4Z7EA

Soluble binding domain of lmo1422 abc-transporter
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
270
structure length
270
Chain Sequence
EITIAGKLGAEPEILINMYKLVIEDETDLKVNVKPNMGKTSFVFNALKSGDIDIYPEFTGTVLETFLKENAKTHDPEEVYTQARDGLAKDFDMTYLKPMKYNNTYALAVSPEFAKENNLEKISDLGPVSDQVKAGFTLEFKDRSDGYKGIQDKYGLTFSNLKTMEPKLRYNAIKSGDINLLDAYSTDSELAQYKLKVLEDDQQLFPPYQGAPLMLTKTLDKYPELKKPLNKLAGKITDDEMRKMNYEVNVNGKSAYTVAKDYLKDQGIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Lmo1422 protein
publication title Crystal Structure of the Substrate-Binding Domain from Listeria monocytogenes Bile-Resistance Determinant BilE
doi rcsb
source organism Listeria monocytogenes egd-e
total genus 98
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4z7eA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4z7eA02
1SYHA 4KCDA 3IO6A 5EHSA 2ZNUA 5B7DA 1B1HA 2I0CA 2XD3A 4N07A 5FTIA 2XXQA 4E0XA 4PE5B 1B58A 2QS1A 2HQ0A 5LOMA 1B1XA 3TAJA 5KCJB 5L9OA 5H8QA 1SVXB 4LQ5A 2ONKE 3IOUA 3SDFA 1XS5A 1R1NA 1VFEA 1FQDA 2X26A 4EF2A 4NMYA 4R9GA 3MWBA 1R6ZA 2D21A 4YICA 4EQ9A 3TQWA 3UORA 1OIBA 3HHGA 5H8NA 3OO6A 3KGCA 3K6XA 2Z23A 1MQJA 5AE4A 2YJPA 1M5DA 1QULA 3U8QA 2Y84A 3KOTA 3SEXA 4ZEFA 2A5SA 2XHDA 2OK2A 2G29A 3O6GA 5B70A 4AQ4A 1OVTA 3IB0A 5CBSA 3PUXE 1SYIA 1PB7A 2DS9A 4OERA 3GLBA 5M2VA 1JW1A 3SEYA 3K1PA 4NE4A 2GRVA 3PMXA 2V93A 5TP9A 1OVBA 2VD3A 3BKIB 1B7ZA 4LUBA 4DCXA 4GL8A 1LCFA 3T96B 1EH3A 4Z7EA 3RLFE 2F6PA 2X7QA 5IAIA 3RN8A 4KFQA 1LAHE 2DWIA 4Z0IA 2I4CA 1M5FA 2FA7A 5I2KA 4IO5A 4GWOA 1IEJA 4OEUA 4DDDA 3F11A 1OQHA 3ILTB 1B3FA 3I5OA 1LAGE 1SW4A 4DXUA 3TYHA 4QF9A 3MVWA 4DIGA 3FVGA 2QJEA 4LATA 3C9HA 4IGRA 5FHNA 1EZ9A 3IOVA 1B52A 5K2YA 5CM6A 4H8JA 4UA8A 2OBGA 1S9TA 4KYSA 4OMBA 3PD9A 3UGWA 2XXWA 4C0RA 3TTNA 2O68A 1N7XA 3H03A 3PU5A 4FORA 1MY4A 2CZLA 3C31A 1B46A 1MS7A 3H06B 1MM7A 1UIUA 1B3HA 3UP9A 4ELPA 3FATA 3JYRA 4H5FA 3K2DA 4JBZA 3CG1A 3EPEA 5HBCA 4EF1A 3SERA 2QMWA 3OD7A 3PPNA 1N3WA 4LA9A 3ILUB 3T93B 3TDJA 1WDNA 2F78A 1FQAA 2X7PA 4P0GA 1D9YA 1FTLA 4KYDA 1EZOA 4TLLB 1XVYA 2DVZA 4IO2A 1NKXA 2O6AA 2XXHA 1MY2A 4GXSB 4ONYA 3K0VA 4F1VA 1MXVA 5H8FA 3MBPA 2Q8JA 3OO9A 3MP6A 4I8CA 1YTVA 1NNKA 1YCJA 3HSTA 5DEXB 2ANJA 1B0LA 5DYHA 1GR2A 3FVNA 1QUJA 2DOJA 1SBPA 4PFUA 1HSJA 3MAMA 4LZ7A 4G4PA 3R26A 4H1XA 4U2RA 3H6TA 1QKBA 2M8CA 1A55A 3CRBA 1R9QA 4QFKA 1II5A 2Y7RA 2RCBA 1URSA 3UK4A 3G3HA 1LFHA 2HEUA 1NH7A 3IB1A 4FEDA 4BDOA 4XKNA 2XXRA 4Q0CA 3M3FA 2NWJA 1LLSA 2I6EA 4XKPA 3DP8A 3KFMA 1P1QA 4AB6A 5I57B 2OWTA 3TZAA 1LB9A 5KDTB 3G3GA 4RK9A 4F2QA 1H44A 1NFTA 5AA4B 4RY1A 3MZ1A 1B32A 3DP6A 4JWOA 3U92A 2PMSA 4OFLA 4U21A 2UVGA 2W7YA 3GBAA 4N6PA 4F39A 4R73A 3I3VA 3RTWB 1TWYA 1FCKA 4OVJA 4QSDA 4M1VA 5L8DA 3A09A 1SW1A 2ESNA 3OSQA 2DXYA 1POY1 4NF8B 3H4ZA 3OO8A 2R71A 4R72A 5TPAA 5CMKA 2GFEA 2OLBA 1MG1A 3D4GA 4XKRA 3D4CA 1RYOA 2P2AA 1LFIA 3VV5A 3MVXA 1MXXA 1B40A 4OTEA 1I6BA 3TELA 1CE2A 3VVDA 1QW0A 3IOWA 4ECFA 2QS4A 2XXIA 3KBRA 4R75A 3VFJA 1DTGA 3KSXA 1RYXA 2ZYNA 1ANFA 3PUZE 4YB5A 2B65A 4HW8A 1ZU0A 3GBBA 4F3PA 2I48A 3O97A 4RJZA 1D3KA 2I4BA 2F5XA 4U4SA 3Q29A 2ONSA 1PBPA 3ZS6A 1MQHA 5I2NB 3K6WA 1PEBA 1XT8A 2IEEA 2F35A 3PMWA 1MPBA 1AL3A 4R6HA 4U1ZA 3PPRA 2QPQA 3FJGA 3T9VA 2F34A 4PFTA 3EQ1A 3M3LA 4X1BA 3B6WA 1M5EA 5CRYA 1Y20A 2PT1A 2OJTA 4DLDA 3FJ7A 3IK6B 2H9BA 2IA4A 4XXUA 3OEMA 1UIVA 4ELRA 3LBSA 2RC8A 4OESA 3TUSA 4RXLA 4HCYA 5KDTA 1MXWA 2V3UA 3C32A 3U72A 4NF6A 3FXRA 4HTGA 1SDXA 1ZBMA 2GHBA 4GXAA 4JSOA 3Q26A 5ISUA 4C1TA 1JVYA 4H67A 3UIFA 3K1NA 3PUVE 1JNFA 4TQUQ 4YU0A 2Y7IA 3OELA 2XXUA 5I58B 3ONMA 1MY0A 4YKJA 4FEBA 4KCCA 3CI8A 3OXNA 1DPEA 1BKAA 2DE4A 2I49A 4PP0A 4GIZA 2O51A 3DELB 3VVFA 2GH9A 1N76A 3G3JA 4E0WA 2OWSA 1MXZA 3FV2A 2UYEA 4LZ5A 5AA2B 3OO7A 4NF5A 1B4HA 4G68C 1T0KA 3C4MA 4BLAA 3E13X 4I62A 1PBQA 5H8HB 4WKMA 3A3UA 4G8NA 2D3IA 3IJOB 4RNSA 3JV9A 4NWDA 4F1UA 4FAJA 1AMFA 3IR1A 3FASA 2HAVA 1VFDA 4F3SA 4OXVA 3K02A 5BUUA 4O3CA 3K01A 3M3KA 1TT1A 2HAUA 4U1OA 4OETA 3N94A 3KN8A 2HFBA 4XKQA 1JVXA 3O6IA 1LSTA 3MQ9A 4ZEKA 2DWHA 1P1NA 4IY5A 4ZZEA 1R9LA 4BDRA 3CR9A 2UVJA 2UYFA 1PC3A 2XD2A 1A54A 5I56B 2Y7WA 4GFRA 4YMBA 3IO4A 5AA3A 3RNNA 3W15C 2XX8A 4GOTA 3TTRA 3THIA 1UQWA 1XOCA 2A5TB 5HM4B 4OYVA 3TODA 1B5JA 3MC2A 2RINA 2Z8EA 4ZEIA 5BWJA 3WAEA 1O64A 2QRYA 4IO7A 3TCFA 4ND9A 1B9JA 4BDNA 1B3LA 3RQTA 2BJJX 2WKYA 1UTHA 1NNPA 1Y3QA 4LQ2A 5JTYA 2I0BA 2ZNSA 1Z7ME 3VXCA 4QRZA 1IXIA 3QAXA 2CMOA 1I6AA 4QSCA 3FD3A 1VE4A 1JQFA 3EN3A 3L6GA 1PB9A 2O7UA 4EDPA 3B7DA 5L9SA 2XXPA 3E4RA 1Z7NE 1A8EA 5ICQA 4ESXA 2V3QA 3MZ9A 2NXOA 1OMPA 4OENA 2F6GA 5KCJA 3HCQA 4EQ7A 5F1QA 2B3BA 2DP8A 4OWDA 1P1WA 5AA2A 1SI1A 2YLNA 3FV1A 1OQGA 1URGA 1IIWA 4U22A 3RTFB 4WXJA 1N84A 1MXUA 2NUVA 3E3KA 1URDA 4LONB 4ZZAA 1POTA 1IUDA 4NWCA 3CSBA 1GV8A 3TMGA 2F8DA 3T9UA 4F3GA 3GXAA 1MPCA 2O1LA 1ZLQA 3S9NC 2H5YA 3LC8A 4TLMB 3S9LC 3PPOA 1HSEA 3T66A 4KPTA 4F19A 1M5CA 4OQOA 1B3GA 4JSDA 3KSJA 1A40A 2RC7A 1SI0A 4U23A 2QSXA 4Q8RA 3SEUA 3TEPA 2V3TA 1D9VA 3KJ7A 1TFDA 1UTBB 3EHSA 4EXKA 4JDFA 1DOTA 2XX9A 1YPNA 2DYXA 1GGGA 2A5TA 2ALUA 2O84X 2I3WA 1FQEA 4NF4B 3UA8A 3PV0E 5I59B 3K1MA 2HZKA 4P0IA 1RKMA 3SEVA 3SKPA 4GF8A 3G3IA 1IQ7A 4LP2B 1MY1A 2Z8FA 1NH8A 3G3KA 3PUYE 1P1UA 4ZEDA 1MDQA 1O7TA 3K4UA 4RPOA 4F31B 3KN7A 3O29A 4DZ1A 3KZGA 1LBBA 4GL0A 5A5XB 1TXFA 4QFOA 4BDQA 2KLFA 5I84A 2F7AA 3CVGA 3IORA 1N7WA 4IO4A 3USDA 1FTKA 4UACA 2LAOA 4XTCQ 4F3BA 4R9FA 3V89B 1VR5A 5IKBA 3QSLA 2ZYKA 4G68B 4U4XA 3SESA 4R74A 2NOOA 4K3FA 3RT6B 3T22A 1B05A 5CMBA 2V84A 2F7BA 3FUZA 3RUMA 3PD8A 5HPQA 1LB8A 1NMUA 4R2FA 4HCWA 3QK6A 5JK4A 5H8QB 4NEDA 3HO7A 4XIGQ 1LAFE 2XX7A 1KWHA 4EXLA 1CB6A 4OFOA 4F18A 3R7XA 4YMAA 4KR5A 3EF7A 2REJA 1LCTA 4HS7A 4BDLA 1SW2A 4PFYA 5H8NB 5DEXA 4YB6A 1Y4CA 2F7CA 3HHFA 1LBCA 3IJXB 4RK2A 3BFTA 1J1NA 1DMBA 3EHTA 4I9DA 3IL1B 3DLNA 4QFNA 4EUOA 1MQGA 4ZEBA 3OMBA 1B51A 1EU8A 3Q25A 1FQFA 3FJMA 1M5BA 3MVYA 2F97A 4R6YA 2AL5A 4NF4A 1IXHA 3FIRA 5I59A 2RKMA 1XVXA 1JEUA 2Y7PA 4GVOA 4POXA 3S9MC 2THIA 3G7WA 1B2HA 3MJNA 3MUQA 4ELOA 3H7MA 2RCAA 3TTKA 1XHYA 5TP9B 4YKIA 3CFXA 4H0WA 3T9XB 1WVJA 3H6WA 1S7YA 5I57A 1OLAA 4GQOA 1MXYA 3G3FA 4EQBA 4H8IA 3PMVA 4YB7A 5AA4A 1A7LA 3MPLA 4THIA 1H3DA 2ZYOA 3S4UA 1N3XA 3CFZA 5I2KB 3T9HB 5F7VA 3C34A 2DVCA 3MP8A 2HXWA 1B4ZA 4GRKA 3PGFA 4JB7A 4LZ8A 3JZJA 3H6UA 3KJTA 3V8XB 2V25A 2PT2A 4IY6A 2DE2A 5JEIA 3KG2A 1NL5A 4YKPA 4NF8A 4IGTA 2P0SA 1F9BA 3TCGA 4ZE8A 5ITOA 2VOZA 2PVUA 4FJPA 4RYAA 2XXTA 3IX1A 4ISUA 3MVZA 3B6TA 2ZNTA 1QUKA 4G8HA 3TTLA 1B3EA 4MH5A 1FTMA 1FTJA 2DE3A 3K6UA 1WODA 2XXVA 1SW5A 3RY3A 3FVKA 3Q28A 2F36A 3C33A 1LFGA 2AIXA 1MDP1 3CFLA 3LUYA 1JW5A 1Y1MA 1IXGA 4G2ZA 4RPNA 3IAZA 3MPKA 4DE8A 3TFLA 1DSNA 3RPWA 3LR1A 1MRPA 3TCHA 3FXQA 4PETA 5I2NA 4O3BA 3L6HA 1GVCA 4MLQA 5H8FB 3KOSA 1QJMA 3VVEA 3KEIA 4OHNA 2PX1A 1LGBC 2FNCA 4POWA 1ZJLA 3VLVA 1BP5A 1DTZA 5K2XA 2Y7KA 1O63A 2DWAA 2DWJA 3CG3A 5DVIA 2OCUA 1HSLA 3S9EA 1B5IA 4WEDA 4QFPA 5FHMA 4Q30B 1QKAA 3H3GA 1S50A 4X1DA 1Y1ZA 5AA2D 3HV1A 2AYSA 1ZMGA 3PUWE 4F22A 3K6VA 2XXYA 3ZKLA 1D4NA 2PYYA 3VLUA 3QUJA 3QUFA 3QXMA 4GLIA 3O6HA 1ZKBA 3V5AA 3O2AA 3TTMA 4BDMA 3C35A 1Y3PA 2H25A 1PB8A 5I58A 1LAXA 1H45A 1B0HA 4F29A 1L5TA 3IOTA 3O28A 4LVQA 5EHMA 5TU0A 3U93A 4H5GA 4WEPA 1B7UA 3IB2A 4F2OA 1Q1KA 4H65A 4FE8A 2VHAA 4MFIA 4Q5TA 1MH4A 1Y3NA 1P99A 1B7HA 4JWYA 4RA1A 1US4A 4NTLA 4R6KA 3HN0A 4KHZE 3S2VA 3BFUA 1N0TA 5H8HA 1GTKA 1ATGA 4ZS9A 2UVIA 3RGYA 3VDFA 3WAFA 1JETA 4O3AA 2RC9A 3QYTA 2ONRA 4YAHX 3PPPA 2QS3A 3O66A 4JXIA 3GZGA 2DSFA 4IO6A 3Q27A 2FYIA 5TPAB 5FTHA 1AIVA 4P11A 3E9XA 2HCAA 3K00A 4N13A 3RT8A 1I6QA 1USYH 2ZMBA 5EYFA 2XXXA 3N6UA 4ESWA 1MPDA 3MP1A 3HPIA 4OEVA 2NVUB 1BIYA 1IITA 1USYE 5I56A 1ZTYA 4C1UA 2G93A 1SD3A 5DT6A 5DVFA 5ICTA 1MQIA 3A3CA 4GD5A 4X9TA 5KZTA 1FQBA 2REGA 2E1SA 1SQYA 2O7IA 3SEWA 4FIMA 2QMXA 2Q88A 2PBWA 1US5A 1JW4A 1VSOA 3PPQA 2ZXTA 4X48A 2VGQA 3B6QA 4G77A 3C36A 3LSWA 4R2BA 4G8MA 3ZSFA 2R6GE 2Z8DA 5CMMA 2Q2AA 3LSLA 1MM6A 1MY3A 2QS2A 3AXFA 4L17A 3TQLA 2H98A 3BBRA 4KQPA 1PDAA 4QFLA 3KN3A 2OZZA 4MF3A 3N6TA 4PQJA 5H8SA 1BTJA 1FQCA 2DQVA 1A99A 4QHQA 3CIJA 3P7IA 3ODBA 2O69A 3W9VA 4NF6B 4OFJA 3EHUA 4MBPA 3QIMA 3DM0A 1AOVA 3FXUA 4DXCA 4OZ9A 5ITPA 3FZVA 3U94A 2QL3A 3LSFB 4KI0E 1TFAA 3I6VA 1ELJA 3H6VA 3OOAA 3OENA 2ABHA 3M8UA 2GHAA 1QUIA 3TPAA 4QSEA 5L9MA 1FW0A 2I3VA 1I69A 1YAEA 2Q2CA 4ZE9A 3VE1B 3U1OA 1QVSA 4NF5B 5DVJA 4IB2A 2H99A 1OLCA 4KD5A 4TOZA 3ECRA 2RF1A 2P1SA 3SETA 5CI5A 4PFWA 2Q9TA 3CSGA 1MH3A 1A8FA 4AB5A 5AA1A 1MQDA 1JEVA 4ELQA 1NNFA 2B3FA 4F1YA 3LSXA 1DPPA 3FGSA 2Q89A 1UTBA 2UXAA 4KYEA 3DP4A 1NNTA 4MLVA 4ZECA 2E0SA 3MW0A 3R6UA 4YKKA 2O1MA 2Z22A 1H76A 1AH5A 5CMCA 4ZDMA 3MZBA 3VLWA 4H6DA 1ZIUA 1EZPA 1Y9UA 3OSRA 4DXBA 2YPNA 1FTOA 1XC1A 2VP1A 1IZ1A 2UVHA 5CC2A 1IXCA 2D5WA 4FECA 4DCYA 3N5LA 5ELVA 1Y4TA 2R9JA 4I1DA 3FVOA 3V83A 1P1OA 5J1DA 5A5XA 2DXRA 3N26A 5FHOA 3O9PA 4YZZA 3W9WA 3TKDA 4FATA 2H4IA 2VD2A 4M4GA 3OEKA 1UTHB 3VXBA 4JWXA 5JTYB 3ZKKA 1H43A 2I58A 2AL4A 1BLFA 2ZYMA 1Q35A 4G68A 1N04A 1B5HA 5DTBA 4IO3A 1B6HA 2HZLA 5CBRA 3UN6A
