4Z7EA

Soluble binding domain of lmo1422 abc-transporter
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
270
structure length
270
Chain Sequence
EITIAGKLGAEPEILINMYKLVIEDETDLKVNVKPNMGKTSFVFNALKSGDIDIYPEFTGTVLETFLKENAKTHDPEEVYTQARDGLAKDFDMTYLKPMKYNNTYALAVSPEFAKENNLEKISDLGPVSDQVKAGFTLEFKDRSDGYKGIQDKYGLTFSNLKTMEPKLRYNAIKSGDINLLDAYSTDSELAQYKLKVLEDDQQLFPPYQGAPLMLTKTLDKYPELKKPLNKLAGKITDDEMRKMNYEVNVNGKSAYTVAKDYLKDQGIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1422 protein
publication title Crystal Structure of the Substrate-Binding Domain from Listeria monocytogenes Bile-Resistance Determinant BilE
doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transport protein
total genus 98
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4z7eA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4z7eA02
1LBCA 5ELVA 5AA1A 2XXTA 1Y9UA 2RC7A 3K6XA 1A8FA 2XXVA 3USDA 5FTHA 4KR5A 1WVJA 1H3DA 3KSJA 3L6HA 2ZYKA 3W15C 3O6HA 4F3GA 1I69A 5EHMA 1M5DA 5F7VA 4EQBA 4OEVA 4R74A 2VOZA 4U4XA 5AA2A 3PD8A 3MPLA 1QKBA 1USYE 5HM4B 3IX1A 1BKAA 4OENA 4IGRA 5ICQA 4EQ7A 1H76A 3O66A 4ZE9A 1NFTA 3T93B 3BBRA 4NF8B 3SERA 1I6QA 2V84A 3H6VA 3TCHA 4P0IA 3B7DA 1BLFA 5LOMA 2DP8A 3FIRA 3JYRA 3C34A 1SYIA 4MLVA 1USYH 1FQBA 3H6WA 3C31A 4KHZE 5TU0A 3IOVA 3QK6A 2OBGA 4ZEIA 4PFTA 3RPWA 2QS1A 3TTNA 2E0SA 1P1WA 5H8SA 4ELOA 1MM7A 4GLIA 3EN3A 3EHSA 3CI8A 1MXXA 2YPNA 3FXRA 4NF6B 1B0HA 4Z0IA 1UQWA 2Y7PA 3KG2A 1FTJA 4RJZA 1ZJLA 3ZSFA 2ZNUA 4JB7A 3T66A 2GHAA 4KCCA 1PB8A 1SDXA 4EF1A 4KYDA 5CBSA 3IR1A 1NKXA 3FASA 3RNNA 4DCXA 1CE2A 1Y3QA 1ZMGA 1GV8A 1NH7A 1QUIA 1B1HA 3M8UA 3N6UA 2DS9A 4OETA 2I0BA 1XOCA 2I4BA 2V3TA 2F5XA 3H7MA 1TT1A 3TTKA 4ZEDA 1DPEA 1Z7ME 3CSBA 4RNSA 3T22A 1I6BA 5DTBA 3UA8A 3KJ7A 1AMFA 1CB6A 3K6WA 4QRZA 3Q28A 1QKAA 4YKPA 3O9PA 1P1NA 4I8CA 3Q27A 3K6VA 2NUVA 1J1NA 4GIZA 5IAIA 2HZLA 3H3GA 4PQJA 5TPAB 1SYHA 1Y20A 4O3CA 1S9TA 3PPNA 4ISUA 1GVCA 1XVYA 3JV9A 3EQ1A 3H6UA 4MH5A 3PMXA 5J1DA 4QFOA 4RY1A 1MG1A 1OQGA 5H8HB 2REJA 3T96B 3I3VA 1TWYA 4XTCQ 1US5A 1O63A 3UORA 3TODA 1B32A 4EXKA 3KN7A 3PUZE 3IOWA 2ZNSA 3O6GA 5B7DA 2P1SA 2NOOA 4WEDA 2ALUA 4GVOA 4ZZEA 4LA9A 4DXBA 4EDPA 4P11A 4OZ9A 3TQWA 4H5GA 4H1XA 3MJNA 3SDFA 3IK6B 4OFJA 5HBCA 1POY1 1PB9A 1UTBB 3LSFB 1D9YA 4RYAA 1D3KA 1GGGA 2VGQA 3PPPA 5H8FA 1OVBA 3HO7A 1D9VA 4OWDA 4QFKA 1YAEA 1SW5A 5IKBA 1UTBA 3MC2A 3C32A 3OXNA 4RK2A 5L8DA 2OZZA 1LB8A 1QULA 3TEPA 1LGBC 1Q1KA 2ABHA 3E9XA 3PV0E 2D5WA 2OWTA 3B6QA 3V5AA 3RGYA 1JVXA 4AB6A 3OSQA 2DE2A 3U8QA 1ZLQA 2P0SA 4FIMA 4X1BA 4OESA 2D3IA 5AE4A 4ELQA 3TKDA 2DE4A 2ANJA 2Q9TA 3PU5A 1LLSA 3CVGA 3GBBA 4YMBA 1MPCA 1QUJA 3K0VA 4THIA 4IO6A 3PPRA 1FTMA 3D4CA 1M5FA 3IB2A 3PGFA 4BDMA 1Y4CA 1MDQA 3M3KA 3S2VA 2DWAA 4F19A 5ICTA 3KBRA 4GXSB 1VFEA 4XKPA 3PUVE 4ELRA 3O97A 3VXBA 1EZPA 4GXAA 3BFTA 2DOJA 4BDNA 2XXIA 4ESWA 4H65A 2I58A 2F36A 3RTFB 3CSGA 4JSDA 3MVWA 4LUBA 1N3XA 1GTKA 1OQHA 3VVEA 3RUMA 4HTGA 3KEIA 3GBAA 3TTMA 5I2NB 1DMBA 4LZ7A 4I62A 2Z8FA 2F7AA 4KYSA 5H8NA 4ZEKA 5CBRA 4ZDMA 3ILTB 3T9UA 4PFUA 3SEYA 2CZLA 1RKMA 3R6UA 1NNPA 3PPOA 2F7BA 1S50A 3OSRA 3PUYE 2Z8DA 4OQOA 1N76A 5FHMA 4QSCA 1B40A 4O3BA 3UP9A 2G93A 3WAFA 2VD3A 1FQEA 1P99A 5ITOA 3KOTA 4N07A 1IXGA 3MPKA 2HFBA 5KDTB 4TLLB 1B6HA 3QSLA 5L9OA 2OJTA 4NF4B 2I4CA 3LC8A 1LFGA 3OEMA 3Q26A 3SEUA 3V89B 4YKJA 4DE8A 1BTJA 3TQLA 2XX8A 4U23A 2HXWA 4MFIA 3E3KA 2NVUB 3U92A 4YKKA 4C1UA 3CIJA 4QFPA 3TCFA 1MQGA 5CMMA 2O7IA 3ZKKA 5TP9B 5BUUA 4HCWA 1OLAA 4DIGA 2F6PA 3LR1A 2PT1A 1M5BA 5CI5A 2PVUA 1JNFA 1QVSA 3DP8A 1URDA 1I6AA 3MWBA 4Q5TA 3SKPA 1MXVA 3HN0A 2ZYMA 3ONMA 5K2XA 2AL5A 2OWSA 2DVCA 5DVJA 2QSXA 3EF7A 1ANFA 3AXFA 3H03A 1B3GA 4OFOA 1URSA 2O69A 1LCFA 1O7TA 1OVTA 1SI0A 4E0WA 1MY2A 4UA8A 2DYXA 5AA2B 1JEUA 4R75A 1B9JA 3G3FA 3K6UA 4F18A 2UYFA 3VVDA 2PX1A 4YZZA 5JEIA 3VLVA 3TTRA 4Q30B 3BKIB 3CR9A 2X7PA 4NTLA 1RYOA 3DP4A 1FTKA 1B46A 5M2VA 2O1LA 4M4GA 3VV5A 1DPPA 4FEBA 4BLAA 3S9NC 2HEUA 1UTHB 4LQ2A 3HV1A 4PP0A 2H98A 1HSJA 2QJEA 3IORA 2H25A 2O1MA 3V83A 1PBQA 4ZEFA 4FE8A 3DM0A 3OD7A 1UTHA 2DQVA 3GZGA 2Q8JA 1XVXA 4NEDA 4RK9A 1IXHA 1TFAA 4EF2A 2I0CA 2Y7WA 3E13X 1EZ9A 2V25A 2DVZA 3QAXA 3EPEA 2V93A 1P1UA 4R9GA 5CMBA 4OTEA 4BDRA 4G8MA 2QMWA 1AL3A 1POTA 3E4RA 3HHGA 5FTIA 3BFUA 1NNFA 1BP5A 3MUQA 3B6TA 3QIMA 1ZTYA 2F7CA 4F29A 4ND9A 5DEXA 1OLCA 4QHQA 4OXVA 4IO4A 4RA1A 4R72A 3K01A 1B7HA 5H8QA 4RPOA 1B2HA 3C4MA 5I84A 1IXIA 4FAJA 1FQCA 4OHNA 2O68A 4IO3A 2ZNTA 4QFNA 3OO7A 1MDP1 4OYVA 1F9BA 1B3EA 4WXJA 4KI0E 4H8IA 3K2DA 4POXA 3G3HA 2XX9A 4KQPA 2Q88A 3S9MC 4EXLA 1RYXA 3CFXA 2XXYA 3O28A 1FQFA 2H99A 2UVGA 3TUSA 2A5TA 4F3SA 4IY6A 4OERA 1JVYA 2OCUA 4PFWA 1LSTA 4MLQA 2RCBA 4RPNA 1HSLA 1MXZA 2GHBA 2QL3A 2UVHA 1EH3A 4G2ZA 4LVQA 5JK4A 4YMAA 3F11A 2I3WA 3M3LA 1MS7A 1DTGA 4G68A 4OFLA 3IJOB 4LONB 2GH9A 5ISUA 1H45A 5KZTA 4GL0A 3VVFA 3IJXB 1FW0A 2ZYNA 3MP8A 4G8NA 5I59A 1VFDA 5DT6A 2V3QA 4H6DA 4HCYA 3TPAA 1MM6A 3RY3A 4FJPA 1Y3NA 1P1QA 1D4NA 4R6HA 4NF5B 4R73A 5DVIA 3W9VA 2THIA 1A8EA 3A3CA 1PEBA 5H8FB 4QSEA 4YB5A 3KGCA 2G29A 4ELPA 3K02A 4NF5A 2UVJA 2ONKE 1SD3A 4HW8A 4YICA 3N6TA 1SI1A 2QPQA 4R2FA 4R6KA 1B5IA 1KWHA 4YKIA 4ONYA 4OEUA 2Z8EA 1MQJA 4ZEBA 3K4UA 3PMVA 3MQ9A 2ZMBA 5HPQA 4KPTA 4Q0CA 1JEVA 3R7XA 4FECA 1Y3PA 3VLWA 3KSXA 4PETA 4IO2A 2ONRA 3C33A 2F35A 4GQOA 1R6ZA 1XHYA 3IOTA 3OO8A 3KJTA 3FV2A 4GWOA 5BWJA 4FATA 3VDFA 4KCDA 3FUZA 1B58A 3H4ZA 1B5JA 4OVJA 3IOUA 1BIYA 2XXQA 5I57B 3UGWA 2GFEA 2QMXA 3W9WA 2VHAA 1Z7NE 1VR5A 2DSFA 4DCYA 4RXLA 5CRYA 1ATGA 4QF9A 5I2KA 4KD5A 1B51A 1MXYA 4P0GA 3FVKA 3LUYA 4AB5A 4U21A 1B52A 1M5EA 2XXWA 5I57A 2XXHA 4QSDA 1LCTA 1MY4A 4JWXA 1AIVA 1LB9A 1UIVA 1MPBA 1IQ7A 2RF1A 2X26A 5CM6A 4XKQA 3IB0A 1TXFA 4LATA 5H8NB 3FXQA 3MBPA 3SEXA 2H4IA 4F1YA 1IEJA 3RT6B 1R9QA 2HQ0A 5EYFA 2QS2A 1B3HA 3MZBA 3UN6A 5I58B 2DXRA 4XKNA 3V8XB 3OOAA 3U94A 5AA3A 1SVXB 4JWYA 3FGSA 3FVNA 5ITPA 3KN8A 3RN8A 1H43A 1WDNA 5I58A 4IB2A 5AA4A 1ZKBA 4Q8RA 1HSEA 4F3BA 4TOZA 3IB1A 1VSOA 3LSXA 3OEKA 1MQHA 2LAOA 3SEVA 1FTOA 1SW2A 3FJMA 3RTWB 2F78A 3OENA 3OELA 3ILUB 4F31B 4X9TA 3UIFA 1N7WA 1JW5A 3VXCA 1QJMA 3OO6A 1MRPA 1ZU0A 4DXCA 2Y7RA 2GRVA 1FQDA 4XKRA 4X1DA 1PDAA 2DWIA 2O51A 1NH8A 4HS7A 3I5OA 1JETA 3T9VA 1XT8A 2I48A 3FD3A 2X7QA 3D4GA 2IA4A 4LP2B 2F97A 1II5A 3TZAA 1WODA 2O7UA 4IO5A 3VFJA 1UIUA 2NXOA 2O84X 3U1OA 3WAEA 2I49A 4N6PA 4GFRA 3IL1B 2F34A 3HHFA 1B1XA 2P2AA 3U93A 4ECFA 3LBSA 4KYEA 2PT2A 3PPQA 4R6YA 3H06B 3G3JA 1N0TA 4LZ5A 4GF8A 1PBPA 3HPIA 1GR2A 1NNKA 1LAXA 1URGA 1MY1A 1ZBMA 4F22A 4U1OA 2E1SA 1MY0A 1JW4A 1H44A 5DYHA 3GLBA 4K3FA 4YU0A 2AYSA 2XXUA 2RC9A 1TFDA 4BDQA 1B4HA 3P7IA 4IY5A 3FZVA 1M5CA 2PBWA 4F39A 3MZ1A 4BDOA 4R9FA 1MY3A 1ZIUA 2H5YA 2V3UA 3TELA 2B3BA 3TYHA 4KFQA 2ESNA 1LFHA 2UVIA 3RQTA 3K00A 4M1VA 2HCAA 1MH4A 3CRBA 3IO6A 3MVZA 2Z23A 3TFLA 4NE4A 1US4A 2YLNA 1MXUA 2KLFA 1R1NA 4GRKA 4C0RA 3O2AA 4NWDA 3TAJA 4F2QA 5FHOA 5L9MA 2RCAA 1FTLA 4AQ4A 2Y7KA 3FATA 4XXUA 3UK4A 2XX7A 3A09A 2PYYA 5B70A 1N84A 4NF8A 5DEXB 3S4UA 4U2RA 3THIA 2NWJA 3KOSA 4DXUA 3N26A 3ZKLA 2QRYA 4TQUQ 5H8QB 1DTZA 1P1OA 4F1UA 1LFIA 3L6GA 3OO9A 2RKMA 3PUWE 4U4SA 4F1VA 3T9XB 3MVYA 2FYIA 1DOTA 1OMPA 3RT8A 3FV1A 4NWCA 4DZ1A 3Q25A 4NF6A 1Q35A 3K1MA 2W7YA 1DSNA 3K1PA 3OMBA 1LAHE 2IEEA 4GL8A 3KFMA 1EU8A 2XD3A 4EUOA 3TDJA 2A5TB 3G3KA 3VLUA 1N04A 4I9DA 2B3FA 4PE5B 3RLFE 1YPNA 3QUJA 3LSLA 2R71A 1NL5A 2I6EA 4G68B 2Y7IA 1N7XA 1Y1ZA 4ZE8A 2DE3A 2H9BA 1L5TA 3PD9A 4IO7A 4QFLA 4I1DA 3SETA 3KN3A 3HCQA 2QS3A 4H67A 4U1ZA 5I59B 3A3UA 1EZOA 4JBZA 1IXCA 1SW1A 1NNTA 3G7WA 1S7YA 2AIXA 3O6IA 4L17A 5TPAA 1MPDA 5F1QA 1T0KA 1LBBA 1B7ZA 1MXWA 1OIBA 1MQIA 3C35A 2F6GA 4DDDA 1XC1A 2VP1A 4ZZAA 2Q2AA 2AL4A 5H8HA 3MZ9A 5EHSA 3SESA 3U72A 3DELB 1FQAA 1O64A 3T9HB 2A5SA 1A7LA 3MVXA 2M8CA 1MQDA 1PB7A 1B3LA 2Y84A 3H6TA 3FJ7A 4C1TA 2FNCA 1Y1MA 4MF3A 3MP1A 4GD5A 4OMBA 2FA7A 3FVGA 4ZS9A 3MP6A 2R9JA 4E0XA 2HZKA 3SEWA 5A5XB 3G3GA 3GXAA 2VD2A 2REGA 3VE1B 4FEDA 5DVFA 1VE4A 4G4PA 3FXUA 4BDLA 3M3FA 3B6WA 1JW1A 1A54A 5I2KB 4X48A 2Q2CA 3TMGA 5A5XA 2HAVA 3DLNA 1N3WA 2ONSA 3ODBA 2XXPA 1Y4TA 5JTYB 2ZXTA 1LAFE 2DWHA 3N5LA 5KCJB 2O6AA 4NMYA 4U22A 2YJPA 2QS4A 1B3FA 4IGTA 1SQYA 2D21A 3C36A 3CG3A 4GOTA 1A40A 2UYEA 1JQFA 5JTYA 4YAHX 3QYTA 3S9EA 1QW0A 3PUXE 5AA2D 5KCJA 3QUFA 4XIGQ 2Z22A 2XHDA 3CFZA 4H5FA 4G77A 4YB7A 5FHNA 1AH5A 1A99A 4POWA 1R9LA 5K2YA 5L9SA 2F8DA 4JWOA 5AA4B 4F2OA 4YB6A 3I6VA 1IUDA 3IAZA 4O3AA 3JZJA 3C9HA 2DWJA 2R6GE 3MW0A 2XXXA 1B7UA 4ZECA 5CMKA 5I56B 3EHUA 3QXMA 3TCGA 2CMOA 3MAMA 3CFLA 3TTLA 4Z7EA 4JDFA 3G3IA 1IZ1A 2RINA 1SW4A 3PMWA 3ZS6A 2PMSA 3FJGA 1XS5A 4ESXA 1YTVA 4DLDA 5I2NA 4G8HA 2B65A 2ZYOA 1IITA 2UXAA 3ECRA 5I56A 3HSTA 3LSWA 2BJJX 2OK2A 3IO4A 3S9LC 3KZGA 4PFYA 3R26A 1B5HA 4R2BA 4G68C 1NMUA 4F3PA 4H0WA 1SBPA 3FVOA 2HAUA 1LAGE 2XXRA 1QUKA 3Q29A 2Q89A 1B05A 5CC2A 1B4ZA 2DXYA 1AOVA 3EHTA 2WKYA 4TLMB 4LZ8A 5KDTA 1PC3A 4LQ5A 4NF4A 4JSOA 3K1NA 1FCKA 5CMCA 4EQ9A 4WKMA 3CG1A 2I3VA 1B0LA 1ELJA 1A55A 1IIWA 4MBPA 3N94A 2RC8A 2XD2A 4WEPA 4FORA 4H8JA 1YCJA 4N13A 1MH3A 4JXIA 5TP9A 3O29A 3DP6A 2OLBA 4UACA
