1QJMA 1B4HA 5DEXB 3K02A 2DVCA 4ZZEA 5I59A 1LAFE 3FD3A 5CMCA 5DVFA 1US4A 1DPPA 3QUJA 1MH3A 1SYHA 1OVBA 3PV0E 1USYH 2Q9TA 4XIGQ 3MPLA 1FQEA 3OEMA 1IEJA 1SDXA 1XHYA 1JW4A 4R73A 3IOVA 4EXLA 1Y9UA 2NVUB 1LCTA 4F3SA 2IEEA 2VD3A 3C35A 5I2NB 2VOZA 5DVJA 4IY6A 3PMXA 3FGSA 1OQHA 1MQHA 2P1SA 1SQYA 1LLSA 3IX1A 2A5TA 4GL8A 3MAMA 2E1SA 2WKYA 1NH7A 1H43A 1B32A 3CG3A 1MQIA 1Y4CA 2ANJA 3KFMA 2ZNTA 4ZE9A 4ZE8A 4POXA 2Z23A 1SW4A 5K2YA 4OESA 3OSRA 4ESWA 1A8EA 3IK6B 4Q8RA 1OLCA 4H5FA 4FJPA 2O6AA 2XXPA 1B05A 1TT1A 4F22A 3IB2A 3IORA 3KOSA 1UTBA 2Z8DA 3MVXA 4LZ8A 3O6IA 3FXRA 4P11A 5KDTA 1MQGA 3Q27A 3BKIB 1P1QA 2IA4A 2W7YA 4LP2B 5H8NB 4H8IA 4I62A 4ZS9A 4EQ7A 4OETA 3MP8A 4U4XA 2XXUA 2Q89A 3HHGA 3S9MC 2E0SA 2OWTA 2ESNA 2F35A 2ZYOA 2NXOA 4RXLA 5I2KB 1YAEA 1D9VA 4U22A 5B7DA 4G68C 1AH5A 4X1DA 2DS9A 1Z7NE 3LUYA 3PD9A 1VR5A 1OVTA 4NWCA 1R1NA 1UQWA 4M4GA 4E0XA 3O97A 3I5OA 1B52A 3O6HA 4X48A 1SW1A 1OLAA 3PD8A 2P0SA 1MM7A 1ZU0A 2V3UA 4AQ4A 5H8FB 2O7UA 2F5XA 3FV1A 1IXHA 3KGCA 1MXYA 1NNPA 5I59B 1PB7A 1I6AA 1MY1A 1YPNA 3DLNA 3OEKA 4QFLA 2UVJA 1VFEA 2XXYA 3N6UA 1LGBC 2H9BA 1NNFA 2PT1A 3G7WA 5ISUA 1XOCA 2ONSA 1L5TA 1FTJA 4GOTA 5JTYA 4PQJA 4R75A 4HCWA 1A40A 2X7QA 1US5A 4PFTA 1YCJA 2XD2A 2HZKA 4F1YA 4IY5A 2H25A 1DMBA 4RJZA 1ZJLA 1MQDA 1OMPA 4EUOA 4FORA 3EHTA 2F7CA 2RKMA 3USDA 4IO5A 3OMBA 4H1XA 3OSQA 3TUSA 4ZEBA 4F39A 4NF8A 1D3KA 1MDP1 1T0KA 1BP5A 4U21A 1WVJA 4PFUA 2I0BA 2X7PA 3MVZA 3C9HA 3TODA 3ZS6A 2HZLA 3IO6A 3C36A 4NMYA 1A8FA 4OMBA 2Y7IA 1KWHA 1POY1 4KR5A 3MPKA 3O9PA 1RKMA 4G8MA 4HW8A 1NMUA 4GL0A 4YB5A 3PPRA 1UIUA 5I2NA 4L17A 3E13X 4RK9A 2DE3A 1GGGA 2DE4A 4GD5A 4U2RA 3T9XB 3PPPA 4WKMA 3RT8A 4U1OA 1QKBA 2DOJA 4U1ZA 3OO7A 1NFTA 1ZMGA 3GBAA 4OEUA 2PMSA 2AL4A 4THIA 3RTWB 2RINA 2KLFA 1N0TA 3PUZE 1TWYA 2VD2A 2F8DA 4IO7A 1ATGA 4EDPA 5AA2D 4HS7A 2AIXA 1LBCA 2I48A 3O28A 1O64A 4MFIA 3TCHA 3KEIA 4BDOA 1S7YA 2F7AA 3H7MA 4NE4A 4BDNA 1LFGA 4H8JA 4IO6A 2V3QA 3C31A 2O84X 2ZMBA 1XVXA 4YKKA 3T66A 3O6GA 4ZDMA 3ECRA 2F6PA 2G29A 4ND9A 2QRYA 3FATA 3M3KA 1BKAA 4I8CA 5F1QA 1AMFA 4I9DA 3VE1B 4KD5A 2XXVA 3H03A 5CM6A 5H8NA 3H3GA 3K6UA 3TEPA 4F18A 4NTLA 5DT6A 1MS7A 1MPDA 3LBSA 2PX1A 3KSXA 1IZ1A 4F31B 3RNNA 1URSA 4LZ5A 2Z8EA 1LFHA 1S9TA 2QS3A 3SERA 5I2KA 1FCKA 3B6TA 3C4MA 3EHSA 1IXCA 4F29A 3DP8A 2QMXA 1B1XA 4RK2A 1IITA 1B40A 1MY0A 2HAVA 2GHAA 3G3JA 4IO2A 5L8DA 3N94A 5B70A 1S50A 1LSTA 1JVXA 1B3EA 3BFUA 4OTEA 4DXUA 3Q25A 3Q26A 4GFRA 3QYTA 4G4PA 1URDA 1ZBMA 4R9FA 1MY2A 3HSTA 4IGRA 4DZ1A 5H8FA 4LATA 3K01A 3VLUA 4P0IA 4F3PA 1OQGA 3KG2A 1B1HA 3Q29A 3O29A 1BLFA 5AA3A 4XTCQ 5AE4A 4C1TA 3FJ7A 4DCXA 1QUJA 1NNTA 5I57B 4LA9A 1EH3A 3OXNA 3KJTA 5EHSA 4BDMA 2ZYNA 1R9LA 3TCGA 2H98A 1NL5A 2FNCA 2DWAA 3SESA 4LUBA 3SKPA 3N26A 3PPNA 4BDLA 3BFTA 2OK2A 2D21A 1LCFA 1WDNA 4YU0A 2Y7KA 1LB8A 3V8XB 4F2QA 3LSLA 3ZKLA 3TELA 4FEDA 4NF6A 3KN7A 5AA1A 4DE8A 4EQ9A 4H5GA 4OYVA 3FXUA 3M3LA 3SETA 3UK4A 2DSFA 1FQAA 5LOMA 1M5EA 1B3LA 4R72A 1LAXA 3OO6A 3F11A 3OO8A 4IO4A 2Q2CA 2DWIA 4MF3A 4QFPA 3DELB 1B7UA 1Y3NA 3G3KA 1H45A 1NH8A 4OFLA 2XX8A 4C0RA 3FVKA 4YAHX 1JETA 3MZ1A 4GF8A 4POWA 4ELOA 3H6VA 3PUWE 3FVGA 3TYHA 3H6WA 1M5CA 3A3CA 1B3GA 1FQBA 1ZLQA 1P1OA 2H99A 4F1VA 3DP4A 4QSEA 3UN6A 1HSLA 2Y7PA 3OENA 3IB1A 3UIFA 4M1VA 4H6DA 3FVNA 3K6VA 3TFLA 4NF4A 4KFQA 1RYXA 3FJGA 1IIWA 3KOTA 3TMGA 2I4CA 1PBPA 1XC1A 4Q5TA 4G68B 2UYEA 5CBSA 3IOTA 5IKBA 2GRVA 2NOOA 1JEVA 2QS1A 5EYFA 2QPQA 1DSNA 5CBRA 1DTZA 3PMVA 4OVJA 3QAXA 4RA1A 4YB6A 4BDQA 2HFBA 2QS4A 1USYE 1SVXB 2O51A 5TPAB 3RT6B 4LVQA 4DXCA 2ZXTA 4F2OA 3MBPA 3FIRA 5J1DA 3TTMA 3TQWA 4G8HA 3C34A 4O3CA 3LSXA 2OLBA 4KPTA 4F19A 4RPOA 1Y3QA 1FW0A 2D5WA 3TDJA 3KBRA 4OWDA 3MP1A 3S4UA 2F97A 3H6UA 4X1BA 3ZSFA 1UTHB 4PFYA 1PDAA 2ZYKA 3VFJA 3MJNA 4JSOA 3RQTA 2I58A 3JZJA 3PUVE 2O68A 4H0WA 2Q2AA 2NUVA 1ZTYA 1VE4A 5A5XB 3W9VA 1J1NA 4ELQA 1B58A 1A7LA 2RCAA 4ESXA 3TAJA 3LR1A 3SEVA 4H65A 1M5BA 4I1DA 1FQCA 3Q28A 3LSFB 1LFIA 4F3GA 1UIVA 3V5AA 4GQOA 3IO4A 1QW0A 4JSDA 5FHMA 1IUDA 3ONMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7H A;  2G93 A;  5L9S A;  3CFL A;  4KYS A;  4EF2 A;  3R26 A;  1PC3 A;  4Q0C A;  2AL5 A;  1N7X A;  4YKI A;  2QL3 A;  3CG1 A;  3P7I A;  3KZG A;  5FTH A;  3K1M A;  4YMA A;  4NF6 B;  1PB8 A;  3S9E A;  4IO3 A;  2XXW A;  2I3V A;  3ILU B;  4Z7E A;  3TZA A;  3OD7 A;  3HN0 A;  3HCQ A;  1POT A;  2UVH A;  4Z0I A;  3VVE A;  2XXR A;  1R6Z A;  2XHD A;  4QSC A;  1AIV A;  4XKP A;  4FIM A;  2DWJ A;  2UXA A;  3FV2 A;  2Z8F A;  3U92 A;  3U1O A;  1MPB A;  3RN8 A;  1WOD A;  2OBG A;  1VFD A;  2QSX A;  5TU0 A;  1BTJ A;  3RY3 A;  5I57 A;  4RNS A;  2DP8 A;  1N3W A;  3L6G A;  2A5S A;  1R9Q A;  2RC8 A;  4NF5 B;  4WED A;  4C1U A;  3R7X A;  4FAT A;  5CMK A;  3MVW A;  3FAS A;  3K4U A;  4NF4 B;  3GZG A;  4YZZ A;  2PBW A;  1PB9 A;  4QFN A;  1I6B A;  1N04 A;  3G3F A;  3T9U A;  4NED A;  4OFJ A;  1N84 A;  4FAJ A;  3MWB A;  3DP6 A;  5I84 A;  4MBP A;  1LBB A;  3IAZ A;  5DTB A;  2I6E A;  4ZEK A;  1H76 A;  5ICT A;  1AL3 A;  2F6G A;  4DCY A;  1A54 A;  1II5 A;  1O7T A;  4GLI A;  2XX9 A;  2Y7R A;  2QJE A;  1JEU A;  4LON B;  4N07 A;  1EZO A;  1H3D A;  4BLA A;  5EHM A;  5DYH A;  3E9X A;  4KYE A;  4LQ2 A;  3W9W A;  3G3I A;  3GBB A;  3AXF A;  3ILT B;  5DVI A;  5JK4 A;  3HO7 A;  3VLW A;  4QRZ A;  5I58 B;  5AA4 B;  3MW0 A;  3L6H A;  4ZEF A;  3DM0 A;  3UP9 A;  2D3I A;  4R6K A;  4IGT A;  4G2Z A;  3JYR A;  3RTF B;  4G77 A;  3IOW A;  2ZNS A;  3THI A;  1IXI A;  3FJM A;  3RPW A;  2XXH