3CG3A

Crystal structure of p. horikoshii periplasmic binding protein moda/wtpa with bound tungstate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
315
structure length
315
Chain Sequence
SREARLIIFHAGSLSIPLSQVEEKFTKYAQEKLGVKVTFQDEASGSVKAVRKVTDLKKRADIVAVADYTLIPQLMIPNYTDFYVLFATNEIVIAFTNKSKYADEMLKNPDKWYEILSRPDVSFGFSDPNQDPCGYRSVMVMKLAELYYGRPIFKELVEKTTNIYSNGTRIYAPKEIIIKDKRVIMRPKETDLVGLVESGSLDYIFIYKSVAKQHHLSYITLPDDINLGDFNKADFYGRVSITLGSTGKTIKAKPIVYGITVLKNAPNRELAIEFLRFLLGNEGRKIFEDNYQEFLSPPVAFGNVPPEIRRLVEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0100 protein PH0151
publication title Distorted octahedral coordination of tungstate in a subfamily of specific binding proteins.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 111
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cg3A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3cg3A01
3HHFA 3G3IA 4HCWA 1B3GA 4ELPA 1I6QA 1P1UA 2FNCA 1OMPA 2Y7WA 3B7DA 4FIMA 3SEXA 1LAXA 3O2AA 5I57A 2F7CA 1BKAA 3SETA 1P1NA 3U92A 3G3KA 2HZKA 1FTOA 1IXIA 1AMFA 4RY1A 3T9UA 5DVFA 3QUFA 3LSWA 4YKJA 1XT8A 1OLAA 4ECFA 4DXCA 1ZBMA 1MS7A 2P1SA 1VSOA 2XXRA 3TCFA 1B4ZA 3FVNA 5HBCA 1NNFA 1JEVA 1IIWA 3RTWB 1WODA 4KPTA 1DOTA 3Q26A 2PYYA 2H98A 4QFNA 4OVJA 3WAFA 2ZYNA 1MXUA 4XKRA 3TPAA 4FJPA 1M5BA 4QSDA 3K6UA 4F2OA 2NUVA 1B7ZA 4HCYA 1SYIA 2LAOA 4YMAA 4ZZEA 4NF4B 2DE4A 2ZXTA 1H44A 5CRYA 3OMBA 1ZU0A 1PBQA 3SEUA 2Q8JA 1QUJA 1RYXA 3VVFA 4UACA 3WAEA 2XXIA 2QL3A 4QSEA 2F8DA 4Q30B 1MXVA 4WXJA 4NMYA 4IO5A 4RJZA 4IGRA 3S9EA 3HHGA 2AIXA 1QVSA 1UQWA 5B7DA 4OEUA 5JTYA 2QS4A 3TTKA 3R6UA 1M5EA 1SI1A 3VVDA 5ELVA 1A40A 1VFDA 3ONMA 2RCAA 5F7VA 4G8HA 2BJJX 3GLBA 3FIRA 4KD5A 3B6QA 1B4HA 3EF7A 4POWA 2O51A 5HM4B 2H99A 1S50A 3TCHA 3BBRA 4AB6A 2DE3A 2F7BA 3VFJA 1MY0A 4H8IA 4DXBA 3KGCA 1JW4A 4MLQA 1URSA 1D9YA 3C4MA 1FQDA 4WKMA 2B3FA 4DCYA 2Z23A 5I59B 3C35A 2F97A 3TTMA 1POTA 3KN7A 2D3IA 3DELB 4QRZA 4ZE8A 1DTZA 1UTBB 1LAHE 4G77A 3TTRA 1IXGA 4U22A 4JDFA 5KCJB 4NEDA 2O1MA 4OWDA 2F6PA 3VLUA 1ZTYA 3FASA 2R6GE 4XXUA 3DLNA 1BLFA 4NF6B 4BLAA 1AOVA 1I6AA 2HXWA 4DIGA 3I6VA 2NVUB 3FVOA 5AA3A 1VFEA 1OVBA 5IKBA 1GTKA 4GVOA 1B2HA 1GGGA 2F6GA 5TU0A 4M4GA 3HCQA 1B52A 2ZYKA 3K1NA 4LQ2A 2QS1A 1D3KA 4JWXA 4LUBA 4OFOA 1NNKA 5H8FA 1UTHA 4GFRA 4PFUA 1QJMA 1MXXA 3OELA 1AH5A 3PMWA 5DYHA 4L17A 3CG3A 4KYSA 4RPNA 4KI0E 1EH3A 1MDP1 5FTIA 2QSXA 3FXRA 1A99A 5M2VA 3BKIB 1MDQA 3S9NC 4JWOA 1FQFA 5AA2A 4N6PA 4AQ4A 4LA9A 1MY4A 5ITOA 1Y4TA 4GXSB 2Z8FA 1N0TA 4GWOA 2YJPA 3N5LA 3K0VA 3CVGA 1GVCA 2GH9A 1B3HA 3LSLA 3K2DA 3BFTA 2G29A 3TCGA 1B58A 1SW4A 1LFIA 3IO6A 3O6HA 1QUKA 2ZNUA 1N7XA 4RYAA 4ZECA 4LP2B 4FE8A 3VLWA 4UA8A 1R6ZA 3TYHA 4I8CA 1ANFA 2Z8EA 3MUQA 2Y7KA 3K02A 3T9HB 4C0RA 1MY1A 3H6UA 4G4PA 5I2KB 1AL3A 2QMWA 3QIMA 2VOZA 1MQGA 1P1OA 2B65A 3MVXA 5TPAA 4PETA 2V93A 3HN0A 4GL0A 1S9TA 2THIA 4IB2A 5ICQA 3QXMA 3O9PA 3FXUA 3IB1A 2WKYA 3KJ7A 3OXNA 2GHBA 1RYOA 5H8SA 1BP5A 3KFMA 4OENA 3JYRA 2ONRA 4R9FA 1B5HA 1B05A 1Y3QA 3ZSFA 2HQ0A 4KQPA 4X1BA 2UVIA 3KOTA 1MPCA 4GL8A 3MW0A 4F3GA 3MQ9A 2X26A 3PGFA 1N84A 1PB8A 3CRBA 2A5TA 2OCUA 5AA1A 3O97A 2PT2A 4NF5B 3RGYA 3QUJA 4KYDA 4LZ8A 1NH7A 4IY6A 3G7WA 4IO3A 5FTHA 4BDOA 1OQGA 1NKXA 2HFBA 5DEXB 4G8MA 1NNPA 3S4UA 3MC2A 4O3CA 4LZ7A 3U94A 1UIUA 3L6HA 2DXRA 3M3LA 1H43A 5ICTA 1KWHA 1MM7A 5H8NB 4NE4A 5L9OA 1JEUA 4XKNA 1DSNA 4ZEDA 1LAGE 5CMCA 1OQHA 5KZTA 1HSEA 2Q2CA 3UGWA 1YPNA 3RQTA 3ZKKA 4O3AA 4YICA 3MP8A 1MXYA 5AA4B 3EQ1A 1JNFA 2I3VA 1SVXB 1OIBA 2NOOA 1TT1A 3FJGA 2V3TA 3H6TA 3OEMA 3E9XA 3A3UA 2AYSA 1J1NA 4EQ7A 4TOZA 4I1DA 2GRVA 1FQAA 5AA2D 3T93B 4IY5A 3MP1A 2RC8A 3MP6A 4U2RA 4NWDA 4ELRA 4OHNA 1FCKA 5TP9B 2DWHA 4N13A 1PC3A 1FTKA 3PPQA 1AIVA 3OO9A 3PD9A 5CI5A 3TUSA 3G3JA 3KSXA 3M3KA 4THIA 4P0IA 3PD8A 4KHZE 2XX9A 2Q9TA 3K1PA 1USYH 4G8NA 3OO6A 2FYIA 5L9MA 2R9JA 3PMVA 2RINA 4TQUQ 3MZ1A 2DQVA 2HCAA 4R6KA 2ZNSA 5EHSA 2D5WA 2RC7A 5AE4A 3KG2A 3K6WA 2OZZA 2Q88A 4DDDA 4U1ZA 2F34A 2QS2A 3R7XA 3C32A 5A5XB 3ZS6A 3PUVE 3M3FA 3Q28A 1YTVA 4O3BA 3B6WA 1ZMGA 4U1OA 5KDTA 2PMSA 3W9WA 5DVJA 4MLVA 1N7WA 2H25A 3MPKA 5LOMA 3S9MC 4IO7A 2DWJA 1L5TA 2V3UA 4OEVA 1B40A 4LONB 2DWIA 3TQLA 3TKDA 2AL4A 4KCCA 3GXAA 4F2QA 1URDA 4OZ9A 5I57B 3MVZA 3H7MA 4IO4A 1FW0A 4R75A 2X7PA 4F3BA 5CBRA 2OBGA 1EZ9A 4H8JA 4NF6A 4ZZAA 1R9LA 3ODBA 1SQYA 2IEEA 3Q27A 3EHUA 3V89B 2YPNA 3K00A 5EHMA 3OENA 4TLLB 1B0HA 4ISUA 3H4ZA 3O6IA 3PUYE 1LAFE 4OTEA 4PFWA 3RY3A 1SW2A 3CFLA 1US4A 1Q35A 3TEPA 4QFPA 3CIJA 1P1WA 1TFAA 5H8QA 1IQ7A 3A09A 1HSLA 1FTMA 3DP4A 3U93A 4MFIA 3ZKLA 3KN8A 2O6AA 2XXQA 3KOSA 1FQCA 5BWJA 1JQFA 3W15C 4BDRA 3QK6A 2VHAA 2XD3A 4EF1A 5IAIA 1ATGA 4HTGA 3S9LC 2F78A 2I0CA 1M5CA 3MVWA 1IITA 3C36A 5K2YA 3FV2A 3MWBA 2DVZA 4OQOA 3H6VA 3FVGA 3IOVA 1N76A 1XC1A 4F3SA 2CMOA 3A3CA 5JTYB 1Y3PA 4X9TA 3O66A 2ANJA 5DVIA 1JW1A 3FD3A 2XXPA 5I2NA 3TDJA 3DM0A 5L9SA 3K4UA 3PPOA 3IB2A 2CZLA 1MY3A 1PEBA 3OOAA 3KEIA 1D4NA 2XXYA 4OERA 1Z7NE 1EU8A 1B1HA 2HAVA 3C34A 2ALUA 2XXXA 2VD2A 2XX8A 4DLDA 3VDFA 3SKPA 1O64A 1N04A 4RNSA 1IUDA 3IORA 5K2XA 5I2KA 1LCTA 1Y1MA 1DPPA 3UN6A 1H76A 3FVKA 3IJOB 4Q5TA 4YKIA 1NMUA 4LVQA 3O6GA 3EHSA 4PFYA 3ECRA 5DTBA 3UORA 1RKMA 1USYE 1MQJA 4ZDMA 4R2FA 3U72A 3F11A 3DP6A 2V25A 3QYTA 3UA8A 2O7IA 3FJMA 4GD5A 3TQWA 4U4XA 4XIGQ 4FEDA 3BFUA 5ITPA 2H4IA 3D4CA 4X1DA 3TZAA 4YB6A 1UTHB 4ELOA 1OVTA 1MH4A 1H45A 3SERA 3LR1A 4NF5A 4R73A 2YLNA 1LLSA 4WEDA 1MH3A 5I56B 4YB5A 3PU5A 4IGTA 5CM6A 2QS3A 5J1DA 4X48A 4H1XA 2Y7IA 2XXVA 3CSBA 2ONSA 3FZVA 3OO8A 4JSDA 3RNNA 5AA2B 2QMXA 3T9VA 3C31A 3TTLA 5DEXA 1XVXA 1LB9A 1MY2A 1A54A 1EZOA 3H03A 4ZS9A 2F35A 4PQJA 2O1LA 1ZLQA 3VE1B 4AB5A 1I69A 1SD3A 5H8NA 4RK2A 2OLBA 2ZYMA 5L8DA 3E3KA 4GIZA 4G68B 3B6TA 1QKAA 1B0LA 3T22A 1GR2A 2M8CA 1JVYA 2GFEA 1UIVA 4Q8RA 3TMGA 3FXQA 1B5IA 4FATA 3RLFE 5AA4A 3CI8A 1GV8A 5H8HB 3HSTA 4BDLA 4F1UA 2X7QA 4ONYA 4EUOA 4E0WA 4WEPA 2UYFA 4EDPA 1ZJLA 4KYEA 3TAJA 2DOJA 4JWYA 1DPEA 4NF8A 1N3XA 1JVXA 4M1VA 2HEUA 1LBCA 4EQ9A 5EYFA 2DXYA 4YKPA 3G3GA 4RXLA 3SDFA 1OLCA 3QAXA 4H67A 4LZ5A 1PB7A 3R26A 3H06B 4F18A 4EQBA 3OSQA 2DVCA 1NL5A 2UYEA 1QW0A 2ZMBA 4DXUA 4GXAA 4OFLA 3HO7A 1H3DA 2O69A 3MBPA 2XD2A 5CMMA 3IJXB 3U8QA 1SW1A 4MBPA 1ZKBA 3N6TA 2OWSA 1B7UA 4G68C 3CFXA 3HV1A 2A5TB 3TTNA 1LFGA 5HPQA 1MQHA 4DZ1A 1TFDA 2ESNA 1HSJA 1SBPA 2RC9A 2XHDA 2DS9A 1XOCA 5A5XA 1CE2A 3M8UA 4NF4A 3T66A 4R2BA 3N6UA 4E0XA 3JZJA 4OYVA 2GHAA 4F31B 3K6VA 2FA7A 3KN3A 3RPWA 4QHQA 3G3FA 4I9DA 5I58B 3ILTB 1II5A 1R1NA 3FGSA 2I0BA 3MVYA 1QULA 4H5FA 2Z22A 2VP1A 3SESA 3SEVA 4EXKA 1Q1KA 2Q2AA 3EHTA 1SYHA 4LATA 4JXIA 3IOWA 4F19A 5BUUA 1B1XA 4OESA 3K6XA 3E4RA 2UVGA 2NWJA 1MG1A 4GQOA 2OK2A 3H3GA 1VE4A 5CMKA 2DE2A 4HW8A 4F22A 2PBWA 2ZYOA 5B70A 4IO2A 1EZPA 3OO7A 2F7AA 4F1YA 3Q29A 5DT6A 4KR5A 1XHYA 3CR9A 1B6HA 1D9VA 1FTLA 1WVJA 1IXHA 3QSLA 2VD3A 5I59A 2O7UA 2I49A 1YAEA 3SEWA 4H5GA 3K01A 1N3WA 1UTBA 4PFTA 5JEIA 4P0GA 4OETA 3EPEA 5KCJA 1XS5A 3I3VA 2RF1A 5CMBA 2ABHA 4ZEFA 1MQDA 4R74A 1R9QA 2XXTA 2VGQA 4ZEKA 1B3LA 3JV9A 4GF8A 1IZ1A 1P99A 4ZEIA 4I62A 2R71A 2DSFA 4OFJA 2PVUA 3S2VA 3L6GA 1LGBC 4FAJA 1LBBA 3PUZE 3IR1A 3GZGA 3MPLA 1A8EA 4XTCQ 2UVHA 2G93A 4RA1A 4JBZA 3TELA 3TODA 5KDTB 4H6DA 2DWAA 2I4CA 3D4GA 4GOTA 2P0SA 2Z8DA 4F1VA 3USDA 1A8FA 3UK4A 3CG1A 3G3HA 3UP9A 2F5XA 4MH5A 4C1TA 3HPIA 1B3FA 2REJA 4TLMB 4XKPA 4PP0A 2OWTA 5JK4A 3IAZA 3PUWE 1O63A 3PV0E 3LUYA 3IX1A 2UXAA 2DYXA 2W7YA 4ESWA 3KSJA 3H6WA 2XXUA 2QRYA 1FQBA 1BIYA 2ONKE 4K3FA 1MXWA 5FHOA 4QFLA 4R72A 3DP8A 1B7HA 3VVEA 3P7IA 4YAHX 4EF2A 3PPPA 4G2ZA 2HZLA 1TXFA 2RCBA 4DE8A 2Y84A 3ILUB 2V84A 4YKKA 1PDAA 2P2AA 4F39A 3IOTA 3IB0A 4MF3A 3V8XB 5F1QA 1S7YA 5H8QB 1Y1ZA 4QFKA 4DCXA 1Y4CA 3Q25A 2Q89A 4F3PA 4ZE9A 1PB9A 3THIA 2D21A 1POY1 3SEYA 4QF9A 3VV5A 4JSOA 5I56A 1A55A 1F9BA 4BDMA 2H5YA 1XVYA 4YMBA 3T9XB 4NWCA 2E1SA 3CSGA 2B3BA 2RKMA 1B51A 1MRPA 3I5OA 2UVJA 3MJNA 1DMBA 3RT8A 3FV1A 5FHNA 4LQ5A 1FQEA 5CBSA 1Y20A 1B46A 2OJTA 4QFOA 2XXWA 5I84A 2AL5A 4G68A 4YB7A 4ND9A 5I2NB 2XXHA 3FUZA 4YZZA 4Z7EA 1Y3NA 5H8FB 4U21A 4EXLA 3IK6B 4XKQA 3RT6B 3PPNA 1MM6A 5H8HA 4HS7A 3IL1B 1ELJA 2I58A 1IXCA 2QJEA 4KCDA 3K1MA 4F29A 4QSCA 1P1QA 5FHMA 3RN8A 1LB8A 3KJTA 1PBPA 1YCJA 2F36A 1Z7ME 3TFLA 1A7LA 1M5DA 3MZBA 3V5AA 4POXA 3AXFA 4Z0IA 3VXCA 1DTGA 3VXBA 3PPRA 1SW5A 2PX1A 2I4BA 4PE5B 3T96B 2O68A 1Y9UA 1MPBA 2REGA 3UIFA 2HAUA 4NTLA 3PMXA 4KFQA 1MXZA 3FATA 1MPDA 4U23A 4C1UA 1URGA 4FECA 1ZIUA 1T0KA 4FEBA 1B32A 2KLFA 3OEKA 4GRKA 1MQIA 1O7TA 4FORA 3N94A 3U1OA 3EN3A 2I3WA 1QUIA 1BTJA 2I6EA 4OXVA 3MZ9A 4N07A 4R6HA 3CFZA 3IO4A 3O28A 3OSRA 4Q0CA 5TP9A 3V83A 4H0WA 5TPAB 3C33A 1NFTA 2A5SA 2IA4A 1B3EA 4YU0A 2Y7RA 1QKBA 2ZNTA 1NNTA 4GLIA 3GBAA 1US5A 3IOUA 5I58A 3KBRA 3LC8A 1IEJA 3RUMA 4RK9A 1JW5A 4ESXA 3PUXE 4ZEBA 2XX7A 1VR5A 4ELQA 2V3QA 1FTJA 4P11A 1LFHA 5CC2A 3MAMA 3LSXA 1B9JA 3C9HA 3VLVA 1JETA 3E13X 1SI0A 1CB6A 1LCFA 4JB7A 3O29A 3KZGA 1I6BA 1SDXA 3LBSA 1LSTA 4R9GA 2E0SA 4OMBA 4H65A 2QPQA 5ISUA 1NH8A 2O84X 4BDQA 4BDNA 4U4SA 2I48A 2DP8A 2PT1A 4IO6A 4RPOA 3RTFB 3LSFB 3W9VA 3GBBA 1TWYA 3FJ7A 4NF8B 2NXOA 1M5FA 1WDNA 2H9BA 1B5JA 2Y7PA 3OD7A 4R6YA 3N26A
