4OHNA

Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
246
Chain Sequence
TSGDNWSKYQSNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAVFEKYGITVNWQPIDWDLKEAELTKGTIDLIWNGYSATDERREKVAFSNSYMKNEQVLVTKKSSGITTAKDMTGKTLGAQAGSSGYADFEANPEILKNIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVGSRKEDTTLVKKINEAFSSLYKDGKFQEISQKWFGEDVATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an ABC uptake transporter substrate binding protein from Streptococcus pneumoniae with Bound Histidine
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
molecule keywords ABC transporter substrate-binding protein
total genus 89
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ohnA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ohnA02
1TFDA 2B3BA 4OFLA 4IO6A 3U72A 1IXIA 2I4CA 1SW1A 2Z22A 2FYIA 3KBRA 4I8CA 2RCBA 3M8UA 1MXXA 3USDA 1OVBA 3N6TA 4GWOA 5DYHA 3RTWB 4F1YA 3MP1A 3Q26A 4NMYA 2PT1A 4YAHX 3TQLA 2Q9TA 3ODBA 3VVEA 5I56A 5I59A 3HPIA 1B7ZA 1VFDA 1Y1MA 2R71A 3CSGA 3LSWA 2FA7A 4R6YA 2XXTA 5DTBA 1B05A 1B51A 3B6QA 1L5TA 4NE4A 1B0HA 2X7PA 3O28A 5I2KB 1B46A 5I58A 4KPTA 4R6KA 2UXAA 3E13X 4F22A 1LCFA 1NNPA 2I48A 1PDAA 2RC7A 2HAVA 3CFLA 3GZGA 3M3KA 4IGTA 3FJ7A 3DP6A 1J1NA 1ZBMA 3D4GA 5H8FA 1FQEA 1QUJA 2Z8FA 2OK2A 4OEUA 4HW8A 1N04A 4DIGA 3OEKA 1LBBA 3A3UA 3QUFA 4QFOA 5CM6A 1DOTA 2DE4A 3T9HB 4EUOA 4C1TA 1XOCA 3FVNA 1Y1ZA 4KYSA 2RINA 4DXBA 2D21A 2E1SA 3OD7A 4PFTA 3UA8A 5AA4B 3S9MC 1CE2A 3C34A 1A7LA 1FTKA 3JYRA 4QFKA 1MXVA 3EPEA 2M8CA 4OMBA 1NL5A 1YAEA 2DYXA 3HCQA 4OTEA 3FJMA 5H8QB 4DCYA 1NFTA 3PMWA 4NF4A 4PFUA 4MLVA 5DEXB 5EHMA 1LGBC 3SDFA 2XXXA 4DZ1A 5TPAA 1Y4CA 4OENA 2Z8EA 3QXMA 4LATA 5J1DA 5F1QA 3VXBA 4YICA 3QAXA 2DXYA 1FQFA 3CI8A 4U4SA 3HV1A 3CFZA 4MLQA 4Q8RA 2GRVA 3O9PA 2G93A 5H8NB 3HN0A 3H6WA 3AXFA 1BIYA 2XXHA 3GXAA 1O7TA 4ND9A 4Q5TA 3U1OA 2XXUA 4F19A 1Y3QA 3U94A 3SEXA 4FE8A 2X26A 1B1HA 2DWAA 2D5WA 3C36A 3QYTA 2VD2A 1QKAA 2NOOA 3JZJA 1QULA 4FIMA 4KCDA 1PEBA 3M3LA 3CRBA 2QL3A 3MZBA 3RPWA 4GFRA 1USYE 2XXIA 3FASA 2V84A 3TTKA 4E0WA 1LFHA 5ISUA 4WEDA 4DDDA 3C33A 3TPAA 4R9GA 1M5BA 3OSQA 1Z7ME 2HQ0A 4WXJA 3RQTA 3L6GA 2XX8A 4GF8A 3E3KA 1HSJA 4G8NA 2XXPA 2VHAA 4G68C 4G8MA 4X9TA 4LVQA 4RYAA 1AMFA 1B3FA 1B5IA 3RGYA 2OBGA 3G3IA 1D4NA 2QRYA 5I57A 1TT1A 2O6AA 1EZOA 3FIRA 1JEUA 2F7BA 3OSRA 4G77A 4RPOA 1T0KA 1SVXB 2Y7KA 1SQYA 1UTBB 2I0CA 2OWSA 4JBZA 3TAJA 1XT8A 3T9UA 3O2AA 4F31B 3G7WA 3V89B 5L9OA 3ECRA 2W7YA 4NF8A 3MZ9A 5B7DA 3IB1A 5ICQA 4IO5A 4YKKA 2HZLA 3SKPA 4F3GA 3EF7A 2RF1A 2QS3A 2UVHA 1GTKA 2DE3A 1POY1 4YKJA 1US5A 3KEIA 4RA1A 2XX9A 3EQ1A 1NH7A 1IUDA 3DLNA 5H8QA 1CB6A 2GHAA 2Y7PA 4TLMB 4ZEIA 4E0XA 3OO9A 1HSEA 1MH3A 1LB9A 2F97A 3SEVA 3BFTA 3JV9A 4EQ7A 1RYOA 3TFLA 5KDTA 4ELOA 3TEPA 3FV2A 1QJMA 4LP2B 5CMBA 1M5CA 3OENA 4N07A 1OMPA 1MQHA 2DWJA 2ANJA 2P1SA 3KGCA 5B70A 4NF5B 3M3FA 4G68A 4XIGQ 3RN8A 1MY0A 4PFYA 3WAFA 1UIUA 3MZ1A 5KCJA 4O3CA 2DVZA 3K02A 3MPKA 2F6GA 1DTZA 1R1NA 2V93A 2PMSA 3C35A 1JVYA 4IB2A 4IO4A 2Q89A 4JXIA 5L8DA 3T22A 4DXUA 1P1OA 1QKBA 3IR1A 3O29A 4MFIA 4QFNA 4GXAA 1R9QA 2P0SA 2Y7RA 2Y7IA 3IJXB 5I2NB 4G4PA 5IKBA 4YKIA 1B3EA 2ALUA 2A5SA 2F5XA 3HO7A 4ZE8A 5CMMA 4KYDA 3RY3A 3TTRA 3QIMA 4NWCA 2OWTA 1KWHA 1WDNA 4BDOA 2GFEA 1OLCA 2XX7A 3MQ9A 3PPQA 2Y84A 2QMXA 2HCAA 3EHSA 4Z7EA 3PD9A 2DE2A 3IAZA 1H44A 4PQJA 2KLFA 1ZLQA 2PT2A 1P1WA 4NF6A 1POTA 3I3VA 3LSLA 5F7VA 1NMUA 2PVUA 4ZZAA 5JEIA 3N6UA 3C32A 3CVGA 3PGFA 1URSA 4OFOA 4R2FA 3K2DA 1FTMA 1H45A 2D3IA 5I58B 3DP8A 4Q0CA 4H65A 4EXLA 1B9JA 1AH5A 1YCJA 5AE4A 1USYH 4RK9A 4BDRA 1SBPA 4U2RA 3TTLA 1SW5A 2GH9A 5JK4A 2F8DA 1LB8A 5AA2B 3Q29A 3F11A 3HHFA 3KOSA 2QS4A 4F39A 1GR2A 4LA9A 3RLFE 2ZNSA 4EF1A 4F3PA 2I0BA 3VVDA 3PMXA 1MY2A 1RKMA 3K0VA 5CBSA 3TODA 4U4XA 1B4HA 1B1XA 1TWYA 2DXRA 3GBBA 4ZDMA 5I57B 3S9EA 1OVTA 3B6WA 4EQBA 4EQ9A 1SW4A 3S4UA 1Y20A 4IGRA 4OYVA 4R74A 1VFEA 3KSXA 3QK6A 4ELPA 1FQAA 1MY1A 2RCAA 2CMOA 2BJJX 3G3HA 3G3GA 2FNCA 1PB9A 3H6VA 5HM4B 5EHSA 2H4IA 3ZKLA 2HAUA 4OHNA 3V83A 4H6DA 2I3VA 3R7XA 4N13A 2G29A 4RJZA 2F7CA 5CRYA 1MXWA 4QFPA 1B58A 3K6WA 3CG1A 1H3DA 3A3CA 4Z0IA 3UP9A 3S9LC 4LQ5A 3OEMA 1FTJA 5L9MA 4R6HA 2ZMBA 4PETA 5FHMA 2DOJA 2F34A 3Q28A 3V5AA 5CC2A 1NKXA 4FJPA 4XTCQ 3K00A 3TCHA 3PMVA 4G2ZA 4L17A 3VFJA 5AA2D 4LUBA 1A8EA 2H98A 1EZ9A 5FTIA 3KJ7A 4GRKA 1Q1KA 2HXWA 1UQWA 5ICTA 2X7QA 3TTMA 1MPCA 4N6PA 4GL8A 1MXUA 3U8QA 2P2AA 2DQVA 3RT6B 4OWDA 5L9SA 2WKYA 1Z7NE 5FHNA 2Q8JA 4JSDA 3IJOB 4YB6A 4P0IA 3IOTA 1B2HA 1LAGE 4ESWA 2DWIA 2F36A 3FXQA 3GLBA 3IK6B 3K1NA 3BFUA 3K4UA 3VLVA 3ZKKA 3OXNA 5ITPA 1LAXA 1AOVA 4F1UA 1SYHA 4RXLA 2NXOA 1LCTA 2VD3A 2O7IA 4ZEKA 4KQPA 2YJPA 1ZMGA 5EYFA 1UIVA 1URDA 1N3WA 2O84X 3PUZE 5M2VA 4OETA 2QS1A 4KHZE 3O66A 3VV5A 5TPAB 2GHBA 2ZNUA 1A99A 4GD5A 3ZS6A 1Y9UA 2I3WA 4THIA 3DELB 3ONMA 3IO6A 3I5OA 4NF8B 1II5A 3KJTA 3DP4A 3VE1B 4JSOA 2NWJA 1MPBA 2THIA 4FECA 4GIZA 2LAOA 4POXA 5TP9A 2E0SA 2VOZA 3O6GA 4UA8A 4YKPA 5H8NA 4LZ8A 3SERA 4F2QA 5IAIA 2PX1A 3IX1A 3FXRA 4ZS9A 3T9XB 2F35A 2ZYMA 3IOVA 3PUYE 1JQFA 3KG2A 4QSEA 4OESA 4F18A 1B5JA 3FXUA 3T96B 4R73A 1DTGA 1IIWA 1S7YA 1S9TA 2ZNTA 4NF4B 4ONYA 5TU0A 4AQ4A 5I84A 2CZLA 3CR9A 5DVFA 4ISUA 1D9YA 1MG1A 2Q88A 4IO3A 5JTYB 1NNKA 2XXVA 3EHUA 1PC3A 2ABHA 4JWYA 5FTHA 2B3FA 4M4GA 2XXRA 4OFJA 4G68B 2F7AA 1B32A 1HSLA 3W15C 1GVCA 1IXGA 3W9VA 1H76A 1SI0A 1NNFA 1MQIA 2Q2CA 1N76A 3K6XA 3OO7A 1B3GA 4U22A 5K2XA 3KOTA 3TDJA 2XXWA 1MDQA 3O6IA 4JDFA 5BUUA 1B7UA 5ELVA 1SYIA 2NUVA 5FHOA 2UYFA 3A09A 3B7DA 4HTGA 3T66A 3U92A 1URGA 3K6UA 4HS7A 3W9WA 2REGA 1OQGA 1ZIUA 3IB2A 4R2BA 2QPQA 3H6UA 5H8FB 5BWJA 2HFBA 1BP5A 3Q27A 4EXKA 4K3FA 1XS5A 1MY3A 1A54A 2VGQA 4U1OA 5DVIA 4F1VA 1PB7A 1JVXA 3MPLA 1F9BA 3VLUA 1EU8A 1JETA 4YMBA 5CMKA 2AL5A 5I59B 4H5GA 1MDP1 3SEUA 2XD3A 4H67A 4DLDA 3OELA 2O7UA 2OCUA 3PV0E 5H8SA 3FUZA 1NNTA 3TELA 3KSJA 4QRZA 4F2OA 1DPPA 4OXVA 3IOWA 1LFIA 2AYSA 2A5TB 3BKIB 2H5YA 4G8HA 4XXUA 1B52A 1MM7A 3V8XB 3H3GA 4JWOA 4GOTA 2QS2A 1H43A 1SD3A 3O6HA 4KD5A 4LZ7A 1B3LA 1GV8A 4QHQA 3K1PA 2Z8DA 4NWDA 3UORA 4ZECA 5CBRA 2V3TA 2V3UA 5I56B 3PPPA 1ANFA 3FZVA 4PE5B 1R9LA 2ZXTA 4GXSB 3TCFA 4XKQA 2B65A 4PFWA 4YB7A 1FTOA 5KCJB 1LAFE 1MY4A 3LBSA 3MP8A 2AL4A 5AA2A 4HCYA 1Y3NA 4PP0A 3SEYA 4BLAA 1YPNA 4C1UA 3FV1A 2QMWA 3TYHA 3KZGA 3LSFB 4U23A 3RTFB 4EDPA 1YTVA 2QJEA 2O1LA 2NVUB 5AA4A 4ZEBA 1WVJA 1LSTA 3RNNA 1N84A 3UK4A 4C0RA 1DSNA 4AB6A 1R6ZA 4RPNA 4X48A 3FJGA 3MVWA 3THIA 1FQBA 3FVOA 1P1QA 3OOAA 4RNSA 1I69A 3K6VA 5DEXA 3FVGA 5CMCA 1B7HA 1AL3A 5AA1A 1VE4A 1IZ1A 2OJTA 1A40A 2I58A 3VLWA 1FQDA 1FCKA 4I62A 3EN3A 3G3FA 4NF5A 4QSDA 3TUSA 3KN7A 4FEBA 3S2VA 4YMAA 3K1MA 4H8IA 1VSOA 1ZKBA 4BDMA 1XHYA 1BTJA 3N26A 4O3AA 3H06B 2Z23A 5LOMA 4R9FA 1MRPA 2H9BA 3FD3A 4RK2A 3H4ZA 1Q35A 2REJA 4P0GA 2HEUA 4TLLB 3E9XA 1O64A 4X1DA 4AB5A 3MAMA 2HZKA 1P1NA 3VDFA 5I2NA 3QUJA 4U1ZA 1D3KA 2F78A 4BDNA 2V3QA 4QF9A 5A5XA 3H6TA 4FORA 2RKMA 3MJNA 2O69A 5DVJA 4MBPA 3TMGA 4I9DA 3BBRA 4POWA 1LAHE 1SI1A 3IOUA 1ATGA 2DVCA 1FTLA 1N7XA 1N0TA 3MBPA 3PUVE 4OZ9A 3TTNA 2PBWA 3L6HA 4GVOA 4LQ2A 4Q30B 1US4A 2V25A 4ZEDA 1D9VA 2UVIA 4DXCA 3VVFA 3UGWA 3MVZA 4KYEA 3VXCA 4ZZEA 4H0WA 2RC9A 4XKRA 3O97A 1MQJA 3MC2A 3CG3A 1MQDA 5CI5A 1Y3PA 4YU0A 2DSFA 1ZU0A 3T9VA 5HPQA 1P99A 1N3XA 5H8HA 4FATA 1JEVA 1PB8A 4HCWA 1B6HA 3MUQA 1JW5A 4TOZA 4TQUQ 3K01A 4QSCA 1EH3A 3SEWA 1S50A 4EF2A 2XD2A 1UTHA 2O51A 1MS7A 1B40A 1LFGA 4YZZA 4ESXA 1B3HA 4MH5A 3RUMA 3WAEA 1RYXA 2QSXA 5DT6A 3CFXA 1M5FA 3PPNA 3PUWE 3FGSA 4GL0A 5K2YA 4F29A 1SDXA 1LLSA 3DM0A 1JNFA 2I49A 3MVYA 3PD8A 3PPRA 4LONB 4NEDA 2Q2AA 4NTLA 4H1XA 4P11A 4QFLA 3MP6A 1M5EA 1AIVA 1QVSA 1I6QA 3HHGA 4BDLA 3SETA 1GGGA 3QSLA 3IORA 4R75A 1I6BA 2R9JA 4KFQA 2DP8A 4U21A 4BDQA 4GQOA 1JW4A 2IA4A 2OLBA 3GBAA 3OMBA 5ITOA 1O63A 4F3BA 5KZTA 1ELJA 3MW0A 3OO8A 4FAJA 3RT8A 3E4RA 3ZSFA 1MXYA 1FW0A 4WKMA 3P7IA 3MVXA 2YPNA 3UN6A 2ONRA 1QW0A 2PYYA 1IXCA 1DPEA 1XC1A 2ONSA 2ZYNA 3KFMA 4NF6B 4UACA 2ZYKA 3FVKA 4IO7A 1LBCA 1BLFA 4IY5A 4KI0E 4OQOA 4ZEFA 4ZE9A 4JB7A 1TFAA 1XVYA 4M1VA 1BKAA 3PU5A 4H5FA 4LZ5A 3IO4A 5I2KA 3B6TA 2RC8A 1P1UA 1OIBA 1MM6A 2DWHA 3PPOA 4IO2A 2I4BA 3H03A 2H99A 3LR1A 4I1DA 1UTBA 2OZZA 3G3JA 3IL1B 4OVJA 4R72A 3LSXA 1NH8A 3U93A 2UVJA 1B0LA 3IB0A 1OQHA 4MF3A 3KN8A 1SW2A 5TP9B 1IXHA 1Y4TA 3ILUB 1MPDA 1PBQA 2Y7WA 4X1BA 2ONKE 3H7MA 4IY6A 4ELQA 1B5HA 1IEJA 2H25A 1MXZA 1M5DA 1ZJLA 3KN3A 3LUYA 3Q25A 2XHDA 1XVXA 5AA3A 3EHTA 1PBPA 4ECFA 3N94A 3D4CA 2AIXA 2A5TA 3TKDA 4ELRA 1VR5A 4KCCA 2ESNA 2ZYOA 3LC8A 4YB5A 1QUKA 4O3BA 2UYEA 4KR5A 3S9NC 1I6AA 5H8HB 3PUXE 1FQCA 5JTYA 3MWBA 4OERA 3C31A 1B4ZA 1OLAA 3CIJA 3N5LA 3OO6A 3C9HA 2UVGA 5A5XB 4GLIA 5KDTB 1UTHB 1IQ7A 1WODA 4FEDA 4WEPA 4XKPA 4DCXA 3R6UA 4JWXA 4F3SA 1N7WA 2XXQA 3ILTB 1IITA 3FATA 3SESA 1ZTYA 3TZAA 1A8FA 3UIFA 3C4MA 2DS9A 3T93B 1QUIA 3I6VA 5HBCA 1EZPA 2I6EA 1MQGA 2IEEA 3HSTA 3TCGA 1TXFA 1A55A 2XXYA 2YLNA 3CSBA 3R26A 4RY1A 4XKNA 3TQWA 4H8JA 2VP1A 3G3KA 4OEVA 4DE8A 1MH4A 2F6PA 2R6GE 2O68A 1DMBA 2O1MA 1JW1A
