3CG3A

Crystal structure of p. horikoshii periplasmic binding protein moda/wtpa with bound tungstate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
315
structure length
315
Chain Sequence
SREARLIIFHAGSLSIPLSQVEEKFTKYAQEKLGVKVTFQDEASGSVKAVRKVTDLKKRADIVAVADYTLIPQLMIPNYTDFYVLFATNEIVIAFTNKSKYADEMLKNPDKWYEILSRPDVSFGFSDPNQDPCGYRSVMVMKLAELYYGRPIFKELVEKTTNIYSNGTRIYAPKEIIIKDKRVIMRPKETDLVGLVESGSLDYIFIYKSVAKQHHLSYITLPDDINLGDFNKADFYGRVSITLGSTGKTIKAKPIVYGITVLKNAPNRELAIEFLRFLLGNEGRKIFEDNYQEFLSPPVAFGNVPPEIRRLVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords UPF0100 protein PH0151
publication title Distorted octahedral coordination of tungstate in a subfamily of specific binding proteins.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 111
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cg3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cg3A01
1PC3A 3DP4A 4OTEA 1MXXA 3HN0A 4WKMA 2A5TA 1FTMA 3P7IA 3FVGA 2QL3A 1A99A 1A8FA 2DP8A 3ODBA 2M8CA 1LB9A 3GXAA 2I3VA 2ONSA 3OXNA 4LVQA 4OESA 1ANFA 1ZTYA 4ZECA 5DVIA 3O6HA 2QMXA 3CRBA 3HSTA 3CFLA 4YZZA 5H8QB 1SDXA 1MM6A 5M2VA 3R6UA 5FTHA 3OO7A 2HZKA 1QUIA 4H8IA 1OVBA 1R9LA 1Y3QA 2D21A 4WEDA 1FQBA 3O28A 4U4SA 2XXRA 3CR9A 4ESXA 2XXPA 4LQ5A 3PMVA 1T0KA 4GF8A 4X1BA 1UTHB 2QS3A 4DLDA 1TFDA 2E1SA 3C36A 4U1ZA 1PEBA 3EF7A 4OZ9A 4BDLA 3TKDA 3SEYA 4NTLA 5ELVA 1HSLA 1ZBMA 2AL4A 3DLNA 3FASA 2R9JA 4FIMA 1B3EA 1B0LA 5CMMA 1MH3A 4XKRA 4FE8A 4YB7A 2D3IA 2Q9TA 1Q1KA 1LAGE 1FQAA 2XD2A 5J1DA 3VVDA 4GVOA 1N3XA 3F11A 1IUDA 2ZYMA 3TZAA 3C34A 2KLFA 1ATGA 4MFIA 4Q0CA 1A55A 1JW4A 3FD3A 2REGA 3DELB 3O2AA 4UACA 1QKBA 3TTLA 1IITA 2DYXA 2P1SA 4G8MA 4M4GA 1EZ9A 1B4ZA 4HCWA 1DSNA 3U94A 1GTKA 1N0TA 3RY3A 1MQDA 1XC1A 2OLBA 1IZ1A 2F35A 2DE3A 4F3PA 2Z23A 2F36A 2ZNTA 2NVUB 1B51A 1LBCA 1NNPA 3ILTB 5BUUA 2I3WA 4X9TA 1USYE 2I0CA 3MPKA 2RINA 1JETA 4XKPA 3SEWA 4QFKA 4LP2B 4F22A 3EQ1A 2O1MA 3TELA 3ONMA 4ELPA 1VR5A 3C32A 5FTIA 2UXAA 5TU0A 1H45A 2ZNSA 1R6ZA 2PT2A 3D4CA 4I1DA 3U92A 4R75A 4X1DA 4NE4A 4RK2A 1MQHA 4I62A 1JVYA 3CVGA 2Q2CA 5A5XA 1FQCA 1B7HA 2DE4A 2I4BA 3JZJA 2F8DA 4BDOA 1BLFA 3KSJA 3TEPA 3OENA 1VFDA 3VXCA 4LONB 3OOAA 2HAUA 3A3CA 3PPQA 3S9NC 4QHQA 3FXRA 1AOVA 1B58A 2YPNA 4NF4A 2XXYA 4GRKA 4ZZEA 3MUQA 3C31A 3PUXE 4DZ1A 3BBRA 1IEJA 3FV2A 3L6GA 1XVXA 1URSA 2X26A 2YLNA 2PVUA 2DWAA 4GXAA 3O97A 4R73A 1II5A 3FJMA 1VFEA 2RC7A 3Q26A 4U23A 4EXKA 3MWBA 1QULA 4MF3A 3Q27A 1OQHA 4P0IA 1Y4CA 4ZEKA 5AA2B 2XXUA 4KQPA 3V89B 3KFMA 3RN8A 4H67A 2B3FA 4OEVA 3O9PA 2HAVA 3LSLA 3I6VA 1MXUA 4U1OA 3PGFA 4GXSB 1PDAA 1L5TA 4RA1A 2RC9A 4NWCA 2O6AA 4IB2A 3OEMA 2D5WA 4F19A 3T93B 5K2YA 5DVFA 4N6PA 2H25A 3EHTA 2Z8EA 3KGCA 3VVEA 3UGWA 3MPLA 3T96B 4R6HA 1NNKA 2DSFA 2OWTA 1XHYA 4ZS9A 3O6IA 1FTLA 4RPNA 4R9GA 2DVZA 3RT8A 1BIYA 2LAOA 4NF8A 3TQWA 3SDFA 4Z7EA 4DXUA 5CRYA 1DTGA 5AA4A 4F29A 5KZTA 4GQOA 4IO6A 2XXXA 3B7DA 2Y7RA 1XT8A 2DWJA 4QF9A 2ZMBA 4H0WA 3VLVA 5CBRA 1A8EA 1RKMA 3H06B 3K1NA 3U72A 5I2KB 3LSWA 4G77A 3H6TA 3PMWA 5TP9A 4ZE8A 4DXBA 3IL1B 1TT1A 4JWOA 1LAHE 4F31B 1I69A 4WXJA 4KYDA 1JNFA 3TTNA 1MPBA 3PU5A 3SKPA 3DP6A 1B2HA 5H8HA 4DCYA 1B3FA 1UQWA 2RKMA 3HV1A 2HZLA 1Y3PA 1FCKA 3H6VA 3OSQA 1HSEA 4ZZAA 1PB7A 4NF6A 4GWOA 2RC8A 3FIRA 3WAEA 1AIVA 3PUWE 3CSGA 1QUKA 1I6AA 5DEXA 5I58B 4XXUA 1FW0A 3G3FA 4G68B 1O64A 3UP9A 3CIJA 4DE8A 4XIGQ 2O68A 2QPQA 3TMGA 3VFJA 1MPDA 1SQYA 3K4UA 4EF1A 3G3IA 3MZ9A 1XVYA 1OLAA 5AA2D 3Q28A 3IOVA 3IR1A 3KEIA 4YB5A 3UA8A 3BFUA 4LZ8A 3T22A 3K1PA 5FHMA 3EHSA 3HPIA 5DT6A 4PFYA 4TOZA 4YU0A 1NL5A 3FXUA 2DQVA 2I0BA 3GBBA 1MDP1 3S9EA 4XTCQ 2Z8DA 4R74A 1DPEA 1FQFA 3TCHA 3W9WA 5H8QA 1FTJA 1M5CA 5BWJA 1H44A 1JEUA 1WODA 4O3BA 3M3KA 3T9VA 3T9XB 4YAHX 1NNTA 2XX7A 2OCUA 4QSDA 4PP0A 3C33A 4YKKA 4PETA 2B65A 1M5DA 1B52A 1LBBA 1US5A 3UN6A 3O66A 3QIMA 3H6WA 2V3UA 4FECA 1BKAA 2A5SA 1UTHA 3QUJA 2GH9A 2X7QA 2H98A 2NXOA 1UIUA 4DCXA 1D9YA 2PT1A 3IJOB 4FEDA 2GHAA 3FVOA 3DM0A 4PFUA 3S9MC 4LUBA 2Y7WA 4DIGA 1QUJA 5CI5A 3W9VA 1LCFA 3TCFA 1MG1A 3CFXA 4U21A 3AXFA 1F9BA 2ZYKA 3KN7A 4G4PA 3W15C 3UIFA 3M3LA 1PB9A 2GRVA 4IO2A 3VXBA 5TPAB 3E3KA 4C1UA 1MM7A 3Q25A 4OENA 4C0RA 1B1XA 1B46A 2QS1A 3OSRA 1B40A 2I4CA 2HEUA 2UVIA 4ZE9A 4E0XA 1R9QA 1NMUA 2V93A 4N13A 4EQ9A 1TWYA 4ESWA 2DWHA 4X48A 3KOTA 4OWDA 2IEEA 3PV0E 4I9DA 3IORA 4KPTA 3TTKA 2VP1A 3DP8A 1M5BA 2Q8JA 2ONRA 3HO7A 5L9MA 1PBPA 5AA3A 3OELA 1MQGA 1XS5A 1ZU0A 1H43A 3IJXB 1VE4A 2ABHA 2Q2AA 4U2RA 3LR1A 2H5YA 3IOTA 3UK4A 1N04A 1TFAA 4XKNA 3RGYA 3K2DA 3PPOA 1S7YA 3PUYE 3SEXA 5CMBA 1SVXB 1ZJLA 5I56B 1AMFA 2DE2A 3N5LA 3RT6B 3OO9A 3OO8A 5I2NB 3N6UA 4KR5A 3L6HA 4FORA 2O7UA 1D9VA 3H6UA 3V83A 5L9OA 4PFWA 1B1HA 4H65A 4H5GA 2Z22A 1Z7NE 5JTYB 5KCJB 4RY1A 2RCAA 3VV5A 4IGTA 3HCQA 1CE2A 2XXTA 1M5EA 4HW8A 3IB0A 1MXVA 4JWXA 1ZMGA 3MZBA 2UVJA 2NWJA 2ZYOA 4AB6A 1P99A 4IY6A 4OFOA 3BFTA 3OEKA 4WEPA 4F18A 5AA2A 4R2BA 4IO5A 3PD8A 2PX1A 3IB1A 1QKAA 2P0SA 4LA9A 1B3GA 2CZLA 4RPOA 3MP6A 3T9UA 3Q29A 3CFZA 4QFNA 3IO6A 4LATA 5F7VA 1D3KA 4P11A 4YB6A 1YPNA 1OLCA 5ITPA 3QXMA 1ELJA 3IOUA 3FVNA 3PPNA 3E13X 3N94A 3KBRA 1A7LA 1R1NA 4MH5A 1B9JA 5FHOA 1URGA 1SW2A 2VOZA 3K0VA 2ZXTA 1AL3A 3H4ZA 1MH4A 2Y7PA 1PBQA 3ECRA 3MJNA 1FQDA 3PMXA 4Q30B 2HFBA 1MDQA 5CBSA 4YMBA 2NOOA 2DWIA 5H8NB 3IK6B 4OQOA 2UYEA 5CM6A 3B6TA 2Y7KA 4TLMB 3TUSA 1OQGA 1O63A 3TDJA 2XX8A 1IXHA 2THIA 3MVXA 3S4UA 4JXIA 4ELRA 5JEIA 5ICQA 4PE5B 5I2KA 4IO3A 3MW0A 1I6QA 4POWA 4AQ4A 3MAMA 4ZEFA 1A40A 2GFEA 2XXIA 2O51A 4R72A 2RF1A 1P1WA 2BJJX 2V25A 4M1VA 3QAXA 3OO6A 3U8QA 3K6XA 4GL8A 3K1MA 2ZYNA 5FHNA 1S50A 2REJA 3FGSA 1NNFA 1UIVA 3G3HA 3LSFB 5ICTA 3KSXA 4P0GA 5I58A 1EU8A 3RQTA 3TAJA 4G68A 1B3LA 3IOWA 3KZGA 1N3WA 4ELQA 3ZKKA 4Q5TA 3USDA 4FAJA 3TQLA 5L9SA 3MC2A 4R6KA 4LZ5A 2ONKE 1OMPA 4U4XA 5H8SA 4EDPA 4IY5A 3D4GA 1SD3A 3TTRA 1WDNA 1NKXA 2O1LA 1QVSA 2F7AA 4OFJA 1B32A 1LLSA 3PPPA 4F39A 1JVXA 4NF5A 3VDFA 3TPAA 1US4A 4GOTA 3G3KA 3IX1A 1B7UA 1JEVA 4F1YA 1Y4TA 2W7YA 3O6GA 5I57A 3FUZA 1SI1A 1BTJA 1SBPA 2CMOA 1VSOA 3RNNA 4O3CA 3O29A 1LB8A 2F7CA 4YKPA 3R26A 1IIWA 4F3GA 3V5AA 3UORA 2ANJA 4IGRA 1LFIA 5IAIA 1UTBB 1B05A 4BLAA 1B5IA 4JB7A 4H8JA 4ELOA 3SEUA 3ZSFA 3A3UA 1CB6A 4NF5B 4JSDA 3OMBA 5AE4A 2VD2A 1OVTA 4H5FA 5CMCA 1QJMA 3K00A 2E0SA 4XKQA 2H99A 3TODA 5I57B 1MQIA 2OJTA 4BDMA 4OXVA 5IKBA 1P1OA 2O69A 1LAXA 4RJZA 2G29A 4F2QA 5H8FB 1POY1 4ZEIA 4R9FA 3S2VA 1DMBA 4ZEDA 5K2XA 2FNCA 3HHFA 3CG1A 4LQ2A 3V8XB 2F7BA 4POXA 4MLVA 1LSTA 4Z0IA 5EYFA 4BDNA 3KJTA 3VLUA 2XXWA 1H3DA 3LUYA 4GLIA 2Y7IA 5TPAA 1IXGA 1SYHA 4LZ7A 2ALUA 2V3QA 1MRPA 4RYAA 1Y1MA 4I8CA 3M3FA 1B7ZA 3I5OA 3EPEA 2IA4A 2XXQA 4ZEBA 3CI8A 4QSCA 1B6HA 3EHUA 1Q35A 4RK9A 4UA8A 1QW0A 2WKYA 1XOCA 1N76A 1B3HA 5AA1A 4AB5A 3MP1A 4OVJA 5KDTB 3ZKLA 4BDQA 4HCYA 3RTFB 2ZNUA 4KI0E 1LFGA 1Z7ME 1MQJA 2A5TB 3K02A 1MXYA 3RTWB 4OERA 2I48A 4OETA 3LSXA 4THIA 4H6DA 4OFLA 1URDA 2Z8FA 4BDRA 3QK6A 3FATA 2DVCA 4RNSA 3IAZA 5I56A 1B4HA 2XX9A 1SI0A 3U1OA 1LCTA 1PB8A 3I3VA 1SYIA 4U22A 4PQJA 1IQ7A 1FTOA 1EZPA 5I2NA 1FTKA 2V3TA 1YCJA 4ND9A 2QSXA 2Y84A 1USYH 3MVZA 2X7PA 3QSLA 3FVKA 4HS7A 4NEDA 1N84A 5JTYA 5KCJA 3N6TA 4G68C 3E9XA 2FA7A 4JSOA 1DPPA 4EF2A 4QRZA 3MZ1A 1B5HA 1MY2A 3MVYA 3MP8A 3T9HB 5F1QA 2G93A 4H1XA 4NWDA 1J1NA 4G8NA 3CSBA 3T66A 1MY1A 2NUVA 4JDFA 5EHMA 1HSJA 1SW5A 3GLBA 3IO4A 1ZKBA 1B0HA 3GZGA 1N7WA 4JBZA 4KFQA 1MXZA 1NFTA 1NH7A 1RYOA 1A54A 1EZOA 3TTMA 2OBGA 2OK2A 3IB2A 5DTBA 3A09A 5I59A 5L8DA 3MVWA 3RPWA 4KHZE 1LGBC 4N07A 2VGQA 2AL5A 1B5JA 4ECFA 4OYVA 2O7IA 3H7MA 5HM4B 3KN8A 4EXLA 3SETA 1LFHA 1MXWA 3C35A 3FV1A 3KOSA 2F78A 2OZZA 5H8NA 2R6GE 5CC2A 3FJGA 1POTA 5DYHA 4IO4A 4TLLB 2I6EA 3TYHA 4MLQA 4DXCA 2QMWA 1JW5A 4PFTA 2QJEA 4K3FA 5JK4A 4EQBA 2H4IA 3OD7A 4KYSA 5I59B 5HBCA 2DXRA 2HQ0A 3U93A 3KN3A 4F2OA 4KYEA 4EUOA 2VD3A 1H76A 4QSEA 1GVCA 3K6WA 2OWSA 2ESNA 1DTZA 3FJ7A 3QUFA 3QYTA 1Y3NA 4ONYA 1YTVA 3N26A 2XXVA 5DVJA 2F34A 1GR2A 2F6PA 3MQ9A 4R2FA 2PMSA 3PPRA 5A5XB 2RCBA 2R71A 3SERA 4GD5A 2VHAA 5I84A 2I58A 3LBSA 1IXIA 4O3AA 2XHDA 2DXYA 3G3JA 3B6QA 1DOTA 4NF4B 3G7WA 3WAFA 4F1UA 4E0WA 4TQUQ 4L17A 2XD3A 4RXLA 3EN3A 4KD5A 2XXHA 1M5FA 5HPQA 3GBAA 3PUVE 1MY3A 2YJPA 4F1VA 4GFRA 3HHGA 2HXWA 1MPCA 3FZVA 2GHBA 4DDDA 2I49A 1EH3A 2B3BA 4YKIA 1WVJA 3SEVA 3VVFA 2O84X 1KWHA 2QS4A 3H03A 1P1NA 3C4MA 4YMAA 3C9HA 1ZLQA 5LOMA 3B6WA 4C1TA 1SW4A 1Y20A 5CMKA 4F3BA 1NH8A 4KCCA 4OHNA 1UTBA 2V84A 2Q89A 3VE1B 2PBWA 3ZS6A 2UVGA 1D4NA 3RUMA 4ZDMA 4MBPA 3H3GA 4HTGA 1N7XA 3KG2A 2P2AA 2QS2A 3KJ7A 1Y9UA 5B70A 1TXFA 4IO7A 2AIXA 4NF8B 5B7DA 3PUZE 4OMBA 3R7XA 1YAEA 5AA4B 1FQEA 2Q88A 4G8HA 1BP5A 3E4RA 5H8FA 2DOJA 5ITOA 1I6BA 3PD9A 1ZIUA 3CG3A 2HCAA 5EHSA 1MS7A 3K6UA 1GV8A 4NMYA 1P1UA 3THIA 3FXQA 4QFPA 4FJPA 3K01A 1AH5A 2UVHA 4FATA 4FEBA 4Q8RA 2UYFA 4R6YA 5TP9B 3TFLA 2QRYA 1P1QA 4YKJA 1GGGA 2FYIA 3M8UA 4KCDA 1JW1A 2AYSA 4ISUA 2F5XA 1O7TA 2DS9A 3ILUB 3LC8A 2F97A 1SW1A 4G2ZA 5H8HB 4QFOA 3K6VA 3SESA 2H9BA 1JQFA 3MBPA 3BKIB 5ISUA 4GIZA 4NF6B 4QFLA 1RYXA 3JV9A 3TCGA 3S9LC 4JWYA 4GL0A 1IXCA 5DEXB 4OEUA 1MY0A 1LAFE 1MY4A 3VLWA 1S9TA 4F3SA 2PYYA 1OIBA 1Y1ZA 3G3GA 5KDTA 4EQ7A 4YICA 2F6GA 3JYRA 3RLFE
