4Z7EA

Soluble binding domain of lmo1422 abc-transporter
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
270
structure length
270
Chain Sequence
EITIAGKLGAEPEILINMYKLVIEDETDLKVNVKPNMGKTSFVFNALKSGDIDIYPEFTGTVLETFLKENAKTHDPEEVYTQARDGLAKDFDMTYLKPMKYNNTYALAVSPEFAKENNLEKISDLGPVSDQVKAGFTLEFKDRSDGYKGIQDKYGLTFSNLKTMEPKLRYNAIKSGDINLLDAYSTDSELAQYKLKVLEDDQQLFPPYQGAPLMLTKTLDKYPELKKPLNKLAGKITDDEMRKMNYEVNVNGKSAYTVAKDYLKDQGIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Substrate-Binding Domain from Listeria monocytogenes Bile-Resistance Determinant BilE
doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transport protein
molecule keywords Lmo1422 protein
total genus 98
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4z7eA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4z7eA02
2XXRA 4LP2B 4ZS9A 1JEVA 1Q1KA 3UK4A 2O1LA 2H9BA 4H65A 3H06B 1S50A 4RY1A 2G93A 2GFEA 5H8QB 1ZLQA 4GLIA 3RLFE 1QULA 3UORA 3Q28A 2E1SA 2PMSA 4ZEKA 1Y4TA 4GXAA 4N07A 3FGSA 4OQOA 3LSLA 2DP8A 4QFLA 5HM4B 4OHNA 2F36A 2YJPA 4R75A 2XXUA 3MVWA 3O97A 4E0WA 3IAZA 2DVZA 2QRYA 4G68B 4ZEDA 3FV2A 1ATGA 2Z22A 4X1DA 2AYSA 1ELJA 4EDPA 2DWIA 1SVXB 5AA4B 1LSTA 3T9HB 2RINA 4G77A 1SW5A 4N6PA 1FQCA 4POXA 1A8EA 1LCTA 2R71A 3I5OA 1N7XA 1H44A 1QW0A 3HCQA 4KYEA 4NF6B 1URDA 5H8QA 5K2XA 4F22A 3LSWA 1Y1MA 1DOTA 3M3KA 1MXVA 3RUMA 4R72A 4H0WA 2B65A 1QUKA 3SDFA 1IQ7A 4YB5A 2DS9A 4F18A 4LZ7A 4GVOA 2A5TA 3O66A 4OZ9A 3KOTA 4UA8A 2REGA 3OO7A 4ELOA 3TDJA 2Y7WA 2F7CA 3OSRA 1MDQA 1USYH 3U93A 4YZZA 1LB9A 1IITA 1P1QA 3H6VA 3OXNA 3H3GA 2PT1A 1NNTA 4PFYA 3MZ9A 5F1QA 4GFRA 4NTLA 5CI5A 3HN0A 2ZXTA 1QUJA 4U4SA 5AA2A 1B32A 5DVJA 3G3FA 5ELVA 3IJXB 3HPIA 3LSFB 3FVKA 1P99A 3KSJA 3CVGA 4P0GA 4ESXA 3UP9A 2QMXA 4EF1A 2GHBA 1ZBMA 2HCAA 2ZYKA 2F35A 4I62A 5LOMA 1XVYA 3KSXA 1H3DA 1FQAA 3BBRA 3IL1B 4F2QA 3UN6A 3OO6A 4DXBA 1SW4A 4QHQA 3SEVA 3GBAA 1TT1A 3RPWA 4BLAA 3H03A 3TEPA 4I8CA 2ZNTA 1DTZA 4ZZAA 2HAVA 1RYXA 1Y3QA 3MZ1A 1A54A 1IXCA 5CMCA 3O9PA 3FVNA 3SEYA 4ZECA 2ZYOA 5ICTA 4ELRA 3K6XA 3LUYA 3MW0A 1B7ZA 1O63A 4H8IA 4F3SA 1OQHA 4LATA 3C34A 3N6UA 4OYVA 1GVCA 1N7WA 3ZSFA 1D9YA 3VE1B 4R9FA 3T9UA 2E0SA 4KPTA 3TCGA 3GBBA 3S9EA 2V25A 3EHTA 1DMBA 1JETA 3QAXA 4OWDA 4R6HA 2V93A 1AL3A 1MQHA 3H4ZA 2Z8DA 1M5DA 4P11A 5JK4A 2XXQA 3P7IA 1NH7A 1N3XA 3ZS6A 3TYHA 2DQVA 4F29A 1B0HA 1D4NA 1B0LA 1NFTA 3KN7A 4ECFA 1RKMA 3E13X 3N6TA 2BJJX 3QUJA 4GRKA 4OETA 4YAHX 3MVZA 4NEDA 3K6VA 4YKJA 1MH3A 2P0SA 4KHZE 4FE8A 1B58A 5FHNA 3PGFA 1YPNA 4YICA 3W15C 5I56A 3DM0A 2V84A 4NF4A 3VXBA 2Y84A 5I2NB 2XXYA 1HSLA 3KFMA 4YKIA 1IXGA 4IO7A 4HCYA 3SEXA 3FASA 3ILUB 5I57B 3SESA 2UYEA 5A5XB 3T9XB 4FEBA 4Q0CA 3TUSA 2AL5A 1MY4A 3MWBA 3TQWA 4BDNA 3FV1A 2RC8A 4TLMB 4ZEBA 1II5A 2O7IA 2UVHA 1R1NA 3QSLA 2I0CA 5DEXB 4FATA 3MP6A 2Q9TA 4NF6A 3S4UA 1MY0A 3DP6A 3FUZA 4GL0A 3VLWA 2H4IA 4WXJA 2NVUB 3IORA 2I48A 4H5FA 1EU8A 2XXXA 3O6GA 4OEUA 4EF2A 2Q8JA 5DVIA 3U94A 4UACA 4ND9A 2G29A 1ZKBA 5H8SA 3V83A 2DWJA 2XXPA 1Y20A 2R9JA 3IB1A 4PFUA 2O7UA 3TTLA 3IOTA 3MAMA 2NOOA 3BKIB 4PP0A 3IK6B 1IEJA 4XKNA 1B3GA 1S7YA 5I59A 1WVJA 2DXYA 2QS4A 3FVGA 4IGTA 4IO4A 3RGYA 3RY3A 1R6ZA 4Z7EA 3T22A 1PBPA 5IKBA 2UYFA 2VD3A 1KWHA 2PT2A 4R74A 4R9GA 4JWOA 4U23A 4JWYA 4XXUA 3HV1A 4KR5A 5EYFA 3U8QA 1POTA 5ITPA 2V3QA 2PYYA 1PDAA 1B5HA 3E4RA 1UQWA 3QK6A 2R6GE 5J1DA 3PMWA 4M4GA 1ZJLA 1SW2A 4H5GA 4O3CA 1S9TA 4NWDA 5JEIA 4XKQA 1SW1A 4ZZEA 1QUIA 3RTWB 4R6KA 1ZMGA 4GOTA 4LA9A 4JSDA 3IB2A 4QFKA 1L5TA 4KI0E 2H99A 1B7UA 4DXCA 1OVBA 4IO5A 2HFBA 4U2RA 4OMBA 2XXWA 3Q26A 1MXZA 4U1OA 3U72A 3PPQA 1Q35A 4DZ1A 1FQDA 1B46A 3LR1A 4DXUA 4WKMA 2F7BA 2DOJA 4WEDA 3PUWE 2DYXA 1P1NA 4TLLB 3PV0E 2ONRA 4GXSB 4NE4A 5I2NA 3CRBA 5ICQA 3S9NC 4JB7A 2M8CA 2OCUA 4G2ZA 4OFLA 4PE5B 5TU0A 2ANJA 3A3CA 5I57A 4RNSA 1AOVA 2I0BA 3QUFA 2O68A 4NF8A 2I4BA 2RCBA 1LAGE 1OLAA 3D4GA 4MFIA 4ESWA 3C31A 3WAFA 2PVUA 4K3FA 2F5XA 4ZE9A 5AA2D 2IA4A 2X7QA 1XVXA 2OLBA 2ZNSA 1OVTA 1SD3A 1XT8A 2Z8FA 2ZYNA 3HO7A 3K1PA 4LQ5A 3Q29A 3M3LA 2Z23A 2YLNA 3T93B 3CFXA 4YMBA 2ZYMA 3A3UA 4EXKA 1FTLA 1NH8A 3K6UA 1OIBA 5M2VA 2QS2A 3GZGA 3O6IA 1MDP1 2O84X 3C33A 3ONMA 4I1DA 3T96B 1B3EA 4MF3A 1BIYA 4ELPA 3RT8A 2KLFA 3QYTA 5F7VA 3I6VA 3V8XB 3LSXA 3W9WA 1MXUA 5ISUA 4QSDA 2XX9A 3FVOA 4ISUA 4JDFA 3AXFA 5H8NB 4H8JA 4R2BA 4RK9A 4ZEIA 3TODA 1FTKA 4BDRA 5HPQA 3L6HA 3FD3A 1AH5A 4GIZA 2XXIA 4IO2A 3K1MA 1MQIA 3K6WA 4GQOA 4R73A 3A09A 3OEKA 4NWCA 5IAIA 3S9MC 3PPOA 3K0VA 3TFLA 2DXRA 2I58A 4QSEA 3VFJA 5CBSA 2QPQA 1OQGA 4I9DA 4QFPA 4Q8RA 1OMPA 3HSTA 3MC2A 2NWJA 5KCJA 1Z7ME 2AIXA 2RKMA 2VP1A 3KOSA 4H1XA 2QS3A 4BDQA 4EUOA 5I59B 2GHAA 5BWJA 2DWHA 1B3FA 5K2YA 5L8DA 1BTJA 1I69A 3TELA 2FYIA 2DE3A 3FXUA 2F8DA 4MLVA 4NF5B 1JQFA 2I49A 3CG1A 1M5CA 2D21A 3K01A 5H8HA 1QKAA 3MPLA 3PUYE 2UVGA 5CBRA 3O6HA 1B51A 1MQJA 3PMXA 2I4CA 1PBQA 1IXHA 2HEUA 2LAOA 3R26A 3JZJA 4U21A 5L9SA 2F6PA 3ODBA 4OFOA 4F3GA 2CZLA 4RJZA 5H8FB 1I6QA 2WKYA 3D4CA 3HHGA 2V3TA 1H43A 3UGWA 4RPOA 3DLNA 1N76A 3O29A 1DTGA 2DE4A 4C0RA 1M5FA 3RN8A 1MPBA 3IR1A 4OVJA 5FHOA 3TCFA 4PFTA 1SYHA 4AB5A 1D9VA 2ZMBA 1MY1A 3PPPA 3MPKA 3MQ9A 3PUZE 1CB6A 1IUDA 4YB7A 2XX8A 3FJ7A 5CMKA 1Y9UA 3SERA 2I3VA 2H98A 4OTEA 4F2OA 1N84A 4F19A 4JSOA 1DPEA 5AA4A 3W9VA 3IB0A 4U22A 5CMBA 2Q88A 1FW0A 1JVYA 1MM6A 3H7MA 3KN8A 1PC3A 2F97A 1JEUA 4JWXA 4PETA 4N13A 3THIA 1EZOA 1CE2A 2OJTA 3E9XA 4G8NA 4LZ8A 1XS5A 4ZDMA 2OWSA 1MM7A 4F1UA 3PUVE 2Q2CA 4LUBA 4XKRA 1FQEA 3TAJA 5JTYA 3T9VA 1POY1 2VD2A 2XXHA 3ECRA 3KJ7A 1JW1A 1TFAA 1N3WA 4GL8A 1H45A 1SI0A 3K4UA 4EQBA 2OZZA 4DCXA 1HSEA 3PMVA 4DCYA 2O51A 3N5LA 3OOAA 4YU0A 3CFLA 1PB7A 4MH5A 3H6TA 3FIRA 4ONYA 1N04A 5I2KB 3V89B 5AA1A 3FXQA 3M8UA 1LFIA 3MP1A 3CIJA 4LQ2A 4MLQA 5DT6A 3RQTA 1LLSA 3IO4A 2OBGA 2NXOA 3MZBA 4R6YA 2D3IA 4RXLA 5H8NA 2RC7A 3T66A 3PPNA 2ESNA 2X26A 3CSGA 4IO6A 3VVDA 4BDOA 1US4A 3TTNA 2UVJA 1QVSA 1VFDA 2Z8EA 2GH9A 1MRPA 3FXRA 3SETA 4TQUQ 1B3HA 1ZU0A 4U4XA 5I84A 5A5XA 3S9LC 1IIWA 5L9MA 2REJA 4U1ZA 3CR9A 1GGGA 1B4ZA 2Y7RA 1QJMA 1TWYA 3C4MA 3IOVA 4DIGA 5AE4A 1SYIA 1O7TA 2QSXA 1MH4A 2XD2A 1M5EA 1NNFA 4YMAA 1MXXA 1SQYA 4NF4B 1LAFE 3R6UA 3CSBA 5TPAA 4R2FA 1LCFA 5HBCA 1RYOA 3VV5A 3UIFA 1VFEA 3QXMA 2B3BA 1TFDA 4L17A 4KYSA 2D5WA 4FJPA 1I6AA 4GWOA 4FIMA 3HHFA 5AA3A 3PU5A 4F3BA 2Y7KA 3MVYA 1VR5A 3G3IA 1GTKA 3OO8A 5CC2A 3BFUA 3U92A 2ONKE 3MBPA 5DEXA 3VDFA 3PD9A 3VVEA 1P1UA 3EPEA 5DVFA 1MPDA 4KD5A 2DVCA 3VXCA 3IOUA 2HZKA 2HQ0A 3IJOB 1SI1A 3O2AA 4NF5A 3JYRA 5B70A 3CI8A 2RCAA 1ANFA 3L6GA 2ABHA 3E3KA 3Q27A 3EHUA 2HAUA 4X1BA 4GF8A 4XIGQ 3TQLA 1EZPA 1ZIUA 4PFWA 4AB6A 4P0IA 1LAXA 2XHDA 1Y3PA 1LBCA 3B6TA 4GD5A 4O3BA 3WAEA 4IO3A 3CG3A 4QF9A 2XXTA 5I58B 1A7LA 1Z7NE 2Y7PA 3B7DA 1A99A 4QSCA 1BP5A 3DP8A 3G3JA 3OSQA 4AQ4A 4X9TA 5B7DA 5CM6A 2RF1A 3OENA 1NKXA 1UTHA 2HXWA 1B6HA 1NMUA 3TPAA 4QFOA 1LFGA 4RPNA 2O6AA 1UIVA 2X7PA 1MG1A 1B40A 4IGRA 4F3PA 3TTRA 2F6GA 5KDTA 2FA7A 2ZNUA 2UXAA 1IXIA 1IZ1A 1MQGA 1WDNA 3FATA 2I3WA 3H6WA 1B2HA 1FCKA 1PB9A 3BFTA 1Y3NA 3C36A 3K02A 4YB6A 4BDMA 4HW8A 2AL4A 4QRZA 3KGCA 5EHSA 5FTIA 1MY3A 3LC8A 1LAHE 4KFQA 1USYE 2CMOA 3C35A 4H67A 2O69A 2DSFA 3F11A 2XD3A 2GRVA 1UTBB 3FJGA 1A8FA 1YAEA 5FHMA 4IY5A 1P1OA 4FEDA 2H5YA 2W7YA 1LGBC 1NL5A 4XTCQ 1B05A 4OENA 2A5SA 1A40A 4OERA 2F78A 4KQPA 5CMMA 3RT6B 3Q25A 2Q2AA 3S2VA 1EH3A 4F39A 2HZLA 2Q89A 4X48A 1A55A 1JVXA 1B9JA 1LBBA 3IX1A 3FJMA 3M3FA 3I3VA 4HCWA 4XKPA 5DTBA 5I2KA 3SKPA 5BUUA 2ALUA 4Z0IA 1PEBA 1GV8A 3SEWA 1VE4A 3LBSA 2VOZA 4G68C 4MBPA 1B4HA 3ZKLA 4JXIA 3JV9A 1TXFA 1UIUA 1FTMA 1MY2A 5FTHA 3RTFB 2I6EA 2QJEA 3KG2A 4ZEFA 1MPCA 1YTVA 2V3UA 4THIA 4ZE8A 3TZAA 2F34A 3UA8A 3IO6A 3N26A 1URSA 1OLCA 3G3HA 4QFNA 1JNFA 1FQBA 3EF7A 4DE8A 5CRYA 1R9QA 2VGQA 4EQ7A 3DP4A 2RC9A 4HS7A 4POWA 3VVFA 1B52A 5TP9B 1I6BA 2PBWA 3KBRA 4JBZA 3EHSA 2PX1A 2Y7IA 4KCDA 4PQJA 1P1WA 3U1OA 1JW4A 5AA2B 1ZTYA 4EQ9A 1JW5A 2OK2A 1BLFA 1B7HA 1WODA 1B5JA 2A5TB 5EHMA 5TPAB 2NUVA 4Q30B 4RA1A 4C1TA 1J1NA 1Y1ZA 4IB2A 3R7XA 3DELB 1B1XA 1FTOA 3VLVA 5KCJB 1LB8A 5KZTA 1SBPA 2H25A 3MUQA 4G4PA 1SDXA 1MQDA 4G8HA 1D3KA 4IY6A 4KCCA 2ONSA 4YKPA 2XXVA 4F31B 1FTJA 1GR2A 1DPPA 3C9HA 3G3GA 3IOWA 1HSJA 3OEMA 3CFZA 4LONB 1DSNA 3EN3A 4M1VA 3TKDA 4F1VA 1NNPA 4YKKA 3SEUA 1AIVA 4OESA 4HTGA 2FNCA 4TOZA 1MS7A 5H8HB 1B3LA 2THIA 1EZ9A 3QIMA 3B6QA 3PPRA 3KEIA 1H76A 1VSOA 3O28A 3OD7A 3FZVA 1O64A 1URGA 2P1SA 4DLDA 3V5AA 1B1HA 3N94A 5H8FA 3H6UA 1M5BA 1B5IA 3KN3A 2XX7A 4G8MA 3VLUA 4C1UA 2QS1A 1Y4CA 4H6DA 5ITOA 3TMGA 3TTKA 3GXAA 1NNKA 3K2DA 4NF8B 4OXVA 3ILTB 3ZKKA 3USDA 1AMFA 4DDDA 3TCHA 2QMWA 4F1YA 5KDTB 4Q5TA 2DWAA 3KZGA 4WEPA 4LVQA 4FORA 4E0XA 5L9OA 2F7AA 4FECA 1LFHA 1YCJA 4EXLA 4RK2A 3G3KA 2B3FA 1R9LA 3K00A 3MJNA 1XC1A 2P2AA 1MXWA 2VHAA 3OELA 4KYDA 5I58A 1T0KA 4BDLA 3MVXA 1PB8A 5I56B 1FQFA 1XOCA 3TTMA 4OFJA 2O1MA 2QL3A 4ELQA 4OEVA 3B6WA 4G68A 4NMYA 4O3AA 3OMBA 3KJTA 3MP8A 4FAJA 1BKAA 3GLBA 1UTBA 1UTHB 2DE2A 1F9BA 2OWTA 1N0TA 1MXYA 3PD8A 3PUXE 1XHYA 5DYHA 3RNNA 5JTYB 3K1NA 2UVIA 1US5A 4LZ5A 5TP9A 3C32A 4RYAA 3G7WA 1QKBA 2IEEA 3EQ1A 3OO9A 2YPNA
