4Z7EA

Soluble binding domain of lmo1422 abc-transporter
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
270
structure length
270
Chain Sequence
b'EITIAGKLGAEPEILINMYKLVIEDETDLKVNVKPNMGKTSFVFNALKSGDIDIYPEFTGTVLETFLKENAKTHDPEEVYTQARDGLAKDFDMTYLKPMKYNNTYALAVSPEFAKENNLEKISDLGPVSDQVKAGFTLEFKDRSDGYKGIQDKYGLTFSNLKTMEPKLRYNAIKSGDINLLDAYSTDSELAQYKLKVLEDDQQLFPPYQGAPLMLTKTLDKYPELKKPLNKLAGKITDDEMRKMNYEVNVNGKSAYTVAKDYLKDQGIIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1422 protein
publication title Crystal Structure of the Substrate-Binding Domain from Listeria monocytogenes Bile-Resistance Determinant BilE
doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Transport protein
total genus 98
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4z7eA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4z7eA02
1PC3A 4ZEKA 4F18A 1Y9UA 2V25A 4XKPA 4X1BA 4XIGQ 3U72A 3KJTA 1LGBC 3KZGA 1M5CA 3PUYE 3HV1A 4M4GA 2ZXTA 2DVCA 4R73A 4ZZAA 4OENA 3KBRA 1N84A 3OO7A 2HXWA 3H3GA 3W15C 3C32A 1I6AA 2QS2A 4XKRA 3OOAA 1YAEA 5B7DA 4IO7A 5CMKA 3OMBA 4OWDA 3N26A 2H99A 1SVXB 1IEJA 1A55A 1BP5A 4NF6A 3MBPA 4C0RA 3I6VA 3ZSFA 2VP1A 3FUZA 2GHAA 2ZNSA 3L6GA 4POWA 2HAUA 2V84A 2Q2CA 4RK2A 3UGWA 4DXCA 3V83A 5L9MA 3LSFB 1TWYA 2F8DA 3M3LA 5DVIA 1AMFA 1POY1 3B6QA 2I49A 3CIJA 4TLLB 4IO5A 3G3GA 4H8JA 3FGSA 1NH7A 1UQWA 3AXFA 2OCUA 5I2KA 3RQTA 3V5AA 4F19A 1LBCA 4GQOA 4EUOA 3HPIA 4FORA 1JW5A 4UACA 3G7WA 2Z22A 4OXVA 4EQ9A 4U4SA 2ONKE 2D3IA 1DOTA 1VFEA 2DP8A 4F22A 1TT1A 3TDJA 2P0SA 3E9XA 3TKDA 4ELRA 4K3FA 4EF2A 2FNCA 1JW1A 1UTHB 3T66A 3TTNA 5KDTA 4I9DA 3LBSA 1B1HA 3FATA 3FVGA 1EZOA 3UP9A 2O7IA 2PBWA 1B3LA 1L5TA 4JWXA 1QULA 3DP6A 5DYHA 2O1LA 4Z0IA 4GVOA 2NVUB 1RKMA 3RTWB 2E0SA 3QAXA 4O3BA 3LSXA 3RNNA 4EQ7A 3VVDA 1UIVA 5DT6A 3PV0E 4WKMA 4I62A 3USDA 1OLAA 2UVJA 1IUDA 3WAEA 2DWHA 1P1QA 5KZTA 2DXRA 2FA7A 5IAIA 4L17A 5KCJB 1ZKBA 1M5DA 4PFTA 4YB5A 2UYFA 3IOWA 3IJXB 3TTKA 1LFIA 1LBBA 3K6VA 3Q26A 4X9TA 4G8HA 4U1ZA 3OO6A 5CMBA 4ZEDA 4R6YA 1FTOA 4EXLA 2OJTA 1FTLA 3KGCA 2I3WA 3N6TA 4RJZA 4OESA 2IA4A 1S7YA 4IO6A 3K02A 2RF1A 3C36A 3SDFA 4OFOA 1II5A 2ZNUA 5CBRA 1JVYA 4FEBA 1XVXA 1ZMGA 4FJPA 3S9MC 1LB9A 4MLQA 1XOCA 3EHUA 3HHGA 1JNFA 3GZGA 3G3KA 3KSXA 1SYIA 4F2OA 4U22A 2HZLA 2G93A 3UORA 2GH9A 4NMYA 3IB1A 3VLWA 1B4HA 1Y3NA 4QSCA 3IJOB 3MUQA 2GRVA 2D5WA 3EPEA 4ELOA 1EZPA 3ONMA 4NF8B 2Z8EA 5B70A 1SW1A 1R9LA 4OERA 4IO2A 4XTCQ 1B3FA 1N0TA 1A54A 4AQ4A 1OIBA 3ILTB 3H6VA 3T9XB 4ELPA 3PPNA 5AA2B 1YTVA 3VE1B 4EQBA 2YPNA 5TP9B 3KG2A 1MY2A 5DTBA 3U93A 3DP8A 3M8UA 3FASA 3THIA 1MQHA 4KYSA 2DQVA 3TYHA 1SW2A 3IORA 3SEUA 5TPAA 3K1PA 1OQHA 4KI0E 3UIFA 4R75A 5TU0A 3CFXA 3W9WA 2QPQA 1RYXA 1NKXA 3SEWA 2PT2A 1P1NA 1AOVA 3TMGA 1P1OA 3CSBA 5HPQA 3TCFA 1MQDA 3DP4A 3MP6A 4F1UA 2F5XA 1FTKA 3O9PA 3V89B 5JTYA 4LP2B 1J1NA 3CG3A 4BDLA 3OENA 2H9BA 4KFQA 2XD3A 1NNKA 4G68C 3VDFA 2Y7RA 3T22A 2H4IA 4JWOA 4LONB 3K0VA 3K2DA 4G2ZA 4H6DA 2H25A 3LSLA 4PP0A 2Q89A 1FQDA 5CRYA 4UA8A 2UXAA 1N7WA 5H8FB 1XS5A 4E0WA 3TCHA 4RPOA 4P11A 4BDRA 3BFTA 3O97A 2XXHA 2Y7KA 4QRZA 4H5GA 2F34A 4U21A 1QKAA 1HSEA 1US4A 1MXZA 2Y7WA 3VFJA 4R74A 3I3VA 3IO6A 2A5TB 4ECFA 4N6PA 1B7HA 1UTBB 4NF5B 2XXIA 5ITPA 1QW0A 3G3FA 2F78A 3U94A 1R1NA 1POTA 3KFMA 2YLNA 4JBZA 1LLSA 3VLUA 3LUYA 5I84A 4F3SA 1QKBA 4R6HA 3PMWA 3MVWA 4BDNA 2R9JA 5I59B 1SD3A 3OSQA 4H8IA 3DM0A 1A99A 3O2AA 5ICQA 3O6IA 3C35A 5I57A 1PBPA 5F1QA 4RY1A 5H8HA 1B6HA 1QUJA 3MPLA 3CI8A 4JWYA 3D4GA 1MXVA 3PPRA 1WDNA 1N7XA 4XKQA 4BDQA 2B65A 3KSJA 3UA8A 4YB7A 1FTMA 4X48A 3QXMA 2QMXA 4U23A 3CFZA 3CR9A 1MY0A 3ZKLA 1FQCA 2RKMA 3OELA 4FE8A 5FHMA 3VV5A 2Y7PA 3K1NA 3H03A 2WKYA 1FQFA 2PT1A 3A3UA 2DVZA 3MVYA 1MQGA 3FV1A 2RC7A 3IX1A 4KYDA 3Q28A 4IY5A 3SEXA 3MAMA 2GFEA 1B3GA 1NMUA 2NXOA 4GL8A 3ZS6A 2F97A 1PBQA 1B58A 4QFLA 4TQUQ 1MM7A 4N13A 4KCCA 1Y4CA 2XD2A 2B3FA 4MFIA 2QL3A 3KOSA 2V3UA 4LQ5A 1GGGA 2GHBA 4RXLA 1USYE 2ZNTA 3R7XA 2O69A 3RTFB 4FIMA 3GBBA 3FXUA 2KLFA 1I6BA 3N5LA 2ALUA 1OVBA 2Y7IA 4F2QA 5KCJA 1H45A 1QUIA 1XT8A 2AL4A 4POXA 3TUSA 4NF4B 2D21A 1Y4TA 3JYRA 3KN8A 3FD3A 4F3GA 3H7MA 5CI5A 1GR2A 1IXHA 2PX1A 3RT8A 1PEBA 4H67A 4F3BA 1IXGA 3PUXE 2DWAA 1FQBA 3VVFA 5AA4B 3C9HA 4QSDA 5I58B 3SETA 2QS1A 4C1TA 3C4MA 3CSGA 5L9SA 4YMBA 1HSJA 4G4PA 4OYVA 3FVOA 4PFYA 4ZEFA 1PB8A 5AA1A 5H8NB 4OEVA 1SBPA 3FXQA 1MPBA 3W9VA 5JEIA 3U8QA 5F7VA 3U92A 1F9BA 1OMPA 3EHTA 3E4RA 4IY6A 1DTZA 1B0LA 5A5XB 1EH3A 4HS7A 3OXNA 4G68B 5BUUA 4WXJA 1MRPA 2F6PA 1CB6A 2ONRA 4YAHX 2UVGA 3MZ1A 3RLFE 5ITOA 1JW4A 1US5A 3TTMA 1RYOA 3IL1B 5J1DA 4KPTA 1B0HA 4R9GA 4KR5A 2O7UA 4KHZE 1PB9A 1D9VA 5CC2A 4NF8A 2AL5A 3HCQA 3BFUA 1ZLQA 2Z8FA 2OBGA 1Y20A 3UK4A 1FQAA 3U1OA 1HSLA 4F1VA 3QIMA 3VLVA 2HZKA 5EHSA 1Q35A 4LQ2A 3SEVA 2XXXA 5TP9A 3MP8A 3PUZE 3FJGA 4TOZA 3IB2A 3ZKKA 5I2KB 3RT6B 4IO3A 1MS7A 5I2NB 2P1SA 2FYIA 4O3CA 3PD9A 2W7YA 1DPPA 4R2BA 1IXIA 4E0XA 2NOOA 1LCTA 4I1DA 2HQ0A 1MM6A 4JB7A 3FVNA 4U1OA 3FVKA 3FIRA 4JDFA 3QUFA 3TQWA 4LZ8A 2CZLA 1NNTA 1BLFA 4DDDA 5CMMA 2V3TA 5EYFA 4X1DA 4KCDA 3V8XB 4MLVA 4ZECA 3MZ9A 1LAFE 3SERA 4DIGA 2HEUA 3OSRA 3LSWA 4PFUA 5FHOA 3IB0A 3CRBA 4YMAA 4FAJA 1H43A 3BKIB 2AYSA 2I0CA 4JSOA 3TEPA 3H6TA 1JEUA 5H8FA 4LZ7A 3VXCA 5K2YA 1WVJA 2F6GA 4OFLA 1VSOA 1AL3A 1PB7A 4G77A 2DSFA 3TODA 2R71A 3PGFA 4YKJA 1S50A 3MJNA 3UN6A 3H06B 1MQIA 1I69A 1ZBMA 2A5TA 1O63A 1LFHA 2RINA 1BTJA 1UTBA 4H1XA 5FTHA 4NF5A 3T93B 1MPDA 1URDA 4ESWA 4GXSB 2I6EA 1SYHA 5BWJA 3Q27A 4OFJA 4GD5A 4WEPA 1B4ZA 4BDMA 3DLNA 4G8NA 3T9HB 4P0IA 3RPWA 1LAXA 3T9UA 1A7LA 1MXYA 5HM4B 3S9EA 1LCFA 2Q8JA 4ZDMA 2ONSA 3BBRA 2DS9A 1WODA 1N3XA 3OO8A 4G8MA 3DELB 2R6GE 3PUVE 1B51A 2QJEA 2ZYOA 2ZMBA 1M5EA 4XXUA 4LZ5A 1MXXA 1BKAA 3MP1A 4OZ9A 3PUWE 1MDP1 1SQYA 4FEDA 2XXRA 1JEVA 1OVTA 3MQ9A 4NTLA 1D4NA 4OHNA 3ILUB 2HAVA 1EZ9A 2V93A 4GLIA 4RK9A 2QRYA 3G3JA 4Q0CA 3HHFA 2XXPA 3WAFA 4PE5B 1N04A 3EQ1A 5TPAB 4HCYA 1TFAA 2VHAA 2H5YA 1SW5A 2RCAA 5FTIA 1IQ7A 3PU5A 4GOTA 3R6UA 4XKNA 3H6UA 3IO4A 3HN0A 3GBAA 2HCAA 3L6HA 3TELA 3GLBA 1GV8A 2I48A 1B46A 2DE2A 4JXIA 1SI0A 4EF1A 1UIUA 2I0BA 4IO4A 2REJA 2DOJA 5LOMA 1N3WA 3O6GA 3P7IA 1P1UA 1H44A 3KN7A 4FATA 3Q25A 4F39A 4IGRA 2XXQA 1CE2A 4GWOA 5JTYB 1XC1A 1DMBA 5DEXB 3KOTA 3FZVA 1GTKA 2RC8A 4PETA 4ZEIA 1FCKA 1NH8A 5AA4A 3SESA 2XHDA 4GXAA 3ODBA 5K2XA 2UVHA 1QJMA 4ND9A 5DVFA 3S9LC 5H8NA 4WEDA 3CFLA 2XXYA 2I4BA 3N6UA 1R6ZA 1Y3QA 1UTHA 2M8CA 4YB6A 2P2AA 2ZYNA 5A5XA 3KEIA 1Z7NE 1MY1A 2ZYMA 4G68A 1TXFA 3S2VA 3Q29A 3PPQA 1TFDA 1FTJA 3PPPA 2I58A 3T96B 1YPNA 4ZE8A 1P1WA 3E13X 5AA2D 2ANJA 3MZBA 4R6KA 2Z23A 2VGQA 4KYEA 3EHSA 3MVZA 1JVXA 1EU8A 1OQGA 1Q1KA 1B3HA 4YKKA 3VXBA 4H65A 1H3DA 3K01A 5AE4A 3VVEA 3B6WA 3MC2A 4BLAA 1D3KA 4ZE9A 1URGA 5I57B 4LATA 1B5HA 4OTEA 5H8HB 3FJ7A 2O6AA 5I56B 4DXBA 1ZTYA 1MXUA 1B1XA 3O66A 2F7BA 1NNPA 2AIXA 2XX8A 1MXWA 1ANFA 2XXUA 1Y1ZA 1IXCA 2QS4A 1B40A 1NL5A 3KN3A 5H8QB 5I2NA 3HSTA 3HO7A 4QFNA 3A3CA 4MBPA 4NWDA 2QS3A 1B7UA 1H76A 2I4CA 4H5FA 2O84X 1VFDA 3S4UA 1URSA 1USYH 1O7TA 1B05A 3IOUA 3C34A 4OVJA 2Q2AA 4PFWA 2F36A 4HTGA 4RPNA 1O64A 3TAJA 5L9OA 1ZJLA 2CMOA 2YJPA 4PQJA 5H8SA 3TPAA 1MH4A 3IOVA 3PMXA 2E1SA 1R9QA 4NF6B 3RN8A 1VR5A 2O51A 4DCXA 4H0WA 4GFRA 1P99A 4EDPA 1JQFA 5AA2A 5AA3A 4GIZA 1N76A 3K6WA 5JK4A 3PMVA 3R26A 2HFBA 1T0KA 4OETA 3JV9A 4LA9A 4N07A 4OEUA 5IKBA 1QVSA 4OQOA 3B6TA 3MPKA 2OLBA 4GL0A 1ZIUA 2V3QA 3O29A 4QSEA 3C31A 2B3BA 2I3VA 3EN3A 4QFPA 2PYYA 3QSLA 4DCYA 1IZ1A 1I6QA 4U4XA 4DLDA 3LC8A 4Q30B 2Z8DA 4QF9A 1IIWA 2VD2A 2DXYA 5KDTB 3SEYA 1A8FA 2NUVA 1OLCA 4R72A 4OMBA 5CBSA 4EXKA 3RUMA 4KQPA 2XXWA 3C33A 1AIVA 2DYXA 4Z7EA 3CVGA 4F1YA 5CM6A 1SI1A 2QSXA 4AB5A 1VE4A 4YKPA 3M3KA 1LSTA 3H4ZA 4HW8A 4HCWA 3OEMA 4TLMB 4R9FA 2F35A 4GF8A 3IR1A 2XXTA 4F31B 3ECRA 4NEDA 4BDOA 1B52A 4F3PA 4IB2A 1LB8A 1MDQA 1Z7ME 3TTLA 3B7DA 4YU0A 1BIYA 3A09A 4Q5TA 2XX9A 3D4CA 2DE3A 2RC9A 3RGYA 3KJ7A 5HBCA 3O28A 4JSDA 3CG1A 2ZYKA 3RY3A 3OO9A 4YKIA 3TQLA 2ABHA 2NWJA 4Q8RA 1A40A 1M5FA 3SKPA 1B5IA 4DZ1A 4RNSA 4KD5A 1MY3A 1FQEA 4FECA 1S9TA 3IAZA 1ELJA 4YZZA 1M5BA 3IOTA 1MY4A 3IK6B 4NE4A 2O68A 4LVQA 2X7PA 1B7ZA 4NWCA 1DPEA 4DE8A 2Q88A 2QMWA 4ZEBA 5I59A 5CMCA 1GVCA 4AB6A 2BJJX 1KWHA 2ESNA 3LR1A 1LFGA 2OZZA 5M2VA 3MW0A 4MH5A 5ELVA 4O3AA 1B5JA 4MF3A 2DWIA 2F7AA 4LUBA 1YCJA 1LAHE 2H98A 4RA1A 5DEXA 1FW0A 3QK6A 2XXVA 4P0GA 4QHQA 3N94A 5L8DA 4C1UA 1XHYA 1Y1MA 1JETA 1ZU0A 4GRKA 2DWJA 1B32A 4U2RA 1NNFA 3K6XA 3O6HA 1QUKA 2IEEA 3EF7A 2VD3A 3OEKA 4QFKA 2O1MA 2PMSA 4IGTA 3QUJA 2UYEA 1A8EA 2Q9TA 3OD7A 1MQJA 5EHMA 3G3HA 1D9YA 1AH5A 5ISUA 1B3EA 4ESXA 3PPOA 3K4UA 4ZZEA 2OK2A 1XVYA 3E3KA 2LAOA 1NFTA 3TTRA 2REGA 2X26A 4ONYA 2PVUA 4THIA 3T9VA 1B2HA 2RCBA 3K00A 5FHNA 1MG1A 2OWTA 4R2FA 3F11A 1B9JA 1MH3A 1PDAA 2THIA 3TZAA 4ISUA 5ICTA 1SW4A 3H6WA 3MVXA 2VOZA 3MWBA 3S9NC 1DTGA 2UVIA 3K1MA 5DVJA 2A5SA 3JZJA 4NF4A 4QFOA 3FXRA 3FJMA 1MPCA 3TFLA 4M1VA 4RYAA 3I5OA 3QYTA 4F29A 4I8CA 1DSNA 3TCGA 1IITA 4DXUA 5I56A 4ZS9A 5I58A 2OWSA 3FV2A 2G29A 1ATGA 2Y84A 2XX7A 3M3FA 4ELQA 1Y3PA 2DE4A 2F7CA 1LAGE 1SDXA 3K6UA 5H8QA 2X7QA 3GXAA 3G3IA 4YICA 3PD8A