A;  3CI8 A;  4G68 A;  1MQJ A;  2BJJ X;  4HTG A;  4XKN A;  3OOA A;  3SEW A;  2V84 A;  4F3B A;  3PUY E;  4GRK A;  4GWO A;  4BDR A;  3V89 B;  1PBQ A;  4QFK A;  3U8Q A;  4K3F A;  2Q8J A;  5TPA A;  4TQU Q;  3U93 A;  1TFA A;  4ELR A;  4RPN A;  2VHA A;  1Y1M A;  1M5D A;  5I56 B;  1FTK A;  1M5F A;  3W15 C;  1CE2 A;  1UTH A;  5AA2 A;  3PUX E;  4U23 A;  3PMW A;  2CZL A;  4ZZA A;  3KN8 A;  2P2A A;  3CRB A;  4QSD A;  2OJT A;  5A5X A;  4MLV A;  3B7D A;  3PPQ A;  3IR1 A;  1DOT A;  2V3T A;  1Y20 A;  4R6H A;  4ZED A;  1QVS A;  3KJ7 A;  4QF9 A;  1GVC A;  1I6Q A;  2HAU A;  1CB6 A;  4XKQ A;  1JVY A;  5HPQ A;  5H8Q B;  2H5Y A;  2REJ A;  4XXU A;  3MUQ A;  2B3B A;  3K00 A;  2OZZ A;  1ANF A;  2ZNU A;  5K2X A;  3GXA A;  2O69 A;  4OZ9 A;  3M3F A;  1FQD A;  1N3X A;  4KQP A;  4GXA A;  1B46 A;  4GVO A;  4OQO A;  4ELP A;  1LAG E;  3ODB A;  4PET A;  2GH9 A;  4F1U A;  1B4Z A;  1I69 A;  3K2D A;  4PP0 A;  1O63 A;  2DXY A;  4R6Y A;  3VV5 A;  3VXC A;  3UOR A;  1SI0 A;  2VGQ A;  5HBC A;  2V93 A;  1MM6 A;  2ALU A;  1XVY A;  3IOU A;  3QXM A;  1A55 A;  3TKD A;  4KYD A;  2H4I A;  3SEX A;  3FVO A;  1FTL A;  3D4G A;  1Z7M E;  2UVG A;  3A09 A;  5TP9 B;  1MXU A;  3TCF A;  4EQB A;  3MP6 A;  2R9J A;  4RY1 A;  5F7V A;  3CFZ A;  3T96 B;  4ISU A;  2I49 A;  2XXT A;  3HV1 A;  4Q30 B;  1JW1 A;  3LC8 A;  1QUK A;  1LAH E;  3K1N A;  4NF5 A;  2RF1 A;  3MZ9 A;  3QIM A;  4TOZ A;  1IXG A;  4OFO A;  2RC7 A;  1A99 A;  3RLF E;  3U72 A;  1EU8 A;  1LB9 A;  1MXV A;  3GLB A;  1ZIU A;  3EHU A;  3CIJ A;  5L9O A;  3G3H A;  1RYO A;  1B9J A;  2Y7W A;  4JWO A;  1VSO A;  2B3F A;  4ECF A;  1B5H A;  1SYI A;  2FYI A;  2GHB A;  1MRP A;  3FXQ A;  2F78 A;  5KCJ A;  3VVD A;  1SBP A;  2PT2 A;  4NWD A;  1BIY A;  2DWH A;  2XXQ A;  3UGW A;  1MY3 A;  4O3B A;  1SW5 A;  1GTK A;  4FE8 A;  3IJO B;  3TTN A;  1P1U A;  4EXK A;  5I58 A;  3E3K A;  5AA4 A;  4DIG A;  1FTM A;  4R2B A;  1JNF A;  5AA2 B;  3OEL A;  1SW2 A;  3EN3 A;  1MXW A;  3H4Z A;  4N13 A;  3HPI A;  3VXB A;  1F9B A;  1PEB A;  2YLN A;  3MC2 A;  2R71 A;  3SEU A;  1P1W A;  2I4B A;  3B6Q A;  5H8H B;  1B6H A;  1Y1Z A;  1MG1 A;  4AB6 A;  5FHO A;  2HEU A;  3O2A A;  3M8U A;  3TTK A;  3KN3 A;  1GR2 A;  3MVY A;  1MXX A;  2UYF A;  4TLM B;  2ZYM A;  3WAF A;  2Z22 A;  2QMW A;  5ITO A;  4JWX A;  2DYX A;  4YMB A;  1B51 A;  1URG A;  3B6W A;  3U94 A;  3SEY A;  3TTR A;  3EF7 A;  4O3A A;  1B5J A;  2X26 A;  2O1L A;  4KI0 E;  5I56 A;  4ZEI A;  1MY4 A;  2RC9 A;  3CSG A;  4DXB A;  2M8C A;  4JWY A;  2V25 A;  2F34 A;  4JDF A;  2NWJ A;  3K6X A;  3FZV A;  2DQV A;  1Y4T A;  2R6G E;  5KZT A;  3CFX A;  3QSL A;  2A5T B;  2HQ0 A;  2XD3 A;  2THI A;  5JEI A;  3T9H B;  3O66 A;  2REG A;  4HCY A;  5M2V A;  4R9G A;  1EZ9 A;  4ZEC A;  1Y3P A;  1P99 A;  1B0L A;  4WXJ A;  5CRY A;  1SI1 A;  4PFW A;  2CMO A;  5DEX A;  2F36 A;  3T9V A;  1GV8 A;  3OO9 A;  1B3F A;  2RCB A;  3CVG A;  4R74 A;  2FA7 A;  5CI5 A;  4JB7 A;  3SDF A;  4OXV A;  5H8Q A;  1HSE A;  3RUM A;  2XXX A;  4IB2 A;  2XXI A;  3TPA A;  2Y84 A;  4TLL B;  5ITP A;  1QUI A;  3E4R A;  3RGY A;  1D4N A;  3D4C A;  2I3W A;  1H44 A;  1UTB B;  5L9M A;  3TQL A;  4OEV A;  1ELJ A;  1HSJ A;  2ONR A;  5ICQ A;  3C32 A;  3EQ1 A;  4WEP A;  1FTO A;  4MLQ A;  4LQ5 A;  5KDT B;  2GFE A;  3JV9 A;  4DLD A;  3IJX B;  4MH5 A;  5IAI A;  2UVI A;  1JQF A;  4AB5 A;  3TTL A;  2DXR A;  1DPE A;  1FQF A;  5HM4 B;  4ONY A;  2QS2 A;  5KCJ B;  5H8S A;  4UAC A;  5TP9 A;  4XKR A;  1TXF A;  1YTV A;  1P1N A;  2I0C A;  4H67 A;  5BUU A;  1MDQ A;  1B3H A;  4G8N A;  3K1P A;  1Q35 A;  4YKP A;  3S9L C;  5FTI A;  3VLV A;  3WAE A;  3PU5 A;  2F7B A;  3MQ9 A;  1MH4 A;  3IB0 A;  1DTG A;  3FUZ A;  3VVF A;  1MPC A;  1NKX A;  4YKJ A;  4FEC A;  3S9N C;  4JBZ A;  3H06 B;  3MZB A;  5ELV A;  3I6V A;  4LZ7 A;  3IL1 B;  3A3U A;  5CC2 A;  4QHQ A;  1XS5 A;  3G3G A;  5FHN A;  1B0H A;  3VDF A;  2O1M A;  3HHF A;  2ONK E;  1B5I A;  2OWS A;  1N76 A;  5CMM A;  4R2F A;  1TFD A;  4E0W A;  3T22 A;  1QUL A;  4PE5 B;  3PGF A;  1N7W A;  3S2V A;  1ZKB A;  2PVU A;  1Q1K A;  2PYY A;  4P0G A;  4RYA A;  3EPE A;  3BBR A;  4KCC A;  1NNK A;  3V83 A;  3PPO A;  2ABH A;  4N6P A;  4U4S A;  4OHN A;  3N5L A;  4QFO A;  3UA8 A;  1XT8 A;  3C33 A;  4KCD A;  5JTY B;  4EF1 A;  3CSB A;  4GXS B;  2VP1 A;  3N6T A;  2HXW A;  1SD3 A;  1B2H A;  3T93 B;  3I3V A;  3K6W A;  3LSW A;  4YB7 A;  3K0V A;  1D9Y A;  1B7Z A;  4X9T A;  1QKA A;  4UA8 A;  3CR9 A;  3R6U A;  4GIZ A;  3QUF A;  4OER A;  2OCU A;  1IQ7 A;  2YPN A;  2DVZ A;  4FEB A;  3ZKK A;  1JW5 A;  2O7I A;  1OIB A;  4OEN A;  4JXI A;  2DE2 A;  5CMB A;  4YIC A;  3QK6 A;  5H8H A;  1EZP A;  2XX7 A;  2Q88 A;  2HCA A;  4KHZ E;  1AOV A;  5BWJ A;  2LAO A;  3H6T A;  4NF8 B;  2B65 A;  1MXZ A;  2YJP A;  2AYS A;  4DDD A;  3KSJ A;  1QJM A;  1B4H A;  5DEX B;  3K02 A;  2DVC A;  4ZZE A;  5I59 A;  1LAF E;  3FD3 A;  5CMC A;  5DVF A;  1US4 A;  1DPP A;  3QUJ A;  1MH3 A;  1SYH A;  1OVB A;  3PV0 E;  1USY H;  2Q9T A;  4XIG Q;  3MPL A;  1FQE A;  3OEM A;  1IEJ A;  1SDX A;  1XHY A;  1JW4 A;  4R73 A;  3IOV A;  4EXL A;  1Y9U A;  2NVU B;  1LCT A;  4F3S A;  2IEE A;  2VD3 A;  3C35 A;  5I2N B;  2VOZ A;  5DVJ A;  4IY6 A;  3PMX A;  3FGS A;  1OQH A;  1MQH A;  2P1S A;  1SQY A;  1LLS A;  3IX1 A;  2A5T A;  4GL8 A;  3MAM A;  2E1S A;  2WKY A;  1NH7 A;  1H43 A;  1B32 A;  3CG3 A;  1MQI A;  1Y4C A;  2ANJ A;  3KFM A;  2ZNT A;  4ZE9 A;  4ZE8 A;  4POX A;  2Z23 A;  1SW4 A;  