1N84A

Human serum transferrin, n-lobe
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Serotransferrin
publication title THE POSITION OF ARGININE 124 CONTROLS THE RATE OF IRON RELEASE FROM THE N-LOBE OF HUMAN SERUM TRANSFERRIN. A STRUCTURAL STUDY
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2002-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n84A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1n84A02
3G3FA 3ILUB 4GXSB 2A5TB 5L9MA 2I3WA 1S9TA 4ZECA 4IY5A 4H6DA 4YMBA 5DEXA 3VLVA 1T0KA 4O3CA 5J1DA 3DP4A 1FQFA 1RYXA 3OSQA 3QXMA 2QJEA 2OBGA 3CFXA 3LSWA 1TFDA 3OOAA 3R26A 1R9LA 4ZE9A 3FXUA 5JTYA 1MQGA 4OENA 3OEMA 2X7PA 3B7DA 4KD5A 1FQAA 1URDA 2Q88A 3CIJA 2BJJX 2AYSA 1SW1A 3UA8A 4MLVA 1AOVA 4R74A 4UACA 3OO9A 4U22A 2YJPA 2O7IA 2IEEA 4KFQA 4KYDA 5DT6A 4OVJA 1NMUA 3HV1A 2RCBA 3FJMA 4N13A 2B65A 5B7DA 2HZLA 3TZAA 4EDPA 2FNCA 3T96B 1ZTYA 5CMBA 2R6GE 1Q1KA 3FVGA 2FA7A 4G68B 4TOZA 1FCKA 4R75A 3P7IA 4POWA 1PBPA 4ELOA 3TTKA 4MF3A 1JETA 4JWOA 3FVNA 2VGQA 2I4BA 4AB5A 1QUJA 4OFOA 2CMOA 1D9YA 3G3JA 5ICTA 4HW8A 3CG1A 5DTBA 3KOTA 3H03A 4QSDA 3OMBA 1B3LA 2X7QA 4I62A 1IZ1A 3CFLA 5CMCA 3O29A 1Y4TA 2UYFA 4MFIA 1VSOA 2Y7KA 3PD8A 4ESWA 5IAIA 3KN7A 3VXBA 2QMXA 1LB8A 4PQJA 4NF5B 1R6ZA 3S9LC 3K6UA 1QVSA 1M5EA 3HCQA 4QRZA 4PETA 3MVYA 4NE4A 4XXUA 5H8QA 4R72A 1Z7ME 2E0SA 4MLQA 4LP2B 2O1LA 2PBWA 3MZ9A 1O7TA 4L17A 3T93B 3FATA 3A3CA 4NF8B 4FAJA 4C1TA 1H45A 1SW4A 2DVCA 3TCGA 3IO4A 1PB9A 1VFEA 2ZXTA 2F97A 2I49A 1B3HA 3C9HA 4XKRA 1N84A 3JYRA 3UORA 2F6PA 2QSXA 5H8FA 3C34A 3OSRA 4H0WA 1B7ZA 3FJ7A 5B70A 5EHMA 3U1OA 1UTBB 1DOTA 1B7HA 1LLSA 5AA3A 1NKXA 3G3GA 1QUIA 4G68C 4P11A 3ILTB 1ZIUA 1MXZA 1P1NA 1WODA 3U8QA 3G3KA 1UTHB 4QFKA 2CZLA 1UIUA 3EHSA 3E3KA 4P0IA 3PPNA 2F7BA 2XXUA 5A5XA 2Q2CA 2IA4A 2UVHA 5I59B 4R2FA 4IO5A 3C35A 1FQDA 4RY1A 1LCTA 3IX1A 2G93A 2ZYMA 1NH7A 2LAOA 5HBCA 3KN8A 1JW4A 3MZBA 3AXFA 1EZOA 5EHSA 3OO8A 3IORA 3LSFB 2I0CA 3QIMA 1PDAA 1MY1A 2O51A 1ELJA 1FQCA 2HZKA 3RY3A 4OEUA 1B4HA 4U4XA 2XXXA 4E0WA 1SBPA 4NF8A 1JVYA 1WVJA 3K4UA 4GIZA 1NFTA 3T9VA 3TELA 1EU8A 5KCJB 3K1MA 4KYSA 2RC7A 3HPIA 5H8HA 4H67A 1TFAA 3C32A 5I2NB 4YKPA 1A7LA 3S9MC 1FTKA 2F34A 3S2VA 4M4GA 3U92A 4XKNA 2F78A 2QMWA 2O1MA 4G77A 3T9HB 1US5A 4RXLA 1MG1A 2OCUA 2XXWA 4HTGA 2REJA 4YMAA 3PMXA 2O6AA 1SI1A 1PB7A 3W9WA 5I2KB 3FVKA 1GVCA 4I9DA 3N94A 4KI0E 4IO3A 1N0TA 3CG3A 2RC9A 1JW1A 3QSLA 4X9TA 1VE4A 3PUXE 4C1UA 1QKBA 3SEVA 1SI0A 3SEXA 1B5JA 3QAXA 4ZEBA 4FECA 1B3FA 4OWDA 4OESA 3THIA 3DP6A 1FTMA 1L5TA 5TP9B 3GZGA 4F19A 4F2OA 1MXVA 5I57A 2PT2A 3PGFA 4JB7A 1HSLA 4HS7A 4NMYA 4KPTA 4GL0A 1A54A 3IO6A 3K1PA 4HCWA 2H98A 3RNNA 1LAHE 4GL8A 3HHFA 1N7XA 4OXVA 2DXYA 4U21A 4POXA 2DVZA 4KHZE 1UQWA 3H6UA 1P1UA 1QULA 2GFEA 4Z0IA 1IXGA 4QFPA 3HSTA 4M1VA 3G3IA 4RK9A 4EXKA 4IY6A 3S4UA 4H5FA 1P1OA 2DQVA 5DEXB 1H3DA 1D3KA 2HXWA 4EQBA 1MH3A 4WKMA 3TQLA 2O7UA 1OVBA 2HEUA 3PMWA 2ONRA 2I3VA 1NNKA 1FQEA 4LUBA 1SW2A 4PFTA 2QS3A 5DVJA 5JTYB 1B40A 4OHNA 1DTGA 3PUWE 3SDFA 4H1XA 2XD2A 3MP1A 1A99A 4DZ1A 3K6VA 3PUZE 3V5AA 1II5A 4IGRA 1B52A 5CI5A 4F18A 2F7CA 5JEIA 3CI8A 3VV5A 1ATGA 5L9OA 4LATA 1I69A 3BKIB 1Y3PA 4JBZA 4NWDA 2G29A 4NWCA 3VVFA 3QYTA 5TPAA 4PFWA 4H65A 4EUOA 4YB6A 4DCXA 4MH5A 4Q0CA 1Y9UA 1MPDA 3FV1A 3MP6A 3MZ1A 3DLNA 4IO6A 1FQBA 1TT1A 1B58A 3SESA 2XX8A 2NXOA 1B0LA 1LFGA 5AA2A 2THIA 4KYEA 4ZEKA 3VDFA 4YB7A 4KR5A 3Q26A 3JV9A 1XVYA 3BBRA 2RCAA 4F3SA 5ICQA 3H06B 4R6KA 5F7VA 4PFUA 1XS5A 4TLMB 1AMFA 4YZZA 4YB5A 4G2ZA 3QUJA 3L6GA 4OMBA 1MY3A 3TPAA 1B32A 1ZLQA 3WAFA 1GTKA 1LAFE 4H5GA 2DE3A 3RTFB 3PUYE 2XHDA 3DELB 5TU0A 1MQDA 4WEDA 3TMGA 2UVJA 3VVEA 4U2RA 2PT1A 5ITOA 4EQ7A 1MXWA 4IO4A 1KWHA 2XXQA 3FZVA 1Y1ZA 4R9GA 5H8QB 3B6WA 3O2AA 4UA8A 4P0GA 4F39A 5L8DA 4U23A 1GR2A 2XXYA 3MWBA 4F3BA 4LZ5A 2OLBA 4U1OA 4XKPA 1NNFA 4EXLA 4BDMA 1SVXB 1B46A 2ZYNA 4KCDA 3IAZA 5JK4A 1FTLA 1USYH 3C36A 4R6HA 1M5CA 3TFLA 5H8FB 2D5WA 4H8IA 1S7YA 3KGCA 4OZ9A 3O28A 2Z8DA 4N6PA 3SEYA 2HAUA 1MQHA 4EF2A 1LFHA 3K2DA 2NVUB 3R7XA 3G7WA 3OEKA 3E9XA 4IO7A 1B05A 3N5LA 3N6UA 1DMBA 3PV0E 5A5XB 1MXXA 1NH8A 2AL5A 3TKDA 1SD3A 4U1ZA 3CSBA 3MC2A 2Y7WA 2DWAA 3RGYA 4NF6A 4GRKA 3IK6B 1DSNA 1I6AA 3JZJA 3HO7A 1BP5A 2DP8A 2Q2AA 2XXRA 1R9QA 2WKYA 4AQ4A 4GFRA 3VXCA 5KDTA 5CMMA 3IOWA 3VLWA 2DXRA 3H6TA 3SKPA 2P2AA 1BTJA 5H8HB 3T9XB 1NL5A 1P99A 2Z23A 2DWJA 2V84A 5CBRA 5K2XA 2ONSA 3UIFA 4E0XA 5HPQA 3KZGA 4GD5A 3B6TA 1Y1MA 5CRYA 1YTVA 4GVOA 2UXAA 1B5IA 1PC3A 3OENA 1NNTA 4OEVA 1MRPA 4FATA 3O66A 2NWJA 2XXPA 3TAJA 3Q29A 2V93A 3M3FA 1Y3QA 1AH5A 1MM7A 3PD9A 3RTWB 1BKAA 1JNFA 1OMPA 2D3IA 2I58A 4QSCA 2DS9A 1VFDA 3RLFE 1FTOA 1N04A 2HQ0A 3KJ7A 1YPNA 1B3EA 2DWIA 3MVWA 3TCHA 2ZNSA 1B6HA 3EN3A 1OLAA 2FYIA 2H99A 3H6WA 2HFBA 4TQUQ 3FIRA 2QS4A 5EYFA 2Q89A 4JWYA 4EF1A 5I57B 2RC8A 3FXRA 3IB1A 2ZNTA 4KCCA 1GV8A 1LAGE 2Y84A 1QUKA 4LQ2A 2PX1A 1A55A 1AL3A 4GF8A 3GXAA 1IEJA 3MBPA 3EPEA 4ZE8A 4F3PA 3C33A 1B1XA 3HN0A 1M5BA 4NF4A 3E13X 4DXUA 2ZYKA 1WDNA 3TTRA 1JEVA 4OFJA 1XOCA 4DCYA 4F1VA 1VR5A 1MY4A 4K3FA 2QPQA 1P1QA 1IQ7A 1SDXA 2P1SA 4BDNA 1IXHA 3LBSA 1URGA 4DXBA 4ND9A 2UVIA 1M5FA 4ELPA 2DWHA 1SQYA 5DVFA 3FD3A 2O68A 3V8XB 2RINA 5FHNA 1Q35A 4GOTA 3KN3A 4R2BA 3WAEA 5I58A 5I56A 2ONKE 4RK2A 3TQWA 3OD7A 1LAXA 4QF9A 1D4NA 3M8UA 4ZZEA 2QS2A 1IIWA 4GXAA 1BIYA 5AA4A 3O6IA 5TPAB 4GQOA 4YICA 3RT6B 1MY0A 4R6YA 1OVTA 3VVDA 4BDLA 2XXIA 1MPCA 1Z7NE 3IB2A 3LR1A 3MUQA 2VD3A 3H4ZA 3TTMA 2VP1A 5AA2B 3TTLA 4X1DA 2HAVA 5I84A 4BLAA 3W9VA 4ELQA 1ZJLA 2PYYA 3VE1B 1NNPA 2XX7A 1PEBA 4F31B 1Y4CA 1Y20A 4QFOA 1A8EA 4X48A 1MM6A 3M3KA 1XT8A 4H8JA 2AL4A 2V3TA 3TUSA 4QSEA 4O3AA 4LQ5A 2OWTA 1N76A 4I8CA 3CSGA 3SERA 4G4PA 3IOTA 3K6WA 4BDOA 4F1YA 3Q27A 3UK4A 2I4CA 2XXVA 3S9NC 1RKMA 2GHBA 3U72A 3K1NA 4Q8RA 1JQFA 1OLCA 4F1UA 5H8NA 4LVQA 2GHAA 2YPNA 3IB0A 2F8DA 2Z8FA 1POY1 3LC8A 4F22A 1EH3A 3MVZA 3QK6A 1B5HA 1YAEA 1MQJA 3H3GA 1F9BA 5AA2D 3LSLA 3OO6A 1A40A 1D9VA 1B2HA 1PBQA 5HM4B 1H43A 3IR1A 3SEWA 2KLFA 3V83A 4LONB 3KOSA 2DE4A 1B51A 4RYAA 4Q30B 3FUZA 2Q8JA 5ITPA 1OQHA 1IXIA 3O9PA 1LB9A 1LFIA 5CC2A 3BFTA 2Y7PA 1OIBA 5KZTA 3T66A 4OETA 3KSXA 1MH4A 3KEIA 3TODA 2QRYA 1JEUA 1FTJA 2ABHA 2GH9A 3GLBA 3KSJA 1MQIA 1OQGA 1HSJA 4XKQA 1LSTA 3O6HA 2HCAA 3C31A 4LZ8A 4ISUA 3H7MA 4BDRA 4NF6B 4RNSA 3ONMA 4OFLA 4FEDA 4DE8A 4QHQA 1S50A 2ANJA 5F1QA 1LGBC 3I6VA 2XXTA 4ECFA 3I3VA 3KG2A 3IL1B 5KDTB 4QFLA 3UN6A 4LZ7A 3PUVE 1QKAA 3K00A 2Z22A 1RYOA 4F2QA 3R6UA 1EZ9A 2XXHA 3ZS6A 3CFZA 4DDDA 2F6GA 3N26A 3OO7A 3KBRA 3K01A 2R9JA 2OZZA 5DYHA 2M8CA 3EF7A 1IXCA 2B3FA 1B7UA 2VD2A 3VLUA 2VHAA 1ZBMA 3GBBA 1I6QA 2ESNA 4R73A 4IB2A 2A5TA 1LBCA 2H25A 1IITA 2GRVA 3T9UA 3D4GA 1H76A 3IJXB 3M3LA 3LSXA 1CB6A 5BWJA 3KFMA 1USYE 4QFNA 3EHUA 3ZKLA 3TDJA 4C0RA 3RQTA 3FXQA 1O64A 2Y7RA 1JW5A 3A3UA 5K2YA 2ZMBA 1B3GA 4OYVA 2OJTA 2H4IA 3LUYA 2XD3A 1MPBA 5ELVA 4THIA 2R71A 5FHOA 3Q28A 4JSDA 2ZNUA 1B0HA 1B1HA 1MS7A 4RPNA 1IUDA 3MPLA 4F3GA 1AIVA 2O69A 1MXYA 2V3QA 4ZEDA 1FW0A 3CR9A 1TWYA 1JVXA 3B6QA 3K0VA 4NF4B 3IOVA 1DPEA 1B4ZA 1Y3NA 1R1NA 4OERA 3HHGA 1N7WA 4G68A 3FASA 1O63A 4I1DA 4DLDA 4GWOA 3IOUA 3MVXA 4DIGA 4ELRA 2VOZA 4PP0A 2QL3A 1SYHA 1LCFA 4EQ9A 1SYIA 5ISUA 3VFJA 1GGGA 4AB6A 3MP8A 4RA1A 1DPPA 2I0BA 4FJPA 4G8HA 4JDFA 3PU5A 4YKJA 1MY2A 4PFYA 1ANFA 2OK2A 5I58B 1URSA 5I56B 3G3HA 5FTIA 1M5DA 2DOJA 3FGSA 2V25A 1LBBA 1N3XA 1HSEA 3N6TA 3UP9A 3PPOA 4NF5A 4YAHX 3D4CA 3PMVA 1TXFA 1XC1A 5AA4B 3QUFA 3OELA 3MJNA 3CRBA 1EZPA 4GLIA 3K02A 4HCYA 4X1BA 1YCJA 1A8FA 3FJGA 1UIVA 4OQOA 4ESXA 3U93A 4LA9A 3KJTA 2DE2A 4KQPA 5AA1A 4G8MA 4ZEIA 1MDQA 2A5SA 3H6VA 3FV2A 3SETA 1MDP1 4OTEA 4YKIA 4ZZAA 3EQ1A 1PB8A 3A09A 4RJZA 3MPKA 5FTHA 4JWXA 1ZMGA 4Q5TA 1XHYA 4R9FA 3MAMA 3USDA 5M2VA 1P1WA 1I6BA 1QW0A 5CBSA 5LOMA 5CMKA 1UTBA 2W7YA 2Z8EA 2DYXA 2Y7IA 4NTLA 4DXCA 1H44A 1N3WA 2XX9A 2AIXA 4FIMA 3TYHA 3OXNA 2YLNA 2P0SA 2I48A 1UTHA 3Q25A 4YU0A 3O6GA 5H8NB 4YKKA 3PPQA 4BDQA 3CVGA 4WEPA 2OWSA 4N07A 2PMSA 5I59A 3IJOB 2REGA 1J1NA 1ZU0A 1BLFA 3DM0A 1DTZA 2UVGA 2H5YA 2B3BA 3O97A 3L6HA 2F5XA 3RUMA 3V89B 4O3BA 4XIGQ 2UYEA 2QS1A 2Q9TA 3RPWA 3FVOA 3GBAA 3DP8A 1CE2A 2D21A 4FE8A 2F35A 3I5OA 4ZS9A 3ZKKA 2I6EA 2H9BA 5KCJA 2F36A 4G8NA 4JSOA 4WXJA 3BFUA 3TTNA 4ONYA 5I2NA 4ZDMA 5FHMA 3ODBA 3SEUA 5BUUA 3UGWA 2V3UA 1QJMA 3MQ9A 2ALUA 2X26A 5H8SA 4RPOA 2PVUA 4XTCQ 1SW5A 3C4MA 2DSFA 3MW0A 4ZEFA 2ZYOA 2NOOA 4Z7EA 2RKMA 4MBPA 5I2KA 3E4RA 1XVXA 5CM6A 4U4SA 3ECRA 1ZKBA 3K6XA 2O84X 5IKBA 2F7AA 3RN8A 4IGTA 3W15C 5L9SA 3U94A 3F11A 4FORA 2NUVA 5TP9A 3S9EA 5AE4A 3T22A 3TEPA 4FEBA 4IO2A 4JXIA 4TLLB 2E1SA 1B9JA 1US4A 3EHTA 1POTA 4NEDA 4F29A 4PE5B 3ZSFA 3TCFA 2RF1A 3PPPA 3PPRA 1MXUA 3RT8A 5DVIA