chains in the Genus database with same CATH superfamily
4LP2B 4ZS9A 4N17A 4RY1A 2QFLA 3UORA 2GFEA 1Y4TA 3IAZA 3FV2A 1ATGA 1SVXB 5AA4B 2RINA 2FIXA 1H44A 4NF6B 5K2XA 4PAKA 4I3YA 3M3KA 5IZ3A 3RUMA 4R72A 1IQ7A 2XWVA 2A5TA 4OZ9A 4UA8A 1LB9A 2XWIA 3H6VA 1NNTA 4PFYA 1SPIA 2ZXTA 4H45A 1B32A 2ZZWA 3G3FA 1JP4A 1P99A 3KSJA 2QMXA 2ZYKA 2F35A 3KSXA 1H3DA 3OO6A 2XWOA 4QHQA 4BLAA 1Y3QA 1A54A 4NG7A 4ZECA 4H8IA 3LUYA 3MW0A 2Z8DA 3P7IA 1NH7A 2DQVA 4F29A 1B0HA 5T3JA 1RKMA 4GRKA 2BJJX 4O7MA 4OETA 4YAHX 3BIHA 4YKJA 1B58A 5FHNA 4N6KA 1FBPA 4NF4A 2XXYA 1HSLA 1IXGA 3FASA 3ILUB 4O94A 2WYPA 2AL5A 2RC8A 2O7IA 2UVHA 5ET8A 4QXDA 1MY0A 4EF2A 5DVIA 2G29A 1Y20A 3IB1A 3TTLA 3IOTA 1FPKA 3MAMA 4PP0A 1B3GA 1WVJA 2QS4A 3FVGA 4IO4A 1R6ZA 4Z7EA 2UYFA 1KWHA 1EYIA 3RPLB 5ITPA 3HV1A 4KR5A 2PYYA 5J1DA 3PMWA 4M4GA 1SW2A 4ZZEA 5A5LA 2OX3A 1QUIA 3RTWB 4GOTA 3IB2A 4KI0E 4IO5A 4OMBA 2WYKA 1FQDA 3LR1A 2F7BA 4WEDA 2DYXA 1FPFA 2KQZA 3CRBA 4JB7A 4G2ZA 4OFLA 2ANJA 4I40A 3QUFA 4NF8A 5J16A 1LAGE 1OLAA 2GQ1A 4MFIA 5AA2D 4K3FA 3T0JA 2ZYNA 3HO7A 3K1PA 1NI9A 3A3UA 1FTLA 1NH8A 2P3NA 1OIBA 3GZGA 3T96B 1B3EA 5F7VA 3I6VA 2XX9A 2VT5A 5H8NB 4H8JA 4GIZA 3K1MA 3K6WA 4GQOA 4NWCA 3K0VA 2DXRA 2I58A 1OQGA 2QVUA 5KCJA 1OMPA 1Z7ME 4EUOA 1IMEA 4PF8A 1I69A 3TELA 2DE3A 2I49A 5IZ3B 1QKAA 1MQJA 2I4CA 2HEUA 1IXHA 3R26A 2F6PA 4F3GA 4NGUA 1I6QA 3D4CA 3UGWA 3HHGA 3DLNA 2DE4A 3U65A 1M5FA 1MPBA 4OVJA 5FHOA 4DI4B 4PFTA 1SYHA 3PPPA 3MQ9A 3PUZE 1IUDA 3FJ7A 4FBPA 2H98A 4OTEA 4F2OA 5EYHA 3W9VA 3IB0A 1FW0A 1MM6A 3KN8A 4I3EA 1PC3A 4N13A 4G8NA 1XS5A 4GWSA 1MM7A 2FHYA 4XKRA 1POY1 2CZIA 1H45A 4DCXA 4YU0A 3CFLA 1N04A 5I2KB 4PC9A 5AA1A 3FXQA 1LFIA 3MP1A 4HE0A 3IO4A 3T66A 3CSGA 1FPJA 4GWZA 3SETA 1MRPA 4TQUQ 5A5XA 5L9MA 2XD2A 1M5EA 4YMAA 1LAFE 3R6UA 5TPAA 5HBCA 3VV5A 3QXMA 2B3BA 1TFDA 2D5WA 4FJPA 4GWOA 5AA3A 2Y7KA 1GTKA 3BFUA 3U92A 2ONKE 3MBPA 3VVEA 2HQ0A 5B70A 2Y5LA 3L6GA 3Q27A 3EHUA 4MMPA 4GF8A 4XIGQ 4PFWA 1Y3PA 1LBCA 3WAEA 4IO3A 1A7LA 3B7DA 1FBDA 4X9TA 4AQ4A 1NV7A 2O6AA 1UIVA 2ZNUA 1MQGA 2Q8MA 2I3WA 2QVVA 3K02A 4YB6A 1FRPA 2AL4A 1MY3A 4OA4A 1LAHE 2CMOA 3C35A 1A8FA 5FHMA 1NL5A 5CMMA 4KQPA 4MNPA 1A55A 4HCWA 5I2KA 1PEBA 1GV8A 4G68C 4MBPA 3ZKLA 2ZZXA 2I6EA 3VXCA 1YTVA 3N26A 4QFNA 2B4MA 1FPDA 4NAPA 1R9QA 1I6BA 1FTAA 3EHSA 2PX1A 4KCDA 2OK2A 5EHMA 1WODA 4RA1A 2MKZA 1Y1ZA 3DELB 4P56A 5KCJB 1LB8A 1SBPA 4G8HA 4F31B 1FTJA 1GR2A 3G3GA 3OEMA 3IOWA 3S9EA 5AA4A 1NNPA 4OESA 1URGA 5I3SA 1B1HA 1IMAA 3N94A 5H8FA 2FBPA 3VLUA 1Y4CA 1NNKA 2QVRA 4OXVA 3ZKKA 1IMCA 4Q5TA 2DWAA 4LVQA 4FECA 4XF5A 3G3KA 3OELA 1PB8A 2QL3A 4ELQA 4G68A 4FAJA 1BKAA 3GLBA 3PUXE 3TZAA 3GYYA 1XHYA 1US5A 2WX9A 1QKBA 3EQ1A 3OO9A 3UK4A 1JEVA 2O1LA 1S50A 5LTCA 2G93A 5H8QB 1ZLQA 4GLIA 2E1SA 4N07A 4OQOA 3LSLA 2DP8A 4OHNA 4EDPA 3O97A 4ZEDA 1NV4A 2DVZA 4X1DA 2AYSA 1ELJA 2DWIA 4UABA 1LSTA 3T9HB 1SW5A 4POXA 4MCOA 1LCTA 1N7XA 4F22A 2B65A 4YB5A 2DS9A 4ELOA 3OO7A 2Y7WA 1YXIA 1USYH 1P1QA 3H3GA 2PT1A 4NTLA 3HN0A 1QUJA 4U4SA 5AA2A 5DVJA 4NX1A 3HPIA 3UP9A 1NV2A 4I62A 1XVYA 3BBRA 1SW4A 3SEVA 3GBAA 3H03A 4MEVA 3MZ1A 1RYXA 4OVTA 3FVNA 2ZYOA 3K6XA 1OQHA 4LATA 4OYVA 1GVCA 1N7WA 3ZSFA 3VE1B 3T9UA 3GBBA 1JETA 4NQ8A 1N3XA 4NHBA 3TYHA 1B0LA 1NFTA 4N91A 3E13X 1YYZA 3MVZA 4NEDA 3K6VA 1MH3A 4YICA 3W15C 5I56A 3DM0A 4IR8A 2Y84A 5I2NB 1D9QA 4IO7A 5A5XB 3TUSA 4BDNA 1II5A 4GL0A 3VLWA 3IORA 3O6GA 2XXPA 4PFUA 3IK6B 1IEJA 1S7YA 3RGYA 2DXYA 4IGTA 5IKBA 3RY3A 4PE3A 1PBPA 4X8RA 4R74A 4JWOA 1PDAA 1B5HA 1ZJLA 4O3CA 4MNIA 1SW1A 4XKQA 4JSDA 5EQ9A 2H99A 1OVBA 2HFBA 2XXWA 3Q26A 3U72A 1B46A 4DXUA 4TLLB 3LUZA 2ONRA 5ICQA 5TU0A 2F3DA 3A3CA 1AOVA 4ESWA 3C31A 1FBEA 2PVUA 2F5XA 1XVXA 2OLBA 4PFBA 2Z8FA 2YLNA 3CFXA 4GBWA 4EXKA 3K6UA 1XI6A 4I1DA 4MF3A 3LSXA 1FBCA 3W9WA 1MXUA 5ISUA 4JDFA 4RK9A 3TODA 4R73A 1AH5A 2XXIA 1MQIA 3OEKA 3S9MC 3PPOA 3VFJA 2QPQA 4QFPA 4I9DA 4Q8RA 3HSTA 2NWJA 1IMDA 2VP1A 2QS3A 4O8MA 4PAFA 1BTJA 2F8DA 3PUYE 1B51A 2CZLA 4RPOA 1N76A 3RN8A 3TCFA 2ZMBA 4YB7A 1CB6A 5CMKA 1Y9UA 1N84A 4JSOA 1DPEA 4PETA 4JWXA 1JEUA 3THIA 2OJTA 3E9XA 4LZ8A 5I7IA 3PUVE 4LUBA 4MAGA 3TAJA 3T9VA 5H8NA 1LEVA 1N3WA 4GL8A 1HSEA 2O51A 1PB7A 4MH5A 3H6TA 4G61A 4LQ2A 2ZZVA 2D3IA 2X26A 4H46A 1US4A 3TTNA 1QVSA 1VFDA 2GH9A 1B3HA 3S9LC 1IIWA 1NUYA 2REJA 2Y7RA 1QJMA 3C4MA 1SYIA 1MH4A 3CSBA 1K9YA 3UIFA 1VFEA 4KYSA 3MVYA 5CC2A 5DEXA 3VDFA 3PD9A 3IOUA 4PAIA 3TQLA 4X1BA 2HAUA 5F24A 2XHDA 3B6TA 4O3BA 4GWWA 5I58B 2XXTA 1Z7NE 3DP8A 3G3JA 1NV1A 2FVZA 1NKXA 3OENA 1B6HA 1KZ8A 1LFGA 1MG1A 3O2AA 4E0XA 1B2HA 1FCKA 4MJOA 4H67A 2O69A 3MSTA 1UTBB 3FJGA 1IMBA 4FEDA 2H5YA 4OERA 1A40A 2F78A 3RT6B 3S2VA 2VPOA 2HZLA 4LN5A 2Q89A 1JVXA 1B9JA 1LBBA 5DTBA 3SKPA 3T1BA 1VE4A 1B4HA 1UIUA 1MY2A 3RTFB 1FBHA 3UA8A 2F34A 1NV5A 1JNFA 2VPNA 2VGQA 2RC9A 4HS7A 4POWA 3NOHA 2Y7IA 5IGAA 1B7HA 2A5TB 3R7XA 1B1XA 1LBVA 3VLVA 5KZTA 1FJ6A 1MQDA 1D3KA 4YKPA 1RDYA 4LONB 1HSJA 3TKDA 3CFZA 1DSNA 1AIVA 4TOZA 2FNCA 5H8HB 3B6QA 3D1RA 3ISPA 1VSOA 3O28A 1O64A 3KN3A 1B5IA 4G8MA 4H6DA 3K2DA 4NF8B 4GWYA 3ILTB 3TCHA 5KDTB 1LFHA 2F7AA 3K00A 2P2AA 1MXWA 2VHAA 2PCRA 4KYDA 4NMYA 2DE2A 3RNNA 5DYHA 1MXYA 4LZ5A 3C32A 4N8YA 1DBZA 4RYAA 2YPNA 2XXRA 1Q1KA 3H06B 3RLFE 1QULA 2F36A 2YJPA 4E0WA 2QRYA 4G68B 2Z22A 4G77A 4N6PA 4PFRA 3I5OA 1QW0A 2PFYA 3HCQA 1URDA 5H8QA 1DOTA 1MXVA 1QUKA 3SDFA 2CZHA 4DI3D 1NUWA 4LZ7A 3O66A 3KOTA 4OVQA 2F7CA 1MDQA 1IITA 3OXNA 4GFRA 5CI5A 4P8BA 3LSFB 3CVGA 4P0GA 2GHBA 2HCAA 1FQAA 3UN6A 3RPWA 4I8CA 1DTZA 2HAVA 4N4UA 5CMCA 3SEYA 4ELRA 4F3SA 1QGXA 1D9YA 4R9FA 4KPTA 4OANA 3TCGA 1DMBA 3QAXA 4OWDA 4R6HA 2V93A 1AL3A 1MQHA 3H4ZA 3HFUA 1M5DA 4P11A 5JK4A 3QUJA 2P0SA 4KHZE 4FE8A 3PGFA 1YPNA 2V84A 3VXBA 1VDWA 3KFMA 4YKIA 4HCYA 3SESA 2UYEA 3T9XB 4FEBA 4Q0CA 3MWBA 1MY4A 3FV1A 4TLMB 4HXVA 3QSLA 2I0CA 4OVRA 3MP6A 3KC0A 4HE1A 4NF6A 5LDZA 3S4UA 3DP6A 3FUZA 4H5FA 4OEUA 1EU8A 4PF6A 1ZKBA 5H8SA 2DWJA 2R9JA 2O7UA 4PFIA 3BKIB 3T22A 5K2YA 2VD3A 4R9GA 5EYFA 4U23A 4XXUA 3U8QA 1POTA 2V3QA 1FPBA 3E4RA 1UQWA 3QK6A 4H5GA 1S9TA 5JEIA 4LA9A 4QFKA 1L5TA 4DXCA 1B7UA 1MXZA 4U1OA 1LBXA 3PUWE 1FPGA 3PV0E 4NE4A 4GXSB 5I2NA 4XFEA 3S9NC 2M8CA 5I57A 4RNSA 2I0BA 2I4BA 1G0HA 3D4GA 3WAFA 4ZE9A 2X7QA 2ZNSA 1OVTA 4LQ5A 3B50A 2Z23A 2BJIA 3T93B 2ZYMA 5M2VA 3O6IA 1K9ZA 1MDP1 3E78A 4ELPA 2KLFA 3QYTA 2CEYA 1LBWA 1NV6A 3FVOA 2OWZA 3AXFA 4ZEIA 1FTKA 4PDHA 3FD3A 3TFLA 4QSEA 5EYGA 3KOSA 4BDQA 4H1XA 2DWHA 1B3FA 5L8DA 4NF5B 5ET6A 1JQFA 1M5CA 2XA5A 3K01A 3MPLA 4AS4A 5CBRA 3O6HA 3PMXA 4U21A 2LAOA 1NV3A 3ODBA 4RJZA 5H8FB 2WKYA 1H43A 3O29A 3IR1A 3IFAA 1MY1A 3A29A 2I3VA 4F19A 4U22A 5CMBA 2F97A 5JTYA 3ECRA 2XXHA 1TFAA 3K4UA 1LBYA 1SI0A 4EQBA 3PMVA 4DCYA 3N5LA 3OOAA 2FIEA 3FIRA 4ONYA 3V89B 3M8UA 3KC1A 3CIJA 5EQ7A 1YZ0A 1LLSA 2OBGA 2NXOA 3MZBA 4R6YA 4RXLA 2RC7A 3PPNA 2ESNA 4BDOA 4IO6A 3VVDA 4GWUA 2Z8EA 4U4XA 5I84A 4U1ZA 5IZZA 1B4ZA 4JVIA 3IOVA 1NNFA 4NN3A 1MXXA 4NF4B 4R2FA 4L17A 3QMFA 1I6AA 4PDDA 5ET5A 3HHFA 3PU5A 1VR5A 3G3IA 1P1UA 2HZKA 1SI1A 4NF5A 3CI8A 2RCAA 2ABHA 1EZPA 1ZIUA 4GX4A 1FBFA 1BP5A 2PFZA 2L5VA 4MNCA 2RF1A 4MIJA 4QFOA 1EYJA 2Q74A 4F3PA 3TTRA 2FA7A 3KBZA 2UXAA 1IXIA 1IZ1A 1WDNA 3H6WA 4P47A 4BDMA 3KGCA 5EHSA 3LC8A 4KFQA 1USYE 1Q9DA 4PBHA 1YAEA 5EQ8A 2W7YA 1LBZA 5HPQA 2A5SA 2Q2AA 3IX1A 4XKPA 3FJMA 2ALUA 4Z0IA 5IZ1A 3SEWA 3LBSA 4X04A 3JV9A 5FTHA 4ZE8A 2CEXA 3KG2A 2Y5KA 4THIA 1URSA 1OLCA 3G3HA 3EF7A 4DE8A 1FPEA 1IMFA 3DP4A 1B52A 5TP9B 4P9KA 4PQJA 5AA2B 1ZTYA 4N6DA 1JW5A 1BLFA 5TPAB 2NUVA 4Q30B 4C1TA 4MHFA 3MUQA 4OVPA 2XWKA 1SDXA 4G4PA 4KCCA 5ESYA 2XXVA 4N8GA 3BIGA 3EN3A 3SEUA 4HTGA 1MS7A 1CNQA 1B3LA 2THIA 1EZ9A 3PPRA 1H76A 4P1EA 3B8BA 3H6UA 2XX7A 4C1UA 3TMGA 3TTKA 4DDDA 3USDA 1AMFA 2QMWA 4F1YA 1YCJA 2B3FA 1R9LA 3MJNA 3RYDA 1XC1A 1T0KA 1FPIA 3MVXA 5I56B 1FQFA 4O3AA 3MP8A 3PD8A 2WEFA 5JTYB 4NWDA 2IEEA 2H9BA 4H65A 4PBQA 1KA1A 