4OHNA

Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
246
Chain Sequence
TSGDNWSKYQSNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAVFEKYGITVNWQPIDWDLKEAELTKGTIDLIWNGYSATDERREKVAFSNSYMKNEQVLVTKKSSGITTAKDMTGKTLGAQAGSSGYADFEANPEILKNIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVGSRKEDTTLVKKINEAFSSLYKDGKFQEISQKWFGEDVATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter substrate-binding protein
publication title Crystal structure of an ABC uptake transporter substrate binding protein from Streptococcus pneumoniae with Bound Histidine
rcsb
source organism Streptococcus pneumoniae
total genus 89
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ohnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ohnA02
4QFNA 4ELQA 3SDFA 4ELOA 3TCGA 1H43A 1S50A 1R9LA 1OLCA 5AA4B 2UVHA 4UACA 1ZBMA 4EXKA 4HS7A 3WAFA 4KPTA 2ONRA 2XXPA 3VXBA 4NF4B 4ZS9A 3P7IA 3FV2A 3MW0A 3IO4A 2Z22A 4U22A 3UORA 1MPCA 2DXRA 2THIA 4DCXA 3OEMA 4BDQA 1A54A 4Z7EA 4N07A 2ESNA 4BDOA 4FIMA 3O9PA 1UTHA 5A5XA 1PDAA 2I48A 4LVQA 1EZPA 4GQOA 2HEUA 2DWIA 1FW0A 5I2KB 2E1SA 2RINA 2XHDA 5L9OA 3VVEA 3MJNA 4GVOA 3D4CA 5LOMA 1DMBA 4NTLA 1FQDA 1OMPA 3FUZA 2O1LA 3TTMA 2XX7A 1TT1A 1OVBA 1AL3A 1MXYA 1NNPA 1AMFA 1B3HA 4R9FA 3G3JA 4F19A 1JW4A 5HM4B 2QS2A 3CR9A 3RUMA 4IO7A 2B3BA 3PMWA 5FHNA 2E0SA 3K00A 1B1HA 2XXWA 4LZ7A 2PT1A 3K1NA 3L6HA 3IO6A 3CSGA 3FD3A 1JNFA 4K3FA 3FGSA 3IOVA 5B7DA 4U23A 3U1OA 4OETA 1AIVA 4U2RA 3ZKKA 2O84X 4KCDA 4KYEA 1IXCA 4U4XA 1NMUA 1PBPA 1M5DA 4ZZAA 5L9SA 2Q8JA 5AA2A 1N3XA 4C0RA 3CVGA 4NF5B 4DXCA 3O28A 3MP1A 3PPOA 1IZ1A 5K2XA 2DYXA 1URDA 4R74A 4R6HA 1SW1A 2F36A 1H76A 1NL5A 1HSLA 2ZYKA 2UYEA 4EXLA 4DDDA 1IXHA 1NH8A 3C36A 2I4CA 5FTHA 4NMYA 3UP9A 2F35A 1MXVA 2ZXTA 1B58A 2I0CA 4P0GA 1NNKA 1Y4TA 5AE4A 4OXVA 1I6BA 3G3KA 3H6UA 1SD3A 2YJPA 4ZECA 3D4GA 3LSFB 4PFUA 2F97A 4YICA 4U4SA 4HW8A 2UVJA 1A8FA 2VOZA 4LQ2A 3DP6A 1BTJA 5CBSA 1GV8A 5IKBA 3S9LC 4G68A 3T93B 3W15C 1FTLA 1MY0A 1N7XA 3PV0E 4QRZA 3U8QA 1Q1KA 1B3LA 3LC8A 4Q8RA 4WXJA 4TLLB 3K1PA 4GWOA 4OVJA 3G3HA 1IITA 1BKAA 1DOTA 3MC2A 5K2YA 4FEBA 2F7CA 1LGBC 4EF2A 3RNNA 5HPQA 4MLVA 4AB5A 4THIA 3V8XB 1T0KA 4G8NA 1MPDA 1B52A 3QIMA 4IO2A 1D9YA 2ZNSA 3G3FA 3OO9A 2AIXA 1ZTYA 3PMXA 3K6WA 4NEDA 1A40A 5CMBA 3QYTA 2RCBA 5I2KA 1POTA 5A5XB 1UTHB 2IA4A 2VD2A 4O3BA 3TCFA 2AYSA 1VFDA 3LSXA 2Y7WA 1H45A 3TTKA 2DOJA 2DWHA 2UVGA 3KN3A 4X48A 2A5SA 2DE3A 1B5IA 5BWJA 2OJTA 3LSLA 4DXUA 4KFQA 5DTBA 3MVXA 1MH3A 1LAHE 1VR5A 3FIRA 3EHTA 1XHYA 4YAHX 2F7BA 3W9VA 3TQLA 4OZ9A 4ECFA 1XVXA 1N84A 4XKQA 2DQVA 4IGRA 4OFOA 3RY3A 3LSWA 1ZLQA 5CM6A 3C34A 1RYOA 4H8JA 1N3WA 4ISUA 4C1TA 2I6EA 3T9UA 3M3LA 1DTZA 2Q89A 2OWTA 3N6UA 1B6HA 3PMVA 4O3CA 4ESXA 1EZOA 3EHSA 4U1ZA 3USDA 1KWHA 5I58A 4OENA 1GGGA 4R6KA 2V84A 4XTCQ 4KYDA 2PT2A 1M5EA 3KGCA 1DPEA 2V25A 5EHSA 2O7IA 2O51A 4DZ1A 4NF5A 3KN7A 4PETA 2ZNUA 4ELPA 3PUXE 5AA2B 1EZ9A 2RC7A 5ISUA 4FEDA 3LR1A 1Q35A 4JDFA 1L5TA 4RNSA 5TP9A 4NF8A 4H1XA 1LCFA 1GVCA 1A99A 4RK2A 3RT8A 1MQIA 2H25A 4F31B 4H6DA 2RKMA 2XXYA 3H6WA 4UA8A 4BDRA 3RPWA 3IB1A 3G7WA 2V3TA 4TLMB 3CFXA 2HAVA 2GHBA 3TODA 4PFWA 2GH9A 3TTNA 3OXNA 3GBAA 3MVZA 1QULA 2H5YA 2Y7IA 2Z8DA 3E4RA 3MWBA 1Y4CA 1TXFA 3M3KA 1XS5A 3A09A 3CRBA 2QL3A 2QPQA 3B6TA 3EHUA 3O97A 3Q28A 2RC9A 1B4HA 3T9VA 3HHFA 4R2BA 3B7DA 4EQBA 1B3GA 2Y7KA 4XKRA 3EPEA 3KN8A 4LATA 4BDLA 4JBZA 4G68B 4AQ4A 2DE4A 4QFLA 5JTYA 2F5XA 2NXOA 3BBRA 3KFMA 3QUFA 5KDTB 3CI8A 3CIJA 4XXUA 4DLDA 5L8DA 4PE5B 4N13A 1JVYA 1ATGA 1N7WA 4ND9A 3MZ9A 2Q88A 4F1VA 2Y7RA 4RY1A 4KCCA 1LFIA 5ICTA 2XD2A 3GXAA 4KI0E 4F22A 3BKIB 1OQGA 3JYRA 3OMBA 3BFTA 3TAJA 4RJZA 1QVSA 1R9QA 4QHQA 1B7UA 1FQFA 3U94A 1SI0A 1VFEA 4PFTA 4FJPA 4YZZA 4JWYA 2XXRA 3G3GA 4FORA 4XIGQ 3UN6A 1DPPA 4R6YA 2REGA 3QUJA 1HSJA 1MS7A 5I59A 2NVUB 3H6VA 3PPQA 4F3SA 1WODA 4GRKA 3IR1A 4Q0CA 4YB7A 1BIYA 3S9NC 2OZZA 4BLAA 1LAFE 2O69A 4ZE9A 2QMWA 3RTFB 1JW1A 3E13X 1FCKA 4Z0IA 2F78A 2QRYA 1P99A 3QSLA 4BDMA 4QFKA 2R71A 5EYFA 4NWDA 5FTIA 4FE8A 3V5AA 3JZJA 1MM7A 1QKAA 5DT6A 3MPLA 3C4MA 1P1OA 4OQOA 2DE2A 2XX8A 3RTWB 2QS1A 5EHMA 3FASA 1II5A 1SBPA 5DEXA 2DS9A 2P2AA 1MM6A 3I6VA 4KD5A 3KSXA 5I58B 3VLWA 4DXBA 3UIFA 2Q2AA 3GBBA 2OK2A 2Z23A 1MXUA 5F7VA 2B65A 1B2HA 2NOOA 3N5LA 2VGQA 2OWSA 4P0IA 1LAGE 3K1MA 3I5OA 1F9BA 1B40A 2FNCA 5TP9B 4RPOA 4NF8B 5I56B 5KCJB 5AA1A 2F8DA 3ECRA 1IQ7A 3K6VA 4G4PA 5H8FA 4U21A 1IXIA 2BJJX 3SEWA 2RC8A 1WDNA 4ZDMA 1QUJA 3VE1B 3IB2A 3KJ7A 3A3CA 4RPNA 3SERA 1S9TA 1YCJA 1NNFA 4ZEFA 4ESWA 1A7LA 4IO3A 2CMOA 2XXQA 4IO6A 2HZKA 1MRPA 4YU0A 1OQHA 1I69A 2QS3A 5ELVA 1P1WA 2GRVA 2HXWA 3O6HA 5DVFA 4BDNA 5CI5A 5KZTA 3S2VA 3OEKA 4GIZA 3K01A 3OD7A 3VVDA 1P1QA 1ZU0A 2Z8EA 5KDTA 3IB0A 4F18A 2DWAA 3L6GA 3CFZA 1YAEA 4FAJA 1MQHA 2GFEA 4WEDA 3UK4A 2YLNA 3T9XB 5JTYB 4GLIA 4U1OA 1FTMA 2X7PA 5CMMA 4X1DA 1SYIA 2I4BA 4XKPA 4G2ZA 4ZEBA 2OCUA 3E3KA 1MXXA 2AL5A 5ITOA 2D3IA 4F29A 2ALUA 1MY3A 3DLNA 4X9TA 5F1QA 5DVIA 1JQFA 3W9WA 1XT8A 4ELRA 4G8MA 1B0HA 4OTEA 2HQ0A 4WKMA 3K0VA 1PB9A 4LZ5A 3VLVA 1USYE 2QJEA 2G93A 3IOUA 3U93A 3MZBA 5HBCA 3VXCA 2ABHA 4GXSB 2UXAA 3TKDA 4H65A 1Y3NA 4HCWA 4M1VA 3H4ZA 3PUYE 1N76A 1URSA 2XXHA 1LBBA 4R75A 1M5BA 4H8IA 5I59B 2OLBA 3DELB 1QKBA 3KZGA 4F2QA 5M2VA 4PFYA 1MY1A 1FQCA 4G68C 2H98A 4GXAA 3ILTB 3LBSA 2A5TA 4E0XA 1OIBA 2PMSA 5TU0A 3C32A 3H6TA 4OWDA 3O6IA 3O29A 1FQEA 1TFAA 1SVXB 4LONB 1H3DA 1P1UA 1Y3QA 2H99A 4KHZE 3O6GA 4MFIA 2I0BA 3SEVA 4OFJA 5H8HA 3TYHA 2W7YA 3DP8A 5DEXB 3TELA 2F6GA 1OVTA 2F7AA 2Z8FA 1MG1A 1JVXA 4LUBA 1GR2A 3HPIA 4NWCA 4EUOA 4RXLA 4P11A 2I58A 2ZYMA 3UA8A 4YMAA 5I56A 5KCJA 2NUVA 4F39A 4OEUA 3Q26A 3GLBA 2R9JA 3OO8A 3TMGA 1B0LA 3C35A 3PPPA 5FHOA 3U72A 4ZEKA 3ONMA 1P1NA 5H8FB 3IOWA 4IY6A 4JSDA 3CFLA 5JEIA 1MXWA 4H0WA 3RN8A 2VD3A 3IORA 3FJ7A 1IUDA 2KLFA 1LSTA 1NKXA 1IEJA 1MY2A 3SESA 3MP8A 2H9BA 1SYHA 1B3FA 3C31A 4ZE8A 3IK6B 1J1NA 4JXIA 4I8CA 4M4GA 1MQJA 2ZNTA 1LAXA 2YPNA 4LQ5A 1GTKA 3TZAA 4IGTA 1IXGA 2HAUA 2IEEA 3MBPA 3H7MA 3G3IA 3R6UA 1PC3A 1A55A 1RYXA 4G8HA 4KQPA 1WVJA 2V3UA 3MUQA 4JWXA 5ICQA 3CSBA 5I2NB 4ZZEA 2Q2CA 1LB9A 3MQ9A 5IAIA 5H8SA 2XXIA 5J1DA 1LFHA 4FECA 2XX9A 1R6ZA 3QAXA 1DSNA 1ANFA 1PBQA 4KYSA 1N0TA 4QFOA 4C1UA 1SQYA 4EF1A 3VFJA 3GZGA 4PP0A 1D9VA 1O64A 1H44A 3WAEA 3K02A 2WKYA 2G29A 3T9HB 3PUVE 1FTOA 2ONSA 3FXRA 4F1UA 2P0SA 1JW5A 2UYFA 4KR5A 3N94A 1FTJA 1NNTA 3V83A 1B5HA 4F3BA 3KOTA 1UIVA 1LB8A 1UTBA 2B3FA 2DP8A 3EN3A 3K6UA 2VHAA 3K2DA 4ZEDA 3SKPA 3CG1A 4F3PA 5I84A 1B7HA 4YKPA 4IB2A 4F3GA 4HCYA 1Y3PA 3MPKA 3U92A 3C9HA 2PX1A 4TQUQ 3EF7A 4POWA 4DIGA 2XXTA 3ZKLA 4R9GA 3F11A 1S7YA 2D5WA 3OO7A 2X26A 2XXUA 4WEPA 2F6PA 4LP2B 1TWYA 4RA1A 1MQDA 3SETA 2O6AA 4OHNA 4HTGA 5TPAB 4YKJA 1I6QA 1MPBA 4IO5A 2A5TB 3LUYA 4QSDA 1ZMGA 2DXYA 2UVIA 3I3VA 4POXA 4OYVA 3ODBA 1B4ZA 4EQ7A 2O7UA 3KJTA 1MDQA 1MXZA 3KG2A 1D3KA 2ZYNA 1CE2A 3IAZA 5FHMA 3ZS6A 2PVUA 1M5FA 1VSOA 4TOZA 4GD5A 1IIWA 1ZIUA 5H8HB 2I49A 3S9MC 5CC2A 2HCAA 4O3AA 4OESA 3VV5A 1Y20A 2F34A 3K4UA 4F2OA 3H03A 2HFBA 1US5A 1LFGA 2Y84A 3OOAA 3TFLA 1SW4A 3E9XA 1Y9UA 3OO6A 5DYHA 1POY1 4JSOA 5I57A 2PYYA 2QSXA 3SEXA 3MZ1A 4DCYA 5JK4A 1SW5A 4GL8A 5H8QB 1LCTA 3EQ1A 4QF9A 3TCHA 2Q9TA 3JV9A 5H8NA 2R6GE 3PD8A 1LLSA 2ZYOA 4X1BA 3Q27A 4YB6A 3OELA 1BLFA 3KSJA 3T22A 2HZLA 3QK6A 3HHGA 3B6QA 3HCQA 3TTRA 4RK9A 3PPRA 2XXVA 2XXXA 3MVYA 3PPNA 2PBWA 5DVJA 4MF3A 4N6PA 4LA9A 4QSCA 4FATA 3M3FA 3IOTA 3FVNA 5BUUA 1B9JA 1LBCA 3S9EA 4Q5TA 2RCAA 3FVOA 3RQTA 3TEPA 4ZEIA 3OENA 4NF6B 3H3GA 1YTVA 2FA7A 5I2NA 1SW2A 4GFRA 4H5FA 3HO7A 2O68A 2Y7PA 3DM0A 1B1XA 3VLUA 3T96B 3V89B 3PGFA 3HV1A 2I3VA 3FZVA 4JWOA 3O66A 3UGWA 3R26A 4QFPA 3FXUA 1OLAA 3Q29A 4JB7A 3Q25A 1Y1ZA 5AA4A 4YMBA 1USYH 3AXFA 3BFUA 1PB7A 1HSEA 5AA3A 1FQAA 4NF4A 2OBGA 3VDFA 4MBPA 1B05A 1RKMA 3FVGA 2H4IA 5ITPA 2QMXA 4OFLA 1MDP1 4OEVA 3HN0A 4IY5A 1QUKA 4H5GA 5CRYA 1FQBA 4I62A 4F1YA 3O2AA 1UTBB 3PUZE 3FATA 2NWJA 1ELJA 1YPNA 1UQWA 3RLFE 1PB8A 1URGA 3THIA 2DVZA 3QXMA 1B46A 1JEVA 2FYIA 1XVYA 4H67A 1AOVA 1MY4A 4GL0A 5B70A 1Z7NE 5L9MA 3KOSA 3RGYA 3FV1A 4G77A 4YB5A 4GOTA 1O63A 1PEBA 4GF8A 3H06B 4IO4A 1Z7ME 1ZJLA 2I3WA 3MAMA 5TPAA 1B32A 1B5JA 2D21A 1B51A 1B7ZA 3OSQA 2V3QA 2O1MA 3T66A 4EQ9A 1NH7A 1TFDA 4OMBA 1I6AA 4PQJA 3TTLA 1B3EA 1Y1MA 1XC1A 3SEUA 3FJMA 2QS4A 1US4A 5CBRA 3IX1A 4AB6A 2ONKE 1SDXA 3DP4A 4DE8A 1QUIA 1QW0A 3TPAA 3TUSA 2DVCA 4Q30B 1FTKA 2ANJA 2M8CA 4QSEA 3RT6B 3HSTA 3M8UA 3KEIA 4NE4A 3OSRA 1EH3A 3MP6A 2P1SA 2XD3A 3A3UA 3IJOB 1SI1A 2GHAA 4ONYA 2LAOA 4RYAA 1AH5A 5CMKA 1MQGA 2V93A 2ZMBA 4R73A 1CB6A 5AA2D 3N26A 3TDJA 4YKIA 5H8QA 4L17A 1R1NA 4XKNA 2DSFA 5I57B 1M5CA 3SEYA 4YKKA 1D4NA 3FJGA 4E0WA 1JEUA 3PU5A 3B6WA 4LZ8A 1VE4A 2X7QA 3FXQA 5H8NB 1NFTA 1ZKBA 1XOCA 3N6TA 2RF1A 1JETA 2AL4A 1DTGA 1MH4A 4MLQA 3ILUB 2DWJA 3S4UA 2VP1A 3IJXB 1A8EA 4NF6A 3R7XA 3PUWE 3C33A 3CG3A 2CZLA 3FVKA 1N04A 1QJMA 4MH5A 2REJA 1O7TA 3KBRA 4I1DA 1UIUA 3ZSFA 4EDPA 1EU8A 3PD9A 4OERA 3K6XA 3MVWA 4R72A 3VVFA 3IL1B 1BP5A 5CMCA 4R2FA 3TQWA 4I9DA