chains in the Genus database with same CATH superfamily
1PC3A 3DP4A 4OTEA 1MXXA 3HN0A 4WKMA 2XWVA 4AS5A 2A5TA 1FTMA 3P7IA 3FVGA 2QL3A 1A99A 1A8FA 2DP8A 3ODBA 2M8CA 1LB9A 3GXAA 2HXRA 2I3VA 2ONSA 3OXNA 4LVQA 4OESA 1ANFA 1ZTYA 1FBHA 4ZECA 4XFEA 5DVIA 3O6HA 2QMXA 3CRBA 3HSTA 3CFLA 4YZZA 5H8QB 1SDXA 1FPLA 1MM6A 5M2VA 3R6UA 5FTHA 2WBDA 3OO7A 2HZKA 1QUIA 4H8IA 1OVBA 4O7IA 1R9LA 1NV6A 5IZ3B 1Y3QA 2D21A 4WEDA 1FQBA 4DI3D 1NUWA 1AWBA 5A5LA 3O28A 4U4SA 1KZ8A 2XXRA 4O94A 3CR9A 4ESXA 2XXPA 4LQ5A 3LUZA 2XWIA 1IMFA 3PMVA 1T0KA 4GF8A 4X1BA 1UTHB 2QS3A 4DLDA 1TFDA 2E1SA 3C36A 4U1ZA 5F24A 1PEBA 3EF7A 4OZ9A 4BDLA 3TKDA 4GWYA 3SEYA 4NTLA 5ELVA 1HSLA 1ZBMA 2AL4A 3DLNA 3FASA 2R9JA 2BJIA 4FIMA 1B3EA 1B0LA 5CMMA 1MH3A 4XKRA 4FE8A 4YB7A 2D3IA 2Q9TA 1Q1KA 1LAGE 1FQAA 2XD2A 5J1DA 3VVDA 4JVCA 4GVOA 1N3XA 3F11A 1IUDA 4P9KA 2ZYMA 3TZAA 3C34A 2KLFA 1ATGA 4MFIA 4Q0CA 1A55A 1JW4A 3FD3A 2REGA 4O7MA 3DELB 3O2AA 4UACA 1QKBA 1FJ9A 1SPIA 3TTLA 1IITA 2DYXA 2P1SA 4G8MA 4M4GA 1EZ9A 1B4ZA 4HCWA 1DSNA 3LV0A 3U94A 1GTKA 1N0TA 3RY3A 4GWSA 4OVRA 1FBEA 1MQDA 3T0JA 1XC1A 2OLBA 1IZ1A 2F35A 2DE3A 4F3PA 2Z23A 2F36A 2ZNTA 4PAFA 2NVUB 1B51A 1LBCA 1NNPA 3ILTB 5BUUA 5EQ7A 2DDKA 2I3WA 4X9TA 1USYE 2I0CA 3MPKA 2RINA 1JETA 1JP4A 4XKPA 3SEWA 4QFKA 4LP2B 4F22A 3EQ1A 2O1MA 3FXBA 3TELA 3ONMA 4ELPA 1VR5A 3C32A 5FTIA 2UXAA 5TU0A 1INPA 1H45A 4JVIA 2ZNSA 1R6ZA 2PT2A 1FPGA 4NHBA 4XF5A 3D4CA 4I1DA 3U92A 4R75A 4X1DA 4NE4A 4RK2A 1MQHA 4I62A 1JVYA 3CVGA 2Q2CA 5A5XA 1FQCA 1B7HA 2DE4A 2FIEA 2I4BA 3JZJA 4N15A 2F8DA 4BDOA 1BLFA 3KSJA 3TEPA 3OENA 1VFDA 3VXCA 4LONB 3OOAA 2HAUA 3A3CA 3PPQA 3S9NC 4QHQA 3FXRA 1AOVA 1B58A 2PCRA 2YPNA 4NF4A 2XXYA 4GRKA 3MSTA 4ZZEA 3MUQA 3C31A 3PUXE 4DZ1A 5IGAA 3BBRA 1IEJA 3FV2A 3L6GA 4O8MA 1XVXA 1URSA 2X26A 2YLNA 2PVUA 2DWAA 2CZIA 4GXAA 3O97A 4R73A 1II5A 5ET5A 3FJMA 1VFEA 2RC7A 3Q26A 1CNQA 4U23A 4EXKA 3MWBA 1FPKA 1QULA 1RDZA 4MF3A 3Q27A 1FRPA 1OQHA 4P0IA 1Y4CA 4ZEKA 5AA2B 2XXUA 4KQPA 3V89B 3KFMA 3RN8A 4H67A 2B3FA 4OEVA 3O9PA 2HAVA 2HHMA 3LSLA 4QBAA 3I6VA 1MXUA 4U1OA 3PGFA 4GXSB 1PDAA 1L5TA 4RA1A 3T1BA 2RC9A 4NWCA 2O6AA 4IB2A 3OEMA 1D9QA 2D5WA 4F19A 3T93B 5K2YA 5DVFA 4N6PA 2H25A 3EHTA 2Z8EA 3KGCA 5EQ9A 3B50A 3VVEA 3UGWA 3MPLA 4OVPA 3T96B 3BIHA 4R6HA 1NNKA 2DSFA 2OWTA 1XHYA 4ZS9A 3O6IA 1FTLA 4RPNA 4R9GA 2DVZA 3RT8A 1BIYA 4H46A 2LAOA 4NF8A 3TQWA 3SDFA 4Z7EA 4DXUA 5CRYA 1DTGA 5AA4A 4F29A 5KZTA 4GQOA 4IO6A 2XXXA 3B7DA 2Y7RA 1VDWA 1XT8A 2DWJA 4QF9A 1EYIA 2ZMBA 4H0WA 3VLVA 5CBRA 1A8EA 1RKMA 3H06B 3K1NA 1NV0A 2OX3A 4HE1A 3U72A 5I2KB 3LSWA 4G77A 3H6TA 2WX9A 5EYGA 3PMWA 5TP9A 5FBPA 4ZE8A 4DXBA 1IMCA 3IL1B 1TT1A 4JWOA 1LAHE 4F31B 1I69A 4WXJA 3D1RA 4KYDA 1JNFA 3TTNA 1MPBA 3PU5A 3SKPA 3DP6A 1B2HA 4MIJA 5H8HA 4DCYA 1B3FA 1UQWA 2XA5A 3U65A 2RKMA 1NUZA 3HV1A 2HZLA 1Y3PA 1FCKA 3H6VA 3OSQA 1HSEA 4ZZAA 1PB7A 4NF6A 4GWOA 4PFRA 2RC8A 3FIRA 3WAEA 1AIVA 3PUWE 2QVVA 3CSGA 3PTYA 1LEVA 1QUKA 1I6AA 5DEXA 4P56A 5I58B 4XXUA 1FW0A 3G3FA 3ISPA 4G68B 1O64A 3UP9A 3CIJA 4DE8A 4XIGQ 2O68A 2QPQA 4PE3A 3TMGA 3VFJA 1MPDA 1SQYA 3K4UA 4EF1A 3G3IA 3MZ9A 1XVYA 3RPLB 1OLAA 5AA2D 3Q28A 1BK4A 1XI6A 3IOVA 3IR1A 3KEIA 4YB5A 3UA8A 3BFUA 4N91A 4LZ8A 3T22A 3K1PA 5FHMA 3EHSA 5ET8A 2XWOA 3HPIA 5DT6A 4PFYA 4TOZA 4YU0A 1FPIA 1NL5A 3FXUA 2DQVA 2I0BA 3GBBA 1MDP1 3S9EA 4HE2A 4XTCQ 1LBZA 2Z8DA 4R74A 2Y5LA 1DPEA 1FQFA 3TCHA 3W9WA 5H8QA 1YZ0A 1FTJA 1M5CA 5BWJA 1H44A 1JEUA 1WODA 4O3BA 3M3KA 4P8BA 3T9VA 3T9XB 4NGUA 4YAHX 1NNTA 2XX7A 2OCUA 4MNPA 4I3YA 5IZ3A 4QSDA 2XWKA 4PP0A 3C33A 4YKKA 4PETA 2B65A 1M5DA 1B52A 1LBBA 1US5A 3UN6A 3O66A 3QIMA 3H6WA 2V3UA 4FECA 2WYPA 1BKAA 2A5SA 1UTHA 3QUJA 2GH9A 2X7QA 2H98A 2QFLA 2NXOA 4PBQA 1UIUA 4DCXA 1D9YA 2ZZXA 2PT1A 4MEVA 3IJOB 4FEDA 4PF6A 2GHAA 5T3JA 3FVOA 3DM0A 4PFUA 1YYZA 3S9MC 4LUBA 2Y7WA 4DIGA 4PCDA 1QUJA 2CZHA 4QXDA 5CI5A 3W9VA 1LCFA 3TCFA 1MG1A 3CFXA 4U21A 3AXFA 1F9BA 2ZYKA 3KN7A 3IFCA 4G4PA 2CEYA 3W15C 3UIFA 3M3LA 1PB9A 1FPBA 1EYJA 2GRVA 4IO2A 3VXBA 5TPAB 3E3KA 4C1UA 4KXPA 2Y5KA 1DCUA 3MYUA 1MM7A 4OVSA 3Q25A 4OENA 4C0RA 1B1XA 1FPFA 1B46A 1FTAA 2QS1A 3OSRA 1B40A 1YXIA 2I4CA 4LN5A 2HEUA 2UVIA 4ZE9A 4GX3A 4E0XA 1R9QA 4MCOA 1NMUA 2V93A 4N13A 4EQ9A 1TWYA 4ESWA 2DWHA 2CEXA 4X48A 3KOTA 4OWDA 2IEEA 3PV0E 4I9DA 3IORA 4KPTA 3TTKA 2VP1A 1NV7A 3DP8A 1M5BA 2Q8JA 2ONRA 1QGXA 3HO7A 5L9MA 1PBPA 3E79A 5AA3A 3OELA 1MQGA 3KC1A 1XS5A 1ZU0A 1H43A 3IJXB 1VE4A 2ABHA 2Q2AA 4U2RA 3LR1A 2H5YA 3BIGA 3IOTA 3UK4A 1N04A 1TFAA 4XKNA 4XEQA 3K2DA 3PPOA 3RGYA 1S7YA 2MKZA 3PUYE 3SEXA 5CMBA 1SVXB 1ZJLA 3CHGA 1NUXA 5I56B 2WYKA 1AMFA 2QVRA 2DE2A 2PFZA 2ZZVA 1DBZA 4NQ8A 3N5LA 5ET7A 3RT6B 3OO9A 3OO8A 5I2NB 1RDYA 3N6UA 4KR5A 3L6HA 4FORA 2O7UA 1D9VA 3H6UA 3V83A 5L9OA 4PFWA 1B1HA 4H65A 4H5GA 2Z22A 1Z7NE 5JTYB 5KCJB 4RY1A 4OANA 2RCAA 3VV5A 4IGTA 3HCQA 4MAGA 1CE2A 2XXTA 1M5EA 4HW8A 3IB0A 5EQAA 1MXVA 1KA0A 4JWXA 1ZMGA 3MZBA 2F3DA 2UVJA 3GYYA 2NWJA 2ZYOA 2JJKA 4AB6A 1P99A 4IY6A 4OFOA 3BFTA 1IMEA 2V4CA 3OEKA 4WEPA 4F18A 5AA2A 4R2BA 4IO5A 3PD8A 2PX1A 3IB1A 1QKAA 2P0SA 4LA9A 1B3GA 2CZLA 4RPOA 4P1LA 3MP6A 3T9UA 3Q29A 3CFZA 4QFNA 3IO6A 4LATA 5F7VA 1D3KA 4P11A 4YB6A 1YPNA 2WEFA 1OLCA 5ITPA 2L5VA 3QXMA 2KR0A 1ELJA 3IOUA 3FVNA 3PPNA 3E13X 3N94A 3KBRA 1A7LA 1R1NA 4MH5A 1B9JA 5FHOA 1URGA 1SW2A 2VOZA 3K0VA 2ZXTA 1AL3A 3H4ZA 1MH4A 1IMDA 2Y7PA 1PBQA 3ECRA 3MJNA 5I3SA 3A29A 1FQDA 3PMXA 4Q30B 2HFBA 1MDQA 5CBSA 4YMBA 2NOOA 2DWIA 5H8NB 4FBPA 3IK6B 4OQOA 2UYEA 5CM6A 3B6TA 2Y7KA 4TLMB 3TUSA 4AS4A 1OQGA 1O63A 3TDJA 2XX8A 1IXHA 2THIA 3MVXA 3S4UA 4OVQA 5IM2A 4JXIA 1DK4A 4ELRA 5JEIA 1LBVA 5ICQA 4PE5B 5I2KA 4IO3A 3MW0A 1I6QA 4POWA 4AQ4A 3MAMA 4ZEFA 1A40A 2GFEA 4X04A 2XXIA 2O51A 4R72A 2RF1A 4N8GA 1P1WA 2BJJX 2V25A 4M1VA 3QAXA 3OO6A 3U8QA 3K6XA 4GL8A 3K1MA 1KA1A 2ZYNA 5FHNA 1S50A 2REJA 4NF0A 3FGSA 1NNFA 1UIVA 3G3HA 1NV4A 4P3LA 3LSFB 5ICTA 4GBVA 3KSXA 4P0GA 5I58A 1EU8A 3RQTA 3TAJA 4G68A 4IR8A 1B3LA 3IOWA 3KZGA 1N3WA 4ELQA 3ZKKA 4Q5TA 3USDA 4FAJA 3TQLA 5L9SA 1G0HA 3MC2A 4R6KA 4LZ5A 2ONKE 3RPLA 1OMPA 4U4XA 5H8SA 4EDPA 4IY5A 3D4GA 2ZZWA 4UABA 1SD3A 1NUYA 3TTRA 1WDNA 1NKXA 2VT5A 4MHFA 2O1LA 1QVSA 2F7AA 4OFJA 1B32A 1LLSA 3PPPA 4F39A 1JVXA 4NF5A 3VDFA 3TPAA 1US4A 4GOTA 3G3KA 3IX1A 1B7UA 2VPNA 1JEVA 4F1YA 1Y4TA 2W7YA 3O6GA 5I57A 3FUZA 1SI1A 1BTJA 1SBPA 2CMOA 1VSOA 3RNNA 4O3CA 3O29A 4PF8A 1FBPA 1LB8A 2F7CA 4YKPA 3R26A 4PDHA 1IIWA 4F3GA 3V5AA 3UORA 2ANJA 4IGRA 1LFIA 2KQZA 5IAIA 1K9YA 1UTBB 2P3NA 1B05A 4BLAA 1B5IA 1LBXA 4JB7A 4H8JA 4ELOA 3SEUA 1IMBA 3ZSFA 5DW8A 3A3UA 1CB6A 4NF5B 4JSDA 3OMBA 5AE4A 2VD2A 1OVTA 1FJ6A 4H5FA 5CMCA 1QJMA 4PDDA 3K00A 2E0SA 4XKQA 2H99A 3TODA 5I57B 1FPEA 1MQIA 2OJTA 4BDMA 4OXVA 5IKBA 1P1OA 1FPDA 2O69A 1LAXA 4RJZA 2G29A 4F2QA 5LTCA 5H8FB 3E78A 1POY1 4ZEIA 4R9FA 4GX4A 2FHYA 3S2VA 1DMBA 4P1EA 4MMPA 4ZEDA 5K2XA 1LBYA 2FNCA 3HHFA 3CG1A 4LQ2A 3V8XB 2F7BA 4POXA 4MLVA 1LSTA 4Z0IA 5EYFA 4BDNA 3KJTA 3VLUA 2XXWA 4HXVA 1H3DA 1NI9A 3LUYA 4OVTA 4GLIA 2Y7IA 5TPAA 1IXGA 1SYHA 4LZ7A 2ALUA 2V3QA 1MRPA 4RYAA 4GX6A 1Y1MA 4I8CA 3M3FA 1B7ZA 3I5OA 3EPEA 4PBHA 2IA4A 2XXQA 4ZEBA 3CI8A 1K9ZA 4QSCA 1B6HA 2FIXA 2CZKA 3EHUA 1Q35A 4RK9A 3SZPA 4UA8A 1QW0A 2WKYA 1XOCA 1N76A 1B3HA 4MJOA 3QMFA 5AA1A 4AB5A 1FSAA 3MP1A 3KC0A 4OVJA 5KDTB 1EYKA 3ZKLA 4BDQA 3NOHA 4HCYA 3RTFB 2QVUA 2ZNUA 4PGPA 4KI0E 1LFGA 1Z7ME 1MQJA 2A5TB 3K02A 1MXYA 3RTWB 5I7IA 4OERA 2I48A 5LDZA 4OETA 3LSXA 4THIA 3FBPA 4H6DA 4OFLA 1URDA 2OWZA 2Z8FA 4BDRA 3QK6A 2Q8MA 3FATA 2DVCA 4JVDA 4RNSA 3IAZA 5I56A 1B4HA 2XX9A 1SI0A 3U1OA 1LCTA 1PB8A 3I3VA 1SYIA 4U22A 4G61A 3KBZA 4PQJA 2FVZA 1IQ7A 1FTOA 1EZPA 5I2NA 4PFBA 1FTKA 2V3TA 4PAIA 1YCJA 4ND9A 2QSXA 2Y84A 4MX6A 5J16A 1USYH 4PAKA 3MVZA 2X7PA 3QSLA 3FVKA 4HS7A 4NEDA 1N84A 5JTYA 5KCJA 3N6TA 4G68C 3E9XA 4GWWA 