chains in the Genus database with same CATH superfamily
1LBCA 1YYZA 5ELVA 5AA1A 1KA0A 2XXTA 1Y9UA 2RC7A 3K6XA 4P1EA 1INPA 1IMDA 1A8FA 2XXVA 3USDA 5FTHA 4KR5A 1WVJA 4MX6A 1H3DA 3KSJA 3L6HA 2ZYKA 3W15C 3O6HA 4F3GA 1I69A 5EHMA 1M5DA 5F7VA 4EQBA 4NAPA 4OEVA 1FTAA 2B4LA 5ET5A 4R74A 4JVIA 2VOZA 4U4XA 5AA2A 4H46A 3PD8A 3MPLA 1QKBA 1USYE 5HM4B 3IX1A 1BKAA 4OENA 4IGRA 5ICQA 4EQ7A 1H76A 2XA5A 3O66A 4ZE9A 1NFTA 3T93B 1FSAA 3BBRA 4NF8B 3SERA 1I6QA 2V84A 3H6VA 3TCHA 5DW8A 4P0IA 3B7DA 1BLFA 1NV7A 5LOMA 2DP8A 3FIRA 2CEXA 1JP4A 3C34A 1D9QA 3JYRA 1SYIA 4MLVA 1FBGA 1USYH 1FQBA 3H6WA 3C31A 4KHZE 5TU0A 3IOVA 4G61A 1FPDA 3QK6A 2XWOA 1G0HA 2OBGA 4ZEIA 4PFTA 3RPWA 2QS1A 3TTNA 2E0SA 1P1WA 5H8SA 4ELOA 1MM7A 4GLIA 1BK4A 3EKIA 3EN3A 3EHSA 3CI8A 1MXXA 2YPNA 3FXRA 4NF6B 1B0HA 4Z0IA 1UQWA 4GX3A 2Y7PA 3KG2A 1FTJA 4RJZA 4NF0A 1ZJLA 3ZSFA 2ZNUA 4JB7A 3T66A 2GHAA 4KCCA 1SDXA 1PB8A 4EF1A 4KYDA 4O7IA 4XEQA 3MYUA 1NUXA 5CBSA 4GWXA 3IR1A 1NKXA 3FASA 3RNNA 4DCXA 1CE2A 1Y3QA 1ZMGA 1GV8A 1NH7A 1QUIA 1B1HA 3M8UA 1FPEA 3N6UA 2DS9A 4OETA 2I0BA 1XOCA 2I4BA 2V3TA 3T1BA 2F5XA 2DDKA 3H7MA 1TT1A 4N8YA 3TTKA 1DPEA 4ZEDA 1Z7ME 3CSBA 4RNSA 3T22A 1I6BA 5DTBA 3UA8A 3KJ7A 1AMFA 1CB6A 3K6WA 4X04A 4QRZA 3Q28A 1QKAA 4YKPA 3A29A 3O9PA 1P1NA 4I8CA 3Q27A 3K6VA 1YXIA 2NUVA 1J1NA 4XFEA 4GIZA 5IAIA 2HZLA 3CHGA 3H3GA 4PQJA 5TPAB 1SYHA 1Y20A 4O3CA 1S9TA 3PPNA 4ISUA 1GVCA 1XVYA 3JV9A 2L5VA 3EQ1A 4DI3D 1K9ZA 3H6UA 4MH5A 3PMXA 5J1DA 4QFOA 4RY1A 1MG1A 1OQGA 5H8HB 2REJA 2OX3A 3T96B 4OANA 3I3VA 2F3BA 1TWYA 4XTCQ 2FVZA 1US5A 1O63A 3UORA 3TODA 1B32A 4EXKA 3KN7A 3PUZE 3IOWA 2ZNSA 3O6GA 4MAGA 5B7DA 2P1SA 2NOOA 4WEDA 2ALUA 4GVOA 3B50A 4ZZEA 4LA9A 4PDDA 1FPGA 4DXBA 2XWIA 4EDPA 4P11A 4OZ9A 3TQWA 4H5GA 4H1XA 3MSTA 3MJNA 5IZ1A 3SDFA 3IK6B 5LTCA 4PAIA 4OFJA 5HBCA 1POY1 1PB9A 1UTBB 4MMPA 4OVSA 1EYJA 3LSFB 1D9YA 4RYAA 1D3KA 1NI9A 4I3YA 2CZHA 1GGGA 2VGQA 1DCUA 3PPPA 5H8FA 1OVBA 3HO7A 1D9VA 4X8RA 4OWDA 4QFKA 1YAEA 1SW5A 5IKBA 1UTBA 3MC2A 3C32A 3OXNA 4RK2A 5L8DA 2OZZA 1LB8A 1QULA 3TEPA 1LGBC 5LDZA 4MHFA 1Q1KA 3BIHA 2ABHA 3E9XA 3PV0E 2D5WA 2OWTA 3B6QA 2QFLA 4PBHA 3V5AA 3RGYA 1JVXA 4AB6A 3OSQA 2DE2A 3U8QA 1ZLQA 2P0SA 4FIMA 4X1BA 4OESA 4P47A 2D3IA 5AE4A 4ELQA 3TKDA 3PTYA 2DE4A 2ANJA 2Q9TA 4NX1A 3PU5A 1LLSA 3CVGA 3GBBA 1MPCA 1QUJA 4THIA 3K0VA 4YMBA 4IO6A 3PPRA 1FTMA 2HXRA 3D4CA 1M5FA 3IB2A 4OVTA 3PGFA 4BDMA 1Y4CA 1MDQA 3M3KA 3S2VA 2DWAA 4F19A 5ICTA 3KBRA 4GXSB 1VFEA 4XKPA 3PUVE 4ELRA 3O97A 3VXBA 1EZPA 4GXAA 3BFTA 2DOJA 4BDNA 3BIGA 2XXIA 4ESWA 4H65A 2I58A 2F36A 3RTFB 3CSGA 2FHYA 2XWVA 4JSDA 3MVWA 4LUBA 1LEVA 1N3XA 3KBZA 5IZ3A 1GTKA 1OQHA 3VVEA 3RUMA 4HTGA 3KEIA 3GBAA 3TTMA 4I3EA 2F3DA 1NUWA 5I2NB 3E78A 1DMBA 4LZ7A 4I62A 2Z8FA 4MEVA 2F7AA 4KYSA 5H8NA 4ZEKA 5ET6A 5CBRA 3LV0A 4ZDMA 3ILTB 3T9UA 4PFUA 3SEYA 2CZLA 1RKMA 3R6UA 1NNPA 3PPOA 2F7BA 1S50A 3OSRA 3PUYE 2Z8DA 4OQOA 1N76A 5FHMA 1FBCA 4QSCA 1B40A 4O3BA 3UP9A 2G93A 3WAFA 2VD3A 1FQEA 3B8BA 1P99A 5ITOA 3KOTA 5EQ8A 4N07A 1IXGA 3MPKA 4HE2A 2HFBA 5KDTB 4TLLB 1B6HA 3QSLA 5L9OA 2OJTA 2WBBA 4NF4B 2I4CA 3LC8A 1LFGA 3OEMA 3Q26A 1NV2A 3RPLB 3SEUA 3V89B 4YKJA 4DE8A 1BTJA 4GWWA 3TQLA 2XX8A 4U23A 2HXWA 4KXPA 4MFIA 2JJKA 3E3KA 2NVUB 3U92A 4YKKA 4C1UA 3CIJA 4QFPA 3TCFA 1MQGA 5CMMA 2O7IA 3ZKKA 4N91A 5TP9B 5BUUA 4HCWA 1OLAA 4DIGA 1KZ8A 2F6PA 3LR1A 2PT1A 1M5BA 5CI5A 2PVUA 1JNFA 1QVSA 3DP8A 1URDA 1I6AA 3MWBA 4HXVA 4Q5TA 3SKPA 1MXVA 3HN0A 2ZYMA 3ONMA 5K2XA 2AL5A 2OWSA 4P8BA 2DVCA 5DVJA 2QSXA 3EF7A 4MIJA 1ANFA 3AXFA 3H03A 1B3GA 4OFOA 1URSA 3IFCA 2O69A 1LCFA 1O7TA 2QVRA 1OVTA 1SI0A 4E0WA 1MY2A 4UA8A 2DYXA 5AA2B 4N6DA 4OA4A 1JEUA 4R75A 1B9JA 3G3FA 3K6UA 2CEYA 4F18A 4HE1A 1IMFA 2QVVA 2UYFA 3VVDA 2PX1A 4YZZA 5JEIA 3VLVA 1LBYA 3TTRA 4Q30B 3BKIB 3CR9A 2X7PA 4NTLA 1RYOA 3DP4A 1FTKA 1B46A 5M2VA 2O1LA 4M4GA 3QMFA 3VV5A 1DPPA 4FEBA 4BLAA 3S9NC 2HEUA 1UTHB 4LQ2A 4MNIA 3HV1A 4PP0A 2H98A 1HSJA 2QJEA 3IORA 2H25A 2O1MA 3V83A 1NV1A 1PBQA 4ZEFA 1QGXA 4FE8A 3DM0A 3OD7A 1UTHA 2DQVA 1NV3A 3GZGA 2Q8JA 1EYKA 1XVXA 4NEDA 4RK9A 1IXHA 3SZPA 1TFAA 4EF2A 2I0CA 2Y7WA 3E13X 1EYIA 4HE0A 1NV4A 4IR8A 1EZ9A 2V25A 2DVZA 3QAXA 3EPEA 2V93A 1P1UA 4R9GA 3FBPA 4PC9A 5IZZA 5CMBA 4OTEA 4BDRA 1FBEA 4G8MA 2QMWA 1AL3A 1POTA 3E4RA 3HHGA 5FTIA 3BFUA 1NV6A 1NNFA 1YZ0A 4NQ8A 4GWYA 1BP5A 3MUQA 3B6TA 3QIMA 5EQ7A 1ZTYA 2F7CA 1FBPA 4F29A 4ND9A 5DEXA 1OLCA 4QHQA 4OXVA 4IO4A 4RA1A 4PAFA 4R72A 3K01A 1B7HA 5H8QA 5ET8A 4RPOA 1B2HA 5FBPA 3C4MA 5I84A 1IXIA 4FAJA 1FQCA 4OHNA 2O68A 2OWZA 3IFAA 4IO3A 2ZNTA 4QFNA 3OO7A 1MDP1 2PFYA 5I7IA 4GBWA 4OYVA 1F9BA 1B3EA 4WXJA 4KI0E 1FBDA 3K2DA 4H8IA 4POXA 3G3HA 2XX9A 4KQPA 2Q88A 3KC1A 2FIXA 3S9MC 4EXLA 1RYXA 3CFXA 2XXYA 3O28A 4AS4A 1FQFA 2H99A 1LBZA 2UVGA 3TUSA 2A5TA 4F3SA 4IY6A 4OERA 1JVYA 2OCUA 4PFWA 1LSTA 4MLQA 2RCBA 4RPNA 1HSLA 1MXZA 2GHBA 2QL3A 2UVHA 1EH3A 4G2ZA 4LVQA 5JK4A 4YMAA 3F11A 2I3WA 3M3LA 1MS7A 1DTGA 4G68A 4I40A 4OFLA 3IJOB 4LONB 2GH9A 5ISUA 1H45A 5KZTA 4GL0A 1CNQA 3IJXB 3VVFA 1FW0A 2ZYNA 3MP8A 2PFZA 4G8NA 5I59A 1VFDA 5DT6A 2V3QA 4H6DA 1NUZA 4HCYA 1FJ6A 3TPAA 1MM6A 3RY3A 4FJPA 4UABA 4AS5A 5ET7A 1Y3NA 1P1QA 1D4NA 2WEFA 3D1RA 1FBFA 4R6HA 4NF5B 4R73A 5DVIA 3W9VA 2THIA 1A8EA 3A3CA 1PEBA 5H8FB 4QSEA 4YB5A 4O94A 3KGCA 5A5LA 2G29A 4PF8A 4ELPA 3K02A 4NF5A 2UVJA 2ONKE 1SD3A 4HW8A 4YICA 3N6TA 1SI1A 2QPQA 4R2FA 4R6KA 1B5IA 1Q9DA 2Q8MA 1KWHA 4YKIA 4ONYA 4OEUA 2Z8EA 3GYYA 1MQJA 4ZEBA 3K4UA 3PMVA 3MQ9A 2ZMBA 5HPQA 4KPTA 3ISPA 4Q0CA 1JEVA 1G0IA 3R7XA 4FECA 1Y3PA 4N17A 3KSXA 3VLWA 1FRPA 4PETA 4IO2A 2ONRA 3C33A 2F35A 4GQOA 1R6ZA 1XHYA 3IOTA 3OO8A 3KJTA 3FV2A 4GWOA 5BWJA 4FATA 3VDFA 5I3SA 4KCDA 3FUZA 1B58A 3H4ZA 1B5JA 4OVJA 3IOUA 4FBPA 1BIYA 2XXQA 5I57B 2QMXA 2GFEA 3UGWA 3W9WA 2VHAA 1Z7NE 4GWZA 1VR5A 2DSFA 4DCYA 4RXLA 5CRYA 1ATGA 4MNPA 2PCRA 4QF9A 5I2KA 4QBAA 1NUYA 4KD5A 1B51A 1MXYA 4P0GA 3FVKA 3LUYA 4AB5A 4U21A 1B52A 1M5EA 2XXWA 5I57A 2XXHA 5IZ3B 4QSDA 2Y5KA 1LCTA 1MY4A 4JWXA 1AIVA 1LB9A 4MNCA 1UIVA 1KA1A 1FPIA 1MPBA 1IQ7A 2RF1A 2X26A 5CM6A 4XKQA 3IB0A 3E79A 4N6KA 1TXFA 4LATA 5H8NB 3FXQA 3MBPA 3SEXA 2H4IA 4F1YA 2HPGA 1IEJA 3RT6B 1R9QA 2HQ0A 5EYFA 2QS2A 1B3HA 3MZBA 3UN6A 5I58B 2DXRA 1RDYA 4OVRA 4XKNA 3V8XB 3OOAA 3U94A 2KR0A 3T0JA 1VDWA 5AA3A 1SVXB 4JWYA 3FGSA 4H45A 3FVNA 5ITPA 3KN8A 3RN8A 1H43A 1WDNA 5I58A 4IB2A 5AA4A 1ZKBA 4Q8RA 1HSEA 4F3BA 4TOZA 3IB1A 1VSOA 1LBVA 3LSXA 3OEKA 1XI6A 1MQHA 2LAOA 2XXKA 3SEVA 1FTOA 1SW2A 3FJMA 3RTWB 2F78A 3OENA 3OELA 3ILUB 4F31B 4X9TA 3UIFA 4PFIA 1N7WA 1JW5A 3VXCA 1QJMA 3OO6A 1MRPA 1ZU0A 4DXCA 2Y7RA 2GRVA 1FQDA 4XKRA 4X1DA 1PDAA 2DWIA 4PBQA 2O51A 1NH8A 4HS7A 3I5OA 1JETA 1FPFA 3T9VA 1XT8A 2I48A 3FD3A 2X7QA 3D4GA 4GX4A 2IA4A 4LP2B 2F97A 1II5A 3TZAA 3HFUA 1WODA 2O7UA 4IO5A 4PFRA 3VFJA 1UIUA 2NXOA 2O84X 2B4MA 3U1OA 3WAEA 2I49A 4N6PA 1K9YA 4GFRA 1FJ9A 3IL1B 2F34A 3HHFA 1B1XA 2P2AA 3RYDA 3U93A 4ECFA 4N4UA 4P1LA 5ESYA 3LBSA 4KYEA 2PT2A 3PPQA 4R6YA 3H06B 3G3JA 1NV5A 1N0TA 4LZ5A 4GF8A 1PBPA 2MKZA 2FBPA 4PTKA 3HPIA 1GR2A 1NNKA 1LAXA 1URGA 1MY1A 1ZBMA 4F22A 4U1OA 2Y5LA 2E1SA 1MY0A 1JW4A 1H44A 5DYHA 3GLBA 4K3FA 4YU0A 2AYSA 2XXUA 2RC9A 1TFDA 4BDQA 1B4HA 3P7IA 4NGUA 4IY5A 3FZVA 1M5CA 2PBWA 4F39A 3MZ1A 2ZZWA 2WYPA 4BDOA 4R9FA 1MY3A 1ZIUA 2H5YA 2V3UA 5IM2A 3TELA 2B3BA 3TYHA 4KFQA 2ESNA 1LFHA 5T3JA 2UVIA 2Q74A 5F24A 3RQTA 3K00A 4M1VA 2HCAA 1MH4A 5EQAA 3CRBA 3IO6A 3MVZA 2Z23A 3TFLA 4NE4A 4P9KA 1IMAA 1US4A 1MXUA 2YLNA 2KLFA 1R1NA 4GRKA 4C0RA 3O2AA 4NWDA 3TAJA 4F2QA 5FHOA 5L9MA 2RCAA 1FTLA 4AQ4A 2Y7KA 3FATA 4XXUA 3UK4A 4GWUA 2XX7A 3A09A 2PYYA 1LBXA 5B70A 1N84A 4NF8A 5DEXB 3S4UA 4U2RA 3THIA 2NWJA 3KOSA 4N81A 4DXUA 3N26A 1LBWA 3ZKLA 2QRYA 5I5PA 1RDZA 4TQUQ 4JVCA 5H8QB 4LN5A 1DTZA 1P1OA 4F1UA 1LFIA 1NV0A 2XWKA 2ZZVA 3L6GA 3OO9A 2RKMA 3PUWE 4U4SA 4F1VA 3T9XB 3MVYA 2FYIA 