chains in the Genus database with same CATH superfamily
1SYHA 3ISPA 4KCDA 3IO6A 5EHSA 2ZNUA 5B7DA 1B1HA 2I0CA 2XD3A 4N07A 5FTIA 2XXQA 4E0XA 4PE5B 1B58A 2QS1A 2HQ0A 5LOMA 1B1XA 3TAJA 5KCJB 5L9OA 5H8QA 1FPKA 1FBDA 1SVXB 4LQ5A 2ONKE 3IOUA 3SDFA 1XS5A 1R1NA 1VFEA 1FQDA 2X26A 4EF2A 4NMYA 4R9GA 3MWBA 1R6ZA 2D21A 4YICA 4EQ9A 3TQWA 3UORA 1OIBA 3HHGA 5H8NA 3OO6A 3KGCA 3K6XA 2Z23A 4PDDA 1MQJA 5AE4A 2YJPA 1M5DA 2P3VA 4GWWA 3B50A 1QULA 4N81A 3U8QA 2Y84A 3KOTA 3SEXA 4ZEFA 2A5SA 2XHDA 2OK2A 2G29A 3O6GA 5B70A 1NUWA 4AQ4A 1OVTA 3PTYA 3IB0A 4NF0A 5CBSA 3PUXE 1SYIA 1PB7A 2DS9A 4OERA 2QVUA 3GLBA 5M2VA 1JW1A 1FPBA 3SEYA 4MNCA 3K1PA 4NE4A 2GRVA 1IMFA 3PMXA 2V93A 5TP9A 1OVBA 2VD3A 3BKIB 3E79A 1B7ZA 4LUBA 4DCXA 4GL8A 1LCFA 3T96B 1EH3A 4Z7EA 4MIJA 3RLFE 2F6PA 2X7QA 5IAIA 4PF8A 3RN8A 4KFQA 4P3LA 1LAHE 2DWIA 4Z0IA 2I4CA 1M5FA 2FA7A 5I2KA 4IO5A 4GWOA 1IEJA 4OEUA 4DDDA 3F11A 1OQHA 3ILTB 1NV2A 1B3FA 3I5OA 1G0HA 1LAGE 1SW4A 4DXUA 3TYHA 4QF9A 3MVWA 4DIGA 3FVGA 2QJEA 3FBPA 4LATA 3C9HA 4IGRA 5FHNA 1EZ9A 3IOVA 4I3YA 1B52A 5K2YA 5CM6A 4H8JA 4UA8A 2OBGA 1S9TA 4KYSA 4OMBA 3PD9A 3UGWA 1SPIA 2XXWA 4C0RA 5FBPA 3TTNA 2O68A 1N7XA 3H03A 2L5VA 3PU5A 4FORA 1MY4A 4OVSA 2CZLA 3C31A 1B46A 1MS7A 3H06B 5IM2A 1MM7A 1UIUA 1LBXA 1B3HA 3UP9A 3LUZA 4ELPA 3FATA 3JYRA 4H5FA 3K2DA 4JBZA 1KZ8A 3CG1A 3EPEA 4N91A 5HBCA 4EF1A 3SERA 2QMWA 2XWOA 3OD7A 3PPNA 1N3WA 4LA9A 3ILUB 4X8RA 4GWSA 3T93B 3TDJA 1WDNA 2F78A 1FQAA 2X7PA 4P0GA 1D9YA 1FTLA 4KYDA 1EZOA 4N15A 2FBPA 4TLLB 1XVYA 2DVZA 4IO2A 1NKXA 2O6AA 2XXHA 1MY2A 4GXSB 4ONYA 3K0VA 4F1VA 1MXVA 5H8FA 1FBEA 3MBPA 2Q8JA 3OO9A 3MP6A 4I8CA 1YTVA 1NNKA 1YCJA 3HSTA 5DEXB 2ANJA 1B0LA 3B8BA 5DYHA 1GR2A 3FVNA 1QUJA 4PGPA 5I7IA 2DOJA 1SBPA 4PFUA 1HSJA 3MAMA 4LZ7A 4G4PA 3R26A 4H1XA 4U2RA 3H6TA 1QKBA 2M8CA 3IFCA 1A55A 3CRBA 1R9QA 4QFKA 1IMAA 1II5A 2Y7RA 2RCBA 1URSA 3UK4A 1NV5A 3G3HA 1LFHA 2HEUA 1NH7A 3IB1A 4FEDA 4BDOA 4XKNA 2XXRA 4Q0CA 3M3FA 2NWJA 1LLSA 2I6EA 4XKPA 3DP8A 3KFMA 1P1QA 4AB6A 5I57B 2OWTA 1NV7A 3TZAA 1LB9A 5KDTB 3G3GA 4RK9A 4F2QA 1H44A 1NFTA 5AA4B 4RY1A 3MZ1A 1B32A 5EQAA 1VDWA 2MKZA 4PBHA 3DP6A 4JWOA 4OVQA 3U92A 2PMSA 4OFLA 4JVIA 4U21A 2UVGA 2W7YA 3GBAA 4N6PA 4F39A 4R73A 3I3VA 3RTWB 4PFIA 1TWYA 1FCKA 4OVJA 4QSDA 4PAFA 4M1VA 5L8DA 3A09A 1SW1A 2ESNA 2OX3A 3OSQA 2DXYA 1POY1 5EYHA 4NF8B 1DCUA 3H4ZA 3OO8A 2R71A 4R72A 5TPAA 5CMKA 4PC9A 2GFEA 2OLBA 4O7MA 1MG1A 4PFBA 3D4GA 4XKRA 3D4CA 1RYOA 2P2AA 1FPIA 3RPLA 1LFIA 3VV5A 3MVXA 4UABA 1MXXA 1B40A 4OTEA 1I6BA 3TELA 1CE2A 4N8GA 3VVDA 1QW0A 3IOWA 4ECFA 2QS4A 2XXIA 3KBRA 4R75A 3VFJA 1DK4A 1DTGA 4AS5A 4I40A 3KSXA 1RYXA 5LDZA 2ZYNA 1ANFA 1FRPA 3PUZE 4YB5A 2B65A 4PF6A 4HW8A 1ZU0A 3GBBA 4F3PA 2I48A 3O97A 4RJZA 1D3KA 2I4BA 2F5XA 1FPLA 4U4SA 1BK4A 3Q29A 2ONSA 1PBPA 1RDZA 3ZS6A 1MQHA 5I2NB 3K6WA 3KC1A 1FBPA 1PEBA 1XT8A 3ROJA 2IEEA 2F35A 4PGNA 3PMWA 1MPBA 1AL3A 4R6HA 4U1ZA 3PPRA 2QPQA 3FJGA 5F24A 3T9VA 2F34A 3QMFA 4PFTA 3EQ1A 3M3LA 5LTCA 4X1BA 1FPJA 3B6WA 1M5EA 5CRYA 1Y20A 2PT1A 2QVRA 2OJTA 1FSAA 4DLDA 3FJ7A 3IK6B 2H9BA 2IA4A 4XXUA 3OEMA 1UIVA 4ELRA 3LBSA 2RC8A 4OESA 5EYGA 3TUSA 4RXLA 1NUXA 4HCYA 5KDTA 1MXWA 2V3UA 1INPA 3C32A 3U72A 4NF6A 1NV1A 3FXRA 4HTGA 1SDXA 1ZBMA 2GHBA 4GXAA 4JSOA 3Q26A 5ISUA 4C1TA 1JVYA 4H67A 3UIFA 3K1NA 3PUVE 5IZZA 1JNFA 4TQUQ 4YU0A 2Y7IA 3OELA 2XXUA 5I58B 1IMDA 3ONMA 1MY0A 4YKJA 4FEBA 4KCCA 3CI8A 3OXNA 1DPEA 5ESYA 1BKAA 2DE4A 2I49A 4PP0A 4GIZA 2O51A 3DELB 3VVFA 2GH9A 1N76A 3G3JA 4E0WA 2OWSA 1MXZA 3FV2A 2UYEA 4LZ5A 5AA2B 3OO7A 4NF5A 1B4HA 4G68C 4DI4B 1T0KA 3C4MA 4MNPA 4BLAA 3E13X 4I62A 1LBZA 1PBQA 5H8HB 4NHBA 4QXDA 4WKMA 3A3UA 4G8NA 2D3IA 3IJOB 4RNSA 4DI3D 3JV9A 4NWDA 4GX3A 4F1UA 4FAJA 1AMFA 3IR1A 4GX4A 3FASA 2HAVA 1VFDA 1RDXA 4F3SA 4OXVA 3K02A 5BUUA 4O3CA 3K01A 3M3KA 1TT1A 2HAUA 3D1RA 4U1OA 4OETA 3N94A 3KN8A 2HFBA 4XKQA 1JVXA 3O6IA 1LSTA 3MQ9A 4ZEKA 2DWHA 1P1NA 4IY5A 4OVTA 4ZZEA 1R9LA 2BJIA 4P9KA 4N6KA 4BDRA 3CR9A 2UVJA 2UYFA 1PC3A 2XD2A 1A54A 3SZPA 5I56B 2Y7WA 4GFRA 4YMBA 3IO4A 5AA3A 3RNNA 3W15C 2XX8A 4GOTA 3TTRA 3THIA 1UQWA 1XOCA 2A5TB 5HM4B 4OYVA 3TODA 1B5JA 3MC2A 2RINA 2Z8EA 4ZEIA 5BWJA 3WAEA 2CZIA 4FBPA 1O64A 2QRYA 4IO7A 3TCFA 4PTKA 4ND9A 1B9JA 4BDNA 1B3LA 3RQTA 2BJJX 2WKYA 1UTHA 1NNPA 4LQ2A 1Y3QA 5JTYA 2I0BA 4P1EA 2ZNSA 1Z7ME 4GWUA 3VXCA 4QRZA 1IXIA 3QAXA 2CMOA 1YXIA 2XWKA 1I6AA 4QSCA 3FD3A 1VE4A 1JQFA 3EN3A 3L6GA 1PB9A 1LBVA 2O7UA 3T1BA 1KA1A 4EDPA 1IMCA 3B7DA 5L9SA 2XXPA 3E4RA 1K9ZA 2VPNA 1Z7NE 1A8EA 5ICQA 2V3QA 4ESXA 3RYDA 3MZ9A 2NXOA 1OMPA 4OENA 2F6GA 5KCJA 1NUZA 4HE2A 3HCQA 4EQ7A 5F1QA 5EQ8A 2HXRA 2B3BA 2DP8A 4OWDA 4NGUA 1P1WA 5AA2A 1SI1A 2YLNA 3FV1A 2WYKA 1YZ0A 1OQGA 2FHYA 1URGA 1IIWA 4U22A 3RTFB 4WXJA 1N84A 1MXUA 2NUVA 3E3KA 1URDA 4LONB 4ZZAA 1POTA 1IUDA 4NWCA 3CSBA 1GV8A 1KA0A 3TMGA 2F8DA 3T9UA 4F3GA 3GXAA 1FJ6A 1MPCA 5ET7A 1NUYA 4OVPA 2O1LA 1K9YA 1ZLQA 3S9NC 2H5YA 3LC8A 4TLMB 3S9LC 3PPOA 1HSEA 3T66A 4KPTA 2V4CA 4JVDA 4F19A 1AWBA 1M5CA 4OQOA 1B3GA 4JSDA 3KSJA 1A40A 2RC7A 1SI0A 4U23A 2QSXA 4Q8RA 3SEUA 3TEPA 4OANA 1FPEA 2V3TA 1D9VA 3KJ7A 1TFDA 2F3DA 2KQZA 4JVCA 2R8TA 1UTBB 3EHSA 2PCRA 4EXKA 4JDFA 4NG7A 1DOTA 2XX9A 1YPNA 2DYXA 1GGGA 2A5TA 2ALUA 2O84X 2I3WA 1FQEA 4NF4B 3UA8A 3PV0E 5I59B 3K1MA 2HZKA 2VT5A 4P0IA 1RKMA 3SEVA 3SKPA 1IMEA 1FPDA 4GF8A 3G3IA 5T3JA 1IQ7A 4LP2B 2XXKA 1MY1A 4PDHA 2Z8FA 1NH8A 3G3KA 3PUYE 1P1UA 4ZEDA 1MDQA 1O7TA 3K4UA 4NN3A 4RPOA 4F31B 5IZ3B 3KN7A 3O29A 1IMBA 4DZ1A 4MJOA 1NI9A 3KZGA 1LBBA 4GL0A 5A5XB 4QBAA 1TXFA 4QFOA 4BDQA 2KLFA 5I84A 2F7AA 3T0JA 3BIHA 3MSTA 3CVGA 3IORA 4HE0A 1N7WA 4IO4A 3USDA 1FTKA 4UACA 3LV0A 4NAPA 2LAOA 4XTCQ 4F3BA 4R9FA 3V89B 1VR5A 4OVRA 5IKBA 3FXBA 3QSLA 1EYJA 2ZYKA 4G68B 4U4XA 1FBGA 1FPFA 3SESA 4R74A 2NOOA 4K3FA 3RT6B 3T22A 1B05A 5CMBA 2V84A 4N4UA 4I3EA 5IZ1A 1YYZA 4MEVA 2F7BA 3FUZA 3RUMA 2B4LA 3HFUA 3PD8A 5HPQA 1LB8A 1NMUA 4OA4A 4R2FA 4HCWA 3QK6A 5JK4A 2XWVA 5H8QB 4NEDA 3HO7A 4XIGQ 1LAFE 2XX7A 1KWHA 4EXLA 1CB6A 4OFOA 1EYIA 4O8MA 4F18A 3R7XA 4YMAA 1XI6A 4KR5A 2CEXA 3EF7A 2REJA 1LCTA 4HS7A 4BDLA 1SW2A 4PFYA 5H8NB 5DEXA 4YB6A 1Y4CA 2F7CA 3HHFA 1LBCA 3IJXB 4RK2A 2CEYA 3BFTA 1J1NA 1CNQA 1DMBA 3EHTA 4I9DA 4PBQA 3IL1B 3DLNA 4QFNA 4EUOA 1MQGA 4ZEBA 2FVZA 5ET5A 3OMBA 1B51A 1EU8A 3Q25A 2WX9A 1FQFA 3FJMA 1M5BA 3MVYA 2F97A 4R6YA 2AL5A 4NF4A 1IXHA 3FIRA 5I59A 2RKMA 1XVXA 1JEUA 2Y7PA 4GVOA 4POXA 3S9MC 2THIA 3G7WA 2OWZA 1B2HA 3MJNA 2Y5LA 3MUQA 4ELOA 3H7MA 2RCAA 3TTKA 5J16A 1XHYA 2XWIA 5TP9B 2FIXA 4YKIA 3CFXA 4H0WA 3T9XB 1WVJA 3H6WA 3MYUA 1S7YA 2HPGA 5I57A 1LEVA 1OLAA 4GQOA 2GQ1A 2PFZA 2JJKA 4XEQA 2HHMA 1MXYA 3G3FA 4EQBA 5I5PA 4H8IA 4N8YA 3NOHA 3PMVA 4YB7A 5AA4A 1A7LA 5A5LA 3MPLA 4THIA 1H3DA 2ZYOA 3S4UA 1N3XA 3CFZA 1DBZA 5I2KB 3T9HB 5F7VA 3C34A 2DVCA 5IGAA 1NV3A 2CZKA 3MP8A 2HXWA 1B4ZA 4GRKA 1FBCA 2P3NA 3PGFA 4JB7A 4LZ8A 3JZJA 3H6UA 3KJTA 4MCOA 2V25A 2PT2A 4IY6A 3V8XB 2DE2A 5JEIA 2B4MA 3KG2A 1NL5A 4YKPA 4NF8A 4IGTA 4PAKA 5ET6A 2ZZVA 2P0SA 1F9BA 3TCGA 5DW8A 4ZE8A 5ITOA 2VOZA 2PVUA 4FJPA 4RYAA 2XXTA 3IX1A 4HE1A 4ISUA 3MVZA 3B6TA 2ZNTA 1QUKA 4G8HA 3TTLA 1B3EA 4MH5A 1FTMA 1FTJA 2DE3A 3K6UA 2CZHA 1WODA 2XXVA 1SW5A 3RY3A 3FVKA 3Q28A 4NX1A 2F36A 3C33A 1LFGA 2AIXA 1MDP1 3CFLA 3LUYA 1JW5A 1Y1MA 4GWXA 1IXGA 4G2ZA 4RPNA 3IAZA 3MPKA 4DE8A 3TFLA 1DSNA 3RPWA 3LR1A 1MRPA 3TCHA 1LBWA 3FXQA 4PETA 5I2NA 4O3BA 1Q9DA 3L6HA 1GVCA 4MLQA 4GWZA 3KOSA 1QJMA 5H8FB 3VVEA 3KEIA 4OHNA 2XA5A 2PX1A 1LGBC 2FNCA 4XF5A 4POWA 1LBYA 1ZJLA 3VLVA 1BP5A 4P1LA 1DTZA 5K2XA 2Y7KA 1O63A 2DWAA 2DWJA 3CG3A 5DVIA 2OCUA 1HSLA 3S9EA 1B5IA 4WEDA 4QFPA 1FJ9A 5FHMA 4Q30B 4MAGA 4MMPA 1QKAA 3H3GA 1RDYA 1S50A 4X1DA 1Y1ZA 5AA2D 3HV1A 2AYSA 1ZMGA 4IR8A 3PUWE 4F22A 3K6VA 2XXYA 3ZKLA 1D4NA 4N6DA 2PYYA 3VLUA 3QUJA 3QUFA 3QXMA 4GLIA 3O6HA 1ZKBA 3V5AA 3O2AA 3TTMA 4BDMA 3C35A 1Y3PA 2H25A 