2FA7A 4JSOA 1DPPA 4EF2A 4OA4A 2R8TA 3ROJA 4QRZA 3MZ1A 1B5HA 4PC9A 1MY2A 3MVYA 3MP8A 3T9HB 3IFAA 5F1QA 2G93A 4H1XA 4NWDA 1J1NA 4G8NA 4GWZA 3CSBA 4GWXA 3T66A 1MY1A 2NUVA 4JDFA 5EHMA 1HSJA 1SW5A 4PGNA 3GLBA 3IO4A 4MNIA 1ZKBA 1B0HA 2XXKA 3GZGA 1N7WA 4JBZA 4KFQA 1MXZA 1NFTA 2Q74A 1NH7A 1RYOA 1A54A 4PTKA 1EZOA 3TTMA 2OBGA 2OK2A 3IB2A 5DTBA 3A09A 5I59A 5L8DA 3MVWA 3RPWA 4KHZE 1RDXA 1LGBC 4N4UA 4N07A 2VGQA 2AL5A 1B5JA 4ECFA 4OYVA 2O7IA 3H7MA 5HM4B 4NG7A 3KN8A 4EXLA 4N6DA 3SETA 1LFHA 1MXWA 3C35A 3FV1A 3KOSA 2F78A 3EKIA 2OZZA 5H8NA 2R6GE 5CC2A 3FJGA 1POTA 5DYHA 4IO4A 4TLLB 2I6EA 3TYHA 4MLQA 4DXCA 2QMWA 1JW5A 4PFTA 2QJEA 5I5PA 2PFYA 4K3FA 5IZ1A 5JK4A 4EQBA 2H4IA 3OD7A 4KYSA 5I59B 5HBCA 1NV2A 2DXRA 2HQ0A 3U93A 3KN3A 4HE0A 4F2OA 4KYEA 4EUOA 4N6KA 2VD3A 1H76A 4QSEA 1GVCA 3K6WA 2OWSA 2ESNA 1DTZA 3FJ7A 3HFUA 3QUFA 3QYTA 1Y3NA 4ONYA 5ET6A 1YTVA 3N26A 2XXVA 5DVJA 2F34A 1GR2A 2F6PA 2B4LA 3MQ9A 4R2FA 2PMSA 3PPRA 5A5XB 2RCBA 2R71A 3SERA 4GD5A 4MNCA 2VHAA 5I84A 2HPGA 2I58A 3LBSA 1IXIA 4O3AA 2XHDA 2DXYA 3G3JA 1LBWA 3B6QA 4N17A 1DOTA 4NF4B 3G7WA 3WAFA 4F1UA 4E0WA 4TQUQ 4L17A 2XD3A 4RXLA 3EN3A 4N8YA 4KD5A 2XXHA 1M5FA 5HPQA 3GBAA 3PUVE 1MY3A 2YJPA 4H45A 4F1VA 4GFRA 3HHGA 2HXWA 1MPCA 3FZVA 2GHBA 4DDDA 2I49A 2B4MA 1NV3A 1EH3A 5IZZA 2B3BA 4YKIA 1WVJA 3SEVA 3VVFA 4P47A 2O84X 1KWHA 2QS4A 2FBPA 3H03A 1P1NA 3C4MA 4YMAA 1FBDA 3C9HA 1ZLQA 5LOMA 3B6WA 4C1TA 1SW4A 1Y20A 2F3BA 5CMKA 4X8RA 4F3BA 1NH8A 4KCCA 4OHNA 1UTBA 2V84A 2Q89A 1Q9DA 1NV1A 3VE1B 2PBWA 3ZS6A 2UVGA 1D4NA 3RUMA 4ZDMA 4MBPA 3H3GA 4HTGA 1N7XA 4N81A 3KG2A 2P2AA 2QS2A 3KJ7A 1FBGA 1Y9UA 5EQ8A 5B70A 2P3VA 1TXFA 4IO7A 2AIXA 4NF8B 5EYHA 5B7DA 3PUZE 4OMBA 4GWUA 3R7XA 1YAEA 5AA4B 1FQEA 2Q88A 4GBWA 4G8HA 1BP5A 3E4RA 5H8FA 2DOJA 5ESYA 5ITOA 1I6BA 3PD9A 4I3EA 1ZIUA 2GQ1A 3CG3A 2WBBA 1IMAA 2HCAA 5EHSA 1MS7A 3K6UA 1GV8A 4NMYA 1P1UA 3RYDA 3THIA 3FXQA 4QFPA 4FJPA 3B8BA 4NX1A 3K01A 4NAPA 1AH5A 2UVHA 4I40A 4FATA 4FEBA 4Q8RA 2UYFA 4R6YA 5TP9B 4DI4B 3TFLA 2QRYA 1P1QA 4YKJA 1GGGA 2FYIA 3M8UA 4KCDA 1JW1A 2AYSA 4ISUA 2F5XA 1O7TA 2DS9A 3ILUB 3LC8A 1FBFA 2F97A 1SW1A 4G2ZA 5H8HB 4QFOA 3K6VA 3SESA 2H9BA 1JQFA 3MBPA 3BKIB 5ISUA 4GIZA 1FPJA 4NF6B 4QFLA 1RYXA 1NV5A 3JV9A 3TCGA 3S9LC 4JWYA 4GL0A 1IXCA 5DEXB 4OEUA 1MY0A 1LAFE 1MY4A 3VLWA 1S9TA 4F3SA 2PYYA 1OIBA 1Y1ZA 4PFIA 3G3GA 4NN3A 2VPOA 1G0IA 5KDTA 1FBCA 4EQ7A 4YICA 2F6GA 3JYRA 3RLFE
chains in the Genus database with same CATH topology
1PC3A 3DP4A 4OTEA 1MXXA 3HN0A 4WKMA 2A5TA 1FTMA 3P7IA 3FVGA 2QL3A 1A99A 1A8FA 2DP8A 3ODBA 2M8CA 1LB9A 3GXAA 2I3VA 2ONSA 3OXNA 4LVQA 4OESA 1ANFA 1ZTYA 4ZECA 5DVIA 3O6HA 2QMXA 3CRBA 3HSTA 3CFLA 4YZZA 5H8QB 1SDXA 1MM6A 5M2VA 3R6UA 5FTHA 3OO7A 2HZKA 1QUIA 4H8IA 1OVBA 1R9LA 1Y3QA 2D21A 4WEDA 1FQBA 3O28A 4U4SA 2XXRA 3CR9A 4ESXA 2XXPA 4LQ5A 3PMVA 1T0KA 4GF8A 4X1BA 1UTHB 2QS3A 4DLDA 1TFDA 2E1SA 3C36A 4U1ZA 1PEBA 3EF7A 4OZ9A 4BDLA 3TKDA 3SEYA 4NTLA 5ELVA 1HSLA 1ZBMA 2AL4A 3DLNA 3FASA 2R9JA 4FIMA 1B3EA 1B0LA 5CMMA 1MH3A 4XKRA 4FE8A 4YB7A 2D3IA 2Q9TA 1Q1KA 1LAGE 1FQAA 2XD2A 5J1DA 3VVDA 4GVOA 1N3XA 3F11A 1IUDA 2ZYMA 3TZAA 3C34A 2KLFA 1ATGA 4MFIA 4Q0CA 1A55A 1JW4A 3FD3A 2REGA 3DELB 3O2AA 4UACA 1QKBA 3TTLA 1IITA 2DYXA 2P1SA 4G8MA 4M4GA 1EZ9A 1B4ZA 4HCWA 1DSNA 3U94A 1GTKA 1N0TA 3RY3A 1MQDA 1XC1A 2OLBA 1IZ1A 2F35A 2DE3A 4F3PA 2Z23A 2F36A 2ZNTA 2NVUB 1B51A 1LBCA 1NNPA 3ILTB 5BUUA 2I3WA 4X9TA 1USYE 2I0CA 3MPKA 2RINA 1JETA 4XKPA 3SEWA 4QFKA 4LP2B 4F22A 3EQ1A 2O1MA 3TELA 3ONMA 4ELPA 1VR5A 3C32A 5FTIA 2UXAA 5TU0A 1H45A 2ZNSA 1R6ZA 2PT2A 3D4CA 4I1DA 3U92A 4R75A 4X1DA 4NE4A 4RK2A 1MQHA 4I62A 1JVYA 3CVGA 2Q2CA 5A5XA 1FQCA 1B7HA 2DE4A 2I4BA 3JZJA 2F8DA 4BDOA 1BLFA 3KSJA 3TEPA 3OENA 1VFDA 3VXCA 4LONB 3OOAA 2HAUA 3A3CA 3PPQA 3S9NC 4QHQA 3FXRA 1AOVA 1B58A 2YPNA 4NF4A 2XXYA 4GRKA 4ZZEA 3MUQA 3C31A 3PUXE 4DZ1A 3BBRA 1IEJA 3FV2A 3L6GA 1XVXA 1URSA 2X26A 2YLNA 2PVUA 2DWAA 4GXAA 3O97A 4R73A 1II5A 3FJMA 1VFEA 2RC7A 3Q26A 4U23A 4EXKA 3MWBA 1QULA 4MF3A 3Q27A 1OQHA 4P0IA 1Y4CA 4ZEKA 5AA2B 2XXUA 4KQPA 3V89B 3KFMA 3RN8A 4H67A 2B3FA 4OEVA 3O9PA 2HAVA 3LSLA 3I6VA 1MXUA 4U1OA 3PGFA 4GXSB 1PDAA 1L5TA 4RA1A 2RC9A 4NWCA 2O6AA 4IB2A 3OEMA 2D5WA 4F19A 3T93B 5K2YA 5DVFA 4N6PA 2H25A 3EHTA 2Z8EA 3KGCA 3VVEA 3UGWA 3MPLA 3T96B 4R6HA 1NNKA 2DSFA 2OWTA 1XHYA 4ZS9A 3O6IA 1FTLA 4RPNA 4R9GA 2DVZA 3RT8A 1BIYA 2LAOA 4NF8A 3TQWA 3SDFA 4Z7EA 4DXUA 5CRYA 1DTGA 5AA4A 4F29A 5KZTA 4GQOA 4IO6A 2XXXA 3B7DA 2Y7RA 1XT8A 2DWJA 4QF9A 2ZMBA 4H0WA 3VLVA 5CBRA 1A8EA 1RKMA 3H06B 3K1NA 3U72A 5I2KB 3LSWA 4G77A 3H6TA 3PMWA 5TP9A 4ZE8A 4DXBA 3IL1B 1TT1A 4JWOA 1LAHE 4F31B 1I69A 4WXJA 4KYDA 1JNFA 3TTNA 1MPBA 3PU5A 3SKPA 3DP6A 1B2HA 5H8HA 4DCYA 1B3FA 1UQWA 2RKMA 3HV1A 2HZLA 1Y3PA 1FCKA 3H6VA 3OSQA 1HSEA 4ZZAA 1PB7A 4NF6A 4GWOA 2RC8A 3FIRA 3WAEA 1AIVA 3PUWE 3CSGA 1QUKA 1I6AA 5DEXA 5I58B 4XXUA 1FW0A 3G3FA 4G68B 1O64A 3UP9A 3CIJA 4DE8A 4XIGQ 2O68A 2QPQA 3TMGA 3VFJA 1MPDA 1SQYA 3K4UA 4EF1A 3G3IA 3MZ9A 1XVYA 1OLAA 5AA2D 3Q28A 3IOVA 3IR1A 3KEIA 4YB5A 3UA8A 3BFUA 4LZ8A 3T22A 3K1PA 5FHMA 3EHSA 3HPIA 5DT6A 4PFYA 4TOZA 4YU0A 1NL5A 3FXUA 2DQVA 2I0BA 3GBBA 1MDP1 3S9EA 4XTCQ 2Z8DA 4R74A 1DPEA 1FQFA 3TCHA 3W9WA 5H8QA 1FTJA 1M5CA 5BWJA 1H44A 1JEUA 1WODA 4O3BA 3M3KA 3T9VA 3T9XB 4YAHX 1NNTA 2XX7A 2OCUA 4QSDA 4PP0A 3C33A 4YKKA 4PETA 2B65A 1M5DA 1B52A 1LBBA 1US5A 3UN6A 3O66A 3QIMA 3H6WA 2V3UA 4FECA 1BKAA 2A5SA 1UTHA 3QUJA 2GH9A 2X7QA 2H98A 2NXOA 1UIUA 4DCXA 1D9YA 2PT1A 3IJOB 4FEDA 2GHAA 3FVOA 3DM0A 4PFUA 3S9MC 4LUBA 2Y7WA 4DIGA 1QUJA 5CI5A 3W9VA 1LCFA 3TCFA 1MG1A 3CFXA 4U21A 3AXFA 1F9BA 2ZYKA 3KN7A 4G4PA 3W15C 3UIFA 3M3LA 1PB9A 2GRVA 4IO2A 3VXBA 5TPAB 3E3KA 4C1UA 1MM7A 3Q25A 4OENA 4C0RA 1B1XA 1B46A 2QS1A 3OSRA 1B40A 2I4CA 2HEUA 2UVIA 4ZE9A 4E0XA 1R9QA 1NMUA 2V93A 4N13A 4EQ9A 1TWYA 4ESWA 2DWHA 4X48A 3KOTA 4OWDA 2IEEA 3PV0E 4I9DA 3IORA 4KPTA 3TTKA 2VP1A 3DP8A 1M5BA 2Q8JA 2ONRA 3HO7A 5L9MA 1PBPA 5AA3A 3OELA 1MQGA 1XS5A 1ZU0A 1H43A 3IJXB 1VE4A 2ABHA 2Q2AA 4U2RA 3LR1A 2H5YA 3IOTA 3UK4A 1N04A 1TFAA 4XKNA 3RGYA 3K2DA 3PPOA 1S7YA 3PUYE 3SEXA 5CMBA 1SVXB 1ZJLA 5I56B 1AMFA 2DE2A 3N5LA 3RT6B 3OO9A 3OO8A 5I2NB 3N6UA 4KR5A 3L6HA 4FORA 2O7UA 1D9VA 3H6UA 3V83A 5L9OA 4PFWA 1B1HA 4H65A 4H5GA 2Z22A 1Z7NE 5JTYB 5KCJB 4RY1A 2RCAA 3VV5A 4IGTA 3HCQA 1CE2A 2XXTA 1M5EA 4HW8A 3IB0A 1MXVA 4JWXA 1ZMGA 3MZBA 2UVJA 2NWJA 2ZYOA 4AB6A 1P99A 4IY6A 4OFOA 3BFTA 3OEKA 4WEPA 4F18A 5AA2A 4R2BA 4IO5A 3PD8A 2PX1A 3IB1A 1QKAA 2P0SA 4LA9A 1B3GA 2CZLA 4RPOA 3MP6A 3T9UA 3Q29A 3CFZA 4QFNA 3IO6A 4LATA 5F7VA 1D3KA 4P11A 4YB6A 1YPNA 1OLCA 5ITPA 3QXMA 1ELJA 3IOUA 3FVNA 3PPNA 3E13X 3N94A 3KBRA 1A7LA 1R1NA 4MH5A 1B9JA 5FHOA 1URGA 1SW2A 2VOZA 3K0VA 2ZXTA 1AL3A 3H4ZA 1MH4A 2Y7PA 1PBQA 3ECRA 3MJNA 1FQDA 3PMXA 4Q30B 2HFBA 1MDQA 5CBSA 4YMBA 2NOOA 2DWIA 5H8NB 3IK6B 4OQOA 2UYEA 5CM6A 3B6TA 2Y7KA 4TLMB 3TUSA 1OQGA 1O63A 3TDJA 2XX8A 1IXHA 2THIA 3MVXA 3S4UA 4JXIA 4ELRA 5JEIA 5ICQA 4PE5B 5I2KA 4IO3A 3MW0A 1I6QA 4POWA 4AQ4A 3MAMA 4ZEFA 1A40A 2GFEA 2XXIA 2O51A 4R72A 2RF1A 1P1WA 2BJJX 2V25A 4M1VA 3QAXA 3OO6A 3U8QA 3K6XA 4GL8A 3K1MA 2ZYNA 5FHNA 1S50A 2REJA 3FGSA 1NNFA 1UIVA 3G3HA 3LSFB 5ICTA 3KSXA 4P0GA 5I58A 1EU8A 3RQTA 3TAJA 4G68A 1B3LA 3IOWA 3KZGA 1N3WA 4ELQA 3ZKKA 4Q5TA 3USDA 4FAJA 3TQLA 5L9SA 3MC2A 4R6KA 4LZ5A 2ONKE 1OMPA 4U4XA 5H8SA 4EDPA 4IY5A 3D4GA 1SD3A 3TTRA 1WDNA 1NKXA 2O1LA 1QVSA 2F7AA 4OFJA 1B32A 1LLSA 3PPPA 4F39A 1JVXA 4NF5A 3VDFA 3TPAA 1US4A 4GOTA 3G3KA 3IX1A 1B7UA 1JEVA 4F1YA 1Y4TA 2W7YA 3O6GA 5I57A 3FUZA 1SI1A 1BTJA 1SBPA 2CMOA 1VSOA 3RNNA 4O3CA 3O29A 1LB8A 2F7CA 4YKPA 3R26A 1IIWA 4F3GA 3V5AA 3UORA 2ANJA 4IGRA 1LFIA 5IAIA 1UTBB 1B05A 4BLAA 1B5IA 4JB7A 4H8JA 4ELOA 3SEUA 3ZSFA 3A3UA 1CB6A 4NF5B 4JSDA 3OMBA 5AE4A 2VD2A 1OVTA 4H5FA 5CMCA 1QJMA 3K00A 2E0SA 4XKQA 2H99A 3TODA 5I57B 1MQIA 2OJTA 4BDMA 4OXVA 5IKBA 1P1OA 2O69A 1LAXA 4RJZA 2G29A 4F2QA 5H8FB 1POY1 4ZEIA 4R9FA 3S2VA 1DMBA 4ZEDA 5K2XA 2FNCA 3HHFA 3CG1A 4LQ2A 3V8XB 2F7BA 4POXA 4MLVA 1LSTA 4Z0IA 5EYFA 4BDNA 3KJTA 3VLUA 2XXWA 1H3DA 3LUYA 4GLIA 2Y7IA 5TPAA 1IXGA 1SYHA 4LZ7A 2ALUA 2V3QA 1MRPA 4RYAA 1Y1MA 4I8CA 3M3FA 1B7ZA 3I5OA 3EPEA 2IA4A 2XXQA 4ZEBA 3CI8A 4QSCA 1B6HA 3EHUA 1Q35A 4RK9A 4UA8A 1QW0A 2WKYA 1XOCA 1N76A 1B3HA 5AA1A 4AB5A 3MP1A 4OVJA 5KDTB 3ZKLA 4BDQA 4HCYA 3RTFB 2ZNUA 4KI0E 1LFGA 1Z7ME 1MQJA 2A5TB 3K02A 1MXYA 3RTWB 4OERA 2I48A 4OETA 3LSXA 4THIA 4H6DA 4OFLA 1URDA 2Z8FA 4BDRA 3QK6A 3FATA 