chains in the Genus database with same CATH superfamily
3G3FA 3ILUB 4GXSB 2A5TB 5L9MA 2I3WA 4UABA 1S9TA 4ZECA 1NV7A 4IY5A 4H6DA 4YMBA 5DEXA 3VLVA 1T0KA 4O3CA 5J1DA 3DP4A 2CZKA 2B4MA 1FQFA 1FPGA 1RYXA 3OSQA 3QXMA 2QJEA 2OBGA 3CFXA 3LSWA 1TFDA 3OOAA 3R26A 3D1RA 1R9LA 4ZE9A 3FXUA 5JTYA 1MQGA 4OENA 3OEMA 2X7PA 2XXKA 3B7DA 4KD5A 1FQAA 1URDA 1YXIA 4XF5A 2Q88A 3CIJA 2BJJX 3KC0A 2AYSA 4MNCA 1SW1A 3UA8A 4MLVA 1AOVA 4R74A 4UACA 3OO9A 4MHFA 4U22A 2YJPA 2O7IA 2IEEA 4KFQA 4KYDA 5DT6A 4MEVA 1Q9DA 4OVJA 1NMUA 1RDZA 3HV1A 2RCBA 3FJMA 4N13A 2B65A 5B7DA 2HZLA 3TZAA 4EDPA 2FNCA 3T96B 2CEXA 1ZTYA 2CEYA 5CMBA 2R6GE 1FTAA 1Q1KA 3FVGA 2FA7A 4G68B 4TOZA 5IGAA 1FCKA 4OA4A 4R75A 4MMPA 4N6DA 3P7IA 5I3SA 4HXVA 4POWA 4NAPA 1PBPA 4ELOA 3TTKA 4MF3A 1JETA 4JWOA 3FVNA 4PAFA 2VGQA 2I4BA 4AB5A 1QUJA 4OFOA 4PAKA 2CMOA 1D9YA 3G3JA 5ICTA 4HW8A 3CG1A 5DTBA 3KOTA 3H03A 4QSDA 3OMBA 1B3LA 4PDHA 4OVSA 2X7QA 4I62A 1IZ1A 3CFLA 5CMCA 3O29A 1Y4TA 2UYFA 4MFIA 1VSOA 2FIXA 2Y7KA 3PD8A 4ESWA 5IAIA 3KN7A 3VXBA 2QMXA 1LB8A 4PQJA 4NF5B 1R6ZA 3S9LC 1KA0A 3K6UA 5IM2A 1QVSA 4PBHA 1M5EA 3HCQA 3NOHA 4QRZA 4PETA 3MVYA 4NE4A 4XXUA 4LN5A 1NV5A 2CZHA 5H8QA 4R72A 1Z7ME 2L5VA 2E0SA 4JVIA 4MLQA 4LP2B 2O1LA 2PBWA 3MZ9A 1O7TA 2WX9A 3GYYA 4L17A 3T93B 3FATA 3A3CA 4NF8B 4FAJA 4C1TA 1H45A 1SW4A 2DVCA 3TCGA 3IO4A 1NV4A 1PB9A 1VFEA 2ZXTA 2F97A 2I49A 1B3HA 1EYKA 2FVZA 3C9HA 5EQ9A 4XKRA 1N84A 3JYRA 3UORA 2F6PA 4NG7A 2QSXA 1IMBA 5H8FA 3C34A 3OSRA 4H0WA 1B7ZA 3FJ7A 5B70A 5EHMA 4I3YA 3U1OA 1UTBB 5EQ8A 1DOTA 1B7HA 1LLSA 5AA3A 1NKXA 3G3GA 1QUIA 4G68C 4P11A 3ILTB 3RPLB 1ZIUA 1NUYA 1MXZA 1P1NA 1WODA 4DI3D 3U8QA 3G3KA 1UTHB 1G0IA 3A29A 4QFKA 2CZLA 1LEVA 1UIUA 3EHSA 3E3KA 4P0IA 4AS5A 3PPNA 2F7BA 2XXUA 5A5XA 2Q2CA 2IA4A 2UVHA 5I59B 4R2FA 4IO5A 3C35A 1FQDA 4RY1A 1LCTA 3IX1A 2G93A 2ZYMA 1NH7A 2LAOA 5HBCA 3KN8A 1JW4A 3MZBA 3AXFA 1EZOA 5EHSA 3OO8A 3IORA 3LSFB 2I0CA 3QIMA 1PDAA 4NX1A 4PGPA 1MY1A 2O51A 4QXDA 1ELJA 1FQCA 2HZKA 3RY3A 4OEUA 1B4HA 4U4XA 2XXXA 4E0WA 1SBPA 4PTKA 4NF8A 1JVYA 2P3VA 1WVJA 3K4UA 4GIZA 4OVQA 1NFTA 3T9VA 3TELA 1EU8A 5KCJB 3K1MA 4KYSA 2RC7A 5ET7A 3HPIA 5H8HA 4H67A 1TFAA 3C32A 5I2NB 4YKPA 1A7LA 3S9MC 1FTKA 2F34A 3S2VA 4M4GA 2WEFA 3U92A 4XKNA 2F78A 2QMWA 2O1MA 4G77A 3T9HB 1NUZA 4PFBA 1US5A 4RXLA 1MG1A 2OCUA 2XXWA 4HTGA 3QMFA 2REJA 4MX6A 4YMAA 3PMXA 2O6AA 1SI1A 1PB7A 3W9WA 5EQ7A 5I2KB 3FVKA 1GVCA 4I9DA 3FBPA 3N94A 4KI0E 4IO3A 3HFUA 4NGUA 1N0TA 3CG3A 2RC9A 1JW1A 3QSLA 4X9TA 1VE4A 4XFEA 3PUXE 4C1UA 1QKBA 3SEVA 1SI0A 3SEXA 1B5JA 4N8YA 3QAXA 4ZEBA 4FECA 1B3FA 4OWDA 4OESA 3THIA 3DP6A 1FTMA 1L5TA 5TP9B 1CNQA 3GZGA 4F19A 4F2OA 1MXVA 5I57A 2PT2A 1K9YA 3PGFA 4JB7A 1HSLA 4HS7A 4NMYA 4KPTA 2Y5LA 3E79A 4GL0A 1A54A 3IO6A 1EYJA 3K1PA 4HCWA 2H98A 3RNNA 1LAHE 4GL8A 3HHFA 1N7XA 4OXVA 2DXYA 2XWOA 2XA5A 4U21A 4POXA 2DVZA 4KHZE 4PGNA 1UQWA 3H6UA 1IMFA 1P1UA 4FBPA 1QULA 2GFEA 4Z0IA 1IXGA 4PE3A 3HSTA 4M1VA 4QFPA 2WBDA 3G3IA 4RK9A 4EXKA 4IY6A 1LBXA 3S4UA 4H5FA 1P1OA 2DQVA 5DEXB 1H3DA 1D3KA 2HXWA 4EQBA 1MH3A 4WKMA 3TQLA 2O7UA 1OVBA 2HEUA 3PMWA 2ONRA 2I3VA 1NNKA 1FQEA 4LUBA 1SW2A 4PFTA 2QS3A 5DVJA 1FPKA 5JTYB 1B40A 4OHNA 1DTGA 3PUWE 3SDFA 4H1XA 2FHYA 2XD2A 2Q74A 1A99A 3MP1A 3SZPA 4DZ1A 3K6VA 3PUZE 1JP4A 3V5AA 1II5A 4IGRA 1B52A 5CI5A 2F7CA 4F18A 5JEIA 3CI8A 3VV5A 1ATGA 5L9OA 4LATA 5LDZA 1I69A 3BKIB 5EYHA 1Y3PA 2P3NA 4JBZA 4NWDA 2G29A 4NWCA 3VVFA 3QYTA 5TPAA 4PFWA 4H65A 4EUOA 4YB6A 4DCXA 4MH5A 4Q0CA 1Y9UA 1MPDA 3FV1A 3MP6A 3MZ1A 4NF0A 3DLNA 4IO6A 1FQBA 1TT1A 1B58A 3SESA 2XX8A 1BK4A 2NXOA 5I7IA 1B0LA 1LFGA 5AA2A 2THIA 4KYEA 4ZEKA 3VDFA 4P3LA 4YB7A 4KR5A 3Q26A 3JV9A 1XVYA 3BBRA 2RCAA 4F3SA 5ICQA 3H06B 2VPNA 4R6KA 4H46A 5F7VA 3B8BA 4PFUA 1XS5A 4TLMB 1AMFA 4YZZA 4YB5A 4G2ZA 3QUJA 3L6GA 4OMBA 4P47A 1MY3A 4HE2A 3TPAA 1B32A 1ZLQA 4OANA 3WAFA 1GTKA 1LAFE 1NV0A 4H5GA 2DE3A 3RTFB 3PUYE 2XHDA 3DELB 5TU0A 1MQDA 4WEDA 1FPLA 4PAIA 3TMGA 2UVJA 3VVEA 4U2RA 2PT1A 5ITOA 4EQ7A 1MXWA 4IO4A 1KWHA 2XXQA 3FZVA 1Y1ZA 4R9GA 2R8TA 5H8QB 1FSAA 3B6WA 3O2AA 4UA8A 4P0GA 4F39A 5L8DA 2DDKA 4U23A 1GR2A 2ZZXA 2XXYA 3MWBA 4F3BA 4LZ5A 2OLBA 2QVUA 4U1OA 4XKPA 1NNFA 3LUZA 4EXLA 4BDMA 1SVXB 1B46A 2ZYNA 4KCDA 3IAZA 5JK4A 1FTLA 1XI6A 1USYH 4G61A 4N81A 3C36A 4R6HA 1M5CA 4PF6A 3TFLA 5H8FB 1QGXA 2D5WA 4H8IA 1S7YA 3KGCA 4OZ9A 3O28A 4MJOA 2Z8DA 4N6PA 3SEYA 4GBWA 2HAUA 1MQHA 4EF2A 1LFHA 3K2DA 2NVUB 3R7XA 3G7WA 3OEKA 3E9XA 4IO7A 1B05A 3N5LA 3N6UA 4O94A 1DMBA 3PV0E 5A5XB 1MXXA 1NH8A 2AL5A 3TKDA 1SD3A 4U1ZA 5LTCA 3CSBA 3MC2A 2Y7WA 2DWAA 3RGYA 4NF6A 4GRKA 3IK6B 1DSNA 4MAGA 1I6AA 3JZJA 3HO7A 1BP5A 2DP8A 2Q2AA 2XXRA 1R9QA 2WKYA 2XWKA 1FBEA 2Y5KA 4AQ4A 4GFRA 3VXCA 5KDTA 3MYUA 5CMMA 3IOWA 2BJIA 3VLWA 2DXRA 3H6TA 1KA1A 3SKPA 2P2AA 1BTJA 4GWSA 5H8HB 3T9XB 1NL5A 1P99A 2F3BA 2Z23A 2DWJA 2V84A 5CBRA 4PCDA 5K2XA 2ONSA 3UIFA 4E0XA 5HPQA 4GX6A 3KZGA 4GD5A 5ET8A 3B6TA 5DW8A 1Y1MA 5CRYA 1YTVA 4GVOA 2UXAA 1B5IA 1PC3A 3OENA 1NNTA 4OEVA 2VT5A 1MRPA 4FATA 3O66A 1FBPA 2NWJA 2XXPA 3TAJA 3Q29A 2QVRA 4OVRA 2V93A 3M3FA 1Y3QA 1AH5A 1MM7A 3PD9A 3RTWB 1BKAA 1JNFA 1OMPA 2D3IA 2I58A 4QSCA 2DS9A 1VFDA 3RLFE 4H45A 4P1LA 1FTOA 1N04A 2HQ0A 3KJ7A 1YPNA 3CHGA 1B3EA 2DWIA 3MVWA 3TCHA 2ZNSA 1B6HA 3EN3A 1OLAA 2FYIA 2H99A 3H6WA 2HFBA 4TQUQ 3FIRA 2QS4A 5EYFA 2Q89A 4JWYA 4EF1A 4N17A 3MSTA 3KC1A 5I57B 2RC8A 3FXRA 3IB1A 2ZNTA 4KCCA 1GV8A 1LBZA 1LAGE 2Y84A 2CZIA 1QUKA 4LQ2A 2PX1A 1A55A 1AL3A 2MKZA 4GF8A 3GXAA 1IEJA 4N8GA 3MBPA 3EPEA 4ZE8A 4F3PA 4PF8A 3C33A 1B1XA 3HN0A 1M5BA 4NF4A 3E13X 3B50A 4DXUA 2ZYKA 1FBFA 1WDNA 1IMEA 3TTRA 1JEVA 4OFJA 1XOCA 4DCYA 1LBWA 4F1VA 1VR5A 1MY4A 4K3FA 2WYPA 2QPQA 1P1QA 1IQ7A 1SDXA 5EYGA 2P1SA 4BDNA 1IXHA 3LBSA 1URGA 4DXBA 1AWBA 1LBVA 1NV3A 4ND9A 2UVIA 1M5FA 4ELPA 2DWHA 1SQYA 4PDDA 5DVFA 4KXPA 3FD3A 2O68A 3V8XB 2RINA 5FHNA 1Q35A 4GOTA 3KN3A 4R2BA 3WAEA 5I58A 5I56A 1NUWA 2ONKE 4RK2A 1FBGA 3TQWA 3OD7A 1LAXA 4QF9A 1D4NA 4PFIA 3M8UA 4ZZEA 1FPFA 2QS2A 1IIWA 4GXAA 1BIYA 5AA4A 2KR0A 3O6IA 5TPAB 4GQOA 4YICA 3RT6B 1MY0A 4R6YA 3IFCA 1OVTA 3VVDA 3T1BA 4BDLA 2XXIA 1MPCA 4HE0A 1Z7NE 3IB2A 3LR1A 4GX3A 3MUQA 2VD3A 3H4ZA 3TTMA 2VP1A 5AA2B 2PFZA 3TTLA 5I5PA 4X1DA 2HAVA 4OVTA 5I84A 4BLAA 3W9VA 4ELQA 1ZJLA 2PYYA 3VE1B 4GWXA 1NNPA 2XX7A 1FPIA 1PEBA 4F31B 1Y4CA 1Y20A 4GWWA 4QFOA 1A8EA 4X48A 1MM6A 3M3KA 2QFLA 1XT8A 4H8JA 2AL4A 2V3TA 3TUSA 4QSEA 4O3AA 4LQ5A 2OWTA 1N76A 4GWZA 4I8CA 3CSGA 3SERA 4G4PA 3IOTA 3KBZA 3K6WA 4BDOA 4F1YA 4MIJA 1FPEA 3Q27A 3UK4A 2HPGA 2I4CA 1INPA 2XXVA 3S9NC 1RKMA 2GHBA 3U72A 2JJKA 3K1NA 4Q8RA 1JQFA 1OLCA 4F1UA 5IZ3A 5H8NA 4LVQA 2GHAA 2YPNA 3IB0A 2F8DA 2Z8FA 1POY1 3BIHA 3LC8A 4F22A 1EH3A 3MVZA 4I3EA 3QK6A 1B5HA 4X8RA 1YAEA 1MQJA 3H3GA 2ZZWA 5A5LA 1F9BA 5AA2D 2XWIA 3LSLA 3OO6A 3ISPA 5T3JA 1A40A 2FBPA 1D9VA 1B2HA 1PBQA 4P9KA 5HM4B 1H43A 3IR1A 3SEWA 2KLFA 3V83A 4LONB 3KOSA 2DE4A 1B51A 4RYAA 1NUXA 4Q30B 3FUZA 2Q8JA 5ITPA 2FIEA 3T0JA 1OQHA 4XEQA 1IXIA 3O9PA 1LB9A 1LFIA 5CC2A 3BFTA 2Y7PA 1OIBA 5KZTA 3T66A 4OETA 3KSXA 1MH4A 3KEIA 3TODA 3FXBA 4NHBA 2XWVA 2QRYA 1JEUA 1FTJA 4QBAA 2ABHA 2GH9A 3GLBA 3KSJA 1MQIA 1OQGA 1HSJA 1LSTA 4XKQA 3O6HA 2HCAA 2WBBA 3C31A 4LZ8A 4ISUA 4MNPA 5J16A 3H7MA 4BDRA 4NF6B 4RNSA 3ONMA 4P1EA 4OFLA 4FEDA 4DE8A 4QHQA 1S50A 5ET6A 2ANJA 5F1QA 1LGBC 1VDWA 2XXTA 3I6VA 2VPOA 1FJ9A 4ECFA 3I3VA 2HHMA 3KG2A 3IL1B 5KDTB 4QFLA 4N4UA 3UN6A 4LZ7A 3PUVE 1QKAA 3K00A 2Z22A 3IFAA 1RYOA 4F2QA 4N15A 3R6UA 1EZ9A 2XXHA 3ZS6A 4GBVA 3CFZA 4DDDA 1NV6A 2F6GA 3N26A 3OO7A 3KBRA 4O7IA 3K01A 2R9JA 2OZZA 5DYHA 5F24A 2M8CA 3EF7A 1IXCA 2OWZA 2B3FA 1B7UA 2VD2A 3VLUA 2VHAA 1ZBMA 3GBBA 1I6QA 1NV2A 2ESNA 4R73A 4IB2A 2A5TA 1LBCA 4GWYA 2H25A 1IITA 2GRVA 3T9UA 4I40A 4HE1A 3D4GA 4P8BA 1H76A 3IJXB 3M3LA 3LSXA 1CB6A 5BWJA 3KFMA 4GWUA 1USYE 4QFNA 2Q8MA 3EHUA 3ZKLA 4NQ8A 4O8MA 3TDJA 4C0RA 3RQTA 3FXQA 1O64A 2B4LA 2Y7RA 1JW5A 3A3UA 5K2YA 2ZMBA 1B3GA 1FRPA 1DCUA 4OYVA 2OJTA 2H4IA 3LUYA 2XD3A 4N91A 1MPBA 5ELVA 1DK4A 4THIA 2R71A 5FHOA 3Q28A 1K9ZA 4JSDA 3PTYA 2ZNUA 1B0HA 1B1HA 1MS7A 4RPNA 1IUDA 3MPLA 4F3GA 1AIVA 2O69A 1FBHA 1MXYA 2V3QA 4ZEDA 1FW0A 3CR9A 2F3DA 1TWYA 1JVXA 3B6QA 