1N84A

Human serum transferrin, n-lobe
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title THE POSITION OF ARGININE 124 CONTROLS THE RATE OF IRON RELEASE FROM THE N-LOBE OF HUMAN SERUM TRANSFERRIN. A STRUCTURAL STUDY
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Serotransferrin
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2002-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n84A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n84A02
3V83A 1MDQA 3TZAA 2I3WA 4Z0IA 3FVOA 2DE4A 2F36A 2UVHA 1SQYA 4C1TA 1MQJA 4OEVA 4F31B 1ZU0A 1UTBA 1YPNA 1N3XA 5DEXB 3FIRA 4U23A 3PPQA 3M3LA 2DSFA 2QS3A 1MXZA 4F2QA 1Y3NA 4NF4A 1MXVA 2F78A 2YPNA 4FIMA 4G68B 3O2AA 4IO3A 4BDMA 3RTFB 5AA2B 3G3JA 1QW0A 1IEJA 2RCAA 3IB2A 1URGA 1B0HA 2HFBA 1MY1A 2OLBA 3C32A 3KJTA 3KOTA 3MVXA 4N6PA 4EQBA 3V8XB 2QS1A 4NWDA 3KOSA 3KBRA 2V3TA 4HCWA 2O6AA 3IOUA 4OZ9A 1M5DA 1Y3QA 2ZNUA 3FVGA 3E13X 4ISUA 4R75A 2XX8A 1S50A 2QMWA 3O6HA 4NF4B 5TPAB 4X48A 3I5OA 2Z8EA 1H45A 4G8MA 2H5YA 1B58A 1MXWA 2QMXA 1GVCA 3VVEA 1FCKA 3RUMA 2QS2A 2O84X 4KHZE 3G7WA 4OXVA 1US5A 1S7YA 1MXYA 2D5WA 2H9BA 2ALUA 3K6XA 4PFTA 4QRZA 4EUOA 4KCCA 5FTIA 4XIGQ 5CMCA 5TPAA 1UTBB 3D4CA 1VR5A 4OENA 5DEXA 1B6HA 4IGTA 1NL5A 3N94A 3RY3A 3UP9A 1FTOA 4ZEBA 1VSOA 3PD9A 1Y4CA 4GFRA 4E0WA 4ELRA 4OFOA 3FUZA 2XXHA 4GRKA 2DXYA 4PE5B 5FTHA 2DYXA 4FEBA 4WXJA 3L6GA 1FTMA 1LFGA 3FV1A 3TODA 2V93A 4KI0E 2HEUA 1HSJA 3TUSA 1RYOA 4F1VA 4G2ZA 3MAMA 4G68A 3S9EA 1MQHA 5DVJA 2DVCA 4YAHX 1D3KA 1B52A 4F18A 1MPCA 2XXIA 2Z22A 2QJEA 1MPBA 2RC9A 3OXNA 3CFXA 1BLFA 1J1NA 3CR9A 3IAZA 4I8CA 1DTGA 2Z8FA 5CM6A 3O29A 4IO4A 3EN3A 3LBSA 3R7XA 5JTYB 4MBPA 3JZJA 3IOTA 5K2YA 5KZTA 3MBPA 3U8QA 4OYVA 4ELOA 4GXSB 1LAHE 4PFWA 5I58B 3H03A 4QFNA 1SI0A 1PBPA 4QSEA 2DWHA 3EHSA 5AA1A 1FW0A 1NH7A 4GD5A 2XXPA 1D9YA 2ZMBA 1PB9A 3IOVA 2P2AA 1LFIA 3MVWA 1TWYA 3MZ1A 4ZE8A 3T66A 1N76A 2HAUA 1I6BA 4LZ8A 3U92A 1AMFA 5DYHA 3VE1B 1TT1A 4EF1A 1M5CA 1Y1MA 1EZ9A 2I4BA 1R6ZA 3G3IA 3A3UA 1XVXA 3KGCA 4FEDA 3DLNA 4IB2A 2DQVA 4Q5TA 4UACA 2Y7PA 3OOAA 5I59A 3DP4A 1B05A 4Z7EA 4R73A 4UA8A 3OO7A 4K3FA 3KFMA 4LVQA 4NE4A 4EF2A 2XXQA 1B40A 4GIZA 4AQ4A 3PV0E 3UA8A 2V25A 1MY4A 2RKMA 3FJ7A 3SETA 3BFTA 2HXWA 2XXYA 4JB7A 3VVFA 4Q8RA 3C4MA 4YU0A 1QVSA 2XXWA 3B6QA 4R6KA 2FYIA 5AA2A 5I2NB 3QUJA 1FQFA 3O6IA 1JVYA 3PD8A 3IL1B 4QFOA 4YZZA 1ZBMA 3Q29A 5H8FB 3U1OA 3K6VA 4U1OA 4EDPA 5CRYA 4GVOA 4ECFA 4PFUA 1KWHA 1PC3A 4MH5A 3SEVA 3ZS6A 4NTLA 2ABHA 3MVYA 4H0WA 1OQHA 3EF7A 1B7UA 1SD3A 4NF8B 3VV5A 4ESWA 1B3LA 1FTLA 4M4GA 5AE4A 3MPLA 3OEMA 3Q26A 5L9OA 4JDFA 4IO6A 3B6WA 3V89B 3RLFE 3BFUA 3PUXE 4X1BA 2OJTA 5CBSA 4QFKA 3OD7A 3SEYA 3PPNA 3C36A 5DTBA 3USDA 1I6AA 2RC7A 2HQ0A 1PB7A 5H8HB 1B1HA 1LAXA 4LONB 3IJOB 4BLAA 1P1NA 5EHSA 3VLUA 1MM7A 1P99A 1POTA 3O9PA 2IEEA 2XX9A 3HPIA 2QS4A 2ESNA 4QFLA 1JNFA 2F7CA 4LZ7A 3RT8A 4OETA 3HCQA 1YAEA 5H8SA 5L8DA 3WAEA 4BDNA 3GZGA 4ELPA 5A5XB 3W9WA 2VD2A 2RINA 1MY0A 5ISUA 1XVYA 3HV1A 5BUUA 3SEUA 1I69A 2Y84A 2D3IA 1SBPA 2I3VA 4R2BA 3PPOA 3I6VA 4G77A 4IY5A 1AOVA 4GLIA 4OTEA 2B3BA 3K1PA 4U2RA 1B4ZA 3FJGA 3L6HA 5CI5A 3OO9A 5HM4B 4KD5A 1NKXA 2B3FA 3F11A 1Q35A 3IB1A 1Y9UA 4HTGA 1N3WA 4R9GA 4ELQA 3CVGA 2I48A 2PMSA 4PFYA 3TYHA 1NNTA 2H4IA 4H67A 4O3BA 4PP0A 3TKDA 3V5AA 2QRYA 3CI8A 3HSTA 5I57B 3K1MA 4R9FA 1QKBA 2F7BA 2P0SA 4RNSA 4I9DA 3PUZE 4ZEDA 1B4HA 3B7DA 2VGQA 1UTHB 4GF8A 5BWJA 2VP1A 1LGBC 3QK6A 1D4NA 2VD3A 4YB6A 3SKPA 4NF8A 4EQ7A 3SDFA 3SEWA 2H98A 3TCFA 3UIFA 1JQFA 1ATGA 1OQGA 1F9BA 1QUJA 1PB8A 1IITA 4IY6A 2O1LA 1BIYA 4H8JA 4F1UA 1AL3A 3IX1A 4F3PA 4R72A 2Q2CA 3MZ9A 1B5HA 1B7ZA 4OFJA 3DP8A 2XXUA 4H8IA 3RNNA 3U72A 3C34A 4YKPA 4WEDA 1MXUA 3C35A 2IA4A 4HS7A 4RPNA 2Q8JA 1FTJA 1PBQA 1RYXA 3M3KA 4N13A 5B70A 3E9XA 3IO4A 3S2VA 3KSXA 1EH3A 1B0LA 1DTZA 1ELJA 2DWIA 1MH3A 3EPEA 3FASA 3T9XB 5LOMA 5CBRA 4PQJA 1WODA 1IUDA 1SI1A 3FV2A 1XT8A 2Y7IA 3MWBA 3MVZA 4F39A 5I59B 1MQDA 3PUYE 4U21A 3K4UA 3ODBA 1B32A 2ZNTA 3CSGA 1BKAA 4FORA 3JV9A 3OMBA 1M5BA 2A5SA 4N07A 3U93A 3C31A 3MP1A 4JWXA 5TU0A 3VLVA 4JWOA 3B6TA 3ZKKA 3HN0A 4BDQA 1SDXA 3N6UA 4POWA 1JETA 1S9TA 2Q89A 4ESXA 4F3BA 2DVZA 2OCUA 1B3GA 1Z7ME 4H5GA 3IR1A 2OBGA 2F5XA 3O28A 4FJPA 1SYIA 2BJJX 2O51A 1VE4A 2F34A 5CMMA 1FTKA 4IO2A 4OVJA 3E4RA 3UN6A 3PPPA 1A8EA 4ZS9A 3VDFA 5CC2A 2LAOA 1NFTA 1JW5A 5L9MA 5CMBA 1DMBA 4JSDA 1MG1A 1PDAA 3EHUA 3K6WA 4XKRA 5AA3A 3TCHA 1XS5A 4P0GA 4YKJA 2V3UA 3PUVE 2I58A 3DP6A 3TTKA 5JTYA 1MS7A 3FVNA 3VFJA 4U4SA 3MJNA 2F8DA 2UXAA 3MC2A 3KZGA 3RPWA 1I6QA 3O66A 1JW4A 4JBZA 2RC8A 4C1UA 1MRPA 2FA7A 2G29A 4YMAA 2O68A 5TP9B 3VLWA 4RJZA 2Y7WA 5KDTA 4P0IA 4XKNA 5KCJB 2NOOA 1LAFE 3G3KA 2H99A 3PMWA 1FQBA 3ILUB 3VXCA 3ZSFA 2DE3A 5B7DA 3IB0A 1USYE 3MQ9A 4JSOA 3GLBA 3LSLA 4R74A 4RK9A 1AIVA 3T9HB 3TDJA 3QYTA 5FHMA 1IXCA 3QAXA 1MQGA 2I6EA 3TEPA 2I0BA 5HPQA 1B9JA 1MPDA 2THIA 3MZBA 4DXBA 1TFDA 2I49A 4NF6A 3MPKA 2PT2A 2R6GE 3FXQA 4OESA 4OFLA 3KN8A 4TQUQ 2Y7RA 1MDP1 4OERA 4BDOA 4RXLA 1OLCA 4XKQA 1QJMA 4OEUA 2F35A 5DVIA 3W15C 1ZJLA 1BP5A 1MQIA 5I2KB 4QHQA 4R6YA 3H3GA 3PUWE 4KFQA 1GTKA 1IIWA 4OMBA 4P11A 5FHNA 5ITPA 1M5FA 1B5JA 2DWJA 2E1SA 1HSEA 5FHOA 5CMKA 5I56A 1A99A 2DOJA 1IQ7A 1JEVA 1QKAA 1LCFA 1MY2A 1SYHA 3CG1A 3OSRA 4X1DA 4ZDMA 1QULA 2E0SA 3OO6A 3PMVA 1TFAA 1B5IA 3SESA 1ANFA 2OK2A 5I2KA 3BKIB 2R9JA 4F3GA 4FATA 4XTCQ 1O64A 2Q9TA 2ANJA 4F29A 1H44A 2ZYMA 3OSQA 5M2VA 1CE2A 1R9LA 5IAIA 4NF5A 3CG3A 5H8HA 1YCJA 1SW2A 1ZIUA 2HAVA 2ZNSA 3HHGA 4FECA 3TTNA 5TP9A 2WKYA 3G3HA 5H8QB 2RF1A 3IO6A 1GV8A 1UQWA 3TCGA 4DDDA 1PEBA 3RTWB 5I84A 1LCTA 3OENA 1UIUA 2ONSA 4GQOA 2UVJA 2F97A 1M5EA 4QFPA 4ZE9A 4DIGA 4DLDA 4FE8A 3PPRA 2GHBA 3S9LC 3LSWA 2F7AA 5H8NA 1NMUA 1MY3A 2FNCA 1A40A 2XD2A 3MUQA 3TELA 1N04A 1VFDA 2D21A 1P1OA 3LSFB 5F7VA 3RGYA 2Q88A 2UVIA 1IZ1A 4EXKA 4YMBA 1YTVA 4ZZEA 3VXBA 2AIXA 1A8FA 1L5TA 3EHTA 1LB8A 1NNFA 1WVJA 4OHNA 2Z23A 5JEIA 4M1VA 3PMXA 1GGGA 4R6HA 4EQ9A 1P1WA 4LQ2A 4BDLA 2UYFA 3DM0A 3U94A 1LFHA 2DP8A 3K0VA 2NUVA 4KQPA 4G68C 2F6GA 1OIBA 4F2OA 3ECRA 5AA4B 5F1QA 3MP6A 4NMYA 2QSXA 4H6DA 3QUFA 2ZYOA 1BTJA 2HZKA 2V84A 3D4GA 3N26A 4I62A 3RT6B 3TTMA 1OMPA 3E3KA 4NWCA 5ICQA 1NH8A 2ZYKA 4POXA 4WKMA 4LP2B 4OQOA 2NXOA 3ILTB 3QSLA 4DCYA 3M3FA 4RPOA 4U1ZA 3S9NC 1B51A 2ONRA 3S4UA 3SERA 1URDA 1MH4A 2Y7KA 2G93A 1FQDA 4KYDA 2Q2AA 3C33A 1O63A 1N7WA 4H65A 1NNKA 4XKPA 4DXCA 1A7LA 3CSBA 4AB5A 5I56B 4FAJA 3KG2A 5KDTB 3TMGA 2PVUA 3Q28A 1A55A 1A54A 1FQEA 3H4ZA 3IORA 3GBAA 3TQWA 3T96B 4KCDA 2ONKE 2UYEA 4ONYA 1CB6A 1US4A 3VVDA 1B1XA 2CMOA 1LBCA 3GBBA 2NWJA 4QF9A 4OWDA 3LC8A 2H25A 3HHFA 3FGSA 1OVBA 2P1SA 3R26A 3JYRA 1B3EA 4GWOA 4KPTA 2O69A 3BBRA 3UORA 2B65A 3K00A 1D9VA 2KLFA 4U22A 2HZLA 3G3FA 4TLLB 1UTHA 2W7YA 3G3GA 1UIVA 3K6UA 4F1YA 4RK2A 5H8QA 4MLQA 3TQLA 1DSNA 2A5TA 2RCBA 1SW4A 3A09A 1N0TA 3OELA 3OEKA 4ZEKA 3K02A 3KN3A 3H06B 4NF5B 2M8CA 2O7UA 1WDNA 4KYSA 5DVFA 2OZZA 1NNPA 4H1XA 4Q30B 3LSXA 4XXUA 4I1DA 4ZZAA 3TTLA 1RKMA 3A3CA 3H6UA 4LA9A 5ICTA 3FZVA 2I0CA 3QIMA 3KSJA 4KR5A 3CIJA 3DELB 4IO5A 1XHYA 3P7IA 3RQTA 1P1QA 1SW5A 3K1NA 3T9VA 2XX7A 1DPEA 5I2NA 2GHAA 2REGA 2AL5A 1VFEA 1II5A 3FJMA 3H6WA 5EHMA 4DCXA 1GR2A 3C9HA 5EYFA 4G8HA 3FATA 3LR1A 3RN8A 4EXLA 3FD3A 1XOCA 3IJXB 4HW8A 3S9MC 1OLAA 4LUBA 2AYSA 3CFLA 4TLMB 2CZLA 1OVTA 4R2FA 3WAFA 4NEDA 4G8NA 1IXHA 4THIA 2DXRA 3KEIA 3TAJA 2X7PA 1Y20A 2VOZA 1JVXA 1N84A 2GFEA 2XXTA 2A5TB 2XXXA 3T93B 4E0XA 2GH9A 5DT6A 1EU8A 3EQ1A 4JXIA 1N7XA 2XHDA 5JK4A 1ZMGA 2R71A 1ZTYA 2AL4A 1FQCA 1LLSA 3K2DA 4DZ1A 1Y3PA 2GRVA 3ONMA 3KJ7A 2X26A 3HO7A 1QUIA 1LAGE 1P1UA 2F6PA 3QXMA 2QL3A 3GXAA 4H5FA 3ZKLA 3FXRA 3IOWA 1B3FA 4F19A 2UVGA 2PBWA 4MF3A 4BDRA 3M8UA 2XXVA 4WEPA 3TFLA 5KCJA 5L9SA 1Y4TA 2V3QA 4F22A 4AB6A 1USYH 4RYAA 2ZYNA 4U4XA 4ZEIA 1H43A 2DWAA 2HCAA 5I57A 5AA2D 1H3DA 3O6GA 4O3CA 5H8FA 2PT1A 1Y1ZA 1T0KA 1URSA 3KN7A 1JEUA 1SVXB 1POY1 4YKKA 4L17A 3I3VA 1R1NA 4QSDA 5J1DA 1H76A 4G4PA 1MXXA 4O3AA 5ITOA 2NVUB 5IKBA 3T9UA 4LATA 4PETA 1DOTA 1R9QA 4GOTA 3LUYA 4GL8A 2I4CA 4LZ5A 3TTRA 1QUKA 2O1MA 1LSTA 1IXGA 3O97A 2YJPA 4GL0A 4MFIA 4YB5A 5A5XA 4MLVA 2Z8DA 5AA4A 4YICA 3Q25A 2O7IA 1O7TA 2REJA 4JWYA 2XD3A 2YLNA 4ND9A 4C0RA 2ZXTA 2OWTA 1EZOA 1TXFA 3H6TA 3W9VA 5I58A 3MW0A 3H6VA 2DS9A 1B7HA 4DXUA 2VHAA 2X7QA 1DPPA 3CRBA 4GXAA 1SW1A 3UK4A 1B2HA 2XXRA 2OWSA 1B46A 4X9TA 3T22A 5HBCA 4ZECA 2PYYA 4YB7A 4YKIA 1B3HA 1Q1KA 3H7MA 1LB9A 1IXIA 3CFZA 3N5LA 3R6UA 1ZLQA 5ELVA 3SEXA 3K01A 2DE2A 4ZEFA 1FQAA 4NF6B 1AH5A 4Q0CA 3AXFA 1ZKBA 4LQ5A 3FXUA 1LBBA 3THIA 1JW1A 4IGRA 4F3SA 2QPQA 4HCYA 3MP8A 2PX1A 5K2XA 4DE8A 5H8NB 1EZPA 3FVKA 1HSLA 3Q27A 3TPAA 4QSCA 3N6TA 3PGFA 4TOZA 3IK6B 4RY1A 1Z7NE 3OO8A 1XC1A 1MM6A 3PU5A 4RA1A 3UGWA 4IO7A 4KYEA