chains in the Genus database with same CATH superfamily
4QFNA 4ELQA 3SDFA 4ELOA 3TCGA 1H43A 1S50A 1FJ6A 1R9LA 1OLCA 5AA4B 2UVHA 4UACA 5IM2A 1ZBMA 1CNQA 4EXKA 4HS7A 4N15A 3WAFA 4KPTA 2ONRA 2XXPA 3VXBA 4NF4B 4ZS9A 3P7IA 3FV2A 3MW0A 4PFIA 3IO4A 4P56A 2Z22A 4U22A 3UORA 1MPCA 2DXRA 2THIA 4DCXA 3OEMA 4BDQA 1FPKA 4GX3A 1A54A 4P3LA 4N07A 4Z7EA 2ESNA 4BDOA 4FIMA 3O9PA 1UTHA 5A5XA 1PDAA 2I48A 4LVQA 1EZPA 4GQOA 2HEUA 2DWIA 3PTYA 1FW0A 5I2KB 2E1SA 2RINA 2XHDA 5L9OA 3VVEA 1NI9A 3MJNA 4GVOA 3D4CA 4P9KA 5LOMA 1DMBA 4NTLA 1FQDA 1OMPA 3FUZA 2O1LA 3TTMA 1FJ9A 2XX7A 1TT1A 1OVBA 1AL3A 5DW8A 5F24A 1MXYA 1NNPA 1AMFA 1B3HA 4R9FA 3G3JA 4F19A 1VDWA 1JW4A 5HM4B 4I40A 4NF0A 2QS2A 3CR9A 3RUMA 2WBBA 4IO7A 2B3BA 3PMWA 5FHNA 4MCOA 2E0SA 3K00A 1B1HA 2XXWA 4LZ7A 2PT1A 3K1NA 2VPOA 3L6HA 3IO6A 3CSGA 3FD3A 1JNFA 4K3FA 3FGSA 3IOVA 5B7DA 4U23A 3U1OA 4OETA 1AIVA 4U2RA 3ZKKA 4X04A 2O84X 4KCDA 4KYEA 3T0JA 1NUWA 4UABA 1IXCA 4U4XA 1NMUA 4PGNA 1PBPA 1M5DA 4ZZAA 5L9SA 2Q8JA 5AA2A 1EYJA 1N3XA 4C0RA 4PAFA 1FPGA 2CZHA 2FHYA 3CVGA 4NF5B 4DXCA 1IMEA 3O28A 3MP1A 3PPOA 1IZ1A 5K2XA 2DYXA 1URDA 2CEYA 2PFYA 4R74A 4HE2A 4R6HA 1SW1A 2F36A 4AS5A 1H76A 1NL5A 1HSLA 2ZYKA 2WX9A 2UYEA 4EXLA 4DDDA 5FBPA 1IXHA 1NH8A 3C36A 4OVTA 2I4CA 5FTHA 4NMYA 3UP9A 2F35A 5ET7A 1MXVA 2ZXTA 1B58A 2I0CA 4P0GA 1NNKA 1Y4TA 5AE4A 4OXVA 1I6BA 3G3KA 3H6UA 4GX6A 1SD3A 2YJPA 4ZECA 3D4GA 3LSFB 4PFUA 2F97A 4YICA 4U4SA 3KC1A 4HW8A 2UVJA 1A8FA 2VOZA 1IMAA 3HFUA 4LQ2A 3DP6A 4HXVA 1BTJA 5CBSA 1YXIA 1GV8A 5IKBA 3S9LC 4G68A 3T93B 3W15C 1FTLA 4PF8A 4MMPA 1MY0A 1N7XA 3PV0E 4QRZA 3U8QA 1Q1KA 1B3LA 3LC8A 4Q8RA 4WXJA 4TLLB 3K1PA 2VPNA 5EQ7A 4GWOA 4OVJA 3G3HA 1IITA 1BKAA 1DOTA 3MC2A 5K2YA 4FEBA 2F7CA 1LGBC 4EF2A 3RNNA 5HPQA 4MLVA 4AB5A 4PC9A 4THIA 4OVSA 1FPJA 3V8XB 1T0KA 4G8NA 1MPDA 1IMCA 1B52A 3QIMA 4IO2A 1IMDA 1D9YA 2ZNSA 3G3FA 3OO9A 2AIXA 1ZTYA 3PMXA 3K6WA 4NEDA 1A40A 1RDXA 5CMBA 2Y5LA 3QYTA 2RCBA 5I2KA 1POTA 4GWSA 2V4CA 5A5XB 1UTHB 4PFRA 2IA4A 3LV0A 2VD2A 4O3BA 3TCFA 2AYSA 1VFDA 3LSXA 2Y7WA 1H45A 3TTKA 2DOJA 2DWHA 2UVGA 3KN3A 4X48A 2A5SA 2DE3A 1B5IA 5BWJA 4IR8A 2OJTA 3LSLA 4DXUA 4KFQA 4P8BA 5DTBA 3MVXA 1MH3A 1LAHE 1VR5A 3FIRA 3EHTA 1XHYA 4YAHX 1EYIA 2F7BA 3W9VA 3TQLA 4GWXA 4OZ9A 4DI3D 4ECFA 2PCRA 1XVXA 1N84A 4XKQA 2DQVA 4IGRA 4NG7A 4OFOA 3RY3A 3LSWA 1ZLQA 5CM6A 3C34A 1RYOA 4H8JA 1N3WA 4ISUA 4C1TA 2HPGA 2I6EA 3T9UA 5ET6A 3M3LA 1DTZA 2Q89A 2OWTA 1FPIA 3N6UA 3KBZA 3PMVA 1B6HA 4O3CA 4ESXA 1EZOA 3EHSA 4U1ZA 3USDA 1KWHA 5I58A 4OENA 1GGGA 4R6KA 2V84A 4XTCQ 1NUZA 4KYDA 2PT2A 1M5EA 3KGCA 1DPEA 2V25A 5EHSA 2O7IA 2O51A 4DZ1A 4NF5A 3KN7A 4PETA 2ZNUA 4ELPA 3PUXE 5AA2B 1EZ9A 2RC7A 5ISUA 4FEDA 3LR1A 4GBWA 1Q35A 4JDFA 1L5TA 4RNSA 5TP9A 4NF8A 4H1XA 1LCFA 1GVCA 1A99A 4RK2A 3RT8A 1MQIA 2H25A 4F31B 4H6DA 2RKMA 2XXYA 3H6WA 1YYZA 4UA8A 4BDRA 3RPWA 4GWWA 3IB1A 3G7WA 2V3TA 4TLMB 3CFXA 2HAVA 2GHBA 3TODA 2QFLA 4PFWA 2GH9A 3TTNA 3OXNA 3GBAA 3MVZA 4O7IA 5EQ8A 1QULA 2H5YA 1QGXA 1NV4A 1IMFA 3RYDA 2Y7IA 2Z8DA 3E4RA 3MWBA 1Y4CA 1TXFA 3M3KA 1XS5A 3A09A 2WYKA 1FBDA 3CRBA 2QL3A 2QPQA 2WEFA 3B6TA 3EHUA 5IZ1A 3O97A 4PAIA 3Q28A 2RC9A 1B4HA 3T9VA 3HHFA 4R2BA 3B7DA 4EQBA 2ZZVA 1B3GA 2Y7KA 4XKRA 3EPEA 3KN8A 4LATA 4BDLA 4GBVA 4JBZA 4MAGA 4PDHA 4G68B 2FBPA 4PGPA 4AQ4A 2DE4A 4QFLA 5JTYA 2F5XA 2NXOA 3BBRA 3KFMA 3QUFA 5KDTB 3CI8A 3CIJA 4XXUA 4DLDA 5L8DA 4PE5B 4N13A 1JVYA 1ATGA 1N7WA 4ND9A 3MZ9A 2Q88A 4F1VA 2Y7RA 2XWOA 4RY1A 2Y5KA 4KCCA 3T1BA 1LFIA 5ICTA 2XD2A 3GXAA 4KI0E 4F22A 3BKIB 1OQGA 3JYRA 4JVCA 3B8BA 3OMBA 3BFTA 3TAJA 4RJZA 4GWYA 1QVSA 1R9QA 4QHQA 1B7UA 1FQFA 3U94A 1SI0A 1VFEA 4PFTA 4FJPA 4YZZA 4JWYA 2XXRA 3G3GA 2CZKA 4FORA 4OA4A 4XIGQ 3UN6A 1DPPA 4R6YA 2REGA 3QUJA 1HSJA 1MS7A 5I59A 2NVUB 3H6VA 3PPQA 4F3SA 2CZIA 1WODA 2HHMA 4GRKA 3IR1A 4Q0CA 2XA5A 4YB7A 1BIYA 3S9NC 2OZZA 4BLAA 1LAFE 2O69A 4ZE9A 2QMWA 3RTFB 1JW1A 3E13X 1FCKA 4Z0IA 2F78A 2QRYA 1P99A 3QSLA 4N8YA 4BDMA 4QFKA 2R71A 5EYFA 1KA0A 4NWDA 4MNPA 5FTIA 4FE8A 3V5AA 3JZJA 3EKIA 4JVIA 1MM7A 4PBHA 1QKAA 5DT6A 3MPLA 3C4MA 4GWZA 1P1OA 4OQOA 2DE2A 2XX8A 1AWBA 3RTWB 2QS1A 5EHMA 3FASA 1II5A 1SBPA 5DEXA 2DS9A 2P2AA 1MM6A 3I6VA 4KD5A 3KSXA 5I58B 3VLWA 4DXBA 3UIFA 2Q2AA 3GBBA 2OK2A 2Z23A 1MXUA 3IFAA 5F7VA 2B65A 1B2HA 2NOOA 2B4LA 4MNIA 4PDDA 1NV1A 3N5LA 2VGQA 4OVRA 2OWSA 4P0IA 1LAGE 3K1MA 1LBVA 1LBYA 3I5OA 1F9BA 1B40A 2FNCA 2Q74A 2R8TA 5TP9B 4RPOA 4NF8B 5I56B 5KCJB 5AA1A 2F8DA 3ECRA 1IQ7A 3K6VA 4G4PA 2JJKA 1NUXA 1FBEA 5H8FA 4U21A 4P1LA 3IFCA 1IXIA 4O8MA 2BJJX 3SEWA 2RC8A 1WDNA 4ZDMA 1QUJA 3VE1B 3IB2A 4NHBA 3KJ7A 3A3CA 4RPNA 3SERA 1S9TA 1YCJA 1FPDA 1NNFA 4ZEFA 4ESWA 1A7LA 4IO3A 5IGAA 2CMOA 2XXQA 3RPLA 4IO6A 2HZKA 1MRPA 4YU0A 1OQHA 1I69A 2QS3A 3KC0A 5ELVA 1P1WA 2GRVA 2HXWA 3O6HA 5DVFA 4BDNA 4MHFA 5CI5A 5KZTA 3S2VA 1G0IA 3OEKA 4GIZA 3K01A 3OD7A 3VVDA 1P1QA 1ZU0A 2Z8EA 5KDTA 3IB0A 4F18A 2DWAA 3L6GA 3CFZA 1YAEA 4FAJA 1MQHA 2GFEA 4WEDA 1FBCA 3UK4A 4OVPA 2YLNA 5J16A 5T3JA 3T9XB 5JTYB 4GLIA 4U1OA 2FIEA 1FTMA 2X7PA 5CMMA 4X1DA 1SYIA 2I4BA 4XKPA 4N6DA 4G2ZA 4ZEBA 4PBQA 2OCUA 3E3KA 1MXXA 2AL5A 5ITOA 2D3IA 1NV0A 4F29A 2XWVA 2ALUA 3B50A 1MY3A 3DLNA 5EYHA 4X9TA 5F1QA 5DVIA 1JQFA 3W9WA 1XT8A 4ELRA 1DCUA 5I5PA 4G8MA 1B0HA 4OTEA 2HQ0A 4WKMA 3K0VA 1PB9A 4LZ5A 5ET8A 3VLVA 1USYE 4H45A 2QJEA 2G93A 3IOUA 3U93A 3MZBA 5HBCA 3VXCA 2ABHA 4GXSB 2UXAA 2HXRA 3TKDA 4H65A 4XF5A 1Y3NA 4HCWA 4M1VA 3H4ZA 3PUYE 4MEVA 1G0HA 2XWIA 2ZZWA 1N76A 1URSA 2XXHA 1LBBA 4R75A 1M5BA 4QBAA 4H8IA 5I59B 2OLBA 3DELB 1QKBA 1XI6A 5IZZA 1INPA 3KZGA 1YZ0A 4F2QA 5M2VA 4PFYA 4I3YA 3BIGA 1MY1A 1FQCA 4G68C 2H98A 4NGUA 4GXAA 3ILTB 5I3SA 5IZ3A 3LBSA 4HE0A 2A5TA 4E0XA 1OIBA 2PMSA 1Q9DA 5TU0A 2OX3A 3C32A 3H6TA 4OWDA 3O6IA 1JP4A 3O29A 1FQEA 1TFAA 1SVXB 5EYGA 4LONB 1H3DA 1P1UA 1Y3QA 2H99A 4KHZE 3O6GA 2QVUA 4MFIA 2I0BA 3SEVA 4OFJA 2VT5A 5H8HA 1NV2A 2W7YA 4LN5A 3DP8A 4G61A 3TYHA 5DEXB 3TELA 2F6GA 1OVTA 2F7AA 2Z8FA 1MG1A 2F3DA 1JVXA 4LUBA 1GR2A 1IMBA 3HPIA 4NWCA 4EUOA 4RXLA 4PFBA 4P11A 2I58A 2ZYMA 3UA8A 4YMAA 5I56A 5KCJA 2NUVA 4F39A 4OEUA 3Q26A 1K9ZA 3GLBA 2R9JA 3OO8A 3TMGA 1B0LA 3C35A 3PPPA 5FHOA 2QVVA 3U72A 4ZEKA 3ONMA 1P1NA 5H8FB 3IOWA 4IY6A 4JSDA 3CFLA 5JEIA 1MXWA 4H0WA 3RN8A 2VD3A 3IORA 3FJ7A 1IUDA 2KLFA 1LSTA 1NKXA 1IEJA 1MY2A 3SESA 3MP8A 2H9BA 2WBDA 1SYHA 1B3FA 3C31A 4ZE8A 3IK6B 1J1NA 1LBXA 4JXIA 4I8CA 4M4GA 1MQJA 4N4UA 2ZNTA 1LAXA 2YPNA 4LQ5A 1GTKA 3TZAA 3RPLB 4IGTA 1IXGA 2HAUA 5ET5A 2IEEA 3MBPA 3H7MA 4KXPA 3G3IA 3R6UA 1PC3A 1A55A 1RYXA 4G8HA 4KQPA 1BK4A 1WVJA 2V3UA 3BIHA 3MUQA 5LDZA 4JWXA 5ICQA 3CSBA 2B4MA 5I2NB 4ZZEA 2Q2CA 1LB9A 3MQ9A 5IAIA 5H8SA 2XXIA 5J1DA 1LFHA 4FECA 2XX9A 1R6ZA 3QAXA 1DSNA 1ANFA 1PBQA 4KYSA 1N0TA 4QFOA 4C1UA 1SQYA 1KA1A 4EF1A 3VFJA 3MYUA 3GZGA 5A5LA 4PP0A 1D9VA 1O64A 1H44A 3WAEA 3K02A 2WKYA 2G29A 3T9HB 3PUVE 1FTOA 2ONSA 3FXRA 4PF6A 4F1UA 2P0SA 1JW5A 4XEQA 2UYFA 3D1RA 4KR5A 3N94A 1D9QA 1FTJA 1NNTA 3V83A 1B5HA 4F3BA 3KOTA 1UIVA 1LB8A 1UTBA 2B3FA 2DP8A 4H46A 3EN3A 1FBGA 3K6UA 1DK4A 2P3NA 2VHAA 3K2DA 4ZEDA 3SKPA 3CG1A 4F3PA 5I84A 1B7HA 4N91A 4YKPA 4IB2A 4F3GA 4HCYA 1FPEA 1Y3PA 3MPKA 3U92A 3C9HA 2PX1A 4TQUQ 3EF7A 4POWA 4DIGA 2XXTA 3ZKLA 4FBPA 4R9GA 3F11A 1S7YA 2D5WA 3OO7A 2X26A 2XXUA 4WEPA 2F6PA 4PE3A 4LP2B 1TWYA 4RA1A 1MQDA 3SETA 2O6AA 4OHNA 4HTGA 5TPAB 4YKJA 1I6QA 1MPBA 4IO5A 5IZ3B 2A5TB 3LUYA 4QSDA 1ZMGA 2DXYA 2UVIA 3I3VA 4POXA 4OYVA 3ODBA 4NN3A 4PCDA 4OANA 4OVQA 1B4ZA 4EQ7A 2O7UA 4O94A 3KJTA 1MDQA 1MXZA 3KG2A 1D3KA 2ZYNA 1CE2A 3IAZA 5FHMA 3ZS6A 3A29A 2PVUA 1M5FA 5I7IA 1VSOA 4TOZA 4GD5A 1IIWA 1ZIUA 5H8HB 2I49A 3S9MC 4O7MA 5CC2A 2HCAA 4O3AA 4OESA 3VV5A 1Y20A 2F34A 3K4UA 4F2OA 4N17A 3H03A 3NOHA 2HFBA 3CHGA 1US5A 1LFGA 2Y84A 3OOAA 3TFLA 1FPLA 1SW4A 3E9XA 1Y9UA 3OO6A 5DYHA 1POY1 4JSOA 1DBZA 5I57A 2PYYA 2QSXA 3SEXA 3MZ1A 4DCYA 5JK4A 1SW5A 4GL8A 5H8QB 3E79A 1LCTA 3EQ1A 4QF9A 5ESYA 3TCHA 