chains in the Genus database with same CATH superfamily
4IO6A 3KBRA 2RCBA 5FBPA 1OVBA 3RTWB 4HXVA 5I59A 3VVEA 4MNPA 3HPIA 1B7ZA 1B0HA 1FBCA 4F22A 1NNPA 2RC7A 4IGTA 3CFLA 3DP6A 1J1NA 1FQEA 2Z8FA 4UABA 1N04A 5CM6A 3T9HB 1XOCA 4PFRA 2RINA 2D21A 1LBYA 3JYRA 1A7LA 1FTKA 2M8CA 4OMBA 1YAEA 4OTEA 3HCQA 1RDYA 5IZ1A 5DEXB 3SDFA 2XXXA 1Y4CA 5EQ7A 3QXMA 4LATA 5J1DA 1FQFA 3HV1A 4Q8RA 3O9PA 2G93A 3H6WA 3AXFA 3U1OA 4ND9A 5I7IA 3SEXA 1B1HA 2DWAA 2VD2A 2MKZA 3M3LA 3CRBA 3RPWA 2XXIA 1LFHA 4HE1A 3TPAA 4I3YA 1Z7ME 2HQ0A 4H46A 4GF8A 2VHAA 4G68C 4X9TA 4LVQA 1AMFA 1B5IA 1D4NA 1TT1A 4JVCA 4G77A 4RPOA 1SVXB 1SQYA 1JP4A 3O2AA 3V89B 3ECRA 2W7YA 5B7DA 4IO5A 1US5A 2XX9A 1NH7A 3DLNA 1CB6A 3OO9A 1HSEA 2VT5A 1LB9A 4GX4A 3JV9A 4EQ7A 3TEPA 4LP2B 4PCDA 2DDKA 1FPKA 4N8YA 5B70A 2FBPA 4O3CA 4XF5A 3MPKA 1DTZA 2PMSA 3C35A 1JVYA 3IR1A 2JJKA 1R9QA 2P0SA 4G4PA 4YKIA 3TTRA 1FBGA 3PPQA 2B4LA 2Y84A 4Z7EA 5F7VA 1NMUA 3PGFA 4R2FA 3CVGA 3K2DA 5EQAA 4Q0CA 4BDRA 4U2RA 2GH9A 5AA2B 2I0BA 3K0VA 3GBBA 1FSAA 4EQBA 4OYVA 2FIXA 3QK6A 2RCAA 2CMOA 1NV6A 2H4IA 4OHNA 4N13A 5CRYA 1MXWA 1QGXA 4NQ8A 1H3DA 3A3CA 3UP9A 3Q28A 1NUXA 2CEXA 2QFLA 1YZ0A 3K00A 5AA2D 1EZ9A 2HXWA 4GL8A 2DQVA 5L9SA 1DK4A 1Z7NE 2Q8JA 3IJOB 4YB6A 3ZKKA 3IK6B 3K1NA 3K4UA 2ZZVA 4RXLA 2YJPA 1UIVA 1URDA 1N3WA 4I40A 2QS1A 4OETA 3O66A 4ZECA 2ZNUA 4THIA 1D9QA 2I3WA 3I5OA 3DP4A 2NWJA 4PDDA 4YKPA 3O6GA 5H8NA 4LZ8A 1EYKA 3PUYE 5IZ3B 3KG2A 4OESA 5DW8A 1RDXA 1B5JA 3FXUA 1IIWA 4NF4B 3CR9A 4ISUA 4IO3A 1NNKA 2ABHA 4G68B 1B32A 3W15C 1H76A 4MNCA 2Q2CA 1N76A 3OO7A 4U22A 3B50A 3O6IA 3B7DA 3U92A 4N81A 3K6UA 2REGA 5BWJA 2QPQA 5H8FB 3Q27A 4K3FA 1MY3A 2VGQA 5DVIA 1JVXA 3VLUA 1EU8A 1JETA 4YMBA 3SEUA 4H67A 4X8RA 3FUZA 3TELA 4QRZA 1FPJA 3V8XB 4JWOA 1H43A 4LZ7A 3UORA 5CBRA 1NV3A 1ANFA 1R9LA 4GXSB 2QVRA 3LBSA 1Y3NA 3RPLA 1YPNA 1KA0A 3CHGA 4U23A 2NVUB 1LSTA 3RNNA 4AB6A 1R6ZA 1CNQA 1P1QA 3K6VA 5AA1A 2I58A 3EN3A 4PBHA 4NF5A 1XHYA 3N26A 1MRPA 2H9BA 3H4ZA 4TLLB 5LDZA 5I2NA 2F78A 2RKMA 4NGUA 3TMGA 2PBWA 3L6HA 5AA4A 3VXCA 4H0WA 4KXPA 1FJ9A 1P99A 1PB8A 1LBXA 1JW5A 2XWKA 1EH3A 4ESXA 4MH5A 5EYGA 5I57A 3PPNA 5K2YA 4F29A 5L9OA 1LLSA 2I49A 3SETA 3QSLA 3IORA 1JW4A 3GBAA 3MW0A 3ZSFA 1MXYA 4WKMA 3P7IA 2YPNA 1XC1A 3KFMA 3FVKA 4OQOA 4ZEFA 1TFAA 3PU5A 4LZ5A 3B6TA 1LBVA 3PPOA 3H03A 3LR1A 2OZZA 4AS5A 3IB0A 1B0LA 3KN8A 1SW2A 3KN3A 3Q25A 3LUYA 3N94A 1BK4A 1VR5A 4YB5A 4MNIA 3S9NC 2UYEA 5H8HB 1FQCA 2KQZA 4OVPA 2UVGA 4GBVA 1UTHB 4FEDA 1WODA 4DCXA 3ILTB 1QUIA 3I6VA 1EZPA 2I6EA 1A55A 2XXYA 3R26A 4RY1A 4H8JA 4OEVA 4R74A 2Q9TA 2O1MA 1JW1A 4OFLA 4PAIA 2WX9A 3U72A 2Z22A 2FYIA 3M8UA 4GWOA 3N6TA 3MP1A 3Q26A 3TQLA 3ODBA 4GWWA 3LSWA 5DTBA 1B51A 3B6QA 4PGPA 1L5TA 4KPTA 4R6KA 2UXAA 2I48A 2BJIA 2OK2A 4OEUA 4C1TA 3FVNA 1Y1ZA 4KYSA 5AA4B 2E1SA 1NI9A 1CE2A 3C34A 3EPEA 1AWBA 3FJMA 4O7MA 1NFTA 3PMWA 5IZZA 1INPA 2PFYA 3VXBA 4YICA 4U4SA 3CI8A 3HN0A 4HE2A 1O7TA 1Y3QA 4FE8A 1QKAA 3JZJA 4KCDA 4PGNA 1SPIA 4WEDA 4DI4B 3L6GA 4I3EA 3E3KA 4RYAA 3RGYA 2QRYA 1EZOA 3FIRA 1JEUA 4G61A 2Y7KA 3HFUA 2OWSA 4JBZA 4OVSA 3QMFA 3MZ9A 5ICQA 2HZLA 4F3GA 3EF7A 4YKJA 5H8QA 5IZ3A 2F97A 3SEVA 1FRPA 1G0HA 4PAKA 3OENA 2DWJA 2ANJA 3KGCA 4G68A 4XIGQ 2Q8MA 4PFYA 3MZ1A 3KC1A 1R1NA 4JXIA 2Q89A 3T22A 5L8DA 1P1OA 3O29A 4MFIA 4GXAA 2A5SA 3HO7A 1IMDA 3QIMA 1WDNA 4BDOA 2GFEA 3MQ9A 2HCAA 3PD9A 1H44A 1FPIA 2PVUA 1FPEA 5I58B 1FTMA 1H45A 4EXLA 1AH5A 5AE4A 1USYH 1SBPA 5JK4A 2CZIA 2F8DA 1LB8A 3Q29A 3F11A 3HHFA 2QS4A 2ZNSA 3VVDA 1RKMA 3TODA 4MHFA 1TWYA 4ZDMA 1OVTA 1VFEA 4ELPA 1MY1A 2OX3A 2WEFA 1IMEA 2BJJX 2FNCA 5EHSA 3ZKLA 2HAUA 3V83A 2FIEA 4H6DA 3CG1A 3S9LC 4LQ5A 4PETA 5FHMA 2F34A 1NKXA 3TCHA 3PMVA 4LUBA 1IMBA 2HPGA 3KJ7A 4GRKA 1UQWA 2X7QA 1MPCA 4N6PA 1FPBA 3U8QA 3RT6B 4OWDA 5EYHA 1LAGE 2DWIA 2F36A 5ITPA 1SYHA 4ZEKA 2O84X 3ZS6A 5TPAB 2GHBA 4GD5A 1Y9UA 4JSOA 2FHYA 1MPBA 4FECA 5TP9A 4POXA 4UA8A 4F2QA 4ZS9A 1NV5A 4QSEA 4F18A 4R73A 5TU0A 2ZNTA 5I84A 2CZLA 5JTYB 1D9YA 1FBEA 2WYPA 3EHUA 4QXDA 5FTHA 4OFJA 2F7AA 2R8TA 1IXGA 1SI0A 2HXRA 3K6XA 1B3GA 2XXWA 1MDQA 5ELVA 1SYIA 2UYFA 3A09A 1OQGA 1ZIUA 4R2BA 2HFBA 1BP5A 4EXKA 2CEYA 4U1OA 4F1VA 1LBZA 1RDZA 2AL5A 5I59B 4PTKA 4H5GA 2XD3A 4DLDA 2O7UA 2OCUA 4F2OA 3IOWA 3BKIB 1B52A 1LEVA 1IMCA 1GV8A 3W9WA 1B3LA 4NWDA 2V3TA 3PPPA 4PFWA 4YB7A 5EQ8A 5KCJB 1LAFE 4HCYA 4BLAA 4PP0A 4C1UA 3FV1A 3LSFB 3RTFB 4EDPA 1YTVA 4RPNA 3FJGA 3FVOA 3OOAA 4RNSA 5DEXA 3FVGA 1AL3A 3VLWA 1FCKA 3IFCA 3G3FA 4QSDA 3TUSA 3KN7A 4FEBA 4YMAA 4H8IA 1BTJA 4O3AA 4P9KA 2REJA 2HEUA 3E9XA 4X1DA 3MAMA 4H45A 1P1NA 1D3KA 4BDNA 4QF9A 3H6TA 4FORA 3MJNA 2O69A 4POWA 1SI1A 3IOUA 3UGWA 3MVZA 4XKRA 2QVVA 1MQDA 2V4CA 5CI5A 1Y3PA 4N15A 5HPQA 4HCWA 1B6HA 3MUQA 3K01A 1FJ6A 3SEWA 1MS7A 1B40A 1LFGA 1RYXA 1K9ZA 5DT6A 3CFXA 1M5FA 1SDXA 1YXIA 3DM0A 4LONB 3MVYA 1AIVA 4O94A 1M5EA 4R75A 4U21A 2OLBA 5KZTA 5ITOA 2P3NA 1O63A 4F3BA 1KA1A 3E4RA 1FW0A 3MSTA 1QW0A 1DPEA 2ONSA 4IO7A 4ZE9A 4JB7A 1XVYA 4M1VA 3IO4A 1P1UA 1MM6A 2DWHA 2I4BA 4I1DA 2H99A 4R72A 3IL1B 4NF0A 3U93A 1OQHA 2PCRA 4MF3A 1MPDA 1PBQA 2VPNA 4X1BA 3H7MA 2H25A 1ZJLA 3EHTA 3D4CA 4ELRA 2A5TA 3TKDA 2ESNA 2ZYOA 4KR5A 3PUXE 5A5XB 5KDTB 3CIJA 3OO6A 4XKPA 4WEPA 3FATA 1A8FA 4X04A 5HBCA 1MQGA 2IEEA 3TQWA 3ROJA 1TFDA 2B3BA 1SW1A 4PAFA 2XWOA 1MXXA 3KC0A 4F1YA 4NMYA 2PT1A 1VFDA 2R71A 3CSGA 2FA7A 1B05A 5I2KB 5I58A 4GBWA 1LCFA 1PDAA 2HAVA 3FJ7A 1ZBMA 3D4GA 5H8FA 4HW8A 2XWVA 4DIGA 1LBBA 1DOTA 4EUOA 4PFTA 3S9MC 3UA8A 5I5PA 2VPOA 1MXVA 1NL5A 2DYXA 5H8QB 5EHMA 2Z8EA 2DXYA 5LTCA 5ET6A 5H8NB 1BIYA 2XXHA 2OWZA 2XXUA 5F24A 2X26A 2D5WA 2NOOA 3T1BA 1QULA 3MZBA 2QL3A 1USYE 3FASA 4NN3A 4DDDA 4JVDA 4R9GA 4WXJA 3OSQA 2XX8A 2XXPA 2KR0A 2OBGA 2O6AA 4GWZA 1T0KA 1UTBB 3T9UA 4YKKA 3SKPA 2RF1A 2QS3A 2UVHA 1GTKA 1IUDA 4ZEIA 2GHAA 4TLMB 4PBQA 4E0XA 4OANA 1MH3A 3BFTA 3TFLA 5KDTA 4ELOA 5CMBA 1M5CA 4N07A 3LV0A 1MQHA 3M3FA 1MY0A 1UIUA 2DVZA 3K02A 2F6GA 4IO4A 4JVIA 1QKBA 4QFNA 2Y7RA 3IJXB 2F5XA 4NAPA 5CMMA 3RY3A 4NWCA 1OLCA 1NUZA 2XX7A 3EHSA 2QMXA 2Y5KA 4PQJA 2DE2A 1ZLQA 1P1WA 1POTA 3LSLA 4ZZAA 4GWSA 3N6UA 3C32A 4OFOA 1IMFA 1URSA 4MEVA 2QVUA 1B9JA 1YCJA 4RK9A 4NG7A 1SW5A 4N17A 2XXKA 2CZHA 1GR2A 4LA9A 3RLFE 4EF1A 2PFZA 1MY2A 5CBSA 4U4XA 1B4HA 1SW4A 4IGRA 5IM2A 1FQAA 3G3HA 3G3GA 2I3VA 4RJZA 4PE3A 4Z0IA 5L9MA 4R6HA 3V5AA 5CC2A 1KZ8A 4FJPA 4XTCQ 4G2ZA 5J16A 2H98A 1Q1KA 5ICTA 2P2AA 2WKYA 4FBPA 4JSDA 3IOTA 1B2HA 3FXQA 3GLBA 3BFUA 3VLVA 4MX6A 1LCTA 3A29A 5EYFA 3PUZE 4XFEA 4KHZE 3SZPA 3IO6A 4NF8B 1II5A 4OVQA 3VE1B 4GIZA 3T93B 3SERA 2HHMA 2PX1A 3T9XB 2F35A 2ZYMA 3RPLB 3T96B 1DTGA 4ONYA 2Q88A 3BIHA 2XXVA 2B3FA 4M4GA 1GVCA 3W9VA 1MQIA 1NV2A 5K2XA 3KOTA 4JDFA 1NV0A 5FHOA 4HTGA 3IB2A 5A5LA 1XS5A 3MPLA 4P1LA 1F9BA 1FBHA 5CMKA 1MDP1 5I3SA 1FTAA 5H8SA 3PV0E 1FPGA 2P3VA 3KSJA 4OXVA 2AYSA 2A5TB 4GOTA 3O6HA 1SD3A 4NHBA 4KD5A 5A5XA 4QHQA 2V3UA 4PE5B 3FZVA 2ZXTA 1FTOA 1MY4A 2GQ1A 2AL4A 2QMWA 3KZGA 2QJEA 4ZEBA 1WVJA 3UK4A 1N84A 2B4MA 3MVWA 5CMCA 3B8BA 1VE4A 2OJTA 1A40A 4N91A 3K1MA 1VSOA 1ZKBA 4BDMA 5LOMA 2Z23A 3FD3A 1Q35A 4P0GA 1O64A 3VDFA 4U1ZA 2V3QA 4I9DA 4PF8A 1LAHE 1ATGA 2DVCA 1N7XA 3MBPA 1N0TA 3TTNA 4Q30B 1US4A 2V25A 4ZEDA 2UVIA 4DXCA 3VVFA 4KYEA 2XWIA 4ZZEA 2RC9A 3O97A 3MC2A 3CG3A 2F3DA 1ZU0A 3T9VA 5H8HA 4FATA 4TQUQ 5I56A 4TOZA 4QSCA 1UTHA 4HE0A 1B3HA 3RUMA 3WAEA 2QSXA 3PUWE 4DXUA 4QFLA 3TCFA 2Q2AA 3MP6A 1YYZA 1I6QA 4IR8A 2R9JA 4KFQA 4BDQA 4GQOA 2IA4A 3OMBA 3OO8A 4FAJA 3UN6A 4F1UA 2PYYA 4NF6B 1K9YA 1LBCA 4KI0E 5I2KA 1BKAA 3ISPA 4H5FA 2RC8A 4IO2A 1G0IA 1UTBA 1NH8A 2UVJA 5TP9B 1IXHA 1Y4TA 2Y7WA 2ONKE 4ELQA 1B5HA 1MXZA 1M5DA 2XHDA 4ECFA 1NV1A 4QBAA 1Q9DA 3MWBA 4OERA 3N5LA 3C9HA 1NUWA 4F3SA 2Q74A 3R6UA 5AA2A 3SESA 3TZAA 3C4MA 2DS9A 3U65A 3TCGA 4XKNA 2VP1A 3G3KA 4P1EA 2R6GE 1IXIA 2I4CA 4I8CA 2Y5LA 3USDA 5DYHA 4N4UA 4YAHX 1Y1MA 4R6YA 2XXTA 4NE4A 2X7PA 3O28A 3LUZA 1B46A 3E13X 3GZGA 3M3KA 3E79A 