4Z7EA

Soluble binding domain of lmo1422 abc-transporter
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
270
structure length
270
Chain Sequence
EITIAGKLGAEPEILINMYKLVIEDETDLKVNVKPNMGKTSFVFNALKSGDIDIYPEFTGTVLETFLKENAKTHDPEEVYTQARDGLAKDFDMTYLKPMKYNNTYALAVSPEFAKENNLEKISDLGPVSDQVKAGFTLEFKDRSDGYKGIQDKYGLTFSNLKTMEPKLRYNAIKSGDINLLDAYSTDSELAQYKLKVLEDDQQLFPPYQGAPLMLTKTLDKYPELKKPLNKLAGKITDDEMRKMNYEVNVNGKSAYTVAKDYLKDQGIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1422 protein
publication title Crystal Structure of the Substrate-Binding Domain from Listeria monocytogenes Bile-Resistance Determinant BilE
doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transport protein
total genus 98
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4z7eA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4z7eA02
1JETA 4KQPA 4RK2A 1B51A 3OO8A 4F3SA 4G2ZA 4ZE9A 3C4MA 1B7UA 2LAOA 2UYFA 4OERA 4EF2A 2ZYOA 3KZGA 3JYRA 1LBBA 2DWJA 4G68B 1WDNA 1OIBA 1B3FA 2D3IA 3HCQA 1URDA 2VOZA 4KI0E 1EZOA 4LP2B 1BP5A 3O6HA 4ESXA 3CI8A 3H03A 5TPAA 1POTA 2RC7A 4PFUA 4OENA 4KR5A 3TTMA 3RTWB 4ECFA 3CG3A 2B3FA 3UP9A 2ONSA 3DM0A 3IJOB 3PUVE 3W9VA 5DVJA 1P1WA 4IO5A 4ZECA 3TQWA 3IB1A 3OD7A 3TELA 3EHSA 2OBGA 1B7ZA 4POXA 2XX9A 4U1ZA 4ZEFA 2HFBA 4FAJA 3OENA 4NF4A 2UXAA 3HV1A 2HQ0A 3PPQA 1D9YA 5AA4A 4U21A 3MAMA 4OMBA 4I8CA 4FEBA 1D3KA 4KCCA 1LGBC 3OEKA 1N3WA 2RCAA 3Q26A 4C0RA 2XXIA 3SESA 1I6BA 1PC3A 4MLQA 2O69A 1UQWA 3ILTB 1GTKA 2HCAA 4PFWA 5I56B 4GD5A 1B32A 3PPPA 2RCBA 4G8HA 4LZ5A 1AOVA 1MS7A 3MVWA 3RGYA 1MY1A 1FTLA 1SYIA 3PMWA 2F36A 4QFOA 3QIMA 2V3QA 2Q2AA 3KN8A 1IXGA 4RPNA 4O3CA 1MPDA 1LFIA 4LQ5A 1Y9UA 1OQGA 1US5A 4YICA 1HSEA 4JWXA 4NMYA 4ELQA 5CC2A 2CMOA 1B52A 2R6GE 1B7HA 2Q88A 4U23A 1MQHA 3TCGA 1POY1 1EU8A 2H9BA 5H8NB 3HN0A 1H3DA 5I2NA 4OTEA 5BWJA 1SI0A 4EXKA 3IB0A 5TPAB 3K01A 2W7YA 3U92A 4Z7EA 3SERA 1DPEA 3B6QA 1I6AA 1XVXA 5TP9A 3LSFB 4ELRA 1VSOA 2Y7RA 3PV0E 4BLAA 3VXBA 2VD3A 2PX1A 4MBPA 3ODBA 5JTYA 3USDA 3KN7A 3MUQA 3U72A 4DCXA 5CBSA 3MVYA 4YB5A 2DP8A 5K2YA 3ILUB 1ATGA 4KFQA 1MXVA 1FCKA 2HAVA 1A40A 1R1NA 3FJ7A 4JWOA 3L6HA 4KHZE 2F8DA 1US4A 4HW8A 1IXCA 3HHGA 5FTHA 4H1XA 5FTIA 5AA2A 3ONMA 1IIWA 1URSA 4NF4B 1DOTA 4R6YA 3HPIA 4OEUA 3OO7A 2R9JA 1N04A 5AA4B 5J1DA 1MXUA 3EQ1A 4THIA 1Y4CA 3O2AA 4YMBA 1O7TA 1LFHA 3FASA 3BBRA 4DIGA 3Q27A 4EUOA 2IA4A 2O1MA 1FQDA 3IJXB 2XXVA 4POWA 3VVDA 3PMVA 1R9QA 3H7MA 3PU5A 1TFAA 2R71A 4QRZA 4KD5A 3HSTA 4JB7A 4LZ8A 1VR5A 3TAJA 2I4CA 3UIFA 3TCHA 4OETA 4N07A 5IKBA 4OESA 3C9HA 5H8HA 3H6TA 3VV5A 4ND9A 4N13A 3CR9A 2NWJA 3MZ9A 5I84A 1B5HA 2V3UA 1QUIA 4P0GA 1B2HA 3E9XA 5I57B 3FJMA 1Y4TA 5I2NB 1LLSA 2ABHA 4M4GA 3V89B 3QK6A 2NXOA 1JW4A 1RKMA 3SKPA 2RF1A 4TQUQ 2XXUA 1Q1KA 1SYHA 3RY3A 2DE2A 4O3AA 1ZU0A 1A8EA 1NNPA 3AXFA 5CBRA 3RT8A 1RYXA 3RLFE 4U22A 4IO2A 4QFLA 3K4UA 5JTYB 2H25A 4IO7A 1ZIUA 2I0CA 3PUXE 2Q2CA 3EN3A 2M8CA 2HAUA 4U1OA 1MQIA 4IY5A 4ZZAA 3LC8A 1S50A 3DP8A 1YTVA 4NF6A 5EHMA 4QSDA 1OVBA 1USYH 4OYVA 5AA2B 3I5OA 2XXPA 2ESNA 4ZEDA 4LATA 5L8DA 3H6UA 4ONYA 1FW0A 3KFMA 5HPQA 3RT6B 1JNFA 3Q25A 3LSLA 4ZEKA 3C35A 4ZS9A 1XHYA 1OVTA 4OVJA 1AIVA 1MPBA 4QSCA 1MDP1 1LAHE 4L17A 1B4ZA 3N94A 3ZSFA 3SDFA 3K1NA 4G8MA 3IX1A 3UGWA 1FTMA 2Q9TA 3A09A 1MQDA 1H44A 1ZTYA 4G68C 3PMXA 4G8NA 2DSFA 5H8HB 1H45A 2ZNTA 2F5XA 4LA9A 5H8QA 1ZJLA 3E3KA 2P1SA 4F22A 4YB7A 1B6HA 1MDQA 3IOUA 3MQ9A 4LZ7A 3D4CA 2Y7KA 3S4UA 1LAXA 1Y3NA 3LSWA 4YMAA 4EQ7A 3S2VA 1HSJA 1PB7A 4WXJA 4C1TA 5I59A 1XC1A 2HXWA 1BTJA 3LUYA 1B1HA 1LAFE 4LONB 3H6WA 2OK2A 2O1LA 4R9FA 2DVZA 2GHBA 3K00A 4F1VA 3TTLA 1B40A 3G3HA 4BDMA 4YZZA 3KJ7A 4PE5B 1VFEA 3V5AA 4H8JA 3R7XA 1PEBA 3K02A 2XXXA 5HBCA 1MY2A 1D9VA 4GVOA 4GWOA 1UIUA 4GLIA 3UN6A 3C36A 1PBQA 4OXVA 4R75A 4NE4A 1JW5A 2NOOA 3M3KA 3TMGA 2Y7PA 4TLLB 2Q8JA 3BFUA 1Y20A 3QSLA 3A3CA 1N7WA 2HZKA 2ZNUA 1M5DA 3S9MC 4IO4A 2UVGA 3K2DA 2I3WA 1SW4A 3WAEA 5CMMA 4NEDA 1B5IA 5BUUA 5ICTA 5I2KB 1ZKBA 2XD3A 1LCFA 3TDJA 2AIXA 4NF5A 5AA2D 3SEWA 1MPCA 4YKJA 4KPTA 4FE8A 4H5GA 3OEMA 5ITPA 3UK4A 3FXUA 4YKIA 4LQ2A 5I58A 1CB6A 4XIGQ 3MJNA 3O9PA 5DEXA 4F31B 1GR2A 5H8QB 1XS5A 4R6HA 5KCJA 2PMSA 4OQOA 1QVSA 1FQAA 1B3EA 5KDTA 2NUVA 4QFNA 5I59B 1OMPA 3RTFB 3CIJA 3PUWE 5F7VA 3U1OA 4GF8A 2O51A 3K6VA 4IGRA 2F35A 4XTCQ 2P0SA 5ICQA 2ANJA 1FTJA 4RY1A 4ZZEA 4IO3A 3FVKA 2OJTA 2AYSA 3CSGA 4Z0IA 4F2OA 4IB2A 4QFKA 4ZDMA 1LB8A 3VFJA 3HO7A 3U8QA 4DE8A 5CRYA 2E1SA 5L9SA 3OXNA 3VE1B 1N84A 3M3FA 3TTKA 1NFTA 2Z22A 4QSEA 1IQ7A 1FQEA 4XKNA 4EQBA 4RK9A 1URGA 3TFLA 5CI5A 3SEUA 4KYSA 1WVJA 2AL4A 1QUJA 1LB9A 1M5CA 4RJZA 1P1OA 1FTOA 3ZKKA 3OO9A 1LFGA 3SEXA 4YB6A 1EZ9A 2IEEA 3IO4A 1MXWA 2D21A 3W15C 1I6QA 1JQFA 3EHUA 1JVXA 1B05A 2F34A 4NF5B 4NF8A 5CMCA 4Q30B 4F1UA 3H06B 4DZ1A 2O84X 3K6XA 5DYHA 5A5XA 3RUMA 3DP4A 5AE4A 2QS4A 5I58B 1ZBMA 5DEXB 1TWYA 3C33A 2H99A 5KCJB 3ECRA 2I3VA 3FUZA 2I49A 1Y3QA 3MPLA 2E0SA 2NVUB 5KDTB 2Y84A 1Z7ME 3PPOA 3QYTA 2KLFA 3T66A 3DELB 5H8FA 1LCTA 4QF9A 2I4BA 2Y7IA 1B0LA 1BLFA 2PYYA 3OMBA 4NTLA 4RNSA 2WKYA 3IR1A 1NL5A 1T0KA 2UVHA 4NWCA 5ITOA 3CSBA 4H6DA 2OCUA 5JK4A 2XXTA 3IOTA 2GHAA 4PQJA 4E0WA 2P2AA 1A55A 2DYXA 4ELOA 1MRPA 2YLNA 3CFLA 3IK6B 2XX8A 5EHSA 4P11A 3KGCA 2Q89A 1SQYA 4XKRA 4TLMB 4UACA 1ELJA 1MXZA 1R6ZA 4GFRA 1SW5A 5FHOA 3UA8A 2FA7A 3B6TA 3S9NC 2XXWA 3RNNA 4H65A 3CFXA 3FXRA 4AB5A 2RINA 2RKMA 3U94A 2Z8DA 2O6AA 3TZAA 3H4ZA 4BDNA 4MLVA 3OSRA 4M1VA 1FQCA 1B1XA 4OFOA 5JEIA 2DS9A 3IAZA 5TP9B 1L5TA 4K3FA 2DWIA 4AQ4A 1NKXA 1NMUA 5DTBA 1XOCA 3N26A 4KYEA 3KN3A 4R6KA 1MY4A 3BFTA 4YKKA 5CMKA 4BDQA 2QS3A 3VLWA 1FQBA 4H67A 5FHNA 4IO6A 1B46A 2HEUA 4NF8B 4FECA 2XXHA 3TEPA 4R73A 4MFIA 3G3GA 1N7XA 3QUJA 2Z8FA 2F78A 1YPNA 1QJMA 4PETA 2PBWA 5A5XB 2RC9A 2PT1A 4OWDA 1IUDA 3Q28A 1R9LA 3MZBA 1P1UA 3GLBA 4OEVA 3SETA 1S7YA 2UYEA 4I62A 3TTNA 3GXAA 1Y1MA 1SD3A 4JWYA 3OSQA 3TYHA 1D4NA 3D4GA 4Q5TA 5B7DA 1B3LA 2ONKE 5H8FB 1Y1ZA 5HM4B 3IORA 1HSLA 3UORA 2VD2A 2QMXA 1M5FA 1GGGA 5AA1A 3FJGA 1VE4A 1N3XA 1XVYA 5FHMA 2V84A 3G3FA 1N0TA 4MH5A 2OZZA 1SVXB 3FV2A 4WEDA 3IOWA 1NH7A 3EPEA 3KBRA 1IZ1A 2I0BA 4YKPA 1P1QA 1F9BA 3PPRA 3FIRA 4ESWA 2F6PA 3DP6A 2QSXA 3L6GA 2H5YA 2G93A 4R72A 4F39A 2X7PA 3QXMA 1IXHA 4X48A 1USYE 4KCDA 1NNKA 2DXRA 2XX7A 2DOJA 1VFDA 1OLCA 4XKQA 3R6UA 3E4RA 1M5EA 4F3BA 3QUFA 1DPPA 3TTRA 1UTBA 2FYIA 3KEIA 3T9VA 1QKAA 2UVIA 4OFLA 3A3UA 1MG1A 2ZYNA 3BKIB 3G7WA 2A5SA 3K1PA 3P7IA 3K6UA 2DWAA 1MH3A 3MP8A 5TU0A 3MBPA 4QHQA 1MXYA 3U93A 2UVJA 3FD3A 1QULA 1N76A 3M3LA 4RPOA 2F7CA 1YAEA 1NNTA 5ISUA 2ZXTA 4NF6B 5F1QA 4C1UA 2BJJX 4R2BA 5CM6A 4PFTA 3G3KA 3MP1A 2REGA 3IL1B 5H8NA 1OLAA 3C31A 4H8IA 3FGSA 1MQJA 3MC2A 4HS7A 1MQGA 3QAXA 3TCFA 4F2QA 3MWBA 1Z7NE 4YU0A 4EXLA 3H3GA 2I48A 2ZNSA 1SW1A 4JSOA 4XXUA 3V8XB 3G3JA 4HTGA 3T93B 2ONRA 4TOZA 3FVOA 3T9UA 2PVUA 1WODA 3F11A 4OFJA 2I6EA 3O6IA 3PD8A 2HZLA 3K1MA 3LBSA 1ZMGA 3TKDA 1EH3A 2QL3A 3FVNA 3MP6A 5M2VA 1PDAA 3MW0A 1PB8A 1ANFA 1DTZA 2X26A 1B58A 3VVFA 3I6VA 4QFPA 1TFDA 1IEJA 3VLUA 1II5A 3N5LA 4JDFA 5AA3A 3DLNA 3RQTA 4BDLA 4H5FA 4DDDA 1NNFA 1B3GA 5K2XA 2XD2A 1M5BA 4BDRA 5EYFA 1XT8A 4O3BA 1DSNA 2GH9A 4WKMA 1S9TA 1SW2A 1UTBB 2GFEA 3LR1A 4H0WA 3EHTA 4PP0A 4ELPA 4FJPA 4GRKA 4UA8A 2ALUA 2F6GA 4NWDA 1PB9A 3FXQA 1MM7A 2QPQA 1BIYA 3B7DA 1IITA 3H6VA 2H4IA 2A5TA 3T9HB 3I3VA 4RXLA 1QUKA 4XKPA 4ZEIA 4YAHX 4F1YA 4DLDA 1RYOA 1GVCA 2AL5A 5I57A 3V83A 1LBCA 4MF3A 1JEVA 3GBAA 1B9JA 3CVGA 1TXFA 1SBPA 2G29A 4F3GA 3CG1A 3N6TA 1JVYA 3TUSA 4LUBA 4WEPA 1AL3A 3G3IA 4R2FA 2OWSA 1I69A 5H8SA 1ZLQA 3GBBA 4ZEBA 2DQVA 3RPWA 3JZJA 2F97A 2THIA 2F7AA 3S9LC 4GXAA 2V93A 1KWHA 3ZS6A 3O28A 4RA1A 2DE3A 2FNCA 4LVQA 2VP1A 3FZVA 4OZ9A 2VGQA 4EF1A 1B3HA 4GQOA 3LSXA 1SI1A 4R9GA 4IY6A 1A8FA 1FQFA 3KSJA 2B3BA 3OO6A 4I9DA 3C34A 4F18A 1OQHA 1P1NA 3M8UA 1LAGE 1PBPA 2Y7WA 4GXSB 3W9WA 2CZLA 5IAIA 1IXIA 3IO6A 2F7BA 1B0HA 1AH5A 5DVIA 3VLVA 4X9TA 3C32A 1TT1A 5LOMA 2RC8A 2QMWA 3PUZE 1FTKA 4F29A 3THIA 1A54A 4HCWA 4BDOA 4JXIA 3GZGA 3O29A 2XHDA 1DMBA 2O7UA 2A5TB 3O97A 2DE4A 1MH4A 5CMBA 3WAFA 1GV8A 3KOSA 4DXCA 3TPAA 1EZPA 2H98A 4Q8RA 4KYDA 1UIVA 2OWTA 2QRYA 1MY3A 3VXCA 3E13X 4ZE8A 5L9MA 4OHNA 3CFZA 4R74A 3R26A 1A7LA 5B70A 3B6WA 4Q0CA 2DXYA 2ZYMA 4ISUA 4G4PA 3IB2A 1NH8A 2DVCA 4DXBA 5DT6A 3T9XB 1YCJA 4G77A 3PPNA 3OELA 3TODA 1UTHA 1Y3PA 1H43A 3MVXA 2OLBA 3ZKLA 4JSDA 2Z8EA 3FVGA 1J1NA 3SEVA 1CE2A 3S9EA 4GOTA 4RYAA 2V3TA 1QW0A 2B65A 2YPNA 2V25A 3TQLA 1JEUA 2Z23A 4FIMA 5DVFA 4G68A 4DCYA 3K0VA 3K6WA 2X7QA 1MY0A 3T22A 2XXQA 2XXYA 4AB6A 4IGTA 3KJTA 3JV9A 3T96B 2ZMBA 2DWHA 4E0XA 2I58A 1B4HA 4X1DA 2D5WA 2GRVA 2YJPA 3CRBA 4X1BA 3IOVA 4GL8A 5L9OA 3FATA 3KG2A 3KSXA 4U4SA 4U2RA 5I2KA 1Q35A 3PUYE 1O64A 3FV1A 5KZTA 3PD9A 4GL0A 3VDFA 1H76A 2O68A 1A99A 4P0IA 5ELVA 3MPKA 4EQ9A 4HCYA 2ZYKA 2QJEA 4FORA 4I1DA 2QS2A 2VHAA 3MZ1A 4N6PA 1P99A 4FEDA 4PFYA 3SEYA 1MM6A 1JW1A 4F19A 4F3PA 1MXXA 1DTGA 1B5JA 2O7IA 3EF7A 3KOTA 3RN8A 3VVEA 4GIZA 2PT2A 3O66A 3N6UA 4U4XA 1AMFA 3MVZA 3OOAA 4EDPA 2REJA 5I56A 2QS1A 4DXUA 1BKAA 4JBZA 3O6GA 1SDXA 1O63A 2XXRA 3HHFA 3Q29A 1UTHB 3PGFA 4FATA 1QKBA 1LSTA