3K0VA 4NF4B 4PFRA 4GX4A 3IOVA 1DPEA 1B4ZA 1NV1A 1Y3NA 1R1NA 4OERA 3HHGA 1N7WA 4G68A 3FASA 1O63A 4I1DA 4DLDA 4GWOA 3IOUA 3MVXA 4JVDA 4DIGA 3EKIA 4ELRA 1SPIA 2VOZA 4PP0A 2QL3A 1SYHA 1DBZA 1YYZA 3RYDA 1LCFA 4EQ9A 1SYIA 5ISUA 3VFJA 1FPJA 1GGGA 4AB6A 3MP8A 4RA1A 1DPPA 2I0BA 1FPBA 4FJPA 4G8HA 1FPDA 4JDFA 3PU5A 4YKJA 4MNIA 1MY2A 4PFYA 1ANFA 2OK2A 4X04A 5I58B 1URSA 5I56B 3G3HA 5FTIA 1M5DA 2DOJA 3FGSA 2V25A 4NN3A 1LBBA 2OX3A 4N6KA 1N3XA 1HSEA 3N6TA 1G0HA 3UP9A 1NI9A 3PPOA 4NF5A 4YAHX 3D4CA 3PMVA 1TXFA 1XC1A 1EYIA 3E78A 4PC9A 3BIGA 5AA4B 3QUFA 3OELA 3MJNA 3CRBA 1EZPA 4GLIA 3K02A 4HCYA 2QVVA 1YCJA 4X1BA 1A8FA 3FJGA 1UIVA 4OQOA 4ESXA 3U93A 4LA9A 3KJTA 2DE2A 4KQPA 5AA1A 4G8MA 4ZEIA 4AS4A 1MDQA 1RDYA 4IR8A 2A5SA 3H6VA 3FV2A 3LV0A 3SETA 1MDP1 4OTEA 4YKIA 1FBCA 4ZZAA 3EQ1A 1PB8A 3A09A 4OVPA 4RJZA 3MPKA 5FTHA 4JWXA 1ZMGA 4Q5TA 1XHYA 4R9FA 3MAMA 3USDA 1FBDA 5M2VA 1P1WA 1I6BA 1QW0A 5CBSA 5LOMA 5CMKA 1UTBA 2W7YA 1IMAA 2Z8EA 2DYXA 2Y7IA 2WYKA 4NTLA 4DXCA 1H44A 1N3WA 2XX9A 5FBPA 2AIXA 4FIMA 3TYHA 5IZZA 3OXNA 3RPLA 2PFYA 2YLNA 2ZZVA 2P0SA 2I48A 1UTHA 3Q25A 4YU0A 3O6GA 5IZ3B 5H8NB 4YKKA 3PPQA 4BDQA 3CVGA 4WEPA 4PBQA 2OWSA 4N07A 2PMSA 5I59A 3IJOB 2REGA 1J1NA 5EQAA 1ZU0A 1BLFA 3DM0A 1DTZA 2UVGA 2H5YA 2KQZA 2B3BA 3O97A 3L6HA 2F5XA 3RUMA 3V89B 4O3BA 4O7MA 4XIGQ 2UYEA 2QS1A 2Q9TA 3RPWA 3FVOA 3GBAA 3DP8A 1CE2A 2D21A 4FE8A 2F35A 3I5OA 4ZS9A 3U65A 3ZKKA 2I6EA 2H9BA 5KCJA 2F36A 4G8NA 4JSOA 4WXJA 3BFUA 3TTNA 2PCRA 4ONYA 5I2NA 2HXRA 1LBYA 1FJ6A 4P56A 5IZ1A 4ZDMA 5FHMA 5ET5A 3ODBA 3SEUA 5BUUA 3UGWA 2V3UA 1QJMA 3ROJA 3MQ9A 2ALUA 2X26A 5H8SA 4RPOA 2PVUA 4XTCQ 1SW5A 3C4MA 2DSFA 3MW0A 4ZEFA 2ZYOA 2NOOA 4Z7EA 2RKMA 4MBPA 5I2KA 3E4RA 1XVXA 5CM6A 4U4SA 3ECRA 1ZKBA 1IMDA 1YZ0A 3K6XA 2O84X 5IKBA 2F7AA 3RN8A 1KZ8A 2GQ1A 4IGTA 3W15C 5L9SA 3U94A 3F11A 4FORA 2NUVA 5TP9A 3S9EA 4JVCA 5AE4A 3T22A 3TEPA 4FEBA 4IO2A 4JXIA 2V4CA 1D9QA 1IMCA 4TLLB 2E1SA 4DI4B 1B9JA 1US4A 3EHTA 1POTA 4NEDA 4F29A 4PE5B 1RDXA 3ZSFA 3TCFA 5ESYA 4MCOA 2RF1A 3PPPA 3PPRA 1MXUA 3RT8A 5DVIA
chains in the Genus database with same CATH topology
3G3FA 3ILUB 4GXSB 2A5TB 5L9MA 2I3WA 1S9TA 4ZECA 4IY5A 4H6DA 4YMBA 5DEXA 3VLVA 1T0KA 4O3CA 5J1DA 3DP4A 1FQFA 1RYXA 3OSQA 3QXMA 2QJEA 2OBGA 3CFXA 3LSWA 1TFDA 3OOAA 3R26A 1R9LA 4ZE9A 3FXUA 5JTYA 1MQGA 4OENA 3OEMA 2X7PA 3B7DA 4KD5A 1FQAA 1URDA 2Q88A 3CIJA 2BJJX 2AYSA 1SW1A 3UA8A 4MLVA 1AOVA 4R74A 4UACA 3OO9A 4U22A 2YJPA 2O7IA 2IEEA 4KFQA 4KYDA 5DT6A 4OVJA 1NMUA 3HV1A 2RCBA 3FJMA 4N13A 2B65A 5B7DA 2HZLA 3TZAA 4EDPA 2FNCA 3T96B 1ZTYA 5CMBA 2R6GE 1Q1KA 3FVGA 2FA7A 4G68B 4TOZA 1FCKA 4R75A 3P7IA 4POWA 1PBPA 4ELOA 3TTKA 4MF3A 1JETA 4JWOA 3FVNA 2VGQA 2I4BA 4AB5A 1QUJA 4OFOA 2CMOA 1D9YA 3G3JA 5ICTA 4HW8A 3CG1A 5DTBA 3KOTA 3H03A 4QSDA 3OMBA 1B3LA 2X7QA 4I62A 1IZ1A 3CFLA 5CMCA 3O29A 1Y4TA 2UYFA 4MFIA 1VSOA 2Y7KA 3PD8A 4ESWA 5IAIA 3KN7A 3VXBA 2QMXA 1LB8A 4PQJA 4NF5B 1R6ZA 3S9LC 3K6UA 1QVSA 1M5EA 3HCQA 4QRZA 4PETA 3MVYA 4NE4A 4XXUA 5H8QA 4R72A 1Z7ME 2E0SA 4MLQA 4LP2B 2O1LA 2PBWA 3MZ9A 1O7TA 4L17A 3T93B 3FATA 3A3CA 4NF8B 4FAJA 4C1TA 1H45A 1SW4A 2DVCA 3TCGA 3IO4A 1PB9A 1VFEA 2ZXTA 2F97A 2I49A 1B3HA 3C9HA 4XKRA 1N84A 3JYRA 3UORA 2F6PA 2QSXA 5H8FA 3C34A 3OSRA 4H0WA 1B7ZA 3FJ7A 5B70A 5EHMA 3U1OA 1UTBB 1DOTA 1B7HA 1LLSA 5AA3A 1NKXA 3G3GA 1QUIA 4G68C 4P11A 3ILTB 1ZIUA 1MXZA 1P1NA 1WODA 3U8QA 3G3KA 1UTHB 4QFKA 2CZLA 1UIUA 3EHSA 3E3KA 4P0IA 3PPNA 2F7BA 2XXUA 5A5XA 2Q2CA 2IA4A 2UVHA 5I59B 4R2FA 4IO5A 3C35A 1FQDA 4RY1A 1LCTA 3IX1A 2G93A 2ZYMA 1NH7A 2LAOA 5HBCA 3KN8A 1JW4A 3MZBA 3AXFA 1EZOA 5EHSA 3OO8A 3IORA 3LSFB 2I0CA 3QIMA 1PDAA 1MY1A 2O51A 1ELJA 1FQCA 2HZKA 3RY3A 4OEUA 1B4HA 4U4XA 2XXXA 4E0WA 1SBPA 4NF8A 1JVYA 1WVJA 3K4UA 4GIZA 1NFTA 3T9VA 3TELA 1EU8A 5KCJB 3K1MA 4KYSA 2RC7A 3HPIA 5H8HA 4H67A 1TFAA 3C32A 5I2NB 4YKPA 1A7LA 3S9MC 1FTKA 2F34A 3S2VA 4M4GA 3U92A 4XKNA 2F78A 2QMWA 2O1MA 4G77A 3T9HB 1US5A 4RXLA 1MG1A 2OCUA 2XXWA 4HTGA 2REJA 4YMAA 3PMXA 2O6AA 1SI1A 1PB7A 3W9WA 5I2KB 3FVKA 1GVCA 4I9DA 3N94A 4KI0E 4IO3A 1N0TA 3CG3A 2RC9A 1JW1A 3QSLA 4X9TA 1VE4A 3PUXE 4C1UA 1QKBA 3SEVA 1SI0A 3SEXA 1B5JA 3QAXA 4ZEBA 4FECA 1B3FA 4OWDA 4OESA 3THIA 3DP6A 1FTMA 1L5TA 5TP9B 3GZGA 4F19A 4F2OA 1MXVA 5I57A 2PT2A 3PGFA 4JB7A 1HSLA 4HS7A 4NMYA 4KPTA 4GL0A 1A54A 3IO6A 3K1PA 4HCWA 2H98A 3RNNA 1LAHE 4GL8A 3HHFA 1N7XA 4OXVA 2DXYA 4U21A 4POXA 2DVZA 4KHZE 1UQWA 3H6UA 1P1UA 1QULA 2GFEA 4Z0IA 1IXGA 4QFPA 3HSTA 4M1VA 3G3IA 4RK9A 4EXKA 4IY6A 3S4UA 4H5FA 1P1OA 2DQVA 5DEXB 1H3DA 1D3KA 2HXWA 4EQBA 1MH3A 4WKMA 3TQLA 2O7UA 1OVBA 2HEUA 3PMWA 2ONRA 2I3VA 1NNKA 1FQEA 4LUBA 1SW2A 4PFTA 2QS3A 5DVJA 5JTYB 1B40A 4OHNA 1DTGA 3PUWE 3SDFA 4H1XA 2XD2A 3MP1A 1A99A 4DZ1A 3K6VA 3PUZE 3V5AA 1II5A 4IGRA 1B52A 5CI5A 4F18A 2F7CA 5JEIA 3CI8A 3VV5A 1ATGA 5L9OA 4LATA 1I69A 3BKIB 1Y3PA 4JBZA 4NWDA 2G29A 4NWCA 3VVFA 3QYTA 5TPAA 4PFWA 4H65A 4EUOA 4YB6A 4DCXA 4MH5A 4Q0CA 1Y9UA 1MPDA 3FV1A 3MP6A 3MZ1A 3DLNA 4IO6A 1FQBA 1TT1A 1B58A 3SESA 2XX8A 2NXOA 1B0LA 1LFGA 5AA2A 2THIA 4KYEA 4ZEKA 3VDFA 4YB7A 4KR5A 3Q26A 3JV9A 1XVYA 3BBRA 2RCAA 4F3SA 5ICQA 3H06B 4R6KA 5F7VA 4PFUA 1XS5A 4TLMB 1AMFA 4YZZA 4YB5A 4G2ZA 3QUJA 3L6GA 4OMBA 1MY3A 3TPAA 1B32A 1ZLQA 3WAFA 1GTKA 1LAFE 4H5GA 2DE3A 3RTFB 3PUYE 2XHDA 3DELB 5TU0A 1MQDA 4WEDA 3TMGA 2UVJA 3VVEA 4U2RA 2PT1A 5ITOA 4EQ7A 1MXWA 4IO4A 1KWHA 2XXQA 3FZVA 1Y1ZA 4R9GA 5H8QB 3B6WA 3O2AA 4UA8A 4P0GA 4F39A 5L8DA 4U23A 1GR2A 2XXYA 3MWBA 4F3BA 4LZ5A 2OLBA 4U1OA 4XKPA 1NNFA 4EXLA 4BDMA 1SVXB 1B46A 2ZYNA 4KCDA 3IAZA 5JK4A 1FTLA 1USYH 3C36A 4R6HA 1M5CA 3TFLA 5H8FB 2D5WA 4H8IA 1S7YA 3KGCA 4OZ9A 3O28A 2Z8DA 4N6PA 3SEYA 2HAUA 1MQHA 4EF2A 1LFHA 3K2DA 2NVUB 3R7XA 3G7WA 3OEKA 3E9XA 4IO7A 1B05A 3N5LA 3N6UA 1DMBA 3PV0E 5A5XB 1MXXA 1NH8A 2AL5A 3TKDA 1SD3A 4U1ZA 3CSBA 3MC2A 2Y7WA 2DWAA 3RGYA 4NF6A 4GRKA 3IK6B 1DSNA 1I6AA 3JZJA 3HO7A 1BP5A 2DP8A 2Q2AA 2XXRA 1R9QA 2WKYA 4AQ4A 4GFRA 3VXCA 5KDTA 5CMMA 3IOWA 3VLWA 2DXRA 3H6TA 3SKPA 2P2AA 1BTJA 5H8HB 3T9XB 1NL5A 1P99A 2Z23A 2DWJA 2V84A 5CBRA 5K2XA 2ONSA 3UIFA 4E0XA 5HPQA 3KZGA 4GD5A 3B6TA 1Y1MA 5CRYA 1YTVA 4GVOA 2UXAA 1B5IA 1PC3A 3OENA 1NNTA 4OEVA 1MRPA 4FATA 3O66A 2NWJA 2XXPA 3TAJA 3Q29A 2V93A 3M3FA 1Y3QA 1AH5A 1MM7A 3PD9A 3RTWB 1BKAA 1JNFA 1OMPA 2D3IA 2I58A 4QSCA 2DS9A 1VFDA 3RLFE 1FTOA 1N04A 2HQ0A 3KJ7A 1YPNA 1B3EA 2DWIA 3MVWA 3TCHA 2ZNSA 1B6HA 3EN3A 1OLAA 2FYIA 2H99A 3H6WA 2HFBA 4TQUQ 3FIRA 2QS4A 5EYFA 2Q89A 4JWYA 4EF1A 5I57B 2RC8A 3FXRA 3IB1A 2ZNTA 4KCCA 1GV8A 1LAGE 2Y84A 1QUKA 4LQ2A 2PX1A 1A55A 1AL3A 4GF8A 3GXAA 1IEJA 3MBPA 3EPEA 4ZE8A 4F3PA 3C33A 1B1XA 3HN0A 1M5BA 4NF4A 3E13X 4DXUA 2ZYKA 1WDNA 3TTRA 1JEVA 4OFJA 1XOCA 4DCYA 4F1VA 1VR5A 1MY4A 4K3FA 2QPQA 1P1QA 1IQ7A 1SDXA 2P1SA 4BDNA 1IXHA 3LBSA 1URGA 4DXBA 4ND9A 2UVIA 1M5FA 4ELPA 2DWHA 1SQYA 5DVFA 3FD3A 2O68A 3V8XB 2RINA 5FHNA 1Q35A 4GOTA 3KN3A 4R2BA 3WAEA 5I58A 5I56A 2ONKE 4RK2A 3TQWA 3OD7A 1LAXA 4QF9A 1D4NA 3M8UA 4ZZEA 2QS2A 1IIWA 4GXAA 1BIYA 5AA4A 3O6IA 5TPAB 4GQOA 4YICA 3RT6B 1MY0A 4R6YA 1OVTA 3VVDA 4BDLA 2XXIA 1MPCA 1Z7NE 3IB2A 3LR1A 3MUQA 2VD3A 3H4ZA 3TTMA 2VP1A 5AA2B 3TTLA 4X1DA 2HAVA 5I84A 4BLAA 3W9VA 4ELQA 1ZJLA 2PYYA 3VE1B 1NNPA 2XX7A 1PEBA 4F31B 1Y4CA 1Y20A 4QFOA 1A8EA 4X48A 1MM6A 3M3KA 1XT8A 4H8JA 2AL4A 2V3TA 3TUSA 4QSEA 4O3AA 4LQ5A 2OWTA 1N76A 4I8CA 3CSGA 3SERA 4G4PA 3IOTA 3K6WA 4BDOA 4F1YA 3Q27A 3UK4A 2I4CA 2XXVA 3S9NC 1RKMA 2GHBA 3U72A 3K1NA 4Q8RA 1JQFA 1OLCA 4F1UA 5H8NA 4LVQA 2GHAA 2YPNA 3IB0A 2F8DA 2Z8FA 1POY1 3LC8A 4F22A 1EH3A 3MVZA 3QK6A 1B5HA 1YAEA 1MQJA 3H3GA 1F9BA 5AA2D 3LSLA 3OO6A 1A40A 1D9VA 1B2HA 1PBQA 5HM4B 1H43A 3IR1A 3SEWA 2KLFA 3V83A 4LONB 3KOSA 2DE4A 1B51A 4RYAA 4Q30B 3FUZA 2Q8JA 5ITPA 1OQHA 1IXIA 3O9PA 1LB9A 1LFIA 5CC2A 3BFTA 2Y7PA 1OIBA 5KZTA 3T66A 4OETA 3KSXA 1MH4A 3KEIA 3TODA 2QRYA 1JEUA 1FTJA 2ABHA 2GH9A 3GLBA 3KSJA 1MQIA 1OQGA 1HSJA 4XKQA 1LSTA 3O6HA 2HCAA 3C31A 4LZ8A 4ISUA 3H7MA 4BDRA 4NF6B 4RNSA 3ONMA 4OFLA 4FEDA 4DE8A 4QHQA 1S50A 2ANJA 5F1QA 1LGBC 3I6VA 2XXTA 4ECFA 3I3VA 3KG2A 3IL1B 5KDTB 4QFLA 3UN6A 4LZ7A 3PUVE 1QKAA 3K00A 2Z22A 1RYOA 4F2QA 3R6UA 1EZ9A 2XXHA 3ZS6A 3CFZA 4DDDA 2F6GA 3N26A 3OO7A 3KBRA 3K01A 2R9JA 2OZZA 5DYHA 2M8CA 3EF7A 1IXCA 2B3FA 1B7UA 2VD2A 3VLUA 2VHAA 1ZBMA 3GBBA 1I6QA 2ESNA 4R73A 4IB2A 2A5TA 1LBCA 2H25A 1IITA 2GRVA 3T9UA 3D4GA 1H76A 3IJXB 3M3LA 3LSXA 1CB6A 5BWJA 3KFMA 1USYE 4QFNA 3EHUA 