1N84A

Human serum transferrin, n-lobe
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title THE POSITION OF ARGININE 124 CONTROLS THE RATE OF IRON RELEASE FROM THE N-LOBE OF HUMAN SERUM TRANSFERRIN. A STRUCTURAL STUDY
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Serotransferrin
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2002-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n84A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n84A02
3K6VA 2DYXA 3FD3A 3N26A 3ZKKA 3MVWA 3MWBA 3SDFA 4GVOA 3KSXA 1SQYA 1VR5A 2AL5A 1MS7A 3M3KA 1L5TA 4G8NA 1OMPA 3O6IA 4OYVA 1GVCA 4Q30B 1JEUA 2HFBA 4XKPA 3VXBA 3CFZA 1QW0A 3FVKA 3Q25A 3BFUA 1Y1ZA 4DXBA 4RY1A 3IB0A 4ESWA 4X1BA 3DP8A 4MH5A 2VOZA 5CI5A 3A09A 3IJXB 3BBRA 4O3CA 2NOOA 2XX9A 1B52A 3OO9A 4NF4A 3THIA 4F29A 4EQ9A 5AA3A 4AB5A 4OVJA 2IA4A 4QF9A 1WDNA 4IGRA 4JDFA 3WAFA 3IB2A 1P1WA 3O97A 3E4RA 5JEIA 3BKIB 4JSDA 2H5YA 3O6GA 2I48A 4JWXA 3R6UA 3G3JA 3DP4A 4IO4A 3UORA 2V84A 1RKMA 1ZKBA 2VHAA 3MUQA 1B5IA 4OERA 5TU0A 3SEXA 3FV1A 4LATA 1MXYA 4MLVA 4NF6B 3MP8A 5A5XA 1FTKA 4OFJA 4GL8A 1S9TA 4R6HA 5H8NA 1IXHA 3MAMA 2GH9A 2XXIA 3PUXE 2Q9TA 1NKXA 4P0GA 5M2VA 5F7VA 5HBCA 5AA2B 1ANFA 5I58A 2D3IA 3SEVA 3VV5A 3S9NC 1MY3A 3RGYA 3TAJA 4RPNA 5K2YA 2OWTA 4X9TA 2UYFA 2QS2A 2Y7PA 2XXHA 3PPRA 5CBSA 1GGGA 5I57A 4EQBA 1USYH 1QULA 2ABHA 4G8HA 3ZSFA 2H99A 1XOCA 4TOZA 4XIGQ 2F78A 2XXRA 4HCYA 3HV1A 3UP9A 1FCKA 4C1UA 3OENA 1LB9A 1QKAA 3H06B 4TLMB 1R9LA 4XKQA 3IOTA 4DZ1A 1MPBA 2RC8A 3PUVE 3TTNA 3VVEA 1MQIA 2QSXA 4ZEKA 2QJEA 1M5FA 4AQ4A 4ZZEA 2ZYNA 1DTZA 3KSJA 5H8FB 4F3PA 1UTHA 1DSNA 2P2AA 2ZNTA 3C32A 4KCCA 5L8DA 4U23A 1F9BA 4KPTA 1QVSA 4RA1A 3DLNA 2PBWA 4L17A 1Y4TA 1H43A 5KDTA 2VD3A 3F11A 3H4ZA 4H5GA 4IY6A 3TQLA 3CI8A 1H44A 3OSQA 4NF5A 4KQPA 4H65A 1DPEA 4H67A 4DXUA 3IB1A 5H8HA 3U94A 1MPDA 4XKRA 1Y3PA 3MZ1A 1EZ9A 4ZZAA 4F19A 1SW2A 2E1SA 3C31A 3FJ7A 3TPAA 2B3BA 5HPQA 2HEUA 3UK4A 4NEDA 3OO6A 1SYHA 4F1VA 1NNKA 5DEXB 1JVYA 3PPOA 4X48A 1N0TA 2HCAA 1LB8A 3H7MA 3QXMA 4BDRA 5I57B 1UQWA 3QIMA 4FE8A 5H8SA 3PMXA 3T9HB 2XD3A 1LCFA 4KYSA 1GR2A 4GF8A 3V83A 3TTLA 4YU0A 4U4SA 5DT6A 3FJGA 3RT8A 4RJZA 5I58B 1TFDA 1OQGA 4YB5A 3EHTA 3OO7A 4LVQA 1SD3A 1P1OA 4P11A 3D4GA 1NNPA 1OVBA 4U2RA 3TCHA 4R6YA 3SEWA 4EF2A 1ZIUA 3T9VA 1OLAA 3GBBA 2O84X 3O6HA 5CMMA 1FQEA 3IL1B 3SEUA 4NE4A 1CE2A 3MP1A 4JWOA 5K2XA 4XTCQ 4F3GA 1B5JA 2FNCA 3PU5A 3CFLA 3KBRA 4QSDA 2X7QA 3QK6A 4FEDA 4KD5A 2HZKA 4KHZE 1SW4A 2G93A 5EYFA 5J1DA 3K0VA 4DIGA 4F39A 3V89B 4GD5A 4YKJA 2XX8A 3IK6B 3KGCA 4GFRA 3TKDA 4EXKA 5TP9B 4IY5A 5DEXA 4ELRA 4YMAA 1Y3NA 4F1UA 2E0SA 5AA4A 3HHFA 2XXXA 4DDDA 4R9FA 1YAEA 1EH3A 1O64A 3MPKA 3MP6A 4FIMA 1UTHB 4LZ8A 3VDFA 4LQ2A 3U92A 1JW1A 1PB8A 1B3EA 3PD9A 4U21A 1AH5A 3TODA 3RNNA 1I6BA 1N7WA 2I58A 4YMBA 2OK2A 3VXCA 3HPIA 3CRBA 1MXZA 2CMOA 3LSWA 3K1MA 2Q88A 1NH8A 2XXUA 4C1TA 1I69A 3RQTA 1N04A 2OCUA 4FECA 4U22A 3RTWB 3E9XA 2I3WA 1QUIA 4AB6A 3R26A 1M5EA 1PDAA 1H76A 1ZTYA 2A5SA 2O68A 5FHNA 2NVUB 5I2KA 1ZU0A 2VP1A 2LAOA 3KN8A 5EHSA 2XXVA 1BLFA 5JTYA 3IJOB 4Q0CA 4DLDA 2Q8JA 2R6GE 4TQUQ 5CBRA 4GOTA 4EQ7A 1MM7A 4OZ9A 5I59B 2RKMA 1R6ZA 2O51A 4IO7A 1FQBA 2Y7WA 2QMXA 1LCTA 2V25A 2V3QA 5CMCA 5DVFA 3SETA 3LC8A 1GTKA 3T9XB 3VLVA 2F36A 2AYSA 4F1YA 4YZZA 1D4NA 4LUBA 4PQJA 4R73A 1N3XA 1P1QA 1NFTA 1PEBA 2H9BA 2Q89A 2VD2A 1LAFE 1IZ1A 3HSTA 4I8CA 4O3AA 1PBPA 5CMBA 4QSEA 1MY1A 3H03A 1B3LA 3HO7A 4YB6A 3K01A 1ELJA 1MQHA 4ZEIA 3IX1A 1Y3QA 1IIWA 2DE3A 3K2DA 4E0WA 4F31B 4ZECA 4QFPA 2OBGA 3TYHA 1XHYA 1QUKA 3V8XB 5L9SA 3FGSA 1PB7A 4WKMA 4O3BA 2A5TA 2P0SA 3TCFA 4BDQA 2I0CA 1MRPA 4FATA 2IEEA 2XXYA 1JQFA 2B3FA 3K6WA 5DTBA 5AA1A 2RF1A 1B32A 2HXWA 2V93A 3R7XA 1VFEA 3T96B 1MY4A 4HTGA 3KFMA 4RPOA 1S7YA 2ANJA 2QS3A 2F5XA 1NNFA 1MPCA 1H45A 1R9QA 3FXRA 1URGA 2XXWA 2YJPA 3M3FA 3PUZE 4IO2A 1IXCA 3RN8A 1B1XA 5L9OA 5ISUA 1R1NA 1UTBB 2DVZA 3VVDA 2DP8A 4QFOA 4BDMA 1FTLA 3O2AA 3VE1B 1LGBC 1B0LA 4XKNA 1Q1KA 3P7IA 2V3UA 4Z0IA 2Z8EA 4FJPA 4DXCA 1MQGA 1POY1 4NWDA 1XC1A 4MFIA 1MDP1 5KCJB 2GFEA 1UIUA 3H6WA 4G77A 5JTYB 3OD7A 4G68A 1B5HA 1IEJA 1MH4A 4H0WA 3B7DA 5TP9A 5I2NA 3ZKLA 4ELQA 1PB9A 4DCYA 4ZE9A 5CM6A 3EHSA 1MY0A 4ZDMA 4ONYA 2O1LA 3MVZA 2F7BA 3LSXA 3IR1A 1P1UA 3QUFA 1S50A 3RPWA 4R72A 2Y7KA 4RK9A 5H8FA 4Z7EA 3O28A 2DWIA 5DYHA 3LSFB 1TXFA 3TELA 1SI0A 4KYDA 4PP0A 3UIFA 1B58A 3T22A 2DVCA 2Z23A 1B0HA 2F34A 5HM4B 4NWCA 1B3HA 5LOMA 2F6PA 3L6HA 1FTJA 2O7UA 3GLBA 4NF5B 3M8UA 5EHMA 3IAZA 3WAEA 5AE4A 1IXGA 1FW0A 3RTFB 1A99A 1BIYA 1D3KA 2F97A 4QRZA 1Q35A 3TTMA 3VFJA 5I59A 1XVXA 3C34A 3Q29A 2I49A 5CMKA 3TEPA 4F2OA 2ZYOA 1ZLQA 3D4CA 3PMVA 5FTHA 5I56A 5JK4A 2QS1A 1NL5A 4YKIA 1T0KA 4RXLA 5I2KB 2PMSA 2PT1A 3G3IA 4FORA 3N6UA 2H25A 1RYXA 4I1DA 5KCJA 4GXAA 4OFOA 4G68B 4H6DA 4PFWA 2GRVA 2XHDA 4F2QA 3IOWA 2DSFA 1A8EA 1QJMA 2ZNUA 1FQDA 1O63A 3PD8A 2CZLA 4Q5TA 3IO6A 3PGFA 4OFLA 3N94A 4HCWA 1POTA 2I4CA 2ZYMA 4LZ5A 4RNSA 5TPAB 3FZVA 2DXYA 3CSGA 1MH3A 2DOJA 1IXIA 1N76A 1US4A 2DWAA 2HAUA 3JZJA 3N6TA 5I2NB 1HSJA 2OWSA 5ELVA 4MF3A 1TWYA 3S4UA 3GXAA 3RY3A 4U1ZA 2BJJX 3I3VA 4QFNA 4R2FA 3K6XA 4G4PA 2ONSA 4ZEDA 2OZZA 3IORA 3O66A 4UA8A 5H8QA 3KOTA 3I5OA 4JXIA 4K3FA 1JEVA 1RYOA 2RC7A 4N6PA 4ELOA 2GHAA 3C33A 4N13A 3T93B 2D21A 2X7PA 2HQ0A 1TT1A 4IO3A 4DE8A 2M8CA 2I6EA 5ICTA 4HS7A 2THIA 3FVOA 1M5BA 5IKBA 5IAIA 2YLNA 5KDTB 3FIRA 3ONMA 4UACA 3USDA 2I3VA 2WKYA 5BWJA 4LP2B 2QL3A 4KCDA 1EU8A 3PMWA 2UVIA 1JW5A 4NF4B 1B4HA 2Y7RA 4ECFA 4F22A 5I56B 5I84A 3EQ1A 3KG2A 1URDA 3U72A 2G29A 3CG1A 3H6TA 3Q28A 4YAHX 2XD2A 3HHGA 4POWA 3FJMA 5CC2A 1A55A 2PYYA 3S9EA 1SI1A 3C4MA 2ZXTA 2DE4A 1B4ZA 1LFIA 2DWHA 2I0BA 1O7TA 2F6GA 4GRKA 2OJTA 1AMFA 2OLBA 3C9HA 4M4GA 4OESA 4R74A 1JETA 3FASA 3G7WA 4OENA 2B65A 2PVUA 3MC2A 3OSRA 2QRYA 4GIZA 2HAVA 4H1XA 1II5A 2RINA 4OMBA 4QFKA 4R9GA 1VE4A 3OXNA 4ELPA 1FQFA 2DS9A 2UVJA 1NH7A 3C36A 3ILTB 3MJNA 3TFLA 3E13X 3MZBA 3GZGA 4QHQA 1LAXA 1OIBA 2O69A 2FA7A 4FEBA 1LAHE 1B9JA 4YKPA 4ZS9A 1MXVA 2YPNA 1ZJLA 2HZLA 1BKAA 4PFYA 4F18A 4BDNA 1MXWA 3H6UA 1SDXA 1IUDA 1WVJA 1PC3A 3Q27A 1I6AA 5FHMA 3TTRA 2NXOA 3TZAA 4NF8A 3LR1A 1DTGA 1P1NA 3PUYE 4ND9A 4EDPA 2O6AA 3TDJA 4ZEBA 2QPQA 4GXSB 1B1HA 1A40A 4GWOA 3OOAA 1Y20A 1EZPA 2F8DA 3K6UA 3ILUB 4LQ5A 1PBQA 1B46A 1Z7NE 1EZOA 4U1OA 1QKBA 1SBPA 2PX1A 3VVFA 1VFDA 2XXTA 3PV0E 3B6TA 4LONB 3S9MC 4YKKA 3KEIA 3LBSA 1XT8A 4NMYA 4PFUA 2I4BA 5DVIA 3QYTA 1CB6A 2NUVA 1Y9UA 3FXUA 1DPPA 1XVYA 3KOSA 5H8QB 3O29A 3N5LA 5BUUA 3UGWA 3TMGA 2Y7IA 3OMBA 2XXQA 4H5FA 1B3FA 1BP5A 1SW1A 2A5TB 1A7LA 4G8MA 3B6QA 1KWHA 3MVYA 1B51A 1WODA 4BDOA 3DELB 1VSOA 3PUWE 4ESXA 1YCJA 1FQCA 1LBBA 3CR9A 1N7XA 2P1SA 4IO6A 3FVNA 3L6GA 4JSOA 1N3WA 4Q8RA 3HN0A 2GHBA 1SVXB 5AA2A 4R2BA 3FXQA 1B7HA 3PPPA 2KLFA 3EHUA 2REJA 2ZYKA 5F1QA 5ITOA 2NWJA 3PPQA 1YPNA 4OEUA 3CIJA 3V5AA 1AIVA 4IB2A 3JYRA 4BDLA 4H8IA 3IOVA 3TQWA 1MXUA 1OLCA 4KYEA 1NNTA 3PPNA 2ZMBA 1LLSA 1B2HA 4RYAA 2PT2A 2F35A 3OEKA 2RC9A 4LZ7A 3H3GA 2O7IA 1P99A 4IO5A 4NF6A 3RLFE 5A5XB 2Z8DA 3VLUA 2DXRA 1D9YA 2UVHA 3LUYA 4KI0E 4ZEFA 4NF8B 1OQHA 3IO4A 2Y84A 4FAJA 2Q2AA 2D5WA 4RK2A 1FTOA 3U1OA 3CSBA 1B7UA 1JVXA 4U4XA 5B7DA 1B05A 4F3SA 4XXUA 3OO8A 4THIA 1UIVA 3SEYA 3U93A 3C35A 1MXXA 3G3GA 4JWYA 2W7YA 1J1NA 4R75A 1B6HA 1MQDA 4QFLA 5FHOA 4OEVA 3UN6A 4ISUA 4TLLB 3W9WA 3B6WA 2R9JA 3K02A 3Q26A 1JW4A 1HSLA 3EN3A 5TPAA 1IQ7A 3ZS6A 1US5A 1QUJA 4HW8A 1DMBA 1AL3A 1SYIA 1URSA 2H98A 1D9VA 1DOTA 3KZGA 5H8HB 4OHNA 4BLAA 5ITPA 1B40A 1Z7ME 1LFGA 3K4UA 4KFQA 1AOVA 2DQVA 4YICA 1YTVA 3H6VA 3DP6A 4OXVA 2V3TA 1M5DA 4GQOA 3SERA 1H3DA 1A8FA 1MG1A 4PETA 3TUSA 1SW5A 2AIXA 1HSEA 2H4IA 2ESNA 4X1DA 4F3BA 1N84A 2UYEA 4IGTA 1MM6A 4P0IA 2Q2CA 1LSTA 3W9VA 2UXAA 1XS5A 4YB7A 1B7ZA 1TFAA 3FV2A 3G3KA 1MQJA 2XX7A 3K00A 1NMUA 3I6VA 3T66A 5ICQA 3U8QA 3SKPA 3TTKA 4I9DA 4GLIA 3CVGA 4DCXA 4EUOA 3HCQA 3QAXA 1MY2A 3S2VA 1LFHA 1OVTA 3MVXA 3GBAA 4WXJA 1Y4CA 3ODBA 3TCGA 4H8JA 4OETA 1BTJA 3M3LA 1USYE 3MW0A 4QSCA 3O9PA 4C0RA 4N07A 3MBPA 3A3UA 4POXA 4PFTA 3K1NA 4R6KA 5KZTA 4MLQA 2QS4A 1IITA 2F7CA 2REGA 2ZNSA 2DE2A 3G3HA 4MBPA 3QSLA 3T9UA 1MDQA 1I6QA 2X26A 2QMWA 3OEMA 3RUMA 3JV9A 4NTLA 3FUZA 1JNFA 2DWJA 3MZ9A 3G3FA 4EXLA 3KJ7A 1LAGE 2UVGA 1FTMA 2O1MA 4KR5A 2AL4A 4OTEA 4OWDA 4OQOA 4JB7A 3S9LC 3MQ9A 4LA9A 3E3KA 4G2ZA 1ZBMA 3RT6B 3W15C 4WEDA 3ECRA 2RCBA 4WEPA 3UA8A 5AA2D 3OELA 1LBCA 1Y1MA 5L9MA 3IOUA 2F7AA 1FQAA 1UTBA 3CG3A 3A3CA 5AA4B 3FATA 2RCAA 3QUJA 5FTIA 1ZMGA 2XXPA 4G68C 3SESA 5H8NB 1B3GA 2Z22A 2R71A 2VGQA 3CFXA 2ALUA 4PE5B 3EPEA 2ONKE 3EF7A 3KN7A 4GL0A 4M1VA 5B70A 2FYIA 3AXFA 2Z8FA 3KJTA 3BFTA 3LSLA 3K1PA 3KN3A 5CRYA 4E0XA 2ONRA 1ATGA 3MPLA 3VLWA 4I62A 4EF1A 1A54A 1GV8A 1M5CA 4JBZA 5DVJA 3DM0A 3FVGA 4ZE8A
chains in the Genus database with same CATH superfamily
3N26A 3MWBA 3KSXA 2AL5A 1L5TA 1RDYA 4MEVA 3ZSFA 2HFBA 2QVRA 1QW0A 1NV6A 1Y1ZA 4RY1A 4MH5A 2XX9A 4NF4A 3THIA 4EQ9A 5AA3A 3R6UA 3DP4A 4IO4A 3UORA 1ZKBA 2VHAA 5AA2B 1B5IA 5HM4B 4OFJA 4R6HA 4P0GA 3PUXE 3VV5A 2Q74A 4X9TA 4AS5A 1QULA 2ABHA 2F78A 4HCYA 3HV1A 4PCDA 2Q8MA 1MPBA 3PUVE 4NF0A 3VVEA 2QSXA 2XWOA 2ZYNA 3KSJA 5H8FB 4F3PA 1UTHA 4KCCA 4N91A 3DLNA 2XXKA 1H43A 2VD3A 1XI6A 3OSQA 1DPEA 4H67A 4PGNA 4BDRA 5I57B 1UQWA 3QIMA 1NV0A 1LCFA 3V83A 4U4SA 3RT8A 5I58B 4YB5A 4HE2A 4P11A 3LUZA 2V4CA 3SEWA 3T9VA 4X04A 1NV7A 3QK6A 2HZKA 2OX3A 1SW4A 2G93A 5FBPA 4DIGA 5JEIA 3TKDA 4EXKA 4IY5A 1Y3NA 4R9FA 3MP6A 1UTHB 3VDFA 1INPA 1PB8A 4HXVA 3RNNA 1N7WA 3HPIA 2Q88A 1NH8A 1I69A 3E9XA 3R26A 1PDAA 1ZTYA 5FHNA 3KN8A 4OZ9A 2O51A 2XWIA 4IO7A 2Y7WA 4MMPA 2V25A 5CMCA 5DVFA 1GTKA 3S9NC 4NQ8A 5I56B 4YZZA 5EQ7A 3HSTA 2VD2A 1FBPA 1PBPA 4QSEA 3HO7A 1B3LA 4YB6A 4F29A 4OVTA 3V8XB 5L9SA 1EYIA 4O3BA 2P0SA 3R7XA 2RF1A 5H8QA 4RPOA 2DDKA 3FXRA 2XXWA 2YJPA 4IO2A 3RN8A 1IXCA 1B1XA 5L9OA 1R1NA 1LBZA 1LGBC 4NWDA 1XC1A 1MDP1 1CNQA 1UIUA 3OD7A 1B5HA 1MH4A 3B7DA 3ZKLA 5CM6A 1PB9A 3EHSA 4ZDMA 2O1LA 3MVZA 3QUFA 1P1UA 3RPWA 4RK9A 5H8FA 4PP0A 3T22A 2F34A 4PGPA 1YYZA 2O7UA 5EHMA 2I49A 5CMKA 3TEPA 4F2OA 2ZYOA 2QS1A 4I1DA 4H6DA 2DSFA 3PD8A 4Q5TA 3IO6A 3PGFA 4O7IA 4HCWA 4G61A 1FPKA 1MH3A 1IXIA 3JZJA 3N6TA 3BIGA 4DI4B 1FPJA 1TWYA 3S4UA 3GXAA 4U1ZA 3K6XA 3KOTA 4O7MA 4K3FA 3C33A 4N13A 1NI9A 2D21A 2X7PA 2CZHA 3FVOA 4O94A 3RPLA 5KDTB 4UACA 4GBWA 4LP2B 4ECFA 4JVIA 3EQ1A 1URDA 3U72A 5CC2A 3FJMA 3S9EA 1B4ZA 1LFIA 4OXVA 3FASA 4OMBA 3OSRA 2QRYA 1KA1A 4R9GA 1FQFA 1NH7A 4QHQA 4ZS9A 1B9JA 4YKPA 2HZLA 1BKAA 5LTCA 4BDNA 1PC3A 5FHMA 3TZAA 4ND9A 1FPEA 2QPQA 4PFBA 3OOAA 1Y20A 1EZPA 3ILUB 4FBPA 1SBPA 1VFDA 2XXTA 3PV0E 4LONB 4YKKA 3LBSA 1YZ0A 3N5LA 1IMDA 5BUUA 3TMGA 1A7LA 3D1RA 1KWHA 3MVYA 1WODA 1FQCA 1N7XA 3FVNA 2FHYA 1N3WA 4R2BA 5ITOA 1IMCA 2NWJA 3PPQA 1AIVA 4OEUA 3CIJA 4H8IA 3TQWA 3FBPA 1MXUA 1IMFA 1NNTA 1B2HA 2RC9A 2Z8DA 4GBVA 3E79A 1D9YA 4PDHA 4ZEFA 4FAJA 1FJ9A 2Q2AA 5A5LA 4RK2A 3CSBA 1JVXA 5DW8A 3OO8A 1UIVA 4R75A 4P47A 3W9WA 3B6WA 2R9JA 3ZS6A 1SYIA 1URSA 5H8HB 1D9VA 1B40A 3K4UA 1AOVA 4XFEA 1H3DA 1A8FA 1RDZA 2UYEA 4P0IA 1XS5A 1B7ZA 1TFAA 3G3KA 1MQJA 3I6VA 5ICQA 3U8QA 2ZZWA 3TTKA 4I9DA 4GLIA 3TCGA 1USYE 4POXA 4MLQA 1IITA 3G3HA 1I6QA 2X26A 2R8TA 2DWJA 3MZ9A 3KJ7A 1LAGE 2O1MA 3KBZA 2CEXA 4JB7A 4OVQA 3MQ9A 2RCBA 4H45A 4WEPA 1LBCA 1UTBA 1SPIA 1ZMGA 2XXPA 4HE0A 2ZZXA 1B3GA 4PAFA 3KN7A 4M1VA 3BFTA 5CRYA 1ATGA 3VLWA 1A54A 4JBZA 2DYXA 3FD3A 3ZKKA 1MS7A 4G8NA 4OYVA 1FBHA 4XKPA 3CFZA 3BFUA 4O3CA 4OVJA 4QF9A 1WDNA 3IB2A 1RKMA 3MUQA 3SEXA 3FV1A 1S9TA 3MAMA 5HBCA 4NX1A 1ANFA 5I5PA 3RGYA 4RPNA 2OWTA 2QS2A 5CBSA 1GGGA 5I57A 4G8HA 2XXRA 1FCKA 4GWWA 4P1LA 4ZEKA 4AQ4A 2P2AA 4KPTA 2PBWA 4L17A 4IY6A 1H44A 1JP4A 3U94A 1MPDA 4ZZAA 3C31A 2B3BA 2HEUA 3UK4A 2HHMA 3OO6A 1SYHA 4F1VA 1DBZA 1LB8A 5H8SA 3PMXA 2XD3A 4KYSA 4GF8A 4N15A 1TFDA 1OQGA 3OO7A 4LVQA 1NNPA 1FRPA 4R6YA 4EF2A 1ZIUA 1OLAA 3GBBA 2O84X 3SEUA 3MP1A 4JWOA 4LN5A 4KHZE 5EYFA 3V89B 2B4LA 2XX8A 4GFRA 4YMAA 5DEXA 2E0SA 5AA4A 3HHFA 4PC9A 4DDDA 1EH3A 4LZ8A 2B4MA 1JW1A 1B3EA 3TODA 1YXIA 3CRBA 2CMOA 3LSWA 2XXUA 3RTWB 4AB6A 3EKIA 1H76A 2NVUB 5I2KA 1ZU0A 5EYHA 3IJOB 4Q0CA 5I59B 4GOTA 1MM7A 2RKMA 1R6ZA 1FQBA 4GWYA 4F1YA 2AYSA 5TP9B 1D4NA 4PQJA 4R73A 2H9BA 1PEBA 3TQLA 2Q89A 4O3AA 3ROJA 1LAFE 1FBCA 1MY1A 1MQHA 4E0WA 1IIWA 2DE3A 3K2DA 4GWUA 4P3LA 2OBGA 5ET6A 1NUXA 4DI3D 4BDQA 2I0CA 2B3FA 3HFUA 2V93A 1B32A 1MY4A 3KFMA 2QS3A 2F5XA 1NUZA 1UTBB 3VE1B 1FPLA 2Y5LA 1B0LA 1Q1KA 3P7IA 4PBHA 2Z8EA 4FJPA 4DXCA 1MQGA 2Y5KA 1POY1 4MFIA 4GX3A 4OVPA 4ONYA 2F7BA 3LSXA 4Z7EA 1TXFA 1SI0A 1B58A 1K9YA 2DVCA 5ESYA 2F6PA 3IAZA 3WAEA 4NAPA 4QRZA 1Q35A 3VFJA 5I59A 1XVXA 2P3VA 1ZLQA 5FTHA 1T0KA 4RXLA 4F2QA 2GRVA 3IOWA 1A8EA 2CZLA 3N94A 2I4CA 5TPAB 3CSGA 2DWAA 5I2NB 2OWSA 5IGAA 2ONSA 2OZZA 4UA8A 2PFYA 1FPDA 4JXIA 2RC7A 1FTAA 2HQ0A 1TT1A 4GX4A 4DE8A 2M8CA 2I6EA 5ICTA 1M5BA 5IAIA 1AWBA 3ONMA 2I3VA 2WKYA 5BWJA 1NV1A 4F22A 5I84A 1B4HA 3CG1A 2XD2A 1A55A 1SI1A 4GRKA 2DE4A 2DWHA 4OVRA 1O7TA 4OESA 2OLBA 4GX6A 1JETA 4MJOA 4GIZA 4H1XA 4QFKA 1II5A 1VE4A 2CZIA 4ELPA 1LAXA 2O69A 4O8MA 2YPNA 3B50A 4PFYA 4F18A 3H6UA 3Q27A 3LR1A 1NUWA 3TDJA 1DK4A 1Z7NE 3VVFA 3S9MC 1XT8A 4PFUA 1CB6A 1DPPA 3KOSA 1BP5A 1SW1A 4G8MA 3B6QA 1B51A 4P1EA 3DELB 3LV0A 4Q8RA 1SVXB 3EHUA 4IB2A 4BDLA 3PPNA 2F35A 3OEKA 1P99A 2QVUA 3RLFE 2WEFA 3VLUA 2DXRA 1LBVA 4KI0E 2D5WA 5B7DA 3C35A 4JWYA 1J1NA 4OEVA 3RYDA 5I3SA 4ISUA 4TLLB 3GYYA 1IQ7A 4I40A 1DOTA 4KFQA 2DQVA 4MHFA 5EQAA 3DP6A 2V3TA 4OANA 1SW5A 2H4IA 4X1DA 1N84A 1IMEA 4GWZA 1LSTA 3W9VA 4YB7A 3K00A 1LFHA 4EUOA 3QAXA 1MY2A 2P3NA 1NV2A 4N6KA 1BTJA 4PBQA 4PFTA 4OVSA 3T0JA 2F7CA 2DE2A 1LBYA 3OEMA 3JV9A 3FUZA 1FPIA 4I3EA 4G2ZA 3W15C 4WEDA 3B8BA 5AA2D 3OELA 1LBWA 1Y1MA 5L9MA 2F7AA 1FQAA 3CG3A 3A3CA 3FATA 2CZKA 4MCOA 2Z22A 2R71A 2VGQA 3EPEA 2ONKE 2Z8FA 3KJTA 3K1PA 2ONRA 3MPLA 1M5CA 3UN6A 4ZE8A 3K6VA 5I7IA 3MVWA 2VT5A 5ET8A 3M3KA 1OMPA 3O6IA 4DXBA 2GQ1A 4ESWA 3DP8A 3A09A 3IJXB 3BBRA 3T1BA 2NOOA 3OO9A 4N4UA 2IA4A 4JDFA 3WAFA 3O97A 3E4RA 4JSDA 2H5YA 3O6GA 2I48A 1FPBA 4PAKA 3G3JA 4LATA 1MXYA 3MP8A 1FTKA 4GL8A 2XXIA 2Q9TA 1NKXA 5M2VA 5F7VA 4NG7A 5I58A 2D3IA 3SEVA 4IR8A 3TAJA 2UYFA 2Y7PA 2VPNA 2XXHA 3PPRA 4EQBA 4UABA 2H99A 1XOCA 3UP9A 4C1UA 3OENA 4XKQA 4DZ1A 1FBDA 1NV4A 3TTNA 1MQIA 1FPFA 1M5FA 2WX9A 1DTZA 1DSNA 2ZNTA 3C32A 4U23A 1F9BA 4RA1A 2XWKA 1Y4TA 5IM2A 3RPLB 5KDTA 3F11A 4H5GA 2WYPA 3KC0A 2HPGA 1EZ9A 4MX6A 2E1SA 3TPAA 4MNCA 4NEDA 5DEXB 1JVYA 3PPOA 4X48A 1N0TA 2HCAA 1EYKA 3T9HB 5IZ3A 3TTLA 4I3YA 2CEYA 1SD3A 3TCHA 3QMFA 1FQEA 4NE4A 1CE2A 1B5JA 3PU5A 3CFLA 3KBRA 4QSDA 4FEDA 4F39A 3IK6B 4N17A 2F3BA 2XXXA 4LQ2A 4QBAA 4U21A 2F3DA 1I6BA 2I58A 2OK2A 3VXCA 1MXZA 3K1MA 1N04A 2OCUA 4U22A 1KZ8A 2I3WA 1QUIA 2A5SA 2O68A 2LAOA 2XXVA 1BLFA 5CBRA 4DLDA 2R6GE 4TQUQ 4EQ7A 3LC8A 1N3XA 1P1QA 1NUYA 5CMBA 1IZ1A 5LDZA 4ZECA 4QFPA 1QUKA 3FGSA 1PB7A 4WKMA 5ET5A 4FATA 1MRPA 2XXYA 3K6WA 5AA1A 5DTBA 1VFEA 1H45A 5ISUA 2DVZA 1KA0A 4BDMA 4QFOA 1FTLA 3O2AA 2V3UA 4Z0IA 1NV5A 4G77A 4H0WA 5I2NA 5TP9A 4JVDA 1MY0A 5EYGA 3IR1A 1S50A 4R72A 2Y7KA 5EQ9A 3O28A 2DWIA 4KYDA 3UIFA 1G0HA 1B0HA 4NWCA 1B3HA 5LOMA 3GLBA 5AE4A 1IXGA 1FW0A 1D3KA 3TTMA 1FBGA 3Q29A 5JK4A 5I56A 4YKIA 1LBXA 3N6UA 2H25A 1RYXA 5KCJA 2WBDA 4GXAA 4OFOA 4G68B 2XHDA 1QJMA 2ZNUA 1O63A 1POTA 3TELA 5JTYA 1US4A 2HAUA 1FSAA 1HSJA 4MF3A 3I3VA 4R2FA 4ZEDA 3I5OA 4ELOA 2THIA 2YLNA 3FIRA 3USDA 2QL3A 4KCDA 1EU8A 3PMWA 1JW5A 3KG2A 2G29A 3HHGA 4POWA 3C4MA 3GZGA 2ZXTA 3IFCA 4XKNA 2F6GA 1AMFA 3C9HA 3G7WA 2PVUA 2HAVA 2RINA 4XF5A 3OXNA 2DS9A 3ILTB 3TFLA 3E13X 1OIBA 1LAHE 1ZJLA 2ZZVA 1WVJA 3TTRA 2NXOA 1LEVA 1DTGA 1IMBA 1P1NA 2O6AA 4ZEBA 1A40A 4GWOA 3K6UA 4LQ5A 3U65A 1PBQA 1B46A 1EZOA 1QKBA 4JVCA 4NMYA 2I4BA 5H8QB 3O29A 3OMBA 5EQ8A 5J16A 4BDOA 1VSOA 2XWVA 4ESXA 1LBBA 2P1SA 3L6GA 3HN0A 2GHBA 3FXQA 5F1QA 3PPPA 2KLFA 2REJA 3IOVA 4MNPA 4P8BA 4RYAA 2PT2A 3H3GA 2O7IA 4NF6A 4IO5A 5A5XB 2HXRA 2UVHA 3LUYA 5F24A 1FTOA 3U1OA 1B05A 3SEYA 3G3GA 1MXXA 4N81A 1B6HA 4QFLA 5FHOA 3K02A 3Q26A 1JW4A 1HSLA 3EN3A 3CHGA 1DMBA 1AL3A 4OHNA 5ITPA 1Z7ME 2KR0A 3BIHA 4GQOA 3SERA 1MG1A 4PAIA 4PETA 1HSEA 4F3BA 1EYJA 2ESNA 4IGTA 2UXAA 3FV2A 2BJIA 2XX7A 1NMUA 3SKPA 3CVGA 1OVTA 4H8JA 3SZPA 3MW0A 3O9PA 3A3UA 3K1NA 2QFLA 5KZTA 2QS4A 2ZNSA 2REGA 4X8RA 3QSLA 1MDQA 3RUMA 2MKZA 3G3FA 4OTEA 4OWDA 4OQOA 2XA5A 4LA9A 1ZBMA 2KQZA 3UA8A 5AA4B 2RCAA 3QUJA 4G68C 1FPGA 3AXFA 3LSLA 3KN3A 4EDPA 4E0XA 3ECRA 5DVJA 3DM0A 3FVGA 3SDFA 4GVOA 1SQYA 1VR5A 1GVCA 4Q30B 1JEUA 3VXBA 3Q25A 3FVKA 5IZZA 3IB0A 4X1BA 2VOZA 5CI5A 1B52A 4AB5A 4IGRA 1P1WA 3BKIB 2QVVA 4JWXA 2V84A 5TU0A 4OERA 4MLVA 4NF6B 5A5XA 2OWZA 1IXHA 5H8NA 2GH9A 4GWSA 1MY3A 5K2YA 1USYH 4F1UA 4XIGQ 4TOZA 1LB9A 1QKAA 3H06B 4TLMB 1R9LA 3IOTA 2RC8A 4NGUA 2QJEA 4ZZEA 5L8DA 1QVSA 4NN3A 5IZ1A 3H4ZA 3CI8A 4NF5A 4KQPA 4H65A 4DXUA 3IB1A 5H8HA 1Y3PA 3MZ1A 1K9ZA 4F19A 1SW2A 4OA4A 3FJ7A 