chains in the Genus database with same CATH superfamily
3TZAA 2I3WA 4Z0IA 2F36A 1NV5A 2UVHA 1UTBA 1N3XA 3FIRA 4U23A 2DSFA 1MXZA 4NF4A 1NV1A 1MXVA 4FIMA 4BDMA 4IO3A 1CNQA 3G3JA 1B0HA 4N6PA 3KJTA 4EQBA 2QS1A 5B7DA 4HCWA 3FVGA 2QMWA 3O6HA 4X48A 3I5OA 2H5YA 2QMXA 3GYYA 1FCKA 4JVDA 2XWOA 3K6XA 4KCCA 5FTIA 5DEXA 1VR5A 1B6HA 2FHYA 4ZEBA 3PD9A 1Y4CA 4GFRA 5DW8A 5ESYA 2V93A 3TUSA 4H45A 2R8TA 1B52A 1MPCA 2QJEA 1MPBA 2RC9A 3CFXA 1BLFA 4LN5A 3EN3A 4I40A 3H03A 1SI0A 5AA1A 1NH7A 2ZMBA 3IOVA 1PB9A 3T66A 3MZ1A 1N76A 3U92A 1I6BA 1AMFA 5DYHA 3VE1B 3KGCA 3A3UA 2DQVA 4UACA 5I59A 1B05A 3T1BA 4UA8A 4K3FA 4MNIA 5IZ3B 3UA8A 2V25A 3FJ7A 2XXWA 3B6QA 2FYIA 5AA2A 4PAKA 2WYPA 4EDPA 4GVOA 4ECFA 4H0WA 3VV5A 4NQ8A 3MPLA 3OEMA 3Q26A 5L9OA 4IO6A 2OJTA 4QFKA 4MAGA 3C36A 3USDA 2RC7A 2HQ0A 1PB7A 1P1NA 1FBDA 1POTA 4QFLA 4LZ7A 5A5XB 3GZGA 5ISUA 1I69A 4R2BA 3I6VA 1B4ZA 3FJGA 1NKXA 3F11A 4HTGA 4O3BA 5T3JA 1QKBA 4I9DA 5EYGA 4NG7A 3QK6A 1D4NA 3SKPA 2DDKA 3SEWA 3TCFA 3UIFA 1ATGA 1OQGA 1F9BA 4F1UA 1B5HA 2XXUA 2IA4A 1RYXA 4N13A 4MNPA 3IO4A 2DWIA 2QVRA 1SI1A 1XT8A 2VT5A 1MQDA 3RT6B 3CSGA 4FORA 3U93A 3C31A 3B6TA 3HN0A 1SDXA 4POWA 2DVZA 1B3GA 1FTKA 3E4RA 3PPPA 2XWIA 5L9MA 1DBZA 4XKRA 1XS5A 3PUVE 4X04A 3TTKA 1MS7A 4U4SA 2UXAA 3MC2A 1I6QA 4JBZA 2RC8A 4C1UA 1NUYA 5KDTA 4XKNA 1LAFE 3G3KA 3ILUB 3GLBA 4MMPA 4QBAA 2XA5A 1MQGA 2I0BA 4OVRA 1MPDA 3MZBA 2ZZXA 3KC0A 2PT2A 2R6GE 3SEYA 4OERA 4RXLA 4XKQA 4OEUA 2F35A 5DVIA 4OVPA 4P11A 1B5JA 2DWJA 5FHOA 5I56A 1NV4A 2DOJA 1JEVA 1MY2A 4ZDMA 4X1DA 4P3LA 1ANFA 2OK2A 4F3GA 4XTCQ 2ANJA 1H44A 2ZYMA 1YCJA 4OVTA 2HAVA 3TTNA 1GV8A 4DDDA 3RTWB 3OENA 1FPKA 2ONSA 4GBVA 4ZE9A 4FE8A 1A40A 5F7VA 2Q88A 1IZ1A 3VXBA 1WVJA 4OHNA 4M1VA 1P1WA 4LQ2A 4OVQA 4GX4A 4N6KA 3U94A 2DP8A 2NUVA 3ECRA 4NMYA 4H6DA 4I62A 4GWXA 1OMPA 1EYKA 2ZYKA 4WKMA 4LP2B 4OQOA 4N6DA 2Y7KA 2Q2AA 1N7WA 1NNKA 1SPIA 5I56B 4FAJA 3KG2A 5KDTB 1A55A 1FQEA 4KCDA 2ONKE 1CB6A 4PFIA 1IMEA 4N8GA 5IGAA 1D9VA 3G3GA 4MLQA 1DSNA 2A5TA 2RCBA 3A09A 3K02A 3T0JA 3KN3A 3TTLA 5ICTA 4IO5A 1XHYA 3K1NA 5J16A 3H6WA 5EHMA 1GR2A 5EYFA 4EXLA 3FATA 1IXHA 4THIA 3KEIA 2X7PA 5DT6A 2GH9A 1N7XA 1G0IA 2XHDA 1ZTYA 3K2DA 1FBEA 1Y3PA 3KJ7A 1LAGE 2Q8MA 4F19A 5L9SA 4BDRA 3TFLA 1Y4TA 2V3QA 4F22A 1USYH 1FSAA 5H8FA 3O6GA 4O3CA 2WBBA 1URSA 3KN7A 1RDYA 2OWZA 1H76A 1MXXA 2NVUB 1R9QA 2PCRA 2I4CA 3TTRA 2YJPA 4MFIA 2Z8DA 5AA4A 1O7TA 1TXFA 3W9VA 4DXUA 3B50A 4G61A 1B2HA 1K9ZA 1B46A 3T22A 5HBCA 1B3HA 1Q1KA 1NV2A 1ZLQA 1AH5A 1LBBA 3THIA 2QPQA 1FBHA 3MP8A 2PX1A 3TPAA 4TOZA 1Z7NE 1XC1A 3PU5A 4RA1A 4IO7A 3V83A 1MDQA 2DE4A 1SQYA 1MQJA 1BK4A 2F78A 4G68B 2MKZA 1IEJA 2RCAA 3IB2A 1URGA 2HFBA 4N15A 1FPBA 4NWDA 3KOSA 3KBRA 2O6AA 1M5DA 1Y3QA 3ROJA 1S50A 2QS2A 2O84X 4KHZE 4JVIA 4OXVA 1FTAA 4PFTA 4QRZA 5LTCA 4ZECA 4XIGQ 5CMCA 1UTBB 3RY3A 1NL5A 3UP9A 1VSOA 4ELRA 4OFOA 3FUZA 2XXHA 4PE5B 2DXYA 4OA4A 3FV1A 2Q74A 4F1VA 3MAMA 3S9EA 1MQHA 4PC9A 4I8CA 3IAZA 1DTGA 2Z8FA 5CM6A 3O29A 3LBSA 3R7XA 3JZJA 3MBPA 4O8MA 4ELOA 4GXSB 1LAHE 3PTYA 1PBPA 4N91A 3EHSA 4GD5A 3MVWA 1TWYA 2HAUA 4EF1A 2I4BA 1R6ZA 3G3IA 4IB2A 3TTMA 3DLNA 4P8BA 1QGXA 2Y7PA 4PBHA 4NE4A 3KFMA 1B40A 4PAFA 2L5VA 3BFTA 2XXYA 3C4MA 4R6KA 1FQFA 3O6IA 4GX3A 1JVYA 3IL1B 3K6VA 2XWKA 1KWHA 3ZS6A 3SEVA 2ABHA 3MVYA 3FBPA 5IZZA 1B3LA 2KR0A 3B6WA 3V89B 4X1BA 3PUXE 1LBVA 3OD7A 3PPNA 1B1HA 1LAXA 3IJOB 3VLUA 3O9PA 2XX9A 3RT8A 5L8DA 4MJOA 2Y84A 2I3VA 4NHBA 1AOVA 3K1PA 3OO9A 1FPGA 4KD5A 2B3FA 3IB1A 1Y9UA 2F3BA 4ELQA 3CVGA 1AWBA 2I48A 2PMSA 3TKDA 5I57B 4RNSA 3RPLB 2CEYA 1UTHB 4GF8A 2HPGA 4DI4B 4EQ7A 2B4LA 1JQFA 4IY6A 1IITA 3IX1A 3LUZA 3MZ9A 4OFJA 2HHMA 1MXUA 4HS7A 3KSXA 1ELJA 1DTZA 2VPOA 5CBRA 5I59B 1BKAA 3OMBA 1M5BA 2A5SA 4JWXA 3VLVA 2FVZA 3SZPA 4BDQA 4F3BA 1S9TA 4H5GA 3IR1A 2F5XA 3O28A 4FJPA 1SYIA 2F34A 3VDFA 4N4UA 3U65A 3EHUA 1PDAA 5AA3A 3TCHA 4YKJA 3FVNA 2VPNA 3MJNA 1JW4A 5IZ1A 4YMAA 3VLWA 2Y7WA 1USYE 5FHMA 1IMCA 3TEPA 2THIA 2I49A 4NF6A 3MPKA 4BDOA 3W15C 1MQIA 4N8YA 4QHQA 4OMBA 5FHNA 2E1SA 5CMKA 1A99A 1IQ7A 1QKAA 3OSRA 1SYHA 3CG1A 3SESA 1QULA 1TFAA 1B5IA 5I2KA 4FATA 4P9KA 5M2VA 3RYDA 1FPIA 3CG3A 1SW2A 4FECA 3HHGA 5H8QB 5I84A 2RF1A 3TCGA 1UQWA 1LCTA 1M5EA 4QFPA 3EKIA 2GHBA 1NMUA 3MUQA 2D21A 3RGYA 2QVVA 1NUXA 4YMBA 1A8FA 5JEIA 2WX9A 1IMDA 2UYFA 1LFHA 5AA4B 5F1QA 3QUFA 1BTJA 3N26A 2V84A 5LDZA 2V4CA 4NWCA 1NH8A 1RDZA 3ILTB 3M3FA 4U1ZA 1B51A 2ONRA 1FQDA 4KYDA 4H65A 1FPJA 1EYJA 3TMGA 3IORA 3TQWA 3T96B 4HE0A 2CMOA 1OVBA 4QXDA 2O69A 3UORA 2KLFA 4F1YA 4RK2A 1LEVA 5H8QA 3TQLA 4ZEKA 4NF5B 2M8CA 2O7UA 1WDNA 2OZZA 1NNPA 4XXUA 4I1DA 1RKMA 2I0CA 3CIJA 3P7IA 3T9VA 1SW5A 2XX7A 2AL5A 4DCXA 1NV3A 1OVTA 2VOZA 2FBPA 2A5TB 2XXXA 4PF8A 3EQ1A 5JK4A 1ZMGA 2GRVA 1LBZA 3ONMA 2X26A 2F6PA 3ZKLA 1LBXA 1B3FA 4MF3A 2XXVA 4WEPA 2KQZA 4RYAA 2ZYNA 1H43A 2HCAA 4HE2A 3E79A 2PT1A 1T0KA 1JEUA 4YKKA 3I3VA 4QSDA 4G4PA 5EYHA 2XWVA 4LATA 4PETA 4LZ5A 1QUKA 4YB5A 5EQ9A 4YICA 3Q25A 4ND9A 2YLNA 2ZXTA 1EZOA 1NUWA 5I58A 3H6VA 1B7HA 2X7QA 1DPPA 3UK4A 2OWSA 5EQ7A 4GWZA 4YB7A 1IXIA 4JVCA 5ELVA 2DE2A 1FQAA 4Q0CA 1ZKBA 3FXUA 4F3SA 5K2XA 1EZPA 3FVKA 4QSCA 3UGWA 4KYEA 4C1TA 4OEVA 4F31B 1ZU0A 1YPNA 4O94A 2QS3A 4F2QA 5I7IA 5AA2B 3B8BA 1IMFA 3ISPA 1DK4A 3C32A 3MVXA 2V3TA 3IOUA 4AQ4A 4OZ9A 4ISUA 3E13X 4NF4B 1H45A 4G8MA 1GVCA 3VVEA 1MXWA 2QVUA 3G7WA 1S7YA 2D5WA 2ALUA 5AE4A 5TPAA 4IGTA 3N94A 1FTOA 5I3SA 4GRKA 5FTHA 4I3EA 2DYXA 1FTMA 2HEUA 4N17A 5DVJA 2DVCA 1D3KA 4F18A 2XXIA 1XI6A 4IO4A 5JTYB 3IOTA 3U8QA 4OYVA 4QFNA 4QSEA 2DWHA 4XF5A 5IZ3A 1FW0A 5AA2D 1D9YA 2P2AA 1Q9DA 1NUZA 1Y1MA 4IO2A 3UN6A 1FJ6A 4Q5TA 4O7IA 2CZHA 3DP4A 4Z7EA 3OO7A 4EF2A 4GIZA 3PV0E 2RKMA 4Q8RA 3SETA 2HXWA 3VVFA 4YU0A 3NOHA 4QFOA 3U1OA 4U1OA 5CRYA 4PFUA 4OANA 1OQHA 1SD3A 1FTLA 5F24A 4GWUA 1FRPA 4JDFA 4PAIA 5EQAA 3RLFE 3BFUA 5CBSA 4PTKA 5DTBA 5H8HB 4LONB 5EHSA 4ZE8A 2IEEA 3HPIA 2F7CA 3HCQA 5H8SA 3WAEA 4ELPA 2VD2A 2RINA 1XVYA 3HV1A 3SEUA 3PPOA 3IFCA 4GLIA 4U2RA 4I3YA 5CI5A 1Q35A 4PFYA 1NNTA 2H4IA 4H67A 3V5AA 4MNCA 2F7BA 2P0SA 3PUZE 4ZEDA 3B7DA 2VGQA 5BWJA 2VP1A 1LGBC 2VD3A 2WBDA 3SDFA 2H98A 2JJKA 3HFUA 1QUJA 1BIYA 1B7ZA 3RNNA 3U72A 4YKPA 4WEDA 1PBQA 3S2VA 1K9YA 1B0LA 1MH3A 5LOMA 1WODA 4PGPA 3FV2A 1EYIA 4U21A 3K4UA 3ODBA 3JV9A 3MP1A 4AS4A 1FBPA 3ZKKA 1JETA 2BJIA 4ESXA 1LBYA 1VE4A 1A8EA 4ZS9A 2LAOA 1JW5A 5CMBA 4JSDA 1YXIA 3K6WA 4NF0A 2F8DA 3KZGA 3O66A 2G29A 2O68A 4P1LA 2NOOA 2H99A 1FQBA 3ZSFA 3IB0A 5ET6A 4RK9A 3LSLA 3T9HB 1IXCA 3QAXA 2I6EA 5HPQA 3LV0A 1TFDA 4OFLA 3FXQA 3KN8A 1MDP1 1OLCA 1ZJLA 1BP5A 3H3GA 3PUWE 2XXKA 1M5FA 2Y5LA 1LCFA 3VXCA 5A5LA 2E0SA 3PMVA 1IMAA 4HE1A 4PBQA 3BKIB 1O64A 2Q9TA 4F29A 5IAIA 2ZNSA 4NX1A 3G3HA 1UIUA 4GQOA 2UVJA 2F97A 3PPRA 3LSWA 2F7AA 5H8NA 1FPFA 1MY3A 2XD2A 3TELA 1N04A 1P1OA 2UVIA 2CZKA 4EXKA 4OVSA 1YTVA 4ZZEA 3BIGA 1NNFA 2Z23A 4R6HA 4EQ9A 4KQPA 4G68C 2F6GA 3RPLA 1OIBA 4F2OA 2P3VA 5EQ8A 2QSXA 2ZYOA 4POXA 3QSLA 4RPOA 3SERA 1URDA 1MH4A 1O63A 4DXCA 1JP4A 3CSBA 4AB5A 2PVUA 1A54A 4ONYA 2UYEA 1KA0A 1US4A 4QF9A 4OWDA 2H25A 2WEFA 3HHFA 3FGSA 2P1SA 1B3EA 4GWOA 1G0HA 3BBRA 1YZ0A 4U22A 2HZLA 3G3FA 4TLLB 3K6UA 4KXPA 4NGUA 3OEKA 2WYKA 4H1XA 3LSXA 3H6UA 4LA9A 3RQTA 3KSJA 3DELB 1P1QA 2REGA 1VFEA 3RN8A 3LR1A 3FD3A 3IJXB 4HW8A 3S9MC 1OLAA 2AYSA 3CFLA 2CZLA 4R2FA 4P47A 3WAFA 4NEDA 4FBPA 1Y20A 1JVXA 3QMFA 1N84A 2GFEA 2XXTA 3T93B 4E0XA 3IFAA 2R71A 2AL4A 1LLSA 3QXMA 3IOWA 2UVGA 2PBWA 1FPLA 4AB6A 2PFYA 5I57A 2DWAA 1Y1ZA 1NV6A 5ITOA 2F3DA 3T9UA 1DOTA 4PCDA 4GOTA 3LUYA 4XEQA 1IXGA 4GL0A 1INPA 2CZIA 2O7IA 4JWYA 2OWTA 3H6TA 4GX6A 3MW0A 4HXVA 2DS9A 3CRBA 2XXRA 4X9TA 4YKIA 2ZZWA 3H7MA 1LB9A 3R6UA 4ZEFA 4NF6B 1FBFA 3CHGA 1JW1A 4IGRA 5ET5A 5H8NB 1HSLA 3Q27A 4GWWA 3N6TA 4RY1A 3OO8A 2P3NA 3FVOA 1YYZA 2GQ1A 5DEXB 3PPQA 3M3LA 1Y3NA 2YPNA 3O2AA 3RTFB 4PF6A 5ET7A 1QW0A 2OLBA 3KOTA 1MY1A 3V8XB 3E78A 3SEXA 4R75A 2ZNUA 2XX8A 5TPAB 2Z8EA 1B58A 2Y5KA 3RUMA 1US5A 1MXYA 2H9BA 4EUOA 4PGNA 3D4CA 4OENA 4E0WA 4FEBA 4WXJA 3L6GA 1LFGA 3TODA 4KI0E 1HSJA 1FBCA 1RYOA 4G2ZA 1KZ8A 4G68A 4YAHX 3MYUA 2Z22A 3OXNA 3CR9A 1J1NA 4O7MA 4MBPA 5K2YA 5KZTA 4PFWA 5I58B 2XXPA 1LFIA 