1PB8A 5I58A 1LAXA 1H45A 1B0HA 4P8BA 2WEFA 4F29A 1L5TA 4PFRA 3IOTA 3O28A 4LVQA 5EHMA 2ZZWA 5TU0A 3U93A 4H5GA 4WEPA 1B7UA 4O94A 3IB2A 4F2OA 4MX6A 1Q1KA 4H65A 4FE8A 2VHAA 4MFIA 4Q5TA 1MH4A 1Y3NA 1P99A 1B7HA 4JWYA 4RA1A 1US4A 4NTLA 4R6KA 1D9QA 3HN0A 4KHZE 4H46A 3S2VA 3BFUA 1N0TA 5H8HA 1GTKA 1ATGA 4ZS9A 4P56A 2UVIA 3RGYA 3VDFA 4AS4A 3WAFA 1JETA 4O3AA 2RC9A 3QYTA 2ONRA 4YAHX 3PPPA 2QS3A 4GBVA 3O66A 4JXIA 2WYPA 3GZGA 2DSFA 4PAIA 2ZZXA 4IO6A 3Q27A 2FYIA 5TPAB 5FTHA 1AIVA 4P11A 3E9XA 2HCAA 1FBHA 2FIEA 3K00A 4N13A 3RT8A 1I6QA 1USYH 2ZMBA 5EYFA 2XXXA 3N6UA 4ESWA 3RPLB 5ET8A 1MPDA 4GX6A 3MP1A 3HPIA 4OEVA 2NVUB 2WBBA 1BIYA 1IITA 1USYE 2WBDA 5I56A 5EQ9A 1ZTYA 4C1UA 3KC0A 2G93A 1SD3A 5DT6A 5DVFA 5ICTA 1MQIA 3A3CA 4GD5A 4X9TA 5KZTA 1FQBA 3CHGA 4MNIA 1FBFA 2REGA 2E1SA 1SQYA 2O7IA 3SEWA 4FIMA 2QMXA 1FTAA 2Q88A 2PBWA 1US5A 1JW4A 1VSOA 3PPQA 2ZXTA 2VGQA 4X48A 3B6QA 4G77A 3C36A 3LSWA 4R2BA 4G8MA 3ZSFA 2R6GE 2Z8DA 4O7IA 5CMMA 4XFEA 2Q2AA 4KXPA 3LSLA 1MM6A 1MY3A 2QS2A 3AXFA 4L17A 3TQLA 2H98A 3BBRA 4KQPA 1PDAA 4QFLA 2Y5KA 3KN3A 1FPGA 1NV6A 2OZZA 4MF3A 1G0IA 3N6TA 4PQJA 5H8SA 1BTJA 1JP4A 1FQCA 2DQVA 1A99A 4QHQA 3CIJA 3P7IA 3ODBA 4P47A 4GWYA 2O69A 2KR0A 3W9VA 4NF6B 4OFJA 3EHUA 4MBPA 3QIMA 3DM0A 1AOVA 4X04A 3FXUA 4DXCA 4OZ9A 5ITPA 3FZVA 3U94A 2QL3A 3LSFB 4KI0E 1TFAA 3I6VA 1ELJA 3H6VA 3OOAA 3OENA 2ABHA 4G61A 3M8UA 2GHAA 1QUIA 3TPAA 4QSEA 1NV4A 5L9MA 1FW0A 2I3VA 1I69A 4GBWA 1YAEA 2Q2CA 4NQ8A 4ZE9A 3VE1B 3U1OA 2QFLA 1QVSA 4NF5B 5DVJA 4IB2A 2H99A 1OLCA 4KD5A 4TOZA 2QVVA 2F3BA 3ECRA 2RF1A 2P1SA 3SETA 5CI5A 4PFWA 2Q9TA 3CSGA 1MH3A 1A8FA 4AB5A 5AA1A 1MQDA 1JEVA 4ELQA 1NNFA 5I3SA 2B3FA 4F1YA 3LSXA 1DPPA 3FGSA 4LN5A 3E78A 2Q89A 2VPOA 3BIGA 4HXVA 3GYYA 1UTBA 2UXAA 4KYEA 3DP4A 1NNTA 4MLVA 4ZECA 2E0SA 3MW0A 3R6UA 4YKKA 2O1MA 2Z22A 1H76A 1AH5A 3A29A 5EQ7A 5CMCA 4PCDA 4ZDMA 3MZBA 3VLWA 4H6DA 3KBZA 1ZIUA 3U65A 1EZPA 1Y9UA 3OSRA 4DXBA 2YPNA 1FTOA 1XC1A 2VP1A 1IZ1A 2UVHA 5CC2A 1IXCA 2D5WA 4FECA 4DCYA 3N5LA 5ELVA 3EKIA 1Y4TA 2R9JA 2Q8MA 5IZ3A 4I1DA 3FVOA 4MHFA 2Q74A 3V83A 1P1OA 5J1DA 5A5XA 2DXRA 3IFAA 3N26A 4N17A 5FHOA 2PFYA 3O9PA 4YZZA 4H45A 3W9WA 1QGXA 3TKDA 4FATA 2H4IA 1EYKA 2VD2A 4M4GA 3OEKA 1UTHB 3VXBA 4JWXA 5JTYB 1NV0A 3ZKKA 1H43A 2I58A 2DDKA 2AL4A 1BLFA 2ZYMA 4PE3A 1Q35A 4G68A 1N04A 1B5HA 5DTBA 4IO3A 1B6HA 2HZLA 5CBRA 3UN6A
chains in the Genus database with same CATH topology
1SYHA 4KCDA 3IO6A 5EHSA 2ZNUA 5B7DA 1B1HA 2I0CA 2XD3A 4N07A 5FTIA 2XXQA 4E0XA 4PE5B 1B58A 2QS1A 2HQ0A 5LOMA 1B1XA 3TAJA 5KCJB 5L9OA 5H8QA 1SVXB 4LQ5A 2ONKE 3IOUA 3SDFA 1XS5A 1R1NA 1VFEA 1FQDA 2X26A 4EF2A 4NMYA 4R9GA 3MWBA 1R6ZA 2D21A 4YICA 4EQ9A 3TQWA 3UORA 1OIBA 3HHGA 5H8NA 3OO6A 3KGCA 3K6XA 2Z23A 1MQJA 5AE4A 2YJPA 1M5DA 1QULA 3U8QA 2Y84A 3KOTA 3SEXA 4ZEFA 2A5SA 2XHDA 2OK2A 2G29A 3O6GA 5B70A 4AQ4A 1OVTA 3IB0A 5CBSA 3PUXE 1SYIA 1PB7A 2DS9A 4OERA 3GLBA 5M2VA 1JW1A 3SEYA 3K1PA 4NE4A 2GRVA 3PMXA 2V93A 5TP9A 1OVBA 2VD3A 3BKIB 1B7ZA 4LUBA 4DCXA 4GL8A 1LCFA 3T96B 1EH3A 4Z7EA 3RLFE 2F6PA 2X7QA 5IAIA 3RN8A 4KFQA 1LAHE 2DWIA 4Z0IA 2I4CA 1M5FA 2FA7A 5I2KA 4IO5A 4GWOA 1IEJA 4OEUA 4DDDA 3F11A 1OQHA 3ILTB 1B3FA 3I5OA 1LAGE 1SW4A 4DXUA 3TYHA 4QF9A 3MVWA 4DIGA 3FVGA 2QJEA 4LATA 3C9HA 4IGRA 5FHNA 1EZ9A 3IOVA 1B52A 5K2YA 5CM6A 4H8JA 4UA8A 2OBGA 1S9TA 4KYSA 4OMBA 3PD9A 3UGWA 2XXWA 4C0RA 3TTNA 2O68A 1N7XA 3H03A 3PU5A 4FORA 1MY4A 2CZLA 3C31A 1B46A 1MS7A 3H06B 1MM7A 1UIUA 1B3HA 3UP9A 4ELPA 3FATA 3JYRA 4H5FA 3K2DA 4JBZA 3CG1A 3EPEA 5HBCA 4EF1A 3SERA 2QMWA 3OD7A 3PPNA 1N3WA 4LA9A 3ILUB 3T93B 3TDJA 1WDNA 2F78A 1FQAA 2X7PA 4P0GA 1D9YA 1FTLA 4KYDA 1EZOA 4TLLB 1XVYA 2DVZA 4IO2A 1NKXA 2O6AA 2XXHA 1MY2A 4GXSB 4ONYA 3K0VA 4F1VA 1MXVA 5H8FA 3MBPA 2Q8JA 3OO9A 3MP6A 4I8CA 1YTVA 1NNKA 1YCJA 3HSTA 5DEXB 2ANJA 1B0LA 5DYHA 1GR2A 3FVNA 1QUJA 2DOJA 1SBPA 4PFUA 1HSJA 3MAMA 4LZ7A 4G4PA 3R26A 4H1XA 4U2RA 3H6TA 1QKBA 2M8CA 1A55A 3CRBA 1R9QA 4QFKA 1II5A 2Y7RA 2RCBA 1URSA 3UK4A 3G3HA 1LFHA 2HEUA 1NH7A 3IB1A 4FEDA 4BDOA 4XKNA 2XXRA 4Q0CA 3M3FA 2NWJA 1LLSA 2I6EA 4XKPA 3DP8A 3KFMA 1P1QA 4AB6A 5I57B 2OWTA 3TZAA 1LB9A 5KDTB 3G3GA 4RK9A 4F2QA 1H44A 1NFTA 5AA4B 4RY1A 3MZ1A 1B32A 3DP6A 4JWOA 3U92A 2PMSA 4OFLA 4U21A 2UVGA 2W7YA 3GBAA 4N6PA 4F39A 4R73A 3I3VA 3RTWB 1TWYA 1FCKA 4OVJA 4QSDA 4M1VA 5L8DA 3A09A 1SW1A 2ESNA 3OSQA 2DXYA 1POY1 4NF8B 3H4ZA 3OO8A 2R71A 4R72A 5TPAA 5CMKA 2GFEA 2OLBA 1MG1A 3D4GA 4XKRA 3D4CA 1RYOA 2P2AA 1LFIA 3VV5A 3MVXA 1MXXA 1B40A 4OTEA 1I6BA 3TELA 1CE2A 3VVDA 1QW0A 3IOWA 4ECFA 2QS4A 2XXIA 3KBRA 4R75A 3VFJA 1DTGA 3KSXA 1RYXA 2ZYNA 1ANFA 3PUZE 4YB5A 2B65A 4HW8A 1ZU0A 3GBBA 4F3PA 2I48A 3O97A 4RJZA 1D3KA 2I4BA 2F5XA 4U4SA 3Q29A 2ONSA 1PBPA 3ZS6A 1MQHA 5I2NB 3K6WA 1PEBA 1XT8A 2IEEA 2F35A 3PMWA 1MPBA 1AL3A 4R6HA 4U1ZA 3PPRA 2QPQA 3FJGA 3T9VA 2F34A 4PFTA 3EQ1A 3M3LA 4X1BA 3B6WA 1M5EA 5CRYA 1Y20A 2PT1A 2OJTA 4DLDA 3FJ7A 3IK6B 2H9BA 2IA4A 4XXUA 3OEMA 1UIVA 4ELRA 3LBSA 2RC8A 4OESA 3TUSA 4RXLA 4HCYA 5KDTA 1MXWA 2V3UA 3C32A 3U72A 4NF6A 3FXRA 4HTGA 1SDXA 1ZBMA 2GHBA 4GXAA 4JSOA 3Q26A 5ISUA 4C1TA 1JVYA 4H67A 3UIFA 3K1NA 3PUVE 1JNFA 4TQUQ 4YU0A 2Y7IA 3OELA 2XXUA 5I58B 3ONMA 1MY0A 4YKJA 4FEBA 4KCCA 3CI8A 3OXNA 1DPEA 1BKAA 2DE4A 2I49A 4PP0A 4GIZA 2O51A 3DELB 3VVFA 2GH9A 1N76A 3G3JA 4E0WA 2OWSA 1MXZA 3FV2A 2UYEA 4LZ5A 5AA2B 3OO7A 4NF5A 1B4HA 4G68C 1T0KA 3C4MA 4BLAA 3E13X 4I62A 1PBQA 5H8HB 4WKMA 3A3UA 4G8NA 2D3IA 3IJOB 4RNSA 3JV9A 4NWDA 4F1UA 4FAJA 1AMFA 3IR1A 3FASA 2HAVA 1VFDA 4F3SA 4OXVA 3K02A 5BUUA 4O3CA 3K01A 3M3KA 1TT1A 2HAUA 4U1OA 4OETA 3N94A 3KN8A 2HFBA 4XKQA 1JVXA 3O6IA 1LSTA 3MQ9A 4ZEKA 2DWHA 1P1NA 4IY5A 4ZZEA 1R9LA 4BDRA 3CR9A 2UVJA 2UYFA 1PC3A 2XD2A 1A54A 5I56B 2Y7WA 4GFRA 4YMBA 3IO4A 5AA3A 3RNNA 3W15C 2XX8A 4GOTA 3TTRA 3THIA 1UQWA 1XOCA 2A5TB 5HM4B 4OYVA 3TODA 1B5JA 3MC2A 2RINA 2Z8EA 4ZEIA 5BWJA 3WAEA 1O64A 2QRYA 4IO7A 3TCFA 4ND9A 1B9JA 4BDNA 1B3LA 3RQTA 2BJJX 2WKYA 1UTHA 1NNPA 1Y3QA 4LQ2A 5JTYA 2I0BA 2ZNSA 1Z7ME 3VXCA 4QRZA 1IXIA 3QAXA 2CMOA 1I6AA 4QSCA 3FD3A 1VE4A 1JQFA 3EN3A 3L6GA 1PB9A 2O7UA 4EDPA 3B7DA 5L9SA 2XXPA 3E4RA 1Z7NE 1A8EA 5ICQA 4ESXA 2V3QA 3MZ9A 2NXOA 1OMPA 4OENA 2F6GA 5KCJA 3HCQA 4EQ7A 5F1QA 2B3BA 2DP8A 4OWDA 1P1WA 5AA2A 1SI1A 2YLNA 3FV1A 1OQGA 1URGA 1IIWA 4U22A 3RTFB 4WXJA 1N84A 1MXUA 2NUVA 3E3KA 1URDA 4LONB 4ZZAA 1POTA 1IUDA 4NWCA 3CSBA 1GV8A 3TMGA 2F8DA 3T9UA 4F3GA 3GXAA 1MPCA 2O1LA 1ZLQA 3S9NC 2H5YA 3LC8A 4TLMB 3S9LC 3PPOA 1HSEA 3T66A 4KPTA 4F19A 1M5CA 4OQOA 1B3GA 4JSDA 3KSJA 1A40A 2RC7A 1SI0A 4U23A 2QSXA 4Q8RA 3SEUA 3TEPA 2V3TA 1D9VA 3KJ7A 1TFDA 1UTBB 3EHSA 4EXKA 4JDFA 1DOTA 2XX9A 1YPNA 2DYXA 1GGGA 2A5TA 2ALUA 2O84X 2I3WA 1FQEA 4NF4B 3UA8A 3PV0E 5I59B 3K1MA 2HZKA 4P0IA 1RKMA 3SEVA 3SKPA 4GF8A 3G3IA 1IQ7A 4LP2B 1MY1A 2Z8FA 1NH8A 3G3KA 3PUYE 1P1UA 4ZEDA 1MDQA 1O7TA 3K4UA 4RPOA 4F31B 3KN7A 3O29A 4DZ1A 3KZGA 1LBBA 4GL0A 5A5XB 1TXFA 4QFOA 4BDQA 2KLFA 5I84A 2F7AA 3CVGA 3IORA 1N7WA 4IO4A 3USDA 1FTKA 4UACA 2LAOA 4XTCQ 4F3BA 4R9FA 3V89B 1VR5A 5IKBA 3QSLA 2ZYKA 4G68B 4U4XA 3SESA 4R74A 2NOOA 4K3FA 3RT6B 3T22A 1B05A 5CMBA 2V84A 2F7BA 3FUZA 3RUMA 3PD8A 5HPQA 1LB8A 1NMUA 4R2FA 4HCWA 3QK6A 5JK4A 5H8QB 4NEDA 3HO7A 4XIGQ 1LAFE 2XX7A 1KWHA 4EXLA 1CB6A 4OFOA 4F18A 3R7XA 4YMAA 4KR5A 3EF7A 2REJA 1LCTA 4HS7A 4BDLA 1SW2A 4PFYA 5H8NB 5DEXA 4YB6A 1Y4CA 2F7CA 3HHFA 1LBCA 3IJXB 4RK2A 3BFTA 1J1NA 1DMBA 3EHTA 4I9DA 3IL1B 3DLNA 4QFNA 4EUOA 1MQGA 4ZEBA 3OMBA 1B51A 1EU8A 3Q25A 1FQFA 3FJMA 1M5BA 3MVYA 2F97A 4R6YA 2AL5A 4NF4A 1IXHA 3FIRA 5I59A 2RKMA 1XVXA 1JEUA 2Y7PA 4GVOA 4POXA 3S9MC 2THIA 3G7WA 1B2HA 3MJNA 3MUQA 4ELOA 3H7MA 2RCAA 3TTKA 1XHYA 5TP9B 4YKIA 3CFXA 4H0WA 3T9XB 1WVJA 3H6WA 1S7YA 5I57A 1OLAA 4GQOA 1MXYA 3G3FA 4EQBA 4H8IA 3PMVA 4YB7A 5AA4A 1A7LA 3MPLA 4THIA 1H3DA 2ZYOA 3S4UA 1N3XA 3CFZA 5I2KB 3T9HB 5F7VA 3C34A 2DVCA 3MP8A 2HXWA 1B4ZA 4GRKA 3PGFA 4JB7A 4LZ8A 3JZJA 3H6UA 3KJTA 3V8XB 2V25A 2PT2A 4IY6A 2DE2A 5JEIA 3KG2A 1NL5A 4YKPA 4NF8A 4IGTA 2P0SA 1F9BA 3TCGA 4ZE8A 5ITOA 2VOZA 2PVUA 4FJPA 4RYAA 2XXTA 3IX1A 4ISUA 3MVZA 3B6TA 2ZNTA 1QUKA 4G8HA 3TTLA 1B3EA 4MH5A 1FTMA 1FTJA 2DE3A 3K6UA 1WODA 2XXVA 1SW5A 3RY3A 3FVKA 3Q28A 2F36A 3C33A 1LFGA 2AIXA 1MDP1 3CFLA 3LUYA 1JW5A 1Y1MA 1IXGA 4G2ZA 4RPNA 3IAZA 3MPKA 4DE8A 3TFLA 1DSNA 3RPWA 3LR1A 1MRPA 3TCHA 3FXQA 4PETA 5I2NA 4O3BA 3L6HA 1GVCA 4MLQA 5H8FB 3KOSA 1QJMA 3VVEA 3KEIA 4OHNA 2PX1A 1LGBC 2FNCA 4POWA 1ZJLA 3VLVA 1BP5A 1DTZA 5K2XA 2Y7KA 