2DVCA 4RNSA 3IAZA 5I56A 1B4HA 2XX9A 1SI0A 3U1OA 1LCTA 1PB8A 3I3VA 1SYIA 4U22A 4PQJA 1IQ7A 1FTOA 1EZPA 5I2NA 1FTKA 2V3TA 1YCJA 4ND9A 2QSXA 2Y84A 1USYH 3MVZA 2X7PA 3QSLA 3FVKA 4HS7A 4NEDA 1N84A 5JTYA 5KCJA 3N6TA 4G68C 3E9XA 2FA7A 4JSOA 1DPPA 4EF2A 4QRZA 3MZ1A 1B5HA 1MY2A 3MVYA 3MP8A 3T9HB 5F1QA 2G93A 4H1XA 4NWDA 1J1NA 4G8NA 3CSBA 3T66A 1MY1A 2NUVA 4JDFA 5EHMA 1HSJA 1SW5A 3GLBA 3IO4A 1ZKBA 1B0HA 3GZGA 1N7WA 4JBZA 4KFQA 1MXZA 1NFTA 1NH7A 1RYOA 1A54A 1EZOA 3TTMA 2OBGA 2OK2A 3IB2A 5DTBA 3A09A 5I59A 5L8DA 3MVWA 3RPWA 4KHZE 1LGBC 4N07A 2VGQA 2AL5A 1B5JA 4ECFA 4OYVA 2O7IA 3H7MA 5HM4B 3KN8A 4EXLA 3SETA 1LFHA 1MXWA 3C35A 3FV1A 3KOSA 2F78A 2OZZA 5H8NA 2R6GE 5CC2A 3FJGA 1POTA 5DYHA 4IO4A 4TLLB 2I6EA 3TYHA 4MLQA 4DXCA 2QMWA 1JW5A 4PFTA 2QJEA 4K3FA 5JK4A 4EQBA 2H4IA 3OD7A 4KYSA 5I59B 5HBCA 2DXRA 2HQ0A 3U93A 3KN3A 4F2OA 4KYEA 4EUOA 2VD3A 1H76A 4QSEA 1GVCA 3K6WA 2OWSA 2ESNA 1DTZA 3FJ7A 3QUFA 3QYTA 1Y3NA 4ONYA 1YTVA 3N26A 2XXVA 5DVJA 2F34A 1GR2A 2F6PA 3MQ9A 4R2FA 2PMSA 3PPRA 5A5XB 2RCBA 2R71A 3SERA 4GD5A 2VHAA 5I84A 2I58A 3LBSA 1IXIA 4O3AA 2XHDA 2DXYA 3G3JA 3B6QA 1DOTA 4NF4B 3G7WA 3WAFA 4F1UA 4E0WA 4TQUQ 4L17A 2XD3A 4RXLA 3EN3A 4KD5A 2XXHA 1M5FA 5HPQA 3GBAA 3PUVE 1MY3A 2YJPA 4F1VA 4GFRA 3HHGA 2HXWA 1MPCA 3FZVA 2GHBA 4DDDA 2I49A 1EH3A 2B3BA 4YKIA 1WVJA 3SEVA 3VVFA 2O84X 1KWHA 2QS4A 3H03A 1P1NA 3C4MA 4YMAA 3C9HA 1ZLQA 5LOMA 3B6WA 4C1TA 1SW4A 1Y20A 5CMKA 4F3BA 1NH8A 4KCCA 4OHNA 1UTBA 2V84A 2Q89A 3VE1B 2PBWA 3ZS6A 2UVGA 1D4NA 3RUMA 4ZDMA 4MBPA 3H3GA 4HTGA 1N7XA 3KG2A 2P2AA 2QS2A 3KJ7A 1Y9UA 5B70A 1TXFA 4IO7A 2AIXA 4NF8B 5B7DA 3PUZE 4OMBA 3R7XA 1YAEA 5AA4B 1FQEA 2Q88A 4G8HA 1BP5A 3E4RA 5H8FA 2DOJA 5ITOA 1I6BA 3PD9A 1ZIUA 3CG3A 2HCAA 5EHSA 1MS7A 3K6UA 1GV8A 4NMYA 1P1UA 3THIA 3FXQA 4QFPA 4FJPA 3K01A 1AH5A 2UVHA 4FATA 4FEBA 4Q8RA 2UYFA 4R6YA 5TP9B 3TFLA 2QRYA 1P1QA 4YKJA 1GGGA 2FYIA 3M8UA 4KCDA 1JW1A 2AYSA 4ISUA 2F5XA 1O7TA 2DS9A 3ILUB 3LC8A 2F97A 1SW1A 4G2ZA 5H8HB 4QFOA 3K6VA 3SESA 2H9BA 1JQFA 3MBPA 3BKIB 5ISUA 4GIZA 4NF6B 4QFLA 1RYXA 3JV9A 3TCGA 3S9LC 4JWYA 4GL0A 1IXCA 5DEXB 4OEUA 1MY0A 1LAFE 1MY4A 3VLWA 1S9TA 4F3SA 2PYYA 1OIBA 1Y1ZA 3G3GA 5KDTA 4EQ7A 4YICA 2F6GA 3JYRA 3RLFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PC3 A;  3DP4 A;  4OTE A;  1MXX A;  3HN0 A;  4WKM A;  2A5T A;  1FTM A;  3P7I A;  3FVG A;  2QL3 A;  1A99 A;  1A8F A;  2DP8 A;  3ODB A;  2M8C A;  1LB9 A;  3GXA A;  2I3V A;  2ONS A;  3OXN A;  4LVQ A;  4OES A;  1ANF A;  1ZTY A;  4ZEC A;  5DVI A;  3O6H A;  2QMX A;  3CRB A;  3HST A;  3CFL A;  4YZZ A;  5H8Q B;  1SDX A;  1MM6 A;  5M2V A;  3R6U A;  5FTH A;  3OO7 A;  2HZK A;  1QUI A;  4H8I A;  1OVB A;  1R9L A;  1Y3Q A;  2D21 A;  4WED A;  1FQB A;  3O28 A;  4U4S A;  2XXR A;  3CR9 A;  4ESX A;  2XXP A;  4LQ5 A;  3PMV A;  1T0K A;  4GF8 A;  4X1B A;  1UTH B;  2QS3 A;  4DLD A;  1TFD A;  2E1S A;  3C36 A;  4U1Z A;  1PEB A;  3EF7 A;  4OZ9 A;  4BDL A;  3TKD A;  3SEY A;  4NTL A;  5ELV A;  1HSL A;  1ZBM A;  2AL4 A;  3DLN A;  3FAS A;  2R9J A;  4FIM A;  1B3E A;  1B0L A;  5CMM A;  1MH3 A;  4XKR A;  4FE8 A;  4YB7 A;  2D3I A;  2Q9T A;  1Q1K A;  1LAG E;  1FQA A;  2XD2 A;  5J1D A;  3VVD A;  4GVO A;  1N3X A;  3F11 A;  1IUD A;  2ZYM A;  3TZA A;  3C34 A;  2KLF A;  1ATG A;  4MFI A;  4Q0C A;  1A55 A;  1JW4 A;  3FD3 A;  2REG A;  3DEL B;  3O2A A;  4UAC A;  1QKB A;  3TTL A;  1IIT A;  2DYX A;  2P1S A;  4G8M A;  4M4G A;  1EZ9 A;  1B4Z A;  4HCW A;  1DSN A;  3U94 A;  1GTK A;  1N0T A;  3RY3 A;  1MQD A;  1XC1 A;  2OLB A;  1IZ1 A;  2F35 A;  2DE3 A;  4F3P A;  2Z23 A;  2F36 A;  2ZNT A;  2NVU B;  1B51 A;  1LBC A;  1NNP A;  3ILT B;  5BUU A;  2I3W A;  4X9T A;  1USY E;  2I0C A;  3MPK A;  2RIN A;  1JET A;  4XKP A;  3SEW A;  4QFK A;  4LP2 B;  4F22 A;  3EQ1 A;  2O1M A;  3TEL A;  3ONM A;  4ELP A;  1VR5 A;  3C32 A;  5FTI A;  2UXA A;  5TU0 A;  1H45 A;  2ZNS A;  1R6Z A;  2PT2 A;  3D4C A;  4I1D A;  3U92 A;  4R75 A;  4X1D A;  4NE4 A;  4RK2 A;  1MQH A;  4I62 A;  1JVY A;  3CVG A;  2Q2C A;  5A5X A;  1FQC A;  1B7H A;  2DE4 A;  2I4B A;  3JZJ A;  2F8D A;  4BDO A;  1BLF A;  3KSJ A;  3TEP A;  3OEN A;  1VFD A;  3VXC A;  4LON B;  3OOA A;  2HAU A;  3A3C A;  3PPQ A;  3S9N C;  4QHQ A;  3FXR A;  1AOV A;  1B58 A;  2YPN A;  4NF4 A;  2XXY A;  4GRK A;  4ZZE A;  3MUQ A;  3C31 A;  3PUX E;  4DZ1 A;  3BBR A;  1IEJ A;  3FV2 A;  3L6G A;  1XVX A;  1URS A;  2X26 A;  2YLN A;  2PVU A;  2DWA A;  4GXA A;  3O97 A;  4R73 A;  1II5 A;  3FJM A;  1VFE A;  2RC7 A;  3Q26 A;  4U23 A;  4EXK A;  3MWB A;  1QUL A;  4MF3 A;  3Q27 A;  1OQH A;  4P0I A;  1Y4C A;  4ZEK A;  5AA2 B;  2XXU A;  4KQP A;  3V89 B;  3KFM A;  3RN8 A;  4H67 A;  2B3F A;  4OEV A;  3O9P A;  2HAV A;  3LSL A;  3I6V A;  1MXU A;  4U1O A;  3PGF A;  4GXS B;  1PDA A;  1L5T A;  4RA1 A;  2RC9 A;  4NWC A;  2O6A A;  4IB2 A;  3OEM A;  2D5W A;  4F19 A;  3T93 B;  5K2Y A;  5DVF A;  4N6P A;  2H25 A;  3EHT A;  2Z8E A;  3KGC A;  3VVE A;  3UGW A;  3MPL A;  3T96 B;  4R6H A;  1NNK A;  2DSF A;  2OWT A;  1XHY A;  4ZS9 A;  3O6I A;  1FTL A;  4RPN A;  4R9G A;  2DVZ A;  3RT8 A;  1BIY A;  2LAO A;  4NF8 A;  3TQW A;  3SDF A;  4Z7E A;  4DXU A;  5CRY A;  1DTG A;  5AA4 A;  4F29 A;  5KZT A;  4GQO A;  4IO6 A;  2XXX A;  3B7D A;  2Y7R A;  1XT8 A;  2DWJ A;  4QF9 A;  2ZMB A;  4H0W A;  3VLV A;  5CBR A;  1A8E A;  1RKM A;  3H06 B;  3K1N A;  3U72 A;  5I2K B;  3LSW A;  4G77 A;  3H6T A;  3PMW A;  5TP9 A;  4ZE8 A;  4DXB A;  3IL1 B;  1TT1 A;  4JWO A;  1LAH E;  4F31 B;  1I69 A;  4WXJ A;  4KYD A;  1JNF A;  3TTN A;  1MPB A;  3PU5 A;  3SKP A;  3DP6 A;  1B2H A;  5H8H A;  4DCY A;  1B3F A;  1UQW A;  2RKM A;  3HV1 A;  2HZL A;  1Y3P A;  1FCK A;  3H6V A;  3OSQ A;  1HSE A;  4ZZA A;  1PB7 A;  4NF6 A;  4GWO A;  2RC8 A;  3FIR A;  3WAE A;  1AIV A;  3PUW E;  3CSG A;  1QUK A;  1I6A A;  5DEX A;  5I58 B;  4XXU A;  1FW0 A;  3G3F A;  4G68 B;  1O64 A;  3UP9 A;  3CIJ A;  4DE8 A;  4XIG Q;  2O68 A;  2QPQ A;  3TMG A;  3VFJ A;  1MPD A;  1SQY A;  3K4U A;  4EF1 A;  3G3I A;  3MZ9 A;  1XVY A;  1OLA A;  5AA2 D;  3Q28 A;  3IOV A;  3IR1 A;  3KEI A;  4YB5 A;  3UA8 A;  3BFU A;  4LZ8 A;  3T22 A;  3K1P A;  5FHM A;  3EHS A;  3HPI A;  5DT6 A;  4PFY A;  4TOZ A;  4YU0 A;  1NL5 A;  3FXU A;  2DQV A;  2I0B A;  3GBB A;  1MDP 1;  3S9E A;  4XTC Q;  2Z8D A;  4R74 A;  1DPE A;  1FQF A;  3TCH A;  3W9W A;  5H8Q A;  1FTJ A;  1M5C A;  5BWJ A;  1H44 A;  1JEU A;  1WOD A;  4O3B A;  3M3K A;  3T9V A;  3T9X B;  4YAH X;  1NNT A;  2XX7 A;  2OCU A;  4QSD A;  4PP0 A;  3C33 A;  4YKK A;  4PET A;  2B65 A;  1M5D A;  1B52 A;  1LBB A;  1US5 A;  3UN6 A;  3O66 A;  3QIM A;  3H6W A;  2V3U A;  4FEC A;  1BKA A;  2A5S A;  1UTH A;  3QUJ A;  2GH9 A;  2X7Q A;  2H98 A;  2NXO A;  1UIU A;  4DCX A;  1D9Y A;  2PT1 A;  3IJO B;  4FED A;  2GHA A;  3FVO A;  3DM0 A;  4PFU A;  3S9M C;  4LUB A;  2Y7W A;  4DIG A;  1QUJ A;  5CI5 A;  3W9V A;  1LCF A;  3TCF A;  1MG1 A;  3CFX A;  4U21 A;  3AXF A;  1F9B A;  2ZYK A;  3KN7 A;  4G4P A;  3W15 C;  3UIF A;  3M3L A;  1PB9 A;  2GRV A;  4IO2 A;  3VXB A;  5TPA B;  3E3K A;  4C1U A;  1MM7 A;  3Q25 A;  4OEN A;  4C0R A;  1B1X A;  1B46 A;  2QS1 A;  3OSR A;  1B40 A;  2I4C A;  2HEU A;  2UVI A;  4ZE9 A;  4E0X A;  1R9Q A;  1NMU A;  2V93 A;  4N13 A;  4EQ9 A;  1TWY A;  4ESW A;  2DWH A;  4X48 A;  3KOT A;  4OWD A;  2IEE A;  3PV0 E;  4I9D A;  3IOR A;  4KPT A;  3TTK A;  2VP1 A;  3DP8 A;  1M5B A;  2Q8J A;  2ONR A;  3HO7 A;  5L9M A;  1PBP A;  5AA3 A;  3OEL A;  1MQG A;  1XS5 A;  1ZU0 A;  1H43 A;  3IJX B;  1VE4 A;  2ABH A;  2Q2A A;  4U2R A;  3LR1 A;  2H5Y A;  3IOT A;  3UK4 A;  1N04 A;  1TFA A;  4XKN A;  3RGY A;  3K2D A;  3PPO A;  1S7Y A;  3PUY E;  3SEX A;  5CMB A;  1SVX B;  1ZJL A;  5I56 B;  1AMF A;  2DE2 A;  3N5L A;  3RT6 B;  3OO9 A;  3OO8 A;  5I2N B;  3N6U A;  4KR5 A;  3L6H A;  4FOR A;  2O7U A;  1D9V A;  3H6U A;  3V83 A;  5L9O A;  4PFW A;  1B1H A;  4H65 A;  4H5G A;  2Z22 A;  1Z7N E;  5JTY B;  5KCJ B;  4RY1 A;  2RCA A;  3VV5 A;  4IGT A;  3HCQ A;  1CE2 A;  2XXT A;  1M5E A;  4HW8 A;  3IB0 A;  1MXV A;  4JWX A;  1ZMG A;  3MZB A;  2UVJ A;  2NWJ A;  2ZYO A;  4AB6 A;  1P99 A;  4IY6 A;  4OFO A;  3BFT A;  3OEK A;  4WEP A;  4F18 A;  5AA2 A;  4R2B A;  4IO5 A;  3PD8 A;  2PX1 A;  3IB1 A;  1QKA A;  2P0S A;  4LA9 A;  1B3G A;  2CZL A;  4RPO A;  3MP6 A;  3T9U A;  3Q29 A;  3CFZ A;  4QFN A;  3IO6 A;  4LAT A;  5F7V A;  1D3K A;  4P11 A;  4YB6 A;  1YPN A;  