4LZ8A 1TT1A 1M5CA 2NWJA 1EZ9A 4FEDA 5IM2A 3VVDA 1XVXA 1DCUA 3OOAA 4R73A 4LVQA 2XXQA 3KBZA 1MY4A 4JB7A 1QVSA 5I2NB 3QUJA 3PD8A 5H8FB 1ZBMA 3Q29A 3MSTA 1PC3A 4MH5A 4NTLA 3EF7A 1B7UA 4NF8B 4ESWA 4M4GA 4PDDA 4PDHA 1I6AA 1MM7A 1P99A 2QS4A 2ESNA 1JNFA 2HXRA 4OETA 1YAEA 4BDNA 3W9WA 1MY0A 5BUUA 2D3IA 1SBPA 2OX3A 1VDWA 4G77A 4IY5A 4OTEA 2B3BA 1LBWA 3L6HA 5HM4B 1RDXA 4NAPA 3BIHA 1N3WA 4R9GA 3TYHA 4PP0A 2QRYA 3CI8A 3HSTA 3K1MA 4R9FA 1B4HA 4NN3A 4YB6A 4NF8A 1PB8A 2O1LA 4H8JA 1AL3A 4F3PA 4R72A 2Q2CA 3DP8A 4H8IA 3C34A 3C35A 4RPNA 2Q8JA 1FTJA 4XFEA 1FPDA 1NV0A 3M3KA 5B70A 4PE3A 3E9XA 1EH3A 3FASA 3EPEA 3T9XB 4DI3D 4PQJA 1IUDA 4F39A 3MWBA 2Y7IA 3MVZA 3PUYE 4BLAA 2ZZVA 1B32A 2ZNTA 4N07A 5TU0A 4JWOA 3N6UA 2Q89A 2OCUA 1Z7ME 2OBGA 2BJJX 2FIXA 2O51A 5CMMA 4OVJA 2QFLA 5CC2A 1NFTA 1DMBA 1MG1A 4P0GA 1NI9A 2V3UA 5JTYA 2I58A 3DP6A 3VFJA 3RPWA 1MRPA 2FA7A 4PFRA 5TP9B 4RJZA 4P0IA 5KCJB 3PMWA 2DE3A 3MQ9A 4JSOA 4R74A 1AIVA 3TDJA 3QYTA 4MHFA 1B9JA 4DXBA 4YZZA 4OESA 4TQUQ 2Y7RA 4AS5A 1QJMA 4P1EA 5I2KB 4R6YA 4KFQA 1GTKA 1IIWA 1KA1A 5ITPA 1HSEA 2CEXA 3OO6A 2R9JA 4MCOA 3OSQA 1CE2A 1R9LA 4NF5A 5H8HA 1ZIUA 3D1RA 5TP9A 2WKYA 3IO6A 1PEBA 4UABA 4PFBA 4DIGA 4DLDA 3S9LC 2FNCA 1VFDA 3LSFB 2AIXA 1L5TA 3EHTA 1LB8A 3PMXA 1GGGA 4P56A 4BDLA 3DM0A 2B4MA 3K0VA 3MP6A 2HZKA 3D4GA 3FXBA 3E3KA 5ICQA 2NXOA 4DCYA 3S9NC 3S4UA 5ET8A 2G93A 3C33A 4XKPA 1A7LA 2FIEA 3Q28A 3H4ZA 3GBAA 1B1XA 3GBBA 1LBCA 3LC8A 4KPTA 3R26A 3JYRA 2B65A 3K00A 4GWYA 1UTHA 2W7YA 1UIVA 1NV7A 1FBGA 3OELA 1SW4A 1N0TA 3H06B 5DVFA 4GBWA 4KYSA 4ZZAA 3A29A 4Q30B 3A3CA 3FZVA 3QIMA 4KR5A 1FPEA 5I2NA 4IR8A 1DPEA 2GHAA 1II5A 3FJMA 1D9QA 4H46A 3C9HA 4G8HA 1XOCA 4LUBA 4TLMB 4MEVA 4G8NA 2DXRA 3TAJA 1FJ9A 1EU8A 4JXIA 4GWSA 1FQCA 4DZ1A 3HO7A 1QUIA 1P1UA 2QL3A 3GXAA 4H5FA 3FXRA 3M8UA 5KCJA 3KC1A 4U4XA 4ZEIA 1H3DA 1SVXB 1POY1 4L17A 1R1NA 5J1DA 4O3AA 5IKBA 4N81A 4GL8A 2O1MA 1LSTA 4MX6A 3O97A 5A5XA 4MLVA 4MIJA 2REJA 4C0RA 2XD3A 2VHAA 4GXAA 4X8RA 1SW1A 5FBPA 2PYYA 2PFZA 3CFZA 3N5LA 3K01A 5I5PA 1IMBA 3AXFA 4LQ5A 4HCYA 4DE8A 3PGFA 3IK6B 1MM6A
chains in the Genus database with same CATH topology
3V83A 1MDQA 3TZAA 2I3WA 4Z0IA 3FVOA 2DE4A 2F36A 2UVHA 1SQYA 4C1TA 1MQJA 4OEVA 4F31B 1ZU0A 1UTBA 1YPNA 1N3XA 5DEXB 3FIRA 4U23A 3PPQA 3M3LA 2DSFA 2QS3A 1MXZA 4F2QA 1Y3NA 4NF4A 1MXVA 2F78A 2YPNA 4FIMA 4G68B 3O2AA 4IO3A 4BDMA 3RTFB 5AA2B 3G3JA 1QW0A 1IEJA 2RCAA 3IB2A 1URGA 1B0HA 2HFBA 1MY1A 2OLBA 3C32A 3KJTA 3KOTA 3MVXA 4N6PA 4EQBA 3V8XB 2QS1A 4NWDA 3KOSA 3KBRA 2V3TA 4HCWA 2O6AA 3IOUA 4OZ9A 1M5DA 1Y3QA 2ZNUA 3FVGA 3E13X 4ISUA 4R75A 2XX8A 1S50A 2QMWA 3O6HA 4NF4B 5TPAB 4X48A 3I5OA 2Z8EA 1H45A 4G8MA 2H5YA 1B58A 1MXWA 2QMXA 1GVCA 3VVEA 1FCKA 3RUMA 2QS2A 2O84X 4KHZE 3G7WA 4OXVA 1US5A 1S7YA 1MXYA 2D5WA 2H9BA 2ALUA 3K6XA 4PFTA 4QRZA 4EUOA 4KCCA 5FTIA 4XIGQ 5CMCA 5TPAA 1UTBB 3D4CA 1VR5A 4OENA 5DEXA 1B6HA 4IGTA 1NL5A 3N94A 3RY3A 3UP9A 1FTOA 4ZEBA 1VSOA 3PD9A 1Y4CA 4GFRA 4E0WA 4ELRA 4OFOA 3FUZA 2XXHA 4GRKA 2DXYA 4PE5B 5FTHA 2DYXA 4FEBA 4WXJA 3L6GA 1FTMA 1LFGA 3FV1A 3TODA 2V93A 4KI0E 2HEUA 1HSJA 3TUSA 1RYOA 4F1VA 4G2ZA 3MAMA 4G68A 3S9EA 1MQHA 5DVJA 2DVCA 4YAHX 1D3KA 1B52A 4F18A 1MPCA 2XXIA 2Z22A 2QJEA 1MPBA 2RC9A 3OXNA 3CFXA 1BLFA 1J1NA 3CR9A 3IAZA 4I8CA 1DTGA 2Z8FA 5CM6A 3O29A 4IO4A 3EN3A 3LBSA 3R7XA 5JTYB 4MBPA 3JZJA 3IOTA 5K2YA 5KZTA 3MBPA 3U8QA 4OYVA 4ELOA 4GXSB 1LAHE 4PFWA 5I58B 3H03A 4QFNA 1SI0A 1PBPA 4QSEA 2DWHA 3EHSA 5AA1A 1FW0A 1NH7A 4GD5A 2XXPA 1D9YA 2ZMBA 1PB9A 3IOVA 2P2AA 1LFIA 3MVWA 1TWYA 3MZ1A 4ZE8A 3T66A 1N76A 2HAUA 1I6BA 4LZ8A 3U92A 1AMFA 5DYHA 3VE1B 1TT1A 4EF1A 1M5CA 1Y1MA 1EZ9A 2I4BA 1R6ZA 3G3IA 3A3UA 1XVXA 3KGCA 4FEDA 3DLNA 4IB2A 2DQVA 4Q5TA 4UACA 2Y7PA 3OOAA 5I59A 3DP4A 1B05A 4Z7EA 4R73A 4UA8A 3OO7A 4K3FA 3KFMA 4LVQA 4NE4A 4EF2A 2XXQA 1B40A 4GIZA 4AQ4A 3PV0E 3UA8A 2V25A 1MY4A 2RKMA 3FJ7A 3SETA 3BFTA 2HXWA 2XXYA 4JB7A 3VVFA 4Q8RA 3C4MA 4YU0A 1QVSA 2XXWA 3B6QA 4R6KA 2FYIA 5AA2A 5I2NB 3QUJA 1FQFA 3O6IA 1JVYA 3PD8A 3IL1B 4QFOA 4YZZA 1ZBMA 3Q29A 5H8FB 3U1OA 3K6VA 4U1OA 4EDPA 5CRYA 4GVOA 4ECFA 4PFUA 1KWHA 1PC3A 4MH5A 3SEVA 3ZS6A 4NTLA 2ABHA 3MVYA 4H0WA 1OQHA 3EF7A 1B7UA 1SD3A 4NF8B 3VV5A 4ESWA 1B3LA 1FTLA 4M4GA 5AE4A 3MPLA 3OEMA 3Q26A 5L9OA 4JDFA 4IO6A 3B6WA 3V89B 3RLFE 3BFUA 3PUXE 4X1BA 2OJTA 5CBSA 4QFKA 3OD7A 3SEYA 3PPNA 3C36A 5DTBA 3USDA 1I6AA 2RC7A 2HQ0A 1PB7A 5H8HB 1B1HA 1LAXA 4LONB 3IJOB 4BLAA 1P1NA 5EHSA 3VLUA 1MM7A 1P99A 1POTA 3O9PA 2IEEA 2XX9A 3HPIA 2QS4A 2ESNA 4QFLA 1JNFA 2F7CA 4LZ7A 3RT8A 4OETA 3HCQA 1YAEA 5H8SA 5L8DA 3WAEA 4BDNA 3GZGA 4ELPA 5A5XB 3W9WA 2VD2A 2RINA 1MY0A 5ISUA 1XVYA 3HV1A 5BUUA 3SEUA 1I69A 2Y84A 2D3IA 1SBPA 2I3VA 4R2BA 3PPOA 3I6VA 4G77A 4IY5A 1AOVA 4GLIA 4OTEA 2B3BA 3K1PA 4U2RA 1B4ZA 3FJGA 3L6HA 5CI5A 3OO9A 5HM4B 4KD5A 1NKXA 2B3FA 3F11A 1Q35A 3IB1A 1Y9UA 4HTGA 1N3WA 4R9GA 4ELQA 3CVGA 2I48A 2PMSA 4PFYA 3TYHA 1NNTA 2H4IA 4H67A 4O3BA 4PP0A 3TKDA 3V5AA 2QRYA 3CI8A 3HSTA 5I57B 3K1MA 4R9FA 1QKBA 2F7BA 2P0SA 4RNSA 4I9DA 3PUZE 4ZEDA 1B4HA 3B7DA 2VGQA 1UTHB 4GF8A 5BWJA 2VP1A 1LGBC 3QK6A 1D4NA 2VD3A 4YB6A 3SKPA 4NF8A 4EQ7A 3SDFA 3SEWA 2H98A 3TCFA 3UIFA 1JQFA 1ATGA 1OQGA 1F9BA 1QUJA 1PB8A 1IITA 4IY6A 2O1LA 1BIYA 4H8JA 4F1UA 1AL3A 3IX1A 4F3PA 4R72A 2Q2CA 3MZ9A 1B5HA 1B7ZA 4OFJA 3DP8A 2XXUA 4H8IA 3RNNA 3U72A 3C34A 4YKPA 4WEDA 1MXUA 3C35A 2IA4A 4HS7A 4RPNA 2Q8JA 1FTJA 1PBQA 1RYXA 3M3KA 4N13A 5B70A 3E9XA 3IO4A 3S2VA 3KSXA 1EH3A 1B0LA 1DTZA 1ELJA 2DWIA 1MH3A 3EPEA 3FASA 3T9XB 5LOMA 5CBRA 4PQJA 1WODA 1IUDA 1SI1A 3FV2A 1XT8A 2Y7IA 3MWBA 3MVZA 4F39A 5I59B 1MQDA 3PUYE 4U21A 3K4UA 3ODBA 1B32A 2ZNTA 3CSGA 1BKAA 4FORA 3JV9A 3OMBA 1M5BA 2A5SA 4N07A 3U93A 3C31A 3MP1A 4JWXA 5TU0A 3VLVA 4JWOA 3B6TA 3ZKKA 3HN0A 4BDQA 1SDXA 3N6UA 4POWA 1JETA 1S9TA 2Q89A 4ESXA 4F3BA 2DVZA 2OCUA 1B3GA 1Z7ME 4H5GA 3IR1A 2OBGA 2F5XA 3O28A 4FJPA 1SYIA 2BJJX 2O51A 1VE4A 2F34A 5CMMA 1FTKA 4IO2A 4OVJA 3E4RA 3UN6A 3PPPA 1A8EA 4ZS9A 3VDFA 5CC2A 2LAOA 1NFTA 1JW5A 5L9MA 5CMBA 1DMBA 4JSDA 1MG1A 1PDAA 3EHUA 3K6WA 4XKRA 5AA3A 3TCHA 1XS5A 4P0GA 4YKJA 2V3UA 3PUVE 2I58A 3DP6A 3TTKA 5JTYA 1MS7A 3FVNA 3VFJA 4U4SA 3MJNA 2F8DA 2UXAA 3MC2A 3KZGA 3RPWA 1I6QA 3O66A 1JW4A 4JBZA 2RC8A 4C1UA 1MRPA 2FA7A 2G29A 4YMAA 2O68A 5TP9B 3VLWA 4RJZA 2Y7WA 5KDTA 4P0IA 4XKNA 5KCJB 2NOOA 1LAFE 3G3KA 2H99A 3PMWA 1FQBA 3ILUB 3VXCA 3ZSFA 2DE3A 5B7DA 3IB0A 1USYE 3MQ9A 4JSOA 3GLBA 3LSLA 4R74A 4RK9A 1AIVA 3T9HB 3TDJA 3QYTA 5FHMA 1IXCA 3QAXA 1MQGA 2I6EA 3TEPA 2I0BA 5HPQA 1B9JA 1MPDA 2THIA 3MZBA 4DXBA 1TFDA 2I49A 4NF6A 3MPKA 2PT2A 2R6GE 3FXQA 4OESA 4OFLA 3KN8A 4TQUQ 2Y7RA 1MDP1 4OERA 4BDOA 4RXLA 1OLCA 4XKQA 1QJMA 4OEUA 2F35A 5DVIA 3W15C 1ZJLA 1BP5A 1MQIA 5I2KB 4QHQA 4R6YA 3H3GA 3PUWE 4KFQA 1GTKA 1IIWA 4OMBA 4P11A 5FHNA 5ITPA 1M5FA 1B5JA 2DWJA 2E1SA 1HSEA 5FHOA 5CMKA 5I56A 1A99A 2DOJA 1IQ7A 1JEVA 1QKAA 1LCFA 1MY2A 1SYHA 3CG1A 3OSRA 4X1DA 4ZDMA 1QULA 2E0SA 3OO6A 3PMVA 1TFAA 1B5IA 3SESA 1ANFA 2OK2A 5I2KA 3BKIB 2R9JA 4F3GA 4FATA 4XTCQ 1O64A 2Q9TA 2ANJA 4F29A 1H44A 2ZYMA 3OSQA 5M2VA 1CE2A 1R9LA 5IAIA 4NF5A 3CG3A 5H8HA 1YCJA 1SW2A 1ZIUA 2HAVA 2ZNSA 3HHGA 4FECA 3TTNA 5TP9A 2WKYA 3G3HA 5H8QB 2RF1A 3IO6A 1GV8A 1UQWA 3TCGA 4DDDA 1PEBA 3RTWB 5I84A 1LCTA 3OENA 1UIUA 2ONSA 4GQOA 2UVJA 2F97A 1M5EA 4QFPA 4ZE9A 4DIGA 4DLDA 4FE8A 3PPRA 2GHBA 3S9LC 3LSWA 2F7AA 5H8NA 1NMUA 1MY3A 2FNCA 1A40A 2XD2A 3MUQA 3TELA 1N04A 1VFDA 2D21A 1P1OA 3LSFB 5F7VA 3RGYA 2Q88A 2UVIA 1IZ1A 4EXKA 4YMBA 1YTVA 4ZZEA 3VXBA 2AIXA 1A8FA 1L5TA 3EHTA 1LB8A 1NNFA 1WVJA 4OHNA 2Z23A 5JEIA 4M1VA 3PMXA 1GGGA 4R6HA 4EQ9A 1P1WA 4LQ2A 4BDLA 2UYFA 3DM0A 3U94A 1LFHA 2DP8A 3K0VA 2NUVA 4KQPA 4G68C 2F6GA 1OIBA 4F2OA 3ECRA 5AA4B 5F1QA 3MP6A 4NMYA 2QSXA 4H6DA 3QUFA 2ZYOA 1BTJA 2HZKA 2V84A 3D4GA 3N26A 4I62A 3RT6B 3TTMA 1OMPA 3E3KA 4NWCA 5ICQA 1NH8A 2ZYKA 4POXA 4WKMA 4LP2B 4OQOA 2NXOA 3ILTB 3QSLA 4DCYA 3M3FA 4RPOA 4U1ZA 3S9NC 1B51A 2ONRA 3S4UA 3SERA 1URDA 1MH4A 2Y7KA 2G93A 1FQDA 4KYDA 2Q2AA 3C33A 1O63A 1N7WA 4H65A 1NNKA 4XKPA 4DXCA 1A7LA 3CSBA 4AB5A 5I56B 4FAJA 3KG2A 5KDTB 3TMGA 2PVUA 3Q28A 1A55A 1A54A 1FQEA 3H4ZA 3IORA 3GBAA 3TQWA 3T96B 4KCDA 2ONKE 2UYEA 4ONYA 1CB6A 1US4A 3VVDA 1B1XA 2CMOA 1LBCA 3GBBA 2NWJA 4QF9A 4OWDA 3LC8A 2H25A 3HHFA 3FGSA 1OVBA 2P1SA 3R26A 3JYRA 1B3EA 4GWOA 4KPTA 2O69A 3BBRA 3UORA 2B65A 3K00A 1D9VA 2KLFA 4U22A 2HZLA 3G3FA 4TLLB 1UTHA 2W7YA 3G3GA 1UIVA 3K6UA 