chains in the Genus database with same CATH superfamily
3HHFA 3G3IA 4HCWA 1B3GA 4ELPA 1I6QA 1P1UA 2FNCA 1BK4A 1OMPA 2Y7WA 3B7DA 4FIMA 3SEXA 1LAXA 3O2AA 5I57A 2F7CA 1DCUA 1BKAA 3SETA 1P1NA 3U92A 1FPEA 3G3KA 2HZKA 1FTOA 1IXIA 1AMFA 2WX9A 4RY1A 3RPLB 3T9UA 5DVFA 3QUFA 3LSWA 2WYPA 4YKJA 1XT8A 1OLAA 4ECFA 4DXCA 1ZBMA 1MS7A 2P1SA 1VSOA 2XXRA 3TCFA 1B4ZA 3FVNA 5HBCA 1NNFA 4O8MA 1JEVA 1IIWA 3E79A 3RTWB 2QVRA 1WODA 4KPTA 4G61A 1DOTA 3Q26A 2PYYA 2H98A 4QFNA 4OVJA 3WAFA 2ZYNA 1MXUA 4XKRA 3TPAA 4FJPA 1M5BA 4QSDA 3K6UA 4F2OA 4MIJA 4O7IA 2NUVA 1B7ZA 4HCYA 1SYIA 2LAOA 2FHYA 4GX4A 4YMAA 4ZZEA 4NF4B 2DE4A 2ZXTA 1H44A 5CRYA 3OMBA 1ZU0A 1PBQA 1FJ6A 3SEUA 2Q8JA 1QUJA 1RYXA 3VVFA 4UACA 3WAEA 2XXIA 5F24A 4P3LA 2QL3A 4QSEA 4P8BA 2F8DA 4Q30B 2XWKA 1MXVA 4WXJA 4NMYA 4IO5A 4RJZA 4IGRA 3S9EA 3HHGA 2AIXA 1QVSA 1UQWA 5B7DA 4OEUA 4GWUA 5JTYA 2QS4A 1YYZA 4GWYA 3TTKA 3R6UA 1M5EA 1SI1A 4NGUA 1FPGA 3VVDA 5ELVA 1A40A 1VFDA 3ONMA 2RCAA 5F7VA 5IGAA 4G8HA 2BJJX 3GLBA 3FIRA 4KD5A 3B6QA 1B4HA 5I5PA 3EF7A 4DI3D 4POWA 2O51A 5HM4B 2H99A 4P1LA 1S50A 3TCHA 3BBRA 4AB6A 2DE3A 2F7BA 3VFJA 1MY0A 4H8IA 4DXBA 3KGCA 1JW4A 4MLQA 1URSA 1D9YA 2OWZA 3C4MA 1FQDA 3MYUA 4WKMA 4GBVA 2B3FA 4DCYA 2Z23A 5I59B 3C35A 2F97A 3TTMA 1POTA 3KN7A 2D3IA 3DELB 4QRZA 4ZE8A 1DTZA 1IMDA 1UTBB 1LAHE 4G77A 4O94A 3TTRA 1IXGA 4U22A 4JDFA 5KCJB 4NEDA 2O1MA 4OWDA 2F6PA 1NUXA 3VLUA 1ZTYA 3FASA 4OVPA 2R6GE 4XXUA 3KC1A 3DLNA 1BLFA 4NF6B 4BLAA 1AOVA 3FXBA 1I6AA 2HXWA 1NV7A 4DIGA 3I6VA 2PCRA 2NVUB 3FVOA 5AA3A 1VFEA 1OVBA 5IKBA 3MSTA 1GTKA 4GVOA 1B2HA 1GGGA 2F6GA 1G0IA 5TU0A 4M4GA 3HCQA 5ET5A 5EYGA 1B52A 2ZYKA 3K1NA 4LQ2A 2QS1A 1D3KA 4JWXA 4LUBA 4OFOA 1NNKA 5H8FA 1NUZA 1UTHA 4GFRA 4PFUA 1QJMA 1MXXA 3OELA 1AH5A 3PMWA 5DYHA 4L17A 3CG3A 4KYSA 4RPNA 4KI0E 1EH3A 1MDP1 2QSXA 5FTIA 1YZ0A 3FXRA 1A99A 4GWSA 3IFAA 5M2VA 3BKIB 1MDQA 3S9NC 4JWOA 1FQFA 5AA2A 2VPNA 4N6PA 4AQ4A 4LA9A 1MY4A 5ITOA 3QMFA 1Y4TA 4GXSB 2Z8FA 1N0TA 4GWOA 2YJPA 3N5LA 3K0VA 3CVGA 1GVCA 2GH9A 1B3HA 3LSLA 4I40A 3K2DA 2R8TA 3BFTA 2G29A 1IMCA 3CHGA 3TCGA 1B58A 1SW4A 1LFIA 2XA5A 5EYHA 3IO6A 3O6HA 1QUKA 1LBZA 2ZNUA 1N7XA 4RYAA 4ZECA 2WYKA 4LP2B 4FE8A 3VLWA 1FBCA 4UA8A 1R6ZA 3TYHA 4I8CA 1ANFA 2Z8EA 5J16A 3MUQA 2Y7KA 3K02A 3T9HB 4C0RA 1MY1A 3H6UA 4G4PA 5I2KB 1AL3A 2QMWA 3QIMA 2VOZA 4IR8A 1MQGA 1FBHA 1FBPA 1P1OA 2B65A 3MVXA 4MNIA 5TPAA 4PETA 2V93A 3HN0A 4GL0A 1S9TA 2THIA 4IB2A 5ICQA 3QXMA 3O9PA 3FXUA 3IB1A 2WKYA 1LEVA 2FBPA 1FPJA 3KJ7A 3OXNA 2GHBA 5T3JA 4N8GA 5EQ7A 1RYOA 5H8SA 1BP5A 3KFMA 1KA0A 2FVZA 4OENA 3JYRA 2ONRA 4R9FA 1B5HA 1B05A 1Y3QA 3ZSFA 2HQ0A 2QVUA 4KQPA 4X1BA 2UVIA 3KOTA 1MPCA 4GL8A 3MW0A 2WBBA 4F3GA 3MQ9A 2X26A 3PGFA 1N84A 1PB8A 3CRBA 2A5TA 2OCUA 4GBWA 5AA1A 3O97A 2PT2A 4NF5B 4NX1A 3RGYA 3QUJA 4KYDA 4LZ8A 1NH7A 4IY6A 3G7WA 4IO3A 4N91A 5FTHA 1NV3A 4BDOA 1OQGA 1NKXA 2HFBA 5DEXB 4MHFA 2FIXA 4G8MA 1NNPA 3S4UA 3MC2A 3NOHA 4O3CA 4LZ7A 3U94A 1UIUA 3L6HA 2XWVA 2DXRA 3M3LA 1H43A 5ICTA 1KWHA 1MM7A 1Q9DA 5H8NB 4NE4A 5L9OA 1JEUA 4O7MA 4XKNA 1DSNA 4PBQA 4XEQA 4ZEDA 1LAGE 5CMCA 1FSAA 1OQHA 5KZTA 1HSEA 2Q2CA 3UGWA 1YPNA 3HFUA 3PTYA 3KC0A 3RQTA 3ZKKA 3RPLA 4O3AA 4XF5A 4YICA 3MP8A 1MXYA 5AA4B 3EQ1A 1JNFA 2I3VA 1SVXB 1OIBA 2NOOA 1TT1A 2QVVA 3FJGA 2XWOA 2V3TA 3H6TA 3OEMA 3E9XA 3A3UA 4QXDA 2AYSA 1J1NA 1FJ9A 4EQ7A 4TOZA 4I1DA 2GRVA 1FQAA 5AA2D 3T93B 4IY5A 3MP1A 2RC8A 2P3VA 1FBDA 3MP6A 4U2RA 4NWDA 4ELRA 4OHNA 1FCKA 5TP9B 2DWHA 4N13A 1PC3A 1FTKA 3PPQA 1AIVA 3OO9A 3PD9A 5CI5A 3TUSA 3G3JA 3KSXA 3M3KA 4THIA 4P0IA 3PD8A 4KHZE 2XX9A 2Q9TA 2ZZVA 3K1PA 2Y5KA 1USYH 4G8NA 4PGPA 3OO6A 1FPBA 2F3BA 2FYIA 5L9MA 2Q74A 2R9JA 3PMVA 2RINA 4TQUQ 3MZ1A 2DQVA 2HCAA 4R6KA 2ZNSA 5EHSA 2D5WA 4GX6A 2RC7A 5IZ3A 5AE4A 3KG2A 3K6WA 2OZZA 4N81A 2Q88A 5IM2A 4DDDA 4U1ZA 2F34A 2QS2A 3R7XA 4H45A 1EYJA 1NV6A 3C32A 5A5XB 3ZS6A 2VT5A 3D1RA 3PUVE 3M3FA 3Q28A 1YTVA 4O3BA 3B6WA 1ZMGA 4U1OA 5KDTA 2PMSA 3W9WA 5DVJA 4MLVA 4HXVA 1N7WA 2H25A 3MPKA 5LOMA 3S9MC 3SZPA 4IO7A 2DWJA 1L5TA 2V3UA 4OEVA 1B40A 4LONB 2DWIA 3TQLA 1IMAA 3TKDA 3B8BA 1FPDA 2AL4A 4KCCA 3GXAA 4F2QA 2B4LA 1URDA 4OZ9A 5I57B 3MVZA 3H7MA 4IO4A 1FW0A 4PDDA 5ET8A 4R75A 2CZKA 2X7PA 4F3BA 5CBRA 2OBGA 1EZ9A 4H8JA 4NF6A 4ZZAA 4NQ8A 1R9LA 3ODBA 1SQYA 2IEEA 3Q27A 3EHUA 3V89B 2YPNA 2Y5LA 3K00A 5EHMA 3OENA 4PAKA 4TLLB 1B0HA 4ISUA 3H4ZA 3O6IA 3PUYE 1LAFE 4MNPA 4OTEA 4PFWA 3RY3A 1SW2A 3CFLA 1US4A 1Q35A 3TEPA 4QFPA 3CIJA 1P1WA 1TFAA 5H8QA 1IQ7A 4N17A 3A09A 1HSLA 1FTMA 3DP4A 3U93A 4MFIA 3ZKLA 3KN8A 2O6AA 2XXQA 5EQ8A 2WEFA 3KOSA 2WBDA 1FQCA 5BWJA 1JQFA 3W15C 4BDRA 3QK6A 2VHAA 4P9KA 2XD3A 4EF1A 5IAIA 1ATGA 2KR0A 4HTGA 3S9LC 2F78A 2HHMA 3A29A 2FIEA 2I0CA 1M5CA 3MVWA 1IITA 1FBFA 3C36A 5K2YA 2XXKA 2VPOA 1DK4A 3FV2A 3MWBA 2DVZA 4OQOA 4PGNA 3H6VA 3FVGA 3IOVA 1N76A 1XC1A 4F3SA 2CMOA 3A3CA 5JTYB 1Y3PA 4X9TA 3O66A 2ANJA 4MJOA 5DVIA 1JW1A 3FD3A 3LUZA 2XXPA 5I2NA 3TDJA 3DM0A 5L9SA 3K4UA 3PPOA 5A5LA 3IB2A 2CZLA 4NAPA 1MY3A 4X8RA 1PEBA 3OOAA 3KEIA 4PCDA 1D4NA 2XXYA 2XWIA 4OERA 3IFCA 1Z7NE 1EU8A 1B1HA 4P56A 2HAVA 3C34A 2ALUA 1NV2A 2XXXA 2VD2A 2XX8A 4DLDA 1JP4A 3VDFA 3SKPA 1O64A 4JVCA 1N04A 4RNSA 2ZZXA 1IUDA 3IORA 5K2XA 5I2KA 1LCTA 1QGXA 1Y1MA 1DPPA 3UN6A 1H76A 3FVKA 3IJOB 4Q5TA 4YKIA 1NMUA 4LVQA 1LBVA 4PFRA 3O6GA 3EHSA 4N6KA 4PFYA 3ECRA 1IMEA 5DTBA 3UORA 1RKMA 1USYE 1MQJA 5LTCA 4ZDMA 4R2FA 1FPLA 3U72A 3F11A 3DP6A 4PAIA 2V25A 3QYTA 4PBHA 3UA8A 2O7IA 3FJMA 4GD5A 3TQWA 4U4XA 4MEVA 4XIGQ 4FEDA 2HXRA 4PFIA 3BFUA 5ITPA 1EYKA 2H4IA 2HPGA 3BIGA 1IMBA 3D4CA 4X1DA 3TZAA 4YB6A 1UTHB 4ELOA 1OVTA 1MH4A 1H45A 4GWXA 3SERA 3LR1A 4NF5A 4R73A 2YLNA 1LLSA 4WEDA 1MH3A 5I56B 4YB5A 4X04A 3PU5A 4IGTA 5CM6A 2QS3A 2CEYA 5J1DA 4X48A 4H1XA 2Y7IA 2XXVA 3CSBA 2ONSA 3FZVA 3OO8A 4JSDA 3RNNA 5AA2B 2QMXA 1KZ8A 3T9VA 3C31A 3TTLA 5DEXA 5ET6A 1XVXA 1LB9A 4NN3A 1MY2A 4PDHA 1A54A 4JVDA 1EZOA 3H03A 4ZS9A 2F35A 4PQJA 2O1LA 1ZLQA 4P1EA 3VE1B 4AB5A 1I69A 1SD3A 4HE1A 4N6DA 4PFBA 4RK2A 5H8NA 1K9ZA 2OLBA 2ZYMA 5L8DA 3E3KA 2GQ1A 4GIZA 5IZ1A 4G68B 3B6TA 1QKAA 1B0LA 3T22A 1GR2A 2M8CA 1JVYA 2GFEA 1UIVA 4Q8RA 3TMGA 2PFYA 3FXQA 1B5IA 4I3EA 4FATA 3RLFE 2JJKA 5AA4A 3CI8A 1GV8A 5H8HB 3HSTA 4BDLA 4F1UA 2CZIA 2X7QA 4ONYA 2CEXA 4EUOA 3ISPA 4E0WA 4WEPA 2UYFA 5FBPA 4EDPA 1ZJLA 4OVRA 2CZHA 4KYEA 3TAJA 4GWZA 2DOJA 4JWYA 1DPEA 4NF8A 1N3XA 1JVXA 4UABA 4M1VA 4DI4B 2HEUA 1LBCA 4EQ9A 5EYFA 2DXYA 4YKPA 2V4CA 3G3GA 4N4UA 4FBPA 1RDZA 4RXLA 3SDFA 1OLCA 3QAXA 4H67A 4LZ5A 1PB7A 3R26A 3H06B 4F18A 4EQBA 3OSQA 2DVCA 1NL5A 2UYEA 1QW0A 2ZMBA 4HE2A 4DXUA 5EQAA 4GXAA 4OFLA 3HO7A 1H3DA 2O69A 3MBPA 2XD2A 5CMMA 3IJXB 3U8QA 1SW1A 4MBPA 1ZKBA 3N6TA 2OWSA 1B7UA 4G68C 2PFZA 3CFXA 5I7IA 3HV1A 2A5TB 4HE0A 3TTNA 1LFGA 5HPQA 3KBZA 1MQHA 4DZ1A 1TFDA 2ESNA 1HSJA 1SBPA 2RC9A 2XHDA 2DS9A 1XOCA 4AS5A 2OX3A 5A5XA 5ESYA 1CE2A 2DDKA 3M8UA 1LBXA 4NF4A 3T66A 4R2BA 3N6UA 4E0XA 3JZJA 4OYVA 4KXPA 2GHAA 4F31B 3K6VA 1NUWA 2FA7A 1YXIA 3KN3A 3RPWA 4OA4A 4QHQA 1INPA 3G3FA 1RDXA 4I9DA 5I58B 2L5VA 3ILTB 1G0HA 1II5A 1R1NA 3FGSA 2I0BA 3MVYA 1QULA 1FPKA 4H5FA 4N15A 2Z22A 2VP1A 3SESA 3SEVA 4EXKA 4P47A 1Q1KA 2Q2AA 3EHTA 1SYHA 4LATA 4JXIA 3IOWA 4F19A 5BUUA 1B1XA 4OESA 3K6XA 3E4RA 2UVGA 2NWJA 1MG1A 4GQOA 4MX6A 2OK2A 3H3GA 1VE4A 5CMKA 2DE2A 4HW8A 4F22A 2PBWA 2ZYOA 5B70A 5LDZA 5I3SA 4IO2A 1EZPA 3OO7A 2B4MA 2KQZA 2BJIA 4GWWA 2F7AA 4F1YA 3GYYA 3Q29A 5DT6A 1FBEA 4KR5A 1XHYA 3CR9A 1B6HA 1D9VA 1FTLA 1WVJA 1IXHA 1CNQA 3QSLA 2VD3A 5I59A 2O7UA 2I49A 1YAEA 3SEWA 4H5GA 3K01A 1N3WA 1UTBA 4PTKA 4PFTA 2Q8MA 5JEIA 4P0GA 4OETA 3EPEA 5KCJA 1XS5A 3I3VA 2RF1A 5CMBA 1KA1A 2ABHA 4ZEFA 4NF0A 1MQDA 4R74A 1R9QA 2XXTA 2VGQA 3T0JA 4ZEKA 1B3LA 3JV9A 4GF8A 1IZ1A 1P99A 4ZEIA 4I62A 1NV5A 2R71A 5IZ3B 1AWBA 2DSFA 4OFJA 2PVUA 3S2VA 3L6GA 1LGBC 4FAJA 1LBBA 3PUZE 