2BJIA 1DOTA 1OMPA 3ROJA 3RT8A 3FV1A 4NWCA 4DZ1A 3Q25A 4NF6A 1Q35A 1DBZA 3K1MA 2W7YA 1DSNA 2GQ1A 3K1PA 3OMBA 4PE3A 1LAHE 2IEEA 4GL8A 4NHBA 3KFMA 1EU8A 2XD3A 4EUOA 4GBVA 3TDJA 2A5TB 1FPLA 3G3KA 4N8GA 3VLUA 1N04A 4I9DA 2B3FA 4PE5B 3RLFE 1YPNA 3QUJA 3LSLA 2R71A 2P3VA 1NL5A 2I6EA 4G68B 2KQZA 2Y7IA 3NOHA 1AWBA 1N7XA 1Y1ZA 4ZE8A 2DE3A 2H9BA 1L5TA 3PD9A 4IO7A 4QFLA 4I1DA 3SETA 3KN3A 3HCQA 2QS3A 4H67A 4U1ZA 5I59B 3A3UA 1EZOA 3FXBA 4JBZA 1IXCA 1SW1A 1NNTA 3G7WA 4PF6A 1S7YA 2AIXA 4PGPA 5EQ9A 4OVPA 3O6IA 4L17A 5TPAA 4JVDA 1MPDA 2HHMA 5F1QA 1T0KA 1LBBA 4P56A 1B7ZA 1MXWA 1OIBA 1MQIA 3C35A 2F6GA 4DDDA 1XC1A 2VP1A 4ZZAA 2Q2AA 2AL4A 5H8HA 3MZ9A 5EHSA 3SESA 3U72A 3DELB 1FQAA 1O64A 3T9HB 2A5SA 4XF5A 1A7LA 3MVXA 2WX9A 2WYKA 2M8CA 1MQDA 1PB7A 3LUZA 1B3LA 2Y84A 3H6TA 2CZKA 3FJ7A 4C1TA 2FNCA 2ZZXA 1Y1MA 4MJOA 4MF3A 3MP1A 4GD5A 4OMBA 2FA7A 1DK4A 3FVGA 4ZS9A 3MP6A 2R9JA 4E0XA 2HZKA 3SEWA 5A5XB 3G3GA 3GXAA 1SPIA 2V4CA 2VD2A 2REGA 3VE1B 1IMEA 4FEDA 5DVFA 1VE4A 4G4PA 3FXUA 4BDLA 4PFBA 3M3FA 3B6WA 1JW1A 1A54A 5I2KB 4X48A 4N15A 2Q2CA 4NN3A 3TMGA 5A5XA 3KC0A 2HAVA 3DLNA 1N3WA 2ONSA 3ODBA 4P3LA 2P3NA 2XXPA 1Y4TA 5JTYB 2ZXTA 1LAFE 2DWHA 3N5LA 4MCOA 5KCJB 2O6AA 4NMYA 4U22A 2YJPA 2QS4A 1IMBA 1B3FA 4PAKA 4IGTA 1SQYA 2D21A 3C36A 3CG3A 4GOTA 1A40A 2UYEA 1JQFA 5JTYA 4PCDA 4YAHX 3QYTA 4O8MA 3S9EA 1QW0A 3PUXE 5IGAA 5AA2D 4NG7A 5KCJA 1FPBA 3QUFA 4XIGQ 2Z22A 2XHDA 3CFZA 4H5FA 4G77A 4YB7A 5EYHA 5FHNA 1AH5A 1A99A 4POWA 1R9LA 5K2YA 3U65A 5L9SA 2F8DA 4GX6A 4JWOA 5AA4B 4F2OA 4YB6A 3I6VA 1IUDA 3IAZA 4O3AA 1RDXA 3JZJA 3C9HA 2DWJA 2R6GE 3MW0A 2XXXA 1B7UA 4ZECA 5EYGA 5CMKA 5I56B 3EHUA 3QXMA 2WBDA 3TCGA 2CMOA 3MAMA 2VPOA 3CFLA 3TTLA 2QVUA 4Z7EA 4JDFA 3G3IA 1IZ1A 2RINA 1SW4A 3PMWA 4QXDA 3ZS6A 2PMSA 3FJGA 1XS5A 4ESXA 2CZIA 1YTVA 4DLDA 5I2NA 4G8HA 2B65A 2ZYOA 4PGNA 1IITA 2UXAA 3ECRA 5I56A 5J16A 3HSTA 3LSWA 1FBHA 2BJJX 2OK2A 3IO4A 3S9LC 3KZGA 4PFYA 3R26A 1B5HA 1FPKA 4R2BA 4G68C 1NMUA 4GWSA 4F3PA 4H0WA 1SBPA 3FVOA 2HAUA 1LAGE 2XXRA 1QUKA 3Q29A 2VT5A 2Q89A 1B05A 5CC2A 1B4ZA 2DXYA 4OVQA 1AOVA 1IMCA 3EHTA 2WKYA 4TLMB 4LZ8A 2R8TA 5KDTA 1PC3A 4LQ5A 4NF4A 4JSOA 3K1NA 1FCKA 5CMCA 4DI4B 4EQ9A 4WKMA 3CG1A 3RPLA 2I3VA 1B0LA 1ELJA 1A55A 1IIWA 4MBPA 3N94A 2RC8A 2XD2A 4WEPA 4PDHA 2VPNA 2FIEA 4FORA 4H8JA 1YCJA 4O7MA 4N13A 1MH3A 4JXIA 5TP9A 3O29A 3DP6A 2OLBA 1FPJA 4UACA
chains in the Genus database with same CATH topology
1LBCA 5ELVA 5AA1A 2XXTA 1Y9UA 2RC7A 3K6XA 1A8FA 2XXVA 3USDA 5FTHA 4KR5A 1WVJA 1H3DA 3KSJA 3L6HA 2ZYKA 3W15C 3O6HA 4F3GA 1I69A 5EHMA 1M5DA 5F7VA 4EQBA 4OEVA 4R74A 2VOZA 4U4XA 5AA2A 3PD8A 3MPLA 1QKBA 1USYE 5HM4B 3IX1A 1BKAA 4OENA 4IGRA 5ICQA 4EQ7A 1H76A 3O66A 4ZE9A 1NFTA 3T93B 3BBRA 4NF8B 3SERA 1I6QA 2V84A 3H6VA 3TCHA 4P0IA 3B7DA 1BLFA 5LOMA 2DP8A 3FIRA 3JYRA 3C34A 1SYIA 4MLVA 1USYH 1FQBA 3H6WA 3C31A 4KHZE 5TU0A 3IOVA 3QK6A 2OBGA 4ZEIA 4PFTA 3RPWA 2QS1A 3TTNA 2E0SA 1P1WA 5H8SA 4ELOA 1MM7A 4GLIA 3EN3A 3EHSA 3CI8A 1MXXA 2YPNA 3FXRA 4NF6B 1B0HA 4Z0IA 1UQWA 2Y7PA 3KG2A 1FTJA 4RJZA 1ZJLA 3ZSFA 2ZNUA 4JB7A 3T66A 2GHAA 4KCCA 1PB8A 1SDXA 4EF1A 4KYDA 5CBSA 3IR1A 1NKXA 3FASA 3RNNA 4DCXA 1CE2A 1Y3QA 1ZMGA 1GV8A 1NH7A 1QUIA 1B1HA 3M8UA 3N6UA 2DS9A 4OETA 2I0BA 1XOCA 2I4BA 2V3TA 2F5XA 3H7MA 1TT1A 3TTKA 4ZEDA 1DPEA 1Z7ME 3CSBA 4RNSA 3T22A 1I6BA 5DTBA 3UA8A 3KJ7A 1AMFA 1CB6A 3K6WA 4QRZA 3Q28A 1QKAA 4YKPA 3O9PA 1P1NA 4I8CA 3Q27A 3K6VA 2NUVA 1J1NA 4GIZA 5IAIA 2HZLA 3H3GA 4PQJA 5TPAB 1SYHA 1Y20A 4O3CA 1S9TA 3PPNA 4ISUA 1GVCA 1XVYA 3JV9A 3EQ1A 3H6UA 4MH5A 3PMXA 5J1DA 4QFOA 4RY1A 1MG1A 1OQGA 5H8HB 2REJA 3T96B 3I3VA 1TWYA 4XTCQ 1US5A 1O63A 3UORA 3TODA 1B32A 4EXKA 3KN7A 3PUZE 3IOWA 2ZNSA 3O6GA 5B7DA 2P1SA 2NOOA 4WEDA 2ALUA 4GVOA 4ZZEA 4LA9A 4DXBA 4EDPA 4P11A 4OZ9A 3TQWA 4H5GA 4H1XA 3MJNA 3SDFA 3IK6B 4OFJA 5HBCA 1POY1 1PB9A 1UTBB 3LSFB 1D9YA 4RYAA 1D3KA 1GGGA 2VGQA 3PPPA 5H8FA 1OVBA 3HO7A 1D9VA 4OWDA 4QFKA 1YAEA 1SW5A 5IKBA 1UTBA 3MC2A 3C32A 3OXNA 4RK2A 5L8DA 2OZZA 1LB8A 1QULA 3TEPA 1LGBC 1Q1KA 2ABHA 3E9XA 3PV0E 2D5WA 2OWTA 3B6QA 3V5AA 3RGYA 1JVXA 4AB6A 3OSQA 2DE2A 3U8QA 1ZLQA 2P0SA 4FIMA 4X1BA 4OESA 2D3IA 5AE4A 4ELQA 3TKDA 2DE4A 2ANJA 2Q9TA 3PU5A 1LLSA 3CVGA 3GBBA 4YMBA 1MPCA 1QUJA 3K0VA 4THIA 4IO6A 3PPRA 1FTMA 3D4CA 1M5FA 3IB2A 3PGFA 4BDMA 1Y4CA 1MDQA 3M3KA 3S2VA 2DWAA 4F19A 5ICTA 3KBRA 4GXSB 1VFEA 4XKPA 3PUVE 4ELRA 3O97A 3VXBA 1EZPA 4GXAA 3BFTA 2DOJA 4BDNA 2XXIA 4ESWA 4H65A 2I58A 2F36A 3RTFB 3CSGA 4JSDA 3MVWA 4LUBA 1N3XA 1GTKA 1OQHA 3VVEA 3RUMA 4HTGA 3KEIA 3GBAA 3TTMA 5I2NB 1DMBA 4LZ7A 4I62A 2Z8FA 2F7AA 4KYSA 5H8NA 4ZEKA 5CBRA 4ZDMA 3ILTB 3T9UA 4PFUA 3SEYA 2CZLA 1RKMA 3R6UA 1NNPA 3PPOA 2F7BA 1S50A 3OSRA 3PUYE 2Z8DA 4OQOA 1N76A 5FHMA 4QSCA 1B40A 4O3BA 3UP9A 2G93A 3WAFA 2VD3A 1FQEA 1P99A 5ITOA 3KOTA 4N07A 1IXGA 3MPKA 2HFBA 5KDTB 4TLLB 1B6HA 3QSLA 5L9OA 2OJTA 4NF4B 2I4CA 3LC8A 1LFGA 3OEMA 3Q26A 3SEUA 3V89B 4YKJA 4DE8A 1BTJA 3TQLA 2XX8A 4U23A 2HXWA 4MFIA 3E3KA 2NVUB 3U92A 4YKKA 4C1UA 3CIJA 4QFPA 3TCFA 1MQGA 5CMMA 2O7IA 3ZKKA 5TP9B 5BUUA 4HCWA 1OLAA 4DIGA 2F6PA 3LR1A 2PT1A 1M5BA 5CI5A 2PVUA 1JNFA 1QVSA 3DP8A 1URDA 1I6AA 3MWBA 4Q5TA 3SKPA 1MXVA 3HN0A 2ZYMA 3ONMA 5K2XA 2AL5A 2OWSA 2DVCA 5DVJA 2QSXA 3EF7A 1ANFA 3AXFA 3H03A 1B3GA 4OFOA 1URSA 2O69A 1LCFA 1O7TA 1OVTA 1SI0A 4E0WA 1MY2A 4UA8A 2DYXA 5AA2B 1JEUA 4R75A 1B9JA 3G3FA 3K6UA 4F18A 2UYFA 3VVDA 2PX1A 4YZZA 5JEIA 3VLVA 3TTRA 4Q30B 3BKIB 3CR9A 2X7PA 4NTLA 1RYOA 3DP4A 1FTKA 1B46A 5M2VA 2O1LA 4M4GA 3VV5A 1DPPA 4FEBA 4BLAA 3S9NC 2HEUA 1UTHB 4LQ2A 3HV1A 4PP0A 2H98A 1HSJA 2QJEA 3IORA 2H25A 2O1MA 3V83A 1PBQA 4ZEFA 4FE8A 3DM0A 3OD7A 1UTHA 2DQVA 3GZGA 2Q8JA 1XVXA 4NEDA 4RK9A 1IXHA 1TFAA 4EF2A 2I0CA 2Y7WA 3E13X 1EZ9A 2V25A 2DVZA 3QAXA 3EPEA 2V93A 1P1UA 4R9GA 5CMBA 4OTEA 4BDRA 4G8MA 2QMWA 1AL3A 1POTA 3E4RA 3HHGA 5FTIA 3BFUA 1NNFA 1BP5A 3MUQA 3B6TA 3QIMA 1ZTYA 2F7CA 4F29A 4ND9A 5DEXA 1OLCA 4QHQA 4OXVA 4IO4A 4RA1A 4R72A 3K01A 1B7HA 5H8QA 4RPOA 1B2HA 3C4MA 5I84A 1IXIA 4FAJA 1FQCA 4OHNA 2O68A 4IO3A 2ZNTA 4QFNA 3OO7A 1MDP1 4OYVA 1F9BA 1B3EA 4WXJA 4KI0E 4H8IA 3K2DA 4POXA 3G3HA 2XX9A 4KQPA 2Q88A 3S9MC 4EXLA 1RYXA 3CFXA 2XXYA 3O28A 1FQFA 2H99A 2UVGA 3TUSA 2A5TA 4F3SA 4IY6A 4OERA 1JVYA 2OCUA 4PFWA 1LSTA 4MLQA 2RCBA 4RPNA 1HSLA 1MXZA 2GHBA 2QL3A 2UVHA 1EH3A 4G2ZA 4LVQA 5JK4A 4YMAA 3F11A 2I3WA 3M3LA 1MS7A 1DTGA 4G68A 4OFLA 3IJOB 4LONB 2GH9A 5ISUA 1H45A 5KZTA 4GL0A 3VVFA 3IJXB 1FW0A 2ZYNA 3MP8A 4G8NA 5I59A 1VFDA 5DT6A 2V3QA 4H6DA 4HCYA 3TPAA 1MM6A 3RY3A 4FJPA 1Y3NA 1P1QA 1D4NA 4R6HA 4NF5B 4R73A 5DVIA 3W9VA 2THIA 1A8EA 3A3CA 1PEBA 5H8FB 4QSEA 4YB5A 3KGCA 2G29A 4ELPA 3K02A 4NF5A 2UVJA 2ONKE 1SD3A 4HW8A 4YICA 3N6TA 1SI1A 2QPQA 4R2FA 4R6KA 1B5IA 1KWHA 4YKIA 4ONYA 4OEUA 2Z8EA 1MQJA 4ZEBA 3K4UA 3PMVA 3MQ9A 2ZMBA 5HPQA 4KPTA 4Q0CA 1JEVA 3R7XA 4FECA 1Y3PA 3VLWA 3KSXA 4PETA 4IO2A 2ONRA 3C33A 2F35A 4GQOA 1R6ZA 1XHYA 3IOTA 3OO8A 3KJTA 3FV2A 4GWOA 5BWJA 4FATA 3VDFA 4KCDA 3FUZA 1B58A 3H4ZA 1B5JA 4OVJA 3IOUA 1BIYA 2XXQA 5I57B 3UGWA 2GFEA 2QMXA 3W9WA 2VHAA 1Z7NE 1VR5A 2DSFA 4DCYA 4RXLA 5CRYA 1ATGA 4QF9A 5I2KA 4KD5A 1B51A 1MXYA 4P0GA 3FVKA 3LUYA 4AB5A 4U21A 1B52A 1M5EA 2XXWA 5I57A 2XXHA 4QSDA 1LCTA 1MY4A 4JWXA 1AIVA 1LB9A 1UIVA 1MPBA 1IQ7A 2RF1A 2X26A 5CM6A 4XKQA 3IB0A 1TXFA 4LATA 5H8NB 3FXQA 3MBPA 3SEXA 2H4IA 4F1YA 1IEJA 3RT6B 1R9QA 2HQ0A 5EYFA 2QS2A 1B3HA 3MZBA 3UN6A 5I58B 2DXRA 4XKNA 3V8XB 3OOAA 3U94A 5AA3A 1SVXB 4JWYA 3FGSA 3FVNA 5ITPA 3KN8A 3RN8A 1H43A 1WDNA 5I58A 4IB2A 5AA4A 1ZKBA 4Q8RA 1HSEA 4F3BA 4TOZA 3IB1A 1VSOA 3LSXA 3OEKA 1MQHA 2LAOA 3SEVA 1FTOA 1SW2A 3FJMA 3RTWB 2F78A 3OENA 3OELA 3ILUB 4F31B 4X9TA 3UIFA 1N7WA 1JW5A 3VXCA 1QJMA 3OO6A 1MRPA 1ZU0A 4DXCA 2Y7RA 2GRVA 1FQDA 4XKRA 4X1DA 1PDAA 2DWIA 2O51A 1NH8A 4HS7A 3I5OA 1JETA 3T9VA 1XT8A 2I48A 3FD3A 2X7QA 3D4GA 2IA4A 4LP2B 2F97A 1II5A 3TZAA 1WODA 2O7UA 4IO5A 3VFJA 1UIUA 2NXOA 2O84X 3U1OA 3WAEA 2I49A 4N6PA 4GFRA 3IL1B 2F34A 3HHFA 1B1XA 2P2AA 3U93A 4ECFA 3LBSA 4KYEA 2PT2A 3PPQA 4R6YA 3H06B 3G3JA 1N0TA 4LZ5A 4GF8A 1PBPA 3HPIA 1GR2A 1NNKA 1LAXA 1URGA 1MY1A 1ZBMA 4F22A 4U1OA 2E1SA 1MY0A 1JW4A 1H44A 5DYHA 3GLBA 4K3FA 4YU0A 2AYSA 2XXUA 2RC9A 1TFDA 4BDQA 1B4HA 3P7IA 4IY5A 3FZVA 1M5CA 2PBWA 4F39A 3MZ1A 4BDOA 4R9FA 1MY3A 1ZIUA 2H5YA 2V3UA 3TELA 2B3BA 3TYHA 4KFQA 2ESNA 1LFHA 2UVIA 3RQTA 3K00A 4M1VA 2HCAA 1MH4A 3CRBA 3IO6A 3MVZA 2Z23A 3TFLA 4NE4A 1US4A 2YLNA 1MXUA 2KLFA 1R1NA 4GRKA 4C0RA 3O2AA 4NWDA 