1QUJA 3OEKA 4QFOA 3A3UA 3QUFA 2DE4A 4DXBA 3OD7A 1FPFA 4QFKA 1FBPA 4DCYA 4MAGA 4NF4A 4PFUA 4MLVA 1LGBC 4DZ1A 4P3LA 5TPAA 4OENA 3MYUA 5F1QA 3QAXA 3E78A 3CFZA 4MLQA 2GRVA 4NX1A 3GXAA 4Q5TA 4F19A 3U94A 3C36A 1VDWA 3QYTA 4FIMA 1PEBA 4GFRA 3TTKA 5ISUA 2V84A 4E0WA 4MJOA 3C33A 1XI6A 1M5BA 3RQTA 3BIGA 1IMAA 1HSJA 4G8NA 4G8MA 1B3FA 3G3IA 2F7BA 3OSRA 2I0CA 3TAJA 1XT8A 4F31B 3G7WA 4NF8A 4OVTA 3IB1A 2DE3A 1POY1 3KEIA 4RA1A 2WBDA 3EQ1A 2Y7PA 4O8MA 1RYOA 4GWUA 3FV2A 1QJMA 1OMPA 2P1SA 4NF5B 3RN8A 4PDHA 5KCJA 2V93A 4IB2A 3D1RA 2Y7IA 5I2NB 2ZZWA 5IKBA 1B3EA 2ALUA 4ZE8A 4KYDA 2OWTA 1KWHA 3IAZA 2KLFA 2PT2A 4NF6A 4MCOA 1LBWA 3I3VA 5IGAA 5JEIA 2D3IA 4PF6A 3DP8A 4H65A 3TTLA 4F39A 4F3PA 3PMXA 1B1XA 2DXRA 3S9EA 5I57B 3B6WA 4EQ9A 3S4UA 1Y20A 3KSXA 4GX3A 1PB9A 3H6VA 5HM4B 4MMPA 2ZZXA 3R7XA 5ET5A 2G29A 2F7CA 1FBDA 4QFPA 1B58A 3K6WA 3OEMA 1FTJA 2ZMBA 2DOJA 3VFJA 4L17A 1NV7A 1A8EA 5FTIA 3TTMA 3GYYA 1MXUA 1FPLA 5FHNA 4P0IA 4ESWA 1AOVA 3OXNA 1LAXA 1EYJA 2NXOA 5ET7A 2VD3A 2O7IA 4KQPA 1ZMGA 4GWXA 4GX6A 4N6KA 5M2VA 3VV5A 1A99A 3DELB 3ONMA 3KJTA 2THIA 2LAOA 2E0SA 2VOZA 5IAIA 1DCUA 3IX1A 3FXRA 4AS4A 3IOVA 1JQFA 4PC9A 2XA5A 3KBZA 1S7YA 1S9TA 4AQ4A 5DVFA 1MG1A 4OA4A 1PC3A 4JWYA 2XXRA 1HSLA 1NNFA 3TDJA 3FBPA 5BUUA 1B7UA 2NUVA 3T66A 1URGA 3PTYA 4HS7A 5ESYA 2FVZA 3H6UA 4O7IA 1A54A 3IFAA 1PB7A 3OELA 1NNTA 1DPPA 1LFIA 2H5YA 4G8HA 2WYKA 4XXUA 1MM7A 3H3GA 4P56A 2QS2A 3K1PA 2Z8DA 5I56B 1NV4A 4XKQA 2B65A 3MP8A 3SEYA 3TYHA 1NUYA 2O1LA 4C0RA 1DSNA 4X48A 3THIA 5ET8A 1FQBA 1I69A 1B7HA 1IZ1A 1FQDA 4I62A 3S2VA 4LN5A 4P8BA 3H06B 4R9FA 4RK2A 4AB5A 2HZKA 3NOHA 3QUJA 4PFBA 2WBBA 5DVJA 4MBPA 3BBRA 1FTLA 3PUVE 4OZ9A 4MIJA 4GVOA 4LQ2A 1FPDA 1D9VA 3EKIA 1MQJA 4P47A 4YU0A 2DSFA 1N3XA 1JEVA 1S50A 4EF2A 2XD2A 2O51A 4YZZA 4N8GA 4DI3D 2F3BA 4GL0A 3FGSA 1JNFA 4NEDA 3PD8A 4NTLA 3PPRA 4P11A 4H1XA 1QVSA 3HHGA 4BDLA 4GWYA 1GGGA 1I6BA 1DBZA 2DP8A 2CZKA 1ELJA 3RT8A 3MVXA 4XEQA 2ONRA 3WAFA 1IXCA 4UACA 2ZYNA 4PFIA 2ZYKA 4IY5A 1BLFA 1OIBA 3RYDA 3G3JA 4OVJA 3LSXA 3ILUB 2L5VA 4N6DA 1FBFA 4IY6A 1IEJA 5T3JA 5EQ9A 1XVXA 5AA3A 1PBPA 2AIXA 4KCCA 3LC8A 3T0JA 1QUKA 4O3BA 1I6AA 5JTYA 3C31A 1B4ZA 1OLAA 4GLIA 1IQ7A 4JWXA 1N7WA 2XXQA 1IITA 1ZTYA 3UIFA 1EYIA 1TXFA 2YLNA 3CSBA 4OVRA 3FXBA 4DE8A 1MH4A 2F6PA 3HSTA 2O68A 1DMBA 3KOSA
chains in the Genus database with same CATH topology
1TFDA 2B3BA 4OFLA 4IO6A 3U72A 1IXIA 2I4CA 1SW1A 2Z22A 2FYIA 3KBRA 4I8CA 2RCBA 3M8UA 1MXXA 3USDA 1OVBA 3N6TA 4GWOA 5DYHA 3RTWB 4F1YA 3MP1A 3Q26A 4NMYA 2PT1A 4YAHX 3TQLA 2Q9TA 3ODBA 3VVEA 5I56A 5I59A 3HPIA 1B7ZA 1VFDA 1Y1MA 2R71A 3CSGA 3LSWA 2FA7A 4R6YA 2XXTA 5DTBA 1B05A 1B51A 3B6QA 1L5TA 4NE4A 1B0HA 2X7PA 3O28A 5I2KB 1B46A 5I58A 4KPTA 4R6KA 2UXAA 3E13X 4F22A 1LCFA 1NNPA 2I48A 1PDAA 2RC7A 2HAVA 3CFLA 3GZGA 3M3KA 4IGTA 3FJ7A 3DP6A 1J1NA 1ZBMA 3D4GA 5H8FA 1FQEA 1QUJA 2Z8FA 2OK2A 4OEUA 4HW8A 1N04A 4DIGA 3OEKA 1LBBA 3A3UA 3QUFA 4QFOA 5CM6A 1DOTA 2DE4A 3T9HB 4EUOA 4C1TA 1XOCA 3FVNA 1Y1ZA 4KYSA 2RINA 4DXBA 2D21A 2E1SA 3OD7A 4PFTA 3UA8A 5AA4B 3S9MC 1CE2A 3C34A 1A7LA 1FTKA 3JYRA 4QFKA 1MXVA 3EPEA 2M8CA 4OMBA 1NL5A 1YAEA 2DYXA 3HCQA 4OTEA 3FJMA 5H8QB 4DCYA 1NFTA 3PMWA 4NF4A 4PFUA 4MLVA 5DEXB 5EHMA 1LGBC 3SDFA 2XXXA 4DZ1A 5TPAA 1Y4CA 4OENA 2Z8EA 3QXMA 4LATA 5J1DA 5F1QA 3VXBA 4YICA 3QAXA 2DXYA 1FQFA 3CI8A 4U4SA 3HV1A 3CFZA 4MLQA 4Q8RA 2GRVA 3O9PA 2G93A 5H8NB 3HN0A 3H6WA 3AXFA 1BIYA 2XXHA 3GXAA 1O7TA 4ND9A 4Q5TA 3U1OA 2XXUA 4F19A 1Y3QA 3U94A 3SEXA 4FE8A 2X26A 1B1HA 2DWAA 2D5WA 3C36A 3QYTA 2VD2A 1QKAA 2NOOA 3JZJA 1QULA 4FIMA 4KCDA 1PEBA 3M3LA 3CRBA 2QL3A 3MZBA 3RPWA 4GFRA 1USYE 2XXIA 3FASA 2V84A 3TTKA 4E0WA 1LFHA 5ISUA 4WEDA 4DDDA 3C33A 3TPAA 4R9GA 1M5BA 3OSQA 1Z7ME 2HQ0A 4WXJA 3RQTA 3L6GA 2XX8A 4GF8A 3E3KA 1HSJA 4G8NA 2XXPA 2VHAA 4G68C 4G8MA 4X9TA 4LVQA 4RYAA 1AMFA 1B3FA 1B5IA 3RGYA 2OBGA 3G3IA 1D4NA 2QRYA 5I57A 1TT1A 2O6AA 1EZOA 3FIRA 1JEUA 2F7BA 3OSRA 4G77A 4RPOA 1T0KA 1SVXB 2Y7KA 1SQYA 1UTBB 2I0CA 2OWSA 4JBZA 3TAJA 1XT8A 3T9UA 3O2AA 4F31B 3G7WA 3V89B 5L9OA 3ECRA 2W7YA 4NF8A 3MZ9A 5B7DA 3IB1A 5ICQA 4IO5A 4YKKA 2HZLA 3SKPA 4F3GA 3EF7A 2RF1A 2QS3A 2UVHA 1GTKA 2DE3A 1POY1 4YKJA 1US5A 3KEIA 4RA1A 2XX9A 3EQ1A 1NH7A 1IUDA 3DLNA 5H8QA 1CB6A 2GHAA 2Y7PA 4TLMB 4ZEIA 4E0XA 3OO9A 1HSEA 1MH3A 1LB9A 2F97A 3SEVA 3BFTA 3JV9A 4EQ7A 1RYOA 3TFLA 5KDTA 4ELOA 3TEPA 3FV2A 1QJMA 4LP2B 5CMBA 1M5CA 3OENA 4N07A 1OMPA 1MQHA 2DWJA 2ANJA 2P1SA 3KGCA 5B70A 4NF5B 3M3FA 4G68A 4XIGQ 3RN8A 1MY0A 4PFYA 3WAFA 1UIUA 3MZ1A 5KCJA 4O3CA 2DVZA 3K02A 3MPKA 2F6GA 1DTZA 1R1NA 2V93A 2PMSA 3C35A 1JVYA 4IB2A 4IO4A 2Q89A 4JXIA 5L8DA 3T22A 4DXUA 1P1OA 1QKBA 3IR1A 3O29A 4MFIA 4QFNA 4GXAA 1R9QA 2P0SA 2Y7RA 2Y7IA 3IJXB 5I2NB 4G4PA 5IKBA 4YKIA 1B3EA 2ALUA 2A5SA 2F5XA 3HO7A 4ZE8A 5CMMA 4KYDA 3RY3A 3TTRA 3QIMA 4NWCA 2OWTA 1KWHA 1WDNA 4BDOA 2GFEA 1OLCA 2XX7A 3MQ9A 3PPQA 2Y84A 2QMXA 2HCAA 3EHSA 4Z7EA 3PD9A 2DE2A 3IAZA 1H44A 4PQJA 2KLFA 1ZLQA 2PT2A 1P1WA 4NF6A 1POTA 3I3VA 3LSLA 5F7VA 1NMUA 2PVUA 4ZZAA 5JEIA 3N6UA 3C32A 3CVGA 3PGFA 1URSA 4OFOA 4R2FA 3K2DA 1FTMA 1H45A 2D3IA 5I58B 3DP8A 4Q0CA 4H65A 4EXLA 1B9JA 1AH5A 1YCJA 5AE4A 1USYH 4RK9A 4BDRA 1SBPA 4U2RA 3TTLA 1SW5A 2GH9A 5JK4A 2F8DA 1LB8A 5AA2B 3Q29A 3F11A 3HHFA 3KOSA 2QS4A 4F39A 1GR2A 4LA9A 3RLFE 2ZNSA 4EF1A 4F3PA 2I0BA 3VVDA 3PMXA 1MY2A 1RKMA 3K0VA 5CBSA 3TODA 4U4XA 1B4HA 1B1XA 1TWYA 2DXRA 3GBBA 4ZDMA 5I57B 3S9EA 1OVTA 3B6WA 4EQBA 4EQ9A 1SW4A 3S4UA 1Y20A 4IGRA 4OYVA 4R74A 1VFEA 3KSXA 3QK6A 4ELPA 1FQAA 1MY1A 2RCAA 2CMOA 2BJJX 3G3HA 3G3GA 2FNCA 1PB9A 3H6VA 5HM4B 5EHSA 2H4IA 3ZKLA 2HAUA 4OHNA 3V83A 4H6DA 2I3VA 3R7XA 4N13A 2G29A 4RJZA 2F7CA 5CRYA 1MXWA 4QFPA 1B58A 3K6WA 3CG1A 1H3DA 3A3CA 4Z0IA 3UP9A 3S9LC 4LQ5A 3OEMA 1FTJA 5L9MA 4R6HA 2ZMBA 4PETA 5FHMA 2DOJA 2F34A 3Q28A 3V5AA 5CC2A 1NKXA 4FJPA 4XTCQ 3K00A 3TCHA 3PMVA 4G2ZA 4L17A 3VFJA 5AA2D 4LUBA 1A8EA 2H98A 1EZ9A 5FTIA 3KJ7A 4GRKA 1Q1KA 2HXWA 1UQWA 5ICTA 2X7QA 3TTMA 1MPCA 4N6PA 4GL8A 1MXUA 3U8QA 2P2AA 2DQVA 3RT6B 4OWDA 5L9SA 2WKYA 1Z7NE 5FHNA 2Q8JA 4JSDA 3IJOB 4YB6A 4P0IA 3IOTA 1B2HA 1LAGE 4ESWA 2DWIA 2F36A 3FXQA 3GLBA 3IK6B 3K1NA 3BFUA 3K4UA 3VLVA 3ZKKA 3OXNA 5ITPA 1LAXA 1AOVA 4F1UA 1SYHA 4RXLA 2NXOA 1LCTA 2VD3A 2O7IA 4ZEKA 4KQPA 2YJPA 1ZMGA 5EYFA 1UIVA 1URDA 1N3WA 2O84X 3PUZE 5M2VA 4OETA 2QS1A 4KHZE 3O66A 3VV5A 5TPAB 2GHBA 2ZNUA 1A99A 4GD5A 3ZS6A 1Y9UA 2I3WA 4THIA 3DELB 3ONMA 3IO6A 3I5OA 4NF8B 1II5A 3KJTA 3DP4A 3VE1B 4JSOA 2NWJA 1MPBA 2THIA 4FECA 4GIZA 2LAOA 4POXA 5TP9A 2E0SA 2VOZA 3O6GA 4UA8A 4YKPA 5H8NA 4LZ8A 3SERA 4F2QA 5IAIA 2PX1A 3IX1A 3FXRA 4ZS9A 3T9XB 2F35A 2ZYMA 3IOVA 3PUYE 1JQFA 3KG2A 4QSEA 4OESA 4F18A 1B5JA 3FXUA 3T96B 4R73A 1DTGA 1IIWA 1S7YA 1S9TA 2ZNTA 4NF4B 4ONYA 5TU0A 4AQ4A 5I84A 2CZLA 3CR9A 5DVFA 4ISUA 1D9YA 1MG1A 2Q88A 4IO3A 5JTYB 1NNKA 2XXVA 3EHUA 1PC3A 2ABHA 4JWYA 5FTHA 2B3FA 4M4GA 2XXRA 4OFJA 4G68B 2F7AA 1B32A 1HSLA 3W15C 1GVCA 1IXGA 3W9VA 1H76A 1SI0A 1NNFA 1MQIA 2Q2CA 1N76A 3K6XA 3OO7A 1B3GA 4U22A 5K2XA 3KOTA 3TDJA 2XXWA 1MDQA 3O6IA 4JDFA 5BUUA 1B7UA 5ELVA 1SYIA 2NUVA 5FHOA 2UYFA 3A09A 3B7DA 4HTGA 3T66A 3U92A 1URGA 3K6UA 4HS7A 3W9WA 2REGA 1OQGA 1ZIUA 3IB2A 4R2BA 2QPQA 3H6UA 5H8FB 5BWJA 2HFBA 1BP5A 3Q27A 4EXKA 4K3FA 1XS5A 1MY3A 1A54A 2VGQA 4U1OA 5DVIA 4F1VA 1PB7A 1JVXA 3MPLA 1F9BA 3VLUA 1EU8A 1JETA 4YMBA 5CMKA 2AL5A 5I59B 4H5GA 1MDP1 3SEUA 2XD3A 4H67A 4DLDA 3OELA 2O7UA 2OCUA 3PV0E 5H8SA 3FUZA 1NNTA 3TELA 3KSJA 4QRZA 4F2OA 1DPPA 4OXVA 3IOWA 1LFIA 2AYSA 2A5TB 3BKIB 2H5YA 4G8HA 4XXUA 1B52A 1MM7A 3V8XB 3H3GA 4JWOA 4GOTA 2QS2A 1H43A 1SD3A 3O6HA 4KD5A 4LZ7A 1B3LA 1GV8A 4QHQA 3K1PA 2Z8DA 4NWDA 3UORA 4ZECA 5CBRA 2V3TA 2V3UA 5I56B 3PPPA 1ANFA 3FZVA 4PE5B 1R9LA 2ZXTA 4GXSB 3TCFA 4XKQA 2B65A 4PFWA 4YB7A 1FTOA 5KCJB 1LAFE 1MY4A 3LBSA 3MP8A 2AL4A 5AA2A 4HCYA 1Y3NA 4PP0A 3SEYA 4BLAA 1YPNA 4C1UA 3FV1A 2QMWA 3TYHA 3KZGA 3LSFB 4U23A 3RTFB 4EDPA 1YTVA 2QJEA 2O1LA 2NVUB 5AA4A 4ZEBA 1WVJA 1LSTA 3RNNA 1N84A 3UK4A 4C0RA 1DSNA 4AB6A 1R6ZA 4RPNA 4X48A 3FJGA 3MVWA 3THIA 1FQBA 3FVOA 1P1QA 3OOAA 4RNSA 1I69A 3K6VA 5DEXA 3FVGA 5CMCA 1B7HA 1AL3A 5AA1A 1VE4A 1IZ1A 2OJTA 1A40A 2I58A 3VLWA 1FQDA 1FCKA 4I62A 3EN3A 3G3FA 4NF5A 4QSDA 3TUSA 3KN7A 4FEBA 3S2VA 4YMAA 3K1MA 4H8IA 1VSOA 1ZKBA 4BDMA 1XHYA 1BTJA 3N26A 4O3AA 3H06B 2Z23A 5LOMA 4R9FA 1MRPA 2H9BA 3FD3A 4RK2A 3H4ZA 1Q35A 2REJA 4P0GA 2HEUA 4TLLB 3E9XA 1O64A 4X1DA 4AB5A 3MAMA 2HZKA 1P1NA 3VDFA 5I2NA 3QUJA 