chains in the Genus database with same CATH superfamily
1PC3A 4ZEKA 4F18A 4I40A 1Y9UA 3B8BA 2V25A 3U65A 4XKPA 4X1BA 4XIGQ 3U72A 3KJTA 4NHBA 1LGBC 3KZGA 1M5CA 3PUYE 3HV1A 1KZ8A 4M4GA 2ZXTA 2DVCA 4R73A 4ZZAA 4OENA 3KBRA 3LV0A 5T3JA 1N84A 3OO7A 2HXWA 3H3GA 3W15C 3HFUA 3C32A 1I6AA 2QS2A 4XKRA 3OOAA 1YAEA 4P1EA 4IO7A 5B7DA 5CMKA 3OMBA 4OWDA 3N26A 2H99A 1SVXB 1IEJA 4XEQA 1A55A 1BP5A 1YZ0A 4NF6A 3MBPA 1SPIA 4C0RA 4GWXA 3I6VA 3ZSFA 2VP1A 3FUZA 2GHAA 5A5LA 2ZNSA 3L6GA 4POWA 2HAUA 2V84A 1VDWA 2Q2CA 4RK2A 3UGWA 4GBVA 4DXCA 3V83A 5L9MA 3LSFB 1TWYA 1K9YA 2F8DA 3M3LA 5DVIA 1AMFA 1FRPA 1POY1 3B6QA 2I49A 3CIJA 4TLLB 3LUZA 4IO5A 3G3GA 1LBZA 4H8JA 3FGSA 1NH7A 1UQWA 3AXFA 2OCUA 5I2KA 3RQTA 5EQAA 1FBPA 4FBPA 3V5AA 4F19A 1LBCA 4GQOA 4EUOA 4OVSA 3HPIA 4FORA 1JW5A 1QGXA 4UACA 3G7WA 2Z22A 4OXVA 4EQ9A 4U4SA 2ONKE 2D3IA 1DOTA 1VFEA 2QFLA 2DP8A 4F22A 1TT1A 3TDJA 2P0SA 3E9XA 3TKDA 4ELRA 4K3FA 4EF2A 2FNCA 4GWSA 4P1LA 1JW1A 1UTHB 3T66A 3TTNA 5KDTA 4I9DA 3LBSA 1B1HA 3FATA 3FVGA 1EZOA 3UP9A 2O7IA 2PBWA 2WYPA 1B3LA 1L5TA 4JWXA 1QULA 3DP6A 5DYHA 2O1LA 4Z0IA 4GVOA 2BJIA 1FPGA 2NVUB 1RKMA 3RTWB 2E0SA 4H46A 3QAXA 1NUXA 2CZIA 4O3BA 3LSXA 3RNNA 4EQ7A 3GYYA 3VVDA 1UIVA 1D9QA 5DT6A 3PV0E 4WKMA 4I62A 2XXKA 1RDXA 3USDA 1OLAA 5FBPA 2UVJA 1IUDA 3WAEA 2DWHA 1P1QA 5KZTA 1IMDA 2DXRA 2FA7A 2QVVA 5IAIA 4L17A 5KCJB 4HE2A 1ZKBA 1M5DA 1NV4A 4PFTA 4N6DA 4YB5A 2UYFA 3IOWA 3IJXB 4OVPA 3KBZA 3TTKA 1LFIA 2ZZWA 1LBBA 3K6VA 3Q26A 4X9TA 4G8HA 4U1ZA 3OO6A 1K9ZA 3ISPA 5CMBA 4ZEDA 4JVIA 4R6YA 1FTOA 4P9KA 4EXLA 2OJTA 1FTLA 3KGCA 2I3WA 3N6TA 1G0HA 4RJZA 4OESA 2IA4A 1S7YA 4IO6A 3K02A 2RF1A 3C36A 1NV0A 3SDFA 4OFOA 1II5A 2ZNUA 5CBRA 1JVYA 4FEBA 1XVXA 1ZMGA 4FJPA 3S9MC 1LB9A 4MLQA 1XOCA 3EHUA 3HHGA 1JNFA 3GZGA 3G3KA 3KSXA 1SYIA 4F2OA 4U22A 2HZLA 2G93A 3UORA 2GH9A 4NMYA 3IB1A 1NV3A 3VLWA 1B4HA 1Y3NA 4QSCA 1FPKA 3IJOB 4PBHA 4PFBA 4MCOA 4KXPA 3MUQA 2GRVA 2D5WA 1DCUA 3EPEA 4ELOA 1EZPA 3ONMA 4NF8B 2ZZXA 2Z8EA 5B70A 1SW1A 1R9LA 2FVZA 4OERA 4IO2A 4XTCQ 1B3FA 2Y5KA 1N0TA 1A54A 4AQ4A 1OIBA 3ILTB 3H6VA 3T9XB 4ELPA 3PPNA 5AA2B 1YTVA 3VE1B 4EQBA 2YPNA 4NN3A 5TP9B 3KG2A 1MY2A 5DTBA 3U93A 3DP8A 3M8UA 3FASA 2FIXA 3THIA 1MQHA 4KYSA 2DQVA 3TYHA 1SW2A 3IORA 3SEUA 5TPAA 3K1PA 1OQHA 4KI0E 3UIFA 2HXRA 4R75A 5TU0A 3CFXA 3W9WA 3BIGA 5ET5A 1RDZA 2QPQA 1RYXA 1NKXA 3EKIA 3SEWA 2PT2A 1IMCA 5IM2A 1P1NA 1AOVA 3TMGA 1P1OA 5ET6A 5IZ3A 3CSBA 4GWYA 5HPQA 3TCFA 4PE3A 1MQDA 3DP4A 1FTAA 3MP6A 4F1UA 1FPFA 2F5XA 4O7IA 5EQ8A 1FTKA 3O9PA 3V89B 5JTYA 4LP2B 1J1NA 3CG3A 4BDLA 3OENA 1RDYA 2H9BA 4KFQA 2XD3A 1NNKA 4G68C 3VDFA 2Y7RA 3T22A 2H4IA 4JWOA 4LONB 3K0VA 3K2DA 4G2ZA 4H6DA 2H25A 5EQ9A 3LSLA 4NF0A 4PP0A 2QVUA 2Q89A 1FQDA 5CRYA 4UA8A 2UXAA 1N7WA 5H8FB 1XS5A 4E0WA 3RPLB 4PAIA 3TCHA 4RPOA 4P11A 4BDRA 3BFTA 3O97A 2XXHA 2Y7KA 4QRZA 4H5GA 2F34A 4U21A 4OVTA 4X04A 1QKAA 1IMEA 1HSEA 1US4A 1MXZA 2Y7WA 3VFJA 4R74A 3I3VA 3IO6A 2A5TB 4ECFA 4N6PA 1B7HA 1UTBB 4NF5B 2XXIA 5ITPA 1QW0A 3G3FA 2F78A 1BK4A 3U94A 4NQ8A 1R1NA 1POTA 3KFMA 2FBPA 2YLNA 4JBZA 1LLSA 3VLUA 4AS5A 3LUYA 2PFYA 5I84A 4F3SA 1QKBA 4R6HA 3PMWA 3MVWA 4BDNA 2R9JA 4OVRA 5I59B 4HE1A 1SD3A 3OSQA 4H8IA 3DM0A 1A99A 3O2AA 5ICQA 3O6IA 3C35A 3FBPA 5I57A 1PBPA 5F1QA 4RY1A 4OVQA 5H8HA 1B6HA 1QUJA 3MPLA 3CI8A 4JWYA 3B50A 3D4GA 1MXVA 2XWIA 3PPRA 1WDNA 1N7XA 4XKQA 5ET7A 4BDQA 2B65A 3KSJA 3UA8A 4YB7A 1FTMA 4X48A 3QXMA 2QMXA 4U23A 3CFZA 3CR9A 1MY0A 3ZKLA 1FQCA 2RKMA 3OELA 1NV7A 4FE8A 5FHMA 4PGPA 3VV5A 2Y7PA 3K1NA 5IZ1A 3H03A 2WKYA 1FQFA 2PT1A 3A3UA 2DVZA 3MVYA 4MMPA 1MQGA 3FV1A 2RC7A 3IX1A 4KYDA 3Q28A 4IY5A 3SEXA 3MAMA 2GFEA 1B3GA 1NMUA 2NXOA 4GL8A 3ZS6A 2XWVA 2F97A 1PBQA 1B58A 4QFLA 3T0JA 4TQUQ 1MM7A 4N13A 1KA0A 4KCCA 1Y4CA 4MX6A 4N6KA 2XD2A 1FPLA 4N8GA 2B3FA 4MFIA 4NAPA 2QL3A 4MHFA 3KOSA 2V3UA 4LQ5A 3MSTA 2QVRA 2Q8MA 1GGGA 2GHBA 4RXLA 2WX9A 1USYE 2ZNTA 3R7XA 2O69A 3RTFB 3ROJA 4FIMA 3GBBA 3T1BA 3FXUA 2KLFA 1I6BA 3N5LA 2ALUA 1OVBA 2Y7IA 4F2QA 5KCJA 1H45A 2XA5A 1QUIA 1XT8A 2AL4A 4POXA 3TUSA 4NF4B 1EYJA 2D21A 4X8RA 1Y4TA 3JYRA 3KN8A 3FD3A 4F3GA 3H7MA 5CI5A 1FBCA 1GR2A 2PFZA 1IXHA 2PX1A 3RT8A 1PEBA 4H67A 4OANA 4F3BA 4I3YA 1IXGA 3PUXE 2DWAA 1FQBA 3VVFA 5AA4B 4XFEA 3C9HA 4QSDA 5I58B 3SETA 4NG7A 2QS1A 4C1TA 3C4MA 3CSGA 5L9SA 4YMBA 1HSJA 4G4PA 4OYVA 3FVOA 4PFYA 4ZEFA 1PB8A 5AA1A 5H8NB 4OEVA 1SBPA 1FPEA 3FXQA 1MPBA 3W9VA 5JEIA 3U8QA 1FBHA 5F7VA 3U92A 1F9BA 1OMPA 3EHTA 3E4RA 4IY6A 1DTZA 1B0LA 5A5XB 1EH3A 4HS7A 3OXNA 4G68B 5BUUA 4WXJA 4AS4A 1MRPA 2F6PA 1CB6A 2ONRA 4YAHX 2UVGA 4GX6A 3MZ1A 3RLFE 5ITOA 1JW4A 1US5A 3TTMA 1RYOA 3IL1B 5J1DA 4KPTA 1B0HA 4R9GA 4KR5A 2O7UA 4KHZE 1PB9A 4G61A 1D9VA 5CC2A 4NF8A 2AL5A 3HCQA 3BFUA 1ZLQA 2Z8FA 2OBGA 1Y20A 3UK4A 3MYUA 1FQAA 3U1OA 1JP4A 1HSLA 4F1VA 4GBWA 3QIMA 3VLVA 2HZKA 5EHSA 1Q35A 4LQ2A 3SEVA 2CZKA 1IMBA 2XXXA 3FXBA 5TP9A 2VPOA 1XI6A 3MP8A 3PUZE 3FJGA 4TOZA 3QMFA 3IB2A 3ZKKA 1DK4A 5I2KB 3RT6B 4IO3A 1MS7A 1NUWA 5I2NB 2P1SA 2FYIA 4O3CA 3PD9A 2W7YA 1DPPA 4R2BA 1IXIA 4E0XA 2NOOA 1LCTA 4O7MA 2WBBA 4NX1A 4I1DA 2HQ0A 2R8TA 4QXDA 1MM6A 4JB7A 3FVNA 4U1OA 3FVKA 3FIRA 4PAKA 4JDFA 4N4UA 3QUFA 1YXIA 3TQWA 4LZ8A 4MNIA 2CZLA 1NNTA 1BLFA 4DDDA 5CMMA 2V3TA 3CHGA 5EYFA 4X1DA 4KCDA 3V8XB 4MLVA 2B4LA 4ZECA 3MZ9A 1LAFE 1IMFA 3SERA 4DIGA 2HEUA 3OSRA 3LSWA 4PFUA 5FHOA 3IB0A 3CRBA 4YMAA 4FAJA 2WEFA 1H43A 4O8MA 3BKIB 2AYSA 2I0CA 4JSOA 3TEPA 3H6TA 1JEUA 5H8FA 4LZ7A 3VXCA 5K2YA 1WVJA 2F6GA 4OFLA 1VSOA 1AL3A 1PB7A 4G77A 4MEVA 2DSFA 3TODA 2R71A 3PGFA 4YKJA 2FIEA 1S50A 3MJNA 3UN6A 3H06B 1MQIA 2ZZVA 1CNQA 1I69A 1ZBMA 2A5TA 1O63A 1FSAA 1LFHA 2RINA 1BTJA 1UTBA 4H1XA 5FTHA 4NF5A 1LBWA 3T93B 1MPDA 1URDA 5EYGA 4ESWA 4GXSB 2I6EA 1SYHA 5BWJA 3Q27A 4OFJA 4GD5A 4WEPA 4PAFA 4MJOA 1B4ZA 4BDMA 3DLNA 4G8NA 3T9HB 4P0IA 3RPWA 1LAXA 1NV1A 3T9UA 1A7LA 1MXYA 5HM4B 3S9EA 1LCFA 4OA4A 2Q8JA 4ZDMA 2ONSA 3BBRA 2DS9A 1WODA 1N3XA 3OO8A 4G8MA 3DELB 2R6GE 3PUVE 1B51A 2QJEA 2ZYOA 2ZMBA 1Q9DA 1EYKA 5IGAA 1M5EA 3RYDA 2OX3A 4XXUA 4LZ5A 1MXXA 4LN5A 1FPJA 1BKAA 3MP1A 4OZ9A 3PUWE 1MDP1 5ET8A 1SQYA 4FEDA 2XXRA 1JEVA 1OVTA 4GWWA 3MQ9A 5EYHA 1LEVA 4NTLA 1D4NA 2L5VA 4OHNA 3ILUB 2HAVA 1EZ9A 2V93A 4GLIA 4RK9A 2QRYA 3G3JA 4Q0CA 3HHFA 2XXPA 3WAFA 4PE5B 1N04A 1FPDA 3EQ1A 5TPAB 4HCYA 1TFAA 4HXVA 2VHAA 2H5YA 1SW5A 5LTCA 2RCAA 5FTIA 1IQ7A 3PU5A 4GOTA 3R6UA 1FPIA 4XKNA 3SZPA 3H6UA 3IO4A 3HN0A 3GBAA 2HCAA 3L6HA 3TELA 3GLBA 1GV8A 2I48A 4IR8A 1B46A 2DE2A 4JXIA 1SI0A 1FBDA 4P3LA 4EF1A 1UIUA 2I0BA 4IO4A 2REJA 2DOJA 4GX3A 5LOMA 1N3WA 4PTKA 3O6GA 3P7IA 1P1UA 1H44A 4JVCA 3KN7A 4FATA 3Q25A 4F39A 4IGRA 2B4MA 2XXQA 1CE2A 4GWOA 5JTYB 1XC1A 1DMBA 3KOTA 5DEXB 3FZVA 1KA1A 2GQ1A 1GTKA 2RC8A 3BIHA 4PETA 4ZEIA 1FCKA 1NH8A 5AA4A 3SESA 2XHDA 2Y5LA 2KQZA 5J16A 4GXAA 3ODBA 5K2XA 4N91A 2UVHA 1QJMA 1INPA 4ND9A 2KR0A 5DVFA 3S9LC 5H8NA 4WEDA 2WYKA 3CFLA 2XXYA 2I4BA 3N6UA 1R6ZA 1Y3QA 2FHYA 1UTHA 3IFAA 1FBGA 2M8CA 4UABA 4YB6A 2P2AA 2ZYNA 5A5XA 3KEIA 1Z7NE 4GWZA 2P3NA 1MY1A 2ZYMA 4G68A 4XF5A 2CZHA 1TXFA 3S2VA 3Q29A 3PPQA 1TFDA 1FTJA 3PPPA 2I58A 3T96B 1YPNA 4ZE8A 1P1WA 3E13X 5AA2D 2ANJA 3MZBA 1FBFA 4R6KA 2Z23A 2VGQA 4KYEA 3EHSA 3MVZA 1JVXA 1EU8A 4N8YA 1OQGA 1Q1KA 4PDDA 1B3HA 4YKKA 5DW8A 3VXBA 1NI9A 4H65A 1H3DA 3K01A 5AE4A 3VVEA 3B6WA 3IFCA 1LBXA 3MC2A 4BLAA 1D3KA 4MAGA 4ZE9A 1URGA 3NOHA 5I57B 4GWUA 4LATA 1B5HA 4I3EA 4MNPA 4OTEA 5H8HB 3E78A 2CEYA 3FJ7A 2O6AA 5I56B 4DXBA 1ZTYA 1MXUA 1B1XA 3O66A 2F7BA 1NNPA 2AIXA 4PFIA 2XX8A 1MXWA 1ANFA 2XXUA 1Y1ZA 1IXCA 2QS4A 1B40A 1NL5A 4JVDA 3KN3A 5H8QB 5I2NA 3HSTA 3HO7A 4QFNA 3A3CA 4MBPA 4NWDA 2QS3A 1FBEA 4PBQA 1B7UA 1H76A 2I4CA 4H5FA 2O84X 1VFDA 3S4UA 1URSA 1USYH 2WBDA 1O7TA 1B05A 3IOUA 3C34A 4OVJA 2Q2AA 2HPGA 4PFWA 2F36A 4HTGA 4RPNA 1NV2A 1O64A 3TAJA 5L9OA 1ZJLA 4MIJA 2CMOA 2YJPA 1DBZA 2PCRA 4PQJA 3KC0A 5H8SA 