3Q28A 2PMSA 3EKIA 4ZEKA 4GXAA 3FGSA 4QFLA 5HM4B 4R75A 2XXUA 3MVWA 5ET7A 1FJ9A 1FQCA 1A8EA 2R71A 4KYEA 3LSWA 1Y1MA 4H0WA 4PGNA 4GVOA 2REGA 2HHMA 3TDJA 3OSRA 3U93A 4YZZA 3MZ9A 5ELVA 3IJXB 3FVKA 4ESXA 4O7IA 4EF1A 1ZBMA 5LOMA 4F2QA 3IL1B 1TT1A 3TEPA 2ZNTA 4ZZAA 1IXCA 3O9PA 2F3BA 5ICTA 2DDKA 1B7ZA 1O63A 3C34A 3N6UA 3RPLA 2E0SA 1AWBA 2V25A 3EHTA 3CHGA 2XXQA 3ZS6A 4GWXA 1D4NA 3KN7A 4ECFA 3N6TA 2R8TA 4PTKA 4GX6A 3SEXA 5I57B 5EQAA 3TQWA 3LV0A 4ZEBA 1R1NA 5DEXB 4FATA 2Q9TA 3PTYA 4HE2A 2H4IA 4WXJA 2NVUB 2I48A 2XXXA 2Q8JA 3U94A 4UACA 4ND9A 3V83A 2NOOA 4XKNA 2WBBA 5AE4A 2PT2A 4JWYA 1FBGA 2R6GE 4NF0A 4R6KA 1ZMGA 4U2RA 3PPQA 1Q35A 4DZ1A 3E79A 4WKMA 2DOJA 1P1NA 2OCUA 4KXPA 4PE5B 2O68A 2RCBA 2IA4A 1SD3A 1XT8A 3Q29A 4GBVA 3M3LA 4YMBA 2QS2A 3C33A 2O84X 3ONMA 2WBDA 1BIYA 3RT8A 3V8XB 3MYUA 4QSDA 4ISUA 4PGPA 4R2BA 4BDRA 3L6HA 4IO2A 1FPLA 3A09A 5IAIA 4P1LA 5CBSA 3MC2A 1RDXA 2AIXA 2P3VA 5I59B 2GHAA 5BWJA 2FYIA 3FXUA 4MLVA 3CG1A 2D21A 5H8HA 2UVGA 1PBQA 3JZJA 5L9SA 4OFOA 2V3TA 1DTGA 4C0RA 1EYKA 4AB5A 1D9VA 3MPKA 2XX8A 3SERA 3FXBA 1NV0A 2Q88A 3H7MA 1JVYA 1EZOA 2JJKA 1CE2A 4ZDMA 2OWSA 4F1UA 2Q2CA 1FQEA 2XXKA 3FBPA 2VD2A 3KJ7A 1JW1A 2OZZA 5FBPA 2HXRA 2KR0A 4MLQA 5DT6A 3RQTA 2UVJA 3FXRA 1ZU0A 4P3LA 3CR9A 1GGGA 2B4LA 1TWYA 4DIGA 2CZKA 1O7TA 2QSXA 1SQYA 4MX6A 1LCFA 1RYOA 3IFCA 5IM2A 4FIMA 1INPA 4F3BA 3OO8A 1FSAA 4XEQA 3EPEA 5DVFA 1MPDA 4KD5A 2DVCA 3IJOB 3JYRA 4DXBA 1ANFA 3E3KA 4JVDA 4AB6A 4P0IA 1LAXA 4GD5A 4QF9A 3CG3A 2Y7PA 1A99A 4QSCA 3OSQA 5B7DA 5CM6A 5I59A 1UTHA 2HXWA 3TPAA 1NMUA 4N81A 4RPNA 2X7PA 1B40A 1DK4A 4IGRA 2F6GA 5KDTA 3FATA 1PB9A 3BFTA 1Y3NA 3C36A 1BK4A 4HW8A 4QRZA 5FTIA 1NUZA 2DSFA 3F11A 2XD3A 2GRVA 4IY5A 1P1OA 3ROJA 1LGBC 4XTCQ 4F18A 1B05A 1KA0A 4OENA 4EXLA 3Q25A 1EH3A 4F39A 4JVCA 4X48A 3M3FA 3I3VA 5BUUA 1NUXA 2VOZA 4PCDA 4JXIA 1TXFA 1FTMA 2QJEA 4ZEFA 1MPCA 2V3UA 3IO6A 1FQBA 5CRYA 4EQ7A 4GX3A 3VVFA 2HPGA 2PBWA 3KBRA 4JBZA 3U1OA 1P1WA 1JW4A 4EQ9A 1G0IA 4N15A 1B5JA 1J1NA 4IB2A 1FTOA 2H25A 4IY6A 2ONSA 1DPPA 3C9HA 4M1VA 4F1VA 4YKKA 4QBAA 3QIMA 5I5PA 3KEIA 4AS5A 4OVSA 3OD7A 3FZVA 2P1SA 4DLDA 3V5AA 2V4CA 1M5BA 2QS1A 5ITOA 3GXAA 3KZGA 4WEPA 4FORA 5L9OA 4RK2A 3SZPA 5I58A 4BDLA 1DCUA 1XOCA 3TTMA 4OFJA 2O1MA 4OEVA 3B6WA 3OMBA 3KJTA 1UTBA 1UTHB 5DW8A 1F9BA 2OWTA 1N0TA 3K1NA 2UVIA 5TP9A 5F1QA 3G7WA 2RKMA 1RDZA
chains in the Genus database with same CATH topology
2XXRA 4LP2B 4ZS9A 1JEVA 1Q1KA 3UK4A 2O1LA 2H9BA 4H65A 3H06B 1S50A 4RY1A 2G93A 2GFEA 5H8QB 1ZLQA 4GLIA 3RLFE 1QULA 3UORA 3Q28A 2E1SA 2PMSA 4ZEKA 1Y4TA 4GXAA 4N07A 3FGSA 4OQOA 3LSLA 2DP8A 4QFLA 5HM4B 4OHNA 2F36A 2YJPA 4R75A 2XXUA 3MVWA 3O97A 4E0WA 3IAZA 2DVZA 2QRYA 4G68B 4ZEDA 3FV2A 1ATGA 2Z22A 4X1DA 2AYSA 1ELJA 4EDPA 2DWIA 1SVXB 5AA4B 1LSTA 3T9HB 2RINA 4G77A 1SW5A 4N6PA 1FQCA 4POXA 1A8EA 1LCTA 2R71A 3I5OA 1N7XA 1H44A 1QW0A 3HCQA 4KYEA 4NF6B 1URDA 5H8QA 5K2XA 4F22A 3LSWA 1Y1MA 1DOTA 3M3KA 1MXVA 3RUMA 4R72A 4H0WA 2B65A 1QUKA 3SDFA 1IQ7A 4YB5A 2DS9A 4F18A 4LZ7A 4GVOA 2A5TA 3O66A 4OZ9A 3KOTA 4UA8A 2REGA 3OO7A 4ELOA 3TDJA 2Y7WA 2F7CA 3OSRA 1MDQA 1USYH 3U93A 4YZZA 1LB9A 1IITA 1P1QA 3H6VA 3OXNA 3H3GA 2PT1A 1NNTA 4PFYA 3MZ9A 5F1QA 4GFRA 4NTLA 5CI5A 3HN0A 2ZXTA 1QUJA 4U4SA 5AA2A 1B32A 5DVJA 3G3FA 5ELVA 3IJXB 3HPIA 3LSFB 3FVKA 1P99A 3KSJA 3CVGA 4P0GA 4ESXA 3UP9A 2QMXA 4EF1A 2GHBA 1ZBMA 2HCAA 2ZYKA 2F35A 4I62A 5LOMA 1XVYA 3KSXA 1H3DA 1FQAA 3BBRA 3IL1B 4F2QA 3UN6A 3OO6A 4DXBA 1SW4A 4QHQA 3SEVA 3GBAA 1TT1A 3RPWA 4BLAA 3H03A 3TEPA 4I8CA 2ZNTA 1DTZA 4ZZAA 2HAVA 1RYXA 1Y3QA 3MZ1A 1A54A 1IXCA 5CMCA 3O9PA 3FVNA 3SEYA 4ZECA 2ZYOA 5ICTA 4ELRA 3K6XA 3LUYA 3MW0A 1B7ZA 1O63A 4H8IA 4F3SA 1OQHA 4LATA 3C34A 3N6UA 4OYVA 1GVCA 1N7WA 3ZSFA 1D9YA 3VE1B 4R9FA 3T9UA 2E0SA 4KPTA 3TCGA 3GBBA 3S9EA 2V25A 3EHTA 1DMBA 1JETA 3QAXA 4OWDA 4R6HA 2V93A 1AL3A 1MQHA 3H4ZA 2Z8DA 1M5DA 4P11A 5JK4A 2XXQA 3P7IA 1NH7A 1N3XA 3ZS6A 3TYHA 2DQVA 4F29A 1B0HA 1D4NA 1B0LA 1NFTA 3KN7A 4ECFA 1RKMA 3E13X 3N6TA 2BJJX 3QUJA 4GRKA 4OETA 4YAHX 3MVZA 4NEDA 3K6VA 4YKJA 1MH3A 2P0SA 4KHZE 4FE8A 1B58A 5FHNA 3PGFA 1YPNA 4YICA 3W15C 5I56A 3DM0A 2V84A 4NF4A 3VXBA 2Y84A 5I2NB 2XXYA 1HSLA 3KFMA 4YKIA 1IXGA 4IO7A 4HCYA 3SEXA 3FASA 3ILUB 5I57B 3SESA 2UYEA 5A5XB 3T9XB 4FEBA 4Q0CA 3TUSA 2AL5A 1MY4A 3MWBA 3TQWA 4BDNA 3FV1A 2RC8A 4TLMB 4ZEBA 1II5A 2O7IA 2UVHA 1R1NA 3QSLA 2I0CA 5DEXB 4FATA 3MP6A 2Q9TA 4NF6A 3S4UA 1MY0A 3DP6A 3FUZA 4GL0A 3VLWA 2H4IA 4WXJA 2NVUB 3IORA 2I48A 4H5FA 1EU8A 2XXXA 3O6GA 4OEUA 4EF2A 2Q8JA 5DVIA 3U94A 4UACA 4ND9A 2G29A 1ZKBA 5H8SA 3V83A 2DWJA 2XXPA 1Y20A 2R9JA 3IB1A 4PFUA 2O7UA 3TTLA 3IOTA 3MAMA 2NOOA 3BKIB 4PP0A 3IK6B 1IEJA 4XKNA 1B3GA 1S7YA 5I59A 1WVJA 2DXYA 2QS4A 3FVGA 4IGTA 4IO4A 3RGYA 3RY3A 1R6ZA 4Z7EA 3T22A 1PBPA 5IKBA 2UYFA 2VD3A 1KWHA 2PT2A 4R74A 4R9GA 4JWOA 4U23A 4JWYA 4XXUA 3HV1A 4KR5A 5EYFA 3U8QA 1POTA 5ITPA 2V3QA 2PYYA 1PDAA 1B5HA 3E4RA 1UQWA 3QK6A 2R6GE 5J1DA 3PMWA 4M4GA 1ZJLA 1SW2A 4H5GA 4O3CA 1S9TA 4NWDA 5JEIA 4XKQA 1SW1A 4ZZEA 1QUIA 3RTWB 4R6KA 1ZMGA 4GOTA 4LA9A 4JSDA 3IB2A 4QFKA 1L5TA 4KI0E 2H99A 1B7UA 4DXCA 1OVBA 4IO5A 2HFBA 4U2RA 4OMBA 2XXWA 3Q26A 1MXZA 4U1OA 3U72A 3PPQA 1Q35A 4DZ1A 1FQDA 1B46A 3LR1A 4DXUA 4WKMA 2F7BA 2DOJA 4WEDA 3PUWE 2DYXA 1P1NA 4TLLB 3PV0E 2ONRA 4GXSB 4NE4A 5I2NA 3CRBA 5ICQA 3S9NC 4JB7A 2M8CA 2OCUA 4G2ZA 4OFLA 4PE5B 5TU0A 2ANJA 3A3CA 5I57A 4RNSA 1AOVA 2I0BA 3QUFA 2O68A 4NF8A 2I4BA 2RCBA 1LAGE 1OLAA 3D4GA 4MFIA 4ESWA 3C31A 3WAFA 2PVUA 4K3FA 2F5XA 4ZE9A 5AA2D 2IA4A 2X7QA 1XVXA 2OLBA 2ZNSA 1OVTA 1SD3A 1XT8A 2Z8FA 2ZYNA 3HO7A 3K1PA 4LQ5A 3Q29A 3M3LA 2Z23A 2YLNA 3T93B 3CFXA 4YMBA 2ZYMA 3A3UA 4EXKA 1FTLA 1NH8A 3K6UA 1OIBA 5M2VA 2QS2A 3GZGA 3O6IA 1MDP1 2O84X 3C33A 3ONMA 4I1DA 3T96B 1B3EA 4MF3A 1BIYA 4ELPA 3RT8A 2KLFA 3QYTA 5F7VA 3I6VA 3V8XB 3LSXA 3W9WA 1MXUA 5ISUA 4QSDA 2XX9A 3FVOA 4ISUA 4JDFA 3AXFA 5H8NB 4H8JA 4R2BA 4RK9A 4ZEIA 3TODA 1FTKA 4BDRA 5HPQA 3L6HA 3FD3A 1AH5A 4GIZA 2XXIA 4IO2A 3K1MA 1MQIA 3K6WA 4GQOA 4R73A 3A09A 3OEKA 4NWCA 5IAIA 3S9MC 3PPOA 3K0VA 3TFLA 2DXRA 2I58A 4QSEA 3VFJA 5CBSA 2QPQA 1OQGA 4I9DA 4QFPA 4Q8RA 1OMPA 3HSTA 3MC2A 2NWJA 5KCJA 1Z7ME 2AIXA 2RKMA 2VP1A 3KOSA 4H1XA 2QS3A 4BDQA 4EUOA 5I59B 2GHAA 5BWJA 2DWHA 1B3FA 5K2YA 5L8DA 1BTJA 1I69A 3TELA 2FYIA 2DE3A 3FXUA 2F8DA 4MLVA 4NF5B 1JQFA 2I49A 3CG1A 1M5CA 2D21A 3K01A 5H8HA 1QKAA 3MPLA 3PUYE 2UVGA 5CBRA 3O6HA 1B51A 1MQJA 3PMXA 2I4CA 1PBQA 1IXHA 2HEUA 2LAOA 3R26A 3JZJA 4U21A 5L9SA 2F6PA 3ODBA 4OFOA 4F3GA 2CZLA 4RJZA 5H8FB 1I6QA 2WKYA 3D4CA 3HHGA 2V3TA 1H43A 3UGWA 4RPOA 3DLNA 1N76A 3O29A 1DTGA 2DE4A 4C0RA 1M5FA 3RN8A 1MPBA 3IR1A 4OVJA 5FHOA 3TCFA 4PFTA 1SYHA 4AB5A 1D9VA 2ZMBA 1MY1A 3PPPA 3MPKA 3MQ9A 3PUZE 1CB6A 1IUDA 4YB7A 2XX8A 3FJ7A 5CMKA 1Y9UA 3SERA 2I3VA 2H98A 4OTEA 4F2OA 1N84A 4F19A 4JSOA 1DPEA 5AA4A 3W9VA 3IB0A 4U22A 5CMBA 2Q88A 1FW0A 1JVYA 1MM6A 3H7MA 3KN8A 1PC3A 2F97A 1JEUA 4JWXA 4PETA 4N13A 3THIA 1EZOA 1CE2A 2OJTA 3E9XA 4G8NA 4LZ8A 1XS5A 4ZDMA 2OWSA 1MM7A 4F1UA 3PUVE 2Q2CA 4LUBA 4XKRA 1FQEA 3TAJA 5JTYA 3T9VA 1POY1 2VD2A 2XXHA 3ECRA 3KJ7A 1JW1A 1TFAA 1N3WA 4GL8A 1H45A 1SI0A 3K4UA 4EQBA 2OZZA 4DCXA 1HSEA 3PMVA 4DCYA 2O51A 3N5LA 3OOAA 4YU0A 3CFLA 1PB7A 4MH5A 3H6TA 3FIRA 4ONYA 1N04A 5I2KB 3V89B 5AA1A 3FXQA 3M8UA 1LFIA 3MP1A 3CIJA 4LQ2A 4MLQA 5DT6A 3RQTA 1LLSA 3IO4A 2OBGA 2NXOA 3MZBA 4R6YA 2D3IA 4RXLA 5H8NA 2RC7A 3T66A 3PPNA 2ESNA 2X26A 3CSGA 4IO6A 3VVDA 4BDOA 1US4A 3TTNA 2UVJA 1QVSA 1VFDA 2Z8EA 2GH9A 1MRPA 3FXRA 3SETA 4TQUQ 1B3HA 1ZU0A 4U4XA 5I84A 5A5XA 3S9LC 1IIWA 5L9MA 2REJA 4U1ZA 3CR9A 1GGGA 1B4ZA 2Y7RA 1QJMA 1TWYA 3C4MA 3IOVA 4DIGA 5AE4A 1SYIA 1O7TA 2QSXA 1MH4A 2XD2A 1M5EA 1NNFA 4YMAA 1MXXA 1SQYA 4NF4B 1LAFE 3R6UA 3CSBA 5TPAA 4R2FA 1LCFA 5HBCA 1RYOA 3VV5A 3UIFA 1VFEA 3QXMA 2B3BA 1TFDA 4L17A 4KYSA 2D5WA 4FJPA 1I6AA 4GWOA 4FIMA 3HHFA 5AA3A 3PU5A 4F3BA 2Y7KA 3MVYA 1VR5A 3G3IA 1GTKA 3OO8A 5CC2A 3BFUA 3U92A 2ONKE 3MBPA 5DEXA 3VDFA 3PD9A 3VVEA 1P1UA 3EPEA 5DVFA 1MPDA 4KD5A 2DVCA 3VXCA 3IOUA 2HZKA 2HQ0A 3IJOB 1SI1A 3O2AA 4NF5A 3JYRA 5B70A 3CI8A 2RCAA 1ANFA 3L6GA 2ABHA 3E3KA 3Q27A 3EHUA 2HAUA 4X1BA 4GF8A 4XIGQ 3TQLA 1EZPA 1ZIUA 4PFWA 4AB6A 4P0IA 1LAXA 2XHDA 1Y3PA 1LBCA 3B6TA 4GD5A 4O3BA 3WAEA 4IO3A 3CG3A 4QF9A 2XXTA 5I58B 1A7LA 1Z7NE 2Y7PA 3B7DA 1A99A 4QSCA 1BP5A 3DP8A 3G3JA 3OSQA 4AQ4A 4X9TA 5B7DA 5CM6A 2RF1A 3OENA 1NKXA 1UTHA 2HXWA 1B6HA 1NMUA 3TPAA 4QFOA 1LFGA 4RPNA 2O6AA 1UIVA 2X7PA 1MG1A 1B40A 