4F1YA 4RK2A 5H8QA 4MLQA 3TQLA 1DSNA 2A5TA 2RCBA 1SW4A 3A09A 1N0TA 3OELA 3OEKA 4ZEKA 3K02A 3KN3A 3H06B 4NF5B 2M8CA 2O7UA 1WDNA 4KYSA 5DVFA 2OZZA 1NNPA 4H1XA 4Q30B 3LSXA 4XXUA 4I1DA 4ZZAA 3TTLA 1RKMA 3A3CA 3H6UA 4LA9A 5ICTA 3FZVA 2I0CA 3QIMA 3KSJA 4KR5A 3CIJA 3DELB 4IO5A 1XHYA 3P7IA 3RQTA 1P1QA 1SW5A 3K1NA 3T9VA 2XX7A 1DPEA 5I2NA 2GHAA 2REGA 2AL5A 1VFEA 1II5A 3FJMA 3H6WA 5EHMA 4DCXA 1GR2A 3C9HA 5EYFA 4G8HA 3FATA 3LR1A 3RN8A 4EXLA 3FD3A 1XOCA 3IJXB 4HW8A 3S9MC 1OLAA 4LUBA 2AYSA 3CFLA 4TLMB 2CZLA 1OVTA 4R2FA 3WAFA 4NEDA 4G8NA 1IXHA 4THIA 2DXRA 3KEIA 3TAJA 2X7PA 1Y20A 2VOZA 1JVXA 1N84A 2GFEA 2XXTA 2A5TB 2XXXA 3T93B 4E0XA 2GH9A 5DT6A 1EU8A 3EQ1A 4JXIA 1N7XA 2XHDA 5JK4A 1ZMGA 2R71A 1ZTYA 2AL4A 1FQCA 1LLSA 3K2DA 4DZ1A 1Y3PA 2GRVA 3ONMA 3KJ7A 2X26A 3HO7A 1QUIA 1LAGE 1P1UA 2F6PA 3QXMA 2QL3A 3GXAA 4H5FA 3ZKLA 3FXRA 3IOWA 1B3FA 4F19A 2UVGA 2PBWA 4MF3A 4BDRA 3M8UA 2XXVA 4WEPA 3TFLA 5KCJA 5L9SA 1Y4TA 2V3QA 4F22A 4AB6A 1USYH 4RYAA 2ZYNA 4U4XA 4ZEIA 1H43A 2DWAA 2HCAA 5I57A 5AA2D 1H3DA 3O6GA 4O3CA 5H8FA 2PT1A 1Y1ZA 1T0KA 1URSA 3KN7A 1JEUA 1SVXB 1POY1 4YKKA 4L17A 3I3VA 1R1NA 4QSDA 5J1DA 1H76A 4G4PA 1MXXA 4O3AA 5ITOA 2NVUB 5IKBA 3T9UA 4LATA 4PETA 1DOTA 1R9QA 4GOTA 3LUYA 4GL8A 2I4CA 4LZ5A 3TTRA 1QUKA 2O1MA 1LSTA 1IXGA 3O97A 2YJPA 4GL0A 4MFIA 4YB5A 5A5XA 4MLVA 2Z8DA 5AA4A 4YICA 3Q25A 2O7IA 1O7TA 2REJA 4JWYA 2XD3A 2YLNA 4ND9A 4C0RA 2ZXTA 2OWTA 1EZOA 1TXFA 3H6TA 3W9VA 5I58A 3MW0A 3H6VA 2DS9A 1B7HA 4DXUA 2VHAA 2X7QA 1DPPA 3CRBA 4GXAA 1SW1A 3UK4A 1B2HA 2XXRA 2OWSA 1B46A 4X9TA 3T22A 5HBCA 4ZECA 2PYYA 4YB7A 4YKIA 1B3HA 1Q1KA 3H7MA 1LB9A 1IXIA 3CFZA 3N5LA 3R6UA 1ZLQA 5ELVA 3SEXA 3K01A 2DE2A 4ZEFA 1FQAA 4NF6B 1AH5A 4Q0CA 3AXFA 1ZKBA 4LQ5A 3FXUA 1LBBA 3THIA 1JW1A 4IGRA 4F3SA 2QPQA 4HCYA 3MP8A 2PX1A 5K2XA 4DE8A 5H8NB 1EZPA 3FVKA 1HSLA 3Q27A 3TPAA 4QSCA 3N6TA 3PGFA 4TOZA 3IK6B 4RY1A 1Z7NE 3OO8A 1XC1A 1MM6A 3PU5A 4RA1A 3UGWA 4IO7A 4KYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V83 A;  1MDQ A;  3TZA A;  2I3W A;  4Z0I A;  3FVO A;  2DE4 A;  2F36 A;  2UVH A;  1SQY A;  4C1T A;  1MQJ A;  4OEV A;  4F31 B;  1ZU0 A;  1UTB A;  1YPN A;  1N3X A;  5DEX B;  3FIR A;  4U23 A;  3PPQ A;  3M3L A;  2DSF A;  2QS3 A;  1MXZ A;  4F2Q A;  1Y3N A;  4NF4 A;  1MXV A;  2F78 A;  2YPN A;  4FIM A;  4G68 B;  3O2A A;  4IO3 A;  4BDM A;  3RTF B;  5AA2 B;  3G3J A;  1QW0 A;  1IEJ A;  2RCA A;  3IB2 A;  1URG A;  1B0H A;  2HFB A;  1MY1 A;  2OLB A;  3C32 A;  3KJT A;  3KOT A;  3MVX A;  4N6P A;  4EQB A;  3V8X B;  2QS1 A;  4NWD A;  3KOS A;  3KBR A;  2V3T A;  4HCW A;  2O6A A;  3IOU A;  4OZ9 A;  1M5D A;  1Y3Q A;  2ZNU A;  3FVG A;  3E13 X;  4ISU A;  4R75 A;  2XX8 A;  1S50 A;  2QMW A;  3O6H A;  4NF4 B;  5TPA B;  4X48 A;  3I5O A;  2Z8E A;  1H45 A;  4G8M A;  2H5Y A;  1B58 A;  1MXW A;  2QMX A;  1GVC A;  3VVE A;  1FCK A;  3RUM A;  2QS2 A;  2O84 X;  4KHZ E;  3G7W A;  4OXV A;  1US5 A;  1S7Y A;  1MXY A;  2D5W A;  2H9B A;  2ALU A;  3K6X A;  4PFT A;  4QRZ A;  4EUO A;  4KCC A;  5FTI A;  4XIG Q;  5CMC A;  5TPA A;  1UTB B;  3D4C A;  1VR5 A;  4OEN A;  5DEX A;  1B6H A;  4IGT A;  1NL5 A;  3N94 A;  3RY3 A;  3UP9 A;  1FTO A;  4ZEB A;  1VSO A;  3PD9 A;  1Y4C A;  4GFR A;  4E0W A;  4ELR A;  4OFO A;  3FUZ A;  2XXH A;  4GRK A;  2DXY A;  4PE5 B;  5FTH A;  2DYX A;  4FEB A;  4WXJ A;  3L6G A;  1FTM A;  1LFG A;  3FV1 A;  3TOD A;  2V93 A;  4KI0 E;  2HEU A;  1HSJ A;  3TUS A;  1RYO A;  4F1V A;  4G2Z A;  3MAM A;  4G68 A;  3S9E A;  1MQH A;  5DVJ A;  2DVC A;  4YAH X;  1D3K A;  1B52 A;  4F18 A;  1MPC A;  2XXI A;  2Z22 A;  2QJE A;  1MPB A;  2RC9 A;  3OXN A;  3CFX A;  1BLF A;  1J1N A;  3CR9 A;  3IAZ A;  4I8C A;  1DTG A;  2Z8F A;  5CM6 A;  3O29 A;  4IO4 A;  3EN3 A;  3LBS A;  3R7X A;  5JTY B;  4MBP A;  3JZJ A;  3IOT A;  5K2Y A;  5KZT A;  3MBP A;  3U8Q A;  4OYV A;  4ELO A;  4GXS B;  1LAH E;  4PFW A;  5I58 B;  3H03 A;  4QFN A;  1SI0 A;  1PBP A;  4QSE A;  2DWH A;  3EHS A;  5AA1 A;  1FW0 A;  1NH7 A;  4GD5 A;  2XXP A;  1D9Y A;  2ZMB A;  1PB9 A;  3IOV A;  2P2A A;  1LFI A;  3MVW A;  1TWY A;  3MZ1 A;  4ZE8 A;  3T66 A;  1N76 A;  2HAU A;  1I6B A;  4LZ8 A;  3U92 A;  1AMF A;  5DYH A;  3VE1 B;  1TT1 A;  4EF1 A;  1M5C A;  1Y1M A;  1EZ9 A;  2I4B A;  1R6Z A;  3G3I A;  3A3U A;  1XVX A;  3KGC A;  4FED A;  3DLN A;  4IB2 A;  2DQV A;  4Q5T A;  4UAC A;  2Y7P A;  3OOA A;  5I59 A;  3DP4 A;  1B05 A;  4Z7E A;  4R73 A;  4UA8 A;  3OO7 A;  4K3F A;  3KFM A;  4LVQ A;  4NE4 A;  4EF2 A;  2XXQ A;  1B40 A;  4GIZ A;  4AQ4 A;  3PV0 E;  3UA8 A;  2V25 A;  1MY4 A;  2RKM A;  3FJ7 A;  3SET A;  3BFT A;  2HXW A;  2XXY A;  4JB7 A;  3VVF A;  4Q8R A;  3C4M A;  4YU0 A;  1QVS A;  2XXW A;  3B6Q A;  4R6K A;  2FYI A;  5AA2 A;  5I2N B;  3QUJ A;  1FQF A;  3O6I A;  1JVY A;  3PD8 A;  3IL1 B;  4QFO A;  4YZZ A;  1ZBM A;  3Q29 A;  5H8F B;  3U1O A;  3K6V A;  4U1O A;  4EDP A;  5CRY A;  4GVO A;  4ECF A;  4PFU A;  1KWH A;  1PC3 A;  4MH5 A;  3SEV A;  3ZS6 A;  4NTL A;  2ABH A;  3MVY A;  4H0W A;  1OQH A;  3EF7 A;  1B7U A;  1SD3 A;  4NF8 B;  3VV5 A;  4ESW A;  1B3L A;  1FTL A;  4M4G A;  5AE4 A;  3MPL A;  3OEM A;  3Q26 A;  5L9O A;  4JDF A;  4IO6 A;  3B6W A;  3V89 B;  3RLF E;  3BFU A;  3PUX E;  4X1B A;  2OJT A;  5CBS A;  4QFK A;  3OD7 A;  3SEY A;  3PPN A;  3C36 A;  5DTB A;  3USD A;  1I6A A;  2RC7 A;  2HQ0 A;  1PB7 A;  5H8H B;  1B1H A;  1LAX A;  4LON B;  3IJO B;  4BLA A;  1P1N A;  5EHS A;  3VLU A;  1MM7 A;  1P99 A;  1POT A;  3O9P A;  2IEE A;  2XX9 A;  3HPI A;  2QS4 A;  2ESN A;  4QFL A;  1JNF A;  2F7C A;  4LZ7 A;  3RT8 A;  4OET A;  3HCQ A;  1YAE A;  5H8S A;  5L8D A;  3WAE A;  4BDN A;  3GZG A;  4ELP A;  5A5X B;  3W9W A;  2VD2 A;  2RIN A;  1MY0 A;  5ISU A;  1XVY A;  3HV1 A;  5BUU A;  3SEU A;  1I69 A;  2Y84 A;  2D3I A;  1SBP A;  2I3V A;  4R2B A;  3PPO A;  3I6V A;  4G77 A;  4IY5 A;  1AOV A;  4GLI A;  4OTE A;  2B3B A;  3K1P A;  4U2R A;  1B4Z A;  3FJG A;  3L6H A;  5CI5 A;  3OO9 A;  5HM4 B;  4KD5 A;  1NKX A;  2B3F A;  3F11 A;  1Q35 A;  3IB1 A;  1Y9U A;  4HTG A;  1N3W A;  4R9G A;  4ELQ A;  3CVG A;  2I48 A;  2PMS A;  4PFY A;  3TYH A;  1NNT A;  2H4I A;  4H67 A;  4O3B A;  4PP0 A;  3TKD A;  3V5A A;  2QRY A;  3CI8 A;  3HST A;  5I57 B;  3K1M A;  4R9F A;  1QKB A;  2F7B A;  2P0S A;  4RNS A;  4I9D A;  3PUZ E;  4ZED A;  1B4H A;  3B7D A;  2VGQ A;  1UTH B;  4GF8 A;  5BWJ A;  2VP1 A;  1LGB C;  3QK6 A;  1D4N A;  2VD3 A;  4YB6 A;  3SKP A;  4NF8 A;  4EQ7 A;  3SDF A;  3SEW A;  2H98 A;  3TCF A;  3UIF A;  1JQF A;  1ATG A;  1OQG A;  1F9B A;  1QUJ A;  1PB8 A;  1IIT A;  4IY6 A;  2O1L A;  1BIY A;  4H8J A;  4F1U A;  1AL3 A;  3IX1 A;  4F3P A;  4R72 A;  2Q2C A;  3MZ9 A;  1B5H A;  1B7Z A;  4OFJ A;  3DP8 A;  2XXU A;  4H8I A;  3RNN A;  3U72 A;  3C34 A;  4YKP A;  4WED A;  1MXU A;  3C35 A;  2IA4 A;  4HS7 A;  4RPN A;  2Q8J A;  1FTJ A;  1PBQ A;  1RYX A;  3M3K A;  4N13 A;  5B70 A;  3E9X A;  3IO4 A;  3S2V A;  3KSX A;  1EH3 A;  1B0L A;  1DTZ A;  1ELJ A;  2DWI A;  1MH3 A;  3EPE A;  3FAS A;  3T9X B;  5LOM A;  5CBR A;  4PQJ A;  1WOD A;  1IUD A;  1SI1 A;  3FV2 A;  1XT8 A;  2Y7I A;  3MWB A;  3MVZ A;  4F39 A;  5I59 B;  1MQD A;  3PUY E;  4U21 A;  3K4U A;  3ODB A;  1B32 A;  2ZNT A;  3CSG A;  1BKA A;  4FOR A;  3JV9 A;  3OMB A;  1M5B A;  2A5S A;  4N07 A;  3U93 A;  3C31 A;  3MP1 A;  4JWX A;  5TU0 A;  3VLV A;  4JWO A;  3B6T A;  3ZKK A;  3HN0 A;  4BDQ A;  1SDX A;  3N6U A;  4POW A;  1JET A;  1S9T A;  2Q89 A;  4ESX A;  4F3B A;  2DVZ A;  2OCU A;  1B3G A;  1Z7M E;  4H5G A;  3IR1 A;  2OBG A;  2F5X A;  3O28 A;  4FJP A;  1SYI A;  2BJJ X;  2O51 A;  1VE4 A;  2F34 A;  5CMM A;  1FTK A;  4IO2 A;  4OVJ A;  3E4R A;  3UN6 A;  3PPP A;  1A8E A;  4ZS9 A;  3VDF A;  5CC2 A;  2LAO A;  1NFT A;  1JW5 A;  5L9M A;  5CMB A;  1DMB A;  4JSD A;  1MG1 A;  1PDA A;  3EHU A;  3K6W A;  4XKR A;  5AA3 A;  3TCH A;  1XS5 A;  4P0G A;  4YKJ A;  2V3U A;  3PUV E;  2I58 A;  3DP6 A;  3TTK A;  5JTY A;  1MS7 A;  3FVN A;  3VFJ A;  4U4S A;  3MJN A;  2F8D A;  2UXA A;  3MC2 A;  3KZG A;  3RPW A;  1I6Q A;  3O66 A;  1JW4 A;  4JBZ A;  2RC8 A;  4C1U A;  1MRP A;  2FA7 A;  2G29 A;  4YMA A;  2O68 A;  5TP9 B;  3VLW A;  4RJZ A;  2Y7W A;  5KDT A;  4P0I A;  4XKN A;  5KCJ B;  2NOO A;  1LAF E;  3G3K A;  2H99 A;  3PMW A;  1FQB A;  3ILU B;  3VXC A;  3ZSF A;  2DE3 A;  5B7D A;  3IB0 A;  1USY E;  3MQ9 A;  4JSO A;  3GLB A;  3LSL