3TPAA 1MH4A 3IOVA 3PMXA 2E1SA 1R9QA 4NF6B 3RN8A 1VR5A 5I7IA 2O51A 4DCXA 4H0WA 4PF8A 4GFRA 1P99A 4EDPA 1JQFA 1NUZA 5AA2A 5AA3A 4GIZA 1N76A 3K6WA 5JK4A 3PMVA 2JJKA 3R26A 2HFBA 1T0KA 4OETA 3JV9A 4LA9A 4PC9A 4N07A 4QBAA 4OEUA 5IKBA 1QVSA 4OQOA 2XWOA 3B6TA 3MPKA 2OLBA 4GL0A 1ZIUA 2V3QA 3O29A 4QSEA 3C31A 2B3BA 4DI4B 2I3VA 1EYIA 1LBYA 3EN3A 4QFPA 2PYYA 3QSLA 4DCYA 1IZ1A 2OWZA 1I6QA 4U4XA 4DLDA 3LC8A 4Q30B 2Z8DA 4QF9A 1IIWA 2VD2A 2DXYA 5KDTB 3SEYA 1A8FA 2NUVA 1OLCA 4R72A 4OMBA 5CBSA 4EXKA 3RUMA 4KQPA 2XXWA 3C33A 1NV6A 1AIVA 2DYXA 4Z7EA 3CVGA 4F1YA 5CM6A 1SI1A 2QSXA 4AB5A 1VE4A 4YKPA 1G0IA 3M3KA 1LSTA 4PDHA 3H4ZA 4HW8A 4HCWA 3OEMA 2V4CA 1FJ6A 4TLMB 4R9FA 2F35A 4GF8A 3IR1A 2XXTA 4F31B 3D1RA 3ECRA 4NEDA 4BDOA 2F3BA 2VT5A 1B52A 4F3PA 4IB2A 1LB8A 2VPNA 1MDQA 1Z7ME 3TTLA 5IZZA 3B7DA 4YU0A 1BIYA 3A09A 4GX4A 4Q5TA 3RPLA 2XX9A 1LBVA 3D4CA 2DE3A 2RC9A 3RGYA 3KJ7A 5HBCA 3O28A 4JSDA 3CG1A 2ZYKA 3RY3A 3OO9A 4YKIA 4N17A 3TQLA 2ABHA 2NWJA 4Q8RA 1A40A 1M5FA 3SKPA 1B5IA 1NV5A 4DZ1A 4RNSA 4KD5A 4HE0A 1MY3A 2Q74A 1FQEA 4FECA 1S9TA 3IAZA 1ELJA 4YZZA 1M5BA 3IOTA 1MY4A 3IK6B 4NE4A 2O68A 4LVQA 2X7PA 4P47A 1B7ZA 4NWCA 1DPEA 4MNCA 4DE8A 2Q88A 4H45A 2QMWA 4ZEBA 5I59A 5CMCA 1GVCA 4AB6A 2BJJX 1KWHA 2ESNA 3LR1A 1LFGA 2OZZA 5M2VA 3MW0A 4MH5A 4PCDA 5ELVA 4O3AA 1B5JA 4MF3A 5I3SA 2DWIA 2F7AA 4LUBA 5EQ7A 5F24A 1FJ9A 1YCJA 2MKZA 1LAHE 2H98A 3E79A 4RA1A 5DEXA 4N15A 1FW0A 3QK6A 2XXVA 2CEXA 4P0GA 4QHQA 3N94A 3PTYA 5L8DA 4C1UA 2XWKA 1XHYA 1IMAA 1Y1MA 1JETA 4P56A 1ZU0A 4GRKA 2DWJA 5I5PA 1B32A 4U2RA 1NNFA 3K6XA 3O6HA 1QUKA 2IEEA 3EF7A 2VD3A 3OEKA 1NUYA 4QFKA 2O1MA 4N81A 2PMSA 4IGTA 3QUJA 2UYEA 2DDKA 1A8EA 2Q9TA 3OD7A 1MQJA 4PF6A 5EHMA 3G3HA 1D9YA 2F3DA 5LDZA 1AH5A 5ISUA 1B3EA 5ESYA 4ESXA 4PFRA 3PPOA 3K4UA 4ZZEA 2OK2A 1XVYA 3E3KA 4O94A 2LAOA 4P8BA 1NFTA 3TTRA 2REGA 2X26A 4ONYA 2PVUA 4THIA 4NGUA 3T9VA 1B2HA 2RCBA 3K00A 5FHNA 1MG1A 4DI3D 1YYZA 2OWTA 3A29A 4PGNA 4R2FA 3F11A 1B9JA 1MH3A 1PDAA 2THIA 3TZAA 1FPBA 5IZ3B 4ISUA 5ICTA 1SW4A 3H6WA 3MVXA 2VOZA 3MWBA 2P3VA 3S9NC 1DTGA 2UVIA 3K1MA 5DVJA 2A5SA 3JZJA 4NF4A 4QFOA 3FXRA 3FJMA 1MPCA 3TFLA 4M1VA 4RYAA 3I5OA 2HHMA 3QYTA 4F29A 4I8CA 1DSNA 3TCGA 1IITA 4DXUA 5I56A 4ZS9A 3KC1A 5I58A 2OWSA 3FV2A 2G29A 1ATGA 2Y84A 2XX7A 3M3FA 4ELQA 1Y3PA 2DE4A 2F7CA 1LAGE 1SDXA 3K6UA 1AWBA 5H8QA 2X7QA 3GXAA 3G3IA 4YICA 3PD8A
chains in the Genus database with same CATH topology
1PC3A 4ZEKA 4F18A 1Y9UA 2V25A 4XKPA 4X1BA 4XIGQ 3U72A 3KJTA 1LGBC 3KZGA 1M5CA 3PUYE 3HV1A 4M4GA 2ZXTA 2DVCA 4R73A 4ZZAA 4OENA 3KBRA 1N84A 3OO7A 2HXWA 3H3GA 3W15C 3C32A 1I6AA 2QS2A 4XKRA 3OOAA 1YAEA 5B7DA 4IO7A 5CMKA 3OMBA 4OWDA 3N26A 2H99A 1SVXB 1IEJA 1A55A 1BP5A 4NF6A 3MBPA 4C0RA 3I6VA 3ZSFA 2VP1A 3FUZA 2GHAA 2ZNSA 3L6GA 4POWA 2HAUA 2V84A 2Q2CA 4RK2A 3UGWA 4DXCA 3V83A 5L9MA 3LSFB 1TWYA 2F8DA 3M3LA 5DVIA 1AMFA 1POY1 3B6QA 2I49A 3CIJA 4TLLB 4IO5A 3G3GA 4H8JA 3FGSA 1NH7A 1UQWA 3AXFA 2OCUA 5I2KA 3RQTA 3V5AA 4F19A 1LBCA 4GQOA 4EUOA 3HPIA 4FORA 1JW5A 4UACA 3G7WA 2Z22A 4OXVA 4EQ9A 4U4SA 2ONKE 2D3IA 1DOTA 1VFEA 2DP8A 4F22A 1TT1A 3TDJA 2P0SA 3E9XA 3TKDA 4ELRA 4K3FA 4EF2A 2FNCA 1JW1A 1UTHB 3T66A 3TTNA 5KDTA 4I9DA 3LBSA 1B1HA 3FATA 3FVGA 1EZOA 3UP9A 2O7IA 2PBWA 1B3LA 1L5TA 4JWXA 1QULA 3DP6A 5DYHA 2O1LA 4Z0IA 4GVOA 2NVUB 1RKMA 3RTWB 2E0SA 3QAXA 4O3BA 3LSXA 3RNNA 4EQ7A 3VVDA 1UIVA 5DT6A 3PV0E 4WKMA 4I62A 3USDA 1OLAA 2UVJA 1IUDA 3WAEA 2DWHA 1P1QA 5KZTA 2DXRA 2FA7A 5IAIA 4L17A 5KCJB 1ZKBA 1M5DA 4PFTA 4YB5A 2UYFA 3IOWA 3IJXB 3TTKA 1LFIA 1LBBA 3K6VA 3Q26A 4X9TA 4G8HA 4U1ZA 3OO6A 5CMBA 4ZEDA 4R6YA 1FTOA 4EXLA 2OJTA 1FTLA 3KGCA 2I3WA 3N6TA 4RJZA 4OESA 2IA4A 1S7YA 4IO6A 3K02A 2RF1A 3C36A 3SDFA 4OFOA 1II5A 2ZNUA 5CBRA 1JVYA 4FEBA 1XVXA 1ZMGA 4FJPA 3S9MC 1LB9A 4MLQA 1XOCA 3EHUA 3HHGA 1JNFA 3GZGA 3G3KA 3KSXA 1SYIA 4F2OA 4U22A 2HZLA 2G93A 3UORA 2GH9A 4NMYA 3IB1A 3VLWA 1B4HA 1Y3NA 4QSCA 3IJOB 3MUQA 2GRVA 2D5WA 3EPEA 4ELOA 1EZPA 3ONMA 4NF8B 2Z8EA 5B70A 1SW1A 1R9LA 4OERA 4IO2A 4XTCQ 1B3FA 1N0TA 1A54A 4AQ4A 1OIBA 3ILTB 3H6VA 3T9XB 4ELPA 3PPNA 5AA2B 1YTVA 3VE1B 4EQBA 2YPNA 5TP9B 3KG2A 1MY2A 5DTBA 3U93A 3DP8A 3M8UA 3FASA 3THIA 1MQHA 4KYSA 2DQVA 3TYHA 1SW2A 3IORA 3SEUA 5TPAA 3K1PA 1OQHA 4KI0E 3UIFA 4R75A 5TU0A 3CFXA 3W9WA 2QPQA 1RYXA 1NKXA 3SEWA 2PT2A 1P1NA 1AOVA 3TMGA 1P1OA 3CSBA 5HPQA 3TCFA 1MQDA 3DP4A 3MP6A 4F1UA 2F5XA 1FTKA 3O9PA 3V89B 5JTYA 4LP2B 1J1NA 3CG3A 4BDLA 3OENA 2H9BA 4KFQA 2XD3A 1NNKA 4G68C 3VDFA 2Y7RA 3T22A 2H4IA 4JWOA 4LONB 3K0VA 3K2DA 4G2ZA 4H6DA 2H25A 3LSLA 4PP0A 2Q89A 1FQDA 5CRYA 4UA8A 2UXAA 1N7WA 5H8FB 1XS5A 4E0WA 3TCHA 4RPOA 4P11A 4BDRA 3BFTA 3O97A 2XXHA 2Y7KA 4QRZA 4H5GA 2F34A 4U21A 1QKAA 1HSEA 1US4A 1MXZA 2Y7WA 3VFJA 4R74A 3I3VA 3IO6A 2A5TB 4ECFA 4N6PA 1B7HA 1UTBB 4NF5B 2XXIA 5ITPA 1QW0A 3G3FA 2F78A 3U94A 1R1NA 1POTA 3KFMA 2YLNA 4JBZA 1LLSA 3VLUA 3LUYA 5I84A 4F3SA 1QKBA 4R6HA 3PMWA 3MVWA 4BDNA 2R9JA 5I59B 1SD3A 3OSQA 4H8IA 3DM0A 1A99A 3O2AA 5ICQA 3O6IA 3C35A 5I57A 1PBPA 5F1QA 4RY1A 5H8HA 1B6HA 1QUJA 3MPLA 3CI8A 4JWYA 3D4GA 1MXVA 3PPRA 1WDNA 1N7XA 4XKQA 4BDQA 2B65A 3KSJA 3UA8A 4YB7A 1FTMA 4X48A 3QXMA 2QMXA 4U23A 3CFZA 3CR9A 1MY0A 3ZKLA 1FQCA 2RKMA 3OELA 4FE8A 5FHMA 3VV5A 2Y7PA 3K1NA 3H03A 2WKYA 1FQFA 2PT1A 3A3UA 2DVZA 3MVYA 1MQGA 3FV1A 2RC7A 3IX1A 4KYDA 3Q28A 4IY5A 3SEXA 3MAMA 2GFEA 1B3GA 1NMUA 2NXOA 4GL8A 3ZS6A 2F97A 1PBQA 1B58A 4QFLA 4TQUQ 1MM7A 4N13A 4KCCA 1Y4CA 2XD2A 2B3FA 4MFIA 2QL3A 3KOSA 2V3UA 4LQ5A 1GGGA 2GHBA 4RXLA 1USYE 2ZNTA 3R7XA 2O69A 3RTFB 4FIMA 3GBBA 3FXUA 2KLFA 1I6BA 3N5LA 2ALUA 1OVBA 2Y7IA 4F2QA 5KCJA 1H45A 1QUIA 1XT8A 2AL4A 4POXA 3TUSA 4NF4B 2D21A 1Y4TA 3JYRA 3KN8A 3FD3A 4F3GA 3H7MA 5CI5A 1GR2A 1IXHA 2PX1A 3RT8A 1PEBA 4H67A 4F3BA 1IXGA 3PUXE 2DWAA 1FQBA 3VVFA 5AA4B 3C9HA 4QSDA 5I58B 3SETA 2QS1A 4C1TA 3C4MA 3CSGA 5L9SA 4YMBA 1HSJA 4G4PA 4OYVA 3FVOA 4PFYA 4ZEFA 1PB8A 5AA1A 5H8NB 4OEVA 1SBPA 3FXQA 1MPBA 3W9VA 5JEIA 3U8QA 5F7VA 3U92A 1F9BA 1OMPA 3EHTA 3E4RA 4IY6A 1DTZA 1B0LA 5A5XB 1EH3A 4HS7A 3OXNA 4G68B 5BUUA 4WXJA 1MRPA 2F6PA 1CB6A 2ONRA 4YAHX 2UVGA 3MZ1A 3RLFE 5ITOA 1JW4A 1US5A 3TTMA 1RYOA 3IL1B 5J1DA 4KPTA 1B0HA 4R9GA 4KR5A 2O7UA 4KHZE 1PB9A 1D9VA 5CC2A 4NF8A 2AL5A 3HCQA 3BFUA 1ZLQA 2Z8FA 2OBGA 1Y20A 3UK4A 1FQAA 3U1OA 1HSLA 4F1VA 3QIMA 3VLVA 2HZKA 5EHSA 1Q35A 4LQ2A 3SEVA 2XXXA 5TP9A 3MP8A 3PUZE 3FJGA 4TOZA 3IB2A 3ZKKA 5I2KB 3RT6B 4IO3A 1MS7A 5I2NB 2P1SA 2FYIA 4O3CA 3PD9A 2W7YA 1DPPA 4R2BA 1IXIA 4E0XA 2NOOA 1LCTA 4I1DA 2HQ0A 1MM6A 4JB7A 3FVNA 4U1OA 3FVKA 3FIRA 4JDFA 3QUFA 3TQWA 4LZ8A 2CZLA 1NNTA 1BLFA 4DDDA 5CMMA 2V3TA 5EYFA 4X1DA 4KCDA 3V8XB 4MLVA 4ZECA 3MZ9A 1LAFE 3SERA 4DIGA 2HEUA 3OSRA 3LSWA 4PFUA 5FHOA 3IB0A 3CRBA 4YMAA 4FAJA 1H43A 3BKIB 2AYSA 2I0CA 4JSOA 3TEPA 3H6TA 1JEUA 5H8FA 4LZ7A 3VXCA 5K2YA 1WVJA 2F6GA 4OFLA 1VSOA 1AL3A 1PB7A 4G77A 2DSFA 3TODA 2R71A 3PGFA 4YKJA 1S50A 3MJNA 3UN6A 3H06B 1MQIA 1I69A 1ZBMA 2A5TA 1O63A 1LFHA 2RINA 1BTJA 1UTBA 4H1XA 5FTHA 4NF5A 3T93B 1MPDA 1URDA 4ESWA 4GXSB 2I6EA 1SYHA 5BWJA 3Q27A 4OFJA 4GD5A 4WEPA 1B4ZA 4BDMA 3DLNA 4G8NA 3T9HB 4P0IA 3RPWA 1LAXA 3T9UA 1A7LA 1MXYA 5HM4B 3S9EA 1LCFA 2Q8JA 4ZDMA 2ONSA 3BBRA 2DS9A 1WODA 1N3XA 3OO8A 4G8MA 3DELB 2R6GE 3PUVE 1B51A 2QJEA 2ZYOA 2ZMBA 1M5EA 4XXUA 4LZ5A 1MXXA 1BKAA 3MP1A 4OZ9A 3PUWE 1MDP1 1SQYA 4FEDA 2XXRA 1JEVA 1OVTA 3MQ9A 4NTLA 1D4NA 4OHNA 3ILUB 2HAVA 1EZ9A 2V93A 4GLIA 4RK9A 2QRYA 3G3JA 4Q0CA 3HHFA 2XXPA 3WAFA 4PE5B 1N04A 3EQ1A 5TPAB 4HCYA 1TFAA 2VHAA 2H5YA 1SW5A 2RCAA 5FTIA 1IQ7A 3PU5A 4GOTA 3R6UA 4XKNA 3H6UA 3IO4A 3HN0A 3GBAA 2HCAA 3L6HA 3TELA 3GLBA 1GV8A 2I48A 1B46A 2DE2A 4JXIA 1SI0A 4EF1A 1UIUA 2I0BA 4IO4A 2REJA 2DOJA 5LOMA 1N3WA 3O6GA 3P7IA 1P1UA 1H44A 3KN7A 4FATA 3Q25A 4F39A 4IGRA 2XXQA 1CE2A 4GWOA 5JTYB 1XC1A 1DMBA 5DEXB 3KOTA 3FZVA 1GTKA 2RC8A 4PETA 4ZEIA 1FCKA 1NH8A 5AA4A 3SESA 2XHDA 4GXAA 3ODBA 5K2XA 2UVHA 1QJMA 4ND9A 5DVFA 3S9LC 5H8NA 4WEDA 3CFLA 2XXYA 2I4BA 3N6UA 1R6ZA 1Y3QA 1UTHA 2M8CA 4YB6A 2P2AA 2ZYNA 5A5XA 3KEIA 1Z7NE 1MY1A 2ZYMA 4G68A 1TXFA 3S2VA 3Q29A 3PPQA 1TFDA 1FTJA 3PPPA 2I58A 3T96B 1YPNA 4ZE8A 1P1WA 3E13X 5AA2D 2ANJA 3MZBA 4R6KA 2Z23A 2VGQA 4KYEA 3EHSA 3MVZA 1JVXA 1EU8A 1OQGA 1Q1KA 1B3HA 4YKKA 3VXBA 4H65A 1H3DA 3K01A 5AE4A 3VVEA 3B6WA 3MC2A 4BLAA 1D3KA 4ZE9A 1URGA 5I57B 4LATA 1B5HA 4OTEA 5H8HB 3FJ7A 2O6AA 5I56B 4DXBA 1ZTYA 1MXUA 1B1XA 3O66A 2F7BA 1NNPA 2AIXA 2XX8A 1MXWA 1ANFA 2XXUA 1Y1ZA 1IXCA 2QS4A 1B40A 1NL5A 3KN3A 