3TAJA 4F2QA 5FHOA 5L9MA 2RCAA 1FTLA 4AQ4A 2Y7KA 3FATA 4XXUA 3UK4A 2XX7A 3A09A 2PYYA 5B70A 1N84A 4NF8A 5DEXB 3S4UA 4U2RA 3THIA 2NWJA 3KOSA 4DXUA 3N26A 3ZKLA 2QRYA 4TQUQ 5H8QB 1DTZA 1P1OA 4F1UA 1LFIA 3L6GA 3OO9A 2RKMA 3PUWE 4U4SA 4F1VA 3T9XB 3MVYA 2FYIA 1DOTA 1OMPA 3RT8A 3FV1A 4NWCA 4DZ1A 3Q25A 4NF6A 1Q35A 3K1MA 2W7YA 1DSNA 3K1PA 3OMBA 1LAHE 2IEEA 4GL8A 3KFMA 1EU8A 2XD3A 4EUOA 3TDJA 2A5TB 3G3KA 3VLUA 1N04A 4I9DA 2B3FA 4PE5B 3RLFE 1YPNA 3QUJA 3LSLA 2R71A 1NL5A 2I6EA 4G68B 2Y7IA 1N7XA 1Y1ZA 4ZE8A 2DE3A 2H9BA 1L5TA 3PD9A 4IO7A 4QFLA 4I1DA 3SETA 3KN3A 3HCQA 2QS3A 4H67A 4U1ZA 5I59B 3A3UA 1EZOA 4JBZA 1IXCA 1SW1A 1NNTA 3G7WA 1S7YA 2AIXA 3O6IA 4L17A 5TPAA 1MPDA 5F1QA 1T0KA 1LBBA 1B7ZA 1MXWA 1OIBA 1MQIA 3C35A 2F6GA 4DDDA 1XC1A 2VP1A 4ZZAA 2Q2AA 2AL4A 5H8HA 3MZ9A 5EHSA 3SESA 3U72A 3DELB 1FQAA 1O64A 3T9HB 2A5SA 1A7LA 3MVXA 2M8CA 1MQDA 1PB7A 1B3LA 2Y84A 3H6TA 3FJ7A 4C1TA 2FNCA 1Y1MA 4MF3A 3MP1A 4GD5A 4OMBA 2FA7A 3FVGA 4ZS9A 3MP6A 2R9JA 4E0XA 2HZKA 3SEWA 5A5XB 3G3GA 3GXAA 2VD2A 2REGA 3VE1B 4FEDA 5DVFA 1VE4A 4G4PA 3FXUA 4BDLA 3M3FA 3B6WA 1JW1A 1A54A 5I2KB 4X48A 2Q2CA 3TMGA 5A5XA 2HAVA 3DLNA 1N3WA 2ONSA 3ODBA 2XXPA 1Y4TA 5JTYB 2ZXTA 1LAFE 2DWHA 3N5LA 5KCJB 2O6AA 4NMYA 4U22A 2YJPA 2QS4A 1B3FA 4IGTA 1SQYA 2D21A 3C36A 3CG3A 4GOTA 1A40A 2UYEA 1JQFA 5JTYA 4YAHX 3QYTA 3S9EA 1QW0A 3PUXE 5AA2D 5KCJA 3QUFA 4XIGQ 2Z22A 2XHDA 3CFZA 4H5FA 4G77A 4YB7A 5FHNA 1AH5A 1A99A 4POWA 1R9LA 5K2YA 5L9SA 2F8DA 4JWOA 5AA4B 4F2OA 4YB6A 3I6VA 1IUDA 3IAZA 4O3AA 3JZJA 3C9HA 2DWJA 2R6GE 3MW0A 2XXXA 1B7UA 4ZECA 5CMKA 5I56B 3EHUA 3QXMA 3TCGA 2CMOA 3MAMA 3CFLA 3TTLA 4Z7EA 4JDFA 3G3IA 1IZ1A 2RINA 1SW4A 3PMWA 3ZS6A 2PMSA 3FJGA 1XS5A 4ESXA 1YTVA 4DLDA 5I2NA 4G8HA 2B65A 2ZYOA 1IITA 2UXAA 3ECRA 5I56A 3HSTA 3LSWA 2BJJX 2OK2A 3IO4A 3S9LC 3KZGA 4PFYA 3R26A 1B5HA 4R2BA 4G68C 1NMUA 4F3PA 4H0WA 1SBPA 3FVOA 2HAUA 1LAGE 2XXRA 1QUKA 3Q29A 2Q89A 1B05A 5CC2A 1B4ZA 2DXYA 1AOVA 3EHTA 2WKYA 4TLMB 4LZ8A 5KDTA 1PC3A 4LQ5A 4NF4A 4JSOA 3K1NA 1FCKA 5CMCA 4EQ9A 4WKMA 3CG1A 2I3VA 1B0LA 1ELJA 1A55A 1IIWA 4MBPA 3N94A 2RC8A 2XD2A 4WEPA 4FORA 4H8JA 1YCJA 4N13A 1MH3A 4JXIA 5TP9A 3O29A 3DP6A 2OLBA 4UACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBC A;  5ELV A;  5AA1 A;  2XXT A;  1Y9U A;  2RC7 A;  3K6X A;  1A8F A;  2XXV A;  3USD A;  5FTH A;  4KR5 A;  1WVJ A;  1H3D A;  3KSJ A;  3L6H A;  2ZYK A;  3W15 C;  3O6H A;  4F3G A;  1I69 A;  5EHM A;  1M5D A;  5F7V A;  4EQB A;  4OEV A;  4R74 A;  2VOZ A;  4U4X A;  5AA2 A;  3PD8 A;  3MPL A;  1QKB A;  1USY E;  5HM4 B;  3IX1 A;  1BKA A;  4OEN A;  4IGR A;  5ICQ A;  4EQ7 A;  1H76 A;  3O66 A;  4ZE9 A;  1NFT A;  3T93 B;  3BBR A;  4NF8 B;  3SER A;  1I6Q A;  2V84 A;  3H6V A;  3TCH A;  4P0I A;  3B7D A;  1BLF A;  5LOM A;  2DP8 A;  3FIR A;  3JYR A;  3C34 A;  1SYI A;  4MLV A;  1USY H;  1FQB A;  3H6W A;  3C31 A;  4KHZ E;  5TU0 A;  3IOV A;  3QK6 A;  2OBG A;  4ZEI A;  4PFT A;  3RPW A;  2QS1 A;  3TTN A;  2E0S A;  1P1W A;  5H8S A;  4ELO A;  1MM7 A;  4GLI A;  3EN3 A;  3EHS A;  3CI8 A;  1MXX A;  2YPN A;  3FXR A;  4NF6 B;  1B0H A;  4Z0I A;  1UQW A;  2Y7P A;  3KG2 A;  1FTJ A;  4RJZ A;  1ZJL A;  3ZSF A;  2ZNU A;  4JB7 A;  3T66 A;  2GHA A;  4KCC A;  1PB8 A;  1SDX A;  4EF1 A;  4KYD A;  5CBS A;  3IR1 A;  1NKX A;  3FAS A;  3RNN A;  4DCX A;  1CE2 A;  1Y3Q A;  1ZMG A;  1GV8 A;  1NH7 A;  1QUI A;  1B1H A;  3M8U A;  3N6U A;  2DS9 A;  4OET A;  2I0B A;  1XOC A;  2I4B A;  2V3T A;  2F5X A;  3H7M A;  1TT1 A;  3TTK A;  4ZED A;  1DPE A;  1Z7M E;  3CSB A;  4RNS A;  3T22 A;  1I6B A;  5DTB A;  3UA8 A;  3KJ7 A;  1AMF A;  1CB6 A;  3K6W A;  4QRZ A;  3Q28 A;  1QKA A;  4YKP A;  3O9P A;  1P1N A;  4I8C A;  3Q27 A;  3K6V A;  2NUV A;  1J1N A;  4GIZ A;  5IAI A;  2HZL A;  3H3G A;  4PQJ A;  5TPA B;  1SYH A;  1Y20 A;  4O3C A;  1S9T A;  3PPN A;  4ISU A;  1GVC A;  1XVY A;  3JV9 A;  3EQ1 A;  3H6U A;  4MH5 A;  3PMX A;  5J1D A;  4QFO A;  4RY1 A;  1MG1 A;  1OQG A;  5H8H B;  2REJ A;  3T96 B;  3I3V A;  1TWY A;  4XTC Q;  1US5 A;  1O63 A;  3UOR A;  3TOD A;  1B32 A;  4EXK A;  3KN7 A;  3PUZ E;  3IOW A;  2ZNS A;  3O6G A;  5B7D A;  2P1S A;  2NOO A;  4WED A;  2ALU A;  4GVO A;  4ZZE A;  4LA9 A;  4DXB A;  4EDP A;  4P11 A;  4OZ9 A;  3TQW A;  4H5G A;  4H1X A;  3MJN A;  3SDF A;  3IK6 B;  4OFJ A;  5HBC A;  1POY 1;  1PB9 A;  1UTB B;  3LSF B;  1D9Y A;  4RYA A;  1D3K A;  1GGG A;  2VGQ A;  3PPP A;  5H8F A;  1OVB A;  3HO7 A;  1D9V A;  4OWD A;  4QFK A;  1YAE A;  1SW5 A;  5IKB A;  1UTB A;  3MC2 A;  3C32 A;  3OXN A;  4RK2 A;  5L8D A;  2OZZ A;  1LB8 A;  1QUL A;  3TEP A;  1LGB C;  1Q1K A;  2ABH A;  3E9X A;  3PV0 E;  2D5W A;  2OWT A;  3B6Q A;  3V5A A;  3RGY A;  1JVX A;  4AB6 A;  3OSQ A;  2DE2 A;  3U8Q A;  1ZLQ A;  2P0S A;  4FIM A;  4X1B A;  4OES A;  2D3I A;  5AE4 A;  4ELQ A;  3TKD A;  2DE4 A;  2ANJ A;  2Q9T A;  3PU5 A;  1LLS A;  3CVG A;  3GBB A;  4YMB A;  1MPC A;  1QUJ A;  3K0V A;  4THI A;  4IO6 A;  3PPR A;  1FTM A;  3D4C A;  1M5F A;  3IB2 A;  3PGF A;  4BDM A;  1Y4C A;  1MDQ A;  3M3K A;  3S2V A;  2DWA A;  4F19 A;  5ICT A;  3KBR A;  4GXS B;  1VFE A;  4XKP A;  3PUV E;  4ELR A;  3O97 A;  3VXB A;  1EZP A;  4GXA A;  3BFT A;  2DOJ A;  4BDN A;  2XXI A;  4ESW A;  4H65 A;  2I58 A;  2F36 A;  3RTF B;  3CSG A;  4JSD A;  3MVW A;  4LUB A;  1N3X A;  1GTK A;  1OQH A;  3VVE A;  3RUM A;  4HTG A;  3KEI A;  3GBA A;  3TTM A;  5I2N B;  1DMB A;  4LZ7 A;  4I62 A;  2Z8F A;  2F7A A;  4KYS A;  5H8N A;  4ZEK A;  5CBR A;  4ZDM A;  3ILT B;  3T9U A;  4PFU A;  3SEY A;  2CZL A;  1RKM A;  3R6U A;  1NNP A;  3PPO A;  2F7B A;  1S50 A;  3OSR A;  3PUY E;  2Z8D A;  4OQO A;  1N76 A;  5FHM A;  4QSC A;  1B40 A;  4O3B A;  3UP9 A;  2G93 A;  3WAF A;  2VD3 A;  1FQE A;  1P99 A;  5ITO A;  3KOT A;  4N07 A;  1IXG A;  3MPK A;  2HFB A;  5KDT B;  4TLL B;  1B6H A;  3QSL A;  5L9O A;  2OJT A;  4NF4 B;  2I4C A;  3LC8 A;  1LFG A;  3OEM A;  3Q26 A;  3SEU A;  3V89 B;  4YKJ A;  4DE8 A;  1BTJ A;  3TQL A;  2XX8 A;  4U23 A;  2HXW A;  4MFI A;  3E3K A;  2NVU B;  3U92 A;  4YKK A;  4C1U A;  3CIJ A;  4QFP A;  3TCF A;  1MQG A;  5CMM A;  2O7I A;  3ZKK A;  5TP9 B;  5BUU A;  4HCW A;  1OLA A;  4DIG A;  2F6P A;  3LR1 A;  2PT1 A;  1M5B A;  5CI5 A;  2PVU A;  1JNF A;  1QVS A;  3DP8 A;  1URD A;  1I6A A;  3MWB A;  4Q5T A;  3SKP A;  1MXV A;  3HN0 A;  2ZYM A;  3ONM A;  5K2X A;  2AL5 A;  2OWS A;  2DVC A;  5DVJ A;  2QSX A;  3EF7 A;  1ANF A;  3AXF A;  3H03 A;  1B3G A;  4OFO A;  1URS A;  2O69 A;  1LCF A;  1O7T A;  1OVT A;  1SI0 A;  4E0W A;  1MY2 A;  4UA8 A;  2DYX A;  5AA2 B;  1JEU A;  4R75 A;  1B9J A;  3G3F A;  3K6U A;  4F18 A;  2UYF A;  3VVD A;  2PX1 A;  4YZZ A;  5JEI A;  3VLV A;  3TTR A;  4Q30 B;  3BKI B;  3CR9 A;  2X7P A;  4NTL A;  1RYO A;  3DP4 A;  1FTK A;  1B46 A;  5M2V A;  2O1L A;  4M4G A;  3VV5 A;  1DPP A;  4FEB A;  4BLA A;  3S9N C;  2HEU A;  1UTH B;  4LQ2 A;  3HV1 A;  4PP0 A;  2H98 A;  1HSJ A;  2QJE A;  3IOR A;  2H25 A;  2O1M A;  3V83 A;  1PBQ A;  4ZEF A;  4FE8 A;  3DM0 A;  3OD7 A;  1UTH A;  2DQV A;  3GZG A;  2Q8J A;  1XVX A;  4NED A;  4RK9 A;  1IXH A;  1TFA A;  4EF2 A;  2I0C A;  2Y7W A;  3E13 X;  1EZ9 A;  2V25 A;  2DVZ A;  3QAX A;  3EPE A;  2V93 A;  1P1U A;  4R9G A;  5CMB A;  4OTE A;  4BDR A;  4G8M A;  2QMW A;  1AL3 A;  1POT A;  3E4R A;  3HHG A;  5FTI A;  3BFU A;  1NNF A;  1BP5 A;  3MUQ A;  3B6T A;  3QIM A;  1ZTY A;  2F7C A;  4F29 A;  4ND9 A;  5DEX A;  1OLC A;  4QHQ A;  4OXV A;  4IO4 A;  4RA1 A;  4R72 A;  3K01 A;  1B7H A;  5H8Q A;  4RPO A;  1B2H A;  3C4M A;  5I84 A;  1IXI A;  4FAJ A;  1FQC A;  4OHN A;  2O68 A;  4IO3 A;  2ZNT A;  4QFN A;  3OO7 A;  1MDP 1;  4OYV A;  1F9B A;  1B3E A;  4WXJ A;  4KI0 E;  4H8I A;  3K2D A;  4POX A;  3G3H A;  2XX9 A;  4KQP A;  2Q88 A;  3S9M C;  4EXL A;  1RYX A;  3CFX A;  2XXY A;  3O28 A;  1FQF A;  2H99 A;  2UVG A;  3TUS A;  2A5T A;  4F3S A;  4IY6 A;  4OER A;  1JVY A;  2OCU A;  4PFW A;  1LST A;  4MLQ A;  2RCB A;  4RPN A;  1HSL A;  1MXZ A;  2GHB A;  2QL3 A;  2UVH A;  1EH3 A;  4G2Z A;  4LVQ A;  5JK4 A;  4YMA A;  3F11 A;  2I3W A;  3M3L A;  1MS7 A;  1DTG A;  4G68 A;  4OFL A;  3IJO B;  4LON B;  2GH9 A;  5ISU A;  1H45 A;  5KZT A;  4GL0 A;  3VVF A;  3IJX B;  1FW0 A;  2ZYN A;  3MP8 A;  4G8N A;  5I59 A;  1VFD A;  5DT6 A;  2V3Q A;  4H6D A;  4HCY A;  3TPA A;  1MM6 A;  3RY3 A;  4FJP A;  1Y3N A;  1P1Q A;  1D4N A;  4R6H A;  4NF5 B;  4R73 A;  5DVI A;  3W9V A;  