1OLC A;  5ITP A;  3QXM A;  1ELJ A;  3IOU A;  3FVN A;  3PPN A;  3E13 X;  3N94 A;  3KBR A;  1A7L A;  1R1N A;  4MH5 A;  1B9J A;  5FHO A;  1URG A;  1SW2 A;  2VOZ A;  3K0V A;  2ZXT A;  1AL3 A;  3H4Z A;  1MH4 A;  2Y7P A;  1PBQ A;  3ECR A;  3MJN A;  1FQD A;  3PMX A;  4Q30 B;  2HFB A;  1MDQ A;  5CBS A;  4YMB A;  2NOO A;  2DWI A;  5H8N B;  3IK6 B;  4OQO A;  2UYE A;  5CM6 A;  3B6T A;  2Y7K A;  4TLM B;  3TUS A;  1OQG A;  1O63 A;  3TDJ A;  2XX8 A;  1IXH A;  2THI A;  3MVX A;  3S4U A;  4JXI A;  4ELR A;  5JEI A;  5ICQ A;  4PE5 B;  5I2K A;  4IO3 A;  3MW0 A;  1I6Q A;  4POW A;  4AQ4 A;  3MAM A;  4ZEF A;  1A40 A;  2GFE A;  2XXI A;  2O51 A;  4R72 A;  2RF1 A;  1P1W A;  2BJJ X;  2V25 A;  4M1V A;  3QAX A;  3OO6 A;  3U8Q A;  3K6X A;  4GL8 A;  3K1M A;  2ZYN A;  5FHN A;  1S50 A;  2REJ A;  3FGS A;  1NNF A;  1UIV A;  3G3H A;  3LSF B;  5ICT A;  3KSX A;  4P0G A;  5I58 A;  1EU8 A;  3RQT A;  3TAJ A;  4G68 A;  1B3L A;  3IOW A;  3KZG A;  1N3W A;  4ELQ A;  3ZKK A;  4Q5T A;  3USD A;  4FAJ A;  3TQL A;  5L9S A;  3MC2 A;  4R6K A;  4LZ5 A;  2ONK E;  1OMP A;  4U4X A;  5H8S A;  4EDP A;  4IY5 A;  3D4G A;  1SD3 A;  3TTR A;  1WDN A;  1NKX A;  2O1L A;  1QVS A;  2F7A A;  4OFJ A;  1B32 A;  1LLS A;  3PPP A;  4F39 A;  1JVX A;  4NF5 A;  3VDF A;  3TPA A;  1US4 A;  4GOT A;  3G3K A;  3IX1 A;  1B7U A;  1JEV A;  4F1Y A;  1Y4T A;  2W7Y A;  3O6G A;  5I57 A;  3FUZ A;  1SI1 A;  1BTJ A;  1SBP A;  2CMO A;  1VSO A;  3RNN A;  4O3C A;  3O29 A;  1LB8 A;  2F7C A;  4YKP A;  3R26 A;  1IIW A;  4F3G A;  3V5A A;  3UOR A;  2ANJ A;  4IGR A;  1LFI A;  5IAI A;  1UTB B;  1B05 A;  4BLA A;  1B5I A;  4JB7 A;  4H8J A;  4ELO A;  3SEU A;  3ZSF A;  3A3U A;  1CB6 A;  4NF5 B;  4JSD A;  3OMB A;  5AE4 A;  2VD2 A;  1OVT A;  4H5F A;  5CMC A;  1QJM A;  3K00 A;  2E0S A;  4XKQ A;  2H99 A;  3TOD A;  5I57 B;  1MQI A;  2OJT A;  4BDM A;  4OXV A;  5IKB A;  1P1O A;  2O69 A;  1LAX A;  4RJZ A;  2G29 A;  4F2Q A;  5H8F B;  1POY 1;  4ZEI A;  4R9F A;  3S2V A;  1DMB A;  4ZED A;  5K2X A;  2FNC A;  3HHF A;  3CG1 A;  4LQ2 A;  3V8X B;  2F7B A;  4POX A;  4MLV A;  1LST A;  4Z0I A;  5EYF A;  4BDN A;  3KJT A;  3VLU A;  2XXW A;  1H3D A;  3LUY A;  4GLI A;  2Y7I A;  5TPA A;  1IXG A;  1SYH A;  4LZ7 A;  2ALU A;  2V3Q A;  1MRP A;  4RYA A;  1Y1M A;  4I8C A;  3M3F A;  1B7Z A;  3I5O A;  3EPE A;  2IA4 A;  2XXQ A;  4ZEB A;  3CI8 A;  4QSC A;  1B6H A;  3EHU A;  1Q35 A;  4RK9 A;  4UA8 A;  1QW0 A;  2WKY A;  1XOC A;  1N76 A;  1B3H A;  5AA1 A;  4AB5 A;  3MP1 A;  4OVJ A;  5KDT B;  3ZKL A;  4BDQ A;  4HCY A;  3RTF B;  2ZNU A;  4KI0 E;  1LFG A;  1Z7M E;  1MQJ A;  2A5T B;  3K02 A;  1MXY A;  3RTW B;  4OER A;  2I48 A;  4OET A;  3LSX A;  4THI A;  4H6D A;  4OFL A;  1URD A;  2Z8F A;  4BDR A;  3QK6 A;  3FAT A;  2DVC A;  4RNS A;  3IAZ A;  5I56 A;  1B4H A;  2XX9 A;  1SI0 A;  3U1O A;  1LCT A;  1PB8 A;  3I3V A;  1SYI A;  4U22 A;  4PQJ A;  1IQ7 A;  1FTO A;  1EZP A;  5I2N A;  1FTK A;  2V3T A;  1YCJ A;  4ND9 A;  2QSX A;  2Y84 A;  1USY H;  3MVZ A;  2X7P A;  3QSL A;  3FVK A;  4HS7 A;  4NED A;  1N84 A;  5JTY A;  5KCJ A;  3N6T A;  4G68 C;  3E9X A;  2FA7 A;  4JSO A;  1DPP A;  4EF2 A;  4QRZ A;  3MZ1 A;  1B5H A;  1MY2 A;  3MVY A;  3MP8 A;  3T9H B;  5F1Q A;  2G93 A;  4H1X A;  4NWD A;  1J1N A;  4G8N A;  3CSB A;  3T66 A;  1MY1 A;  2NUV A;  4JDF A;  5EHM A;  1HSJ A;  1SW5 A;  3GLB A;  3IO4 A;  1ZKB A;  1B0H A;  3GZG A;  1N7W A;  4JBZ A;  4KFQ A;  1MXZ A;  1NFT A;  1NH7 A;  1RYO A;  1A54 A;  1EZO A;  3TTM A;  2OBG A;  2OK2 A;  3IB2 A;  5DTB A;  3A09 A;  5I59 A;  5L8D A;  3MVW A;  3RPW A;  4KHZ E;  1LGB C;  4N07 A;  2VGQ A;  2AL5 A;  1B5J A;  4ECF A;  4OYV A;  2O7I A;  3H7M A;  5HM4 B;  3KN8 A;  4EXL A;  3SET A;  1LFH A;  1MXW A;  3C35 A;  3FV1 A;  3KOS A;  2F78 A;  2OZZ A;  5H8N A;  2R6G E;  5CC2 A;  3FJG A;  1POT A;  5DYH A;  4IO4 A;  4TLL B;  2I6E A;  3TYH A;  4MLQ A;  4DXC A;  2QMW A;  1JW5 A;  4PFT A;  2QJE A;  4K3F A;  5JK4 A;  4EQB A;  2H4I A;  3OD7 A;  4KYS A;  5I59 B;  5HBC A;  2DXR A;  2HQ0 A;  3U93 A;  3KN3 A;  4F2O A;  4KYE A;  4EUO A;  2VD3 A;  1H76 A;  4QSE A;  1GVC A;  3K6W A;  2OWS A;  2ESN A;  1DTZ A;  3FJ7 A;  3QUF A;  3QYT A;  1Y3N A;  4ONY A;  1YTV A;  3N26 A;  2XXV A;  5DVJ A;  2F34 A;  1GR2 A;  2F6P A;  3MQ9 A;  4R2F A;  2PMS A;  3PPR A;  5A5X B;  2RCB A;  2R71 A;  3SER A;  4GD5 A;  2VHA A;  5I84 A;  2I58 A;  3LBS A;  1IXI A;  4O3A A;  2XHD A;  2DXY A;  3G3J A;  3B6Q A;  1DOT A;  4NF4 B;  3G7W A;  3WAF A;  4F1U A;  4E0W A;  4TQU Q;  4L17 A;  2XD3 A;  4RXL A;  3EN3 A;  4KD5 A;  2XXH A;  1M5F A;  5HPQ A;  3GBA A;  3PUV E;  1MY3 A;  2YJP A;  4F1V A;  4GFR A;  3HHG A;  2HXW A;  1MPC A;  3FZV A;  2GHB A;  4DDD A;  2I49 A;  1EH3 A;  2B3B A;  4YKI A;  1WVJ A;  3SEV A;  3VVF A;  2O84 X;  1KWH A;  2QS4 A;  3H03 A;  1P1N A;  3C4M A;  4YMA A;  3C9H A;  1ZLQ A;  5LOM A;  3B6W A;  4C1T A;  1SW4 A;  1Y20 A;  5CMK A;  4F3B A;  1NH8 A;  4KCC A;  4OHN A;  1UTB A;  2V84 A;  2Q89 A;  3VE1 B;  2PBW A;  3ZS6 A;  2UVG A;  1D4N A;  3RUM A;  4ZDM A;  4MBP A;  3H3G A;  4HTG A;  1N7X A;  3KG2 A;  2P2A A;  2QS2 A;  3KJ7 A;  1Y9U A;  5B70 A;  1TXF A;  4IO7 A;  2AIX A;  4NF8 B;  5B7D A;  3PUZ E;  4OMB A;  3R7X A;  1YAE A;  5AA4 B;  1FQE A;  2Q88 A;  4G8H A;  1BP5 A;  3E4R A;  5H8F A;  2DOJ A;  5ITO A;  1I6B A;  3PD9 A;  1ZIU A;  3CG3 A;  2HCA A;  5EHS A;  1MS7 A;  3K6U A;  1GV8 A;  4NMY A;  1P1U A;  3THI A;  3FXQ A;  4QFP A;  4FJP A;  3K01 A;  1AH5 A;  2UVH A;  4FAT A;  4FEB A;  4Q8R A;  2UYF A;  4R6Y A;  5TP9 B;  3TFL A;  2QRY A;  1P1Q A;  4YKJ A;  1GGG A;  2FYI A;  3M8U A;  4KCD A;  1JW1 A;  2AYS A;  4ISU A;  2F5X A;  1O7T A;  2DS9 A;  3ILU B;  3LC8 A;  2F97 A;  1SW1 A;  4G2Z A;  5H8H B;  4QFO A;  3K6V A;  3SES A;  2H9B A;  1JQF A;  3MBP A;  3BKI B;  5ISU A;  4GIZ A;  4NF6 B;  4QFL A;  1RYX A;  3JV9 A;  3TCG A;  3S9L C;  4JWY A;  4GL0 A;  1IXC A;  5DEX B;  4OEU A;  1MY0 A;  1LAF E;  1MY4 A;  3VLW A;  1S9T A;  4F3S A;  2PYY A;  1OIB A;  1Y1Z A;  3G3G A;  5KDT A;  4EQ7 A;  4YIC A;  2F6G A;  3JYR A;  3RLF E; 
#chains in the Genus database with same CATH topology
 1PC3 A;  3DP4 A;  4OTE A;  1MXX A;  3HN0 A;  4WKM A;  2XWV A;  4AS5 A;  2A5T A;  1FTM A;  3P7I A;  3FVG A;  2QL3 A;  1A99 A;  1A8F A;  2DP8 A;  3ODB A;  2M8C A;  1LB9 A;  3GXA A;  2HXR A;  2I3V A;  2ONS A;  3OXN A;  4LVQ A;  4OES A;  1ANF A;  1ZTY A;  1FBH A;  4ZEC A;  4XFE A;  5DVI A;  3O6H A;  2QMX A;  3CRB A;  3HST A;  3CFL A;  4YZZ A;  5H8Q B;  1SDX A;  1FPL A;  1MM6 A;  5M2V A;  3R6U A;  5FTH A;  2WBD A;  3OO7 A;  2HZK A;  1QUI A;  4H8I A;  1OVB A;  4O7I A;  1R9L A;  1NV6 A;  5IZ3 B;  1Y3Q A;  2D21 A;  4WED A;  1FQB A;  4DI3 D;  1NUW A;  1AWB A;  5A5L A;  3O28 A;  4U4S A;  1KZ8 A;  2XXR A;  4O94 A;  3CR9 A;  4ESX A;  2XXP A;  4LQ5 A;  3LUZ A;  2XWI A;  1IMF A;  3PMV A;  1T0K A;  4GF8 A;  4X1B A;  1UTH B;  2QS3 A;  4DLD A;  1TFD A;  2E1S A;  3C36 A;  4U1Z A;  5F24 A;  1PEB A;  3EF7 A;  4OZ9 A;  4BDL A;  3TKD A;  4GWY A;  3SEY A;  4NTL A;  5ELV A;  1HSL A;  1ZBM A;  2AL4 A;  3DLN A;  3FAS A;  2R9J A;  2BJI A;  4FIM A;  1B3E A;  1B0L A;  5CMM A;  1MH3 A;  4XKR A;  4FE8 A;  4YB7 A;  2D3I A;  2Q9T A;  1Q1K A;  1LAG E;  1FQA A;  2XD2 A;  5J1D A;  3VVD A;  4JVC A;  4GVO A;  1N3X A;  3F11 A;  1IUD A;  4P9K A;  2ZYM A;  3TZA A;  3C34 A;  2KLF A;  1ATG A;  4MFI A;  4Q0C A;  1A55 A;  1JW4 A;  3FD3 A;  2REG A;  4O7M A;  3DEL B;  3O2A A;  4UAC A;  1QKB A;  1FJ9 A;  1SPI A;  3TTL A;  1IIT A;  2DYX A;  2P1S A;  4G8M A;  4M4G A;  1EZ9 A;  1B4Z A;  4HCW A;  1DSN A;  3LV0 A;  3U94 A;  1GTK A;  1N0T A;  3RY3 A;  4GWS A;  4OVR A;  1FBE A;  1MQD A;  3T0J A;  1XC1 A;  2OLB A;  1IZ1 A;  2F35 A;  2DE3 A;  4F3P A;  2Z23 A;  2F36 A;  2ZNT A;  4PAF A;  2NVU B;  1B51 A;  1LBC A;  1NNP A;  3ILT B;  5BUU A;  5EQ7 A;  2DDK A;  2I3W A;  4X9T A;  1USY E;  2I0C A;  3MPK A;  2RIN A;  1JET A;  1JP4 A;  4XKP A;  3SEW A;  4QFK A;  4LP2 B;  4F22 A;  3EQ1 A;  2O1M A;  3FXB A;  3TEL A;  3ONM A;  4ELP A;  1VR5 A;  3C32 A;  5FTI A;  2UXA A;  5TU0 A;  1INP A;  1H45 A;  4JVI A;  2ZNS A;  1R6Z A;  2PT2 A;  1FPG A;  4NHB A;  4XF5 A;  3D4C A;  4I1D A;  3U92 A;  4R75 A;  4X1D A;  4NE4 A;  4RK2 A;  1MQH A;  4I62 A;  1JVY A;  3CVG A;  2Q2C A;  5A5X A;  1FQC A;  1B7H A;  2DE4 A;  2FIE A;  2I4B A;  3JZJ A;  4N15 A;  2F8D A;  4BDO A;  