4R2FA

Crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
394
structure length
394
Chain Sequence
GAIKFWDMPWATPAYNDAAKKIAEGFSGANSKATYQIIQWNNFYQTFSSAIASKTGPAVSTGGGFQAFQFEEQGQIAYADKVIEKLKSNGQFDDFLPGVVEPFKTSKGYVAVPWQLDIRPLWYRKSLFEKAGVGVPTDWASLLEAGKKLKGVGAVGFATGSGAGNNIGNHLMIMMMLNNGGGVFTKDGELDVLNDRNVEAVEFLLELVSNGVIDPAAVSYTTDNLNAQWKDSKAAYGMLTLGVPERVGDTSGDIVVASPIAGPHGDKAALIFPNNIMMYTNTPSQEASEEFVVYYLGKLKELWQQKLMNALPVFKSITEMPEFTADPNNVKIVNEYVPIAKTFASQGTALSANLAALDGGQALNQFTQTVLTGKTDAKSALTAFDTGLKSVLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein family 1
publication title Crystal structure of sugar transporter ACHL_0255 from Arthrobacter chlorophenolicus, target EFI-510633
rcsb
source organism Arthrobacter chlorophenolicus
molecule tags Transport protein
total genus 135
structure length 394
sequence length 394
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r2fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r2fA02
4G68A 4YAHX 4TLLB 3FD3A 4NWCA 3IOUA 3EHTA 3LR1A 1IQ7A 2QMXA 1TXFA 1F9BA 4YKJA 3TPAA 1PDAA 1B7UA 3FUZA 3H3GA 4ESXA 2GHBA 4OEVA 2XXQA 1A40A 4YMAA 1UTHA 4E0WA 4PFYA 2HZLA 3E4RA 3CFLA 1NNPA 4EQ7A 1LFGA 1SVXB 4O3CA 2PYYA 2LAOA 3W9WA 4HS7A 1A54A 4R2BA 1B32A 1DTGA 3FJ7A 4DDDA 4U23A 3MAMA 4IO7A 1Y4TA 4N13A 3KJ7A 2H4IA 3TCGA 3MPKA 3QSLA 3O6HA 1LAGE 1VSOA 3TTLA 4NF6B 2DVZA 2HCAA 1OVTA 3RUMA 4ELPA 1UIVA 1IITA 1ZJLA 2VOZA 1QKAA 3Q26A 1B05A 1SDXA 3EHUA 2R71A 1US5A 3OEKA 4YZZA 1MQIA 3A09A 2F5XA 2OCUA 3GLBA 1QKBA 2NVUB 1FQDA 5I58A 3T9VA 3UP9A 2Y7WA 4OMBA 2Y7PA 3DP4A 3USDA 4F22A 2NXOA 3UORA 4IO3A 4IGTA 2OLBA 5IAIA 5AA3A 4LZ8A 2QS2A 1FTOA 4OYVA 2AIXA 2DS9A 4YB5A 3MZBA 1GVCA 2F8DA 2CZLA 1H43A 4GXSB 3JZJA 4ZEDA 4WEPA 3E9XA 4M1VA 2O51A 2OWSA 3K6XA 4IB2A 3WAFA 5TU0A 3JYRA 2Z22A 1EZOA 2NWJA 3RT8A 3UK4A 5K2XA 2ZYNA 2ZYMA 3OENA 4ZZAA 2DQVA 4Q8RA 4NF6A 4F1VA 2I49A 3RLFE 4GQOA 2ABHA 3CFZA 2Z23A 1TWYA 3VXBA 5TPAB 2F6GA 3PUZE 3O6GA 4QFKA 5KCJB 3IX1A 1JVXA 2XXVA 1TFAA 2RC8A 3K4UA 4Z7EA 2P2AA 2Q2AA 5HPQA 3IOTA 4KHZE 2XX9A 3U1OA 4KYEA 3G7WA 