chains in the Genus database with same CATH superfamily
1JETA 4KQPA 4RK2A 1B51A 1FPLA 3OO8A 4F3SA 2VPOA 4G2ZA 4ZE9A 3C4MA 1B7UA 4PF6A 2LAOA 2UYFA 4OERA 4EF2A 2ZYOA 3KZGA 3JYRA 4GWXA 1LBBA 2DWJA 4G68B 2FVZA 1WDNA 1OIBA 1B3FA 2D3IA 1VDWA 3HCQA 1URDA 1RDXA 2VOZA 4KI0E 1EZOA 2XWIA 4LP2B 1BP5A 3O6HA 4GBWA 4ESXA 3CI8A 3H03A 5TPAA 1POTA 2RC7A 4PFUA 4OENA 4KR5A 3TTMA 3RTWB 4ECFA 3CG3A 1G0HA 2B3FA 3UP9A 4NX1A 2ONSA 3DM0A 3IJOB 3PUVE 3MYUA 3W9VA 5DVJA 1P1WA 4IO5A 4HE1A 4ZECA 2CZKA 3TQWA 3IB1A 3OD7A 3TELA 1FPGA 1NV2A 3EHSA 2OBGA 1B7ZA 4POXA 2XX9A 4U1ZA 4ZEFA 2HFBA 1NUZA 4FAJA 3OENA 2WBBA 2VPNA 1BK4A 4NF4A 2UXAA 3HV1A 2HQ0A 3PPQA 1D9YA 5AA4A 4U21A 3MAMA 5DW8A 4OMBA 4LN5A 4I8CA 4FEBA 1D3KA 4KCCA 1LGBC 2XXKA 3OEKA 1N3WA 2RCAA 3Q26A 4C0RA 2XXIA 3SESA 1I6BA 1PC3A 4MLQA 2O69A 1UQWA 4DI4B 4FBPA 4NGUA 3ILTB 1GTKA 2FIEA 2HCAA 4PFWA 5I56B 4GD5A 1B32A 3PPPA 2RCBA 4G8HA 4LZ5A 1AOVA 1MS7A 3MVWA 3RGYA 1MY1A 1FTLA 1SYIA 1FRPA 3PMWA 2F36A 4QFOA 3QIMA 2V3QA 2Q2AA 3KN8A 1IXGA 4PGPA 4RPNA 4O3CA 1MPDA 1LFIA 4LQ5A 1FBGA 1Y9UA 1OQGA 1US5A 4YICA 1LBVA 1HSEA 4JWXA 4NMYA 4ELQA 5CC2A 2CMOA 1B52A 2R6GE 1B7HA 2Q88A 4U23A 1MQHA 4MAGA 3TCGA 1POY1 1EU8A 2H9BA 5H8NB 3HN0A 1H3DA 5I2NA 4OTEA 5BWJA 3T1BA 1SI0A 4NF0A 4EXKA 3IB0A 5TPAB 3K01A 2W7YA 3U92A 4Z7EA 3SERA 1DPEA 1FTAA 3B6QA 4N17A 1I6AA 4PFIA 1XVXA 3HFUA 5EQ7A 5TP9A 3LSFB 4ELRA 1VSOA 2Y7RA 3PV0E 2B4LA 4BLAA 3VXBA 5LDZA 2VD3A 2PX1A 4MBPA 3ODBA 5JTYA 3USDA 3KN7A 3MUQA 3U72A 4DCXA 5CBSA 3MVYA 5LTCA 4YB5A 2DP8A 5K2YA 3ILUB 1ATGA 4KFQA 1MXVA 1FCKA 2HAVA 1Q9DA 1A40A 1R1NA 3FJ7A 4JWOA 3L6HA 4KHZE 2F8DA 1US4A 4HW8A 1IXCA 3HHGA 4NG7A 5FTHA 4H1XA 5FTIA 5AA2A 5EQAA 3NOHA 3ONMA 1IIWA 1URSA 4QBAA 4NF4B 1DOTA 4R6YA 3HPIA 4OEUA 3OO7A 2R9JA 1N04A 5AA4B 5J1DA 1MXUA 3EQ1A 4THIA 1Y4CA 3O2AA 4YMBA 1O7TA 1LFHA 2HPGA 4GBVA 3FASA 3BBRA 4DIGA 4P1EA 3Q27A 4EUOA 2IA4A 2O1MA 5IM2A 1FQDA 3IJXB 2XXVA 4N91A 4GX3A 4POWA 3VVDA 3PMVA 1R9QA 3H7MA 3KC1A 3PU5A 1TFAA 2R71A 1FPJA 4QRZA 4P56A 4KD5A 3HSTA 4JB7A 4LZ8A 1VR5A 3TAJA 2I4CA 4JVCA 3UIFA 3TCHA 4OETA 1YXIA 4N07A 5IKBA 4OESA 3C9HA 5H8HA 3H6TA 3VV5A 4ND9A 4N13A 3CR9A 2NWJA 3MZ9A 5I84A 1B5HA 2V3UA 2L5VA 5EYHA 2PFYA 1QUIA 4P0GA 3EKIA 1B2HA 3E9XA 2R8TA 5I57B 3FJMA 1Y4TA 5I2NB 1LLSA 2ABHA 4M4GA 3V89B 3QK6A 2NXOA 1JW4A 4N8GA 5F24A 1RKMA 3SKPA 2RF1A 4TQUQ 2XXUA 1Q1KA 1SYHA 1D9QA 3RY3A 1EYJA 2DE2A 4O3AA 1ZU0A 1A8EA 1NNPA 3AXFA 5CBRA 3RT8A 1RYXA 3RLFE 4U22A 4IO2A 4QFLA 4NAPA 3K4UA 5JTYB 2H25A 4IO7A 1ZIUA 2I0CA 3PUXE 4G61A 2Q2CA 3EN3A 2M8CA 2XWKA 2HAUA 3A29A 4U1OA 1MQIA 4XF5A 4IY5A 4ZZAA 3LC8A 1S50A 3DP8A 1YTVA 4NF6A 4OA4A 5EHMA 4QSDA 1OVBA 1USYH 4OYVA 5AA2B 4PAFA 1FPKA 3I5OA 2XXPA 2QVVA 2ESNA 1LBZA 4MX6A 1FBHA 4ZEDA 4LATA 5L8DA 3ROJA 3H6UA 4ONYA 1FW0A 3KFMA 5HPQA 3RT6B 1JNFA 3Q25A 3LSLA 4ZEKA 1LBYA 3C35A 3PTYA 4ZS9A 1XHYA 4NQ8A 1OVTA 5FBPA 4OVJA 1AIVA 2XWVA 2FHYA 4P1LA 1MPBA 4QSCA 1MDP1 3SZPA 1LAHE 4L17A 1B4ZA 3N94A 3ZSFA 3SDFA 3K1NA 4G8MA 3IX1A 3UGWA 4GWSA 1FTMA 2Q9TA 3A09A 1FJ9A 1MQDA 1H44A 1ZTYA 4G68C 3PMXA 4G8NA 2DSFA 2F3BA 5IZZA 5H8HB 1H45A 2PFZA 2ZNTA 2F5XA 4LA9A 5ET7A 5H8QA 1ZJLA 3E3KA 2P1SA 4F22A 4YB7A 1B6HA 1MDQA 3IOUA 3MQ9A 4LZ7A 3D4CA 2Y7KA 3S4UA 1LAXA 1Y3NA 1IMCA 3LSWA 4YMAA 4EQ7A 3S2VA 1HSJA 1PB7A 4WXJA 4C1TA 2HXRA 5I59A 1XC1A 2HXWA 1BTJA 3LUYA 1B1HA 1LAFE 4LONB 3H6WA 2OK2A 2O1LA 4R9FA 1FBPA 2DVZA 2GHBA 3K00A 4F1VA 3TTLA 1B40A 3G3HA 4BDMA 4YZZA 3KJ7A 4PE5B 1VFEA 1FPFA 3V5AA 4H8JA 3R7XA 4XEQA 1PEBA 3K02A 1DBZA 2XXXA 5HBCA 1MY2A 1D9VA 4GVOA 4GWOA 1UIUA 1RDZA 4GLIA 3UN6A 1FBCA 1FSAA 3C36A 1AWBA 1PBQA 4OXVA 4R75A 4NE4A 1JW5A 3E78A 2NOOA 3M3KA 3TMGA 2Y7PA 4TLLB 1G0IA 2Q8JA 3BFUA 1Y20A 2P3NA 3QSLA 3A3CA 1N7WA 2HZKA 2CZIA 1EYIA 2ZNUA 1M5DA 3S9MC 3KBZA 4IO4A 2UVGA 3K2DA 1NV1A 2I3WA 1SW4A 3WAEA 5CMMA 1CNQA 5IZ1A 4GWYA 4NEDA 1B5IA 4H46A 5BUUA 5ICTA 5I2KB 1ZKBA 2XD3A 1LCFA 3TDJA 2AIXA 4NF5A 5AA2D 3SEWA 1MPCA 4YKJA 4KPTA 4FE8A 4H5GA 1LBWA 4IR8A 3OEMA 5ITPA 3UK4A 3FXUA 4P9KA 4YKIA 2Y5LA 4LQ2A 5J16A 5I58A 1CB6A 4XIGQ 4P3LA 3MJNA 3O9PA 5DEXA 4F31B 1GR2A 5H8QB 1XS5A 3E79A 4R6HA 5KCJA 1IMBA 2PMSA 4OQOA 1QVSA 1FQAA 1B3EA 5KDTA 2NUVA 4QFNA 5I59B 1OMPA 3RTFB 3CIJA 3PUWE 4P8BA 5F7VA 3U1OA 4GF8A 2O51A 3K6VA 3BIHA 4IGRA 2F35A 4PE3A 4XTCQ 2P0SA 5ICQA 1LEVA 2ANJA 3IFCA 1FTJA 4RY1A 4ZZEA 4IO3A 1EYKA 3FVKA 2OJTA 2AYSA 3CSGA 4Z0IA 4F2OA 4IB2A 4QFKA 3GYYA 1LB8A 4ZDMA 3VFJA 3HO7A 5I7IA 1KA1A 1IMDA 3U8QA 4DE8A 5CRYA 2E1SA 5L9SA 1NV0A 3OXNA 3VE1B 1N84A 5A5LA 2QVUA 3M3FA 3TTKA 4MNIA 1NFTA 2Z22A 4QSEA 1IQ7A 1FQEA 4XKNA 4EQBA 4PBHA 4RK9A 1URGA 3TFLA 5CI5A 3SEUA 4KYSA 1WVJA 2AL4A 1QUJA 1LB9A 1M5CA 2WEFA 4RJZA 1P1OA 1FTOA 3ZKKA 5ET5A 3OO9A 1LFGA 4I3YA 3SEXA 4YB6A 1EZ9A 3U65A 2IEEA 3IO4A 2B4MA 1MXWA 2D21A 3W15C 1FBEA 1I6QA 1JQFA 3EHUA 1JVXA 4PBQA 1B05A 2F34A 4NF5B 4NF8A 5CMCA 1NI9A 4Q30B 4F1UA 3H06B 4DZ1A 2O84X 3K6XA 5DYHA 5A5XA 3RUMA 3DP4A 5AE4A 2QS4A 2ZZXA 5I58B 1ZBMA 5DEXB 1TWYA 1FPDA 3C33A 2H99A 5KCJB 3ECRA 2I3VA 2Q74A 3FUZA 2I49A 1Y3QA 4NHBA 3MPLA 2E0SA 2NVUB 5KDTB 2Y84A 1Z7ME 3PPOA 3QYTA 2KLFA 3B8BA 3T66A 3DELB 3FXBA 5H8FA 1LCTA 4QF9A 2I4BA 2XA5A 2Y7IA 4AS4A 1B0LA 1BLFA 3QMFA 2PYYA 1YYZA 3OMBA 4NTLA 4RNSA 2WKYA 3IR1A 1NL5A 1T0KA 2UVHA 4PDHA 4NWCA 5ITOA 3CSBA 4H6DA 2OCUA 5JK4A 2XXTA 3IOTA 2GHAA 4PQJA 4E0WA 2P2AA 1A55A 2DYXA 4ELOA 1MRPA 2YLNA 3CFLA 2P3VA 2PCRA 3IK6B 2XX8A 5ET6A 5EHSA 1NV6A 4P11A 4N6KA 3KGCA 2Q89A 1SQYA 4XKRA 4TLMB 4UACA 1ELJA 4I40A 1MXZA 1R6ZA 4GFRA 1SW5A 5FHOA 3UA8A 2FA7A 3B6TA 3S9NC 2CEYA 2XXWA 3RNNA 1QGXA 4H65A 3CFXA 3FXRA 4GX6A 2FBPA 4AB5A 4N4UA 2RINA 2RKMA 3U94A 1K9YA 2Z8DA 2O6AA 3TZAA 3H4ZA 4BDNA 4KXPA 4MLVA 3OSRA 4M1VA 1FQCA 1B1XA 4OFOA 5JEIA 2DS9A 2GQ1A 3IAZA 5TP9B 1L5TA 4K3FA 2DWIA 4AQ4A 1NKXA 2VT5A 1NMUA 5DTBA 1XOCA 3N26A 4MNCA 1LBXA 4KYEA 3KN3A 4R6KA 1MY4A 3BFTA 4YKKA 1FJ6A 5CMKA 4BDQA 2QS3A 1IMFA 3VLWA 1FQBA 4H67A 5FHNA 4IO6A 1B46A 2HEUA 2OX3A 4FECA 4NF8B 2XXHA 3TEPA 4R73A 4UABA 4MFIA 3G3GA 1N7XA 3QUJA 2Z8FA 4N81A 2F78A 2BJIA 1YPNA 1QJMA 4PETA 2PBWA 5A5XB 2RC9A 2PT1A 4AS5A 2JJKA 4OWDA 1IUDA 3Q28A 1R9LA 4PF8A 3MZBA 4DI3D 1P1UA 3GLBA 4OEVA 3SETA 1S7YA 2UYEA 4I62A 3TTNA 3GXAA 1Y1MA 1SD3A 4JWYA 3OSQA 3TYHA 1D4NA 3D4GA 4Q5TA 5B7DA 1B3LA 2HHMA 2ONKE 5H8FB 1Y1ZA 5HM4B 4PTKA 3IORA 1HSLA 3UORA 4PC9A 2VD2A 2QMXA 4N8YA 1M5FA 1GGGA 5AA1A 3FJGA 1VE4A 1N3XA 1XVYA 5FHMA 2V84A 3G3FA 1N0TA 4MH5A 2OZZA 1SVXB 3FV2A 4WEDA 3IOWA 1NH7A 3EPEA 3KBRA 1IZ1A 2I0BA 4YKPA 1P1QA 1F9BA 3PPRA 3FIRA 4ESWA 2F6PA 3DP6A 2QSXA 1YZ0A 3L6GA 2H5YA 2G93A 4R72A 4F39A 2X7PA 3QXMA 1IXHA 4X48A 1USYE 3BIGA 4KCDA 1NNKA 4PAIA 2DXRA 4O7MA 2XX7A 2DOJA 1VFDA 5T3JA 1OLCA 4XKQA 2CZHA 3R6UA 3E4RA 1M5EA 4F3BA 3QUFA 1DPPA 3TTRA 1UTBA 2FYIA 3KEIA 3T9VA 1QKAA 4OVPA 2UVIA 1FBFA 4HE2A 4OFLA 3A3UA 1MG1A 2ZYNA 3BKIB 3G7WA 2A5SA 3K1PA 3P7IA 3K6UA 1FPIA 2DWAA 1MH3A 3MP8A 5TU0A 1IMEA 4PAKA 3MBPA 4QHQA 1MXYA 3U93A 2UVJA 1NV7A 3FD3A 1QULA 1N76A 3M3LA 3IFAA 4RPOA 2F7CA 1YAEA 1NNTA 5EQ8A 5ISUA 2ZXTA 4NF6B 5F1QA 4NN3A 4C1UA 4HXVA 2BJJX 4R2BA 3D1RA 5CM6A 4PFTA 3G3KA 3MP1A 2REGA 3IL1B 4JVDA 1FPEA 5H8NA 1OLAA 3C31A 4H8IA 2F3DA 3RYDA 3FGSA 1MQJA 3MC2A 4PDDA 1RDYA 4HS7A 1MQGA 3QAXA 3TCFA 4F2QA 3MWBA 1Z7NE 4YU0A 4EXLA 2V4CA 3H3GA 2I48A 2ZNSA 1SW1A 4JSOA 4XXUA 3V8XB 3G3JA 4HTGA 3T93B 2ONRA 4TOZA 3FVOA 3T9UA 1INPA 2PVUA 2Y5KA 1WODA 3F11A 4OFJA 2I6EA 3O6IA 3PD8A 2HZLA 4P47A 3K1MA 3LBSA 1ZMGA 3TKDA 1EH3A 2QL3A 3FVNA 1NUYA 5I3SA 3MP6A 5M2VA 1PDAA 3MW0A 1PB8A 1ANFA 1DTZA 2X26A 4GX4A 1B58A 3VVFA 3I6VA 4QFPA 1TFDA 1IEJA 1XI6A 3VLUA 1II5A 3N5LA 4JDFA 5AA3A 3DLNA 3RQTA 4BDLA 5IZ3A 4H5FA 4DDDA 1NNFA 3LUZA 1B3GA 5K2XA 2XD2A 1M5BA 4BDRA 5EYFA 1XT8A 4O3BA 1DSNA 4QXDA 2GH9A 4WKMA 1S9TA 1SW2A 1UTBB 2GFEA 3LR1A 4H0WA 3EHTA 4PP0A 4ELPA 1NV3A 1NV4A 4FJPA 