5K2Y A;  4OES A;  3OSR A;  4ESW A;  1A8E A;  3IK6 B;  4Q8R A;  1OLC A;  4H5F A;  4FJP A;  2O6A A;  2XXP A;  1B05 A;  1TT1 A;  4F22 A;  3IB2 A;  3IOR A;  3KOS A;  1UTB A;  2Z8D A;  3MVX A;  4LZ8 A;  3O6I A;  3FXR A;  4P11 A;  5KDT A;  1MQG A;  3Q27 A;  3BKI B;  1P1Q A;  2IA4 A;  2W7Y A;  4LP2 B;  5H8N B;  4H8I A;  4I62 A;  4ZS9 A;  4EQ7 A;  4OET A;  3MP8 A;  4U4X A;  2XXU A;  2Q89 A;  3HHG A;  3S9M C;  2E0S A;  2OWT A;  2ESN A;  2F35 A;  2ZYO A;  2NXO A;  4RXL A;  5I2K B;  1YAE A;  1D9V A;  4U22 A;  5B7D A;  4G68 C;  1AH5 A;  4X1D A;  2DS9 A;  1Z7N E;  3LUY A;  3PD9 A;  1VR5 A;  1OVT A;  4NWC A;  1R1N A;  1UQW A;  4M4G A;  4E0X A;  3O97 A;  3I5O A;  1B52 A;  3O6H A;  4X48 A;  1SW1 A;  1OLA A;  3PD8 A;  2P0S A;  1MM7 A;  1ZU0 A;  2V3U A;  4AQ4 A;  5H8F B;  2O7U A;  2F5X A;  3FV1 A;  1IXH A;  3KGC A;  1MXY A;  1NNP A;  5I59 B;  1PB7 A;  1I6A A;  1MY1 A;  1YPN A;  3DLN A;  3OEK A;  4QFL A;  2UVJ A;  1VFE A;  2XXY A;  3N6U A;  1LGB C;  2H9B A;  1NNF A;  2PT1 A;  3G7W A;  5ISU A;  1XOC A;  2ONS A;  1L5T A;  1FTJ A;  4GOT A;  5JTY A;  4PQJ A;  4R75 A;  4HCW A;  1A40 A;  2X7Q A;  1US5 A;  4PFT A;  1YCJ A;  2XD2 A;  2HZK A;  4F1Y A;  4IY5 A;  2H25 A;  1DMB A;  4RJZ A;  1ZJL A;  1MQD A;  1OMP A;  4EUO A;  4FOR A;  3EHT A;  2F7C A;  2RKM A;  3USD A;  4IO5 A;  3OMB A;  4H1X A;  3OSQ A;  3TUS A;  4ZEB A;  4F39 A;  4NF8 A;  1D3K A;  1MDP 1;  1T0K A;  1BP5 A;  4U21 A;  1WVJ A;  4PFU A;  2I0B A;  2X7P A;  3MVZ A;  3C9H A;  3TOD A;  3ZS6 A;  2HZL A;  3IO6 A;  3C36 A;  4NMY A;  1A8F A;  4OMB A;  2Y7I A;  1KWH A;  1POY 1;  4KR5 A;  3MPK A;  3O9P A;  1RKM A;  4G8M A;  4HW8 A;  1NMU A;  4GL0 A;  4YB5 A;  3PPR A;  1UIU A;  5I2N A;  4L17 A;  3E13 X;  4RK9 A;  2DE3 A;  1GGG A;  2DE4 A;  4GD5 A;  4U2R A;  3T9X B;  3PPP A;  4WKM A;  3RT8 A;  4U1O A;  1QKB A;  2DOJ A;  4U1Z A;  3OO7 A;  1NFT A;  1ZMG A;  3GBA A;  4OEU A;  2PMS A;  2AL4 A;  4THI A;  3RTW B;  2RIN A;  2KLF A;  1N0T A;  3PUZ E;  1TWY A;  2VD2 A;  2F8D A;  4IO7 A;  1ATG A;  4EDP A;  5AA2 D;  4HS7 A;  2AIX A;  1LBC A;  2I48 A;  3O28 A;  1O64 A;  4MFI A;  3TCH A;  3KEI A;  4BDO A;  1S7Y A;  2F7A A;  3H7M A;  4NE4 A;  4BDN A;  1LFG A;  4H8J A;  4IO6 A;  2V3Q A;  3C31 A;  2O84 X;  2ZMB A;  1XVX A;  4YKK A;  3T66 A;  3O6G A;  4ZDM A;  3ECR A;  2F6P A;  2G29 A;  4ND9 A;  2QRY A;  3FAT A;  3M3K A;  1BKA A;  4I8C A;  5F1Q A;  1AMF A;  4I9D A;  3VE1 B;  4KD5 A;  2XXV A;  3H03 A;  5CM6 A;  5H8N A;  3H3G A;  3K6U A;  3TEP A;  4F18 A;  4NTL A;  5DT6 A;  1MS7 A;  1MPD A;  3LBS A;  2PX1 A;  3KSX A;  1IZ1 A;  4F31 B;  3RNN A;  1URS A;  4LZ5 A;  2Z8E A;  1LFH A;  1S9T A;  2QS3 A;  3SER A;  5I2K A;  1FCK A;  3B6T A;  3C4M A;  3EHS A;  1IXC A;  4F29 A;  3DP8 A;  2QMX A;  1B1X A;  4RK2 A;  1IIT A;  1B40 A;  1MY0 A;  2HAV A;  2GHA A;  3G3J A;  4IO2 A;  5L8D A;  3N94 A;  5B70 A;  1S50 A;  1LST A;  1JVX A;  1B3E A;  3BFU A;  4OTE A;  4DXU A;  3Q25 A;  3Q26 A;  4GFR A;  3QYT A;  4G4P A;  1URD A;  1ZBM A;  4R9F A;  1MY2 A;  3HST A;  4IGR A;  4DZ1 A;  5H8F A;  4LAT A;  3K01 A;  3VLU A;  4P0I A;  4F3P A;  1OQG A;  3KG2 A;  1B1H A;  3Q29 A;  3O29 A;  1BLF A;  5AA3 A;  4XTC Q;  5AE4 A;  4C1T A;  3FJ7 A;  4DCX A;  1QUJ A;  1NNT A;  5I57 B;  4LA9 A;  1EH3 A;  3OXN A;  3KJT A;  5EHS A;  4BDM A;  2ZYN A;  1R9L A;  3TCG A;  2H98 A;  1NL5 A;  2FNC A;  2DWA A;  3SES A;  4LUB A;  3SKP A;  3N26 A;  3PPN A;  4BDL A;  3BFT A;  2OK2 A;  2D21 A;  1LCF A;  1WDN A;  4YU0 A;  2Y7K A;  1LB8 A;  3V8X B;  4F2Q A;  3LSL A;  3ZKL A;  3TEL A;  4FED A;  4NF6 A;  3KN7 A;  5AA1 A;  4DE8 A;  4EQ9 A;  4H5G A;  4OYV A;  3FXU A;  3M3L A;  3SET A;  3UK4 A;  2DSF A;  1FQA A;  5LOM A;  1M5E A;  1B3L A;  4R72 A;  1LAX A;  3OO6 A;  3F11 A;  3OO8 A;  4IO4 A;  2Q2C A;  2DWI A;  4MF3 A;  4QFP A;  3DEL B;  1B7U A;  1Y3N A;  3G3K A;  1H45 A;  1NH8 A;  4OFL A;  2XX8 A;  4C0R A;  3FVK A;  4YAH X;  1JET A;  3MZ1 A;  4GF8 A;  4POW A;  4ELO A;  3H6V A;  3PUW E;  3FVG A;  3TYH A;  3H6W A;  1M5C A;  3A3C A;  1B3G A;  1FQB A;  1ZLQ A;  1P1O A;  2H99 A;  4F1V A;  3DP4 A;  4QSE A;  3UN6 A;  1HSL A;  2Y7P A;  3OEN A;  3IB1 A;  3UIF A;  4M1V A;  4H6D A;  3FVN A;  3K6V A;  3TFL A;  4NF4 A;  4KFQ A;  1RYX A;  3FJG A;  1IIW A;  3KOT A;  3TMG A;  2I4C A;  1PBP A;  1XC1 A;  4Q5T A;  4G68 B;  2UYE A;  5CBS A;  3IOT A;  5IKB A;  2GRV A;  2NOO A;  1JEV A;  2QS1 A;  5EYF A;  2QPQ A;  1DSN A;  5CBR A;  1DTZ A;  3PMV A;  4OVJ A;  3QAX A;  4RA1 A;  4YB6 A;  4BDQ A;  2HFB A;  2QS4 A;  1USY E;  1SVX B;  2O51 A;  5TPA B;  3RT6 B;  4LVQ A;  4DXC A;  2ZXT A;  4F2O A;  3MBP A;  3FIR A;  5J1D A;  3TTM A;  3TQW A;  4G8H A;  3C34 A;  4O3C A;  3LSX A;  2OLB A;  4KPT A;  4F19 A;  4RPO A;  1Y3Q A;  1FW0 A;  2D5W A;  3TDJ A;  3KBR A;  4OWD A;  3MP1 A;  3S4U A;  2F97 A;  3H6U A;  4X1B A;  3ZSF A;  1UTH B;  4PFY A;  1PDA A;  2ZYK A;  3VFJ A;  3MJN A;  4JSO A;  3RQT A;  2I58 A;  3JZJ A;  3PUV E;  2O68 A;  4H0W A;  2Q2A A;  2NUV A;  1ZTY A;  1VE4 A;  5A5X B;  3W9V A;  1J1N A;  4ELQ A;  1B58 A;  1A7L A;  2RCA A;  4ESX A;  3TAJ A;  3LR1 A;  3SEV A;  4H65 A;  1M5B A;  4I1D A;  1FQC A;  3Q28 A;  3LSF B;  1LFI A;  4F3G A;  1UIV A;  3V5A A;  4GQO A;  3IO4 A;  1QW0 A;  4JSD A;  5FHM A;  1IUD A;  3ONM A; 
#chains in the Genus database with same CATH topology