3IR1A 3GZGA 3MPLA 4LN5A 1A8EA 4XTCQ 2UVHA 2G93A 4RA1A 4JBZA 4OVTA 3TELA 3TODA 4MNCA 5KDTB 4PE3A 1NV0A 4H6DA 2DWAA 2I4CA 3D4GA 1SPIA 4GOTA 2P0SA 2Z8DA 4F1VA 3USDA 1A8FA 3UK4A 3CG1A 3G3HA 3UP9A 2F5XA 4MH5A 4C1TA 3HPIA 1B3FA 2REJA 4TLMB 4XKPA 4AS4A 4PP0A 2OWTA 1NV1A 5JK4A 3IAZA 3PUWE 1O63A 3PV0E 3LUYA 3IX1A 2UXAA 2DYXA 2W7YA 4ESWA 3KSJA 3H6WA 2XXUA 2QRYA 1FQBA 1BIYA 2ONKE 3E78A 4K3FA 1MXWA 1DBZA 5FHOA 4QFLA 4R72A 3DP8A 1B7HA 3VVEA 3P7IA 4YAHX 4EF2A 3PPPA 4G2ZA 2HZLA 1TXFA 2RCBA 4QBAA 3ROJA 4DE8A 2MKZA 2Y84A 3ILUB 2V84A 4YKKA 5DW8A 1PDAA 1LBYA 2P2AA 4F39A 3IOTA 3IB0A 4MF3A 3V8XB 5F1QA 1S7YA 5H8QB 4H46A 4I3YA 1Y1ZA 4QFKA 4DCXA 1Y4CA 3Q25A 2Q89A 4F3PA 4ZE9A 1PB9A 3THIA 4MMPA 2D21A 1POY1 3SEYA 4QF9A 3VV5A 4JSOA 1XI6A 5I56A 1A55A 4NHBA 1F9BA 4BDMA 2H5YA 1XVYA 4YMBA 3T9XB 3U65A 4NWCA 2E1SA 3CSGA 2B3BA 2RKMA 1B51A 1MRPA 3I5OA 2UVJA 3MJNA 1DMBA 3RT8A 3T1BA 3FV1A 5FHNA 4LQ5A 1FQEA 5CBSA 1Y20A 1B46A 4OVQA 2OJTA 4QFOA 2XXWA 5I84A 2AL5A 4G68A 4YB7A 4ND9A 5I2NB 2XXHA 3FUZA 4YZZA 4Z7EA 1Y3NA 1IMFA 5H8FB 4U21A 4EXLA 1LBWA 3IK6B 4XKQA 3RT6B 3PPNA 1MM6A 4OANA 2ZZWA 5H8HA 1FPFA 4HS7A 3IL1B 1ELJA 2I58A 1IXCA 2QJEA 4KCDA 3K1MA 4F29A 4QSCA 4PAFA 1P1QA 4JVIA 4NG7A 5FHMA 3RN8A 1LB8A 3KJTA 1PBPA 1YCJA 2F36A 1Z7ME 3TFLA 1A7LA 4N8YA 1M5DA 3MZBA 3V5AA 4POXA 3AXFA 4Z0IA 3VXCA 1FPIA 3LV0A 1DTGA 3VXBA 3PPRA 1FBGA 1SW5A 2PX1A 2I4BA 4PE5B 3T96B 4OVSA 2O68A 2P3NA 1Y9UA 5ET7A 1MPBA 2REGA 3UIFA 2HAUA 4NTLA 4MCOA 3PMXA 1VDWA 4KFQA 1FRPA 1MXZA 3FATA 1MPDA 4U23A 4C1UA 1URGA 4FECA 1ZIUA 1T0KA 4FEBA 1B32A 2KLFA 3OEKA 4GRKA 1MQIA 1O7TA 4FORA 3N94A 3U1OA 3EN3A 3BIHA 2I3WA 1QUIA 3FBPA 1BTJA 2I6EA 4PF6A 4OXVA 3MZ9A 1NUYA 4N07A 4R6HA 3CFZA 3IO4A 3O28A 4PC9A 3OSRA 4Q0CA 5TP9A 3V83A 4GX3A 4H0WA 3EKIA 5TPAB 3C33A 1D9QA 1NFTA 2A5SA 2IA4A 1B3EA 4YU0A 2Y7RA 1QKBA 1NV4A 2ZNTA 1NNTA 4GLIA 3GBAA 1US5A 3IOUA 5I58A 3KBRA 3LC8A 1IEJA 3RUMA 1EYIA 4RK9A 1JW5A 4ESXA 3PUXE 4ZEBA 2XX7A 1VR5A 4ELQA 2V3QA 1FTJA 4P11A 1LFHA 5CC2A 3MAMA 3LSXA 1B9JA 2QFLA 5EQ9A 3B50A 3C9HA 3VLVA 1JETA 3E13X 1SI0A 1CB6A 1LCFA 4JB7A 3O29A 1FTAA 2F3DA 3KZGA 1I6BA 4XFEA 1SDXA 3LBSA 1LSTA 4R9GA 2E0SA 4OMBA 4H65A 2QPQA 5ISUA 1NH8A 2O84X 5IZZA 4BDQA 4BDNA 4U4SA 1NI9A 2I48A 4MAGA 1K9YA 2DP8A 2PT1A 4IO6A 4RPOA 3RTFB 3LSFB 1RDYA 4PF8A 3W9VA 3RYDA 3GBBA 1TWYA 3FJ7A 4NF8B 2NXOA 1M5FA 1WDNA 2H9BA 1B5JA 2Y7PA 3OD7A 4R6YA 3N26A
chains in the Genus database with same CATH topology
3HHFA 3G3IA 4HCWA 1B3GA 4ELPA 1I6QA 1P1UA 2FNCA 1OMPA 2Y7WA 3B7DA 4FIMA 3SEXA 1LAXA 3O2AA 5I57A 2F7CA 1BKAA 3SETA 1P1NA 3U92A 3G3KA 2HZKA 1FTOA 1IXIA 1AMFA 4RY1A 3T9UA 5DVFA 3QUFA 3LSWA 4YKJA 1XT8A 1OLAA 4ECFA 4DXCA 1ZBMA 1MS7A 2P1SA 1VSOA 2XXRA 3TCFA 1B4ZA 3FVNA 5HBCA 1NNFA 1JEVA 1IIWA 3RTWB 1WODA 4KPTA 1DOTA 3Q26A 2PYYA 2H98A 4QFNA 4OVJA 3WAFA 2ZYNA 1MXUA 4XKRA 3TPAA 4FJPA 1M5BA 4QSDA 3K6UA 4F2OA 2NUVA 1B7ZA 4HCYA 1SYIA 2LAOA 4YMAA 4ZZEA 4NF4B 2DE4A 2ZXTA 1H44A 5CRYA 3OMBA 1ZU0A 1PBQA 3SEUA 2Q8JA 1QUJA 1RYXA 3VVFA 4UACA 3WAEA 2XXIA 2QL3A 4QSEA 2F8DA 4Q30B 1MXVA 4WXJA 4NMYA 4IO5A 4RJZA 4IGRA 3S9EA 3HHGA 2AIXA 1QVSA 1UQWA 5B7DA 4OEUA 5JTYA 2QS4A 3TTKA 3R6UA 1M5EA 1SI1A 3VVDA 5ELVA 1A40A 1VFDA 3ONMA 2RCAA 5F7VA 4G8HA 2BJJX 3GLBA 3FIRA 4KD5A 3B6QA 1B4HA 3EF7A 4POWA 2O51A 5HM4B 2H99A 1S50A 3TCHA 3BBRA 4AB6A 2DE3A 2F7BA 3VFJA 1MY0A 4H8IA 4DXBA 3KGCA 1JW4A 4MLQA 1URSA 1D9YA 3C4MA 1FQDA 4WKMA 2B3FA 4DCYA 2Z23A 5I59B 3C35A 2F97A 3TTMA 1POTA 3KN7A 2D3IA 3DELB 4QRZA 4ZE8A 1DTZA 1UTBB 1LAHE 4G77A 3TTRA 1IXGA 4U22A 4JDFA 5KCJB 4NEDA 2O1MA 4OWDA 2F6PA 3VLUA 1ZTYA 3FASA 2R6GE 4XXUA 3DLNA 1BLFA 4NF6B 4BLAA 1AOVA 1I6AA 2HXWA 4DIGA 3I6VA 2NVUB 3FVOA 5AA3A 1VFEA 1OVBA 5IKBA 1GTKA 4GVOA 1B2HA 1GGGA 2F6GA 5TU0A 4M4GA 3HCQA 1B52A 2ZYKA 3K1NA 4LQ2A 2QS1A 1D3KA 4JWXA 4LUBA 4OFOA 1NNKA 5H8FA 1UTHA 4GFRA 4PFUA 1QJMA 1MXXA 3OELA 1AH5A 3PMWA 5DYHA 4L17A 3CG3A 4KYSA 4RPNA 4KI0E 1EH3A 1MDP1 5FTIA 2QSXA 3FXRA 1A99A 5M2VA 3BKIB 1MDQA 3S9NC 4JWOA 1FQFA 5AA2A 4N6PA 4AQ4A 4LA9A 1MY4A 5ITOA 1Y4TA 4GXSB 2Z8FA 1N0TA 4GWOA 2YJPA 3N5LA 3K0VA 3CVGA 1GVCA 2GH9A 1B3HA 3LSLA 3K2DA 3BFTA 2G29A 3TCGA 1B58A 1SW4A 1LFIA 3IO6A 3O6HA 1QUKA 2ZNUA 1N7XA 4RYAA 4ZECA 4LP2B 4FE8A 3VLWA 4UA8A 1R6ZA 3TYHA 4I8CA 1ANFA 2Z8EA 3MUQA 2Y7KA 3K02A 3T9HB 4C0RA 1MY1A 3H6UA 4G4PA 5I2KB 1AL3A 2QMWA 3QIMA 2VOZA 1MQGA 1P1OA 2B65A 3MVXA 5TPAA 4PETA 2V93A 3HN0A 4GL0A 1S9TA 2THIA 4IB2A 5ICQA 3QXMA 3O9PA 3FXUA 3IB1A 2WKYA 3KJ7A 3OXNA 2GHBA 1RYOA 5H8SA 1BP5A 3KFMA 4OENA 3JYRA 2ONRA 4R9FA 1B5HA 1B05A 1Y3QA 3ZSFA 2HQ0A 4KQPA 4X1BA 2UVIA 3KOTA 1MPCA 4GL8A 3MW0A 4F3GA 3MQ9A 2X26A 3PGFA 1N84A 1PB8A 3CRBA 2A5TA 2OCUA 5AA1A 3O97A 2PT2A 4NF5B 3RGYA 3QUJA 4KYDA 4LZ8A 1NH7A 4IY6A 3G7WA 4IO3A 5FTHA 4BDOA 1OQGA 1NKXA 2HFBA 5DEXB 4G8MA 1NNPA 3S4UA 3MC2A 4O3CA 4LZ7A 3U94A 1UIUA 3L6HA 2DXRA 3M3LA 1H43A 5ICTA 1KWHA 1MM7A 5H8NB 4NE4A 5L9OA 1JEUA 4XKNA 1DSNA 4ZEDA 1LAGE 5CMCA 1OQHA 5KZTA 1HSEA 2Q2CA 3UGWA 1YPNA 3RQTA 3ZKKA 4O3AA 4YICA 3MP8A 1MXYA 5AA4B 3EQ1A 1JNFA 2I3VA 1SVXB 1OIBA 2NOOA 1TT1A 3FJGA 2V3TA 3H6TA 3OEMA 3E9XA 3A3UA 2AYSA 1J1NA 4EQ7A 4TOZA 4I1DA 2GRVA 1FQAA 5AA2D 3T93B 4IY5A 3MP1A 2RC8A 3MP6A 4U2RA 4NWDA 4ELRA 4OHNA 1FCKA 5TP9B 2DWHA 4N13A 1PC3A 1FTKA 3PPQA 1AIVA 3OO9A 3PD9A 5CI5A 3TUSA 3G3JA 3KSXA 3M3KA 4THIA 4P0IA 3PD8A 4KHZE 2XX9A 2Q9TA 3K1PA 1USYH 4G8NA 3OO6A 2FYIA 5L9MA 2R9JA 3PMVA 2RINA 4TQUQ 3MZ1A 2DQVA 2HCAA 4R6KA 2ZNSA 5EHSA 2D5WA 2RC7A 5AE4A 3KG2A 3K6WA 2OZZA 2Q88A 4DDDA 4U1ZA 2F34A 2QS2A 3R7XA 3C32A 5A5XB 3ZS6A 3PUVE 3M3FA 3Q28A 1YTVA 4O3BA 3B6WA 1ZMGA 4U1OA 5KDTA 2PMSA 3W9WA 5DVJA 4MLVA 1N7WA 2H25A 3MPKA 5LOMA 3S9MC 4IO7A 2DWJA 1L5TA 2V3UA 4OEVA 1B40A 4LONB 2DWIA 3TQLA 3TKDA 2AL4A 4KCCA 3GXAA 4F2QA 1URDA 4OZ9A 5I57B 3MVZA 3H7MA 4IO4A 1FW0A 4R75A 2X7PA 4F3BA 5CBRA 2OBGA 1EZ9A 4H8JA 4NF6A 4ZZAA 1R9LA 3ODBA 1SQYA 2IEEA 3Q27A 3EHUA 3V89B 2YPNA 3K00A 5EHMA 3OENA 4TLLB 1B0HA 4ISUA 3H4ZA 3O6IA 3PUYE 1LAFE 4OTEA 4PFWA 3RY3A 1SW2A 3CFLA 1US4A 1Q35A 3TEPA 4QFPA 3CIJA 1P1WA 1TFAA 5H8QA 1IQ7A 3A09A 1HSLA 1FTMA 3DP4A 3U93A 4MFIA 3ZKLA 3KN8A 2O6AA 2XXQA 3KOSA 1FQCA 5BWJA 1JQFA 3W15C 4BDRA 3QK6A 2VHAA 2XD3A 4EF1A 5IAIA 1ATGA 4HTGA 3S9LC 2F78A 2I0CA 1M5CA 3MVWA 1IITA 3C36A 5K2YA 3FV2A 3MWBA 2DVZA 4OQOA 3H6VA 3FVGA 3IOVA 1N76A 1XC1A 4F3SA 2CMOA 3A3CA 5JTYB 1Y3PA 4X9TA 3O66A 2ANJA 5DVIA 1JW1A 3FD3A 2XXPA 5I2NA 3TDJA 3DM0A 5L9SA 3K4UA 3PPOA 3IB2A 2CZLA 1MY3A 1PEBA 3OOAA 3KEIA 1D4NA 2XXYA 4OERA 1Z7NE 1EU8A 1B1HA 2HAVA 3C34A 2ALUA 2XXXA 2VD2A 2XX8A 4DLDA 3VDFA 3SKPA 1O64A 1N04A 4RNSA 1IUDA 3IORA 5K2XA 5I2KA 1LCTA 1Y1MA 1DPPA 3UN6A 1H76A 3FVKA 3IJOB 4Q5TA 4YKIA 1NMUA 4LVQA 3O6GA 3EHSA 4PFYA 3ECRA 5DTBA 3UORA 1RKMA 1USYE 1MQJA 4ZDMA 4R2FA 3U72A 3F11A 3DP6A 2V25A 3QYTA 3UA8A 2O7IA 3FJMA 4GD5A 3TQWA 4U4XA 4XIGQ 4FEDA 3BFUA 5ITPA 2H4IA 3D4CA 4X1DA 3TZAA 4YB6A 1UTHB 4ELOA 1OVTA 1MH4A 1H45A 3SERA 3LR1A 4NF5A 4R73A 2YLNA 1LLSA 4WEDA 1MH3A 5I56B 4YB5A 3PU5A 4IGTA 5CM6A 2QS3A 5J1DA 4X48A 4H1XA 2Y7IA 2XXVA 3CSBA 2ONSA 3FZVA 3OO8A 4JSDA 3RNNA 5AA2B 2QMXA 3T9VA 3C31A 3TTLA 5DEXA 1XVXA 1LB9A 1MY2A 1A54A 1EZOA 3H03A 4ZS9A 2F35A 4PQJA 2O1LA 1ZLQA 3VE1B 4AB5A 1I69A 1SD3A 5H8NA 4RK2A 2OLBA 2ZYMA 5L8DA 3E3KA 4GIZA 4G68B 3B6TA 1QKAA 1B0LA 3T22A 1GR2A 2M8CA 1JVYA 2GFEA 1UIVA 4Q8RA 3TMGA 3FXQA 1B5IA 4FATA 3RLFE 5AA4A 3CI8A 1GV8A 5H8HB 3HSTA 4BDLA 4F1UA 2X7QA 4ONYA 4EUOA 4E0WA 4WEPA 2UYFA 4EDPA 1ZJLA 4KYEA 3TAJA 2DOJA 4JWYA 1DPEA 4NF8A 1N3XA 1JVXA 4M1VA 2HEUA 1LBCA 4EQ9A 5EYFA 2DXYA 4YKPA 3G3GA 4RXLA 3SDFA 1OLCA 3QAXA 4H67A 4LZ5A 1PB7A 3R26A 3H06B 4F18A 4EQBA 3OSQA 2DVCA 1NL5A 2UYEA 1QW0A 2ZMBA 4DXUA 4GXAA 4OFLA 3HO7A 1H3DA 2O69A 3MBPA 2XD2A 5CMMA 3IJXB 3U8QA 1SW1A 4MBPA 1ZKBA 3N6TA 2OWSA 1B7UA 4G68C 3CFXA 3HV1A 2A5TB 3TTNA 1LFGA 5HPQA 1MQHA 4DZ1A 1TFDA 2ESNA 1HSJA 1SBPA 2RC9A 2XHDA 2DS9A 1XOCA 5A5XA 1CE2A 3M8UA 4NF4A 3T66A 4R2BA 3N6UA 4E0XA 3JZJA 4OYVA 2GHAA 4F31B 3K6VA 2FA7A 3KN3A 3RPWA 4QHQA 3G3FA 4I9DA 5I58B 3ILTB 1II5A 1R1NA 3FGSA 2I0BA 3MVYA 1QULA 4H5FA 2Z22A 2VP1A 3SESA 3SEVA 4EXKA 1Q1KA 2Q2AA 3EHTA 1SYHA 4LATA 4JXIA 3IOWA 4F19A 5BUUA 1B1XA 4OESA 3K6XA 3E4RA 2UVGA 2NWJA 1MG1A 4GQOA 2OK2A 3H3GA 1VE4A 5CMKA 2DE2A 4HW8A 4F22A 2PBWA 2ZYOA 5B70A 4IO2A 1EZPA 3OO7A 2F7AA 4F1YA 3Q29A 5DT6A 4KR5A 1XHYA 3CR9A 1B6HA 1D9VA 1FTLA 1WVJA 1IXHA 3QSLA 2VD3A 5I59A 2O7UA 2I49A 1YAEA 3SEWA 4H5GA 3K01A 1N3WA 1UTBA 4PFTA 