2WX9A 4GRKA 4X04A 4UA8A 3KC0A 4OANA 2ALUA 2F6GA 4NWDA 2WYKA 1PB9A 3FXQA 4XFEA 1MM7A 1NUXA 2QPQA 1BIYA 3B7DA 1IITA 3H6VA 2H4IA 2A5TA 3T9HB 3I3VA 4RXLA 1QUKA 2KR0A 4XKPA 4ZEIA 4YAHX 5IGAA 3MSTA 4F1YA 4DLDA 1RYOA 1GVCA 2AL5A 4X8RA 5I57A 4OVTA 3V83A 1LBCA 4MF3A 1JEVA 3GBAA 4I3EA 1B9JA 3CVGA 1TXFA 2QVRA 1SBPA 2G29A 4F3GA 4O94A 3CG1A 1NUWA 3N6TA 1JVYA 3TUSA 4LUBA 5EQ9A 4WEPA 4PFRA 1AL3A 3G3IA 4R2FA 2OWSA 4O7IA 1I69A 5H8SA 1ZLQA 3GBBA 5ESYA 2ZZVA 4PFBA 4ZEBA 2WYPA 4O8MA 2DQVA 3RPWA 3JZJA 2F97A 2THIA 2F7AA 3S9LC 4GXAA 2V93A 2MKZA 1KWHA 4GWWA 3ZS6A 1SPIA 3O28A 4RA1A 2DE3A 2FNCA 4LVQA 2VP1A 3FZVA 4OZ9A 2VGQA 5I5PA 4EF1A 1B3HA 4GQOA 5IZ3B 3LSXA 1SI1A 4R9GA 3B50A 4IY6A 1A8FA 2OWZA 1FQFA 3KSJA 2B3BA 3FBPA 3OO6A 4I9DA 3C34A 4F18A 1OQHA 1P1NA 3M8UA 4OVQA 1LAGE 1PBPA 2Y7WA 4GXSB 3W9WA 2CZLA 5IAIA 1IXIA 3IO6A 2F7BA 1B0HA 1AH5A 2FIXA 5DVIA 3VLVA 4X9TA 3ISPA 3C32A 4MHFA 1TT1A 5LOMA 2RC8A 2QMWA 3PUZE 1FTKA 4F29A 1FPBA 3THIA 1A54A 4MIJA 4HCWA 4BDOA 5EYGA 4JXIA 4JVIA 3GZGA 3O29A 4MJOA 4MMPA 2XHDA 3T0JA 1DMBA 2O7UA 2A5TB 3O97A 3RPLA 2DE4A 1MH4A 5CMBA 3WAFA 1GV8A 3KOSA 4DXCA 3TPAA 1EZPA 2H98A 4Q8RA 4KYDA 1UIVA 2OWTA 2QRYA 1MY3A 1DCUA 3VXCA 3E13X 4ZE8A 5L9MA 4OHNA 3CFZA 4R74A 3R26A 1A7LA 5B70A 3B6WA 4Q0CA 2DXYA 2ZYMA 4ISUA 4G4PA 3IB2A 1NH8A 2DVCA 4DXBA 4GWZA 5DT6A 3T9XB 4GWUA 1YCJA 4G77A 3PPNA 3OELA 3TODA 2DDKA 1UTHA 1Y3PA 1H43A 3MVXA 2OLBA 3ZKLA 4JSDA 4MNPA 2Z8EA 3FVGA 1J1NA 2ZZWA 3SEVA 1CE2A 3S9EA 4GOTA 4RYAA 2V3TA 1QW0A 2B65A 2YPNA 5ET8A 2V25A 3TQLA 1JEUA 2Z23A 4FIMA 4N15A 2XWOA 5DVFA 4G68A 4DCYA 3K0VA 3K6WA 2X7QA 1MY0A 3T22A 2XXQA 2XXYA 4AB6A 4N6DA 4IGTA 3KJTA 3JV9A 3T96B 2ZMBA 1KA0A 2DWHA 2I58A 4H45A 4E0XA 1B4HA 4X1DA 2D5WA 2GRVA 2YJPA 1DK4A 3CRBA 4X1BA 4HE0A 3IOVA 4PGNA 4GL8A 5L9OA 3FATA 3KG2A 3KSXA 4U4SA 1FBDA 4U2RA 5I2KA 1Q35A 3PUYE 1O64A 3FV1A 5KZTA 3PD9A 4GL0A 3VDFA 1H76A 2O68A 3CHGA 1A99A 2CEXA 4P0IA 2Q8MA 5ELVA 1IMAA 3MPKA 4OVSA 4EQ9A 4HCYA 2ZYKA 2QJEA 1K9ZA 4FORA 4I1DA 2QS2A 2VHAA 3MZ1A 4N6PA 1P99A 4FEDA 4PFYA 3SEYA 3RPLB 1MM6A 1JW1A 4F19A 4MCOA 4F3PA 1MXXA 1DTGA 1B5JA 2O7IA 3EF7A 2KQZA 3KOTA 2QFLA 3RN8A 3VVEA 4GIZA 2PT2A 1KZ8A 3O66A 3N6UA 4U4XA 1AMFA 4OVRA 3MVZA 3OOAA 4EDPA 2REJA 1JP4A 5I56A 2QS1A 4DXUA 4PCDA 1BKAA 4JBZA 3O6GA 1SDXA 1O63A 2XXRA 3HHFA 3Q29A 3LV0A 1UTHB 3PGFA 4FATA 1QKBA 1LSTA 2WBDA 4MEVA 1NV5A
chains in the Genus database with same CATH topology
1JETA 4KQPA 4RK2A 1B51A 3OO8A 4F3SA 4G2ZA 4ZE9A 3C4MA 1B7UA 2LAOA 2UYFA 4OERA 4EF2A 2ZYOA 3KZGA 3JYRA 1LBBA 2DWJA 4G68B 1WDNA 1OIBA 1B3FA 2D3IA 3HCQA 1URDA 2VOZA 4KI0E 1EZOA 4LP2B 1BP5A 3O6HA 4ESXA 3CI8A 3H03A 5TPAA 1POTA 2RC7A 4PFUA 4OENA 4KR5A 3TTMA 3RTWB 4ECFA 3CG3A 2B3FA 3UP9A 2ONSA 3DM0A 3IJOB 3PUVE 3W9VA 5DVJA 1P1WA 4IO5A 4ZECA 3TQWA 3IB1A 3OD7A 3TELA 3EHSA 2OBGA 1B7ZA 4POXA 2XX9A 4U1ZA 4ZEFA 2HFBA 4FAJA 3OENA 4NF4A 2UXAA 3HV1A 2HQ0A 3PPQA 1D9YA 5AA4A 4U21A 3MAMA 4OMBA 4I8CA 4FEBA 1D3KA 4KCCA 1LGBC 3OEKA 1N3WA 2RCAA 3Q26A 4C0RA 2XXIA 3SESA 1I6BA 1PC3A 4MLQA 2O69A 1UQWA 3ILTB 1GTKA 2HCAA 4PFWA 5I56B 4GD5A 1B32A 3PPPA 2RCBA 4G8HA 4LZ5A 1AOVA 1MS7A 3MVWA 3RGYA 1MY1A 1FTLA 1SYIA 3PMWA 2F36A 4QFOA 3QIMA 2V3QA 2Q2AA 3KN8A 1IXGA 4RPNA 4O3CA 1MPDA 1LFIA 4LQ5A 1Y9UA 1OQGA 1US5A 4YICA 1HSEA 4JWXA 4NMYA 4ELQA 5CC2A 2CMOA 1B52A 2R6GE 1B7HA 2Q88A 4U23A 1MQHA 3TCGA 1POY1 1EU8A 2H9BA 5H8NB 3HN0A 1H3DA 5I2NA 4OTEA 5BWJA 1SI0A 4EXKA 3IB0A 5TPAB 3K01A 2W7YA 3U92A 4Z7EA 3SERA 1DPEA 3B6QA 1I6AA 1XVXA 5TP9A 3LSFB 4ELRA 1VSOA 2Y7RA 3PV0E 4BLAA 3VXBA 2VD3A 2PX1A 4MBPA 3ODBA 5JTYA 3USDA 3KN7A 3MUQA 3U72A 4DCXA 5CBSA 3MVYA 4YB5A 2DP8A 5K2YA 3ILUB 1ATGA 4KFQA 1MXVA 1FCKA 2HAVA 1A40A 1R1NA 3FJ7A 4JWOA 3L6HA 4KHZE 2F8DA 1US4A 4HW8A 1IXCA 3HHGA 5FTHA 4H1XA 5FTIA 5AA2A 3ONMA 1IIWA 1URSA 4NF4B 1DOTA 4R6YA 3HPIA 4OEUA 3OO7A 2R9JA 1N04A 5AA4B 5J1DA 1MXUA 3EQ1A 4THIA 1Y4CA 3O2AA 4YMBA 1O7TA 1LFHA 3FASA 3BBRA 4DIGA 3Q27A 4EUOA 2IA4A 2O1MA 1FQDA 3IJXB 2XXVA 4POWA 3VVDA 3PMVA 1R9QA 3H7MA 3PU5A 1TFAA 2R71A 4QRZA 4KD5A 3HSTA 4JB7A 4LZ8A 1VR5A 3TAJA 2I4CA 3UIFA 3TCHA 4OETA 4N07A 5IKBA 4OESA 3C9HA 5H8HA 3H6TA 3VV5A 4ND9A 4N13A 3CR9A 2NWJA 3MZ9A 5I84A 1B5HA 2V3UA 1QUIA 4P0GA 1B2HA 3E9XA 5I57B 3FJMA 1Y4TA 5I2NB 1LLSA 2ABHA 4M4GA 3V89B 3QK6A 2NXOA 1JW4A 1RKMA 3SKPA 2RF1A 4TQUQ 2XXUA 1Q1KA 1SYHA 3RY3A 2DE2A 4O3AA 1ZU0A 1A8EA 1NNPA 3AXFA 5CBRA 3RT8A 1RYXA 3RLFE 4U22A 4IO2A 4QFLA 3K4UA 5JTYB 2H25A 4IO7A 1ZIUA 2I0CA 3PUXE 2Q2CA 3EN3A 2M8CA 2HAUA 4U1OA 1MQIA 4IY5A 4ZZAA 3LC8A 1S50A 3DP8A 1YTVA 4NF6A 5EHMA 4QSDA 1OVBA 1USYH 4OYVA 5AA2B 3I5OA 2XXPA 2ESNA 4ZEDA 4LATA 5L8DA 3H6UA 4ONYA 1FW0A 3KFMA 5HPQA 3RT6B 1JNFA 3Q25A 3LSLA 4ZEKA 3C35A 4ZS9A 1XHYA 1OVTA 4OVJA 1AIVA 1MPBA 4QSCA 1MDP1 1LAHE 4L17A 1B4ZA 3N94A 3ZSFA 3SDFA 3K1NA 4G8MA 3IX1A 3UGWA 1FTMA 2Q9TA 3A09A 1MQDA 1H44A 1ZTYA 4G68C 3PMXA 4G8NA 2DSFA 5H8HB 1H45A 2ZNTA 2F5XA 4LA9A 5H8QA 1ZJLA 3E3KA 2P1SA 4F22A 4YB7A 1B6HA 1MDQA 3IOUA 3MQ9A 4LZ7A 3D4CA 2Y7KA 3S4UA 1LAXA 1Y3NA 3LSWA 4YMAA 4EQ7A 3S2VA 1HSJA 1PB7A 4WXJA 4C1TA 5I59A 1XC1A 2HXWA 1BTJA 3LUYA 1B1HA 1LAFE 4LONB 3H6WA 2OK2A 2O1LA 4R9FA 2DVZA 2GHBA 3K00A 4F1VA 3TTLA 1B40A 3G3HA 4BDMA 4YZZA 3KJ7A 4PE5B 1VFEA 3V5AA 4H8JA 3R7XA 1PEBA 3K02A 2XXXA 5HBCA 1MY2A 1D9VA 4GVOA 4GWOA 1UIUA 4GLIA 3UN6A 3C36A 1PBQA 4OXVA 4R75A 4NE4A 1JW5A 2NOOA 3M3KA 3TMGA 2Y7PA 4TLLB 2Q8JA 3BFUA 1Y20A 3QSLA 3A3CA 1N7WA 2HZKA 2ZNUA 1M5DA 3S9MC 4IO4A 2UVGA 3K2DA 2I3WA 1SW4A 3WAEA 5CMMA 4NEDA 1B5IA 5BUUA 5ICTA 5I2KB 1ZKBA 2XD3A 1LCFA 3TDJA 2AIXA 4NF5A 5AA2D 3SEWA 1MPCA 4YKJA 4KPTA 4FE8A 4H5GA 3OEMA 5ITPA 3UK4A 3FXUA 4YKIA 4LQ2A 5I58A 1CB6A 4XIGQ 3MJNA 3O9PA 5DEXA 4F31B 1GR2A 5H8QB 1XS5A 4R6HA 5KCJA 2PMSA 4OQOA 1QVSA 1FQAA 1B3EA 5KDTA 2NUVA 4QFNA 5I59B 1OMPA 3RTFB 3CIJA 3PUWE 5F7VA 3U1OA 4GF8A 2O51A 3K6VA 4IGRA 2F35A 4XTCQ 2P0SA 5ICQA 2ANJA 1FTJA 4RY1A 4ZZEA 4IO3A 3FVKA 2OJTA 2AYSA 3CSGA 4Z0IA 4F2OA 4IB2A 4QFKA 4ZDMA 1LB8A 3VFJA 3HO7A 3U8QA 4DE8A 5CRYA 2E1SA 5L9SA 3OXNA 3VE1B 1N84A 3M3FA 3TTKA 1NFTA 2Z22A 4QSEA 1IQ7A 1FQEA 4XKNA 4EQBA 4RK9A 1URGA 3TFLA 5CI5A 3SEUA 4KYSA 1WVJA 2AL4A 1QUJA 1LB9A 1M5CA 4RJZA 1P1OA 1FTOA 3ZKKA 3OO9A 1LFGA 3SEXA 4YB6A 1EZ9A 2IEEA 3IO4A 1MXWA 2D21A 3W15C 1I6QA 1JQFA 3EHUA 1JVXA 1B05A 2F34A 4NF5B 4NF8A 5CMCA 4Q30B 4F1UA 3H06B 4DZ1A 2O84X 3K6XA 5DYHA 5A5XA 3RUMA 3DP4A 5AE4A 2QS4A 5I58B 1ZBMA 5DEXB 1TWYA 3C33A 2H99A 5KCJB 3ECRA 2I3VA 3FUZA 2I49A 1Y3QA 3MPLA 2E0SA 2NVUB 5KDTB 2Y84A 1Z7ME 3PPOA 3QYTA 2KLFA 3T66A 3DELB 5H8FA 1LCTA 4QF9A 2I4BA 2Y7IA 1B0LA 1BLFA 2PYYA 3OMBA 4NTLA 4RNSA 2WKYA 3IR1A 1NL5A 1T0KA 2UVHA 4NWCA 5ITOA 3CSBA 4H6DA 2OCUA 5JK4A 2XXTA 3IOTA 2GHAA 4PQJA 4E0WA 2P2AA 1A55A 2DYXA 4ELOA 1MRPA 2YLNA 3CFLA 3IK6B 2XX8A 5EHSA 4P11A 3KGCA 2Q89A 1SQYA 4XKRA 4TLMB 4UACA 1ELJA 1MXZA 1R6ZA 4GFRA 1SW5A 5FHOA 3UA8A 2FA7A 3B6TA 3S9NC 2XXWA 3RNNA 4H65A 3CFXA 3FXRA 4AB5A 2RINA 2RKMA 3U94A 2Z8DA 2O6AA 3TZAA 3H4ZA 4BDNA 4MLVA 3OSRA 4M1VA 1FQCA 1B1XA 4OFOA 5JEIA 2DS9A 3IAZA 5TP9B 1L5TA 4K3FA 2DWIA 4AQ4A 1NKXA 1NMUA 5DTBA 1XOCA 3N26A 4KYEA 3KN3A 4R6KA 1MY4A 3BFTA 4YKKA 5CMKA 4BDQA 2QS3A 3VLWA 1FQBA 4H67A 5FHNA 4IO6A 1B46A 2HEUA 4NF8B 4FECA 2XXHA 3TEPA 4R73A 4MFIA 3G3GA 1N7XA 3QUJA 2Z8FA 2F78A 1YPNA 1QJMA 4PETA 2PBWA 5A5XB 2RC9A 2PT1A 4OWDA 1IUDA 3Q28A 1R9LA 3MZBA 1P1UA 3GLBA 4OEVA 3SETA 1S7YA 2UYEA 4I62A 3TTNA 3GXAA 1Y1MA 1SD3A 4JWYA 3OSQA 3TYHA 1D4NA 3D4GA 4Q5TA 5B7DA 1B3LA 2ONKE 5H8FB 1Y1ZA 5HM4B 3IORA 1HSLA 3UORA 2VD2A 2QMXA 1M5FA 1GGGA 5AA1A 3FJGA 1VE4A 1N3XA 1XVYA 5FHMA 2V84A 3G3FA 1N0TA 4MH5A 2OZZA 1SVXB 3FV2A 4WEDA 3IOWA 1NH7A 3EPEA 3KBRA 1IZ1A 2I0BA 4YKPA 1P1QA 1F9BA 3PPRA 3FIRA 4ESWA 2F6PA 3DP6A 2QSXA 3L6GA 2H5YA 2G93A 4R72A 4F39A 2X7PA 3QXMA 1IXHA 4X48A 1USYE 4KCDA 1NNKA 2DXRA 2XX7A 2DOJA 1VFDA 1OLCA 4XKQA 3R6UA 3E4RA 1M5EA 4F3BA 3QUFA 1DPPA 3TTRA 1UTBA 2FYIA 3KEIA 3T9VA 1QKAA 2UVIA 4OFLA 3A3UA 1MG1A 2ZYNA 3BKIB 3G7WA 2A5SA 3K1PA 3P7IA 3K6UA 2DWAA 1MH3A 3MP8A 5TU0A 3MBPA 4QHQA 1MXYA 3U93A 2UVJA 3FD3A 1QULA 1N76A 3M3LA 4RPOA 2F7CA 1YAEA 1NNTA 5ISUA 2ZXTA 4NF6B 5F1QA 4C1UA 2BJJX 4R2BA 5CM6A 4PFTA 3G3KA 3MP1A 2REGA 3IL1B 5H8NA 1OLAA 3C31A 4H8IA 3FGSA 1MQJA 3MC2A 4HS7A 1MQGA 3QAXA 3TCFA 4F2QA 3MWBA 1Z7NE 4YU0A 4EXLA 3H3GA 2I48A 2ZNSA 1SW1A 4JSOA 4XXUA 3V8XB 3G3JA 4HTGA 3T93B 2ONRA 4TOZA 3FVOA 3T9UA 2PVUA 1WODA 3F11A 4OFJA 2I6EA 3O6IA 3PD8A 2HZLA 3K1MA 3LBSA 1ZMGA 3TKDA 1EH3A 