 1B7H A;  2G93 A;  5L9S A;  3CFL A;  4KYS A;  4EF2 A;  1FBE A;  3R26 A;  4PAI A;  1PC3 A;  4Q0C A;  1RDZ A;  2AL5 A;  1N7X A;  4YKI A;  2QL3 A;  3CG1 A;  1FBG A;  3P7I A;  3KZG A;  5FTH A;  3K1M A;  4OVQ A;  4YMA A;  1YZ0 A;  4NF6 B;  1PB8 A;  3S9E A;  4IO3 A;  2XXW A;  2I3V A;  3ILU B;  4Z7E A;  3TZA A;  3OD7 A;  3HN0 A;  2XXK A;  1XI6 A;  3HCQ A;  1POT A;  2UVH A;  4Z0I A;  1AWB A;  3VVE A;  4JVD A;  2XXR A;  5ESY A;  1R6Z A;  2XHD A;  4QSC A;  1AIV A;  4XKP A;  4FIM A;  2DWJ A;  2UXA A;  3FV2 A;  2Z8F A;  3U92 A;  3U1O A;  1MPB A;  3RN8 A;  1WOD A;  2OBG A;  1VFD A;  2QSX A;  5TU0 A;  1BTJ A;  3RY3 A;  5I57 A;  4RNS A;  2DP8 A;  1N3W A;  3L6G A;  2A5S A;  1R9Q A;  2RC8 A;  4NF5 B;  4WED A;  4P9K A;  4C1U A;  3R7X A;  4FAT A;  4FBP A;  5CMK A;  2Y5L A;  3MVW A;  3FAS A;  2CEY A;  4GBV A;  3K4U A;  4NF4 B;  3GZG A;  4YZZ A;  2PBW A;  1FTA A;  1PB9 A;  4QFN A;  1I6B A;  1N04 A;  3G3F A;  3T9U A;  4NED A;  4OFJ A;  1N84 A;  4FAJ A;  3MWB A;  3DP6 A;  5I84 A;  4MBP A;  1LBB A;  3IAZ A;  5DTB A;  1KA1 A;  2I6E A;  4ZEK A;  1H76 A;  5ICT A;  1AL3 A;  2F6G A;  4DCY A;  1A54 A;  5ET5 A;  1II5 A;  1O7T A;  4GLI A;  1LBZ A;  2XX9 A;  2Y7R A;  2QJE A;  1JEU A;  4LON B;  4N07 A;  1EZO A;  1H3D A;  4BLA A;  5EHM A;  5DYH A;  3HFU A;  3E9X A;  5EQ7 A;  4KYE A;  4LQ2 A;  3W9W A;  3G3I A;  3GBB A;  3AXF A;  3ILT B;  5DVI A;  2F3B A;  5JK4 A;  3HO7 A;  3VLW A;  4QRZ A;  5I58 B;  5AA4 B;  2HPG A;  3MW0 A;  3L6H A;  4ZEF A;  3DM0 A;  3UP9 A;  3CHG A;  2D3I A;  4R6K A;  2B4L A;  4IGT A;  4G2Z A;  4PTK A;  3JYR A;  3RTF B;  4G77 A;  3IOW A;  2ZNS A;  4P47 A;  3THI A;  1IXI A;  3FJM A;  1YXI A;  3RPW A;  2XXH A;  3CI8 A;  4O7I A;  3SZP A;  4G68 A;  1MQJ A;  2BJJ X;  4HTG A;  4PBH A;  4I3Y A;  4XKN A;  3OOA A;  1EYJ A;  3SEW A;  2V84 A;  4F3B A;  3PUY E;  4GRK A;  4GWO A;  2B4M A;  4BDR A;  3V89 B;  1PBQ A;  4QFK A;  4GWY A;  3U8Q A;  4K3F A;  2Q8J A;  4MX6 A;  5TPA A;  5A5L A;  4TQU Q;  4HE2 A;  3U93 A;  1TFA A;  2V4C A;  5IZ1 A;  2FBP A;  4ELR A;  4RPN A;  2VHA A;  1Y1M A;  5ET8 A;  1M5D A;  5I56 B;  1FTK A;  1M5F A;  3W15 C;  1CE2 A;  4MJO A;  1UTH A;  5AA2 A;  3PUX E;  4U23 A;  3PMW A;  1FPB A;  2CZL A;  4ZZA A;  3KN8 A;  2P2A A;  3CRB A;  4GWW A;  4QSD A;  4N15 A;  2OJT A;  5A5X A;  4MLV A;  4NF0 A;  3B7D A;  3PPQ A;  3IR1 A;  1NUX A;  1DOT A;  2V3T A;  1Y20 A;  4R6H A;  4ZED A;  1QVS A;  4N17 A;  3KJ7 A;  4DI4 B;  4QF9 A;  1GVC A;  2L5V A;  1I6Q A;  1IMA A;  2HAU A;  1CB6 A;  4XKQ A;  1JVY A;  5HPQ A;  5H8Q B;  2H5Y A;  2REJ A;  4XXU A;  1K9Y A;  1EYK A;  2B3B A;  3MUQ A;  4PFR A;  1QGX A;  3K00 A;  2OZZ A;  1ANF A;  2ZNU A;  5K2X A;  3GXA A;  2O69 A;  4OZ9 A;  3M3F A;  1FQD A;  1N3X A;  2BJI A;  5IZ3 B;  4KQP A;  4GXA A;  1B46 A;  4GVO A;  3LV0 A;  4OQO A;  3B50 A;  4ELP A;  1LAG E;  3ODB A;  4PET A;  2GH9 A;  4F1U A;  1B4Z A;  1I69 A;  3K2D A;  4PP0 A;  1O63 A;  2DXY A;  2CZI A;  4R6Y A;  3VV5 A;  3VXC A;  3UOR A;  1SI0 A;  2PCR A;  2VGQ A;  5HBC A;  2V93 A;  1MM6 A;  2ALU A;  1XVY A;  5EYH A;  3IOU A;  3QXM A;  1A55 A;  2Q74 A;  4KYD A;  3TKD A;  2H4I A;  3SEX A;  3FVO A;  3ROJ A;  1FTL A;  3D4G A;  1Z7M E;  2UVG A;  3A09 A;  5TP9 B;  1MXU A;  3TCF A;  4EQB A;  3MP6 A;  3E78 A;  4OVT A;  2Q8M A;  2R9J A;  4RY1 A;  4N8G A;  5ET7 A;  2XWV A;  5F7V A;  3CFZ A;  3T96 B;  4ISU A;  2I49 A;  2XXT A;  3HV1 A;  4Q30 B;  1NV2 A;  1JW1 A;  3LC8 A;  1QUK A;  1LAH E;  3K1N A;  4NF5 A;  2RF1 A;  3MZ9 A;  3QIM A;  4TOZ A;  1IXG A;  3EKI A;  4OFO A;  2RC7 A;  1A99 A;  3RLF E;  4HE1 A;  3QMF A;  1FPK A;  2HHM A;  3U72 A;  4MMP A;  1FSA A;  1EU8 A;  1LB9 A;  4O7M A;  4GWU A;  1SPI A;  5I7I A;  1MXV A;  4I3E A;  3GLB A;  1FPI A;  1ZIU A;  3EHU A;  4AS5 A;  3CIJ A;  1FPL A;  5L9O A;  3G3H A;  1RYO A;  1B9J A;  2Y7W A;  4JWO A;  1VSO A;  2B3F A;  4O8M A;  4ECF A;  1B5H A;  1SYI A;  2FYI A;  4MCO A;  1FBP A;  2GHB A;  1MRP A;  2R8T A;  3FXQ A;  2F78 A;  5KCJ A;  3VVD A;  1SBP A;  2PT2 A;  4NWD A;  1BIY A;  2DWH A;  1LBY A;  2P3V A;  2XXQ A;  3RPL A;  3UGW A;  1MY3 A;  4O3B A;  3MST A;  1FPE A;  4JVC A;  1SW5 A;  2QVU A;  1GTK A;  4FE8 A;  3E79 A;  3IJO B;  3TTN A;  1P1U A;  4EXK A;  2OWZ A;  5I58 A;  3E3K A;  5AA4 A;  4DIG A;  1FTM A;  4R2B A;  4OAN A;  1JNF A;  5AA2 B;  5IGA A;  3OEL A;  1SW2 A;  3EN3 A;  1MXW A;  3H4Z A;  4N13 A;  3HPI A;  3VXB A;  1F9B A;  1PEB A;  2FVZ A;  2YLN A;  3MC2 A;  2R71 A;  3SEU A;  1P1W A;  4GWZ A;  2I4B A;  3B6Q A;  5H8H B;  4KXP A;  1B6H A;  1Y1Z A;  2QFL A;  1MG1 A;  4AB6 A;  2OX3 A;  5FHO A;  2HEU A;  3O2A A;  3M8U A;  3TTK A;  3KN3 A;  1GR2 A;  3MVY A;  1MXX A;  2UYF A;  4PGP A;  4TLM B;  2ZYM A;  4PGN A;  3WAF A;  2Z22 A;  3PTY A;  4JVI A;  2QMW A;  5ITO A;  4JWX A;  2DYX A;  4YMB A;  1B51 A;  1URG A;  3B6W A;  3U94 A;  3SEY A;  3TTR A;  3EF7 A;  4O3A A;  1B5J A;  2X26 A;  2O1L A;  4KI0 E;  5I56 A;  5LDZ A;  4ZEI A;  1MY4 A;  2RC9 A;  3CSG A;  4DXB A;  2M8C A;  2ZZV A;  4JWY A;  4GX4 A;  1G0H A;  2V25 A;  2F34 A;  4JDF A;  2NWJ A;  3K6X A;  4QBA A;  2P3N A;  3FZV A;  2DQV A;  1Y4T A;  2R6G E;  5KZT A;  3CFX A;  1FBF A;  3QSL A;  2A5T B;  2HQ0 A;  2XD3 A;  2THI A;  5JEI A;  3T9H B;  3O66 A;  2REG A;  1NV4 A;  4HCY A;  5M2V A;  4R9G A;  1EZ9 A;  4ZEC A;  2MKZ A;  1Y3P A;  1P99 A;  1B0L A;  4WXJ A;  4P56 A;  5CRY A;  1SI1 A;  4PFW A;  2CMO A;  5DEX A;  2F36 A;  3T9V A;  1GV8 A;  3OO9 A;  1B3F A;  2RCB A;  3CVG A;  4R74 A;  3FXB A;  2FA7 A;  5CI5 A;  4JB7 