2Q9TA 3JV9A 5H8NA 2R6GE 3PD8A 1LLSA 2ZYOA 4X1BA 3Q27A 4YB6A 3OELA 1BLFA 3GYYA 3MSTA 3KSJA 2CEXA 3T22A 2HZLA 3QK6A 3HHGA 3B6QA 3HCQA 3TTRA 4RK9A 3PPRA 2XXVA 2XXXA 3MVYA 2DDKA 2P3VA 3PPNA 2PBWA 5DVJA 4MF3A 4N6KA 4N6PA 4LA9A 4QSCA 4FATA 3M3FA 3IOTA 3FVNA 5BUUA 1B9JA 1LBCA 3S9EA 1LEVA 1RDZA 4Q5TA 2RCAA 3FVOA 3RQTA 3TEPA 4ZEIA 4MIJA 1FSAA 4P1EA 3OENA 4NF6B 3H3GA 1YTVA 2FA7A 5I2NA 1SW2A 4GFRA 4H5FA 4XFEA 3HO7A 2O68A 2Y7PA 3DM0A 1B1XA 3E78A 3VLUA 3T96B 3V89B 3PGFA 3HV1A 2I3VA 3FZVA 4JWOA 3O66A 1KZ8A 3UGWA 1FPBA 3R26A 4QFPA 4HE1A 3FXUA 2MKZA 1NV7A 1FRPA 1OLAA 1FBPA 3Q29A 4JB7A 3Q25A 1Y1ZA 3QMFA 5AA4A 4YMBA 4P47A 1USYH 3AXFA 3BFUA 1PB7A 1HSEA 3FXBA 4NQ8A 5AA3A 3ROJA 1FQAA 4NF4A 4GX4A 2OBGA 3VDFA 4MBPA 1B05A 1RKMA 3FVGA 2H4IA 5ITPA 2QMXA 4OFLA 1MDP1 4OEVA 3HN0A 4PTKA 4IY5A 1QUKA 4H5GA 4N8GA 1FQBA 4I62A 5CRYA 4F1YA 3O2AA 1UTBB 3PUZE 3FATA 2NWJA 2FIXA 1ELJA 1YPNA 1UQWA 3RLFE 3LUZA 1PB8A 1URGA 3THIA 2DVZA 3QXMA 1B46A 1JEVA 1NV5A 2FYIA 1XVYA 4H67A 1AOVA 1MY4A 4GL0A 5B70A 1Z7NE 5L9MA 2PFZA 3KOSA 3RGYA 3FV1A 4G77A 4YB5A 4GOTA 1O63A 1PEBA 4GF8A 3H06B 4IO4A 5LTCA 2WYPA 1Z7ME 1ZJLA 2I3WA 3MAMA 5TPAA 1B32A 1B5JA 2XWKA 1LBZA 2QVRA 2D21A 4NX1A 1B51A 1B7ZA 4X8RA 3OSQA 2BJIA 2XXKA 2V3QA 2O1MA 3T66A 1NUYA 4EQ9A 1NH7A 1TFDA 2GQ1A 4OMBA 1I6AA 4PQJA 3TTLA 1B3EA 3SZPA 1Y1MA 1FBHA 1XC1A 5EQAA 3SEUA 3FJMA 2QS4A 1US4A 3ISPA 5CBRA 3IX1A 4AB6A 2ONKE 1SDXA 3DP4A 2FVZA 4DE8A 1QUIA 1FPFA 1QW0A 3TPAA 3TUSA 2DVCA 4Q30B 1FTKA 2ANJA 2M8CA 4QSEA 3RT6B 3HSTA 3M8UA 1NV3A 3KEIA 4NE4A 3OSRA 1EH3A 3MP6A 2P1SA 2XD3A 3A3UA 4JVDA 3IJOB 1SI1A 2GHAA 4ONYA 2LAOA 4PAKA 4RYAA 1AH5A 4N81A 5CMKA 2Q8MA 4MNCA 1MQGA 2V93A 2ZMBA 4R73A 4QXDA 1CB6A 1SPIA 5AA2D 4AS4A 3U65A 3N26A 1LBWA 3TDJA 2ZZXA 4MJOA 4YKIA 5H8QA 4L17A 1R1NA 2F3BA 4I3EA 4XKNA 2DSFA 5I57B 1M5CA 3SEYA 4MX6A 4YKKA 1D4NA 3FJGA 4E0WA 4GWUA 1EYKA 1JEUA 1RDYA 3PU5A 3B6WA 4LZ8A 1VE4A 2X7QA 3FXQA 5H8NB 1NFTA 1ZKBA 1XOCA 3N6TA 2RF1A 3FBPA 1JETA 2AL4A 1DTGA 1MH4A 4MLQA 3ILUB 1K9YA 2DWJA 2KR0A 3S4UA 2VP1A 3IJXB 4DI4B 1A8EA 2OWZA 4NF6A 1FTAA 3R7XA 3PUWE 3C33A 3CG3A 4NAPA 2CZLA 3FVKA 1N04A 1QJMA 4MH5A 2REJA 1O7TA 3KBRA 1NV6A 5EQ9A 4I1DA 1UIUA 3ZSFA 4EDPA 1EU8A 2KQZA 3PD9A 4OERA 3K6XA 1FBFA 3MVWA 4R72A 3VVFA 3IL1B 1BP5A 5CMCA 4R2FA 3TQWA 2L5VA 4I9DA
chains in the Genus database with same CATH topology
4QFNA 4ELQA 3SDFA 4ELOA 3TCGA 1H43A 1S50A 1R9LA 1OLCA 5AA4B 2UVHA 4UACA 1ZBMA 4EXKA 4HS7A 3WAFA 4KPTA 2ONRA 2XXPA 3VXBA 4NF4B 4ZS9A 3P7IA 3FV2A 3MW0A 3IO4A 2Z22A 4U22A 3UORA 1MPCA 2DXRA 2THIA 4DCXA 3OEMA 4BDQA 1A54A 4Z7EA 4N07A 2ESNA 4BDOA 4FIMA 3O9PA 1UTHA 5A5XA 1PDAA 2I48A 4LVQA 1EZPA 4GQOA 2HEUA 2DWIA 1FW0A 5I2KB 2E1SA 2RINA 2XHDA 5L9OA 3VVEA 3MJNA 4GVOA 3D4CA 5LOMA 1DMBA 4NTLA 1FQDA 1OMPA 3FUZA 2O1LA 3TTMA 2XX7A 1TT1A 1OVBA 1AL3A 1MXYA 1NNPA 1AMFA 1B3HA 4R9FA 3G3JA 4F19A 1JW4A 5HM4B 2QS2A 3CR9A 3RUMA 4IO7A 2B3BA 3PMWA 5FHNA 2E0SA 3K00A 1B1HA 2XXWA 4LZ7A 2PT1A 3K1NA 3L6HA 3IO6A 3CSGA 3FD3A 1JNFA 4K3FA 3FGSA 3IOVA 5B7DA 4U23A 3U1OA 4OETA 1AIVA 4U2RA 3ZKKA 2O84X 4KCDA 4KYEA 1IXCA 4U4XA 1NMUA 1PBPA 1M5DA 4ZZAA 5L9SA 2Q8JA 5AA2A 1N3XA 4C0RA 3CVGA 4NF5B 4DXCA 3O28A 3MP1A 3PPOA 1IZ1A 5K2XA 2DYXA 1URDA 4R74A 4R6HA 1SW1A 2F36A 1H76A 1NL5A 1HSLA 2ZYKA 2UYEA 4EXLA 4DDDA 1IXHA 1NH8A 3C36A 2I4CA 5FTHA 4NMYA 3UP9A 2F35A 1MXVA 2ZXTA 1B58A 2I0CA 4P0GA 1NNKA 1Y4TA 5AE4A 4OXVA 1I6BA 3G3KA 3H6UA 1SD3A 2YJPA 4ZECA 3D4GA 3LSFB 4PFUA 2F97A 4YICA 4U4SA 4HW8A 2UVJA 1A8FA 2VOZA 4LQ2A 3DP6A 1BTJA 5CBSA 1GV8A 5IKBA 3S9LC 4G68A 3T93B 3W15C 1FTLA 1MY0A 1N7XA 3PV0E 4QRZA 3U8QA 1Q1KA 1B3LA 3LC8A 4Q8RA 4WXJA 4TLLB 3K1PA 4GWOA 4OVJA 3G3HA 1IITA 1BKAA 1DOTA 3MC2A 5K2YA 4FEBA 2F7CA 1LGBC 4EF2A 3RNNA 5HPQA 4MLVA 4AB5A 4THIA 3V8XB 1T0KA 4G8NA 1MPDA 1B52A 3QIMA 4IO2A 1D9YA 2ZNSA 3G3FA 3OO9A 2AIXA 1ZTYA 3PMXA 3K6WA 4NEDA 1A40A 5CMBA 3QYTA 2RCBA 5I2KA 1POTA 5A5XB 1UTHB 2IA4A 2VD2A 4O3BA 3TCFA 2AYSA 1VFDA 3LSXA 2Y7WA 1H45A 3TTKA 2DOJA 2DWHA 2UVGA 3KN3A 4X48A 2A5SA 2DE3A 1B5IA 5BWJA 2OJTA 3LSLA 4DXUA 4KFQA 5DTBA 3MVXA 1MH3A 1LAHE 1VR5A 3FIRA 3EHTA 1XHYA 4YAHX 2F7BA 3W9VA 3TQLA 4OZ9A 4ECFA 1XVXA 1N84A 4XKQA 2DQVA 4IGRA 4OFOA 3RY3A 3LSWA 1ZLQA 5CM6A 3C34A 1RYOA 4H8JA 1N3WA 4ISUA 4C1TA 2I6EA 3T9UA 3M3LA 1DTZA 2Q89A 2OWTA 3N6UA 1B6HA 3PMVA 4O3CA 4ESXA 1EZOA 3EHSA 4U1ZA 3USDA 1KWHA 5I58A 4OENA 1GGGA 4R6KA 2V84A 4XTCQ 4KYDA 2PT2A 1M5EA 3KGCA 1DPEA 2V25A 5EHSA 2O7IA 2O51A 4DZ1A 4NF5A 3KN7A 4PETA 2ZNUA 4ELPA 3PUXE 5AA2B 1EZ9A 2RC7A 5ISUA 4FEDA 3LR1A 1Q35A 4JDFA 1L5TA 4RNSA 5TP9A 4NF8A 4H1XA 1LCFA 1GVCA 1A99A 4RK2A 3RT8A 1MQIA 2H25A 4F31B 4H6DA 2RKMA 2XXYA 3H6WA 4UA8A 4BDRA 3RPWA 3IB1A 3G7WA 2V3TA 4TLMB 3CFXA 2HAVA 2GHBA 3TODA 4PFWA 2GH9A 3TTNA 3OXNA 3GBAA 3MVZA 1QULA 2H5YA 2Y7IA 2Z8DA 3E4RA 3MWBA 1Y4CA 1TXFA 3M3KA 1XS5A 3A09A 3CRBA 2QL3A 2QPQA 3B6TA 3EHUA 3O97A 3Q28A 2RC9A 1B4HA 3T9VA 3HHFA 4R2BA 3B7DA 4EQBA 1B3GA 2Y7KA 4XKRA 3EPEA 3KN8A 4LATA 4BDLA 4JBZA 4G68B 4AQ4A 2DE4A 4QFLA 5JTYA 2F5XA 2NXOA 3BBRA 3KFMA 3QUFA 5KDTB 3CI8A 3CIJA 4XXUA 4DLDA 5L8DA 4PE5B 4N13A 1JVYA 1ATGA 1N7WA 4ND9A 3MZ9A 2Q88A 4F1VA 2Y7RA 4RY1A 4KCCA 1LFIA 5ICTA 2XD2A 3GXAA 4KI0E 4F22A 3BKIB 1OQGA 3JYRA 3OMBA 3BFTA 3TAJA 4RJZA 1QVSA 1R9QA 4QHQA 1B7UA 1FQFA 3U94A 1SI0A 1VFEA 4PFTA 4FJPA 4YZZA 4JWYA 2XXRA 3G3GA 4FORA 4XIGQ 3UN6A 1DPPA 4R6YA 2REGA 3QUJA 1HSJA 1MS7A 5I59A 2NVUB 3H6VA 3PPQA 4F3SA 1WODA 4GRKA 3IR1A 4Q0CA 4YB7A 1BIYA 3S9NC 2OZZA 4BLAA 1LAFE 2O69A 4ZE9A 2QMWA 3RTFB 1JW1A 3E13X 1FCKA 4Z0IA 2F78A 2QRYA 1P99A 3QSLA 4BDMA 4QFKA 2R71A 5EYFA 4NWDA 5FTIA 4FE8A 3V5AA 3JZJA 1MM7A 1QKAA 5DT6A 3MPLA 3C4MA 1P1OA 4OQOA 2DE2A 2XX8A 3RTWB 2QS1A 5EHMA 3FASA 1II5A 1SBPA 5DEXA 2DS9A 2P2AA 1MM6A 3I6VA 4KD5A 3KSXA 5I58B 3VLWA 4DXBA 3UIFA 2Q2AA 3GBBA 2OK2A 2Z23A 1MXUA 5F7VA 2B65A 1B2HA 2NOOA 3N5LA 2VGQA 2OWSA 4P0IA 1LAGE 3K1MA 3I5OA 1F9BA 1B40A 2FNCA 5TP9B 4RPOA 4NF8B 5I56B 5KCJB 5AA1A 2F8DA 3ECRA 1IQ7A 3K6VA 4G4PA 5H8FA 4U21A 1IXIA 2BJJX 3SEWA 2RC8A 1WDNA 4ZDMA 1QUJA 3VE1B 3IB2A 3KJ7A 3A3CA 4RPNA 3SERA 1S9TA 1YCJA 1NNFA 4ZEFA 4ESWA 1A7LA 4IO3A 2CMOA 2XXQA 4IO6A 2HZKA 1MRPA 4YU0A 1OQHA 1I69A 2QS3A 5ELVA 1P1WA 2GRVA 2HXWA 3O6HA 5DVFA 4BDNA 5CI5A 5KZTA 3S2VA 3OEKA 4GIZA 3K01A 3OD7A 3VVDA 1P1QA 1ZU0A 2Z8EA 5KDTA 3IB0A 4F18A 2DWAA 3L6GA 3CFZA 1YAEA 4FAJA 1MQHA 2GFEA 4WEDA 3UK4A 2YLNA 3T9XB 5JTYB 4GLIA 4U1OA 1FTMA 2X7PA 5CMMA 4X1DA 1SYIA 2I4BA 4XKPA 4G2ZA 4ZEBA 2OCUA 3E3KA 1MXXA 2AL5A 5ITOA 2D3IA 4F29A 2ALUA 1MY3A 3DLNA 4X9TA 5F1QA 5DVIA 1JQFA 3W9WA 1XT8A 4ELRA 4G8MA 1B0HA 4OTEA 2HQ0A 4WKMA 3K0VA 1PB9A 4LZ5A 3VLVA 1USYE 2QJEA 2G93A 3IOUA 3U93A 3MZBA 5HBCA 3VXCA 2ABHA 4GXSB 2UXAA 3TKDA 4H65A 1Y3NA 4HCWA 4M1VA 3H4ZA 3PUYE 1N76A 1URSA 2XXHA 1LBBA 4R75A 1M5BA 4H8IA 5I59B 2OLBA 3DELB 1QKBA 3KZGA 4F2QA 5M2VA 4PFYA 1MY1A 1FQCA 4G68C 2H98A 4GXAA 3ILTB 3LBSA 2A5TA 4E0XA 1OIBA 2PMSA 5TU0A 3C32A 3H6TA 4OWDA 3O6IA 3O29A 1FQEA 1TFAA 1SVXB 4LONB 1H3DA 1P1UA 1Y3QA 2H99A 4KHZE 3O6GA 4MFIA 2I0BA 3SEVA 4OFJA 5H8HA 3TYHA 2W7YA 3DP8A 5DEXB 3TELA 2F6GA 1OVTA 2F7AA 2Z8FA 1MG1A 1JVXA 4LUBA 1GR2A 3HPIA 4NWCA 4EUOA 4RXLA 4P11A 2I58A 2ZYMA 3UA8A 4YMAA 5I56A 5KCJA 2NUVA 4F39A 4OEUA 3Q26A 3GLBA 2R9JA 3OO8A 3TMGA 1B0LA 3C35A 3PPPA 5FHOA 3U72A 4ZEKA 3ONMA 1P1NA 5H8FB 3IOWA 4IY6A 4JSDA 3CFLA 5JEIA 1MXWA 4H0WA 3RN8A 2VD3A 3IORA 3FJ7A 1IUDA 2KLFA 1LSTA 1NKXA 1IEJA 1MY2A 3SESA 3MP8A 2H9BA 1SYHA 1B3FA 3C31A 4ZE8A 3IK6B 1J1NA 4JXIA 4I8CA 4M4GA 1MQJA 2ZNTA 1LAXA 2YPNA 4LQ5A 1GTKA 3TZAA 4IGTA 1IXGA 2HAUA 2IEEA 3MBPA 3H7MA 3G3IA 3R6UA 1PC3A 1A55A 1RYXA 4G8HA 4KQPA 1WVJA 2V3UA 3MUQA 4JWXA 5ICQA 3CSBA 5I2NB 4ZZEA 2Q2CA 1LB9A 3MQ9A 5IAIA 5H8SA 2XXIA 5J1DA 1LFHA 4FECA 2XX9A 1R6ZA 3QAXA 1DSNA 1ANFA 1PBQA 4KYSA 1N0TA 4QFOA 4C1UA 1SQYA 4EF1A 3VFJA 3GZGA 4PP0A 1D9VA 1O64A 1H44A 3WAEA 3K02A 2WKYA 2G29A 3T9HB 3PUVE 1FTOA 2ONSA 3FXRA 4F1UA 2P0SA 1JW5A 2UYFA 4KR5A 3N94A 1FTJA 1NNTA 3V83A 1B5HA 4F3BA 3KOTA 1UIVA 1LB8A 1UTBA 2B3FA 2DP8A 3EN3A 3K6UA 2VHAA 3K2DA 4ZEDA 3SKPA 3CG1A 4F3PA 5I84A 1B7HA 4YKPA 4IB2A 4F3GA 4HCYA 1Y3PA 3MPKA 3U92A 3C9HA 2PX1A 4TQUQ 3EF7A 4POWA 4DIGA 2XXTA 3ZKLA 4R9GA 3F11A 1S7YA 2D5WA 3OO7A 2X26A 2XXUA 4WEPA 2F6PA 4LP2B 1TWYA 4RA1A 1MQDA 3SETA 2O6AA 4OHNA 4HTGA 5TPAB 4YKJA 1I6QA 1MPBA 4IO5A 2A5TB 3LUYA 4QSDA 1ZMGA 2DXYA 2UVIA 3I3VA 4POXA 4OYVA 3ODBA 1B4ZA 4EQ7A 2O7UA 3KJTA 1MDQA 1MXZA 3KG2A 1D3KA 