1FBEA 5HPQA 1NNKA 3QXMA 3H7MA 4FE8A 1GR2A 4YU0A 5DT6A 3FJGA 4RJZA 3EHTA 2VPOA 1P1OA 3D4GA 1OVBA 4U2RA 4H46A 3O6HA 5CMMA 3IL1B 4KXPA 4MAGA 4NHBA 4XTCQ 2FNCA 2X7QA 4KD5A 5J1DA 3K0VA 4GD5A 4YKJA 3KGCA 4ELRA 1YAEA 1O64A 3MPKA 4FIMA 1G0IA 3U92A 3PD9A 1QGXA 1AH5A 4YMBA 4C1TA 3RQTA 4FECA 1M5EA 2VP1A 5EHSA 2Q8JA 2QMXA 1LCTA 2V3QA 3SETA 3T9XB 3VLVA 2F36A 4LUBA 4I8CA 1NFTA 3H03A 4ZEIA 3K01A 1ELJA 3IX1A 1Y3QA 4F31B 3TYHA 1XHYA 3A29A 2A5TA 3TCFA 2IEEA 1JQFA 2HXWA 3T96B 4HTGA 1S7YA 4XKRA 2ANJA 1NNFA 1R9QA 1MPCA 1URGA 3PUZE 3M3FA 3VVDA 2DP8A 5KCJB 3KC1A 2GFEA 5JTYB 3H6WA 4G68A 1IEJA 4ELQA 4ZE9A 4DCYA 5DYHA 3LSFB 2Z23A 3L6HA 1FTJA 4NF5B 3FXBA 3M8UA 4XEQA 3RTFB 1A99A 1BIYA 2F97A 3C34A 3D4CA 3PMVA 1NL5A 2PMSA 2PT1A 3G3IA 4FORA 4PFWA 1FQDA 4PDDA 4OFLA 2ZYMA 4LZ5A 4RNSA 3FZVA 2DXYA 2DOJA 1N76A 3PTYA 5ELVA 2PFZA 3RY3A 2BJJX 4QFNA 4G4PA 3IORA 3O66A 4N6DA 1JEVA 1RYOA 4PFIA 4N6PA 2GHAA 3MYUA 1D9QA 3T93B 1IMAA 4IO3A 1BK4A 4HS7A 5IKBA 2UVIA 4NF4B 2Y7RA 3H6TA 3Q28A 4YAHX 2PYYA 2I0BA 4R74A 2OJTA 4M4GA 4OENA 2B65A 5AA2A 3MC2A 5I2KB 2FVZA 2UVJA 4PF8A 3C36A 3MJNA 3MZBA 4FEBA 2FA7A 5TPAA 1MXVA 1MXWA 1SDXA 1IUDA 1I6AA 4NF8A 3PUYE 4GXSB 1B1HA 2F8DA 2PCRA 4U1OA 2PX1A 4GWXA 3B6TA 3KEIA 5DVIA 3QYTA 2NUVA 1Y9UA 3FXUA 1XVYA 4QXDA 4AS4A 3UGWA 2Y7IA 4H5FA 2XXQA 1B3FA 2A5TB 3E78A 2L5VA 3ISPA 3PUWE 1YCJA 3CR9A 2JJKA 4IO6A 4JSOA 1B7HA 2ZYKA 3V5AA 1YPNA 3JYRA 1DCUA 1OLCA 4KYEA 2ZMBA 1LLSA 1Q9DA 4LZ7A 4PF6A 4NF8B 1OQHA 3IO4A 2Y84A 3IFAA 1B7UA 5T3JA 4U4XA 4F3SA 4XXUA 4THIA 3U93A 2W7YA 1RDXA 1MQDA 2FIXA 4N8YA 1FJ6A 1US5A 1QUJA 4HW8A 3KZGA 2H98A 4BLAA 1LFGA 3NOHA 4YICA 1YTVA 3H6VA 1M5DA 3TUSA 2AIXA 4MIJA 1MM6A 2Q2CA 5IZ3B 3T66A 4MNIA 4DCXA 3HCQA 3S2VA 3MVXA 3GBAA 1FBFA 1Y4CA 3ODBA 4WXJA 4OETA 3M3LA 5ET7A 2FIEA 4QSCA 4C0RA 4N07A 4P9KA 3MBPA 4PTKA 4PE3A 4R6KA 4MBPA 2WBBA 4PFRA 3T9UA 2QMWA 4NTLA 1JNFA 4EXLA 2UVGA 1FTMA 4KR5A 2AL4A 2FBPA 1VDWA 3S9LC 3E3KA 3RT6B 2WYKA 3IOUA 4N8GA 5FTIA 3SESA 5H8NB 3CFXA 1NV3A 2ALUA 4PE5B 5B70A 3EF7A 4GL0A 2FYIA 4EF1A 3MSTA 4I62A 1GV8A 4P56A 5K2XA 4F3GA 4HE1A
chains in the Genus database with same CATH topology
3K6VA 2DYXA 3FD3A 3N26A 3ZKKA 3MVWA 3MWBA 3SDFA 4GVOA 3KSXA 1SQYA 1VR5A 2AL5A 1MS7A 3M3KA 1L5TA 4G8NA 1OMPA 3O6IA 4OYVA 1GVCA 4Q30B 1JEUA 2HFBA 4XKPA 3VXBA 3CFZA 1QW0A 3FVKA 3Q25A 3BFUA 1Y1ZA 4DXBA 4RY1A 3IB0A 4ESWA 4X1BA 3DP8A 4MH5A 2VOZA 5CI5A 3A09A 3IJXB 3BBRA 4O3CA 2NOOA 2XX9A 1B52A 3OO9A 4NF4A 3THIA 4F29A 4EQ9A 5AA3A 4AB5A 4OVJA 2IA4A 4QF9A 1WDNA 4IGRA 4JDFA 3WAFA 3IB2A 1P1WA 3O97A 3E4RA 5JEIA 3BKIB 4JSDA 2H5YA 3O6GA 2I48A 4JWXA 3R6UA 3G3JA 3DP4A 4IO4A 3UORA 2V84A 1RKMA 1ZKBA 2VHAA 3MUQA 1B5IA 4OERA 5TU0A 3SEXA 3FV1A 4LATA 1MXYA 4MLVA 4NF6B 3MP8A 5A5XA 1FTKA 4OFJA 4GL8A 1S9TA 4R6HA 5H8NA 1IXHA 3MAMA 2GH9A 2XXIA 3PUXE 2Q9TA 1NKXA 4P0GA 5M2VA 5F7VA 5HBCA 5AA2B 1ANFA 5I58A 2D3IA 3SEVA 3VV5A 3S9NC 1MY3A 3RGYA 3TAJA 4RPNA 5K2YA 2OWTA 4X9TA 2UYFA 2QS2A 2Y7PA 2XXHA 3PPRA 5CBSA 1GGGA 5I57A 4EQBA 1USYH 1QULA 2ABHA 4G8HA 3ZSFA 2H99A 1XOCA 4TOZA 4XIGQ 2F78A 2XXRA 4HCYA 3HV1A 3UP9A 1FCKA 4C1UA 3OENA 1LB9A 1QKAA 3H06B 4TLMB 1R9LA 4XKQA 3IOTA 4DZ1A 1MPBA 2RC8A 3PUVE 3TTNA 3VVEA 1MQIA 2QSXA 4ZEKA 2QJEA 1M5FA 4AQ4A 4ZZEA 2ZYNA 1DTZA 3KSJA 5H8FB 4F3PA 1UTHA 1DSNA 2P2AA 2ZNTA 3C32A 4KCCA 5L8DA 4U23A 1F9BA 4KPTA 1QVSA 4RA1A 3DLNA 2PBWA 4L17A 1Y4TA 1H43A 5KDTA 2VD3A 3F11A 3H4ZA 4H5GA 4IY6A 3TQLA 3CI8A 1H44A 3OSQA 4NF5A 4KQPA 4H65A 1DPEA 4H67A 4DXUA 3IB1A 5H8HA 3U94A 1MPDA 4XKRA 1Y3PA 3MZ1A 1EZ9A 4ZZAA 4F19A 1SW2A 2E1SA 3C31A 3FJ7A 3TPAA 2B3BA 5HPQA 2HEUA 3UK4A 4NEDA 3OO6A 1SYHA 4F1VA 1NNKA 5DEXB 1JVYA 3PPOA 4X48A 1N0TA 2HCAA 1LB8A 3H7MA 3QXMA 4BDRA 5I57B 1UQWA 3QIMA 4FE8A 5H8SA 3PMXA 3T9HB 2XD3A 1LCFA 4KYSA 1GR2A 4GF8A 3V83A 3TTLA 4YU0A 4U4SA 5DT6A 3FJGA 3RT8A 4RJZA 5I58B 1TFDA 1OQGA 4YB5A 3EHTA 3OO7A 4LVQA 1SD3A 1P1OA 4P11A 3D4GA 1NNPA 1OVBA 4U2RA 3TCHA 4R6YA 3SEWA 4EF2A 1ZIUA 3T9VA 1OLAA 3GBBA 2O84X 3O6HA 5CMMA 1FQEA 3IL1B 3SEUA 4NE4A 1CE2A 3MP1A 4JWOA 5K2XA 4XTCQ 4F3GA 1B5JA 2FNCA 3PU5A 3CFLA 3KBRA 4QSDA 2X7QA 3QK6A 4FEDA 4KD5A 2HZKA 4KHZE 1SW4A 2G93A 5EYFA 5J1DA 3K0VA 4DIGA 4F39A 3V89B 4GD5A 4YKJA 2XX8A 3IK6B 3KGCA 4GFRA 3TKDA 4EXKA 5TP9B 4IY5A 5DEXA 4ELRA 4YMAA 1Y3NA 4F1UA 2E0SA 5AA4A 3HHFA 2XXXA 4DDDA 4R9FA 1YAEA 1EH3A 1O64A 3MPKA 3MP6A 4FIMA 1UTHB 4LZ8A 3VDFA 4LQ2A 3U92A 1JW1A 1PB8A 1B3EA 3PD9A 4U21A 1AH5A 3TODA 3RNNA 1I6BA 1N7WA 2I58A 4YMBA 2OK2A 3VXCA 3HPIA 3CRBA 1MXZA 2CMOA 3LSWA 3K1MA 2Q88A 1NH8A 2XXUA 4C1TA 1I69A 3RQTA 1N04A 2OCUA 4FECA 4U22A 3RTWB 3E9XA 2I3WA 1QUIA 4AB6A 3R26A 1M5EA 1PDAA 1H76A 1ZTYA 2A5SA 2O68A 5FHNA 2NVUB 5I2KA 1ZU0A 2VP1A 2LAOA 3KN8A 5EHSA 2XXVA 1BLFA 5JTYA 3IJOB 4Q0CA 4DLDA 2Q8JA 2R6GE 4TQUQ 5CBRA 4GOTA 4EQ7A 1MM7A 4OZ9A 5I59B 2RKMA 1R6ZA 2O51A 4IO7A 1FQBA 2Y7WA 2QMXA 1LCTA 2V25A 2V3QA 5CMCA 5DVFA 3SETA 3LC8A 1GTKA 3T9XB 3VLVA 2F36A 2AYSA 4F1YA 4YZZA 1D4NA 4LUBA 4PQJA 4R73A 1N3XA 1P1QA 1NFTA 1PEBA 2H9BA 2Q89A 2VD2A 1LAFE 1IZ1A 3HSTA 4I8CA 4O3AA 1PBPA 5CMBA 4QSEA 1MY1A 3H03A 1B3LA 3HO7A 4YB6A 3K01A 1ELJA 1MQHA 4ZEIA 3IX1A 1Y3QA 1IIWA 2DE3A 3K2DA 4E0WA 4F31B 4ZECA 4QFPA 2OBGA 3TYHA 1XHYA 1QUKA 3V8XB 5L9SA 3FGSA 1PB7A 4WKMA 4O3BA 2A5TA 2P0SA 3TCFA 4BDQA 2I0CA 1MRPA 4FATA 2IEEA 2XXYA 1JQFA 2B3FA 3K6WA 5DTBA 5AA1A 2RF1A 1B32A 2HXWA 2V93A 3R7XA 1VFEA 3T96B 1MY4A 4HTGA 3KFMA 4RPOA 1S7YA 2ANJA 2QS3A 2F5XA 1NNFA 1MPCA 1H45A 1R9QA 3FXRA 1URGA 2XXWA 2YJPA 3M3FA 3PUZE 4IO2A 1IXCA 3RN8A 1B1XA 5L9OA 5ISUA 1R1NA 1UTBB 2DVZA 3VVDA 2DP8A 4QFOA 4BDMA 1FTLA 3O2AA 3VE1B 1LGBC 1B0LA 4XKNA 1Q1KA 3P7IA 2V3UA 4Z0IA 2Z8EA 4FJPA 4DXCA 1MQGA 1POY1 4NWDA 1XC1A 4MFIA 1MDP1 5KCJB 2GFEA 1UIUA 3H6WA 4G77A 5JTYB 3OD7A 4G68A 1B5HA 1IEJA 1MH4A 4H0WA 3B7DA 5TP9A 5I2NA 3ZKLA 4ELQA 1PB9A 4DCYA 4ZE9A 5CM6A 3EHSA 1MY0A 4ZDMA 4ONYA 2O1LA 3MVZA 2F7BA 3LSXA 3IR1A 1P1UA 3QUFA 1S50A 3RPWA 4R72A 2Y7KA 4RK9A 5H8FA 4Z7EA 3O28A 2DWIA 5DYHA 3LSFB 1TXFA 3TELA 1SI0A 4KYDA 4PP0A 3UIFA 1B58A 3T22A 2DVCA 2Z23A 1B0HA 2F34A 5HM4B 4NWCA 1B3HA 5LOMA 2F6PA 3L6HA 1FTJA 2O7UA 3GLBA 4NF5B 3M8UA 5EHMA 3IAZA 3WAEA 5AE4A 1IXGA 1FW0A 3RTFB 1A99A 1BIYA 1D3KA 2F97A 4QRZA 1Q35A 3TTMA 3VFJA 5I59A 1XVXA 3C34A 3Q29A 2I49A 5CMKA 3TEPA 4F2OA 2ZYOA 1ZLQA 3D4CA 3PMVA 5FTHA 5I56A 5JK4A 2QS1A 1NL5A 4YKIA 1T0KA 4RXLA 5I2KB 2PMSA 2PT1A 3G3IA 4FORA 3N6UA 2H25A 1RYXA 4I1DA 5KCJA 4GXAA 4OFOA 4G68B 4H6DA 4PFWA 2GRVA 2XHDA 4F2QA 3IOWA 2DSFA 1A8EA 1QJMA 2ZNUA 1FQDA 1O63A 3PD8A 2CZLA 4Q5TA 3IO6A 3PGFA 4OFLA 3N94A 4HCWA 1POTA 2I4CA 2ZYMA 4LZ5A 4RNSA 5TPAB 3FZVA 2DXYA 3CSGA 1MH3A 2DOJA 1IXIA 1N76A 1US4A 2DWAA 2HAUA 3JZJA 3N6TA 5I2NB 1HSJA 2OWSA 5ELVA 4MF3A 1TWYA 3S4UA 3GXAA 3RY3A 4U1ZA 2BJJX 3I3VA 4QFNA 4R2FA 3K6XA 4G4PA 2ONSA 4ZEDA 2OZZA 3IORA 3O66A 4UA8A 5H8QA 3KOTA 3I5OA 4JXIA 4K3FA 1JEVA 1RYOA 2RC7A 4N6PA 4ELOA 2GHAA 3C33A 4N13A 3T93B 2D21A 2X7PA 2HQ0A 1TT1A 4IO3A 4DE8A 2M8CA 2I6EA 5ICTA 4HS7A 2THIA 3FVOA 1M5BA 5IKBA 5IAIA 2YLNA 5KDTB 3FIRA 3ONMA 4UACA 3USDA 2I3VA 2WKYA 5BWJA 4LP2B 2QL3A 4KCDA 1EU8A 3PMWA 2UVIA 1JW5A 4NF4B 1B4HA 2Y7RA 4ECFA 4F22A 5I56B 5I84A 3EQ1A 3KG2A 1URDA 3U72A 2G29A 3CG1A 3H6TA 3Q28A 4YAHX 2XD2A 3HHGA 4POWA 3FJMA 5CC2A 1A55A 2PYYA 3S9EA 1SI1A 3C4MA 2ZXTA 2DE4A 1B4ZA 1LFIA 2DWHA 2I0BA 1O7TA 2F6GA 4GRKA 2OJTA 1AMFA 2OLBA 3C9HA 4M4GA 4OESA 4R74A 1JETA 3FASA 3G7WA 4OENA 2B65A 2PVUA 3MC2A 3OSRA 2QRYA 4GIZA 2HAVA 4H1XA 1II5A 2RINA 4OMBA 4QFKA 4R9GA 1VE4A 3OXNA 4ELPA 1FQFA 2DS9A 2UVJA 1NH7A 3C36A 3ILTB 3MJNA 3TFLA 3E13X 3MZBA 3GZGA 4QHQA 1LAXA 1OIBA 2O69A 2FA7A 4FEBA 1LAHE 1B9JA 4YKPA 4ZS9A 1MXVA 2YPNA 1ZJLA 2HZLA 1BKAA 4PFYA 4F18A 4BDNA 1MXWA 3H6UA 1SDXA 1IUDA 1WVJA 1PC3A 3Q27A 1I6AA 5FHMA 3TTRA 2NXOA 3TZAA 4NF8A 3LR1A 1DTGA 1P1NA 3PUYE 4ND9A 4EDPA 2O6AA 3TDJA 4ZEBA 2QPQA 4GXSB 1B1HA 1A40A 4GWOA 3OOAA 1Y20A 1EZPA 2F8DA 3K6UA 3ILUB 4LQ5A 1PBQA 1B46A 1Z7NE 1EZOA 4U1OA 1QKBA 1SBPA 2PX1A 3VVFA 1VFDA 2XXTA 3PV0E 3B6TA 4LONB 3S9MC 4YKKA 3KEIA 3LBSA 1XT8A 4NMYA 4PFUA 2I4BA 5DVIA 3QYTA 1CB6A 2NUVA 1Y9UA 3FXUA 1DPPA 1XVYA 3KOSA 5H8QB 3O29A 3N5LA 5BUUA 3UGWA 3TMGA 2Y7IA 3OMBA 2XXQA 4H5FA 1B3FA 1BP5A 1SW1A 2A5TB 1A7LA 4G8MA 3B6QA 1KWHA 3MVYA 1B51A 1WODA 4BDOA 3DELB 1VSOA 3PUWE 4ESXA 1YCJA 1FQCA 1LBBA 3CR9A 1N7XA 2P1SA 4IO6A 3FVNA 3L6GA 4JSOA 1N3WA 4Q8RA 3HN0A 2GHBA 1SVXB 5AA2A 4R2BA 3FXQA 1B7HA 3PPPA 2KLFA 