3ZKLA 3TDJA 4C0RA 3RQTA 3FXQA 1O64A 2Y7RA 1JW5A 3A3UA 5K2YA 2ZMBA 1B3GA 4OYVA 2OJTA 2H4IA 3LUYA 2XD3A 1MPBA 5ELVA 4THIA 2R71A 5FHOA 3Q28A 4JSDA 2ZNUA 1B0HA 1B1HA 1MS7A 4RPNA 1IUDA 3MPLA 4F3GA 1AIVA 2O69A 1MXYA 2V3QA 4ZEDA 1FW0A 3CR9A 1TWYA 1JVXA 3B6QA 3K0VA 4NF4B 3IOVA 1DPEA 1B4ZA 1Y3NA 1R1NA 4OERA 3HHGA 1N7WA 4G68A 3FASA 1O63A 4I1DA 4DLDA 4GWOA 3IOUA 3MVXA 4DIGA 4ELRA 2VOZA 4PP0A 2QL3A 1SYHA 1LCFA 4EQ9A 1SYIA 5ISUA 3VFJA 1GGGA 4AB6A 3MP8A 4RA1A 1DPPA 2I0BA 4FJPA 4G8HA 4JDFA 3PU5A 4YKJA 1MY2A 4PFYA 1ANFA 2OK2A 5I58B 1URSA 5I56B 3G3HA 5FTIA 1M5DA 2DOJA 3FGSA 2V25A 1LBBA 1N3XA 1HSEA 3N6TA 3UP9A 3PPOA 4NF5A 4YAHX 3D4CA 3PMVA 1TXFA 1XC1A 5AA4B 3QUFA 3OELA 3MJNA 3CRBA 1EZPA 4GLIA 3K02A 4HCYA 4X1BA 1YCJA 1A8FA 3FJGA 1UIVA 4OQOA 4ESXA 3U93A 4LA9A 3KJTA 2DE2A 4KQPA 5AA1A 4G8MA 4ZEIA 1MDQA 2A5SA 3H6VA 3FV2A 3SETA 1MDP1 4OTEA 4YKIA 4ZZAA 3EQ1A 1PB8A 3A09A 4RJZA 3MPKA 5FTHA 4JWXA 1ZMGA 4Q5TA 1XHYA 4R9FA 3MAMA 3USDA 5M2VA 1P1WA 1I6BA 1QW0A 5CBSA 5LOMA 5CMKA 1UTBA 2W7YA 2Z8EA 2DYXA 2Y7IA 4NTLA 4DXCA 1H44A 1N3WA 2XX9A 2AIXA 4FIMA 3TYHA 3OXNA 2YLNA 2P0SA 2I48A 1UTHA 3Q25A 4YU0A 3O6GA 5H8NB 4YKKA 3PPQA 4BDQA 3CVGA 4WEPA 2OWSA 4N07A 2PMSA 5I59A 3IJOB 2REGA 1J1NA 1ZU0A 1BLFA 3DM0A 1DTZA 2UVGA 2H5YA 2B3BA 3O97A 3L6HA 2F5XA 3RUMA 3V89B 4O3BA 4XIGQ 2UYEA 2QS1A 2Q9TA 3RPWA 3FVOA 3GBAA 3DP8A 1CE2A 2D21A 4FE8A 2F35A 3I5OA 4ZS9A 3ZKKA 2I6EA 2H9BA 5KCJA 2F36A 4G8NA 4JSOA 4WXJA 3BFUA 3TTNA 4ONYA 5I2NA 4ZDMA 5FHMA 3ODBA 3SEUA 5BUUA 3UGWA 2V3UA 1QJMA 3MQ9A 2ALUA 2X26A 5H8SA 4RPOA 2PVUA 4XTCQ 1SW5A 3C4MA 2DSFA 3MW0A 4ZEFA 2ZYOA 2NOOA 4Z7EA 2RKMA 4MBPA 5I2KA 3E4RA 1XVXA 5CM6A 4U4SA 3ECRA 1ZKBA 3K6XA 2O84X 5IKBA 2F7AA 3RN8A 4IGTA 3W15C 5L9SA 3U94A 3F11A 4FORA 2NUVA 5TP9A 3S9EA 5AE4A 3T22A 3TEPA 4FEBA 4IO2A 4JXIA 4TLLB 2E1SA 1B9JA 1US4A 3EHTA 1POTA 4NEDA 4F29A 4PE5B 3ZSFA 3TCFA 2RF1A 3PPPA 3PPRA 1MXUA 3RT8A 5DVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3F A;  3ILU B;  4GXS B;  2A5T B;  5L9M A;  2I3W A;  1S9T A;  4ZEC A;  4IY5 A;  4H6D A;  4YMB A;  5DEX A;  3VLV A;  1T0K A;  4O3C A;  5J1D A;  3DP4 A;  1FQF A;  1RYX A;  3OSQ A;  3QXM A;  2QJE A;  2OBG A;  3CFX A;  3LSW A;  1TFD A;  3OOA A;  3R26 A;  1R9L A;  4ZE9 A;  3FXU A;  5JTY A;  1MQG A;  4OEN A;  3OEM A;  2X7P A;  3B7D A;  4KD5 A;  1FQA A;  1URD A;  2Q88 A;  3CIJ A;  2BJJ X;  2AYS A;  1SW1 A;  3UA8 A;  4MLV A;  1AOV A;  4R74 A;  4UAC A;  3OO9 A;  4U22 A;  2YJP A;  2O7I A;  2IEE A;  4KFQ A;  4KYD A;  5DT6 A;  4OVJ A;  1NMU A;  3HV1 A;  2RCB A;  3FJM A;  4N13 A;  2B65 A;  5B7D A;  2HZL A;  3TZA A;  4EDP A;  2FNC A;  3T96 B;  1ZTY A;  5CMB A;  2R6G E;  1Q1K A;  3FVG A;  2FA7 A;  4G68 B;  4TOZ A;  1FCK A;  4R75 A;  3P7I A;  4POW A;  1PBP A;  4ELO A;  3TTK A;  4MF3 A;  1JET A;  4JWO A;  3FVN A;  2VGQ A;  2I4B A;  4AB5 A;  1QUJ A;  4OFO A;  2CMO A;  1D9Y A;  3G3J A;  5ICT A;  4HW8 A;  3CG1 A;  5DTB A;  3KOT A;  3H03 A;  4QSD A;  3OMB A;  1B3L A;  2X7Q A;  4I62 A;  1IZ1 A;  3CFL A;  5CMC A;  3O29 A;  1Y4T A;  2UYF A;  4MFI A;  1VSO A;  2Y7K A;  3PD8 A;  4ESW A;  5IAI A;  3KN7 A;  3VXB A;  2QMX A;  1LB8 A;  4PQJ A;  4NF5 B;  1R6Z A;  3S9L C;  3K6U A;  1QVS A;  1M5E A;  3HCQ A;  4QRZ A;  4PET A;  3MVY A;  4NE4 A;  4XXU A;  5H8Q A;  4R72 A;  1Z7M E;  2E0S A;  4MLQ A;  4LP2 B;  2O1L A;  2PBW A;  3MZ9 A;  1O7T A;  4L17 A;  3T93 B;  3FAT A;  3A3C A;  4NF8 B;  4FAJ A;  4C1T A;  1H45 A;  1SW4 A;  2DVC A;  3TCG A;  3IO4 A;  1PB9 A;  1VFE A;  2ZXT A;  2F97 A;  2I49 A;  1B3H A;  3C9H A;  4XKR A;  1N84 A;  3JYR A;  3UOR A;  2F6P A;  2QSX A;  5H8F A;  3C34 A;  3OSR A;  4H0W A;  1B7Z A;  3FJ7 A;  5B70 A;  5EHM A;  3U1O A;  1UTB B;  1DOT A;  1B7H A;  1LLS A;  5AA3 A;  1NKX A;  3G3G A;  1QUI A;  4G68 C;  4P11 A;  3ILT B;  1ZIU A;  1MXZ A;  1P1N A;  1WOD A;  3U8Q A;  3G3K A;  1UTH B;  4QFK A;  2CZL A;  1UIU A;  3EHS A;  3E3K A;  4P0I A;  3PPN A;  2F7B A;  2XXU A;  5A5X A;  2Q2C A;  2IA4 A;  2UVH A;  5I59 B;  4R2F A;  4IO5 A;  3C35 A;  1FQD A;  4RY1 A;  1LCT A;  3IX1 A;  2G93 A;  2ZYM A;  1NH7 A;  2LAO A;  5HBC A;  3KN8 A;  1JW4 A;  3MZB A;  3AXF A;  1EZO A;  5EHS A;  3OO8 A;  3IOR A;  3LSF B;  2I0C A;  3QIM A;  1PDA A;  1MY1 A;  2O51 A;  1ELJ A;  1FQC A;  2HZK A;  3RY3 A;  4OEU A;  1B4H A;  4U4X A;  2XXX A;  4E0W A;  1SBP A;  4NF8 A;  1JVY A;  1WVJ A;  3K4U A;  4GIZ A;  1NFT A;  3T9V A;  3TEL A;  1EU8 A;  5KCJ B;  3K1M A;  4KYS A;  2RC7 A;  3HPI A;  5H8H A;  4H67 A;  1TFA A;  3C32 A;  5I2N B;  4YKP A;  1A7L A;  3S9M C;  1FTK A;  2F34 A;  3S2V A;  4M4G A;  3U92 A;  4XKN A;  2F78 A;  2QMW A;  2O1M A;  4G77 A;  3T9H B;  1US5 A;  4RXL A;  1MG1 A;  2OCU A;  2XXW A;  4HTG A;  2REJ A;  4YMA A;  3PMX A;  2O6A A;  1SI1 A;  1PB7 A;  3W9W A;  5I2K B;  3FVK A;  1GVC A;  4I9D A;  3N94 A;  4KI0 E;  4IO3 A;  1N0T A;  3CG3 A;  2RC9 A;  1JW1 A;  3QSL A;  4X9T A;  1VE4 A;  3PUX E;  4C1U A;  1QKB A;  3SEV A;  1SI0 A;  3SEX A;  1B5J A;  3QAX A;  4ZEB A;  4FEC A;  1B3F A;  4OWD A;  4OES A;  3THI A;  3DP6 A;  1FTM A;  1L5T A;  5TP9 B;  3GZG A;  4F19 A;  4F2O A;  1MXV A;  5I57 A;  2PT2 A;  3PGF A;  4JB7 A;  1HSL A;  4HS7 A;  4NMY A;  4KPT A;  4GL0 A;  1A54 A;  3IO6 A;  3K1P A;  4HCW A;  2H98 A;  3RNN A;  1LAH E;  4GL8 A;  3HHF A;  1N7X A;  4OXV A;  2DXY A;  4U21 A;  4POX A;  2DVZ A;  4KHZ E;  1UQW A;  3H6U A;  1P1U A;  1QUL A;  2GFE A;  4Z0I A;  1IXG A;  4QFP A;  3HST A;  4M1V A;  3G3I A;  4RK9 A;  4EXK A;  4IY6 A;  3S4U A;  4H5F A;  1P1O A;  2DQV A;  5DEX B;  1H3D A;  1D3K A;  2HXW A;  4EQB A;  1MH3 A;  4WKM A;  3TQL A;  2O7U A;  1OVB A;  2HEU A;  3PMW A;  2ONR A;  2I3V A;  1NNK A;  1FQE A;  4LUB A;  1SW2 A;  4PFT A;  2QS3 A;  5DVJ A;  5JTY B;  1B40 A;  4OHN A;  1DTG A;  3PUW E;  3SDF A;  4H1X A;  2XD2 A;  3MP1 A;  1A99 A;  4DZ1 A;  3K6V A;  3PUZ E;  3V5A A;  1II5 A;  4IGR A;  1B52 A;  5CI5 A;  4F18 A;  2F7C A;  5JEI A;  3CI8 A;  3VV5 A;  1ATG A;  5L9O A;  4LAT A;  1I69 A;  3BKI B;  1Y3P A;  4JBZ A;  4NWD A;  2G29 A;  4NWC A;  3VVF A;  3QYT A;  5TPA A;  4PFW A;  4H65 A;  4EUO A;  4YB6 A;  4DCX A;  4MH5 A;  4Q0C A;  1Y9U A;  1MPD A;  3FV1 A;  3MP6 A;  3MZ1 A;  3DLN A;  4IO6 A;  1FQB A;  1TT1 A;  1B58 A;  3SES A;  2XX8 A;  2NXO A;  1B0L A;  1LFG A;  5AA2 A;  2THI A;  4KYE A;  4ZEK A;  3VDF A;  4YB7 A;  4KR5 A;  3Q26 A;  3JV9 A;  1XVY A;  3BBR A;  2RCA A;  4F3S A;  5ICQ A;  3H06 B;  4R6K A;  5F7V A;  4PFU A;  1XS5 A;  4TLM B;  1AMF A;  4YZZ A;  4YB5 A;  4G2Z A;  3QUJ A;  3L6G A;  4OMB A;  1MY3 A;  3TPA A;  1B32 A;  1ZLQ A;  3WAF A;  1GTK A;  1LAF E;  4H5G A;  2DE3 A;  3RTF B;  3PUY E;  2XHD A;  3DEL B;  5TU0 A;  1MQD A;  4WED A;  3TMG A;  2UVJ A;  3VVE A;  4U2R A;  2PT1 A;  5ITO A;  4EQ7 A;  1MXW A;  4IO4 A;  1KWH A;  2XXQ A;  3FZV A;  1Y1Z A;  4R9G A;  5H8Q B;  3B6W A;  3O2A A;  4UA8 A;  4P0G A;  4F39 A;  5L8D A;  4U23 A;  1GR2 A;  2XXY A;  3MWB A;  4F3B A;  4LZ5 A;  2OLB A;  4U1O A;  4XKP A;  1NNF A;  4EXL A;  4BDM A;  1SVX B;  1B46 A;  2ZYN A;  4KCD A;  3IAZ A;  5JK4 A;  1FTL A;  1USY H;  3C36 A;  4R6H A;  1M5C A;  3TFL A;  5H8F B;  2D5W A;  4H8I A;  1S7Y A;  3KGC A;  4OZ9 A;  3O28 A;  2Z8D A;  4N6P A;  3SEY A;  2HAU A;  1MQH A;  4EF2 A;  1LFH A;  3K2D A;  2NVU B;  3R7X A;  3G7W A;  3OEK A;  3E9X A;  4IO7 A;  1B05 A;  3N5L A;  3N6U A;  1DMB A;  3PV0 E;  5A5X B;  1MXX A;  1NH8 A;  2AL5 A;  3TKD A;  1SD3 A;  4U1Z A;  3CSB A;  3MC2 A;  2Y7W A;  2DWA A;  3RGY A;  4NF6 A;  4GRK A;  3IK6 B;  1DSN A;  1I6A A;  3JZJ A;  3HO7 A;  1BP5 A;  2DP8 A;  2Q2A A;  2XXR A;  1R9Q A;  2WKY A;  4AQ4 A;  4GFR A;  3VXC A;  5KDT A;  5CMM A;  3IOW A;  3VLW A;  2DXR A;  3H6T A;  3SKP A;  2P2A A;  1BTJ A;  5H8H B;  3T9X B;  1NL5 A;  1P99 A;  2Z23 A;  2DWJ A;  2V84 A;  5CBR A;  5K2X A;  2ONS A;  3UIF A;  4E0X A;  5HPQ A;  3KZG A;  4GD5 A;  3B6T A;  1Y1M A;  5CRY A;  1YTV A;  4GVO A;  2UXA A;  1B5I A;  1PC3 A;  3OEN A;  1NNT A;  4OEV A;  1MRP A;  4FAT A;  3O66 A;  2NWJ A;  2XXP A;  3TAJ A;  3Q29 A;  2V93 A;  3M3F A;  1Y3Q A;  1AH5 A;  1MM7 A;  3PD9 A;  3RTW B;  1BKA A;  1JNF A;  1OMP A;  2D3I A;  2I58 A;  4QSC A;  2DS9 A;  1VFD A;  3RLF E;  1FTO A;  1N04 A;  2HQ0 A;  3KJ7 A;  1YPN A;  1B3E A;  2DWI A;  3MVW A;  3TCH A;  2ZNS A;  1B6H A;  3EN3 A;  1OLA A;  2FYI A;  