2QL3A 3FVNA 3MP6A 5M2VA 1PDAA 3MW0A 1PB8A 1ANFA 1DTZA 2X26A 1B58A 3VVFA 3I6VA 4QFPA 1TFDA 1IEJA 3VLUA 1II5A 3N5LA 4JDFA 5AA3A 3DLNA 3RQTA 4BDLA 4H5FA 4DDDA 1NNFA 1B3GA 5K2XA 2XD2A 1M5BA 4BDRA 5EYFA 1XT8A 4O3BA 1DSNA 2GH9A 4WKMA 1S9TA 1SW2A 1UTBB 2GFEA 3LR1A 4H0WA 3EHTA 4PP0A 4ELPA 4FJPA 4GRKA 4UA8A 2ALUA 2F6GA 4NWDA 1PB9A 3FXQA 1MM7A 2QPQA 1BIYA 3B7DA 1IITA 3H6VA 2H4IA 2A5TA 3T9HB 3I3VA 4RXLA 1QUKA 4XKPA 4ZEIA 4YAHX 4F1YA 4DLDA 1RYOA 1GVCA 2AL5A 5I57A 3V83A 1LBCA 4MF3A 1JEVA 3GBAA 1B9JA 3CVGA 1TXFA 1SBPA 2G29A 4F3GA 3CG1A 3N6TA 1JVYA 3TUSA 4LUBA 4WEPA 1AL3A 3G3IA 4R2FA 2OWSA 1I69A 5H8SA 1ZLQA 3GBBA 4ZEBA 2DQVA 3RPWA 3JZJA 2F97A 2THIA 2F7AA 3S9LC 4GXAA 2V93A 1KWHA 3ZS6A 3O28A 4RA1A 2DE3A 2FNCA 4LVQA 2VP1A 3FZVA 4OZ9A 2VGQA 4EF1A 1B3HA 4GQOA 3LSXA 1SI1A 4R9GA 4IY6A 1A8FA 1FQFA 3KSJA 2B3BA 3OO6A 4I9DA 3C34A 4F18A 1OQHA 1P1NA 3M8UA 1LAGE 1PBPA 2Y7WA 4GXSB 3W9WA 2CZLA 5IAIA 1IXIA 3IO6A 2F7BA 1B0HA 1AH5A 5DVIA 3VLVA 4X9TA 3C32A 1TT1A 5LOMA 2RC8A 2QMWA 3PUZE 1FTKA 4F29A 3THIA 1A54A 4HCWA 4BDOA 4JXIA 3GZGA 3O29A 2XHDA 1DMBA 2O7UA 2A5TB 3O97A 2DE4A 1MH4A 5CMBA 3WAFA 1GV8A 3KOSA 4DXCA 3TPAA 1EZPA 2H98A 4Q8RA 4KYDA 1UIVA 2OWTA 2QRYA 1MY3A 3VXCA 3E13X 4ZE8A 5L9MA 4OHNA 3CFZA 4R74A 3R26A 1A7LA 5B70A 3B6WA 4Q0CA 2DXYA 2ZYMA 4ISUA 4G4PA 3IB2A 1NH8A 2DVCA 4DXBA 5DT6A 3T9XB 1YCJA 4G77A 3PPNA 3OELA 3TODA 1UTHA 1Y3PA 1H43A 3MVXA 2OLBA 3ZKLA 4JSDA 2Z8EA 3FVGA 1J1NA 3SEVA 1CE2A 3S9EA 4GOTA 4RYAA 2V3TA 1QW0A 2B65A 2YPNA 2V25A 3TQLA 1JEUA 2Z23A 4FIMA 5DVFA 4G68A 4DCYA 3K0VA 3K6WA 2X7QA 1MY0A 3T22A 2XXQA 2XXYA 4AB6A 4IGTA 3KJTA 3JV9A 3T96B 2ZMBA 2DWHA 4E0XA 2I58A 1B4HA 4X1DA 2D5WA 2GRVA 2YJPA 3CRBA 4X1BA 3IOVA 4GL8A 5L9OA 3FATA 3KG2A 3KSXA 4U4SA 4U2RA 5I2KA 1Q35A 3PUYE 1O64A 3FV1A 5KZTA 3PD9A 4GL0A 3VDFA 1H76A 2O68A 1A99A 4P0IA 5ELVA 3MPKA 4EQ9A 4HCYA 2ZYKA 2QJEA 4FORA 4I1DA 2QS2A 2VHAA 3MZ1A 4N6PA 1P99A 4FEDA 4PFYA 3SEYA 1MM6A 1JW1A 4F19A 4F3PA 1MXXA 1DTGA 1B5JA 2O7IA 3EF7A 3KOTA 3RN8A 3VVEA 4GIZA 2PT2A 3O66A 3N6UA 4U4XA 1AMFA 3MVZA 3OOAA 4EDPA 2REJA 5I56A 2QS1A 4DXUA 1BKAA 4JBZA 3O6GA 1SDXA 1O63A 2XXRA 3HHFA 3Q29A 1UTHB 3PGFA 4FATA 1QKBA 1LSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JET A;  4KQP A;  4RK2 A;  1B51 A;  3OO8 A;  4F3S A;  4G2Z A;  4ZE9 A;  3C4M A;  1B7U A;  2LAO A;  2UYF A;  4OER A;  4EF2 A;  2ZYO A;  3KZG A;  3JYR A;  1LBB A;  2DWJ A;  4G68 B;  1WDN A;  1OIB A;  1B3F A;  2D3I A;  3HCQ A;  1URD A;  2VOZ A;  4KI0 E;  1EZO A;  4LP2 B;  1BP5 A;  3O6H A;  4ESX A;  3CI8 A;  3H03 A;  5TPA A;  1POT A;  2RC7 A;  4PFU A;  4OEN A;  4KR5 A;  3TTM A;  3RTW B;  4ECF A;  3CG3 A;  2B3F A;  3UP9 A;  2ONS A;  3DM0 A;  3IJO B;  3PUV E;  3W9V A;  5DVJ A;  1P1W A;  4IO5 A;  4ZEC A;  3TQW A;  3IB1 A;  3OD7 A;  3TEL A;  3EHS A;  2OBG A;  1B7Z A;  4POX A;  2XX9 A;  4U1Z A;  4ZEF A;  2HFB A;  4FAJ A;  3OEN A;  4NF4 A;  2UXA A;  3HV1 A;  2HQ0 A;  3PPQ A;  1D9Y A;  5AA4 A;  4U21 A;  3MAM A;  4OMB A;  4I8C A;  4FEB A;  1D3K A;  4KCC A;  1LGB C;  3OEK A;  1N3W A;  2RCA A;  3Q26 A;  4C0R A;  2XXI A;  3SES A;  1I6B A;  1PC3 A;  4MLQ A;  2O69 A;  1UQW A;  3ILT B;  1GTK A;  2HCA A;  4PFW A;  5I56 B;  4GD5 A;  1B32 A;  3PPP A;  2RCB A;  4G8H A;  4LZ5 A;  1AOV A;  1MS7 A;  3MVW A;  3RGY A;  1MY1 A;  1FTL A;  1SYI A;  3PMW A;  2F36 A;  4QFO A;  3QIM A;  2V3Q A;  2Q2A A;  3KN8 A;  1IXG A;  4RPN A;  4O3C A;  1MPD A;  1LFI A;  4LQ5 A;  1Y9U A;  1OQG A;  1US5 A;  4YIC A;  1HSE A;  4JWX A;  4NMY A;  4ELQ A;  5CC2 A;  2CMO A;  1B52 A;  2R6G E;  1B7H A;  2Q88 A;  4U23 A;  1MQH A;  3TCG A;  1POY 1;  1EU8 A;  2H9B A;  5H8N B;  3HN0 A;  1H3D A;  5I2N A;  4OTE A;  5BWJ A;  1SI0 A;  4EXK A;  3IB0 A;  5TPA B;  3K01 A;  2W7Y A;  3U92 A;  4Z7E A;  3SER A;  1DPE A;  3B6Q A;  1I6A A;  1XVX A;  5TP9 A;  3LSF B;  4ELR A;  1VSO A;  2Y7R A;  3PV0 E;  4BLA A;  3VXB A;  2VD3 A;  2PX1 A;  4MBP A;  3ODB A;  5JTY A;  3USD A;  3KN7 A;  3MUQ A;  3U72 A;  4DCX A;  5CBS A;  3MVY A;  4YB5 A;  2DP8 A;  5K2Y A;  3ILU B;  1ATG A;  4KFQ A;  1MXV A;  1FCK A;  2HAV A;  1A40 A;  1R1N A;  3FJ7 A;  4JWO A;  3L6H A;  4KHZ E;  2F8D A;  1US4 A;  4HW8 A;  1IXC A;  3HHG A;  5FTH A;  4H1X A;  5FTI A;  5AA2 A;  3ONM A;  1IIW A;  1URS A;  4NF4 B;  1DOT A;  4R6Y A;  3HPI A;  4OEU A;  3OO7 A;  2R9J A;  1N04 A;  5AA4 B;  5J1D A;  1MXU A;  3EQ1 A;  4THI A;  1Y4C A;  3O2A A;  4YMB A;  1O7T A;  1LFH A;  3FAS A;  3BBR A;  4DIG A;  3Q27 A;  4EUO A;  2IA4 A;  2O1M A;  1FQD A;  3IJX B;  2XXV A;  4POW A;  3VVD A;  3PMV A;  1R9Q A;  3H7M A;  3PU5 A;  1TFA A;  2R71 A;  4QRZ A;  4KD5 A;  3HST A;  4JB7 A;  4LZ8 A;  1VR5 A;  3TAJ A;  2I4C A;  3UIF A;  3TCH A;  4OET A;  4N07 A;  5IKB A;  4OES A;  3C9H A;  5H8H A;  3H6T A;  3VV5 A;  4ND9 A;  4N13 A;  3CR9 A;  2NWJ A;  3MZ9 A;  5I84 A;  1B5H A;  2V3U A;  1QUI A;  4P0G A;  1B2H A;  3E9X A;  5I57 B;  3FJM A;  1Y4T A;  5I2N B;  1LLS A;  2ABH A;  4M4G A;  3V89 B;  3QK6 A;  2NXO A;  1JW4 A;  1RKM A;  3SKP A;  2RF1 A;  4TQU Q;  2XXU A;  1Q1K A;  1SYH A;  3RY3 A;  2DE2 A;  4O3A A;  1ZU0 A;  1A8E A;  1NNP A;  3AXF A;  5CBR A;  3RT8 A;  1RYX A;  3RLF E;  4U22 A;  4IO2 A;  4QFL A;  3K4U A;  5JTY B;  2H25 A;  4IO7 A;  1ZIU A;  2I0C A;  3PUX E;  2Q2C A;  3EN3 A;  2M8C A;  2HAU A;  4U1O A;  1MQI A;  4IY5 A;  4ZZA A;  3LC8 A;  1S50 A;  3DP8 A;  1YTV A;  4NF6 A;  5EHM A;  4QSD A;  1OVB A;  1USY H;  4OYV A;  5AA2 B;  3I5O A;  2XXP A;  2ESN A;  4ZED A;  4LAT A;  5L8D A;  3H6U A;  4ONY A;  1FW0 A;  3KFM A;  5HPQ A;  3RT6 B;  1JNF A;  3Q25 A;  3LSL A;  4ZEK A;  3C35 A;  4ZS9 A;  1XHY A;  1OVT A;  4OVJ A;  1AIV A;  1MPB A;  4QSC A;  1MDP 1;  1LAH E;  4L17 A;  1B4Z A;  3N94 A;  3ZSF A;  3SDF A;  3K1N A;  4G8M A;  3IX1 A;  3UGW A;  1FTM A;  2Q9T A;  3A09 A;  1MQD A;  1H44 A;  1ZTY A;  4G68 C;  3PMX A;  4G8N A;  2DSF A;  5H8H B;  1H45 A;  2ZNT A;  2F5X A;  4LA9 A;  5H8Q A;  1ZJL A;  3E3K A;  2P1S A;  4F22 A;  4YB7 A;  1B6H A;  1MDQ A;  3IOU A;  3MQ9 A;  4LZ7 A;  3D4C A;  2Y7K A;  3S4U A;  1LAX A;  1Y3N A;  3LSW A;  4YMA A;  4EQ7 A;  3S2V A;  1HSJ A;  1PB7 A;  4WXJ A;  4C1T A;  5I59 A;  1XC1 A;  2HXW A;  1BTJ A;  3LUY A;  1B1H A;  1LAF E;  4LON B;  3H6W A;  2OK2 A;  2O1L A;  4R9F A;  2DVZ A;  2GHB A;  3K00 A;  4F1V A;  3TTL A;  1B40 A;  3G3H A;  4BDM A;  4YZZ A;  3KJ7 A;  4PE5 B;  1VFE A;  3V5A A;  4H8J A;  3R7X A;  1PEB A;  3K02 A;  2XXX A;  5HBC A;  1MY2 A;  1D9V A;  4GVO A;  4GWO A;  1UIU A;  4GLI A;  3UN6 A;  3C36 A;  1PBQ A;  4OXV A;  4R75 A;  4NE4 A;  1JW5 A;  2NOO A;  3M3K A;  3TMG A;  2Y7P A;  4TLL B;  2Q8J A;  3BFU A;  1Y20 A;  3QSL A;  3A3C A;  1N7W A;  2HZK A;  2ZNU A;  1M5D A;  3S9M C;  4IO4 A;  2UVG A;  3K2D A;  2I3W A;  1SW4 A;  3WAE A;  5CMM A;  4NED A;  1B5I A;  5BUU A;  5ICT A;  5I2K B;  1ZKB A;  2XD3 A;  1LCF A;  3TDJ A;  2AIX A;  4NF5 A;  5AA2 D;  3SEW A;  1MPC A;  4YKJ A;  4KPT A;  4FE8 A;  4H5G A;  3OEM A;  5ITP A;  3UK4 A;  3FXU A;  4YKI A;  4LQ2 A;  5I58 A;  1CB6 A;  4XIG Q;  3MJN A;  3O9P A;  5DEX A;  4F31 B;  1GR2 A;  5H8Q B;  1XS5 A;  4R6H A;  5KCJ A;  2PMS A;  4OQO A;  1QVS A;  1FQA A;  1B3E A;  5KDT A;  2NUV A;  4QFN A;  5I59 B;  1OMP A;  3RTF B;  3CIJ A;  3PUW E;  5F7V A;  3U1O A;  4GF8 A;  2O51 A;  3K6V A;  4IGR A;  2F35 A;  4XTC Q;  2P0S A;  5ICQ A;  2ANJ A;  1FTJ A;  4RY1 A;  4ZZE A;  4IO3 A;  3FVK A;  2OJT A;  2AYS A;  3CSG A;  4Z0I A;  4F2O A;  4IB2 A;  4QFK A;  4ZDM A;  1LB8 A;  3VFJ A;  3HO7 A;  3U8Q A;  4DE8 A;  5CRY A;  2E1S A;  5L9S A;  3OXN A;  3VE1 B;  1N84 A;  3M3F A;  3TTK A;  1NFT A;  2Z22 A;  4QSE A;  1IQ7 A;  1FQE A;  4XKN A;  4EQB A;  4RK9 A;  1URG A;  3TFL A;  5CI5 A;  3SEU A;  4KYS A;  1WVJ A;  2AL4 A;  1QUJ A;  1LB9 A;  1M5C A;  4RJZ A;  1P1O A;  1FTO A;  3ZKK A;  3OO9 A;  1LFG A;  3SEX A;  4YB6 A;  1EZ9 A;  2IEE A;  3IO4 A;  1MXW A;  2D21 A;  3W15 C;  1I6Q A;  1JQF A;  3EHU A;  1JVX A;  1B05 A;  2F34 A;  4NF5 B;  4NF8 A;  5CMC A;  4Q30 B;  4F1U A;  3H06 B;  4DZ1 A;  2O84 X;  3K6X A;  5DYH A;  5A5X A;  3RUM A;  3DP4 A;  5AE4 A;  2QS4 A;  5I58 B;  1ZBM A;  5DEX B;  1TWY A;  3C33 A;  2H99 A;  5KCJ B;  3ECR A;  2I3V A;  3FUZ A;  2I49 A;  1Y3Q A;  3MPL A;  2E0S A;  2NVU B;  5KDT B;  2Y84 A;  1Z7M E;  3PPO A;  3QYT A;  2KLF A;  3T66 A;  3DEL B;  5H8F A;  1LCT A;  4QF9 A;  2I4B A;  2Y7I A;  1B0L A;  