A;  4R74 A;  4RK9 A;  1AIV A;  3T9H B;  3TDJ A;  3QYT A;  5FHM A;  1IXC A;  3QAX A;  1MQG A;  2I6E A;  3TEP A;  2I0B A;  5HPQ A;  1B9J A;  1MPD A;  2THI A;  3MZB A;  4DXB A;  1TFD A;  2I49 A;  4NF6 A;  3MPK A;  2PT2 A;  2R6G E;  3FXQ A;  4OES A;  4OFL A;  3KN8 A;  4TQU Q;  2Y7R A;  1MDP 1;  4OER A;  4BDO A;  4RXL A;  1OLC A;  4XKQ A;  1QJM A;  4OEU A;  2F35 A;  5DVI A;  3W15 C;  1ZJL A;  1BP5 A;  1MQI A;  5I2K B;  4QHQ A;  4R6Y A;  3H3G A;  3PUW E;  4KFQ A;  1GTK A;  1IIW A;  4OMB A;  4P11 A;  5FHN A;  5ITP A;  1M5F A;  1B5J A;  2DWJ A;  2E1S A;  1HSE A;  5FHO A;  5CMK A;  5I56 A;  1A99 A;  2DOJ A;  1IQ7 A;  1JEV A;  1QKA A;  1LCF A;  1MY2 A;  1SYH A;  3CG1 A;  3OSR A;  4X1D A;  4ZDM A;  1QUL A;  2E0S A;  3OO6 A;  3PMV A;  1TFA A;  1B5I A;  3SES A;  1ANF A;  2OK2 A;  5I2K A;  3BKI B;  2R9J A;  4F3G A;  4FAT A;  4XTC Q;  1O64 A;  2Q9T A;  2ANJ A;  4F29 A;  1H44 A;  2ZYM A;  3OSQ A;  5M2V A;  1CE2 A;  1R9L A;  5IAI A;  4NF5 A;  3CG3 A;  5H8H A;  1YCJ A;  1SW2 A;  1ZIU A;  2HAV A;  2ZNS A;  3HHG A;  4FEC A;  3TTN A;  5TP9 A;  2WKY A;  3G3H A;  5H8Q B;  2RF1 A;  3IO6 A;  1GV8 A;  1UQW A;  3TCG A;  4DDD A;  1PEB A;  3RTW B;  5I84 A;  1LCT A;  3OEN A;  1UIU A;  2ONS A;  4GQO A;  2UVJ A;  2F97 A;  1M5E A;  4QFP A;  4ZE9 A;  4DIG A;  4DLD A;  4FE8 A;  3PPR A;  2GHB A;  3S9L C;  3LSW A;  2F7A A;  5H8N A;  1NMU A;  1MY3 A;  2FNC A;  1A40 A;  2XD2 A;  3MUQ A;  3TEL A;  1N04 A;  1VFD A;  2D21 A;  1P1O A;  3LSF B;  5F7V A;  3RGY A;  2Q88 A;  2UVI A;  1IZ1 A;  4EXK A;  4YMB A;  1YTV A;  4ZZE A;  3VXB A;  2AIX A;  1A8F A;  1L5T A;  3EHT A;  1LB8 A;  1NNF A;  1WVJ A;  4OHN A;  2Z23 A;  5JEI A;  4M1V A;  3PMX A;  1GGG A;  4R6H A;  4EQ9 A;  1P1W A;  4LQ2 A;  4BDL A;  2UYF A;  3DM0 A;  3U94 A;  1LFH A;  2DP8 A;  3K0V A;  2NUV A;  4KQP A;  4G68 C;  2F6G A;  1OIB A;  4F2O A;  3ECR A;  5AA4 B;  5F1Q A;  3MP6 A;  4NMY A;  2QSX A;  4H6D A;  3QUF A;  2ZYO A;  1BTJ A;  2HZK A;  2V84 A;  3D4G A;  3N26 A;  4I62 A;  3RT6 B;  3TTM A;  1OMP A;  3E3K A;  4NWC A;  5ICQ A;  1NH8 A;  2ZYK A;  4POX A;  4WKM A;  4LP2 B;  4OQO A;  2NXO A;  3ILT B;  3QSL A;  4DCY A;  3M3F A;  4RPO A;  4U1Z A;  3S9N C;  1B51 A;  2ONR A;  3S4U A;  3SER A;  1URD A;  1MH4 A;  2Y7K A;  2G93 A;  1FQD A;  4KYD A;  2Q2A A;  3C33 A;  1O63 A;  1N7W A;  4H65 A;  1NNK A;  4XKP A;  4DXC A;  1A7L A;  3CSB A;  4AB5 A;  5I56 B;  4FAJ A;  3KG2 A;  5KDT B;  3TMG A;  2PVU A;  3Q28 A;  1A55 A;  1A54 A;  1FQE A;  3H4Z A;  3IOR A;  3GBA A;  3TQW A;  3T96 B;  4KCD A;  2ONK E;  2UYE A;  4ONY A;  1CB6 A;  1US4 A;  3VVD A;  1B1X A;  2CMO A;  1LBC A;  3GBB A;  2NWJ A;  4QF9 A;  4OWD A;  3LC8 A;  2H25 A;  3HHF A;  3FGS A;  1OVB A;  2P1S A;  3R26 A;  3JYR A;  1B3E A;  4GWO A;  4KPT A;  2O69 A;  3BBR A;  3UOR A;  2B65 A;  3K00 A;  1D9V A;  2KLF A;  4U22 A;  2HZL A;  3G3F A;  4TLL B;  1UTH A;  2W7Y A;  3G3G A;  1UIV A;  3K6U A;  4F1Y A;  4RK2 A;  5H8Q A;  4MLQ A;  3TQL A;  1DSN A;  2A5T A;  2RCB A;  1SW4 A;  3A09 A;  1N0T A;  3OEL A;  3OEK A;  4ZEK A;  3K02 A;  3KN3 A;  3H06 B;  4NF5 B;  2M8C A;  2O7U A;  1WDN A;  4KYS A;  5DVF A;  2OZZ A;  1NNP A;  4H1X A;  4Q30 B;  3LSX A;  4XXU A;  4I1D A;  4ZZA A;  3TTL A;  1RKM A;  3A3C A;  3H6U A;  4LA9 A;  5ICT A;  3FZV A;  2I0C A;  3QIM A;  3KSJ A;  4KR5 A;  3CIJ A;  3DEL B;  4IO5 A;  1XHY A;  3P7I A;  3RQT A;  1P1Q A;  1SW5 A;  3K1N A;  3T9V A;  2XX7 A;  1DPE A;  5I2N A;  2GHA A;  2REG A;  2AL5 A;  1VFE A;  1II5 A;  3FJM A;  3H6W A;  5EHM A;  4DCX A;  1GR2 A;  3C9H A;  5EYF A;  4G8H A;  3FAT A;  3LR1 A;  3RN8 A;  4EXL A;  3FD3 A;  1XOC A;  3IJX B;  4HW8 A;  3S9M C;  1OLA A;  4LUB A;  2AYS A;  3CFL A;  4TLM B;  2CZL A;  1OVT A;  4R2F A;  3WAF A;  4NED A;  4G8N A;  1IXH A;  4THI A;  2DXR A;  3KEI A;  3TAJ A;  2X7P A;  1Y20 A;  2VOZ A;  1JVX A;  1N84 A;  2GFE A;  2XXT A;  2A5T B;  2XXX A;  3T93 B;  4E0X A;  2GH9 A;  5DT6 A;  1EU8 A;  3EQ1 A;  4JXI A;  1N7X A;  2XHD A;  5JK4 A;  1ZMG A;  2R71 A;  1ZTY A;  2AL4 A;  1FQC A;  1LLS A;  3K2D A;  4DZ1 A;  1Y3P A;  2GRV A;  3ONM A;  3KJ7 A;  2X26 A;  3HO7 A;  1QUI A;  1LAG E;  1P1U A;  2F6P A;  3QXM A;  2QL3 A;  3GXA A;  4H5F A;  3ZKL A;  3FXR A;  3IOW A;  1B3F A;  4F19 A;  2UVG A;  2PBW A;  4MF3 A;  4BDR A;  3M8U A;  2XXV A;  4WEP A;  3TFL A;  5KCJ A;  5L9S A;  1Y4T A;  2V3Q A;  4F22 A;  4AB6 A;  1USY H;  4RYA A;  2ZYN A;  4U4X A;  4ZEI A;  1H43 A;  2DWA A;  2HCA A;  5I57 A;  5AA2 D;  1H3D A;  3O6G A;  4O3C A;  5H8F A;  2PT1 A;  1Y1Z A;  1T0K A;  1URS A;  3KN7 A;  1JEU A;  1SVX B;  1POY 1;  4YKK A;  4L17 A;  3I3V A;  1R1N A;  4QSD A;  5J1D A;  1H76 A;  4G4P A;  1MXX A;  4O3A A;  5ITO A;  2NVU B;  5IKB A;  3T9U A;  4LAT A;  4PET A;  1DOT A;  1R9Q A;  4GOT A;  3LUY A;  4GL8 A;  2I4C A;  4LZ5 A;  3TTR A;  1QUK A;  2O1M A;  1LST A;  1IXG A;  3O97 A;  2YJP A;  4GL0 A;  4MFI A;  4YB5 A;  5A5X A;  4MLV A;  2Z8D A;  5AA4 A;  4YIC A;  3Q25 A;  2O7I A;  1O7T A;  2REJ A;  4JWY A;  2XD3 A;  2YLN A;  4ND9 A;  4C0R A;  2ZXT A;  2OWT A;  1EZO A;  1TXF A;  3H6T A;  3W9V A;  5I58 A;  3MW0 A;  3H6V A;  2DS9 A;  1B7H A;  4DXU A;  2VHA A;  2X7Q A;  1DPP A;  3CRB A;  4GXA A;  1SW1 A;  3UK4 A;  1B2H A;  2XXR A;  2OWS A;  1B46 A;  4X9T A;  3T22 A;  5HBC A;  4ZEC A;  2PYY A;  4YB7 A;  4YKI A;  1B3H A;  1Q1K A;  3H7M A;  1LB9 A;  1IXI A;  3CFZ A;  3N5L A;  3R6U A;  1ZLQ A;  5ELV A;  3SEX A;  3K01 A;  2DE2 A;  4ZEF A;  1FQA A;  4NF6 B;  1AH5 A;  4Q0C A;  3AXF A;  1ZKB A;  4LQ5 A;  3FXU A;  1LBB A;  3THI A;  1JW1 A;  4IGR A;  4F3S A;  2QPQ A;  4HCY A;  3MP8 A;  2PX1 A;  5K2X A;  4DE8 A;  5H8N B;  1EZP A;  3FVK A;  1HSL A;  3Q27 A;  3TPA A;  4QSC A;  3N6T A;  3PGF A;  4TOZ A;  3IK6 B;  4RY1 A;  1Z7N E;  3OO8 A;  1XC1 A;  1MM6 A;  3PU5 A;  4RA1 A;  3UGW A;  4IO7 A;  4KYE A; 
#chains in the Genus database with same CATH topology
 3TZA A;  2I3W A;  4Z0I A;  2F36 A;  1NV5 A;  2UVH A;  1UTB A;  1N3X A;  3FIR A;  4U23 A;  2DSF A;  1MXZ A;  4NF4 A;  1NV1 A;  1MXV A;  4FIM A;  4BDM A;  4IO3 A;  1CNQ A;  3G3J A;  1B0H A;  4N6P A;  3KJT A;  4EQB A;  2QS1 A;  5B7D A;  4HCW A;  3FVG A;  2QMW A;  3O6H A;  4X48 A;  3I5O A;  2H5Y A;  2QMX A;  3GYY A;  1FCK A;  4JVD A;  2XWO A;  3K6X A;  4KCC A;  5FTI A;  5DEX A;  1VR5 A;  1B6H A;  2FHY A;  4ZEB A;  3PD9 A;  1Y4C A;  4GFR A;  5DW8 A;  5ESY A;  2V93 A;  3TUS A;  4H45 A;  2R8T A;  1B52 A;  1MPC A;  2QJE A;  1MPB A;  2RC9 A;  3CFX A;  1BLF A;  4LN5 A;  3EN3 A;  4I40 A;  3H03 A;  1SI0 A;  5AA1 A;  1NH7 A;  2ZMB A;  3IOV A;  1PB9 A;  3T66 A;  3MZ1 A;  1N76 A;  3U92 A;  1I6B A;  1AMF A;  5DYH A;  3VE1 B;  3KGC A;  3A3U A;  2DQV A;  4UAC A;  5I59 A;  1B05 A;  3T1B A;  4UA8 A;  4K3F A;  4MNI A;  5IZ3 B;  3UA8 A;  2V25 A;  3FJ7 A;  2XXW A;  3B6Q A;  2FYI A;  5AA2 A;  4PAK A;  2WYP A;  4EDP A;  4GVO A;  4ECF A;  4H0W A;  3VV5 A;  4NQ8 A;  3MPL A;  3OEM A;  3Q26 A;  5L9O A;  4IO6 A;  2OJT A;  4QFK A;  4MAG A;  3C36 A;  3USD A;  2RC7 A;  2HQ0 A;  1PB7 A;  1P1N A;  1FBD A;  1POT A;  4QFL A;  4LZ7 A;  5A5X B;  3GZG A;  5ISU A;  1I69 A;  4R2B A;  3I6V A;  1B4Z A;  3FJG A;  1NKX A;  3F11 A;  4HTG A;  4O3B A;  5T3J A;  1QKB A;  4I9D A;  5EYG A;  4NG7 A;  3QK6 A;  1D4N A;  3SKP A;  2DDK A;  3SEW A;  3TCF A;  3UIF A;  1ATG A;  1OQG A;  1F9B A;  4F1U A;  1B5H A;  2XXU A;  2IA4 A;  1RYX A;  4N13 A;  4MNP A;  3IO4 A;  2DWI A;  2QVR A;  1SI1 A;  1XT8 A;  2VT5 A;  1MQD A;  3RT6 B;  3CSG A;  4FOR A;  3U93 A;  3C31 A;  3B6T A;  3HN0 A;  1SDX A;  4POW A;  2DVZ A;  1B3G A;  1FTK A;  3E4R A;  3PPP A;  2XWI A;  5L9M A;  1DBZ A;  4XKR A;  1XS5 A;  3PUV E;  4X04 A;  3TTK A;  1MS7 A;  4U4S A;  2UXA A;  3MC2 A;  1I6Q A;  4JBZ A;  2RC8 A;  4C1U A;  1NUY A;  5KDT A;  4XKN A;  1LAF E;  3G3K A;  3ILU B;  3GLB A;  4MMP A;  4QBA A;  2XA5 A;  1MQG A;  2I0B A;  4OVR A;  1MPD A;  3MZB A;  2ZZX A;  3KC0 A;  2PT2 A;  2R6G E;  3SEY A;  4OER A;  4RXL A;  4XKQ A;  4OEU A;  2F35 A;  5DVI A;  4OVP A;  4P11 A;  1B5J A;  2DWJ A;  5FHO A;  5I56 A;  1NV4 A;  2DOJ A;  1JEV A;  1MY2 A;  4ZDM A;  4X1D A;  4P3L A;  1ANF A;  2OK2 A;  4F3G A;  4XTC Q;  2ANJ A;  1H44 A;  2ZYM A;  1YCJ A;  4OVT A;  2HAV A;  3TTN A;  1GV8 A;  4DDD A;  3RTW B;  3OEN A;  1FPK A;  2ONS A;  4GBV A;  4ZE9 A;  