4U1ZA 1D3KA 2F78A 4BDNA 2V3QA 4QF9A 5A5XA 3H6TA 4FORA 2RKMA 3MJNA 2O69A 5DVJA 4MBPA 3TMGA 4I9DA 3BBRA 4POWA 1LAHE 1SI1A 3IOUA 1ATGA 2DVCA 1FTLA 1N7XA 1N0TA 3MBPA 3PUVE 4OZ9A 3TTNA 2PBWA 3L6HA 4GVOA 4LQ2A 4Q30B 1US4A 2V25A 4ZEDA 1D9VA 2UVIA 4DXCA 3VVFA 3UGWA 3MVZA 4KYEA 3VXCA 4ZZEA 4H0WA 2RC9A 4XKRA 3O97A 1MQJA 3MC2A 3CG3A 1MQDA 5CI5A 1Y3PA 4YU0A 2DSFA 1ZU0A 3T9VA 5HPQA 1P99A 1N3XA 5H8HA 4FATA 1JEVA 1PB8A 4HCWA 1B6HA 3MUQA 1JW5A 4TOZA 4TQUQ 3K01A 4QSCA 1EH3A 3SEWA 1S50A 4EF2A 2XD2A 1UTHA 2O51A 1MS7A 1B40A 1LFGA 4YZZA 4ESXA 1B3HA 4MH5A 3RUMA 3WAEA 1RYXA 2QSXA 5DT6A 3CFXA 1M5FA 3PPNA 3PUWE 3FGSA 4GL0A 5K2YA 4F29A 1SDXA 1LLSA 3DM0A 1JNFA 2I49A 3MVYA 3PD8A 3PPRA 4LONB 4NEDA 2Q2AA 4NTLA 4H1XA 4P11A 4QFLA 3MP6A 1M5EA 1AIVA 1QVSA 1I6QA 3HHGA 4BDLA 3SETA 1GGGA 3QSLA 3IORA 4R75A 1I6BA 2R9JA 4KFQA 2DP8A 4U21A 4BDQA 4GQOA 1JW4A 2IA4A 2OLBA 3GBAA 3OMBA 5ITOA 1O63A 4F3BA 5KZTA 1ELJA 3MW0A 3OO8A 4FAJA 3RT8A 3E4RA 3ZSFA 1MXYA 1FW0A 4WKMA 3P7IA 3MVXA 2YPNA 3UN6A 2ONRA 1QW0A 2PYYA 1IXCA 1DPEA 1XC1A 2ONSA 2ZYNA 3KFMA 4NF6B 4UACA 2ZYKA 3FVKA 4IO7A 1LBCA 1BLFA 4IY5A 4KI0E 4OQOA 4ZEFA 4ZE9A 4JB7A 1TFAA 1XVYA 4M1VA 1BKAA 3PU5A 4H5FA 4LZ5A 3IO4A 5I2KA 3B6TA 2RC8A 1P1UA 1OIBA 1MM6A 2DWHA 3PPOA 4IO2A 2I4BA 3H03A 2H99A 3LR1A 4I1DA 1UTBA 2OZZA 3G3JA 3IL1B 4OVJA 4R72A 3LSXA 1NH8A 3U93A 2UVJA 1B0LA 3IB0A 1OQHA 4MF3A 3KN8A 1SW2A 5TP9B 1IXHA 1Y4TA 3ILUB 1MPDA 1PBQA 2Y7WA 4X1BA 2ONKE 3H7MA 4IY6A 4ELQA 1B5HA 1IEJA 2H25A 1MXZA 1M5DA 1ZJLA 3KN3A 3LUYA 3Q25A 2XHDA 1XVXA 5AA3A 3EHTA 1PBPA 4ECFA 3N94A 3D4CA 2AIXA 2A5TA 3TKDA 4ELRA 1VR5A 4KCCA 2ESNA 2ZYOA 3LC8A 4YB5A 1QUKA 4O3BA 2UYEA 4KR5A 3S9NC 1I6AA 5H8HB 3PUXE 1FQCA 5JTYA 3MWBA 4OERA 3C31A 1B4ZA 1OLAA 3CIJA 3N5LA 3OO6A 3C9HA 2UVGA 5A5XB 4GLIA 5KDTB 1UTHB 1IQ7A 1WODA 4FEDA 4WEPA 4XKPA 4DCXA 3R6UA 4JWXA 4F3SA 1N7WA 2XXQA 3ILTB 1IITA 3FATA 3SESA 1ZTYA 3TZAA 1A8FA 3UIFA 3C4MA 2DS9A 3T93B 1QUIA 3I6VA 5HBCA 1EZPA 2I6EA 1MQGA 2IEEA 3HSTA 3TCGA 1TXFA 1A55A 2XXYA 2YLNA 3CSBA 3R26A 4RY1A 4XKNA 3TQWA 4H8JA 2VP1A 3G3KA 4OEVA 4DE8A 1MH4A 2F6PA 2R6GE 2O68A 1DMBA 2O1MA 1JW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFD A;  2B3B A;  4OFL A;  4IO6 A;  3U72 A;  1IXI A;  2I4C A;  1SW1 A;  2Z22 A;  2FYI A;  3KBR A;  4I8C A;  2RCB A;  3M8U A;  1MXX A;  3USD A;  1OVB A;  3N6T A;  4GWO A;  5DYH A;  3RTW B;  4F1Y A;  3MP1 A;  3Q26 A;  4NMY A;  2PT1 A;  4YAH X;  3TQL A;  2Q9T A;  3ODB A;  3VVE A;  5I56 A;  5I59 A;  3HPI A;  1B7Z A;  1VFD A;  1Y1M A;  2R71 A;  3CSG A;  3LSW A;  2FA7 A;  4R6Y A;  2XXT A;  5DTB A;  1B05 A;  1B51 A;  3B6Q A;  1L5T A;  4NE4 A;  1B0H A;  2X7P A;  3O28 A;  5I2K B;  1B46 A;  5I58 A;  4KPT A;  4R6K A;  2UXA A;  3E13 X;  4F22 A;  1LCF A;  1NNP A;  2I48 A;  1PDA A;  2RC7 A;  2HAV A;  3CFL A;  3GZG A;  3M3K A;  4IGT A;  3FJ7 A;  3DP6 A;  1J1N A;  1ZBM A;  3D4G A;  5H8F A;  1FQE A;  1QUJ A;  2Z8F A;  2OK2 A;  4OEU A;  4HW8 A;  1N04 A;  4DIG A;  3OEK A;  1LBB A;  3A3U A;  3QUF A;  4QFO A;  5CM6 A;  1DOT A;  2DE4 A;  3T9H B;  4EUO A;  4C1T A;  1XOC A;  3FVN A;  1Y1Z A;  4KYS A;  2RIN A;  4DXB A;  2D21 A;  2E1S A;  3OD7 A;  4PFT A;  3UA8 A;  5AA4 B;  3S9M C;  1CE2 A;  3C34 A;  1A7L A;  1FTK A;  3JYR A;  4QFK A;  1MXV A;  3EPE A;  2M8C A;  4OMB A;  1NL5 A;  1YAE A;  2DYX A;  3HCQ A;  4OTE A;  3FJM A;  5H8Q B;  4DCY A;  1NFT A;  3PMW A;  4NF4 A;  4PFU A;  4MLV A;  5DEX B;  5EHM A;  1LGB C;  3SDF A;  2XXX A;  4DZ1 A;  5TPA A;  1Y4C A;  4OEN A;  2Z8E A;  3QXM A;  4LAT A;  5J1D A;  5F1Q A;  3VXB A;  4YIC A;  3QAX A;  2DXY A;  1FQF A;  3CI8 A;  4U4S A;  3HV1 A;  3CFZ A;  4MLQ A;  4Q8R A;  2GRV A;  3O9P A;  2G93 A;  5H8N B;  3HN0 A;  3H6W A;  3AXF A;  1BIY A;  2XXH A;  3GXA A;  1O7T A;  4ND9 A;  4Q5T A;  3U1O A;  2XXU A;  4F19 A;  1Y3Q A;  3U94 A;  3SEX A;  4FE8 A;  2X26 A;  1B1H A;  2DWA A;  2D5W A;  3C36 A;  3QYT A;  2VD2 A;  1QKA A;  2NOO A;  3JZJ A;  1QUL A;  4FIM A;  4KCD A;  1PEB A;  3M3L A;  3CRB A;  2QL3 A;  3MZB A;  3RPW A;  4GFR A;  1USY E;  2XXI A;  3FAS A;  2V84 A;  3TTK A;  4E0W A;  1LFH A;  5ISU A;  4WED A;  4DDD A;  3C33 A;  3TPA A;  4R9G A;  1M5B A;  3OSQ A;  1Z7M E;  2HQ0 A;  4WXJ A;  3RQT A;  3L6G A;  2XX8 A;  4GF8 A;  3E3K A;  1HSJ A;  4G8N A;  2XXP A;  2VHA A;  4G68 C;  4G8M A;  4X9T A;  4LVQ A;  4RYA A;  1AMF A;  1B3F A;  1B5I A;  3RGY A;  2OBG A;  3G3I A;  1D4N A;  2QRY A;  5I57 A;  1TT1 A;  2O6A A;  1EZO A;  3FIR A;  1JEU A;  2F7B A;  3OSR A;  4G77 A;  4RPO A;  1T0K A;  1SVX B;  2Y7K A;  1SQY A;  1UTB B;  2I0C A;  2OWS A;  4JBZ A;  3TAJ A;  1XT8 A;  3T9U A;  3O2A A;  4F31 B;  3G7W A;  3V89 B;  5L9O A;  3ECR A;  2W7Y A;  4NF8 A;  3MZ9 A;  5B7D A;  3IB1 A;  5ICQ A;  4IO5 A;  4YKK A;  2HZL A;  3SKP A;  4F3G A;  3EF7 A;  2RF1 A;  2QS3 A;  2UVH A;  1GTK A;  2DE3 A;  1POY 1;  4YKJ A;  1US5 A;  3KEI A;  4RA1 A;  2XX9 A;  3EQ1 A;  1NH7 A;  1IUD A;  3DLN A;  5H8Q A;  1CB6 A;  2GHA A;  2Y7P A;  4TLM B;  4ZEI A;  4E0X A;  3OO9 A;  1HSE A;  1MH3 A;  1LB9 A;  2F97 A;  3SEV A;  3BFT A;  3JV9 A;  4EQ7 A;  1RYO A;  3TFL A;  5KDT A;  4ELO A;  3TEP A;  3FV2 A;  1QJM A;  4LP2 B;  5CMB A;  1M5C A;  3OEN A;  4N07 A;  1OMP A;  1MQH A;  2DWJ A;  2ANJ A;  2P1S A;  3KGC A;  5B70 A;  4NF5 B;  3M3F A;  4G68 A;  4XIG Q;  3RN8 A;  1MY0 A;  4PFY A;  3WAF A;  1UIU A;  3MZ1 A;  5KCJ A;  4O3C A;  2DVZ A;  3K02 A;  3MPK A;  2F6G A;  1DTZ A;  1R1N A;  2V93 A;  2PMS A;  3C35 A;  1JVY A;  4IB2 A;  4IO4 A;  2Q89 A;  4JXI A;  5L8D A;  3T22 A;  4DXU A;  1P1O A;  1QKB A;  3IR1 A;  3O29 A;  4MFI A;  4QFN A;  4GXA A;  1R9Q A;  2P0S A;  2Y7R A;  2Y7I A;  3IJX B;  5I2N B;  4G4P A;  5IKB A;  4YKI A;  1B3E A;  2ALU A;  2A5S A;  2F5X A;  3HO7 A;  4ZE8 A;  5CMM A;  4KYD A;  3RY3 A;  3TTR A;  3QIM A;  4NWC A;  2OWT A;  1KWH A;  1WDN A;  4BDO A;  2GFE A;  1OLC A;  2XX7 A;  3MQ9 A;  3PPQ A;  2Y84 A;  2QMX A;  2HCA A;  3EHS A;  4Z7E A;  3PD9 A;  2DE2 A;  3IAZ A;  1H44 A;  4PQJ A;  2KLF A;  1ZLQ A;  2PT2 A;  1P1W A;  4NF6 A;  1POT A;  3I3V A;  3LSL A;  5F7V A;  1NMU A;  2PVU A;  4ZZA A;  5JEI A;  3N6U A;  3C32 A;  3CVG A;  3PGF A;  1URS A;  4OFO A;  4R2F A;  3K2D A;  1FTM A;  1H45 A;  2D3I A;  5I58 B;  3DP8 A;  4Q0C A;  4H65 A;  4EXL A;  1B9J A;  1AH5 A;  1YCJ A;  5AE4 A;  1USY H;  4RK9 A;  4BDR A;  1SBP A;  4U2R A;  3TTL A;  1SW5 A;  2GH9 A;  5JK4 A;  2F8D A;  1LB8 A;  5AA2 B;  3Q29 A;  3F11 A;  3HHF A;  3KOS A;  2QS4 A;  4F39 A;  1GR2 A;  4LA9 A;  3RLF E;  2ZNS A;  4EF1 A;  4F3P A;  2I0B A;  3VVD A;  3PMX A;  1MY2 A;  1RKM A;  3K0V A;  5CBS A;  3TOD A;  4U4X A;  1B4H A;  1B1X A;  1TWY A;  2DXR A;  3GBB A;  4ZDM A;  5I57 B;  3S9E A;  1OVT A;  3B6W A;  4EQB A;  4EQ9 A;  1SW4 A;  3S4U A;  1Y20 A;  4IGR A;  4OYV A;  4R74 A;  1VFE A;  3KSX A;  3QK6 A;  4ELP A;  1FQA A;  1MY1 A;  2RCA A;  2CMO A;  2BJJ X;  3G3H A;  3G3G A;  2FNC A;  1PB9 A;  3H6V A;  5HM4 B;  5EHS A;  2H4I A;  3ZKL A;  2HAU A;  4OHN A;  3V83 A;  4H6D A;  2I3V A;  3R7X A;  4N13 A;  2G29 A;  4RJZ A;  2F7C A;  5CRY A;  1MXW A;  4QFP A;  1B58 A;  3K6W A;  3CG1 A;  1H3D A;  3A3C A;  4Z0I A;  3UP9 A;  3S9L C;  4LQ5 A;  3OEM A;  1FTJ A;  5L9M A;  4R6H A;  2ZMB A;  4PET A;  5FHM A;  2DOJ A;  2F34 A;  3Q28 A;  3V5A A;  5CC2 A;  1NKX A;  4FJP A;  4XTC Q;  3K00 A;  3TCH A;  3PMV A;  4G2Z A;  4L17 A;  3VFJ A;  5AA2 D;  4LUB A;  1A8E A;  2H98 A;  1EZ9 A;  5FTI A;  3KJ7 A;  4GRK A;  1Q1K A;  2HXW A;  1UQW A;  5ICT A;  2X7Q A;  3TTM A;  1MPC A;  4N6P A;  4GL8 A;  1MXU A;  3U8Q A;  2P2A A;  2DQV A;  3RT6 B;  4OWD A;  5L9S A;  2WKY A;  1Z7N E;  5FHN A;  2Q8J A;  4JSD A;  3IJO B;  4YB6 A;  4P0I A;  3IOT A;  1B2H A;  1LAG E;  4ESW A;  2DWI A;  2F36 A;  3FXQ A;  3GLB A;  3IK6 B;  3K1N A;  3BFU A;  3K4U A;  3VLV A;  3ZKK A;  3OXN A;  5ITP A;  1LAX A;  1AOV A;  4F1U A;  1SYH A;  4RXL A;  2NXO A;  1LCT A;  2VD3 A;  2O7I A;  4ZEK A;  4KQP A;  2YJP A;  1ZMG A;  5EYF A;  1UIV A;  1URD A;  1N3W A;  2O84 X;  3PUZ E;  5M2V A;  4OET A;  2QS1 A;  4KHZ E;  3O66 A;  3VV5 A;  5TPA B;  2GHB A;  2ZNU A;  1A99 A;  4GD5 A;  3ZS6 A;  1Y9U A;  2I3W A;  4THI A;  3DEL B;  3ONM A;  3IO6 A;  3I5O A;  4NF8 B;  1II5 A;  3KJT A;  3DP4 A;  3VE1 B;  4JSO A;  2NWJ A;  1MPB A;  2THI A;  4FEC A;  4GIZ A;  2LAO A;  4POX A;  5TP9 A;  2E0S A;  2VOZ A;  3O6G A;  4UA8 A;  4YKP