5JEIA 4P0GA 4OETA 3EPEA 5KCJA 1XS5A 3I3VA 2RF1A 5CMBA 2ABHA 4ZEFA 1MQDA 4R74A 1R9QA 2XXTA 2VGQA 4ZEKA 1B3LA 3JV9A 4GF8A 1IZ1A 1P99A 4ZEIA 4I62A 2R71A 2DSFA 4OFJA 2PVUA 3S2VA 3L6GA 1LGBC 4FAJA 1LBBA 3PUZE 3IR1A 3GZGA 3MPLA 1A8EA 4XTCQ 2UVHA 2G93A 4RA1A 4JBZA 3TELA 3TODA 5KDTB 4H6DA 2DWAA 2I4CA 3D4GA 4GOTA 2P0SA 2Z8DA 4F1VA 3USDA 1A8FA 3UK4A 3CG1A 3G3HA 3UP9A 2F5XA 4MH5A 4C1TA 3HPIA 1B3FA 2REJA 4TLMB 4XKPA 4PP0A 2OWTA 5JK4A 3IAZA 3PUWE 1O63A 3PV0E 3LUYA 3IX1A 2UXAA 2DYXA 2W7YA 4ESWA 3KSJA 3H6WA 2XXUA 2QRYA 1FQBA 1BIYA 2ONKE 4K3FA 1MXWA 5FHOA 4QFLA 4R72A 3DP8A 1B7HA 3VVEA 3P7IA 4YAHX 4EF2A 3PPPA 4G2ZA 2HZLA 1TXFA 2RCBA 4DE8A 2Y84A 3ILUB 2V84A 4YKKA 1PDAA 2P2AA 4F39A 3IOTA 3IB0A 4MF3A 3V8XB 5F1QA 1S7YA 5H8QB 1Y1ZA 4QFKA 4DCXA 1Y4CA 3Q25A 2Q89A 4F3PA 4ZE9A 1PB9A 3THIA 2D21A 1POY1 3SEYA 4QF9A 3VV5A 4JSOA 5I56A 1A55A 1F9BA 4BDMA 2H5YA 1XVYA 4YMBA 3T9XB 4NWCA 2E1SA 3CSGA 2B3BA 2RKMA 1B51A 1MRPA 3I5OA 2UVJA 3MJNA 1DMBA 3RT8A 3FV1A 5FHNA 4LQ5A 1FQEA 5CBSA 1Y20A 1B46A 2OJTA 4QFOA 2XXWA 5I84A 2AL5A 4G68A 4YB7A 4ND9A 5I2NB 2XXHA 3FUZA 4YZZA 4Z7EA 1Y3NA 5H8FB 4U21A 4EXLA 3IK6B 4XKQA 3RT6B 3PPNA 1MM6A 5H8HA 4HS7A 3IL1B 1ELJA 2I58A 1IXCA 2QJEA 4KCDA 3K1MA 4F29A 4QSCA 1P1QA 5FHMA 3RN8A 1LB8A 3KJTA 1PBPA 1YCJA 2F36A 1Z7ME 3TFLA 1A7LA 1M5DA 3MZBA 3V5AA 4POXA 3AXFA 4Z0IA 3VXCA 1DTGA 3VXBA 3PPRA 1SW5A 2PX1A 2I4BA 4PE5B 3T96B 2O68A 1Y9UA 1MPBA 2REGA 3UIFA 2HAUA 4NTLA 3PMXA 4KFQA 1MXZA 3FATA 1MPDA 4U23A 4C1UA 1URGA 4FECA 1ZIUA 1T0KA 4FEBA 1B32A 2KLFA 3OEKA 4GRKA 1MQIA 1O7TA 4FORA 3N94A 3U1OA 3EN3A 2I3WA 1QUIA 1BTJA 2I6EA 4OXVA 3MZ9A 4N07A 4R6HA 3CFZA 3IO4A 3O28A 3OSRA 4Q0CA 5TP9A 3V83A 4H0WA 5TPAB 3C33A 1NFTA 2A5SA 2IA4A 1B3EA 4YU0A 2Y7RA 1QKBA 2ZNTA 1NNTA 4GLIA 3GBAA 1US5A 3IOUA 5I58A 3KBRA 3LC8A 1IEJA 3RUMA 4RK9A 1JW5A 4ESXA 3PUXE 4ZEBA 2XX7A 1VR5A 4ELQA 2V3QA 1FTJA 4P11A 1LFHA 5CC2A 3MAMA 3LSXA 1B9JA 3C9HA 3VLVA 1JETA 3E13X 1SI0A 1CB6A 1LCFA 4JB7A 3O29A 3KZGA 1I6BA 1SDXA 3LBSA 1LSTA 4R9GA 2E0SA 4OMBA 4H65A 2QPQA 5ISUA 1NH8A 2O84X 4BDQA 4BDNA 4U4SA 2I48A 2DP8A 2PT1A 4IO6A 4RPOA 3RTFB 3LSFB 3W9VA 3GBBA 1TWYA 3FJ7A 4NF8B 2NXOA 1M5FA 1WDNA 2H9BA 1B5JA 2Y7PA 3OD7A 4R6YA 3N26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHF A;  3G3I A;  4HCW A;  1B3G A;  4ELP A;  1I6Q A;  1P1U A;  2FNC A;  1OMP A;  2Y7W A;  3B7D A;  4FIM A;  3SEX A;  1LAX A;  3O2A A;  5I57 A;  2F7C A;  1BKA A;  3SET A;  1P1N A;  3U92 A;  3G3K A;  2HZK A;  1FTO A;  1IXI A;  1AMF A;  4RY1 A;  3T9U A;  5DVF A;  3QUF A;  3LSW A;  4YKJ A;  1XT8 A;  1OLA A;  4ECF A;  4DXC A;  1ZBM A;  1MS7 A;  2P1S A;  1VSO A;  2XXR A;  3TCF A;  1B4Z A;  3FVN A;  5HBC A;  1NNF A;  1JEV A;  1IIW A;  3RTW B;  1WOD A;  4KPT A;  1DOT A;  3Q26 A;  2PYY A;  2H98 A;  4QFN A;  4OVJ A;  3WAF A;  2ZYN A;  1MXU A;  4XKR A;  3TPA A;  4FJP A;  1M5B A;  4QSD A;  3K6U A;  4F2O A;  2NUV A;  1B7Z A;  4HCY A;  1SYI A;  2LAO A;  4YMA A;  4ZZE A;  4NF4 B;  2DE4 A;  2ZXT A;  1H44 A;  5CRY A;  3OMB A;  1ZU0 A;  1PBQ A;  3SEU A;  2Q8J A;  1QUJ A;  1RYX A;  3VVF A;  4UAC A;  3WAE A;  2XXI A;  2QL3 A;  4QSE A;  2F8D A;  4Q30 B;  1MXV A;  4WXJ A;  4NMY A;  4IO5 A;  4RJZ A;  4IGR A;  3S9E A;  3HHG A;  2AIX A;  1QVS A;  1UQW A;  5B7D A;  4OEU A;  5JTY A;  2QS4 A;  3TTK A;  3R6U A;  1M5E A;  1SI1 A;  3VVD A;  5ELV A;  1A40 A;  1VFD A;  3ONM A;  2RCA A;  5F7V A;  4G8H A;  2BJJ X;  3GLB A;  3FIR A;  4KD5 A;  3B6Q A;  1B4H A;  3EF7 A;  4POW A;  2O51 A;  5HM4 B;  2H99 A;  1S50 A;  3TCH A;  3BBR A;  4AB6 A;  2DE3 A;  2F7B A;  3VFJ A;  1MY0 A;  4H8I A;  4DXB A;  3KGC A;  1JW4 A;  4MLQ A;  1URS A;  1D9Y A;  3C4M A;  1FQD A;  4WKM A;  2B3F A;  4DCY A;  2Z23 A;  5I59 B;  3C35 A;  2F97 A;  3TTM A;  1POT A;  3KN7 A;  2D3I A;  3DEL B;  4QRZ A;  4ZE8 A;  1DTZ A;  1UTB B;  1LAH E;  4G77 A;  3TTR A;  1IXG A;  4U22 A;  4JDF A;  5KCJ B;  4NED A;  2O1M A;  4OWD A;  2F6P A;  3VLU A;  1ZTY A;  3FAS A;  2R6G E;  4XXU A;  3DLN A;  1BLF A;  4NF6 B;  4BLA A;  1AOV A;  1I6A A;  2HXW A;  4DIG A;  3I6V A;  2NVU B;  3FVO A;  5AA3 A;  1VFE A;  1OVB A;  5IKB A;  1GTK A;  4GVO A;  1B2H A;  1GGG A;  2F6G A;  5TU0 A;  4M4G A;  3HCQ A;  1B52 A;  2ZYK A;  3K1N A;  4LQ2 A;  2QS1 A;  1D3K A;  4JWX A;  4LUB A;  4OFO A;  1NNK A;  5H8F A;  1UTH A;  4GFR A;  4PFU A;  1QJM A;  1MXX A;  3OEL A;  1AH5 A;  3PMW A;  5DYH A;  4L17 A;  3CG3 A;  4KYS A;  4RPN A;  4KI0 E;  1EH3 A;  1MDP 1;  5FTI A;  2QSX A;  3FXR A;  1A99 A;  5M2V A;  3BKI B;  1MDQ A;  3S9N C;  4JWO A;  1FQF A;  5AA2 A;  4N6P A;  4AQ4 A;  4LA9 A;  1MY4 A;  5ITO A;  1Y4T A;  4GXS B;  2Z8F A;  1N0T A;  4GWO A;  2YJP A;  3N5L A;  3K0V A;  3CVG A;  1GVC A;  2GH9 A;  1B3H A;  3LSL A;  3K2D A;  3BFT A;  2G29 A;  3TCG A;  1B58 A;  1SW4 A;  1LFI A;  3IO6 A;  3O6H A;  1QUK A;  2ZNU A;  1N7X A;  4RYA A;  4ZEC A;  4LP2 B;  4FE8 A;  3VLW A;  4UA8 A;  1R6Z A;  3TYH A;  4I8C A;  1ANF A;  2Z8E A;  3MUQ A;  2Y7K A;  3K02 A;  3T9H B;  4C0R A;  1MY1 A;  3H6U A;  4G4P A;  5I2K B;  1AL3 A;  2QMW A;  3QIM A;  2VOZ A;  1MQG A;  1P1O A;  2B65 A;  3MVX A;  5TPA A;  4PET A;  2V93 A;  3HN0 A;  4GL0 A;  1S9T A;  2THI A;  4IB2 A;  5ICQ A;  3QXM A;  3O9P A;  3FXU A;  3IB1 A;  2WKY A;  3KJ7 A;  3OXN A;  2GHB A;  1RYO A;  5H8S A;  1BP5 A;  3KFM A;  4OEN A;  3JYR A;  2ONR A;  4R9F A;  1B5H A;  1B05 A;  1Y3Q A;  3ZSF A;  2HQ0 A;  4KQP A;  4X1B A;  2UVI A;  3KOT A;  1MPC A;  4GL8 A;  3MW0 A;  4F3G A;  3MQ9 A;  2X26 A;  3PGF A;  1N84 A;  1PB8 A;  3CRB A;  2A5T A;  2OCU A;  5AA1 A;  3O97 A;  2PT2 A;  4NF5 B;  3RGY A;  3QUJ A;  4KYD A;  4LZ8 A;  1NH7 A;  4IY6 A;  3G7W A;  4IO3 A;  5FTH A;  4BDO A;  1OQG A;  1NKX A;  2HFB A;  5DEX B;  4G8M A;  1NNP A;  3S4U A;  3MC2 A;  4O3C A;  4LZ7 A;  3U94 A;  1UIU A;  3L6H A;  2DXR A;  3M3L A;  1H43 A;  5ICT A;  1KWH A;  1MM7 A;  5H8N B;  4NE4 A;  5L9O A;  1JEU A;  4XKN A;  1DSN A;  4ZED A;  1LAG E;  5CMC A;  1OQH A;  5KZT A;  1HSE A;  2Q2C A;  3UGW A;  1YPN A;  3RQT A;  3ZKK A;  4O3A A;  4YIC A;  3MP8 A;  1MXY A;  5AA4 B;  3EQ1 A;  1JNF A;  2I3V A;  1SVX B;  1OIB A;  2NOO A;  1TT1 A;  3FJG A;  2V3T A;  3H6T A;  3OEM A;  3E9X A;  3A3U A;  2AYS A;  1J1N A;  4EQ7 A;  4TOZ A;  4I1D A;  2GRV A;  1FQA A;  5AA2 D;  3T93 B;  4IY5 A;  3MP1 A;  2RC8 A;  3MP6 A;  4U2R A;  4NWD A;  4ELR A;  4OHN A;  1FCK A;  5TP9 B;  2DWH A;  4N13 A;  1PC3 A;  1FTK A;  3PPQ A;  1AIV A;  3OO9 A;  3PD9 A;  5CI5 A;  3TUS A;  3G3J A;  3KSX A;  3M3K A;  4THI A;  4P0I A;  3PD8 A;  4KHZ E;  2XX9 A;  2Q9T A;  3K1P A;  1USY H;  4G8N A;  3OO6 A;  2FYI A;  5L9M A;  2R9J A;  3PMV A;  2RIN A;  4TQU Q;  3MZ1 A;  2DQV A;  2HCA A;  4R6K A;  2ZNS A;  5EHS A;  2D5W A;  2RC7 A;  5AE4 A;  3KG2 A;  3K6W A;  2OZZ A;  2Q88 A;  4DDD A;  4U1Z A;  2F34 A;  2QS2 A;  3R7X A;  3C32 A;  5A5X B;  3ZS6 A;  3PUV E;  3M3F A;  3Q28 A;  1YTV A;  4O3B A;  3B6W A;  1ZMG A;  4U1O A;  5KDT A;  2PMS A;  3W9W A;  5DVJ A;  4MLV A;  1N7W A;  2H25 A;  3MPK A;  5LOM A;  3S9M C;  4IO7 A;  2DWJ A;  1L5T A;  2V3U A;  4OEV A;  1B40 A;  4LON B;  2DWI A;  3TQL A;  3TKD A;  2AL4 A;  4KCC A;  3GXA A;  4F2Q A;  1URD A;  4OZ9 A;  5I57 B;  3MVZ A;  3H7M A;  4IO4 A;  1FW0 A;  4R75 A;  2X7P A;  4F3B A;  5CBR A;  2OBG A;  1EZ9 A;  4H8J A;  4NF6 A;  4ZZA A;  1R9L A;  3ODB A;  1SQY A;  2IEE A;  3Q27 A;  3EHU A;  3V89 B;  2YPN A;  3K00 A;  5EHM A;  3OEN A;  4TLL B;  1B0H A;  4ISU A;  3H4Z A;  3O6I A;  3PUY E;  1LAF E;  4OTE A;  4PFW A;  3RY3 A;  1SW2 A;  3CFL A;  1US4 A;  1Q35 A;  3TEP A;  4QFP A;  3CIJ A;  1P1W A;  1TFA A;  5H8Q A;  1IQ7 A;  3A09 A;  1HSL A;  1FTM A;  3DP4 A;  3U93 A;  4MFI A;  3ZKL A;  3KN8 A;  2O6A A;  2XXQ A;  3KOS A;  1FQC A;  5BWJ A;  1JQF A;  3W15 C;  4BDR A;  3QK6 A;  2VHA A;  2XD3 A;  4EF1 A;  5IAI A;  1ATG A;  4HTG A;  3S9L C;  2F78 A;  2I0C A;  1M5C A;  3MVW A;  1IIT A;  3C36 A;  5K2Y A;  3FV2 A;  3MWB A;  2DVZ A;  4OQO A;  3H6V A;  3FVG A;  3IOV A;  1N76 A;  1XC1 A;  4F3S A;  2CMO A;  3A3C A;  5JTY B;  1Y3P A;  4X9T A;  3O66 A;  2ANJ A;  5DVI A;  1JW1 A;  3FD3 A;  2XXP A;  5I2N A;  3TDJ A;  3DM0 A;  5L9S A;  3K4U A;  3PPO A;  3IB2 A;  2CZL A;  1MY3 A;  1PEB A;  3OOA A;  3KEI A;  1D4N A;  2XXY A;  4OER A;  1Z7N E;  1EU8 A;  1B1H A;  2HAV A;  3C34 A;  2ALU A;  2XXX A;  2VD2 A;  2XX8 A;  4DLD A;  3VDF A;  3SKP A;  1O64 A;  1N04 