2ZYNA 1CE2A 3IAZA 5FHMA 3ZS6A 2PVUA 1M5FA 1VSOA 4TOZA 4GD5A 1IIWA 1ZIUA 5H8HB 2I49A 3S9MC 5CC2A 2HCAA 4O3AA 4OESA 3VV5A 1Y20A 2F34A 3K4UA 4F2OA 3H03A 2HFBA 1US5A 1LFGA 2Y84A 3OOAA 3TFLA 1SW4A 3E9XA 1Y9UA 3OO6A 5DYHA 1POY1 4JSOA 5I57A 2PYYA 2QSXA 3SEXA 3MZ1A 4DCYA 5JK4A 1SW5A 4GL8A 5H8QB 1LCTA 3EQ1A 4QF9A 3TCHA 2Q9TA 3JV9A 5H8NA 2R6GE 3PD8A 1LLSA 2ZYOA 4X1BA 3Q27A 4YB6A 3OELA 1BLFA 3KSJA 3T22A 2HZLA 3QK6A 3HHGA 3B6QA 3HCQA 3TTRA 4RK9A 3PPRA 2XXVA 2XXXA 3MVYA 3PPNA 2PBWA 5DVJA 4MF3A 4N6PA 4LA9A 4QSCA 4FATA 3M3FA 3IOTA 3FVNA 5BUUA 1B9JA 1LBCA 3S9EA 4Q5TA 2RCAA 3FVOA 3RQTA 3TEPA 4ZEIA 3OENA 4NF6B 3H3GA 1YTVA 2FA7A 5I2NA 1SW2A 4GFRA 4H5FA 3HO7A 2O68A 2Y7PA 3DM0A 1B1XA 3VLUA 3T96B 3V89B 3PGFA 3HV1A 2I3VA 3FZVA 4JWOA 3O66A 3UGWA 3R26A 4QFPA 3FXUA 1OLAA 3Q29A 4JB7A 3Q25A 1Y1ZA 5AA4A 4YMBA 1USYH 3AXFA 3BFUA 1PB7A 1HSEA 5AA3A 1FQAA 4NF4A 2OBGA 3VDFA 4MBPA 1B05A 1RKMA 3FVGA 2H4IA 5ITPA 2QMXA 4OFLA 1MDP1 4OEVA 3HN0A 4IY5A 1QUKA 4H5GA 5CRYA 1FQBA 4I62A 4F1YA 3O2AA 1UTBB 3PUZE 3FATA 2NWJA 1ELJA 1YPNA 1UQWA 3RLFE 1PB8A 1URGA 3THIA 2DVZA 3QXMA 1B46A 1JEVA 2FYIA 1XVYA 4H67A 1AOVA 1MY4A 4GL0A 5B70A 1Z7NE 5L9MA 3KOSA 3RGYA 3FV1A 4G77A 4YB5A 4GOTA 1O63A 1PEBA 4GF8A 3H06B 4IO4A 1Z7ME 1ZJLA 2I3WA 3MAMA 5TPAA 1B32A 1B5JA 2D21A 1B51A 1B7ZA 3OSQA 2V3QA 2O1MA 3T66A 4EQ9A 1NH7A 1TFDA 4OMBA 1I6AA 4PQJA 3TTLA 1B3EA 1Y1MA 1XC1A 3SEUA 3FJMA 2QS4A 1US4A 5CBRA 3IX1A 4AB6A 2ONKE 1SDXA 3DP4A 4DE8A 1QUIA 1QW0A 3TPAA 3TUSA 2DVCA 4Q30B 1FTKA 2ANJA 2M8CA 4QSEA 3RT6B 3HSTA 3M8UA 3KEIA 4NE4A 3OSRA 1EH3A 3MP6A 2P1SA 2XD3A 3A3UA 3IJOB 1SI1A 2GHAA 4ONYA 2LAOA 4RYAA 1AH5A 5CMKA 1MQGA 2V93A 2ZMBA 4R73A 1CB6A 5AA2D 3N26A 3TDJA 4YKIA 5H8QA 4L17A 1R1NA 4XKNA 2DSFA 5I57B 1M5CA 3SEYA 4YKKA 1D4NA 3FJGA 4E0WA 1JEUA 3PU5A 3B6WA 4LZ8A 1VE4A 2X7QA 3FXQA 5H8NB 1NFTA 1ZKBA 1XOCA 3N6TA 2RF1A 1JETA 2AL4A 1DTGA 1MH4A 4MLQA 3ILUB 2DWJA 3S4UA 2VP1A 3IJXB 1A8EA 4NF6A 3R7XA 3PUWE 3C33A 3CG3A 2CZLA 3FVKA 1N04A 1QJMA 4MH5A 2REJA 1O7TA 3KBRA 4I1DA 1UIUA 3ZSFA 4EDPA 1EU8A 3PD9A 4OERA 3K6XA 3MVWA 4R72A 3VVFA 3IL1B 1BP5A 5CMCA 4R2FA 3TQWA 4I9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QFN A;  4ELQ A;  3SDF A;  4ELO A;  3TCG A;  1H43 A;  1S50 A;  1R9L A;  1OLC A;  5AA4 B;  2UVH A;  4UAC A;  1ZBM A;  4EXK A;  4HS7 A;  3WAF A;  4KPT A;  2ONR A;  2XXP A;  3VXB A;  4NF4 B;  4ZS9 A;  3P7I A;  3FV2 A;  3MW0 A;  3IO4 A;  2Z22 A;  4U22 A;  3UOR A;  1MPC A;  2DXR A;  2THI A;  4DCX A;  3OEM A;  4BDQ A;  1A54 A;  4Z7E A;  4N07 A;  2ESN A;  4BDO A;  4FIM A;  3O9P A;  1UTH A;  5A5X A;  1PDA A;  2I48 A;  4LVQ A;  1EZP A;  4GQO A;  2HEU A;  2DWI A;  1FW0 A;  5I2K B;  2E1S A;  2RIN A;  2XHD A;  5L9O A;  3VVE A;  3MJN A;  4GVO A;  3D4C A;  5LOM A;  1DMB A;  4NTL A;  1FQD A;  1OMP A;  3FUZ A;  2O1L A;  3TTM A;  2XX7 A;  1TT1 A;  1OVB A;  1AL3 A;  1MXY A;  1NNP A;  1AMF A;  1B3H A;  4R9F A;  3G3J A;  4F19 A;  1JW4 A;  5HM4 B;  2QS2 A;  3CR9 A;  3RUM A;  4IO7 A;  2B3B A;  3PMW A;  5FHN A;  2E0S A;  3K00 A;  1B1H A;  2XXW A;  4LZ7 A;  2PT1 A;  3K1N A;  3L6H A;  3IO6 A;  3CSG A;  3FD3 A;  1JNF A;  4K3F A;  3FGS A;  3IOV A;  5B7D A;  4U23 A;  3U1O A;  4OET A;  1AIV A;  4U2R A;  3ZKK A;  2O84 X;  4KCD A;  4KYE A;  1IXC A;  4U4X A;  1NMU A;  1PBP A;  1M5D A;  4ZZA A;  5L9S A;  2Q8J A;  5AA2 A;  1N3X A;  4C0R A;  3CVG A;  4NF5 B;  4DXC A;  3O28 A;  3MP1 A;  3PPO A;  1IZ1 A;  5K2X A;  2DYX A;  1URD A;  4R74 A;  4R6H A;  1SW1 A;  2F36 A;  1H76 A;  1NL5 A;  1HSL A;  2ZYK A;  2UYE A;  4EXL A;  4DDD A;  1IXH A;  1NH8 A;  3C36 A;  2I4C A;  5FTH A;  4NMY A;  3UP9 A;  2F35 A;  1MXV A;  2ZXT A;  1B58 A;  2I0C A;  4P0G A;  1NNK A;  1Y4T A;  5AE4 A;  4OXV A;  1I6B A;  3G3K A;  3H6U A;  1SD3 A;  2YJP A;  4ZEC A;  3D4G A;  3LSF B;  4PFU A;  2F97 A;  4YIC A;  4U4S A;  4HW8 A;  2UVJ A;  1A8F A;  2VOZ A;  4LQ2 A;  3DP6 A;  1BTJ A;  5CBS A;  1GV8 A;  5IKB A;  3S9L C;  4G68 A;  3T93 B;  3W15 C;  1FTL A;  1MY0 A;  1N7X A;  3PV0 E;  4QRZ A;  3U8Q A;  1Q1K A;  1B3L A;  3LC8 A;  4Q8R A;  4WXJ A;  4TLL B;  3K1P A;  4GWO A;  4OVJ A;  3G3H A;  1IIT A;  1BKA A;  1DOT A;  3MC2 A;  5K2Y A;  4FEB A;  2F7C A;  1LGB C;  4EF2 A;  3RNN A;  5HPQ A;  4MLV A;  4AB5 A;  4THI A;  3V8X B;  1T0K A;  4G8N A;  1MPD A;  1B52 A;  3QIM A;  4IO2 A;  1D9Y A;  2ZNS A;  3G3F A;  3OO9 A;  2AIX A;  1ZTY A;  3PMX A;  3K6W A;  4NED A;  1A40 A;  5CMB A;  3QYT A;  2RCB A;  5I2K A;  1POT A;  5A5X B;  1UTH B;  2IA4 A;  2VD2 A;  4O3B A;  3TCF A;  2AYS A;  1VFD A;  3LSX A;  2Y7W A;  1H45 A;  3TTK A;  2DOJ A;  2DWH A;  2UVG A;  3KN3 A;  4X48 A;  2A5S A;  2DE3 A;  1B5I A;  5BWJ A;  2OJT A;  3LSL A;  4DXU A;  4KFQ A;  5DTB A;  3MVX A;  1MH3 A;  1LAH E;  1VR5 A;  3FIR A;  3EHT A;  1XHY A;  4YAH X;  2F7B A;  3W9V A;  3TQL A;  4OZ9 A;  4ECF A;  1XVX A;  1N84 A;  4XKQ A;  2DQV A;  4IGR A;  4OFO A;  3RY3 A;  3LSW A;  1ZLQ A;  5CM6 A;  3C34 A;  1RYO A;  4H8J A;  1N3W A;  4ISU A;  4C1T A;  2I6E A;  3T9U A;  3M3L A;  1DTZ A;  2Q89 A;  2OWT A;  3N6U A;  1B6H A;  3PMV A;  4O3C A;  4ESX A;  1EZO A;  3EHS A;  4U1Z A;  3USD A;  1KWH A;  5I58 A;  4OEN A;  1GGG A;  4R6K A;  2V84 A;  4XTC Q;  4KYD A;  2PT2 A;  1M5E A;  3KGC A;  1DPE A;  2V25 A;  5EHS A;  2O7I A;  2O51 A;  4DZ1 A;  4NF5 A;  3KN7 A;  4PET A;  2ZNU A;  4ELP A;  3PUX E;  5AA2 B;  1EZ9 A;  2RC7 A;  5ISU A;  4FED A;  3LR1 A;  1Q35 A;  4JDF A;  1L5T A;  4RNS A;  5TP9 A;  4NF8 A;  4H1X A;  1LCF A;  1GVC A;  1A99 A;  4RK2 A;  3RT8 A;  1MQI A;  2H25 A;  4F31 B;  4H6D A;  2RKM A;  2XXY A;  3H6W A;  4UA8 A;  4BDR A;  3RPW A;  3IB1 A;  3G7W A;  2V3T A;  4TLM B;  3CFX A;  2HAV A;  2GHB A;  3TOD A;  4PFW A;  2GH9 A;  3TTN A;  3OXN A;  3GBA A;  3MVZ A;  1QUL A;  2H5Y A;  2Y7I A;  2Z8D A;  3E4R A;  3MWB A;  1Y4C A;  1TXF A;  3M3K A;  1XS5 A;  3A09 A;  3CRB A;  2QL3 A;  2QPQ A;  3B6T A;  3EHU A;  3O97 A;  3Q28 A;  2RC9 A;  1B4H A;  3T9V A;  3HHF A;  4R2B A;  3B7D A;  4EQB A;  1B3G A;  2Y7K A;  4XKR A;  3EPE A;  3KN8 A;  4LAT A;  4BDL A;  4JBZ A;  4G68 B;  4AQ4 A;  2DE4 A;  4QFL A;  5JTY A;  2F5X A;  2NXO A;  3BBR A;  3KFM A;  3QUF A;  5KDT B;  3CI8 A;  3CIJ A;  4XXU A;  4DLD A;  5L8D A;  4PE5 B;  4N13 A;  1JVY A;  1ATG A;  1N7W A;  4ND9 A;  3MZ9 A;  2Q88 A;  4F1V A;  2Y7R A;  4RY1 A;  4KCC A;  1LFI A;  5ICT A;  2XD2 A;  3GXA A;  4KI0 E;  4F22 A;  3BKI B;  1OQG A;  3JYR A;  3OMB A;  3BFT A;  3TAJ A;  4RJZ A;  1QVS A;  1R9Q A;  4QHQ A;  1B7U A;  1FQF A;  3U94 A;  1SI0 A;  1VFE A;  4PFT A;  4FJP A;  4YZZ A;  4JWY A;  2XXR A;  3G3G A;  4FOR A;  4XIG Q;  3UN6 A;  1DPP A;  4R6Y A;  2REG A;  3QUJ A;  1HSJ A;  1MS7 A;  5I59 A;  2NVU B;  3H6V A;  3PPQ A;  4F3S A;  1WOD A;  4GRK A;  3IR1 A;  4Q0C A;  4YB7 A;  1BIY A;  3S9N C;  2OZZ A;  4BLA A;  1LAF E;  2O69 A;  4ZE9 A;  2QMW A;  3RTF B;  1JW1 A;  3E13 X;  1FCK A;  4Z0I A;  2F78 A;  2QRY A;  1P99 A;  3QSL A;  4BDM A;  4QFK A;  2R71 A;  5EYF A;  4NWD A;  5FTI A;  4FE8 A;  3V5A A;  3JZJ A;  1MM7 A;  1QKA A;  5DT6 A;  3MPL A;  3C4M A;  1P1O A;  4OQO A;  2DE2 A;  2XX8 A;  3RTW B;  2QS1 A;  5EHM A;  3FAS A;  1II5 A;  1SBP A;  5DEX A;  2DS9 A;  2P2A A;  1MM6 A;  3I6V A;  4KD5 A;  3KSX A;  5I58 B;  3VLW A;  4DXB A;  3UIF A;  2Q2A A;  3GBB A;  2OK2 A;  2Z23 A;  1MXU A;  5F7V A;  2B65 A;  1B2H A;  2NOO A;  3N5L A;  2VGQ A;  2OWS A;  4P0I A;  1LAG E;  3K1M A;  3I5O A;  1F9B A;  1B40 A;  2FNC A;  5TP9 B;  4RPO A;  4NF8 B;  5I56 B;  5KCJ B;  5AA1 A;  2F8D A;  3ECR A;  1IQ7 A;  3K6V A;  4G4P A;  5H8F A;  4U21 A;  1IXI A;  2BJJ X;  3SEW A;  2RC8 A;  1WDN A;  4ZDM A;  1QUJ A;  3VE1 B;  3IB2 A;  3KJ7 A;  3A3C A;  4RPN A;  3SER A;  1S9T A;  1YCJ A;  1NNF A;  4ZEF A;  4ESW A;  1A7L A;  4IO3 A;  2CMO A;  2XXQ A;  4IO6 A;  2HZK A;  1MRP A;  4YU0 A;  1OQH A;  1I69 A;  2QS3 A;  5ELV A;  1P1W A;  2GRV A;  2HXW A;  3O6H A;  5DVF A;  4BDN A;  5CI5 A;  5KZT A;  3S2V A;  3OEK A;  4GIZ A;  3K01 A;  3OD7 A;  3VVD A;  1P1Q A;  1ZU0 A;  2Z8E A;  5KDT A;  3IB0 A;  4F18 A;  2DWA A;  3L6G A;  3CFZ A;  1YAE A;  4FAJ A;  1MQH A;  2GFE A;  4WED A;  3UK4 A;  2YLN A;  3T9X B;  5JTY B;  4GLI A;  4U1O A;  1FTM A;  2X7P A;  5CMM A;  4X1D A;  1SYI A;  2I4B A;  4XKP A;  4G2Z A;  4ZEB A;  2OCU A;  3E3K A;  1MXX A;  2AL5 A;  5ITO A;  2D3I A;  4F29 A;  2ALU A;  1MY3 A;  3DLN A;  4X9T