3EHUA 2REJA 2ZYKA 5F1QA 5ITOA 2NWJA 3PPQA 1YPNA 4OEUA 3CIJA 3V5AA 1AIVA 4IB2A 3JYRA 4BDLA 4H8IA 3IOVA 3TQWA 1MXUA 1OLCA 4KYEA 1NNTA 3PPNA 2ZMBA 1LLSA 1B2HA 4RYAA 2PT2A 2F35A 3OEKA 2RC9A 4LZ7A 3H3GA 2O7IA 1P99A 4IO5A 4NF6A 3RLFE 5A5XB 2Z8DA 3VLUA 2DXRA 1D9YA 2UVHA 3LUYA 4KI0E 4ZEFA 4NF8B 1OQHA 3IO4A 2Y84A 4FAJA 2Q2AA 2D5WA 4RK2A 1FTOA 3U1OA 3CSBA 1B7UA 1JVXA 4U4XA 5B7DA 1B05A 4F3SA 4XXUA 3OO8A 4THIA 1UIVA 3SEYA 3U93A 3C35A 1MXXA 3G3GA 4JWYA 2W7YA 1J1NA 4R75A 1B6HA 1MQDA 4QFLA 5FHOA 4OEVA 3UN6A 4ISUA 4TLLB 3W9WA 3B6WA 2R9JA 3K02A 3Q26A 1JW4A 1HSLA 3EN3A 5TPAA 1IQ7A 3ZS6A 1US5A 1QUJA 4HW8A 1DMBA 1AL3A 1SYIA 1URSA 2H98A 1D9VA 1DOTA 3KZGA 5H8HB 4OHNA 4BLAA 5ITPA 1B40A 1Z7ME 1LFGA 3K4UA 4KFQA 1AOVA 2DQVA 4YICA 1YTVA 3H6VA 3DP6A 4OXVA 2V3TA 1M5DA 4GQOA 3SERA 1H3DA 1A8FA 1MG1A 4PETA 3TUSA 1SW5A 2AIXA 1HSEA 2H4IA 2ESNA 4X1DA 4F3BA 1N84A 2UYEA 4IGTA 1MM6A 4P0IA 2Q2CA 1LSTA 3W9VA 2UXAA 1XS5A 4YB7A 1B7ZA 1TFAA 3FV2A 3G3KA 1MQJA 2XX7A 3K00A 1NMUA 3I6VA 3T66A 5ICQA 3U8QA 3SKPA 3TTKA 4I9DA 4GLIA 3CVGA 4DCXA 4EUOA 3HCQA 3QAXA 1MY2A 3S2VA 1LFHA 1OVTA 3MVXA 3GBAA 4WXJA 1Y4CA 3ODBA 3TCGA 4H8JA 4OETA 1BTJA 3M3LA 1USYE 3MW0A 4QSCA 3O9PA 4C0RA 4N07A 3MBPA 3A3UA 4POXA 4PFTA 3K1NA 4R6KA 5KZTA 4MLQA 2QS4A 1IITA 2F7CA 2REGA 2ZNSA 2DE2A 3G3HA 4MBPA 3QSLA 3T9UA 1MDQA 1I6QA 2X26A 2QMWA 3OEMA 3RUMA 3JV9A 4NTLA 3FUZA 1JNFA 2DWJA 3MZ9A 3G3FA 4EXLA 3KJ7A 1LAGE 2UVGA 1FTMA 2O1MA 4KR5A 2AL4A 4OTEA 4OWDA 4OQOA 4JB7A 3S9LC 3MQ9A 4LA9A 3E3KA 4G2ZA 1ZBMA 3RT6B 3W15C 4WEDA 3ECRA 2RCBA 4WEPA 3UA8A 5AA2D 3OELA 1LBCA 1Y1MA 5L9MA 3IOUA 2F7AA 1FQAA 1UTBA 3CG3A 3A3CA 5AA4B 3FATA 2RCAA 3QUJA 5FTIA 1ZMGA 2XXPA 4G68C 3SESA 5H8NB 1B3GA 2Z22A 2R71A 2VGQA 3CFXA 2ALUA 4PE5B 3EPEA 2ONKE 3EF7A 3KN7A 4GL0A 4M1VA 5B70A 2FYIA 3AXFA 2Z8FA 3KJTA 3BFTA 3LSLA 3K1PA 3KN3A 5CRYA 4E0XA 2ONRA 1ATGA 3MPLA 3VLWA 4I62A 4EF1A 1A54A 1GV8A 1M5CA 4JBZA 5DVJA 3DM0A 3FVGA 4ZE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6V A;  2DYX A;  3FD3 A;  3N26 A;  3ZKK A;  3MVW A;  3MWB A;  3SDF A;  4GVO A;  3KSX A;  1SQY A;  1VR5 A;  2AL5 A;  1MS7 A;  3M3K A;  1L5T A;  4G8N A;  1OMP A;  3O6I A;  4OYV A;  1GVC A;  4Q30 B;  1JEU A;  2HFB A;  4XKP A;  3VXB A;  3CFZ A;  1QW0 A;  3FVK A;  3Q25 A;  3BFU A;  1Y1Z A;  4DXB A;  4RY1 A;  3IB0 A;  4ESW A;  4X1B A;  3DP8 A;  4MH5 A;  2VOZ A;  5CI5 A;  3A09 A;  3IJX B;  3BBR A;  4O3C A;  2NOO A;  2XX9 A;  1B52 A;  3OO9 A;  4NF4 A;  3THI A;  4F29 A;  4EQ9 A;  5AA3 A;  4AB5 A;  4OVJ A;  2IA4 A;  4QF9 A;  1WDN A;  4IGR A;  4JDF A;  3WAF A;  3IB2 A;  1P1W A;  3O97 A;  3E4R A;  5JEI A;  3BKI B;  4JSD A;  2H5Y A;  3O6G A;  2I48 A;  4JWX A;  3R6U A;  3G3J A;  3DP4 A;  4IO4 A;  3UOR A;  2V84 A;  1RKM A;  1ZKB A;  2VHA A;  3MUQ A;  1B5I A;  4OER A;  5TU0 A;  3SEX A;  3FV1 A;  4LAT A;  1MXY A;  4MLV A;  4NF6 B;  3MP8 A;  5A5X A;  1FTK A;  4OFJ A;  4GL8 A;  1S9T A;  4R6H A;  5H8N A;  1IXH A;  3MAM A;  2GH9 A;  2XXI A;  3PUX E;  2Q9T A;  1NKX A;  4P0G A;  5M2V A;  5F7V A;  5HBC A;  5AA2 B;  1ANF A;  5I58 A;  2D3I A;  3SEV A;  3VV5 A;  3S9N C;  1MY3 A;  3RGY A;  3TAJ A;  4RPN A;  5K2Y A;  2OWT A;  4X9T A;  2UYF A;  2QS2 A;  2Y7P A;  2XXH A;  3PPR A;  5CBS A;  1GGG A;  5I57 A;  4EQB A;  1USY H;  1QUL A;  2ABH A;  4G8H A;  3ZSF A;  2H99 A;  1XOC A;  4TOZ A;  4XIG Q;  2F78 A;  2XXR A;  4HCY A;  3HV1 A;  3UP9 A;  1FCK A;  4C1U A;  3OEN A;  1LB9 A;  1QKA A;  3H06 B;  4TLM B;  1R9L A;  4XKQ A;  3IOT A;  4DZ1 A;  1MPB A;  2RC8 A;  3PUV E;  3TTN A;  3VVE A;  1MQI A;  2QSX A;  4ZEK A;  2QJE A;  1M5F A;  4AQ4 A;  4ZZE A;  2ZYN A;  1DTZ A;  3KSJ A;  5H8F B;  4F3P A;  1UTH A;  1DSN A;  2P2A A;  2ZNT A;  3C32 A;  4KCC A;  5L8D A;  4U23 A;  1F9B A;  4KPT A;  1QVS A;  4RA1 A;  3DLN A;  2PBW A;  4L17 A;  1Y4T A;  1H43 A;  5KDT A;  2VD3 A;  3F11 A;  3H4Z A;  4H5G A;  4IY6 A;  3TQL A;  3CI8 A;  1H44 A;  3OSQ A;  4NF5 A;  4KQP A;  4H65 A;  1DPE A;  4H67 A;  4DXU A;  3IB1 A;  5H8H A;  3U94 A;  1MPD A;  4XKR A;  1Y3P A;  3MZ1 A;  1EZ9 A;  4ZZA A;  4F19 A;  1SW2 A;  2E1S A;  3C31 A;  3FJ7 A;  3TPA A;  2B3B A;  5HPQ A;  2HEU A;  3UK4 A;  4NED A;  3OO6 A;  1SYH A;  4F1V A;  1NNK A;  5DEX B;  1JVY A;  3PPO A;  4X48 A;  1N0T A;  2HCA A;  1LB8 A;  3H7M A;  3QXM A;  4BDR A;  5I57 B;  1UQW A;  3QIM A;  4FE8 A;  5H8S A;  3PMX A;  3T9H B;  2XD3 A;  1LCF A;  4KYS A;  1GR2 A;  4GF8 A;  3V83 A;  3TTL A;  4YU0 A;  4U4S A;  5DT6 A;  3FJG A;  3RT8 A;  4RJZ A;  5I58 B;  1TFD A;  1OQG A;  4YB5 A;  3EHT A;  3OO7 A;  4LVQ A;  1SD3 A;  1P1O A;  4P11 A;  3D4G A;  1NNP A;  1OVB A;  4U2R A;  3TCH A;  4R6Y A;  3SEW A;  4EF2 A;  1ZIU A;  3T9V A;  1OLA A;  3GBB A;  2O84 X;  3O6H A;  5CMM A;  1FQE A;  3IL1 B;  3SEU A;  4NE4 A;  1CE2 A;  3MP1 A;  4JWO A;  5K2X A;  4XTC Q;  4F3G A;  1B5J A;  2FNC A;  3PU5 A;  3CFL A;  3KBR A;  4QSD A;  2X7Q A;  3QK6 A;  4FED A;  4KD5 A;  2HZK A;  4KHZ E;  1SW4 A;  2G93 A;  5EYF A;  5J1D A;  3K0V A;  4DIG A;  4F39 A;  3V89 B;  4GD5 A;  4YKJ A;  2XX8 A;  3IK6 B;  3KGC A;  4GFR A;  3TKD A;  4EXK A;  5TP9 B;  4IY5 A;  5DEX A;  4ELR A;  4YMA A;  1Y3N A;  4F1U A;  2E0S A;  5AA4 A;  3HHF A;  2XXX A;  4DDD A;  4R9F A;  1YAE A;  1EH3 A;  1O64 A;  3MPK A;  3MP6 A;  4FIM A;  1UTH B;  4LZ8 A;  3VDF A;  4LQ2 A;  3U92 A;  1JW1 A;  1PB8 A;  1B3E A;  3PD9 A;  4U21 A;  1AH5 A;  3TOD A;  3RNN A;  1I6B A;  1N7W A;  2I58 A;  4YMB A;  2OK2 A;  3VXC A;  3HPI A;  3CRB A;  1MXZ A;  2CMO A;  3LSW A;  3K1M A;  2Q88 A;  1NH8 A;  2XXU A;  4C1T A;  1I69 A;  3RQT A;  1N04 A;  2OCU A;  4FEC A;  4U22 A;  3RTW B;  3E9X A;  2I3W A;  1QUI A;  4AB6 A;  3R26 A;  1M5E A;  1PDA A;  1H76 A;  1ZTY A;  2A5S A;  2O68 A;  5FHN A;  2NVU B;  5I2K A;  1ZU0 A;  2VP1 A;  2LAO A;  3KN8 A;  5EHS A;  2XXV A;  1BLF A;  5JTY A;  3IJO B;  4Q0C A;  4DLD A;  2Q8J A;  2R6G E;  4TQU Q;  5CBR A;  4GOT A;  4EQ7 A;  1MM7 A;  4OZ9 A;  5I59 B;  2RKM A;  1R6Z A;  2O51 A;  4IO7 A;  1FQB A;  2Y7W A;  2QMX A;  1LCT A;  2V25 A;  2V3Q A;  5CMC A;  5DVF A;  3SET A;  3LC8 A;  1GTK A;  3T9X B;  3VLV A;  2F36 A;  2AYS A;  4F1Y A;  4YZZ A;  1D4N A;  4LUB A;  4PQJ A;  4R73 A;  1N3X A;  1P1Q A;  1NFT A;  1PEB A;  2H9B A;  2Q89 A;  2VD2 A;  1LAF E;  1IZ1 A;  3HST A;  4I8C A;  4O3A A;  1PBP A;  5CMB A;  4QSE A;  1MY1 A;  3H03 A;  1B3L A;  3HO7 A;  4YB6 A;  3K01 A;  1ELJ A;  1MQH A;  4ZEI A;  3IX1 A;  1Y3Q A;  1IIW A;  2DE3 A;  3K2D A;  4E0W A;  4F31 B;  4ZEC A;  4QFP A;  2OBG A;  3TYH A;  1XHY A;  1QUK A;  3V8X B;  5L9S A;  3FGS A;  1PB7 A;  4WKM A;  4O3B A;  2A5T A;  2P0S A;  3TCF A;  4BDQ A;  2I0C A;  1MRP A;  4FAT A;  2IEE A;  2XXY A;  1JQF A;  2B3F A;  3K6W A;  5DTB A;  5AA1 A;  2RF1 A;  1B32 A;  2HXW A;  2V93 A;  3R7X A;  1VFE A;  3T96 B;  1MY4 A;  4HTG A;  3KFM A;  4RPO A;  1S7Y A;  2ANJ A;  2QS3 A;  2F5X A;  1NNF A;  1MPC A;  1H45 A;  1R9Q A;  3FXR A;  1URG A;  2XXW A;  2YJP A;  3M3F A;  3PUZ E;  4IO2 A;  1IXC A;  3RN8 A;  1B1X A;  5L9O A;  5ISU A;  1R1N A;  1UTB B;  2DVZ A;  3VVD A;  2DP8 A;  4QFO A;  4BDM A;  1FTL A;  3O2A A;  3VE1 B;  1LGB C;  1B0L A;  4XKN A;  1Q1K A;  3P7I A;  2V3U A;  4Z0I A;  2Z8E A;  4FJP A;  4DXC A;  1MQG A;  1POY 1;  4NWD A;  1XC1 A;  4MFI A;  1MDP 1;  5KCJ B;  2GFE A;  1UIU A;  3H6W A;  4G77 A;  5JTY B;  3OD7 A;  4G68 A;  1B5H A;  1IEJ A;  1MH4 A;  4H0W A;  3B7D A;  5TP9 A;  5I2N A;  3ZKL A;  4ELQ A;  1PB9 A;  4DCY A;  4ZE9 A;  5CM6 A;  3EHS A;  1MY0 A;  4ZDM A;  4ONY A;  2O1L A;  3MVZ A;  2F7B A;  3LSX A;  3IR1 A;  1P1U A;  3QUF A;  1S50 A;  3RPW A;  4R72 A;  2Y7K A;  4RK9 A;  5H8F A;  4Z7E A;  3O28 A;  2DWI A;  5DYH A;  3LSF B;  1TXF A;  3TEL A;  1SI0 A;  4KYD A;  4PP0 A;  3UIF A;  1B58 A;  3T22 A;  2DVC A;  2Z23 A;  1B0H A;  2F34 A;  5HM4 B;  4NWC A;  1B3H A;  5LOM A;  2F6P A;  3L6H A;  1FTJ A;  2O7U A;  3GLB A;  4NF5 B;  3M8U A;  5EHM A;  3IAZ A;  3WAE A;  5AE4 A;  1IXG A;  1FW0 A;  3RTF B;  1A99 A;  1BIY A;  1D3K A;  2F97 A;  4QRZ A;  1Q35 A;  3TTM A;  3VFJ A;  5I59 A;  1XVX A;  3C34 A;  3Q29 A;  2I49 A;  5CMK A;  3TEP A;  4F2O A;  2ZYO A;  1ZLQ A;  3D4C A;  3PMV A;  5FTH A;  5I56 A;  5JK4 A;  2QS1 A;  1NL5 A;  4YKI A;  1T0K A;  4RXL A;  5I2K B;  2PMS A;  2PT1 A;  3G3I A;  4FOR A;  3N6U A;  2H25 A;  1RYX A;  4I1D A;  5KCJ A;  4GXA