1BLF A;  2PYY A;  3OMB A;  4NTL A;  4RNS A;  2WKY A;  3IR1 A;  1NL5 A;  1T0K A;  2UVH A;  4NWC A;  5ITO A;  3CSB A;  4H6D A;  2OCU A;  5JK4 A;  2XXT A;  3IOT A;  2GHA A;  4PQJ A;  4E0W A;  2P2A A;  1A55 A;  2DYX A;  4ELO A;  1MRP A;  2YLN A;  3CFL A;  3IK6 B;  2XX8 A;  5EHS A;  4P11 A;  3KGC A;  2Q89 A;  1SQY A;  4XKR A;  4TLM B;  4UAC A;  1ELJ A;  1MXZ A;  1R6Z A;  4GFR A;  1SW5 A;  5FHO A;  3UA8 A;  2FA7 A;  3B6T A;  3S9N C;  2XXW A;  3RNN A;  4H65 A;  3CFX A;  3FXR A;  4AB5 A;  2RIN A;  2RKM A;  3U94 A;  2Z8D A;  2O6A A;  3TZA A;  3H4Z A;  4BDN A;  4MLV A;  3OSR A;  4M1V A;  1FQC A;  1B1X A;  4OFO A;  5JEI A;  2DS9 A;  3IAZ A;  5TP9 B;  1L5T A;  4K3F A;  2DWI A;  4AQ4 A;  1NKX A;  1NMU A;  5DTB A;  1XOC A;  3N26 A;  4KYE A;  3KN3 A;  4R6K A;  1MY4 A;  3BFT A;  4YKK A;  5CMK A;  4BDQ A;  2QS3 A;  3VLW A;  1FQB A;  4H67 A;  5FHN A;  4IO6 A;  1B46 A;  2HEU A;  4NF8 B;  4FEC A;  2XXH A;  3TEP A;  4R73 A;  4MFI A;  3G3G A;  1N7X A;  3QUJ A;  2Z8F A;  2F78 A;  1YPN A;  1QJM A;  4PET A;  2PBW A;  5A5X B;  2RC9 A;  2PT1 A;  4OWD A;  1IUD A;  3Q28 A;  1R9L A;  3MZB A;  1P1U A;  3GLB A;  4OEV A;  3SET A;  1S7Y A;  2UYE A;  4I62 A;  3TTN A;  3GXA A;  1Y1M A;  1SD3 A;  4JWY A;  3OSQ A;  3TYH A;  1D4N A;  3D4G A;  4Q5T A;  5B7D A;  1B3L A;  2ONK E;  5H8F B;  1Y1Z A;  5HM4 B;  3IOR A;  1HSL A;  3UOR A;  2VD2 A;  2QMX A;  1M5F A;  1GGG A;  5AA1 A;  3FJG A;  1VE4 A;  1N3X A;  1XVY A;  5FHM A;  2V84 A;  3G3F A;  1N0T A;  4MH5 A;  2OZZ A;  1SVX B;  3FV2 A;  4WED A;  3IOW A;  1NH7 A;  3EPE A;  3KBR A;  1IZ1 A;  2I0B A;  4YKP A;  1P1Q A;  1F9B A;  3PPR A;  3FIR A;  4ESW A;  2F6P A;  3DP6 A;  2QSX A;  3L6G A;  2H5Y A;  2G93 A;  4R72 A;  4F39 A;  2X7P A;  3QXM A;  1IXH A;  4X48 A;  1USY E;  4KCD A;  1NNK A;  2DXR A;  2XX7 A;  2DOJ A;  1VFD A;  1OLC A;  4XKQ A;  3R6U A;  3E4R A;  1M5E A;  4F3B A;  3QUF A;  1DPP A;  3TTR A;  1UTB A;  2FYI A;  3KEI A;  3T9V A;  1QKA A;  2UVI A;  4OFL A;  3A3U A;  1MG1 A;  2ZYN A;  3BKI B;  3G7W A;  2A5S A;  3K1P A;  3P7I A;  3K6U A;  2DWA A;  1MH3 A;  3MP8 A;  5TU0 A;  3MBP A;  4QHQ A;  1MXY A;  3U93 A;  2UVJ A;  3FD3 A;  1QUL A;  1N76 A;  3M3L A;  4RPO A;  2F7C A;  1YAE A;  1NNT A;  5ISU A;  2ZXT A;  4NF6 B;  5F1Q A;  4C1U A;  2BJJ X;  4R2B A;  5CM6 A;  4PFT A;  3G3K A;  3MP1 A;  2REG A;  3IL1 B;  5H8N A;  1OLA A;  3C31 A;  4H8I A;  3FGS A;  1MQJ A;  3MC2 A;  4HS7 A;  1MQG A;  3QAX A;  3TCF A;  4F2Q A;  3MWB A;  1Z7N E;  4YU0 A;  4EXL A;  3H3G A;  2I48 A;  2ZNS A;  1SW1 A;  4JSO A;  4XXU A;  3V8X B;  3G3J A;  4HTG A;  3T93 B;  2ONR A;  4TOZ A;  3FVO A;  3T9U A;  2PVU A;  1WOD A;  3F11 A;  4OFJ A;  2I6E A;  3O6I A;  3PD8 A;  2HZL A;  3K1M A;  3LBS A;  1ZMG A;  3TKD A;  1EH3 A;  2QL3 A;  3FVN A;  3MP6 A;  5M2V A;  1PDA A;  3MW0 A;  1PB8 A;  1ANF A;  1DTZ A;  2X26 A;  1B58 A;  3VVF A;  3I6V A;  4QFP A;  1TFD A;  1IEJ A;  3VLU A;  1II5 A;  3N5L A;  4JDF A;  5AA3 A;  3DLN A;  3RQT A;  4BDL A;  4H5F A;  4DDD A;  1NNF A;  1B3G A;  5K2X A;  2XD2 A;  1M5B A;  4BDR A;  5EYF A;  1XT8 A;  4O3B A;  1DSN A;  2GH9 A;  4WKM A;  1S9T A;  1SW2 A;  1UTB B;  2GFE A;  3LR1 A;  4H0W A;  3EHT A;  4PP0 A;  4ELP A;  4FJP A;  4GRK A;  4UA8 A;  2ALU A;  2F6G A;  4NWD A;  1PB9 A;  3FXQ A;  1MM7 A;  2QPQ A;  1BIY A;  3B7D A;  1IIT A;  3H6V A;  2H4I A;  2A5T A;  3T9H B;  3I3V A;  4RXL A;  1QUK A;  4XKP A;  4ZEI A;  4YAH X;  4F1Y A;  4DLD A;  1RYO A;  1GVC A;  2AL5 A;  5I57 A;  3V83 A;  1LBC A;  4MF3 A;  1JEV A;  3GBA A;  1B9J A;  3CVG A;  1TXF A;  1SBP A;  2G29 A;  4F3G A;  3CG1 A;  3N6T A;  1JVY A;  3TUS A;  4LUB A;  4WEP A;  1AL3 A;  3G3I A;  4R2F A;  2OWS A;  1I69 A;  5H8S A;  1ZLQ A;  3GBB A;  4ZEB A;  2DQV A;  3RPW A;  3JZJ A;  2F97 A;  2THI A;  2F7A A;  3S9L C;  4GXA A;  2V93 A;  1KWH A;  3ZS6 A;  3O28 A;  4RA1 A;  2DE3 A;  2FNC A;  4LVQ A;  2VP1 A;  3FZV A;  4OZ9 A;  2VGQ A;  4EF1 A;  1B3H A;  4GQO A;  3LSX A;  1SI1 A;  4R9G A;  4IY6 A;  1A8F A;  1FQF A;  3KSJ A;  2B3B A;  3OO6 A;  4I9D A;  3C34 A;  4F18 A;  1OQH A;  1P1N A;  3M8U A;  1LAG E;  1PBP A;  2Y7W A;  4GXS B;  3W9W A;  2CZL A;  5IAI A;  1IXI A;  3IO6 A;  2F7B A;  1B0H A;  1AH5 A;  5DVI A;  3VLV A;  4X9T A;  3C32 A;  1TT1 A;  5LOM A;  2RC8 A;  2QMW A;  3PUZ E;  1FTK A;  4F29 A;  3THI A;  1A54 A;  4HCW A;  4BDO A;  4JXI A;  3GZG A;  3O29 A;  2XHD A;  1DMB A;  2O7U A;  2A5T B;  3O97 A;  2DE4 A;  1MH4 A;  5CMB A;  3WAF A;  1GV8 A;  3KOS A;  4DXC A;  3TPA A;  1EZP A;  2H98 A;  4Q8R A;  4KYD A;  1UIV A;  2OWT A;  2QRY A;  1MY3 A;  3VXC A;  3E13 X;  4ZE8 A;  5L9M A;  4OHN A;  3CFZ A;  4R74 A;  3R26 A;  1A7L A;  5B70 A;  3B6W A;  4Q0C A;  2DXY A;  2ZYM A;  4ISU A;  4G4P A;  3IB2 A;  1NH8 A;  2DVC A;  4DXB A;  5DT6 A;  3T9X B;  1YCJ A;  4G77 A;  3PPN A;  3OEL A;  3TOD A;  1UTH A;  1Y3P A;  1H43 A;  3MVX A;  2OLB A;  3ZKL A;  4JSD A;  2Z8E A;  3FVG A;  1J1N A;  3SEV A;  1CE2 A;  3S9E A;  4GOT A;  4RYA A;  2V3T A;  1QW0 A;  2B65 A;  2YPN A;  2V25 A;  3TQL A;  1JEU A;  2Z23 A;  4FIM A;  5DVF A;  4G68 A;  4DCY A;  3K0V A;  3K6W A;  2X7Q A;  1MY0 A;  3T22 A;  2XXQ A;  2XXY A;  4AB6 A;  4IGT A;  3KJT A;  3JV9 A;  3T96 B;  2ZMB A;  2DWH A;  4E0X A;  2I58 A;  1B4H A;  4X1D A;  2D5W A;  2GRV A;  2YJP A;  3CRB A;  4X1B A;  3IOV A;  4GL8 A;  5L9O A;  3FAT A;  3KG2 A;  3KSX A;  4U4S A;  4U2R A;  5I2K A;  1Q35 A;  3PUY E;  1O64 A;  3FV1 A;  5KZT A;  3PD9 A;  4GL0 A;  3VDF A;  1H76 A;  2O68 A;  1A99 A;  4P0I A;  5ELV A;  3MPK A;  4EQ9 A;  4HCY A;  2ZYK A;  2QJE A;  4FOR A;  4I1D A;  2QS2 A;  2VHA A;  3MZ1 A;  4N6P A;  1P99 A;  4FED A;  4PFY A;  3SEY A;  1MM6 A;  1JW1 A;  4F19 A;  4F3P A;  1MXX A;  1DTG A;  1B5J A;  2O7I A;  3EF7 A;  3KOT A;  3RN8 A;  3VVE A;  4GIZ A;  2PT2 A;  3O66 A;  3N6U A;  4U4X A;  1AMF A;  3MVZ A;  3OOA A;  4EDP A;  2REJ A;  5I56 A;  2QS1 A;  4DXU A;  1BKA A;  4JBZ A;  3O6G A;  1SDX A;  1O63 A;  2XXR A;  3HHF A;  3Q29 A;  1UTH B;  3PGF A;  4FAT A;  1QKB A;  1LST A; 
#chains in the Genus database with same CATH topology
 1JET A;  4KQP A;  4RK2 A;  1B51 A;  1FPL A;  3OO8 A;  4F3S A;  2VPO A;  4G2Z A;  4ZE9 A;  3C4M A;  1B7U A;  4PF6 A;  2LAO A;  2UYF A;  4OER A;  4EF2 A;  2ZYO A;  3KZG A;  3JYR A;  4GWX A;  1LBB A;  2DWJ A;  4G68 B;  2FVZ A;  1WDN A;  1OIB A;  1B3F A;  2D3I A;  1VDW A;  3HCQ A;  1URD A;  1RDX A;  2VOZ A;  4KI0 E;  1EZO A;  2XWI A;  4LP2 B;  1BP5 A;  3O6H A;  4GBW A;  4ESX A;  3CI8 A;  3H03 A;  5TPA A;  1POT A;  2RC7 A;  4PFU A;  4OEN A;  4KR5 A;  3TTM A;  3RTW B;  4ECF A;  3CG3 A;  1G0H A;  2B3F A;  3UP9 A;  4NX1 A;  2ONS A;  3DM0 A;  3IJO B;  3PUV E;  3MYU A;  3W9V A;  5DVJ A;  1P1W A;  4IO5 A;  4HE1 A;  4ZEC A;  2CZK A;  3TQW A;  3IB1 A;  3OD7 A;  3TEL A;  1FPG A;  1NV2 A;  3EHS A;  2OBG A;  1B7Z A;  4POX A;  2XX9 A;  4U1Z A;  4ZEF A;  2HFB A;  1NUZ A;  4FAJ A;  3OEN A;  2WBB A;  2VPN A;  1BK4 A;  4NF4 A;  2UXA A;  3HV1 A;  2HQ0 A;  3PPQ A;  1D9Y A;  5AA4 A;  4U21 A;  3MAM A;  5DW8 A;  4OMB A;  4LN5 A;  4I8C A;  4FEB A;  1D3K A;  4KCC A;  1LGB C;  2XXK A;  3OEK A;  1N3W A;  2RCA A;  3Q26 A;  4C0R A;  2XXI A;  3SES A;  1I6B A;  1PC3 A;  4MLQ A;  2O69 A;  1UQW A;  4DI4 B;  4FBP A;  4NGU A;  3ILT B;  1GTK A;  2FIE A;  2HCA A;  4PFW A;  5I56 B;  4GD5 A;  1B32 A;  3PPP A;  2RCB A;  4G8H A;  4LZ5 A;  1AOV A;  1MS7 A;  3MVW A;  3RGY A;  1MY1 A;  1FTL A;  1SYI A;  1FRP A;  3PMW A;  2F36 A;  4QFO A;  3QIM A;  2V3Q A;  2Q2A A;  3KN8 A;  1IXG A;  4PGP A;  4RPN A;  4O3C A;  1MPD A;  1LFI A;  4LQ5 A;  1FBG A;  1Y9U A;  1OQG A;  1US5 A;  4YIC A;  1LBV A;  1HSE A;  4JWX A;  4NMY A;  4ELQ A;  5CC2 A;  2CMO A;  1B52 A;  2R6G E;  1B7H A;  2Q88 A;  4U23 A;  1MQH A;  4MAG A;  3TCG A;  1POY 1;  1EU8 A;  2H9B A;  5H8N B;  3HN0 A;  1H3D A;  5I2N A;  4OTE A;  5BWJ A;  3T1B A;  1SI0 A;  4NF0 A;  4EXK A;  3IB0 A;  5TPA B;  3K01 A;  2W7Y A;  3U92 A;  4Z7E A;  3SER A;  1DPE A;  1FTA A;  3B6Q A;  4N17 A;  1I6A A;  4PFI A;  1XVX A;  3HFU A;  5EQ7 A;  5TP9 A;  3LSF B;  4ELR A;  1VSO A;  2Y7R A;  3PV0 E;  2B4L A;  4BLA A;  3VXB A;  5LDZ A;  2VD3 A;  2PX1 A;  4MBP A;  3ODB A;  5JTY A;  3USD A;  3KN7 A;  3MUQ A;  3U72 A;  4DCX A;  5CBS A;  3MVY A;  5LTC A;  4YB5 A;  2DP8 A;  5K2Y A;  3ILU B;  1ATG A;  4KFQ A;  1MXV A;  1FCK A;  2HAV A;  