A;  3SDF A;  4OXV A;  5H8Q A;  1HSE A;  3RUM A;  2XXX A;  4IB2 A;  1KZ8 A;  2XXI A;  3TPA A;  2Y84 A;  4TLL B;  5ITP A;  1QUI A;  3E4R A;  3RGY A;  5IZ3 A;  4NG7 A;  1D4N A;  3D4C A;  2I3W A;  1H44 A;  1UTB B;  2CZH A;  4UAB A;  5L9M A;  1FPG A;  1FBC A;  4X8R A;  3TQL A;  4OEV A;  1ELJ A;  1HSJ A;  2ONR A;  5ICQ A;  3C32 A;  3EQ1 A;  4WEP A;  1FTO A;  4MLQ A;  4X04 A;  4LQ5 A;  5KDT B;  4NX1 A;  2GFE A;  3JV9 A;  4DLD A;  3IJX B;  4MH5 A;  5IAI A;  4G61 A;  2UVI A;  1JQF A;  4AB5 A;  3TTL A;  2DXR A;  1DPE A;  1FQF A;  5HM4 B;  5ET6 A;  4ONY A;  2QS2 A;  5KCJ B;  5H8S A;  4UAC A;  3RYD A;  5TP9 A;  4XKR A;  1TXF A;  1YTV A;  3RPL B;  1P1N A;  2I0C A;  4H67 A;  5BUU A;  1MDQ A;  1B3H A;  5T3J A;  4G8N A;  3K1P A;  1Q35 A;  4YKP A;  3S9L C;  2WBB A;  5FTI A;  3VLV A;  3WAE A;  1IMF A;  2F7B A;  3PU5 A;  4PAF A;  4PCD A;  3MQ9 A;  1FPD A;  1MH4 A;  3IB0 A;  2FHY A;  1DTG A;  4H45 A;  3FUZ A;  3VVF A;  1MPC A;  1NKX A;  4YKJ A;  4FEC A;  3FBP A;  3S9N C;  4JBZ A;  3H06 B;  1LBV A;  3MZB A;  5ELV A;  3I6V A;  4LZ7 A;  3IL1 B;  3A3U A;  5CC2 A;  4QHQ A;  2XA5 A;  1XS5 A;  4NN3 A;  3G3G A;  5FHN A;  1B0H A;  3VDF A;  2O1M A;  3HHF A;  2ONK E;  1B5I A;  2OWS A;  4AS4 A;  1N76 A;  5CMM A;  4R2F A;  1TFD A;  4E0W A;  3T22 A;  1QUL A;  4PE5 B;  3PGF A;  1N7W A;  3S2V A;  1ZKB A;  2PVU A;  1Q1K A;  2PYY A;  4P0G A;  4RYA A;  3EPE A;  3BBR A;  4KCC A;  1NNK A;  1NV3 A;  3PPO A;  3V83 A;  2ABH A;  1NUZ A;  4N6P A;  4U4S A;  4OHN A;  3U65 A;  3N5L A;  4QFO A;  3UA8 A;  1XT8 A;  3C33 A;  3IFC A;  4KCD A;  5JTY B;  4EF1 A;  3CSB A;  4GXS B;  2VP1 A;  3N6T A;  2HXW A;  1SD3 A;  1FBD A;  4XFE A;  1B2H A;  2FIE A;  3T93 B;  3I3V A;  3K6W A;  3LSW A;  4HXV A;  4YB7 A;  3K0V A;  1D9Y A;  1B7Z A;  4X9T A;  1QKA A;  4UA8 A;  3CR9 A;  5IM2 A;  3R6U A;  4GIZ A;  3QUF A;  4OER A;  2OCU A;  1IQ7 A;  2YPN A;  2DVZ A;  3D1R A;  4FEB A;  1G0I A;  1NV7 A;  3ZKK A;  1JW5 A;  2O7I A;  3KC1 A;  1OIB A;  4OEN A;  4JXI A;  2DE2 A;  5CMB A;  4YIC A;  3QK6 A;  5H8H A;  1EZP A;  2XX7 A;  2Q88 A;  2HCA A;  4KHZ E;  1AOV A;  5BWJ A;  2LAO A;  4HE0 A;  3H6T A;  1NV0 A;  4NF8 B;  2B65 A;  1MXZ A;  2YJP A;  2AYS A;  2JJK A;  4DDD A;  3KSJ A;  1QJM A;  1B4H A;  5DEX B;  3K02 A;  2DVC A;  4ZZE A;  5I59 A;  1LAF E;  3FD3 A;  1IMC A;  5CMC A;  5DVF A;  1US4 A;  1DPP A;  3QUJ A;  1MH3 A;  1SYH A;  1OVB A;  3PV0 E;  1USY H;  2Q9T A;  4XIG Q;  3MPL A;  1FQE A;  3OEM A;  1IEJ A;  1SDX A;  1XHY A;  1JW4 A;  4PF8 A;  4R73 A;  3IOV A;  4EXL A;  4GBW A;  1Y9U A;  2NVU B;  1LCT A;  1IMB A;  4F3S A;  2IEE A;  2VD3 A;  3C35 A;  5I2N B;  2VOZ A;  1EYI A;  5DVJ A;  4IY6 A;  3PMX A;  4PDH A;  3FGS A;  1OQH A;  1MQH A;  2P1S A;  1SQY A;  1LLS A;  1NUY A;  3IX1 A;  2A5T A;  4GL8 A;  3MAM A;  2E1S A;  2WKY A;  1NH7 A;  1H43 A;  1B32 A;  3CG3 A;  1MQI A;  1Y4C A;  2ANJ A;  3KFM A;  1FPF A;  1JP4 A;  2ZNT A;  4ZE9 A;  1INP A;  4ZE8 A;  4POX A;  3BIH A;  2Z23 A;  1K9Z A;  1SW4 A;  5K2Y A;  4OES A;  4OVS A;  3OSR A;  1YYZ A;  4ESW A;  1A8E A;  3IK6 B;  4Q8R A;  1OLC A;  4PFB A;  4H5F A;  4FJP A;  2O6A A;  2XXP A;  4NGU A;  1B05 A;  1TT1 A;  4F22 A;  3IB2 A;  3IOR A;  3KOS A;  1UTB A;  5EYG A;  2Z8D A;  4N81 A;  3MVX A;  4LZ8 A;  3O6I A;  3FXR A;  4P11 A;  5KDT A;  3T0J A;  1LBW A;  1MQG A;  3Q27 A;  3BKI B;  1P1Q A;  2IA4 A;  2W7Y A;  4LP2 B;  5H8N B;  4H8I A;  4I62 A;  4ZS9 A;  4EQ7 A;  4OET A;  3MP8 A;  4U4X A;  2XXU A;  4P3L A;  2Q89 A;  3HHG A;  4MAG A;  3S9M C;  2E0S A;  2OWT A;  2ESN A;  4DI3 D;  2F35 A;  2ZYO A;  2NXO A;  4RXL A;  5I2K B;  1YAE A;  1D9V A;  4U22 A;  5B7D A;  1NV5 A;  4G68 C;  1AH5 A;  4X1D A;  2DS9 A;  1Z7N E;  3LUY A;  3PD9 A;  1VR5 A;  1OVT A;  1IME A;  4NWC A;  1R1N A;  1UQW A;  4MIJ A;  4M4G A;  4E0X A;  4XEQ A;  3O97 A;  5F24 A;  3I5O A;  1B52 A;  3O6H A;  4X48 A;  1SW1 A;  1OLA A;  3PD8 A;  2P0S A;  1MM7 A;  1ZU0 A;  2V3U A;  1LEV A;  4AQ4 A;  5H8F B;  2O7U A;  2F5X A;  3FV1 A;  1IXH A;  4N6K A;  3KGC A;  4I40 A;  1MXY A;  1NNP A;  5I59 B;  1PB7 A;  1I6A A;  4MEV A;  1D9Q A;  1MY1 A;  1NV1 A;  4QFL A;  1YPN A;  3DLN A;  3OEK A;  4MNI A;  4H46 A;  2UVJ A;  1VFE A;  2XXY A;  3N6U A;  1LGB C;  2H9B A;  1NNF A;  2PT1 A;  3G7W A;  5ISU A;  1XOC A;  2ONS A;  1L5T A;  1FTJ A;  4GOT A;  5JTY A;  4PQJ A;  4R75 A;  4HCW A;  1A40 A;  3KBZ A;  2X7Q A;  1FJ9 A;  1US5 A;  4PFT A;  2VPN A;  1YCJ A;  2XD2 A;  2HZK A;  4F1Y A;  1NI9 A;  4IY5 A;  2H25 A;  1DMB A;  4RJZ A;  1FBH A;  1ZJL A;  1MQD A;  2WYK A;  4MNC A;  1OMP A;  4EUO A;  4FOR A;  5J16 A;  3EHT A;  1DBZ A;  2F7C A;  2RKM A;  4QXD A;  3USD A;  4IO5 A;  3OMB A;  4H1X A;  3OSQ A;  3TUS A;  4ZEB A;  4F39 A;  4NF8 A;  1D3K A;  1MDP 1;  5LTC A;  1T0K A;  1BP5 A;  4U21 A;  1WVJ A;  4PFU A;  2I0B A;  2X7P A;  3MVZ A;  3C9H A;  3TOD A;  3ZS6 A;  2HZL A;  3IO6 A;  3C36 A;  4NMY A;  1A8F A;  4N6D A;  4OMB A;  2Y7I A;  1KWH A;  1POY 1;  4KR5 A;  3MPK A;  3O9P A;  4NHB A;  1RKM A;  4G8M A;  4HW8 A;  1NMU A;  2KQZ A;  4GL0 A;  4YB5 A;  1KA0 A;  3PPR A;  1UIU A;  5I2N A;  4L17 A;  3E13 X;  4RK9 A;  2DE3 A;  1GGG A;  2DE4 A;  4GD5 A;  4U2R A;  3T9X B;  3PPP A;  4WKM A;  3RT8 A;  4U1O A;  1QKB A;  2DOJ A;  4U1Z A;  3OO7 A;  1NFT A;  4PBQ A;  1ZMG A;  3GBA A;  4OEU A;  2PMS A;  2AL4 A;  4THI A;  2VT5 A;  4PE3 A;  3RTW B;  1FJ6 A;  2RIN A;  2KLF A;  1N0T A;  3PUZ E;  4N8Y A;  4NAP