A;  5H8N A;  4LZ8 A;  3SER A;  4F2Q A;  5IAI A;  2PX1 A;  3IX1 A;  3FXR A;  4ZS9 A;  3T9X B;  2F35 A;  2ZYM A;  3IOV A;  3PUY E;  1JQF A;  3KG2 A;  4QSE A;  4OES A;  4F18 A;  1B5J A;  3FXU A;  3T96 B;  4R73 A;  1DTG A;  1IIW A;  1S7Y A;  1S9T A;  2ZNT A;  4NF4 B;  4ONY A;  5TU0 A;  4AQ4 A;  5I84 A;  2CZL A;  3CR9 A;  5DVF A;  4ISU A;  1D9Y A;  1MG1 A;  2Q88 A;  4IO3 A;  5JTY B;  1NNK A;  2XXV A;  3EHU A;  1PC3 A;  2ABH A;  4JWY A;  5FTH A;  2B3F A;  4M4G A;  2XXR A;  4OFJ A;  4G68 B;  2F7A A;  1B32 A;  1HSL A;  3W15 C;  1GVC A;  1IXG A;  3W9V A;  1H76 A;  1SI0 A;  1NNF A;  1MQI A;  2Q2C A;  1N76 A;  3K6X A;  3OO7 A;  1B3G A;  4U22 A;  5K2X A;  3KOT A;  3TDJ A;  2XXW A;  1MDQ A;  3O6I A;  4JDF A;  5BUU A;  1B7U A;  5ELV A;  1SYI A;  2NUV A;  5FHO A;  2UYF A;  3A09 A;  3B7D A;  4HTG A;  3T66 A;  3U92 A;  1URG A;  3K6U A;  4HS7 A;  3W9W A;  2REG A;  1OQG A;  1ZIU A;  3IB2 A;  4R2B A;  2QPQ A;  3H6U A;  5H8F B;  5BWJ A;  2HFB A;  1BP5 A;  3Q27 A;  4EXK A;  4K3F A;  1XS5 A;  1MY3 A;  1A54 A;  2VGQ A;  4U1O A;  5DVI A;  4F1V A;  1PB7 A;  1JVX A;  3MPL A;  1F9B A;  3VLU A;  1EU8 A;  1JET A;  4YMB A;  5CMK A;  2AL5 A;  5I59 B;  4H5G A;  1MDP 1;  3SEU A;  2XD3 A;  4H67 A;  4DLD A;  3OEL A;  2O7U A;  2OCU A;  3PV0 E;  5H8S A;  3FUZ A;  1NNT A;  3TEL A;  3KSJ A;  4QRZ A;  4F2O A;  1DPP A;  4OXV A;  3IOW A;  1LFI A;  2AYS A;  2A5T B;  3BKI B;  2H5Y A;  4G8H A;  4XXU A;  1B52 A;  1MM7 A;  3V8X B;  3H3G A;  4JWO A;  4GOT A;  2QS2 A;  1H43 A;  1SD3 A;  3O6H A;  4KD5 A;  4LZ7 A;  1B3L A;  1GV8 A;  4QHQ A;  3K1P A;  2Z8D A;  4NWD A;  3UOR A;  4ZEC A;  5CBR A;  2V3T A;  2V3U A;  5I56 B;  3PPP A;  1ANF A;  3FZV A;  4PE5 B;  1R9L A;  2ZXT A;  4GXS B;  3TCF A;  4XKQ A;  2B65 A;  4PFW A;  4YB7 A;  1FTO A;  5KCJ B;  1LAF E;  1MY4 A;  3LBS A;  3MP8 A;  2AL4 A;  5AA2 A;  4HCY A;  1Y3N A;  4PP0 A;  3SEY A;  4BLA A;  1YPN A;  4C1U A;  3FV1 A;  2QMW A;  3TYH A;  3KZG A;  3LSF B;  4U23 A;  3RTF B;  4EDP A;  1YTV A;  2QJE A;  2O1L A;  2NVU B;  5AA4 A;  4ZEB A;  1WVJ A;  1LST A;  3RNN A;  1N84 A;  3UK4 A;  4C0R A;  1DSN A;  4AB6 A;  1R6Z A;  4RPN A;  4X48 A;  3FJG A;  3MVW A;  3THI A;  1FQB A;  3FVO A;  1P1Q A;  3OOA A;  4RNS A;  1I69 A;  3K6V A;  5DEX A;  3FVG A;  5CMC A;  1B7H A;  1AL3 A;  5AA1 A;  1VE4 A;  1IZ1 A;  2OJT A;  1A40 A;  2I58 A;  3VLW A;  1FQD A;  1FCK A;  4I62 A;  3EN3 A;  3G3F A;  4NF5 A;  4QSD A;  3TUS A;  3KN7 A;  4FEB A;  3S2V A;  4YMA A;  3K1M A;  4H8I A;  1VSO A;  1ZKB A;  4BDM A;  1XHY A;  1BTJ A;  3N26 A;  4O3A A;  3H06 B;  2Z23 A;  5LOM A;  4R9F A;  1MRP A;  2H9B A;  3FD3 A;  4RK2 A;  3H4Z A;  1Q35 A;  2REJ A;  4P0G A;  2HEU A;  4TLL B;  3E9X A;  1O64 A;  4X1D A;  4AB5 A;  3MAM A;  2HZK A;  1P1N A;  3VDF A;  5I2N A;  3QUJ A;  4U1Z A;  1D3K A;  2F78 A;  4BDN A;  2V3Q A;  4QF9 A;  5A5X A;  3H6T A;  4FOR A;  2RKM A;  3MJN A;  2O69 A;  5DVJ A;  4MBP A;  3TMG A;  4I9D A;  3BBR A;  4POW A;  1LAH E;  1SI1 A;  3IOU A;  1ATG A;  2DVC A;  1FTL A;  1N7X A;  1N0T A;  3MBP A;  3PUV E;  4OZ9 A;  3TTN A;  2PBW A;  3L6H A;  4GVO A;  4LQ2 A;  4Q30 B;  1US4 A;  2V25 A;  4ZED A;  1D9V A;  2UVI A;  4DXC A;  3VVF A;  3UGW A;  3MVZ A;  4KYE A;  3VXC A;  4ZZE A;  4H0W A;  2RC9 A;  4XKR A;  3O97 A;  1MQJ A;  3MC2 A;  3CG3 A;  1MQD A;  5CI5 A;  1Y3P A;  4YU0 A;  2DSF A;  1ZU0 A;  3T9V A;  5HPQ A;  1P99 A;  1N3X A;  5H8H A;  4FAT A;  1JEV A;  1PB8 A;  4HCW A;  1B6H A;  3MUQ A;  1JW5 A;  4TOZ A;  4TQU Q;  3K01 A;  4QSC A;  1EH3 A;  3SEW A;  1S50 A;  4EF2 A;  2XD2 A;  1UTH A;  2O51 A;  1MS7 A;  1B40 A;  1LFG A;  4YZZ A;  4ESX A;  1B3H A;  4MH5 A;  3RUM A;  3WAE A;  1RYX A;  2QSX A;  5DT6 A;  3CFX A;  1M5F A;  3PPN A;  3PUW E;  3FGS A;  4GL0 A;  5K2Y A;  4F29 A;  1SDX A;  1LLS A;  3DM0 A;  1JNF A;  2I49 A;  3MVY A;  3PD8 A;  3PPR A;  4LON B;  4NED A;  2Q2A A;  4NTL A;  4H1X A;  4P11 A;  4QFL A;  3MP6 A;  1M5E A;  1AIV A;  1QVS A;  1I6Q A;  3HHG A;  4BDL A;  3SET A;  1GGG A;  3QSL A;  3IOR A;  4R75 A;  1I6B A;  2R9J A;  4KFQ A;  2DP8 A;  4U21 A;  4BDQ A;  4GQO A;  1JW4 A;  2IA4 A;  2OLB A;  3GBA A;  3OMB A;  5ITO A;  1O63 A;  4F3B A;  5KZT A;  1ELJ A;  3MW0 A;  3OO8 A;  4FAJ A;  3RT8 A;  3E4R A;  3ZSF A;  1MXY A;  1FW0 A;  4WKM A;  3P7I A;  3MVX A;  2YPN A;  3UN6 A;  2ONR A;  1QW0 A;  2PYY A;  1IXC A;  1DPE A;  1XC1 A;  2ONS A;  2ZYN A;  3KFM A;  4NF6 B;  4UAC A;  2ZYK A;  3FVK A;  4IO7 A;  1LBC A;  1BLF A;  4IY5 A;  4KI0 E;  4OQO A;  4ZEF A;  4ZE9 A;  4JB7 A;  1TFA A;  1XVY A;  4M1V A;  1BKA A;  3PU5 A;  4H5F A;  4LZ5 A;  3IO4 A;  5I2K A;  3B6T A;  2RC8 A;  1P1U A;  1OIB A;  1MM6 A;  2DWH A;  3PPO A;  4IO2 A;  2I4B A;  3H03 A;  2H99 A;  3LR1 A;  4I1D A;  1UTB A;  2OZZ A;  3G3J A;  3IL1 B;  4OVJ A;  4R72 A;  3LSX A;  1NH8 A;  3U93 A;  2UVJ A;  1B0L A;  3IB0 A;  1OQH A;  4MF3 A;  3KN8 A;  1SW2 A;  5TP9 B;  1IXH A;  1Y4T A;  3ILU B;  1MPD A;  1PBQ A;  2Y7W A;  4X1B A;  2ONK E;  3H7M A;  4IY6 A;  4ELQ A;  1B5H A;  1IEJ A;  2H25 A;  1MXZ A;  1M5D A;  1ZJL A;  3KN3 A;  3LUY A;  3Q25 A;  2XHD A;  1XVX A;  5AA3 A;  3EHT A;  1PBP A;  4ECF A;  3N94 A;  3D4C A;  2AIX A;  2A5T A;  3TKD A;  4ELR A;  1VR5 A;  4KCC A;  2ESN A;  2ZYO A;  3LC8 A;  4YB5 A;  1QUK A;  4O3B A;  2UYE A;  4KR5 A;  3S9N C;  1I6A A;  5H8H B;  3PUX E;  1FQC A;  5JTY A;  3MWB A;  4OER A;  3C31 A;  1B4Z A;  1OLA A;  3CIJ A;  3N5L A;  3OO6 A;  3C9H A;  2UVG A;  5A5X B;  4GLI A;  5KDT B;  1UTH B;  1IQ7 A;  1WOD A;  4FED A;  4WEP A;  4XKP A;  4DCX A;  3R6U A;  4JWX A;  4F3S A;  1N7W A;  2XXQ A;  3ILT B;  1IIT A;  3FAT A;  3SES A;  1ZTY A;  3TZA A;  1A8F A;  3UIF A;  3C4M A;  2DS9 A;  3T93 B;  1QUI A;  3I6V A;  5HBC A;  1EZP A;  2I6E A;  1MQG A;  2IEE A;  3HST A;  3TCG A;  1TXF A;  1A55 A;  2XXY A;  2YLN A;  3CSB A;  3R26 A;  4RY1 A;  4XKN A;  3TQW A;  4H8J A;  2VP1 A;  3G3K A;  4OEV A;  4DE8 A;  1MH4 A;  2F6P A;  2R6G E;  2O68 A;  1DMB A;  2O1M A;  1JW1 A; 
#chains in the Genus database with same CATH topology
 4IO6 A;  3KBR A;  2RCB A;  5FBP A;  1OVB A;  3RTW B;  4HXV A;  5I59 A;  3VVE A;  4MNP A;  3HPI A;  1B7Z A;  1B0H A;  1FBC A;  4F22 A;  1NNP A;  2RC7 A;  4IGT A;  3CFL A;  3DP6 A;  1J1N A;  1FQE A;  2Z8F A;  4UAB A;  1N04 A;  5CM6 A;  3T9H B;  1XOC A;  4PFR A;  2RIN A;  2D21 A;  1LBY A;  3JYR A;  1A7L A;  1FTK A;  2M8C A;  4OMB A;  1YAE A;  4OTE A;  3HCQ A;  1RDY A;  5IZ1 A;  5DEX B;  3SDF A;  2XXX A;  1Y4C A;  5EQ7 A;  3QXM A;  4LAT A;  5J1D A;  1FQF A;  3HV1 A;  4Q8R A;  3O9P A;  2G93 A;  3H6W A;  3AXF A;  3U1O A;  4ND9 A;  5I7I A;  3SEX A;  1B1H A;  2DWA A;  2VD2 A;  2MKZ A;  3M3L A;  3CRB A;  3RPW A;  2XXI A;  1LFH A;  4HE1 A;  3TPA A;  4I3Y A;  1Z7M E;  2HQ0 A;  4H46 A;  4GF8 A;  2VHA A;  4G68 C;  4X9T A;  4LVQ A;  1AMF A;  1B5I A;  1D4N A;  1TT1 A;  4JVC A;  4G77 A;  4RPO A;  1SVX B;  1SQY A;  1JP4 A;  3O2A A;  3V89 B;  3ECR A;  2W7Y A;  5B7D A;  4IO5 A;  1US5 A;  2XX9 A;  1NH7 A;  3DLN A;  1CB6 A;  3OO9 A;  1HSE A;  2VT5 A;  1LB9 A;  4GX4 A;  3JV9 A;  4EQ7 A;  3TEP A;  4LP2 B;  4PCD A;  2DDK A;  1FPK A;  4N8Y A;  5B70 A;  2FBP A;  4O3C A;  4XF5 A;  3MPK A;  1DTZ A;  2PMS A;  3C35 A;  1JVY A;  3IR1 A;  2JJK A;  1R9Q A;  2P0S A;  4G4P A;  4YKI A;  3TTR A;  1FBG A;  3PPQ A;  2B4L A;  2Y84 A;  4Z7E A;  5F7V A;  1NMU A;  3PGF A;  4R2F A;  3CVG A;  3K2D A;  5EQA A;  4Q0C A;  4BDR A;  4U2R A;  2GH9 A;  5AA2 B;  2I0B A;  3K0V A;  3GBB A;  1FSA A;  4EQB A;  4OYV A;  2FIX A;  3QK6 A;  2RCA A;  2CMO A;  1NV6 A;  2H4I A;  4OHN A;  4N13 A;  5CRY A;  1MXW A;  1QGX A;  4NQ8 A;  1H3D A;  3A3C A;  3UP9 A;  3Q28 A;  1NUX A;  2CEX A;  2QFL A;  1YZ0 A;  3K00 A;  5AA2 D;  1EZ9 A;  2HXW A;  4GL8 A;  2DQV A;  5L9S A;  1DK4 A;  1Z7N E;  2Q8J A;  3IJO B;  4YB6 A;  3ZKK A;  3IK6 B;  3K1N A;  3K4U A;  2ZZV A;  4RXL A;  2YJP A;  1UIV A;  1URD A;  1N3W A;  4I40 A;  2QS1 A;  4OET A;  3O66 A;  4ZEC A;  2ZNU A;  4THI A;  1D9Q A;  2I3W A;  3I5O A;  3DP4 A;  2NWJ A;  4PDD A;  4YKP A;  3O6G A;  5H8N A;  4LZ8 A;  1EYK A;  3PUY E;  5IZ3 B;  3KG2 A;  4OES A;  5DW8 A;  1RDX A;  1B5J A;  3FXU A;  1IIW A;  4NF4 B;  3CR9 A;  4ISU A;  4IO3 A;  1NNK A;  2ABH A;  4G68 B;  1B32 A;  3W15 C;  1H76 A;  4MNC A;  2Q2C A;  1N76 A;  3OO7 A;  4U22 A;  3B50 A;  3O6I A;  3B7D A;  3U92 