2THI A;  1A8E A;  3A3C A;  1PEB A;  5H8F B;  4QSE A;  4YB5 A;  3KGC A;  2G29 A;  4ELP A;  3K02 A;  4NF5 A;  2UVJ A;  2ONK E;  1SD3 A;  4HW8 A;  4YIC A;  3N6T A;  1SI1 A;  2QPQ A;  4R2F A;  4R6K A;  1B5I A;  1KWH A;  4YKI A;  4ONY A;  4OEU A;  2Z8E A;  1MQJ A;  4ZEB A;  3K4U A;  3PMV A;  3MQ9 A;  2ZMB A;  5HPQ A;  4KPT A;  4Q0C A;  1JEV A;  3R7X A;  4FEC A;  1Y3P A;  3VLW A;  3KSX A;  4PET A;  4IO2 A;  2ONR A;  3C33 A;  2F35 A;  4GQO A;  1R6Z A;  1XHY A;  3IOT A;  3OO8 A;  3KJT A;  3FV2 A;  4GWO A;  5BWJ A;  4FAT A;  3VDF A;  4KCD A;  3FUZ A;  1B58 A;  3H4Z A;  1B5J A;  4OVJ A;  3IOU A;  1BIY A;  2XXQ A;  5I57 B;  3UGW A;  2GFE A;  2QMX A;  3W9W A;  2VHA A;  1Z7N E;  1VR5 A;  2DSF A;  4DCY A;  4RXL A;  5CRY A;  1ATG A;  4QF9 A;  5I2K A;  4KD5 A;  1B51 A;  1MXY A;  4P0G A;  3FVK A;  3LUY A;  4AB5 A;  4U21 A;  1B52 A;  1M5E A;  2XXW A;  5I57 A;  2XXH A;  4QSD A;  1LCT A;  1MY4 A;  4JWX A;  1AIV A;  1LB9 A;  1UIV A;  1MPB A;  1IQ7 A;  2RF1 A;  2X26 A;  5CM6 A;  4XKQ A;  3IB0 A;  1TXF A;  4LAT A;  5H8N B;  3FXQ A;  3MBP A;  3SEX A;  2H4I A;  4F1Y A;  1IEJ A;  3RT6 B;  1R9Q A;  2HQ0 A;  5EYF A;  2QS2 A;  1B3H A;  3MZB A;  3UN6 A;  5I58 B;  2DXR A;  4XKN A;  3V8X B;  3OOA A;  3U94 A;  5AA3 A;  1SVX B;  4JWY A;  3FGS A;  3FVN A;  5ITP A;  3KN8 A;  3RN8 A;  1H43 A;  1WDN A;  5I58 A;  4IB2 A;  5AA4 A;  1ZKB A;  4Q8R A;  1HSE A;  4F3B A;  4TOZ A;  3IB1 A;  1VSO A;  3LSX A;  3OEK A;  1MQH A;  2LAO A;  3SEV A;  1FTO A;  1SW2 A;  3FJM A;  3RTW B;  2F78 A;  3OEN A;  3OEL A;  3ILU B;  4F31 B;  4X9T A;  3UIF A;  1N7W A;  1JW5 A;  3VXC A;  1QJM A;  3OO6 A;  1MRP A;  1ZU0 A;  4DXC A;  2Y7R A;  2GRV A;  1FQD A;  4XKR A;  4X1D A;  1PDA A;  2DWI A;  2O51 A;  1NH8 A;  4HS7 A;  3I5O A;  1JET A;  3T9V A;  1XT8 A;  2I48 A;  3FD3 A;  2X7Q A;  3D4G A;  2IA4 A;  4LP2 B;  2F97 A;  1II5 A;  3TZA A;  1WOD A;  2O7U A;  4IO5 A;  3VFJ A;  1UIU A;  2NXO A;  2O84 X;  3U1O A;  3WAE A;  2I49 A;  4N6P A;  4GFR A;  3IL1 B;  2F34 A;  3HHF A;  1B1X A;  2P2A A;  3U93 A;  4ECF A;  3LBS A;  4KYE A;  2PT2 A;  3PPQ A;  4R6Y A;  3H06 B;  3G3J A;  1N0T A;  4LZ5 A;  4GF8 A;  1PBP A;  3HPI A;  1GR2 A;  1NNK A;  1LAX A;  1URG A;  1MY1 A;  1ZBM A;  4F22 A;  4U1O A;  2E1S A;  1MY0 A;  1JW4 A;  1H44 A;  5DYH A;  3GLB A;  4K3F A;  4YU0 A;  2AYS A;  2XXU A;  2RC9 A;  1TFD A;  4BDQ A;  1B4H A;  3P7I A;  4IY5 A;  3FZV A;  1M5C A;  2PBW A;  4F39 A;  3MZ1 A;  4BDO A;  4R9F A;  1MY3 A;  1ZIU A;  2H5Y A;  2V3U A;  3TEL A;  2B3B A;  3TYH A;  4KFQ A;  2ESN A;  1LFH A;  2UVI A;  3RQT A;  3K00 A;  4M1V A;  2HCA A;  1MH4 A;  3CRB A;  3IO6 A;  3MVZ A;  2Z23 A;  3TFL A;  4NE4 A;  1US4 A;  2YLN A;  1MXU A;  2KLF A;  1R1N A;  4GRK A;  4C0R A;  3O2A A;  4NWD A;  3TAJ A;  4F2Q A;  5FHO A;  5L9M A;  2RCA A;  1FTL A;  4AQ4 A;  2Y7K A;  3FAT A;  4XXU A;  3UK4 A;  2XX7 A;  3A09 A;  2PYY A;  5B70 A;  1N84 A;  4NF8 A;  5DEX B;  3S4U A;  4U2R A;  3THI A;  2NWJ A;  3KOS A;  4DXU A;  3N26 A;  3ZKL A;  2QRY A;  4TQU Q;  5H8Q B;  1DTZ A;  1P1O A;  4F1U A;  1LFI A;  3L6G A;  3OO9 A;  2RKM A;  3PUW E;  4U4S A;  4F1V A;  3T9X B;  3MVY A;  2FYI A;  1DOT A;  1OMP A;  3RT8 A;  3FV1 A;  4NWC A;  4DZ1 A;  3Q25 A;  4NF6 A;  1Q35 A;  3K1M A;  2W7Y A;  1DSN A;  3K1P A;  3OMB A;  1LAH E;  2IEE A;  4GL8 A;  3KFM A;  1EU8 A;  2XD3 A;  4EUO A;  3TDJ A;  2A5T B;  3G3K A;  3VLU A;  1N04 A;  4I9D A;  2B3F A;  4PE5 B;  3RLF E;  1YPN A;  3QUJ A;  3LSL A;  2R71 A;  1NL5 A;  2I6E A;  4G68 B;  2Y7I A;  1N7X A;  1Y1Z A;  4ZE8 A;  2DE3 A;  2H9B A;  1L5T A;  3PD9 A;  4IO7 A;  4QFL A;  4I1D A;  3SET A;  3KN3 A;  3HCQ A;  2QS3 A;  4H67 A;  4U1Z A;  5I59 B;  3A3U A;  1EZO A;  4JBZ A;  1IXC A;  1SW1 A;  1NNT A;  3G7W A;  1S7Y A;  2AIX A;  3O6I A;  4L17 A;  5TPA A;  1MPD A;  5F1Q A;  1T0K A;  1LBB A;  1B7Z A;  1MXW A;  1OIB A;  1MQI A;  3C35 A;  2F6G A;  4DDD A;  1XC1 A;  2VP1 A;  4ZZA A;  2Q2A A;  2AL4 A;  5H8H A;  3MZ9 A;  5EHS A;  3SES A;  3U72 A;  3DEL B;  1FQA A;  1O64 A;  3T9H B;  2A5S A;  1A7L A;  3MVX A;  2M8C A;  1MQD A;  1PB7 A;  1B3L A;  2Y84 A;  3H6T A;  3FJ7 A;  4C1T A;  2FNC A;  1Y1M A;  4MF3 A;  3MP1 A;  4GD5 A;  4OMB A;  2FA7 A;  3FVG A;  4ZS9 A;  3MP6 A;  2R9J A;  4E0X A;  2HZK A;  3SEW A;  5A5X B;  3G3G A;  3GXA A;  2VD2 A;  2REG A;  3VE1 B;  4FED A;  5DVF A;  1VE4 A;  4G4P A;  3FXU A;  4BDL A;  3M3F A;  3B6W A;  1JW1 A;  1A54 A;  5I2K B;  4X48 A;  2Q2C A;  3TMG A;  5A5X A;  2HAV A;  3DLN A;  1N3W A;  2ONS A;  3ODB A;  2XXP A;  1Y4T A;  5JTY B;  2ZXT A;  1LAF E;  2DWH A;  3N5L A;  5KCJ B;  2O6A A;  4NMY A;  4U22 A;  2YJP A;  2QS4 A;  1B3F A;  4IGT A;  1SQY A;  2D21 A;  3C36 A;  3CG3 A;  4GOT A;  1A40 A;  2UYE A;  1JQF A;  5JTY A;  4YAH X;  3QYT A;  3S9E A;  1QW0 A;  3PUX E;  5AA2 D;  5KCJ A;  3QUF A;  4XIG Q;  2Z22 A;  2XHD A;  3CFZ A;  4H5F A;  4G77 A;  4YB7 A;  5FHN A;  1AH5 A;  1A99 A;  4POW A;  1R9L A;  5K2Y A;  5L9S A;  2F8D A;  4JWO A;  5AA4 B;  4F2O A;  4YB6 A;  3I6V A;  1IUD A;  3IAZ A;  4O3A A;  3JZJ A;  3C9H A;  2DWJ A;  2R6G E;  3MW0 A;  2XXX A;  1B7U A;  4ZEC A;  5CMK A;  5I56 B;  3EHU A;  3QXM A;  3TCG A;  2CMO A;  3MAM A;  3CFL A;  3TTL A;  4Z7E A;  4JDF A;  3G3I A;  1IZ1 A;  2RIN A;  1SW4 A;  3PMW A;  3ZS6 A;  2PMS A;  3FJG A;  1XS5 A;  4ESX A;  1YTV A;  4DLD A;  5I2N A;  4G8H A;  2B65 A;  2ZYO A;  1IIT A;  2UXA A;  3ECR A;  5I56 A;  3HST A;  3LSW A;  2BJJ X;  2OK2 A;  3IO4 A;  3S9L C;  3KZG A;  4PFY A;  3R26 A;  1B5H A;  4R2B A;  4G68 C;  1NMU A;  4F3P A;  4H0W A;  1SBP A;  3FVO A;  2HAU A;  1LAG E;  2XXR A;  1QUK A;  3Q29 A;  2Q89 A;  1B05 A;  5CC2 A;  1B4Z A;  2DXY A;  1AOV A;  3EHT A;  2WKY A;  4TLM B;  4LZ8 A;  5KDT A;  1PC3 A;  4LQ5 A;  4NF4 A;  4JSO A;  3K1N A;  1FCK A;  5CMC A;  4EQ9 A;  4WKM A;  3CG1 A;  2I3V A;  1B0L A;  1ELJ A;  1A55 A;  1IIW A;  4MBP A;  3N94 A;  2RC8 A;  2XD2 A;  4WEP A;  4FOR A;  4H8J A;  1YCJ A;  4N13 A;  1MH3 A;  4JXI A;  5TP9 A;  3O29 A;  3DP6 A;  2OLB A;  4UAC A; 
#chains in the Genus database with same CATH topology
 1LBC A;  1YYZ A;  5ELV A;  5AA1 A;  1KA0 A;  2XXT A;  1Y9U A;  2RC7 A;  3K6X A;  4P1E A;  1INP A;  1IMD A;  1A8F A;  2XXV A;  3USD A;  5FTH A;  4KR5 A;  1WVJ A;  4MX6 A;  1H3D A;  3KSJ A;  3L6H A;  2ZYK A;  3W15 C;  3O6H A;  4F3G A;  1I69 A;  5EHM A;  1M5D A;  5F7V A;  4EQB A;  4NAP A;  4OEV A;  1FTA A;  2B4L A;  5ET5 A;  4R74 A;  4JVI A;  2VOZ A;  4U4X A;  5AA2 A;  4H46 A;  3PD8 A;  3MPL A;  1QKB A;  1USY E;  5HM4 B;  3IX1 A;  1BKA A;  4OEN A;  4IGR A;  5ICQ A;  4EQ7 A;  1H76 A;  2XA5 A;  3O66 A;  4ZE9 A;  1NFT A;  3T93 B;  1FSA A;  3BBR A;  4NF8 B;  3SER A;  1I6Q A;  2V84 A;  3H6V A;  3TCH A;  5DW8 A;  4P0I A;  3B7D A;  1BLF A;  1NV7 A;  5LOM A;  2DP8 A;  3FIR A;  2CEX A;  1JP4 A;  3C34 A;  1D9Q A;  3JYR A;  1SYI A;  4MLV A;  1FBG A;  1USY H;  1FQB A;  3H6W A;  3C31 A;  4KHZ E;  5TU0 A;  3IOV A;  4G61 A;  1FPD A;  3QK6 A;  2XWO A;  1G0H A;  2OBG A;  4ZEI A;  4PFT A;  3RPW A;  2QS1 A;  3TTN A;  2E0S A;  1P1W A;  5H8S A;  4ELO A;  1MM7 A;  4GLI A;  1BK4 A;  3EKI A;  3EN3 A;  3EHS A;  3CI8 A;  1MXX A;  2YPN A;  3FXR A;  4NF6 B;  1B0H A;  4Z0I A;  1UQW A;  4GX3 A;  2Y7P A;  3KG2 A;  1FTJ A;  4RJZ A;  4NF0 A;  1ZJL A;  3ZSF A;  2ZNU A;  4JB7 A;  3T66 A;  2GHA A;  4KCC A;  1SDX A;  1PB8 A;  4EF1 A;  4KYD A;  4O7I A;  4XEQ A;  3MYU A;  1NUX A;  5CBS A;  4GWX A;  3IR1 A;  1NKX A;  3FAS A;  3RNN A;  4DCX A;  1CE2 A;  1Y3Q A;  1ZMG A;  1GV8 A;  1NH7 A;  1QUI A;  1B1H A;  3M8U A;  1FPE A;  3N6U A;  2DS9 A;  4OET A;  2I0B A;  1XOC A;  2I4B A;  2V3T A;  3T1B A;  2F5X A;  2DDK A;  3H7M A;  1TT1 A;  4N8Y A;  3TTK A;  1DPE A;  4ZED A;  1Z7M E;  3CSB A;  4RNS A;  3T22 A;  1I6B A;  5DTB A;  3UA8 A;  3KJ7 A;  1AMF A;  1CB6 A;  3K6W A;  4X04 A;  4QRZ A;  3Q28 A;  1QKA A;  4YKP A;  3A29 A;  3O9P A;  1P1N A;  4I8C A;  3Q27 A;  3K6V A;  1YXI A;  2NUV A;  1J1N A;  4XFE A;  4GIZ A;  5IAI A;  2HZL A;  3CHG A;  3H3G A;  4PQJ A;  5TPA B;  1SYH A;  1Y20 A;  4O3C A;  1S9T A;  3PPN A;  4ISU A;  1GVC A;  1XVY A;  3JV9 A;  2L5V A;  3EQ1 A;  4DI3 D;  1K9Z A;  3H6U A;  4MH5 A;  3PMX A;  5J1D A;  4QFO A;  4RY1 A;  1MG1 A;  1OQG A;  5H8H B;  2REJ A;  2OX3 A;  3T96 B;  4OAN A;  3I3V A;  2F3B A;  1TWY A;  4XTC Q;  2FVZ A;  1US5 A;  1O63 A;  