5H8QB 5I2NA 3HSTA 3HO7A 4QFNA 3A3CA 4MBPA 4NWDA 2QS3A 1B7UA 1H76A 2I4CA 4H5FA 2O84X 1VFDA 3S4UA 1URSA 1USYH 1O7TA 1B05A 3IOUA 3C34A 4OVJA 2Q2AA 4PFWA 2F36A 4HTGA 4RPNA 1O64A 3TAJA 5L9OA 1ZJLA 2CMOA 2YJPA 4PQJA 5H8SA 3TPAA 1MH4A 3IOVA 3PMXA 2E1SA 1R9QA 4NF6B 3RN8A 1VR5A 2O51A 4DCXA 4H0WA 4GFRA 1P99A 4EDPA 1JQFA 5AA2A 5AA3A 4GIZA 1N76A 3K6WA 5JK4A 3PMVA 3R26A 2HFBA 1T0KA 4OETA 3JV9A 4LA9A 4N07A 4OEUA 5IKBA 1QVSA 4OQOA 3B6TA 3MPKA 2OLBA 4GL0A 1ZIUA 2V3QA 3O29A 4QSEA 3C31A 2B3BA 2I3VA 3EN3A 4QFPA 2PYYA 3QSLA 4DCYA 1IZ1A 1I6QA 4U4XA 4DLDA 3LC8A 4Q30B 2Z8DA 4QF9A 1IIWA 2VD2A 2DXYA 5KDTB 3SEYA 1A8FA 2NUVA 1OLCA 4R72A 4OMBA 5CBSA 4EXKA 3RUMA 4KQPA 2XXWA 3C33A 1AIVA 2DYXA 4Z7EA 3CVGA 4F1YA 5CM6A 1SI1A 2QSXA 4AB5A 1VE4A 4YKPA 3M3KA 1LSTA 3H4ZA 4HW8A 4HCWA 3OEMA 4TLMB 4R9FA 2F35A 4GF8A 3IR1A 2XXTA 4F31B 3ECRA 4NEDA 4BDOA 1B52A 4F3PA 4IB2A 1LB8A 1MDQA 1Z7ME 3TTLA 3B7DA 4YU0A 1BIYA 3A09A 4Q5TA 2XX9A 3D4CA 2DE3A 2RC9A 3RGYA 3KJ7A 5HBCA 3O28A 4JSDA 3CG1A 2ZYKA 3RY3A 3OO9A 4YKIA 3TQLA 2ABHA 2NWJA 4Q8RA 1A40A 1M5FA 3SKPA 1B5IA 4DZ1A 4RNSA 4KD5A 1MY3A 1FQEA 4FECA 1S9TA 3IAZA 1ELJA 4YZZA 1M5BA 3IOTA 1MY4A 3IK6B 4NE4A 2O68A 4LVQA 2X7PA 1B7ZA 4NWCA 1DPEA 4DE8A 2Q88A 2QMWA 4ZEBA 5I59A 5CMCA 1GVCA 4AB6A 2BJJX 1KWHA 2ESNA 3LR1A 1LFGA 2OZZA 5M2VA 3MW0A 4MH5A 5ELVA 4O3AA 1B5JA 4MF3A 2DWIA 2F7AA 4LUBA 1YCJA 1LAHE 2H98A 4RA1A 5DEXA 1FW0A 3QK6A 2XXVA 4P0GA 4QHQA 3N94A 5L8DA 4C1UA 1XHYA 1Y1MA 1JETA 1ZU0A 4GRKA 2DWJA 1B32A 4U2RA 1NNFA 3K6XA 3O6HA 1QUKA 2IEEA 3EF7A 2VD3A 3OEKA 4QFKA 2O1MA 2PMSA 4IGTA 3QUJA 2UYEA 1A8EA 2Q9TA 3OD7A 1MQJA 5EHMA 3G3HA 1D9YA 1AH5A 5ISUA 1B3EA 4ESXA 3PPOA 3K4UA 4ZZEA 2OK2A 1XVYA 3E3KA 2LAOA 1NFTA 3TTRA 2REGA 2X26A 4ONYA 2PVUA 4THIA 3T9VA 1B2HA 2RCBA 3K00A 5FHNA 1MG1A 2OWTA 4R2FA 3F11A 1B9JA 1MH3A 1PDAA 2THIA 3TZAA 4ISUA 5ICTA 1SW4A 3H6WA 3MVXA 2VOZA 3MWBA 3S9NC 1DTGA 2UVIA 3K1MA 5DVJA 2A5SA 3JZJA 4NF4A 4QFOA 3FXRA 3FJMA 1MPCA 3TFLA 4M1VA 4RYAA 3I5OA 3QYTA 4F29A 4I8CA 1DSNA 3TCGA 1IITA 4DXUA 5I56A 4ZS9A 5I58A 2OWSA 3FV2A 2G29A 1ATGA 2Y84A 2XX7A 3M3FA 4ELQA 1Y3PA 2DE4A 2F7CA 1LAGE 1SDXA 3K6UA 5H8QA 2X7QA 3GXAA 3G3IA 4YICA 3PD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PC3 A;  4ZEK A;  4F18 A;  1Y9U A;  2V25 A;  4XKP A;  4X1B A;  4XIG Q;  3U72 A;  3KJT A;  1LGB C;  3KZG A;  1M5C A;  3PUY E;  3HV1 A;  4M4G A;  2ZXT A;  2DVC A;  4R73 A;  4ZZA A;  4OEN A;  3KBR A;  1N84 A;  3OO7 A;  2HXW A;  3H3G A;  3W15 C;  3C32 A;  1I6A A;  2QS2 A;  4XKR A;  3OOA A;  1YAE A;  5B7D A;  4IO7 A;  5CMK A;  3OMB A;  4OWD A;  3N26 A;  2H99 A;  1SVX B;  1IEJ A;  1A55 A;  1BP5 A;  4NF6 A;  3MBP A;  4C0R A;  3I6V A;  3ZSF A;  2VP1 A;  3FUZ A;  2GHA A;  2ZNS A;  3L6G A;  4POW A;  2HAU A;  2V84 A;  2Q2C A;  4RK2 A;  3UGW A;  4DXC A;  3V83 A;  5L9M A;  3LSF B;  1TWY A;  2F8D A;  3M3L A;  5DVI A;  1AMF A;  1POY 1;  3B6Q A;  2I49 A;  3CIJ A;  4TLL B;  4IO5 A;  3G3G A;  4H8J A;  3FGS A;  1NH7 A;  1UQW A;  3AXF A;  2OCU A;  5I2K A;  3RQT A;  3V5A A;  4F19 A;  1LBC A;  4GQO A;  4EUO A;  3HPI A;  4FOR A;  1JW5 A;  4UAC A;  3G7W A;  2Z22 A;  4OXV A;  4EQ9 A;  4U4S A;  2ONK E;  2D3I A;  1DOT A;  1VFE A;  2DP8 A;  4F22 A;  1TT1 A;  3TDJ A;  2P0S A;  3E9X A;  3TKD A;  4ELR A;  4K3F A;  4EF2 A;  2FNC A;  1JW1 A;  1UTH B;  3T66 A;  3TTN A;  5KDT A;  4I9D A;  3LBS A;  1B1H A;  3FAT A;  3FVG A;  1EZO A;  3UP9 A;  2O7I A;  2PBW A;  1B3L A;  1L5T A;  4JWX A;  1QUL A;  3DP6 A;  5DYH A;  2O1L A;  4Z0I A;  4GVO A;  2NVU B;  1RKM A;  3RTW B;  2E0S A;  3QAX A;  4O3B A;  3LSX A;  3RNN A;  4EQ7 A;  3VVD A;  1UIV A;  5DT6 A;  3PV0 E;  4WKM A;  4I62 A;  3USD A;  1OLA A;  2UVJ A;  1IUD A;  3WAE A;  2DWH A;  1P1Q A;  5KZT A;  2DXR A;  2FA7 A;  5IAI A;  4L17 A;  5KCJ B;  1ZKB A;  1M5D A;  4PFT A;  4YB5 A;  2UYF A;  3IOW A;  3IJX B;  3TTK A;  1LFI A;  1LBB A;  3K6V A;  3Q26 A;  4X9T A;  4G8H A;  4U1Z A;  3OO6 A;  5CMB A;  4ZED A;  4R6Y A;  1FTO A;  4EXL A;  2OJT A;  1FTL A;  3KGC A;  2I3W A;  3N6T A;  4RJZ A;  4OES A;  2IA4 A;  1S7Y A;  4IO6 A;  3K02 A;  2RF1 A;  3C36 A;  3SDF A;  4OFO A;  1II5 A;  2ZNU A;  5CBR A;  1JVY A;  4FEB A;  1XVX A;  1ZMG A;  4FJP A;  3S9M C;  1LB9 A;  4MLQ A;  1XOC A;  3EHU A;  3HHG A;  1JNF A;  3GZG A;  3G3K A;  3KSX A;  1SYI A;  4F2O A;  4U22 A;  2HZL A;  2G93 A;  3UOR A;  2GH9 A;  4NMY A;  3IB1 A;  3VLW A;  1B4H A;  1Y3N A;  4QSC A;  3IJO B;  3MUQ A;  2GRV A;  2D5W A;  3EPE A;  4ELO A;  1EZP A;  3ONM A;  4NF8 B;  2Z8E A;  5B70 A;  1SW1 A;  1R9L A;  4OER A;  4IO2 A;  4XTC Q;  1B3F A;  1N0T A;  1A54 A;  4AQ4 A;  1OIB A;  3ILT B;  3H6V A;  3T9X B;  4ELP A;  3PPN A;  5AA2 B;  1YTV A;  3VE1 B;  4EQB A;  2YPN A;  5TP9 B;  3KG2 A;  1MY2 A;  5DTB A;  3U93 A;  3DP8 A;  3M8U A;  3FAS A;  3THI A;  1MQH A;  4KYS A;  2DQV A;  3TYH A;  1SW2 A;  3IOR A;  3SEU A;  5TPA A;  3K1P A;  1OQH A;  4KI0 E;  3UIF A;  4R75 A;  5TU0 A;  3CFX A;  3W9W A;  2QPQ A;  1RYX A;  1NKX A;  3SEW A;  2PT2 A;  1P1N A;  1AOV A;  3TMG A;  1P1O A;  3CSB A;  5HPQ A;  3TCF A;  1MQD A;  3DP4 A;  3MP6 A;  4F1U A;  2F5X A;  1FTK A;  3O9P A;  3V89 B;  5JTY A;  4LP2 B;  1J1N A;  3CG3 A;  4BDL A;  3OEN A;  2H9B A;  4KFQ A;  2XD3 A;  1NNK A;  4G68 C;  3VDF A;  2Y7R A;  3T22 A;  2H4I A;  4JWO A;  4LON B;  3K0V A;  3K2D A;  4G2Z A;  4H6D A;  2H25 A;  3LSL A;  4PP0 A;  2Q89 A;  1FQD A;  5CRY A;  4UA8 A;  2UXA A;  1N7W A;  5H8F B;  1XS5 A;  4E0W A;  3TCH A;  4RPO A;  4P11 A;  4BDR A;  3BFT A;  3O97 A;  2XXH A;  2Y7K A;  4QRZ A;  4H5G A;  2F34 A;  4U21 A;  1QKA A;  1HSE A;  1US4 A;  1MXZ A;  2Y7W A;  3VFJ A;  4R74 A;  3I3V A;  3IO6 A;  2A5T B;  4ECF A;  4N6P A;  1B7H A;  1UTB B;  4NF5 B;  2XXI A;  5ITP A;  1QW0 A;  3G3F A;  2F78 A;  3U94 A;  1R1N A;  1POT A;  3KFM A;  2YLN A;  4JBZ A;  1LLS A;  3VLU A;  3LUY A;  5I84 A;  4F3S A;  1QKB A;  4R6H A;  3PMW A;  3MVW A;  4BDN A;  2R9J A;  5I59 B;  1SD3 A;  3OSQ A;  4H8I A;  3DM0 A;  1A99 A;  3O2A A;  5ICQ A;  3O6I A;  3C35 A;  5I57 A;  1PBP A;  5F1Q A;  4RY1 A;  5H8H A;  1B6H A;  1QUJ A;  3MPL A;  3CI8 A;  4JWY A;  3D4G A;  1MXV A;  3PPR A;  1WDN A;  1N7X A;  4XKQ A;  4BDQ A;  2B65 A;  3KSJ A;  3UA8 A;  4YB7 A;  1FTM A;  4X48 A;  3QXM A;  2QMX A;  4U23 A;  3CFZ A;  3CR9 A;  1MY0 A;  3ZKL A;  1FQC A;  2RKM A;  3OEL A;  4FE8 A;  5FHM A;  3VV5 A;  2Y7P A;  3K1N A;  3H03 A;  2WKY A;  1FQF A;  2PT1 A;  3A3U A;  2DVZ A;  3MVY A;  1MQG A;  3FV1 A;  2RC7 A;  3IX1 A;  4KYD A;  3Q28 A;  4IY5 A;  3SEX A;  3MAM A;  2GFE A;  1B3G A;  1NMU A;  2NXO A;  4GL8 A;  3ZS6 A;  2F97 A;  1PBQ A;  1B58 A;  4QFL A;  4TQU Q;  1MM7 A;  4N13 A;  4KCC A;  1Y4C A;  2XD2 A;  2B3F A;  4MFI A;  2QL3 A;  3KOS A;  2V3U A;  4LQ5 A;  1GGG A;  2GHB A;  4RXL A;  1USY E;  2ZNT A;  3R7X A;  2O69 A;  3RTF B;  4FIM A;  3GBB A;  3FXU A;  2KLF A;  1I6B A;  3N5L A;  2ALU A;  1OVB A;  2Y7I A;  4F2Q A;  5KCJ A;  1H45 A;  1QUI A;  1XT8 A;  2AL4 A;  4POX A;  3TUS A;  4NF4 B;  2D21 A;  1Y4T A;  3JYR A;  3KN8 A;  3FD3 A;  4F3G A;  3H7M A;  5CI5 A;  1GR2 A;  1IXH A;  2PX1 A;  3RT8 A;  1PEB A;  4H67 A;  4F3B A;  1IXG A;  3PUX E;  2DWA A;  1FQB A;  3VVF A;  5AA4 B;  3C9H A;  4QSD A;  5I58 B;  3SET A;  2QS1 A;  4C1T A;  3C4M A;  3CSG A;  5L9S A;  4YMB A;  1HSJ A;  4G4P A;  4OYV A;  3FVO A;  4PFY A;  4ZEF A;  1PB8 A;  5AA1 A;  5H8N B;  4OEV A;  1SBP A;  3FXQ A;  1MPB A;  3W9V A;  5JEI A;  3U8Q A;  5F7V A;  3U92 A;  1F9B A;  1OMP A;  3EHT A;  3E4R A;  4IY6 A;  1DTZ A;  1B0L A;  5A5X B;  1EH3 A;  4HS7 A;  3OXN A;  4G68 B;  5BUU A;  4WXJ A;  1MRP A;  2F6P A;  1CB6 A;  2ONR A;  4YAH X;  2UVG A;  3MZ1 A;  3RLF E;  5ITO A;  1JW4 A;  1US5 A;  3TTM A;  1RYO A;  3IL1 B;  5J1D A;  4KPT A;  1B0H A;  4R9G A;  4KR5 A;  2O7U A;  4KHZ E;  1PB9 A;  1D9V A;  5CC2 A;  4NF8 A;  2AL5 A;  3HCQ A;  3BFU A;  1ZLQ A;  2Z8F A;  2OBG A;  1Y20 A;  3UK4 A;  1FQA A;  3U1O A;  1HSL A;  4F1V A;  3QIM A;  3VLV A;  2HZK A;  5EHS A;  1Q35 A;  4LQ2 A;  3SEV A;  2XXX A;  5TP9 A;  3MP8 A;  3PUZ E;  3FJG A;  4TOZ A;  3IB2 A;  3ZKK A;  5I2K B;  3RT6 B;  4IO3 A;  1MS7 A;  5I2N B;  2P1S A;  2FYI A;  4O3C A;  3PD9 A;  2W7Y A;  1DPP A;  4R2B A;  1IXI A;  4E0X A;  2NOO A;  1LCT A;  4I1D A;  2HQ0 A;  1MM6 A;  4JB7 A;  3FVN A;  4U1O A;  3FVK A;  3FIR A;  4JDF A;  3QUF A;  3TQW A;  4LZ8 A;  2CZL A;  1NNT A;  