1Q9D A;  1A40 A;  1R1N A;  3FJ7 A;  4JWO A;  3L6H A;  4KHZ E;  2F8D A;  1US4 A;  4HW8 A;  1IXC A;  3HHG A;  4NG7 A;  5FTH A;  4H1X A;  5FTI A;  5AA2 A;  5EQA A;  3NOH A;  3ONM A;  1IIW A;  1URS A;  4QBA A;  4NF4 B;  1DOT A;  4R6Y A;  3HPI A;  4OEU A;  3OO7 A;  2R9J A;  1N04 A;  5AA4 B;  5J1D A;  1MXU A;  3EQ1 A;  4THI A;  1Y4C A;  3O2A A;  4YMB A;  1O7T A;  1LFH A;  2HPG A;  4GBV A;  3FAS A;  3BBR A;  4DIG A;  4P1E A;  3Q27 A;  4EUO A;  2IA4 A;  2O1M A;  5IM2 A;  1FQD A;  3IJX B;  2XXV A;  4N91 A;  4GX3 A;  4POW A;  3VVD A;  3PMV A;  1R9Q A;  3H7M A;  3KC1 A;  3PU5 A;  1TFA A;  2R71 A;  1FPJ A;  4QRZ A;  4P56 A;  4KD5 A;  3HST A;  4JB7 A;  4LZ8 A;  1VR5 A;  3TAJ A;  2I4C A;  4JVC A;  3UIF A;  3TCH A;  4OET A;  1YXI A;  4N07 A;  5IKB A;  4OES A;  3C9H A;  5H8H A;  3H6T A;  3VV5 A;  4ND9 A;  4N13 A;  3CR9 A;  2NWJ A;  3MZ9 A;  5I84 A;  1B5H A;  2V3U A;  2L5V A;  5EYH A;  2PFY A;  1QUI A;  4P0G A;  3EKI A;  1B2H A;  3E9X A;  2R8T A;  5I57 B;  3FJM A;  1Y4T A;  5I2N B;  1LLS A;  2ABH A;  4M4G A;  3V89 B;  3QK6 A;  2NXO A;  1JW4 A;  4N8G A;  5F24 A;  1RKM A;  3SKP A;  2RF1 A;  4TQU Q;  2XXU A;  1Q1K A;  1SYH A;  1D9Q A;  3RY3 A;  1EYJ A;  2DE2 A;  4O3A A;  1ZU0 A;  1A8E A;  1NNP A;  3AXF A;  5CBR A;  3RT8 A;  1RYX A;  3RLF E;  4U22 A;  4IO2 A;  4QFL A;  4NAP A;  3K4U A;  5JTY B;  2H25 A;  4IO7 A;  1ZIU A;  2I0C A;  3PUX E;  4G61 A;  2Q2C A;  3EN3 A;  2M8C A;  2XWK A;  2HAU A;  3A29 A;  4U1O A;  1MQI A;  4XF5 A;  4IY5 A;  4ZZA A;  3LC8 A;  1S50 A;  3DP8 A;  1YTV A;  4NF6 A;  4OA4 A;  5EHM A;  4QSD A;  1OVB A;  1USY H;  4OYV A;  5AA2 B;  4PAF A;  1FPK A;  3I5O A;  2XXP A;  2QVV A;  2ESN A;  1LBZ A;  4MX6 A;  1FBH A;  4ZED A;  4LAT A;  5L8D A;  3ROJ A;  3H6U A;  4ONY A;  1FW0 A;  3KFM A;  5HPQ A;  3RT6 B;  1JNF A;  3Q25 A;  3LSL A;  4ZEK A;  1LBY A;  3C35 A;  3PTY A;  4ZS9 A;  1XHY A;  4NQ8 A;  1OVT A;  5FBP A;  4OVJ A;  1AIV A;  2XWV A;  2FHY A;  4P1L A;  1MPB A;  4QSC A;  1MDP 1;  3SZP A;  1LAH E;  4L17 A;  1B4Z A;  3N94 A;  3ZSF A;  3SDF A;  3K1N A;  4G8M A;  3IX1 A;  3UGW A;  4GWS A;  1FTM A;  2Q9T A;  3A09 A;  1FJ9 A;  1MQD A;  1H44 A;  1ZTY A;  4G68 C;  3PMX A;  4G8N A;  2DSF A;  2F3B A;  5IZZ A;  5H8H B;  1H45 A;  2PFZ A;  2ZNT A;  2F5X A;  4LA9 A;  5ET7 A;  5H8Q A;  1ZJL A;  3E3K A;  2P1S A;  4F22 A;  4YB7 A;  1B6H A;  1MDQ A;  3IOU A;  3MQ9 A;  4LZ7 A;  3D4C A;  2Y7K A;  3S4U A;  1LAX A;  1Y3N A;  1IMC A;  3LSW A;  4YMA A;  4EQ7 A;  3S2V A;  1HSJ A;  1PB7 A;  4WXJ A;  4C1T A;  2HXR A;  5I59 A;  1XC1 A;  2HXW A;  1BTJ A;  3LUY A;  1B1H A;  1LAF E;  4LON B;  3H6W A;  2OK2 A;  2O1L A;  4R9F A;  1FBP A;  2DVZ A;  2GHB A;  3K00 A;  4F1V A;  3TTL A;  1B40 A;  3G3H A;  4BDM A;  4YZZ A;  3KJ7 A;  4PE5 B;  1VFE A;  1FPF A;  3V5A A;  4H8J A;  3R7X A;  4XEQ A;  1PEB A;  3K02 A;  1DBZ A;  2XXX A;  5HBC A;  1MY2 A;  1D9V A;  4GVO A;  4GWO A;  1UIU A;  1RDZ A;  4GLI A;  3UN6 A;  1FBC A;  1FSA A;  3C36 A;  1AWB A;  1PBQ A;  4OXV A;  4R75 A;  4NE4 A;  1JW5 A;  3E78 A;  2NOO A;  3M3K A;  3TMG A;  2Y7P A;  4TLL B;  1G0I A;  2Q8J A;  3BFU A;  1Y20 A;  2P3N A;  3QSL A;  3A3C A;  1N7W A;  2HZK A;  2CZI A;  1EYI A;  2ZNU A;  1M5D A;  3S9M C;  3KBZ A;  4IO4 A;  2UVG A;  3K2D A;  1NV1 A;  2I3W A;  1SW4 A;  3WAE A;  5CMM A;  1CNQ A;  5IZ1 A;  4GWY A;  4NED A;  1B5I A;  4H46 A;  5BUU A;  5ICT A;  5I2K B;  1ZKB A;  2XD3 A;  1LCF A;  3TDJ A;  2AIX A;  4NF5 A;  5AA2 D;  3SEW A;  1MPC A;  4YKJ A;  4KPT A;  4FE8 A;  4H5G A;  1LBW A;  4IR8 A;  3OEM A;  5ITP A;  3UK4 A;  3FXU A;  4P9K A;  4YKI A;  2Y5L A;  4LQ2 A;  5J16 A;  5I58 A;  1CB6 A;  4XIG Q;  4P3L A;  3MJN A;  3O9P A;  5DEX A;  4F31 B;  1GR2 A;  5H8Q B;  1XS5 A;  3E79 A;  4R6H A;  5KCJ A;  1IMB A;  2PMS A;  4OQO A;  1QVS A;  1FQA A;  1B3E A;  5KDT A;  2NUV A;  4QFN A;  5I59 B;  1OMP A;  3RTF B;  3CIJ A;  3PUW E;  4P8B A;  5F7V A;  3U1O A;  4GF8 A;  2O51 A;  3K6V A;  3BIH A;  4IGR A;  2F35 A;  4PE3 A;  4XTC Q;  2P0S A;  5ICQ A;  1LEV A;  2ANJ A;  3IFC A;  1FTJ A;  4RY1 A;  4ZZE A;  4IO3 A;  1EYK A;  3FVK A;  2OJT A;  2AYS A;  3CSG A;  4Z0I A;  4F2O A;  4IB2 A;  4QFK A;  3GYY A;  1LB8 A;  4ZDM A;  3VFJ A;  3HO7 A;  5I7I A;  1KA1 A;  1IMD A;  3U8Q A;  4DE8 A;  5CRY A;  2E1S A;  5L9S A;  1NV0 A;  3OXN A;  3VE1 B;  1N84 A;  5A5L A;  2QVU A;  3M3F A;  3TTK A;  4MNI A;  1NFT A;  2Z22 A;  4QSE A;  1IQ7 A;  1FQE A;  4XKN A;  4EQB A;  4PBH A;  4RK9 A;  1URG A;  3TFL A;  5CI5 A;  3SEU A;  4KYS A;  1WVJ A;  2AL4 A;  1QUJ A;  1LB9 A;  1M5C A;  2WEF A;  4RJZ A;  1P1O A;  1FTO A;  3ZKK A;  5ET5 A;  3OO9 A;  1LFG A;  4I3Y A;  3SEX A;  4YB6 A;  1EZ9 A;  3U65 A;  2IEE A;  3IO4 A;  2B4M A;  1MXW A;  2D21 A;  3W15 C;  1FBE A;  1I6Q A;  1JQF A;  3EHU A;  1JVX A;  4PBQ A;  1B05 A;  2F34 A;  4NF5 B;  4NF8 A;  5CMC A;  1NI9 A;  4Q30 B;  4F1U A;  3H06 B;  4DZ1 A;  2O84 X;  3K6X A;  5DYH A;  5A5X A;  3RUM A;  3DP4 A;  5AE4 A;  2QS4 A;  2ZZX A;  5I58 B;  1ZBM A;  5DEX B;  1TWY A;  1FPD A;  3C33 A;  2H99 A;  5KCJ B;  3ECR A;  2I3V A;  2Q74 A;  3FUZ A;  2I49 A;  1Y3Q A;  4NHB A;  3MPL A;  2E0S A;  2NVU B;  5KDT B;  2Y84 A;  1Z7M E;  3PPO A;  3QYT A;  2KLF A;  3B8B A;  3T66 A;  3DEL B;  3FXB A;  5H8F A;  1LCT A;  4QF9 A;  2I4B A;  2XA5 A;  2Y7I A;  4AS4 A;  1B0L A;  1BLF A;  3QMF A;  2PYY A;  1YYZ A;  3OMB A;  4NTL A;  4RNS A;  2WKY A;  3IR1 A;  1NL5 A;  1T0K A;  2UVH A;  4PDH A;  4NWC A;  5ITO A;  3CSB A;  4H6D A;  2OCU A;  5JK4 A;  2XXT A;  3IOT A;  2GHA A;  4PQJ A;  4E0W A;  2P2A A;  1A55 A;  2DYX A;  4ELO A;  1MRP A;  2YLN A;  3CFL A;  2P3V A;  2PCR A;  3IK6 B;  2XX8 A;  5ET6 A;  5EHS A;  1NV6 A;  4P11 A;  4N6K A;  3KGC A;  2Q89 A;  1SQY A;  4XKR A;  4TLM B;  4UAC A;  1ELJ A;  4I40 A;  1MXZ A;  1R6Z A;  4GFR A;  1SW5 A;  5FHO A;  3UA8 A;  2FA7 A;  3B6T A;  3S9N C;  2CEY A;  2XXW A;  3RNN A;  1QGX A;  4H65 A;  3CFX A;  3FXR A;  4GX6 A;  2FBP A;  4AB5 A;  4N4U A;  2RIN A;  2RKM A;  3U94 A;  1K9Y A;  2Z8D A;  2O6A A;  3TZA A;  3H4Z A;  4BDN A;  4KXP A;  4MLV A;  3OSR A;  4M1V A;  1FQC A;  1B1X A;  4OFO A;  5JEI A;  2DS9 A;  2GQ1 A;  3IAZ A;  5TP9 B;  1L5T A;  4K3F A;  2DWI A;  4AQ4 A;  1NKX A;  2VT5 A;  1NMU A;  5DTB A;  1XOC A;  3N26 A;  4MNC A;  1LBX A;  4KYE A;  3KN3 A;  4R6K A;  1MY4 A;  3BFT A;  4YKK A;  1FJ6 A;  5CMK A;  4BDQ A;  2QS3 A;  1IMF A;  3VLW A;  1FQB A;  4H67 A;  5FHN A;  4IO6 A;  1B46 A;  2HEU A;  2OX3 A;  4FEC A;  4NF8 B;  2XXH A;  3TEP A;  4R73 A;  4UAB A;  4MFI A;  3G3G A;  1N7X A;  3QUJ A;  2Z8F A;  4N81 A;  2F78 A;  2BJI A;  1YPN A;  1QJM A;  4PET A;  2PBW A;  5A5X B;  2RC9 A;  2PT1 A;  4AS5 A;  2JJK A;  4OWD A;  1IUD A;  3Q28 A;  1R9L A;  4PF8 A;  3MZB A;  4DI3 D;  1P1U A;  3GLB A;  4OEV A;  3SET A;  1S7Y A;  2UYE A;  4I62 A;  3TTN A;  3GXA A;  1Y1M A;  1SD3 A;  4JWY A;  3OSQ A;  3TYH A;  1D4N A;  3D4G A;  4Q5T A;  5B7D A;  1B3L A;  2HHM A;  2ONK E;  5H8F B;  1Y1Z A;  5HM4 B;  4PTK A;  3IOR A;  1HSL A;  3UOR A;  4PC9 A;  2VD2 A;  2QMX A;  4N8Y A;  1M5F A;  1GGG A;  5AA1 A;  3FJG A;  1VE4 A;  1N3X A;  1XVY A;  5FHM A;  2V84 A;  3G3F A;  1N0T A;  4MH5 A;  2OZZ A;  1SVX B;  3FV2 A;  4WED A;  3IOW A;  1NH7 A;  3EPE A;  3KBR A;  1IZ1 A;  2I0B A;  4YKP A;  1P1Q A;  1F9B A;  3PPR A;  3FIR A;  4ESW A;  2F6P A;  3DP6 A;  2QSX A;  1YZ0 A;  3L6G A;  2H5Y A;  2G93 A;  4R72 A;  4F39 A;  2X7P A;  3QXM A;  1IXH A;  4X48 A;  1USY E;  3BIG A;  4KCD A;  1NNK A;  4PAI A;  2DXR A;  4O7M A;  2XX7 A;  2DOJ A;  1VFD A;  5T3J A;  1OLC A;  4XKQ A;  2CZH A;  3R6U A;  3E4R A;  1M5E A;  4F3B A;  3QUF A;  1DPP A;  3TTR A;  1UTB A;  2FYI A;  3KEI A;  3T9V A;  1QKA A;  4OVP A;  2UVI A;  1FBF A;  4HE2 A;  4OFL A;  3A3U A;  1MG1 A;  2ZYN A;  3BKI B;  3G7W A;  2A5S A;  3K1P A;  3P7I A;  3K6U A;  1FPI A;  2DWA A;  1MH3 A;  3MP8 A;  5TU0 A;  1IME A;  4PAK A;  3MBP A;  4QHQ A;  1MXY A;  3U93 A;  2UVJ A;  1NV7 A;  3FD3 A;  1QUL A;  1N76 A;  3M3L A;  3IFA A;  4RPO A;  2F7C A;  1YAE A;  1NNT A;  5EQ8 A;  5ISU A;  2ZXT A;  4NF6 B;  5F1Q A;  4NN3 A;  4C1U A;  4HXV A;  2BJJ X;  4R2B A;  3D1R A;  5CM6 A;  4PFT A;  3G3K A;  3MP1 A;  2REG A;  3IL1 B;  4JVD A;  1FPE A;  5H8N A;  1OLA A;  3C31 A;  4H8I A;  2F3D A;  3RYD A;  3FGS A;  1MQJ A;  3MC2 A;  4PDD A;  1RDY A;  4HS7 A;  1MQG A;  3QAX A;  3TCF