2H99 A;  3H6W A;  2HFB A;  4TQU Q;  3FIR A;  2QS4 A;  5EYF A;  2Q89 A;  4JWY A;  4EF1 A;  5I57 B;  2RC8 A;  3FXR A;  3IB1 A;  2ZNT A;  4KCC A;  1GV8 A;  1LAG E;  2Y84 A;  1QUK A;  4LQ2 A;  2PX1 A;  1A55 A;  1AL3 A;  4GF8 A;  3GXA A;  1IEJ A;  3MBP A;  3EPE A;  4ZE8 A;  4F3P A;  3C33 A;  1B1X A;  3HN0 A;  1M5B A;  4NF4 A;  3E13 X;  4DXU A;  2ZYK A;  1WDN A;  3TTR A;  1JEV A;  4OFJ A;  1XOC A;  4DCY A;  4F1V A;  1VR5 A;  1MY4 A;  4K3F A;  2QPQ A;  1P1Q A;  1IQ7 A;  1SDX A;  2P1S A;  4BDN A;  1IXH A;  3LBS A;  1URG A;  4DXB A;  4ND9 A;  2UVI A;  1M5F A;  4ELP A;  2DWH A;  1SQY A;  5DVF A;  3FD3 A;  2O68 A;  3V8X B;  2RIN A;  5FHN A;  1Q35 A;  4GOT A;  3KN3 A;  4R2B A;  3WAE A;  5I58 A;  5I56 A;  2ONK E;  4RK2 A;  3TQW A;  3OD7 A;  1LAX A;  4QF9 A;  1D4N A;  3M8U A;  4ZZE A;  2QS2 A;  1IIW A;  4GXA A;  1BIY A;  5AA4 A;  3O6I A;  5TPA B;  4GQO A;  4YIC A;  3RT6 B;  1MY0 A;  4R6Y A;  1OVT A;  3VVD A;  4BDL A;  2XXI A;  1MPC A;  1Z7N E;  3IB2 A;  3LR1 A;  3MUQ A;  2VD3 A;  3H4Z A;  3TTM A;  2VP1 A;  5AA2 B;  3TTL A;  4X1D A;  2HAV A;  5I84 A;  4BLA A;  3W9V A;  4ELQ A;  1ZJL A;  2PYY A;  3VE1 B;  1NNP A;  2XX7 A;  1PEB A;  4F31 B;  1Y4C A;  1Y20 A;  4QFO A;  1A8E A;  4X48 A;  1MM6 A;  3M3K A;  1XT8 A;  4H8J A;  2AL4 A;  2V3T A;  3TUS A;  4QSE A;  4O3A A;  4LQ5 A;  2OWT A;  1N76 A;  4I8C A;  3CSG A;  3SER A;  4G4P A;  3IOT A;  3K6W A;  4BDO A;  4F1Y A;  3Q27 A;  3UK4 A;  2I4C A;  2XXV A;  3S9N C;  1RKM A;  2GHB A;  3U72 A;  3K1N A;  4Q8R A;  1JQF A;  1OLC A;  4F1U A;  5H8N A;  4LVQ A;  2GHA A;  2YPN A;  3IB0 A;  2F8D A;  2Z8F A;  1POY 1;  3LC8 A;  4F22 A;  1EH3 A;  3MVZ A;  3QK6 A;  1B5H A;  1YAE A;  1MQJ A;  3H3G A;  1F9B A;  5AA2 D;  3LSL A;  3OO6 A;  1A40 A;  1D9V A;  1B2H A;  1PBQ A;  5HM4 B;  1H43 A;  3IR1 A;  3SEW A;  2KLF A;  3V83 A;  4LON B;  3KOS A;  2DE4 A;  1B51 A;  4RYA A;  4Q30 B;  3FUZ A;  2Q8J A;  5ITP A;  1OQH A;  1IXI A;  3O9P A;  1LB9 A;  1LFI A;  5CC2 A;  3BFT A;  2Y7P A;  1OIB A;  5KZT A;  3T66 A;  4OET A;  3KSX A;  1MH4 A;  3KEI A;  3TOD A;  2QRY A;  1JEU A;  1FTJ A;  2ABH A;  2GH9 A;  3GLB A;  3KSJ A;  1MQI A;  1OQG A;  1HSJ A;  4XKQ A;  1LST A;  3O6H A;  2HCA A;  3C31 A;  4LZ8 A;  4ISU A;  3H7M A;  4BDR A;  4NF6 B;  4RNS A;  3ONM A;  4OFL A;  4FED A;  4DE8 A;  4QHQ A;  1S50 A;  2ANJ A;  5F1Q A;  1LGB C;  3I6V A;  2XXT A;  4ECF A;  3I3V A;  3KG2 A;  3IL1 B;  5KDT B;  4QFL A;  3UN6 A;  4LZ7 A;  3PUV E;  1QKA A;  3K00 A;  2Z22 A;  1RYO A;  4F2Q A;  3R6U A;  1EZ9 A;  2XXH A;  3ZS6 A;  3CFZ A;  4DDD A;  2F6G A;  3N26 A;  3OO7 A;  3KBR A;  3K01 A;  2R9J A;  2OZZ A;  5DYH A;  2M8C A;  3EF7 A;  1IXC A;  2B3F A;  1B7U A;  2VD2 A;  3VLU A;  2VHA A;  1ZBM A;  3GBB A;  1I6Q A;  2ESN A;  4R73 A;  4IB2 A;  2A5T A;  1LBC A;  2H25 A;  1IIT A;  2GRV A;  3T9U A;  3D4G A;  1H76 A;  3IJX B;  3M3L A;  3LSX A;  1CB6 A;  5BWJ A;  3KFM A;  1USY E;  4QFN A;  3EHU A;  3ZKL A;  3TDJ A;  4C0R A;  3RQT A;  3FXQ A;  1O64 A;  2Y7R A;  1JW5 A;  3A3U A;  5K2Y A;  2ZMB A;  1B3G A;  4OYV A;  2OJT A;  2H4I A;  3LUY A;  2XD3 A;  1MPB A;  5ELV A;  4THI A;  2R71 A;  5FHO A;  3Q28 A;  4JSD A;  2ZNU A;  1B0H A;  1B1H A;  1MS7 A;  4RPN A;  1IUD A;  3MPL A;  4F3G A;  1AIV A;  2O69 A;  1MXY A;  2V3Q A;  4ZED A;  1FW0 A;  3CR9 A;  1TWY A;  1JVX A;  3B6Q A;  3K0V A;  4NF4 B;  3IOV A;  1DPE A;  1B4Z A;  1Y3N A;  1R1N A;  4OER A;  3HHG A;  1N7W A;  4G68 A;  3FAS A;  1O63 A;  4I1D A;  4DLD A;  4GWO A;  3IOU A;  3MVX A;  4DIG A;  4ELR A;  2VOZ A;  4PP0 A;  2QL3 A;  1SYH A;  1LCF A;  4EQ9 A;  1SYI A;  5ISU A;  3VFJ A;  1GGG A;  4AB6 A;  3MP8 A;  4RA1 A;  1DPP A;  2I0B A;  4FJP A;  4G8H A;  4JDF A;  3PU5 A;  4YKJ A;  1MY2 A;  4PFY A;  1ANF A;  2OK2 A;  5I58 B;  1URS A;  5I56 B;  3G3H A;  5FTI A;  1M5D A;  2DOJ A;  3FGS A;  2V25 A;  1LBB A;  1N3X A;  1HSE A;  3N6T A;  3UP9 A;  3PPO A;  4NF5 A;  4YAH X;  3D4C A;  3PMV A;  1TXF A;  1XC1 A;  5AA4 B;  3QUF A;  3OEL A;  3MJN A;  3CRB A;  1EZP A;  4GLI A;  3K02 A;  4HCY A;  4X1B A;  1YCJ A;  1A8F A;  3FJG A;  1UIV A;  4OQO A;  4ESX A;  3U93 A;  4LA9 A;  3KJT A;  2DE2 A;  4KQP A;  5AA1 A;  4G8M A;  4ZEI A;  1MDQ A;  2A5S A;  3H6V A;  3FV2 A;  3SET A;  1MDP 1;  4OTE A;  4YKI A;  4ZZA A;  3EQ1 A;  1PB8 A;  3A09 A;  4RJZ A;  3MPK A;  5FTH A;  4JWX A;  1ZMG A;  4Q5T A;  1XHY A;  4R9F A;  3MAM A;  3USD A;  5M2V A;  1P1W A;  1I6B A;  1QW0 A;  5CBS A;  5LOM A;  5CMK A;  1UTB A;  2W7Y A;  2Z8E A;  2DYX A;  2Y7I A;  4NTL A;  4DXC A;  1H44 A;  1N3W A;  2XX9 A;  2AIX A;  4FIM A;  3TYH A;  3OXN A;  2YLN A;  2P0S A;  2I48 A;  1UTH A;  3Q25 A;  4YU0 A;  3O6G A;  5H8N B;  4YKK A;  3PPQ A;  4BDQ A;  3CVG A;  4WEP A;  2OWS A;  4N07 A;  2PMS A;  5I59 A;  3IJO B;  2REG A;  1J1N A;  1ZU0 A;  1BLF A;  3DM0 A;  1DTZ A;  2UVG A;  2H5Y A;  2B3B A;  3O97 A;  3L6H A;  2F5X A;  3RUM A;  3V89 B;  4O3B A;  4XIG Q;  2UYE A;  2QS1 A;  2Q9T A;  3RPW A;  3FVO A;  3GBA A;  3DP8 A;  1CE2 A;  2D21 A;  4FE8 A;  2F35 A;  3I5O A;  4ZS9 A;  3ZKK A;  2I6E A;  2H9B A;  5KCJ A;  2F36 A;  4G8N A;  4JSO A;  4WXJ A;  3BFU A;  3TTN A;  4ONY A;  5I2N A;  4ZDM A;  5FHM A;  3ODB A;  3SEU A;  5BUU A;  3UGW A;  2V3U A;  1QJM A;  3MQ9 A;  2ALU A;  2X26 A;  5H8S A;  4RPO A;  2PVU A;  4XTC Q;  1SW5 A;  3C4M A;  2DSF A;  3MW0 A;  4ZEF A;  2ZYO A;  2NOO A;  4Z7E A;  2RKM A;  4MBP A;  5I2K A;  3E4R A;  1XVX A;  5CM6 A;  4U4S A;  3ECR A;  1ZKB A;  3K6X A;  2O84 X;  5IKB A;  2F7A A;  3RN8 A;  4IGT A;  3W15 C;  5L9S A;  3U94 A;  3F11 A;  4FOR A;  2NUV A;  5TP9 A;  3S9E A;  5AE4 A;  3T22 A;  3TEP A;  4FEB A;  4IO2 A;  4JXI A;  4TLL B;  2E1S A;  1B9J A;  1US4 A;  3EHT A;  1POT A;  4NED A;  4F29 A;  4PE5 B;  3ZSF A;  3TCF A;  2RF1 A;  3PPP A;  3PPR A;  1MXU A;  3RT8 A;  5DVI A; 
#chains in the Genus database with same CATH topology
 3G3F A;  3ILU B;  4GXS B;  2A5T B;  5L9M A;  2I3W A;  4UAB A;  1S9T A;  4ZEC A;  1NV7 A;  4IY5 A;  4H6D A;  4YMB A;  5DEX A;  3VLV A;  1T0K A;  4O3C A;  5J1D A;  3DP4 A;  2CZK A;  2B4M A;  1FQF A;  1FPG A;  1RYX A;  3OSQ A;  3QXM A;  2QJE A;  2OBG A;  3CFX A;  3LSW A;  1TFD A;  3OOA A;  3R26 A;  3D1R A;  1R9L A;  4ZE9 A;  3FXU A;  5JTY A;  1MQG A;  4OEN A;  3OEM A;  2X7P A;  2XXK A;  3B7D A;  4KD5 A;  1FQA A;  1URD A;  1YXI A;  4XF5 A;  2Q88 A;  3CIJ A;  2BJJ X;  3KC0 A;  2AYS A;  4MNC A;  1SW1 A;  3UA8 A;  4MLV A;  1AOV A;  4R74 A;  4UAC A;  3OO9 A;  4MHF A;  4U22 A;  2YJP A;  2O7I A;  2IEE A;  4KFQ A;  4KYD A;  5DT6 A;  4MEV A;  1Q9D A;  4OVJ A;  1NMU A;  1RDZ A;  3HV1 A;  2RCB A;  3FJM A;  4N13 A;  2B65 A;  5B7D A;  2HZL A;  3TZA A;  4EDP A;  2FNC A;  3T96 B;  2CEX A;  1ZTY A;  2CEY A;  5CMB A;  2R6G E;  1FTA A;  1Q1K A;  3FVG A;  2FA7 A;  4G68 B;  4TOZ A;  5IGA A;  1FCK A;  4OA4 A;  4R75 A;  4MMP A;  4N6D A;  3P7I A;  5I3S A;  4HXV A;  4POW A;  4NAP A;  1PBP A;  4ELO A;  3TTK A;  4MF3 A;  1JET A;  4JWO A;  3FVN A;  4PAF A;  2VGQ A;  2I4B A;  4AB5 A;  1QUJ A;  4OFO A;  4PAK A;  2CMO A;  1D9Y A;  3G3J A;  5ICT A;  4HW8 A;  3CG1 A;  5DTB A;  3KOT A;  3H03 A;  4QSD A;  3OMB A;  1B3L A;  4PDH A;  4OVS A;  2X7Q A;  4I62 A;  1IZ1 A;  3CFL A;  5CMC A;  3O29 A;  1Y4T A;  2UYF A;  4MFI A;  1VSO A;  2FIX A;  2Y7K A;  3PD8 A;  4ESW A;  5IAI A;  3KN7 A;  3VXB A;  2QMX A;  1LB8 A;  4PQJ A;  4NF5 B;  1R6Z A;  3S9L C;  1KA0 A;  3K6U A;  5IM2 A;  1QVS A;  4PBH A;  1M5E A;  3HCQ A;  3NOH A;  4QRZ A;  4PET A;  3MVY A;  4NE4 A;  4XXU A;  4LN5 A;  1NV5 A;  2CZH A;  5H8Q A;  4R72 A;  1Z7M E;  2L5V A;  2E0S A;  4JVI A;  4MLQ A;  4LP2 B;  2O1L A;  2PBW A;  3MZ9 A;  1O7T A;  2WX9 A;  3GYY A;  4L17 A;  3T93 B;  3FAT A;  3A3C A;  4NF8 B;  4FAJ A;  4C1T A;  1H45 A;  1SW4 A;  2DVC A;  3TCG A;  3IO4 A;  1NV4 A;  1PB9 A;  1VFE A;  2ZXT A;  2F97 A;  2I49 A;  1B3H A;  1EYK A;  2FVZ A;  3C9H A;  5EQ9 A;  4XKR A;  1N84 A;  3JYR A;  3UOR A;  2F6P A;  4NG7 A;  2QSX A;  1IMB A;  5H8F A;  3C34 A;  3OSR A;  4H0W A;  1B7Z A;  3FJ7 A;  5B70 A;  5EHM A;  4I3Y A;  3U1O A;  1UTB B;  5EQ8 A;  1DOT A;  1B7H A;  1LLS A;  5AA3 A;  1NKX A;  3G3G A;  1QUI A;  4G68 C;  4P11 A;  3ILT B;  3RPL B;  1ZIU A;  1NUY A;  1MXZ A;  1P1N A;  1WOD A;  4DI3 D;  3U8Q A;  3G3K A;  1UTH B;  1G0I A;  3A29 A;  4QFK