A;  4RNS A;  1IUD A;  3IOR A;  5K2X A;  5I2K A;  1LCT A;  1Y1M A;  1DPP A;  3UN6 A;  1H76 A;  3FVK A;  3IJO B;  4Q5T A;  4YKI A;  1NMU A;  4LVQ A;  3O6G A;  3EHS A;  4PFY A;  3ECR A;  5DTB A;  3UOR A;  1RKM A;  1USY E;  1MQJ A;  4ZDM A;  4R2F A;  3U72 A;  3F11 A;  3DP6 A;  2V25 A;  3QYT A;  3UA8 A;  2O7I A;  3FJM A;  4GD5 A;  3TQW A;  4U4X A;  4XIG Q;  4FED A;  3BFU A;  5ITP A;  2H4I A;  3D4C A;  4X1D A;  3TZA A;  4YB6 A;  1UTH B;  4ELO A;  1OVT A;  1MH4 A;  1H45 A;  3SER A;  3LR1 A;  4NF5 A;  4R73 A;  2YLN A;  1LLS A;  4WED A;  1MH3 A;  5I56 B;  4YB5 A;  3PU5 A;  4IGT A;  5CM6 A;  2QS3 A;  5J1D A;  4X48 A;  4H1X A;  2Y7I A;  2XXV A;  3CSB A;  2ONS A;  3FZV A;  3OO8 A;  4JSD A;  3RNN A;  5AA2 B;  2QMX A;  3T9V A;  3C31 A;  3TTL A;  5DEX A;  1XVX A;  1LB9 A;  1MY2 A;  1A54 A;  1EZO A;  3H03 A;  4ZS9 A;  2F35 A;  4PQJ A;  2O1L A;  1ZLQ A;  3VE1 B;  4AB5 A;  1I69 A;  1SD3 A;  5H8N A;  4RK2 A;  2OLB A;  2ZYM A;  5L8D A;  3E3K A;  4GIZ A;  4G68 B;  3B6T A;  1QKA A;  1B0L A;  3T22 A;  1GR2 A;  2M8C A;  1JVY A;  2GFE A;  1UIV A;  4Q8R A;  3TMG A;  3FXQ A;  1B5I A;  4FAT A;  3RLF E;  5AA4 A;  3CI8 A;  1GV8 A;  5H8H B;  3HST A;  4BDL A;  4F1U A;  2X7Q A;  4ONY A;  4EUO A;  4E0W A;  4WEP A;  2UYF A;  4EDP A;  1ZJL A;  4KYE A;  3TAJ A;  2DOJ A;  4JWY A;  1DPE A;  4NF8 A;  1N3X A;  1JVX A;  4M1V A;  2HEU A;  1LBC A;  4EQ9 A;  5EYF A;  2DXY A;  4YKP A;  3G3G A;  4RXL A;  3SDF A;  1OLC A;  3QAX A;  4H67 A;  4LZ5 A;  1PB7 A;  3R26 A;  3H06 B;  4F18 A;  4EQB A;  3OSQ A;  2DVC A;  1NL5 A;  2UYE A;  1QW0 A;  2ZMB A;  4DXU A;  4GXA A;  4OFL A;  3HO7 A;  1H3D A;  2O69 A;  3MBP A;  2XD2 A;  5CMM A;  3IJX B;  3U8Q A;  1SW1 A;  4MBP A;  1ZKB A;  3N6T A;  2OWS A;  1B7U A;  4G68 C;  3CFX A;  3HV1 A;  2A5T B;  3TTN A;  1LFG A;  5HPQ A;  1MQH A;  4DZ1 A;  1TFD A;  2ESN A;  1HSJ A;  1SBP A;  2RC9 A;  2XHD A;  2DS9 A;  1XOC A;  5A5X A;  1CE2 A;  3M8U A;  4NF4 A;  3T66 A;  4R2B A;  3N6U A;  4E0X A;  3JZJ A;  4OYV A;  2GHA A;  4F31 B;  3K6V A;  2FA7 A;  3KN3 A;  3RPW A;  4QHQ A;  3G3F A;  4I9D A;  5I58 B;  3ILT B;  1II5 A;  1R1N A;  3FGS A;  2I0B A;  3MVY A;  1QUL A;  4H5F A;  2Z22 A;  2VP1 A;  3SES A;  3SEV A;  4EXK A;  1Q1K A;  2Q2A A;  3EHT A;  1SYH A;  4LAT A;  4JXI A;  3IOW A;  4F19 A;  5BUU A;  1B1X A;  4OES A;  3K6X A;  3E4R A;  2UVG A;  2NWJ A;  1MG1 A;  4GQO A;  2OK2 A;  3H3G A;  1VE4 A;  5CMK A;  2DE2 A;  4HW8 A;  4F22 A;  2PBW A;  2ZYO A;  5B70 A;  4IO2 A;  1EZP A;  3OO7 A;  2F7A A;  4F1Y A;  3Q29 A;  5DT6 A;  4KR5 A;  1XHY A;  3CR9 A;  1B6H A;  1D9V A;  1FTL A;  1WVJ A;  1IXH A;  3QSL A;  2VD3 A;  5I59 A;  2O7U A;  2I49 A;  1YAE A;  3SEW A;  4H5G A;  3K01 A;  1N3W A;  1UTB A;  4PFT A;  5JEI A;  4P0G A;  4OET A;  3EPE A;  5KCJ A;  1XS5 A;  3I3V A;  2RF1 A;  5CMB A;  2ABH A;  4ZEF A;  1MQD A;  4R74 A;  1R9Q A;  2XXT A;  2VGQ A;  4ZEK A;  1B3L A;  3JV9 A;  4GF8 A;  1IZ1 A;  1P99 A;  4ZEI A;  4I62 A;  2R71 A;  2DSF A;  4OFJ A;  2PVU A;  3S2V A;  3L6G A;  1LGB C;  4FAJ A;  1LBB A;  3PUZ E;  3IR1 A;  3GZG A;  3MPL A;  1A8E A;  4XTC Q;  2UVH A;  2G93 A;  4RA1 A;  4JBZ A;  3TEL A;  3TOD A;  5KDT B;  4H6D A;  2DWA A;  2I4C A;  3D4G A;  4GOT A;  2P0S A;  2Z8D A;  4F1V A;  3USD A;  1A8F A;  3UK4 A;  3CG1 A;  3G3H A;  3UP9 A;  2F5X A;  4MH5 A;  4C1T A;  3HPI A;  1B3F A;  2REJ A;  4TLM B;  4XKP A;  4PP0 A;  2OWT A;  5JK4 A;  3IAZ A;  3PUW E;  1O63 A;  3PV0 E;  3LUY A;  3IX1 A;  2UXA A;  2DYX A;  2W7Y A;  4ESW A;  3KSJ A;  3H6W A;  2XXU A;  2QRY A;  1FQB A;  1BIY A;  2ONK E;  4K3F A;  1MXW A;  5FHO A;  4QFL A;  4R72 A;  3DP8 A;  1B7H A;  3VVE A;  3P7I A;  4YAH X;  4EF2 A;  3PPP A;  4G2Z A;  2HZL A;  1TXF A;  2RCB A;  4DE8 A;  2Y84 A;  3ILU B;  2V84 A;  4YKK A;  1PDA A;  2P2A A;  4F39 A;  3IOT A;  3IB0 A;  4MF3 A;  3V8X B;  5F1Q A;  1S7Y A;  5H8Q B;  1Y1Z A;  4QFK A;  4DCX A;  1Y4C A;  3Q25 A;  2Q89 A;  4F3P A;  4ZE9 A;  1PB9 A;  3THI A;  2D21 A;  1POY 1;  3SEY A;  4QF9 A;  3VV5 A;  4JSO A;  5I56 A;  1A55 A;  1F9B A;  4BDM A;  2H5Y A;  1XVY A;  4YMB A;  3T9X B;  4NWC A;  2E1S A;  3CSG A;  2B3B A;  2RKM A;  1B51 A;  1MRP A;  3I5O A;  2UVJ A;  3MJN A;  1DMB A;  3RT8 A;  3FV1 A;  5FHN A;  4LQ5 A;  1FQE A;  5CBS A;  1Y20 A;  1B46 A;  2OJT A;  4QFO A;  2XXW A;  5I84 A;  2AL5 A;  4G68 A;  4YB7 A;  4ND9 A;  5I2N B;  2XXH A;  3FUZ A;  4YZZ A;  4Z7E A;  1Y3N A;  5H8F B;  4U21 A;  4EXL A;  3IK6 B;  4XKQ A;  3RT6 B;  3PPN A;  1MM6 A;  5H8H A;  4HS7 A;  3IL1 B;  1ELJ A;  2I58 A;  1IXC A;  2QJE A;  4KCD A;  3K1M A;  4F29 A;  4QSC A;  1P1Q A;  5FHM A;  3RN8 A;  1LB8 A;  3KJT A;  1PBP A;  1YCJ A;  2F36 A;  1Z7M E;  3TFL A;  1A7L A;  1M5D A;  3MZB A;  3V5A A;  4POX A;  3AXF A;  4Z0I A;  3VXC A;  1DTG A;  3VXB A;  3PPR A;  1SW5 A;  2PX1 A;  2I4B A;  4PE5 B;  3T96 B;  2O68 A;  1Y9U A;  1MPB A;  2REG A;  3UIF A;  2HAU A;  4NTL A;  3PMX A;  4KFQ A;  1MXZ A;  3FAT A;  1MPD A;  4U23 A;  4C1U A;  1URG A;  4FEC A;  1ZIU A;  1T0K A;  4FEB A;  1B32 A;  2KLF A;  3OEK A;  4GRK A;  1MQI A;  1O7T A;  4FOR A;  3N94 A;  3U1O A;  3EN3 A;  2I3W A;  1QUI A;  1BTJ A;  2I6E A;  4OXV A;  3MZ9 A;  4N07 A;  4R6H A;  3CFZ A;  3IO4 A;  3O28 A;  3OSR A;  4Q0C A;  5TP9 A;  3V83 A;  4H0W A;  5TPA B;  3C33 A;  1NFT A;  2A5S A;  2IA4 A;  1B3E A;  4YU0 A;  2Y7R A;  1QKB A;  2ZNT A;  1NNT A;  4GLI A;  3GBA A;  1US5 A;  3IOU A;  5I58 A;  3KBR A;  3LC8 A;  1IEJ A;  3RUM A;  4RK9 A;  1JW5 A;  4ESX A;  3PUX E;  4ZEB A;  2XX7 A;  1VR5 A;  4ELQ A;  2V3Q A;  1FTJ A;  4P11 A;  1LFH A;  5CC2 A;  3MAM A;  3LSX A;  1B9J A;  3C9H A;  3VLV A;  1JET A;  3E13 X;  1SI0 A;  1CB6 A;  1LCF A;  4JB7 A;  3O29 A;  3KZG A;  1I6B A;  1SDX A;  3LBS A;  1LST A;  4R9G A;  2E0S A;  4OMB A;  4H65 A;  2QPQ A;  5ISU A;  1NH8 A;  2O84 X;  4BDQ A;  4BDN A;  4U4S A;  2I48 A;  2DP8 A;  2PT1 A;  4IO6 A;  4RPO A;  3RTF B;  3LSF B;  3W9V A;  3GBB A;  1TWY A;  3FJ7 A;  4NF8 B;  2NXO A;  1M5F A;  1WDN A;  2H9B A;  1B5J A;  2Y7P A;  3OD7 A;  4R6Y A;  3N26 A; 
#chains in the Genus database with same CATH topology
 3HHF A;  3G3I A;  4HCW A;  1B3G A;  4ELP A;  1I6Q A;  1P1U A;  2FNC A;  1BK4 A;  1OMP A;  2Y7W A;  3B7D A;  4FIM A;  3SEX A;  1LAX A;  3O2A A;  5I57 A;  2F7C A;  1DCU A;  1BKA A;  3SET A;  1P1N A;  3U92 A;  1FPE A;  3G3K A;  2HZK A;  1FTO A;  1IXI A;  1AMF A;  2WX9 A;  4RY1 A;  3RPL B;  3T9U A;  5DVF A;  3QUF A;  3LSW A;  2WYP A;  4YKJ A;  1XT8 A;  1OLA A;  4ECF A;  4DXC A;  1ZBM A;  1MS7 A;  2P1S A;  1VSO A;  2XXR A;  3TCF A;  1B4Z A;  3FVN A;  5HBC A;  1NNF A;  4O8M A;  1JEV A;  1IIW A;  3E79 A;  3RTW B;  2QVR A;  1WOD A;  4KPT A;  4G61 A;  1DOT A;  3Q26 A;  2PYY A;  2H98 A;  4QFN A;  4OVJ A;  3WAF A;  2ZYN A;  1MXU A;  4XKR A;  3TPA A;  4FJP A;  1M5B A;  4QSD A;  3K6U A;  4F2O A;  4MIJ A;  4O7I A;  2NUV A;  1B7Z A;  4HCY A;  1SYI A;  2LAO A;  2FHY A;  4GX4 A;  4YMA A;  4ZZE A;  4NF4 B;  2DE4 A;  2ZXT A;  1H44 A;  5CRY A;  3OMB A;  1ZU0 A;  1PBQ A;  1FJ6 A;  3SEU A;  2Q8J A;  1QUJ A;  1RYX A;  3VVF A;  4UAC A;  3WAE A;  2XXI A;  5F24 A;  4P3L A;  2QL3 A;  4QSE A;  4P8B A;  2F8D A;  4Q30 B;  2XWK A;  1MXV A;  4WXJ A;  4NMY A;  4IO5 A;  4RJZ A;  4IGR A;  3S9E A;  3HHG A;  2AIX A;  1QVS A;  1UQW A;  5B7D A;  4OEU A;  4GWU A;  5JTY A;  2QS4 A;  1YYZ A;  4GWY A;  3TTK A;  3R6U A;  1M5E A;  1SI1 A;  4NGU A;  1FPG A;  3VVD A;  5ELV A;  1A40 A;  1VFD A;  3ONM A;  2RCA A;  5F7V A;  5IGA A;  4G8H A;  2BJJ X;  3GLB A;  3FIR A;  4KD5 A;  3B6Q A;  1B4H A;  5I5P A;  3EF7 A;  4DI3 D;  4POW A;  2O51 A;  5HM4 B;  2H99 A;  4P1L A;  1S50 A;  3TCH A;  3BBR A;  4AB6 A;  2DE3 A;  2F7B A;  3VFJ A;  1MY0 A;  4H8I A;  4DXB A;  3KGC A;  1JW4 A;  4MLQ A;  1URS A;  1D9Y A;  2OWZ A;  3C4M A;  1FQD A;  3MYU A;  4WKM A;  4GBV A;  2B3F A;  4DCY A;  2Z23 A;  5I59 B;  3C35 A;  2F97 A;  3TTM A;  1POT A;  3KN7 A;  2D3I A;  3DEL B;  4QRZ A;  4ZE8 A;  1DTZ A;  1IMD A;  1UTB B;  1LAH E;  4G77 A;  4O94 A;  3TTR A;  1IXG A;  4U22 A;  4JDF A;  5KCJ B;  4NED A;  2O1M A;  4OWD A;  2F6P A;  1NUX A;  3VLU A;  1ZTY A;  3FAS A;  4OVP A;  2R6G E;  4XXU A;  3KC1 A;  3DLN A;  1BLF A;  4NF6 B;  4BLA A;  1AOV A;  3FXB A;  1I6A A;  2HXW A;  1NV7 A;  4DIG A;  3I6V A;  2PCR A;  2NVU B;  3FVO A;  5AA3 A;  1VFE A;  1OVB A;  5IKB A;  3MST A;  1GTK