4FE8 A;  1A40 A;  5F7V A;  2Q88 A;  1IZ1 A;  3VXB A;  1WVJ A;  4OHN A;  4M1V A;  1P1W A;  4LQ2 A;  4OVQ A;  4GX4 A;  4N6K A;  3U94 A;  2DP8 A;  2NUV A;  3ECR A;  4NMY A;  4H6D A;  4I62 A;  4GWX A;  1OMP A;  1EYK A;  2ZYK A;  4WKM A;  4LP2 B;  4OQO A;  4N6D A;  2Y7K A;  2Q2A A;  1N7W A;  1NNK A;  1SPI A;  5I56 B;  4FAJ A;  3KG2 A;  5KDT B;  1A55 A;  1FQE A;  4KCD A;  2ONK E;  1CB6 A;  4PFI A;  1IME A;  4N8G A;  5IGA A;  1D9V A;  3G3G A;  4MLQ A;  1DSN A;  2A5T A;  2RCB A;  3A09 A;  3K02 A;  3T0J A;  3KN3 A;  3TTL A;  5ICT A;  4IO5 A;  1XHY A;  3K1N A;  5J16 A;  3H6W A;  5EHM A;  1GR2 A;  5EYF A;  4EXL A;  3FAT A;  1IXH A;  4THI A;  3KEI A;  2X7P A;  5DT6 A;  2GH9 A;  1N7X A;  1G0I A;  2XHD A;  1ZTY A;  3K2D A;  1FBE A;  1Y3P A;  3KJ7 A;  1LAG E;  2Q8M A;  4F19 A;  5L9S A;  4BDR A;  3TFL A;  1Y4T A;  2V3Q A;  4F22 A;  1USY H;  1FSA A;  5H8F A;  3O6G A;  4O3C A;  2WBB A;  1URS A;  3KN7 A;  1RDY A;  2OWZ A;  1H76 A;  1MXX A;  2NVU B;  1R9Q A;  2PCR A;  2I4C A;  3TTR A;  2YJP A;  4MFI A;  2Z8D A;  5AA4 A;  1O7T A;  1TXF A;  3W9V A;  4DXU A;  3B50 A;  4G61 A;  1B2H A;  1K9Z A;  1B46 A;  3T22 A;  5HBC A;  1B3H A;  1Q1K A;  1NV2 A;  1ZLQ A;  1AH5 A;  1LBB A;  3THI A;  2QPQ A;  1FBH A;  3MP8 A;  2PX1 A;  3TPA A;  4TOZ A;  1Z7N E;  1XC1 A;  3PU5 A;  4RA1 A;  4IO7 A;  3V83 A;  1MDQ A;  2DE4 A;  1SQY A;  1MQJ A;  1BK4 A;  2F78 A;  4G68 B;  2MKZ A;  1IEJ A;  2RCA A;  3IB2 A;  1URG A;  2HFB A;  4N15 A;  1FPB A;  4NWD A;  3KOS A;  3KBR A;  2O6A A;  1M5D A;  1Y3Q A;  3ROJ A;  1S50 A;  2QS2 A;  2O84 X;  4KHZ E;  4JVI A;  4OXV A;  1FTA A;  4PFT A;  4QRZ A;  5LTC A;  4ZEC A;  4XIG Q;  5CMC A;  1UTB B;  3RY3 A;  1NL5 A;  3UP9 A;  1VSO A;  4ELR A;  4OFO A;  3FUZ A;  2XXH A;  4PE5 B;  2DXY A;  4OA4 A;  3FV1 A;  2Q74 A;  4F1V A;  3MAM A;  3S9E A;  1MQH A;  4PC9 A;  4I8C A;  3IAZ A;  1DTG A;  2Z8F A;  5CM6 A;  3O29 A;  3LBS A;  3R7X A;  3JZJ A;  3MBP A;  4O8M A;  4ELO A;  4GXS B;  1LAH E;  3PTY A;  1PBP A;  4N91 A;  3EHS A;  4GD5 A;  3MVW A;  1TWY A;  2HAU A;  4EF1 A;  2I4B A;  1R6Z A;  3G3I A;  4IB2 A;  3TTM A;  3DLN A;  4P8B A;  1QGX A;  2Y7P A;  4PBH A;  4NE4 A;  3KFM A;  1B40 A;  4PAF A;  2L5V A;  3BFT A;  2XXY A;  3C4M A;  4R6K A;  1FQF A;  3O6I A;  4GX3 A;  1JVY A;  3IL1 B;  3K6V A;  2XWK A;  1KWH A;  3ZS6 A;  3SEV A;  2ABH A;  3MVY A;  3FBP A;  5IZZ A;  1B3L A;  2KR0 A;  3B6W A;  3V89 B;  4X1B A;  3PUX E;  1LBV A;  3OD7 A;  3PPN A;  1B1H A;  1LAX A;  3IJO B;  3VLU A;  3O9P A;  2XX9 A;  3RT8 A;  5L8D A;  4MJO A;  2Y84 A;  2I3V A;  4NHB A;  1AOV A;  3K1P A;  3OO9 A;  1FPG A;  4KD5 A;  2B3F A;  3IB1 A;  1Y9U A;  2F3B A;  4ELQ A;  3CVG A;  1AWB A;  2I48 A;  2PMS A;  3TKD A;  5I57 B;  4RNS A;  3RPL B;  2CEY A;  1UTH B;  4GF8 A;  2HPG A;  4DI4 B;  4EQ7 A;  2B4L A;  1JQF A;  4IY6 A;  1IIT A;  3IX1 A;  3LUZ A;  3MZ9 A;  4OFJ A;  2HHM A;  1MXU A;  4HS7 A;  3KSX A;  1ELJ A;  1DTZ A;  2VPO A;  5CBR A;  5I59 B;  1BKA A;  3OMB A;  1M5B A;  2A5S A;  4JWX A;  3VLV A;  2FVZ A;  3SZP A;  4BDQ A;  4F3B A;  1S9T A;  4H5G A;  3IR1 A;  2F5X A;  3O28 A;  4FJP A;  1SYI A;  2F34 A;  3VDF A;  4N4U A;  3U65 A;  3EHU A;  1PDA A;  5AA3 A;  3TCH A;  4YKJ A;  3FVN A;  2VPN A;  3MJN A;  1JW4 A;  5IZ1 A;  4YMA A;  3VLW A;  2Y7W A;  1USY E;  5FHM A;  1IMC A;  3TEP A;  2THI A;  2I49 A;  4NF6 A;  3MPK A;  4BDO A;  3W15 C;  1MQI A;  4N8Y A;  4QHQ A;  4OMB A;  5FHN A;  2E1S A;  5CMK A;  1A99 A;  1IQ7 A;  1QKA A;  3OSR A;  1SYH A;  3CG1 A;  3SES A;  1QUL A;  1TFA A;  1B5I A;  5I2K A;  4FAT A;  4P9K A;  5M2V A;  3RYD A;  1FPI A;  3CG3 A;  1SW2 A;  4FEC A;  3HHG A;  5H8Q B;  5I84 A;  2RF1 A;  3TCG A;  1UQW A;  1LCT A;  1M5E A;  4QFP A;  3EKI A;  2GHB A;  1NMU A;  3MUQ A;  2D21 A;  3RGY A;  2QVV A;  1NUX A;  4YMB A;  1A8F A;  5JEI A;  2WX9 A;  1IMD A;  2UYF A;  1LFH A;  5AA4 B;  5F1Q A;  3QUF A;  1BTJ A;  3N26 A;  2V84 A;  5LDZ A;  2V4C A;  4NWC A;  1NH8 A;  1RDZ A;  3ILT B;  3M3F A;  4U1Z A;  1B51 A;  2ONR A;  1FQD A;  4KYD A;  4H65 A;  1FPJ A;  1EYJ A;  3TMG A;  3IOR A;  3TQW A;  3T96 B;  4HE0 A;  2CMO A;  1OVB A;  4QXD A;  2O69 A;  3UOR A;  2KLF A;  4F1Y A;  4RK2 A;  1LEV A;  5H8Q A;  3TQL A;  4ZEK A;  4NF5 B;  2M8C A;  2O7U A;  1WDN A;  2OZZ A;  1NNP A;  4XXU A;  4I1D A;  1RKM A;  2I0C A;  3CIJ A;  3P7I A;  3T9V A;  1SW5 A;  2XX7 A;  2AL5 A;  4DCX A;  1NV3 A;  1OVT A;  2VOZ A;  2FBP A;  2A5T B;  2XXX A;  4PF8 A;  3EQ1 A;  5JK4 A;  1ZMG A;  2GRV A;  1LBZ A;  3ONM A;  2X26 A;  2F6P A;  3ZKL A;  1LBX A;  1B3F A;  4MF3 A;  2XXV A;  4WEP A;  2KQZ A;  4RYA A;  2ZYN A;  1H43 A;  2HCA A;  4HE2 A;  3E79 A;  2PT1 A;  1T0K A;  1JEU A;  4YKK A;  3I3V A;  4QSD A;  4G4P A;  5EYH A;  2XWV A;  4LAT A;  4PET A;  4LZ5 A;  1QUK A;  4YB5 A;  5EQ9 A;  4YIC A;  3Q25 A;  4ND9 A;  2YLN A;  2ZXT A;  1EZO A;  1NUW A;  5I58 A;  3H6V A;  1B7H A;  2X7Q A;  1DPP A;  3UK4 A;  2OWS A;  5EQ7 A;  4GWZ A;  4YB7 A;  1IXI A;  4JVC A;  5ELV A;  2DE2 A;  1FQA A;  4Q0C A;  1ZKB A;  3FXU A;  4F3S A;  5K2X A;  1EZP A;  3FVK A;  4QSC A;  3UGW A;  4KYE A;  4C1T A;  4OEV A;  4F31 B;  1ZU0 A;  1YPN A;  4O94 A;  2QS3 A;  4F2Q A;  5I7I A;  5AA2 B;  3B8B A;  1IMF A;  3ISP A;  1DK4 A;  3C32 A;  3MVX A;  2V3T A;  3IOU A;  4AQ4 A;  4OZ9 A;  4ISU A;  3E13 X;  4NF4 B;  1H45 A;  4G8M A;  1GVC A;  3VVE A;  1MXW A;  2QVU A;  3G7W A;  1S7Y A;  2D5W A;  2ALU A;  5AE4 A;  5TPA A;  4IGT A;  3N94 A;  1FTO A;  5I3S A;  4GRK A;  5FTH A;  4I3E A;  2DYX A;  1FTM A;  2HEU A;  4N17 A;  5DVJ A;  2DVC A;  1D3K A;  4F18 A;  2XXI A;  1XI6 A;  4IO4 A;  5JTY B;  3IOT A;  3U8Q A;  4OYV A;  4QFN A;  4QSE A;  2DWH A;  4XF5 A;  5IZ3 A;  1FW0 A;  5AA2 D;  1D9Y A;  2P2A A;  1Q9D A;  1NUZ A;  1Y1M A;  4IO2 A;  3UN6 A;  1FJ6 A;  4Q5T A;  4O7I A;  2CZH A;  3DP4 A;  4Z7E A;  3OO7 A;  4EF2 A;  4GIZ A;  3PV0 E;  2RKM A;  4Q8R A;  3SET A;  2HXW A;  3VVF A;  4YU0 A;  3NOH A;  4QFO A;  3U1O A;  4U1O A;  5CRY A;  4PFU A;  4OAN A;  1OQH A;  1SD3 A;  1FTL A;  5F24 A;  4GWU A;  1FRP A;  4JDF A;  4PAI A;  5EQA A;  3RLF E;  3BFU A;  5CBS A;  4PTK A;  5DTB A;  5H8H B;  4LON B;  5EHS A;  4ZE8 A;  2IEE A;  3HPI A;  2F7C A;  3HCQ A;  5H8S A;  3WAE A;  4ELP A;  2VD2 A;  2RIN A;  1XVY A;  3HV1 A;  3SEU A;  3PPO A;  3IFC A;  4GLI A;  4U2R A;  4I3Y A;  5CI5 A;  1Q35 A;  4PFY A;  1NNT A;  2H4I A;  4H67 A;  3V5A A;  4MNC A;  2F7B A;  2P0S A;  3PUZ E;  4ZED A;  3B7D A;  2VGQ A;  5BWJ A;  2VP1 A;  1LGB C;  2VD3 A;  2WBD A;  3SDF A;  2H98 A;  2JJK A;  3HFU A;  1QUJ A;  1BIY A;  1B7Z A;  3RNN A;  3U72 A;  4YKP A;  4WED A;  1PBQ A;  3S2V A;  1K9Y A;  1B0L A;  1MH3 A;  5LOM A;  1WOD A;  4PGP A;  3FV2 A;  1EYI A;  4U21 A;  3K4U A;  3ODB A;  3JV9 A;  3MP1 A;  4AS4 A;  1FBP A;  3ZKK A;  1JET A;  2BJI A;  4ESX A;  1LBY A;  1VE4 A;  1A8E A;  4ZS9 A;  2LAO A;  1JW5 A;  5CMB A;  4JSD A;  1YXI A;  3K6W A;  4NF0 A;  2F8D A;  3KZG A;  3O66 A;  2G29 A;  2O68 A;  4P1L A;  2NOO A;  2H99 A;  1FQB A;  3ZSF A;  3IB0 A;  5ET6 A;  4RK9 A;  3LSL A;  3T9H B;  1IXC A;  3QAX A;  2I6E A;  5HPQ A;  3LV0 A;  1TFD A;  4OFL A;  3FXQ A;  3KN8 A;  1MDP 1;  1OLC A;  1ZJL A;  1BP5 A;  3H3G A;  3PUW E;  2XXK A;  1M5F A;  2Y5L A;  1LCF A;  3VXC A;  5A5L A;  2E0S A;  3PMV A;  1IMA A;  4HE1 A;  4PBQ A;  3BKI B;  1O64 A;  2Q9T A;  4F29 A;  5IAI A;  2ZNS A;  4NX1 A;  3G3H A;  1UIU A;  4GQO A;  2UVJ A;  2F97 A;  3PPR A;  3LSW A;  2F7A A;  5H8N A;  1FPF A;  1MY3 A;  2XD2 A;  3TEL A;  1N04 A;  1P1O A;  2UVI A;  2CZK A;  4EXK A;  4OVS A;  1YTV A;  4ZZE A;  3BIG A;  1NNF A;  2Z23 A;  4R6H A;  4EQ9 A;  4KQP A;  4G68 C;  2F6G A;  3RPL A;  1OIB A;  4F2O A;  2P3V A;  5EQ8 A;  2QSX A;  2ZYO A;  4POX A;  3QSL A;  4RPO A;  3SER A;  1URD A;  1MH4 A;  1O63 A;  4DXC A;  1JP4 A;  3CSB A;  4AB5 A;  2PVU A;  1A54 A;  4ONY A;  2UYE A;  1KA0 A;  1US4 A;  4QF9 A;  4OWD A;  2H25 A;  2WEF A;  3HHF A;  3FGS A;  2P1S A;  1B3E A;  4GWO A;  1G0H A;  3BBR A;  1YZ0 A;  4U22 A;  2HZL A;  3G3F A;  4TLL B;  3K6U A;  4KXP A;  4NGU A;  3OEK A;  2WYK A;  4H1X A;  3LSX A;  3H6U A;  4LA9 A;  3RQT A;  3KSJ A;  3DEL B;  1P1Q A;  2REG A;  1VFE A;  3RN8 A;  3LR1 A;  3FD3 A;  3IJX B;  4HW8 A;  3S9M C;  1OLA A;  2AYS A;  3CFL A;  2CZL A;  4R2F A;  4P47 A;  3WAF A;  