A;  2CZL A;  1LEV A;  1UIU A;  3EHS A;  3E3K A;  4P0I A;  4AS5 A;  3PPN A;  2F7B A;  2XXU A;  5A5X A;  2Q2C A;  2IA4 A;  2UVH A;  5I59 B;  4R2F A;  4IO5 A;  3C35 A;  1FQD A;  4RY1 A;  1LCT A;  3IX1 A;  2G93 A;  2ZYM A;  1NH7 A;  2LAO A;  5HBC A;  3KN8 A;  1JW4 A;  3MZB A;  3AXF A;  1EZO A;  5EHS A;  3OO8 A;  3IOR A;  3LSF B;  2I0C A;  3QIM A;  1PDA A;  4NX1 A;  4PGP A;  1MY1 A;  2O51 A;  4QXD A;  1ELJ A;  1FQC A;  2HZK A;  3RY3 A;  4OEU A;  1B4H A;  4U4X A;  2XXX A;  4E0W A;  1SBP A;  4PTK A;  4NF8 A;  1JVY A;  2P3V A;  1WVJ A;  3K4U A;  4GIZ A;  4OVQ A;  1NFT A;  3T9V A;  3TEL A;  1EU8 A;  5KCJ B;  3K1M A;  4KYS A;  2RC7 A;  5ET7 A;  3HPI A;  5H8H A;  4H67 A;  1TFA A;  3C32 A;  5I2N B;  4YKP A;  1A7L A;  3S9M C;  1FTK A;  2F34 A;  3S2V A;  4M4G A;  2WEF A;  3U92 A;  4XKN A;  2F78 A;  2QMW A;  2O1M A;  4G77 A;  3T9H B;  1NUZ A;  4PFB A;  1US5 A;  4RXL A;  1MG1 A;  2OCU A;  2XXW A;  4HTG A;  3QMF A;  2REJ A;  4MX6 A;  4YMA A;  3PMX A;  2O6A A;  1SI1 A;  1PB7 A;  3W9W A;  5EQ7 A;  5I2K B;  3FVK A;  1GVC A;  4I9D A;  3FBP A;  3N94 A;  4KI0 E;  4IO3 A;  3HFU A;  4NGU A;  1N0T A;  3CG3 A;  2RC9 A;  1JW1 A;  3QSL A;  4X9T A;  1VE4 A;  4XFE A;  3PUX E;  4C1U A;  1QKB A;  3SEV A;  1SI0 A;  3SEX A;  1B5J A;  4N8Y A;  3QAX A;  4ZEB A;  4FEC A;  1B3F A;  4OWD A;  4OES A;  3THI A;  3DP6 A;  1FTM A;  1L5T A;  5TP9 B;  1CNQ A;  3GZG A;  4F19 A;  4F2O A;  1MXV A;  5I57 A;  2PT2 A;  1K9Y A;  3PGF A;  4JB7 A;  1HSL A;  4HS7 A;  4NMY A;  4KPT A;  2Y5L A;  3E79 A;  4GL0 A;  1A54 A;  3IO6 A;  1EYJ A;  3K1P A;  4HCW A;  2H98 A;  3RNN A;  1LAH E;  4GL8 A;  3HHF A;  1N7X A;  4OXV A;  2DXY A;  2XWO A;  2XA5 A;  4U21 A;  4POX A;  2DVZ A;  4KHZ E;  4PGN A;  1UQW A;  3H6U A;  1IMF A;  1P1U A;  4FBP A;  1QUL A;  2GFE A;  4Z0I A;  1IXG A;  4PE3 A;  3HST A;  4M1V A;  4QFP A;  2WBD A;  3G3I A;  4RK9 A;  4EXK A;  4IY6 A;  1LBX A;  3S4U A;  4H5F A;  1P1O A;  2DQV A;  5DEX B;  1H3D A;  1D3K A;  2HXW A;  4EQB A;  1MH3 A;  4WKM A;  3TQL A;  2O7U A;  1OVB A;  2HEU A;  3PMW A;  2ONR A;  2I3V A;  1NNK A;  1FQE A;  4LUB A;  1SW2 A;  4PFT A;  2QS3 A;  5DVJ A;  1FPK A;  5JTY B;  1B40 A;  4OHN A;  1DTG A;  3PUW E;  3SDF A;  4H1X A;  2FHY A;  2XD2 A;  2Q74 A;  1A99 A;  3MP1 A;  3SZP A;  4DZ1 A;  3K6V A;  3PUZ E;  1JP4 A;  3V5A A;  1II5 A;  4IGR A;  1B52 A;  5CI5 A;  2F7C A;  4F18 A;  5JEI A;  3CI8 A;  3VV5 A;  1ATG A;  5L9O A;  4LAT A;  5LDZ A;  1I69 A;  3BKI B;  5EYH A;  1Y3P A;  2P3N A;  4JBZ A;  4NWD A;  2G29 A;  4NWC A;  3VVF A;  3QYT A;  5TPA A;  4PFW A;  4H65 A;  4EUO A;  4YB6 A;  4DCX A;  4MH5 A;  4Q0C A;  1Y9U A;  1MPD A;  3FV1 A;  3MP6 A;  3MZ1 A;  4NF0 A;  3DLN A;  4IO6 A;  1FQB A;  1TT1 A;  1B58 A;  3SES A;  2XX8 A;  1BK4 A;  2NXO A;  5I7I A;  1B0L A;  1LFG A;  5AA2 A;  2THI A;  4KYE A;  4ZEK A;  3VDF A;  4P3L A;  4YB7 A;  4KR5 A;  3Q26 A;  3JV9 A;  1XVY A;  3BBR A;  2RCA A;  4F3S A;  5ICQ A;  3H06 B;  2VPN A;  4R6K A;  4H46 A;  5F7V A;  3B8B A;  4PFU A;  1XS5 A;  4TLM B;  1AMF A;  4YZZ A;  4YB5 A;  4G2Z A;  3QUJ A;  3L6G A;  4OMB A;  4P47 A;  1MY3 A;  4HE2 A;  3TPA A;  1B32 A;  1ZLQ A;  4OAN A;  3WAF A;  1GTK A;  1LAF E;  1NV0 A;  4H5G A;  2DE3 A;  3RTF B;  3PUY E;  2XHD A;  3DEL B;  5TU0 A;  1MQD A;  4WED A;  1FPL A;  4PAI A;  3TMG A;  2UVJ A;  3VVE A;  4U2R A;  2PT1 A;  5ITO A;  4EQ7 A;  1MXW A;  4IO4 A;  1KWH A;  2XXQ A;  3FZV A;  1Y1Z A;  4R9G A;  2R8T A;  5H8Q B;  1FSA A;  3B6W A;  3O2A A;  4UA8 A;  4P0G A;  4F39 A;  5L8D A;  2DDK A;  4U23 A;  1GR2 A;  2ZZX A;  2XXY A;  3MWB A;  4F3B A;  4LZ5 A;  2OLB A;  2QVU A;  4U1O A;  4XKP A;  1NNF A;  3LUZ A;  4EXL A;  4BDM A;  1SVX B;  1B46 A;  2ZYN A;  4KCD A;  3IAZ A;  5JK4 A;  1FTL A;  1XI6 A;  1USY H;  4G61 A;  4N81 A;  3C36 A;  4R6H A;  1M5C A;  4PF6 A;  3TFL A;  5H8F B;  1QGX A;  2D5W A;  4H8I A;  1S7Y A;  3KGC A;  4OZ9 A;  3O28 A;  4MJO A;  2Z8D A;  4N6P A;  3SEY A;  4GBW A;  2HAU A;  1MQH A;  4EF2 A;  1LFH A;  3K2D A;  2NVU B;  3R7X A;  3G7W A;  3OEK A;  3E9X A;  4IO7 A;  1B05 A;  3N5L A;  3N6U A;  4O94 A;  1DMB A;  3PV0 E;  5A5X B;  1MXX A;  1NH8 A;  2AL5 A;  3TKD A;  1SD3 A;  4U1Z A;  5LTC A;  3CSB A;  3MC2 A;  2Y7W A;  2DWA A;  3RGY A;  4NF6 A;  4GRK A;  3IK6 B;  1DSN A;  4MAG A;  1I6A A;  3JZJ A;  3HO7 A;  1BP5 A;  2DP8 A;  2Q2A A;  2XXR A;  1R9Q A;  2WKY A;  2XWK A;  1FBE A;  2Y5K A;  4AQ4 A;  4GFR A;  3VXC A;  5KDT A;  3MYU A;  5CMM A;  3IOW A;  2BJI A;  3VLW A;  2DXR A;  3H6T A;  1KA1 A;  3SKP A;  2P2A A;  1BTJ A;  4GWS A;  5H8H B;  3T9X B;  1NL5 A;  1P99 A;  2F3B A;  2Z23 A;  2DWJ A;  2V84 A;  5CBR A;  4PCD A;  5K2X A;  2ONS A;  3UIF A;  4E0X A;  5HPQ A;  4GX6 A;  3KZG A;  4GD5 A;  5ET8 A;  3B6T A;  5DW8 A;  1Y1M A;  5CRY A;  1YTV A;  4GVO A;  2UXA A;  1B5I A;  1PC3 A;  3OEN A;  1NNT A;  4OEV A;  2VT5 A;  1MRP A;  4FAT A;  3O66 A;  1FBP A;  2NWJ A;  2XXP A;  3TAJ A;  3Q29 A;  2QVR A;  4OVR A;  2V93 A;  3M3F A;  1Y3Q A;  1AH5 A;  1MM7 A;  3PD9 A;  3RTW B;  1BKA A;  1JNF A;  1OMP A;  2D3I A;  2I58 A;  4QSC A;  2DS9 A;  1VFD A;  3RLF E;  4H45 A;  4P1L A;  1FTO A;  1N04 A;  2HQ0 A;  3KJ7 A;  1YPN A;  3CHG A;  1B3E A;  2DWI A;  3MVW A;  3TCH A;  2ZNS A;  1B6H A;  3EN3 A;  1OLA A;  2FYI A;  2H99 A;  3H6W A;  2HFB A;  4TQU Q;  3FIR A;  2QS4 A;  5EYF A;  2Q89 A;  4JWY A;  4EF1 A;  4N17 A;  3MST A;  3KC1 A;  5I57 B;  2RC8 A;  3FXR A;  3IB1 A;  2ZNT A;  4KCC A;  1GV8 A;  1LBZ A;  1LAG E;  2Y84 A;  2CZI A;  1QUK A;  4LQ2 A;  2PX1 A;  1A55 A;  1AL3 A;  2MKZ A;  4GF8 A;  3GXA A;  1IEJ A;  4N8G A;  3MBP A;  3EPE A;  4ZE8 A;  4F3P A;  4PF8 A;  3C33 A;  1B1X A;  3HN0 A;  1M5B A;  4NF4 A;  3E13 X;  3B50 A;  4DXU A;  2ZYK A;  1FBF A;  1WDN A;  1IME A;  3TTR A;  1JEV A;  4OFJ A;  1XOC A;  4DCY A;  1LBW A;  4F1V A;  1VR5 A;  1MY4 A;  4K3F A;  2WYP A;  2QPQ A;  1P1Q A;  1IQ7 A;  1SDX A;  5EYG A;  2P1S A;  4BDN A;  1IXH A;  3LBS A;  1URG A;  4DXB A;  1AWB A;  1LBV A;  1NV3 A;  4ND9 A;  2UVI A;  1M5F A;  4ELP A;  2DWH A;  1SQY A;  4PDD A;  5DVF A;  4KXP A;  3FD3 A;  2O68 A;  3V8X B;  2RIN A;  5FHN A;  1Q35 A;  4GOT A;  3KN3 A;  4R2B A;  3WAE A;  5I58 A;  5I56 A;  1NUW A;  2ONK E;  4RK2 A;  1FBG A;  3TQW A;  3OD7 A;  1LAX A;  4QF9 A;  1D4N A;  4PFI A;  3M8U A;  4ZZE A;  1FPF A;  2QS2 A;  1IIW A;  4GXA A;  1BIY A;  5AA4 A;  2KR0 A;  3O6I A;  5TPA B;  4GQO A;  4YIC A;  3RT6 B;  1MY0 A;  4R6Y A;  3IFC A;  1OVT A;  3VVD A;  3T1B A;  4BDL A;  2XXI A;  1MPC A;  4HE0 A;  1Z7N E;  3IB2 A;  3LR1 A;  4GX3 A;  3MUQ A;  2VD3 A;  3H4Z A;  3TTM A;  2VP1 A;  5AA2 B;  2PFZ A;  3TTL A;  5I5P A;  4X1D A;  2HAV A;  4OVT A;  5I84 A;  4BLA A;  3W9V A;  4ELQ A;  1ZJL A;  2PYY A;  3VE1 B;  4GWX A;  1NNP A;  2XX7 A;  1FPI A;  1PEB A;  4F31 B;  1Y4C A;  1Y20 A;  4GWW A;  4QFO A;  1A8E A;  4X48 A;  1MM6 A;  3M3K A;  2QFL A;  1XT8 A;  4H8J A;  2AL4 A;  2V3T A;  3TUS A;  4QSE A;  4O3A A;  4LQ5 A;  2OWT A;  1N76 A;  4GWZ A;  4I8C A;  3CSG A;  3SER A;  4G4P A;  3IOT A;  3KBZ A;  3K6W A;  4BDO A;  4F1Y A;  4MIJ A;  1FPE A;  3Q27 A;  3UK4 A;  2HPG A;  2I4C A;  1INP A;  2XXV A;  3S9N C;  1RKM A;  2GHB A;  3U72 A;  2JJK A;  3K1N A;  4Q8R A;  1JQF A;  1OLC A;  4F1U A;  5IZ3 A;  5H8N A;  4LVQ A;  2GHA A;  2YPN A;  3IB0 A;  2F8D A;  2Z8F A;  1POY 1;  3BIH A;  3LC8 A;  4F22 A;  1EH3 A;  3MVZ A;  4I3E A;  3QK6 A;  1B5H A;  4X8R A;  1YAE A;  1MQJ A;  3H3G A;  2ZZW A;  5A5L A;  1F9B A;  5AA2 D;  2XWI A;  3LSL A;  3OO6 A;  3ISP A;  5T3J A;  1A40 A;  2FBP A;  1D9V A;  1B2H A;  1PBQ A;  4P9K A;  5HM4 B;  1H43 A;  3IR1 A;  3SEW A;  2KLF A;  3V83 A;  4LON B;  3KOS A;  2DE4 A;  1B51 A;  4RYA A;  1NUX A;  4Q30 B;  3FUZ A;  2Q8J A;  5ITP A;  2FIE A;  3T0J A;  1OQH A;  4XEQ A;  1IXI A;  3O9P A;  1LB9 A;  1LFI A;  5CC2 A;  3BFT A;  2Y7P A;  1OIB A;  5KZT A;  3T66 A;  4OET A;  3KSX A;  1MH4 A;  3KEI A;  3TOD A;  3FXB A;  4NHB A;  2XWV A;  2QRY A;  1JEU A;  1FTJ A;  4QBA A;  2ABH A;  2GH9 A;  3GLB A;  3KSJ A;  1MQI A;  1OQG A;  1HSJ A;  1LST A;  4XKQ A;  3O6H A;  2HCA A;  2WBB A;  3C31 A;  4LZ8 A;  4ISU A;  4MNP A;  5J16 A;  3H7M A;  4BDR A;  4NF6 B;  4RNS A;  3ONM A;  4P1E A;  4OFL A;  4FED A;  4DE8 A;  4QHQ A;  1S50 A;  5ET6 A;  2ANJ A;  5F1Q A;  1LGB C;  1VDW A;  