4IGRA 4F3PA 3TTRA 2F6GA 5KDTA 2FA7A 2ZNUA 2UXAA 1IXIA 1IZ1A 1MQGA 1WDNA 3FATA 2I3WA 3H6WA 1B2HA 1FCKA 1PB9A 3BFTA 1Y3NA 3C36A 3K02A 4YB6A 4BDMA 4HW8A 2AL4A 4QRZA 3KGCA 5EHSA 5FTIA 1MY3A 3LC8A 1LAHE 4KFQA 1USYE 2CMOA 3C35A 4H67A 2O69A 2DSFA 3F11A 2XD3A 2GRVA 1UTBB 3FJGA 1A8FA 1YAEA 5FHMA 4IY5A 1P1OA 4FEDA 2H5YA 2W7YA 1LGBC 1NL5A 4XTCQ 1B05A 4OENA 2A5SA 1A40A 4OERA 2F78A 4KQPA 5CMMA 3RT6B 3Q25A 2Q2AA 3S2VA 1EH3A 4F39A 2HZLA 2Q89A 4X48A 1A55A 1JVXA 1B9JA 1LBBA 3IX1A 3FJMA 3M3FA 3I3VA 4HCWA 4XKPA 5DTBA 5I2KA 3SKPA 5BUUA 2ALUA 4Z0IA 1PEBA 1GV8A 3SEWA 1VE4A 3LBSA 2VOZA 4G68C 4MBPA 1B4HA 3ZKLA 4JXIA 3JV9A 1TXFA 1UIUA 1FTMA 1MY2A 5FTHA 3RTFB 2I6EA 2QJEA 3KG2A 4ZEFA 1MPCA 1YTVA 2V3UA 4THIA 4ZE8A 3TZAA 2F34A 3UA8A 3IO6A 3N26A 1URSA 1OLCA 3G3HA 4QFNA 1JNFA 1FQBA 3EF7A 4DE8A 5CRYA 1R9QA 2VGQA 4EQ7A 3DP4A 2RC9A 4HS7A 4POWA 3VVFA 1B52A 5TP9B 1I6BA 2PBWA 3KBRA 4JBZA 3EHSA 2PX1A 2Y7IA 4KCDA 4PQJA 1P1WA 3U1OA 1JW4A 5AA2B 1ZTYA 4EQ9A 1JW5A 2OK2A 1BLFA 1B7HA 1WODA 1B5JA 2A5TB 5EHMA 5TPAB 2NUVA 4Q30B 4RA1A 4C1TA 1J1NA 1Y1ZA 4IB2A 3R7XA 3DELB 1B1XA 1FTOA 3VLVA 5KCJB 1LB8A 5KZTA 1SBPA 2H25A 3MUQA 4G4PA 1SDXA 1MQDA 4G8HA 1D3KA 4IY6A 4KCCA 2ONSA 4YKPA 2XXVA 4F31B 1FTJA 1GR2A 1DPPA 3C9HA 3G3GA 3IOWA 1HSJA 3OEMA 3CFZA 4LONB 1DSNA 3EN3A 4M1VA 3TKDA 4F1VA 1NNPA 4YKKA 3SEUA 1AIVA 4OESA 4HTGA 2FNCA 4TOZA 1MS7A 5H8HB 1B3LA 2THIA 1EZ9A 3QIMA 3B6QA 3PPRA 3KEIA 1H76A 1VSOA 3O28A 3OD7A 3FZVA 1O64A 1URGA 2P1SA 4DLDA 3V5AA 1B1HA 3N94A 5H8FA 3H6UA 1M5BA 1B5IA 3KN3A 2XX7A 4G8MA 3VLUA 4C1UA 2QS1A 1Y4CA 4H6DA 5ITOA 3TMGA 3TTKA 3GXAA 1NNKA 3K2DA 4NF8B 4OXVA 3ILTB 3ZKKA 3USDA 1AMFA 4DDDA 3TCHA 2QMWA 4F1YA 5KDTB 4Q5TA 2DWAA 3KZGA 4WEPA 4LVQA 4FORA 4E0XA 5L9OA 2F7AA 4FECA 1LFHA 1YCJA 4EXLA 4RK2A 3G3KA 2B3FA 1R9LA 3K00A 3MJNA 1XC1A 2P2AA 1MXWA 2VHAA 3OELA 4KYDA 5I58A 1T0KA 4BDLA 3MVXA 1PB8A 5I56B 1FQFA 1XOCA 3TTMA 4OFJA 2O1MA 2QL3A 4ELQA 4OEVA 3B6WA 4G68A 4NMYA 4O3AA 3OMBA 3KJTA 3MP8A 4FAJA 1BKAA 3GLBA 1UTBA 1UTHB 2DE2A 1F9BA 2OWTA 1N0TA 1MXYA 3PD8A 3PUXE 1XHYA 5DYHA 3RNNA 5JTYB 3K1NA 2UVIA 1US5A 4LZ5A 5TP9A 3C32A 4RYAA 3G7WA 1QKBA 2IEEA 3EQ1A 3OO9A 2YPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXR A;  4LP2 B;  4ZS9 A;  1JEV A;  1Q1K A;  3UK4 A;  2O1L A;  2H9B A;  4H65 A;  3H06 B;  1S50 A;  4RY1 A;  2G93 A;  2GFE A;  5H8Q B;  1ZLQ A;  4GLI A;  3RLF E;  1QUL A;  3UOR A;  3Q28 A;  2E1S A;  2PMS A;  4ZEK A;  1Y4T A;  4GXA A;  4N07 A;  3FGS A;  4OQO A;  3LSL A;  2DP8 A;  4QFL A;  5HM4 B;  4OHN A;  2F36 A;  2YJP A;  4R75 A;  2XXU A;  3MVW A;  3O97 A;  4E0W A;  3IAZ A;  2DVZ A;  2QRY A;  4G68 B;  4ZED A;  3FV2 A;  1ATG A;  2Z22 A;  4X1D A;  2AYS A;  1ELJ A;  4EDP A;  2DWI A;  1SVX B;  5AA4 B;  1LST A;  3T9H B;  2RIN A;  4G77 A;  1SW5 A;  4N6P A;  1FQC A;  4POX A;  1A8E A;  1LCT A;  2R71 A;  3I5O A;  1N7X A;  1H44 A;  1QW0 A;  3HCQ A;  4KYE A;  4NF6 B;  1URD A;  5H8Q A;  5K2X A;  4F22 A;  3LSW A;  1Y1M A;  1DOT A;  3M3K A;  1MXV A;  3RUM A;  4R72 A;  4H0W A;  2B65 A;  1QUK A;  3SDF A;  1IQ7 A;  4YB5 A;  2DS9 A;  4F18 A;  4LZ7 A;  4GVO A;  2A5T A;  3O66 A;  4OZ9 A;  3KOT A;  4UA8 A;  2REG A;  3OO7 A;  4ELO A;  3TDJ A;  2Y7W A;  2F7C A;  3OSR A;  1MDQ A;  1USY H;  3U93 A;  4YZZ A;  1LB9 A;  1IIT A;  1P1Q A;  3H6V A;  3OXN A;  3H3G A;  2PT1 A;  1NNT A;  4PFY A;  3MZ9 A;  5F1Q A;  4GFR A;  4NTL A;  5CI5 A;  3HN0 A;  2ZXT A;  1QUJ A;  4U4S A;  5AA2 A;  1B32 A;  5DVJ A;  3G3F A;  5ELV A;  3IJX B;  3HPI A;  3LSF B;  3FVK A;  1P99 A;  3KSJ A;  3CVG A;  4P0G A;  4ESX A;  3UP9 A;  2QMX A;  4EF1 A;  2GHB A;  1ZBM A;  2HCA A;  2ZYK A;  2F35 A;  4I62 A;  5LOM A;  1XVY A;  3KSX A;  1H3D A;  1FQA A;  3BBR A;  3IL1 B;  4F2Q A;  3UN6 A;  3OO6 A;  4DXB A;  1SW4 A;  4QHQ A;  3SEV A;  3GBA A;  1TT1 A;  3RPW A;  4BLA A;  3H03 A;  3TEP A;  4I8C A;  2ZNT A;  1DTZ A;  4ZZA A;  2HAV A;  1RYX A;  1Y3Q A;  3MZ1 A;  1A54 A;  1IXC A;  5CMC A;  3O9P A;  3FVN A;  3SEY A;  4ZEC A;  2ZYO A;  5ICT A;  4ELR A;  3K6X A;  3LUY A;  3MW0 A;  1B7Z A;  1O63 A;  4H8I A;  4F3S A;  1OQH A;  4LAT A;  3C34 A;  3N6U A;  4OYV A;  1GVC A;  1N7W A;  3ZSF A;  1D9Y A;  3VE1 B;  4R9F A;  3T9U A;  2E0S A;  4KPT A;  3TCG A;  3GBB A;  3S9E A;  2V25 A;  3EHT A;  1DMB A;  1JET A;  3QAX A;  4OWD A;  4R6H A;  2V93 A;  1AL3 A;  1MQH A;  3H4Z A;  2Z8D A;  1M5D A;  4P11 A;  5JK4 A;  2XXQ A;  3P7I A;  1NH7 A;  1N3X A;  3ZS6 A;  3TYH A;  2DQV A;  4F29 A;  1B0H A;  1D4N A;  1B0L A;  1NFT A;  3KN7 A;  4ECF A;  1RKM A;  3E13 X;  3N6T A;  2BJJ X;  3QUJ A;  4GRK A;  4OET A;  4YAH X;  3MVZ A;  4NED A;  3K6V A;  4YKJ A;  1MH3 A;  2P0S A;  4KHZ E;  4FE8 A;  1B58 A;  5FHN A;  3PGF A;  1YPN A;  4YIC A;  3W15 C;  5I56 A;  3DM0 A;  2V84 A;  4NF4 A;  3VXB A;  2Y84 A;  5I2N B;  2XXY A;  1HSL A;  3KFM A;  4YKI A;  1IXG A;  4IO7 A;  4HCY A;  3SEX A;  3FAS A;  3ILU B;  5I57 B;  3SES A;  2UYE A;  5A5X B;  3T9X B;  4FEB A;  4Q0C A;  3TUS A;  2AL5 A;  1MY4 A;  3MWB A;  3TQW A;  4BDN A;  3FV1 A;  2RC8 A;  4TLM B;  4ZEB A;  1II5 A;  2O7I A;  2UVH A;  1R1N A;  3QSL A;  2I0C A;  5DEX B;  4FAT A;  3MP6 A;  2Q9T A;  4NF6 A;  3S4U A;  1MY0 A;  3DP6 A;  3FUZ A;  4GL0 A;  3VLW A;  2H4I A;  4WXJ A;  2NVU B;  3IOR A;  2I48 A;  4H5F A;  1EU8 A;  2XXX A;  3O6G A;  4OEU A;  4EF2 A;  2Q8J A;  5DVI A;  3U94 A;  4UAC A;  4ND9 A;  2G29 A;  1ZKB A;  5H8S A;  3V83 A;  2DWJ A;  2XXP A;  1Y20 A;  2R9J A;  3IB1 A;  4PFU A;  2O7U A;  3TTL A;  3IOT A;  3MAM A;  2NOO A;  3BKI B;  4PP0 A;  3IK6 B;  1IEJ A;  4XKN A;  1B3G A;  1S7Y A;  5I59 A;  1WVJ A;  2DXY A;  2QS4 A;  3FVG A;  4IGT A;  4IO4 A;  3RGY A;  3RY3 A;  1R6Z A;  4Z7E A;  3T22 A;  1PBP A;  5IKB A;  2UYF A;  2VD3 A;  1KWH A;  2PT2 A;  4R74 A;  4R9G A;  4JWO A;  4U23 A;  4JWY A;  4XXU A;  3HV1 A;  4KR5 A;  5EYF A;  3U8Q A;  1POT A;  5ITP A;  2V3Q A;  2PYY A;  1PDA A;  1B5H A;  3E4R A;  1UQW A;  3QK6 A;  2R6G E;  5J1D A;  3PMW A;  4M4G A;  1ZJL A;  1SW2 A;  4H5G A;  4O3C A;  1S9T A;  4NWD A;  5JEI A;  4XKQ A;  1SW1 A;  4ZZE A;  1QUI A;  3RTW B;  4R6K A;  1ZMG A;  4GOT A;  4LA9 A;  4JSD A;  3IB2 A;  4QFK A;  1L5T A;  4KI0 E;  2H99 A;  1B7U A;  4DXC A;  1OVB A;  4IO5 A;  2HFB A;  4U2R A;  4OMB A;  2XXW A;  3Q26 A;  1MXZ A;  4U1O A;  3U72 A;  3PPQ A;  1Q35 A;  4DZ1 A;  1FQD A;  1B46 A;  3LR1 A;  4DXU A;  4WKM A;  2F7B A;  2DOJ A;  4WED A;  3PUW E;  2DYX A;  1P1N A;  4TLL B;  3PV0 E;  2ONR A;  4GXS B;  4NE4 A;  5I2N A;  3CRB A;  5ICQ A;  3S9N C;  4JB7 A;  2M8C A;  2OCU A;  4G2Z A;  4OFL A;  4PE5 B;  5TU0 A;  2ANJ A;  3A3C A;  5I57 A;  4RNS A;  1AOV A;  2I0B A;  3QUF A;  2O68 A;  4NF8 A;  2I4B A;  2RCB A;  1LAG E;  1OLA A;  3D4G A;  4MFI A;  4ESW A;  3C31 A;  3WAF A;  2PVU A;  4K3F A;  2F5X A;  4ZE9 A;  5AA2 D;  2IA4 A;  2X7Q A;  1XVX A;  2OLB A;  2ZNS A;  1OVT A;  1SD3 A;  1XT8 A;  2Z8F A;  2ZYN A;  3HO7 A;  3K1P A;  4LQ5 A;  3Q29 A;  3M3L A;  2Z23 A;  2YLN A;  3T93 B;  3CFX A;  4YMB A;  2ZYM A;  3A3U A;  4EXK A;  1FTL A;  1NH8 A;  3K6U A;  1OIB A;  5M2V A;  2QS2 A;  3GZG A;  3O6I A;  1MDP 1;  2O84 X;  3C33 A;  3ONM A;  4I1D A;  3T96 B;  1B3E A;  4MF3 A;  1BIY A;  4ELP A;  3RT8 A;  2KLF A;  3QYT A;  5F7V A;  3I6V A;  3V8X B;  3LSX A;  3W9W A;  1MXU A;  5ISU A;  4QSD A;  2XX9 A;  3FVO A;  4ISU A;  4JDF A;  3AXF A;  5H8N B;  4H8J A;  4R2B A;  4RK9 A;  4ZEI A;  3TOD A;  1FTK A;  4BDR A;  5HPQ A;  3L6H A;  3FD3 A;  1AH5 A;  4GIZ A;  2XXI A;  4IO2 A;  3K1M A;  1MQI A;  3K6W A;  4GQO A;  4R73 A;  3A09 A;  3OEK A;  4NWC A;  5IAI A;  3S9M C;  3PPO A;  3K0V A;  3TFL A;  2DXR A;  2I58 A;  4QSE A;  3VFJ A;  5CBS A;  2QPQ A;  1OQG A;  4I9D A;  4QFP A;  4Q8R A;  1OMP A;  3HST A;  3MC2 A;  2NWJ A;  5KCJ A;  1Z7M E;  2AIX A;  2RKM A;  2VP1 A;  3KOS A;  4H1X A;  2QS3 A;  4BDQ A;  4EUO A;  5I59 B;  2GHA A;  5BWJ A;  2DWH A;  1B3F A;  5K2Y A;  5L8D A;  1BTJ A;  1I69 A;  3TEL A;  2FYI A;  2DE3 A;  3FXU A;  2F8D A;  4MLV A;  4NF5 B;  1JQF A;  2I49 A;  3CG1 A;  1M5C A;  2D21 A;  3K01 A;  5H8H A;  1QKA A;  3MPL A;  3PUY E;  2UVG A;  5CBR A;  3O6H A;  1B51 A;  1MQJ A;  3PMX A;  2I4C A;  1PBQ A;  1IXH A;  2HEU A;  2LAO A;  3R26 A;  3JZJ A;  4U21 A;  5L9S A;  2F6P A;  3ODB A;  4OFO A;  4F3G A;  2CZL A;  4RJZ A;  5H8F B;  1I6Q A;  2WKY A;  3D4C A;  3HHG A;  2V3T A;  1H43 A;  3UGW A;  4RPO A;  