1O63A 2DWAA 2DWJA 3CG3A 5DVIA 2OCUA 1HSLA 3S9EA 1B5IA 4WEDA 4QFPA 5FHMA 4Q30B 1QKAA 3H3GA 1S50A 4X1DA 1Y1ZA 5AA2D 3HV1A 2AYSA 1ZMGA 3PUWE 4F22A 3K6VA 2XXYA 3ZKLA 1D4NA 2PYYA 3VLUA 3QUJA 3QUFA 3QXMA 4GLIA 3O6HA 1ZKBA 3V5AA 3O2AA 3TTMA 4BDMA 3C35A 1Y3PA 2H25A 1PB8A 5I58A 1LAXA 1H45A 1B0HA 4F29A 1L5TA 3IOTA 3O28A 4LVQA 5EHMA 5TU0A 3U93A 4H5GA 4WEPA 1B7UA 3IB2A 4F2OA 1Q1KA 4H65A 4FE8A 2VHAA 4MFIA 4Q5TA 1MH4A 1Y3NA 1P99A 1B7HA 4JWYA 4RA1A 1US4A 4NTLA 4R6KA 3HN0A 4KHZE 3S2VA 3BFUA 1N0TA 5H8HA 1GTKA 1ATGA 4ZS9A 2UVIA 3RGYA 3VDFA 3WAFA 1JETA 4O3AA 2RC9A 3QYTA 2ONRA 4YAHX 3PPPA 2QS3A 3O66A 4JXIA 3GZGA 2DSFA 4IO6A 3Q27A 2FYIA 5TPAB 5FTHA 1AIVA 4P11A 3E9XA 2HCAA 3K00A 4N13A 3RT8A 1I6QA 1USYH 2ZMBA 5EYFA 2XXXA 3N6UA 4ESWA 1MPDA 3MP1A 3HPIA 4OEVA 2NVUB 1BIYA 1IITA 1USYE 5I56A 1ZTYA 4C1UA 2G93A 1SD3A 5DT6A 5DVFA 5ICTA 1MQIA 3A3CA 4GD5A 4X9TA 5KZTA 1FQBA 2REGA 2E1SA 1SQYA 2O7IA 3SEWA 4FIMA 2QMXA 2Q88A 2PBWA 1US5A 1JW4A 1VSOA 3PPQA 2ZXTA 4X48A 2VGQA 3B6QA 4G77A 3C36A 3LSWA 4R2BA 4G8MA 3ZSFA 2R6GE 2Z8DA 5CMMA 2Q2AA 3LSLA 1MM6A 1MY3A 2QS2A 3AXFA 4L17A 3TQLA 2H98A 3BBRA 4KQPA 1PDAA 4QFLA 3KN3A 2OZZA 4MF3A 3N6TA 4PQJA 5H8SA 1BTJA 1FQCA 2DQVA 1A99A 4QHQA 3CIJA 3P7IA 3ODBA 2O69A 3W9VA 4NF6B 4OFJA 3EHUA 4MBPA 3QIMA 3DM0A 1AOVA 3FXUA 4DXCA 4OZ9A 5ITPA 3FZVA 3U94A 2QL3A 3LSFB 4KI0E 1TFAA 3I6VA 1ELJA 3H6VA 3OOAA 3OENA 2ABHA 3M8UA 2GHAA 1QUIA 3TPAA 4QSEA 5L9MA 1FW0A 2I3VA 1I69A 1YAEA 2Q2CA 4ZE9A 3VE1B 3U1OA 1QVSA 4NF5B 5DVJA 4IB2A 2H99A 1OLCA 4KD5A 4TOZA 3ECRA 2RF1A 2P1SA 3SETA 5CI5A 4PFWA 2Q9TA 3CSGA 1MH3A 1A8FA 4AB5A 5AA1A 1MQDA 1JEVA 4ELQA 1NNFA 2B3FA 4F1YA 3LSXA 1DPPA 3FGSA 2Q89A 1UTBA 2UXAA 4KYEA 3DP4A 1NNTA 4MLVA 4ZECA 2E0SA 3MW0A 3R6UA 4YKKA 2O1MA 2Z22A 1H76A 1AH5A 5CMCA 4ZDMA 3MZBA 3VLWA 4H6DA 1ZIUA 1EZPA 1Y9UA 3OSRA 4DXBA 2YPNA 1FTOA 1XC1A 2VP1A 1IZ1A 2UVHA 5CC2A 1IXCA 2D5WA 4FECA 4DCYA 3N5LA 5ELVA 1Y4TA 2R9JA 4I1DA 3FVOA 3V83A 1P1OA 5J1DA 5A5XA 2DXRA 3N26A 5FHOA 3O9PA 4YZZA 3W9WA 3TKDA 4FATA 2H4IA 2VD2A 4M4GA 3OEKA 1UTHB 3VXBA 4JWXA 5JTYB 3ZKKA 1H43A 2I58A 2AL4A 1BLFA 2ZYMA 1Q35A 4G68A 1N04A 1B5HA 5DTBA 4IO3A 1B6HA 2HZLA 5CBRA 3UN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYH A;  4KCD A;  3IO6 A;  5EHS A;  2ZNU A;  5B7D A;  1B1H A;  2I0C A;  2XD3 A;  4N07 A;  5FTI A;  2XXQ A;  4E0X A;  4PE5 B;  1B58 A;  2QS1 A;  2HQ0 A;  5LOM A;  1B1X A;  3TAJ A;  5KCJ B;  5L9O A;  5H8Q A;  1SVX B;  4LQ5 A;  2ONK E;  3IOU A;  3SDF A;  1XS5 A;  1R1N A;  1VFE A;  1FQD A;  2X26 A;  4EF2 A;  4NMY A;  4R9G A;  3MWB A;  1R6Z A;  2D21 A;  4YIC A;  4EQ9 A;  3TQW A;  3UOR A;  1OIB A;  3HHG A;  5H8N A;  3OO6 A;  3KGC A;  3K6X A;  2Z23 A;  1MQJ A;  5AE4 A;  2YJP A;  1M5D A;  1QUL A;  3U8Q A;  2Y84 A;  3KOT A;  3SEX A;  4ZEF A;  2A5S A;  2XHD A;  2OK2 A;  2G29 A;  3O6G A;  5B70 A;  4AQ4 A;  1OVT A;  3IB0 A;  5CBS A;  3PUX E;  1SYI A;  1PB7 A;  2DS9 A;  4OER A;  3GLB A;  5M2V A;  1JW1 A;  3SEY A;  3K1P A;  4NE4 A;  2GRV A;  3PMX A;  2V93 A;  5TP9 A;  1OVB A;  2VD3 A;  3BKI B;  1B7Z A;  4LUB A;  4DCX A;  4GL8 A;  1LCF A;  3T96 B;  1EH3 A;  4Z7E A;  3RLF E;  2F6P A;  2X7Q A;  5IAI A;  3RN8 A;  4KFQ A;  1LAH E;  2DWI A;  4Z0I A;  2I4C A;  1M5F A;  2FA7 A;  5I2K A;  4IO5 A;  4GWO A;  1IEJ A;  4OEU A;  4DDD A;  3F11 A;  1OQH A;  3ILT B;  1B3F A;  3I5O A;  1LAG E;  1SW4 A;  4DXU A;  3TYH A;  4QF9 A;  3MVW A;  4DIG A;  3FVG A;  2QJE A;  4LAT A;  3C9H A;  4IGR A;  5FHN A;  1EZ9 A;  3IOV A;  1B52 A;  5K2Y A;  5CM6 A;  4H8J A;  4UA8 A;  2OBG A;  1S9T A;  4KYS A;  4OMB A;  3PD9 A;  3UGW A;  2XXW A;  4C0R A;  3TTN A;  2O68 A;  1N7X A;  3H03 A;  3PU5 A;  4FOR A;  1MY4 A;  2CZL A;  3C31 A;  1B46 A;  1MS7 A;  3H06 B;  1MM7 A;  1UIU A;  1B3H A;  3UP9 A;  4ELP A;  3FAT A;  3JYR A;  4H5F A;  3K2D A;  4JBZ A;  3CG1 A;  3EPE A;  5HBC A;  4EF1 A;  3SER A;  2QMW A;  3OD7 A;  3PPN A;  1N3W A;  4LA9 A;  3ILU B;  3T93 B;  3TDJ A;  1WDN A;  2F78 A;  1FQA A;  2X7P A;  4P0G A;  1D9Y A;  1FTL A;  4KYD A;  1EZO A;  4TLL B;  1XVY A;  2DVZ A;  4IO2 A;  1NKX A;  2O6A A;  2XXH A;  1MY2 A;  4GXS B;  4ONY A;  3K0V A;  4F1V A;  1MXV A;  5H8F A;  3MBP A;  2Q8J A;  3OO9 A;  3MP6 A;  4I8C A;  1YTV A;  1NNK A;  1YCJ A;  3HST A;  5DEX B;  2ANJ A;  1B0L A;  5DYH A;  1GR2 A;  3FVN A;  1QUJ A;  2DOJ A;  1SBP A;  4PFU A;  1HSJ A;  3MAM A;  4LZ7 A;  4G4P A;  3R26 A;  4H1X A;  4U2R A;  3H6T A;  1QKB A;  2M8C A;  1A55 A;  3CRB A;  1R9Q A;  4QFK A;  1II5 A;  2Y7R A;  2RCB A;  1URS A;  3UK4 A;  3G3H A;  1LFH A;  2HEU A;  1NH7 A;  3IB1 A;  4FED A;  4BDO A;  4XKN A;  2XXR A;  4Q0C A;  3M3F A;  2NWJ A;  1LLS A;  2I6E A;  4XKP A;  3DP8 A;  3KFM A;  1P1Q A;  4AB6 A;  5I57 B;  2OWT A;  3TZA A;  1LB9 A;  5KDT B;  3G3G A;  4RK9 A;  4F2Q A;  1H44 A;  1NFT A;  5AA4 B;  4RY1 A;  3MZ1 A;  1B32 A;  3DP6 A;  4JWO A;  3U92 A;  2PMS A;  4OFL A;  4U21 A;  2UVG A;  2W7Y A;  3GBA A;  4N6P A;  4F39 A;  4R73 A;  3I3V A;  3RTW B;  1TWY A;  1FCK A;  4OVJ A;  4QSD A;  4M1V A;  5L8D A;  3A09 A;  1SW1 A;  2ESN A;  3OSQ A;  2DXY A;  1POY 1;  4NF8 B;  3H4Z A;  3OO8 A;  2R71 A;  4R72 A;  5TPA A;  5CMK A;  2GFE A;  2OLB A;  1MG1 A;  3D4G A;  4XKR A;  3D4C A;  1RYO A;  2P2A A;  1LFI A;  3VV5 A;  3MVX A;  1MXX A;  1B40 A;  4OTE A;  1I6B A;  3TEL A;  1CE2 A;  3VVD A;  1QW0 A;  3IOW A;  4ECF A;  2QS4 A;  2XXI A;  3KBR A;  4R75 A;  3VFJ A;  1DTG A;  3KSX A;  1RYX A;  2ZYN A;  1ANF A;  3PUZ E;  4YB5 A;  2B65 A;  4HW8 A;  1ZU0 A;  3GBB A;  4F3P A;  2I48 A;  3O97 A;  4RJZ A;  1D3K A;  2I4B A;  2F5X A;  4U4S A;  3Q29 A;  2ONS A;  1PBP A;  3ZS6 A;  1MQH A;  5I2N B;  3K6W A;  1PEB A;  1XT8 A;  2IEE A;  2F35 A;  3PMW A;  1MPB A;  1AL3 A;  4R6H A;  4U1Z A;  3PPR A;  2QPQ A;  3FJG A;  3T9V A;  2F34 A;  4PFT A;  3EQ1 A;  3M3L A;  4X1B A;  3B6W A;  1M5E A;  5CRY A;  1Y20 A;  2PT1 A;  2OJT A;  4DLD A;  3FJ7 A;  3IK6 B;  2H9B A;  2IA4 A;  4XXU A;  3OEM A;  1UIV A;  4ELR A;  3LBS A;  2RC8 A;  4OES A;  3TUS A;  4RXL A;  4HCY A;  5KDT A;  1MXW A;  2V3U A;  3C32 A;  3U72 A;  4NF6 A;  3FXR A;  4HTG A;  1SDX A;  1ZBM A;  2GHB A;  4GXA A;  4JSO A;  3Q26 A;  5ISU A;  4C1T A;  1JVY A;  4H67 A;  3UIF A;  3K1N A;  3PUV E;  1JNF A;  4TQU Q;  4YU0 A;  2Y7I A;  3OEL A;  2XXU A;  5I58 B;  3ONM A;  1MY0 A;  4YKJ A;  4FEB A;  4KCC A;  3CI8 A;  3OXN A;  1DPE A;  1BKA A;  2DE4 A;  2I49 A;  4PP0 A;  4GIZ A;  2O51 A;  3DEL B;  3VVF A;  2GH9 A;  1N76 A;  3G3J A;  4E0W A;  2OWS A;  1MXZ A;  3FV2 A;  2UYE A;  4LZ5 A;  5AA2 B;  3OO7 A;  4NF5 A;  1B4H A;  4G68 C;  1T0K A;  3C4M A;  4BLA A;  3E13 X;  4I62 A;  1PBQ A;  5H8H B;  4WKM A;  3A3U A;  4G8N A;  2D3I A;  3IJO B;  4RNS A;  3JV9 A;  4NWD A;  4F1U A;  4FAJ A;  1AMF A;  3IR1 A;  3FAS A;  2HAV A;  1VFD A;  4F3S A;  4OXV A;  3K02 A;  5BUU A;  4O3C A;  3K01 A;  3M3K A;  1TT1 A;  2HAU A;  4U1O A;  4OET A;  3N94 A;  3KN8 A;  2HFB A;  4XKQ A;  1JVX A;  3O6I A;  1LST A;  3MQ9 A;  4ZEK A;  2DWH A;  1P1N A;  4IY5 A;  4ZZE A;  1R9L A;  4BDR A;  3CR9 A;  2UVJ A;  2UYF A;  1PC3 A;  2XD2 A;  1A54 A;  5I56 B;  2Y7W A;  4GFR A;  4YMB A;  3IO4 A;  5AA3 A;  3RNN A;  3W15 C;  2XX8 A;  4GOT A;  3TTR A;  3THI A;  1UQW A;  1XOC A;  2A5T B;  5HM4 B;  4OYV A;  3TOD A;  1B5J A;  3MC2 A;  2RIN A;  2Z8E A;  4ZEI A;  5BWJ A;  3WAE A;  1O64 A;  2QRY A;  4IO7 A;  3TCF A;  4ND9 A;  1B9J A;  4BDN A;  1B3L A;  3RQT A;  2BJJ X;  2WKY A;  1UTH A;  1NNP A;  1Y3Q A;  4LQ2 A;  5JTY A;  2I0B A;  2ZNS A;  1Z7M E;  3VXC A;  4QRZ A;  1IXI A;  3QAX A;  2CMO A;  1I6A A;  4QSC A;  3FD3 A;  1VE4 A;  1JQF A;  3EN3 A;  3L6G A;  1PB9 A;  2O7U A;  4EDP A;  3B7D A;  5L9S A;  2XXP A;  3E4R A;  1Z7N E;  1A8E A;  5ICQ A;  4ESX A;  2V3Q A;  3MZ9 A;  2NXO A;  1OMP A;  4OEN A;  2F6G A;  5KCJ A;  3HCQ A;  4EQ7 A;  5F1Q A;  2B3B A;  2DP8 A;  4OWD A;  1P1W A;  5AA2 A;  1SI1 A;  2YLN A;  3FV1 A;  1OQG A;  1URG A;  1IIW A;  4U22 A;  3RTF B;  4WXJ A;  1N84 A;  1MXU A;  2NUV A;  3E3K A;  1URD A;  4LON B;  4ZZA A;  1POT A;  1IUD A;  4NWC A;  3CSB A;  1GV8 A;  3TMG A;  2F8D A;  3T9U A;  4F3G A;  3GXA A;  1MPC A;  2O1L A;  1ZLQ A;  3S9N C;  2H5Y A;  3LC8 A;  4TLM B;  3S9L C;  3PPO A;  1HSE A;  3T66 A;  4KPT A;  4F19 A;  1M5C A;  4OQO A;  1B3G A;  4JSD A;  3KSJ A;  1A40 A;  2RC7 A;  1SI0 A;  4U23 A;  2QSX A;  4Q8R A;  3SEU A;  3TEP A;  2V3T A;  