A;  5F1Q A;  5DVI A;  1JQF A;  3W9W A;  1XT8 A;  4ELR A;  4G8M A;  1B0H A;  4OTE A;  2HQ0 A;  4WKM A;  3K0V A;  1PB9 A;  4LZ5 A;  3VLV A;  1USY E;  2QJE A;  2G93 A;  3IOU A;  3U93 A;  3MZB A;  5HBC A;  3VXC A;  2ABH A;  4GXS B;  2UXA A;  3TKD A;  4H65 A;  1Y3N A;  4HCW A;  4M1V A;  3H4Z A;  3PUY E;  1N76 A;  1URS A;  2XXH A;  1LBB A;  4R75 A;  1M5B A;  4H8I A;  5I59 B;  2OLB A;  3DEL B;  1QKB A;  3KZG A;  4F2Q A;  5M2V A;  4PFY A;  1MY1 A;  1FQC A;  4G68 C;  2H98 A;  4GXA A;  3ILT B;  3LBS A;  2A5T A;  4E0X A;  1OIB A;  2PMS A;  5TU0 A;  3C32 A;  3H6T A;  4OWD A;  3O6I A;  3O29 A;  1FQE A;  1TFA A;  1SVX B;  4LON B;  1H3D A;  1P1U A;  1Y3Q A;  2H99 A;  4KHZ E;  3O6G A;  4MFI A;  2I0B A;  3SEV A;  4OFJ A;  5H8H A;  3TYH A;  2W7Y A;  3DP8 A;  5DEX B;  3TEL A;  2F6G A;  1OVT A;  2F7A A;  2Z8F A;  1MG1 A;  1JVX A;  4LUB A;  1GR2 A;  3HPI A;  4NWC A;  4EUO A;  4RXL A;  4P11 A;  2I58 A;  2ZYM A;  3UA8 A;  4YMA A;  5I56 A;  5KCJ A;  2NUV A;  4F39 A;  4OEU A;  3Q26 A;  3GLB A;  2R9J A;  3OO8 A;  3TMG A;  1B0L A;  3C35 A;  3PPP A;  5FHO A;  3U72 A;  4ZEK A;  3ONM A;  1P1N A;  5H8F B;  3IOW A;  4IY6 A;  4JSD A;  3CFL A;  5JEI A;  1MXW A;  4H0W A;  3RN8 A;  2VD3 A;  3IOR A;  3FJ7 A;  1IUD A;  2KLF A;  1LST A;  1NKX A;  1IEJ A;  1MY2 A;  3SES A;  3MP8 A;  2H9B A;  1SYH A;  1B3F A;  3C31 A;  4ZE8 A;  3IK6 B;  1J1N A;  4JXI A;  4I8C A;  4M4G A;  1MQJ A;  2ZNT A;  1LAX A;  2YPN A;  4LQ5 A;  1GTK A;  3TZA A;  4IGT A;  1IXG A;  2HAU A;  2IEE A;  3MBP A;  3H7M A;  3G3I A;  3R6U A;  1PC3 A;  1A55 A;  1RYX A;  4G8H A;  4KQP A;  1WVJ A;  2V3U A;  3MUQ A;  4JWX A;  5ICQ A;  3CSB A;  5I2N B;  4ZZE A;  2Q2C A;  1LB9 A;  3MQ9 A;  5IAI A;  5H8S A;  2XXI A;  5J1D A;  1LFH A;  4FEC A;  2XX9 A;  1R6Z A;  3QAX A;  1DSN A;  1ANF A;  1PBQ A;  4KYS A;  1N0T A;  4QFO A;  4C1U A;  1SQY A;  4EF1 A;  3VFJ A;  3GZG A;  4PP0 A;  1D9V A;  1O64 A;  1H44 A;  3WAE A;  3K02 A;  2WKY A;  2G29 A;  3T9H B;  3PUV E;  1FTO A;  2ONS A;  3FXR A;  4F1U A;  2P0S A;  1JW5 A;  2UYF A;  4KR5 A;  3N94 A;  1FTJ A;  1NNT A;  3V83 A;  1B5H A;  4F3B A;  3KOT A;  1UIV A;  1LB8 A;  1UTB A;  2B3F A;  2DP8 A;  3EN3 A;  3K6U A;  2VHA A;  3K2D A;  4ZED A;  3SKP A;  3CG1 A;  4F3P A;  5I84 A;  1B7H A;  4YKP A;  4IB2 A;  4F3G A;  4HCY A;  1Y3P A;  3MPK A;  3U92 A;  3C9H A;  2PX1 A;  4TQU Q;  3EF7 A;  4POW A;  4DIG A;  2XXT A;  3ZKL A;  4R9G A;  3F11 A;  1S7Y A;  2D5W A;  3OO7 A;  2X26 A;  2XXU A;  4WEP A;  2F6P A;  4LP2 B;  1TWY A;  4RA1 A;  1MQD A;  3SET A;  2O6A A;  4OHN A;  4HTG A;  5TPA B;  4YKJ A;  1I6Q A;  1MPB A;  4IO5 A;  2A5T B;  3LUY A;  4QSD A;  1ZMG A;  2DXY A;  2UVI A;  3I3V A;  4POX A;  4OYV A;  3ODB A;  1B4Z A;  4EQ7 A;  2O7U A;  3KJT A;  1MDQ A;  1MXZ A;  3KG2 A;  1D3K A;  2ZYN A;  1CE2 A;  3IAZ A;  5FHM A;  3ZS6 A;  2PVU A;  1M5F A;  1VSO A;  4TOZ A;  4GD5 A;  1IIW A;  1ZIU A;  5H8H B;  2I49 A;  3S9M C;  5CC2 A;  2HCA A;  4O3A A;  4OES A;  3VV5 A;  1Y20 A;  2F34 A;  3K4U A;  4F2O A;  3H03 A;  2HFB A;  1US5 A;  1LFG A;  2Y84 A;  3OOA A;  3TFL A;  1SW4 A;  3E9X A;  1Y9U A;  3OO6 A;  5DYH A;  1POY 1;  4JSO A;  5I57 A;  2PYY A;  2QSX A;  3SEX A;  3MZ1 A;  4DCY A;  5JK4 A;  1SW5 A;  4GL8 A;  5H8Q B;  1LCT A;  3EQ1 A;  4QF9 A;  3TCH A;  2Q9T A;  3JV9 A;  5H8N A;  2R6G E;  3PD8 A;  1LLS A;  2ZYO A;  4X1B A;  3Q27 A;  4YB6 A;  3OEL A;  1BLF A;  3KSJ A;  3T22 A;  2HZL A;  3QK6 A;  3HHG A;  3B6Q A;  3HCQ A;  3TTR A;  4RK9 A;  3PPR A;  2XXV A;  2XXX A;  3MVY A;  3PPN A;  2PBW A;  5DVJ A;  4MF3 A;  4N6P A;  4LA9 A;  4QSC A;  4FAT A;  3M3F A;  3IOT A;  3FVN A;  5BUU A;  1B9J A;  1LBC A;  3S9E A;  4Q5T A;  2RCA A;  3FVO A;  3RQT A;  3TEP A;  4ZEI A;  3OEN A;  4NF6 B;  3H3G A;  1YTV A;  2FA7 A;  5I2N A;  1SW2 A;  4GFR A;  4H5F A;  3HO7 A;  2O68 A;  2Y7P A;  3DM0 A;  1B1X A;  3VLU A;  3T96 B;  3V89 B;  3PGF A;  3HV1 A;  2I3V A;  3FZV A;  4JWO A;  3O66 A;  3UGW A;  3R26 A;  4QFP A;  3FXU A;  1OLA A;  3Q29 A;  4JB7 A;  3Q25 A;  1Y1Z A;  5AA4 A;  4YMB A;  1USY H;  3AXF A;  3BFU A;  1PB7 A;  1HSE A;  5AA3 A;  1FQA A;  4NF4 A;  2OBG A;  3VDF A;  4MBP A;  1B05 A;  1RKM A;  3FVG A;  2H4I A;  5ITP A;  2QMX A;  4OFL A;  1MDP 1;  4OEV A;  3HN0 A;  4IY5 A;  1QUK A;  4H5G A;  5CRY A;  1FQB A;  4I62 A;  4F1Y A;  3O2A A;  1UTB B;  3PUZ E;  3FAT A;  2NWJ A;  1ELJ A;  1YPN A;  1UQW A;  3RLF E;  1PB8 A;  1URG A;  3THI A;  2DVZ A;  3QXM A;  1B46 A;  1JEV A;  2FYI A;  1XVY A;  4H67 A;  1AOV A;  1MY4 A;  4GL0 A;  5B70 A;  1Z7N E;  5L9M A;  3KOS A;  3RGY A;  3FV1 A;  4G77 A;  4YB5 A;  4GOT A;  1O63 A;  1PEB A;  4GF8 A;  3H06 B;  4IO4 A;  1Z7M E;  1ZJL A;  2I3W A;  3MAM A;  5TPA A;  1B32 A;  1B5J A;  2D21 A;  1B51 A;  1B7Z A;  3OSQ A;  2V3Q A;  2O1M A;  3T66 A;  4EQ9 A;  1NH7 A;  1TFD A;  4OMB A;  1I6A A;  4PQJ A;  3TTL A;  1B3E A;  1Y1M A;  1XC1 A;  3SEU A;  3FJM A;  2QS4 A;  1US4 A;  5CBR A;  3IX1 A;  4AB6 A;  2ONK E;  1SDX A;  3DP4 A;  4DE8 A;  1QUI A;  1QW0 A;  3TPA A;  3TUS A;  2DVC A;  4Q30 B;  1FTK A;  2ANJ A;  2M8C A;  4QSE A;  3RT6 B;  3HST A;  3M8U A;  3KEI A;  4NE4 A;  3OSR A;  1EH3 A;  3MP6 A;  2P1S A;  2XD3 A;  3A3U A;  3IJO B;  1SI1 A;  2GHA A;  4ONY A;  2LAO A;  4RYA A;  1AH5 A;  5CMK A;  1MQG A;  2V93 A;  2ZMB A;  4R73 A;  1CB6 A;  5AA2 D;  3N26 A;  3TDJ A;  4YKI A;  5H8Q A;  4L17 A;  1R1N A;  4XKN A;  2DSF A;  5I57 B;  1M5C A;  3SEY A;  4YKK A;  1D4N A;  3FJG A;  4E0W A;  1JEU A;  3PU5 A;  3B6W A;  4LZ8 A;  1VE4 A;  2X7Q A;  3FXQ A;  5H8N B;  1NFT A;  1ZKB A;  1XOC A;  3N6T A;  2RF1 A;  1JET A;  2AL4 A;  1DTG A;  1MH4 A;  4MLQ A;  3ILU B;  2DWJ A;  3S4U A;  2VP1 A;  3IJX B;  1A8E A;  4NF6 A;  3R7X A;  3PUW E;  3C33 A;  3CG3 A;  2CZL A;  3FVK A;  1N04 A;  1QJM A;  4MH5 A;  2REJ A;  1O7T A;  3KBR A;  4I1D A;  1UIU A;  3ZSF A;  4EDP A;  1EU8 A;  3PD9 A;  4OER A;  3K6X A;  3MVW A;  4R72 A;  3VVF A;  3IL1 B;  1BP5 A;  5CMC A;  4R2F A;  3TQW A;  4I9D A; 
#chains in the Genus database with same CATH topology
 4QFN A;  4ELQ A;  3SDF A;  4ELO A;  3TCG A;  1H43 A;  1S50 A;  1FJ6 A;  1R9L A;  1OLC A;  5AA4 B;  2UVH A;  4UAC A;  5IM2 A;  1ZBM A;  1CNQ A;  4EXK A;  4HS7 A;  4N15 A;  3WAF A;  4KPT A;  2ONR A;  2XXP A;  3VXB A;  4NF4 B;  4ZS9 A;  3P7I A;  3FV2 A;  3MW0 A;  4PFI A;  3IO4 A;  4P56 A;  2Z22 A;  4U22 A;  3UOR A;  1MPC A;  2DXR A;  2THI A;  4DCX A;  3OEM A;  4BDQ A;  1FPK A;  4GX3 A;  1A54 A;  4P3L A;  4N07 A;  4Z7E A;  2ESN A;  4BDO A;  4FIM A;  3O9P A;  1UTH A;  5A5X A;  1PDA A;  2I48 A;  4LVQ A;  1EZP A;  4GQO A;  2HEU A;  2DWI A;  3PTY A;  1FW0 A;  5I2K B;  2E1S A;  2RIN A;  2XHD A;  5L9O A;  3VVE A;  1NI9 A;  3MJN A;  4GVO A;  3D4C A;  4P9K A;  5LOM A;  1DMB A;  4NTL A;  1FQD A;  1OMP A;  3FUZ A;  2O1L A;  3TTM A;  1FJ9 A;  2XX7 A;  1TT1 A;  1OVB A;  1AL3 A;  5DW8 A;  5F24 A;  1MXY A;  1NNP A;  1AMF A;  1B3H A;  4R9F A;  3G3J A;  4F19 A;  1VDW A;  1JW4 A;  5HM4 B;  4I40 A;  4NF0 A;  2QS2 A;  3CR9 A;  3RUM A;  2WBB A;  4IO7 A;  2B3B A;  3PMW A;  5FHN A;  4MCO A;  2E0S A;  3K00 A;  1B1H A;  2XXW A;  4LZ7 A;  2PT1 A;  3K1N A;  2VPO A;  3L6H A;  3IO6 A;  3CSG A;  3FD3 A;  1JNF A;  4K3F A;  3FGS A;  3IOV A;  5B7D A;  4U23 A;  3U1O A;  4OET A;  1AIV A;  4U2R A;  3ZKK A;  4X04 A;  2O84 X;  4KCD A;  4KYE A;  3T0J A;  1NUW A;  4UAB A;  1IXC A;  4U4X A;  1NMU A;  4PGN A;  1PBP A;  1M5D A;  4ZZA A;  5L9S A;  2Q8J A;  5AA2 A;  1EYJ A;  1N3X A;  4C0R A;  4PAF A;  1FPG A;  2CZH A;  2FHY A;  3CVG A;  4NF5 B;  4DXC A;  1IME A;  3O28 A;  3MP1 A;  3PPO A;  1IZ1 A;  5K2X A;  2DYX A;  1URD A;  2CEY A;  2PFY A;  4R74 A;  4HE2 A;  4R6H A;  1SW1 A;  2F36 A;  4AS5 A;  1H76 A;  1NL5 A;  1HSL A;  2ZYK A;  2WX9 A;  2UYE A;  4EXL A;  4DDD A;  5FBP A;  1IXH A;  1NH8 A;  3C36 A;  4OVT A;  2I4C A;  5FTH A;  4NMY A;  3UP9 A;  2F35 A;  5ET7 A;  1MXV A;  2ZXT A;  1B58 A;  2I0C A;  4P0G A;  1NNK A;  1Y4T A;  5AE4 A;  4OXV A;  1I6B A;  3G3K A;  3H6U A;  4GX6 A;  1SD3 A;  2YJP A;  4ZEC A;  3D4G A;  3LSF B;  4PFU A;  2F97 A;  4YIC A;  4U4S A;  3KC1 A;  4HW8 A;  2UVJ A;  1A8F A;  2VOZ A;  1IMA A;  3HFU A;  4LQ2 A;  3DP6 A;  4HXV A;  1BTJ A;  5CBS A;  1YXI A;  1GV8 A;  5IKB A;  3S9L C;  4G68 A;  3T93 B;  3W15 C;  1FTL A;  4PF8 A;  4MMP A;  1MY0 A;  1N7X A;  3PV0 E;  4QRZ A;  3U8Q A;  1Q1K A;  1B3L A;  3LC8 A;  4Q8R A;  4WXJ A;  4TLL B;  3K1P A;  2VPN A;  5EQ7 A;  4GWO A;  4OVJ A;  3G3H A;  1IIT A;  1BKA A;  1DOT A;  3MC2 A;  5K2Y A;  4FEB A;  2F7C A;  1LGB C;  4EF2 A;  3RNN A;  5HPQ A;  4MLV A;  4AB5 A;  4PC9 A;  4THI A;  4OVS A;  1FPJ A;  3V8X B;  1T0K A;  4G8N A;  1MPD A;  1IMC A;  1B52 A;  3QIM A;  4IO2 A;  1IMD A;  1D9Y A;  2ZNS A;  3G3F A;  3OO9 A;  2AIX A;  1ZTY A;  3PMX A;  3K6W A;  4NED A;  1A40 A;  1RDX A;  5CMB A;  2Y5L A;  3QYT A;  2RCB A;  5I2K A;  1POT A;  4GWS A;  2V4C A;  5A5X B;  1UTH B;  4PFR A;  2IA4 A;  3LV0 A;  2VD2 A;  4O3B A;  3TCF A;  2AYS A;  1VFD A;  3LSX A;  2Y7W A;  1H45 A;  3TTK A;  2DOJ A;  2DWH A;  2UVG A;  3KN3 A;  4X48 A;  2A5S A;  2DE3 A;  1B5I A;  5BWJ A;  4IR8 A;  2OJT A;  3LSL A;  4DXU A;  4KFQ A;  4P8B A;  5DTB A;  3MVX A;  1MH3 A;  1LAH E;  1VR5 A;  3FIR A;  3EHT A;  1XHY A;  4YAH X;  1EYI A;  2F7B A;  3W9V A;  3TQL A;  4GWX A;  4OZ9 A;  4DI3 D;  4ECF A;  2PCR A;  1XVX A;  1N84 A;  4XKQ A;  2DQV A;  4IGR A;  4NG7 A;  4OFO A;  3RY3 A;  3LSW A;  1ZLQ A;  5CM6 A;  3C34 A;  1RYO A;  4H8J A;  1N3W A;  4ISU A;  4C1T A;  2HPG A;  2I6E A;  3T9U A;  5ET6 A;  3M3L A;  1DTZ A;  2Q89 A;  2OWT A;  1FPI A;  3N6U A;  3KBZ A;  3PMV A;  1B6H A;  4O3C A;  4ESX A;  1EZO A;  3EHS A;  4U1Z A;  3USD A;  1KWH A;  5I58 A;  4OEN A;  1GGG A;  4R6K A;  2V84 A;  4XTC Q;  1NUZ A;  4KYD A;  2PT2 A;  1M5E A;  3KGC A;  1DPE A;  2V25 A;  5EHS A;  2O7I A;  2O51 A;  4DZ1 A;  4NF5 A;  3KN7 A;  4PET A;  2ZNU A;  4ELP A;  3PUX E;  5AA2 B;  1EZ9 A;  2RC7 A;  5ISU A;  4FED A;  3LR1 A;  4GBW A;  1Q35 A;  4JDF A;  1L5T A;  4RNS A;  5TP9 A;  4NF8 A;  4H1X A;  1LCF A;  1GVC A;  1A99 A;  4RK2 A;  3RT8 A;  1MQI A;  2H25 A;  4F31 B;  4H6D A;  2RKM A;  2XXY A;  3H6W A;  1YYZ A;  4UA8 A;  4BDR A;  3RPW A;  4GWW A;  3IB1 A;  3G7W A;  2V3T A;  4TLM B;  3CFX A;  2HAV A;  2GHB A;  3TOD A;  2QFL A;  4PFW A;  2GH9 A;  3TTN A;  3OXN A;  3GBA A;  3MVZ A;  4O7I A;  5EQ8 A;  1QUL A;  2H5Y A;  1QGX A;  1NV4 A;  1IMF A;  3RYD A;  2Y7I A;  2Z8D A;  3E4R A;  3MWB A;  1Y4C A;  1TXF A;  3M3K A;  1XS5 A;  3A09 A;  2WYK A;  1FBD A;  3CRB A;  2QL3 A;  2QPQ A;  2WEF A;  3B6T A;  3EHU A;  5IZ1 A;  3O97 A;  4PAI A;  3Q28 A;  2RC9 A;  1B4H A;  3T9V A;  3HHF A;  4R2B A;  3B7D A;  4EQB A;  2ZZV A;  1B3G A;  2Y7K A;  4XKR A;  3EPE A;  3KN8 A;  4LAT A;  4BDL A;  4GBV A;  4JBZ A;  4MAG A;  4PDH A;  4G68 B;  2FBP A;  4PGP A;  4AQ4 A;  2DE4 A;  4QFL A;  5JTY A;  2F5X A;  2NXO A;  3BBR A;  3KFM A;  3QUF A;  5KDT B;  3CI8 A;  3CIJ A;  4XXU A;  4DLD A;  5L8D A;  4PE5 B;  4N13 A;  1JVY A;  1ATG A;  1N7W A;  4ND9 A;  3MZ9 A;  2Q88 A;  4F1V A;  2Y7R A;  2XWO A;  4RY1 A;  2Y5K A;  4KCC A;  3T1B A;  1LFI A;  5ICT A;  2XD2 A;  3GXA A;  4KI0 E;  4F22 A;  3BKI B;  1OQG A;  3JYR A;  4JVC A;  3B8B A;  3OMB A;  3BFT A;  3TAJ A;  4RJZ A;  4GWY A;  1QVS A;  1R9Q A;  4QHQ A;  1B7U A;  1FQF A;  3U94 A;  1SI0 A;  1VFE A;  4PFT A;  4FJP A;  4YZZ A;  4JWY A;  2XXR A;  3G3G A;  2CZK A;  4FOR A;  4OA4 A;  4XIG Q;  3UN6 A;  1DPP A;  4R6Y A;  2REG A;  3QUJ A;  1HSJ A;  1MS7 A;  5I59 A;  2NVU B;  3H6V A;  3PPQ A;  4F3S A;  2CZI A;  1WOD A;  2HHM A;  4GRK A;  3IR1 A;  4Q0C A;  2XA5 A;  4YB7 A;  1BIY A;  3S9N C;  2OZZ A;  4BLA A;  1LAF E;  2O69 A;  4ZE9 A;  2QMW A;  3RTF B;  1JW1 A;  3E13 X;  1FCK A;  4Z0I A;  2F78 A;  2QRY A;  1P99 A;  3QSL A;  4N8Y A;  4BDM A;  4QFK A;  2R71 A;  5EYF A;  1KA0 A;  4NWD A;  4MNP A;  5FTI A;  4FE8 A;  3V5A A;  3JZJ A;  3EKI A;  4JVI A;  1MM7 A;  4PBH A;  1QKA A;  5DT6 A;  3MPL A;  3C4M A;  4GWZ A;  1P1O A;  4OQO A;  2DE2 A;  2XX8 A;  1AWB A;  3RTW B;  2QS1 A;  5EHM A;  3FAS A;  1II5 A;  1SBP A;  5DEX A;  2DS9 A;  2P2A A;  1MM6 A;  3I6V A;  4KD5 A;  3KSX A;  5I58 B;  3VLW A;  4DXB A;  3UIF A;  2Q2A A;  3GBB A;  2OK2 A;  2Z23 A;  1MXU A;  3IFA A;  5F7V A;  2B65 A;  1B2H A;  2NOO A;  2B4L A;  4MNI A;  4PDD A;  1NV1 A;  3N5L A;  2VGQ A;  4OVR A;  2OWS A;  4P0I A;  1LAG E;  3K1M A;  1LBV A;  1LBY A;  3I5O A;  1F9B A;  1B40 A;  2FNC A;  2Q74 A;  2R8T A;  5TP9 B;  4RPO A;  4NF8 B;  5I56 B;  5KCJ B;  5AA1 A;  2F8D A;  3ECR A;  1IQ7 A;  3K6V A;  4G4P A;  2JJK A;  1NUX A;  1FBE A;  5H8F A;  4U21 A;  4P1L A;  3IFC A;  1IXI A;  4O8M A;  2BJJ X;  3SEW A;  2RC8 A;  1WDN A;  4ZDM A;  1QUJ A;  3VE1 B;  3IB2 A;  4NHB A;  3KJ7 A;  3A3C A;  4RPN A;  3SER A;  1S9T A;  1YCJ A;  1FPD A;  1NNF A;  4ZEF A;  4ESW A;  1A7L A;  4IO3 A;  5IGA A;  2CMO A;  2XXQ A;  3RPL A;  4IO6 A;  2HZK A;  1MRP A;  4YU0 A;  1OQH A;  1I69 A;  2QS3 A;  3KC0 A;  5ELV A;  1P1W A;  2GRV A;  2HXW A;  3O6H A;  5DVF A;  4BDN A;  4MHF A;  5CI5 A;  5KZT A;  3S2V A;  1G0I A;  3OEK A;  4GIZ A;  3K01 A;  3OD7 A;  3VVD A;  1P1Q A;  1ZU0 A;  2Z8E A;  5KDT A;  3IB0 A;  4F18 A;  2DWA A;  3L6G A;  3CFZ A;  1YAE A;  4FAJ A;  1MQH A;  2GFE A;  4WED A;  1FBC A;  3UK4 A;  4OVP A;  2YLN A;  5J16 A;  5T3J A;  3T9X B;  5JTY B;  4GLI A;  4U1O A;  2FIE A;  1FTM A;  2X7P A;  5CMM A;  4X1D A;  1SYI A;  2I4B A;  4XKP A;  4N6D A;  4G2Z A;  4ZEB A;  4PBQ A;  2OCU A;  3E3K A;  1MXX A;  2AL5 A;  5ITO A;  2D3I A;  1NV0 A;  4F29 A;  2XWV A;  2ALU A;  3B50 A;  1MY3 A;  3DLN A;  5EYH A;  4X9T A;  5F1Q A;  5DVI A;  1JQF A;  3W9W A;  1XT8 A;  4ELR A;  1DCU A;  5I5P A;  4G8M A;  1B0H A;  4OTE A;  2HQ0 A;  4WKM A;  3K0V A;  1PB9 A;  4LZ5 A;  5ET8 A;  3VLV A;  1USY E;  4H45 A;  2QJE A;  2G93 A;  3IOU A;  3U93 A;  3MZB A;  5HBC A;  3VXC A;  2ABH A;  4GXS B;  2UXA A;  2HXR A;  3TKD A;  4H65 A;  4XF5 A;  1Y3N A;  4HCW A;  4M1V A;  3H4Z A;  3PUY E;  4MEV A;  1G0H A;  2XWI A;  2ZZW A;  1N76 A;  1URS A;  2XXH A;  1LBB A;  4R75 A;  1M5B A;  4QBA A;  4H8I A;  5I59 B;  2OLB A;  3DEL B;  1QKB A;  1XI6 A;  5IZZ A;  1INP A;  3KZG A;  1YZ0 A;  4F2Q A;  5M2V A;  4PFY A;  4I3Y A;  3BIG A;  1MY1 A;  1FQC A;  4G68 C;  2H98 A;  4NGU A;  4GXA A;  3ILT B;  5I3S A;  5IZ3 A;  3LBS A;  4HE0 A;  2A5T A;  4E0X A;  1OIB A;  2PMS A;  1Q9D A;  5TU0 A;  2OX3 A;  3C32 A;  3H6T A;  4OWD A;  3O6I A;  1JP4 A;  3O29 A;  1FQE A;  1TFA A;  1SVX B;  5EYG A;  4LON B;  1H3D A;  1P1U A;  1Y3Q A;  2H99 A;  4KHZ E;  3O6G A;  2QVU A;  4MFI A;  2I0B A;  3SEV A;  4OFJ A;  2VT5 A;  5H8H A;  1NV2 A;  2W7Y A;  4LN5 A;  3DP8 A;  4G61 A;  3TYH A;  5DEX B;  3TEL A;  2F6G A;  1OVT A;  2F7A A;  2Z8F A;  1MG1 A;  2F3D A;  1JVX A;  4LUB A;  1GR2 A;  1IMB A;  3HPI A;  4NWC A;  4EUO A;  4RXL A;  4PFB A;  4P11 A;  2I58 A;  2ZYM A;  3UA8 A;  4YMA A;  5I56 A;  5KCJ A;  2NUV A;  4F39 A;  4OEU A;  3Q26 A;  1K9Z A;  3GLB A;  2R9J A;  3OO8 A;  3TMG A;  1B0L A;  3C35 A;  3PPP A;  5FHO A;  2QVV A;  3U72 A;  4ZEK A;  3ONM A;  1P1N A;  5H8F B;  3IOW A;  4IY6 A;  4JSD A;  3CFL A;  5JEI A;  1MXW A;  4H0W A;  3RN8 A;  2VD3 A;  3IOR A;  3FJ7 A;  1IUD A;  2KLF A;  1LST A;  1NKX A;  1IEJ A;  1MY2 A;  3SES A;  3MP8 A;  2H9B A;  2WBD A;  1SYH A;  1B3F A;  3C31 A;  4ZE8 A;  3IK6 B;  1J1N A;  1LBX A;  4JXI A;  4I8C A;  4M4G A;  1MQJ A;  4N4U A;  2ZNT A;  1LAX A;  2YPN A;  4LQ5 A;  1GTK A;  3TZA A;  3RPL B;  4IGT A;  1IXG A;  2HAU A;  5ET5 A;  2IEE A;  3MBP A;  3H7M A;  4KXP A;  3G3I A;  3R6U A;  1PC3 A;  1A55 A;  1RYX A;  4G8H A;  4KQP A;  1BK4 A;  1WVJ A;  2V3U A;  3BIH A;  3MUQ A;  5LDZ A;  4JWX A;  5ICQ A;  3CSB A;  2B4M A;  5I2N B;  4ZZE A;  2Q2C A;  1LB9 A;  3MQ9 A;  5IAI A;  5H8S A;  2XXI A;  5J1D A;  1LFH A;  4FEC A;  2XX9 A;  1R6Z A;  3QAX A;  1DSN A;  1ANF A;  1PBQ A;  4KYS A;  1N0T A;  4QFO A;  4C1U A;  1SQY A;  1KA1 A;  4EF1 A;  3VFJ A;  3MYU A;  3GZG A;  5A5L A;  4PP0 A;  1D9V A;  1O64 A;  1H44 A;  3WAE A;  3K02 A;  2WKY A;  2G29 A;  3T9H B;  3PUV E;  1FTO A;  2ONS A;  3FXR A;  4PF6 A;  4F1U A;  2P0S A;  1JW5 A;  4XEQ A;  2UYF A;  3D1R A;  4KR5 A;  3N94 A;  1D9Q A;  1FTJ A;  1NNT A;  3V83 A;  1B5H A;  4F3B A;  3KOT A;  1UIV A;  1LB8 A;  1UTB A;  2B3F A;  2DP8 A;  4H46 A;  3EN3 A;  1FBG A;  3K6U A;  1DK4 A;  2P3N A;  2VHA A;  3K2D A;  4ZED A;  3SKP A;  3CG1 A;  4F3P A;  5I84 A;  1B7H A;  4N91 A;  4YKP A;  4IB2 A;  4F3G A;  4HCY A;  1FPE A;  1Y3P A;  3MPK A;  3U92 A;  3C9H A;  2PX1 A;  4TQU Q;  3EF7 A;  4POW A;  4DIG A;  2XXT A;  3ZKL A;  4FBP A;  4R9G A;  3F11 A;  1S7Y A;  2D5W A;  3OO7 A;  2X26 A;  2XXU A;  4WEP