1BLF A;  4DDD A;  5CMM A;  2V3T A;  5EYF A;  4X1D A;  4KCD A;  3V8X B;  4MLV A;  4ZEC A;  3MZ9 A;  1LAF E;  3SER A;  4DIG A;  2HEU A;  3OSR A;  3LSW A;  4PFU A;  5FHO A;  3IB0 A;  3CRB A;  4YMA A;  4FAJ A;  1H43 A;  3BKI B;  2AYS A;  2I0C A;  4JSO A;  3TEP A;  3H6T A;  1JEU A;  5H8F A;  4LZ7 A;  3VXC A;  5K2Y A;  1WVJ A;  2F6G A;  4OFL A;  1VSO A;  1AL3 A;  1PB7 A;  4G77 A;  2DSF A;  3TOD A;  2R71 A;  3PGF A;  4YKJ A;  1S50 A;  3MJN A;  3UN6 A;  3H06 B;  1MQI A;  1I69 A;  1ZBM A;  2A5T A;  1O63 A;  1LFH A;  2RIN A;  1BTJ A;  1UTB A;  4H1X A;  5FTH A;  4NF5 A;  3T93 B;  1MPD A;  1URD A;  4ESW A;  4GXS B;  2I6E A;  1SYH A;  5BWJ A;  3Q27 A;  4OFJ A;  4GD5 A;  4WEP A;  1B4Z A;  4BDM A;  3DLN A;  4G8N A;  3T9H B;  4P0I A;  3RPW A;  1LAX A;  3T9U A;  1A7L A;  1MXY A;  5HM4 B;  3S9E A;  1LCF A;  2Q8J A;  4ZDM A;  2ONS A;  3BBR A;  2DS9 A;  1WOD A;  1N3X A;  3OO8 A;  4G8M A;  3DEL B;  2R6G E;  3PUV E;  1B51 A;  2QJE A;  2ZYO A;  2ZMB A;  1M5E A;  4XXU A;  4LZ5 A;  1MXX A;  1BKA A;  3MP1 A;  4OZ9 A;  3PUW E;  1MDP 1;  1SQY A;  4FED A;  2XXR A;  1JEV A;  1OVT A;  3MQ9 A;  4NTL A;  1D4N A;  4OHN A;  3ILU B;  2HAV A;  1EZ9 A;  2V93 A;  4GLI A;  4RK9 A;  2QRY A;  3G3J A;  4Q0C A;  3HHF A;  2XXP A;  3WAF A;  4PE5 B;  1N04 A;  3EQ1 A;  5TPA B;  4HCY A;  1TFA A;  2VHA A;  2H5Y A;  1SW5 A;  2RCA A;  5FTI A;  1IQ7 A;  3PU5 A;  4GOT A;  3R6U A;  4XKN A;  3H6U A;  3IO4 A;  3HN0 A;  3GBA A;  2HCA A;  3L6H A;  3TEL A;  3GLB A;  1GV8 A;  2I48 A;  1B46 A;  2DE2 A;  4JXI A;  1SI0 A;  4EF1 A;  1UIU A;  2I0B A;  4IO4 A;  2REJ A;  2DOJ A;  5LOM A;  1N3W A;  3O6G A;  3P7I A;  1P1U A;  1H44 A;  3KN7 A;  4FAT A;  3Q25 A;  4F39 A;  4IGR A;  2XXQ A;  1CE2 A;  4GWO A;  5JTY B;  1XC1 A;  1DMB A;  5DEX B;  3KOT A;  3FZV A;  1GTK A;  2RC8 A;  4PET A;  4ZEI A;  1FCK A;  1NH8 A;  5AA4 A;  3SES A;  2XHD A;  4GXA A;  3ODB A;  5K2X A;  2UVH A;  1QJM A;  4ND9 A;  5DVF A;  3S9L C;  5H8N A;  4WED A;  3CFL A;  2XXY A;  2I4B A;  3N6U A;  1R6Z A;  1Y3Q A;  1UTH A;  2M8C A;  4YB6 A;  2P2A A;  2ZYN A;  5A5X A;  3KEI A;  1Z7N E;  1MY1 A;  2ZYM A;  4G68 A;  1TXF A;  3S2V A;  3Q29 A;  3PPQ A;  1TFD A;  1FTJ A;  3PPP A;  2I58 A;  3T96 B;  1YPN A;  4ZE8 A;  1P1W A;  3E13 X;  5AA2 D;  2ANJ A;  3MZB A;  4R6K A;  2Z23 A;  2VGQ A;  4KYE A;  3EHS A;  3MVZ A;  1JVX A;  1EU8 A;  1OQG A;  1Q1K A;  1B3H A;  4YKK A;  3VXB A;  4H65 A;  1H3D A;  3K01 A;  5AE4 A;  3VVE A;  3B6W A;  3MC2 A;  4BLA A;  1D3K A;  4ZE9 A;  1URG A;  5I57 B;  4LAT A;  1B5H A;  4OTE A;  5H8H B;  3FJ7 A;  2O6A A;  5I56 B;  4DXB A;  1ZTY A;  1MXU A;  1B1X A;  3O66 A;  2F7B A;  1NNP A;  2AIX A;  2XX8 A;  1MXW A;  1ANF A;  2XXU A;  1Y1Z A;  1IXC A;  2QS4 A;  1B40 A;  1NL5 A;  3KN3 A;  5H8Q B;  5I2N A;  3HST A;  3HO7 A;  4QFN A;  3A3C A;  4MBP A;  4NWD A;  2QS3 A;  1B7U A;  1H76 A;  2I4C A;  4H5F A;  2O84 X;  1VFD A;  3S4U A;  1URS A;  1USY H;  1O7T A;  1B05 A;  3IOU A;  3C34 A;  4OVJ A;  2Q2A A;  4PFW A;  2F36 A;  4HTG A;  4RPN A;  1O64 A;  3TAJ A;  5L9O A;  1ZJL A;  2CMO A;  2YJP A;  4PQJ A;  5H8S A;  3TPA A;  1MH4 A;  3IOV A;  3PMX A;  2E1S A;  1R9Q A;  4NF6 B;  3RN8 A;  1VR5 A;  2O51 A;  4DCX A;  4H0W A;  4GFR A;  1P99 A;  4EDP A;  1JQF A;  5AA2 A;  5AA3 A;  4GIZ A;  1N76 A;  3K6W A;  5JK4 A;  3PMV A;  3R26 A;  2HFB A;  1T0K A;  4OET A;  3JV9 A;  4LA9 A;  4N07 A;  4OEU A;  5IKB A;  1QVS A;  4OQO A;  3B6T A;  3MPK A;  2OLB A;  4GL0 A;  1ZIU A;  2V3Q A;  3O29 A;  4QSE A;  3C31 A;  2B3B A;  2I3V A;  3EN3 A;  4QFP A;  2PYY A;  3QSL A;  4DCY A;  1IZ1 A;  1I6Q A;  4U4X A;  4DLD A;  3LC8 A;  4Q30 B;  2Z8D A;  4QF9 A;  1IIW A;  2VD2 A;  2DXY A;  5KDT B;  3SEY A;  1A8F A;  2NUV A;  1OLC A;  4R72 A;  4OMB A;  5CBS A;  4EXK A;  3RUM A;  4KQP A;  2XXW A;  3C33 A;  1AIV A;  2DYX A;  4Z7E A;  3CVG A;  4F1Y A;  5CM6 A;  1SI1 A;  2QSX A;  4AB5 A;  1VE4 A;  4YKP A;  3M3K A;  1LST A;  3H4Z A;  4HW8 A;  4HCW A;  3OEM A;  4TLM B;  4R9F A;  2F35 A;  4GF8 A;  3IR1 A;  2XXT A;  4F31 B;  3ECR A;  4NED A;  4BDO A;  1B52 A;  4F3P A;  4IB2 A;  1LB8 A;  1MDQ A;  1Z7M E;  3TTL A;  3B7D A;  4YU0 A;  1BIY A;  3A09 A;  4Q5T A;  2XX9 A;  3D4C A;  2DE3 A;  2RC9 A;  3RGY A;  3KJ7 A;  5HBC A;  3O28 A;  4JSD A;  3CG1 A;  2ZYK A;  3RY3 A;  3OO9 A;  4YKI A;  3TQL A;  2ABH A;  2NWJ A;  4Q8R A;  1A40 A;  1M5F A;  3SKP A;  1B5I A;  4DZ1 A;  4RNS A;  4KD5 A;  1MY3 A;  1FQE A;  4FEC A;  1S9T A;  3IAZ A;  1ELJ A;  4YZZ A;  1M5B A;  3IOT A;  1MY4 A;  3IK6 B;  4NE4 A;  2O68 A;  4LVQ A;  2X7P A;  1B7Z A;  4NWC A;  1DPE A;  4DE8 A;  2Q88 A;  2QMW A;  4ZEB A;  5I59 A;  5CMC A;  1GVC A;  4AB6 A;  2BJJ X;  1KWH A;  2ESN A;  3LR1 A;  1LFG A;  2OZZ A;  5M2V A;  3MW0 A;  4MH5 A;  5ELV A;  4O3A A;  1B5J A;  4MF3 A;  2DWI A;  2F7A A;  4LUB A;  1YCJ A;  1LAH E;  2H98 A;  4RA1 A;  5DEX A;  1FW0 A;  3QK6 A;  2XXV A;  4P0G A;  4QHQ A;  3N94 A;  5L8D A;  4C1U A;  1XHY A;  1Y1M A;  1JET A;  1ZU0 A;  4GRK A;  2DWJ A;  1B32 A;  4U2R A;  1NNF A;  3K6X A;  3O6H A;  1QUK A;  2IEE A;  3EF7 A;  2VD3 A;  3OEK A;  4QFK A;  2O1M A;  2PMS A;  4IGT A;  3QUJ A;  2UYE A;  1A8E A;  2Q9T A;  3OD7 A;  1MQJ A;  5EHM A;  3G3H A;  1D9Y A;  1AH5 A;  5ISU A;  1B3E A;  4ESX A;  3PPO A;  3K4U A;  4ZZE A;  2OK2 A;  1XVY A;  3E3K A;  2LAO A;  1NFT A;  3TTR A;  2REG A;  2X26 A;  4ONY A;  2PVU A;  4THI A;  3T9V A;  1B2H A;  2RCB A;  3K00 A;  5FHN A;  1MG1 A;  2OWT A;  4R2F A;  3F11 A;  1B9J A;  1MH3 A;  1PDA A;  2THI A;  3TZA A;  4ISU A;  5ICT A;  1SW4 A;  3H6W A;  3MVX A;  2VOZ A;  3MWB A;  3S9N C;  1DTG A;  2UVI A;  3K1M A;  5DVJ A;  2A5S A;  3JZJ A;  4NF4 A;  4QFO A;  3FXR A;  3FJM A;  1MPC A;  3TFL A;  4M1V A;  4RYA A;  3I5O A;  3QYT A;  4F29 A;  4I8C A;  1DSN A;  3TCG A;  1IIT A;  4DXU A;  5I56 A;  4ZS9 A;  5I58 A;  2OWS A;  3FV2 A;  2G29 A;  1ATG A;  2Y84 A;  2XX7 A;  3M3F A;  4ELQ A;  1Y3P A;  2DE4 A;  2F7C A;  1LAG E;  1SDX A;  3K6U A;  5H8Q A;  2X7Q A;  3GXA A;  3G3I A;  4YIC A;  3PD8 A; 
#chains in the Genus database with same CATH topology
 1PC3 A;  4ZEK A;  4F18 A;  4I40 A;  1Y9U A;  3B8B A;  2V25 A;  3U65 A;  4XKP A;  4X1B A;  4XIG Q;  3U72 A;  3KJT A;  4NHB A;  1LGB C;  3KZG A;  1M5C A;  3PUY E;  3HV1 A;  1KZ8 A;  4M4G A;  2ZXT A;  2DVC A;  4R73 A;  4ZZA A;  4OEN A;  3KBR A;  3LV0 A;  5T3J A;  1N84 A;  3OO7 A;  2HXW A;  3H3G A;  3W15 C;  3HFU A;  3C32 A;  1I6A A;  2QS2 A;  4XKR A;  3OOA A;  1YAE A;  4P1E A;  4IO7 A;  5B7D A;  5CMK A;  3OMB A;  4OWD A;  3N26 A;  2H99 A;  1SVX B;  1IEJ A;  4XEQ A;  1A55 A;  1BP5 A;  1YZ0 A;  4NF6 A;  3MBP A;  1SPI A;  4C0R A;  4GWX A;  3I6V A;  3ZSF A;  2VP1 A;  3FUZ A;  2GHA A;  5A5L A;  2ZNS A;  3L6G A;  4POW A;  2HAU A;  2V84 A;  1VDW A;  2Q2C A;  4RK2 A;  3UGW A;  4GBV A;  4DXC A;  3V83 A;  5L9M A;  3LSF B;  1TWY A;  1K9Y A;  2F8D A;  3M3L A;  5DVI A;  1AMF A;  1FRP A;  1POY 1;  3B6Q A;  2I49 A;  3CIJ A;  4TLL B;  3LUZ A;  4IO5 A;  3G3G A;  1LBZ A;  4H8J A;  3FGS A;  1NH7 A;  1UQW A;  3AXF A;  2OCU A;  5I2K A;  3RQT A;  5EQA A;  1FBP A;  4FBP A;  3V5A A;  4F19 A;  1LBC A;  4GQO A;  4EUO A;  4OVS A;  3HPI A;  4FOR A;  1JW5 A;  1QGX A;  4UAC A;  3G7W A;  2Z22 A;  4OXV A;  4EQ9 A;  4U4S A;  2ONK E;  2D3I A;  1DOT A;  1VFE A;  2QFL A;  2DP8 A;  4F22 A;  1TT1 A;  3TDJ A;  2P0S A;  3E9X A;  3TKD A;  4ELR A;  4K3F A;  4EF2 A;  2FNC A;  4GWS A;  4P1L A;  1JW1 A;  1UTH B;  3T66 A;  3TTN A;  5KDT A;  4I9D A;  3LBS A;  1B1H A;  3FAT A;  3FVG A;  1EZO A;  3UP9 A;  2O7I A;  2PBW A;  2WYP A;  1B3L A;  1L5T A;  4JWX A;  1QUL A;  3DP6 A;  5DYH A;  2O1L A;  4Z0I A;  4GVO A;  2BJI A;  1FPG A;  2NVU B;  1RKM A;  3RTW B;  2E0S A;  4H46 A;  3QAX A;  1NUX A;  2CZI A;  4O3B A;  3LSX A;  3RNN A;  4EQ7 A;  3GYY A;  3VVD A;  1UIV A;  1D9Q A;  5DT6 A;  3PV0 E;  4WKM A;  4I62 A;  2XXK A;  1RDX A;  3USD A;  1OLA A;  5FBP A;  2UVJ A;  1IUD A;  3WAE A;  2DWH A;  1P1Q A;  5KZT A;  1IMD A;  2DXR A;  2FA7 A;  2QVV A;  5IAI A;  4L17 A;  5KCJ B;  4HE2 A;  1ZKB A;  1M5D A;  1NV4 A;  4PFT A;  4N6D A;  4YB5 A;  2UYF A;  3IOW A;  3IJX B;  4OVP A;  3KBZ A;  3TTK A;  1LFI A;  2ZZW A;  1LBB A;  3K6V A;  3Q26 A;  4X9T A;  4G8H A;  4U1Z A;  3OO6 A;  1K9Z A;  3ISP A;  5CMB A;  4ZED A;  4JVI A;  4R6Y A;  1FTO A;  4P9K A;  4EXL A;  2OJT A;  1FTL A;  