A;  4OFO A;  4G68 B;  4H6D A;  4PFW A;  2GRV A;  2XHD A;  4F2Q A;  3IOW A;  2DSF A;  1A8E A;  1QJM A;  2ZNU A;  1FQD A;  1O63 A;  3PD8 A;  2CZL A;  4Q5T A;  3IO6 A;  3PGF A;  4OFL A;  3N94 A;  4HCW A;  1POT A;  2I4C A;  2ZYM A;  4LZ5 A;  4RNS A;  5TPA B;  3FZV A;  2DXY A;  3CSG A;  1MH3 A;  2DOJ A;  1IXI A;  1N76 A;  1US4 A;  2DWA A;  2HAU A;  3JZJ A;  3N6T A;  5I2N B;  1HSJ A;  2OWS A;  5ELV A;  4MF3 A;  1TWY A;  3S4U A;  3GXA A;  3RY3 A;  4U1Z A;  2BJJ X;  3I3V A;  4QFN A;  4R2F A;  3K6X A;  4G4P A;  2ONS A;  4ZED A;  2OZZ A;  3IOR A;  3O66 A;  4UA8 A;  5H8Q A;  3KOT A;  3I5O A;  4JXI A;  4K3F A;  1JEV A;  1RYO A;  2RC7 A;  4N6P A;  4ELO A;  2GHA A;  3C33 A;  4N13 A;  3T93 B;  2D21 A;  2X7P A;  2HQ0 A;  1TT1 A;  4IO3 A;  4DE8 A;  2M8C A;  2I6E A;  5ICT A;  4HS7 A;  2THI A;  3FVO A;  1M5B A;  5IKB A;  5IAI A;  2YLN A;  5KDT B;  3FIR A;  3ONM A;  4UAC A;  3USD A;  2I3V A;  2WKY A;  5BWJ A;  4LP2 B;  2QL3 A;  4KCD A;  1EU8 A;  3PMW A;  2UVI A;  1JW5 A;  4NF4 B;  1B4H A;  2Y7R A;  4ECF A;  4F22 A;  5I56 B;  5I84 A;  3EQ1 A;  3KG2 A;  1URD A;  3U72 A;  2G29 A;  3CG1 A;  3H6T A;  3Q28 A;  4YAH X;  2XD2 A;  3HHG A;  4POW A;  3FJM A;  5CC2 A;  1A55 A;  2PYY A;  3S9E A;  1SI1 A;  3C4M A;  2ZXT A;  2DE4 A;  1B4Z A;  1LFI A;  2DWH A;  2I0B A;  1O7T A;  2F6G A;  4GRK A;  2OJT A;  1AMF A;  2OLB A;  3C9H A;  4M4G A;  4OES A;  4R74 A;  1JET A;  3FAS A;  3G7W A;  4OEN A;  2B65 A;  2PVU A;  3MC2 A;  3OSR A;  2QRY A;  4GIZ A;  2HAV A;  4H1X A;  1II5 A;  2RIN A;  4OMB A;  4QFK A;  4R9G A;  1VE4 A;  3OXN A;  4ELP A;  1FQF A;  2DS9 A;  2UVJ A;  1NH7 A;  3C36 A;  3ILT B;  3MJN A;  3TFL A;  3E13 X;  3MZB A;  3GZG A;  4QHQ A;  1LAX A;  1OIB A;  2O69 A;  2FA7 A;  4FEB A;  1LAH E;  1B9J A;  4YKP A;  4ZS9 A;  1MXV A;  2YPN A;  1ZJL A;  2HZL A;  1BKA A;  4PFY A;  4F18 A;  4BDN A;  1MXW A;  3H6U A;  1SDX A;  1IUD A;  1WVJ A;  1PC3 A;  3Q27 A;  1I6A A;  5FHM A;  3TTR A;  2NXO A;  3TZA A;  4NF8 A;  3LR1 A;  1DTG A;  1P1N A;  3PUY E;  4ND9 A;  4EDP A;  2O6A A;  3TDJ A;  4ZEB A;  2QPQ A;  4GXS B;  1B1H A;  1A40 A;  4GWO A;  3OOA A;  1Y20 A;  1EZP A;  2F8D A;  3K6U A;  3ILU B;  4LQ5 A;  1PBQ A;  1B46 A;  1Z7N E;  1EZO A;  4U1O A;  1QKB A;  1SBP A;  2PX1 A;  3VVF A;  1VFD A;  2XXT A;  3PV0 E;  3B6T A;  4LON B;  3S9M C;  4YKK A;  3KEI A;  3LBS A;  1XT8 A;  4NMY A;  4PFU A;  2I4B A;  5DVI A;  3QYT A;  1CB6 A;  2NUV A;  1Y9U A;  3FXU A;  1DPP A;  1XVY A;  3KOS A;  5H8Q B;  3O29 A;  3N5L A;  5BUU A;  3UGW A;  3TMG A;  2Y7I A;  3OMB A;  2XXQ A;  4H5F A;  1B3F A;  1BP5 A;  1SW1 A;  2A5T B;  1A7L A;  4G8M A;  3B6Q A;  1KWH A;  3MVY A;  1B51 A;  1WOD A;  4BDO A;  3DEL B;  1VSO A;  3PUW E;  4ESX A;  1YCJ A;  1FQC A;  1LBB A;  3CR9 A;  1N7X A;  2P1S A;  4IO6 A;  3FVN A;  3L6G A;  4JSO A;  1N3W A;  4Q8R A;  3HN0 A;  2GHB A;  1SVX B;  5AA2 A;  4R2B A;  3FXQ A;  1B7H A;  3PPP A;  2KLF A;  3EHU A;  2REJ A;  2ZYK A;  5F1Q A;  5ITO A;  2NWJ A;  3PPQ A;  1YPN A;  4OEU A;  3CIJ A;  3V5A A;  1AIV A;  4IB2 A;  3JYR A;  4BDL A;  4H8I A;  3IOV A;  3TQW A;  1MXU A;  1OLC A;  4KYE A;  1NNT A;  3PPN A;  2ZMB A;  1LLS A;  1B2H A;  4RYA A;  2PT2 A;  2F35 A;  3OEK A;  2RC9 A;  4LZ7 A;  3H3G A;  2O7I A;  1P99 A;  4IO5 A;  4NF6 A;  3RLF E;  5A5X B;  2Z8D A;  3VLU A;  2DXR A;  1D9Y A;  2UVH A;  3LUY A;  4KI0 E;  4ZEF A;  4NF8 B;  1OQH A;  3IO4 A;  2Y84 A;  4FAJ A;  2Q2A A;  2D5W A;  4RK2 A;  1FTO A;  3U1O A;  3CSB A;  1B7U A;  1JVX A;  4U4X A;  5B7D A;  1B05 A;  4F3S A;  4XXU A;  3OO8 A;  4THI A;  1UIV A;  3SEY A;  3U93 A;  3C35 A;  1MXX A;  3G3G A;  4JWY A;  2W7Y A;  1J1N A;  4R75 A;  1B6H A;  1MQD A;  4QFL A;  5FHO A;  4OEV A;  3UN6 A;  4ISU A;  4TLL B;  3W9W A;  3B6W A;  2R9J A;  3K02 A;  3Q26 A;  1JW4 A;  1HSL A;  3EN3 A;  5TPA A;  1IQ7 A;  3ZS6 A;  1US5 A;  1QUJ A;  4HW8 A;  1DMB A;  1AL3 A;  1SYI A;  1URS A;  2H98 A;  1D9V A;  1DOT A;  3KZG A;  5H8H B;  4OHN A;  4BLA A;  5ITP A;  1B40 A;  1Z7M E;  1LFG A;  3K4U A;  4KFQ A;  1AOV A;  2DQV A;  4YIC A;  1YTV A;  3H6V A;  3DP6 A;  4OXV A;  2V3T A;  1M5D A;  4GQO A;  3SER A;  1H3D A;  1A8F A;  1MG1 A;  4PET A;  3TUS A;  1SW5 A;  2AIX A;  1HSE A;  2H4I A;  2ESN A;  4X1D A;  4F3B A;  1N84 A;  2UYE A;  4IGT A;  1MM6 A;  4P0I A;  2Q2C A;  1LST A;  3W9V A;  2UXA A;  1XS5 A;  4YB7 A;  1B7Z A;  1TFA A;  3FV2 A;  3G3K A;  1MQJ A;  2XX7 A;  3K00 A;  1NMU A;  3I6V A;  3T66 A;  5ICQ A;  3U8Q A;  3SKP A;  3TTK A;  4I9D A;  4GLI A;  3CVG A;  4DCX A;  4EUO A;  3HCQ A;  3QAX A;  1MY2 A;  3S2V A;  1LFH A;  1OVT A;  3MVX A;  3GBA A;  4WXJ A;  1Y4C A;  3ODB A;  3TCG A;  4H8J A;  4OET A;  1BTJ A;  3M3L A;  1USY E;  3MW0 A;  4QSC A;  3O9P A;  4C0R A;  4N07 A;  3MBP A;  3A3U A;  4POX A;  4PFT A;  3K1N A;  4R6K A;  5KZT A;  4MLQ A;  2QS4 A;  1IIT A;  2F7C A;  2REG A;  2ZNS A;  2DE2 A;  3G3H A;  4MBP A;  3QSL A;  3T9U A;  1MDQ A;  1I6Q A;  2X26 A;  2QMW A;  3OEM A;  3RUM A;  3JV9 A;  4NTL A;  3FUZ A;  1JNF A;  2DWJ A;  3MZ9 A;  3G3F A;  4EXL A;  3KJ7 A;  1LAG E;  2UVG A;  1FTM A;  2O1M A;  4KR5 A;  2AL4 A;  4OTE A;  4OWD A;  4OQO A;  4JB7 A;  3S9L C;  3MQ9 A;  4LA9 A;  3E3K A;  4G2Z A;  1ZBM A;  3RT6 B;  3W15 C;  4WED A;  3ECR A;  2RCB A;  4WEP A;  3UA8 A;  5AA2 D;  3OEL A;  1LBC A;  1Y1M A;  5L9M A;  3IOU A;  2F7A A;  1FQA A;  1UTB A;  3CG3 A;  3A3C A;  5AA4 B;  3FAT A;  2RCA A;  3QUJ A;  5FTI A;  1ZMG A;  2XXP A;  4G68 C;  3SES A;  5H8N B;  1B3G A;  2Z22 A;  2R71 A;  2VGQ A;  3CFX A;  2ALU A;  4PE5 B;  3EPE A;  2ONK E;  3EF7 A;  3KN7 A;  4GL0 A;  4M1V A;  5B70 A;  2FYI A;  3AXF A;  2Z8F A;  3KJT A;  3BFT A;  3LSL A;  3K1P A;  3KN3 A;  5CRY A;  4E0X A;  2ONR A;  1ATG A;  3MPL A;  3VLW A;  4I62 A;  4EF1 A;  1A54 A;  1GV8 A;  1M5C A;  4JBZ A;  5DVJ A;  3DM0 A;  3FVG A;  4ZE8 A; 
#chains in the Genus database with same CATH topology
 3N26 A;  3MWB A;  3KSX A;  2AL5 A;  1L5T A;  1RDY A;  4MEV A;  3ZSF A;  2HFB A;  2QVR A;  1QW0 A;  1NV6 A;  1Y1Z A;  4RY1 A;  4MH5 A;  2XX9 A;  4NF4 A;  3THI A;  4EQ9 A;  5AA3 A;  3R6U A;  3DP4 A;  4IO4 A;  3UOR A;  1ZKB A;  2VHA A;  5AA2 B;  1B5I A;  5HM4 B;  4OFJ A;  4R6H A;  4P0G A;  3PUX E;  3VV5 A;  2Q74 A;  4X9T A;  4AS5 A;  1QUL A;  2ABH A;  2F78 A;  4HCY A;  3HV1 A;  4PCD A;  2Q8M A;  1MPB A;  3PUV E;  4NF0 A;  3VVE A;  2QSX A;  2XWO A;  2ZYN A;  3KSJ A;  5H8F B;  4F3P A;  1UTH A;  4KCC A;  4N91 A;  3DLN A;  2XXK A;  1H43 A;  2VD3 A;  1XI6 A;  3OSQ A;  1DPE A;  4H67 A;  4PGN A;  4BDR A;  5I57 B;  1UQW A;  3QIM A;  1NV0 A;  1LCF A;  3V83 A;  4U4S A;  3RT8 A;  5I58 B;  4YB5 A;  4HE2 A;  4P11 A;  3LUZ A;  2V4C A;  3SEW A;  3T9V A;  4X04 A;  1NV7 A;  3QK6 A;  2HZK A;  2OX3 A;  1SW4 A;  2G93 A;  5FBP A;  4DIG A;  5JEI A;  3TKD A;  4EXK A;  4IY5 A;  1Y3N A;  4R9F A;  3MP6 A;  1UTH B;  3VDF A;  1INP A;  1PB8 A;  4HXV A;  3RNN A;  1N7W A;  3HPI A;  2Q88 A;  1NH8 A;  1I69 A;  3E9X A;  3R26 A;  1PDA A;  1ZTY A;  5FHN A;  3KN8 A;  4OZ9 A;  2O51 A;  2XWI A;  4IO7 A;  2Y7W A;  4MMP A;  2V25 A;  5CMC A;  5DVF A;  1GTK A;  3S9N C;  4NQ8 A;  5I56 B;  4YZZ A;  5EQ7 A;  3HST A;  2VD2 A;  1FBP A;  1PBP A;  4QSE A;  3HO7 A;  1B3L A;  4YB6 A;  4F29 A;  4OVT A;  3V8X B;  5L9S A;  1EYI A;  4O3B A;  2P0S A;  3R7X A;  2RF1 A;  5H8Q A;  4RPO A;  2DDK A;  3FXR A;  2XXW A;  2YJP A;  4IO2 A;  3RN8 A;  1IXC A;  1B1X A;  5L9O A;  1R1N A;  1LBZ A;  1LGB C;  4NWD A;  1XC1 A;  1MDP 1;  1CNQ A;  1UIU A;  3OD7 A;  1B5H A;  1MH4 A;  3B7D A;  3ZKL A;  5CM6 A;  1PB9 A;  3EHS A;  4ZDM A;  2O1L A;  3MVZ A;  3QUF A;  1P1U A;  3RPW A;  4RK9 A;  5H8F A;  4PP0 A;  3T22 A;  2F34 A;  4PGP A;  1YYZ A;  2O7U A;  5EHM A;  2I49 A;  5CMK A;  3TEP A;  4F2O A;  2ZYO A;  2QS1 A;  4I1D A;  4H6D A;  2DSF A;  3PD8 A;  4Q5T A;  3IO6 A;  3PGF A;  4O7I A;  4HCW A;  4G61 A;  1FPK A;  1MH3 A;  1IXI A;  3JZJ A;  3N6T A;  3BIG A;  4DI4 B;  1FPJ A;  1TWY A;  3S4U A;  3GXA A;  4U1Z A;  3K6X A;  3KOT A;  4O7M A;  4K3F A;  3C33 A;  4N13 A;  1NI9 A;  2D21 A;  2X7P A;  2CZH A;  3FVO A;  4O94 A;  3RPL A;  5KDT B;  4UAC A;  4GBW A;  4LP2 B;  4ECF A;  4JVI A;  3EQ1 A;  1URD A;  3U72 A;  5CC2 A;  3FJM A;  3S9E A;  1B4Z A;  1LFI A;  4OXV A;  3FAS A;  4OMB A;  3OSR A;  2QRY A;  1KA1 A;  4R9G A;  1FQF A;  