1BLF A;  3KSJ A;  3TEP A;  3OEN A;  1VFD A;  3VXC A;  4LON B;  3OOA A;  2HAU A;  3A3C A;  3PPQ A;  3S9N C;  4QHQ A;  3FXR A;  1AOV A;  1B58 A;  2PCR A;  2YPN A;  4NF4 A;  2XXY A;  4GRK A;  3MST A;  4ZZE A;  3MUQ A;  3C31 A;  3PUX E;  4DZ1 A;  5IGA A;  3BBR A;  1IEJ A;  3FV2 A;  3L6G A;  4O8M A;  1XVX A;  1URS A;  2X26 A;  2YLN A;  2PVU A;  2DWA A;  2CZI A;  4GXA A;  3O97 A;  4R73 A;  1II5 A;  5ET5 A;  3FJM A;  1VFE A;  2RC7 A;  3Q26 A;  1CNQ A;  4U23 A;  4EXK A;  3MWB A;  1FPK A;  1QUL A;  1RDZ A;  4MF3 A;  3Q27 A;  1FRP A;  1OQH A;  4P0I A;  1Y4C A;  4ZEK A;  5AA2 B;  2XXU A;  4KQP A;  3V89 B;  3KFM A;  3RN8 A;  4H67 A;  2B3F A;  4OEV A;  3O9P A;  2HAV A;  2HHM A;  3LSL A;  4QBA A;  3I6V A;  1MXU A;  4U1O A;  3PGF A;  4GXS B;  1PDA A;  1L5T A;  4RA1 A;  3T1B A;  2RC9 A;  4NWC A;  2O6A A;  4IB2 A;  3OEM A;  1D9Q A;  2D5W A;  4F19 A;  3T93 B;  5K2Y A;  5DVF A;  4N6P A;  2H25 A;  3EHT A;  2Z8E A;  3KGC A;  5EQ9 A;  3B50 A;  3VVE A;  3UGW A;  3MPL A;  4OVP A;  3T96 B;  3BIH A;  4R6H A;  1NNK A;  2DSF A;  2OWT A;  1XHY A;  4ZS9 A;  3O6I A;  1FTL A;  4RPN A;  4R9G A;  2DVZ A;  3RT8 A;  1BIY A;  4H46 A;  2LAO A;  4NF8 A;  3TQW A;  3SDF A;  4Z7E A;  4DXU A;  5CRY A;  1DTG A;  5AA4 A;  4F29 A;  5KZT A;  4GQO A;  4IO6 A;  2XXX A;  3B7D A;  2Y7R A;  1VDW A;  1XT8 A;  2DWJ A;  4QF9 A;  1EYI A;  2ZMB A;  4H0W A;  3VLV A;  5CBR A;  1A8E A;  1RKM A;  3H06 B;  3K1N A;  1NV0 A;  2OX3 A;  4HE1 A;  3U72 A;  5I2K B;  3LSW A;  4G77 A;  3H6T A;  2WX9 A;  5EYG A;  3PMW A;  5TP9 A;  5FBP A;  4ZE8 A;  4DXB A;  1IMC A;  3IL1 B;  1TT1 A;  4JWO A;  1LAH E;  4F31 B;  1I69 A;  4WXJ A;  3D1R A;  4KYD A;  1JNF A;  3TTN A;  1MPB A;  3PU5 A;  3SKP A;  3DP6 A;  1B2H A;  4MIJ A;  5H8H A;  4DCY A;  1B3F A;  1UQW A;  2XA5 A;  3U65 A;  2RKM A;  1NUZ A;  3HV1 A;  2HZL A;  1Y3P A;  1FCK A;  3H6V A;  3OSQ A;  1HSE A;  4ZZA A;  1PB7 A;  4NF6 A;  4GWO A;  4PFR A;  2RC8 A;  3FIR A;  3WAE A;  1AIV A;  3PUW E;  2QVV A;  3CSG A;  3PTY A;  1LEV A;  1QUK A;  1I6A A;  5DEX A;  4P56 A;  5I58 B;  4XXU A;  1FW0 A;  3G3F A;  3ISP A;  4G68 B;  1O64 A;  3UP9 A;  3CIJ A;  4DE8 A;  4XIG Q;  2O68 A;  2QPQ A;  4PE3 A;  3TMG A;  3VFJ A;  1MPD A;  1SQY A;  3K4U A;  4EF1 A;  3G3I A;  3MZ9 A;  1XVY A;  3RPL B;  1OLA A;  5AA2 D;  3Q28 A;  1BK4 A;  1XI6 A;  3IOV A;  3IR1 A;  3KEI A;  4YB5 A;  3UA8 A;  3BFU A;  4N91 A;  4LZ8 A;  3T22 A;  3K1P A;  5FHM A;  3EHS A;  5ET8 A;  2XWO A;  3HPI A;  5DT6 A;  4PFY A;  4TOZ A;  4YU0 A;  1FPI A;  1NL5 A;  3FXU A;  2DQV A;  2I0B A;  3GBB A;  1MDP 1;  3S9E A;  4HE2 A;  4XTC Q;  1LBZ A;  2Z8D A;  4R74 A;  2Y5L A;  1DPE A;  1FQF A;  3TCH A;  3W9W A;  5H8Q A;  1YZ0 A;  1FTJ A;  1M5C A;  5BWJ A;  1H44 A;  1JEU A;  1WOD A;  4O3B A;  3M3K A;  4P8B A;  3T9V A;  3T9X B;  4NGU A;  4YAH X;  1NNT A;  2XX7 A;  2OCU A;  4MNP A;  4I3Y A;  5IZ3 A;  4QSD A;  2XWK A;  4PP0 A;  3C33 A;  4YKK A;  4PET A;  2B65 A;  1M5D A;  1B52 A;  1LBB A;  1US5 A;  3UN6 A;  3O66 A;  3QIM A;  3H6W A;  2V3U A;  4FEC A;  2WYP A;  1BKA A;  2A5S A;  1UTH A;  3QUJ A;  2GH9 A;  2X7Q A;  2H98 A;  2QFL A;  2NXO A;  4PBQ A;  1UIU A;  4DCX A;  1D9Y A;  2ZZX A;  2PT1 A;  4MEV A;  3IJO B;  4FED A;  4PF6 A;  2GHA A;  5T3J A;  3FVO A;  3DM0 A;  4PFU A;  1YYZ A;  3S9M C;  4LUB A;  2Y7W A;  4DIG A;  4PCD A;  1QUJ A;  2CZH A;  4QXD A;  5CI5 A;  3W9V A;  1LCF A;  3TCF A;  1MG1 A;  3CFX A;  4U21 A;  3AXF A;  1F9B A;  2ZYK A;  3KN7 A;  3IFC A;  4G4P A;  2CEY A;  3W15 C;  3UIF A;  3M3L A;  1PB9 A;  1FPB A;  1EYJ A;  2GRV A;  4IO2 A;  3VXB A;  5TPA B;  3E3K A;  4C1U A;  4KXP A;  2Y5K A;  1DCU A;  3MYU A;  1MM7 A;  4OVS A;  3Q25 A;  4OEN A;  4C0R A;  1B1X A;  1FPF A;  1B46 A;  1FTA A;  2QS1 A;  3OSR A;  1B40 A;  1YXI A;  2I4C A;  4LN5 A;  2HEU A;  2UVI A;  4ZE9 A;  4GX3 A;  4E0X A;  1R9Q A;  4MCO A;  1NMU A;  2V93 A;  4N13 A;  4EQ9 A;  1TWY A;  4ESW A;  2DWH A;  2CEX A;  4X48 A;  3KOT A;  4OWD A;  2IEE A;  3PV0 E;  4I9D A;  3IOR A;  4KPT A;  3TTK A;  2VP1 A;  1NV7 A;  3DP8 A;  1M5B A;  2Q8J A;  2ONR A;  1QGX A;  3HO7 A;  5L9M A;  1PBP A;  3E79 A;  5AA3 A;  3OEL A;  1MQG A;  3KC1 A;  1XS5 A;  1ZU0 A;  1H43 A;  3IJX B;  1VE4 A;  2ABH A;  2Q2A A;  4U2R A;  3LR1 A;  2H5Y A;  3BIG A;  3IOT A;  3UK4 A;  1N04 A;  1TFA A;  4XKN A;  4XEQ A;  3K2D A;  3PPO A;  3RGY A;  1S7Y A;  2MKZ A;  3PUY E;  3SEX A;  5CMB A;  1SVX B;  1ZJL A;  3CHG A;  1NUX A;  5I56 B;  2WYK A;  1AMF A;  2QVR A;  2DE2 A;  2PFZ A;  2ZZV A;  1DBZ A;  4NQ8 A;  3N5L A;  5ET7 A;  3RT6 B;  3OO9 A;  3OO8 A;  5I2N B;  1RDY A;  3N6U A;  4KR5 A;  3L6H A;  4FOR A;  2O7U A;  1D9V A;  3H6U A;  3V83 A;  5L9O A;  4PFW A;  1B1H A;  4H65 A;  4H5G A;  2Z22 A;  1Z7N E;  5JTY B;  5KCJ B;  4RY1 A;  4OAN A;  2RCA A;  3VV5 A;  4IGT A;  3HCQ A;  4MAG A;  1CE2 A;  2XXT A;  1M5E A;  4HW8 A;  3IB0 A;  5EQA A;  1MXV A;  1KA0 A;  4JWX A;  1ZMG A;  3MZB A;  2F3D A;  2UVJ A;  3GYY A;  2NWJ A;  2ZYO A;  2JJK A;  4AB6 A;  1P99 A;  4IY6 A;  4OFO A;  3BFT A;  1IME A;  2V4C A;  3OEK A;  4WEP A;  4F18 A;  5AA2 A;  4R2B A;  4IO5 A;  3PD8 A;  2PX1 A;  3IB1 A;  1QKA A;  2P0S A;  4LA9 A;  1B3G A;  2CZL A;  4RPO A;  4P1L A;  3MP6 A;  3T9U A;  3Q29 A;  3CFZ A;  4QFN A;  3IO6 A;  4LAT A;  5F7V A;  1D3K A;  4P11 A;  4YB6 A;  1YPN A;  2WEF A;  1OLC A;  5ITP A;  2L5V A;  3QXM A;  2KR0 A;  1ELJ A;  3IOU A;  3FVN A;  3PPN A;  3E13 X;  3N94 A;  3KBR A;  1A7L A;  1R1N A;  4MH5 A;  1B9J A;  5FHO A;  1URG A;  1SW2 A;  2VOZ A;  3K0V A;  2ZXT A;  1AL3 A;  3H4Z A;  1MH4 A;  1IMD A;  2Y7P A;  1PBQ A;  3ECR A;  3MJN A;  5I3S A;  3A29 A;  1FQD A;  3PMX A;  4Q30 B;  2HFB A;  1MDQ A;  5CBS A;  4YMB A;  2NOO A;  2DWI A;  5H8N B;  4FBP A;  3IK6 B;  4OQO A;  2UYE A;  5CM6 A;  3B6T A;  2Y7K A;  4TLM B;  3TUS A;  4AS4 A;  1OQG A;  1O63 A;  3TDJ A;  2XX8 A;  1IXH A;  2THI A;  3MVX A;  3S4U A;  4OVQ A;  5IM2 A;  4JXI A;  1DK4 A;  4ELR A;  5JEI A;  1LBV A;  5ICQ A;  4PE5 B;  5I2K A;  4IO3 A;  3MW0 A;  1I6Q A;  4POW A;  4AQ4 A;  3MAM A;  4ZEF A;  1A40 A;  2GFE A;  4X04 A;  2XXI A;  2O51 A;  4R72 A;  2RF1 A;  4N8G A;  1P1W A;  2BJJ X;  2V25 A;  4M1V A;  3QAX A;  3OO6 A;  3U8Q A;  3K6X A;  4GL8 A;  3K1M A;  1KA1 A;  2ZYN A;  5FHN A;  1S50 A;  2REJ A;  4NF0 A;  3FGS A;  1NNF A;  1UIV A;  3G3H A;  1NV4 A;  4P3L A;  3LSF B;  5ICT A;  4GBV A;  3KSX A;  4P0G A;  5I58 A;  1EU8 A;  3RQT A;  3TAJ A;  4G68 A;  4IR8 A;  1B3L A;  3IOW A;  3KZG A;  1N3W A;  4ELQ A;  3ZKK A;  4Q5T A;  3USD A;  4FAJ A;  3TQL A;  5L9S A;  1G0H A;  3MC2 A;  4R6K A;  4LZ5 A;  2ONK E;  3RPL A;  1OMP A;  4U4X A;  5H8S A;  4EDP A;  4IY5 A;  3D4G A;  2ZZW A;  4UAB A;  1SD3 A;  1NUY A;  3TTR A;  1WDN A;  1NKX A;  2VT5 A;  4MHF A;  2O1L A;  1QVS A;  2F7A A;  4OFJ A;  1B32 A;  1LLS A;  3PPP A;  4F39 A;  1JVX A;  4NF5 A;  3VDF A;  3TPA A;  1US4 A;  4GOT A;  3G3K A;  3IX1 A;  1B7U A;  2VPN A;  1JEV A;  4F1Y A;  1Y4T A;  2W7Y A;  3O6G A;  5I57 A;  3FUZ A;  1SI1 A;  1BTJ A;  1SBP A;  2CMO A;  1VSO A;  3RNN A;  4O3C A;  3O29 A;  4PF8 A;  1FBP A;  1LB8 A;  2F7C A;  4YKP A;  3R26 A;  4PDH A;  1IIW A;  4F3G A;  3V5A A;  3UOR A;  2ANJ A;  4IGR A;  1LFI A;  2KQZ A;  5IAI A;  1K9Y A;  1UTB B;  2P3N A;  1B05 A;  4BLA A;  1B5I A;  1LBX A;  4JB7 A;  4H8J A;  4ELO A;  3SEU A;  1IMB A;  3ZSF A;  5DW8 A;  3A3U A;  1CB6 A;  4NF5 B;  4JSD A;  3OMB A;  5AE4 A;  2VD2 A;  1OVT A;  1FJ6 A;  4H5F A;  5CMC A;  1QJM A;  4PDD A;  3K00 A;  2E0S A;  4XKQ A;  2H99 A;  3TOD A;  5I57 B;  1FPE A;  1MQI A;  2OJT A;  4BDM A;  4OXV A;  5IKB A;  1P1O A;  1FPD A;  2O69 A;  1LAX A;  4RJZ A;  2G29 A;  4F2Q A;  5LTC A;  5H8F B;  3E78 A;  1POY 1;  4ZEI A;  4R9F A;  4GX4 A;  2FHY A;  3S2V A;  1DMB A;  4P1E A;  4MMP A;  4ZED A;  5K2X A;  1LBY A;  2FNC A;  3HHF A;  3CG1 A;  4LQ2 A;  3V8X B;  2F7B A;  4POX A;  4MLV A;  1LST A;  4Z0I A;  5EYF A;  4BDN A;  3KJT A;  3VLU A;  2XXW A;  4HXV A;  1H3D A;  1NI9 A;  3LUY A;  4OVT A;  4GLI A;  2Y7I A;  5TPA A;  1IXG A;  1SYH A;  4LZ7 A;  2ALU A;  2V3Q A;  1MRP A;  4RYA A;  4GX6 A;  1Y1M A;  4I8C A;  3M3F A;  1B7Z A;  3I5O A;  3EPE A;  4PBH A;  2IA4 A;  2XXQ A;  4ZEB A;  3CI8 A;  1K9Z A;  4QSC A;  1B6H A;  2FIX A;  2CZK A;  3EHU A;  1Q35 A;  4RK9 A;  3SZP A;  4UA8 A;  1QW0 A;  2WKY A;  1XOC A;  1N76 A;  1B3H A;  4MJO A;  