3KGC A;  2I3W A;  3N6T A;  1G0H A;  4RJZ A;  4OES A;  2IA4 A;  1S7Y A;  4IO6 A;  3K02 A;  2RF1 A;  3C36 A;  1NV0 A;  3SDF A;  4OFO A;  1II5 A;  2ZNU A;  5CBR A;  1JVY A;  4FEB A;  1XVX A;  1ZMG A;  4FJP A;  3S9M C;  1LB9 A;  4MLQ A;  1XOC A;  3EHU A;  3HHG A;  1JNF A;  3GZG A;  3G3K A;  3KSX A;  1SYI A;  4F2O A;  4U22 A;  2HZL A;  2G93 A;  3UOR A;  2GH9 A;  4NMY A;  3IB1 A;  1NV3 A;  3VLW A;  1B4H A;  1Y3N A;  4QSC A;  1FPK A;  3IJO B;  4PBH A;  4PFB A;  4MCO A;  4KXP A;  3MUQ A;  2GRV A;  2D5W A;  1DCU A;  3EPE A;  4ELO A;  1EZP A;  3ONM A;  4NF8 B;  2ZZX A;  2Z8E A;  5B70 A;  1SW1 A;  1R9L A;  2FVZ A;  4OER A;  4IO2 A;  4XTC Q;  1B3F A;  2Y5K A;  1N0T A;  1A54 A;  4AQ4 A;  1OIB A;  3ILT B;  3H6V A;  3T9X B;  4ELP A;  3PPN A;  5AA2 B;  1YTV A;  3VE1 B;  4EQB A;  2YPN A;  4NN3 A;  5TP9 B;  3KG2 A;  1MY2 A;  5DTB A;  3U93 A;  3DP8 A;  3M8U A;  3FAS A;  2FIX A;  3THI A;  1MQH A;  4KYS A;  2DQV A;  3TYH A;  1SW2 A;  3IOR A;  3SEU A;  5TPA A;  3K1P A;  1OQH A;  4KI0 E;  3UIF A;  2HXR A;  4R75 A;  5TU0 A;  3CFX A;  3W9W A;  3BIG A;  5ET5 A;  1RDZ A;  2QPQ A;  1RYX A;  1NKX A;  3EKI A;  3SEW A;  2PT2 A;  1IMC A;  5IM2 A;  1P1N A;  1AOV A;  3TMG A;  1P1O A;  5ET6 A;  5IZ3 A;  3CSB A;  4GWY A;  5HPQ A;  3TCF A;  4PE3 A;  1MQD A;  3DP4 A;  1FTA A;  3MP6 A;  4F1U A;  1FPF A;  2F5X A;  4O7I A;  5EQ8 A;  1FTK A;  3O9P A;  3V89 B;  5JTY A;  4LP2 B;  1J1N A;  3CG3 A;  4BDL A;  3OEN A;  1RDY A;  2H9B A;  4KFQ A;  2XD3 A;  1NNK A;  4G68 C;  3VDF A;  2Y7R A;  3T22 A;  2H4I A;  4JWO A;  4LON B;  3K0V A;  3K2D A;  4G2Z A;  4H6D A;  2H25 A;  5EQ9 A;  3LSL A;  4NF0 A;  4PP0 A;  2QVU A;  2Q89 A;  1FQD A;  5CRY A;  4UA8 A;  2UXA A;  1N7W A;  5H8F B;  1XS5 A;  4E0W A;  3RPL B;  4PAI A;  3TCH A;  4RPO A;  4P11 A;  4BDR A;  3BFT A;  3O97 A;  2XXH A;  2Y7K A;  4QRZ A;  4H5G A;  2F34 A;  4U21 A;  4OVT A;  4X04 A;  1QKA A;  1IME A;  1HSE A;  1US4 A;  1MXZ A;  2Y7W A;  3VFJ A;  4R74 A;  3I3V A;  3IO6 A;  2A5T B;  4ECF A;  4N6P A;  1B7H A;  1UTB B;  4NF5 B;  2XXI A;  5ITP A;  1QW0 A;  3G3F A;  2F78 A;  1BK4 A;  3U94 A;  4NQ8 A;  1R1N A;  1POT A;  3KFM A;  2FBP A;  2YLN A;  4JBZ A;  1LLS A;  3VLU A;  4AS5 A;  3LUY A;  2PFY A;  5I84 A;  4F3S A;  1QKB A;  4R6H A;  3PMW A;  3MVW A;  4BDN A;  2R9J A;  4OVR A;  5I59 B;  4HE1 A;  1SD3 A;  3OSQ A;  4H8I A;  3DM0 A;  1A99 A;  3O2A A;  5ICQ A;  3O6I A;  3C35 A;  3FBP A;  5I57 A;  1PBP A;  5F1Q A;  4RY1 A;  4OVQ A;  5H8H A;  1B6H A;  1QUJ A;  3MPL A;  3CI8 A;  4JWY A;  3B50 A;  3D4G A;  1MXV A;  2XWI A;  3PPR A;  1WDN A;  1N7X A;  4XKQ A;  5ET7 A;  4BDQ A;  2B65 A;  3KSJ A;  3UA8 A;  4YB7 A;  1FTM A;  4X48 A;  3QXM A;  2QMX A;  4U23 A;  3CFZ A;  3CR9 A;  1MY0 A;  3ZKL A;  1FQC A;  2RKM A;  3OEL A;  1NV7 A;  4FE8 A;  5FHM A;  4PGP A;  3VV5 A;  2Y7P A;  3K1N A;  5IZ1 A;  3H03 A;  2WKY A;  1FQF A;  2PT1 A;  3A3U A;  2DVZ A;  3MVY A;  4MMP A;  1MQG A;  3FV1 A;  2RC7 A;  3IX1 A;  4KYD A;  3Q28 A;  4IY5 A;  3SEX A;  3MAM A;  2GFE A;  1B3G A;  1NMU A;  2NXO A;  4GL8 A;  3ZS6 A;  2XWV A;  2F97 A;  1PBQ A;  1B58 A;  4QFL A;  3T0J A;  4TQU Q;  1MM7 A;  4N13 A;  1KA0 A;  4KCC A;  1Y4C A;  4MX6 A;  4N6K A;  2XD2 A;  1FPL A;  4N8G A;  2B3F A;  4MFI A;  4NAP A;  2QL3 A;  4MHF A;  3KOS A;  2V3U A;  4LQ5 A;  3MST A;  2QVR A;  2Q8M A;  1GGG A;  2GHB A;  4RXL A;  2WX9 A;  1USY E;  2ZNT A;  3R7X A;  2O69 A;  3RTF B;  3ROJ A;  4FIM A;  3GBB A;  3T1B A;  3FXU A;  2KLF A;  1I6B A;  3N5L A;  2ALU A;  1OVB A;  2Y7I A;  4F2Q A;  5KCJ A;  1H45 A;  2XA5 A;  1QUI A;  1XT8 A;  2AL4 A;  4POX A;  3TUS A;  4NF4 B;  1EYJ A;  2D21 A;  4X8R A;  1Y4T A;  3JYR A;  3KN8 A;  3FD3 A;  4F3G A;  3H7M A;  5CI5 A;  1FBC A;  1GR2 A;  2PFZ A;  1IXH A;  2PX1 A;  3RT8 A;  1PEB A;  4H67 A;  4OAN A;  4F3B A;  4I3Y A;  1IXG A;  3PUX E;  2DWA A;  1FQB A;  3VVF A;  5AA4 B;  4XFE A;  3C9H A;  4QSD A;  5I58 B;  3SET A;  4NG7 A;  2QS1 A;  4C1T A;  3C4M A;  3CSG A;  5L9S A;  4YMB A;  1HSJ A;  4G4P A;  4OYV A;  3FVO A;  4PFY A;  4ZEF A;  1PB8 A;  5AA1 A;  5H8N B;  4OEV A;  1SBP A;  1FPE A;  3FXQ A;  1MPB A;  3W9V A;  5JEI A;  3U8Q A;  1FBH A;  5F7V A;  3U92 A;  1F9B A;  1OMP A;  3EHT A;  3E4R A;  4IY6 A;  1DTZ A;  1B0L A;  5A5X B;  1EH3 A;  4HS7 A;  3OXN A;  4G68 B;  5BUU A;  4WXJ A;  4AS4 A;  1MRP A;  2F6P A;  1CB6 A;  2ONR A;  4YAH X;  2UVG A;  4GX6 A;  3MZ1 A;  3RLF E;  5ITO A;  1JW4 A;  1US5 A;  3TTM A;  1RYO A;  3IL1 B;  5J1D A;  4KPT A;  1B0H A;  4R9G A;  4KR5 A;  2O7U A;  4KHZ E;  1PB9 A;  4G61 A;  1D9V A;  5CC2 A;  4NF8 A;  2AL5 A;  3HCQ A;  3BFU A;  1ZLQ A;  2Z8F A;  2OBG A;  1Y20 A;  3UK4 A;  3MYU A;  1FQA A;  3U1O A;  1JP4 A;  1HSL A;  4F1V A;  4GBW A;  3QIM A;  3VLV A;  2HZK A;  5EHS A;  1Q35 A;  4LQ2 A;  3SEV A;  2CZK A;  1IMB A;  2XXX A;  3FXB A;  5TP9 A;  2VPO A;  1XI6 A;  3MP8 A;  3PUZ E;  3FJG A;  4TOZ A;  3QMF A;  3IB2 A;  3ZKK A;  1DK4 A;  5I2K B;  3RT6 B;  4IO3 A;  1MS7 A;  1NUW A;  5I2N B;  2P1S A;  2FYI A;  4O3C A;  3PD9 A;  2W7Y A;  1DPP A;  4R2B A;  1IXI A;  4E0X A;  2NOO A;  1LCT A;  4O7M A;  2WBB A;  4NX1 A;  4I1D A;  2HQ0 A;  2R8T A;  4QXD A;  1MM6 A;  4JB7 A;  3FVN A;  4U1O A;  3FVK A;  3FIR A;  4PAK A;  4JDF A;  4N4U A;  3QUF A;  1YXI A;  3TQW A;  4LZ8 A;  4MNI A;  2CZL A;  1NNT A;  1BLF A;  4DDD A;  5CMM A;  2V3T A;  3CHG A;  5EYF A;  4X1D A;  4KCD A;  3V8X B;  4MLV A;  2B4L A;  4ZEC A;  3MZ9 A;  1LAF E;  1IMF A;  3SER A;  4DIG A;  2HEU A;  3OSR A;  3LSW A;  4PFU A;  5FHO A;  3IB0 A;  3CRB A;  4YMA A;  4FAJ A;  2WEF A;  1H43 A;  4O8M A;  3BKI B;  2AYS A;  2I0C A;  4JSO A;  3TEP A;  3H6T A;  1JEU A;  5H8F A;  4LZ7 A;  3VXC A;  5K2Y A;  1WVJ A;  2F6G A;  4OFL A;  1VSO A;  1AL3 A;  1PB7 A;  4G77 A;  4MEV A;  2DSF A;  3TOD A;  2R71 A;  3PGF A;  4YKJ A;  2FIE A;  1S50 A;  3MJN A;  3UN6 A;  3H06 B;  1MQI A;  2ZZV A;  1CNQ A;  1I69 A;  1ZBM A;  2A5T A;  1O63 A;  1FSA A;  1LFH A;  2RIN A;  1BTJ A;  1UTB A;  4H1X A;  5FTH A;  4NF5 A;  1LBW A;  3T93 B;  1MPD A;  1URD A;  5EYG A;  4ESW A;  4GXS B;  2I6E A;  1SYH A;  5BWJ A;  3Q27 A;  4OFJ A;  4GD5 A;  4WEP A;  4PAF A;  4MJO A;  1B4Z A;  4BDM A;  3DLN A;  4G8N A;  3T9H B;  4P0I A;  3RPW A;  1LAX A;  1NV1 A;  3T9U A;  1A7L A;  1MXY A;  5HM4 B;  3S9E A;  1LCF A;  4OA4 A;  2Q8J A;  4ZDM A;  2ONS A;  3BBR A;  2DS9 A;  1WOD A;  1N3X A;  3OO8 A;  4G8M A;  3DEL B;  2R6G E;  3PUV E;  1B51 A;  2QJE A;  2ZYO A;  2ZMB A;  1Q9D A;  1EYK A;  5IGA A;  1M5E A;  3RYD A;  2OX3 A;  4XXU A;  4LZ5 A;  1MXX A;  4LN5 A;  1FPJ A;  1BKA A;  3MP1 A;  4OZ9 A;  3PUW E;  1MDP 1;  5ET8 A;  1SQY A;  4FED A;  2XXR A;  1JEV A;  1OVT A;  4GWW A;  3MQ9 A;  5EYH A;  1LEV A;  4NTL A;  1D4N A;  2L5V A;  4OHN A;  3ILU B;  2HAV A;  1EZ9 A;  2V93 A;  4GLI A;  4RK9 A;  2QRY A;  3G3J A;  4Q0C A;  3HHF A;  2XXP A;  3WAF A;  4PE5 B;  1N04 A;  1FPD A;  3EQ1 A;  5TPA B;  4HCY A;  1TFA A;  4HXV A;  2VHA A;  2H5Y A;  1SW5 A;  5LTC A;  2RCA A;  5FTI A;  1IQ7 A;  3PU5 A;  4GOT A;  3R6U A;  1FPI A;  4XKN A;  3SZP A;  3H6U A;  3IO4 A;  3HN0 A;  3GBA A;  2HCA A;  3L6H A;  3TEL A;  3GLB A;  1GV8 A;  2I48 A;  4IR8 A;  1B46 A;  2DE2 A;  4JXI A;  1SI0 A;  1FBD A;  4P3L A;  4EF1 A;  1UIU A;  2I0B A;  4IO4 A;  2REJ A;  2DOJ A;  4GX3 A;  5LOM A;  1N3W A;  4PTK A;  3O6G A;  3P7I A;  1P1U A;  1H44 A;  4JVC A;  3KN7 A;  4FAT A;  3Q25 A;  4F39 A;  4IGR A;  2B4M A;  2XXQ A;  1CE2 A;  4GWO A;  5JTY B;  1XC1 A;  1DMB A;  3KOT A;  5DEX B;  3FZV A;  1KA1 A;  2GQ1 A;  1GTK A;  2RC8 A;  3BIH A;  4PET A;  4ZEI A;  1FCK A;  1NH8 A;  5AA4 A;  3SES A;  2XHD A;  2Y5L A;  2KQZ A;  5J16 A;  4GXA A;  3ODB A;  5K2X A;  4N91 A;  2UVH A;  1QJM A;  1INP A;  4ND9 A;  2KR0 A;  5DVF A;  3S9L C;  5H8N A;  4WED A;  2WYK A;  3CFL A;  2XXY A;  2I4B A;  3N6U A;  1R6Z A;  1Y3Q A;  2FHY A;  1UTH A;  3IFA A;  1FBG A;  2M8C A;  4UAB A;  4YB6 A;  2P2A A;  2ZYN A;  5A5X A;  3KEI A;  1Z7N E;  4GWZ A;  2P3N A;  1MY1 A;  2ZYM A;  4G68 A;  4XF5 A;  2CZH A;  1TXF A;  3S2V A;  3Q29 A;  3PPQ A;  1TFD A;  1FTJ A;  3PPP A;  2I58 A;  3T96 B;  1YPN A;  4ZE8 A;  1P1W A;  3E13 X;  5AA2 D;  2ANJ A;  3MZB A;  1FBF A;  4R6K A;  2Z23 A;  2VGQ A;  4KYE A;  3EHS A;  3MVZ A;  1JVX A;  1EU8 A;  4N8Y A;  1OQG A;  1Q1K A;  4PDD A;  1B3H A;  4YKK A;  5DW8 A;  3VXB A;  