3UOR A;  3TOD A;  1B32 A;  4EXK A;  3KN7 A;  3PUZ E;  3IOW A;  2ZNS A;  3O6G A;  4MAG A;  5B7D A;  2P1S A;  2NOO A;  4WED A;  2ALU A;  4GVO A;  3B50 A;  4ZZE A;  4LA9 A;  4PDD A;  1FPG A;  4DXB A;  2XWI A;  4EDP A;  4P11 A;  4OZ9 A;  3TQW A;  4H5G A;  4H1X A;  3MST A;  3MJN A;  5IZ1 A;  3SDF A;  3IK6 B;  5LTC A;  4PAI A;  4OFJ A;  5HBC A;  1POY 1;  1PB9 A;  1UTB B;  4MMP A;  4OVS A;  1EYJ A;  3LSF B;  1D9Y A;  4RYA A;  1D3K A;  1NI9 A;  4I3Y A;  2CZH A;  1GGG A;  2VGQ A;  1DCU A;  3PPP A;  5H8F A;  1OVB A;  3HO7 A;  1D9V A;  4X8R A;  4OWD A;  4QFK A;  1YAE A;  1SW5 A;  5IKB A;  1UTB A;  3MC2 A;  3C32 A;  3OXN A;  4RK2 A;  5L8D A;  2OZZ A;  1LB8 A;  1QUL A;  3TEP A;  1LGB C;  5LDZ A;  4MHF A;  1Q1K A;  3BIH A;  2ABH A;  3E9X A;  3PV0 E;  2D5W A;  2OWT A;  3B6Q A;  2QFL A;  4PBH A;  3V5A A;  3RGY A;  1JVX A;  4AB6 A;  3OSQ A;  2DE2 A;  3U8Q A;  1ZLQ A;  2P0S A;  4FIM A;  4X1B A;  4OES A;  4P47 A;  2D3I A;  5AE4 A;  4ELQ A;  3TKD A;  3PTY A;  2DE4 A;  2ANJ A;  2Q9T A;  4NX1 A;  3PU5 A;  1LLS A;  3CVG A;  3GBB A;  1MPC A;  1QUJ A;  4THI A;  3K0V A;  4YMB A;  4IO6 A;  3PPR A;  1FTM A;  2HXR A;  3D4C A;  1M5F A;  3IB2 A;  4OVT A;  3PGF A;  4BDM A;  1Y4C A;  1MDQ A;  3M3K A;  3S2V A;  2DWA A;  4F19 A;  5ICT A;  3KBR A;  4GXS B;  1VFE A;  4XKP A;  3PUV E;  4ELR A;  3O97 A;  3VXB A;  1EZP A;  4GXA A;  3BFT A;  2DOJ A;  4BDN A;  3BIG A;  2XXI A;  4ESW A;  4H65 A;  2I58 A;  2F36 A;  3RTF B;  3CSG A;  2FHY A;  2XWV A;  4JSD A;  3MVW A;  4LUB A;  1LEV A;  1N3X A;  3KBZ A;  5IZ3 A;  1GTK A;  1OQH A;  3VVE A;  3RUM A;  4HTG A;  3KEI A;  3GBA A;  3TTM A;  4I3E A;  2F3D A;  1NUW A;  5I2N B;  3E78 A;  1DMB A;  4LZ7 A;  4I62 A;  2Z8F A;  4MEV A;  2F7A A;  4KYS A;  5H8N A;  4ZEK A;  5ET6 A;  5CBR A;  3LV0 A;  4ZDM A;  3ILT B;  3T9U A;  4PFU A;  3SEY A;  2CZL A;  1RKM A;  3R6U A;  1NNP A;  3PPO A;  2F7B A;  1S50 A;  3OSR A;  3PUY E;  2Z8D A;  4OQO A;  1N76 A;  5FHM A;  1FBC A;  4QSC A;  1B40 A;  4O3B A;  3UP9 A;  2G93 A;  3WAF A;  2VD3 A;  1FQE A;  3B8B A;  1P99 A;  5ITO A;  3KOT A;  5EQ8 A;  4N07 A;  1IXG A;  3MPK A;  4HE2 A;  2HFB A;  5KDT B;  4TLL B;  1B6H A;  3QSL A;  5L9O A;  2OJT A;  2WBB A;  4NF4 B;  2I4C A;  3LC8 A;  1LFG A;  3OEM A;  3Q26 A;  1NV2 A;  3RPL B;  3SEU A;  3V89 B;  4YKJ A;  4DE8 A;  1BTJ A;  4GWW A;  3TQL A;  2XX8 A;  4U23 A;  2HXW A;  4KXP A;  4MFI A;  2JJK A;  3E3K A;  2NVU B;  3U92 A;  4YKK A;  4C1U A;  3CIJ A;  4QFP A;  3TCF A;  1MQG A;  5CMM A;  2O7I A;  3ZKK A;  4N91 A;  5TP9 B;  5BUU A;  4HCW A;  1OLA A;  4DIG A;  1KZ8 A;  2F6P A;  3LR1 A;  2PT1 A;  1M5B A;  5CI5 A;  2PVU A;  1JNF A;  1QVS A;  3DP8 A;  1URD A;  1I6A A;  3MWB A;  4HXV A;  4Q5T A;  3SKP A;  1MXV A;  3HN0 A;  2ZYM A;  3ONM A;  5K2X A;  2AL5 A;  2OWS A;  4P8B A;  2DVC A;  5DVJ A;  2QSX A;  3EF7 A;  4MIJ A;  1ANF A;  3AXF A;  3H03 A;  1B3G A;  4OFO A;  1URS A;  3IFC A;  2O69 A;  1LCF A;  1O7T A;  2QVR A;  1OVT A;  1SI0 A;  4E0W A;  1MY2 A;  4UA8 A;  2DYX A;  5AA2 B;  4N6D A;  4OA4 A;  1JEU A;  4R75 A;  1B9J A;  3G3F A;  3K6U A;  2CEY A;  4F18 A;  4HE1 A;  1IMF A;  2QVV A;  2UYF A;  3VVD A;  2PX1 A;  4YZZ A;  5JEI A;  3VLV A;  1LBY A;  3TTR A;  4Q30 B;  3BKI B;  3CR9 A;  2X7P A;  4NTL A;  1RYO A;  3DP4 A;  1FTK A;  1B46 A;  5M2V A;  2O1L A;  4M4G A;  3QMF A;  3VV5 A;  1DPP A;  4FEB A;  4BLA A;  3S9N C;  2HEU A;  1UTH B;  4LQ2 A;  4MNI A;  3HV1 A;  4PP0 A;  2H98 A;  1HSJ A;  2QJE A;  3IOR A;  2H25 A;  2O1M A;  3V83 A;  1NV1 A;  1PBQ A;  4ZEF A;  1QGX A;  4FE8 A;  3DM0 A;  3OD7 A;  1UTH A;  2DQV A;  1NV3 A;  3GZG A;  2Q8J A;  1EYK A;  1XVX A;  4NED A;  4RK9 A;  1IXH A;  3SZP A;  1TFA A;  4EF2 A;  2I0C A;  2Y7W A;  3E13 X;  1EYI A;  4HE0 A;  1NV4 A;  4IR8 A;  1EZ9 A;  2V25 A;  2DVZ A;  3QAX A;  3EPE A;  2V93 A;  1P1U A;  4R9G A;  3FBP A;  4PC9 A;  5IZZ A;  5CMB A;  4OTE A;  4BDR A;  1FBE A;  4G8M A;  2QMW A;  1AL3 A;  1POT A;  3E4R A;  3HHG A;  5FTI A;  3BFU A;  1NV6 A;  1NNF A;  1YZ0 A;  4NQ8 A;  4GWY A;  1BP5 A;  3MUQ A;  3B6T A;  3QIM A;  5EQ7 A;  1ZTY A;  2F7C A;  1FBP A;  4F29 A;  4ND9 A;  5DEX A;  1OLC A;  4QHQ A;  4OXV A;  4IO4 A;  4RA1 A;  4PAF A;  4R72 A;  3K01 A;  1B7H A;  5H8Q A;  5ET8 A;  4RPO A;  1B2H A;  5FBP A;  3C4M A;  5I84 A;  1IXI A;  4FAJ A;  1FQC A;  4OHN A;  2O68 A;  2OWZ A;  3IFA A;  4IO3 A;  2ZNT A;  4QFN A;  3OO7 A;  1MDP 1;  2PFY A;  5I7I A;  4GBW A;  4OYV A;  1F9B A;  1B3E A;  4WXJ A;  4KI0 E;  1FBD A;  3K2D A;  4H8I A;  4POX A;  3G3H A;  2XX9 A;  4KQP A;  2Q88 A;  3KC1 A;  2FIX A;  3S9M C;  4EXL A;  1RYX A;  3CFX A;  2XXY A;  3O28 A;  4AS4 A;  1FQF A;  2H99 A;  1LBZ A;  2UVG A;  3TUS A;  2A5T A;  4F3S A;  4IY6 A;  4OER A;  1JVY A;  2OCU A;  4PFW A;  1LST A;  4MLQ A;  2RCB A;  4RPN A;  1HSL A;  1MXZ A;  2GHB A;  2QL3 A;  2UVH A;  1EH3 A;  4G2Z A;  4LVQ A;  5JK4 A;  4YMA A;  3F11 A;  2I3W A;  3M3L A;  1MS7 A;  1DTG A;  4G68 A;  4I40 A;  4OFL A;  3IJO B;  4LON B;  2GH9 A;  5ISU A;  1H45 A;  5KZT A;  4GL0 A;  1CNQ A;  3IJX B;  3VVF A;  1FW0 A;  2ZYN A;  3MP8 A;  2PFZ A;  4G8N A;  5I59 A;  1VFD A;  5DT6 A;  2V3Q A;  4H6D A;  1NUZ A;  4HCY A;  1FJ6 A;  3TPA A;  1MM6 A;  3RY3 A;  4FJP A;  4UAB A;  4AS5 A;  5ET7 A;  1Y3N A;  1P1Q A;  1D4N A;  2WEF A;  3D1R A;  1FBF A;  4R6H A;  4NF5 B;  4R73 A;  5DVI A;  3W9V A;  2THI A;  1A8E A;  3A3C A;  1PEB A;  5H8F B;  4QSE A;  4YB5 A;  4O94 A;  3KGC A;  5A5L A;  2G29 A;  4PF8 A;  4ELP A;  3K02 A;  4NF5 A;  2UVJ A;  2ONK E;  1SD3 A;  4HW8 A;  4YIC A;  3N6T A;  1SI1 A;  2QPQ A;  4R2F A;  4R6K A;  1B5I A;  1Q9D A;  2Q8M A;  1KWH A;  4YKI A;  4ONY A;  4OEU A;  2Z8E A;  3GYY A;  1MQJ A;  4ZEB A;  3K4U A;  3PMV A;  3MQ9 A;  2ZMB A;  5HPQ A;  4KPT A;  3ISP A;  4Q0C A;  1JEV A;  1G0I A;  3R7X A;  4FEC A;  1Y3P A;  4N17 A;  3KSX A;  3VLW A;  1FRP A;  4PET A;  4IO2 A;  2ONR A;  3C33 A;  2F35 A;  4GQO A;  1R6Z A;  1XHY A;  3IOT A;  3OO8 A;  3KJT A;  3FV2 A;  4GWO A;  5BWJ A;  4FAT A;  3VDF A;  5I3S A;  4KCD A;  3FUZ A;  1B58 A;  3H4Z A;  1B5J A;  4OVJ A;  3IOU A;  4FBP A;  1BIY A;  2XXQ A;  5I57 B;  2QMX A;  2GFE A;  3UGW A;  3W9W A;  2VHA A;  1Z7N E;  4GWZ A;  1VR5 A;  2DSF A;  4DCY A;  4RXL A;  5CRY A;  1ATG A;  4MNP A;  2PCR A;  4QF9 A;  5I2K A;  4QBA A;  1NUY A;  4KD5 A;  1B51 A;  1MXY A;  4P0G A;  3FVK A;  3LUY A;  4AB5 A;  4U21 A;  1B52 A;  1M5E A;  2XXW A;  5I57 A;  2XXH A;  5IZ3 B;  4QSD A;  2Y5K A;  1LCT A;  1MY4 A;  4JWX A;  1AIV A;  1LB9 A;  4MNC A;  1UIV A;  1KA1 A;  1FPI A;  1MPB A;  1IQ7 A;  2RF1 A;  2X26 A;  5CM6 A;  4XKQ A;  3IB0 A;  3E79 A;  4N6K A;  1TXF A;  4LAT A;  5H8N B;  3FXQ A;  3MBP A;  3SEX A;  2H4I A;  4F1Y A;  2HPG A;  1IEJ A;  3RT6 B;  1R9Q A;  2HQ0 A;  5EYF A;  2QS2 A;  1B3H A;  3MZB A;  3UN6 A;  5I58 B;  2DXR A;  1RDY A;  4OVR A;  4XKN A;  3V8X B;  3OOA A;  3U94 A;  2KR0 A;  3T0J A;  1VDW A;  5AA3 A;  1SVX B;  4JWY A;  3FGS A;  4H45 A;  3FVN A;  5ITP A;  3KN8 A;  3RN8 A;  1H43 A;  1WDN A;  5I58 A;  4IB2 A;  5AA4 A;  1ZKB A;  4Q8R A;  1HSE A;  4F3B A;  4TOZ A;  3IB1 A;  1VSO A;  1LBV A;  3LSX A;  3OEK A;  1XI6 A;  1MQH A;  2LAO A;  2XXK A;  3SEV A;  1FTO A;  1SW2 A;  3FJM A;  3RTW B;  2F78 A;  3OEN A;  3OEL A;  3ILU B;  4F31 B;  4X9T A;  3UIF A;  4PFI A;  1N7W A;  1JW5 A;  3VXC A;  1QJM A;  3OO6 A;  1MRP A;  1ZU0 A;  4DXC A;  2Y7R A;  2GRV A;  1FQD A;  4XKR A;  4X1D A;  1PDA A;  2DWI A;  4PBQ A;  2O51 A;  1NH8 A;  4HS7 A;  3I5O A;  1JET A;  1FPF A;  3T9V A;  1XT8 A;  2I48 A;  3FD3 A;  2X7Q A;  3D4G A;  4GX4 A;  2IA4 A;  4LP2 B;  2F97 A;  1II5 A;  3TZA A;  3HFU A;  1WOD A;  2O7U A;  4IO5 A;  4PFR A;  3VFJ A;  1UIU A;  2NXO A;  2O84 X;  2B4M A;  3U1O A;  3WAE A;  2I49 A;  4N6P A;  1K9Y A;  4GFR A;  1FJ9 A;  3IL1 B;  2F34 A;  3HHF A;  1B1X A;  2P2A A;  3RYD A;  3U93 A;  4ECF A;  4N4U A;  4P1L A;  5ESY A;  3LBS A;  4KYE A;  2PT2 A;  3PPQ A;  4R6Y A;  3H06 B;  3G3J A;  1NV5 A;  1N0T A;  4LZ5 A;  4GF8 A;  1PBP A;  2MKZ A;  2FBP A;  4PTK A;  3HPI A;  1GR2 A;  1NNK A;  1LAX A;  1URG A;  1MY1 A;  1ZBM A;  4F22 A;  4U1O A;  2Y5L A;  2E1S A;  1MY0 A;  1JW4 A;  1H44 A;  5DYH A;  3GLB A;  4K3F A;  4YU0 A;  2AYS A;  2XXU A;  2RC9 A;  1TFD A;  4BDQ A;  1B4H A;  3P7I A;  4NGU A;  4IY5 A;  3FZV A;  1M5C A;  2PBW A;  4F39 A;  3MZ1 A;  2ZZW A;  