3DLN A;  1N76 A;  3O29 A;  1DTG A;  2DE4 A;  4C0R A;  1M5F A;  3RN8 A;  1MPB A;  3IR1 A;  4OVJ A;  5FHO A;  3TCF A;  4PFT A;  1SYH A;  4AB5 A;  1D9V A;  2ZMB A;  1MY1 A;  3PPP A;  3MPK A;  3MQ9 A;  3PUZ E;  1CB6 A;  1IUD A;  4YB7 A;  2XX8 A;  3FJ7 A;  5CMK A;  1Y9U A;  3SER A;  2I3V A;  2H98 A;  4OTE A;  4F2O A;  1N84 A;  4F19 A;  4JSO A;  1DPE A;  5AA4 A;  3W9V A;  3IB0 A;  4U22 A;  5CMB A;  2Q88 A;  1FW0 A;  1JVY A;  1MM6 A;  3H7M A;  3KN8 A;  1PC3 A;  2F97 A;  1JEU A;  4JWX A;  4PET A;  4N13 A;  3THI A;  1EZO A;  1CE2 A;  2OJT A;  3E9X A;  4G8N A;  4LZ8 A;  1XS5 A;  4ZDM A;  2OWS A;  1MM7 A;  4F1U A;  3PUV E;  2Q2C A;  4LUB A;  4XKR A;  1FQE A;  3TAJ A;  5JTY A;  3T9V A;  1POY 1;  2VD2 A;  2XXH A;  3ECR A;  3KJ7 A;  1JW1 A;  1TFA A;  1N3W A;  4GL8 A;  1H45 A;  1SI0 A;  3K4U A;  4EQB A;  2OZZ A;  4DCX A;  1HSE A;  3PMV A;  4DCY A;  2O51 A;  3N5L A;  3OOA A;  4YU0 A;  3CFL A;  1PB7 A;  4MH5 A;  3H6T A;  3FIR A;  4ONY A;  1N04 A;  5I2K B;  3V89 B;  5AA1 A;  3FXQ A;  3M8U A;  1LFI A;  3MP1 A;  3CIJ A;  4LQ2 A;  4MLQ A;  5DT6 A;  3RQT A;  1LLS A;  3IO4 A;  2OBG A;  2NXO A;  3MZB A;  4R6Y A;  2D3I A;  4RXL A;  5H8N A;  2RC7 A;  3T66 A;  3PPN A;  2ESN A;  2X26 A;  3CSG A;  4IO6 A;  3VVD A;  4BDO A;  1US4 A;  3TTN A;  2UVJ A;  1QVS A;  1VFD A;  2Z8E A;  2GH9 A;  1MRP A;  3FXR A;  3SET A;  4TQU Q;  1B3H A;  1ZU0 A;  4U4X A;  5I84 A;  5A5X A;  3S9L C;  1IIW A;  5L9M A;  2REJ A;  4U1Z A;  3CR9 A;  1GGG A;  1B4Z A;  2Y7R A;  1QJM A;  1TWY A;  3C4M A;  3IOV A;  4DIG A;  5AE4 A;  1SYI A;  1O7T A;  2QSX A;  1MH4 A;  2XD2 A;  1M5E A;  1NNF A;  4YMA A;  1MXX A;  1SQY A;  4NF4 B;  1LAF E;  3R6U A;  3CSB A;  5TPA A;  4R2F A;  1LCF A;  5HBC A;  1RYO A;  3VV5 A;  3UIF A;  1VFE A;  3QXM A;  2B3B A;  1TFD A;  4L17 A;  4KYS A;  2D5W A;  4FJP A;  1I6A A;  4GWO A;  4FIM A;  3HHF A;  5AA3 A;  3PU5 A;  4F3B A;  2Y7K A;  3MVY A;  1VR5 A;  3G3I A;  1GTK A;  3OO8 A;  5CC2 A;  3BFU A;  3U92 A;  2ONK E;  3MBP A;  5DEX A;  3VDF A;  3PD9 A;  3VVE A;  1P1U A;  3EPE A;  5DVF A;  1MPD A;  4KD5 A;  2DVC A;  3VXC A;  3IOU A;  2HZK A;  2HQ0 A;  3IJO B;  1SI1 A;  3O2A A;  4NF5 A;  3JYR A;  5B70 A;  3CI8 A;  2RCA A;  1ANF A;  3L6G A;  2ABH A;  3E3K A;  3Q27 A;  3EHU A;  2HAU A;  4X1B A;  4GF8 A;  4XIG Q;  3TQL A;  1EZP A;  1ZIU A;  4PFW A;  4AB6 A;  4P0I A;  1LAX A;  2XHD A;  1Y3P A;  1LBC A;  3B6T A;  4GD5 A;  4O3B A;  3WAE A;  4IO3 A;  3CG3 A;  4QF9 A;  2XXT A;  5I58 B;  1A7L A;  1Z7N E;  2Y7P A;  3B7D A;  1A99 A;  4QSC A;  1BP5 A;  3DP8 A;  3G3J A;  3OSQ A;  4AQ4 A;  4X9T A;  5B7D A;  5CM6 A;  2RF1 A;  3OEN A;  1NKX A;  1UTH A;  2HXW A;  1B6H A;  1NMU A;  3TPA A;  4QFO A;  1LFG A;  4RPN A;  2O6A A;  1UIV A;  2X7P A;  1MG1 A;  1B40 A;  4IGR A;  4F3P A;  3TTR A;  2F6G A;  5KDT A;  2FA7 A;  2ZNU A;  2UXA A;  1IXI A;  1IZ1 A;  1MQG A;  1WDN A;  3FAT A;  2I3W A;  3H6W A;  1B2H A;  1FCK A;  1PB9 A;  3BFT A;  1Y3N A;  3C36 A;  3K02 A;  4YB6 A;  4BDM A;  4HW8 A;  2AL4 A;  4QRZ A;  3KGC A;  5EHS A;  5FTI A;  1MY3 A;  3LC8 A;  1LAH E;  4KFQ A;  1USY E;  2CMO A;  3C35 A;  4H67 A;  2O69 A;  2DSF A;  3F11 A;  2XD3 A;  2GRV A;  1UTB B;  3FJG A;  1A8F A;  1YAE A;  5FHM A;  4IY5 A;  1P1O A;  4FED A;  2H5Y A;  2W7Y A;  1LGB C;  1NL5 A;  4XTC Q;  1B05 A;  4OEN A;  2A5S A;  1A40 A;  4OER A;  2F78 A;  4KQP A;  5CMM A;  3RT6 B;  3Q25 A;  2Q2A A;  3S2V A;  1EH3 A;  4F39 A;  2HZL A;  2Q89 A;  4X48 A;  1A55 A;  1JVX A;  1B9J A;  1LBB A;  3IX1 A;  3FJM A;  3M3F A;  3I3V A;  4HCW A;  4XKP A;  5DTB A;  5I2K A;  3SKP A;  5BUU A;  2ALU A;  4Z0I A;  1PEB A;  1GV8 A;  3SEW A;  1VE4 A;  3LBS A;  2VOZ A;  4G68 C;  4MBP A;  1B4H A;  3ZKL A;  4JXI A;  3JV9 A;  1TXF A;  1UIU A;  1FTM A;  1MY2 A;  5FTH A;  3RTF B;  2I6E A;  2QJE A;  3KG2 A;  4ZEF A;  1MPC A;  1YTV A;  2V3U A;  4THI A;  4ZE8 A;  3TZA A;  2F34 A;  3UA8 A;  3IO6 A;  3N26 A;  1URS A;  1OLC A;  3G3H A;  4QFN A;  1JNF A;  1FQB A;  3EF7 A;  4DE8 A;  5CRY A;  1R9Q A;  2VGQ A;  4EQ7 A;  3DP4 A;  2RC9 A;  4HS7 A;  4POW A;  3VVF A;  1B52 A;  5TP9 B;  1I6B A;  2PBW A;  3KBR A;  4JBZ A;  3EHS A;  2PX1 A;  2Y7I A;  4KCD A;  4PQJ A;  1P1W A;  3U1O A;  1JW4 A;  5AA2 B;  1ZTY A;  4EQ9 A;  1JW5 A;  2OK2 A;  1BLF A;  1B7H A;  1WOD A;  1B5J A;  2A5T B;  5EHM A;  5TPA B;  2NUV A;  4Q30 B;  4RA1 A;  4C1T A;  1J1N A;  1Y1Z A;  4IB2 A;  3R7X A;  3DEL B;  1B1X A;  1FTO A;  3VLV A;  5KCJ B;  1LB8 A;  5KZT A;  1SBP A;  2H25 A;  3MUQ A;  4G4P A;  1SDX A;  1MQD A;  4G8H A;  1D3K A;  4IY6 A;  4KCC A;  2ONS A;  4YKP A;  2XXV A;  4F31 B;  1FTJ A;  1GR2 A;  1DPP A;  3C9H A;  3G3G A;  3IOW A;  1HSJ A;  3OEM A;  3CFZ A;  4LON B;  1DSN A;  3EN3 A;  4M1V A;  3TKD A;  4F1V A;  1NNP A;  4YKK A;  3SEU A;  1AIV A;  4OES A;  4HTG A;  2FNC A;  4TOZ A;  1MS7 A;  5H8H B;  1B3L A;  2THI A;  1EZ9 A;  3QIM A;  3B6Q A;  3PPR A;  3KEI A;  1H76 A;  1VSO A;  3O28 A;  3OD7 A;  3FZV A;  1O64 A;  1URG A;  2P1S A;  4DLD A;  3V5A A;  1B1H A;  3N94 A;  5H8F A;  3H6U A;  1M5B A;  1B5I A;  3KN3 A;  2XX7 A;  4G8M A;  3VLU A;  4C1U A;  2QS1 A;  1Y4C A;  4H6D A;  5ITO A;  3TMG A;  3TTK A;  3GXA A;  1NNK A;  3K2D A;  4NF8 B;  4OXV A;  3ILT B;  3ZKK A;  3USD A;  1AMF A;  4DDD A;  3TCH A;  2QMW A;  4F1Y A;  5KDT B;  4Q5T A;  2DWA A;  3KZG A;  4WEP A;  4LVQ A;  4FOR A;  4E0X A;  5L9O A;  2F7A A;  4FEC A;  1LFH A;  1YCJ A;  4EXL A;  4RK2 A;  3G3K A;  2B3F A;  1R9L A;  3K00 A;  3MJN A;  1XC1 A;  2P2A A;  1MXW A;  2VHA A;  3OEL A;  4KYD A;  5I58 A;  1T0K A;  4BDL A;  3MVX A;  1PB8 A;  5I56 B;  1FQF A;  1XOC A;  3TTM A;  4OFJ A;  2O1M A;  2QL3 A;  4ELQ A;  4OEV A;  3B6W A;  4G68 A;  4NMY A;  4O3A A;  3OMB A;  3KJT A;  3MP8 A;  4FAJ A;  1BKA A;  3GLB A;  1UTB A;  1UTH B;  2DE2 A;  1F9B A;  2OWT A;  1N0T A;  1MXY A;  3PD8 A;  3PUX E;  1XHY A;  5DYH A;  3RNN A;  5JTY B;  3K1N A;  2UVI A;  1US5 A;  4LZ5 A;  5TP9 A;  3C32 A;  4RYA A;  3G7W A;  1QKB A;  2IEE A;  3EQ1 A;  3OO9 A;  2YPN A; 
#chains in the Genus database with same CATH topology
 4LP2 B;  4ZS9 A;  4N17 A;  4RY1 A;  2QFL A;  3UOR A;  2GFE A;  1Y4T A;  3IAZ A;  3FV2 A;  1ATG A;  1SVX B;  5AA4 B;  2RIN A;  2FIX A;  1H44 A;  4NF6 B;  5K2X A;  4PAK A;  4I3Y A;  3M3K A;  5IZ3 A;  3RUM A;  4R72 A;  1IQ7 A;  2XWV A;  2A5T A;  4OZ9 A;  4UA8 A;  1LB9 A;  2XWI A;  3H6V A;  1NNT A;  4PFY A;  1SPI A;  2ZXT A;  4H45 A;  1B32 A;  2ZZW A;  3G3F A;  1JP4 A;  1P99 A;  3KSJ A;  2QMX A;  2ZYK A;  2F35 A;  3KSX A;  1H3D A;  3OO6 A;  2XWO A;  4QHQ A;  4BLA A;  1Y3Q A;  1A54 A;  4NG7 A;  4ZEC A;  4H8I A;  3LUY A;  3MW0 A;  2Z8D A;  3P7I A;  1NH7 A;  2DQV A;  4F29 A;  1B0H A;  5T3J A;  1RKM A;  4GRK A;  2BJJ X;  4O7M A;  4OET A;  4YAH X;  3BIH A;  4YKJ A;  1B58 A;  5FHN A;  4N6K A;  1FBP A;  4NF4 A;  2XXY A;  1HSL A;  1IXG A;  3FAS A;  3ILU B;  4O94 A;  2WYP A;  2AL5 A;  2RC8 A;  2O7I A;  2UVH A;  5ET8 A;  4QXD A;  1MY0 A;  4EF2 A;  5DVI A;  2G29 A;  1Y20 A;  3IB1 A;  3TTL A;  3IOT A;  1FPK A;  3MAM A;  4PP0 A;  1B3G A;  1WVJ A;  2QS4 A;  3FVG A;  4IO4 A;  1R6Z A;  4Z7E A;  2UYF A;  1KWH A;  1EYI A;  3RPL B;  5ITP A;  3HV1 A;  4KR5 A;  2PYY A;  5J1D A;  3PMW A;  4M4G A;  1SW2 A;  4ZZE A;  5A5L A;  2OX3 A;  1QUI A;  3RTW B;  4GOT A;  3IB2 A;  4KI0 E;  4IO5 A;  4OMB A;  2WYK A;  1FQD A;  3LR1 A;  2F7B A;  4WED A;  2DYX A;  1FPF A;  2KQZ A;  3CRB A;  4JB7 A;  4G2Z A;  4OFL A;  2ANJ A;  4I40 A;  3QUF A;  4NF8 A;  5J16 A;  1LAG E;  1OLA A;  2GQ1 A;  4MFI A;  5AA2 D;  4K3F A;  3T0J A;  2ZYN A;  3HO7 A;  3K1P A;  1NI9 A;  3A3U A;  1FTL A;  1NH8 A;  2P3N A;  1OIB A;  3GZG A;  3T96 B;  1B3E A;  5F7V A;  3I6V A;  2XX9 A;  2VT5 A;  5H8N B;  4H8J A;  4GIZ A;  3K1M A;  3K6W A;  4GQO A;  4NWC A;  3K0V A;  2DXR A;  2I58 A;  1OQG A;  2QVU A;  5KCJ A;  1OMP A;  1Z7M E;  4EUO A;  1IME A;  4PF8 A;  1I69 A;  3TEL A;  2DE3 A;  2I49 A;  5IZ3 B;  1QKA A;  1MQJ A;  2I4C A;  2HEU A;  1IXH A;  3R26 A;  2F6P A;  4F3G A;  4NGU A;  1I6Q A;  3D4C A;  3UGW A;  3HHG A;  3DLN A;  2DE4 A;  3U65 A;  1M5F A;  1MPB A;  4OVJ A;  5FHO A;  4DI4 B;  4PFT A;  1SYH A;  3PPP A;  3MQ9 A;  3PUZ E;  1IUD A;  3FJ7 A;  4FBP A;  2H98 A;  4OTE A;  4F2O A;  5EYH A;  3W9V A;  3IB0 A;  1FW0 A;  1MM6 A;  3KN8 A;  4I3E A;  1PC3 A;  4N13 A;  4G8N A;  1XS5 A;  4GWS A;  