1SW1A 4FEBA 3SEYA 1JW5A 1P99A 4TLMB 4F18A 3PUXE 1B1XA 3N5LA 3VDFA 1I6AA 1POY1 1MM6A 4XKNA 4JDFA 4XKPA 3G3JA 3IB0A 1SYHA 1P1OA 2D21A 4JSDA 1Y3PA 4NF8B 4F3BA 3H6UA 3KZGA 3WAEA 5FHMA 1LSTA 3MP6A 2O7UA 4G8NA 2QMWA 4F1YA 1HSLA 5AA2D 4I1DA 1EZPA 1PB7A 4ZEKA 2O6AA 2F36A 3A3UA 3K0VA 1B5HA 2NOOA 4H8JA 3E13X 3HV1A 1XOCA 2V93A 3ILUB 5TPAA 1OLAA 5BUUA 4GLIA 2QL3A 1URGA 5KCJA 1MH4A 3OELA 4Q5TA 1RKMA 1OIBA 5CRYA 1NFTA 2O7IA 5H8QA 3O29A 4DCXA 3BBRA 1NH7A 3UA8A 2REGA 2A5TB 5ITOA 2Y7KA 3FJMA 3LSFB 3FXRA 2GH9A 3VLUA 1FQBA 5J1DA 1BIYA 1MXVA 4LZ5A 2ZYKA 3TQWA 3M3KA 1FTLA 1MRPA 3G3HA 3N94A 4FIMA 4MFIA 4NF8A 1EH3A 4F29A 3CSBA 2Q88A 4OFOA 4AQ4A 3PMXA 1ATGA 2F78A 4PFUA 4HCWA 5CC2A 1B3FA 1MQDA 4ZE8A 2PX1A 5F1QA 4BDRA 5JK4A 2ESNA 2Q2CA 4P11A 1FQCA 4HCYA 3LSWA 1MY3A 1MH3A 1VR5A 5AA4A 3GBAA 4ISUA 4NMYA 1NH8A 3M8UA 2VD3A 4GRKA 1OMPA 1B46A 1O7TA 2F97A 4KFQA 4OETA 2I0BA 3FXQA 1P1QA 2Q9TA 3QUJA 2D5WA 2DE2A 2Z8DA 4YICA 1VFEA 3C35A 4H6DA 4R74A 2HXWA 1S7YA 3RT6B 3HCQA 4G68B 4H67A 2B3BA 4MLQA 2AYSA 1N84A 3G3IA 5ELVA 4EQ9A 5TP9B 3FJGA 4FORA 5CMKA 1UTHB 3HHFA 5FTIA 1OLCA 3IJXB 5ICQA 1DMBA 1HSJA 1FCKA 3IOVA 4I62A 3EQ1A 3ILTB 4F19A 2QPQA 3TMGA 4R6HA 4EXLA 1DPPA 2DWHA 1LBBA 3EPEA 2QS4A 1OVBA 1M5FA 3TYHA 2O84X 3A3CA 3RTWB 3TKDA 2XXYA 5L9SA 4LQ2A 1O64A 3V83A 3OO7A 3IO6A 3MPLA 2YLNA 1D9YA 3BKIB 4OFLA 1DSNA 3CG3A 4KCCA 4F39A 2ONSA 3SEUA 3EHSA 4TQUQ 1FQFA 4G8HA 3FVOA 5EHMA 1FTJA 3LUYA 3HPIA 1PB9A 4QSEA 5CI5A 3BFTA 4OQOA 4KPTA 2UXAA 1BLFA 2I4BA 2DXRA 2UYFA 1NL5A 1S9TA 4ZZEA 1JNFA 3I6VA 3SDFA 5TP9A 1YPNA 1CE2A 3VFJA 3O97A 2THIA 1AOVA 2VP1A 1Z7NE 3FV1A 4ELQA 5I84A 1J1NA 3FVNA 2XXUA 2HAVA 2IA4A 3O6IA 2R9JA 5H8HB 3OXNA 1MXWA 1JEUA 1URSA 3OSRA 5KZTA 1SBPA 5K2YA 2UVHA 2E1SA 1LBCA 4WEDA 1TFDA 4JWXA 3IORA 4OEUA 4F31B 2H9BA 5L9MA 3G3GA 3UN6A 3CI8A 1B5JA 4NE4A 4O3AA 1US4A 2PBWA 2O1MA 2XX8A 4ZEBA 3GBBA 3QAXA 4Q30B 1B4ZA 4OERA 2QS1A 4QSDA 4AB5A 3S9NC 2I0CA 4P0GA 3VVFA 5H8FA 1LAFE 4KYSA 3S2VA 4ONYA 4OFJA 1ZTYA 4OWDA 1H3DA 3VVEA 1M5EA 4GVOA 1Y1ZA 3QIMA 3MQ9A 4X1DA 3E3KA 4RJZA 3TUSA 3KSJA 