A;  4GVO A;  1B2H A;  1GGG A;  2F6G A;  1G0I A;  5TU0 A;  4M4G A;  3HCQ A;  5ET5 A;  5EYG A;  1B52 A;  2ZYK A;  3K1N A;  4LQ2 A;  2QS1 A;  1D3K A;  4JWX A;  4LUB A;  4OFO A;  1NNK A;  5H8F A;  1NUZ A;  1UTH A;  4GFR A;  4PFU A;  1QJM A;  1MXX A;  3OEL A;  1AH5 A;  3PMW A;  5DYH A;  4L17 A;  3CG3 A;  4KYS A;  4RPN A;  4KI0 E;  1EH3 A;  1MDP 1;  2QSX A;  5FTI A;  1YZ0 A;  3FXR A;  1A99 A;  4GWS A;  3IFA A;  5M2V A;  3BKI B;  1MDQ A;  3S9N C;  4JWO A;  1FQF A;  5AA2 A;  2VPN A;  4N6P A;  4AQ4 A;  4LA9 A;  1MY4 A;  5ITO A;  3QMF A;  1Y4T A;  4GXS B;  2Z8F A;  1N0T A;  4GWO A;  2YJP A;  3N5L A;  3K0V A;  3CVG A;  1GVC A;  2GH9 A;  1B3H A;  3LSL A;  4I40 A;  3K2D A;  2R8T A;  3BFT A;  2G29 A;  1IMC A;  3CHG A;  3TCG A;  1B58 A;  1SW4 A;  1LFI A;  2XA5 A;  5EYH A;  3IO6 A;  3O6H A;  1QUK A;  1LBZ A;  2ZNU A;  1N7X A;  4RYA A;  4ZEC A;  2WYK A;  4LP2 B;  4FE8 A;  3VLW A;  1FBC A;  4UA8 A;  1R6Z A;  3TYH A;  4I8C A;  1ANF A;  2Z8E A;  5J16 A;  3MUQ A;  2Y7K A;  3K02 A;  3T9H B;  4C0R A;  1MY1 A;  3H6U A;  4G4P A;  5I2K B;  1AL3 A;  2QMW A;  3QIM A;  2VOZ A;  4IR8 A;  1MQG A;  1FBH A;  1FBP A;  1P1O A;  2B65 A;  3MVX A;  4MNI A;  5TPA A;  4PET A;  2V93 A;  3HN0 A;  4GL0 A;  1S9T A;  2THI A;  4IB2 A;  5ICQ A;  3QXM A;  3O9P A;  3FXU A;  3IB1 A;  2WKY A;  1LEV A;  2FBP A;  1FPJ A;  3KJ7 A;  3OXN A;  2GHB A;  5T3J A;  4N8G A;  5EQ7 A;  1RYO A;  5H8S A;  1BP5 A;  3KFM A;  1KA0 A;  2FVZ A;  4OEN A;  3JYR A;  2ONR A;  4R9F A;  1B5H A;  1B05 A;  1Y3Q A;  3ZSF A;  2HQ0 A;  2QVU A;  4KQP A;  4X1B A;  2UVI A;  3KOT A;  1MPC A;  4GL8 A;  3MW0 A;  2WBB A;  4F3G A;  3MQ9 A;  2X26 A;  3PGF A;  1N84 A;  1PB8 A;  3CRB A;  2A5T A;  2OCU A;  4GBW A;  5AA1 A;  3O97 A;  2PT2 A;  4NF5 B;  4NX1 A;  3RGY A;  3QUJ A;  4KYD A;  4LZ8 A;  1NH7 A;  4IY6 A;  3G7W A;  4IO3 A;  4N91 A;  5FTH A;  1NV3 A;  4BDO A;  1OQG A;  1NKX A;  2HFB A;  5DEX B;  4MHF A;  2FIX A;  4G8M A;  1NNP A;  3S4U A;  3MC2 A;  3NOH A;  4O3C A;  4LZ7 A;  3U94 A;  1UIU A;  3L6H A;  2XWV A;  2DXR A;  3M3L A;  1H43 A;  5ICT A;  1KWH A;  1MM7 A;  1Q9D A;  5H8N B;  4NE4 A;  5L9O A;  1JEU A;  4O7M A;  4XKN A;  1DSN A;  4PBQ A;  4XEQ A;  4ZED A;  1LAG E;  5CMC A;  1FSA A;  1OQH A;  5KZT A;  1HSE A;  2Q2C A;  3UGW A;  1YPN A;  3HFU A;  3PTY A;  3KC0 A;  3RQT A;  3ZKK A;  3RPL A;  4O3A A;  4XF5 A;  4YIC A;  3MP8 A;  1MXY A;  5AA4 B;  3EQ1 A;  1JNF A;  2I3V A;  1SVX B;  1OIB A;  2NOO A;  1TT1 A;  2QVV A;  3FJG A;  2XWO A;  2V3T A;  3H6T A;  3OEM A;  3E9X A;  3A3U A;  4QXD A;  2AYS A;  1J1N A;  1FJ9 A;  4EQ7 A;  4TOZ A;  4I1D A;  2GRV A;  1FQA A;  5AA2 D;  3T93 B;  4IY5 A;  3MP1 A;  2RC8 A;  2P3V A;  1FBD A;  3MP6 A;  4U2R A;  4NWD A;  4ELR A;  4OHN A;  1FCK A;  5TP9 B;  2DWH A;  4N13 A;  1PC3 A;  1FTK A;  3PPQ A;  1AIV A;  3OO9 A;  3PD9 A;  5CI5 A;  3TUS A;  3G3J A;  3KSX A;  3M3K A;  4THI A;  4P0I A;  3PD8 A;  4KHZ E;  2XX9 A;  2Q9T A;  2ZZV A;  3K1P A;  2Y5K A;  1USY H;  4G8N A;  4PGP A;  3OO6 A;  1FPB A;  2F3B A;  2FYI A;  5L9M A;  2Q74 A;  2R9J A;  3PMV A;  2RIN A;  4TQU Q;  3MZ1 A;  2DQV A;  2HCA A;  4R6K A;  2ZNS A;  5EHS A;  2D5W A;  4GX6 A;  2RC7 A;  5IZ3 A;  5AE4 A;  3KG2 A;  3K6W A;  2OZZ A;  4N81 A;  2Q88 A;  5IM2 A;  4DDD A;  4U1Z A;  2F34 A;  2QS2 A;  3R7X A;  4H45 A;  1EYJ A;  1NV6 A;  3C32 A;  5A5X B;  3ZS6 A;  2VT5 A;  3D1R A;  3PUV E;  3M3F A;  3Q28 A;  1YTV A;  4O3B A;  3B6W A;  1ZMG A;  4U1O A;  5KDT A;  2PMS A;  3W9W A;  5DVJ A;  4MLV A;  4HXV A;  1N7W A;  2H25 A;  3MPK A;  5LOM A;  3S9M C;  3SZP A;  4IO7 A;  2DWJ A;  1L5T A;  2V3U A;  4OEV A;  1B40 A;  4LON B;  2DWI A;  3TQL A;  1IMA A;  3TKD A;  3B8B A;  1FPD A;  2AL4 A;  4KCC A;  3GXA A;  4F2Q A;  2B4L A;  1URD A;  4OZ9 A;  5I57 B;  3MVZ A;  3H7M A;  4IO4 A;  1FW0 A;  4PDD A;  5ET8 A;  4R75 A;  2CZK A;  2X7P A;  4F3B A;  5CBR A;  2OBG A;  1EZ9 A;  4H8J A;  4NF6 A;  4ZZA A;  4NQ8 A;  1R9L A;  3ODB A;  1SQY A;  2IEE A;  3Q27 A;  3EHU A;  3V89 B;  2YPN A;  2Y5L A;  3K00 A;  5EHM A;  3OEN A;  4PAK A;  4TLL B;  1B0H A;  4ISU A;  3H4Z A;  3O6I A;  3PUY E;  1LAF E;  4MNP A;  4OTE A;  4PFW A;  3RY3 A;  1SW2 A;  3CFL A;  1US4 A;  1Q35 A;  3TEP A;  4QFP A;  3CIJ A;  1P1W A;  1TFA A;  5H8Q A;  1IQ7 A;  4N17 A;  3A09 A;  1HSL A;  1FTM A;  3DP4 A;  3U93 A;  4MFI A;  3ZKL A;  3KN8 A;  2O6A A;  2XXQ A;  5EQ8 A;  2WEF A;  3KOS A;  2WBD A;  1FQC A;  5BWJ A;  1JQF A;  3W15 C;  4BDR A;  3QK6 A;  2VHA A;  4P9K A;  2XD3 A;  4EF1 A;  5IAI A;  1ATG A;  2KR0 A;  4HTG A;  3S9L C;  2F78 A;  2HHM A;  3A29 A;  2FIE A;  2I0C A;  1M5C A;  3MVW A;  1IIT A;  1FBF A;  3C36 A;  5K2Y A;  2XXK A;  2VPO A;  1DK4 A;  3FV2 A;  3MWB A;  2DVZ A;  4OQO A;  4PGN A;  3H6V A;  3FVG A;  3IOV A;  1N76 A;  1XC1 A;  4F3S A;  2CMO A;  3A3C A;  5JTY B;  1Y3P A;  4X9T A;  3O66 A;  2ANJ A;  4MJO A;  5DVI A;  1JW1 A;  3FD3 A;  3LUZ A;  2XXP A;  5I2N A;  3TDJ A;  3DM0 A;  5L9S A;  3K4U A;  3PPO A;  5A5L A;  3IB2 A;  2CZL A;  4NAP A;  1MY3 A;  4X8R A;  1PEB A;  3OOA A;  3KEI A;  4PCD A;  1D4N A;  2XXY A;  2XWI A;  4OER A;  3IFC A;  1Z7N E;  1EU8 A;  1B1H A;  4P56 A;  2HAV A;  3C34 A;  2ALU A;  1NV2 A;  2XXX A;  2VD2 A;  2XX8 A;  4DLD A;  1JP4 A;  3VDF A;  3SKP A;  1O64 A;  4JVC A;  1N04 A;  4RNS A;  2ZZX A;  1IUD A;  3IOR A;  5K2X A;  5I2K A;  1LCT A;  1QGX A;  1Y1M A;  1DPP A;  3UN6 A;  1H76 A;  3FVK A;  3IJO B;  4Q5T A;  4YKI A;  1NMU A;  4LVQ A;  1LBV A;  4PFR A;  3O6G A;  3EHS A;  4N6K A;  4PFY A;  3ECR A;  1IME A;  5DTB A;  3UOR A;  1RKM A;  1USY E;  1MQJ A;  5LTC A;  4ZDM A;  4R2F A;  1FPL A;  3U72 A;  3F11 A;  3DP6 A;  4PAI A;  2V25 A;  3QYT A;  4PBH A;  3UA8 A;  2O7I A;  3FJM A;  4GD5 A;  3TQW A;  4U4X A;  4MEV A;  4XIG Q;  4FED A;  2HXR A;  4PFI A;  3BFU A;  5ITP A;  1EYK A;  2H4I A;  2HPG A;  3BIG A;  1IMB A;  3D4C A;  4X1D A;  3TZA A;  4YB6 A;  1UTH B;  4ELO A;  1OVT A;  1MH4 A;  1H45 A;  4GWX A;  3SER A;  3LR1 A;  4NF5 A;  4R73 A;  2YLN A;  1LLS A;  4WED A;  1MH3 A;  5I56 B;  4YB5 A;  4X04 A;  3PU5 A;  4IGT A;  5CM6 A;  2QS3 A;  2CEY A;  5J1D A;  4X48 A;  4H1X A;  2Y7I A;  2XXV A;  3CSB A;  2ONS A;  3FZV A;  3OO8 A;  4JSD A;  3RNN A;  5AA2 B;  2QMX A;  1KZ8 A;  3T9V A;  3C31 A;  3TTL A;  5DEX A;  5ET6 A;  1XVX A;  1LB9 A;  4NN3 A;  1MY2 A;  4PDH A;  1A54 A;  4JVD A;  1EZO A;  3H03 A;  4ZS9 A;  2F35 A;  4PQJ A;  2O1L A;  1ZLQ A;  4P1E A;  3VE1 B;  4AB5 A;  1I69 A;  1SD3 A;  4HE1 A;  4N6D A;  4PFB A;  4RK2 A;  5H8N A;  1K9Z A;  2OLB A;  2ZYM A;  5L8D A;  3E3K A;  2GQ1 A;  4GIZ A;  5IZ1 A;  4G68 B;  3B6T A;  1QKA A;  1B0L A;  3T22 A;  1GR2 A;  2M8C A;  1JVY A;  2GFE A;  1UIV A;  4Q8R A;  3TMG A;  2PFY A;  3FXQ A;  1B5I A;  4I3E A;  4FAT A;  3RLF E;  2JJK A;  5AA4 A;  3CI8 A;  1GV8 A;  5H8H B;  3HST A;  4BDL A;  4F1U A;  2CZI A;  2X7Q A;  4ONY A;  2CEX A;  4EUO A;  3ISP A;  4E0W A;  4WEP A;  2UYF A;  5FBP A;  4EDP A;  1ZJL A;  4OVR A;  2CZH A;  4KYE A;  3TAJ A;  4GWZ A;  2DOJ A;  4JWY A;  1DPE A;  4NF8 A;  1N3X A;  1JVX A;  4UAB A;  4M1V A;  4DI4 B;  2HEU A;  1LBC A;  4EQ9 A;  5EYF A;  2DXY A;  4YKP A;  2V4C A;  3G3G A;  4N4U A;  4FBP A;  1RDZ A;  4RXL A;  3SDF A;  1OLC A;  3QAX A;  4H67 A;  4LZ5 A;  1PB7 A;  3R26 A;  3H06 B;  4F18 A;  4EQB A;  3OSQ A;  2DVC A;  1NL5 A;  2UYE A;  1QW0 A;  2ZMB A;  4HE2 A;  4DXU A;  5EQA A;  4GXA A;  4OFL A;  3HO7 A;  1H3D A;  2O69 A;  3MBP A;  2XD2 A;  5CMM A;  3IJX B;  3U8Q A;  1SW1 A;  4MBP A;  1ZKB A;  3N6T A;  2OWS A;  1B7U A;  4G68 C;  2PFZ A;  3CFX A;  5I7I A;  3HV1 A;  2A5T B;  4HE0 A;  3TTN A;  1LFG A;  5HPQ A;  3KBZ A;  1MQH A;  4DZ1 A;  1TFD A;  2ESN A;  1HSJ A;  1SBP A;  2RC9 A;  2XHD A;  2DS9 A;  1XOC A;  4AS5 A;  2OX3 A;  5A5X A;  5ESY A;  1CE2 A;  2DDK A;  3M8U A;  1LBX A;  4NF4 A;  3T66 A;  4R2B A;  3N6U A;  4E0X A;  3JZJ A;  4OYV A;  4KXP A;  2GHA A;  4F31 B;  3K6V A;  1NUW A;  2FA7 A;  1YXI A;  3KN3 A;  3RPW A;  4OA4 A;  4QHQ A;  1INP A;  3G3F A;  1RDX A;  4I9D A;  5I58 B;  2L5V A;  3ILT B;  1G0H A;  1II5 A;  1R1N A;  3FGS A;  2I0B A;  3MVY A;  1QUL A;  1FPK A;  4H5F A;  4N15 A;  2Z22 A;  2VP1 A;  3SES A;  3SEV A;  4EXK A;  4P47 A;  1Q1K A;  2Q2A A;  3EHT A;  1SYH A;  4LAT A;  4JXI A;  3IOW A;  4F19 A;  5BUU A;  1B1X A;  4OES A;  3K6X A;  3E4R A;  2UVG A;  2NWJ A;  1MG1 A;  