A;  4N81 A;  3K6U A;  2REG A;  5BWJ A;  2QPQ A;  5H8F B;  3Q27 A;  4K3F A;  1MY3 A;  2VGQ A;  5DVI A;  1JVX A;  3VLU A;  1EU8 A;  1JET A;  4YMB A;  3SEU A;  4H67 A;  4X8R A;  3FUZ A;  3TEL A;  4QRZ A;  1FPJ A;  3V8X B;  4JWO A;  1H43 A;  4LZ7 A;  3UOR A;  5CBR A;  1NV3 A;  1ANF A;  1R9L A;  4GXS B;  2QVR A;  3LBS A;  1Y3N A;  3RPL A;  1YPN A;  1KA0 A;  3CHG A;  4U23 A;  2NVU B;  1LST A;  3RNN A;  4AB6 A;  1R6Z A;  1CNQ A;  1P1Q A;  3K6V A;  5AA1 A;  2I58 A;  3EN3 A;  4PBH A;  4NF5 A;  1XHY A;  3N26 A;  1MRP A;  2H9B A;  3H4Z A;  4TLL B;  5LDZ A;  5I2N A;  2F78 A;  2RKM A;  4NGU A;  3TMG A;  2PBW A;  3L6H A;  5AA4 A;  3VXC A;  4H0W A;  4KXP A;  1FJ9 A;  1P99 A;  1PB8 A;  1LBX A;  1JW5 A;  2XWK A;  1EH3 A;  4ESX A;  4MH5 A;  5EYG A;  5I57 A;  3PPN A;  5K2Y A;  4F29 A;  5L9O A;  1LLS A;  2I49 A;  3SET A;  3QSL A;  3IOR A;  1JW4 A;  3GBA A;  3MW0 A;  3ZSF A;  1MXY A;  4WKM A;  3P7I A;  2YPN A;  1XC1 A;  3KFM A;  3FVK A;  4OQO A;  4ZEF A;  1TFA A;  3PU5 A;  4LZ5 A;  3B6T A;  1LBV A;  3PPO A;  3H03 A;  3LR1 A;  2OZZ A;  4AS5 A;  3IB0 A;  1B0L A;  3KN8 A;  1SW2 A;  3KN3 A;  3Q25 A;  3LUY A;  3N94 A;  1BK4 A;  1VR5 A;  4YB5 A;  4MNI A;  3S9N C;  2UYE A;  5H8H B;  1FQC A;  2KQZ A;  4OVP A;  2UVG A;  4GBV A;  1UTH B;  4FED A;  1WOD A;  4DCX A;  3ILT B;  1QUI A;  3I6V A;  1EZP A;  2I6E A;  1A55 A;  2XXY A;  3R26 A;  4RY1 A;  4H8J A;  4OEV A;  4R74 A;  2Q9T A;  2O1M A;  1JW1 A;  4OFL A;  4PAI A;  2WX9 A;  3U72 A;  2Z22 A;  2FYI A;  3M8U A;  4GWO A;  3N6T A;  3MP1 A;  3Q26 A;  3TQL A;  3ODB A;  4GWW A;  3LSW A;  5DTB A;  1B51 A;  3B6Q A;  4PGP A;  1L5T A;  4KPT A;  4R6K A;  2UXA A;  2I48 A;  2BJI A;  2OK2 A;  4OEU A;  4C1T A;  3FVN A;  1Y1Z A;  4KYS A;  5AA4 B;  2E1S A;  1NI9 A;  1CE2 A;  3C34 A;  3EPE A;  1AWB A;  3FJM A;  4O7M A;  1NFT A;  3PMW A;  5IZZ A;  1INP A;  2PFY A;  3VXB A;  4YIC A;  4U4S A;  3CI8 A;  3HN0 A;  4HE2 A;  1O7T A;  1Y3Q A;  4FE8 A;  1QKA A;  3JZJ A;  4KCD A;  4PGN A;  1SPI A;  4WED A;  4DI4 B;  3L6G A;  4I3E A;  3E3K A;  4RYA A;  3RGY A;  2QRY A;  1EZO A;  3FIR A;  1JEU A;  4G61 A;  2Y7K A;  3HFU A;  2OWS A;  4JBZ A;  4OVS A;  3QMF A;  3MZ9 A;  5ICQ A;  2HZL A;  4F3G A;  3EF7 A;  4YKJ A;  5H8Q A;  5IZ3 A;  2F97 A;  3SEV A;  1FRP A;  1G0H A;  4PAK A;  3OEN A;  2DWJ A;  2ANJ A;  3KGC A;  4G68 A;  4XIG Q;  2Q8M A;  4PFY A;  3MZ1 A;  3KC1 A;  1R1N A;  4JXI A;  2Q89 A;  3T22 A;  5L8D A;  1P1O A;  3O29 A;  4MFI A;  4GXA A;  2A5S A;  3HO7 A;  1IMD A;  3QIM A;  1WDN A;  4BDO A;  2GFE A;  3MQ9 A;  2HCA A;  3PD9 A;  1H44 A;  1FPI A;  2PVU A;  1FPE A;  5I58 B;  1FTM A;  1H45 A;  4EXL A;  1AH5 A;  5AE4 A;  1USY H;  1SBP A;  5JK4 A;  2CZI A;  2F8D A;  1LB8 A;  3Q29 A;  3F11 A;  3HHF A;  2QS4 A;  2ZNS A;  3VVD A;  1RKM A;  3TOD A;  4MHF A;  1TWY A;  4ZDM A;  1OVT A;  1VFE A;  4ELP A;  1MY1 A;  2OX3 A;  2WEF A;  1IME A;  2BJJ X;  2FNC A;  5EHS A;  3ZKL A;  2HAU A;  3V83 A;  2FIE A;  4H6D A;  3CG1 A;  3S9L C;  4LQ5 A;  4PET A;  5FHM A;  2F34 A;  1NKX A;  3TCH A;  3PMV A;  4LUB A;  1IMB A;  2HPG A;  3KJ7 A;  4GRK A;  1UQW A;  2X7Q A;  1MPC A;  4N6P A;  1FPB A;  3U8Q A;  3RT6 B;  4OWD A;  5EYH A;  1LAG E;  2DWI A;  2F36 A;  5ITP A;  1SYH A;  4ZEK A;  2O84 X;  3ZS6 A;  5TPA B;  2GHB A;  4GD5 A;  1Y9U A;  4JSO A;  2FHY A;  1MPB A;  4FEC A;  5TP9 A;  4POX A;  4UA8 A;  4F2Q A;  4ZS9 A;  1NV5 A;  4QSE A;  4F18 A;  4R73 A;  5TU0 A;  2ZNT A;  5I84 A;  2CZL A;  5JTY B;  1D9Y A;  1FBE A;  2WYP A;  3EHU A;  4QXD A;  5FTH A;  4OFJ A;  2F7A A;  2R8T A;  1IXG A;  1SI0 A;  2HXR A;  3K6X A;  1B3G A;  2XXW A;  1MDQ A;  5ELV A;  1SYI A;  2UYF A;  3A09 A;  1OQG A;  1ZIU A;  4R2B A;  2HFB A;  1BP5 A;  4EXK A;  2CEY A;  4U1O A;  4F1V A;  1LBZ A;  1RDZ A;  2AL5 A;  5I59 B;  4PTK A;  4H5G A;  2XD3 A;  4DLD A;  2O7U A;  2OCU A;  4F2O A;  3IOW A;  3BKI B;  1B52 A;  1LEV A;  1IMC A;  1GV8 A;  3W9W A;  1B3L A;  4NWD A;  2V3T A;  3PPP A;  4PFW A;  4YB7 A;  5EQ8 A;  5KCJ B;  1LAF E;  4HCY A;  4BLA A;  4PP0 A;  4C1U A;  3FV1 A;  3LSF B;  3RTF B;  4EDP A;  1YTV A;  4RPN A;  3FJG A;  3FVO A;  3OOA A;  4RNS A;  5DEX A;  3FVG A;  1AL3 A;  3VLW A;  1FCK A;  3IFC A;  3G3F A;  4QSD A;  3TUS A;  3KN7 A;  4FEB A;  4YMA A;  4H8I A;  1BTJ A;  4O3A A;  4P9K A;  2REJ A;  2HEU A;  3E9X A;  4X1D A;  3MAM A;  4H45 A;  1P1N A;  1D3K A;  4BDN A;  4QF9 A;  3H6T A;  4FOR A;  3MJN A;  2O69 A;  4POW A;  1SI1 A;  3IOU A;  3UGW A;  3MVZ A;  4XKR A;  2QVV A;  1MQD A;  2V4C A;  5CI5 A;  1Y3P A;  4N15 A;  5HPQ A;  4HCW A;  1B6H A;  3MUQ A;  3K01 A;  1FJ6 A;  3SEW A;  1MS7 A;  1B40 A;  1LFG A;  1RYX A;  1K9Z A;  5DT6 A;  3CFX A;  1M5F A;  1SDX A;  1YXI A;  3DM0 A;  4LON B;  3MVY A;  1AIV A;  4O94 A;  1M5E A;  4R75 A;  4U21 A;  2OLB A;  5KZT A;  5ITO A;  2P3N A;  1O63 A;  4F3B A;  1KA1 A;  3E4R A;  1FW0 A;  3MST A;  1QW0 A;  1DPE A;  2ONS A;  4IO7 A;  4ZE9 A;  4JB7 A;  1XVY A;  4M1V A;  3IO4 A;  1P1U A;  1MM6 A;  2DWH A;  2I4B A;  4I1D A;  2H99 A;  4R72 A;  3IL1 B;  4NF0 A;  3U93 A;  1OQH A;  2PCR A;  4MF3 A;  1MPD A;  1PBQ A;  2VPN A;  4X1B A;  3H7M A;  2H25 A;  1ZJL A;  3EHT A;  3D4C A;  4ELR A;  2A5T A;  3TKD A;  2ESN A;  2ZYO A;  4KR5 A;  3PUX E;  5A5X B;  5KDT B;  3CIJ A;  3OO6 A;  4XKP A;  4WEP A;  3FAT A;  1A8F A;  4X04 A;  5HBC A;  1MQG A;  2IEE A;  3TQW A;  3ROJ A;  1TFD A;  2B3B A;  1SW1 A;  4PAF A;  2XWO A;  1MXX A;  3KC0 A;  4F1Y A;  4NMY A;  2PT1 A;  1VFD A;  2R71 A;  3CSG A;  2FA7 A;  1B05 A;  5I2K B;  5I58 A;  4GBW A;  1LCF A;  1PDA A;  2HAV A;  3FJ7 A;  1ZBM A;  3D4G A;  5H8F A;  4HW8 A;  2XWV A;  4DIG A;  1LBB A;  1DOT A;  4EUO A;  4PFT A;  3S9M C;  3UA8 A;  5I5P A;  2VPO A;  1MXV A;  1NL5 A;  2DYX A;  5H8Q B;  5EHM A;  2Z8E A;  2DXY A;  5LTC A;  5ET6 A;  5H8N B;  1BIY A;  2XXH A;  2OWZ A;  2XXU A;  5F24 A;  2X26 A;  2D5W A;  2NOO A;  3T1B A;  1QUL A;  3MZB A;  2QL3 A;  1USY E;  3FAS A;  4NN3 A;  4DDD A;  4JVD A;  4R9G A;  4WXJ A;  3OSQ A;  2XX8 A;  2XXP A;  2KR0 A;  2OBG A;  2O6A A;  4GWZ A;  1T0K A;  1UTB B;  3T9U A;  4YKK A;  3SKP A;  2RF1 A;  2QS3 A;  2UVH A;  1GTK A;  1IUD A;  4ZEI A;  2GHA A;  4TLM B;  4PBQ A;  4E0X A;  4OAN A;  1MH3 A;  3BFT A;  3TFL A;  5KDT A;  4ELO A;  5CMB A;  1M5C A;  4N07 A;  3LV0 A;  1MQH A;  3M3F A;  1MY0 A;  1UIU A;  2DVZ A;  3K02 A;  2F6G A;  4IO4 A;  4JVI A;  1QKB A;  4QFN A;  2Y7R A;  3IJX B;  2F5X A;  4NAP A;  5CMM A;  3RY3 A;  4NWC A;  1OLC A;  1NUZ A;  2XX7 A;  3EHS A;  2QMX A;  2Y5K A;  4PQJ A;  2DE2 A;  1ZLQ A;  1P1W A;  1POT A;  3LSL A;  4ZZA A;  4GWS A;  3N6U A;  3C32 A;  4OFO A;  1IMF A;  1URS A;  4MEV A;  2QVU A;  1B9J A;  1YCJ A;  4RK9 A;  4NG7 A;  1SW5 A;  4N17 A;  2XXK A;  2CZH A;  1GR2 A;  4LA9 A;  3RLF E;  4EF1 A;  2PFZ A;  1MY2 A;  5CBS A;  4U4X A;  1B4H A;  1SW4 A;  4IGR A;  5IM2 A;  1FQA A;  3G3H A;  3G3G A;  2I3V A;  4RJZ A;  4PE3 A;  4Z0I A;  5L9M A;  4R6H A;  3V5A A;  5CC2 A;  1KZ8 A;  4FJP A;  4XTC Q;  4G2Z A;  5J16 A;  2H98 A;  1Q1K A;  5ICT A;  2P2A A;  2WKY A;  4FBP A;  4JSD A;  3IOT A;  1B2H A;  3FXQ A;  3GLB A;  3BFU A;  3VLV A;  4MX6 A;  1LCT A;  3A29 A;  5EYF A;  3PUZ E;  4XFE A;  4KHZ E;  3SZP A;  3IO6 A;  4NF8 B;  1II5 A;  4OVQ A;  3VE1 B;  4GIZ A;  3T93 B;  3SER A;  2HHM A;  2PX1 A;  3T9X B;  2F35 A;  2ZYM A;  3RPL B;  3T96 B;  1DTG A;  4ONY A;  2Q88 A;  3BIH A;  2XXV A;  2B3F A;  4M4G A;  1GVC A;  3W9V A;  1MQI A;  1NV2 A;  5K2X A;  3KOT A;  4JDF A;  1NV0 A;  5FHO A;  4HTG A;  3IB2 A;  5A5L A;  1XS5 A;  3MPL A;  4P1L A;  1F9B A;  1FBH A;  5CMK A;  1MDP 1;  5I3S A;  1FTA A;  5H8S A;  3PV0 E;  1FPG A;  2P3V A;  3KSJ A;  4OXV A;  2AYS A;  2A5T B;  4GOT A;  3O6H A;  1SD3 A;  4NHB A;  4KD5 A;  5A5X A;  4QHQ A;  2V3U A;  4PE5 B;  3FZV A;  2ZXT A;  1FTO A;  1MY4 A;  2GQ1 A;  2AL4 A;  2QMW A;  3KZG A;  2QJE A;  4ZEB A;  1WVJ A;  3UK4 A;  1N84 A;  2B4M A;  3MVW A;  5CMC A;  3B8B A;  1VE4 A;  2OJT A;  1A40 A;  4N91 A;  3K1M A;  1VSO A;  1ZKB A;  4BDM A;  5LOM A;  2Z23 A;  3FD3 A;  1Q35 A;  4P0G A;  1O64 A;  3VDF A;  4U1Z A;  2V3Q A;  4I9D A;  4PF8 A;  1LAH E;  1ATG A;  2DVC A;  1N7X A;  3MBP A;  1N0T A;  3TTN A;  4Q30 B;  1US4 A;  2V25 A;  4ZED A;  2UVI A;  4DXC A;  3VVF A;  4KYE A;  2XWI A;  4ZZE A;  2RC9 A;  3O97 A;  3MC2 A;  3CG3 A;  2F3D A;  1ZU0 