A;  1TWY A;  2VD2 A;  2F8D A;  2DDK A;  4IO7 A;  1ATG A;  4EDP A;  5AA2 D;  4HS7 A;  2AIX A;  1LBC A;  2I48 A;  3O28 A;  2CZK A;  1O64 A;  4MFI A;  3TCH A;  3KEI A;  4BDO A;  3ISP A;  4OA4 A;  5DW8 A;  1S7Y A;  2F7A A;  3H7M A;  4NE4 A;  4BDN A;  1LFG A;  4H8J A;  4IO6 A;  2V3Q A;  3C31 A;  2WYP A;  2O84 X;  2ZMB A;  1XVX A;  4YKK A;  3T66 A;  3O6G A;  2Y5K A;  4ZDM A;  1Q9D A;  3ECR A;  2F6P A;  2G29 A;  4ND9 A;  2QRY A;  3FAT A;  4OVP A;  5EQ8 A;  2ZZW A;  3M3K A;  1BKA A;  4I8C A;  5F1Q A;  1AMF A;  4I9D A;  3VE1 B;  4KD5 A;  2XXV A;  3H03 A;  5CM6 A;  5H8N A;  3H3G A;  3K6U A;  3TEP A;  4F18 A;  4NTL A;  5DT6 A;  3B8B A;  1MS7 A;  5FBP A;  1MPD A;  3LBS A;  4P8B A;  2PX1 A;  3KSX A;  4IR8 A;  1IZ1 A;  4F31 B;  3RNN A;  1URS A;  4LZ5 A;  2Z8E A;  1LFH A;  4N4U A;  5IZZ A;  1S9T A;  2QS3 A;  3SER A;  5I2K A;  1FCK A;  5I3S A;  3B6T A;  3C4M A;  1FPJ A;  3EHS A;  1IXC A;  4F29 A;  5EQ9 A;  3DP8 A;  2QMX A;  1B1X A;  3NOH A;  4RK2 A;  1IIT A;  1B40 A;  1MY0 A;  2HAV A;  2GHA A;  3G3J A;  4IO2 A;  5L8D A;  3N94 A;  5B70 A;  4LN5 A;  1S50 A;  1LST A;  1JVX A;  1B3E A;  3BFU A;  4OTE A;  4DXU A;  3Q25 A;  2XWO A;  3Q26 A;  1NV6 A;  3BIG A;  4GFR A;  3QYT A;  4G4P A;  1URD A;  1ZBM A;  4MNP A;  4R9F A;  1MY2 A;  3HST A;  4GWX A;  4IGR A;  1LBX A;  4DZ1 A;  5H8F A;  4LAT A;  2WX9 A;  3K01 A;  3VLU A;  4P0I A;  4MHF A;  4F3P A;  1DK4 A;  2ZZX A;  1OQG A;  3KG2 A;  1B1H A;  3Q29 A;  3O29 A;  1BLF A;  5AA3 A;  4XTC Q;  5AE4 A;  1BK4 A;  4C1T A;  3FJ7 A;  4DCX A;  1QUJ A;  1RDY A;  1NNT A;  4O94 A;  5I57 B;  4LA9 A;  1EH3 A;  3OXN A;  3KJT A;  5EHS A;  4BDM A;  2ZYN A;  3KC0 A;  1R9L A;  3TCG A;  2H98 A;  4P1E A;  1NL5 A;  2FNC A;  2DWA A;  2XWK A;  4OVR A;  3SES A;  4LUB A;  4PAK A;  3SKP A;  3N26 A;  3PPN A;  2WEF A;  2CEX A;  4BDL A;  3BFT A;  2OK2 A;  4PF6 A;  2D21 A;  1LCF A;  1WDN A;  4N91 A;  4YU0 A;  2Y7K A;  1LB8 A;  3V8X B;  4F2Q A;  2XWI A;  3LSL A;  3ZKL A;  3TEL A;  4FED A;  4NF6 A;  3KN7 A;  5AA1 A;  4DE8 A;  4EQ9 A;  4H5G A;  4OYV A;  3FXU A;  3M3L A;  3SET A;  3UK4 A;  2DSF A;  1FQA A;  5LOM A;  1M5E A;  1B3L A;  4R72 A;  1LAX A;  3OO6 A;  3F11 A;  3OO8 A;  4IO4 A;  2Q2C A;  2DWI A;  4MF3 A;  4P1L A;  1FRP A;  4QFP A;  3DEL B;  1B7U A;  1Y3N A;  3G3K A;  1H45 A;  2FIX A;  1NH8 A;  4GWS A;  4OFL A;  3T1B A;  2XX8 A;  4C0R A;  3FVK A;  4YAH X;  1JET A;  3MZ1 A;  1CNQ A;  2HXR A;  4GF8 A;  4POW A;  4ELO A;  2VPO A;  3H6V A;  3PUW E;  3FVG A;  3TYH A;  3H6W A;  1M5C A;  3A3C A;  1B3G A;  3GYY A;  1FQB A;  1ZLQ A;  1P1O A;  2QVV A;  2H99 A;  4F1V A;  3DP4 A;  4QSE A;  3UN6 A;  1HSL A;  2KR0 A;  2Y7P A;  3OEN A;  3IB1 A;  3UIF A;  4M1V A;  4H6D A;  3FVN A;  3K6V A;  3TFL A;  4NF4 A;  4KFQ A;  1RYX A;  3FJG A;  1IIW A;  3KOT A;  3TMG A;  2I4C A;  1PBP A;  1XC1 A;  4Q5T A;  4G68 B;  2UYE A;  5CBS A;  3IOT A;  5IKB A;  2GRV A;  2NOO A;  1JEV A;  2QS1 A;  5EYF A;  2QPQ A;  3IFA A;  2PFZ A;  1DSN A;  5CBR A;  1DTZ A;  3PMV A;  4OVJ A;  3QAX A;  4RA1 A;  4YB6 A;  4BDQ A;  2HFB A;  2QS4 A;  1USY E;  1SVX B;  2O51 A;  5TPA B;  3RT6 B;  4LVQ A;  4DXC A;  4XF5 A;  2ZXT A;  2QVR A;  4F2O A;  3MBP A;  3FIR A;  1RDX A;  5J1D A;  3TTM A;  3TQW A;  4G8H A;  3C34 A;  4O3C A;  3LSX A;  2OLB A;  4KPT A;  5I5P A;  4F19 A;  4RPO A;  1Y3Q A;  1FW0 A;  2D5W A;  3TDJ A;  3KBR A;  4OWD A;  3MP1 A;  3S4U A;  2F97 A;  3H6U A;  1IMD A;  4X1B A;  3ZSF A;  1UTH B;  4PFY A;  1PDA A;  4PC9 A;  2ZYK A;  2PFY A;  3VFJ A;  3MJN A;  1VDW A;  4JSO A;  2WBD A;  3A29 A;  1DCU A;  3RQT A;  2I58 A;  3JZJ A;  2F3D A;  2GQ1 A;  3PUV E;  2O68 A;  4H0W A;  4PDD A;  4NQ8 A;  2Q2A A;  2NUV A;  1ZTY A;  1VE4 A;  3LUZ A;  5A5X B;  3W9V A;  1J1N A;  5EQA A;  4ELQ A;  1B58 A;  1A7L A;  2RCA A;  4PFI A;  4ESX A;  3TAJ A;  3LR1 A;  3SEV A;  4H65 A;  1M5B A;  4I1D A;  1NUW A;  1FQC A;  3Q28 A;  3LSF B;  1LFI A;  4F3G A;  1UIV A;  4GX3 A;  3V5A A;  4GQO A;  3MYU A;  3IO4 A;  4GX6 A;  1QW0 A;  4JSD A;  5FHM A;  1IUD A;  3ONM A; 
#chains in the Genus database with same CATH homology
 1B7H A;  2G93 A;  5L9S A;  3CFL A;  4KYS A;  4EF2 A;  3R26 A;  1PC3 A;  4Q0C A;  2AL5 A;  1N7X A;  4YKI A;  2QL3 A;  3CG1 A;  3P7I A;  3KZG A;  5FTH A;  3K1M A;  4YMA A;  4NF6 B;  1PB8 A;  3S9E A;  4IO3 A;  2XXW A;  2I3V A;  3ILU B;  4Z7E A;  3TZA A;  3OD7 A;  3HN0 A;  3HCQ A;  1POT A;  2UVH A;  4Z0I A;  3VVE A;  2XXR A;  1R6Z A;  2XHD A;  4QSC A;  1AIV A;  4XKP A;  4FIM A;  2DWJ A;  2UXA A;  3FV2 A;  2Z8F A;  3U92 A;  3U1O A;  1MPB A;  3RN8 A;  1WOD A;  2OBG A;  1VFD A;  2QSX A;  5TU0 A;  1BTJ A;  3RY3 A;  5I57 A;  4RNS A;  2DP8 A;  1N3W A;  3L6G A;  2A5S A;  1R9Q A;  2RC8 A;  4NF5 B;  4WED A;  4C1U A;  3R7X A;  4FAT A;  5CMK A;  3MVW A;  3FAS A;  3K4U A;  4NF4 B;  3GZG A;  4YZZ A;  2PBW A;  1PB9 A;  4QFN A;  1I6B A;  1N04 A;  3G3F A;  3T9U A;  4NED A;  4OFJ A;  1N84 A;  4FAJ A;  3MWB A;  3DP6 A;  5I84 A;  4MBP A;  1LBB A;  3IAZ A;  5DTB A;  2I6E A;  4ZEK A;  1H76 A;  5ICT A;  1AL3 A;  2F6G A;  4DCY A;  1A54 A;  1II5 A;  1O7T A;  4GLI A;  2XX9 A;  2Y7R A;  2QJE A;  1JEU A;  4LON B;  4N07 A;  1EZO A;  1H3D A;  4BLA A;  5EHM A;  5DYH A;  3E9X A;  4KYE A;  4LQ2 A;  3W9W A;  3G3I A;  3GBB A;  3AXF A;  3ILT B;  5DVI A;  5JK4 A;  3HO7 A;  3VLW A;  4QRZ A;  5I58 B;  5AA4 B;  3MW0 A;  3L6H A;  4ZEF A;  3DM0 A;  3UP9 A;  2D3I A;  4R6K A;  4IGT A;  