1D9V A;  3KJ7 A;  1TFD A;  1UTB B;  3EHS A;  4EXK A;  4JDF A;  1DOT A;  2XX9 A;  1YPN A;  2DYX A;  1GGG A;  2A5T A;  2ALU A;  2O84 X;  2I3W A;  1FQE A;  4NF4 B;  3UA8 A;  3PV0 E;  5I59 B;  3K1M A;  2HZK A;  4P0I A;  1RKM A;  3SEV A;  3SKP A;  4GF8 A;  3G3I A;  1IQ7 A;  4LP2 B;  1MY1 A;  2Z8F A;  1NH8 A;  3G3K A;  3PUY E;  1P1U A;  4ZED A;  1MDQ A;  1O7T A;  3K4U A;  4RPO A;  4F31 B;  3KN7 A;  3O29 A;  4DZ1 A;  3KZG A;  1LBB A;  4GL0 A;  5A5X B;  1TXF A;  4QFO A;  4BDQ A;  2KLF A;  5I84 A;  2F7A A;  3CVG A;  3IOR A;  1N7W A;  4IO4 A;  3USD A;  1FTK A;  4UAC A;  2LAO A;  4XTC Q;  4F3B A;  4R9F A;  3V89 B;  1VR5 A;  5IKB A;  3QSL A;  2ZYK A;  4G68 B;  4U4X A;  3SES A;  4R74 A;  2NOO A;  4K3F A;  3RT6 B;  3T22 A;  1B05 A;  5CMB A;  2V84 A;  2F7B A;  3FUZ A;  3RUM A;  3PD8 A;  5HPQ A;  1LB8 A;  1NMU A;  4R2F A;  4HCW A;  3QK6 A;  5JK4 A;  5H8Q B;  4NED A;  3HO7 A;  4XIG Q;  1LAF E;  2XX7 A;  1KWH A;  4EXL A;  1CB6 A;  4OFO A;  4F18 A;  3R7X A;  4YMA A;  4KR5 A;  3EF7 A;  2REJ A;  1LCT A;  4HS7 A;  4BDL A;  1SW2 A;  4PFY A;  5H8N B;  5DEX A;  4YB6 A;  1Y4C A;  2F7C A;  3HHF A;  1LBC A;  3IJX B;  4RK2 A;  3BFT A;  1J1N A;  1DMB A;  3EHT A;  4I9D A;  3IL1 B;  3DLN A;  4QFN A;  4EUO A;  1MQG A;  4ZEB A;  3OMB A;  1B51 A;  1EU8 A;  3Q25 A;  1FQF A;  3FJM A;  1M5B A;  3MVY A;  2F97 A;  4R6Y A;  2AL5 A;  4NF4 A;  1IXH A;  3FIR A;  5I59 A;  2RKM A;  1XVX A;  1JEU A;  2Y7P A;  4GVO A;  4POX A;  3S9M C;  2THI A;  3G7W A;  1B2H A;  3MJN A;  3MUQ A;  4ELO A;  3H7M A;  2RCA A;  3TTK A;  1XHY A;  5TP9 B;  4YKI A;  3CFX A;  4H0W A;  3T9X B;  1WVJ A;  3H6W A;  1S7Y A;  5I57 A;  1OLA A;  4GQO A;  1MXY A;  3G3F A;  4EQB A;  4H8I A;  3PMV A;  4YB7 A;  5AA4 A;  1A7L A;  3MPL A;  4THI A;  1H3D A;  2ZYO A;  3S4U A;  1N3X A;  3CFZ A;  5I2K B;  3T9H B;  5F7V A;  3C34 A;  2DVC A;  3MP8 A;  2HXW A;  1B4Z A;  4GRK A;  3PGF A;  4JB7 A;  4LZ8 A;  3JZJ A;  3H6U A;  3KJT A;  3V8X B;  2V25 A;  2PT2 A;  4IY6 A;  2DE2 A;  5JEI A;  3KG2 A;  1NL5 A;  4YKP A;  4NF8 A;  4IGT A;  2P0S A;  1F9B A;  3TCG A;  4ZE8 A;  5ITO A;  2VOZ A;  2PVU A;  4FJP A;  4RYA A;  2XXT A;  3IX1 A;  4ISU A;  3MVZ A;  3B6T A;  2ZNT A;  1QUK A;  4G8H A;  3TTL A;  1B3E A;  4MH5 A;  1FTM A;  1FTJ A;  2DE3 A;  3K6U A;  1WOD A;  2XXV A;  1SW5 A;  3RY3 A;  3FVK A;  3Q28 A;  2F36 A;  3C33 A;  1LFG A;  2AIX A;  1MDP 1;  3CFL A;  3LUY A;  1JW5 A;  1Y1M A;  1IXG A;  4G2Z A;  4RPN A;  3IAZ A;  3MPK A;  4DE8 A;  3TFL A;  1DSN A;  3RPW A;  3LR1 A;  1MRP A;  3TCH A;  3FXQ A;  4PET A;  5I2N A;  4O3B A;  3L6H A;  1GVC A;  4MLQ A;  5H8F B;  3KOS A;  1QJM A;  3VVE A;  3KEI A;  4OHN A;  2PX1 A;  1LGB C;  2FNC A;  4POW A;  1ZJL A;  3VLV A;  1BP5 A;  1DTZ A;  5K2X A;  2Y7K A;  1O63 A;  2DWA A;  2DWJ A;  3CG3 A;  5DVI A;  2OCU A;  1HSL A;  3S9E A;  1B5I A;  4WED A;  4QFP A;  5FHM A;  4Q30 B;  1QKA A;  3H3G A;  1S50 A;  4X1D A;  1Y1Z A;  5AA2 D;  3HV1 A;  2AYS A;  1ZMG A;  3PUW E;  4F22 A;  3K6V A;  2XXY A;  3ZKL A;  1D4N A;  2PYY A;  3VLU A;  3QUJ A;  3QUF A;  3QXM A;  4GLI A;  3O6H A;  1ZKB A;  3V5A A;  3O2A A;  3TTM A;  4BDM A;  3C35 A;  1Y3P A;  2H25 A;  1PB8 A;  5I58 A;  1LAX A;  1H45 A;  1B0H A;  4F29 A;  1L5T A;  3IOT A;  3O28 A;  4LVQ A;  5EHM A;  5TU0 A;  3U93 A;  4H5G A;  4WEP A;  1B7U A;  3IB2 A;  4F2O A;  1Q1K A;  4H65 A;  4FE8 A;  2VHA A;  4MFI A;  4Q5T A;  1MH4 A;  1Y3N A;  1P99 A;  1B7H A;  4JWY A;  4RA1 A;  1US4 A;  4NTL A;  4R6K A;  3HN0 A;  4KHZ E;  3S2V A;  3BFU A;  1N0T A;  5H8H A;  1GTK A;  1ATG A;  4ZS9 A;  2UVI A;  3RGY A;  3VDF A;  3WAF A;  1JET A;  4O3A A;  2RC9 A;  3QYT A;  2ONR A;  4YAH X;  3PPP A;  2QS3 A;  3O66 A;  4JXI A;  3GZG A;  2DSF A;  4IO6 A;  3Q27 A;  2FYI A;  5TPA B;  5FTH A;  1AIV A;  4P11 A;  3E9X A;  2HCA A;  3K00 A;  4N13 A;  3RT8 A;  1I6Q A;  1USY H;  2ZMB A;  5EYF A;  2XXX A;  3N6U A;  4ESW A;  1MPD A;  3MP1 A;  3HPI A;  4OEV A;  2NVU B;  1BIY A;  1IIT A;  1USY E;  5I56 A;  1ZTY A;  4C1U A;  2G93 A;  1SD3 A;  5DT6 A;  5DVF A;  5ICT A;  1MQI A;  3A3C A;  4GD5 A;  4X9T A;  5KZT A;  1FQB A;  2REG A;  2E1S A;  1SQY A;  2O7I A;  3SEW A;  4FIM A;  2QMX A;  2Q88 A;  2PBW A;  1US5 A;  1JW4 A;  1VSO A;  3PPQ A;  2ZXT A;  4X48 A;  2VGQ A;  3B6Q A;  4G77 A;  3C36 A;  3LSW A;  4R2B A;  4G8M A;  3ZSF A;  2R6G E;  2Z8D A;  5CMM A;  2Q2A A;  3LSL A;  1MM6 A;  1MY3 A;  2QS2 A;  3AXF A;  4L17 A;  3TQL A;  2H98 A;  3BBR A;  4KQP A;  1PDA A;  4QFL A;  3KN3 A;  2OZZ A;  4MF3 A;  3N6T A;  4PQJ A;  5H8S A;  1BTJ A;  1FQC A;  2DQV A;  1A99 A;  4QHQ A;  3CIJ A;  3P7I A;  3ODB A;  2O69 A;  3W9V A;  4NF6 B;  4OFJ A;  3EHU A;  4MBP A;  3QIM A;  3DM0 A;  1AOV A;  3FXU A;  4DXC A;  4OZ9 A;  5ITP A;  3FZV A;  3U94 A;  2QL3 A;  3LSF B;  4KI0 E;  1TFA A;  3I6V A;  1ELJ A;  3H6V A;  3OOA A;  3OEN A;  2ABH A;  3M8U A;  2GHA A;  1QUI A;  3TPA A;  4QSE A;  5L9M A;  1FW0 A;  2I3V A;  1I69 A;  1YAE A;  2Q2C A;  4ZE9 A;  3VE1 B;  3U1O A;  1QVS A;  4NF5 B;  5DVJ A;  4IB2 A;  2H99 A;  1OLC A;  4KD5 A;  4TOZ A;  3ECR A;  2RF1 A;  2P1S A;  3SET A;  5CI5 A;  4PFW A;  2Q9T A;  3CSG A;  1MH3 A;  1A8F A;  4AB5 A;  5AA1 A;  1MQD A;  1JEV A;  4ELQ A;  1NNF A;  2B3F A;  4F1Y A;  3LSX A;  1DPP A;  3FGS A;  2Q89 A;  1UTB A;  2UXA A;  4KYE A;  3DP4 A;  1NNT A;  4MLV A;  4ZEC A;  2E0S A;  3MW0 A;  3R6U A;  4YKK A;  2O1M A;  2Z22 A;  1H76 A;  1AH5 A;  5CMC A;  4ZDM A;  3MZB A;  3VLW A;  4H6D A;  1ZIU A;  1EZP A;  1Y9U A;  3OSR A;  4DXB A;  2YPN A;  1FTO A;  1XC1 A;  2VP1 A;  1IZ1 A;  2UVH A;  5CC2 A;  1IXC A;  2D5W A;  4FEC A;  4DCY A;  3N5L A;  5ELV A;  1Y4T A;  2R9J A;  4I1D A;  3FVO A;  3V83 A;  1P1O A;  5J1D A;  5A5X A;  2DXR A;  3N26 A;  5FHO A;  3O9P A;  4YZZ A;  3W9W A;  3TKD A;  4FAT A;  2H4I A;  2VD2 A;  4M4G A;  3OEK A;  1UTH B;  3VXB A;  4JWX A;  5JTY B;  3ZKK A;  1H43 A;  2I58 A;  2AL4 A;  1BLF A;  2ZYM A;  1Q35 A;  4G68 A;  1N04 A;  1B5H A;  5DTB A;  4IO3 A;  1B6H A;  2HZL A;  5CBR A;  3UN6 A; 
#chains in the Genus database with same CATH topology
 1SYH A;  3ISP A;  4KCD A;  3IO6 A;  5EHS A;  2ZNU A;  5B7D A;  1B1H A;  2I0C A;  2XD3 A;  4N07 A;  5FTI A;  2XXQ A;  4E0X A;  4PE5 B;  1B58 A;  2QS1 A;  2HQ0 A;  5LOM A;  1B1X A;  3TAJ A;  5KCJ B;  5L9O A;  5H8Q A;  1FPK A;  1FBD A;  1SVX B;  4LQ5 A;  2ONK E;  3IOU A;  3SDF A;  1XS5 A;  1R1N A;  1VFE A;  1FQD A;  2X26 A;  4EF2 A;  4NMY A;  4R9G A;  3MWB A;  1R6Z A;  2D21 A;  4YIC A;  4EQ9 A;  3TQW A;  3UOR A;  1OIB A;  3HHG A;  5H8N A;  3OO6 A;  3KGC A;  3K6X A;  2Z23 A;  4PDD A;  1MQJ A;  5AE4 A;  2YJP A;  1M5D A;  2P3V A;  4GWW A;  3B50 A;  1QUL A;  4N81 A;  3U8Q A;  2Y84 A;  3KOT A;  3SEX A;  4ZEF A;  2A5S A;  2XHD A;  2OK2 A;  2G29 A;  3O6G A;  5B70 A;  1NUW A;  4AQ4 A;  1OVT A;  3PTY A;  3IB0 A;  4NF0 A;  5CBS A;  3PUX E;  1SYI A;  1PB7 A;  2DS9 A;  4OER A;  2QVU A;  3GLB A;  5M2V A;  1JW1 A;  1FPB A;  3SEY A;  4MNC A;  3K1P A;  4NE4 A;  2GRV A;  1IMF A;  3PMX A;  2V93 A;  5TP9 A;  1OVB A;  2VD3 A;  3BKI B;  3E79 A;  1B7Z A;  4LUB A;  4DCX A;  4GL8 A;  1LCF A;  3T96 B;  1EH3 A;  4Z7E A;  4MIJ A;  3RLF E;  2F6P A;  2X7Q A;  5IAI A;  4PF8 A;  3RN8 A;  4KFQ A;  4P3L A;  1LAH E;  2DWI A;  4Z0I A;  2I4C A;  1M5F A;  2FA7 A;  5I2K A;  4IO5 A;  4GWO A;  1IEJ A;  4OEU A;  4DDD A;  3F11 A;  1OQH A;  3ILT B;  1NV2 A;  1B3F A;  3I5O A;  1G0H A;  1LAG E;  1SW4 A;  4DXU A;  3TYH A;  4QF9 A;  3MVW A;  4DIG A;  3FVG A;  2QJE A;  3FBP A;  4LAT A;  3C9H A;  4IGR A;  5FHN A;  1EZ9 A;  3IOV A;  4I3Y A;  1B52 A;  5K2Y A;  5CM6 A;  4H8J A;  4UA8 A;  2OBG A;  1S9T A;  4KYS A;  4OMB A;  3PD9 A;  3UGW A;  1SPI A;  2XXW A;  4C0R A;  5FBP A;  3TTN A;  2O68 A;  1N7X A;  3H03 A;  2L5V A;  3PU5 A;  4FOR A;  1MY4 A;  4OVS A;  2CZL A;  3C31 A;  1B46 A;  1MS7 A;  3H06 B;  5IM2 A;  1MM7 A;  1UIU A;  1LBX A;  1B3H A;  3UP9 A;  3LUZ A;  4ELP A;  3FAT A;  3JYR A;  4H5F A;  3K2D A;  4JBZ A;  1KZ8 A;  3CG1 A;  3EPE A;  4N91 A;  5HBC A;  4EF1 A;  3SER A;  2QMW A;  2XWO A;  3OD7 A;  3PPN A;  1N3W A;  4LA9 A;  3ILU B;  4X8R A;  4GWS A;  3T93 B;  3TDJ A;  1WDN A;  2F78 A;  1FQA A;  2X7P A;  4P0G A;  1D9Y A;  1FTL A;  4KYD A;  1EZO A;  4N15 A;  2FBP A;  4TLL B;  1XVY A;  2DVZ A;  4IO2 A;  1NKX A;  2O6A A;  2XXH A;  1MY2 A;  4GXS B;  4ONY A;  3K0V A;  4F1V A;  1MXV A;  5H8F A;  1FBE A;  3MBP A;  2Q8J A;  3OO9 A;  3MP6 A;  4I8C A;  1YTV A;  1NNK A;  1YCJ A;  3HST A;  5DEX B;  2ANJ A;  1B0L A;  3B8B A;  5DYH A;  1GR2 A;  3FVN A;  1QUJ A;  4PGP A;  5I7I A;  2DOJ A;  1SBP A;  4PFU A;  1HSJ A;  3MAM A;  4LZ7 A;  4G4P A;  3R26 A;  4H1X A;  4U2R A;  3H6T A;  1QKB A;  2M8C A;  3IFC A;  1A55 A;  3CRB A;  1R9Q A;  4QFK A;  1IMA A;  1II5 A;  2Y7R A;  2RCB A;  1URS A;  3UK4 A;  1NV5 A;  3G3H A;  1LFH A;  2HEU A;  1NH7 A;  3IB1 A;  4FED A;  4BDO A;  4XKN A;  2XXR A;  4Q0C A;  3M3F A;  2NWJ A;  1LLS A;  2I6E A;  4XKP A;  3DP8 A;  3KFM A;  1P1Q A;  4AB6 A;  5I57 B;  2OWT A;  1NV7 A;  3TZA A;  1LB9 A;  5KDT B;  3G3G A;  4RK9 A;  4F2Q A;  1H44 A;  1NFT A;  5AA4 B;  4RY1 A;  3MZ1 A;  1B32 A;  5EQA A;  1VDW A;  2MKZ A;  4PBH A;  3DP6 A;  4JWO A;  4OVQ A;  3U92 A;  2PMS A;  4OFL A;  4JVI A;  4U21 A;  2UVG A;  2W7Y A;  3GBA A;  4N6P A;  4F39 A;  4R73 A;  3I3V A;  3RTW B;  4PFI A;  1TWY A;  1FCK A;  4OVJ A;  4QSD A;  4PAF A;  4M1V A;  5L8D A;  3A09 A;  1SW1 A;  2ESN A;  2OX3 A;  3OSQ A;  2DXY A;  1POY 1;  5EYH A;  4NF8 B;  1DCU A;  3H4Z A;  3OO8 A;  2R71 A;  4R72 A;  5TPA A;  5CMK A;  4PC9 A;  2GFE A;  2OLB A;  4O7M A;  1MG1 A;  4PFB A;  3D4G A;  4XKR A;  3D4C A;  1RYO A;  2P2A A;  1FPI A;  3RPL A;  1LFI A;  3VV5 A;  3MVX A;  4UAB A;  1MXX A;  1B40 A;  4OTE A;  1I6B A;  3TEL A;  1CE2 A;  4N8G A;  3VVD A;  1QW0 A;  3IOW A;  4ECF A;  2QS4 A;  2XXI A;  3KBR A;  4R75 A;  3VFJ A;  1DK4 A;  1DTG A;  4AS5 A;  4I40 A;  3KSX A;  1RYX A;  5LDZ A;  2ZYN A;  1ANF A;  1FRP A;  3PUZ E;  4YB5 A;  2B65 A;  4PF6 A;  4HW8 A;  1ZU0 A;  3GBB A;  4F3P A;  2I48 A;  3O97 A;  4RJZ A;  1D3K A;  2I4B A;  2F5X A;  1FPL A;  4U4S A;  1BK4 A;  3Q29 A;  2ONS A;  1PBP A;  1RDZ A;  3ZS6 A;  1MQH A;  5I2N B;  3K6W A;  3KC1 A;  1FBP A;  1PEB A;  1XT8 A;  3ROJ A;  2IEE A;  2F35 A;  4PGN A;  3PMW A;  1MPB A;  1AL3 A;  4R6H A;  4U1Z A;  3PPR A;  2QPQ A;  3FJG A;  5F24 A;  3T9V A;  2F34 A;  3QMF A;  4PFT A;  3EQ1 A;  3M3L A;  5LTC A;  4X1B A;  1FPJ A;  3B6W A;  1M5E A;  5CRY A;  1Y20 A;  2PT1 A;  2QVR A;  2OJT A;  1FSA A;  4DLD A;  3FJ7 A;  3IK6 B;  2H9B A;  2IA4 A;  4XXU A;  3OEM A;  1UIV A;  4ELR A;  3LBS A;  2RC8 A;  4OES A;  5EYG A;  3TUS A;  4RXL A;  1NUX A;  4HCY A;  5KDT A;  1MXW A;  2V3U A;  1INP A;  3C32 A;  3U72 A;  4NF6 A;  1NV1 A;  3FXR A;  4HTG A;  1SDX A;  1ZBM A;  2GHB A;  4GXA A;  4JSO A;  3Q26 A;  5ISU A;  4C1T A;  1JVY A;  4H67 A;  3UIF A;  3K1N A;  3PUV E;  5IZZ A;  1JNF A;  4TQU Q;  4YU0 A;  2Y7I A;  3OEL A;  2XXU A;  5I58 B;  1IMD A;  3ONM A;  1MY0 A;  4YKJ A;  4FEB A;  4KCC A;  3CI8 A;  3OXN A;  1DPE A;  5ESY A;  1BKA A;  2DE4 A;  2I49 A;  4PP0 A;  4GIZ A;  2O51 A;  3DEL B;  3VVF A;  2GH9 A;  1N76 A;  3G3J A;  4E0W A;  2OWS A;  1MXZ A;  3FV2 A;  2UYE A;  4LZ5 A;  5AA2 B;  3OO7 A;  4NF5 A;  1B4H A;  4G68 C;  4DI4 B;  1T0K A;  3C4M A;  4MNP A;  4BLA A;  3E13 X;  4I62 A;  1LBZ A;  1PBQ A;  5H8H B;  4NHB A;  4QXD A;  4WKM A;  3A3U A;  4G8N A;  2D3I A;  3IJO B;  4RNS A;  4DI3 D;  3JV9 A;  4NWD A;  4GX3 A;  4F1U A;  4FAJ A;  1AMF A;  3IR1 A;  4GX4 A;  3FAS A;  2HAV A;  1VFD A;  1RDX A;  4F3S A;  4OXV A;  3K02 A;  5BUU A;  4O3C A;  3K01 A;  3M3K A;  1TT1 A;  2HAU A;  3D1R A;  4U1O A;  4OET A;  3N94 A;  3KN8 A;  2HFB A;  4XKQ A;  1JVX A;  3O6I A;  1LST A;  3MQ9 A;  4ZEK A;  2DWH A;  1P1N A;  4IY5 A;  4OVT A;  4ZZE A;  1R9L A;  2BJI A;  4P9K A;  4N6K A;  4BDR A;  3CR9 A;  2UVJ A;  2UYF A;  1PC3 A;  2XD2 A;  1A54 A;  3SZP A;  5I56 B;  2Y7W A;  4GFR A;  4YMB A;  3IO4 A;  5AA3 A;  3RNN A;  3W15 C;  2XX8 A;  4GOT A;  3TTR A;  3THI A;  1UQW A;  1XOC A;  2A5T B;  5HM4 B;  4OYV A;  3TOD A;  1B5J A;  3MC2 A;  2RIN A;  2Z8E A;  4ZEI A;  5BWJ A;  3WAE A;  2CZI A;  4FBP A;  1O64 A;  2QRY A;  4IO7 A;  3TCF A;  4PTK A;  4ND9 A;  1B9J A;  4BDN A;  1B3L A;  3RQT A;  2BJJ X;  2WKY A;  1UTH A;  1NNP A;  4LQ2 A;  1Y3Q A;  5JTY A;  2I0B A;  4P1E A;  2ZNS A;  1Z7M E;  4GWU A;  3VXC A;  4QRZ A;  1IXI A;  3QAX A;  2CMO A;  1YXI A;  2XWK A;  1I6A A;  4QSC A;  3FD3 A;  1VE4 A;  1JQF A;  3EN3 A;  3L6G A;  1PB9 A;  1LBV A;  2O7U A;  3T1B A;  1KA1 A;  4EDP A;  1IMC A;  3B7D A;  5L9S A;  2XXP A;  3E4R A;  1K9Z A;  2VPN A;  1Z7N E;  1A8E A;  5ICQ A;  2V3Q A;  4ESX A;  3RYD A;  3MZ9 A;  2NXO A;  1OMP A;  4OEN A;  2F6G A;  5KCJ A;  1NUZ A;  4HE2 A;  3HCQ A;  4EQ7 A;  5F1Q A;  5EQ8 A;  2HXR A;  2B3B A;  2DP8 A;  4OWD A;  4NGU A;  1P1W A;  5AA2 A;  1SI1 A;  2YLN A;  3FV1 A;  2WYK A;  1YZ0 A;  1OQG A;  2FHY A;  1URG A;  1IIW A;  4U22 A;  3RTF B;  4WXJ A;  1N84 A;  1MXU A;  2NUV A;  3E3K A;  1URD A;  4LON B;  4ZZA A;  1POT A;  1IUD A;  4NWC A;  3CSB A;  1GV8 A;  1KA0 A;  3TMG A;  2F8D A;  3T9U A;  4F3G A;  3GXA A;  1FJ6 A;  1MPC A;  5ET7 A;  1NUY A;  4OVP A;  2O1L A;  1K9Y A;  1ZLQ A;  3S9N C;  2H5Y A;  3LC8 A;  4TLM B;  3S9L C;  3PPO A;  1HSE A;  3T66 A;  4KPT A;  2V4C A;  4JVD A;  4F19 A;  1AWB A;  1M5C A;  4OQO A;  1B3G A;  4JSD A;  3KSJ A;  1A40 A;  2RC7 A;  1SI0 A;  4U23 A;  2QSX A;  4Q8R A;  3SEU A;  3TEP A;  4OAN A;  1FPE A;  2V3T A;  1D9V A;  3KJ7 A;  1TFD A;  2F3D A;  2KQZ A;  4JVC A;  2R8T A;  1UTB B;  3EHS A;  2PCR A;  4EXK A;  4JDF A;  4NG7 A;  1DOT A;  2XX9 A;  1YPN A;  2DYX A;  1GGG A;  2A5T A;  2ALU A;  2O84 X;  2I3W A;  1FQE A;  4NF4 B;  3UA8 A;  3PV0 E;  5I59 B;  3K1M A;  2HZK A;  2VT5 A;  4P0I A;  1RKM A;  3SEV A;  3SKP A;  1IME A;  1FPD A;  4GF8 A;  3G3I A;  5T3J A;  1IQ7 A;  4LP2 B;  2XXK A;  1MY1 A;  4PDH A;  2Z8F A;  1NH8 A;  3G3K A;  3PUY E;  1P1U A;  4ZED A;  1MDQ A;  1O7T A;  3K4U A;  4NN3 A;  4RPO A;  4F31 B;  5IZ3 B;  3KN7 A;  3O29 A;  1IMB A;  4DZ1 A;  4MJO A;  1NI9 A;  3KZG A;  1LBB A;  4GL0 A;  5A5X B;  4QBA A;  1TXF A;  4QFO A;  4BDQ A;  2KLF A;  5I84 A;  2F7A A;  3T0J A;  3BIH A;  3MST A;  3CVG A;  3IOR A;  4HE0 A;  1N7W A;  4IO4 A;  3USD A;  1FTK A;  4UAC A;  3LV0 A;  4NAP A;  2LAO A;  4XTC Q;  4F3B A;  4R9F A;  3V89 B;  1VR5 A;  4OVR A;  5IKB A;  3FXB A;  3QSL A;  1EYJ A;  2ZYK A;  4G68 B;  4U4X A;  1FBG A;  1FPF A;  3SES A;  4R74 A;  2NOO A;  4K3F A;  3RT6 B;  3T22 A;  1B05 A;  5CMB A;  2V84 A;  4N4U A;  4I3E A;  5IZ1 A;  1YYZ A;  4MEV A;  2F7B A;  3FUZ A;  3RUM A;  2B4L A;  3HFU A;  3PD8 A;  5HPQ A;  1LB8 A;  1NMU A;  4OA4 A;  4R2F A;  4HCW A;  3QK6 A;  5JK4 A;  2XWV A;  5H8Q B;  4NED A;  3HO7 A;  4XIG Q;  1LAF E;  2XX7 A;  1KWH A;  4EXL A;  1CB6 A;  4OFO A;  1EYI A;  4O8M A;  4F18 A;  3R7X A;  4YMA A;  1XI6 A;  4KR5 A;  2CEX A;  3EF7 A;  2REJ A;  1LCT A;  4HS7 A;  4BDL A;  1SW2 A;  4PFY A;  5H8N B;  5DEX A;  4YB6 A;  1Y4C A;  2F7C A;  3HHF A;  1LBC A;  3IJX B;  4RK2 A;  2CEY A;  3BFT A;  1J1N A;  1CNQ A;  1DMB A;  3EHT A;  4I9D A;  4PBQ A;  3IL1 B;  3DLN A;  4QFN A;  4EUO A;  1MQG A;  4ZEB A;  2FVZ A;  5ET5 A;  3OMB A;  1B51 A;  1EU8 A;  3Q25 A;  2WX9 A;  1FQF A;  3FJM A;  1M5B A;  3MVY A;  2F97 A;  4R6Y A;  2AL5 A;  4NF4 A;  1IXH A;  3FIR A;  5I59 A;  2RKM A;  1XVX A;  1JEU A;  2Y7P A;  4GVO A;  4POX A;  3S9M C;  2THI A;  3G7W A;  2OWZ A;  1B2H A;  3MJN A;  2Y5L A;  3MUQ A;  4ELO A;  3H7M A;  2RCA A;  3TTK A;  5J16 A;  1XHY A;  2XWI A;  5TP9 B;  2FIX A;  4YKI A;  3CFX A;  4H0W A;  3T9X B;  1WVJ A;  3H6W A;  3MYU A;  1S7Y A;  2HPG A;  5I57 A;  1LEV A;  1OLA A;  4GQO A;  2GQ1 A;  2PFZ A;  2JJK A;  4XEQ A;  2HHM A;  1MXY A;  3G3F A;  4EQB A;  5I5P A;  4H8I A;  4N8Y A;  3NOH A;  3PMV A;  4YB7 A;  5AA4 A;  1A7L A;  5A5L A;  3MPL A;  4THI A;  1H3D A;  2ZYO A;  3S4U A;  1N3X A;  3CFZ A;  1DBZ A;  5I2K B;  3T9H B;  5F7V A;  3C34 A;  2DVC A;  5IGA A;  1NV3 A;  2CZK A;  3MP8 A;  2HXW A;  1B4Z A;  4GRK A;  1FBC A;  2P3N A;  3PGF A;  4JB7 A;  4LZ8 A;  3JZJ A;  3H6U A;  3KJT A;  4MCO A;  2V25 A;  2PT2 A;  4IY6 A;  3V8X B;  2DE2 A;  5JEI A;  2B4M A;  3KG2 A;  1NL5 A;  4YKP A;  4NF8 A;  4IGT A;  4PAK A;  5ET6 A;  2ZZV A;  2P0S A;  1F9B A;  3TCG A;  5DW8 A;  4ZE8 A;  5ITO A;  2VOZ A;  2PVU A;  4FJP A;  4RYA A;  2XXT A;  3IX1 A;  4HE1 A;  4ISU A;  3MVZ A;  3B6T A;  2ZNT A;  1QUK A;  4G8H A;  3TTL A;  1B3E A;  4MH5 A;  1FTM A;  1FTJ A;  2DE3 A;  3K6U A;  2CZH A;  1WOD A;  2XXV A;  1SW5 A;  3RY3 A;  3FVK A;  3Q28 A;  4NX1 A;  2F36 A;  3C33 A;  1LFG A;  2AIX A;  1MDP 1;  3CFL