A;  4F2Q A;  3MWB A;  1Z7N E;  4YU0 A;  4EXL A;  2V4C A;  3H3G A;  2I48 A;  2ZNS A;  1SW1 A;  4JSO A;  4XXU A;  3V8X B;  3G3J A;  4HTG A;  3T93 B;  2ONR A;  4TOZ A;  3FVO A;  3T9U A;  1INP A;  2PVU A;  2Y5K A;  1WOD A;  3F11 A;  4OFJ A;  2I6E A;  3O6I A;  3PD8 A;  2HZL A;  4P47 A;  3K1M A;  3LBS A;  1ZMG A;  3TKD A;  1EH3 A;  2QL3 A;  3FVN A;  1NUY A;  5I3S A;  3MP6 A;  5M2V A;  1PDA A;  3MW0 A;  1PB8 A;  1ANF A;  1DTZ A;  2X26 A;  4GX4 A;  1B58 A;  3VVF A;  3I6V A;  4QFP A;  1TFD A;  1IEJ A;  1XI6 A;  3VLU A;  1II5 A;  3N5L A;  4JDF A;  5AA3 A;  3DLN A;  3RQT A;  4BDL A;  5IZ3 A;  4H5F A;  4DDD A;  1NNF A;  3LUZ A;  1B3G A;  5K2X A;  2XD2 A;  1M5B A;  4BDR A;  5EYF A;  1XT8 A;  4O3B A;  1DSN A;  4QXD A;  2GH9 A;  4WKM A;  1S9T A;  1SW2 A;  1UTB B;  2GFE A;  3LR1 A;  4H0W A;  3EHT A;  4PP0 A;  4ELP A;  1NV3 A;  1NV4 A;  4FJP A;  2WX9 A;  4GRK A;  4X04 A;  4UA8 A;  3KC0 A;  4OAN A;  2ALU A;  2F6G A;  4NWD A;  2WYK A;  1PB9 A;  3FXQ A;  4XFE A;  1MM7 A;  1NUX A;  2QPQ A;  1BIY A;  3B7D A;  1IIT A;  3H6V A;  2H4I A;  2A5T A;  3T9H B;  3I3V A;  4RXL A;  1QUK A;  2KR0 A;  4XKP A;  4ZEI A;  4YAH X;  5IGA A;  3MST A;  4F1Y A;  4DLD A;  1RYO A;  1GVC A;  2AL5 A;  4X8R A;  5I57 A;  4OVT A;  3V83 A;  1LBC A;  4MF3 A;  1JEV A;  3GBA A;  4I3E A;  1B9J A;  3CVG A;  1TXF A;  2QVR A;  1SBP A;  2G29 A;  4F3G A;  4O94 A;  3CG1 A;  1NUW A;  3N6T A;  1JVY A;  3TUS A;  4LUB A;  5EQ9 A;  4WEP A;  4PFR A;  1AL3 A;  3G3I A;  4R2F A;  2OWS A;  4O7I A;  1I69 A;  5H8S A;  1ZLQ A;  3GBB A;  5ESY A;  2ZZV A;  4PFB A;  4ZEB A;  2WYP A;  4O8M A;  2DQV A;  3RPW A;  3JZJ A;  2F97 A;  2THI A;  2F7A A;  3S9L C;  4GXA A;  2V93 A;  2MKZ A;  1KWH A;  4GWW A;  3ZS6 A;  1SPI A;  3O28 A;  4RA1 A;  2DE3 A;  2FNC A;  4LVQ A;  2VP1 A;  3FZV A;  4OZ9 A;  2VGQ A;  5I5P A;  4EF1 A;  1B3H A;  4GQO A;  5IZ3 B;  3LSX A;  1SI1 A;  4R9G A;  3B50 A;  4IY6 A;  1A8F A;  2OWZ A;  1FQF A;  3KSJ A;  2B3B A;  3FBP A;  3OO6 A;  4I9D A;  3C34 A;  4F18 A;  1OQH A;  1P1N A;  3M8U A;  4OVQ A;  1LAG E;  1PBP A;  2Y7W A;  4GXS B;  3W9W A;  2CZL A;  5IAI A;  1IXI A;  3IO6 A;  2F7B A;  1B0H A;  1AH5 A;  2FIX A;  5DVI A;  3VLV A;  4X9T A;  3ISP A;  3C32 A;  4MHF A;  1TT1 A;  5LOM A;  2RC8 A;  2QMW A;  3PUZ E;  1FTK A;  4F29 A;  1FPB A;  3THI A;  1A54 A;  4MIJ A;  4HCW A;  4BDO A;  5EYG A;  4JXI A;  4JVI A;  3GZG A;  3O29 A;  4MJO A;  4MMP A;  2XHD A;  3T0J A;  1DMB A;  2O7U A;  2A5T B;  3O97 A;  3RPL A;  2DE4 A;  1MH4 A;  5CMB A;  3WAF A;  1GV8 A;  3KOS A;  4DXC A;  3TPA A;  1EZP A;  2H98 A;  4Q8R A;  4KYD A;  1UIV A;  2OWT A;  2QRY A;  1MY3 A;  1DCU A;  3VXC A;  3E13 X;  4ZE8 A;  5L9M A;  4OHN A;  3CFZ A;  4R74 A;  3R26 A;  1A7L A;  5B70 A;  3B6W A;  4Q0C A;  2DXY A;  2ZYM A;  4ISU A;  4G4P A;  3IB2 A;  1NH8 A;  2DVC A;  4DXB A;  4GWZ A;  5DT6 A;  3T9X B;  4GWU A;  1YCJ A;  4G77 A;  3PPN A;  3OEL A;  3TOD A;  2DDK A;  1UTH A;  1Y3P A;  1H43 A;  3MVX A;  2OLB A;  3ZKL A;  4JSD A;  4MNP A;  2Z8E A;  3FVG A;  1J1N A;  2ZZW A;  3SEV A;  1CE2 A;  3S9E A;  4GOT A;  4RYA A;  2V3T A;  1QW0 A;  2B65 A;  2YPN A;  5ET8 A;  2V25 A;  3TQL A;  1JEU A;  2Z23 A;  4FIM A;  4N15 A;  2XWO A;  5DVF A;  4G68 A;  4DCY A;  3K0V A;  3K6W A;  2X7Q A;  1MY0 A;  3T22 A;  2XXQ A;  2XXY A;  4AB6 A;  4N6D A;  4IGT A;  3KJT A;  3JV9 A;  3T96 B;  2ZMB A;  1KA0 A;  2DWH A;  2I58 A;  4H45 A;  4E0X A;  1B4H A;  4X1D A;  2D5W A;  2GRV A;  2YJP A;  1DK4 A;  3CRB A;  4X1B A;  4HE0 A;  3IOV A;  4PGN A;  4GL8 A;  5L9O A;  3FAT A;  3KG2 A;  3KSX A;  4U4S A;  1FBD A;  4U2R A;  5I2K A;  1Q35 A;  3PUY E;  1O64 A;  3FV1 A;  5KZT A;  3PD9 A;  4GL0 A;  3VDF A;  1H76 A;  2O68 A;  3CHG A;  1A99 A;  2CEX A;  4P0I A;  2Q8M A;  5ELV A;  1IMA A;  3MPK A;  4OVS A;  4EQ9 A;  4HCY A;  2ZYK A;  2QJE A;  1K9Z A;  4FOR A;  4I1D A;  2QS2 A;  2VHA A;  3MZ1 A;  4N6P A;  1P99 A;  4FED A;  4PFY A;  3SEY A;  3RPL B;  1MM6 A;  1JW1 A;  4F19 A;  4MCO A;  4F3P A;  1MXX A;  1DTG A;  1B5J A;  2O7I A;  3EF7 A;  2KQZ A;  3KOT A;  2QFL A;  3RN8 A;  3VVE A;  4GIZ A;  2PT2 A;  1KZ8 A;  3O66 A;  3N6U A;  4U4X A;  1AMF A;  4OVR A;  3MVZ A;  3OOA A;  4EDP A;  2REJ A;  1JP4 A;  5I56 A;  2QS1 A;  4DXU A;  4PCD A;  1BKA A;  4JBZ A;  3O6G A;  1SDX A;  1O63 A;  2XXR A;  3HHF A;  3Q29 A;  3LV0 A;  1UTH B;  3PGF A;  4FAT A;  1QKB A;  1LST A;  2WBD A;  4MEV A;  1NV5 A; 
#chains in the Genus database with same CATH homology
 1JET A;  4KQP A;  4RK2 A;  1B51 A;  3OO8 A;  4F3S A;  4G2Z A;  4ZE9 A;  3C4M A;  1B7U A;  2LAO A;  2UYF A;  4OER A;  4EF2 A;  2ZYO A;  3KZG A;  3JYR A;  1LBB A;  2DWJ A;  4G68 B;  1WDN A;  1OIB A;  1B3F A;  2D3I A;  3HCQ A;  1URD A;  2VOZ A;  4KI0 E;  1EZO A;  4LP2 B;  1BP5 A;  3O6H A;  4ESX A;  3CI8 A;  3H03 A;  5TPA A;  1POT A;  2RC7 A;  4PFU A;  4OEN A;  4KR5 A;  3TTM A;  3RTW B;  4ECF A;  3CG3 A;  2B3F A;  3UP9 A;  2ONS A;  3DM0 A;  3IJO B;  3PUV E;  3W9V A;  5DVJ A;  1P1W A;  4IO5 A;  4ZEC A;  3TQW A;  3IB1 A;  3OD7 A;  3TEL A;  3EHS A;  2OBG A;  1B7Z A;  4POX A;  2XX9 A;  4U1Z A;  4ZEF A;  2HFB A;  4FAJ A;  3OEN A;  4NF4 A;  2UXA A;  3HV1 A;  2HQ0 A;  3PPQ A;  1D9Y A;  5AA4 A;  4U21 A;  3MAM A;  4OMB A;  4I8C A;  4FEB A;  1D3K A;  4KCC A;  1LGB C;  3OEK A;  1N3W A;  2RCA A;  3Q26 A;  4C0R A;  2XXI A;  3SES A;  1I6B A;  1PC3 A;  4MLQ A;  2O69 A;  1UQW A;  3ILT B;  1GTK A;  2HCA A;  4PFW A;  5I56 B;  4GD5 A;  1B32 A;  3PPP A;  2RCB A;  4G8H A;  4LZ5 A;  1AOV A;  1MS7 A;  3MVW A;  3RGY A;  1MY1 A;  1FTL A;  1SYI A;  3PMW A;  2F36 A;  4QFO A;  3QIM A;  2V3Q A;  2Q2A A;  3KN8 A;  1IXG A;  4RPN A;  4O3C A;  1MPD A;  1LFI A;  4LQ5 A;  1Y9U A;  1OQG A;  1US5 A;  4YIC A;  1HSE A;  4JWX A;  4NMY A;  4ELQ A;  5CC2 A;  2CMO A;  1B52 A;  2R6G E;  1B7H A;  2Q88 A;  4U23 A;  1MQH A;  3TCG A;  1POY 1;  1EU8 A;  2H9B A;  5H8N B;  3HN0 A;  1H3D A;  5I2N A;  4OTE A;  5BWJ A;  1SI0 A;  4EXK A;  3IB0 A;  5TPA B;  3K01 A;  2W7Y A;  3U92 A;  4Z7E A;  3SER A;  1DPE A;  3B6Q A;  1I6A A;  1XVX A;  5TP9 A;  3LSF B;  4ELR A;  1VSO A;  2Y7R A;  3PV0 E;  4BLA A;  3VXB A;  2VD3 A;  2PX1 A;  4MBP A;  3ODB A;  5JTY A;  3USD A;  3KN7 A;  3MUQ A;  3U72 A;  4DCX A;  5CBS A;  3MVY A;  4YB5 A;  2DP8 A;  5K2Y A;  3ILU B;  1ATG A;  4KFQ A;  1MXV A;  1FCK A;  2HAV A;  1A40 A;  1R1N A;  3FJ7 A;  4JWO A;  3L6H A;  4KHZ E;  2F8D A;  1US4 A;  4HW8 A;  1IXC A;  3HHG A;  5FTH A;  4H1X A;  5FTI A;  5AA2 A;  3ONM A;  1IIW A;  1URS A;  4NF4 B;  1DOT A;  4R6Y A;  3HPI A;  4OEU A;  3OO7 A;  2R9J A;  1N04 A;  5AA4 B;  5J1D A;  1MXU A;  3EQ1 A;  4THI A;  1Y4C A;  3O2A A;  4YMB A;  1O7T A;  1LFH A;  3FAS A;  3BBR A;  4DIG A;  3Q27 A;  4EUO A;  2IA4 A;  2O1M A;  1FQD A;  3IJX B;  2XXV A;  4POW A;  3VVD A;  3PMV A;  1R9Q A;  3H7M A;  3PU5 A;  1TFA A;  2R71 A;  4QRZ A;  4KD5 A;  3HST A;  4JB7 A;  4LZ8 A;  1VR5 A;  3TAJ A;  2I4C A;  3UIF A;  3TCH A;  4OET A;  4N07 A;  5IKB A;  4OES A;  3C9H A;  5H8H A;  3H6T A;  3VV5 A;  4ND9 A;  4N13 A;  3CR9 A;  2NWJ A;  3MZ9 A;  5I84 A;  1B5H A;  2V3U A;  1QUI A;  4P0G A;  1B2H A;  3E9X A;  5I57 B;  3FJM A;  1Y4T A;  5I2N B;  1LLS A;  2ABH A;  4M4G A;  3V89 B;  3QK6 A;  2NXO A;  1JW4 A;  1RKM A;  3SKP A;  2RF1 A;  4TQU Q;  2XXU A;  1Q1K A;  1SYH A;  3RY3 A;  2DE2 A;  4O3A A;  1ZU0 A;  1A8E A;  1NNP A;  3AXF A;  5CBR A;  3RT8 A;  1RYX A;  3RLF E;  4U22 A;  4IO2 A;  4QFL A;  3K4U A;  5JTY B;  2H25 A;  4IO7 A;  1ZIU A;  2I0C A;  3PUX E;  2Q2C A;  3EN3 A;  2M8C A;  2HAU A;  4U1O A;  1MQI A;  4IY5 A;  4ZZA A;  3LC8 A;  1S50 A;  3DP8 A;  1YTV A;  4NF6 A;  5EHM A;  4QSD A;  1OVB A;  1USY H;  4OYV A;  5AA2 B;  3I5O A;  2XXP A;  2ESN A;  4ZED A;  4LAT A;  5L8D A;  3H6U A;  4ONY A;  1FW0 A;  3KFM A;  5HPQ A;  3RT6 B;  1JNF A;  3Q25 A;  3LSL A;  4ZEK A;  3C35 A;  4ZS9 A;  1XHY A;  1OVT A;  4OVJ A;  1AIV A;  1MPB A;  4QSC A;  1MDP 1;  1LAH E;  4L17 A;  1B4Z A;  3N94 A;  3ZSF A;  3SDF A;  3K1N A;  4G8M A;  3IX1 A;  3UGW A;  1FTM A;  2Q9T A;  3A09 A;  1MQD A;  1H44 A;  1ZTY A;  4G68 C;  3PMX A;  4G8N A;  2DSF A;  5H8H B;  1H45 A;  2ZNT A;  2F5X A;  4LA9 A;  5H8Q A;  1ZJL A;  3E3K A;  2P1S A;  4F22 A;  4YB7 A;  1B6H A;  1MDQ A;  3IOU A;  3MQ9 A;  4LZ7 A;  3D4C A;  2Y7K A;  3S4U A;  1LAX A;  1Y3N A;  3LSW A;  4YMA A;  4EQ7 A;  3S2V