4NED A;  4FBP A;  1Y20 A;  1JVX A;  3QMF A;  1N84 A;  2GFE A;  2XXT A;  3T93 B;  4E0X A;  3IFA A;  2R71 A;  2AL4 A;  1LLS A;  3QXM A;  3IOW A;  2UVG A;  2PBW A;  1FPL A;  4AB6 A;  2PFY A;  5I57 A;  2DWA A;  1Y1Z A;  1NV6 A;  5ITO A;  2F3D A;  3T9U A;  1DOT A;  4PCD A;  4GOT A;  3LUY A;  4XEQ A;  1IXG A;  4GL0 A;  1INP A;  2CZI A;  2O7I A;  4JWY A;  2OWT A;  3H6T A;  4GX6 A;  3MW0 A;  4HXV A;  2DS9 A;  3CRB A;  2XXR A;  4X9T A;  4YKI A;  2ZZW A;  3H7M A;  1LB9 A;  3R6U A;  4ZEF A;  4NF6 B;  1FBF A;  3CHG A;  1JW1 A;  4IGR A;  5ET5 A;  5H8N B;  1HSL A;  3Q27 A;  4GWW A;  3N6T A;  4RY1 A;  3OO8 A;  2P3N A;  3FVO A;  1YYZ A;  2GQ1 A;  5DEX B;  3PPQ A;  3M3L A;  1Y3N A;  2YPN A;  3O2A A;  3RTF B;  4PF6 A;  5ET7 A;  1QW0 A;  2OLB A;  3KOT A;  1MY1 A;  3V8X B;  3E78 A;  3SEX A;  4R75 A;  2ZNU A;  2XX8 A;  5TPA B;  2Z8E A;  1B58 A;  2Y5K A;  3RUM A;  1US5 A;  1MXY A;  2H9B A;  4EUO A;  4PGN A;  3D4C A;  4OEN A;  4E0W A;  4FEB A;  4WXJ A;  3L6G A;  1LFG A;  3TOD A;  4KI0 E;  1HSJ A;  1FBC A;  1RYO A;  4G2Z A;  1KZ8 A;  4G68 A;  4YAH X;  3MYU A;  2Z22 A;  3OXN A;  3CR9 A;  1J1N A;  4O7M A;  4MBP A;  5K2Y A;  5KZT A;  4PFW A;  5I58 B;  2XXP A;  1LFI A;  4LZ8 A;  1TT1 A;  1M5C A;  2NWJ A;  1EZ9 A;  4FED A;  5IM2 A;  3VVD A;  1XVX A;  1DCU A;  3OOA A;  4R73 A;  4LVQ A;  2XXQ A;  3KBZ A;  1MY4 A;  4JB7 A;  1QVS A;  5I2N B;  3QUJ A;  3PD8 A;  5H8F B;  1ZBM A;  3Q29 A;  3MST A;  1PC3 A;  4MH5 A;  4NTL A;  3EF7 A;  1B7U A;  4NF8 B;  4ESW A;  4M4G A;  4PDD A;  4PDH A;  1I6A A;  1MM7 A;  1P99 A;  2QS4 A;  2ESN A;  1JNF A;  2HXR A;  4OET A;  1YAE A;  4BDN A;  3W9W A;  1MY0 A;  5BUU A;  2D3I A;  1SBP A;  2OX3 A;  1VDW A;  4G77 A;  4IY5 A;  4OTE A;  2B3B A;  1LBW A;  3L6H A;  5HM4 B;  1RDX A;  4NAP A;  3BIH A;  1N3W A;  4R9G A;  3TYH A;  4PP0 A;  2QRY A;  3CI8 A;  3HST A;  3K1M A;  4R9F A;  1B4H A;  4NN3 A;  4YB6 A;  4NF8 A;  1PB8 A;  2O1L A;  4H8J A;  1AL3 A;  4F3P A;  4R72 A;  2Q2C A;  3DP8 A;  4H8I A;  3C34 A;  3C35 A;  4RPN A;  2Q8J A;  1FTJ A;  4XFE A;  1FPD A;  1NV0 A;  3M3K A;  5B70 A;  4PE3 A;  3E9X A;  1EH3 A;  3FAS A;  3EPE A;  3T9X B;  4DI3 D;  4PQJ A;  1IUD A;  4F39 A;  3MWB A;  2Y7I A;  3MVZ A;  3PUY E;  4BLA A;  2ZZV A;  1B32 A;  2ZNT A;  4N07 A;  5TU0 A;  4JWO A;  3N6U A;  2Q89 A;  2OCU A;  1Z7M E;  2OBG A;  2BJJ X;  2FIX A;  2O51 A;  5CMM A;  4OVJ A;  2QFL A;  5CC2 A;  1NFT A;  1DMB A;  1MG1 A;  4P0G A;  1NI9 A;  2V3U A;  5JTY A;  2I58 A;  3DP6 A;  3VFJ A;  3RPW A;  1MRP A;  2FA7 A;  4PFR A;  5TP9 B;  4RJZ A;  4P0I A;  5KCJ B;  3PMW A;  2DE3 A;  3MQ9 A;  4JSO A;  4R74 A;  1AIV A;  3TDJ A;  3QYT A;  4MHF A;  1B9J A;  4DXB A;  4YZZ A;  4OES A;  4TQU Q;  2Y7R A;  4AS5 A;  1QJM A;  4P1E A;  5I2K B;  4R6Y A;  4KFQ A;  1GTK A;  1IIW A;  1KA1 A;  5ITP A;  1HSE A;  2CEX A;  3OO6 A;  2R9J A;  4MCO A;  3OSQ A;  1CE2 A;  1R9L A;  4NF5 A;  5H8H A;  1ZIU A;  3D1R A;  5TP9 A;  2WKY A;  3IO6 A;  1PEB A;  4UAB A;  4PFB A;  4DIG A;  4DLD A;  3S9L C;  2FNC A;  1VFD A;  3LSF B;  2AIX A;  1L5T A;  3EHT A;  1LB8 A;  3PMX A;  1GGG A;  4P56 A;  4BDL A;  3DM0 A;  2B4M A;  3K0V A;  3MP6 A;  2HZK A;  3D4G A;  3FXB A;  3E3K A;  5ICQ A;  2NXO A;  4DCY A;  3S9N C;  3S4U A;  5ET8 A;  2G93 A;  3C33 A;  4XKP A;  1A7L A;  2FIE A;  3Q28 A;  3H4Z A;  3GBA A;  1B1X A;  3GBB A;  1LBC A;  3LC8 A;  4KPT A;  3R26 A;  3JYR A;  2B65 A;  3K00 A;  4GWY A;  1UTH A;  2W7Y A;  1UIV A;  1NV7 A;  1FBG A;  3OEL A;  1SW4 A;  1N0T A;  3H06 B;  5DVF A;  4GBW A;  4KYS A;  4ZZA A;  3A29 A;  4Q30 B;  3A3C A;  3FZV A;  3QIM A;  4KR5 A;  1FPE A;  5I2N A;  4IR8 A;  1DPE A;  2GHA A;  1II5 A;  3FJM A;  1D9Q A;  4H46 A;  3C9H A;  4G8H A;  1XOC A;  4LUB A;  4TLM B;  4MEV A;  4G8N A;  2DXR A;  3TAJ A;  1FJ9 A;  1EU8 A;  4JXI A;  4GWS A;  1FQC A;  4DZ1 A;  3HO7 A;  1QUI A;  1P1U A;  2QL3 A;  3GXA A;  4H5F A;  3FXR A;  3M8U A;  5KCJ A;  3KC1 A;  4U4X A;  4ZEI A;  1H3D A;  1SVX B;  1POY 1;  4L17 A;  1R1N A;  5J1D A;  4O3A A;  5IKB A;  4N81 A;  4GL8 A;  2O1M A;  1LST A;  4MX6 A;  3O97 A;  5A5X A;  4MLV A;  4MIJ A;  2REJ A;  4C0R A;  2XD3 A;  2VHA A;  4GXA A;  4X8R A;  1SW1 A;  5FBP A;  2PYY A;  2PFZ A;  3CFZ A;  3N5L A;  3K01 A;  5I5P A;  1IMB A;  3AXF A;  4LQ5 A;  4HCY A;  4DE8 A;  3PGF A;  3IK6 B;  1MM6 A; 
#chains in the Genus database with same CATH homology
 3V83 A;  1MDQ A;  3TZA A;  2I3W A;  4Z0I A;  3FVO A;  2DE4 A;  2F36 A;  2UVH A;  1SQY A;  4C1T A;  1MQJ A;  4OEV A;  4F31 B;  1ZU0 A;  1UTB A;  1YPN A;  1N3X A;  5DEX B;  3FIR A;  4U23 A;  3PPQ A;  3M3L A;  2DSF A;  2QS3 A;  1MXZ A;  4F2Q A;  1Y3N A;  4NF4 A;  1MXV A;  2F78 A;  2YPN A;  4FIM A;  4G68 B;  3O2A A;  4IO3 A;  4BDM A;  3RTF B;  5AA2 B;  3G3J A;  1QW0 A;  1IEJ A;  2RCA A;  3IB2 A;  1URG A;  1B0H A;  2HFB A;  1MY1 A;  2OLB A;  3C32 A;  3KJT A;  3KOT A;  3MVX A;  4N6P A;  4EQB A;  3V8X B;  2QS1 A;  4NWD A;  3KOS A;  3KBR A;  2V3T A;  4HCW A;  2O6A A;  3IOU A;  4OZ9 A;  1M5D A;  1Y3Q A;  2ZNU A;  3FVG A;  3E13 X;  4ISU A;  4R75 A;  2XX8 A;  1S50 A;  2QMW A;  3O6H A;  4NF4 B;  5TPA B;  4X48 A;  3I5O A;  2Z8E A;  1H45 A;  4G8M A;  2H5Y A;  1B58 A;  1MXW A;  2QMX A;  1GVC A;  3VVE A;  1FCK A;  3RUM A;  2QS2 A;  2O84 X;  4KHZ E;  3G7W A;  4OXV A;  1US5 A;  1S7Y A;  1MXY A;  2D5W A;  2H9B A;  2ALU A;  3K6X A;  4PFT A;  4QRZ A;  4EUO A;  4KCC A;  5FTI A;  4XIG Q;  5CMC A;  5TPA A;  1UTB B;  3D4C A;  1VR5 A;  4OEN A;  5DEX A;  1B6H A;  4IGT A;  1NL5 A;  3N94 A;  3RY3 A;  3UP9 A;  1FTO A;  4ZEB A;  1VSO A;  3PD9 A;  1Y4C A;  4GFR A;  4E0W A;  4ELR A;  4OFO A;  3FUZ A;  2XXH A;  4GRK A;  2DXY A;  4PE5 B;  5FTH A;  2DYX A;  4FEB A;  4WXJ A;  3L6G A;  1FTM A;  1LFG A;  3FV1 A;  3TOD A;  2V93 A;  4KI0 E;  2HEU A;  1HSJ A;  3TUS A;  1RYO A;  4F1V A;  4G2Z A;  3MAM A;  4G68 A;  3S9E A;  1MQH A;  5DVJ A;  2DVC A;  4YAH X;  1D3K A;  1B52 A;  4F18 A;  1MPC A;  2XXI A;  2Z22 A;  2QJE A;  1MPB A;  2RC9 A;  3OXN A;  3CFX A;  1BLF A;  1J1N A;  3CR9 A;  3IAZ A;  4I8C A;  1DTG A;  2Z8F A;  5CM6 A;  3O29 A;  4IO4 A;  3EN3 A;  3LBS A;  3R7X A;  5JTY B;  4MBP A;  3JZJ A;  3IOT A;  5K2Y A;  5KZT A;  3MBP A;  3U8Q A;  4OYV A;  4ELO A;  4GXS B;  1LAH E;  4PFW A;  5I58 B;  3H03 A;  4QFN A;  1SI0 A;  1PBP A;  4QSE A;  2DWH A;  3EHS A;  5AA1 A;  1FW0 A;  1NH7 A;  4GD5 A;  2XXP A;  1D9Y A;  2ZMB A;  1PB9 A;  3IOV A;  2P2A A;  1LFI A;  3MVW A;  1TWY A;  3MZ1 A;  4ZE8 A;  3T66 A;  1N76 A;  2HAU A;  1I6B A;  4LZ8 A;  3U92 A;  1AMF A;  5DYH A;  3VE1 B;  1TT1 A;  4EF1 A;  1M5C A;  1Y1M A;  1EZ9 A;  2I4B A;  1R6Z A;  3G3I A;  3A3U A;  1XVX A;  3KGC A;  4FED A;  3DLN A;  4IB2 A;  2DQV A;  4Q5T A;  4UAC A;  2Y7P A;  3OOA A;  5I59 A;  3DP4 A;  1B05 A;  4Z7E A;  4R73 A;  4UA8 A;  3OO7 A;  4K3F A;  3KFM A;  4LVQ A;  4NE4 A;  4EF2 A;  2XXQ A;  1B40 A;  4GIZ A;  4AQ4 A;  3PV0 E;  3UA8 A;  2V25 A;  1MY4 A;  2RKM A;  3FJ7 A;  3SET A;  3BFT A;  2HXW A;  2XXY A;  4JB7 A;  3VVF A;  4Q8R A;  3C4M A;  4YU0 A;  1QVS A;  2XXW A;  3B6Q A;  4R6K A;  2FYI A;  5AA2 A;  5I2N B;  3QUJ A;  1FQF A;  3O6I A;  1JVY A;  3PD8 A;  3IL1 B;  4QFO A;  4YZZ A;  1ZBM A;  3Q29 A;  5H8F B;  3U1O A;  3K6V A;  4U1O A;  4EDP A;  5CRY A;  4GVO A;  4ECF A;  4PFU A;  1KWH A;  1PC3 A;  4MH5 A;  3SEV A;  3ZS6 A;  4NTL A;  2ABH A;  3MVY A;  4H0W A;  1OQH A;  3EF7 A;  1B7U A;  1SD3 A;  4NF8 B;  3VV5 A;  4ESW A;  1B3L A;  1FTL A;  4M4G A;  5AE4 A;  3MPL A;  3OEM A;  3Q26 A;  5L9O A;  4JDF A;  4IO6 A;  3B6W A;  3V89 B;  3RLF E;  3BFU A;  3PUX E;  4X1B A;  2OJT A;  5CBS A;  4QFK A;  3OD7 A;  3SEY A;  3PPN A;  3C36 A;  5DTB A;  3USD A;  1I6A A;  2RC7 A;  2HQ0 A;  1PB7 A;  5H8H B;  1B1H A;  1LAX A;  4LON B;  3IJO B;  4BLA A;  1P1N A;  5EHS A;  3VLU A;  1MM7 A;  1P99 A;  1POT A;  3O9P A;  2IEE A;  2XX9 A;  3HPI A;  2QS4 A;  2ESN A;  4QFL A;  1JNF A;  2F7C A;  4LZ7 A;  3RT8 A;  4OET A;  3HCQ A;  1YAE A;  5H8S A;  5L8D A;  3WAE A;  4BDN A;  3GZG A;  4ELP A;  5A5X B;  3W9W A;  2VD2 A;  2RIN A;  1MY0 A;  5ISU A;  1XVY A;  3HV1 A;  5BUU A;  3SEU A;  1I69 A;  2Y84 A;  2D3I A;  1SBP A;  2I3V A;  4R2B A;  3PPO A;  3I6V A;  4G77 A;  4IY5 A;  1AOV A;  4GLI A;  4OTE A;  2B3B A;  3K1P A;  4U2R A;  1B4Z A;  3FJG A;  3L6H A;  5CI5 A;  