4G2Z A;  3JYR A;  3RTF B;  4G77 A;  3IOW A;  2ZNS A;  3THI A;  1IXI A;  3FJM A;  3RPW A;  2XXH A;  3CI8 A;  4G68 A;  1MQJ A;  2BJJ X;  4HTG A;  4XKN A;  3OOA A;  3SEW A;  2V84 A;  4F3B A;  3PUY E;  4GRK A;  4GWO A;  4BDR A;  3V89 B;  1PBQ A;  4QFK A;  3U8Q A;  4K3F A;  2Q8J A;  5TPA A;  4TQU Q;  3U93 A;  1TFA A;  4ELR A;  4RPN A;  2VHA A;  1Y1M A;  1M5D A;  5I56 B;  1FTK A;  1M5F A;  3W15 C;  1CE2 A;  1UTH A;  5AA2 A;  3PUX E;  4U23 A;  3PMW A;  2CZL A;  4ZZA A;  3KN8 A;  2P2A A;  3CRB A;  4QSD A;  2OJT A;  5A5X A;  4MLV A;  3B7D A;  3PPQ A;  3IR1 A;  1DOT A;  2V3T A;  1Y20 A;  4R6H A;  4ZED A;  1QVS A;  3KJ7 A;  4QF9 A;  1GVC A;  1I6Q A;  2HAU A;  1CB6 A;  4XKQ A;  1JVY A;  5HPQ A;  5H8Q B;  2H5Y A;  2REJ A;  4XXU A;  3MUQ A;  2B3B A;  3K00 A;  2OZZ A;  1ANF A;  2ZNU A;  5K2X A;  3GXA A;  2O69 A;  4OZ9 A;  3M3F A;  1FQD A;  1N3X A;  4KQP A;  4GXA A;  1B46 A;  4GVO A;  4OQO A;  4ELP A;  1LAG E;  3ODB A;  4PET A;  2GH9 A;  4F1U A;  1B4Z A;  1I69 A;  3K2D A;  4PP0 A;  1O63 A;  2DXY A;  4R6Y A;  3VV5 A;  3VXC A;  3UOR A;  1SI0 A;  2VGQ A;  5HBC A;  2V93 A;  1MM6 A;  2ALU A;  1XVY A;  3IOU A;  3QXM A;  1A55 A;  3TKD A;  4KYD A;  2H4I A;  3SEX A;  3FVO A;  1FTL A;  3D4G A;  1Z7M E;  2UVG A;  3A09 A;  5TP9 B;  1MXU A;  3TCF A;  4EQB A;  3MP6 A;  2R9J A;  4RY1 A;  5F7V A;  3CFZ A;  3T96 B;  4ISU A;  2I49 A;  2XXT A;  3HV1 A;  4Q30 B;  1JW1 A;  3LC8 A;  1QUK A;  1LAH E;  3K1N A;  4NF5 A;  2RF1 A;  3MZ9 A;  3QIM A;  4TOZ A;  1IXG A;  4OFO A;  2RC7 A;  1A99 A;  3RLF E;  3U72 A;  1EU8 A;  1LB9 A;  1MXV A;  3GLB A;  1ZIU A;  3EHU A;  3CIJ A;  5L9O A;  3G3H A;  1RYO A;  1B9J A;  2Y7W A;  4JWO A;  1VSO A;  2B3F A;  4ECF A;  1B5H A;  1SYI A;  2FYI A;  2GHB A;  1MRP A;  3FXQ A;  2F78 A;  5KCJ A;  3VVD A;  1SBP A;  2PT2 A;  4NWD A;  1BIY A;  2DWH A;  2XXQ A;  3UGW A;  1MY3 A;  4O3B A;  1SW5 A;  1GTK A;  4FE8 A;  3IJO B;  3TTN A;  1P1U A;  4EXK A;  5I58 A;  3E3K A;  5AA4 A;  4DIG A;  1FTM A;  4R2B A;  1JNF A;  5AA2 B;  3OEL A;  1SW2 A;  3EN3 A;  1MXW A;  3H4Z A;  4N13 A;  3HPI A;  3VXB A;  1F9B A;  1PEB A;  2YLN A;  3MC2 A;  2R71 A;  3SEU A;  1P1W A;  2I4B A;  3B6Q A;  5H8H B;  1B6H A;  1Y1Z A;  1MG1 A;  4AB6 A;  5FHO A;  2HEU A;  3O2A A;  3M8U A;  3TTK A;  3KN3 A;  1GR2 A;  3MVY A;  1MXX A;  2UYF A;  4TLM B;  2ZYM A;  3WAF A;  2Z22 A;  2QMW A;  5ITO A;  4JWX A;  2DYX A;  4YMB A;  1B51 A;  1URG A;  3B6W A;  3U94 A;  3SEY A;  3TTR A;  3EF7 A;  4O3A A;  1B5J A;  2X26 A;  2O1L A;  4KI0 E;  5I56 A;  4ZEI A;  1MY4 A;  2RC9 A;  3CSG A;  4DXB A;  2M8C A;  4JWY A;  2V25 A;  2F34 A;  4JDF A;  2NWJ A;  3K6X A;  3FZV A;  2DQV A;  1Y4T A;  2R6G E;  5KZT A;  3CFX A;  3QSL A;  2A5T B;  2HQ0 A;  2XD3 A;  2THI A;  5JEI A;  3T9H B;  3O66 A;  2REG A;  4HCY A;  5M2V A;  4R9G A;  1EZ9 A;  4ZEC A;  1Y3P A;  1P99 A;  1B0L A;  4WXJ A;  5CRY A;  1SI1 A;  4PFW A;  2CMO A;  5DEX A;  2F36 A;  3T9V A;  1GV8 A;  3OO9 A;  1B3F A;  2RCB A;  3CVG A;  4R74 A;  2FA7 A;  5CI5 A;  4JB7 A;  3SDF A;  4OXV A;  5H8Q A;  1HSE A;  3RUM A;  2XXX A;  4IB2 A;  2XXI A;  3TPA A;  2Y84 A;  4TLL B;  5ITP A;  1QUI A;  3E4R A;  3RGY A;  1D4N A;  3D4C A;  2I3W A;  1H44 A;  1UTB B;  5L9M A;  3TQL A;  4OEV A;  1ELJ A;  1HSJ A;  2ONR A;  5ICQ A;  3C32 A;  3EQ1 A;  4WEP A;  1FTO A;  4MLQ A;  4LQ5 A;  5KDT B;  2GFE A;  3JV9 A;  4DLD A;  3IJX B;  4MH5 A;  5IAI A;  2UVI A;  1JQF A;  4AB5 A;  3TTL A;  2DXR A;  1DPE A;  1FQF A;  5HM4 B;  4ONY A;  2QS2 A;  5KCJ B;  5H8S A;  4UAC A;  5TP9 A;  4XKR A;  1TXF A;  1YTV A;  1P1N A;  2I0C A;  4H67 A;  5BUU A;  1MDQ A;  1B3H A;  4G8N A;  3K1P A;  1Q35 A;  4YKP A;  3S9L C;  5FTI A;  3VLV A;  3WAE A;  3PU5 A;  2F7B A;  3MQ9 A;  1MH4 A;  3IB0 A;  1DTG A;  3FUZ A;  3VVF A;  1MPC A;  1NKX A;  4YKJ A;  4FEC A;  3S9N C;  4JBZ A;  3H06 B;  3MZB A;  5ELV A;  3I6V A;  4LZ7 A;  3IL1 B;  3A3U A;  5CC2 A;  4QHQ A;  1XS5 A;  3G3G A;  5FHN A;  1B0H A;  3VDF A;  2O1M A;  3HHF A;  2ONK E;  1B5I A;  2OWS A;  1N76 A;  5CMM A;  4R2F A;  1TFD A;  4E0W A;  3T22 A;  1QUL A;  4PE5 B;  3PGF A;  1N7W A;  3S2V A;  1ZKB A;  2PVU A;  1Q1K A;  2PYY A;  4P0G A;  4RYA A;  3EPE A;  3BBR A;  4KCC A;  1NNK A;  3V83 A;  3PPO A;  2ABH A;  4N6P A;  4U4S A;  4OHN A;  3N5L A;  4QFO A;  3UA8 A;  1XT8 A;  3C33 A;  4KCD A;  5JTY B;  4EF1 A;  3CSB A;  4GXS B;  2VP1 A;  3N6T A;  2HXW A;  1SD3 A;  1B2H A;  3T93 B;  3I3V A;  3K6W A;  3LSW A;  4YB7 A;  3K0V A;  1D9Y A;  1B7Z A;  4X9T A;  1QKA A;  4UA8 A;  3CR9 A;  3R6U A;  4GIZ A;  3QUF A;  4OER A;  2OCU A;  1IQ7 A;  2YPN A;  2DVZ A;  4FEB A;  3ZKK A;  1JW5 A;  2O7I A;  1OIB A;  4OEN A;  4JXI A;  2DE2 A;  5CMB A;  4YIC A;  3QK6 A;  5H8H A;  1EZP A;  2XX7 A;  2Q88 A;  2HCA A;  4KHZ E;  1AOV A;  5BWJ A;  2LAO A;  3H6T A;  4NF8 B;  2B65 A;  1MXZ A;  2YJP A;  2AYS A;  4DDD A;  3KSJ A;  1QJM A;  1B4H A;  5DEX B;  3K02 A;  2DVC A;  4ZZE A;  5I59 A;  1LAF E;  3FD3 A;  5CMC A;  5DVF A;  1US4 A;  1DPP A;  3QUJ A;  1MH3 A;  1SYH A;  1OVB A;  3PV0 E;  1USY H;  2Q9T A;  4XIG Q;  3MPL A;  1FQE A;  3OEM A;  1IEJ A;  1SDX A;  1XHY A;  1JW4 A;  4R73 A;  3IOV A;  4EXL A;  1Y9U A;  2NVU B;  1LCT A;  4F3S A;  2IEE A;  2VD3 A;  3C35 A;  5I2N B;  2VOZ A;  5DVJ A;  4IY6 A;  3PMX A;  3FGS A;  1OQH A;  1MQH A;  2P1S A;  1SQY A;  1LLS A;  3IX1 A;  2A5T A;  4GL8 A;  3MAM A;  2E1S A;  2WKY A;  1NH7 A;  1H43 A;  1B32 A;  3CG3 A;  