1MM7 A;  2FHY A;  4XKR A;  1POY 1;  2CZI A;  1H45 A;  4DCX A;  4YU0 A;  3CFL A;  1N04 A;  5I2K B;  4PC9 A;  5AA1 A;  3FXQ A;  1LFI A;  3MP1 A;  4HE0 A;  3IO4 A;  3T66 A;  3CSG A;  1FPJ A;  4GWZ A;  3SET A;  1MRP A;  4TQU Q;  5A5X A;  5L9M A;  2XD2 A;  1M5E A;  4YMA A;  1LAF E;  3R6U A;  5TPA A;  5HBC A;  3VV5 A;  3QXM A;  2B3B A;  1TFD A;  2D5W A;  4FJP A;  4GWO A;  5AA3 A;  2Y7K A;  1GTK A;  3BFU A;  3U92 A;  2ONK E;  3MBP A;  3VVE A;  2HQ0 A;  5B70 A;  2Y5L A;  3L6G A;  3Q27 A;  3EHU A;  4MMP A;  4GF8 A;  4XIG Q;  4PFW A;  1Y3P A;  1LBC A;  3WAE A;  4IO3 A;  1A7L A;  3B7D A;  1FBD A;  4X9T A;  4AQ4 A;  1NV7 A;  2O6A A;  1UIV A;  2ZNU A;  1MQG A;  2Q8M A;  2I3W A;  2QVV A;  3K02 A;  4YB6 A;  1FRP A;  2AL4 A;  1MY3 A;  4OA4 A;  1LAH E;  2CMO A;  3C35 A;  1A8F A;  5FHM A;  1NL5 A;  5CMM A;  4KQP A;  4MNP A;  1A55 A;  4HCW A;  5I2K A;  1PEB A;  1GV8 A;  4G68 C;  4MBP A;  3ZKL A;  2ZZX A;  2I6E A;  3VXC A;  1YTV A;  3N26 A;  4QFN A;  2B4M A;  1FPD A;  4NAP A;  1R9Q A;  1I6B A;  1FTA A;  3EHS A;  2PX1 A;  4KCD A;  2OK2 A;  5EHM A;  1WOD A;  4RA1 A;  2MKZ A;  1Y1Z A;  3DEL B;  4P56 A;  5KCJ B;  1LB8 A;  1SBP A;  4G8H A;  4F31 B;  1FTJ A;  1GR2 A;  3G3G A;  3OEM A;  3IOW A;  3S9E A;  5AA4 A;  1NNP A;  4OES A;  1URG A;  5I3S A;  1B1H A;  1IMA A;  3N94 A;  5H8F A;  2FBP A;  3VLU A;  1Y4C A;  1NNK A;  2QVR A;  4OXV A;  3ZKK A;  1IMC A;  4Q5T A;  2DWA A;  4LVQ A;  4FEC A;  4XF5 A;  3G3K A;  3OEL A;  1PB8 A;  2QL3 A;  4ELQ A;  4G68 A;  4FAJ A;  1BKA A;  3GLB A;  3PUX E;  3TZA A;  3GYY A;  1XHY A;  1US5 A;  2WX9 A;  1QKB A;  3EQ1 A;  3OO9 A;  3UK4 A;  1JEV A;  2O1L A;  1S50 A;  5LTC A;  2G93 A;  5H8Q B;  1ZLQ A;  4GLI A;  2E1S A;  4N07 A;  4OQO A;  3LSL A;  2DP8 A;  4OHN A;  4EDP A;  3O97 A;  4ZED A;  1NV4 A;  2DVZ A;  4X1D A;  2AYS A;  1ELJ A;  2DWI A;  4UAB A;  1LST A;  3T9H B;  1SW5 A;  4POX A;  4MCO A;  1LCT A;  1N7X A;  4F22 A;  2B65 A;  4YB5 A;  2DS9 A;  4ELO A;  3OO7 A;  2Y7W A;  1YXI A;  1USY H;  1P1Q A;  3H3G A;  2PT1 A;  4NTL A;  3HN0 A;  1QUJ A;  4U4S A;  5AA2 A;  5DVJ A;  4NX1 A;  3HPI A;  3UP9 A;  1NV2 A;  4I62 A;  1XVY A;  3BBR A;  1SW4 A;  3SEV A;  3GBA A;  3H03 A;  4MEV A;  3MZ1 A;  1RYX A;  4OVT A;  3FVN A;  2ZYO A;  3K6X A;  1OQH A;  4LAT A;  4OYV A;  1GVC A;  1N7W A;  3ZSF A;  3VE1 B;  3T9U A;  3GBB A;  1JET A;  4NQ8 A;  1N3X A;  4NHB A;  3TYH A;  1B0L A;  1NFT A;  4N91 A;  3E13 X;  1YYZ A;  3MVZ A;  4NED A;  3K6V A;  1MH3 A;  4YIC A;  3W15 C;  5I56 A;  3DM0 A;  4IR8 A;  2Y84 A;  5I2N B;  1D9Q A;  4IO7 A;  5A5X B;  3TUS A;  4BDN A;  1II5 A;  4GL0 A;  3VLW A;  3IOR A;  3O6G A;  2XXP A;  4PFU A;  3IK6 B;  1IEJ A;  1S7Y A;  3RGY A;  2DXY A;  4IGT A;  5IKB A;  3RY3 A;  4PE3 A;  1PBP A;  4X8R A;  4R74 A;  4JWO A;  1PDA A;  1B5H A;  1ZJL A;  4O3C A;  4MNI A;  1SW1 A;  4XKQ A;  4JSD A;  5EQ9 A;  2H99 A;  1OVB A;  2HFB A;  2XXW A;  3Q26 A;  3U72 A;  1B46 A;  4DXU A;  4TLL B;  3LUZ A;  2ONR A;  5ICQ A;  5TU0 A;  2F3D A;  3A3C A;  1AOV A;  4ESW A;  3C31 A;  1FBE A;  2PVU A;  2F5X A;  1XVX A;  2OLB A;  4PFB A;  2Z8F A;  2YLN A;  3CFX A;  4GBW A;  4EXK A;  3K6U A;  1XI6 A;  4I1D A;  4MF3 A;  3LSX A;  1FBC A;  3W9W A;  1MXU A;  5ISU A;  4JDF A;  4RK9 A;  3TOD A;  4R73 A;  1AH5 A;  2XXI A;  1MQI A;  3OEK A;  3S9M C;  3PPO A;  3VFJ A;  2QPQ A;  4QFP A;  4I9D A;  4Q8R A;  3HST A;  2NWJ A;  1IMD A;  2VP1 A;  2QS3 A;  4O8M A;  4PAF A;  1BTJ A;  2F8D A;  3PUY E;  1B51 A;  2CZL A;  4RPO A;  1N76 A;  3RN8 A;  3TCF A;  2ZMB A;  4YB7 A;  1CB6 A;  5CMK A;  1Y9U A;  1N84 A;  4JSO A;  1DPE A;  4PET A;  4JWX A;  1JEU A;  3THI A;  2OJT A;  3E9X A;  4LZ8 A;  5I7I A;  3PUV E;  4LUB A;  4MAG A;  3TAJ A;  3T9V A;  5H8N A;  1LEV A;  1N3W A;  4GL8 A;  1HSE A;  2O51 A;  1PB7 A;  4MH5 A;  3H6T A;  4G61 A;  4LQ2 A;  2ZZV A;  2D3I A;  2X26 A;  4H46 A;  1US4 A;  3TTN A;  1QVS A;  1VFD A;  2GH9 A;  1B3H A;  3S9L C;  1IIW A;  1NUY A;  2REJ A;  2Y7R A;  1QJM A;  3C4M A;  1SYI A;  1MH4 A;  3CSB A;  1K9Y A;  3UIF A;  1VFE A;  4KYS A;  3MVY A;  5CC2 A;  5DEX A;  3VDF A;  3PD9 A;  3IOU A;  4PAI A;  3TQL A;  4X1B A;  2HAU A;  5F24 A;  2XHD A;  3B6T A;  4O3B A;  4GWW A;  5I58 B;  2XXT A;  1Z7N E;  3DP8 A;  3G3J A;  1NV1 A;  2FVZ A;  1NKX A;  3OEN A;  1B6H A;  1KZ8 A;  1LFG A;  1MG1 A;  3O2A A;  4E0X A;  1B2H A;  1FCK A;  4MJO A;  4H67 A;  2O69 A;  3MST A;  1UTB B;  3FJG A;  1IMB A;  4FED A;  2H5Y A;  4OER A;  1A40 A;  2F78 A;  3RT6 B;  3S2V A;  2VPO A;  2HZL A;  4LN5 A;  2Q89 A;  1JVX A;  1B9J A;  1LBB A;  5DTB A;  3SKP A;  3T1B A;  1VE4 A;  1B4H A;  1UIU A;  1MY2 A;  3RTF B;  1FBH A;  3UA8 A;  2F34 A;  1NV5 A;  1JNF A;  2VPN A;  2VGQ A;  2RC9 A;  4HS7 A;  4POW A;  3NOH A;  2Y7I A;  5IGA A;  1B7H A;  2A5T B;  3R7X A;  1B1X A;  1LBV A;  3VLV A;  5KZT A;  1FJ6 A;  1MQD A;  1D3K A;  4YKP A;  1RDY A;  4LON B;  1HSJ A;  3TKD A;  3CFZ A;  1DSN A;  1AIV A;  4TOZ A;  2FNC A;  5H8H B;  3B6Q A;  3D1R A;  3ISP A;  1VSO A;  3O28 A;  1O64 A;  3KN3 A;  1B5I A;  4G8M A;  4H6D A;  3K2D A;  4NF8 B;  4GWY A;  3ILT B;  3TCH A;  5KDT B;  1LFH A;  2F7A A;  3K00 A;  2P2A A;  1MXW A;  2VHA A;  2PCR A;  4KYD A;  4NMY A;  2DE2 A;  3RNN A;  5DYH A;  1MXY A;  4LZ5 A;  3C32 A;  4N8Y A;  1DBZ A;  4RYA A;  2YPN A;  2XXR A;  1Q1K A;  3H06 B;  3RLF E;  1QUL A;  2F36 A;  2YJP A;  4E0W A;  2QRY A;  4G68 B;  2Z22 A;  4G77 A;  4N6P A;  4PFR A;  3I5O A;  1QW0 A;  2PFY A;  3HCQ A;  1URD A;  5H8Q A;  1DOT A;  1MXV A;  1QUK A;  3SDF A;  2CZH A;  4DI3 D;  1NUW A;  4LZ7 A;  3O66 A;  3KOT A;  4OVQ A;  2F7C A;  1MDQ A;  1IIT A;  3OXN A;  4GFR A;  5CI5 A;  4P8B A;  3LSF B;  3CVG A;  4P0G A;  2GHB A;  2HCA A;  1FQA A;  3UN6 A;  3RPW A;  4I8C A;  1DTZ A;  2HAV A;  4N4U A;  5CMC A;  3SEY A;  4ELR A;  4F3S A;  1QGX A;  1D9Y A;  4R9F A;  4KPT A;  4OAN A;  3TCG A;  1DMB A;  3QAX A;  4OWD A;  4R6H A;  2V93 A;  1AL3 A;  1MQH A;  3H4Z A;  3HFU A;  1M5D A;  4P11 A;  5JK4 A;  3QUJ A;  2P0S A;  4KHZ E;  4FE8 A;  3PGF A;  1YPN A;  2V84 A;  3VXB A;  1VDW A;  3KFM A;  4YKI A;  4HCY A;  3SES A;  2UYE A;  3T9X B;  4FEB A;  4Q0C A;  3MWB A;  1MY4 A;  3FV1 A;  4TLM B;  4HXV A;  3QSL A;  2I0C A;  4OVR A;  3MP6 A;  3KC0 A;  4HE1 A;  4NF6 A;  5LDZ A;  3S4U A;  3DP6 A;  3FUZ A;  4H5F A;  4OEU A;  1EU8 A;  4PF6 A;  1ZKB A;  5H8S A;  2DWJ A;  2R9J A;  2O7U A;  4PFI A;  3BKI B;  3T22 A;  5K2Y A;  2VD3 A;  4R9G A;  5EYF A;  4U23 A;  4XXU A;  3U8Q A;  1POT A;  2V3Q A;  1FPB A;  3E4R A;  1UQW A;  3QK6 A;  4H5G A;  1S9T A;  5JEI A;  4LA9 A;  4QFK A;  1L5T A;  4DXC A;  1B7U A;  1MXZ A;  4U1O A;  1LBX A;  3PUW E;  1FPG A;  3PV0 E;  4NE4 A;  4GXS B;  5I2N A;  4XFE A;  3S9N C;  2M8C A;  5I57 A;  4RNS A;  2I0B A;  2I4B A;  1G0H A;  3D4G A;  3WAF A;  4ZE9 A;  2X7Q A;  2ZNS A;  1OVT A;  4LQ5 A;  3B50 A;  2Z23 A;  2BJI A;  3T93 B;  2ZYM A;  5M2V A;  3O6I A;  1K9Z A;  1MDP 1;  3E78 A;  4ELP A;  2KLF A;  3QYT A;  2CEY A;  1LBW A;  1NV6 A;  3FVO A;  2OWZ A;  3AXF A;  4ZEI A;  1FTK A;  4PDH A;  3FD3 A;  3TFL A;  4QSE A;  5EYG A;  3KOS A;  4BDQ A;  4H1X A;  2DWH A;  1B3F A;  5L8D A;  4NF5 B;  5ET6 A;  1JQF A;  1M5C A;  2XA5 A;  3K01 A;  3MPL A;  4AS4 A;  5CBR A;  3O6H A;  3PMX A;  4U21 A;  2LAO A;  1NV3 A;  3ODB A;  4RJZ A;  5H8F B;  2WKY A;  1H43 A;  3O29 A;  3IR1 A;  3IFA A;  1MY1 A;  3A29 A;  2I3V A;  4F19 A;  4U22 A;  5CMB A;  2F97 A;  5JTY A;  3ECR A;  2XXH A;  1TFA A;  3K4U A;  1LBY A;  1SI0 A;  4EQB A;  3PMV A;  4DCY A;  3N5L A;  3OOA A;  2FIE A;  3FIR A;  4ONY A;  3V89 B;  3M8U A;  3KC1 A;  3CIJ A;  5EQ7 A;  1YZ0 A;  1LLS A;  2OBG A;  2NXO A;  3MZB A;  4R6Y A;  4RXL A;  2RC7 A;  3PPN A;  2ESN A;  4BDO A;  4IO6 A;  3VVD A;  4GWU A;  2Z8E A;  4U4X A;  5I84 A;  4U1Z A;  5IZZ A;  1B4Z A;  4JVI A;  3IOV A;  1NNF A;  4NN3 A;  1MXX A;  4NF4 B;  4R2F A;  4L17 A;  3QMF A;  1I6A A;  4PDD A;  5ET5 A;  3HHF A;  3PU5 A;  1VR5 A;  3G3I A;  1P1U A;  2HZK A;  1SI1 A;  4NF5 A;  3CI8 A;  2RCA A;  2ABH A;  1EZP A;  1ZIU A;  4GX4 A;  1FBF A;  1BP5 A;  2PFZ A;  2L5V A;  4MNC A;  2RF1 A;  4MIJ A;  4QFO A;  1EYJ A;  2Q74 A;  4F3P A;  3TTR A;  2FA7 A;  3KBZ A;  2UXA A;  1IXI A;  1IZ1 A;  1WDN A;  3H6W A;  4P47 A;  4BDM A;  3KGC A;  5EHS A;  3LC8 A;  4KFQ A;  1USY E;  1Q9D A;  4PBH A;  1YAE A;  5EQ8 A;  2W7Y A;  