A;  3LUY A;  1JW5 A;  1Y1M A;  4GWX A;  1IXG A;  4G2Z A;  4RPN A;  3IAZ A;  3MPK A;  4DE8 A;  3TFL A;  1DSN A;  3RPW A;  3LR1 A;  1MRP A;  3TCH A;  1LBW A;  3FXQ A;  4PET A;  5I2N A;  4O3B A;  1Q9D A;  3L6H A;  1GVC A;  4MLQ A;  4GWZ A;  3KOS A;  1QJM A;  5H8F B;  3VVE A;  3KEI A;  4OHN A;  2XA5 A;  2PX1 A;  1LGB C;  2FNC A;  4XF5 A;  4POW A;  1LBY A;  1ZJL A;  3VLV A;  1BP5 A;  4P1L A;  1DTZ A;  5K2X A;  2Y7K A;  1O63 A;  2DWA A;  2DWJ A;  3CG3 A;  5DVI A;  2OCU A;  1HSL A;  3S9E A;  1B5I A;  4WED A;  4QFP A;  1FJ9 A;  5FHM A;  4Q30 B;  4MAG A;  4MMP A;  1QKA A;  3H3G A;  1RDY A;  1S50 A;  4X1D A;  1Y1Z A;  5AA2 D;  3HV1 A;  2AYS A;  1ZMG A;  4IR8 A;  3PUW E;  4F22 A;  3K6V A;  2XXY A;  3ZKL A;  1D4N A;  4N6D A;  2PYY A;  3VLU A;  3QUJ A;  3QUF A;  3QXM A;  4GLI A;  3O6H A;  1ZKB A;  3V5A A;  3O2A A;  3TTM A;  4BDM A;  3C35 A;  1Y3P A;  2H25 A;  1PB8 A;  5I58 A;  1LAX A;  1H45 A;  1B0H A;  4P8B A;  2WEF A;  4F29 A;  1L5T A;  4PFR A;  3IOT A;  3O28 A;  4LVQ A;  5EHM A;  2ZZW A;  5TU0 A;  3U93 A;  4H5G A;  4WEP A;  1B7U A;  4O94 A;  3IB2 A;  4F2O A;  4MX6 A;  1Q1K A;  4H65 A;  4FE8 A;  2VHA A;  4MFI A;  4Q5T A;  1MH4 A;  1Y3N A;  1P99 A;  1B7H A;  4JWY A;  4RA1 A;  1US4 A;  4NTL A;  4R6K A;  1D9Q A;  3HN0 A;  4KHZ E;  4H46 A;  3S2V A;  3BFU A;  1N0T A;  5H8H A;  1GTK A;  1ATG A;  4ZS9 A;  4P56 A;  2UVI A;  3RGY A;  3VDF A;  4AS4 A;  3WAF A;  1JET A;  4O3A A;  2RC9 A;  3QYT A;  2ONR A;  4YAH X;  3PPP A;  2QS3 A;  4GBV A;  3O66 A;  4JXI A;  2WYP A;  3GZG A;  2DSF A;  4PAI A;  2ZZX A;  4IO6 A;  3Q27 A;  2FYI A;  5TPA B;  5FTH A;  1AIV A;  4P11 A;  3E9X A;  2HCA A;  1FBH A;  2FIE A;  3K00 A;  4N13 A;  3RT8 A;  1I6Q A;  1USY H;  2ZMB A;  5EYF A;  2XXX A;  3N6U A;  4ESW A;  3RPL B;  5ET8 A;  1MPD A;  4GX6 A;  3MP1 A;  3HPI A;  4OEV A;  2NVU B;  2WBB A;  1BIY A;  1IIT A;  1USY E;  2WBD A;  5I56 A;  5EQ9 A;  1ZTY A;  4C1U A;  3KC0 A;  2G93 A;  1SD3 A;  5DT6 A;  5DVF A;  5ICT A;  1MQI A;  3A3C A;  4GD5 A;  4X9T A;  5KZT A;  1FQB A;  3CHG A;  4MNI A;  1FBF A;  2REG A;  2E1S A;  1SQY A;  2O7I A;  3SEW A;  4FIM A;  2QMX A;  1FTA A;  2Q88 A;  2PBW A;  1US5 A;  1JW4 A;  1VSO A;  3PPQ A;  2ZXT A;  2VGQ A;  4X48 A;  3B6Q A;  4G77 A;  3C36 A;  3LSW A;  4R2B A;  4G8M A;  3ZSF A;  2R6G E;  2Z8D A;  4O7I A;  5CMM A;  4XFE A;  2Q2A A;  4KXP A;  3LSL A;  1MM6 A;  1MY3 A;  2QS2 A;  3AXF A;  4L17 A;  3TQL A;  2H98 A;  3BBR A;  4KQP A;  1PDA A;  4QFL A;  2Y5K A;  3KN3 A;  1FPG A;  1NV6 A;  2OZZ A;  4MF3 A;  1G0I A;  3N6T A;  4PQJ A;  5H8S A;  1BTJ A;  1JP4 A;  1FQC A;  2DQV A;  1A99 A;  4QHQ A;  3CIJ A;  3P7I A;  3ODB A;  4P47 A;  4GWY A;  2O69 A;  2KR0 A;  3W9V A;  4NF6 B;  4OFJ A;  3EHU A;  4MBP A;  3QIM A;  3DM0 A;  1AOV A;  4X04 A;  3FXU A;  4DXC A;  4OZ9 A;  5ITP A;  3FZV A;  3U94 A;  2QL3 A;  3LSF B;  4KI0 E;  1TFA A;  3I6V A;  1ELJ A;  3H6V A;  3OOA A;  3OEN A;  2ABH A;  4G61 A;  3M8U A;  2GHA A;  1QUI A;  3TPA A;  4QSE A;  1NV4 A;  5L9M A;  1FW0 A;  2I3V A;  1I69 A;  4GBW A;  1YAE A;  2Q2C A;  4NQ8 A;  4ZE9 A;  3VE1 B;  3U1O A;  2QFL A;  1QVS A;  4NF5 B;  5DVJ A;  4IB2 A;  2H99 A;  1OLC A;  4KD5 A;  4TOZ A;  2QVV A;  2F3B A;  3ECR A;  2RF1 A;  2P1S A;  3SET A;  5CI5 A;  4PFW A;  2Q9T A;  3CSG A;  1MH3 A;  1A8F A;  4AB5 A;  5AA1 A;  1MQD A;  1JEV A;  4ELQ A;  1NNF A;  5I3S A;  2B3F A;  4F1Y A;  3LSX A;  1DPP A;  3FGS A;  4LN5 A;  3E78 A;  2Q89 A;  2VPO A;  3BIG A;  4HXV A;  3GYY A;  1UTB A;  2UXA A;  4KYE A;  3DP4 A;  1NNT A;  4MLV A;  4ZEC A;  2E0S A;  3MW0 A;  3R6U A;  4YKK A;  2O1M A;  2Z22 A;  1H76 A;  1AH5 A;  3A29 A;  5EQ7 A;  5CMC A;  4PCD A;  4ZDM A;  3MZB A;  3VLW A;  4H6D A;  3KBZ A;  1ZIU A;  3U65 A;  1EZP A;  1Y9U A;  3OSR A;  4DXB A;  2YPN A;  1FTO A;  1XC1 A;  2VP1 A;  1IZ1 A;  2UVH A;  5CC2 A;  1IXC A;  2D5W A;  4FEC A;  4DCY A;  3N5L A;  5ELV A;  3EKI A;  1Y4T A;  2R9J A;  2Q8M A;  5IZ3 A;  4I1D A;  3FVO A;  4MHF A;  2Q74 A;  3V83 A;  1P1O A;  5J1D A;  5A5X A;  2DXR A;  3IFA A;  3N26 A;  4N17 A;  5FHO A;  2PFY A;  3O9P A;  4YZZ A;  4H45 A;  3W9W A;  1QGX A;  3TKD A;  4FAT A;  2H4I A;  1EYK A;  2VD2 A;  4M4G A;  3OEK A;  1UTH B;  3VXB A;  4JWX A;  5JTY B;  1NV0 A;  3ZKK A;  1H43 A;  2I58 A;  2DDK A;  2AL4 A;  1BLF A;  2ZYM A;  4PE3 A;  1Q35 A;  4G68 A;  1N04 A;  1B5H A;  5DTB A;  4IO3 A;  1B6H A;  2HZL A;  5CBR A;  3UN6 A; 
#chains in the Genus database with same CATH homology
 1SYH A;  4KCD A;  3IO6 A;  5EHS A;  2ZNU A;  5B7D A;  1B1H A;  2I0C A;  2XD3 A;  4N07 A;  5FTI A;  2XXQ A;  4E0X A;  4PE5 B;  1B58 A;  2QS1 A;  2HQ0 A;  5LOM A;  1B1X A;  3TAJ A;  5KCJ B;  5L9O A;  5H8Q A;  1SVX B;  4LQ5 A;  2ONK E;  3IOU A;  3SDF A;  1XS5 A;  1R1N A;  1VFE A;  1FQD A;  2X26 A;  4EF2 A;  4NMY A;  4R9G A;  3MWB A;  1R6Z A;  2D21 A;  4YIC A;  4EQ9 A;  3TQW A;  3UOR A;  1OIB A;  3HHG A;  5H8N A;  3OO6 A;  3KGC A;  3K6X A;  2Z23 A;  1MQJ A;  5AE4 A;  2YJP A;  1M5D A;  1QUL A;  3U8Q A;  2Y84 A;  3KOT A;  3SEX A;  4ZEF A;  2A5S A;  2XHD A;  2OK2 A;  2G29 A;  3O6G A;  5B70 A;  4AQ4 A;  1OVT A;  3IB0 A;  5CBS A;  3PUX E;  1SYI A;  1PB7 A;  2DS9 A;  4OER A;  3GLB A;  5M2V A;  1JW1 A;  3SEY A;  3K1P A;  4NE4 A;  2GRV A;  3PMX A;  2V93 A;  5TP9 A;  1OVB A;  2VD3 A;  3BKI B;  1B7Z A;  4LUB A;  4DCX A;  4GL8 A;  1LCF A;  3T96 B;  1EH3 A;  4Z7E A;  3RLF E;  2F6P A;  2X7Q A;  5IAI A;  3RN8 A;  4KFQ A;  1LAH E;  2DWI A;  4Z0I A;  2I4C A;  1M5F A;  2FA7 A;  5I2K A;  4IO5 A;  4GWO A;  1IEJ A;  4OEU A;  4DDD A;  3F11 A;  1OQH A;  3ILT B;  1B3F A;  3I5O A;  1LAG E;  1SW4 A;  4DXU A;  3TYH A;  4QF9 A;  3MVW A;  4DIG A;  3FVG A;  2QJE A;  4LAT A;  3C9H A;  4IGR A;  5FHN A;  1EZ9 A;  3IOV A;  1B52 A;  5K2Y A;  5CM6 A;  4H8J A;  4UA8 A;  2OBG A;  1S9T A;  4KYS A;  4OMB A;  3PD9 A;  3UGW A;  2XXW A;  4C0R A;  3TTN A;  2O68 A;  1N7X A;  3H03 A;  3PU5 A;  4FOR A;  1MY4 A;  2CZL A;  3C31 A;  1B46 A;  1MS7 A;  3H06 B;  1MM7 A;  1UIU A;  1B3H A;  3UP9 A;  4ELP A;  3FAT A;  3JYR A;  4H5F A;  3K2D A;  4JBZ A;  3CG1 A;  3EPE A;  5HBC A;  4EF1 A;  3SER A;  2QMW A;  3OD7 A;  3PPN A;  1N3W A;  4LA9 A;  3ILU B;  3T93 B;  3TDJ A;  1WDN A;  2F78 A;  1FQA A;  2X7P A;  4P0G A;  1D9Y A;  1FTL A;  4KYD A;  1EZO A;  4TLL B;  1XVY A;  2DVZ A;  4IO2 A;  1NKX A;  2O6A A;  2XXH A;  1MY2 A;  4GXS B;  4ONY A;  3K0V A;  4F1V A;  1MXV A;  5H8F A;  3MBP A;  2Q8J A;  3OO9 A;  3MP6 A;  4I8C A;  1YTV A;  1NNK A;  1YCJ A;  3HST A;  5DEX B;  2ANJ A;  1B0L A;  5DYH A;  1GR2 A;  3FVN A;  1QUJ A;  2DOJ A;  1SBP A;  4PFU A;  1HSJ A;  3MAM A;  4LZ7 A;  4G4P A;  3R26 A;  4H1X A;  4U2R A;  3H6T A;  1QKB A;  2M8C A;  1A55 A;  3CRB A;  1R9Q A;  4QFK A;  1II5 A;  2Y7R A;  2RCB A;  1URS A;  3UK4 A;  3G3H A;  1LFH A;  2HEU A;  1NH7 A;  3IB1 A;  4FED A;  4BDO A;  4XKN A;  2XXR A;  4Q0C A;  3M3F A;  2NWJ A;  1LLS A;  2I6E A;  4XKP A;  3DP8 A;  3KFM A;  1P1Q A;  4AB6 A;  5I57 B;  2OWT A;  3TZA A;  1LB9 A;  5KDT B;  3G3G A;  4RK9 A;  4F2Q A;  1H44 A;  1NFT A;  5AA4 B;  4RY1 A;  3MZ1 A;  1B32 A;  3DP6 A;  4JWO A;  3U92 A;  2PMS A;  4OFL A;  4U21 A;  2UVG A;  2W7Y A;  3GBA A;  4N6P A;  4F39 A;  4R73 A;  3I3V A;  3RTW B;  1TWY A;  1FCK A;  4OVJ A;  4QSD A;  4M1V A;  5L8D A;  3A09 A;  1SW1 A;  2ESN A;  3OSQ A;  2DXY A;  1POY 1;  4NF8 B;  3H4Z A;  3OO8 A;  2R71 A;  4R72 A;  5TPA A;  5CMK A;  2GFE A;  2OLB A;  1MG1 A;  3D4G A;  4XKR A;  3D4C A;  1RYO A;  2P2A A;  1LFI A;  3VV5 A;  3MVX A;  1MXX A;  1B40 A;  4OTE A;  1I6B A;  3TEL A;  1CE2 A;  3VVD A;  1QW0 A;  3IOW A;  4ECF A;  2QS4 A;  2XXI A;  3KBR A;  4R75 A;  3VFJ A;  1DTG A;  3KSX A;  1RYX A;  2ZYN A;  1ANF A;  3PUZ E;  4YB5 A;  2B65 A;  4HW8 A;  1ZU0 A;  3GBB A;  4F3P A;  2I48 A;  3O97 A;  4RJZ A;  1D3K A;  2I4B A;  2F5X A;  4U4S A;  3Q29 A;  2ONS A;  1PBP A;  3ZS6 A;  1MQH A;  5I2N B;  3K6W A;  1PEB A;  1XT8 A;  2IEE A;  2F35 A;  3PMW A;  1MPB A;  1AL3 A;  4R6H A;  4U1Z A;  3PPR A;  2QPQ A;  3FJG A;  3T9V A;  2F34 A;  4PFT A;  3EQ1 A;  3M3L A;  4X1B A;  3B6W A;  1M5E A;  5CRY A;  1Y20 A;  2PT1 A;  2OJT A;  4DLD A;  3FJ7 A;  3IK6 B;  2H9B A;  2IA4 A;  4XXU A;  3OEM A;  1UIV A;  4ELR A;  3LBS A;  2RC8 A;  4OES A;  3TUS A;  4RXL A;  4HCY A;  5KDT A;  1MXW A;  2V3U A;  3C32 A;  3U72 A;  4NF6 A;  3FXR A;  4HTG