3QMF A;  5AA1 A;  4AB5 A;  1FSA A;  3MP1 A;  3KC0 A;  4OVJ A;  5KDT B;  1EYK A;  3ZKL A;  4BDQ A;  3NOH A;  4HCY A;  3RTF B;  2QVU A;  2ZNU A;  4PGP A;  4KI0 E;  1LFG A;  1Z7M E;  1MQJ A;  2A5T B;  3K02 A;  1MXY A;  3RTW B;  5I7I A;  4OER A;  2I48 A;  5LDZ A;  4OET A;  3LSX A;  4THI A;  3FBP A;  4H6D A;  4OFL A;  1URD A;  2OWZ A;  2Z8F A;  4BDR A;  3QK6 A;  2Q8M A;  3FAT A;  2DVC A;  4JVD A;  4RNS A;  3IAZ A;  5I56 A;  1B4H A;  2XX9 A;  1SI0 A;  3U1O A;  1LCT A;  1PB8 A;  3I3V A;  1SYI A;  4U22 A;  4G61 A;  3KBZ A;  4PQJ A;  2FVZ A;  1IQ7 A;  1FTO A;  1EZP A;  5I2N A;  4PFB A;  1FTK A;  2V3T A;  4PAI A;  1YCJ A;  4ND9 A;  2QSX A;  2Y84 A;  4MX6 A;  5J16 A;  1USY H;  4PAK A;  3MVZ A;  2X7P A;  3QSL A;  3FVK A;  4HS7 A;  4NED A;  1N84 A;  5JTY A;  5KCJ A;  3N6T A;  4G68 C;  3E9X A;  4GWW A;  2FA7 A;  4JSO A;  1DPP A;  4EF2 A;  4OA4 A;  2R8T A;  3ROJ A;  4QRZ A;  3MZ1 A;  1B5H A;  4PC9 A;  1MY2 A;  3MVY A;  3MP8 A;  3T9H B;  3IFA A;  5F1Q A;  2G93 A;  4H1X A;  4NWD A;  1J1N A;  4G8N A;  4GWZ A;  3CSB A;  4GWX A;  3T66 A;  1MY1 A;  2NUV A;  4JDF A;  5EHM A;  1HSJ A;  1SW5 A;  4PGN A;  3GLB A;  3IO4 A;  4MNI A;  1ZKB A;  1B0H A;  2XXK A;  3GZG A;  1N7W A;  4JBZ A;  4KFQ A;  1MXZ A;  1NFT A;  2Q74 A;  1NH7 A;  1RYO A;  1A54 A;  4PTK A;  1EZO A;  3TTM A;  2OBG A;  2OK2 A;  3IB2 A;  5DTB A;  3A09 A;  5I59 A;  5L8D A;  3MVW A;  3RPW A;  4KHZ E;  1RDX A;  1LGB C;  4N4U A;  4N07 A;  2VGQ A;  2AL5 A;  1B5J A;  4ECF A;  4OYV A;  2O7I A;  3H7M A;  5HM4 B;  4NG7 A;  3KN8 A;  4EXL A;  4N6D A;  3SET A;  1LFH A;  1MXW A;  3C35 A;  3FV1 A;  3KOS A;  2F78 A;  3EKI A;  2OZZ A;  5H8N A;  2R6G E;  5CC2 A;  3FJG A;  1POT A;  5DYH A;  4IO4 A;  4TLL B;  2I6E A;  3TYH A;  4MLQ A;  4DXC A;  2QMW A;  1JW5 A;  4PFT A;  2QJE A;  5I5P A;  2PFY A;  4K3F A;  5IZ1 A;  5JK4 A;  4EQB A;  2H4I A;  3OD7 A;  4KYS A;  5I59 B;  5HBC A;  1NV2 A;  2DXR A;  2HQ0 A;  3U93 A;  3KN3 A;  4HE0 A;  4F2O A;  4KYE A;  4EUO A;  4N6K A;  2VD3 A;  1H76 A;  4QSE A;  1GVC A;  3K6W A;  2OWS A;  2ESN A;  1DTZ A;  3FJ7 A;  3HFU A;  3QUF A;  3QYT A;  1Y3N A;  4ONY A;  5ET6 A;  1YTV A;  3N26 A;  2XXV A;  5DVJ A;  2F34 A;  1GR2 A;  2F6P A;  2B4L A;  3MQ9 A;  4R2F A;  2PMS A;  3PPR A;  5A5X B;  2RCB A;  2R71 A;  3SER A;  4GD5 A;  4MNC A;  2VHA A;  5I84 A;  2HPG A;  2I58 A;  3LBS A;  1IXI A;  4O3A A;  2XHD A;  2DXY A;  3G3J A;  1LBW A;  3B6Q A;  4N17 A;  1DOT A;  4NF4 B;  3G7W A;  3WAF A;  4F1U A;  4E0W A;  4TQU Q;  4L17 A;  2XD3 A;  4RXL A;  3EN3 A;  4N8Y A;  4KD5 A;  2XXH A;  1M5F A;  5HPQ A;  3GBA A;  3PUV E;  1MY3 A;  2YJP A;  4H45 A;  4F1V A;  4GFR A;  3HHG A;  2HXW A;  1MPC A;  3FZV A;  2GHB A;  4DDD A;  2I49 A;  2B4M A;  1NV3 A;  1EH3 A;  5IZZ A;  2B3B A;  4YKI A;  1WVJ A;  3SEV A;  3VVF A;  4P47 A;  2O84 X;  1KWH A;  2QS4 A;  2FBP A;  3H03 A;  1P1N A;  3C4M A;  4YMA A;  1FBD A;  3C9H A;  1ZLQ A;  5LOM A;  3B6W A;  4C1T A;  1SW4 A;  1Y20 A;  2F3B A;  5CMK A;  4X8R A;  4F3B A;  1NH8 A;  4KCC A;  4OHN A;  1UTB A;  2V84 A;  2Q89 A;  1Q9D A;  1NV1 A;  3VE1 B;  2PBW A;  3ZS6 A;  2UVG A;  1D4N A;  3RUM A;  4ZDM A;  4MBP A;  3H3G A;  4HTG A;  1N7X A;  4N81 A;  3KG2 A;  2P2A A;  2QS2 A;  3KJ7 A;  1FBG A;  1Y9U A;  5EQ8 A;  5B70 A;  2P3V A;  1TXF A;  4IO7 A;  2AIX A;  4NF8 B;  5EYH A;  5B7D A;  3PUZ E;  4OMB A;  4GWU A;  3R7X A;  1YAE A;  5AA4 B;  1FQE A;  2Q88 A;  4GBW A;  4G8H A;  1BP5 A;  3E4R A;  5H8F A;  2DOJ A;  5ESY A;  5ITO A;  1I6B A;  3PD9 A;  4I3E A;  1ZIU A;  2GQ1 A;  3CG3 A;  2WBB A;  1IMA A;  2HCA A;  5EHS A;  1MS7 A;  3K6U A;  1GV8 A;  4NMY A;  1P1U A;  3RYD A;  3THI A;  3FXQ A;  4QFP A;  4FJP A;  3B8B A;  4NX1 A;  3K01 A;  4NAP A;  1AH5 A;  2UVH A;  4I40 A;  4FAT A;  4FEB A;  4Q8R A;  2UYF A;  4R6Y A;  5TP9 B;  4DI4 B;  3TFL A;  2QRY A;  1P1Q A;  4YKJ A;  1GGG A;  2FYI A;  3M8U A;  4KCD A;  1JW1 A;  2AYS A;  4ISU A;  2F5X A;  1O7T A;  2DS9 A;  3ILU B;  3LC8 A;  1FBF A;  2F97 A;  1SW1 A;  4G2Z A;  5H8H B;  4QFO A;  3K6V A;  3SES A;  2H9B A;  1JQF A;  3MBP A;  3BKI B;  5ISU A;  4GIZ A;  1FPJ A;  4NF6 B;  4QFL A;  1RYX A;  1NV5 A;  3JV9 A;  3TCG A;  3S9L C;  4JWY A;  4GL0 A;  1IXC A;  5DEX B;  4OEU A;  1MY0 A;  1LAF E;  1MY4 A;  3VLW A;  1S9T A;  4F3S A;  2PYY A;  1OIB A;  1Y1Z A;  4PFI A;  3G3G A;  4NN3 A;  2VPO A;  1G0I A;  5KDT A;  1FBC A;  4EQ7 A;  4YIC A;  2F6G A;  3JYR A;  3RLF E; 
#chains in the Genus database with same CATH homology
 1PC3 A;  3DP4 A;  4OTE A;  1MXX A;  3HN0 A;  4WKM A;  2A5T A;  1FTM A;  3P7I A;  3FVG A;  2QL3 A;  1A99 A;  1A8F A;  2DP8 A;  3ODB A;  2M8C A;  1LB9 A;  3GXA A;  2I3V A;  2ONS A;  3OXN A;  4LVQ A;  4OES A;  1ANF A;  1ZTY A;  4ZEC A;  5DVI A;  3O6H A;  2QMX A;  3CRB A;  3HST A;  3CFL A;  4YZZ A;  5H8Q B;  1SDX A;  1MM6 A;  5M2V A;  3R6U A;  5FTH A;  3OO7 A;  2HZK A;  1QUI A;  4H8I A;  1OVB A;  1R9L A;  1Y3Q A;  2D21 A;  4WED A;  1FQB A;  3O28 A;  4U4S A;  2XXR A;  3CR9 A;  4ESX A;  2XXP A;  4LQ5 A;  3PMV A;  1T0K A;  4GF8 A;  4X1B A;  1UTH B;  2QS3 A;  4DLD A;  1TFD A;  2E1S A;  3C36 A;  4U1Z A;  1PEB A;  3EF7 A;  4OZ9 A;  4BDL A;  3TKD A;  3SEY A;  4NTL A;  5ELV A;  1HSL A;  1ZBM A;  2AL4 A;  3DLN A;  3FAS A;  2R9J A;  4FIM A;  1B3E A;  1B0L A;  5CMM A;  1MH3 A;  4XKR A;  4FE8 A;  4YB7 A;  2D3I A;  2Q9T A;  1Q1K A;  1LAG E;  1FQA A;  2XD2 A;  5J1D A;  3VVD A;  4GVO A;  1N3X A;  3F11 A;  1IUD A;  2ZYM A;  3TZA A;  3C34 A;  2KLF A;  1ATG A;  4MFI A;  4Q0C A;  1A55 A;  1JW4 A;  3FD3 A;  2REG A;  3DEL B;  3O2A A;  4UAC A;  1QKB A;  3TTL A;  1IIT A;  2DYX A;  2P1S A;  4G8M A;  4M4G A;  1EZ9 A;  1B4Z A;  4HCW A;  1DSN A;  3U94 A;  1GTK A;  1N0T A;  3RY3 A;  1MQD A;  1XC1 A;  2OLB A;  1IZ1 A;  2F35 A;  2DE3 A;  4F3P A;  2Z23 A;  2F36 A;  2ZNT A;  2NVU B;  1B51 A;  1LBC A;  1NNP A;  3ILT B;  5BUU A;  2I3W A;  4X9T A;  1USY E;  2I0C A;  3MPK A;  2RIN A;  1JET A;  4XKP A;  3SEW A;  4QFK A;  4LP2 B;  4F22 A;  3EQ1 A;  2O1M A;  3TEL A;  3ONM A;  4ELP A;  1VR5 A;  3C32 A;  5FTI A;  2UXA A;  5TU0 A;  1H45 A;  2ZNS A;  1R6Z A;  2PT2 A;  3D4C A;  4I1D A;  3U92 A;  4R75 A;  4X1D A;  4NE4 A;  4RK2 A;  1MQH A;  4I62 A;  1JVY A;  3CVG A;  2Q2C A;  5A5X A;  1FQC A;  1B7H A;  2DE4 A;  2I4B A;  3JZJ A;  2F8D A;  4BDO A;  1BLF A;  3KSJ A;  3TEP A;  3OEN A;  1VFD A;  3VXC A;  4LON B;  3OOA A;  2HAU A;  3A3C A;  3PPQ A;  3S9N C;  4QHQ A;  3FXR A;  1AOV A;  1B58 A;  2YPN A;  4NF4 A;  2XXY A;  4GRK A;  4ZZE A;  3MUQ A;  3C31 A;  3PUX E;  4DZ1 A;  3BBR A;  1IEJ A;  3FV2 A;  3L6G A;  1XVX A;  1URS A;  2X26 A;  2YLN A;  2PVU A;  2DWA A;  4GXA A;  3O97 A;  4R73 A;  1II5 A;  3FJM A;  1VFE A;  2RC7 A;  3Q26 A;  4U23 A;  4EXK A;  3MWB A;  1QUL A;  4MF3 A;  3Q27 A;  1OQH A;  4P0I A;  1Y4C A;  4ZEK A;  5AA2 B;  2XXU A;  4KQP A;  3V89 B;  3KFM A;  3RN8 A;  4H67 A;  2B3F A;  4OEV A;  3O9P A;  2HAV A;  3LSL A;  3I6V A;  1MXU A;  4U1O A;  3PGF A;  4GXS B;  1PDA A;  1L5T A;  4RA1 A;  2RC9 A;  4NWC A;  2O6A A;  4IB2 A;  3OEM A;  2D5W A;  4F19 A;  3T93 B;  5K2Y A;  5DVF A;  4N6P A;  2H25 A;  3EHT A;  2Z8E A;  3KGC A;  3VVE A;  3UGW A;  3MPL A;  3T96 B;  4R6H A;  1NNK A;  2DSF A;  2OWT A;  1XHY A;  4ZS9 A;  3O6I A;  1FTL A;  4RPN A;  4R9G A;  2DVZ A;  3RT8 A;  1BIY A;  2LAO A;  4NF8 A;  3TQW A;  3SDF A;  4Z7E A;  4DXU A;  5CRY A;  1DTG A;  5AA4 A;  4F29 A;  5KZT A;  4GQO A;  4IO6 A;  2XXX A;  3B7D A;  2Y7R A;  1XT8 A;  2DWJ A;  4QF9 A;  2ZMB A;  4H0W A;  3VLV A;  5CBR A;  1A8E A;  1RKM A;  3H06 B;  3K1N A;  3U72 A;  5I2K B;  3LSW A;  4G77 A;  3H6T A;  3PMW A;  5TP9 A;  4ZE8 A;  4DXB A;  3IL1 B;  1TT1 A;  4JWO A;  1LAH E;  4F31 B;  1I69 A;  4WXJ A;  4KYD A;  1JNF A;  3TTN A;  1MPB A;  3PU5 A;  3SKP A;  3DP6 A;  1B2H A;  5H8H A;  4DCY A;  1B3F A;  1UQW A;  2RKM A;  3HV1 A;  2HZL A;  1Y3P A;  1FCK A;  3H6V A;  3OSQ A;  1HSE A;  4ZZA A;  1PB7 A;  4NF6 A;  4GWO A;  2RC8 A;  3FIR A;  3WAE A;  1AIV A;  3PUW E;  3CSG A;  1QUK A;  1I6A A;  5DEX A;  5I58 B;  4XXU A;  1FW0 A;  3G3F A;  4G68 B;  1O64 A;  3UP9 A;  3CIJ A;  4DE8 A;  4XIG Q;  2O68 A;  2QPQ A;  3TMG A;  3VFJ A;  1MPD A;  1SQY A;  3K4U A;  4EF1 A;  3G3I A;  3MZ9 A;  1XVY A;  1OLA A;  5AA2 D;  3Q28 A;  3IOV A;  3IR1 A;  3KEI A;  4YB5 A;  3UA8 A;  3BFU A;  4LZ8 A;  3T22 A;  3K1P A;  5FHM