2WYP A;  4BDO A;  4R9F A;  1MY3 A;  1ZIU A;  2H5Y A;  2V3U A;  5IM2 A;  3TEL A;  2B3B A;  3TYH A;  4KFQ A;  2ESN A;  1LFH A;  5T3J A;  2UVI A;  2Q74 A;  5F24 A;  3RQT A;  3K00 A;  4M1V A;  2HCA A;  1MH4 A;  5EQA A;  3CRB A;  3IO6 A;  3MVZ A;  2Z23 A;  3TFL A;  4NE4 A;  4P9K A;  1IMA A;  1US4 A;  1MXU A;  2YLN A;  2KLF A;  1R1N A;  4GRK A;  4C0R A;  3O2A A;  4NWD A;  3TAJ A;  4F2Q A;  5FHO A;  5L9M A;  2RCA A;  1FTL A;  4AQ4 A;  2Y7K A;  3FAT A;  4XXU A;  3UK4 A;  4GWU A;  2XX7 A;  3A09 A;  2PYY A;  1LBX A;  5B70 A;  1N84 A;  4NF8 A;  5DEX B;  3S4U A;  4U2R A;  3THI A;  2NWJ A;  3KOS A;  4N81 A;  4DXU A;  3N26 A;  1LBW A;  3ZKL A;  2QRY A;  5I5P A;  1RDZ A;  4TQU Q;  4JVC A;  5H8Q B;  4LN5 A;  1DTZ A;  1P1O A;  4F1U A;  1LFI A;  1NV0 A;  2XWK A;  2ZZV A;  3L6G A;  3OO9 A;  2RKM A;  3PUW E;  4U4S A;  4F1V A;  3T9X B;  3MVY A;  2FYI A;  2BJI A;  1DOT A;  1OMP A;  3ROJ A;  3RT8 A;  3FV1 A;  4NWC A;  4DZ1 A;  3Q25 A;  4NF6 A;  1Q35 A;  1DBZ A;  3K1M A;  2W7Y A;  1DSN A;  2GQ1 A;  3K1P A;  3OMB A;  4PE3 A;  1LAH E;  2IEE A;  4GL8 A;  4NHB A;  3KFM A;  1EU8 A;  2XD3 A;  4EUO A;  4GBV A;  3TDJ A;  2A5T B;  1FPL A;  3G3K A;  4N8G A;  3VLU A;  1N04 A;  4I9D A;  2B3F A;  4PE5 B;  3RLF E;  1YPN A;  3QUJ A;  3LSL A;  2R71 A;  2P3V A;  1NL5 A;  2I6E A;  4G68 B;  2KQZ A;  2Y7I A;  3NOH A;  1AWB A;  1N7X A;  1Y1Z A;  4ZE8 A;  2DE3 A;  2H9B A;  1L5T A;  3PD9 A;  4IO7 A;  4QFL A;  4I1D A;  3SET A;  3KN3 A;  3HCQ A;  2QS3 A;  4H67 A;  4U1Z A;  5I59 B;  3A3U A;  1EZO A;  3FXB A;  4JBZ A;  1IXC A;  1SW1 A;  1NNT A;  3G7W A;  4PF6 A;  1S7Y A;  2AIX A;  4PGP A;  5EQ9 A;  4OVP A;  3O6I A;  4L17 A;  5TPA A;  4JVD A;  1MPD A;  2HHM A;  5F1Q A;  1T0K A;  1LBB A;  4P56 A;  1B7Z A;  1MXW A;  1OIB A;  1MQI A;  3C35 A;  2F6G A;  4DDD A;  1XC1 A;  2VP1 A;  4ZZA A;  2Q2A A;  2AL4 A;  5H8H A;  3MZ9 A;  5EHS A;  3SES A;  3U72 A;  3DEL B;  1FQA A;  1O64 A;  3T9H B;  2A5S A;  4XF5 A;  1A7L A;  3MVX A;  2WX9 A;  2WYK A;  2M8C A;  1MQD A;  1PB7 A;  3LUZ A;  1B3L A;  2Y84 A;  3H6T A;  2CZK A;  3FJ7 A;  4C1T A;  2FNC A;  2ZZX A;  1Y1M A;  4MJO A;  4MF3 A;  3MP1 A;  4GD5 A;  4OMB A;  2FA7 A;  1DK4 A;  3FVG A;  4ZS9 A;  3MP6 A;  2R9J A;  4E0X A;  2HZK A;  3SEW A;  5A5X B;  3G3G A;  3GXA A;  1SPI A;  2V4C A;  2VD2 A;  2REG A;  3VE1 B;  1IME A;  4FED A;  5DVF A;  1VE4 A;  4G4P A;  3FXU A;  4BDL A;  4PFB A;  3M3F A;  3B6W A;  1JW1 A;  1A54 A;  5I2K B;  4X48 A;  4N15 A;  2Q2C A;  4NN3 A;  3TMG A;  5A5X A;  3KC0 A;  2HAV A;  3DLN A;  1N3W A;  2ONS A;  3ODB A;  4P3L A;  2P3N A;  2XXP A;  1Y4T A;  5JTY B;  2ZXT A;  1LAF E;  2DWH A;  3N5L A;  4MCO A;  5KCJ B;  2O6A A;  4NMY A;  4U22 A;  2YJP A;  2QS4 A;  1IMB A;  1B3F A;  4PAK A;  4IGT A;  1SQY A;  2D21 A;  3C36 A;  3CG3 A;  4GOT A;  1A40 A;  2UYE A;  1JQF A;  5JTY A;  4PCD A;  4YAH X;  3QYT A;  4O8M A;  3S9E A;  1QW0 A;  3PUX E;  5IGA A;  5AA2 D;  4NG7 A;  5KCJ A;  1FPB A;  3QUF A;  4XIG Q;  2Z22 A;  2XHD A;  3CFZ A;  4H5F A;  4G77 A;  4YB7 A;  5EYH A;  5FHN A;  1AH5 A;  1A99 A;  4POW A;  1R9L A;  5K2Y A;  3U65 A;  5L9S A;  2F8D A;  4GX6 A;  4JWO A;  5AA4 B;  4F2O A;  4YB6 A;  3I6V A;  1IUD A;  3IAZ A;  4O3A A;  1RDX A;  3JZJ A;  3C9H A;  2DWJ A;  2R6G E;  3MW0 A;  2XXX A;  1B7U A;  4ZEC A;  5EYG A;  5CMK A;  5I56 B;  3EHU A;  3QXM A;  2WBD A;  3TCG A;  2CMO A;  3MAM A;  2VPO A;  3CFL A;  3TTL A;  2QVU A;  4Z7E A;  4JDF A;  3G3I A;  1IZ1 A;  2RIN A;  1SW4 A;  3PMW A;  4QXD A;  3ZS6 A;  2PMS A;  3FJG A;  1XS5 A;  4ESX A;  2CZI A;  1YTV A;  4DLD A;  5I2N A;  4G8H A;  2B65 A;  2ZYO A;  4PGN A;  1IIT A;  2UXA A;  3ECR A;  5I56 A;  5J16 A;  3HST A;  3LSW A;  1FBH A;  2BJJ X;  2OK2 A;  3IO4 A;  3S9L C;  3KZG A;  4PFY A;  3R26 A;  1B5H A;  1FPK A;  4R2B A;  4G68 C;  1NMU A;  4GWS A;  4F3P A;  4H0W A;  1SBP A;  3FVO A;  2HAU A;  1LAG E;  2XXR A;  1QUK A;  3Q29 A;  2VT5 A;  2Q89 A;  1B05 A;  5CC2 A;  1B4Z A;  2DXY A;  4OVQ A;  1AOV A;  1IMC A;  3EHT A;  2WKY A;  4TLM B;  4LZ8 A;  2R8T A;  5KDT A;  1PC3 A;  4LQ5 A;  4NF4 A;  4JSO A;  3K1N A;  1FCK A;  5CMC A;  4DI4 B;  4EQ9 A;  4WKM A;  3CG1 A;  3RPL A;  2I3V A;  1B0L A;  1ELJ A;  1A55 A;  1IIW A;  4MBP A;  3N94 A;  2RC8 A;  2XD2 A;  4WEP A;  4PDH A;  2VPN A;  2FIE A;  4FOR A;  4H8J A;  1YCJ A;  4O7M A;  4N13 A;  1MH3 A;  4JXI A;  5TP9 A;  3O29 A;  3DP6 A;  2OLB A;  1FPJ A;  4UAC A; 
#chains in the Genus database with same CATH homology
 1LBC A;  5ELV A;  5AA1 A;  2XXT A;  1Y9U A;  2RC7 A;  3K6X A;  1A8F A;  2XXV A;  3USD A;  5FTH A;  4KR5 A;  1WVJ A;  1H3D A;  3KSJ A;  3L6H A;  2ZYK A;  3W15 C;  3O6H A;  4F3G A;  1I69 A;  5EHM A;  1M5D A;  5F7V A;  4EQB A;  4OEV A;  4R74 A;  2VOZ A;  4U4X A;  5AA2 A;  3PD8 A;  3MPL A;  1QKB A;  1USY E;  5HM4 B;  3IX1 A;  1BKA A;  4OEN A;  4IGR A;  5ICQ A;  4EQ7 A;  1H76 A;  3O66 A;  4ZE9 A;  1NFT A;  3T93 B;  3BBR A;  4NF8 B;  3SER A;  1I6Q A;  2V84 A;  3H6V A;  3TCH A;  4P0I A;  3B7D A;  1BLF A;  5LOM A;  2DP8 A;  3FIR A;  3JYR A;  3C34 A;  1SYI A;  4MLV A;  1USY H;  1FQB A;  3H6W A;  3C31 A;  4KHZ E;  5TU0 A;  3IOV A;  3QK6 A;  2OBG A;  4ZEI A;  4PFT A;  3RPW A;  2QS1 A;  3TTN A;  2E0S A;  1P1W A;  5H8S A;  4ELO A;  1MM7 A;  4GLI A;  3EN3 A;  3EHS A;  3CI8 A;  1MXX A;  2YPN A;  3FXR A;  4NF6 B;  1B0H A;  4Z0I A;  1UQW A;  2Y7P A;  3KG2 A;  1FTJ A;  4RJZ A;  1ZJL A;  3ZSF A;  2ZNU A;  4JB7 A;  3T66 A;  2GHA A;  4KCC A;  1PB8 A;  1SDX A;  4EF1 A;  4KYD A;  5CBS A;  3IR1 A;  1NKX A;  3FAS A;  3RNN A;  4DCX A;  1CE2 A;  1Y3Q A;  1ZMG A;  1GV8 A;  1NH7 A;  1QUI A;  1B1H A;  3M8U A;  3N6U A;  2DS9 A;  4OET A;  2I0B A;  1XOC A;  2I4B A;  2V3T A;  2F5X A;  3H7M A;  1TT1 A;  3TTK A;  4ZED A;  1DPE A;  1Z7M E;  3CSB A;  4RNS A;  3T22 A;  1I6B A;  5DTB A;  3UA8 A;  3KJ7 A;  1AMF A;  1CB6 A;  3K6W A;  4QRZ A;  3Q28 A;  1QKA A;  4YKP A;  3O9P A;  1P1N A;  4I8C A;  3Q27 A;  3K6V A;  2NUV A;  1J1N A;  4GIZ A;  5IAI A;  2HZL A;  3H3G A;  4PQJ A;  5TPA B;  1SYH A;  1Y20 A;  4O3C A;  1S9T A;  3PPN A;  4ISU A;  1GVC A;  1XVY A;  3JV9 A;  3EQ1 A;  3H6U A;  4MH5 A;  3PMX A;  5J1D A;  4QFO A;  4RY1 A;  1MG1 A;  1OQG A;  5H8H B;  2REJ A;  3T96 B;  3I3V A;  1TWY A;  4XTC Q;  1US5 A;  1O63 A;  3UOR A;  3TOD A;  1B32 A;  4EXK A;  3KN7 A;  3PUZ E;  3IOW A;  2ZNS A;  3O6G A;  5B7D A;  2P1S A;  2NOO A;  4WED A;  2ALU A;  4GVO A;  4ZZE A;  4LA9 A;  4DXB A;  4EDP A;  4P11 A;  4OZ9 A;  3TQW A;  4H5G A;  4H1X A;  3MJN A;  3SDF A;  3IK6 B;  4OFJ A;  5HBC A;  1POY 1;  1PB9 A;  1UTB B;  3LSF B;  1D9Y A;  4RYA A;  1D3K A;  1GGG A;  2VGQ A;  3PPP A;  5H8F A;  1OVB A;  3HO7 A;  1D9V A;  4OWD A;  4QFK A;  1YAE A;  1SW5 A;  5IKB A;  1UTB A;  3MC2 A;  3C32 A;  3OXN A;  4RK2 A;  5L8D A;  2OZZ A;  1LB8 A;  1QUL A;  3TEP A;  1LGB C;  1Q1K A;  2ABH A;  3E9X A;  3PV0 E;  2D5W A;  2OWT A;  3B6Q A;  3V5A A;  3RGY A;  1JVX A;  4AB6 A;  3OSQ A;  2DE2 A;  3U8Q A;  1ZLQ A;  2P0S A;  4FIM A;  4X1B A;  4OES A;  2D3I A;  5AE4 A;  4ELQ A;  3TKD A;  2DE4 A;  2ANJ A;  2Q9T A;  3PU5 A;  1LLS A;  3CVG A;  3GBB A;  4YMB A;  1MPC A;  1QUJ A;  3K0V A;  4THI A;  4IO6 A;  3PPR A;  1FTM A;  3D4C A;  1M5F A;  3IB2 A;  3PGF A;  4BDM A;  1Y4C A;  1MDQ A;  3M3K A;  3S2V A;  2DWA A;  4F19 A;  5ICT A;  3KBR A;  4GXS B;  1VFE A;  4XKP A;  3PUV E;  4ELR A;  3O97 A;  3VXB A;  1EZP A;  4GXA A;  3BFT A;  2DOJ A;  4BDN A;  2XXI A;  4ESW A;  4H65 A;  2I58 A;  2F36 A;  3RTF B;  3CSG A;  4JSD A;  3MVW A;  4LUB A;  1N3X A;  1GTK A;  1OQH A;  3VVE A;  3RUM A;  4HTG A;  3KEI A;  3GBA A;  3TTM A;  5I2N B;  1DMB A;  4LZ7 A;  4I62 A;  2Z8F A;  2F7A A;  4KYS A;  5H8N A;  4ZEK A;  5CBR A;  4ZDM A;  3ILT B;  3T9U A;  4PFU A;  3SEY A;  2CZL A;  1RKM A;  3R6U A;  1NNP A;  3PPO A;  2F7B A;  1S50 A;  3OSR A;  3PUY E;  2Z8D A;  4OQO A;  1N76 A;  5FHM A;  4QSC A;  1B40 A;  4O3B A;  3UP9 A;  2G93 A;  3WAF A;  2VD3 A;  1FQE A;  1P99 A;  5ITO A;  3KOT A;  4N07 A;  1IXG A;  3MPK A;  2HFB A;  5KDT B;  4TLL B;  1B6H A;  3QSL A;  5L9O A;  2OJT A;  4NF4 B;  2I4C A;  3LC8 A;  1LFG A;  3OEM A;  3Q26 A;  3SEU A;  3V89 B;  4YKJ A;  4DE8 A;  1BTJ A;  3TQL A;  2XX8 A;  4U23 A;  2HXW A;  4MFI A;  3E3K A;  2NVU B;  3U92 A;  4YKK A;  4C1U A;  3CIJ A;  4QFP A;  3TCF A;  1MQG A;  5CMM A;  2O7I A;  3ZKK A;  5TP9 