2XXT A;  3I6V A;  2VPO A;  1FJ9 A;  4ECF A;  3I3V A;  2HHM A;  3KG2 A;  3IL1 B;  5KDT B;  4QFL A;  4N4U A;  3UN6 A;  4LZ7 A;  3PUV E;  1QKA A;  3K00 A;  2Z22 A;  3IFA A;  1RYO A;  4F2Q A;  4N15 A;  3R6U A;  1EZ9 A;  2XXH A;  3ZS6 A;  4GBV A;  3CFZ A;  4DDD A;  1NV6 A;  2F6G A;  3N26 A;  3OO7 A;  3KBR A;  4O7I A;  3K01 A;  2R9J A;  2OZZ A;  5DYH A;  5F24 A;  2M8C A;  3EF7 A;  1IXC A;  2OWZ A;  2B3F A;  1B7U A;  2VD2 A;  3VLU A;  2VHA A;  1ZBM A;  3GBB A;  1I6Q A;  1NV2 A;  2ESN A;  4R73 A;  4IB2 A;  2A5T A;  1LBC A;  4GWY A;  2H25 A;  1IIT A;  2GRV A;  3T9U A;  4I40 A;  4HE1 A;  3D4G A;  4P8B A;  1H76 A;  3IJX B;  3M3L A;  3LSX A;  1CB6 A;  5BWJ A;  3KFM A;  4GWU A;  1USY E;  4QFN A;  2Q8M A;  3EHU A;  3ZKL A;  4NQ8 A;  4O8M A;  3TDJ A;  4C0R A;  3RQT A;  3FXQ A;  1O64 A;  2B4L A;  2Y7R A;  1JW5 A;  3A3U A;  5K2Y A;  2ZMB A;  1B3G A;  1FRP A;  1DCU A;  4OYV A;  2OJT A;  2H4I A;  3LUY A;  2XD3 A;  4N91 A;  1MPB A;  5ELV A;  1DK4 A;  4THI A;  2R71 A;  5FHO A;  3Q28 A;  1K9Z A;  4JSD A;  3PTY A;  2ZNU A;  1B0H A;  1B1H A;  1MS7 A;  4RPN A;  1IUD A;  3MPL A;  4F3G A;  1AIV A;  2O69 A;  1FBH A;  1MXY A;  2V3Q A;  4ZED A;  1FW0 A;  3CR9 A;  2F3D A;  1TWY A;  1JVX A;  3B6Q A;  3K0V A;  4NF4 B;  4PFR A;  4GX4 A;  3IOV A;  1DPE A;  1B4Z A;  1NV1 A;  1Y3N A;  1R1N A;  4OER A;  3HHG A;  1N7W A;  4G68 A;  3FAS A;  1O63 A;  4I1D A;  4DLD A;  4GWO A;  3IOU A;  3MVX A;  4JVD A;  4DIG A;  3EKI A;  4ELR A;  1SPI A;  2VOZ A;  4PP0 A;  2QL3 A;  1SYH A;  1DBZ A;  1YYZ A;  3RYD A;  1LCF A;  4EQ9 A;  1SYI A;  5ISU A;  3VFJ A;  1FPJ A;  1GGG A;  4AB6 A;  3MP8 A;  4RA1 A;  1DPP A;  2I0B A;  1FPB A;  4FJP A;  4G8H A;  1FPD A;  4JDF A;  3PU5 A;  4YKJ A;  4MNI A;  1MY2 A;  4PFY A;  1ANF A;  2OK2 A;  4X04 A;  5I58 B;  1URS A;  5I56 B;  3G3H A;  5FTI A;  1M5D A;  2DOJ A;  3FGS A;  2V25 A;  4NN3 A;  1LBB A;  2OX3 A;  4N6K A;  1N3X A;  1HSE A;  3N6T A;  1G0H A;  3UP9 A;  1NI9 A;  3PPO A;  4NF5 A;  4YAH X;  3D4C A;  3PMV A;  1TXF A;  1XC1 A;  1EYI A;  3E78 A;  4PC9 A;  3BIG A;  5AA4 B;  3QUF A;  3OEL A;  3MJN A;  3CRB A;  1EZP A;  4GLI A;  3K02 A;  4HCY A;  2QVV A;  1YCJ A;  4X1B A;  1A8F A;  3FJG A;  1UIV A;  4OQO A;  4ESX A;  3U93 A;  4LA9 A;  3KJT A;  2DE2 A;  4KQP A;  5AA1 A;  4G8M A;  4ZEI A;  4AS4 A;  1MDQ A;  1RDY A;  4IR8 A;  2A5S A;  3H6V A;  3FV2 A;  3LV0 A;  3SET A;  1MDP 1;  4OTE A;  4YKI A;  1FBC A;  4ZZA A;  3EQ1 A;  1PB8 A;  3A09 A;  4OVP A;  4RJZ A;  3MPK A;  5FTH A;  4JWX A;  1ZMG A;  4Q5T A;  1XHY A;  4R9F A;  3MAM A;  3USD A;  1FBD A;  5M2V A;  1P1W A;  1I6B A;  1QW0 A;  5CBS A;  5LOM A;  5CMK A;  1UTB A;  2W7Y A;  1IMA A;  2Z8E A;  2DYX A;  2Y7I A;  2WYK A;  4NTL A;  4DXC A;  1H44 A;  1N3W A;  2XX9 A;  5FBP A;  2AIX A;  4FIM A;  3TYH A;  5IZZ A;  3OXN A;  3RPL A;  2PFY A;  2YLN A;  2ZZV A;  2P0S A;  2I48 A;  1UTH A;  3Q25 A;  4YU0 A;  3O6G A;  5IZ3 B;  5H8N B;  4YKK A;  3PPQ A;  4BDQ A;  3CVG A;  4WEP A;  4PBQ A;  2OWS A;  4N07 A;  2PMS A;  5I59 A;  3IJO B;  2REG A;  1J1N A;  5EQA A;  1ZU0 A;  1BLF A;  3DM0 A;  1DTZ A;  2UVG A;  2H5Y A;  2KQZ A;  2B3B A;  3O97 A;  3L6H A;  2F5X A;  3RUM A;  3V89 B;  4O3B A;  4O7M A;  4XIG Q;  2UYE A;  2QS1 A;  2Q9T A;  3RPW A;  3FVO A;  3GBA A;  3DP8 A;  1CE2 A;  2D21 A;  4FE8 A;  2F35 A;  3I5O A;  4ZS9 A;  3U65 A;  3ZKK A;  2I6E A;  2H9B A;  5KCJ A;  2F36 A;  4G8N A;  4JSO A;  4WXJ A;  3BFU A;  3TTN A;  2PCR A;  4ONY A;  5I2N A;  2HXR A;  1LBY A;  1FJ6 A;  4P56 A;  5IZ1 A;  4ZDM A;  5FHM A;  5ET5 A;  3ODB A;  3SEU A;  5BUU A;  3UGW A;  2V3U A;  1QJM A;  3ROJ A;  3MQ9 A;  2ALU A;  2X26 A;  5H8S A;  4RPO A;  2PVU A;  4XTC Q;  1SW5 A;  3C4M A;  2DSF A;  3MW0 A;  4ZEF A;  2ZYO A;  2NOO A;  4Z7E A;  2RKM A;  4MBP A;  5I2K A;  3E4R A;  1XVX A;  5CM6 A;  4U4S A;  3ECR A;  1ZKB A;  1IMD A;  1YZ0 A;  3K6X A;  2O84 X;  5IKB A;  2F7A A;  3RN8 A;  1KZ8 A;  2GQ1 A;  4IGT A;  3W15 C;  5L9S A;  3U94 A;  3F11 A;  4FOR A;  2NUV A;  5TP9 A;  3S9E A;  4JVC A;  5AE4 A;  3T22 A;  3TEP A;  4FEB A;  4IO2 A;  4JXI A;  2V4C A;  1D9Q A;  1IMC A;  4TLL B;  2E1S A;  4DI4 B;  1B9J A;  1US4 A;  3EHT A;  1POT A;  4NED A;  4F29 A;  4PE5 B;  1RDX A;  3ZSF A;  3TCF A;  5ESY A;  4MCO A;  2RF1 A;  3PPP A;  3PPR A;  1MXU A;  3RT8 A;  5DVI A; 
#chains in the Genus database with same CATH homology
 3G3F A;  3ILU B;  4GXS B;  2A5T B;  5L9M A;  2I3W A;  1S9T A;  4ZEC A;  4IY5 A;  4H6D A;  4YMB A;  5DEX A;  3VLV A;  1T0K A;  4O3C A;  5J1D A;  3DP4 A;  1FQF A;  1RYX A;  3OSQ A;  3QXM A;  2QJE A;  2OBG A;  3CFX A;  3LSW A;  1TFD A;  3OOA A;  3R26 A;  1R9L A;  4ZE9 A;  3FXU A;  5JTY A;  1MQG A;  4OEN A;  3OEM A;  2X7P A;  3B7D A;  4KD5 A;  1FQA A;  1URD A;  2Q88 A;  3CIJ A;  2BJJ X;  2AYS A;  1SW1 A;  3UA8 A;  4MLV A;  1AOV A;  4R74 A;  4UAC A;  3OO9 A;  4U22 A;  2YJP A;  2O7I A;  2IEE A;  4KFQ A;  4KYD A;  5DT6 A;  4OVJ A;  1NMU A;  3HV1 A;  2RCB A;  3FJM A;  4N13 A;  2B65 A;  5B7D A;  2HZL A;  3TZA A;  4EDP A;  2FNC A;  3T96 B;  1ZTY A;  5CMB A;  2R6G E;  1Q1K A;  3FVG A;  2FA7 A;  4G68 B;  4TOZ A;  1FCK A;  4R75 A;  3P7I A;  4POW A;  1PBP A;  4ELO A;  3TTK A;  4MF3 A;  1JET A;  4JWO A;  3FVN A;  2VGQ A;  2I4B A;  4AB5 A;  1QUJ A;  4OFO A;  2CMO A;  1D9Y A;  3G3J A;  5ICT A;  4HW8 A;  3CG1 A;  5DTB A;  3KOT A;  3H03 A;  4QSD A;  3OMB A;  1B3L A;  2X7Q A;  4I62 A;  1IZ1 A;  3CFL A;  5CMC A;  3O29 A;  1Y4T A;  2UYF A;  4MFI A;  1VSO A;  2Y7K A;  3PD8 A;  4ESW A;  5IAI A;  3KN7 A;  3VXB A;  2QMX A;  1LB8 A;  4PQJ A;  4NF5 B;  1R6Z A;  3S9L C;  3K6U A;  1QVS A;  1M5E A;  3HCQ A;  4QRZ A;  4PET A;  3MVY A;  4NE4 A;  4XXU A;  5H8Q A;  4R72 A;  1Z7M E;  2E0S A;  4MLQ A;  4LP2 B;  2O1L A;  2PBW A;  3MZ9 A;  1O7T A;  4L17 A;  3T93 B;  3FAT A;  3A3C A;  4NF8 B;  4FAJ A;  4C1T A;  1H45 A;  1SW4 A;  2DVC A;  3TCG A;  3IO4 A;  1PB9 A;  1VFE A;  2ZXT A;  2F97 A;  2I49 A;  1B3H A;  3C9H A;  4XKR A;  1N84 A;  3JYR A;  3UOR A;  2F6P A;  2QSX A;  5H8F A;  3C34 A;  3OSR A;  4H0W A;  1B7Z A;  3FJ7 A;  5B70 A;  5EHM A;  3U1O A;  1UTB B;  1DOT A;  1B7H A;  1LLS A;  5AA3 A;  1NKX A;  3G3G A;  1QUI A;  4G68 C;  4P11 A;  3ILT B;  1ZIU A;  1MXZ A;  1P1N A;  1WOD A;  3U8Q A;  3G3K A;  1UTH B;  4QFK A;  2CZL A;  1UIU A;  3EHS A;  3E3K A;  4P0I A;  3PPN A;  2F7B A;  2XXU A;  5A5X A;  2Q2C A;  2IA4 A;  2UVH A;  5I59 B;  4R2F A;  4IO5 A;  3C35 A;  1FQD A;  4RY1 A;  1LCT A;  3IX1 A;  2G93 A;  2ZYM A;  1NH7 A;  2LAO A;  5HBC A;  3KN8 A;  1JW4 A;  3MZB A;  3AXF A;  1EZO A;  5EHS A;  3OO8 A;  3IOR A;  3LSF B;  2I0C A;  3QIM A;  1PDA A;  1MY1 A;  2O51 A;  1ELJ A;  1FQC A;  2HZK A;  3RY3 A;  4OEU A;  1B4H A;  4U4X A;  2XXX A;  4E0W A;  1SBP A;  4NF8 A;  1JVY A;  1WVJ A;  3K4U A;  4GIZ A;  1NFT A;  3T9V A;  3TEL A;  1EU8 A;  5KCJ B;  3K1M A;  4KYS A;  2RC7 A;  3HPI A;  5H8H A;  4H67 A;  1TFA A;  3C32 A;  5I2N B;  4YKP A;  1A7L A;  3S9M C;  1FTK A;  2F34 A;  3S2V A;  4M4G A;  3U92 A;  4XKN A;  2F78 A;  2QMW A;  2O1M A;  4G77 A;  3T9H B;  1US5 A;  4RXL A;  1MG1 A;  2OCU A;  2XXW A;  4HTG A;  2REJ A;  4YMA A;  3PMX A;  2O6A A;  1SI1 A;  1PB7 A;  3W9W A;  5I2K B;  3FVK A;  1GVC A;  4I9D A;  3N94 A;  4KI0 E;  4IO3 A;  1N0T A;  3CG3 A;  2RC9 A;  1JW1 A;  3QSL A;  4X9T A;  1VE4 A;  3PUX E;  4C1U A;  1QKB A;  3SEV A;  1SI0 A;  3SEX A;  1B5J A;  3QAX A;  4ZEB A;  4FEC A;  1B3F A;  4OWD A;  4OES A;  3THI A;  3DP6 A;  1FTM A;  1L5T A;  5TP9 B;  3GZG A;  4F19 A;  4F2O A;  1MXV A;  5I57 A;  2PT2 A;  3PGF A;  4JB7 A;  1HSL A;  4HS7 A;  4NMY A;  4KPT A;  4GL0 A;  1A54 A;  3IO6 A;  3K1P A;  4HCW A;  2H98 A;  3RNN A;  1LAH E;  4GL8 A;  3HHF A;  1N7X A;  4OXV A;  2DXY A;  4U21 A;  4POX A;  2DVZ A;  4KHZ E;  1UQW A;  3H6U A;  1P1U A;  1QUL A;  2GFE A;  4Z0I A;  1IXG A;  4QFP A;  3HST A;  4M1V A;  3G3I A;  4RK9 A;  4EXK A;  4IY6 A;  3S4U A;  4H5F A;  1P1O A;  2DQV A;  5DEX B;  1H3D A;  1D3K A;  2HXW A;  4EQB A;  1MH3 A;  4WKM A;  3TQL A;  2O7U A;  1OVB A;  2HEU A;  3PMW A;  2ONR A;  2I3V A;  1NNK A;  1FQE A;  4LUB A;  1SW2 A;  4PFT A;  2QS3 A;  5DVJ A;  5JTY B;  1B40 A;  4OHN A;  1DTG A;  3PUW E;  3SDF A;  4H1X A;  2XD2 A;  3MP1 A;  1A99 A;  4DZ1 A;  3K6V A;  3PUZ E;  3V5A A;  1II5 A;  4IGR A;  1B52 A;  