1NH7 A;  4QHQ A;  4ZS9 A;  1B9J A;  4YKP A;  2HZL A;  1BKA A;  5LTC A;  4BDN A;  1PC3 A;  5FHM A;  3TZA A;  4ND9 A;  1FPE A;  2QPQ A;  4PFB A;  3OOA A;  1Y20 A;  1EZP A;  3ILU B;  4FBP A;  1SBP A;  1VFD A;  2XXT A;  3PV0 E;  4LON B;  4YKK A;  3LBS A;  1YZ0 A;  3N5L A;  1IMD A;  5BUU A;  3TMG A;  1A7L A;  3D1R A;  1KWH A;  3MVY A;  1WOD A;  1FQC A;  1N7X A;  3FVN A;  2FHY A;  1N3W A;  4R2B A;  5ITO A;  1IMC A;  2NWJ A;  3PPQ A;  1AIV A;  4OEU A;  3CIJ A;  4H8I A;  3TQW A;  3FBP A;  1MXU A;  1IMF A;  1NNT A;  1B2H A;  2RC9 A;  2Z8D A;  4GBV A;  3E79 A;  1D9Y A;  4PDH A;  4ZEF A;  4FAJ A;  1FJ9 A;  2Q2A A;  5A5L A;  4RK2 A;  3CSB A;  1JVX A;  5DW8 A;  3OO8 A;  1UIV A;  4R75 A;  4P47 A;  3W9W A;  3B6W A;  2R9J A;  3ZS6 A;  1SYI A;  1URS A;  5H8H B;  1D9V A;  1B40 A;  3K4U A;  1AOV A;  4XFE A;  1H3D A;  1A8F A;  1RDZ A;  2UYE A;  4P0I A;  1XS5 A;  1B7Z A;  1TFA A;  3G3K A;  1MQJ A;  3I6V A;  5ICQ A;  3U8Q A;  2ZZW A;  3TTK A;  4I9D A;  4GLI A;  3TCG A;  1USY E;  4POX A;  4MLQ A;  1IIT A;  3G3H A;  1I6Q A;  2X26 A;  2R8T A;  2DWJ A;  3MZ9 A;  3KJ7 A;  1LAG E;  2O1M A;  3KBZ A;  2CEX A;  4JB7 A;  4OVQ A;  3MQ9 A;  2RCB A;  4H45 A;  4WEP A;  1LBC A;  1UTB A;  1SPI A;  1ZMG A;  2XXP A;  4HE0 A;  2ZZX A;  1B3G A;  4PAF A;  3KN7 A;  4M1V A;  3BFT A;  5CRY A;  1ATG A;  3VLW A;  1A54 A;  4JBZ A;  2DYX A;  3FD3 A;  3ZKK A;  1MS7 A;  4G8N A;  4OYV A;  1FBH A;  4XKP A;  3CFZ A;  3BFU A;  4O3C A;  4OVJ A;  4QF9 A;  1WDN A;  3IB2 A;  1RKM A;  3MUQ A;  3SEX A;  3FV1 A;  1S9T A;  3MAM A;  5HBC A;  4NX1 A;  1ANF A;  5I5P A;  3RGY A;  4RPN A;  2OWT A;  2QS2 A;  5CBS A;  1GGG A;  5I57 A;  4G8H A;  2XXR A;  1FCK A;  4GWW A;  4P1L A;  4ZEK A;  4AQ4 A;  2P2A A;  4KPT A;  2PBW A;  4L17 A;  4IY6 A;  1H44 A;  1JP4 A;  3U94 A;  1MPD A;  4ZZA A;  3C31 A;  2B3B A;  2HEU A;  3UK4 A;  2HHM A;  3OO6 A;  1SYH A;  4F1V A;  1DBZ A;  1LB8 A;  5H8S A;  3PMX A;  2XD3 A;  4KYS A;  4GF8 A;  4N15 A;  1TFD A;  1OQG A;  3OO7 A;  4LVQ A;  1NNP A;  1FRP A;  4R6Y A;  4EF2 A;  1ZIU A;  1OLA A;  3GBB A;  2O84 X;  3SEU A;  3MP1 A;  4JWO A;  4LN5 A;  4KHZ E;  5EYF A;  3V89 B;  2B4L A;  2XX8 A;  4GFR A;  4YMA A;  5DEX A;  2E0S A;  5AA4 A;  3HHF A;  4PC9 A;  4DDD A;  1EH3 A;  4LZ8 A;  2B4M A;  1JW1 A;  1B3E A;  3TOD A;  1YXI A;  3CRB A;  2CMO A;  3LSW A;  2XXU A;  3RTW B;  4AB6 A;  3EKI A;  1H76 A;  2NVU B;  5I2K A;  1ZU0 A;  5EYH A;  3IJO B;  4Q0C A;  5I59 B;  4GOT A;  1MM7 A;  2RKM A;  1R6Z A;  1FQB A;  4GWY A;  4F1Y A;  2AYS A;  5TP9 B;  1D4N A;  4PQJ A;  4R73 A;  2H9B A;  1PEB A;  3TQL A;  2Q89 A;  4O3A A;  3ROJ A;  1LAF E;  1FBC A;  1MY1 A;  1MQH A;  4E0W A;  1IIW A;  2DE3 A;  3K2D A;  4GWU A;  4P3L A;  2OBG A;  5ET6 A;  1NUX A;  4DI3 D;  4BDQ A;  2I0C A;  2B3F A;  3HFU A;  2V93 A;  1B32 A;  1MY4 A;  3KFM A;  2QS3 A;  2F5X A;  1NUZ A;  1UTB B;  3VE1 B;  1FPL A;  2Y5L A;  1B0L A;  1Q1K A;  3P7I A;  4PBH A;  2Z8E A;  4FJP A;  4DXC A;  1MQG A;  2Y5K A;  1POY 1;  4MFI A;  4GX3 A;  4OVP A;  4ONY A;  2F7B A;  3LSX A;  4Z7E A;  1TXF A;  1SI0 A;  1B58 A;  1K9Y A;  2DVC A;  5ESY A;  2F6P A;  3IAZ A;  3WAE A;  4NAP A;  4QRZ A;  1Q35 A;  3VFJ A;  5I59 A;  1XVX A;  2P3V A;  1ZLQ A;  5FTH A;  1T0K A;  4RXL A;  4F2Q A;  2GRV A;  3IOW A;  1A8E A;  2CZL A;  3N94 A;  2I4C A;  5TPA B;  3CSG A;  2DWA A;  5I2N B;  2OWS A;  5IGA A;  2ONS A;  2OZZ A;  4UA8 A;  2PFY A;  1FPD A;  4JXI A;  2RC7 A;  1FTA A;  2HQ0 A;  1TT1 A;  4GX4 A;  4DE8 A;  2M8C A;  2I6E A;  5ICT A;  1M5B A;  5IAI A;  1AWB A;  3ONM A;  2I3V A;  2WKY A;  5BWJ A;  1NV1 A;  4F22 A;  5I84 A;  1B4H A;  3CG1 A;  2XD2 A;  1A55 A;  1SI1 A;  4GRK A;  2DE4 A;  2DWH A;  4OVR A;  1O7T A;  4OES A;  2OLB A;  4GX6 A;  1JET A;  4MJO A;  4GIZ A;  4H1X A;  4QFK A;  1II5 A;  1VE4 A;  2CZI A;  4ELP A;  1LAX A;  2O69 A;  4O8M A;  2YPN A;  3B50 A;  4PFY A;  4F18 A;  3H6U A;  3Q27 A;  3LR1 A;  1NUW A;  3TDJ A;  1DK4 A;  1Z7N E;  3VVF A;  3S9M C;  1XT8 A;  4PFU A;  1CB6 A;  1DPP A;  3KOS A;  1BP5 A;  1SW1 A;  4G8M A;  3B6Q A;  1B51 A;  4P1E A;  3DEL B;  3LV0 A;  4Q8R A;  1SVX B;  3EHU A;  4IB2 A;  4BDL A;  3PPN A;  2F35 A;  3OEK A;  1P99 A;  2QVU A;  3RLF E;  2WEF A;  3VLU A;  2DXR A;  1LBV A;  4KI0 E;  2D5W A;  5B7D A;  3C35 A;  4JWY A;  1J1N A;  4OEV A;  3RYD A;  5I3S A;  4ISU A;  4TLL B;  3GYY A;  1IQ7 A;  4I40 A;  1DOT A;  4KFQ A;  2DQV A;  4MHF A;  5EQA A;  3DP6 A;  2V3T A;  4OAN A;  1SW5 A;  2H4I A;  4X1D A;  1N84 A;  1IME A;  4GWZ A;  1LST A;  3W9V A;  4YB7 A;  3K00 A;  1LFH A;  4EUO A;  3QAX A;  1MY2 A;  2P3N A;  1NV2 A;  4N6K A;  1BTJ A;  4PBQ A;  4PFT A;  4OVS A;  3T0J A;  2F7C A;  2DE2 A;  1LBY A;  3OEM A;  3JV9 A;  3FUZ A;  1FPI A;  4I3E A;  4G2Z A;  3W15 C;  4WED A;  3B8B A;  5AA2 D;  3OEL A;  1LBW A;  1Y1M A;  5L9M A;  2F7A A;  1FQA A;  3CG3 A;  3A3C A;  3FAT A;  2CZK A;  4MCO A;  2Z22 A;  2R71 A;  2VGQ A;  3EPE A;  2ONK E;  2Z8F A;  3KJT A;  3K1P A;  2ONR A;  3MPL A;  1M5C A;  3UN6 A;  4ZE8 A;  3K6V A;  5I7I A;  3MVW A;  2VT5 A;  5ET8 A;  3M3K A;  1OMP A;  3O6I A;  4DXB A;  2GQ1 A;  4ESW A;  3DP8 A;  3A09 A;  3IJX B;  3BBR A;  3T1B A;  2NOO A;  3OO9 A;  4N4U A;  2IA4 A;  4JDF A;  3WAF A;  3O97 A;  3E4R A;  4JSD A;  2H5Y A;  3O6G A;  2I48 A;  1FPB A;  4PAK A;  3G3J A;  4LAT A;  1MXY A;  3MP8 A;  1FTK A;  4GL8 A;  2XXI A;  2Q9T A;  1NKX A;  5M2V A;  5F7V A;  4NG7 A;  5I58 A;  2D3I A;  3SEV A;  4IR8 A;  3TAJ A;  2UYF A;  2Y7P A;  2VPN A;  2XXH A;  3PPR A;  4EQB A;  4UAB A;  2H99 A;  1XOC A;  3UP9 A;  4C1U A;  3OEN A;  4XKQ A;  4DZ1 A;  1FBD A;  1NV4 A;  3TTN A;  1MQI A;  1FPF A;  1M5F A;  2WX9 A;  1DTZ A;  1DSN A;  2ZNT A;  3C32 A;  4U23 A;  1F9B A;  4RA1 A;  2XWK A;  1Y4T A;  5IM2 A;  3RPL B;  5KDT A;  3F11 A;  4H5G A;  2WYP A;  3KC0 A;  2HPG A;  1EZ9 A;  4MX6 A;  2E1S A;  3TPA A;  4MNC A;  4NED A;  5DEX B;  1JVY A;  3PPO A;  4X48 A;  1N0T A;  2HCA A;  1EYK A;  3T9H B;  5IZ3 A;  3TTL A;  4I3Y A;  2CEY A;  1SD3 A;  3TCH A;  3QMF A;  1FQE A;  4NE4 A;  1CE2 A;  1B5J A;  3PU5 A;  3CFL A;  3KBR A;  4QSD A;  4FED A;  4F39 A;  3IK6 B;  4N17 A;  2F3B A;  2XXX A;  4LQ2 A;  4QBA A;  4U21 A;  2F3D A;  1I6B A;  2I58 A;  2OK2 A;  3VXC A;  1MXZ A;  3K1M A;  1N04 A;  2OCU A;  4U22 A;  1KZ8 A;  2I3W A;  1QUI A;  2A5S A;  2O68 A;  2LAO A;  2XXV A;  1BLF A;  5CBR A;  4DLD A;  2R6G E;  4TQU Q;  4EQ7 A;  3LC8 A;  1N3X A;  1P1Q A;  1NUY A;  5CMB A;  1IZ1 A;  5LDZ A;  4ZEC A;  4QFP A;  1QUK A;  3FGS A;  1PB7 A;  4WKM A;  5ET5 A;  4FAT A;  1MRP A;  2XXY A;  3K6W A;  5AA1 A;  5DTB A;  1VFE A;  1H45 A;  5ISU A;  2DVZ A;  1KA0 A;  4BDM A;  4QFO A;  1FTL A;  3O2A A;  2V3U A;  4Z0I A;  1NV5 A;  4G77 A;  4H0W A;  5I2N A;  5TP9 A;  4JVD A;  1MY0 A;  5EYG A;  3IR1 A;  1S50 A;  4R72 A;  2Y7K A;  5EQ9 A;  3O28 A;  2DWI A;  4KYD A;  3UIF A;  1G0H A;  1B0H A;  4NWC A;  1B3H A;  5LOM A;  3GLB A;  5AE4 A;  1IXG A;  1FW0 A;  1D3K A;  3TTM A;  1FBG A;  3Q29 A;  5JK4 A;  5I56 A;  4YKI A;  1LBX A;  3N6U A;  2H25 A;  1RYX A;  5KCJ A;  2WBD A;  4GXA A;  4OFO A;  4G68 B;  2XHD A;  1QJM A;  2ZNU A;  1O63 A;  1POT A;  3TEL A;  5JTY A;  1US4 A;  2HAU A;  1FSA A;  1HSJ A;  4MF3 A;  3I3V A;  4R2F A;  4ZED A;  3I5O A;  4ELO A;  2THI A;  2YLN A;  3FIR A;  3USD A;  2QL3 A;  4KCD A;  1EU8 A;  3PMW A;  1JW5 A;  3KG2 A;  2G29 A;  3HHG A;  4POW A;  3C4M A;  3GZG A;  2ZXT A;  3IFC A;  4XKN A;  2F6G A;  1AMF A;  3C9H A;  3G7W A;  2PVU A;  2HAV A;  2RIN A;  4XF5 A;  3OXN A;  2DS9 A;  3ILT B;  3TFL A;  3E13 X;  1OIB A;  1LAH E;  1ZJL A;  2ZZV A;  1WVJ A;  3TTR A;  2NXO A;  1LEV A;  1DTG A;  1IMB A;  1P1N A;  2O6A A;  4ZEB A;  1A40 A;  4GWO A;  3K6U A;  4LQ5 A;  3U65 A;  1PBQ A;  1B46 A;  1EZO A;  1QKB A;  4JVC A;  4NMY A;  2I4B A;  5H8Q B;  3O29 A;  3OMB A;  5EQ8 A;  5J16 A;  4BDO A;  1VSO A;  2XWV A;  4ESX A;  1LBB A;  2P1S A;  3L6G A;  3HN0 A;  2GHB A;  3FXQ A;  5F1Q A;  3PPP A;  2KLF A;  2REJ A;  3IOV A;  4MNP A;  4P8B A;  4RYA A;  2PT2 A;  3H3G A;  2O7I A;  4NF6 A;  4IO5 A;  5A5X B;  2HXR A;  2UVH A;  3LUY A;  5F24 A;  1FTO A;  3U1O A;  1B05 A;  3SEY A;  3G3G A;  1MXX A;  4N81 A;  1B6H A;  4QFL A;  5FHO A;  3K02 A;  3Q26 A;  1JW4 A;  1HSL A;  3EN3 A;  3CHG A;  1DMB A;  1AL3 A;  4OHN A;  5ITP A;  