1NI9 A;  4H65 A;  1H3D A;  3K01 A;  5AE4 A;  3VVE A;  3B6W A;  3IFC A;  1LBX A;  3MC2 A;  4BLA A;  1D3K A;  4MAG A;  4ZE9 A;  1URG A;  3NOH A;  5I57 B;  4GWU A;  4LAT A;  1B5H A;  4I3E A;  4MNP A;  4OTE A;  5H8H B;  3E78 A;  2CEY A;  3FJ7 A;  2O6A A;  5I56 B;  4DXB A;  1ZTY A;  1MXU A;  1B1X A;  3O66 A;  2F7B A;  1NNP A;  2AIX A;  4PFI A;  2XX8 A;  1MXW A;  1ANF A;  2XXU A;  1Y1Z A;  1IXC A;  2QS4 A;  1B40 A;  1NL5 A;  4JVD A;  3KN3 A;  5H8Q B;  5I2N A;  3HST A;  3HO7 A;  4QFN A;  3A3C A;  4MBP A;  4NWD A;  2QS3 A;  1FBE A;  4PBQ A;  1B7U A;  1H76 A;  2I4C A;  4H5F A;  2O84 X;  1VFD A;  3S4U A;  1URS A;  1USY H;  2WBD A;  1O7T A;  1B05 A;  3IOU A;  3C34 A;  4OVJ A;  2Q2A A;  2HPG A;  4PFW A;  2F36 A;  4HTG A;  4RPN A;  1NV2 A;  1O64 A;  3TAJ A;  5L9O A;  1ZJL A;  4MIJ A;  2CMO A;  2YJP A;  1DBZ A;  2PCR A;  4PQJ A;  3KC0 A;  5H8S A;  3TPA A;  1MH4 A;  3IOV A;  3PMX A;  2E1S A;  1R9Q A;  4NF6 B;  3RN8 A;  1VR5 A;  5I7I A;  2O51 A;  4DCX A;  4H0W A;  4PF8 A;  4GFR A;  1P99 A;  4EDP A;  1JQF A;  1NUZ A;  5AA2 A;  5AA3 A;  4GIZ A;  1N76 A;  3K6W A;  5JK4 A;  3PMV A;  2JJK A;  3R26 A;  2HFB A;  1T0K A;  4OET A;  3JV9 A;  4LA9 A;  4PC9 A;  4N07 A;  4QBA A;  4OEU A;  5IKB A;  1QVS A;  4OQO A;  2XWO A;  3B6T A;  3MPK A;  2OLB A;  4GL0 A;  1ZIU A;  2V3Q A;  3O29 A;  4QSE A;  3C31 A;  2B3B A;  4DI4 B;  2I3V A;  1EYI A;  1LBY A;  3EN3 A;  4QFP A;  2PYY A;  3QSL A;  4DCY A;  1IZ1 A;  2OWZ A;  1I6Q A;  4U4X A;  4DLD A;  3LC8 A;  4Q30 B;  2Z8D A;  4QF9 A;  1IIW A;  2VD2 A;  2DXY A;  5KDT B;  3SEY A;  1A8F A;  2NUV A;  1OLC A;  4R72 A;  4OMB A;  5CBS A;  4EXK A;  3RUM A;  4KQP A;  2XXW A;  3C33 A;  1NV6 A;  1AIV A;  2DYX A;  4Z7E A;  3CVG A;  4F1Y A;  5CM6 A;  1SI1 A;  2QSX A;  4AB5 A;  1VE4 A;  4YKP A;  1G0I A;  3M3K A;  1LST A;  4PDH A;  3H4Z A;  4HW8 A;  4HCW A;  3OEM A;  2V4C A;  1FJ6 A;  4TLM B;  4R9F A;  2F35 A;  4GF8 A;  3IR1 A;  2XXT A;  4F31 B;  3D1R A;  3ECR A;  4NED A;  4BDO A;  2F3B A;  2VT5 A;  1B52 A;  4F3P A;  4IB2 A;  1LB8 A;  2VPN A;  1MDQ A;  1Z7M E;  3TTL A;  5IZZ A;  3B7D A;  4YU0 A;  1BIY A;  3A09 A;  4GX4 A;  4Q5T A;  3RPL A;  2XX9 A;  1LBV A;  3D4C A;  2DE3 A;  2RC9 A;  3RGY A;  3KJ7 A;  5HBC A;  3O28 A;  4JSD A;  3CG1 A;  2ZYK A;  3RY3 A;  3OO9 A;  4YKI A;  4N17 A;  3TQL A;  2ABH A;  2NWJ A;  4Q8R A;  1A40 A;  1M5F A;  3SKP A;  1B5I A;  1NV5 A;  4DZ1 A;  4RNS A;  4KD5 A;  4HE0 A;  1MY3 A;  2Q74 A;  1FQE A;  4FEC A;  1S9T A;  3IAZ A;  1ELJ A;  4YZZ A;  1M5B A;  3IOT A;  1MY4 A;  3IK6 B;  4NE4 A;  2O68 A;  4LVQ A;  2X7P A;  4P47 A;  1B7Z A;  4NWC A;  1DPE A;  4MNC A;  4DE8 A;  2Q88 A;  4H45 A;  2QMW A;  4ZEB A;  5I59 A;  5CMC A;  1GVC A;  4AB6 A;  2BJJ X;  1KWH A;  2ESN A;  3LR1 A;  1LFG A;  2OZZ A;  5M2V A;  3MW0 A;  4MH5 A;  4PCD A;  5ELV A;  4O3A A;  1B5J A;  4MF3 A;  5I3S A;  2DWI A;  2F7A A;  4LUB A;  5EQ7 A;  5F24 A;  1FJ9 A;  1YCJ A;  2MKZ A;  1LAH E;  2H98 A;  3E79 A;  4RA1 A;  5DEX A;  4N15 A;  1FW0 A;  3QK6 A;  2XXV A;  2CEX A;  4P0G A;  4QHQ A;  3N94 A;  3PTY A;  5L8D A;  4C1U A;  2XWK A;  1XHY A;  1IMA A;  1Y1M A;  1JET A;  4P56 A;  1ZU0 A;  4GRK A;  2DWJ A;  5I5P A;  1B32 A;  4U2R A;  1NNF A;  3K6X A;  3O6H A;  1QUK A;  2IEE A;  3EF7 A;  2VD3 A;  3OEK A;  1NUY A;  4QFK A;  2O1M A;  4N81 A;  2PMS A;  4IGT A;  3QUJ A;  2UYE A;  2DDK A;  1A8E A;  2Q9T A;  3OD7 A;  1MQJ A;  4PF6 A;  5EHM A;  3G3H A;  1D9Y A;  2F3D A;  5LDZ A;  1AH5 A;  5ISU A;  1B3E A;  5ESY A;  4ESX A;  4PFR A;  3PPO A;  3K4U A;  4ZZE A;  2OK2 A;  1XVY A;  3E3K A;  4O94 A;  2LAO A;  4P8B A;  1NFT A;  3TTR A;  2REG A;  2X26 A;  4ONY A;  2PVU A;  4THI A;  4NGU A;  3T9V A;  1B2H A;  2RCB A;  3K00 A;  5FHN A;  1MG1 A;  4DI3 D;  1YYZ A;  2OWT A;  3A29 A;  4PGN A;  4R2F A;  3F11 A;  1B9J A;  1MH3 A;  1PDA A;  2THI A;  3TZA A;  1FPB A;  5IZ3 B;  4ISU A;  5ICT A;  1SW4 A;  3H6W A;  3MVX A;  2VOZ A;  3MWB A;  2P3V A;  3S9N C;  1DTG A;  2UVI A;  3K1M A;  5DVJ A;  2A5S A;  3JZJ A;  4NF4 A;  4QFO A;  3FXR A;  3FJM A;  1MPC A;  3TFL A;  4M1V A;  4RYA A;  3I5O A;  2HHM A;  3QYT A;  4F29 A;  4I8C A;  1DSN A;  3TCG A;  1IIT A;  4DXU A;  5I56 A;  4ZS9 A;  3KC1 A;  5I58 A;  2OWS A;  3FV2 A;  2G29 A;  1ATG A;  2Y84 A;  2XX7 A;  3M3F A;  4ELQ A;  1Y3P A;  2DE4 A;  2F7C A;  1LAG E;  1SDX A;  3K6U A;  1AWB A;  5H8Q A;  2X7Q A;  3GXA A;  3G3I A;  4YIC A;  3PD8 A; 
#chains in the Genus database with same CATH homology
 1PC3 A;  4ZEK A;  4F18 A;  1Y9U A;  2V25 A;  4XKP A;  4X1B A;  4XIG Q;  3U72 A;  3KJT A;  1LGB C;  3KZG A;  1M5C A;  3PUY E;  3HV1 A;  4M4G A;  2ZXT A;  2DVC A;  4R73 A;  4ZZA A;  4OEN A;  3KBR A;  1N84 A;  3OO7 A;  2HXW A;  3H3G A;  3W15 C;  3C32 A;  1I6A A;  2QS2 A;  4XKR A;  3OOA A;  1YAE A;  5B7D A;  4IO7 A;  5CMK A;  3OMB A;  4OWD A;  3N26 A;  2H99 A;  1SVX B;  1IEJ A;  1A55 A;  1BP5 A;  4NF6 A;  3MBP A;  4C0R A;  3I6V A;  3ZSF A;  2VP1 A;  3FUZ A;  2GHA A;  2ZNS A;  3L6G A;  4POW A;  2HAU A;  2V84 A;  2Q2C A;  4RK2 A;  3UGW A;  4DXC A;  3V83 A;  5L9M A;  3LSF B;  1TWY A;  2F8D A;  3M3L A;  5DVI A;  1AMF A;  1POY 1;  3B6Q A;  2I49 A;  3CIJ A;  4TLL B;  4IO5 A;  3G3G A;  4H8J A;  3FGS A;  1NH7 A;  1UQW A;  3AXF A;  2OCU A;  5I2K A;  3RQT A;  3V5A A;  4F19 A;  1LBC A;  4GQO A;  4EUO A;  3HPI A;  4FOR A;  1JW5 A;  4UAC A;  3G7W A;  2Z22 A;  4OXV A;  4EQ9 A;  4U4S A;  2ONK E;  2D3I A;  1DOT A;  1VFE A;  2DP8 A;  4F22 A;  1TT1 A;  3TDJ A;  2P0S A;  3E9X A;  3TKD A;  4ELR A;  4K3F A;  4EF2 A;  2FNC A;  1JW1 A;  1UTH B;  3T66 A;  3TTN A;  5KDT A;  4I9D A;  3LBS A;  1B1H A;  3FAT A;  3FVG A;  1EZO A;  3UP9 A;  2O7I A;  2PBW A;  1B3L A;  1L5T A;  4JWX A;  1QUL A;  3DP6 A;  5DYH A;  2O1L A;  4Z0I A;  4GVO A;  2NVU B;  1RKM A;  3RTW B;  2E0S A;  3QAX A;  4O3B A;  3LSX A;  3RNN A;  4EQ7 A;  3VVD A;  1UIV A;  5DT6 A;  3PV0 E;  4WKM A;  4I62 A;  3USD A;  1OLA A;  2UVJ A;  1IUD A;  3WAE A;  2DWH A;  1P1Q A;  5KZT A;  2DXR A;  2FA7 A;  5IAI A;  4L17 A;  5KCJ B;  1ZKB A;  1M5D A;  4PFT A;  4YB5 A;  2UYF A;  3IOW A;  3IJX B;  3TTK A;  1LFI A;  1LBB A;  3K6V A;  3Q26 A;  4X9T A;  4G8H A;  4U1Z A;  3OO6 A;  5CMB A;  4ZED A;  4R6Y A;  1FTO A;  4EXL A;  2OJT A;  1FTL A;  3KGC A;  2I3W A;  3N6T A;  4RJZ A;  4OES A;  2IA4 A;  1S7Y A;  4IO6 A;  3K02 A;  2RF1 A;  3C36 A;  3SDF A;  4OFO A;  1II5 A;  2ZNU A;  5CBR A;  1JVY A;  4FEB A;  1XVX A;  1ZMG A;  4FJP A;  3S9M C;  1LB9 A;  4MLQ A;  1XOC A;  3EHU A;  3HHG A;  1JNF A;  3GZG A;  3G3K A;  3KSX A;  1SYI A;  4F2O A;  4U22 A;  2HZL A;  2G93 A;  3UOR A;  2GH9 A;  4NMY A;  3IB1 A;  3VLW A;  1B4H A;  1Y3N A;  4QSC A;  3IJO B;  3MUQ A;  2GRV A;  2D5W A;  3EPE A;  4ELO A;  1EZP A;  3ONM A;  4NF8 B;  2Z8E A;  5B70 A;  1SW1 A;  1R9L A;  4OER A;  4IO2 A;  4XTC Q;  1B3F A;  1N0T A;  1A54 A;  4AQ4 A;  1OIB A;  3ILT B;  3H6V A;  3T9X B;  4ELP A;  3PPN A;  5AA2 B;  1YTV A;  3VE1 B;  4EQB A;  2YPN A;  5TP9 B;  3KG2 A;  1MY2 A;  5DTB A;  3U93 A;  3DP8 A;  3M8U A;  3FAS A;  3THI A;  1MQH A;  4KYS A;  2DQV A;  3TYH A;  1SW2 A;  3IOR A;  3SEU A;  5TPA A;  3K1P A;  1OQH A;  4KI0 E;  3UIF A;  4R75 A;  5TU0 A;  3CFX A;  3W9W A;  2QPQ A;  1RYX A;  1NKX A;  3SEW A;  2PT2 A;  1P1N A;  1AOV A;  3TMG A;  1P1O A;  3CSB A;  5HPQ A;  3TCF A;  1MQD A;  3DP4 A;  3MP6 A;  4F1U A;  2F5X A;  1FTK A;  3O9P A;  3V89 B;  5JTY A;  4LP2 B;  1J1N A;  3CG3 A;  4BDL A;  3OEN A;  2H9B A;  4KFQ A;  2XD3 A;  1NNK A;  4G68 C;  3VDF A;  2Y7R A;  3T22 A;  2H4I A;  4JWO A;  4LON B;  3K0V A;  3K2D A;  4G2Z A;  4H6D A;  2H25 A;  3LSL A;  4PP0 A;  2Q89 A;  1FQD A;  5CRY A;  4UA8 A;  2UXA A;  1N7W A;  5H8F B;  1XS5 A;  4E0W A;  3TCH A;  4RPO A;  4P11 A;  4BDR A;  3BFT A;  3O97 A;  2XXH A;  2Y7K A;  4QRZ A;  4H5G A;  2F34 A;  4U21 A;  1QKA A;  1HSE A;  1US4 A;  1MXZ A;  2Y7W A;  3VFJ A;  4R74 A;  3I3V A;  3IO6 A;  2A5T B;  4ECF A;  4N6P A;  1B7H A;  1UTB B;  4NF5 B;  2XXI A;  5ITP A;  1QW0 A;  3G3F A;  2F78 A;  3U94 A;  1R1N A;  1POT A;  3KFM A;  2YLN A;  4JBZ A;  1LLS A;  3VLU A;  3LUY A;  5I84 A;  4F3S A;  1QKB A;  4R6H A;  3PMW A;  3MVW A;  4BDN A;  2R9J A;  5I59 B;  1SD3 A;  3OSQ A;  4H8I A;  3DM0 A;  1A99 A;  3O2A A;  5ICQ A;  3O6I A;  3C35 A;  5I57 A;  1PBP A;  5F1Q A;  4RY1 A;  5H8H A;  1B6H A;  1QUJ A;  3MPL A;  3CI8 