A;  3EHS A;  3HPI A;  5DT6 A;  4PFY A;  4TOZ A;  4YU0 A;  1NL5 A;  3FXU A;  2DQV A;  2I0B A;  3GBB A;  1MDP 1;  3S9E A;  4XTC Q;  2Z8D A;  4R74 A;  1DPE A;  1FQF A;  3TCH A;  3W9W A;  5H8Q A;  1FTJ A;  1M5C A;  5BWJ A;  1H44 A;  1JEU A;  1WOD A;  4O3B A;  3M3K A;  3T9V A;  3T9X B;  4YAH X;  1NNT A;  2XX7 A;  2OCU A;  4QSD A;  4PP0 A;  3C33 A;  4YKK A;  4PET A;  2B65 A;  1M5D A;  1B52 A;  1LBB A;  1US5 A;  3UN6 A;  3O66 A;  3QIM A;  3H6W A;  2V3U A;  4FEC A;  1BKA A;  2A5S A;  1UTH A;  3QUJ A;  2GH9 A;  2X7Q A;  2H98 A;  2NXO A;  1UIU A;  4DCX A;  1D9Y A;  2PT1 A;  3IJO B;  4FED A;  2GHA A;  3FVO A;  3DM0 A;  4PFU A;  3S9M C;  4LUB A;  2Y7W A;  4DIG A;  1QUJ A;  5CI5 A;  3W9V A;  1LCF A;  3TCF A;  1MG1 A;  3CFX A;  4U21 A;  3AXF A;  1F9B A;  2ZYK A;  3KN7 A;  4G4P A;  3W15 C;  3UIF A;  3M3L A;  1PB9 A;  2GRV A;  4IO2 A;  3VXB A;  5TPA B;  3E3K A;  4C1U A;  1MM7 A;  3Q25 A;  4OEN A;  4C0R A;  1B1X A;  1B46 A;  2QS1 A;  3OSR A;  1B40 A;  2I4C A;  2HEU A;  2UVI A;  4ZE9 A;  4E0X A;  1R9Q A;  1NMU A;  2V93 A;  4N13 A;  4EQ9 A;  1TWY A;  4ESW A;  2DWH A;  4X48 A;  3KOT A;  4OWD A;  2IEE A;  3PV0 E;  4I9D A;  3IOR A;  4KPT A;  3TTK A;  2VP1 A;  3DP8 A;  1M5B A;  2Q8J A;  2ONR A;  3HO7 A;  5L9M A;  1PBP A;  5AA3 A;  3OEL A;  1MQG A;  1XS5 A;  1ZU0 A;  1H43 A;  3IJX B;  1VE4 A;  2ABH A;  2Q2A A;  4U2R A;  3LR1 A;  2H5Y A;  3IOT A;  3UK4 A;  1N04 A;  1TFA A;  4XKN A;  3RGY A;  3K2D A;  3PPO A;  1S7Y A;  3PUY E;  3SEX A;  5CMB A;  1SVX B;  1ZJL A;  5I56 B;  1AMF A;  2DE2 A;  3N5L A;  3RT6 B;  3OO9 A;  3OO8 A;  5I2N B;  3N6U A;  4KR5 A;  3L6H A;  4FOR A;  2O7U A;  1D9V A;  3H6U A;  3V83 A;  5L9O A;  4PFW A;  1B1H A;  4H65 A;  4H5G A;  2Z22 A;  1Z7N E;  5JTY B;  5KCJ B;  4RY1 A;  2RCA A;  3VV5 A;  4IGT A;  3HCQ A;  1CE2 A;  2XXT A;  1M5E A;  4HW8 A;  3IB0 A;  1MXV A;  4JWX A;  1ZMG A;  3MZB A;  2UVJ A;  2NWJ A;  2ZYO A;  4AB6 A;  1P99 A;  4IY6 A;  4OFO A;  3BFT A;  3OEK A;  4WEP A;  4F18 A;  5AA2 A;  4R2B A;  4IO5 A;  3PD8 A;  2PX1 A;  3IB1 A;  1QKA A;  2P0S A;  4LA9 A;  1B3G A;  2CZL A;  4RPO A;  3MP6 A;  3T9U A;  3Q29 A;  3CFZ A;  4QFN A;  3IO6 A;  4LAT A;  5F7V A;  1D3K A;  4P11 A;  4YB6 A;  1YPN A;  1OLC A;  5ITP A;  3QXM A;  1ELJ A;  3IOU A;  3FVN A;  3PPN A;  3E13 X;  3N94 A;  3KBR A;  1A7L A;  1R1N A;  4MH5 A;  1B9J A;  5FHO A;  1URG A;  1SW2 A;  2VOZ A;  3K0V A;  2ZXT A;  1AL3 A;  3H4Z A;  1MH4 A;  2Y7P A;  1PBQ A;  3ECR A;  3MJN A;  1FQD A;  3PMX A;  4Q30 B;  2HFB A;  1MDQ A;  5CBS A;  4YMB A;  2NOO A;  2DWI A;  5H8N B;  3IK6 B;  4OQO A;  2UYE A;  5CM6 A;  3B6T A;  2Y7K A;  4TLM B;  3TUS A;  1OQG A;  1O63 A;  3TDJ A;  2XX8 A;  1IXH A;  2THI A;  3MVX A;  3S4U A;  4JXI A;  4ELR A;  5JEI A;  5ICQ A;  4PE5 B;  5I2K A;  4IO3 A;  3MW0 A;  1I6Q A;  4POW A;  4AQ4 A;  3MAM A;  4ZEF A;  1A40 A;  2GFE A;  2XXI A;  2O51 A;  4R72 A;  2RF1 A;  1P1W A;  2BJJ X;  2V25 A;  4M1V A;  3QAX A;  3OO6 A;  3U8Q A;  3K6X A;  4GL8 A;  3K1M A;  2ZYN A;  5FHN A;  1S50 A;  2REJ A;  3FGS A;  1NNF A;  1UIV A;  3G3H A;  3LSF B;  5ICT A;  3KSX A;  4P0G A;  5I58 A;  1EU8 A;  3RQT A;  3TAJ A;  4G68 A;  1B3L A;  3IOW A;  3KZG A;  1N3W A;  4ELQ A;  3ZKK A;  4Q5T A;  3USD A;  4FAJ A;  3TQL A;  5L9S A;  3MC2 A;  4R6K A;  4LZ5 A;  2ONK E;  1OMP A;  4U4X A;  5H8S A;  4EDP A;  4IY5 A;  3D4G A;  1SD3 A;  3TTR A;  1WDN A;  1NKX A;  2O1L A;  1QVS A;  2F7A A;  4OFJ A;  1B32 A;  1LLS A;  3PPP A;  4F39 A;  1JVX A;  4NF5 A;  3VDF A;  3TPA A;  1US4 A;  4GOT A;  3G3K A;  3IX1 A;  1B7U A;  1JEV A;  4F1Y A;  1Y4T A;  2W7Y A;  3O6G A;  5I57 A;  3FUZ A;  1SI1 A;  1BTJ A;  1SBP A;  2CMO A;  1VSO A;  3RNN A;  4O3C A;  3O29 A;  1LB8 A;  2F7C A;  4YKP A;  3R26 A;  1IIW A;  4F3G A;  3V5A A;  3UOR A;  2ANJ A;  4IGR A;  1LFI A;  5IAI A;  1UTB B;  1B05 A;  4BLA A;  1B5I A;  4JB7 A;  4H8J A;  4ELO A;  3SEU A;  3ZSF A;  3A3U A;  1CB6 A;  4NF5 B;  4JSD A;  3OMB A;  5AE4 A;  2VD2 A;  1OVT A;  4H5F A;  5CMC A;  1QJM A;  3K00 A;  2E0S A;  4XKQ A;  2H99 A;  3TOD A;  5I57 B;  1MQI A;  2OJT A;  4BDM A;  4OXV A;  5IKB A;  1P1O A;  2O69 A;  1LAX A;  4RJZ A;  2G29 A;  4F2Q A;  5H8F B;  1POY 1;  4ZEI A;  4R9F A;  3S2V A;  1DMB A;  4ZED A;  5K2X A;  2FNC A;  3HHF A;  3CG1 A;  4LQ2 A;  3V8X B;  2F7B A;  4POX A;  4MLV A;  1LST A;  4Z0I A;  5EYF A;  4BDN A;  3KJT A;  3VLU A;  2XXW A;  1H3D A;  3LUY A;  4GLI A;  2Y7I A;  5TPA A;  1IXG A;  1SYH A;  4LZ7 A;  2ALU A;  2V3Q A;  1MRP A;  4RYA A;  1Y1M A;  4I8C A;  3M3F A;  1B7Z A;  3I5O A;  3EPE A;  2IA4 A;  2XXQ A;  4ZEB A;  3CI8 A;  4QSC A;  1B6H A;  3EHU A;  1Q35 A;  4RK9 A;  4UA8 A;  1QW0 A;  2WKY A;  1XOC A;  1N76 A;  1B3H A;  5AA1 A;  4AB5 A;  3MP1 A;  4OVJ A;  5KDT B;  3ZKL A;  4BDQ A;  4HCY A;  3RTF B;  2ZNU A;  4KI0 E;  1LFG A;  1Z7M E;  1MQJ A;  2A5T B;  3K02 A;  1MXY A;  3RTW B;  4OER A;  2I48 A;  4OET A;  3LSX A;  4THI A;  4H6D A;  4OFL A;  1URD A;  2Z8F A;  4BDR A;  3QK6 A;  3FAT A;  2DVC A;  4RNS A;  3IAZ A;  5I56 A;  1B4H A;  2XX9 A;  1SI0 A;  3U1O A;  1LCT A;  1PB8 A;  3I3V A;  1SYI A;  4U22 A;  4PQJ A;  1IQ7 A;  1FTO A;  1EZP A;  5I2N A;  1FTK A;  2V3T A;  1YCJ A;  4ND9 A;  2QSX A;  2Y84 A;  1USY H;  3MVZ A;  2X7P A;  3QSL A;  3FVK A;  4HS7 A;  4NED A;  1N84 A;  5JTY A;  5KCJ A;  3N6T A;  4G68 C;  3E9X A;  2FA7 A;  4JSO A;  1DPP A;  4EF2 A;  4QRZ A;  3MZ1 A;  1B5H A;  1MY2 A;  3MVY A;  3MP8 A;  3T9H B;  5F1Q A;  2G93 A;  4H1X A;  4NWD A;  1J1N A;  4G8N A;  3CSB A;  3T66 A;  1MY1 A;  2NUV A;  4JDF A;  5EHM A;  1HSJ A;  1SW5 A;  3GLB A;  3IO4 A;  1ZKB A;  1B0H A;  3GZG A;  1N7W A;  4JBZ A;  4KFQ A;  1MXZ A;  1NFT A;  1NH7 A;  1RYO A;  1A54 A;  1EZO A;  3TTM A;  2OBG A;  2OK2 A;  3IB2 A;  5DTB A;  3A09 A;  5I59 A;  5L8D A;  3MVW A;  3RPW A;  4KHZ E;  1LGB C;  4N07 A;  2VGQ A;  2AL5 A;  1B5J A;  4ECF A;  4OYV A;  2O7I A;  3H7M A;  5HM4 B;  3KN8 A;  4EXL A;  3SET A;  1LFH A;  1MXW A;  3C35 A;  3FV1 A;  3KOS A;  2F78 A;  2OZZ A;  5H8N A;  2R6G E;  5CC2 A;  3FJG A;  1POT A;  5DYH A;  4IO4 A;  4TLL B;  2I6E A;  3TYH A;  4MLQ A;  4DXC A;  2QMW A;  1JW5 A;  4PFT A;  2QJE A;  4K3F A;  5JK4 A;  4EQB A;  2H4I A;  3OD7 A;  4KYS A;  5I59 B;  5HBC A;  2DXR A;  2HQ0 A;  3U93 A;  3KN3 A;  4F2O A;  4KYE A;  4EUO A;  2VD3 A;  1H76 A;  4QSE A;  1GVC A;  3K6W A;  2OWS A;  2ESN A;  1DTZ A;  3FJ7 A;  3QUF A;  3QYT A;  1Y3N A;  4ONY A;  1YTV A;  3N26 A;  2XXV A;  5DVJ A;  2F34 A;  1GR2 A;  2F6P A;  3MQ9 A;  4R2F A;  2PMS A;  3PPR A;  5A5X B;  2RCB A;  2R71 A;  3SER A;  4GD5 A;  2VHA A;  5I84 A;  2I58 A;  3LBS A;  1IXI A;  4O3A A;  2XHD A;  2DXY A;  3G3J A;  3B6Q A;  1DOT A;  4NF4 B;  3G7W A;  3WAF A;  4F1U A;  4E0W A;  4TQU Q;  4L17 A;  2XD3 A;  4RXL A;  3EN3 A;  4KD5 A;  2XXH A;  1M5F A;  5HPQ A;  3GBA A;  3PUV E;  1MY3 A;  2YJP A;  4F1V A;  4GFR A;  3HHG A;  2HXW A;  1MPC A;  3FZV A;  2GHB A;  4DDD A;  2I49 A;  1EH3 A;  2B3B A;  4YKI A;  1WVJ A;  3SEV A;  3VVF A;  2O84 X;  1KWH A;  2QS4 A;  3H03 A;  1P1N A;  3C4M A;  4YMA A;  3C9H A;  1ZLQ A;  5LOM A;  3B6W A;  4C1T A;  1SW4 A;  1Y20 A;  5CMK A;  4F3B A;  1NH8 A;  4KCC A;  4OHN A;  1UTB A;  2V84 A;  2Q89 A;  3VE1 B;  2PBW A;  3ZS6 A;  2UVG A;  1D4N A;  3RUM A;  4ZDM A;  4MBP A;  3H3G A;  4HTG A;  1N7X A;  3KG2 A;  2P2A A;  2QS2 A;  3KJ7 A;  1Y9U A;  5B70 A;  1TXF A;  4IO7 A;  2AIX A;  4NF8 B;  5B7D A;  3PUZ E;  4OMB A;  3R7X A;  1YAE A;  5AA4 B;  1FQE A;  2Q88 A;  4G8H A;  1BP5 A;  3E4R A;  5H8F A;  2DOJ A;  5ITO A;  1I6B A;  3PD9 A;  1ZIU A;  3CG3 A;  2HCA A;  5EHS A;  1MS7 A;  3K6U A;  1GV8 A;  4NMY A;  1P1U A;  3THI A;  3FXQ A;  4QFP A;  4FJP A;  3K01 A;  1AH5 A;  2UVH A;  4FAT A;  4FEB A;  4Q8R A;  2UYF A;  4R6Y A;  5TP9 B;  3TFL A;  2QRY A;  1P1Q A;  4YKJ A;  1GGG A;  2FYI A;  3M8U A;  4KCD A;  1JW1 A;  2AYS A;  4ISU A;  2F5X A;  1O7T A;  2DS9 A;  3ILU B;  3LC8 A;  2F97 A;  1SW1 A;  4G2Z A;  5H8H B;  4QFO A;  3K6V A;  3SES A;  2H9B A;  1JQF A;  3MBP A;  3BKI B;  5ISU A;  4GIZ A;  4NF6 B;  4QFL A;  1RYX A;  3JV9 A;  3TCG A;  3S9L C;  4JWY A;  4GL0 A;  1IXC A;  5DEX B;  4OEU A;  1MY0 A;  1LAF E;  1MY4 A;  3VLW A;  1S9T A;  4F3S A;  2PYY A;  1OIB A;  1Y1Z A;  3G3G A;  5KDT A;  4EQ7 A;  4YIC A;  2F6G A;  3JYR A;  3RLF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...