4GQO A;  4MX6 A;  2OK2 A;  3H3G A;  1VE4 A;  5CMK A;  2DE2 A;  4HW8 A;  4F22 A;  2PBW A;  2ZYO A;  5B70 A;  5LDZ A;  5I3S A;  4IO2 A;  1EZP A;  3OO7 A;  2B4M A;  2KQZ A;  2BJI A;  4GWW A;  2F7A A;  4F1Y A;  3GYY A;  3Q29 A;  5DT6 A;  1FBE A;  4KR5 A;  1XHY A;  3CR9 A;  1B6H A;  1D9V A;  1FTL A;  1WVJ A;  1IXH A;  1CNQ A;  3QSL A;  2VD3 A;  5I59 A;  2O7U A;  2I49 A;  1YAE A;  3SEW A;  4H5G A;  3K01 A;  1N3W A;  1UTB A;  4PTK A;  4PFT A;  2Q8M A;  5JEI A;  4P0G A;  4OET A;  3EPE A;  5KCJ A;  1XS5 A;  3I3V A;  2RF1 A;  5CMB A;  1KA1 A;  2ABH A;  4ZEF A;  4NF0 A;  1MQD A;  4R74 A;  1R9Q A;  2XXT A;  2VGQ A;  3T0J A;  4ZEK A;  1B3L A;  3JV9 A;  4GF8 A;  1IZ1 A;  1P99 A;  4ZEI A;  4I62 A;  1NV5 A;  2R71 A;  5IZ3 B;  1AWB A;  2DSF A;  4OFJ A;  2PVU A;  3S2V A;  3L6G A;  1LGB C;  4FAJ A;  1LBB A;  3PUZ E;  3IR1 A;  3GZG A;  3MPL A;  4LN5 A;  1A8E A;  4XTC Q;  2UVH A;  2G93 A;  4RA1 A;  4JBZ A;  4OVT A;  3TEL A;  3TOD A;  4MNC A;  5KDT B;  4PE3 A;  1NV0 A;  4H6D A;  2DWA A;  2I4C A;  3D4G A;  1SPI A;  4GOT A;  2P0S A;  2Z8D A;  4F1V A;  3USD A;  1A8F A;  3UK4 A;  3CG1 A;  3G3H A;  3UP9 A;  2F5X A;  4MH5 A;  4C1T A;  3HPI A;  1B3F A;  2REJ A;  4TLM B;  4XKP A;  4AS4 A;  4PP0 A;  2OWT A;  1NV1 A;  5JK4 A;  3IAZ A;  3PUW E;  1O63 A;  3PV0 E;  3LUY A;  3IX1 A;  2UXA A;  2DYX A;  2W7Y A;  4ESW A;  3KSJ A;  3H6W A;  2XXU A;  2QRY A;  1FQB A;  1BIY A;  2ONK E;  3E78 A;  4K3F A;  1MXW A;  1DBZ A;  5FHO A;  4QFL A;  4R72 A;  3DP8 A;  1B7H A;  3VVE A;  3P7I A;  4YAH X;  4EF2 A;  3PPP A;  4G2Z A;  2HZL A;  1TXF A;  2RCB A;  4QBA A;  3ROJ A;  4DE8 A;  2MKZ A;  2Y84 A;  3ILU B;  2V84 A;  4YKK A;  5DW8 A;  1PDA A;  1LBY A;  2P2A A;  4F39 A;  3IOT A;  3IB0 A;  4MF3 A;  3V8X B;  5F1Q A;  1S7Y A;  5H8Q B;  4H46 A;  4I3Y A;  1Y1Z A;  4QFK A;  4DCX A;  1Y4C A;  3Q25 A;  2Q89 A;  4F3P A;  4ZE9 A;  1PB9 A;  3THI A;  4MMP A;  2D21 A;  1POY 1;  3SEY A;  4QF9 A;  3VV5 A;  4JSO A;  1XI6 A;  5I56 A;  1A55 A;  4NHB A;  1F9B A;  4BDM A;  2H5Y A;  1XVY A;  4YMB A;  3T9X B;  3U65 A;  4NWC A;  2E1S A;  3CSG A;  2B3B A;  2RKM A;  1B51 A;  1MRP A;  3I5O A;  2UVJ A;  3MJN A;  1DMB A;  3RT8 A;  3T1B A;  3FV1 A;  5FHN A;  4LQ5 A;  1FQE A;  5CBS A;  1Y20 A;  1B46 A;  4OVQ A;  2OJT A;  4QFO A;  2XXW A;  5I84 A;  2AL5 A;  4G68 A;  4YB7 A;  4ND9 A;  5I2N B;  2XXH A;  3FUZ A;  4YZZ A;  4Z7E A;  1Y3N A;  1IMF A;  5H8F B;  4U21 A;  4EXL A;  1LBW A;  3IK6 B;  4XKQ A;  3RT6 B;  3PPN A;  1MM6 A;  4OAN A;  2ZZW A;  5H8H A;  1FPF A;  4HS7 A;  3IL1 B;  1ELJ A;  2I58 A;  1IXC A;  2QJE A;  4KCD A;  3K1M A;  4F29 A;  4QSC A;  4PAF A;  1P1Q A;  4JVI A;  4NG7 A;  5FHM A;  3RN8 A;  1LB8 A;  3KJT A;  1PBP A;  1YCJ A;  2F36 A;  1Z7M E;  3TFL A;  1A7L A;  4N8Y A;  1M5D A;  3MZB A;  3V5A A;  4POX A;  3AXF A;  4Z0I A;  3VXC A;  1FPI A;  3LV0 A;  1DTG A;  3VXB A;  3PPR A;  1FBG A;  1SW5 A;  2PX1 A;  2I4B A;  4PE5 B;  3T96 B;  4OVS A;  2O68 A;  2P3N A;  1Y9U A;  5ET7 A;  1MPB A;  2REG A;  3UIF A;  2HAU A;  4NTL A;  4MCO A;  3PMX A;  1VDW A;  4KFQ A;  1FRP A;  1MXZ A;  3FAT A;  1MPD A;  4U23 A;  4C1U A;  1URG A;  4FEC A;  1ZIU A;  1T0K A;  4FEB A;  1B32 A;  2KLF A;  3OEK A;  4GRK A;  1MQI A;  1O7T A;  4FOR A;  3N94 A;  3U1O A;  3EN3 A;  3BIH A;  2I3W A;  1QUI A;  3FBP A;  1BTJ A;  2I6E A;  4PF6 A;  4OXV A;  3MZ9 A;  1NUY A;  4N07 A;  4R6H A;  3CFZ A;  3IO4 A;  3O28 A;  4PC9 A;  3OSR A;  4Q0C A;  5TP9 A;  3V83 A;  4GX3 A;  4H0W A;  3EKI A;  5TPA B;  3C33 A;  1D9Q A;  1NFT A;  2A5S A;  2IA4 A;  1B3E A;  4YU0 A;  2Y7R A;  1QKB A;  1NV4 A;  2ZNT A;  1NNT A;  4GLI A;  3GBA A;  1US5 A;  3IOU A;  5I58 A;  3KBR A;  3LC8 A;  1IEJ A;  3RUM A;  1EYI A;  4RK9 A;  1JW5 A;  4ESX A;  3PUX E;  4ZEB A;  2XX7 A;  1VR5 A;  4ELQ A;  2V3Q A;  1FTJ A;  4P11 A;  1LFH A;  5CC2 A;  3MAM A;  3LSX A;  1B9J A;  2QFL A;  5EQ9 A;  3B50 A;  3C9H A;  3VLV A;  1JET A;  3E13 X;  1SI0 A;  1CB6 A;  1LCF A;  4JB7 A;  3O29 A;  1FTA A;  2F3D A;  3KZG A;  1I6B A;  4XFE A;  1SDX A;  3LBS A;  1LST A;  4R9G A;  2E0S A;  4OMB A;  4H65 A;  2QPQ A;  5ISU A;  1NH8 A;  2O84 X;  5IZZ A;  4BDQ A;  4BDN A;  4U4S A;  1NI9 A;  2I48 A;  4MAG A;  1K9Y A;  2DP8 A;  2PT1 A;  4IO6 A;  4RPO A;  3RTF B;  3LSF B;  1RDY A;  4PF8 A;  3W9V A;  3RYD A;  3GBB A;  1TWY A;  3FJ7 A;  4NF8 B;  2NXO A;  1M5F A;  1WDN A;  2H9B A;  1B5J A;  2Y7P A;  3OD7 A;  4R6Y A;  3N26 A; 
#chains in the Genus database with same CATH homology
 3HHF A;  3G3I A;  4HCW A;  1B3G A;  4ELP A;  1I6Q A;  1P1U A;  2FNC A;  1OMP A;  2Y7W A;  3B7D A;  4FIM A;  3SEX A;  1LAX A;  3O2A A;  5I57 A;  2F7C A;  1BKA A;  3SET A;  1P1N A;  3U92 A;  3G3K A;  2HZK A;  1FTO A;  1IXI A;  1AMF A;  4RY1 A;  3T9U A;  5DVF A;  3QUF A;  3LSW A;  4YKJ A;  1XT8 A;  1OLA A;  4ECF A;  4DXC A;  1ZBM A;  1MS7 A;  2P1S A;  1VSO A;  2XXR A;  3TCF A;  1B4Z A;  3FVN A;  5HBC A;  1NNF A;  1JEV A;  1IIW A;  3RTW B;  1WOD A;  4KPT A;  1DOT A;  3Q26 A;  2PYY A;  2H98 A;  4QFN A;  4OVJ A;  3WAF A;  2ZYN A;  1MXU A;  4XKR A;  3TPA A;  4FJP A;  1M5B A;  4QSD A;  3K6U A;  4F2O A;  2NUV A;  1B7Z A;  4HCY A;  1SYI A;  2LAO A;  4YMA A;  4ZZE A;  4NF4 B;  2DE4 A;  2ZXT A;  1H44 A;  5CRY A;  3OMB A;  1ZU0 A;  1PBQ A;  3SEU A;  2Q8J A;  1QUJ A;  1RYX A;  3VVF A;  4UAC A;  3WAE A;  2XXI A;  2QL3 A;  4QSE A;  2F8D A;  4Q30 B;  1MXV A;  4WXJ A;  4NMY A;  4IO5 A;  4RJZ A;  4IGR A;  3S9E A;  3HHG A;  2AIX A;  1QVS A;  1UQW A;  5B7D A;  4OEU A;  5JTY A;  2QS4 A;  3TTK A;  3R6U A;  1M5E A;  1SI1 A;  3VVD A;  5ELV A;  1A40 A;  1VFD A;  3ONM A;  2RCA A;  5F7V A;  4G8H A;  2BJJ X;  3GLB A;  3FIR A;  4KD5 A;  3B6Q A;  1B4H A;  3EF7 A;  4POW A;  2O51 A;  5HM4 B;  2H99 A;  1S50 A;  3TCH A;  3BBR A;  4AB6 A;  2DE3 A;  2F7B A;  3VFJ A;  1MY0 A;  4H8I A;  4DXB A;  3KGC A;  1JW4 A;  4MLQ A;  1URS A;  1D9Y A;  3C4M A;  1FQD A;  4WKM A;  2B3F A;  4DCY A;  2Z23 A;  5I59 B;  3C35 A;  2F97 A;  3TTM A;  1POT A;  3KN7 A;  2D3I A;  3DEL B;  4QRZ A;  4ZE8 A;  1DTZ A;  1UTB B;  1LAH E;  4G77 A;  3TTR A;  1IXG A;  4U22 A;  4JDF A;  5KCJ B;  4NED A;  2O1M A;  4OWD A;  2F6P A;  3VLU A;  1ZTY A;  3FAS A;  2R6G E;  4XXU A;  3DLN A;  1BLF A;  4NF6 B;  4BLA A;  1AOV A;  1I6A A;  2HXW A;  4DIG A;  3I6V A;  2NVU B;  3FVO A;  5AA3 A;  1VFE A;  1OVB A;  5IKB A;  1GTK A;  4GVO A;  1B2H A;  1GGG A;  2F6G A;  5TU0 A;  4M4G A;  3HCQ A;  1B52 A;  2ZYK A;  3K1N A;  4LQ2 A;  2QS1 A;  1D3K A;  4JWX A;  4LUB A;  4OFO A;  1NNK A;  5H8F A;  1UTH A;  4GFR A;  4PFU A;  1QJM A;  1MXX A;  3OEL A;  1AH5 A;  3PMW A;  5DYH A;  4L17 A;  3CG3 A;  4KYS A;  4RPN A;  4KI0 E;  1EH3 A;  1MDP 1;  5FTI A;  2QSX A;  3FXR A;  1A99 A;  5M2V A;  3BKI B;  1MDQ A;  3S9N C;  4JWO A;  1FQF A;  5AA2 A;  4N6P A;  4AQ4 A;  4LA9 A;  1MY4 A;  5ITO A;  1Y4T A;  4GXS B;  2Z8F A;  1N0T A;  4GWO A;  2YJP A;  3N5L A;  3K0V A;  3CVG A;  1GVC A;  2GH9 A;  1B3H A;  3LSL A;  3K2D A;  3BFT A;  2G29 A;  3TCG A;  1B58 A;  1SW4 A;  1LFI A;  3IO6 A;  3O6H A;  1QUK A;  2ZNU A;  1N7X A;  4RYA A;  4ZEC A;  4LP2 B;  4FE8 A;  3VLW A;  4UA8 A;  1R6Z A;  3TYH A;  4I8C A;  1ANF A;  2Z8E A;  3MUQ A;  2Y7K A;  3K02 A;  3T9H B;  4C0R A;  1MY1 A;  3H6U A;  4G4P A;  5I2K B;  1AL3 A;  2QMW A;  3QIM A;  2VOZ A;  1MQG A;  1P1O A;  2B65 A;  3MVX A;  5TPA A;  4PET A;  2V93 A;  3HN0 A;  4GL0 A;  1S9T A;  2THI A;  4IB2 A;  5ICQ A;  3QXM A;  3O9P A;  3FXU A;  3IB1 A;  2WKY A;  3KJ7 A;  3OXN A;  2GHB A;  1RYO A;  5H8S A;  1BP5 A;  3KFM A;  4OEN A;  3JYR A;  2ONR A;  4R9F A;  1B5H A;  1B05 A;  1Y3Q A;  3ZSF A;  2HQ0 A;  4KQP A;  4X1B A;  2UVI A;  3KOT A;  1MPC A;  4GL8 A;  3MW0 A;  4F3G A;  3MQ9 A;  2X26 A;  3PGF A;  1N84 A;  1PB8 A;  3CRB A;  2A5T A;  2OCU A;  5AA1 A;  3O97 A;  2PT2 A;  4NF5 B;  3RGY A;  3QUJ A;  4KYD A;  4LZ8 A;  1NH7 A;  4IY6 A;  3G7W A;  4IO3 A;  5FTH A;  4BDO A;  1OQG A;  1NKX A;  2HFB A;  5DEX B;  4G8M A;  1NNP A;  3S4U A;  3MC2 A;  4O3C A;  4LZ7 A;  3U94 A;  1UIU A;  3L6H A;  2DXR A;  3M3L A;  1H43 A;  5ICT A;  1KWH A;  1MM7 A;  5H8N B;  4NE4 A;  5L9O A;  1JEU A;  4XKN A;  1DSN A;  4ZED A;  1LAG E;  5CMC A;  1OQH A;  5KZT A;  1HSE A;  2Q2C A;  3UGW A;  1YPN A;  3RQT A;  3ZKK A;  4O3A A;  4YIC A;  3MP8 A;  1MXY A;  5AA4 B;  3EQ1 A;  1JNF A;  2I3V A;  1SVX B;  1OIB A;  2NOO A;  