A;  3T9V A;  5H8H A;  4FAT A;  4TQU Q;  5I56 A;  4TOZ A;  4QSC A;  1UTH A;  4HE0 A;  1B3H A;  3RUM A;  3WAE A;  2QSX A;  3PUW E;  4DXU A;  4QFL A;  3TCF A;  2Q2A A;  3MP6 A;  1YYZ A;  1I6Q A;  4IR8 A;  2R9J A;  4KFQ A;  4BDQ A;  4GQO A;  2IA4 A;  3OMB A;  3OO8 A;  4FAJ A;  3UN6 A;  4F1U A;  2PYY A;  4NF6 B;  1K9Y A;  1LBC A;  4KI0 E;  5I2K A;  1BKA A;  3ISP A;  4H5F A;  2RC8 A;  4IO2 A;  1G0I A;  1UTB A;  1NH8 A;  2UVJ A;  5TP9 B;  1IXH A;  1Y4T A;  2Y7W A;  2ONK E;  4ELQ A;  1B5H A;  1MXZ A;  1M5D A;  2XHD A;  4ECF A;  1NV1 A;  4QBA A;  1Q9D A;  3MWB A;  4OER A;  3N5L A;  3C9H A;  1NUW A;  4F3S A;  2Q74 A;  3R6U A;  5AA2 A;  3SES A;  3TZA A;  3C4M A;  2DS9 A;  3U65 A;  3TCG A;  4XKN A;  2VP1 A;  3G3K A;  4P1E A;  2R6G E;  1IXI A;  2I4C A;  4I8C A;  2Y5L A;  3USD A;  5DYH A;  4N4U A;  4YAH X;  1Y1M A;  4R6Y A;  2XXT A;  4NE4 A;  2X7P A;  3O28 A;  3LUZ A;  1B46 A;  3E13 X;  3GZG A;  3M3K A;  3E79 A;  1QUJ A;  3OEK A;  4QFO A;  3A3U A;  3QUF A;  2DE4 A;  4DXB A;  3OD7 A;  1FPF A;  4QFK A;  1FBP A;  4DCY A;  4MAG A;  4NF4 A;  4PFU A;  4MLV A;  1LGB C;  4DZ1 A;  4P3L A;  5TPA A;  4OEN A;  3MYU A;  5F1Q A;  3QAX A;  3E78 A;  3CFZ A;  4MLQ A;  2GRV A;  4NX1 A;  3GXA A;  4Q5T A;  4F19 A;  3U94 A;  3C36 A;  1VDW A;  3QYT A;  4FIM A;  1PEB A;  4GFR A;  3TTK A;  5ISU A;  2V84 A;  4E0W A;  4MJO A;  3C33 A;  1XI6 A;  1M5B A;  3RQT A;  3BIG A;  1IMA A;  1HSJ A;  4G8N A;  4G8M A;  1B3F A;  3G3I A;  2F7B A;  3OSR A;  2I0C A;  3TAJ A;  1XT8 A;  4F31 B;  3G7W A;  4NF8 A;  4OVT A;  3IB1 A;  2DE3 A;  1POY 1;  3KEI A;  4RA1 A;  2WBD A;  3EQ1 A;  2Y7P A;  4O8M A;  1RYO A;  4GWU A;  3FV2 A;  1QJM A;  1OMP A;  2P1S A;  4NF5 B;  3RN8 A;  4PDH A;  5KCJ A;  2V93 A;  4IB2 A;  3D1R A;  2Y7I A;  5I2N B;  2ZZW A;  5IKB A;  1B3E A;  2ALU A;  4ZE8 A;  4KYD A;  2OWT A;  1KWH A;  3IAZ A;  2KLF A;  2PT2 A;  4NF6 A;  4MCO A;  1LBW A;  3I3V A;  5IGA A;  5JEI A;  2D3I A;  4PF6 A;  3DP8 A;  4H65 A;  3TTL A;  4F39 A;  4F3P A;  3PMX A;  1B1X A;  2DXR A;  3S9E A;  5I57 B;  3B6W A;  4EQ9 A;  3S4U A;  1Y20 A;  3KSX A;  4GX3 A;  1PB9 A;  3H6V A;  5HM4 B;  4MMP A;  2ZZX A;  3R7X A;  5ET5 A;  2G29 A;  2F7C A;  1FBD A;  4QFP A;  1B58 A;  3K6W A;  3OEM A;  1FTJ A;  2ZMB A;  2DOJ A;  3VFJ A;  4L17 A;  1NV7 A;  1A8E A;  5FTI A;  3TTM A;  3GYY A;  1MXU A;  1FPL A;  5FHN A;  4P0I A;  4ESW A;  1AOV A;  3OXN A;  1LAX A;  1EYJ A;  2NXO A;  5ET7 A;  2VD3 A;  2O7I A;  4KQP A;  1ZMG A;  4GWX A;  4GX6 A;  4N6K A;  5M2V A;  3VV5 A;  1A99 A;  3DEL B;  3ONM A;  3KJT A;  2THI A;  2LAO A;  2E0S A;  2VOZ A;  5IAI A;  1DCU A;  3IX1 A;  3FXR A;  4AS4 A;  3IOV A;  1JQF A;  4PC9 A;  2XA5 A;  3KBZ A;  1S7Y A;  1S9T A;  4AQ4 A;  5DVF A;  1MG1 A;  4OA4 A;  1PC3 A;  4JWY A;  2XXR A;  1HSL A;  1NNF A;  3TDJ A;  3FBP A;  5BUU A;  1B7U A;  2NUV A;  3T66 A;  1URG A;  3PTY A;  4HS7 A;  5ESY A;  2FVZ A;  3H6U A;  4O7I A;  1A54 A;  3IFA A;  1PB7 A;  3OEL A;  1NNT A;  1DPP A;  1LFI A;  2H5Y A;  4G8H A;  2WYK A;  4XXU A;  1MM7 A;  3H3G A;  4P56 A;  2QS2 A;  3K1P A;  2Z8D A;  5I56 B;  1NV4 A;  4XKQ A;  2B65 A;  3MP8 A;  3SEY A;  3TYH A;  1NUY A;  2O1L A;  4C0R A;  1DSN A;  4X48 A;  3THI A;  5ET8 A;  1FQB A;  1I69 A;  1B7H A;  1IZ1 A;  1FQD A;  4I62 A;  3S2V A;  4LN5 A;  4P8B A;  3H06 B;  4R9F A;  4RK2 A;  4AB5 A;  2HZK A;  3NOH A;  3QUJ A;  4PFB A;  2WBB A;  5DVJ A;  4MBP A;  3BBR A;  1FTL A;  3PUV E;  4OZ9 A;  4MIJ A;  4GVO A;  4LQ2 A;  1FPD A;  1D9V A;  3EKI A;  1MQJ A;  4P47 A;  4YU0 A;  2DSF A;  1N3X A;  1JEV A;  1S50 A;  4EF2 A;  2XD2 A;  2O51 A;  4YZZ A;  4N8G A;  4DI3 D;  2F3B A;  4GL0 A;  3FGS A;  1JNF A;  4NED A;  3PD8 A;  4NTL A;  3PPR A;  4P11 A;  4H1X A;  1QVS A;  3HHG A;  4BDL A;  4GWY A;  1GGG A;  1I6B A;  1DBZ A;  2DP8 A;  2CZK A;  1ELJ A;  3RT8 A;  3MVX A;  4XEQ A;  2ONR A;  3WAF A;  1IXC A;  4UAC A;  2ZYN A;  4PFI A;  2ZYK A;  4IY5 A;  1BLF A;  1OIB A;  3RYD A;  3G3J A;  4OVJ A;  3LSX A;  3ILU B;  2L5V A;  4N6D A;  1FBF A;  4IY6 A;  1IEJ A;  5T3J A;  5EQ9 A;  1XVX A;  5AA3 A;  1PBP A;  2AIX A;  4KCC A;  3LC8 A;  3T0J A;  1QUK A;  4O3B A;  1I6A A;  5JTY A;  3C31 A;  1B4Z A;  1OLA A;  4GLI A;  1IQ7 A;  4JWX A;  1N7W A;  2XXQ A;  1IIT A;  1ZTY A;  3UIF A;  1EYI A;  1TXF A;  2YLN A;  3CSB A;  4OVR A;  3FXB A;  4DE8 A;  1MH4 A;  2F6P A;  3HST A;  2O68 A;  1DMB A;  3KOS A; 
#chains in the Genus database with same CATH homology
 1TFD A;  2B3B A;  4OFL A;  4IO6 A;  3U72 A;  1IXI A;  2I4C A;  1SW1 A;  2Z22 A;  2FYI A;  3KBR A;  4I8C A;  2RCB A;  3M8U A;  1MXX A;  3USD A;  1OVB A;  3N6T A;  4GWO A;  5DYH A;  3RTW B;  4F1Y A;  3MP1 A;  3Q26 A;  4NMY A;  2PT1 A;  4YAH X;  3TQL A;  2Q9T A;  3ODB A;  3VVE A;  5I56 A;  5I59 A;  3HPI A;  1B7Z A;  1VFD A;  1Y1M A;  2R71 A;  3CSG A;  3LSW A;  2FA7 A;  4R6Y A;  2XXT A;  5DTB A;  1B05 A;  1B51 A;  3B6Q A;  1L5T A;  4NE4 A;  1B0H A;  2X7P A;  3O28 A;  5I2K B;  1B46 A;  5I58 A;  4KPT A;  4R6K A;  2UXA A;  3E13 X;  4F22 A;  1LCF A;  1NNP A;  2I48 A;  1PDA A;  2RC7 A;  2HAV A;  3CFL A;  3GZG A;  3M3K A;  4IGT A;  3FJ7 A;  3DP6 A;  1J1N A;  1ZBM A;  3D4G A;  5H8F A;  1FQE A;  1QUJ A;  2Z8F A;  2OK2 A;  4OEU A;  4HW8 A;  1N04 A;  4DIG A;  3OEK A;  1LBB A;  3A3U A;  3QUF A;  4QFO A;  5CM6 A;  1DOT A;  2DE4 A;  3T9H B;  4EUO A;  4C1T A;  1XOC A;  3FVN A;  1Y1Z A;  4KYS A;  2RIN A;  4DXB A;  2D21 A;  2E1S A;  3OD7 A;  4PFT A;  3UA8 A;  5AA4 B;  3S9M C;  1CE2 A;  3C34 A;  1A7L A;  1FTK A;  3JYR A;  4QFK A;  1MXV A;  3EPE A;  2M8C A;  4OMB A;  1NL5 A;  1YAE A;  2DYX A;  3HCQ A;  4OTE A;  3FJM A;  5H8Q B;  4DCY A;  1NFT A;  3PMW A;  4NF4 A;  4PFU A;  4MLV A;  5DEX B;  5EHM A;  1LGB C;  3SDF A;  2XXX A;  4DZ1 A;  5TPA A;  1Y4C A;  4OEN A;  2Z8E A;  3QXM A;  4LAT A;  5J1D A;  5F1Q A;  3VXB A;  4YIC A;  3QAX A;  2DXY A;  1FQF A;  3CI8 A;  4U4S A;  3HV1 A;  3CFZ A;  4MLQ A;  4Q8R A;  2GRV A;  3O9P A;  2G93 A;  5H8N B;  3HN0 A;  3H6W A;  3AXF A;  1BIY A;  2XXH A;  3GXA A;  1O7T A;  4ND9 A;  4Q5T A;  3U1O A;  2XXU A;  4F19 A;  1Y3Q A;  3U94 A;  3SEX A;  4FE8 A;  2X26 A;  1B1H A;  2DWA A;  2D5W A;  3C36 A;  3QYT A;  2VD2 A;  1QKA A;  2NOO A;  3JZJ A;  1QUL A;  4FIM A;  4KCD A;  1PEB A;  3M3L A;  3CRB A;  2QL3 A;  3MZB A;  3RPW A;  4GFR A;  1USY E;  2XXI A;  3FAS A;  2V84 A;  3TTK A;  4E0W A;  1LFH A;  5ISU A;  4WED A;  4DDD A;  3C33 A;  3TPA A;  4R9G A;  1M5B A;  3OSQ A;  1Z7M E;  2HQ0 A;  4WXJ A;  3RQT A;  3L6G A;  2XX8 A;  4GF8 A;  3E3K A;  1HSJ A;  4G8N A;  2XXP A;  2VHA A;  4G68 C;  4G8M A;  4X9T A;  4LVQ A;  4RYA A;  1AMF A;  1B3F A;  1B5I A;  3RGY A;  2OBG A;  3G3I A;  1D4N A;  2QRY A;  5I57 A;  1TT1 A;  2O6A A;  1EZO A;  3FIR A;  1JEU A;  2F7B A;  3OSR A;  4G77 A;  4RPO A;  1T0K A;  1SVX B;  2Y7K A;  1SQY A;  1UTB B;  2I0C A;  2OWS A;  4JBZ A;  3TAJ A;  1XT8 A;  3T9U A;  3O2A A;  4F31 B;  3G7W A;  3V89 B;  5L9O A;  3ECR A;  2W7Y A;  4NF8 A;  3MZ9 A;  5B7D A;  3IB1 A;  5ICQ A;  4IO5 A;  4YKK A;  2HZL A;  3SKP A;  4F3G A;  3EF7 A;  2RF1 A;  2QS3 A;  2UVH A;  1GTK A;  2DE3 A;  1POY 1;  4YKJ A;  1US5 A;  3KEI A;  4RA1 A;  2XX9 A;  3EQ1 A;  1NH7 A;  1IUD A;  3DLN A;  5H8Q A;  1CB6 A;  2GHA A;  2Y7P A;  4TLM B;  4ZEI A;  4E0X A;  3OO9 A;  1HSE A;  1MH3 A;  1LB9 A;  2F97 A;  3SEV A;  3BFT A;  3JV9 A;  4EQ7 A;  1RYO A;  3TFL A;  5KDT A;  4ELO A;  3TEP A;  3FV2 A;  1QJM A;  4LP2 B;  5CMB A;  1M5C A;  3OEN A;  4N07 A;  1OMP A;  1MQH A;  2DWJ A;  2ANJ A;  2P1S A;  3KGC A;  5B70 A;  4NF5 B;  3M3F A;  4G68 A;  4XIG Q;  3RN8 A;  1MY0 A;  4PFY A;  3WAF A;  1UIU A;  3MZ1 A;  5KCJ A;  4O3C A;  2DVZ A;  3K02 A;  3MPK A;  2F6G A;  1DTZ A;  1R1N A;  2V93 A;  2PMS A;  3C35 A;  1JVY A;  4IB2 A;  4IO4 A;  2Q89 A;  4JXI A;  5L8D A;  3T22 A;  4DXU A;  1P1O A;  1QKB A;  3IR1 A;  3O29 A;  4MFI A;  4QFN A;  4GXA A;  1R9Q A;  2P0S A;  2Y7R A;  2Y7I A;  3IJX B;  5I2N B;  4G4P A;  5IKB A;  4YKI A;  1B3E A;  2ALU A;  2A5S A;  2F5X A;  3HO7 A;  4ZE8 A;  5CMM A;  4KYD A;  3RY3 A;  3TTR A;  3QIM A;  4NWC A;  2OWT A;  1KWH A;  1WDN A;  4BDO A;  2GFE A;  1OLC A;  2XX7 A;  3MQ9 A;  3PPQ A;  2Y84 A;  2QMX A;  2HCA A;  3EHS A;  4Z7E A;  3PD9 A;  2DE2 A;  3IAZ A;  1H44 A;  4PQJ A;  2KLF A;  1ZLQ A;  2PT2 A;  1P1W A;  4NF6 A;  1POT A;  3I3V A;  3LSL