3OO9 A;  5HM4 B;  4KD5 A;  1NKX A;  2B3F A;  3F11 A;  1Q35 A;  3IB1 A;  1Y9U A;  4HTG A;  1N3W A;  4R9G A;  4ELQ A;  3CVG A;  2I48 A;  2PMS A;  4PFY A;  3TYH A;  1NNT A;  2H4I A;  4H67 A;  4O3B A;  4PP0 A;  3TKD A;  3V5A A;  2QRY A;  3CI8 A;  3HST A;  5I57 B;  3K1M A;  4R9F A;  1QKB A;  2F7B A;  2P0S A;  4RNS A;  4I9D A;  3PUZ E;  4ZED A;  1B4H A;  3B7D A;  2VGQ A;  1UTH B;  4GF8 A;  5BWJ A;  2VP1 A;  1LGB C;  3QK6 A;  1D4N A;  2VD3 A;  4YB6 A;  3SKP A;  4NF8 A;  4EQ7 A;  3SDF A;  3SEW A;  2H98 A;  3TCF A;  3UIF A;  1JQF A;  1ATG A;  1OQG A;  1F9B A;  1QUJ A;  1PB8 A;  1IIT A;  4IY6 A;  2O1L A;  1BIY A;  4H8J A;  4F1U A;  1AL3 A;  3IX1 A;  4F3P A;  4R72 A;  2Q2C A;  3MZ9 A;  1B5H A;  1B7Z A;  4OFJ A;  3DP8 A;  2XXU A;  4H8I A;  3RNN A;  3U72 A;  3C34 A;  4YKP A;  4WED A;  1MXU A;  3C35 A;  2IA4 A;  4HS7 A;  4RPN A;  2Q8J A;  1FTJ A;  1PBQ A;  1RYX A;  3M3K A;  4N13 A;  5B70 A;  3E9X A;  3IO4 A;  3S2V A;  3KSX A;  1EH3 A;  1B0L A;  1DTZ A;  1ELJ A;  2DWI A;  1MH3 A;  3EPE A;  3FAS A;  3T9X B;  5LOM A;  5CBR A;  4PQJ A;  1WOD A;  1IUD A;  1SI1 A;  3FV2 A;  1XT8 A;  2Y7I A;  3MWB A;  3MVZ A;  4F39 A;  5I59 B;  1MQD A;  3PUY E;  4U21 A;  3K4U A;  3ODB A;  1B32 A;  2ZNT A;  3CSG A;  1BKA A;  4FOR A;  3JV9 A;  3OMB A;  1M5B A;  2A5S A;  4N07 A;  3U93 A;  3C31 A;  3MP1 A;  4JWX A;  5TU0 A;  3VLV A;  4JWO A;  3B6T A;  3ZKK A;  3HN0 A;  4BDQ A;  1SDX A;  3N6U A;  4POW A;  1JET A;  1S9T A;  2Q89 A;  4ESX A;  4F3B A;  2DVZ A;  2OCU A;  1B3G A;  1Z7M E;  4H5G A;  3IR1 A;  2OBG A;  2F5X A;  3O28 A;  4FJP A;  1SYI A;  2BJJ X;  2O51 A;  1VE4 A;  2F34 A;  5CMM A;  1FTK A;  4IO2 A;  4OVJ A;  3E4R A;  3UN6 A;  3PPP A;  1A8E A;  4ZS9 A;  3VDF A;  5CC2 A;  2LAO A;  1NFT A;  1JW5 A;  5L9M A;  5CMB A;  1DMB A;  4JSD A;  1MG1 A;  1PDA A;  3EHU A;  3K6W A;  4XKR A;  5AA3 A;  3TCH A;  1XS5 A;  4P0G A;  4YKJ A;  2V3U A;  3PUV E;  2I58 A;  3DP6 A;  3TTK A;  5JTY A;  1MS7 A;  3FVN A;  3VFJ A;  4U4S A;  3MJN A;  2F8D A;  2UXA A;  3MC2 A;  3KZG A;  3RPW A;  1I6Q A;  3O66 A;  1JW4 A;  4JBZ A;  2RC8 A;  4C1U A;  1MRP A;  2FA7 A;  2G29 A;  4YMA A;  2O68 A;  5TP9 B;  3VLW A;  4RJZ A;  2Y7W A;  5KDT A;  4P0I A;  4XKN A;  5KCJ B;  2NOO A;  1LAF E;  3G3K A;  2H99 A;  3PMW A;  1FQB A;  3ILU B;  3VXC A;  3ZSF A;  2DE3 A;  5B7D A;  3IB0 A;  1USY E;  3MQ9 A;  4JSO A;  3GLB A;  3LSL A;  4R74 A;  4RK9 A;  1AIV A;  3T9H B;  3TDJ A;  3QYT A;  5FHM A;  1IXC A;  3QAX A;  1MQG A;  2I6E A;  3TEP A;  2I0B A;  5HPQ A;  1B9J A;  1MPD A;  2THI A;  3MZB A;  4DXB A;  1TFD A;  2I49 A;  4NF6 A;  3MPK A;  2PT2 A;  2R6G E;  3FXQ A;  4OES A;  4OFL A;  3KN8 A;  4TQU Q;  2Y7R A;  1MDP 1;  4OER A;  4BDO A;  4RXL A;  1OLC A;  4XKQ A;  1QJM A;  4OEU A;  2F35 A;  5DVI A;  3W15 C;  1ZJL A;  1BP5 A;  1MQI A;  5I2K B;  4QHQ A;  4R6Y A;  3H3G A;  3PUW E;  4KFQ A;  1GTK A;  1IIW A;  4OMB A;  4P11 A;  5FHN A;  5ITP A;  1M5F A;  1B5J A;  2DWJ A;  2E1S A;  1HSE A;  5FHO A;  5CMK A;  5I56 A;  1A99 A;  2DOJ A;  1IQ7 A;  1JEV A;  1QKA A;  1LCF A;  1MY2 A;  1SYH A;  3CG1 A;  3OSR A;  4X1D A;  4ZDM A;  1QUL A;  2E0S A;  3OO6 A;  3PMV A;  1TFA A;  1B5I A;  3SES A;  1ANF A;  2OK2 A;  5I2K A;  3BKI B;  2R9J A;  4F3G A;  4FAT A;  4XTC Q;  1O64 A;  2Q9T A;  2ANJ A;  4F29 A;  1H44 A;  2ZYM A;  3OSQ A;  5M2V A;  1CE2 A;  1R9L A;  5IAI A;  4NF5 A;  3CG3 A;  5H8H A;  1YCJ A;  1SW2 A;  1ZIU A;  2HAV A;  2ZNS A;  3HHG A;  4FEC A;  3TTN A;  5TP9 A;  2WKY A;  3G3H A;  5H8Q B;  2RF1 A;  3IO6 A;  1GV8 A;  1UQW A;  3TCG A;  4DDD A;  1PEB A;  3RTW B;  5I84 A;  1LCT A;  3OEN A;  1UIU A;  2ONS A;  4GQO A;  2UVJ A;  2F97 A;  1M5E A;  4QFP A;  4ZE9 A;  4DIG A;  4DLD A;  4FE8 A;  3PPR A;  2GHB A;  3S9L C;  3LSW A;  2F7A A;  5H8N A;  1NMU A;  1MY3 A;  2FNC A;  1A40 A;  2XD2 A;  3MUQ A;  3TEL A;  1N04 A;  1VFD A;  2D21 A;  1P1O A;  3LSF B;  5F7V A;  3RGY A;  2Q88 A;  2UVI A;  1IZ1 A;  4EXK A;  4YMB A;  1YTV A;  4ZZE A;  3VXB A;  2AIX A;  1A8F A;  1L5T A;  3EHT A;  1LB8 A;  1NNF A;  1WVJ A;  4OHN A;  2Z23 A;  5JEI A;  4M1V A;  3PMX A;  1GGG A;  4R6H A;  4EQ9 A;  1P1W A;  4LQ2 A;  4BDL A;  2UYF A;  3DM0 A;  3U94 A;  1LFH A;  2DP8 A;  3K0V A;  2NUV A;  4KQP A;  4G68 C;  2F6G A;  1OIB A;  4F2O A;  3ECR A;  5AA4 B;  5F1Q A;  3MP6 A;  4NMY A;  2QSX A;  4H6D A;  3QUF A;  2ZYO A;  1BTJ A;  2HZK A;  2V84 A;  3D4G A;  3N26 A;  4I62 A;  3RT6 B;  3TTM A;  1OMP A;  3E3K A;  4NWC A;  5ICQ A;  1NH8 A;  2ZYK A;  4POX A;  4WKM A;  4LP2 B;  4OQO A;  2NXO A;  3ILT B;  3QSL A;  4DCY A;  3M3F A;  4RPO A;  4U1Z A;  3S9N C;  1B51 A;  2ONR A;  3S4U A;  3SER A;  1URD A;  1MH4 A;  2Y7K A;  2G93 A;  1FQD A;  4KYD A;  2Q2A A;  3C33 A;  1O63 A;  1N7W A;  4H65 A;  1NNK A;  4XKP A;  4DXC A;  1A7L A;  3CSB A;  4AB5 A;  5I56 B;  4FAJ A;  3KG2 A;  5KDT B;  3TMG A;  2PVU A;  3Q28 A;  1A55 A;  1A54 A;  1FQE A;  3H4Z A;  3IOR A;  3GBA A;  3TQW A;  3T96 B;  4KCD A;  2ONK E;  2UYE A;  4ONY A;  1CB6 A;  1US4 A;  3VVD A;  1B1X A;  2CMO A;  1LBC A;  3GBB A;  2NWJ A;  4QF9 A;  4OWD A;  3LC8 A;  2H25 A;  3HHF A;  3FGS A;  1OVB A;  2P1S A;  3R26 A;  3JYR A;  1B3E A;  4GWO A;  4KPT A;  2O69 A;  3BBR A;  3UOR A;  2B65 A;  3K00 A;  1D9V A;  2KLF A;  4U22 A;  2HZL A;  3G3F A;  4TLL B;  1UTH A;  2W7Y A;  3G3G A;  1UIV A;  3K6U A;  4F1Y A;  4RK2 A;  5H8Q A;  4MLQ A;  3TQL A;  1DSN A;  2A5T A;  2RCB A;  1SW4 A;  3A09 A;  1N0T A;  3OEL A;  3OEK A;  4ZEK A;  3K02 A;  3KN3 A;  3H06 B;  4NF5 B;  2M8C A;  2O7U A;  1WDN A;  4KYS A;  5DVF A;  2OZZ A;  1NNP A;  4H1X A;  4Q30 B;  3LSX A;  4XXU A;  4I1D A;  4ZZA A;  3TTL A;  1RKM A;  3A3C A;  3H6U A;  4LA9 A;  5ICT A;  3FZV A;  2I0C A;  3QIM A;  3KSJ A;  4KR5 A;  3CIJ A;  3DEL B;  4IO5 A;  1XHY A;  3P7I A;  3RQT A;  1P1Q A;  1SW5 A;  3K1N A;  3T9V A;  2XX7 A;  1DPE A;  5I2N A;  2GHA A;  2REG A;  2AL5 A;  1VFE A;  1II5 A;  3FJM A;  3H6W A;  5EHM A;  4DCX A;  1GR2 A;  3C9H A;  5EYF A;  4G8H A;  3FAT A;  3LR1 A;  3RN8 A;  4EXL A;  3FD3 A;  1XOC A;  3IJX B;  4HW8 A;  3S9M C;  1OLA A;  4LUB A;  2AYS A;  3CFL A;  4TLM B;  2CZL A;  1OVT A;  4R2F A;  3WAF A;  4NED A;  4G8N A;  1IXH A;  4THI A;  2DXR A;  3KEI A;  3TAJ A;  2X7P A;  1Y20 A;  2VOZ A;  1JVX A;  1N84 A;  2GFE A;  2XXT A;  2A5T B;  2XXX A;  3T93 B;  4E0X A;  2GH9 A;  5DT6 A;  1EU8 A;  3EQ1 A;  4JXI A;  1N7X A;  2XHD A;  5JK4 A;  1ZMG A;  2R71 A;  1ZTY A;  2AL4 A;  1FQC A;  1LLS A;  3K2D A;  4DZ1 A;  1Y3P A;  2GRV A;  3ONM A;  3KJ7 A;  2X26 A;  3HO7 A;  1QUI A;  1LAG E;  1P1U A;  2F6P A;  3QXM A;  2QL3 A;  3GXA A;  4H5F A;  3ZKL A;  3FXR A;  3IOW A;  1B3F A;  4F19 A;  2UVG A;  2PBW A;  4MF3 A;  4BDR A;  3M8U A;  2XXV A;  4WEP A;  3TFL A;  5KCJ A;  5L9S A;  1Y4T A;  2V3Q A;  4F22 A;  4AB6 A;  1USY H;  4RYA A;  2ZYN A;  4U4X A;  4ZEI A;  1H43 A;  2DWA A;  2HCA A;  5I57 A;  5AA2 D;  1H3D A;  3O6G A;  4O3C A;  5H8F A;  2PT1 A;  1Y1Z A;  1T0K A;  1URS A;  3KN7 A;  1JEU A;  1SVX B;  1POY 1;  4YKK A;  4L17 A;  3I3V A;  1R1N A;  4QSD A;  5J1D A;  1H76 A;  4G4P A;  1MXX A;  4O3A A;  5ITO A;  2NVU B;  5IKB A;  3T9U A;  4LAT A;  4PET A;  1DOT A;  1R9Q A;  4GOT A;  3LUY A;  4GL8 A;  2I4C A;  4LZ5 A;  3TTR A;  1QUK A;  2O1M A;  1LST A;  1IXG A;  3O97 A;  2YJP A;  4GL0 A;  4MFI A;  4YB5 A;  5A5X A;  4MLV A;  2Z8D A;  5AA4 A;  4YIC A;  3Q25 A;  2O7I A;  1O7T A;  2REJ A;  4JWY A;  2XD3 A;  2YLN A;  4ND9 A;  4C0R A;  2ZXT A;  2OWT A;  1EZO A;  1TXF A;  3H6T A;  3W9V A;  5I58 A;  3MW0 A;  3H6V A;  2DS9 A;  1B7H A;  4DXU A;  2VHA A;  2X7Q A;  1DPP A;  3CRB A;  4GXA A;  1SW1 A;  3UK4 A;  1B2H A;  2XXR A;  2OWS A;  1B46 A;  4X9T A;  3T22 A;  5HBC A;  4ZEC A;  2PYY A;  4YB7 A;  4YKI A;  1B3H A;  1Q1K A;  3H7M A;  1LB9 A;  1IXI A;  3CFZ A;  3N5L A;  3R6U A;  1ZLQ A;  5ELV A;  3SEX A;  3K01 A;  2DE2 A;  4ZEF A;  1FQA A;  4NF6 B;  1AH5 A;  4Q0C A;  3AXF A;  1ZKB A;  4LQ5 A;  3FXU A;  1LBB A;  3THI A;  1JW1 A;  4IGR A;  4F3S A;  2QPQ A;  4HCY A;  3MP8 A;  2PX1 A;  5K2X A;  4DE8 A;  5H8N B;  1EZP A;  3FVK A;  1HSL A;  3Q27 A;  3TPA A;  4QSC A;  3N6T A;  3PGF A;  4TOZ A;  3IK6 B;  4RY1 A;  1Z7N E;  3OO8 A;  1XC1 A;  1MM6 A;  3PU5 A;  4RA1 A;  3UGW A;  4IO7 A;  4KYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...