1LBZ A;  5HPQ A;  2A5S A;  2Q2A A;  3IX1 A;  4XKP A;  3FJM A;  2ALU A;  4Z0I A;  5IZ1 A;  3SEW A;  3LBS A;  4X04 A;  3JV9 A;  5FTH A;  4ZE8 A;  2CEX A;  3KG2 A;  2Y5K A;  4THI A;  1URS A;  1OLC A;  3G3H A;  3EF7 A;  4DE8 A;  1FPE A;  1IMF A;  3DP4 A;  1B52 A;  5TP9 B;  4P9K A;  4PQJ A;  5AA2 B;  1ZTY A;  4N6D A;  1JW5 A;  1BLF A;  5TPA B;  2NUV A;  4Q30 B;  4C1T A;  4MHF A;  3MUQ A;  4OVP A;  2XWK A;  1SDX A;  4G4P A;  4KCC A;  5ESY A;  2XXV A;  4N8G A;  3BIG A;  3EN3 A;  3SEU A;  4HTG A;  1MS7 A;  1CNQ A;  1B3L A;  2THI A;  1EZ9 A;  3PPR A;  1H76 A;  4P1E A;  3B8B A;  3H6U A;  2XX7 A;  4C1U A;  3TMG A;  3TTK A;  4DDD A;  3USD A;  1AMF A;  2QMW A;  4F1Y A;  1YCJ A;  2B3F A;  1R9L A;  3MJN A;  3RYD A;  1XC1 A;  1T0K A;  1FPI A;  3MVX A;  5I56 B;  1FQF A;  4O3A A;  3MP8 A;  3PD8 A;  2WEF A;  5JTY B;  4NWD A;  2IEE A;  2H9B A;  4H65 A;  4PBQ A;  1KA1 A;  3Q28 A;  2PMS A;  3EKI A;  4ZEK A;  4GXA A;  3FGS A;  4QFL A;  5HM4 B;  4R75 A;  2XXU A;  3MVW A;  5ET7 A;  1FJ9 A;  1FQC A;  1A8E A;  2R71 A;  4KYE A;  3LSW A;  1Y1M A;  4H0W A;  4PGN A;  4GVO A;  2REG A;  2HHM A;  3TDJ A;  3OSR A;  3U93 A;  4YZZ A;  3MZ9 A;  5ELV A;  3IJX B;  3FVK A;  4ESX A;  4O7I A;  4EF1 A;  1ZBM A;  5LOM A;  4F2Q A;  3IL1 B;  1TT1 A;  3TEP A;  2ZNT A;  4ZZA A;  1IXC A;  3O9P A;  2F3B A;  5ICT A;  2DDK A;  1B7Z A;  1O63 A;  3C34 A;  3N6U A;  3RPL A;  2E0S A;  1AWB A;  2V25 A;  3EHT A;  3CHG A;  2XXQ A;  3ZS6 A;  4GWX A;  1D4N A;  3KN7 A;  4ECF A;  3N6T A;  2R8T A;  4PTK A;  4GX6 A;  3SEX A;  5I57 B;  5EQA A;  3TQW A;  3LV0 A;  4ZEB A;  1R1N A;  5DEX B;  4FAT A;  2Q9T A;  3PTY A;  4HE2 A;  2H4I A;  4WXJ A;  2NVU B;  2I48 A;  2XXX A;  2Q8J A;  3U94 A;  4UAC A;  4ND9 A;  3V83 A;  2NOO A;  4XKN A;  2WBB A;  5AE4 A;  2PT2 A;  4JWY A;  1FBG A;  2R6G E;  4NF0 A;  4R6K A;  1ZMG A;  4U2R A;  3PPQ A;  1Q35 A;  4DZ1 A;  3E79 A;  4WKM A;  2DOJ A;  1P1N A;  2OCU A;  4KXP A;  4PE5 B;  2O68 A;  2RCB A;  2IA4 A;  1SD3 A;  1XT8 A;  3Q29 A;  4GBV A;  3M3L A;  4YMB A;  2QS2 A;  3C33 A;  2O84 X;  3ONM A;  2WBD A;  1BIY A;  3RT8 A;  3V8X B;  3MYU A;  4QSD A;  4ISU A;  4PGP A;  4R2B A;  4BDR A;  3L6H A;  4IO2 A;  1FPL A;  3A09 A;  5IAI A;  4P1L A;  5CBS A;  3MC2 A;  1RDX A;  2AIX A;  2P3V A;  5I59 B;  2GHA A;  5BWJ A;  2FYI A;  3FXU A;  4MLV A;  3CG1 A;  2D21 A;  5H8H A;  2UVG A;  1PBQ A;  3JZJ A;  5L9S A;  4OFO A;  2V3T A;  1DTG A;  4C0R A;  1EYK A;  4AB5 A;  1D9V A;  3MPK A;  2XX8 A;  3SER A;  3FXB A;  1NV0 A;  2Q88 A;  3H7M A;  1JVY A;  1EZO A;  2JJK A;  1CE2 A;  4ZDM A;  2OWS A;  4F1U A;  2Q2C A;  1FQE A;  2XXK A;  3FBP A;  2VD2 A;  3KJ7 A;  1JW1 A;  2OZZ A;  5FBP A;  2HXR A;  2KR0 A;  4MLQ A;  5DT6 A;  3RQT A;  2UVJ A;  3FXR A;  1ZU0 A;  4P3L A;  3CR9 A;  1GGG A;  2B4L A;  1TWY A;  4DIG A;  2CZK A;  1O7T A;  2QSX A;  1SQY A;  4MX6 A;  1LCF A;  1RYO A;  3IFC A;  5IM2 A;  4FIM A;  1INP A;  4F3B A;  3OO8 A;  1FSA A;  4XEQ A;  3EPE A;  5DVF A;  1MPD A;  4KD5 A;  2DVC A;  3IJO B;  3JYR A;  4DXB A;  1ANF A;  3E3K A;  4JVD A;  4AB6 A;  4P0I A;  1LAX A;  4GD5 A;  4QF9 A;  3CG3 A;  2Y7P A;  1A99 A;  4QSC A;  3OSQ A;  5B7D A;  5CM6 A;  5I59 A;  1UTH A;  2HXW A;  3TPA A;  1NMU A;  4N81 A;  4RPN A;  2X7P A;  1B40 A;  1DK4 A;  4IGR A;  2F6G A;  5KDT A;  3FAT A;  1PB9 A;  3BFT A;  1Y3N A;  3C36 A;  1BK4 A;  4HW8 A;  4QRZ A;  5FTI A;  1NUZ A;  2DSF A;  3F11 A;  2XD3 A;  2GRV A;  4IY5 A;  1P1O A;  3ROJ A;  1LGB C;  4XTC Q;  4F18 A;  1B05 A;  1KA0 A;  4OEN A;  4EXL A;  3Q25 A;  1EH3 A;  4F39 A;  4JVC A;  4X48 A;  3M3F A;  3I3V A;  5BUU A;  1NUX A;  2VOZ A;  4PCD A;  4JXI A;  1TXF A;  1FTM A;  2QJE A;  4ZEF A;  1MPC A;  2V3U A;  3IO6 A;  1FQB A;  5CRY A;  4EQ7 A;  4GX3 A;  3VVF A;  2HPG A;  2PBW A;  3KBR A;  4JBZ A;  3U1O A;  1P1W A;  1JW4 A;  4EQ9 A;  1G0I A;  4N15 A;  1B5J A;  1J1N A;  4IB2 A;  1FTO A;  2H25 A;  4IY6 A;  2ONS A;  1DPP A;  3C9H A;  4M1V A;  4F1V A;  4YKK A;  4QBA A;  3QIM A;  5I5P A;  3KEI A;  4AS5 A;  4OVS A;  3OD7 A;  3FZV A;  2P1S A;  4DLD A;  3V5A A;  2V4C A;  1M5B A;  2QS1 A;  5ITO A;  3GXA A;  3KZG A;  4WEP A;  4FOR A;  5L9O A;  4RK2 A;  3SZP A;  5I58 A;  4BDL A;  1DCU A;  1XOC A;  3TTM A;  4OFJ A;  2O1M A;  4OEV A;  3B6W A;  3OMB A;  3KJT A;  1UTB A;  1UTH B;  5DW8 A;  1F9B A;  2OWT A;  1N0T A;  3K1N A;  2UVI A;  5TP9 A;  5F1Q A;  3G7W A;  2RKM A;  1RDZ A; 
#chains in the Genus database with same CATH homology
 2XXR A;  4LP2 B;  4ZS9 A;  1JEV A;  1Q1K A;  3UK4 A;  2O1L A;  2H9B A;  4H65 A;  3H06 B;  1S50 A;  4RY1 A;  2G93 A;  2GFE A;  5H8Q B;  1ZLQ A;  4GLI A;  3RLF E;  1QUL A;  3UOR A;  3Q28 A;  2E1S A;  2PMS A;  4ZEK A;  1Y4T A;  4GXA A;  4N07 A;  3FGS A;  4OQO A;  3LSL A;  2DP8 A;  4QFL A;  5HM4 B;  4OHN A;  2F36 A;  2YJP A;  4R75 A;  2XXU A;  3MVW A;  3O97 A;  4E0W A;  3IAZ A;  2DVZ A;  2QRY A;  4G68 B;  4ZED A;  3FV2 A;  1ATG A;  2Z22 A;  4X1D A;  2AYS A;  1ELJ A;  4EDP A;  2DWI A;  1SVX B;  5AA4 B;  1LST A;  3T9H B;  2RIN A;  4G77 A;  1SW5 A;  4N6P A;  1FQC A;  4POX A;  1A8E A;  1LCT A;  2R71 A;  3I5O A;  1N7X A;  1H44 A;  1QW0 A;  3HCQ A;  4KYE A;  4NF6 B;  1URD A;  5H8Q A;  5K2X A;  4F22 A;  3LSW A;  1Y1M A;  1DOT A;  3M3K A;  1MXV A;  3RUM A;  4R72 A;  4H0W A;  2B65 A;  1QUK A;  3SDF A;  1IQ7 A;  4YB5 A;  2DS9 A;  4F18 A;  4LZ7 A;  4GVO A;  2A5T A;  3O66 A;  4OZ9 A;  3KOT A;  4UA8 A;  2REG A;  3OO7 A;  4ELO A;  3TDJ A;  2Y7W A;  2F7C A;  3OSR A;  1MDQ A;  1USY H;  3U93 A;  4YZZ A;  1LB9 A;  1IIT A;  1P1Q A;  3H6V A;  3OXN A;  3H3G A;  2PT1 A;  1NNT A;  4PFY A;  3MZ9 A;  5F1Q A;  4GFR A;  4NTL A;  5CI5 A;  3HN0 A;  2ZXT A;  1QUJ A;  4U4S A;  5AA2 A;  1B32 A;  5DVJ A;  3G3F A;  5ELV A;  3IJX B;  3HPI A;  3LSF B;  3FVK A;  1P99 A;  3KSJ A;  3CVG A;  4P0G A;  4ESX A;  3UP9 A;  2QMX A;  4EF1 A;  2GHB A;  1ZBM A;  2HCA A;  2ZYK A;  2F35 A;  4I62 A;  5LOM A;  1XVY A;  3KSX A;  1H3D A;  1FQA A;  3BBR A;  3IL1 B;  4F2Q A;  3UN6 A;  3OO6 A;  4DXB A;  1SW4 A;  4QHQ A;  3SEV A;  3GBA A;  1TT1 A;  3RPW A;  4BLA A;  3H03 A;  3TEP A;  4I8C A;  2ZNT A;  1DTZ A;  4ZZA A;  2HAV A;  1RYX A;  1Y3Q A;  3MZ1 A;  1A54 A;  1IXC A;  5CMC A;  3O9P A;  3FVN A;  3SEY A;  4ZEC A;  2ZYO A;  5ICT A;  4ELR A;  3K6X A;  3LUY A;  3MW0 A;  1B7Z A;  1O63 A;  4H8I A;  4F3S A;  1OQH A;  4LAT A;  3C34 A;  3N6U A;  4OYV A;  1GVC A;  1N7W A;  3ZSF A;  1D9Y A;  3VE1 B;  4R9F A;  3T9U A;  2E0S A;  4KPT A;  3TCG A;  3GBB A;  3S9E A;  2V25 A;  3EHT A;  1DMB A;  1JET A;  3QAX A;  4OWD A;  4R6H A;  2V93 A;  1AL3 A;  1MQH A;  3H4Z A;  2Z8D A;  1M5D A;  4P11 A;  5JK4 A;  2XXQ A;  3P7I A;  1NH7 A;  1N3X A;  3ZS6 A;  3TYH A;  2DQV A;  4F29 A;  1B0H A;  1D4N A;  1B0L A;  1NFT A;  3KN7 A;  4ECF A;  1RKM A;  3E13 X;  3N6T A;  2BJJ X;  3QUJ A;  4GRK A;  4OET A;  4YAH X;  3MVZ A;  4NED A;  3K6V A;  4YKJ A;  1MH3 A;  2P0S A;  4KHZ E;  4FE8 A;  1B58 A;  5FHN A;  3PGF A;  1YPN A;  4YIC A;  3W15 C;  5I56 A;  3DM0 A;  2V84 A;  4NF4 A;  3VXB A;  2Y84 A;  5I2N B;  2XXY A;  1HSL A;  3KFM A;  4YKI A;  1IXG A;  4IO7 A;  4HCY A;  3SEX A;  3FAS A;  3ILU B;  5I57 B;  3SES A;  2UYE A;  5A5X B;  3T9X B;  4FEB A;  4Q0C A;  3TUS A;  2AL5 A;  1MY4 A;  3MWB A;  3TQW A;  4BDN A;  3FV1 A;  2RC8 A;  4TLM B;  4ZEB A;  1II5 A;  2O7I A;  2UVH A;  1R1N A;  3QSL A;  2I0C A;  5DEX B;  4FAT A;  3MP6 A;  2Q9T A;  4NF6 A;  3S4U A;  1MY0 A;  3DP6 A;  3FUZ A;  4GL0 A;  3VLW A;  2H4I A;  4WXJ A;  2NVU B;  3IOR A;  2I48 A;  4H5F A;  1EU8 A;  2XXX A;  3O6G A;  4OEU A;  4EF2 A;  2Q8J A;  5DVI A;  3U94 A;  4UAC A;  4ND9 A;  2G29 A;  1ZKB A;  5H8S A;  3V83 A;  2DWJ A;  2XXP A;  1Y20 A;  2R9J A;  3IB1 A;  4PFU A;  2O7U A;  3TTL A;  3IOT A;  3MAM A;  2NOO A;  3BKI B;  4PP0 A;  3IK6 B;  1IEJ A;  4XKN A;  1B3G A;  1S7Y A;  5I59 A;  1WVJ A;  2DXY A;  2QS4 A;  3FVG A;  4IGT A;  4IO4 A;  3RGY A;  3RY3 A;  1R6Z A;  4Z7E A;  3T22 A;  1PBP A;  5IKB A;  2UYF A;  2VD3 A;  1KWH A;  2PT2 A;  4R74 A;  4R9G A;  4JWO A;  4U23 A;  4JWY A;  4XXU A;  3HV1 A;  4KR5 A;  5EYF A;  3U8Q A;  1POT A;  5ITP A;  2V3Q A;  2PYY A;  1PDA A;  1B5H A;  3E4R A;  1UQW A;  3QK6 A;  2R6G E;  5J1D A;  3PMW A;  4M4G A;  1ZJL A;  1SW2 A;  4H5G A;  4O3C A;  1S9T A;  4NWD A;  5JEI A;  4XKQ A;  1SW1 A;  4ZZE A;  1QUI A;  3RTW B;  4R6K