A;  1HSJ A;  1PB7 A;  4WXJ A;  4C1T A;  5I59 A;  1XC1 A;  2HXW A;  1BTJ A;  3LUY A;  1B1H A;  1LAF E;  4LON B;  3H6W A;  2OK2 A;  2O1L A;  4R9F A;  2DVZ A;  2GHB A;  3K00 A;  4F1V A;  3TTL A;  1B40 A;  3G3H A;  4BDM A;  4YZZ A;  3KJ7 A;  4PE5 B;  1VFE A;  3V5A A;  4H8J A;  3R7X A;  1PEB A;  3K02 A;  2XXX A;  5HBC A;  1MY2 A;  1D9V A;  4GVO A;  4GWO A;  1UIU A;  4GLI A;  3UN6 A;  3C36 A;  1PBQ A;  4OXV A;  4R75 A;  4NE4 A;  1JW5 A;  2NOO A;  3M3K A;  3TMG A;  2Y7P A;  4TLL B;  2Q8J A;  3BFU A;  1Y20 A;  3QSL A;  3A3C A;  1N7W A;  2HZK A;  2ZNU A;  1M5D A;  3S9M C;  4IO4 A;  2UVG A;  3K2D A;  2I3W A;  1SW4 A;  3WAE A;  5CMM A;  4NED A;  1B5I A;  5BUU A;  5ICT A;  5I2K B;  1ZKB A;  2XD3 A;  1LCF A;  3TDJ A;  2AIX A;  4NF5 A;  5AA2 D;  3SEW A;  1MPC A;  4YKJ A;  4KPT A;  4FE8 A;  4H5G A;  3OEM A;  5ITP A;  3UK4 A;  3FXU A;  4YKI A;  4LQ2 A;  5I58 A;  1CB6 A;  4XIG Q;  3MJN A;  3O9P A;  5DEX A;  4F31 B;  1GR2 A;  5H8Q B;  1XS5 A;  4R6H A;  5KCJ A;  2PMS A;  4OQO A;  1QVS A;  1FQA A;  1B3E A;  5KDT A;  2NUV A;  4QFN A;  5I59 B;  1OMP A;  3RTF B;  3CIJ A;  3PUW E;  5F7V A;  3U1O A;  4GF8 A;  2O51 A;  3K6V A;  4IGR A;  2F35 A;  4XTC Q;  2P0S A;  5ICQ A;  2ANJ A;  1FTJ A;  4RY1 A;  4ZZE A;  4IO3 A;  3FVK A;  2OJT A;  2AYS A;  3CSG A;  4Z0I A;  4F2O A;  4IB2 A;  4QFK A;  4ZDM A;  1LB8 A;  3VFJ A;  3HO7 A;  3U8Q A;  4DE8 A;  5CRY A;  2E1S A;  5L9S A;  3OXN A;  3VE1 B;  1N84 A;  3M3F A;  3TTK A;  1NFT A;  2Z22 A;  4QSE A;  1IQ7 A;  1FQE A;  4XKN A;  4EQB A;  4RK9 A;  1URG A;  3TFL A;  5CI5 A;  3SEU A;  4KYS A;  1WVJ A;  2AL4 A;  1QUJ A;  1LB9 A;  1M5C A;  4RJZ A;  1P1O A;  1FTO A;  3ZKK A;  3OO9 A;  1LFG A;  3SEX A;  4YB6 A;  1EZ9 A;  2IEE A;  3IO4 A;  1MXW A;  2D21 A;  3W15 C;  1I6Q A;  1JQF A;  3EHU A;  1JVX A;  1B05 A;  2F34 A;  4NF5 B;  4NF8 A;  5CMC A;  4Q30 B;  4F1U A;  3H06 B;  4DZ1 A;  2O84 X;  3K6X A;  5DYH A;  5A5X A;  3RUM A;  3DP4 A;  5AE4 A;  2QS4 A;  5I58 B;  1ZBM A;  5DEX B;  1TWY A;  3C33 A;  2H99 A;  5KCJ B;  3ECR A;  2I3V A;  3FUZ A;  2I49 A;  1Y3Q A;  3MPL A;  2E0S A;  2NVU B;  5KDT B;  2Y84 A;  1Z7M E;  3PPO A;  3QYT A;  2KLF A;  3T66 A;  3DEL B;  5H8F A;  1LCT A;  4QF9 A;  2I4B A;  2Y7I A;  1B0L A;  1BLF A;  2PYY A;  3OMB A;  4NTL A;  4RNS A;  2WKY A;  3IR1 A;  1NL5 A;  1T0K A;  2UVH A;  4NWC A;  5ITO A;  3CSB A;  4H6D A;  2OCU A;  5JK4 A;  2XXT A;  3IOT A;  2GHA A;  4PQJ A;  4E0W A;  2P2A A;  1A55 A;  2DYX A;  4ELO A;  1MRP A;  2YLN A;  3CFL A;  3IK6 B;  2XX8 A;  5EHS A;  4P11 A;  3KGC A;  2Q89 A;  1SQY A;  4XKR A;  4TLM B;  4UAC A;  1ELJ A;  1MXZ A;  1R6Z A;  4GFR A;  1SW5 A;  5FHO A;  3UA8 A;  2FA7 A;  3B6T A;  3S9N C;  2XXW A;  3RNN A;  4H65 A;  3CFX A;  3FXR A;  4AB5 A;  2RIN A;  2RKM A;  3U94 A;  2Z8D A;  2O6A A;  3TZA A;  3H4Z A;  4BDN A;  4MLV A;  3OSR A;  4M1V A;  1FQC A;  1B1X A;  4OFO A;  5JEI A;  2DS9 A;  3IAZ A;  5TP9 B;  1L5T A;  4K3F A;  2DWI A;  4AQ4 A;  1NKX A;  1NMU A;  5DTB A;  1XOC A;  3N26 A;  4KYE A;  3KN3 A;  4R6K A;  1MY4 A;  3BFT A;  4YKK A;  5CMK A;  4BDQ A;  2QS3 A;  3VLW A;  1FQB A;  4H67 A;  5FHN A;  4IO6 A;  1B46 A;  2HEU A;  4NF8 B;  4FEC A;  2XXH A;  3TEP A;  4R73 A;  4MFI A;  3G3G A;  1N7X A;  3QUJ A;  2Z8F A;  2F78 A;  1YPN A;  1QJM A;  4PET A;  2PBW A;  5A5X B;  2RC9 A;  2PT1 A;  4OWD A;  1IUD A;  3Q28 A;  1R9L A;  3MZB A;  1P1U A;  3GLB A;  4OEV A;  3SET A;  1S7Y A;  2UYE A;  4I62 A;  3TTN A;  3GXA A;  1Y1M A;  1SD3 A;  4JWY A;  3OSQ A;  3TYH A;  1D4N A;  3D4G A;  4Q5T A;  5B7D A;  1B3L A;  2ONK E;  5H8F B;  1Y1Z A;  5HM4 B;  3IOR A;  1HSL A;  3UOR A;  2VD2 A;  2QMX A;  1M5F A;  1GGG A;  5AA1 A;  3FJG A;  1VE4 A;  1N3X A;  1XVY A;  5FHM A;  2V84 A;  3G3F A;  1N0T A;  4MH5 A;  2OZZ A;  1SVX B;  3FV2 A;  4WED A;  3IOW A;  1NH7 A;  3EPE A;  3KBR A;  1IZ1 A;  2I0B A;  4YKP A;  1P1Q A;  1F9B A;  3PPR A;  3FIR A;  4ESW A;  2F6P A;  3DP6 A;  2QSX A;  3L6G A;  2H5Y A;  2G93 A;  4R72 A;  4F39 A;  2X7P A;  3QXM A;  1IXH A;  4X48 A;  1USY E;  4KCD A;  1NNK A;  2DXR A;  2XX7 A;  2DOJ A;  1VFD A;  1OLC A;  4XKQ A;  3R6U A;  3E4R A;  1M5E A;  4F3B A;  3QUF A;  1DPP A;  3TTR A;  1UTB A;  2FYI A;  3KEI A;  3T9V A;  1QKA A;  2UVI A;  4OFL A;  3A3U A;  1MG1 A;  2ZYN A;  3BKI B;  3G7W A;  2A5S A;  3K1P A;  3P7I A;  3K6U A;  2DWA A;  1MH3 A;  3MP8 A;  5TU0 A;  3MBP A;  4QHQ A;  1MXY A;  3U93 A;  2UVJ A;  3FD3 A;  1QUL A;  1N76 A;  3M3L A;  4RPO A;  2F7C A;  1YAE A;  1NNT A;  5ISU A;  2ZXT A;  4NF6 B;  5F1Q A;  4C1U A;  2BJJ X;  4R2B A;  5CM6 A;  4PFT A;  3G3K A;  3MP1 A;  2REG A;  3IL1 B;  5H8N A;  1OLA A;  3C31 A;  4H8I A;  3FGS A;  1MQJ A;  3MC2 A;  4HS7 A;  1MQG A;  3QAX A;  3TCF A;  4F2Q A;  3MWB A;  1Z7N E;  4YU0 A;  4EXL A;  3H3G A;  2I48 A;  2ZNS A;  1SW1 A;  4JSO A;  4XXU A;  3V8X B;  3G3J A;  4HTG A;  3T93 B;  2ONR A;  4TOZ A;  3FVO A;  3T9U A;  2PVU A;  1WOD A;  3F11 A;  4OFJ A;  2I6E A;  3O6I A;  3PD8 A;  2HZL A;  3K1M A;  3LBS A;  1ZMG A;  3TKD A;  1EH3 A;  2QL3 A;  3FVN A;  3MP6 A;  5M2V A;  1PDA A;  3MW0 A;  1PB8 A;  1ANF A;  1DTZ A;  2X26 A;  1B58 A;  3VVF A;  3I6V A;  4QFP A;  1TFD A;  1IEJ A;  3VLU A;  1II5 A;  3N5L A;  4JDF A;  5AA3 A;  3DLN A;  3RQT A;  4BDL A;  4H5F A;  4DDD A;  1NNF A;  1B3G A;  5K2X A;  2XD2 A;  1M5B A;  4BDR A;  5EYF A;  1XT8 A;  4O3B A;  1DSN A;  2GH9 A;  4WKM A;  1S9T A;  1SW2 A;  1UTB B;  2GFE A;  3LR1 A;  4H0W A;  3EHT A;  4PP0 A;  4ELP A;  4FJP A;  4GRK A;  4UA8 A;  2ALU A;  2F6G A;  4NWD A;  1PB9 A;  3FXQ A;  1MM7 A;  2QPQ A;  1BIY A;  3B7D A;  1IIT A;  3H6V A;  2H4I A;  2A5T A;  3T9H B;  3I3V A;  4RXL A;  1QUK A;  4XKP A;  4ZEI A;  4YAH X;  4F1Y A;  4DLD A;  1RYO A;  1GVC A;  2AL5 A;  5I57 A;  3V83 A;  1LBC A;  4MF3 A;  1JEV A;  3GBA A;  1B9J A;  3CVG A;  1TXF A;  1SBP A;  2G29 A;  4F3G A;  3CG1 A;  3N6T A;  1JVY A;  3TUS A;  4LUB A;  4WEP A;  1AL3 A;  3G3I A;  4R2F A;  2OWS A;  1I69 A;  5H8S A;  1ZLQ A;  3GBB A;  4ZEB A;  2DQV A;  3RPW A;  3JZJ A;  2F97 A;  2THI A;  2F7A A;  3S9L C;  4GXA A;  2V93 A;  1KWH A;  3ZS6 A;  3O28 A;  4RA1 A;  2DE3 A;  2FNC A;  4LVQ A;  2VP1 A;  3FZV A;  4OZ9 A;  2VGQ A;  4EF1 A;  1B3H A;  4GQO A;  3LSX A;  1SI1 A;  4R9G A;  4IY6 A;  1A8F A;  1FQF A;  3KSJ A;  2B3B A;  3OO6 A;  4I9D A;  3C34 A;  4F18 A;  1OQH A;  1P1N A;  3M8U A;  1LAG E;  1PBP A;  2Y7W A;  4GXS B;  3W9W A;  2CZL A;  5IAI A;  1IXI A;  3IO6 A;  2F7B A;  1B0H A;  1AH5 A;  5DVI A;  3VLV A;  4X9T A;  3C32 A;  1TT1 A;  5LOM A;  2RC8 A;  2QMW A;  3PUZ E;  1FTK A;  4F29 A;  3THI A;  1A54 A;  4HCW A;  4BDO A;  4JXI A;  3GZG A;  3O29 A;  2XHD A;  1DMB A;  2O7U A;  2A5T B;  3O97 A;  2DE4 A;  1MH4 A;  5CMB A;  3WAF A;  1GV8 A;  3KOS A;  4DXC A;  3TPA A;  1EZP A;  2H98 A;  4Q8R A;  4KYD A;  1UIV A;  2OWT A;  2QRY A;  1MY3 A;  3VXC A;  3E13 X;  4ZE8 A;  5L9M A;  4OHN A;  3CFZ A;  4R74 A;  3R26 A;  1A7L A;  5B70 A;  3B6W A;  4Q0C A;  2DXY A;  2ZYM A;  4ISU A;  4G4P A;  3IB2 A;  1NH8 A;  2DVC A;  4DXB A;  5DT6 A;  3T9X B;  1YCJ A;  4G77 A;  3PPN A;  3OEL A;  3TOD A;  1UTH A;  1Y3P A;  1H43 A;  3MVX A;  2OLB A;  3ZKL A;  4JSD A;  2Z8E A;  3FVG A;  1J1N A;  3SEV A;  1CE2 A;  3S9E A;  4GOT A;  4RYA A;  2V3T A;  1QW0 A;  2B65 A;  2YPN A;  2V25 A;  3TQL A;  1JEU A;  2Z23 A;  4FIM A;  5DVF A;  4G68 A;  4DCY A;  3K0V A;  3K6W A;  2X7Q A;  1MY0 A;  3T22 A;  2XXQ A;  2XXY A;  4AB6 A;  4IGT A;  3KJT A;  3JV9 A;  3T96 B;  2ZMB A;  2DWH A;  4E0X A;  2I58 A;  1B4H A;  4X1D A;  2D5W A;  2GRV A;  2YJP A;  3CRB A;  4X1B A;  3IOV A;  4GL8 A;  5L9O A;  3FAT A;  3KG2 A;  3KSX A;  4U4S A;  4U2R A;  5I2K A;  1Q35 A;  3PUY E;  1O64 A;  3FV1 A;  5KZT A;  3PD9 A;  4GL0 A;  3VDF A;  1H76 A;  2O68 A;  1A99 A;  4P0I A;  5ELV A;  3MPK A;  4EQ9 A;  4HCY A;  2ZYK A;  2QJE A;  4FOR A;  4I1D A;  2QS2 A;  2VHA A;  3MZ1 A;  4N6P A;  1P99 A;  4FED A;  4PFY A;  3SEY A;  1MM6 A;  1JW1 A;  4F19 A;  4F3P A;  1MXX A;  1DTG A;  1B5J A;  2O7I A;  3EF7 A;  3KOT A;  3RN8 A;  3VVE A;  4GIZ A;  2PT2 A;  3O66 A;  3N6U A;  4U4X A;  1AMF A;  3MVZ A;  3OOA A;  4EDP A;  2REJ A;  5I56 A;  2QS1 A;  4DXU A;  1BKA A;  4JBZ A;  3O6G A;  1SDX A;  1O63 A;  2XXR A;  3HHF A;  3Q29 A;  1UTH B;  3PGF A;  4FAT A;  1QKB A;  1LST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...