A;  1SDX A;  1ZBM A;  2GHB A;  4GXA A;  4JSO A;  3Q26 A;  5ISU A;  4C1T A;  1JVY A;  4H67 A;  3UIF A;  3K1N A;  3PUV E;  1JNF A;  4TQU Q;  4YU0 A;  2Y7I A;  3OEL A;  2XXU A;  5I58 B;  3ONM A;  1MY0 A;  4YKJ A;  4FEB A;  4KCC A;  3CI8 A;  3OXN A;  1DPE A;  1BKA A;  2DE4 A;  2I49 A;  4PP0 A;  4GIZ A;  2O51 A;  3DEL B;  3VVF A;  2GH9 A;  1N76 A;  3G3J A;  4E0W A;  2OWS A;  1MXZ A;  3FV2 A;  2UYE A;  4LZ5 A;  5AA2 B;  3OO7 A;  4NF5 A;  1B4H A;  4G68 C;  1T0K A;  3C4M A;  4BLA A;  3E13 X;  4I62 A;  1PBQ A;  5H8H B;  4WKM A;  3A3U A;  4G8N A;  2D3I A;  3IJO B;  4RNS A;  3JV9 A;  4NWD A;  4F1U A;  4FAJ A;  1AMF A;  3IR1 A;  3FAS A;  2HAV A;  1VFD A;  4F3S A;  4OXV A;  3K02 A;  5BUU A;  4O3C A;  3K01 A;  3M3K A;  1TT1 A;  2HAU A;  4U1O A;  4OET A;  3N94 A;  3KN8 A;  2HFB A;  4XKQ A;  1JVX A;  3O6I A;  1LST A;  3MQ9 A;  4ZEK A;  2DWH A;  1P1N A;  4IY5 A;  4ZZE A;  1R9L A;  4BDR A;  3CR9 A;  2UVJ A;  2UYF A;  1PC3 A;  2XD2 A;  1A54 A;  5I56 B;  2Y7W A;  4GFR A;  4YMB A;  3IO4 A;  5AA3 A;  3RNN A;  3W15 C;  2XX8 A;  4GOT A;  3TTR A;  3THI A;  1UQW A;  1XOC A;  2A5T B;  5HM4 B;  4OYV A;  3TOD A;  1B5J A;  3MC2 A;  2RIN A;  2Z8E A;  4ZEI A;  5BWJ A;  3WAE A;  1O64 A;  2QRY A;  4IO7 A;  3TCF A;  4ND9 A;  1B9J A;  4BDN A;  1B3L A;  3RQT A;  2BJJ X;  2WKY A;  1UTH A;  1NNP A;  1Y3Q A;  4LQ2 A;  5JTY A;  2I0B A;  2ZNS A;  1Z7M E;  3VXC A;  4QRZ A;  1IXI A;  3QAX A;  2CMO A;  1I6A A;  4QSC A;  3FD3 A;  1VE4 A;  1JQF A;  3EN3 A;  3L6G A;  1PB9 A;  2O7U A;  4EDP A;  3B7D A;  5L9S A;  2XXP A;  3E4R A;  1Z7N E;  1A8E A;  5ICQ A;  4ESX A;  2V3Q A;  3MZ9 A;  2NXO A;  1OMP A;  4OEN A;  2F6G A;  5KCJ A;  3HCQ A;  4EQ7 A;  5F1Q A;  2B3B A;  2DP8 A;  4OWD A;  1P1W A;  5AA2 A;  1SI1 A;  2YLN A;  3FV1 A;  1OQG A;  1URG A;  1IIW A;  4U22 A;  3RTF B;  4WXJ A;  1N84 A;  1MXU A;  2NUV A;  3E3K A;  1URD A;  4LON B;  4ZZA A;  1POT A;  1IUD A;  4NWC A;  3CSB A;  1GV8 A;  3TMG A;  2F8D A;  3T9U A;  4F3G A;  3GXA A;  1MPC A;  2O1L A;  1ZLQ A;  3S9N C;  2H5Y A;  3LC8 A;  4TLM B;  3S9L C;  3PPO A;  1HSE A;  3T66 A;  4KPT A;  4F19 A;  1M5C A;  4OQO A;  1B3G A;  4JSD A;  3KSJ A;  1A40 A;  2RC7 A;  1SI0 A;  4U23 A;  2QSX A;  4Q8R A;  3SEU A;  3TEP A;  2V3T A;  1D9V A;  3KJ7 A;  1TFD A;  1UTB B;  3EHS A;  4EXK A;  4JDF A;  1DOT A;  2XX9 A;  1YPN A;  2DYX A;  1GGG A;  2A5T A;  2ALU A;  2O84 X;  2I3W A;  1FQE A;  4NF4 B;  3UA8 A;  3PV0 E;  5I59 B;  3K1M A;  2HZK A;  4P0I A;  1RKM A;  3SEV A;  3SKP A;  4GF8 A;  3G3I A;  1IQ7 A;  4LP2 B;  1MY1 A;  2Z8F A;  1NH8 A;  3G3K A;  3PUY E;  1P1U A;  4ZED A;  1MDQ A;  1O7T A;  3K4U A;  4RPO A;  4F31 B;  3KN7 A;  3O29 A;  4DZ1 A;  3KZG A;  1LBB A;  4GL0 A;  5A5X B;  1TXF A;  4QFO A;  4BDQ A;  2KLF A;  5I84 A;  2F7A A;  3CVG A;  3IOR A;  1N7W A;  4IO4 A;  3USD A;  1FTK A;  4UAC A;  2LAO A;  4XTC Q;  4F3B A;  4R9F A;  3V89 B;  1VR5 A;  5IKB A;  3QSL A;  2ZYK A;  4G68 B;  4U4X A;  3SES A;  4R74 A;  2NOO A;  4K3F A;  3RT6 B;  3T22 A;  1B05 A;  5CMB A;  2V84 A;  2F7B A;  3FUZ A;  3RUM A;  3PD8 A;  5HPQ A;  1LB8 A;  1NMU A;  4R2F A;  4HCW A;  3QK6 A;  5JK4 A;  5H8Q B;  4NED A;  3HO7 A;  4XIG Q;  1LAF E;  2XX7 A;  1KWH A;  4EXL A;  1CB6 A;  4OFO A;  4F18 A;  3R7X A;  4YMA A;  4KR5 A;  3EF7 A;  2REJ A;  1LCT A;  4HS7 A;  4BDL A;  1SW2 A;  4PFY A;  5H8N B;  5DEX A;  4YB6 A;  1Y4C A;  2F7C A;  3HHF A;  1LBC A;  3IJX B;  4RK2 A;  3BFT A;  1J1N A;  1DMB A;  3EHT A;  4I9D A;  3IL1 B;  3DLN A;  4QFN A;  4EUO A;  1MQG A;  4ZEB A;  3OMB A;  1B51 A;  1EU8 A;  3Q25 A;  1FQF A;  3FJM A;  1M5B A;  3MVY A;  2F97 A;  4R6Y A;  2AL5 A;  4NF4 A;  1IXH A;  3FIR A;  5I59 A;  2RKM A;  1XVX A;  1JEU A;  2Y7P A;  4GVO A;  4POX A;  3S9M C;  2THI A;  3G7W A;  1B2H A;  3MJN A;  3MUQ A;  4ELO A;  3H7M A;  2RCA A;  3TTK A;  1XHY A;  5TP9 B;  4YKI A;  3CFX A;  4H0W A;  3T9X B;  1WVJ A;  3H6W A;  1S7Y A;  5I57 A;  1OLA A;  4GQO A;  1MXY A;  3G3F A;  4EQB A;  4H8I A;  3PMV A;  4YB7 A;  5AA4 A;  1A7L A;  3MPL A;  4THI A;  1H3D A;  2ZYO A;  3S4U A;  1N3X A;  3CFZ A;  5I2K B;  3T9H B;  5F7V A;  3C34 A;  2DVC A;  3MP8 A;  2HXW A;  1B4Z A;  4GRK A;  3PGF A;  4JB7 A;  4LZ8 A;  3JZJ A;  3H6U A;  3KJT A;  3V8X B;  2V25 A;  2PT2 A;  4IY6 A;  2DE2 A;  5JEI A;  3KG2 A;  1NL5 A;  4YKP A;  4NF8 A;  4IGT A;  2P0S A;  1F9B A;  3TCG A;  4ZE8 A;  5ITO A;  2VOZ A;  2PVU A;  4FJP A;  4RYA A;  2XXT A;  3IX1 A;  4ISU A;  3MVZ A;  3B6T A;  2ZNT A;  1QUK A;  4G8H A;  3TTL A;  1B3E A;  4MH5 A;  1FTM A;  1FTJ A;  2DE3 A;  3K6U A;  1WOD A;  2XXV A;  1SW5 A;  3RY3 A;  3FVK A;  3Q28 A;  2F36 A;  3C33 A;  1LFG A;  2AIX A;  1MDP 1;  3CFL A;  3LUY A;  1JW5 A;  1Y1M A;  1IXG A;  4G2Z A;  4RPN A;  3IAZ A;  3MPK A;  4DE8 A;  3TFL A;  1DSN A;  3RPW A;  3LR1 A;  1MRP A;  3TCH A;  3FXQ A;  4PET A;  5I2N A;  4O3B A;  3L6H A;  1GVC A;  4MLQ A;  5H8F B;  3KOS A;  1QJM A;  3VVE A;  3KEI A;  4OHN A;  2PX1 A;  1LGB C;  2FNC A;  4POW A;  1ZJL A;  3VLV A;  1BP5 A;  1DTZ A;  5K2X A;  2Y7K A;  1O63 A;  2DWA A;  2DWJ A;  3CG3 A;  5DVI A;  2OCU A;  1HSL A;  3S9E A;  1B5I A;  4WED A;  4QFP A;  5FHM A;  4Q30 B;  1QKA A;  3H3G A;  1S50 A;  4X1D A;  1Y1Z A;  5AA2 D;  3HV1 A;  2AYS A;  1ZMG A;  3PUW E;  4F22 A;  3K6V A;  2XXY A;  3ZKL A;  1D4N A;  2PYY A;  3VLU A;  3QUJ A;  3QUF A;  3QXM A;  4GLI A;  3O6H A;  1ZKB A;  3V5A A;  3O2A A;  3TTM A;  4BDM A;  3C35 A;  1Y3P A;  2H25 A;  1PB8 A;  5I58 A;  1LAX A;  1H45 A;  1B0H A;  4F29 A;  1L5T A;  3IOT A;  3O28 A;  4LVQ A;  5EHM A;  5TU0 A;  3U93 A;  4H5G A;  4WEP A;  1B7U A;  3IB2 A;  4F2O A;  1Q1K A;  4H65 A;  4FE8 A;  2VHA A;  4MFI A;  4Q5T A;  1MH4 A;  1Y3N A;  1P99 A;  1B7H A;  4JWY A;  4RA1 A;  1US4 A;  4NTL A;  4R6K A;  3HN0 A;  4KHZ E;  3S2V A;  3BFU A;  1N0T A;  5H8H A;  1GTK A;  1ATG A;  4ZS9 A;  2UVI A;  3RGY A;  3VDF A;  3WAF A;  1JET A;  4O3A A;  2RC9 A;  3QYT A;  2ONR A;  4YAH X;  3PPP A;  2QS3 A;  3O66 A;  4JXI A;  3GZG A;  2DSF A;  4IO6 A;  3Q27 A;  2FYI A;  5TPA B;  5FTH A;  1AIV A;  4P11 A;  3E9X A;  2HCA A;  3K00 A;  4N13 A;  3RT8 A;  1I6Q A;  1USY H;  2ZMB A;  5EYF A;  2XXX A;  3N6U A;  4ESW A;  1MPD A;  3MP1 A;  3HPI A;  4OEV A;  2NVU B;  1BIY A;  1IIT A;  1USY E;  5I56 A;  1ZTY A;  4C1U A;  2G93 A;  1SD3 A;  5DT6 A;  5DVF A;  5ICT A;  1MQI A;  3A3C A;  4GD5 A;  4X9T A;  5KZT A;  1FQB A;  2REG A;  2E1S A;  1SQY A;  2O7I A;  3SEW A;  4FIM A;  2QMX A;  2Q88 A;  2PBW A;  1US5 A;  1JW4 A;  1VSO A;  3PPQ A;  2ZXT A;  4X48 A;  2VGQ A;  3B6Q A;  4G77 A;  3C36 A;  3LSW A;  4R2B A;  4G8M A;  3ZSF A;  2R6G E;  2Z8D A;  5CMM A;  2Q2A A;  3LSL A;  1MM6 A;  1MY3 A;  2QS2 A;  3AXF A;  4L17 A;  3TQL A;  2H98 A;  3BBR A;  4KQP A;  1PDA A;  4QFL A;  3KN3 A;  2OZZ A;  4MF3 A;  3N6T A;  4PQJ A;  5H8S A;  1BTJ A;  1FQC A;  2DQV A;  1A99 A;  4QHQ A;  3CIJ A;  3P7I A;  3ODB A;  2O69 A;  3W9V A;  4NF6 B;  4OFJ A;  3EHU A;  4MBP A;  3QIM A;  3DM0 A;  1AOV A;  3FXU A;  4DXC A;  4OZ9 A;  5ITP A;  3FZV A;  3U94 A;  2QL3 A;  3LSF B;  4KI0 E;  1TFA A;  3I6V A;  1ELJ A;  3H6V A;  3OOA A;  3OEN A;  2ABH A;  3M8U A;  2GHA A;  1QUI A;  3TPA A;  4QSE A;  5L9M A;  1FW0 A;  2I3V A;  1I69 A;  1YAE A;  2Q2C A;  4ZE9 A;  3VE1 B;  3U1O A;  1QVS A;  4NF5 B;  5DVJ A;  4IB2 A;  2H99 A;  1OLC A;  4KD5 A;  4TOZ A;  3ECR A;  2RF1 A;  2P1S A;  3SET A;  5CI5 A;  4PFW A;  2Q9T A;  3CSG A;  1MH3 A;  1A8F A;  4AB5 A;  5AA1 A;  1MQD A;  1JEV A;  4ELQ A;  1NNF A;  2B3F A;  4F1Y A;  3LSX A;  1DPP A;  3FGS A;  2Q89 A;  1UTB A;  2UXA A;  4KYE A;  3DP4 A;  1NNT A;  4MLV A;  4ZEC A;  2E0S A;  3MW0 A;  3R6U A;  4YKK A;  2O1M A;  2Z22 A;  1H76 A;  1AH5 A;  5CMC A;  4ZDM A;  3MZB A;  3VLW A;  4H6D A;  1ZIU A;  1EZP A;  1Y9U A;  3OSR A;  4DXB A;  2YPN A;  1FTO A;  1XC1 A;  2VP1 A;  1IZ1 A;  2UVH A;  5CC2 A;  1IXC A;  2D5W A;  4FEC A;  4DCY A;  3N5L A;  5ELV A;  1Y4T A;  2R9J A;  4I1D A;  3FVO A;  3V83 A;  1P1O A;  5J1D A;  5A5X A;  2DXR A;  3N26 A;  5FHO A;  3O9P A;  4YZZ A;  3W9W A;  3TKD A;  4FAT A;  2H4I A;  2VD2 A;  4M4G A;  3OEK A;  1UTH B;  3VXB A;  4JWX A;  5JTY B;  3ZKK A;  1H43 A;  2I58 A;  2AL4 A;  1BLF A;  2ZYM A;  1Q35 A;  4G68 A;  1N04 A;  1B5H A;  5DTB A;  4IO3 A;  1B6H A;  2HZL A;  5CBR A;  3UN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...