1Z7M E;  2KR0 A;  3BIH A;  4GQO A;  3SER A;  1MG1 A;  4PAI A;  4PET A;  1HSE A;  4F3B A;  1EYJ A;  2ESN A;  4IGT A;  2UXA A;  3FV2 A;  2BJI A;  2XX7 A;  1NMU A;  3SKP A;  3CVG A;  1OVT A;  4H8J A;  3SZP A;  3MW0 A;  3O9P A;  3A3U A;  3K1N A;  2QFL A;  5KZT A;  2QS4 A;  2ZNS A;  2REG A;  4X8R A;  3QSL A;  1MDQ A;  3RUM A;  2MKZ A;  3G3F A;  4OTE A;  4OWD A;  4OQO A;  2XA5 A;  4LA9 A;  1ZBM A;  2KQZ A;  3UA8 A;  5AA4 B;  2RCA A;  3QUJ A;  4G68 C;  1FPG A;  3AXF A;  3LSL A;  3KN3 A;  4EDP A;  4E0X A;  3ECR A;  5DVJ A;  3DM0 A;  3FVG A;  3SDF A;  4GVO A;  1SQY A;  1VR5 A;  1GVC A;  4Q30 B;  1JEU A;  3VXB A;  3Q25 A;  3FVK A;  5IZZ A;  3IB0 A;  4X1B A;  2VOZ A;  5CI5 A;  1B52 A;  4AB5 A;  4IGR A;  1P1W A;  3BKI B;  2QVV A;  4JWX A;  2V84 A;  5TU0 A;  4OER A;  4MLV A;  4NF6 B;  5A5X A;  2OWZ A;  1IXH A;  5H8N A;  2GH9 A;  4GWS A;  1MY3 A;  5K2Y A;  1USY H;  4F1U A;  4XIG Q;  4TOZ A;  1LB9 A;  1QKA A;  3H06 B;  4TLM B;  1R9L A;  3IOT A;  2RC8 A;  4NGU A;  2QJE A;  4ZZE A;  5L8D A;  1QVS A;  4NN3 A;  5IZ1 A;  3H4Z A;  3CI8 A;  4NF5 A;  4KQP A;  4H65 A;  4DXU A;  3IB1 A;  5H8H A;  1Y3P A;  3MZ1 A;  1K9Z A;  4F19 A;  1SW2 A;  4OA4 A;  3FJ7 A;  1FBE A;  5HPQ A;  1NNK A;  3QXM A;  3H7M A;  4FE8 A;  1GR2 A;  4YU0 A;  5DT6 A;  3FJG A;  4RJZ A;  3EHT A;  2VPO A;  1P1O A;  3D4G A;  1OVB A;  4U2R A;  4H46 A;  3O6H A;  5CMM A;  3IL1 B;  4KXP A;  4MAG A;  4NHB A;  4XTC Q;  2FNC A;  2X7Q A;  4KD5 A;  5J1D A;  3K0V A;  4GD5 A;  4YKJ A;  3KGC A;  4ELR A;  1YAE A;  1O64 A;  3MPK A;  4FIM A;  1G0I A;  3U92 A;  3PD9 A;  1QGX A;  1AH5 A;  4YMB A;  4C1T A;  3RQT A;  4FEC A;  1M5E A;  2VP1 A;  5EHS A;  2Q8J A;  2QMX A;  1LCT A;  2V3Q A;  3SET A;  3T9X B;  3VLV A;  2F36 A;  4LUB A;  4I8C A;  1NFT A;  3H03 A;  4ZEI A;  3K01 A;  1ELJ A;  3IX1 A;  1Y3Q A;  4F31 B;  3TYH A;  1XHY A;  3A29 A;  2A5T A;  3TCF A;  2IEE A;  1JQF A;  2HXW A;  3T96 B;  4HTG A;  1S7Y A;  4XKR A;  2ANJ A;  1NNF A;  1R9Q A;  1MPC A;  1URG A;  3PUZ E;  3M3F A;  3VVD A;  2DP8 A;  5KCJ B;  3KC1 A;  2GFE A;  5JTY B;  3H6W A;  4G68 A;  1IEJ A;  4ELQ A;  4ZE9 A;  4DCY A;  5DYH A;  3LSF B;  2Z23 A;  3L6H A;  1FTJ A;  4NF5 B;  3FXB A;  3M8U A;  4XEQ A;  3RTF B;  1A99 A;  1BIY A;  2F97 A;  3C34 A;  3D4C A;  3PMV A;  1NL5 A;  2PMS A;  2PT1 A;  3G3I A;  4FOR A;  4PFW A;  1FQD A;  4PDD A;  4OFL A;  2ZYM A;  4LZ5 A;  4RNS A;  3FZV A;  2DXY A;  2DOJ A;  1N76 A;  3PTY A;  5ELV A;  2PFZ A;  3RY3 A;  2BJJ X;  4QFN A;  4G4P A;  3IOR A;  3O66 A;  4N6D A;  1JEV A;  1RYO A;  4PFI A;  4N6P A;  2GHA A;  3MYU A;  1D9Q A;  3T93 B;  1IMA A;  4IO3 A;  1BK4 A;  4HS7 A;  5IKB A;  2UVI A;  4NF4 B;  2Y7R A;  3H6T A;  3Q28 A;  4YAH X;  2PYY A;  2I0B A;  4R74 A;  2OJT A;  4M4G A;  4OEN A;  2B65 A;  5AA2 A;  3MC2 A;  5I2K B;  2FVZ A;  2UVJ A;  4PF8 A;  3C36 A;  3MJN A;  3MZB A;  4FEB A;  2FA7 A;  5TPA A;  1MXV A;  1MXW A;  1SDX A;  1IUD A;  1I6A A;  4NF8 A;  3PUY E;  4GXS B;  1B1H A;  2F8D A;  2PCR A;  4U1O A;  2PX1 A;  4GWX A;  3B6T A;  3KEI A;  5DVI A;  3QYT A;  2NUV A;  1Y9U A;  3FXU A;  1XVY A;  4QXD A;  4AS4 A;  3UGW A;  2Y7I A;  4H5F A;  2XXQ A;  1B3F A;  2A5T B;  3E78 A;  2L5V A;  3ISP A;  3PUW E;  1YCJ A;  3CR9 A;  2JJK A;  4IO6 A;  4JSO A;  1B7H A;  2ZYK A;  3V5A A;  1YPN A;  3JYR A;  1DCU A;  1OLC A;  4KYE A;  2ZMB A;  1LLS A;  1Q9D A;  4LZ7 A;  4PF6 A;  4NF8 B;  1OQH A;  3IO4 A;  2Y84 A;  3IFA A;  1B7U A;  5T3J A;  4U4X A;  4F3S A;  4XXU A;  4THI A;  3U93 A;  2W7Y A;  1RDX A;  1MQD A;  2FIX A;  4N8Y A;  1FJ6 A;  1US5 A;  1QUJ A;  4HW8 A;  3KZG A;  2H98 A;  4BLA A;  1LFG A;  3NOH A;  4YIC A;  1YTV A;  3H6V A;  1M5D A;  3TUS A;  2AIX A;  4MIJ A;  1MM6 A;  2Q2C A;  5IZ3 B;  3T66 A;  4MNI A;  4DCX A;  3HCQ A;  3S2V A;  3MVX A;  3GBA A;  1FBF A;  1Y4C A;  3ODB A;  4WXJ A;  4OET A;  3M3L A;  5ET7 A;  2FIE A;  4QSC A;  4C0R A;  4N07 A;  4P9K A;  3MBP A;  4PTK A;  4PE3 A;  4R6K A;  4MBP A;  2WBB A;  4PFR A;  3T9U A;  2QMW A;  4NTL A;  1JNF A;  4EXL A;  2UVG A;  1FTM A;  4KR5 A;  2AL4 A;  2FBP A;  1VDW A;  3S9L C;  3E3K A;  3RT6 B;  2WYK A;  3IOU A;  4N8G A;  5FTI A;  3SES A;  5H8N B;  3CFX A;  1NV3 A;  2ALU A;  4PE5 B;  5B70 A;  3EF7 A;  4GL0 A;  2FYI A;  4EF1 A;  3MST A;  4I62 A;  1GV8 A;  4P56 A;  5K2X A;  4F3G A;  4HE1 A; 
#chains in the Genus database with same CATH homology
 3K6V A;  2DYX A;  3FD3 A;  3N26 A;  3ZKK A;  3MVW A;  3MWB A;  3SDF A;  4GVO A;  3KSX A;  1SQY A;  1VR5 A;  2AL5 A;  1MS7 A;  3M3K A;  1L5T A;  4G8N A;  1OMP A;  3O6I A;  4OYV A;  1GVC A;  4Q30 B;  1JEU A;  2HFB A;  4XKP A;  3VXB A;  3CFZ A;  1QW0 A;  3FVK A;  3Q25 A;  3BFU A;  1Y1Z A;  4DXB A;  4RY1 A;  3IB0 A;  4ESW A;  4X1B A;  3DP8 A;  4MH5 A;  2VOZ A;  5CI5 A;  3A09 A;  3IJX B;  3BBR A;  4O3C A;  2NOO A;  2XX9 A;  1B52 A;  3OO9 A;  4NF4 A;  3THI A;  4F29 A;  4EQ9 A;  5AA3 A;  4AB5 A;  4OVJ A;  2IA4 A;  4QF9 A;  1WDN A;  4IGR A;  4JDF A;  3WAF A;  3IB2 A;  1P1W A;  3O97 A;  3E4R A;  5JEI A;  3BKI B;  4JSD A;  2H5Y A;  3O6G A;  2I48 A;  4JWX A;  3R6U A;  3G3J A;  3DP4 A;  4IO4 A;  3UOR A;  2V84 A;  1RKM A;  1ZKB A;  2VHA A;  3MUQ A;  1B5I A;  4OER A;  5TU0 A;  3SEX A;  3FV1 A;  4LAT A;  1MXY A;  4MLV A;  4NF6 B;  3MP8 A;  5A5X A;  1FTK A;  4OFJ A;  4GL8 A;  1S9T A;  4R6H A;  5H8N A;  1IXH A;  3MAM A;  2GH9 A;  2XXI A;  3PUX E;  2Q9T A;  1NKX A;  4P0G A;  5M2V A;  5F7V A;  5HBC A;  5AA2 B;  1ANF A;  5I58 A;  2D3I A;  3SEV A;  3VV5 A;  3S9N C;  1MY3 A;  3RGY A;  3TAJ A;  4RPN A;  5K2Y A;  2OWT A;  4X9T A;  2UYF A;  2QS2 A;  2Y7P A;  2XXH A;  3PPR A;  5CBS A;  1GGG A;  5I57 A;  4EQB A;  1USY H;  1QUL A;  2ABH A;  4G8H A;  3ZSF A;  2H99 A;  1XOC A;  4TOZ A;  4XIG Q;  2F78 A;  2XXR A;  4HCY A;  3HV1 A;  3UP9 A;  1FCK A;  4C1U A;  3OEN A;  1LB9 A;  1QKA A;  3H06 B;  4TLM B;  1R9L A;  4XKQ A;  3IOT A;  4DZ1 A;  1MPB A;  2RC8 A;  3PUV E;  3TTN A;  3VVE A;  1MQI A;  2QSX A;  4ZEK A;  2QJE A;  1M5F A;  4AQ4 A;  4ZZE A;  2ZYN A;  1DTZ A;  3KSJ A;  5H8F B;  4F3P A;  1UTH A;  1DSN A;  2P2A A;  2ZNT A;  3C32 A;  4KCC A;  5L8D A;  4U23 A;  1F9B A;  4KPT A;  1QVS A;  4RA1 A;  3DLN A;  2PBW A;  4L17 A;  1Y4T A;  1H43 A;  5KDT A;  2VD3 A;  3F11 A;  3H4Z A;  4H5G A;  4IY6 A;  3TQL A;  3CI8 A;  1H44 A;  3OSQ A;  4NF5 A;  4KQP A;  4H65 A;  1DPE A;  4H67 A;  4DXU A;  3IB1 A;  5H8H A;  3U94 A;  1MPD A;  4XKR A;  1Y3P A;  3MZ1 A;  1EZ9 A;  4ZZA A;  4F19 A;  1SW2 A;  2E1S A;  3C31 A;  3FJ7 A;  3TPA A;  2B3B A;  5HPQ A;  2HEU A;  3UK4 A;  4NED A;  3OO6 A;  1SYH A;  4F1V A;  1NNK A;  5DEX B;  1JVY A;  3PPO A;  4X48 A;  1N0T A;  2HCA A;  1LB8 A;  3H7M A;  3QXM A;  4BDR A;  5I57 B;  1UQW A;  3QIM A;  4FE8 A;  5H8S A;  3PMX A;  3T9H B;  2XD3 A;  1LCF A;  4KYS A;  1GR2 A;  4GF8 A;  3V83 A;  3TTL A;  4YU0 A;  4U4S A;  5DT6 A;  3FJG A;  3RT8 A;  4RJZ A;  5I58 B;  1TFD A;  1OQG A;  4YB5 A;  3EHT A;  3OO7 A;  4LVQ A;  1SD3 A;  1P1O A;  4P11 A;  3D4G A;  1NNP A;  1OVB A;  4U2R A;  3TCH A;  4R6Y A;  3SEW A;  4EF2 A;  1ZIU A;  3T9V A;  1OLA A;  3GBB A;  2O84 X;  3O6H A;  5CMM A;  1FQE A;  3IL1 B;  3SEU A;  4NE4 A;  1CE2 A;  3MP1 A;  4JWO A;  5K2X A;  4XTC Q;  4F3G A;  1B5J A;  2FNC A;  3PU5 A;  3CFL A;  3KBR A;  4QSD A;  2X7Q A;  3QK6 A;  4FED A;  4KD5 A;  2HZK A;  4KHZ E;  1SW4 A;  2G93 A;  5EYF A;  5J1D A;  3K0V A;  4DIG A;  4F39 A;  3V89 B;  4GD5 A;  4YKJ A;  2XX8 A;  3IK6 B;  3KGC A;  4GFR A;  3TKD A;  4EXK A;  5TP9 B;  4IY5 A;  5DEX A;  4ELR A;  4YMA A;  1Y3N A;  4F1U A;  2E0S A;  5AA4 A;  3HHF A;  2XXX A;  4DDD A;  4R9F A;  1YAE A;  1EH3 A;  1O64 A;  3MPK A;  3MP6 A;  4FIM A;  1UTH B;  4LZ8 A;  3VDF A;  4LQ2 A;  3U92 A;  1JW1 A;  1PB8 A;  1B3E A;  3PD9 A;  4U21 A;  1AH5 A;  3TOD A;  3RNN A;  1I6B A;  1N7W A;  2I58 A;  4YMB A;  2OK2 A;  3VXC A;  3HPI A;  3CRB A;  1MXZ A;  2CMO A;  3LSW A;  3K1M A;  2Q88 A;  1NH8 A;  2XXU A;  4C1T A;  1I69 A;  3RQT A;  1N04 A;  2OCU A;  4FEC A;  4U22 A;  3RTW B;  3E9X A;  2I3W A;  1QUI A;  4AB6 A;  3R26 A;  1M5E A;  1PDA A;  1H76 A;  1ZTY A;  2A5S A;  2O68 A;  5FHN A;  2NVU B;  5I2K A;  1ZU0 A;  2VP1 A;  2LAO A;  3KN8 A;  5EHS A;  2XXV A;  1BLF A;  5JTY A;  3IJO B;  4Q0C A;  4DLD A;  2Q8J A;  2R6G E;  4TQU Q;  5CBR A;  4GOT A;  4EQ7 A;  