A;  1ZMG A;  4GOT A;  4LA9 A;  4JSD A;  3IB2 A;  4QFK A;  1L5T A;  4KI0 E;  2H99 A;  1B7U A;  4DXC A;  1OVB A;  4IO5 A;  2HFB A;  4U2R A;  4OMB A;  2XXW A;  3Q26 A;  1MXZ A;  4U1O A;  3U72 A;  3PPQ A;  1Q35 A;  4DZ1 A;  1FQD A;  1B46 A;  3LR1 A;  4DXU A;  4WKM A;  2F7B A;  2DOJ A;  4WED A;  3PUW E;  2DYX A;  1P1N A;  4TLL B;  3PV0 E;  2ONR A;  4GXS B;  4NE4 A;  5I2N A;  3CRB A;  5ICQ A;  3S9N C;  4JB7 A;  2M8C A;  2OCU A;  4G2Z A;  4OFL A;  4PE5 B;  5TU0 A;  2ANJ A;  3A3C A;  5I57 A;  4RNS A;  1AOV A;  2I0B A;  3QUF A;  2O68 A;  4NF8 A;  2I4B A;  2RCB A;  1LAG E;  1OLA A;  3D4G A;  4MFI A;  4ESW A;  3C31 A;  3WAF A;  2PVU A;  4K3F A;  2F5X A;  4ZE9 A;  5AA2 D;  2IA4 A;  2X7Q A;  1XVX A;  2OLB A;  2ZNS A;  1OVT A;  1SD3 A;  1XT8 A;  2Z8F A;  2ZYN A;  3HO7 A;  3K1P A;  4LQ5 A;  3Q29 A;  3M3L A;  2Z23 A;  2YLN A;  3T93 B;  3CFX A;  4YMB A;  2ZYM A;  3A3U A;  4EXK A;  1FTL A;  1NH8 A;  3K6U A;  1OIB A;  5M2V A;  2QS2 A;  3GZG A;  3O6I A;  1MDP 1;  2O84 X;  3C33 A;  3ONM A;  4I1D A;  3T96 B;  1B3E A;  4MF3 A;  1BIY A;  4ELP A;  3RT8 A;  2KLF A;  3QYT A;  5F7V A;  3I6V A;  3V8X B;  3LSX A;  3W9W A;  1MXU A;  5ISU A;  4QSD A;  2XX9 A;  3FVO A;  4ISU A;  4JDF A;  3AXF A;  5H8N B;  4H8J A;  4R2B A;  4RK9 A;  4ZEI A;  3TOD A;  1FTK A;  4BDR A;  5HPQ A;  3L6H A;  3FD3 A;  1AH5 A;  4GIZ A;  2XXI A;  4IO2 A;  3K1M A;  1MQI A;  3K6W A;  4GQO A;  4R73 A;  3A09 A;  3OEK A;  4NWC A;  5IAI A;  3S9M C;  3PPO A;  3K0V A;  3TFL A;  2DXR A;  2I58 A;  4QSE A;  3VFJ A;  5CBS A;  2QPQ A;  1OQG A;  4I9D A;  4QFP A;  4Q8R A;  1OMP A;  3HST A;  3MC2 A;  2NWJ A;  5KCJ A;  1Z7M E;  2AIX A;  2RKM A;  2VP1 A;  3KOS A;  4H1X A;  2QS3 A;  4BDQ A;  4EUO A;  5I59 B;  2GHA A;  5BWJ A;  2DWH A;  1B3F A;  5K2Y A;  5L8D A;  1BTJ A;  1I69 A;  3TEL A;  2FYI A;  2DE3 A;  3FXU A;  2F8D A;  4MLV A;  4NF5 B;  1JQF A;  2I49 A;  3CG1 A;  1M5C A;  2D21 A;  3K01 A;  5H8H A;  1QKA A;  3MPL A;  3PUY E;  2UVG A;  5CBR A;  3O6H A;  1B51 A;  1MQJ A;  3PMX A;  2I4C A;  1PBQ A;  1IXH A;  2HEU A;  2LAO A;  3R26 A;  3JZJ A;  4U21 A;  5L9S A;  2F6P A;  3ODB A;  4OFO A;  4F3G A;  2CZL A;  4RJZ A;  5H8F B;  1I6Q A;  2WKY A;  3D4C A;  3HHG A;  2V3T A;  1H43 A;  3UGW A;  4RPO A;  3DLN A;  1N76 A;  3O29 A;  1DTG A;  2DE4 A;  4C0R A;  1M5F A;  3RN8 A;  1MPB A;  3IR1 A;  4OVJ A;  5FHO A;  3TCF A;  4PFT A;  1SYH A;  4AB5 A;  1D9V A;  2ZMB A;  1MY1 A;  3PPP A;  3MPK A;  3MQ9 A;  3PUZ E;  1CB6 A;  1IUD A;  4YB7 A;  2XX8 A;  3FJ7 A;  5CMK A;  1Y9U A;  3SER A;  2I3V A;  2H98 A;  4OTE A;  4F2O A;  1N84 A;  4F19 A;  4JSO A;  1DPE A;  5AA4 A;  3W9V A;  3IB0 A;  4U22 A;  5CMB A;  2Q88 A;  1FW0 A;  1JVY A;  1MM6 A;  3H7M A;  3KN8 A;  1PC3 A;  2F97 A;  1JEU A;  4JWX A;  4PET A;  4N13 A;  3THI A;  1EZO A;  1CE2 A;  2OJT A;  3E9X A;  4G8N A;  4LZ8 A;  1XS5 A;  4ZDM A;  2OWS A;  1MM7 A;  4F1U A;  3PUV E;  2Q2C A;  4LUB A;  4XKR A;  1FQE A;  3TAJ A;  5JTY A;  3T9V A;  1POY 1;  2VD2 A;  2XXH A;  3ECR A;  3KJ7 A;  1JW1 A;  1TFA A;  1N3W A;  4GL8 A;  1H45 A;  1SI0 A;  3K4U A;  4EQB A;  2OZZ A;  4DCX A;  1HSE A;  3PMV A;  4DCY A;  2O51 A;  3N5L A;  3OOA A;  4YU0 A;  3CFL A;  1PB7 A;  4MH5 A;  3H6T A;  3FIR A;  4ONY A;  1N04 A;  5I2K B;  3V89 B;  5AA1 A;  3FXQ A;  3M8U A;  1LFI A;  3MP1 A;  3CIJ A;  4LQ2 A;  4MLQ A;  5DT6 A;  3RQT A;  1LLS A;  3IO4 A;  2OBG A;  2NXO A;  3MZB A;  4R6Y A;  2D3I A;  4RXL A;  5H8N A;  2RC7 A;  3T66 A;  3PPN A;  2ESN A;  2X26 A;  3CSG A;  4IO6 A;  3VVD A;  4BDO A;  1US4 A;  3TTN A;  2UVJ A;  1QVS A;  1VFD A;  2Z8E A;  2GH9 A;  1MRP A;  3FXR A;  3SET A;  4TQU Q;  1B3H A;  1ZU0 A;  4U4X A;  5I84 A;  5A5X A;  3S9L C;  1IIW A;  5L9M A;  2REJ A;  4U1Z A;  3CR9 A;  1GGG A;  1B4Z A;  2Y7R A;  1QJM A;  1TWY A;  3C4M A;  3IOV A;  4DIG A;  5AE4 A;  1SYI A;  1O7T A;  2QSX A;  1MH4 A;  2XD2 A;  1M5E A;  1NNF A;  4YMA A;  1MXX A;  1SQY A;  4NF4 B;  1LAF E;  3R6U A;  3CSB A;  5TPA A;  4R2F A;  1LCF A;  5HBC A;  1RYO A;  3VV5 A;  3UIF A;  1VFE A;  3QXM A;  2B3B A;  1TFD A;  4L17 A;  4KYS A;  2D5W A;  4FJP A;  1I6A A;  4GWO A;  4FIM A;  3HHF A;  5AA3 A;  3PU5 A;  4F3B A;  2Y7K A;  3MVY A;  1VR5 A;  3G3I A;  1GTK A;  3OO8 A;  5CC2 A;  3BFU A;  3U92 A;  2ONK E;  3MBP A;  5DEX A;  3VDF A;  3PD9 A;  3VVE A;  1P1U A;  3EPE A;  5DVF A;  1MPD A;  4KD5 A;  2DVC A;  3VXC A;  3IOU A;  2HZK A;  2HQ0 A;  3IJO B;  1SI1 A;  3O2A A;  4NF5 A;  3JYR A;  5B70 A;  3CI8 A;  2RCA A;  1ANF A;  3L6G A;  2ABH A;  3E3K A;  3Q27 A;  3EHU A;  2HAU A;  4X1B A;  4GF8 A;  4XIG Q;  3TQL A;  1EZP A;  1ZIU A;  4PFW A;  4AB6 A;  4P0I A;  1LAX A;  2XHD A;  1Y3P A;  1LBC A;  3B6T A;  4GD5 A;  4O3B A;  3WAE A;  4IO3 A;  3CG3 A;  4QF9 A;  2XXT A;  5I58 B;  1A7L A;  1Z7N E;  2Y7P A;  3B7D A;  1A99 A;  4QSC A;  1BP5 A;  3DP8 A;  3G3J A;  3OSQ A;  4AQ4 A;  4X9T A;  5B7D A;  5CM6 A;  2RF1 A;  3OEN A;  1NKX A;  1UTH A;  2HXW A;  1B6H A;  1NMU A;  3TPA A;  4QFO A;  1LFG A;  4RPN A;  2O6A A;  1UIV A;  2X7P A;  1MG1 A;  1B40 A;  4IGR A;  4F3P A;  3TTR A;  2F6G A;  5KDT A;  2FA7 A;  2ZNU A;  2UXA A;  1IXI A;  1IZ1 A;  1MQG A;  1WDN A;  3FAT A;  2I3W A;  3H6W A;  1B2H A;  1FCK A;  1PB9 A;  3BFT A;  1Y3N A;  3C36 A;  3K02 A;  4YB6 A;  4BDM A;  4HW8 A;  2AL4 A;  4QRZ A;  3KGC A;  5EHS A;  5FTI A;  1MY3 A;  3LC8 A;  1LAH E;  4KFQ A;  1USY E;  2CMO A;  3C35 A;  4H67 A;  2O69 A;  2DSF A;  3F11 A;  2XD3 A;  2GRV A;  1UTB B;  3FJG A;  1A8F A;  1YAE A;  5FHM A;  4IY5 A;  1P1O A;  4FED A;  2H5Y A;  2W7Y A;  1LGB C;  1NL5 A;  4XTC Q;  1B05 A;  4OEN A;  2A5S A;  1A40 A;  4OER A;  2F78 A;  4KQP A;  5CMM A;  3RT6 B;  3Q25 A;  2Q2A A;  3S2V A;  1EH3 A;  4F39 A;  2HZL A;  2Q89 A;  4X48 A;  1A55 A;  1JVX A;  1B9J A;  1LBB A;  3IX1 A;  3FJM A;  3M3F A;  3I3V A;  4HCW A;  4XKP A;  5DTB A;  5I2K A;  3SKP A;  5BUU A;  2ALU A;  4Z0I A;  1PEB A;  1GV8 A;  3SEW A;  1VE4 A;  3LBS A;  2VOZ A;  4G68 C;  4MBP A;  1B4H A;  3ZKL A;  4JXI A;  3JV9 A;  1TXF A;  1UIU A;  1FTM A;  1MY2 A;  5FTH A;  3RTF B;  2I6E A;  2QJE A;  3KG2 A;  4ZEF A;  1MPC A;  1YTV A;  2V3U A;  4THI A;  4ZE8 A;  3TZA A;  2F34 A;  3UA8 A;  3IO6 A;  3N26 A;  1URS A;  1OLC A;  3G3H A;  4QFN A;  1JNF A;  1FQB A;  3EF7 A;  4DE8 A;  5CRY A;  1R9Q A;  2VGQ A;  4EQ7 A;  3DP4 A;  2RC9 A;  4HS7 A;  4POW A;  3VVF A;  1B52 A;  5TP9 B;  1I6B A;  2PBW A;  3KBR A;  4JBZ A;  3EHS A;  2PX1 A;  2Y7I A;  4KCD A;  4PQJ A;  1P1W A;  3U1O A;  1JW4 A;  5AA2 B;  1ZTY A;  4EQ9 A;  1JW5 A;  2OK2 A;  1BLF A;  1B7H A;  1WOD A;  1B5J A;  2A5T B;  5EHM A;  5TPA B;  2NUV A;  4Q30 B;  4RA1 A;  4C1T A;  1J1N A;  1Y1Z A;  4IB2 A;  3R7X A;  3DEL B;  1B1X A;  1FTO A;  3VLV A;  5KCJ B;  1LB8 A;  5KZT A;  1SBP A;  2H25 A;  3MUQ A;  4G4P A;  1SDX A;  1MQD A;  4G8H A;  1D3K A;  4IY6 A;  4KCC A;  2ONS A;  4YKP A;  2XXV A;  4F31 B;  1FTJ A;  1GR2 A;  1DPP A;  3C9H A;  3G3G A;  3IOW A;  1HSJ A;  3OEM A;  3CFZ A;  4LON B;  1DSN A;  3EN3 A;  4M1V A;  3TKD A;  4F1V A;  1NNP A;  4YKK A;  3SEU A;  1AIV A;  4OES A;  4HTG A;  2FNC A;  4TOZ A;  1MS7 A;  5H8H B;  1B3L A;  2THI A;  1EZ9 A;  3QIM A;  3B6Q A;  3PPR A;  3KEI A;  1H76 A;  1VSO A;  3O28 A;  3OD7 A;  3FZV A;  1O64 A;  1URG A;  2P1S A;  4DLD A;  3V5A A;  1B1H A;  3N94 A;  5H8F A;  3H6U A;  1M5B A;  1B5I A;  3KN3 A;  2XX7 A;  4G8M A;  3VLU A;  4C1U A;  2QS1 A;  1Y4C A;  4H6D A;  5ITO A;  3TMG A;  3TTK A;  3GXA A;  1NNK A;  3K2D A;  4NF8 B;  4OXV A;  3ILT B;  3ZKK A;  3USD A;  1AMF A;  4DDD A;  3TCH A;  2QMW A;  4F1Y A;  5KDT B;  4Q5T A;  2DWA A;  3KZG A;  4WEP A;  4LVQ A;  4FOR A;  4E0X A;  5L9O A;  2F7A A;  4FEC A;  1LFH A;  1YCJ A;  4EXL A;  4RK2 A;  3G3K A;  2B3F A;  1R9L A;  3K00 A;  3MJN A;  1XC1 A;  2P2A A;  1MXW A;  2VHA A;  3OEL A;  4KYD A;  5I58 A;  1T0K A;  4BDL A;  3MVX A;  1PB8 A;  5I56 B;  1FQF A;  1XOC A;  3TTM A;  4OFJ A;  2O1M A;  2QL3 A;  4ELQ A;  4OEV A;  3B6W A;  4G68 A;  4NMY A;  4O3A A;  3OMB A;  3KJT A;  3MP8 A;  4FAJ A;  1BKA A;  3GLB A;  1UTB A;  1UTH B;  2DE2 A;  1F9B A;  2OWT A;  1N0T A;  1MXY A;  3PD8 A;  3PUX E;  1XHY A;  5DYH A;  3RNN A;  5JTY B;  3K1N A;  2UVI A;  1US5 A;  4LZ5 A;  5TP9 A;  3C32 A;  4RYA A;  3G7W A;  1QKB A;  2IEE A;  3EQ1 A;  3OO9 A;  2YPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...