1MQI A;  1Y4C A;  2ANJ A;  3KFM A;  2ZNT A;  4ZE9 A;  4ZE8 A;  4POX A;  2Z23 A;  1SW4 A;  5K2Y A;  4OES A;  3OSR A;  4ESW A;  1A8E A;  3IK6 B;  4Q8R A;  1OLC A;  4H5F A;  4FJP A;  2O6A A;  2XXP A;  1B05 A;  1TT1 A;  4F22 A;  3IB2 A;  3IOR A;  3KOS A;  1UTB A;  2Z8D A;  3MVX A;  4LZ8 A;  3O6I A;  3FXR A;  4P11 A;  5KDT A;  1MQG A;  3Q27 A;  3BKI B;  1P1Q A;  2IA4 A;  2W7Y A;  4LP2 B;  5H8N B;  4H8I A;  4I62 A;  4ZS9 A;  4EQ7 A;  4OET A;  3MP8 A;  4U4X A;  2XXU A;  2Q89 A;  3HHG A;  3S9M C;  2E0S A;  2OWT A;  2ESN A;  2F35 A;  2ZYO A;  2NXO A;  4RXL A;  5I2K B;  1YAE A;  1D9V A;  4U22 A;  5B7D A;  4G68 C;  1AH5 A;  4X1D A;  2DS9 A;  1Z7N E;  3LUY A;  3PD9 A;  1VR5 A;  1OVT A;  4NWC A;  1R1N A;  1UQW A;  4M4G A;  4E0X A;  3O97 A;  3I5O A;  1B52 A;  3O6H A;  4X48 A;  1SW1 A;  1OLA A;  3PD8 A;  2P0S A;  1MM7 A;  1ZU0 A;  2V3U A;  4AQ4 A;  5H8F B;  2O7U A;  2F5X A;  3FV1 A;  1IXH A;  3KGC A;  1MXY A;  1NNP A;  5I59 B;  1PB7 A;  1I6A A;  1MY1 A;  1YPN A;  3DLN A;  3OEK A;  4QFL A;  2UVJ A;  1VFE A;  2XXY A;  3N6U A;  1LGB C;  2H9B A;  1NNF A;  2PT1 A;  3G7W A;  5ISU A;  1XOC A;  2ONS A;  1L5T A;  1FTJ A;  4GOT A;  5JTY A;  4PQJ A;  4R75 A;  4HCW A;  1A40 A;  2X7Q A;  1US5 A;  4PFT A;  1YCJ A;  2XD2 A;  2HZK A;  4F1Y A;  4IY5 A;  2H25 A;  1DMB A;  4RJZ A;  1ZJL A;  1MQD A;  1OMP A;  4EUO A;  4FOR A;  3EHT A;  2F7C A;  2RKM A;  3USD A;  4IO5 A;  3OMB A;  4H1X A;  3OSQ A;  3TUS A;  4ZEB A;  4F39 A;  4NF8 A;  1D3K A;  1MDP 1;  1T0K A;  1BP5 A;  4U21 A;  1WVJ A;  4PFU A;  2I0B A;  2X7P A;  3MVZ A;  3C9H A;  3TOD A;  3ZS6 A;  2HZL A;  3IO6 A;  3C36 A;  4NMY A;  1A8F A;  4OMB A;  2Y7I A;  1KWH A;  1POY 1;  4KR5 A;  3MPK A;  3O9P A;  1RKM A;  4G8M A;  4HW8 A;  1NMU A;  4GL0 A;  4YB5 A;  3PPR A;  1UIU A;  5I2N A;  4L17 A;  3E13 X;  4RK9 A;  2DE3 A;  1GGG A;  2DE4 A;  4GD5 A;  4U2R A;  3T9X B;  3PPP A;  4WKM A;  3RT8 A;  4U1O A;  1QKB A;  2DOJ A;  4U1Z A;  3OO7 A;  1NFT A;  1ZMG A;  3GBA A;  4OEU A;  2PMS A;  2AL4 A;  4THI A;  3RTW B;  2RIN A;  2KLF A;  1N0T A;  3PUZ E;  1TWY A;  2VD2 A;  2F8D A;  4IO7 A;  1ATG A;  4EDP A;  5AA2 D;  4HS7 A;  2AIX A;  1LBC A;  2I48 A;  3O28 A;  1O64 A;  4MFI A;  3TCH A;  3KEI A;  4BDO A;  1S7Y A;  2F7A A;  3H7M A;  4NE4 A;  4BDN A;  1LFG A;  4H8J A;  4IO6 A;  2V3Q A;  3C31 A;  2O84 X;  2ZMB A;  1XVX A;  4YKK A;  3T66 A;  3O6G A;  4ZDM A;  3ECR A;  2F6P A;  2G29 A;  4ND9 A;  2QRY A;  3FAT A;  3M3K A;  1BKA A;  4I8C A;  5F1Q A;  1AMF A;  4I9D A;  3VE1 B;  4KD5 A;  2XXV A;  3H03 A;  5CM6 A;  5H8N A;  3H3G A;  3K6U A;  3TEP A;  4F18 A;  4NTL A;  5DT6 A;  1MS7 A;  1MPD A;  3LBS A;  2PX1 A;  3KSX A;  1IZ1 A;  4F31 B;  3RNN A;  1URS A;  4LZ5 A;  2Z8E A;  1LFH A;  1S9T A;  2QS3 A;  3SER A;  5I2K A;  1FCK A;  3B6T A;  3C4M A;  3EHS A;  1IXC A;  4F29 A;  3DP8 A;  2QMX A;  1B1X A;  4RK2 A;  1IIT A;  1B40 A;  1MY0 A;  2HAV A;  2GHA A;  3G3J A;  4IO2 A;  5L8D A;  3N94 A;  5B70 A;  1S50 A;  1LST A;  1JVX A;  1B3E A;  3BFU A;  4OTE A;  4DXU A;  3Q25 A;  3Q26 A;  4GFR A;  3QYT A;  4G4P A;  1URD A;  1ZBM A;  4R9F A;  1MY2 A;  3HST A;  4IGR A;  4DZ1 A;  5H8F A;  4LAT A;  3K01 A;  3VLU A;  4P0I A;  4F3P A;  1OQG A;  3KG2 A;  1B1H A;  3Q29 A;  3O29 A;  1BLF A;  5AA3 A;  4XTC Q;  5AE4 A;  4C1T A;  3FJ7 A;  4DCX A;  1QUJ A;  1NNT A;  5I57 B;  4LA9 A;  1EH3 A;  3OXN A;  3KJT A;  5EHS A;  4BDM A;  2ZYN A;  1R9L A;  3TCG A;  2H98 A;  1NL5 A;  2FNC A;  2DWA A;  3SES A;  4LUB A;  3SKP A;  3N26 A;  3PPN A;  4BDL A;  3BFT A;  2OK2 A;  2D21 A;  1LCF A;  1WDN A;  4YU0 A;  2Y7K A;  1LB8 A;  3V8X B;  4F2Q A;  3LSL A;  3ZKL A;  3TEL A;  4FED A;  4NF6 A;  3KN7 A;  5AA1 A;  4DE8 A;  4EQ9 A;  4H5G A;  4OYV A;  3FXU A;  3M3L A;  3SET A;  3UK4 A;  2DSF A;  1FQA A;  5LOM A;  1M5E A;  1B3L A;  4R72 A;  1LAX A;  3OO6 A;  3F11 A;  3OO8 A;  4IO4 A;  2Q2C A;  2DWI A;  4MF3 A;  4QFP A;  3DEL B;  1B7U A;  1Y3N A;  3G3K A;  1H45 A;  1NH8 A;  4OFL A;  2XX8 A;  4C0R A;  3FVK A;  4YAH X;  1JET A;  3MZ1 A;  4GF8 A;  4POW A;  4ELO A;  3H6V A;  3PUW E;  3FVG A;  3TYH A;  3H6W A;  1M5C A;  3A3C A;  1B3G A;  1FQB A;  1ZLQ A;  1P1O A;  2H99 A;  4F1V A;  3DP4 A;  4QSE A;  3UN6 A;  1HSL A;  2Y7P A;  3OEN A;  3IB1 A;  3UIF A;  4M1V A;  4H6D A;  3FVN A;  3K6V A;  3TFL A;  4NF4 A;  4KFQ A;  1RYX A;  3FJG A;  1IIW A;  3KOT A;  3TMG A;  2I4C A;  1PBP A;  1XC1 A;  4Q5T A;  4G68 B;  2UYE A;  5CBS A;  3IOT A;  5IKB A;  2GRV A;  2NOO A;  1JEV A;  2QS1 A;  5EYF A;  2QPQ A;  1DSN A;  5CBR A;  1DTZ A;  3PMV A;  4OVJ A;  3QAX A;  4RA1 A;  4YB6 A;  4BDQ A;  2HFB A;  2QS4 A;  1USY E;  1SVX B;  2O51 A;  5TPA B;  3RT6 B;  4LVQ A;  4DXC A;  2ZXT A;  4F2O A;  3MBP A;  3FIR A;  5J1D A;  3TTM A;  3TQW A;  4G8H A;  3C34 A;  4O3C A;  3LSX A;  2OLB A;  4KPT A;  4F19 A;  4RPO A;  1Y3Q A;  1FW0 A;  2D5W A;  3TDJ A;  3KBR A;  4OWD A;  3MP1 A;  3S4U A;  2F97 A;  3H6U A;  4X1B A;  3ZSF A;  1UTH B;  4PFY A;  1PDA A;  2ZYK A;  3VFJ A;  3MJN A;  4JSO A;  3RQT A;  2I58 A;  3JZJ A;  3PUV E;  2O68 A;  4H0W A;  2Q2A A;  2NUV A;  1ZTY A;  1VE4 A;  5A5X B;  3W9V A;  1J1N A;  4ELQ A;  1B58 A;  1A7L A;  2RCA A;  4ESX A;  3TAJ A;  3LR1 A;  3SEV A;  4H65 A;  1M5B A;  4I1D A;  1FQC A;  3Q28 A;  3LSF B;  1LFI A;  4F3G A;  1UIV A;  3V5A A;  4GQO A;  3IO4 A;  1QW0 A;  4JSD A;  5FHM A;  1IUD A;  3ONM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...