A;  2F6P A;  4PE3 A;  4LP2 B;  1TWY A;  4RA1 A;  1MQD A;  3SET A;  2O6A A;  4OHN A;  4HTG A;  5TPA B;  4YKJ A;  1I6Q A;  1MPB A;  4IO5 A;  5IZ3 B;  2A5T B;  3LUY A;  4QSD A;  1ZMG A;  2DXY A;  2UVI A;  3I3V A;  4POX A;  4OYV A;  3ODB A;  4NN3 A;  4PCD A;  4OAN A;  4OVQ A;  1B4Z A;  4EQ7 A;  2O7U A;  4O94 A;  3KJT A;  1MDQ A;  1MXZ A;  3KG2 A;  1D3K A;  2ZYN A;  1CE2 A;  3IAZ A;  5FHM A;  3ZS6 A;  3A29 A;  2PVU A;  1M5F A;  5I7I A;  1VSO A;  4TOZ A;  4GD5 A;  1IIW A;  1ZIU A;  5H8H B;  2I49 A;  3S9M C;  4O7M A;  5CC2 A;  2HCA A;  4O3A A;  4OES A;  3VV5 A;  1Y20 A;  2F34 A;  3K4U A;  4F2O A;  4N17 A;  3H03 A;  3NOH A;  2HFB A;  3CHG A;  1US5 A;  1LFG A;  2Y84 A;  3OOA A;  3TFL A;  1FPL A;  1SW4 A;  3E9X A;  1Y9U A;  3OO6 A;  5DYH A;  1POY 1;  4JSO A;  1DBZ A;  5I57 A;  2PYY A;  2QSX A;  3SEX A;  3MZ1 A;  4DCY A;  5JK4 A;  1SW5 A;  4GL8 A;  5H8Q B;  3E79 A;  1LCT A;  3EQ1 A;  4QF9 A;  5ESY A;  3TCH A;  2Q9T A;  3JV9 A;  5H8N A;  2R6G E;  3PD8 A;  1LLS A;  2ZYO A;  4X1B A;  3Q27 A;  4YB6 A;  3OEL A;  1BLF A;  3GYY A;  3MST A;  3KSJ A;  2CEX A;  3T22 A;  2HZL A;  3QK6 A;  3HHG A;  3B6Q A;  3HCQ A;  3TTR A;  4RK9 A;  3PPR A;  2XXV A;  2XXX A;  3MVY A;  2DDK A;  2P3V A;  3PPN A;  2PBW A;  5DVJ A;  4MF3 A;  4N6K A;  4N6P A;  4LA9 A;  4QSC A;  4FAT A;  3M3F A;  3IOT A;  3FVN A;  5BUU A;  1B9J A;  1LBC A;  3S9E A;  1LEV A;  1RDZ A;  4Q5T A;  2RCA A;  3FVO A;  3RQT A;  3TEP A;  4ZEI A;  4MIJ A;  1FSA A;  4P1E A;  3OEN A;  4NF6 B;  3H3G A;  1YTV A;  2FA7 A;  5I2N A;  1SW2 A;  4GFR A;  4H5F A;  4XFE A;  3HO7 A;  2O68 A;  2Y7P A;  3DM0 A;  1B1X A;  3E78 A;  3VLU A;  3T96 B;  3V89 B;  3PGF A;  3HV1 A;  2I3V A;  3FZV A;  4JWO A;  3O66 A;  1KZ8 A;  3UGW A;  1FPB A;  3R26 A;  4QFP A;  4HE1 A;  3FXU A;  2MKZ A;  1NV7 A;  1FRP A;  1OLA A;  1FBP A;  3Q29 A;  4JB7 A;  3Q25 A;  1Y1Z A;  3QMF A;  5AA4 A;  4YMB A;  4P47 A;  1USY H;  3AXF A;  3BFU A;  1PB7 A;  1HSE A;  3FXB A;  4NQ8 A;  5AA3 A;  3ROJ A;  1FQA A;  4NF4 A;  4GX4 A;  2OBG A;  3VDF A;  4MBP A;  1B05 A;  1RKM A;  3FVG A;  2H4I A;  5ITP A;  2QMX A;  4OFL A;  1MDP 1;  4OEV A;  3HN0 A;  4PTK A;  4IY5 A;  1QUK A;  4H5G A;  4N8G A;  1FQB A;  4I62 A;  5CRY A;  4F1Y A;  3O2A A;  1UTB B;  3PUZ E;  3FAT A;  2NWJ A;  2FIX A;  1ELJ A;  1YPN A;  1UQW A;  3RLF E;  3LUZ A;  1PB8 A;  1URG A;  3THI A;  2DVZ A;  3QXM A;  1B46 A;  1JEV A;  1NV5 A;  2FYI A;  1XVY A;  4H67 A;  1AOV A;  1MY4 A;  4GL0 A;  5B70 A;  1Z7N E;  5L9M A;  2PFZ A;  3KOS A;  3RGY A;  3FV1 A;  4G77 A;  4YB5 A;  4GOT A;  1O63 A;  1PEB A;  4GF8 A;  3H06 B;  4IO4 A;  5LTC A;  2WYP A;  1Z7M E;  1ZJL A;  2I3W A;  3MAM A;  5TPA A;  1B32 A;  1B5J A;  2XWK A;  1LBZ A;  2QVR A;  2D21 A;  4NX1 A;  1B51 A;  1B7Z A;  4X8R A;  3OSQ A;  2BJI A;  2XXK A;  2V3Q A;  2O1M A;  3T66 A;  1NUY A;  4EQ9 A;  1NH7 A;  1TFD A;  2GQ1 A;  4OMB A;  1I6A A;  4PQJ A;  3TTL A;  1B3E A;  3SZP A;  1Y1M A;  1FBH A;  1XC1 A;  5EQA A;  3SEU A;  3FJM A;  2QS4 A;  1US4 A;  3ISP A;  5CBR A;  3IX1 A;  4AB6 A;  2ONK E;  1SDX A;  3DP4 A;  2FVZ A;  4DE8 A;  1QUI A;  1FPF A;  1QW0 A;  3TPA A;  3TUS A;  2DVC A;  4Q30 B;  1FTK A;  2ANJ A;  2M8C A;  4QSE A;  3RT6 B;  3HST A;  3M8U A;  1NV3 A;  3KEI A;  4NE4 A;  3OSR A;  1EH3 A;  3MP6 A;  2P1S A;  2XD3 A;  3A3U A;  4JVD A;  3IJO B;  1SI1 A;  2GHA A;  4ONY A;  2LAO A;  4PAK A;  4RYA A;  1AH5 A;  4N81 A;  5CMK A;  2Q8M A;  4MNC A;  1MQG A;  2V93 A;  2ZMB A;  4R73 A;  4QXD A;  1CB6 A;  1SPI A;  5AA2 D;  4AS4 A;  3U65 A;  3N26 A;  1LBW A;  3TDJ A;  2ZZX A;  4MJO A;  4YKI A;  5H8Q A;  4L17 A;  1R1N A;  2F3B A;  4I3E A;  4XKN A;  2DSF A;  5I57 B;  1M5C A;  3SEY A;  4MX6 A;  4YKK A;  1D4N A;  3FJG A;  4E0W A;  4GWU A;  1EYK A;  1JEU A;  1RDY A;  3PU5 A;  3B6W A;  4LZ8 A;  1VE4 A;  2X7Q A;  3FXQ A;  5H8N B;  1NFT A;  1ZKB A;  1XOC A;  3N6T A;  2RF1 A;  3FBP A;  1JET A;  2AL4 A;  1DTG A;  1MH4 A;  4MLQ A;  3ILU B;  1K9Y A;  2DWJ A;  2KR0 A;  3S4U A;  2VP1 A;  3IJX B;  4DI4 B;  1A8E A;  2OWZ A;  4NF6 A;  1FTA A;  3R7X A;  3PUW E;  3C33 A;  3CG3 A;  4NAP A;  2CZL A;  3FVK A;  1N04 A;  1QJM A;  4MH5 A;  2REJ A;  1O7T A;  3KBR A;  1NV6 A;  5EQ9 A;  4I1D A;  1UIU A;  3ZSF A;  4EDP A;  1EU8 A;  2KQZ A;  3PD9 A;  4OER A;  3K6X A;  1FBF A;  3MVW A;  4R72 A;  3VVF A;  3IL1 B;  1BP5 A;  5CMC A;  4R2F A;  3TQW A;  2L5V A;  4I9D A; 
#chains in the Genus database with same CATH homology
 4QFN A;  4ELQ A;  3SDF A;  4ELO A;  3TCG A;  1H43 A;  1S50 A;  1R9L A;  1OLC A;  5AA4 B;  2UVH A;  4UAC A;  1ZBM A;  4EXK A;  4HS7 A;  3WAF A;  4KPT A;  2ONR A;  2XXP A;  3VXB A;  4NF4 B;  4ZS9 A;  3P7I A;  3FV2 A;  3MW0 A;  3IO4 A;  2Z22 A;  4U22 A;  3UOR A;  1MPC A;  2DXR A;  2THI A;  4DCX A;  3OEM A;  4BDQ A;  1A54 A;  4Z7E A;  4N07 A;  2ESN A;  4BDO A;  4FIM A;  3O9P A;  1UTH A;  5A5X A;  1PDA A;  2I48 A;  4LVQ A;  1EZP A;  4GQO A;  2HEU A;  2DWI A;  1FW0 A;  5I2K B;  2E1S A;  2RIN A;  2XHD A;  5L9O A;  3VVE A;  3MJN A;  4GVO A;  3D4C A;  5LOM A;  1DMB A;  4NTL A;  1FQD A;  1OMP A;  3FUZ A;  2O1L A;  3TTM A;  2XX7 A;  1TT1 A;  1OVB A;  1AL3 A;  1MXY A;  1NNP A;  1AMF A;  1B3H A;  4R9F A;  3G3J A;  4F19 A;  1JW4 A;  5HM4 B;  2QS2 A;  3CR9 A;  3RUM A;  4IO7 A;  2B3B A;  3PMW A;  5FHN A;  2E0S A;  3K00 A;  1B1H A;  2XXW A;  4LZ7 A;  2PT1 A;  3K1N A;  3L6H A;  3IO6 A;  3CSG A;  3FD3 A;  1JNF A;  4K3F A;  3FGS A;  3IOV A;  5B7D A;  4U23 A;  3U1O A;  4OET A;  1AIV A;  4U2R A;  3ZKK A;  2O84 X;  4KCD A;  4KYE A;  1IXC A;  4U4X A;  1NMU A;  1PBP A;  1M5D A;  4ZZA A;  5L9S A;  2Q8J A;  5AA2 A;  1N3X A;  4C0R A;  3CVG A;  4NF5 B;  4DXC A;  3O28 A;  3MP1 A;  3PPO A;  1IZ1 A;  5K2X A;  2DYX A;  1URD A;  4R74 A;  4R6H A;  1SW1 A;  2F36 A;  1H76 A;  1NL5 A;  1HSL A;  2ZYK A;  2UYE A;  4EXL A;  4DDD A;  1IXH A;  1NH8 A;  3C36 A;  2I4C A;  5FTH A;  4NMY A;  3UP9 A;  2F35 A;  1MXV A;  2ZXT A;  1B58 A;  2I0C A;  4P0G A;  1NNK A;  1Y4T A;  5AE4 A;  4OXV A;  1I6B A;  3G3K A;  3H6U A;  1SD3 A;  2YJP A;  4ZEC A;  3D4G A;  3LSF B;  4PFU A;  2F97 A;  4YIC A;  4U4S A;  4HW8 A;  2UVJ A;  1A8F A;  2VOZ A;  4LQ2 A;  3DP6 A;  1BTJ A;  5CBS A;  1GV8 A;  5IKB A;  3S9L C;  4G68 A;  3T93 B;  3W15 C;  1FTL A;  1MY0 A;  1N7X A;  3PV0 E;  4QRZ A;  3U8Q A;  1Q1K A;  1B3L A;  3LC8 A;  4Q8R A;  4WXJ A;  4TLL B;  3K1P A;  4GWO A;  4OVJ A;  3G3H A;  1IIT A;  1BKA A;  1DOT A;  3MC2 A;  5K2Y A;  4FEB A;  2F7C A;  1LGB C;  4EF2 A;  3RNN A;  5HPQ A;  4MLV A;  4AB5 A;  4THI A;  3V8X B;  1T0K A;  4G8N A;  1MPD A;  1B52 A;  3QIM A;  4IO2 A;  1D9Y A;  2ZNS A;  3G3F A;  3OO9 A;  2AIX A;  1ZTY A;  3PMX A;  3K6W A;  4NED A;  1A40 A;  5CMB A;  3QYT A;  2RCB A;  5I2K A;  1POT A;  5A5X B;  1UTH B;  2IA4 A;  2VD2 A;  4O3B A;  3TCF A;  2AYS A;  1VFD A;  3LSX A;  2Y7W A;  1H45 A;  3TTK A;  2DOJ A;  2DWH A;  2UVG A;  3KN3 A;  4X48 A;  2A5S A;  2DE3 A;  1B5I A;  5BWJ A;  2OJT A;  3LSL A;  4DXU A;  4KFQ A;  5DTB A;  3MVX A;  1MH3 A;  1LAH E;  1VR5 A;  3FIR A;  3EHT A;  1XHY A;  4YAH X;  2F7B A;  3W9V A;  3TQL A;  4OZ9 A;  4ECF A;  1XVX A;  1N84 A;  4XKQ A;  2DQV A;  4IGR A;  4OFO A;  3RY3 A;  3LSW A;  1ZLQ A;  5CM6 A;  3C34 A;  1RYO A;  4H8J A;  1N3W A;  4ISU A;  4C1T A;  2I6E A;  3T9U A;  3M3L A;  1DTZ A;  2Q89 A;  2OWT A;  3N6U A;  1B6H A;  3PMV A;  4O3C A;  4ESX A;  1EZO A;  3EHS A;  4U1Z A;  3USD A;  1KWH A;  5I58 A;  4OEN A;  1GGG A;  4R6K A;  2V84 A;  4XTC Q;  4KYD A;  2PT2 A;  1M5E A;  3KGC A;  1DPE A;  2V25 A;  5EHS A;  2O7I A;  2O51 A;  4DZ1 A;  4NF5 A;  3KN7 A;  4PET A;  2ZNU A;  4ELP A;  3PUX E;  5AA2 B;  1EZ9 A;  2RC7 A;  5ISU A;  4FED A;  3LR1 A;  1Q35 A;  4JDF A;  1L5T A;  4RNS A;  5TP9 A;  4NF8 A;  4H1X A;  1LCF A;  1GVC A;  1A99 A;  4RK2 A;  3RT8 A;  1MQI A;  2H25 A;  4F31 B;  4H6D A;  2RKM A;  2XXY A;  3H6W A;  4UA8 A;  4BDR A;  3RPW A;  3IB1 A;  3G7W A;  2V3T A;  4TLM B;  3CFX A;  2HAV A;  2GHB A;  3TOD A;  4PFW A;  2GH9 A;  3TTN A;  3OXN A;  3GBA A;  3MVZ A;  1QUL A;  2H5Y A;  2Y7I A;  2Z8D A;  3E4R A;  3MWB A;  1Y4C A;  1TXF A;  3M3K A;  1XS5 A;  3A09 A;  3CRB A;  2QL3 A;  2QPQ A;  3B6T A;  3EHU A;  3O97 A;  3Q28 A;  2RC9 A;  1B4H A;  3T9V A;  3HHF A;  4R2B A;  3B7D A;  4EQB A;  1B3G A;  2Y7K A;  4XKR A;  3EPE A;  3KN8 A;  4LAT A;  4BDL A;  4JBZ A;  4G68 B;  4AQ4 A;  2DE4 A;  4QFL A;  5JTY A;  2F5X A;  2NXO A;  3BBR A;  3KFM A;  3QUF A;  5KDT B;  3CI8 A;  3CIJ A;  4XXU A;  4DLD A;  5L8D A;  4PE5 B;  4N13 A;  1JVY A;  1ATG A;  1N7W A;  4ND9 A;  3MZ9 A;  2Q88 A;  4F1V A;  2Y7R A;  4RY1 A;  4KCC A;  1LFI A;  5ICT A;  2XD2 A;  3GXA A;  4KI0 E;  4F22 A;  3BKI B;  1OQG A;  3JYR A;  3OMB A;  3BFT A;  3TAJ A;  4RJZ A;  1QVS A;  1R9Q A;  4QHQ A;  1B7U A;  1FQF A;  3U94 A;  1SI0 A;  1VFE A;  4PFT A;  4FJP A;  4YZZ A;  4JWY A;  2XXR A;  3G3G A;  4FOR A;  4XIG Q;  3UN6 A;  1DPP A;  4R6Y A;  2REG A;  3QUJ A;  1HSJ A;  1MS7 A;  5I59 A;  2NVU B;  3H6V A;  3PPQ A;  4F3S A;  1WOD A;  4GRK A;  3IR1 A;  4Q0C A;  4YB7 A;  1BIY A;  3S9N C;  2OZZ A;  4BLA A;  1LAF E;  2O69 A;  4ZE9 A;  2QMW A;  3RTF B;  1JW1 A;  3E13 X;  1FCK A;  4Z0I A;  2F78 A;  2QRY A;  1P99 A;  3QSL A;  4BDM A;  4QFK A;  2R71 A;  5EYF A;  4NWD A;  5FTI A;  4FE8 A;  3V5A A;  3JZJ A;  1MM7 A;  1QKA A;  5DT6 A;  3MPL A;  3C4M A;  1P1O A;  4OQO A;  2DE2 A;  2XX8 A;  3RTW B;  2QS1 A;  5EHM A;  3FAS A;  1II5 A;  1SBP A;  5DEX A;  2DS9 A;  2P2A A;  1MM6 A;  3I6V A;  4KD5 A;  3KSX A;  5I58 B;  3VLW A;  4DXB A;  3UIF A;  2Q2A A;  3GBB A;  2OK2 A;  2Z23 A;  1MXU A;  5F7V A;  2B65 A;  1B2H A;  2NOO A;  3N5L A;  2VGQ A;  2OWS A;  4P0I A;  1LAG E;  3K1M A;  3I5O A;  1F9B A;  1B40 A;  2FNC A;  5TP9 B;  4RPO A;  4NF8 B;  5I56 B;  5KCJ B;  5AA1 A;  2F8D A;  3ECR A;  1IQ7 A;  3K6V A;  4G4P A;  5H8F A;  4U21 A;  1IXI A;  2BJJ X;  3SEW A;  2RC8 A;  1WDN A;  4ZDM A;  1QUJ A;  3VE1 B;  3IB2 A;  3KJ7 A;  3A3C A;  4RPN A;  3SER A;  1S9T A;  1YCJ A;  1NNF A;  4ZEF A;  4ESW A;  1A7L A;  4IO3 A;  2CMO A;  2XXQ A;  4IO6 A;  2HZK A;  1MRP A;  4YU0 A;  1OQH A;  1I69 A;  2QS3 A;  5ELV A;  1P1W A;  2GRV A;  2HXW A;  3O6H A;  5DVF A;  4BDN A;  5CI5 A;  5KZT A;  3S2V A;  3OEK A;  4GIZ A;  3K01 A;  3OD7 A;  3VVD A;  1P1Q A;  1ZU0 A;  2Z8E A;  5KDT A;  3IB0 A;  4F18 A;  2DWA A;  3L6G A;  3CFZ A;  1YAE A;  4FAJ A;  1MQH A;  2GFE A;  4WED A;  3UK4 A;  2YLN A;  3T9X B;  5JTY B;  4GLI A;  4U1O A;  1FTM A;  2X7P A;  5CMM A;  4X1D A;  1SYI A;  2I4B A;  4XKP A;  4G2Z A;  4ZEB A;  2OCU A;  3E3K A;  1MXX A;  2AL5 A;  5ITO A;  2D3I A;  4F29 A;  2ALU A;  1MY3 A;  3DLN A;  4X9T A;  5F1Q A;  5DVI A;  1JQF A;  3W9W A;  1XT8 A;  4ELR A;  4G8M A;  1B0H A;  4OTE A;  2HQ0 A;  4WKM A;  3K0V A;  1PB9 A;  4LZ5 A;  3VLV A;  1USY E;  2QJE A;  2G93 A;  3IOU A;  3U93 A;  3MZB A;  5HBC A;  3VXC A;  2ABH A;  4GXS B;  2UXA A;  3TKD A;  4H65 A;  1Y3N A;  4HCW A;  4M1V A;  3H4Z A;  3PUY E;  1N76 A;  1URS A;  2XXH A;  1LBB A;  4R75 A;  1M5B A;  4H8I A;  5I59 B;  2OLB A;  3DEL B;  1QKB A;  3KZG A;  4F2Q A;  5M2V A;  4PFY A;  1MY1 A;  1FQC A;  4G68 C;  2H98 A;  4GXA A;  3ILT B;  3LBS A;  2A5T A;  4E0X A;  1OIB A;  2PMS A;  5TU0 A;  3C32 A;  3H6T A;  4OWD A;  3O6I A;  3O29 A;  1FQE A;  1TFA A;  1SVX B;  4LON B;  1H3D A;  1P1U A;  1Y3Q A;  2H99 A;  4KHZ E;  3O6G A;  4MFI A;  2I0B A;  3SEV A;  4OFJ A;  5H8H A;  3TYH A;  2W7Y A;  3DP8 A;  5DEX B;  3TEL A;  2F6G A;  1OVT A;  2F7A A;  2Z8F A;  1MG1 A;  1JVX A;  4LUB A;  1GR2 A;  3HPI A;  4NWC A;  4EUO A;  4RXL A;  4P11 A;  2I58 A;  2ZYM A;  3UA8 A;  4YMA A;  5I56 A;  5KCJ A;  2NUV A;  4F39 A;  4OEU A;  3Q26 A;  3GLB A;  2R9J A;  3OO8 A;  3TMG A;  1B0L A;  3C35 A;  3PPP A;  5FHO A;  3U72 A;  4ZEK A;  3ONM A;  1P1N A;  5H8F B;  3IOW A;  4IY6 A;  4JSD A;  3CFL A;  5JEI A;  1MXW A;  4H0W A;  3RN8 A;  2VD3 A;  3IOR A;  3FJ7 A;  1IUD A;  2KLF A;  1LST A;  1NKX A;  1IEJ A;  1MY2 A;  3SES A;  3MP8 A;  2H9B A;  1SYH A;  1B3F A;  3C31 A;  4ZE8 A;  3IK6 B;  1J1N A;  4JXI A;  4I8C A;  4M4G A;  1MQJ A;  2ZNT A;  1LAX A;  2YPN A;  4LQ5 A;  1GTK A;  3TZA A;  4IGT A;  1IXG A;  2HAU A;  2IEE A;  3MBP A;  3H7M A;  3G3I A;  3R6U A;  1PC3 A;  1A55 A;  1RYX A;  4G8H A;  4KQP A;  1WVJ A;  2V3U A;  3MUQ A;  4JWX A;  5ICQ A;  3CSB A;  5I2N B;  4ZZE A;  2Q2C A;  1LB9 A;  3MQ9 A;  5IAI A;  5H8S A;  2XXI A;  5J1D A;  1LFH A;  4FEC A;  2XX9 A;  1R6Z A;  3QAX A;  1DSN A;  1ANF A;  1PBQ A;  4KYS A;  1N0T A;  4QFO A;  4C1U A;  1SQY A;  4EF1 A;  3VFJ A;  3GZG A;  4PP0 A;  1D9V A;  1O64 A;  1H44 A;  3WAE A;  3K02 A;  2WKY A;  2G29 A;  3T9H B;  3PUV E;  1FTO A;  2ONS A;  3FXR A;  4F1U A;  2P0S A;  1JW5 A;  2UYF A;  4KR5 A;  3N94 A;  1FTJ A;  1NNT A;  3V83 A;  1B5H A;  4F3B A;  3KOT A;  1UIV A;  1LB8 A;  1UTB A;  2B3F A;  2DP8 A;  3EN3 A;  3K6U A;  2VHA A;  3K2D A;  4ZED A;  3SKP A;  3CG1 A;  4F3P A;  5I84 A;  1B7H A;  4YKP A;  4IB2 A;  4F3G A;  4HCY A;  1Y3P A;  3MPK A;  3U92 A;  3C9H A;  2PX1 A;  4TQU Q;  3EF7 A;  4POW A;  4DIG A;  2XXT A;  3ZKL A;  4R9G A;  3F11 A;  1S7Y A;  2D5W A;  3OO7 A;  2X26 A;  2XXU A;  4WEP A;  2F6P A;  4LP2 B;  1TWY A;  4RA1 A;  1MQD A;  3SET A;  2O6A A;  4OHN A;  4HTG A;  5TPA B;  4YKJ A;  1I6Q A;  1MPB A;  4IO5 A;  2A5T B;  3LUY A;  4QSD A;  1ZMG A;  2DXY A;  2UVI A;  3I3V A;  4POX A;  4OYV A;  3ODB A;  1B4Z A;  4EQ7 A;  2O7U A;  3KJT A;  1MDQ A;  1MXZ A;  3KG2 A;  1D3K A;  2ZYN A;  1CE2 A;  3IAZ A;  5FHM A;  3ZS6 A;  2PVU A;  1M5F A;  1VSO A;  4TOZ A;  4GD5 A;  1IIW A;  1ZIU A;  5H8H B;  2I49 A;  3S9M C;  5CC2 A;  2HCA A;  4O3A A;  4OES A;  3VV5 A;  1Y20 A;  2F34 A;  3K4U A;  4F2O A;  3H03 A;  2HFB A;  1US5 A;  1LFG A;  2Y84 A;  3OOA A;  3TFL A;  1SW4 A;  3E9X A;  1Y9U A;  3OO6 A;  5DYH A;  1POY 1;  4JSO A;  5I57 A;  2PYY A;  2QSX A;  3SEX A;  3MZ1 A;  4DCY A;  5JK4 A;  1SW5 A;  4GL8 A;  5H8Q B;  1LCT A;  3EQ1 A;  4QF9 A;  3TCH A;  2Q9T A;  3JV9 A;  5H8N A;  2R6G E;  3PD8 A;  1LLS A;  2ZYO A;  4X1B A;  3Q27 A;  4YB6 A;  3OEL A;  1BLF A;  3KSJ A;  3T22 A;  2HZL A;  3QK6 A;  3HHG A;  3B6Q A;  3HCQ A;  3TTR A;  4RK9 A;  3PPR A;  2XXV A;  2XXX A;  3MVY A;  3PPN A;  2PBW A;  5DVJ A;  4MF3 A;  4N6P A;  4LA9 A;  4QSC A;  4FAT A;  3M3F A;  3IOT A;  3FVN A;  5BUU A;  1B9J A;  1LBC A;  3S9E A;  4Q5T A;  2RCA A;  3FVO A;  3RQT A;  3TEP A;  4ZEI A;  3OEN A;  4NF6 B;  3H3G A;  1YTV A;  2FA7 A;  5I2N A;  1SW2 A;  4GFR A;  4H5F A;  3HO7 A;  2O68 A;  2Y7P A;  3DM0 A;  1B1X A;  3VLU A;  3T96 B;  3V89 B;  3PGF A;  3HV1 A;  2I3V A;  3FZV A;  4JWO A;  3O66 A;  3UGW A;  3R26 A;  4QFP A;  3FXU A;  1OLA A;  3Q29 A;  4JB7 A;  3Q25 A;  1Y1Z A;  5AA4 A;  4YMB A;  1USY H;  3AXF A;  3BFU A;  1PB7 A;  1HSE A;  5AA3 A;  1FQA A;  4NF4 A;  2OBG A;  3VDF A;  4MBP A;  1B05 A;  1RKM A;  3FVG A;  2H4I A;  5ITP A;  2QMX A;  4OFL A;  1MDP 1;  4OEV A;  3HN0 A;  4IY5 A;  1QUK A;  4H5G A;  5CRY A;  1FQB A;  4I62 A;  4F1Y A;  3O2A A;  1UTB B;  3PUZ E;  3FAT A;  2NWJ A;  1ELJ A;  1YPN A;  1UQW A;  3RLF E;  1PB8 A;  1URG A;  3THI A;  2DVZ A;  3QXM A;  1B46 A;  1JEV A;  2FYI A;  1XVY A;  4H67 A;  1AOV A;  1MY4 A;  4GL0 A;  5B70 A;  1Z7N E;  5L9M A;  3KOS A;  3RGY A;  3FV1 A;  4G77 A;  4YB5 A;  4GOT A;  1O63 A;  1PEB A;  4GF8 A;  3H06 B;  4IO4 A;  1Z7M E;  1ZJL A;  2I3W A;  3MAM A;  5TPA A;  1B32 A;  1B5J A;  2D21 A;  1B51 A;  1B7Z A;  3OSQ A;  2V3Q A;  2O1M A;  3T66 A;  4EQ9 A;  1NH7 A;  1TFD A;  4OMB A;  1I6A A;  4PQJ A;  3TTL A;  1B3E A;  1Y1M A;  1XC1 A;  3SEU A;  3FJM A;  2QS4 A;  1US4 A;  5CBR A;  3IX1 A;  4AB6 A;  2ONK E;  1SDX A;  3DP4 A;  4DE8 A;  1QUI A;  1QW0 A;  3TPA A;  3TUS A;  2DVC A;  4Q30 B;  1FTK A;  2ANJ A;  2M8C A;  4QSE A;  3RT6 B;  3HST A;  3M8U A;  3KEI A;  4NE4 A;  3OSR A;  1EH3 A;  3MP6 A;  2P1S A;  2XD3 A;  3A3U A;  3IJO B;  1SI1 A;  2GHA A;  4ONY A;  2LAO A;  4RYA A;  1AH5 A;  5CMK A;  1MQG A;  2V93 A;  2ZMB A;  4R73 A;  1CB6 A;  5AA2 D;  3N26 A;  3TDJ A;  4YKI A;  5H8Q A;  4L17 A;  1R1N A;  4XKN A;  2DSF A;  5I57 B;  1M5C A;  3SEY A;  4YKK A;  1D4N A;  3FJG A;  4E0W A;  1JEU A;  3PU5 A;  3B6W A;  4LZ8 A;  1VE4 A;  2X7Q A;  3FXQ A;  5H8N B;  1NFT A;  1ZKB A;  1XOC A;  3N6T A;  2RF1 A;  1JET A;  2AL4 A;  1DTG A;  1MH4 A;  4MLQ A;  3ILU B;  2DWJ A;  3S4U A;  2VP1 A;  3IJX B;  1A8E A;  4NF6 A;  3R7X A;  3PUW E;  3C33 A;  3CG3 A;  2CZL A;  3FVK A;  1N04 A;  1QJM A;  4MH5 A;  2REJ A;  1O7T A;  3KBR A;  4I1D A;  1UIU A;  3ZSF A;  4EDP A;  1EU8 A;  3PD9 A;  4OER A;  3K6X A;  3MVW A;  4R72 A;  3VVF A;  3IL1 B;  1BP5 A;  5CMC A;  4R2F A;  3TQW A;  4I9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...