A;  4JWY A;  3D4G A;  1MXV A;  3PPR A;  1WDN A;  1N7X A;  4XKQ A;  4BDQ A;  2B65 A;  3KSJ A;  3UA8 A;  4YB7 A;  1FTM A;  4X48 A;  3QXM A;  2QMX A;  4U23 A;  3CFZ A;  3CR9 A;  1MY0 A;  3ZKL A;  1FQC A;  2RKM A;  3OEL A;  4FE8 A;  5FHM A;  3VV5 A;  2Y7P A;  3K1N A;  3H03 A;  2WKY A;  1FQF A;  2PT1 A;  3A3U A;  2DVZ A;  3MVY A;  1MQG A;  3FV1 A;  2RC7 A;  3IX1 A;  4KYD A;  3Q28 A;  4IY5 A;  3SEX A;  3MAM A;  2GFE A;  1B3G A;  1NMU A;  2NXO A;  4GL8 A;  3ZS6 A;  2F97 A;  1PBQ A;  1B58 A;  4QFL A;  4TQU Q;  1MM7 A;  4N13 A;  4KCC A;  1Y4C A;  2XD2 A;  2B3F A;  4MFI A;  2QL3 A;  3KOS A;  2V3U A;  4LQ5 A;  1GGG A;  2GHB A;  4RXL A;  1USY E;  2ZNT A;  3R7X A;  2O69 A;  3RTF B;  4FIM A;  3GBB A;  3FXU A;  2KLF A;  1I6B A;  3N5L A;  2ALU A;  1OVB A;  2Y7I A;  4F2Q A;  5KCJ A;  1H45 A;  1QUI A;  1XT8 A;  2AL4 A;  4POX A;  3TUS A;  4NF4 B;  2D21 A;  1Y4T A;  3JYR A;  3KN8 A;  3FD3 A;  4F3G A;  3H7M A;  5CI5 A;  1GR2 A;  1IXH A;  2PX1 A;  3RT8 A;  1PEB A;  4H67 A;  4F3B A;  1IXG A;  3PUX E;  2DWA A;  1FQB A;  3VVF A;  5AA4 B;  3C9H A;  4QSD A;  5I58 B;  3SET A;  2QS1 A;  4C1T A;  3C4M A;  3CSG A;  5L9S A;  4YMB A;  1HSJ A;  4G4P A;  4OYV A;  3FVO A;  4PFY A;  4ZEF A;  1PB8 A;  5AA1 A;  5H8N B;  4OEV A;  1SBP A;  3FXQ A;  1MPB A;  3W9V A;  5JEI A;  3U8Q A;  5F7V A;  3U92 A;  1F9B A;  1OMP A;  3EHT A;  3E4R A;  4IY6 A;  1DTZ A;  1B0L A;  5A5X B;  1EH3 A;  4HS7 A;  3OXN A;  4G68 B;  5BUU A;  4WXJ A;  1MRP A;  2F6P A;  1CB6 A;  2ONR A;  4YAH X;  2UVG A;  3MZ1 A;  3RLF E;  5ITO A;  1JW4 A;  1US5 A;  3TTM A;  1RYO A;  3IL1 B;  5J1D A;  4KPT A;  1B0H A;  4R9G A;  4KR5 A;  2O7U A;  4KHZ E;  1PB9 A;  1D9V A;  5CC2 A;  4NF8 A;  2AL5 A;  3HCQ A;  3BFU A;  1ZLQ A;  2Z8F A;  2OBG A;  1Y20 A;  3UK4 A;  1FQA A;  3U1O A;  1HSL A;  4F1V A;  3QIM A;  3VLV A;  2HZK A;  5EHS A;  1Q35 A;  4LQ2 A;  3SEV A;  2XXX A;  5TP9 A;  3MP8 A;  3PUZ E;  3FJG A;  4TOZ A;  3IB2 A;  3ZKK A;  5I2K B;  3RT6 B;  4IO3 A;  1MS7 A;  5I2N B;  2P1S A;  2FYI A;  4O3C A;  3PD9 A;  2W7Y A;  1DPP A;  4R2B A;  1IXI A;  4E0X A;  2NOO A;  1LCT A;  4I1D A;  2HQ0 A;  1MM6 A;  4JB7 A;  3FVN A;  4U1O A;  3FVK A;  3FIR A;  4JDF A;  3QUF A;  3TQW A;  4LZ8 A;  2CZL A;  1NNT A;  1BLF A;  4DDD A;  5CMM A;  2V3T A;  5EYF A;  4X1D A;  4KCD A;  3V8X B;  4MLV A;  4ZEC A;  3MZ9 A;  1LAF E;  3SER A;  4DIG A;  2HEU A;  3OSR A;  3LSW A;  4PFU A;  5FHO A;  3IB0 A;  3CRB A;  4YMA A;  4FAJ A;  1H43 A;  3BKI B;  2AYS A;  2I0C A;  4JSO A;  3TEP A;  3H6T A;  1JEU A;  5H8F A;  4LZ7 A;  3VXC A;  5K2Y A;  1WVJ A;  2F6G A;  4OFL A;  1VSO A;  1AL3 A;  1PB7 A;  4G77 A;  2DSF A;  3TOD A;  2R71 A;  3PGF A;  4YKJ A;  1S50 A;  3MJN A;  3UN6 A;  3H06 B;  1MQI A;  1I69 A;  1ZBM A;  2A5T A;  1O63 A;  1LFH A;  2RIN A;  1BTJ A;  1UTB A;  4H1X A;  5FTH A;  4NF5 A;  3T93 B;  1MPD A;  1URD A;  4ESW A;  4GXS B;  2I6E A;  1SYH A;  5BWJ A;  3Q27 A;  4OFJ A;  4GD5 A;  4WEP A;  1B4Z A;  4BDM A;  3DLN A;  4G8N A;  3T9H B;  4P0I A;  3RPW A;  1LAX A;  3T9U A;  1A7L A;  1MXY A;  5HM4 B;  3S9E A;  1LCF A;  2Q8J A;  4ZDM A;  2ONS A;  3BBR A;  2DS9 A;  1WOD A;  1N3X A;  3OO8 A;  4G8M A;  3DEL B;  2R6G E;  3PUV E;  1B51 A;  2QJE A;  2ZYO A;  2ZMB A;  1M5E A;  4XXU A;  4LZ5 A;  1MXX A;  1BKA A;  3MP1 A;  4OZ9 A;  3PUW E;  1MDP 1;  1SQY A;  4FED A;  2XXR A;  1JEV A;  1OVT A;  3MQ9 A;  4NTL A;  1D4N A;  4OHN A;  3ILU B;  2HAV A;  1EZ9 A;  2V93 A;  4GLI A;  4RK9 A;  2QRY A;  3G3J A;  4Q0C A;  3HHF A;  2XXP A;  3WAF A;  4PE5 B;  1N04 A;  3EQ1 A;  5TPA B;  4HCY A;  1TFA A;  2VHA A;  2H5Y A;  1SW5 A;  2RCA A;  5FTI A;  1IQ7 A;  3PU5 A;  4GOT A;  3R6U A;  4XKN A;  3H6U A;  3IO4 A;  3HN0 A;  3GBA A;  2HCA A;  3L6H A;  3TEL A;  3GLB A;  1GV8 A;  2I48 A;  1B46 A;  2DE2 A;  4JXI A;  1SI0 A;  4EF1 A;  1UIU A;  2I0B A;  4IO4 A;  2REJ A;  2DOJ A;  5LOM A;  1N3W A;  3O6G A;  3P7I A;  1P1U A;  1H44 A;  3KN7 A;  4FAT A;  3Q25 A;  4F39 A;  4IGR A;  2XXQ A;  1CE2 A;  4GWO A;  5JTY B;  1XC1 A;  1DMB A;  5DEX B;  3KOT A;  3FZV A;  1GTK A;  2RC8 A;  4PET A;  4ZEI A;  1FCK A;  1NH8 A;  5AA4 A;  3SES A;  2XHD A;  4GXA A;  3ODB A;  5K2X A;  2UVH A;  1QJM A;  4ND9 A;  5DVF A;  3S9L C;  5H8N A;  4WED A;  3CFL A;  2XXY A;  2I4B A;  3N6U A;  1R6Z A;  1Y3Q A;  1UTH A;  2M8C A;  4YB6 A;  2P2A A;  2ZYN A;  5A5X A;  3KEI A;  1Z7N E;  1MY1 A;  2ZYM A;  4G68 A;  1TXF A;  3S2V A;  3Q29 A;  3PPQ A;  1TFD A;  1FTJ A;  3PPP A;  2I58 A;  3T96 B;  1YPN A;  4ZE8 A;  1P1W A;  3E13 X;  5AA2 D;  2ANJ A;  3MZB A;  4R6K A;  2Z23 A;  2VGQ A;  4KYE A;  3EHS A;  3MVZ A;  1JVX A;  1EU8 A;  1OQG A;  1Q1K A;  1B3H A;  4YKK A;  3VXB A;  4H65 A;  1H3D A;  3K01 A;  5AE4 A;  3VVE A;  3B6W A;  3MC2 A;  4BLA A;  1D3K A;  4ZE9 A;  1URG A;  5I57 B;  4LAT A;  1B5H A;  4OTE A;  5H8H B;  3FJ7 A;  2O6A A;  5I56 B;  4DXB A;  1ZTY A;  1MXU A;  1B1X A;  3O66 A;  2F7B A;  1NNP A;  2AIX A;  2XX8 A;  1MXW A;  1ANF A;  2XXU A;  1Y1Z A;  1IXC A;  2QS4 A;  1B40 A;  1NL5 A;  3KN3 A;  5H8Q B;  5I2N A;  3HST A;  3HO7 A;  4QFN A;  3A3C A;  4MBP A;  4NWD A;  2QS3 A;  1B7U A;  1H76 A;  2I4C A;  4H5F A;  2O84 X;  1VFD A;  3S4U A;  1URS A;  1USY H;  1O7T A;  1B05 A;  3IOU A;  3C34 A;  4OVJ A;  2Q2A A;  4PFW A;  2F36 A;  4HTG A;  4RPN A;  1O64 A;  3TAJ A;  5L9O A;  1ZJL A;  2CMO A;  2YJP A;  4PQJ A;  5H8S A;  3TPA A;  1MH4 A;  3IOV A;  3PMX A;  2E1S A;  1R9Q A;  4NF6 B;  3RN8 A;  1VR5 A;  2O51 A;  4DCX A;  4H0W A;  4GFR A;  1P99 A;  4EDP A;  1JQF A;  5AA2 A;  5AA3 A;  4GIZ A;  1N76 A;  3K6W A;  5JK4 A;  3PMV A;  3R26 A;  2HFB A;  1T0K A;  4OET A;  3JV9 A;  4LA9 A;  4N07 A;  4OEU A;  5IKB A;  1QVS A;  4OQO A;  3B6T A;  3MPK A;  2OLB A;  4GL0 A;  1ZIU A;  2V3Q A;  3O29 A;  4QSE A;  3C31 A;  2B3B A;  2I3V A;  3EN3 A;  4QFP A;  2PYY A;  3QSL A;  4DCY A;  1IZ1 A;  1I6Q A;  4U4X A;  4DLD A;  3LC8 A;  4Q30 B;  2Z8D A;  4QF9 A;  1IIW A;  2VD2 A;  2DXY A;  5KDT B;  3SEY A;  1A8F A;  2NUV A;  1OLC A;  4R72 A;  4OMB A;  5CBS A;  4EXK A;  3RUM A;  4KQP A;  2XXW A;  3C33 A;  1AIV A;  2DYX A;  4Z7E A;  3CVG A;  4F1Y A;  5CM6 A;  1SI1 A;  2QSX A;  4AB5 A;  1VE4 A;  4YKP A;  3M3K A;  1LST A;  3H4Z A;  4HW8 A;  4HCW A;  3OEM A;  4TLM B;  4R9F A;  2F35 A;  4GF8 A;  3IR1 A;  2XXT A;  4F31 B;  3ECR A;  4NED A;  4BDO A;  1B52 A;  4F3P A;  4IB2 A;  1LB8 A;  1MDQ A;  1Z7M E;  3TTL A;  3B7D A;  4YU0 A;  1BIY A;  3A09 A;  4Q5T A;  2XX9 A;  3D4C A;  2DE3 A;  2RC9 A;  3RGY A;  3KJ7 A;  5HBC A;  3O28 A;  4JSD A;  3CG1 A;  2ZYK A;  3RY3 A;  3OO9 A;  4YKI A;  3TQL A;  2ABH A;  2NWJ A;  4Q8R A;  1A40 A;  1M5F A;  3SKP A;  1B5I A;  4DZ1 A;  4RNS A;  4KD5 A;  1MY3 A;  1FQE A;  4FEC A;  1S9T A;  3IAZ A;  1ELJ A;  4YZZ A;  1M5B A;  3IOT A;  1MY4 A;  3IK6 B;  4NE4 A;  2O68 A;  4LVQ A;  2X7P A;  1B7Z A;  4NWC A;  1DPE A;  4DE8 A;  2Q88 A;  2QMW A;  4ZEB A;  5I59 A;  5CMC A;  1GVC A;  4AB6 A;  2BJJ X;  1KWH A;  2ESN A;  3LR1 A;  1LFG A;  2OZZ A;  5M2V A;  3MW0 A;  4MH5 A;  5ELV A;  4O3A A;  1B5J A;  4MF3 A;  2DWI A;  2F7A A;  4LUB A;  1YCJ A;  1LAH E;  2H98 A;  4RA1 A;  5DEX A;  1FW0 A;  3QK6 A;  2XXV A;  4P0G A;  4QHQ A;  3N94 A;  5L8D A;  4C1U A;  1XHY A;  1Y1M A;  1JET A;  1ZU0 A;  4GRK A;  2DWJ A;  1B32 A;  4U2R A;  1NNF A;  3K6X A;  3O6H A;  1QUK A;  2IEE A;  3EF7 A;  2VD3 A;  3OEK A;  4QFK A;  2O1M A;  2PMS A;  4IGT A;  3QUJ A;  2UYE A;  1A8E A;  2Q9T A;  3OD7 A;  1MQJ A;  5EHM A;  3G3H A;  1D9Y A;  1AH5 A;  5ISU A;  1B3E A;  4ESX A;  3PPO A;  3K4U A;  4ZZE A;  2OK2 A;  1XVY A;  3E3K A;  2LAO A;  1NFT A;  3TTR A;  2REG A;  2X26 A;  4ONY A;  2PVU A;  4THI A;  3T9V A;  1B2H A;  2RCB A;  3K00 A;  5FHN A;  1MG1 A;  2OWT A;  4R2F A;  3F11 A;  1B9J A;  1MH3 A;  1PDA A;  2THI A;  3TZA A;  4ISU A;  5ICT A;  1SW4 A;  3H6W A;  3MVX A;  2VOZ A;  3MWB A;  3S9N C;  1DTG A;  2UVI A;  3K1M A;  5DVJ A;  2A5S A;  3JZJ A;  4NF4 A;  4QFO A;  3FXR A;  3FJM A;  1MPC A;  3TFL A;  4M1V A;  4RYA A;  3I5O A;  3QYT A;  4F29 A;  4I8C A;  1DSN A;  3TCG A;  1IIT A;  4DXU A;  5I56 A;  4ZS9 A;  5I58 A;  2OWS A;  3FV2 A;  2G29 A;  1ATG A;  2Y84 A;  2XX7 A;  3M3F A;  4ELQ A;  1Y3P A;  2DE4 A;  2F7C A;  1LAG E;  1SDX A;  3K6U A;  5H8Q A;  2X7Q A;  3GXA A;  3G3I A;  4YIC A;  3PD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...