1MM7 A;  4OZ9 A;  5I59 B;  2RKM A;  1R6Z A;  2O51 A;  4IO7 A;  1FQB A;  2Y7W A;  2QMX A;  1LCT A;  2V25 A;  2V3Q A;  5CMC A;  5DVF A;  3SET A;  3LC8 A;  1GTK A;  3T9X B;  3VLV A;  2F36 A;  2AYS A;  4F1Y A;  4YZZ A;  1D4N A;  4LUB A;  4PQJ A;  4R73 A;  1N3X A;  1P1Q A;  1NFT A;  1PEB A;  2H9B A;  2Q89 A;  2VD2 A;  1LAF E;  1IZ1 A;  3HST A;  4I8C A;  4O3A A;  1PBP A;  5CMB A;  4QSE A;  1MY1 A;  3H03 A;  1B3L A;  3HO7 A;  4YB6 A;  3K01 A;  1ELJ A;  1MQH A;  4ZEI A;  3IX1 A;  1Y3Q A;  1IIW A;  2DE3 A;  3K2D A;  4E0W A;  4F31 B;  4ZEC A;  4QFP A;  2OBG A;  3TYH A;  1XHY A;  1QUK A;  3V8X B;  5L9S A;  3FGS A;  1PB7 A;  4WKM A;  4O3B A;  2A5T A;  2P0S A;  3TCF A;  4BDQ A;  2I0C A;  1MRP A;  4FAT A;  2IEE A;  2XXY A;  1JQF A;  2B3F A;  3K6W A;  5DTB A;  5AA1 A;  2RF1 A;  1B32 A;  2HXW A;  2V93 A;  3R7X A;  1VFE A;  3T96 B;  1MY4 A;  4HTG A;  3KFM A;  4RPO A;  1S7Y A;  2ANJ A;  2QS3 A;  2F5X A;  1NNF A;  1MPC A;  1H45 A;  1R9Q A;  3FXR A;  1URG A;  2XXW A;  2YJP A;  3M3F A;  3PUZ E;  4IO2 A;  1IXC A;  3RN8 A;  1B1X A;  5L9O A;  5ISU A;  1R1N A;  1UTB B;  2DVZ A;  3VVD A;  2DP8 A;  4QFO A;  4BDM A;  1FTL A;  3O2A A;  3VE1 B;  1LGB C;  1B0L A;  4XKN A;  1Q1K A;  3P7I A;  2V3U A;  4Z0I A;  2Z8E A;  4FJP A;  4DXC A;  1MQG A;  1POY 1;  4NWD A;  1XC1 A;  4MFI A;  1MDP 1;  5KCJ B;  2GFE A;  1UIU A;  3H6W A;  4G77 A;  5JTY B;  3OD7 A;  4G68 A;  1B5H A;  1IEJ A;  1MH4 A;  4H0W A;  3B7D A;  5TP9 A;  5I2N A;  3ZKL A;  4ELQ A;  1PB9 A;  4DCY A;  4ZE9 A;  5CM6 A;  3EHS A;  1MY0 A;  4ZDM A;  4ONY A;  2O1L A;  3MVZ A;  2F7B A;  3LSX A;  3IR1 A;  1P1U A;  3QUF A;  1S50 A;  3RPW A;  4R72 A;  2Y7K A;  4RK9 A;  5H8F A;  4Z7E A;  3O28 A;  2DWI A;  5DYH A;  3LSF B;  1TXF A;  3TEL A;  1SI0 A;  4KYD A;  4PP0 A;  3UIF A;  1B58 A;  3T22 A;  2DVC A;  2Z23 A;  1B0H A;  2F34 A;  5HM4 B;  4NWC A;  1B3H A;  5LOM A;  2F6P A;  3L6H A;  1FTJ A;  2O7U A;  3GLB A;  4NF5 B;  3M8U A;  5EHM A;  3IAZ A;  3WAE A;  5AE4 A;  1IXG A;  1FW0 A;  3RTF B;  1A99 A;  1BIY A;  1D3K A;  2F97 A;  4QRZ A;  1Q35 A;  3TTM A;  3VFJ A;  5I59 A;  1XVX A;  3C34 A;  3Q29 A;  2I49 A;  5CMK A;  3TEP A;  4F2O A;  2ZYO A;  1ZLQ A;  3D4C A;  3PMV A;  5FTH A;  5I56 A;  5JK4 A;  2QS1 A;  1NL5 A;  4YKI A;  1T0K A;  4RXL A;  5I2K B;  2PMS A;  2PT1 A;  3G3I A;  4FOR A;  3N6U A;  2H25 A;  1RYX A;  4I1D A;  5KCJ A;  4GXA A;  4OFO A;  4G68 B;  4H6D A;  4PFW A;  2GRV A;  2XHD A;  4F2Q A;  3IOW A;  2DSF A;  1A8E A;  1QJM A;  2ZNU A;  1FQD A;  1O63 A;  3PD8 A;  2CZL A;  4Q5T A;  3IO6 A;  3PGF A;  4OFL A;  3N94 A;  4HCW A;  1POT A;  2I4C A;  2ZYM A;  4LZ5 A;  4RNS A;  5TPA B;  3FZV A;  2DXY A;  3CSG A;  1MH3 A;  2DOJ A;  1IXI A;  1N76 A;  1US4 A;  2DWA A;  2HAU A;  3JZJ A;  3N6T A;  5I2N B;  1HSJ A;  2OWS A;  5ELV A;  4MF3 A;  1TWY A;  3S4U A;  3GXA A;  3RY3 A;  4U1Z A;  2BJJ X;  3I3V A;  4QFN A;  4R2F A;  3K6X A;  4G4P A;  2ONS A;  4ZED A;  2OZZ A;  3IOR A;  3O66 A;  4UA8 A;  5H8Q A;  3KOT A;  3I5O A;  4JXI A;  4K3F A;  1JEV A;  1RYO A;  2RC7 A;  4N6P A;  4ELO A;  2GHA A;  3C33 A;  4N13 A;  3T93 B;  2D21 A;  2X7P A;  2HQ0 A;  1TT1 A;  4IO3 A;  4DE8 A;  2M8C A;  2I6E A;  5ICT A;  4HS7 A;  2THI A;  3FVO A;  1M5B A;  5IKB A;  5IAI A;  2YLN A;  5KDT B;  3FIR A;  3ONM A;  4UAC A;  3USD A;  2I3V A;  2WKY A;  5BWJ A;  4LP2 B;  2QL3 A;  4KCD A;  1EU8 A;  3PMW A;  2UVI A;  1JW5 A;  4NF4 B;  1B4H A;  2Y7R A;  4ECF A;  4F22 A;  5I56 B;  5I84 A;  3EQ1 A;  3KG2 A;  1URD A;  3U72 A;  2G29 A;  3CG1 A;  3H6T A;  3Q28 A;  4YAH X;  2XD2 A;  3HHG A;  4POW A;  3FJM A;  5CC2 A;  1A55 A;  2PYY A;  3S9E A;  1SI1 A;  3C4M A;  2ZXT A;  2DE4 A;  1B4Z A;  1LFI A;  2DWH A;  2I0B A;  1O7T A;  2F6G A;  4GRK A;  2OJT A;  1AMF A;  2OLB A;  3C9H A;  4M4G A;  4OES A;  4R74 A;  1JET A;  3FAS A;  3G7W A;  4OEN A;  2B65 A;  2PVU A;  3MC2 A;  3OSR A;  2QRY A;  4GIZ A;  2HAV A;  4H1X A;  1II5 A;  2RIN A;  4OMB A;  4QFK A;  4R9G A;  1VE4 A;  3OXN A;  4ELP A;  1FQF A;  2DS9 A;  2UVJ A;  1NH7 A;  3C36 A;  3ILT B;  3MJN A;  3TFL A;  3E13 X;  3MZB A;  3GZG A;  4QHQ A;  1LAX A;  1OIB A;  2O69 A;  2FA7 A;  4FEB A;  1LAH E;  1B9J A;  4YKP A;  4ZS9 A;  1MXV A;  2YPN A;  1ZJL A;  2HZL A;  1BKA A;  4PFY A;  4F18 A;  4BDN A;  1MXW A;  3H6U A;  1SDX A;  1IUD A;  1WVJ A;  1PC3 A;  3Q27 A;  1I6A A;  5FHM A;  3TTR A;  2NXO A;  3TZA A;  4NF8 A;  3LR1 A;  1DTG A;  1P1N A;  3PUY E;  4ND9 A;  4EDP A;  2O6A A;  3TDJ A;  4ZEB A;  2QPQ A;  4GXS B;  1B1H A;  1A40 A;  4GWO A;  3OOA A;  1Y20 A;  1EZP A;  2F8D A;  3K6U A;  3ILU B;  4LQ5 A;  1PBQ A;  1B46 A;  1Z7N E;  1EZO A;  4U1O A;  1QKB A;  1SBP A;  2PX1 A;  3VVF A;  1VFD A;  2XXT A;  3PV0 E;  3B6T A;  4LON B;  3S9M C;  4YKK A;  3KEI A;  3LBS A;  1XT8 A;  4NMY A;  4PFU A;  2I4B A;  5DVI A;  3QYT A;  1CB6 A;  2NUV A;  1Y9U A;  3FXU A;  1DPP A;  1XVY A;  3KOS A;  5H8Q B;  3O29 A;  3N5L A;  5BUU A;  3UGW A;  3TMG A;  2Y7I A;  3OMB A;  2XXQ A;  4H5F A;  1B3F A;  1BP5 A;  1SW1 A;  2A5T B;  1A7L A;  4G8M A;  3B6Q A;  1KWH A;  3MVY A;  1B51 A;  1WOD A;  4BDO A;  3DEL B;  1VSO A;  3PUW E;  4ESX A;  1YCJ A;  1FQC A;  1LBB A;  3CR9 A;  1N7X A;  2P1S A;  4IO6 A;  3FVN A;  3L6G A;  4JSO A;  1N3W A;  4Q8R A;  3HN0 A;  2GHB A;  1SVX B;  5AA2 A;  4R2B A;  3FXQ A;  1B7H A;  3PPP A;  2KLF A;  3EHU A;  2REJ A;  2ZYK A;  5F1Q A;  5ITO A;  2NWJ A;  3PPQ A;  1YPN A;  4OEU A;  3CIJ A;  3V5A A;  1AIV A;  4IB2 A;  3JYR A;  4BDL A;  4H8I A;  3IOV A;  3TQW A;  1MXU A;  1OLC A;  4KYE A;  1NNT A;  3PPN A;  2ZMB A;  1LLS A;  1B2H A;  4RYA A;  2PT2 A;  2F35 A;  3OEK A;  2RC9 A;  4LZ7 A;  3H3G A;  2O7I A;  1P99 A;  4IO5 A;  4NF6 A;  3RLF E;  5A5X B;  2Z8D A;  3VLU A;  2DXR A;  1D9Y A;  2UVH A;  3LUY A;  4KI0 E;  4ZEF A;  4NF8 B;  1OQH A;  3IO4 A;  2Y84 A;  4FAJ A;  2Q2A A;  2D5W A;  4RK2 A;  1FTO A;  3U1O A;  3CSB A;  1B7U A;  1JVX A;  4U4X A;  5B7D A;  1B05 A;  4F3S A;  4XXU A;  3OO8 A;  4THI A;  1UIV A;  3SEY A;  3U93 A;  3C35 A;  1MXX A;  3G3G A;  4JWY A;  2W7Y A;  1J1N A;  4R75 A;  1B6H A;  1MQD A;  4QFL A;  5FHO A;  4OEV A;  3UN6 A;  4ISU A;  4TLL B;  3W9W A;  3B6W A;  2R9J A;  3K02 A;  3Q26 A;  1JW4 A;  1HSL A;  3EN3 A;  5TPA A;  1IQ7 A;  3ZS6 A;  1US5 A;  1QUJ A;  4HW8 A;  1DMB A;  1AL3 A;  1SYI A;  1URS A;  2H98 A;  1D9V A;  1DOT A;  3KZG A;  5H8H B;  4OHN A;  4BLA A;  5ITP A;  1B40 A;  1Z7M E;  1LFG A;  3K4U A;  4KFQ A;  1AOV A;  2DQV A;  4YIC A;  1YTV A;  3H6V A;  3DP6 A;  4OXV A;  2V3T A;  1M5D A;  4GQO A;  3SER A;  1H3D A;  1A8F A;  1MG1 A;  4PET A;  3TUS A;  1SW5 A;  2AIX A;  1HSE A;  2H4I A;  2ESN A;  4X1D A;  4F3B A;  1N84 A;  2UYE A;  4IGT A;  1MM6 A;  4P0I A;  2Q2C A;  1LST A;  3W9V A;  2UXA A;  1XS5 A;  4YB7 A;  1B7Z A;  1TFA A;  3FV2 A;  3G3K A;  1MQJ A;  2XX7 A;  3K00 A;  1NMU A;  3I6V A;  3T66 A;  5ICQ A;  3U8Q A;  3SKP A;  3TTK A;  4I9D A;  4GLI A;  3CVG A;  4DCX A;  4EUO A;  3HCQ A;  3QAX A;  1MY2 A;  3S2V A;  1LFH A;  1OVT A;  3MVX A;  3GBA A;  4WXJ A;  1Y4C A;  3ODB A;  3TCG A;  4H8J A;  4OET A;  1BTJ A;  3M3L A;  1USY E;  3MW0 A;  4QSC A;  3O9P A;  4C0R A;  4N07 A;  3MBP A;  3A3U A;  4POX A;  4PFT A;  3K1N A;  4R6K A;  5KZT A;  4MLQ A;  2QS4 A;  1IIT A;  2F7C A;  2REG A;  2ZNS A;  2DE2 A;  3G3H A;  4MBP A;  3QSL A;  3T9U A;  1MDQ A;  1I6Q A;  2X26 A;  2QMW A;  3OEM A;  3RUM A;  3JV9 A;  4NTL A;  3FUZ A;  1JNF A;  2DWJ A;  3MZ9 A;  3G3F A;  4EXL A;  3KJ7 A;  1LAG E;  2UVG A;  1FTM A;  2O1M A;  4KR5 A;  2AL4 A;  4OTE A;  4OWD A;  4OQO A;  4JB7 A;  3S9L C;  3MQ9 A;  4LA9 A;  3E3K A;  4G2Z A;  1ZBM A;  3RT6 B;  3W15 C;  4WED A;  3ECR A;  2RCB A;  4WEP A;  3UA8 A;  5AA2 D;  3OEL A;  1LBC A;  1Y1M A;  5L9M A;  3IOU A;  2F7A A;  1FQA A;  1UTB A;  3CG3 A;  3A3C A;  5AA4 B;  3FAT A;  2RCA A;  3QUJ A;  5FTI A;  1ZMG A;  2XXP A;  4G68 C;  3SES A;  5H8N B;  1B3G A;  2Z22 A;  2R71 A;  2VGQ A;  3CFX A;  2ALU A;  4PE5 B;  3EPE A;  2ONK E;  3EF7 A;  3KN7 A;  4GL0 A;  4M1V A;  5B70 A;  2FYI A;  3AXF A;  2Z8F A;  3KJT A;  3BFT A;  3LSL A;  3K1P A;  3KN3 A;  5CRY A;  4E0X A;  2ONR A;  1ATG A;  3MPL A;  3VLW A;  4I62 A;  4EF1 A;  1A54 A;  1GV8 A;  1M5C A;  4JBZ A;  5DVJ A;  3DM0 A;  3FVG A;  4ZE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...