A;  5F7V A;  1NMU A;  2PVU A;  4ZZA A;  5JEI A;  3N6U A;  3C32 A;  3CVG A;  3PGF A;  1URS A;  4OFO A;  4R2F A;  3K2D A;  1FTM A;  1H45 A;  2D3I A;  5I58 B;  3DP8 A;  4Q0C A;  4H65 A;  4EXL A;  1B9J A;  1AH5 A;  1YCJ A;  5AE4 A;  1USY H;  4RK9 A;  4BDR A;  1SBP A;  4U2R A;  3TTL A;  1SW5 A;  2GH9 A;  5JK4 A;  2F8D A;  1LB8 A;  5AA2 B;  3Q29 A;  3F11 A;  3HHF A;  3KOS A;  2QS4 A;  4F39 A;  1GR2 A;  4LA9 A;  3RLF E;  2ZNS A;  4EF1 A;  4F3P A;  2I0B A;  3VVD A;  3PMX A;  1MY2 A;  1RKM A;  3K0V A;  5CBS A;  3TOD A;  4U4X A;  1B4H A;  1B1X A;  1TWY A;  2DXR A;  3GBB A;  4ZDM A;  5I57 B;  3S9E A;  1OVT A;  3B6W A;  4EQB A;  4EQ9 A;  1SW4 A;  3S4U A;  1Y20 A;  4IGR A;  4OYV A;  4R74 A;  1VFE A;  3KSX A;  3QK6 A;  4ELP A;  1FQA A;  1MY1 A;  2RCA A;  2CMO A;  2BJJ X;  3G3H A;  3G3G A;  2FNC A;  1PB9 A;  3H6V A;  5HM4 B;  5EHS A;  2H4I A;  3ZKL A;  2HAU A;  4OHN A;  3V83 A;  4H6D A;  2I3V A;  3R7X A;  4N13 A;  2G29 A;  4RJZ A;  2F7C A;  5CRY A;  1MXW A;  4QFP A;  1B58 A;  3K6W A;  3CG1 A;  1H3D A;  3A3C A;  4Z0I A;  3UP9 A;  3S9L C;  4LQ5 A;  3OEM A;  1FTJ A;  5L9M A;  4R6H A;  2ZMB A;  4PET A;  5FHM A;  2DOJ A;  2F34 A;  3Q28 A;  3V5A A;  5CC2 A;  1NKX A;  4FJP A;  4XTC Q;  3K00 A;  3TCH A;  3PMV A;  4G2Z A;  4L17 A;  3VFJ A;  5AA2 D;  4LUB A;  1A8E A;  2H98 A;  1EZ9 A;  5FTI A;  3KJ7 A;  4GRK A;  1Q1K A;  2HXW A;  1UQW A;  5ICT A;  2X7Q A;  3TTM A;  1MPC A;  4N6P A;  4GL8 A;  1MXU A;  3U8Q A;  2P2A A;  2DQV A;  3RT6 B;  4OWD A;  5L9S A;  2WKY A;  1Z7N E;  5FHN A;  2Q8J A;  4JSD A;  3IJO B;  4YB6 A;  4P0I A;  3IOT A;  1B2H A;  1LAG E;  4ESW A;  2DWI A;  2F36 A;  3FXQ A;  3GLB A;  3IK6 B;  3K1N A;  3BFU A;  3K4U A;  3VLV A;  3ZKK A;  3OXN A;  5ITP A;  1LAX A;  1AOV A;  4F1U A;  1SYH A;  4RXL A;  2NXO A;  1LCT A;  2VD3 A;  2O7I A;  4ZEK A;  4KQP A;  2YJP A;  1ZMG A;  5EYF A;  1UIV A;  1URD A;  1N3W A;  2O84 X;  3PUZ E;  5M2V A;  4OET A;  2QS1 A;  4KHZ E;  3O66 A;  3VV5 A;  5TPA B;  2GHB A;  2ZNU A;  1A99 A;  4GD5 A;  3ZS6 A;  1Y9U A;  2I3W A;  4THI A;  3DEL B;  3ONM A;  3IO6 A;  3I5O A;  4NF8 B;  1II5 A;  3KJT A;  3DP4 A;  3VE1 B;  4JSO A;  2NWJ A;  1MPB A;  2THI A;  4FEC A;  4GIZ A;  2LAO A;  4POX A;  5TP9 A;  2E0S A;  2VOZ A;  3O6G A;  4UA8 A;  4YKP A;  5H8N A;  4LZ8 A;  3SER A;  4F2Q A;  5IAI A;  2PX1 A;  3IX1 A;  3FXR A;  4ZS9 A;  3T9X B;  2F35 A;  2ZYM A;  3IOV A;  3PUY E;  1JQF A;  3KG2 A;  4QSE A;  4OES A;  4F18 A;  1B5J A;  3FXU A;  3T96 B;  4R73 A;  1DTG A;  1IIW A;  1S7Y A;  1S9T A;  2ZNT A;  4NF4 B;  4ONY A;  5TU0 A;  4AQ4 A;  5I84 A;  2CZL A;  3CR9 A;  5DVF A;  4ISU A;  1D9Y A;  1MG1 A;  2Q88 A;  4IO3 A;  5JTY B;  1NNK A;  2XXV A;  3EHU A;  1PC3 A;  2ABH A;  4JWY A;  5FTH A;  2B3F A;  4M4G A;  2XXR A;  4OFJ A;  4G68 B;  2F7A A;  1B32 A;  1HSL A;  3W15 C;  1GVC A;  1IXG A;  3W9V A;  1H76 A;  1SI0 A;  1NNF A;  1MQI A;  2Q2C A;  1N76 A;  3K6X A;  3OO7 A;  1B3G A;  4U22 A;  5K2X A;  3KOT A;  3TDJ A;  2XXW A;  1MDQ A;  3O6I A;  4JDF A;  5BUU A;  1B7U A;  5ELV A;  1SYI A;  2NUV A;  5FHO A;  2UYF A;  3A09 A;  3B7D A;  4HTG A;  3T66 A;  3U92 A;  1URG A;  3K6U A;  4HS7 A;  3W9W A;  2REG A;  1OQG A;  1ZIU A;  3IB2 A;  4R2B A;  2QPQ A;  3H6U A;  5H8F B;  5BWJ A;  2HFB A;  1BP5 A;  3Q27 A;  4EXK A;  4K3F A;  1XS5 A;  1MY3 A;  1A54 A;  2VGQ A;  4U1O A;  5DVI A;  4F1V A;  1PB7 A;  1JVX A;  3MPL A;  1F9B A;  3VLU A;  1EU8 A;  1JET A;  4YMB A;  5CMK A;  2AL5 A;  5I59 B;  4H5G A;  1MDP 1;  3SEU A;  2XD3 A;  4H67 A;  4DLD A;  3OEL A;  2O7U A;  2OCU A;  3PV0 E;  5H8S A;  3FUZ A;  1NNT A;  3TEL A;  3KSJ A;  4QRZ A;  4F2O A;  1DPP A;  4OXV A;  3IOW A;  1LFI A;  2AYS A;  2A5T B;  3BKI B;  2H5Y A;  4G8H A;  4XXU A;  1B52 A;  1MM7 A;  3V8X B;  3H3G A;  4JWO A;  4GOT A;  2QS2 A;  1H43 A;  1SD3 A;  3O6H A;  4KD5 A;  4LZ7 A;  1B3L A;  1GV8 A;  4QHQ A;  3K1P A;  2Z8D A;  4NWD A;  3UOR A;  4ZEC A;  5CBR A;  2V3T A;  2V3U A;  5I56 B;  3PPP A;  1ANF A;  3FZV A;  4PE5 B;  1R9L A;  2ZXT A;  4GXS B;  3TCF A;  4XKQ A;  2B65 A;  4PFW A;  4YB7 A;  1FTO A;  5KCJ B;  1LAF E;  1MY4 A;  3LBS A;  3MP8 A;  2AL4 A;  5AA2 A;  4HCY A;  1Y3N A;  4PP0 A;  3SEY A;  4BLA A;  1YPN A;  4C1U A;  3FV1 A;  2QMW A;  3TYH A;  3KZG A;  3LSF B;  4U23 A;  3RTF B;  4EDP A;  1YTV A;  2QJE A;  2O1L A;  2NVU B;  5AA4 A;  4ZEB A;  1WVJ A;  1LST A;  3RNN A;  1N84 A;  3UK4 A;  4C0R A;  1DSN A;  4AB6 A;  1R6Z A;  4RPN A;  4X48 A;  3FJG A;  3MVW A;  3THI A;  1FQB A;  3FVO A;  1P1Q A;  3OOA A;  4RNS A;  1I69 A;  3K6V A;  5DEX A;  3FVG A;  5CMC A;  1B7H A;  1AL3 A;  5AA1 A;  1VE4 A;  1IZ1 A;  2OJT A;  1A40 A;  2I58 A;  3VLW A;  1FQD A;  1FCK A;  4I62 A;  3EN3 A;  3G3F A;  4NF5 A;  4QSD A;  3TUS A;  3KN7 A;  4FEB A;  3S2V A;  4YMA A;  3K1M A;  4H8I A;  1VSO A;  1ZKB A;  4BDM A;  1XHY A;  1BTJ A;  3N26 A;  4O3A A;  3H06 B;  2Z23 A;  5LOM A;  4R9F A;  1MRP A;  2H9B A;  3FD3 A;  4RK2 A;  3H4Z A;  1Q35 A;  2REJ A;  4P0G A;  2HEU A;  4TLL B;  3E9X A;  1O64 A;  4X1D A;  4AB5 A;  3MAM A;  2HZK A;  1P1N A;  3VDF A;  5I2N A;  3QUJ A;  4U1Z A;  1D3K A;  2F78 A;  4BDN A;  2V3Q A;  4QF9 A;  5A5X A;  3H6T A;  4FOR A;  2RKM A;  3MJN A;  2O69 A;  5DVJ A;  4MBP A;  3TMG A;  4I9D A;  3BBR A;  4POW A;  1LAH E;  1SI1 A;  3IOU A;  1ATG A;  2DVC A;  1FTL A;  1N7X A;  1N0T A;  3MBP A;  3PUV E;  4OZ9 A;  3TTN A;  2PBW A;  3L6H A;  4GVO A;  4LQ2 A;  4Q30 B;  1US4 A;  2V25 A;  4ZED A;  1D9V A;  2UVI A;  4DXC A;  3VVF A;  3UGW A;  3MVZ A;  4KYE A;  3VXC A;  4ZZE A;  4H0W A;  2RC9 A;  4XKR A;  3O97 A;  1MQJ A;  3MC2 A;  3CG3 A;  1MQD A;  5CI5 A;  1Y3P A;  4YU0 A;  2DSF A;  1ZU0 A;  3T9V A;  5HPQ A;  1P99 A;  1N3X A;  5H8H A;  4FAT A;  1JEV A;  1PB8 A;  4HCW A;  1B6H A;  3MUQ A;  1JW5 A;  4TOZ A;  4TQU Q;  3K01 A;  4QSC A;  1EH3 A;  3SEW A;  1S50 A;  4EF2 A;  2XD2 A;  1UTH A;  2O51 A;  1MS7 A;  1B40 A;  1LFG A;  4YZZ A;  4ESX A;  1B3H A;  4MH5 A;  3RUM A;  3WAE A;  1RYX A;  2QSX A;  5DT6 A;  3CFX A;  1M5F A;  3PPN A;  3PUW E;  3FGS A;  4GL0 A;  5K2Y A;  4F29 A;  1SDX A;  1LLS A;  3DM0 A;  1JNF A;  2I49 A;  3MVY A;  3PD8 A;  3PPR A;  4LON B;  4NED A;  2Q2A A;  4NTL A;  4H1X A;  4P11 A;  4QFL A;  3MP6 A;  1M5E A;  1AIV A;  1QVS A;  1I6Q A;  3HHG A;  4BDL A;  3SET A;  1GGG A;  3QSL A;  3IOR A;  4R75 A;  1I6B A;  2R9J A;  4KFQ A;  2DP8 A;  4U21 A;  4BDQ A;  4GQO A;  1JW4 A;  2IA4 A;  2OLB A;  3GBA A;  3OMB A;  5ITO A;  1O63 A;  4F3B A;  5KZT A;  1ELJ A;  3MW0 A;  3OO8 A;  4FAJ A;  3RT8 A;  3E4R A;  3ZSF A;  1MXY A;  1FW0 A;  4WKM A;  3P7I A;  3MVX A;  2YPN A;  3UN6 A;  2ONR A;  1QW0 A;  2PYY A;  1IXC A;  1DPE A;  1XC1 A;  2ONS A;  2ZYN A;  3KFM A;  4NF6 B;  4UAC A;  2ZYK A;  3FVK A;  4IO7 A;  1LBC A;  1BLF A;  4IY5 A;  4KI0 E;  4OQO A;  4ZEF A;  4ZE9 A;  4JB7 A;  1TFA A;  1XVY A;  4M1V A;  1BKA A;  3PU5 A;  4H5F A;  4LZ5 A;  3IO4 A;  5I2K A;  3B6T A;  2RC8 A;  1P1U A;  1OIB A;  1MM6 A;  2DWH A;  3PPO A;  4IO2 A;  2I4B A;  3H03 A;  2H99 A;  3LR1 A;  4I1D A;  1UTB A;  2OZZ A;  3G3J A;  3IL1 B;  4OVJ A;  4R72 A;  3LSX A;  1NH8 A;  3U93 A;  2UVJ A;  1B0L A;  3IB0 A;  1OQH A;  4MF3 A;  3KN8 A;  1SW2 A;  5TP9 B;  1IXH A;  1Y4T A;  3ILU B;  1MPD A;  1PBQ A;  2Y7W A;  4X1B A;  2ONK E;  3H7M A;  4IY6 A;  4ELQ A;  1B5H A;  1IEJ A;  2H25 A;  1MXZ A;  1M5D A;  1ZJL A;  3KN3 A;  3LUY A;  3Q25 A;  2XHD A;  1XVX A;  5AA3 A;  3EHT A;  1PBP A;  4ECF A;  3N94 A;  3D4C A;  2AIX A;  2A5T A;  3TKD A;  4ELR A;  1VR5 A;  4KCC A;  2ESN A;  2ZYO A;  3LC8 A;  4YB5 A;  1QUK A;  4O3B A;  2UYE A;  4KR5 A;  3S9N C;  1I6A A;  5H8H B;  3PUX E;  1FQC A;  5JTY A;  3MWB A;  4OER A;  3C31 A;  1B4Z A;  1OLA A;  3CIJ A;  3N5L A;  3OO6 A;  3C9H A;  2UVG A;  5A5X B;  4GLI A;  5KDT B;  1UTH B;  1IQ7 A;  1WOD A;  4FED A;  4WEP A;  4XKP A;  4DCX A;  3R6U A;  4JWX A;  4F3S A;  1N7W A;  2XXQ A;  3ILT B;  1IIT A;  3FAT A;  3SES A;  1ZTY A;  3TZA A;  1A8F A;  3UIF A;  3C4M A;  2DS9 A;  3T93 B;  1QUI A;  3I6V A;  5HBC A;  1EZP A;  2I6E A;  1MQG A;  2IEE A;  3HST A;  3TCG A;  1TXF A;  1A55 A;  2XXY A;  2YLN A;  3CSB A;  3R26 A;  4RY1 A;  4XKN A;  3TQW A;  4H8J A;  2VP1 A;  3G3K A;  4OEV A;  4DE8 A;  1MH4 A;  2F6P A;  2R6G E;  2O68 A;  1DMB A;  2O1M A;  1JW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...