1TT1 A;  3FJG A;  2V3T A;  3H6T A;  3OEM A;  3E9X A;  3A3U A;  2AYS A;  1J1N A;  4EQ7 A;  4TOZ A;  4I1D A;  2GRV A;  1FQA A;  5AA2 D;  3T93 B;  4IY5 A;  3MP1 A;  2RC8 A;  3MP6 A;  4U2R A;  4NWD A;  4ELR A;  4OHN A;  1FCK A;  5TP9 B;  2DWH A;  4N13 A;  1PC3 A;  1FTK A;  3PPQ A;  1AIV A;  3OO9 A;  3PD9 A;  5CI5 A;  3TUS A;  3G3J A;  3KSX A;  3M3K A;  4THI A;  4P0I A;  3PD8 A;  4KHZ E;  2XX9 A;  2Q9T A;  3K1P A;  1USY H;  4G8N A;  3OO6 A;  2FYI A;  5L9M A;  2R9J A;  3PMV A;  2RIN A;  4TQU Q;  3MZ1 A;  2DQV A;  2HCA A;  4R6K A;  2ZNS A;  5EHS A;  2D5W A;  2RC7 A;  5AE4 A;  3KG2 A;  3K6W A;  2OZZ A;  2Q88 A;  4DDD A;  4U1Z A;  2F34 A;  2QS2 A;  3R7X A;  3C32 A;  5A5X B;  3ZS6 A;  3PUV E;  3M3F A;  3Q28 A;  1YTV A;  4O3B A;  3B6W A;  1ZMG A;  4U1O A;  5KDT A;  2PMS A;  3W9W A;  5DVJ A;  4MLV A;  1N7W A;  2H25 A;  3MPK A;  5LOM A;  3S9M C;  4IO7 A;  2DWJ A;  1L5T A;  2V3U A;  4OEV A;  1B40 A;  4LON B;  2DWI A;  3TQL A;  3TKD A;  2AL4 A;  4KCC A;  3GXA A;  4F2Q A;  1URD A;  4OZ9 A;  5I57 B;  3MVZ A;  3H7M A;  4IO4 A;  1FW0 A;  4R75 A;  2X7P A;  4F3B A;  5CBR A;  2OBG A;  1EZ9 A;  4H8J A;  4NF6 A;  4ZZA A;  1R9L A;  3ODB A;  1SQY A;  2IEE A;  3Q27 A;  3EHU A;  3V89 B;  2YPN A;  3K00 A;  5EHM A;  3OEN A;  4TLL B;  1B0H A;  4ISU A;  3H4Z A;  3O6I A;  3PUY E;  1LAF E;  4OTE A;  4PFW A;  3RY3 A;  1SW2 A;  3CFL A;  1US4 A;  1Q35 A;  3TEP A;  4QFP A;  3CIJ A;  1P1W A;  1TFA A;  5H8Q A;  1IQ7 A;  3A09 A;  1HSL A;  1FTM A;  3DP4 A;  3U93 A;  4MFI A;  3ZKL A;  3KN8 A;  2O6A A;  2XXQ A;  3KOS A;  1FQC A;  5BWJ A;  1JQF A;  3W15 C;  4BDR A;  3QK6 A;  2VHA A;  2XD3 A;  4EF1 A;  5IAI A;  1ATG A;  4HTG A;  3S9L C;  2F78 A;  2I0C A;  1M5C A;  3MVW A;  1IIT A;  3C36 A;  5K2Y A;  3FV2 A;  3MWB A;  2DVZ A;  4OQO A;  3H6V A;  3FVG A;  3IOV A;  1N76 A;  1XC1 A;  4F3S A;  2CMO A;  3A3C A;  5JTY B;  1Y3P A;  4X9T A;  3O66 A;  2ANJ A;  5DVI A;  1JW1 A;  3FD3 A;  2XXP A;  5I2N A;  3TDJ A;  3DM0 A;  5L9S A;  3K4U A;  3PPO A;  3IB2 A;  2CZL A;  1MY3 A;  1PEB A;  3OOA A;  3KEI A;  1D4N A;  2XXY A;  4OER A;  1Z7N E;  1EU8 A;  1B1H A;  2HAV A;  3C34 A;  2ALU A;  2XXX A;  2VD2 A;  2XX8 A;  4DLD A;  3VDF A;  3SKP A;  1O64 A;  1N04 A;  4RNS A;  1IUD A;  3IOR A;  5K2X A;  5I2K A;  1LCT A;  1Y1M A;  1DPP A;  3UN6 A;  1H76 A;  3FVK A;  3IJO B;  4Q5T A;  4YKI A;  1NMU A;  4LVQ A;  3O6G A;  3EHS A;  4PFY A;  3ECR A;  5DTB A;  3UOR A;  1RKM A;  1USY E;  1MQJ A;  4ZDM A;  4R2F A;  3U72 A;  3F11 A;  3DP6 A;  2V25 A;  3QYT A;  3UA8 A;  2O7I A;  3FJM A;  4GD5 A;  3TQW A;  4U4X A;  4XIG Q;  4FED A;  3BFU A;  5ITP A;  2H4I A;  3D4C A;  4X1D A;  3TZA A;  4YB6 A;  1UTH B;  4ELO A;  1OVT A;  1MH4 A;  1H45 A;  3SER A;  3LR1 A;  4NF5 A;  4R73 A;  2YLN A;  1LLS A;  4WED A;  1MH3 A;  5I56 B;  4YB5 A;  3PU5 A;  4IGT A;  5CM6 A;  2QS3 A;  5J1D A;  4X48 A;  4H1X A;  2Y7I A;  2XXV A;  3CSB A;  2ONS A;  3FZV A;  3OO8 A;  4JSD A;  3RNN A;  5AA2 B;  2QMX A;  3T9V A;  3C31 A;  3TTL A;  5DEX A;  1XVX A;  1LB9 A;  1MY2 A;  1A54 A;  1EZO A;  3H03 A;  4ZS9 A;  2F35 A;  4PQJ A;  2O1L A;  1ZLQ A;  3VE1 B;  4AB5 A;  1I69 A;  1SD3 A;  5H8N A;  4RK2 A;  2OLB A;  2ZYM A;  5L8D A;  3E3K A;  4GIZ A;  4G68 B;  3B6T A;  1QKA A;  1B0L A;  3T22 A;  1GR2 A;  2M8C A;  1JVY A;  2GFE A;  1UIV A;  4Q8R A;  3TMG A;  3FXQ A;  1B5I A;  4FAT A;  3RLF E;  5AA4 A;  3CI8 A;  1GV8 A;  5H8H B;  3HST A;  4BDL A;  4F1U A;  2X7Q A;  4ONY A;  4EUO A;  4E0W A;  4WEP A;  2UYF A;  4EDP A;  1ZJL A;  4KYE A;  3TAJ A;  2DOJ A;  4JWY A;  1DPE A;  4NF8 A;  1N3X A;  1JVX A;  4M1V A;  2HEU A;  1LBC A;  4EQ9 A;  5EYF A;  2DXY A;  4YKP A;  3G3G A;  4RXL A;  3SDF A;  1OLC A;  3QAX A;  4H67 A;  4LZ5 A;  1PB7 A;  3R26 A;  3H06 B;  4F18 A;  4EQB A;  3OSQ A;  2DVC A;  1NL5 A;  2UYE A;  1QW0 A;  2ZMB A;  4DXU A;  4GXA A;  4OFL A;  3HO7 A;  1H3D A;  2O69 A;  3MBP A;  2XD2 A;  5CMM A;  3IJX B;  3U8Q A;  1SW1 A;  4MBP A;  1ZKB A;  3N6T A;  2OWS A;  1B7U A;  4G68 C;  3CFX A;  3HV1 A;  2A5T B;  3TTN A;  1LFG A;  5HPQ A;  1MQH A;  4DZ1 A;  1TFD A;  2ESN A;  1HSJ A;  1SBP A;  2RC9 A;  2XHD A;  2DS9 A;  1XOC A;  5A5X A;  1CE2 A;  3M8U A;  4NF4 A;  3T66 A;  4R2B A;  3N6U A;  4E0X A;  3JZJ A;  4OYV A;  2GHA A;  4F31 B;  3K6V A;  2FA7 A;  3KN3 A;  3RPW A;  4QHQ A;  3G3F A;  4I9D A;  5I58 B;  3ILT B;  1II5 A;  1R1N A;  3FGS A;  2I0B A;  3MVY A;  1QUL A;  4H5F A;  2Z22 A;  2VP1 A;  3SES A;  3SEV A;  4EXK A;  1Q1K A;  2Q2A A;  3EHT A;  1SYH A;  4LAT A;  4JXI A;  3IOW A;  4F19 A;  5BUU A;  1B1X A;  4OES A;  3K6X A;  3E4R A;  2UVG A;  2NWJ A;  1MG1 A;  4GQO A;  2OK2 A;  3H3G A;  1VE4 A;  5CMK A;  2DE2 A;  4HW8 A;  4F22 A;  2PBW A;  2ZYO A;  5B70 A;  4IO2 A;  1EZP A;  3OO7 A;  2F7A A;  4F1Y A;  3Q29 A;  5DT6 A;  4KR5 A;  1XHY A;  3CR9 A;  1B6H A;  1D9V A;  1FTL A;  1WVJ A;  1IXH A;  3QSL A;  2VD3 A;  5I59 A;  2O7U A;  2I49 A;  1YAE A;  3SEW A;  4H5G A;  3K01 A;  1N3W A;  1UTB A;  4PFT A;  5JEI A;  4P0G A;  4OET A;  3EPE A;  5KCJ A;  1XS5 A;  3I3V A;  2RF1 A;  5CMB A;  2ABH A;  4ZEF A;  1MQD A;  4R74 A;  1R9Q A;  2XXT A;  2VGQ A;  4ZEK A;  1B3L A;  3JV9 A;  4GF8 A;  1IZ1 A;  1P99 A;  4ZEI A;  4I62 A;  2R71 A;  2DSF A;  4OFJ A;  2PVU A;  3S2V A;  3L6G A;  1LGB C;  4FAJ A;  1LBB A;  3PUZ E;  3IR1 A;  3GZG A;  3MPL A;  1A8E A;  4XTC Q;  2UVH A;  2G93 A;  4RA1 A;  4JBZ A;  3TEL A;  3TOD A;  5KDT B;  4H6D A;  2DWA A;  2I4C A;  3D4G A;  4GOT A;  2P0S A;  2Z8D A;  4F1V A;  3USD A;  1A8F A;  3UK4 A;  3CG1 A;  3G3H A;  3UP9 A;  2F5X A;  4MH5 A;  4C1T A;  3HPI A;  1B3F A;  2REJ A;  4TLM B;  4XKP A;  4PP0 A;  2OWT A;  5JK4 A;  3IAZ A;  3PUW E;  1O63 A;  3PV0 E;  3LUY A;  3IX1 A;  2UXA A;  2DYX A;  2W7Y A;  4ESW A;  3KSJ A;  3H6W A;  2XXU A;  2QRY A;  1FQB A;  1BIY A;  2ONK E;  4K3F A;  1MXW A;  5FHO A;  4QFL A;  4R72 A;  3DP8 A;  1B7H A;  3VVE A;  3P7I A;  4YAH X;  4EF2 A;  3PPP A;  4G2Z A;  2HZL A;  1TXF A;  2RCB A;  4DE8 A;  2Y84 A;  3ILU B;  2V84 A;  4YKK A;  1PDA A;  2P2A A;  4F39 A;  3IOT A;  3IB0 A;  4MF3 A;  3V8X B;  5F1Q A;  1S7Y A;  5H8Q B;  1Y1Z A;  4QFK A;  4DCX A;  1Y4C A;  3Q25 A;  2Q89 A;  4F3P A;  4ZE9 A;  1PB9 A;  3THI A;  2D21 A;  1POY 1;  3SEY A;  4QF9 A;  3VV5 A;  4JSO A;  5I56 A;  1A55 A;  1F9B A;  4BDM A;  2H5Y A;  1XVY A;  4YMB A;  3T9X B;  4NWC A;  2E1S A;  3CSG A;  2B3B A;  2RKM A;  1B51 A;  1MRP A;  3I5O A;  2UVJ A;  3MJN A;  1DMB A;  3RT8 A;  3FV1 A;  5FHN A;  4LQ5 A;  1FQE A;  5CBS A;  1Y20 A;  1B46 A;  2OJT A;  4QFO A;  2XXW A;  5I84 A;  2AL5 A;  4G68 A;  4YB7 A;  4ND9 A;  5I2N B;  2XXH A;  3FUZ A;  4YZZ A;  4Z7E A;  1Y3N A;  5H8F B;  4U21 A;  4EXL A;  3IK6 B;  4XKQ A;  3RT6 B;  3PPN A;  1MM6 A;  5H8H A;  4HS7 A;  3IL1 B;  1ELJ A;  2I58 A;  1IXC A;  2QJE A;  4KCD A;  3K1M A;  4F29 A;  4QSC A;  1P1Q A;  5FHM A;  3RN8 A;  1LB8 A;  3KJT A;  1PBP A;  1YCJ A;  2F36 A;  1Z7M E;  3TFL A;  1A7L A;  1M5D A;  3MZB A;  3V5A A;  4POX A;  3AXF A;  4Z0I A;  3VXC A;  1DTG A;  3VXB A;  3PPR A;  1SW5 A;  2PX1 A;  2I4B A;  4PE5 B;  3T96 B;  2O68 A;  1Y9U A;  1MPB A;  2REG A;  3UIF A;  2HAU A;  4NTL A;  3PMX A;  4KFQ A;  1MXZ A;  3FAT A;  1MPD A;  4U23 A;  4C1U A;  1URG A;  4FEC A;  1ZIU A;  1T0K A;  4FEB A;  1B32 A;  2KLF A;  3OEK A;  4GRK A;  1MQI A;  1O7T A;  4FOR A;  3N94 A;  3U1O A;  3EN3 A;  2I3W A;  1QUI A;  1BTJ A;  2I6E A;  4OXV A;  3MZ9 A;  4N07 A;  4R6H A;  3CFZ A;  3IO4 A;  3O28 A;  3OSR A;  4Q0C A;  5TP9 A;  3V83 A;  4H0W A;  5TPA B;  3C33 A;  1NFT A;  2A5S A;  2IA4 A;  1B3E A;  4YU0 A;  2Y7R A;  1QKB A;  2ZNT A;  1NNT A;  4GLI A;  3GBA A;  1US5 A;  3IOU A;  5I58 A;  3KBR A;  3LC8 A;  1IEJ A;  3RUM A;  4RK9 A;  1JW5 A;  4ESX A;  3PUX E;  4ZEB A;  2XX7 A;  1VR5 A;  4ELQ A;  2V3Q A;  1FTJ A;  4P11 A;  1LFH A;  5CC2 A;  3MAM A;  3LSX A;  1B9J A;  3C9H A;  3VLV A;  1JET A;  3E13 X;  1SI0 A;  1CB6 A;  1LCF A;  4JB7 A;  3O29 A;  3KZG A;  1I6B A;  1SDX A;  3LBS A;  1LST A;  4R9G A;  2E0S A;  4OMB A;  4H65 A;  2QPQ A;  5ISU A;  1NH8 A;  2O84 X;  4BDQ A;  4BDN A;  4U4S A;  2I48 A;  2DP8 A;  2PT1 A;  4IO6 A;  4RPO A;  3RTF B;  3LSF B;  3W9V A;  3GBB A;  1TWY A;  3FJ7 A;  4NF8 B;  2NXO A;  1M5F A;  1WDN A;  2H9B A;  1B5J A;  2Y7P A;  3OD7 A;  4R6Y A;  3N26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...