B;  5BUU A;  4HCW A;  1OLA A;  4DIG A;  2F6P A;  3LR1 A;  2PT1 A;  1M5B A;  5CI5 A;  2PVU A;  1JNF A;  1QVS A;  3DP8 A;  1URD A;  1I6A A;  3MWB A;  4Q5T A;  3SKP A;  1MXV A;  3HN0 A;  2ZYM A;  3ONM A;  5K2X A;  2AL5 A;  2OWS A;  2DVC A;  5DVJ A;  2QSX A;  3EF7 A;  1ANF A;  3AXF A;  3H03 A;  1B3G A;  4OFO A;  1URS A;  2O69 A;  1LCF A;  1O7T A;  1OVT A;  1SI0 A;  4E0W A;  1MY2 A;  4UA8 A;  2DYX A;  5AA2 B;  1JEU A;  4R75 A;  1B9J A;  3G3F A;  3K6U A;  4F18 A;  2UYF A;  3VVD A;  2PX1 A;  4YZZ A;  5JEI A;  3VLV A;  3TTR A;  4Q30 B;  3BKI B;  3CR9 A;  2X7P A;  4NTL A;  1RYO A;  3DP4 A;  1FTK A;  1B46 A;  5M2V A;  2O1L A;  4M4G A;  3VV5 A;  1DPP A;  4FEB A;  4BLA A;  3S9N C;  2HEU A;  1UTH B;  4LQ2 A;  3HV1 A;  4PP0 A;  2H98 A;  1HSJ A;  2QJE A;  3IOR A;  2H25 A;  2O1M A;  3V83 A;  1PBQ A;  4ZEF A;  4FE8 A;  3DM0 A;  3OD7 A;  1UTH A;  2DQV A;  3GZG A;  2Q8J A;  1XVX A;  4NED A;  4RK9 A;  1IXH A;  1TFA A;  4EF2 A;  2I0C A;  2Y7W A;  3E13 X;  1EZ9 A;  2V25 A;  2DVZ A;  3QAX A;  3EPE A;  2V93 A;  1P1U A;  4R9G A;  5CMB A;  4OTE A;  4BDR A;  4G8M A;  2QMW A;  1AL3 A;  1POT A;  3E4R A;  3HHG A;  5FTI A;  3BFU A;  1NNF A;  1BP5 A;  3MUQ A;  3B6T A;  3QIM A;  1ZTY A;  2F7C A;  4F29 A;  4ND9 A;  5DEX A;  1OLC A;  4QHQ A;  4OXV A;  4IO4 A;  4RA1 A;  4R72 A;  3K01 A;  1B7H A;  5H8Q A;  4RPO A;  1B2H A;  3C4M A;  5I84 A;  1IXI A;  4FAJ A;  1FQC A;  4OHN A;  2O68 A;  4IO3 A;  2ZNT A;  4QFN A;  3OO7 A;  1MDP 1;  4OYV A;  1F9B A;  1B3E A;  4WXJ A;  4KI0 E;  4H8I A;  3K2D A;  4POX A;  3G3H A;  2XX9 A;  4KQP A;  2Q88 A;  3S9M C;  4EXL A;  1RYX A;  3CFX A;  2XXY A;  3O28 A;  1FQF A;  2H99 A;  2UVG A;  3TUS A;  2A5T A;  4F3S A;  4IY6 A;  4OER A;  1JVY A;  2OCU A;  4PFW A;  1LST A;  4MLQ A;  2RCB A;  4RPN A;  1HSL A;  1MXZ A;  2GHB A;  2QL3 A;  2UVH A;  1EH3 A;  4G2Z A;  4LVQ A;  5JK4 A;  4YMA A;  3F11 A;  2I3W A;  3M3L A;  1MS7 A;  1DTG A;  4G68 A;  4OFL A;  3IJO B;  4LON B;  2GH9 A;  5ISU A;  1H45 A;  5KZT A;  4GL0 A;  3VVF A;  3IJX B;  1FW0 A;  2ZYN A;  3MP8 A;  4G8N A;  5I59 A;  1VFD A;  5DT6 A;  2V3Q A;  4H6D A;  4HCY A;  3TPA A;  1MM6 A;  3RY3 A;  4FJP A;  1Y3N A;  1P1Q A;  1D4N A;  4R6H A;  4NF5 B;  4R73 A;  5DVI A;  3W9V A;  2THI A;  1A8E A;  3A3C A;  1PEB A;  5H8F B;  4QSE A;  4YB5 A;  3KGC A;  2G29 A;  4ELP A;  3K02 A;  4NF5 A;  2UVJ A;  2ONK E;  1SD3 A;  4HW8 A;  4YIC A;  3N6T A;  1SI1 A;  2QPQ A;  4R2F A;  4R6K A;  1B5I A;  1KWH A;  4YKI A;  4ONY A;  4OEU A;  2Z8E A;  1MQJ A;  4ZEB A;  3K4U A;  3PMV A;  3MQ9 A;  2ZMB A;  5HPQ A;  4KPT A;  4Q0C A;  1JEV A;  3R7X A;  4FEC A;  1Y3P A;  3VLW A;  3KSX A;  4PET A;  4IO2 A;  2ONR A;  3C33 A;  2F35 A;  4GQO A;  1R6Z A;  1XHY A;  3IOT A;  3OO8 A;  3KJT A;  3FV2 A;  4GWO A;  5BWJ A;  4FAT A;  3VDF A;  4KCD A;  3FUZ A;  1B58 A;  3H4Z A;  1B5J A;  4OVJ A;  3IOU A;  1BIY A;  2XXQ A;  5I57 B;  3UGW A;  2GFE A;  2QMX A;  3W9W A;  2VHA A;  1Z7N E;  1VR5 A;  2DSF A;  4DCY A;  4RXL A;  5CRY A;  1ATG A;  4QF9 A;  5I2K A;  4KD5 A;  1B51 A;  1MXY A;  4P0G A;  3FVK A;  3LUY A;  4AB5 A;  4U21 A;  1B52 A;  1M5E A;  2XXW A;  5I57 A;  2XXH A;  4QSD A;  1LCT A;  1MY4 A;  4JWX A;  1AIV A;  1LB9 A;  1UIV A;  1MPB A;  1IQ7 A;  2RF1 A;  2X26 A;  5CM6 A;  4XKQ A;  3IB0 A;  1TXF A;  4LAT A;  5H8N B;  3FXQ A;  3MBP A;  3SEX A;  2H4I A;  4F1Y A;  1IEJ A;  3RT6 B;  1R9Q A;  2HQ0 A;  5EYF A;  2QS2 A;  1B3H A;  3MZB A;  3UN6 A;  5I58 B;  2DXR A;  4XKN A;  3V8X B;  3OOA A;  3U94 A;  5AA3 A;  1SVX B;  4JWY A;  3FGS A;  3FVN A;  5ITP A;  3KN8 A;  3RN8 A;  1H43 A;  1WDN A;  5I58 A;  4IB2 A;  5AA4 A;  1ZKB A;  4Q8R A;  1HSE A;  4F3B A;  4TOZ A;  3IB1 A;  1VSO A;  3LSX A;  3OEK A;  1MQH A;  2LAO A;  3SEV A;  1FTO A;  1SW2 A;  3FJM A;  3RTW B;  2F78 A;  3OEN A;  3OEL A;  3ILU B;  4F31 B;  4X9T A;  3UIF A;  1N7W A;  1JW5 A;  3VXC A;  1QJM A;  3OO6 A;  1MRP A;  1ZU0 A;  4DXC A;  2Y7R A;  2GRV A;  1FQD A;  4XKR A;  4X1D A;  1PDA A;  2DWI A;  2O51 A;  1NH8 A;  4HS7 A;  3I5O A;  1JET A;  3T9V A;  1XT8 A;  2I48 A;  3FD3 A;  2X7Q A;  3D4G A;  2IA4 A;  4LP2 B;  2F97 A;  1II5 A;  3TZA A;  1WOD A;  2O7U A;  4IO5 A;  3VFJ A;  1UIU A;  2NXO A;  2O84 X;  3U1O A;  3WAE A;  2I49 A;  4N6P A;  4GFR A;  3IL1 B;  2F34 A;  3HHF A;  1B1X A;  2P2A A;  3U93 A;  4ECF A;  3LBS A;  4KYE A;  2PT2 A;  3PPQ A;  4R6Y A;  3H06 B;  3G3J A;  1N0T A;  4LZ5 A;  4GF8 A;  1PBP A;  3HPI A;  1GR2 A;  1NNK A;  1LAX A;  1URG A;  1MY1 A;  1ZBM A;  4F22 A;  4U1O A;  2E1S A;  1MY0 A;  1JW4 A;  1H44 A;  5DYH A;  3GLB A;  4K3F A;  4YU0 A;  2AYS A;  2XXU A;  2RC9 A;  1TFD A;  4BDQ A;  1B4H A;  3P7I A;  4IY5 A;  3FZV A;  1M5C A;  2PBW A;  4F39 A;  3MZ1 A;  4BDO A;  4R9F A;  1MY3 A;  1ZIU A;  2H5Y A;  2V3U A;  3TEL A;  2B3B A;  3TYH A;  4KFQ A;  2ESN A;  1LFH A;  2UVI A;  3RQT A;  3K00 A;  4M1V A;  2HCA A;  1MH4 A;  3CRB A;  3IO6 A;  3MVZ A;  2Z23 A;  3TFL A;  4NE4 A;  1US4 A;  2YLN A;  1MXU A;  2KLF A;  1R1N A;  4GRK A;  4C0R A;  3O2A A;  4NWD A;  3TAJ A;  4F2Q A;  5FHO A;  5L9M A;  2RCA A;  1FTL A;  4AQ4 A;  2Y7K A;  3FAT A;  4XXU A;  3UK4 A;  2XX7 A;  3A09 A;  2PYY A;  5B70 A;  1N84 A;  4NF8 A;  5DEX B;  3S4U A;  4U2R A;  3THI A;  2NWJ A;  3KOS A;  4DXU A;  3N26 A;  3ZKL A;  2QRY A;  4TQU Q;  5H8Q B;  1DTZ A;  1P1O A;  4F1U A;  1LFI A;  3L6G A;  3OO9 A;  2RKM A;  3PUW E;  4U4S A;  4F1V A;  3T9X B;  3MVY A;  2FYI A;  1DOT A;  1OMP A;  3RT8 A;  3FV1 A;  4NWC A;  4DZ1 A;  3Q25 A;  4NF6 A;  1Q35 A;  3K1M A;  2W7Y A;  1DSN A;  3K1P A;  3OMB A;  1LAH E;  2IEE A;  4GL8 A;  3KFM A;  1EU8 A;  2XD3 A;  4EUO A;  3TDJ A;  2A5T B;  3G3K A;  3VLU A;  1N04 A;  4I9D A;  2B3F A;  4PE5 B;  3RLF E;  1YPN A;  3QUJ A;  3LSL A;  2R71 A;  1NL5 A;  2I6E A;  4G68 B;  2Y7I A;  1N7X A;  1Y1Z A;  4ZE8 A;  2DE3 A;  2H9B A;  1L5T A;  3PD9 A;  4IO7 A;  4QFL A;  4I1D A;  3SET A;  3KN3 A;  3HCQ A;  2QS3 A;  4H67 A;  4U1Z A;  5I59 B;  3A3U A;  1EZO A;  4JBZ A;  1IXC A;  1SW1 A;  1NNT A;  3G7W A;  1S7Y A;  2AIX A;  3O6I A;  4L17 A;  5TPA A;  1MPD A;  5F1Q A;  1T0K A;  1LBB A;  1B7Z A;  1MXW A;  1OIB A;  1MQI A;  3C35 A;  2F6G A;  4DDD A;  1XC1 A;  2VP1 A;  4ZZA A;  2Q2A A;  2AL4 A;  5H8H A;  3MZ9 A;  5EHS A;  3SES A;  3U72 A;  3DEL B;  1FQA A;  1O64 A;  3T9H B;  2A5S A;  1A7L A;  3MVX A;  2M8C A;  1MQD A;  1PB7 A;  1B3L A;  2Y84 A;  3H6T A;  3FJ7 A;  4C1T A;  2FNC A;  1Y1M A;  4MF3 A;  3MP1 A;  4GD5 A;  4OMB A;  2FA7 A;  3FVG A;  4ZS9 A;  3MP6 A;  2R9J A;  4E0X A;  2HZK A;  3SEW A;  5A5X B;  3G3G A;  3GXA A;  2VD2 A;  2REG A;  3VE1 B;  4FED A;  5DVF A;  1VE4 A;  4G4P A;  3FXU A;  4BDL A;  3M3F A;  3B6W A;  1JW1 A;  1A54 A;  5I2K B;  4X48 A;  2Q2C A;  3TMG A;  5A5X A;  2HAV A;  3DLN A;  1N3W A;  2ONS A;  3ODB A;  2XXP A;  1Y4T A;  5JTY B;  2ZXT A;  1LAF E;  2DWH A;  3N5L A;  5KCJ B;  2O6A A;  4NMY A;  4U22 A;  2YJP A;  2QS4 A;  1B3F A;  4IGT A;  1SQY A;  2D21 A;  3C36 A;  3CG3 A;  4GOT A;  1A40 A;  2UYE A;  1JQF A;  5JTY A;  4YAH X;  3QYT A;  3S9E A;  1QW0 A;  3PUX E;  5AA2 D;  5KCJ A;  3QUF A;  4XIG Q;  2Z22 A;  2XHD A;  3CFZ A;  4H5F A;  4G77 A;  4YB7 A;  5FHN A;  1AH5 A;  1A99 A;  4POW A;  1R9L A;  5K2Y A;  5L9S A;  2F8D A;  4JWO A;  5AA4 B;  4F2O A;  4YB6 A;  3I6V A;  1IUD A;  3IAZ A;  4O3A A;  3JZJ A;  3C9H A;  2DWJ A;  2R6G E;  3MW0 A;  2XXX A;  1B7U A;  4ZEC A;  5CMK A;  5I56 B;  3EHU A;  3QXM A;  3TCG A;  2CMO A;  3MAM A;  3CFL A;  3TTL A;  4Z7E A;  4JDF A;  3G3I A;  1IZ1 A;  2RIN A;  1SW4 A;  3PMW A;  3ZS6 A;  2PMS A;  3FJG A;  1XS5 A;  4ESX A;  1YTV A;  4DLD A;  5I2N A;  4G8H A;  2B65 A;  2ZYO A;  1IIT A;  2UXA A;  3ECR A;  5I56 A;  3HST A;  3LSW A;  2BJJ X;  2OK2 A;  3IO4 A;  3S9L C;  3KZG A;  4PFY A;  3R26 A;  1B5H A;  4R2B A;  4G68 C;  1NMU A;  4F3P A;  4H0W A;  1SBP A;  3FVO A;  2HAU A;  1LAG E;  2XXR A;  1QUK A;  3Q29 A;  2Q89 A;  1B05 A;  5CC2 A;  1B4Z A;  2DXY A;  1AOV A;  3EHT A;  2WKY A;  4TLM B;  4LZ8 A;  5KDT A;  1PC3 A;  4LQ5 A;  4NF4 A;  4JSO A;  3K1N A;  1FCK A;  5CMC A;  4EQ9 A;  4WKM A;  3CG1 A;  2I3V A;  1B0L A;  1ELJ A;  1A55 A;  1IIW A;  4MBP A;  3N94 A;  2RC8 A;  2XD2 A;  4WEP A;  4FOR A;  4H8J A;  1YCJ A;  4N13 A;  1MH3 A;  4JXI A;  5TP9 A;  3O29 A;  3DP6 A;  2OLB A;  4UAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...