5CI5 A;  4F18 A;  2F7C A;  5JEI A;  3CI8 A;  3VV5 A;  1ATG A;  5L9O A;  4LAT A;  1I69 A;  3BKI B;  1Y3P A;  4JBZ A;  4NWD A;  2G29 A;  4NWC A;  3VVF A;  3QYT A;  5TPA A;  4PFW A;  4H65 A;  4EUO A;  4YB6 A;  4DCX A;  4MH5 A;  4Q0C A;  1Y9U A;  1MPD A;  3FV1 A;  3MP6 A;  3MZ1 A;  3DLN A;  4IO6 A;  1FQB A;  1TT1 A;  1B58 A;  3SES A;  2XX8 A;  2NXO A;  1B0L A;  1LFG A;  5AA2 A;  2THI A;  4KYE A;  4ZEK A;  3VDF A;  4YB7 A;  4KR5 A;  3Q26 A;  3JV9 A;  1XVY A;  3BBR A;  2RCA A;  4F3S A;  5ICQ A;  3H06 B;  4R6K A;  5F7V A;  4PFU A;  1XS5 A;  4TLM B;  1AMF A;  4YZZ A;  4YB5 A;  4G2Z A;  3QUJ A;  3L6G A;  4OMB A;  1MY3 A;  3TPA A;  1B32 A;  1ZLQ A;  3WAF A;  1GTK A;  1LAF E;  4H5G A;  2DE3 A;  3RTF B;  3PUY E;  2XHD A;  3DEL B;  5TU0 A;  1MQD A;  4WED A;  3TMG A;  2UVJ A;  3VVE A;  4U2R A;  2PT1 A;  5ITO A;  4EQ7 A;  1MXW A;  4IO4 A;  1KWH A;  2XXQ A;  3FZV A;  1Y1Z A;  4R9G A;  5H8Q B;  3B6W A;  3O2A A;  4UA8 A;  4P0G A;  4F39 A;  5L8D A;  4U23 A;  1GR2 A;  2XXY A;  3MWB A;  4F3B A;  4LZ5 A;  2OLB A;  4U1O A;  4XKP A;  1NNF A;  4EXL A;  4BDM A;  1SVX B;  1B46 A;  2ZYN A;  4KCD A;  3IAZ A;  5JK4 A;  1FTL A;  1USY H;  3C36 A;  4R6H A;  1M5C A;  3TFL A;  5H8F B;  2D5W A;  4H8I A;  1S7Y A;  3KGC A;  4OZ9 A;  3O28 A;  2Z8D A;  4N6P A;  3SEY A;  2HAU A;  1MQH A;  4EF2 A;  1LFH A;  3K2D A;  2NVU B;  3R7X A;  3G7W A;  3OEK A;  3E9X A;  4IO7 A;  1B05 A;  3N5L A;  3N6U A;  1DMB A;  3PV0 E;  5A5X B;  1MXX A;  1NH8 A;  2AL5 A;  3TKD A;  1SD3 A;  4U1Z A;  3CSB A;  3MC2 A;  2Y7W A;  2DWA A;  3RGY A;  4NF6 A;  4GRK A;  3IK6 B;  1DSN A;  1I6A A;  3JZJ A;  3HO7 A;  1BP5 A;  2DP8 A;  2Q2A A;  2XXR A;  1R9Q A;  2WKY A;  4AQ4 A;  4GFR A;  3VXC A;  5KDT A;  5CMM A;  3IOW A;  3VLW A;  2DXR A;  3H6T A;  3SKP A;  2P2A A;  1BTJ A;  5H8H B;  3T9X B;  1NL5 A;  1P99 A;  2Z23 A;  2DWJ A;  2V84 A;  5CBR A;  5K2X A;  2ONS A;  3UIF A;  4E0X A;  5HPQ A;  3KZG A;  4GD5 A;  3B6T A;  1Y1M A;  5CRY A;  1YTV A;  4GVO A;  2UXA A;  1B5I A;  1PC3 A;  3OEN A;  1NNT A;  4OEV A;  1MRP A;  4FAT A;  3O66 A;  2NWJ A;  2XXP A;  3TAJ A;  3Q29 A;  2V93 A;  3M3F A;  1Y3Q A;  1AH5 A;  1MM7 A;  3PD9 A;  3RTW B;  1BKA A;  1JNF A;  1OMP A;  2D3I A;  2I58 A;  4QSC A;  2DS9 A;  1VFD A;  3RLF E;  1FTO A;  1N04 A;  2HQ0 A;  3KJ7 A;  1YPN A;  1B3E A;  2DWI A;  3MVW A;  3TCH A;  2ZNS A;  1B6H A;  3EN3 A;  1OLA A;  2FYI A;  2H99 A;  3H6W A;  2HFB A;  4TQU Q;  3FIR A;  2QS4 A;  5EYF A;  2Q89 A;  4JWY A;  4EF1 A;  5I57 B;  2RC8 A;  3FXR A;  3IB1 A;  2ZNT A;  4KCC A;  1GV8 A;  1LAG E;  2Y84 A;  1QUK A;  4LQ2 A;  2PX1 A;  1A55 A;  1AL3 A;  4GF8 A;  3GXA A;  1IEJ A;  3MBP A;  3EPE A;  4ZE8 A;  4F3P A;  3C33 A;  1B1X A;  3HN0 A;  1M5B A;  4NF4 A;  3E13 X;  4DXU A;  2ZYK A;  1WDN A;  3TTR A;  1JEV A;  4OFJ A;  1XOC A;  4DCY A;  4F1V A;  1VR5 A;  1MY4 A;  4K3F A;  2QPQ A;  1P1Q A;  1IQ7 A;  1SDX A;  2P1S A;  4BDN A;  1IXH A;  3LBS A;  1URG A;  4DXB A;  4ND9 A;  2UVI A;  1M5F A;  4ELP A;  2DWH A;  1SQY A;  5DVF A;  3FD3 A;  2O68 A;  3V8X B;  2RIN A;  5FHN A;  1Q35 A;  4GOT A;  3KN3 A;  4R2B A;  3WAE A;  5I58 A;  5I56 A;  2ONK E;  4RK2 A;  3TQW A;  3OD7 A;  1LAX A;  4QF9 A;  1D4N A;  3M8U A;  4ZZE A;  2QS2 A;  1IIW A;  4GXA A;  1BIY A;  5AA4 A;  3O6I A;  5TPA B;  4GQO A;  4YIC A;  3RT6 B;  1MY0 A;  4R6Y A;  1OVT A;  3VVD A;  4BDL A;  2XXI A;  1MPC A;  1Z7N E;  3IB2 A;  3LR1 A;  3MUQ A;  2VD3 A;  3H4Z A;  3TTM A;  2VP1 A;  5AA2 B;  3TTL A;  4X1D A;  2HAV A;  5I84 A;  4BLA A;  3W9V A;  4ELQ A;  1ZJL A;  2PYY A;  3VE1 B;  1NNP A;  2XX7 A;  1PEB A;  4F31 B;  1Y4C A;  1Y20 A;  4QFO A;  1A8E A;  4X48 A;  1MM6 A;  3M3K A;  1XT8 A;  4H8J A;  2AL4 A;  2V3T A;  3TUS A;  4QSE A;  4O3A A;  4LQ5 A;  2OWT A;  1N76 A;  4I8C A;  3CSG A;  3SER A;  4G4P A;  3IOT A;  3K6W A;  4BDO A;  4F1Y A;  3Q27 A;  3UK4 A;  2I4C A;  2XXV A;  3S9N C;  1RKM A;  2GHB A;  3U72 A;  3K1N A;  4Q8R A;  1JQF A;  1OLC A;  4F1U A;  5H8N A;  4LVQ A;  2GHA A;  2YPN A;  3IB0 A;  2F8D A;  2Z8F A;  1POY 1;  3LC8 A;  4F22 A;  1EH3 A;  3MVZ A;  3QK6 A;  1B5H A;  1YAE A;  1MQJ A;  3H3G A;  1F9B A;  5AA2 D;  3LSL A;  3OO6 A;  1A40 A;  1D9V A;  1B2H A;  1PBQ A;  5HM4 B;  1H43 A;  3IR1 A;  3SEW A;  2KLF A;  3V83 A;  4LON B;  3KOS A;  2DE4 A;  1B51 A;  4RYA A;  4Q30 B;  3FUZ A;  2Q8J A;  5ITP A;  1OQH A;  1IXI A;  3O9P A;  1LB9 A;  1LFI A;  5CC2 A;  3BFT A;  2Y7P A;  1OIB A;  5KZT A;  3T66 A;  4OET A;  3KSX A;  1MH4 A;  3KEI A;  3TOD A;  2QRY A;  1JEU A;  1FTJ A;  2ABH A;  2GH9 A;  3GLB A;  3KSJ A;  1MQI A;  1OQG A;  1HSJ A;  4XKQ A;  1LST A;  3O6H A;  2HCA A;  3C31 A;  4LZ8 A;  4ISU A;  3H7M A;  4BDR A;  4NF6 B;  4RNS A;  3ONM A;  4OFL A;  4FED A;  4DE8 A;  4QHQ A;  1S50 A;  2ANJ A;  5F1Q A;  1LGB C;  3I6V A;  2XXT A;  4ECF A;  3I3V A;  3KG2 A;  3IL1 B;  5KDT B;  4QFL A;  3UN6 A;  4LZ7 A;  3PUV E;  1QKA A;  3K00 A;  2Z22 A;  1RYO A;  4F2Q A;  3R6U A;  1EZ9 A;  2XXH A;  3ZS6 A;  3CFZ A;  4DDD A;  2F6G A;  3N26 A;  3OO7 A;  3KBR A;  3K01 A;  2R9J A;  2OZZ A;  5DYH A;  2M8C A;  3EF7 A;  1IXC A;  2B3F A;  1B7U A;  2VD2 A;  3VLU A;  2VHA A;  1ZBM A;  3GBB A;  1I6Q A;  2ESN A;  4R73 A;  4IB2 A;  2A5T A;  1LBC A;  2H25 A;  1IIT A;  2GRV A;  3T9U A;  3D4G A;  1H76 A;  3IJX B;  3M3L A;  3LSX A;  1CB6 A;  5BWJ A;  3KFM A;  1USY E;  4QFN A;  3EHU A;  3ZKL A;  3TDJ A;  4C0R A;  3RQT A;  3FXQ A;  1O64 A;  2Y7R A;  1JW5 A;  3A3U A;  5K2Y A;  2ZMB A;  1B3G A;  4OYV A;  2OJT A;  2H4I A;  3LUY A;  2XD3 A;  1MPB A;  5ELV A;  4THI A;  2R71 A;  5FHO A;  3Q28 A;  4JSD A;  2ZNU A;  1B0H A;  1B1H A;  1MS7 A;  4RPN A;  1IUD A;  3MPL A;  4F3G A;  1AIV A;  2O69 A;  1MXY A;  2V3Q A;  4ZED A;  1FW0 A;  3CR9 A;  1TWY A;  1JVX A;  3B6Q A;  3K0V A;  4NF4 B;  3IOV A;  1DPE A;  1B4Z A;  1Y3N A;  1R1N A;  4OER A;  3HHG A;  1N7W A;  4G68 A;  3FAS A;  1O63 A;  4I1D A;  4DLD A;  4GWO A;  3IOU A;  3MVX A;  4DIG A;  4ELR A;  2VOZ A;  4PP0 A;  2QL3 A;  1SYH A;  1LCF A;  4EQ9 A;  1SYI A;  5ISU A;  3VFJ A;  1GGG A;  4AB6 A;  3MP8 A;  4RA1 A;  1DPP A;  2I0B A;  4FJP A;  4G8H A;  4JDF A;  3PU5 A;  4YKJ A;  1MY2 A;  4PFY A;  1ANF A;  2OK2 A;  5I58 B;  1URS A;  5I56 B;  3G3H A;  5FTI A;  1M5D A;  2DOJ A;  3FGS A;  2V25 A;  1LBB A;  1N3X A;  1HSE A;  3N6T A;  3UP9 A;  3PPO A;  4NF5 A;  4YAH X;  3D4C A;  3PMV A;  1TXF A;  1XC1 A;  5AA4 B;  3QUF A;  3OEL A;  3MJN A;  3CRB A;  1EZP A;  4GLI A;  3K02 A;  4HCY A;  4X1B A;  1YCJ A;  1A8F A;  3FJG A;  1UIV A;  4OQO A;  4ESX A;  3U93 A;  4LA9 A;  3KJT A;  2DE2 A;  4KQP A;  5AA1 A;  4G8M A;  4ZEI A;  1MDQ A;  2A5S A;  3H6V A;  3FV2 A;  3SET A;  1MDP 1;  4OTE A;  4YKI A;  4ZZA A;  3EQ1 A;  1PB8 A;  3A09 A;  4RJZ A;  3MPK A;  5FTH A;  4JWX A;  1ZMG A;  4Q5T A;  1XHY A;  4R9F A;  3MAM A;  3USD A;  5M2V A;  1P1W A;  1I6B A;  1QW0 A;  5CBS A;  5LOM A;  5CMK A;  1UTB A;  2W7Y A;  2Z8E A;  2DYX A;  2Y7I A;  4NTL A;  4DXC A;  1H44 A;  1N3W A;  2XX9 A;  2AIX A;  4FIM A;  3TYH A;  3OXN A;  2YLN A;  2P0S A;  2I48 A;  1UTH A;  3Q25 A;  4YU0 A;  3O6G A;  5H8N B;  4YKK A;  3PPQ A;  4BDQ A;  3CVG A;  4WEP A;  2OWS A;  4N07 A;  2PMS A;  5I59 A;  3IJO B;  2REG A;  1J1N A;  1ZU0 A;  1BLF A;  3DM0 A;  1DTZ A;  2UVG A;  2H5Y A;  2B3B A;  3O97 A;  3L6H A;  2F5X A;  3RUM A;  3V89 B;  4O3B A;  4XIG Q;  2UYE A;  2QS1 A;  2Q9T A;  3RPW A;  3FVO A;  3GBA A;  3DP8 A;  1CE2 A;  2D21 A;  4FE8 A;  2F35 A;  3I5O A;  4ZS9 A;  3ZKK A;  2I6E A;  2H9B A;  5KCJ A;  2F36 A;  4G8N A;  4JSO A;  4WXJ A;  3BFU A;  3TTN A;  4ONY A;  5I2N A;  4ZDM A;  5FHM A;  3ODB A;  3SEU A;  5BUU A;  3UGW A;  2V3U A;  1QJM A;  3MQ9 A;  2ALU A;  2X26 A;  5H8S A;  4RPO A;  2PVU A;  4XTC Q;  1SW5 A;  3C4M A;  2DSF A;  3MW0 A;  4ZEF A;  2ZYO A;  2NOO A;  4Z7E A;  2RKM A;  4MBP A;  5I2K A;  3E4R A;  1XVX A;  5CM6 A;  4U4S A;  3ECR A;  1ZKB A;  3K6X A;  2O84 X;  5IKB A;  2F7A A;  3RN8 A;  4IGT A;  3W15 C;  5L9S A;  3U94 A;  3F11 A;  4FOR A;  2NUV A;  5TP9 A;  3S9E A;  5AE4 A;  3T22 A;  3TEP A;  4FEB A;  4IO2 A;  4JXI A;  4TLL B;  2E1S A;  1B9J A;  1US4 A;  3EHT A;  1POT A;  4NED A;  4F29 A;  4PE5 B;  3ZSF A;  3TCF A;  2RF1 A;  3PPP A;  3PPR A;  1MXU A;  3RT8 A;  5DVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...