1AH5A 1I69A 4U1OA 2IEEA 1Y3NA 3K2DA 3QXMA 1H44A 3IOWA 2H25A 3D4GA 1JVYA 2F35A 1H45A 5EHSA 5I2KB 3ONMA 4EF1A 4R6YA 4PFTA 5H8HA 3TTNA 1USYH 1FW0A 3N6TA 2ZMBA 2P1SA 2OBGA 3MJNA 2H98A 1NKXA 1B4HA 3VE1B 2OK2A 4ZS9A 2UYEA 1LB9A 1ZIUA 1N76A 3F11A 4HTGA 3VLVA 2F6PA 2UVGA 3PUYE 4ESWA 4IGRA 4MH5A 5FTHA 3RY3A 4QFPA 1MPBA 2CMOA 1Y20A 3U93A 4IO5A 3RN8A 1QULA 3IK6B 2HAUA 1IEJA 2DE4A 5LOMA 4GD5A 2RCAA 1POTA 4HW8A 4PFWA 5H8QB 1O63A 1LAHE 2H5YA 4H65A 1XS5A 4PE5B 5BWJA 3KOTA 4UA8A 3IL1B 2QSXA 3H6VA 3T66A 1URDA 3PD9A 4RA1A 2PVUA 4DIGA 5L9OA 3C34A 3AXFA 2DYXA 1SW4A 5DVFA 2DSFA 4MBPA 4ZEIA 2RCBA 2XD2A 3H6WA 3T96B 3S9MC 5EYFA 2HEUA 1B2HA 3TDJA 1USYE 4OESA 5I2KA 1GTKA 3PPQA 4Q0CA 4EUOA 3C9HA 1LCTA 2ONKE 3K6UA 3DP8A 4IO2A 3KEIA 3TELA 4PP0A 1Q35A 1MS7A 2RINA 1MXUA 3ZS6A 4RK9A 5L8DA 3K1NA 3W15C 2R6GE 1P1UA 2G93A 3H4ZA 3DELB 4F2QA 5AA4B 4H8IA 2YPNA 1CB6A 2XX7A 4H1XA 5FHNA 4NEDA 3S9LC 3Q27A 1LAXA 1XVYA 3V5AA 4H0WA 4R73A 3SETA 1ZKBA 4DXUA 3O66A 3R6UA 4OZ9A 1B40A 4QFLA 2RKMA 2I3VA 2Q89A 1MY0A 1Y4CA 5DVJA 1RYXA 3RPWA 4GXAA 2VHAA 5H8NB 1SYIA 1A55A 4GIZA 1H76A 2P0SA 4NF5B 3LBSA 3IB1A 5A5XB 3SEVA 1MG1A 4NF4B 1LGBC 3ODBA 3H03A 4KR5A 4DLDA 4BLAA 4NWDA 1MPDA 4FE8A 4LONB 3MVXA 3PU5A 3FATA 5CBRA 4KQPA 5I2NA 3HHGA 3PPOA 3LSLA 2I48A 1WVJA 3LC8A 1B3GA 4LQ5A 5AE4A 2I58A 1GV8A 2DWAA 1SW2A 4YKKA 5I56B 4OENA 2FYIA 3QYTA 1LFHA 3TZAA 1QUJA 4GL0A 1JEVA 4RY1A 1N0TA 2V3UA 4I8CA 2UVJA 2Z8EA 4GL8A 3TCFA 2KLFA 3HSTA 1TT1A 3PMVA 5I57B 2ZNTA 5B7DA 3GXAA 5B70A 4JWYA 2XD3A 3B6TA 4YKIA 1JETA 4EQBA 1HSEA 4L17A 3TTMA 4POWA 4FAJA 5H8NA 3ZSFA 3V89B 3N6UA 3B6WA 4NF5A 2QJEA 4EF2A 4QSCA 5A5XA 4GF8A 3T9HB 2B65A 1Y1MA 1IXHA 4NF4A 1NNTA 1T0KA 2OZZA 3MVWA 1MXXA 3BFUA 1B51A 1IXIA 1GR2A 4LVQA 2QRYA 2V3QA 3KN7A 2PT1A 4IO4A 1MXZA 1N7XA 3L6HA 2PMSA 3PPRA 2F7AA 2YJPA 3MWBA 4MLVA 4FECA 1AL3A 2X7PA 4F2OA 3TODA 3OSQA 4ELOA 2I6EA 2X7QA 1LFIA 2D3IA 4XKQA 2AL5A 5JTYB 4DCYA 2Y84A 4LATA 1M5BA 4R9GA 5I56A 3TTRA 3EF7A 2GRVA 1DTZA 3C4MA 4R9FA 3VXCA 1D9VA 1MY2A 2Y7RA 4PETA 3RTFB 1N04A 1SI1A 1FQAA 3U72A 3SKPA 5I57A 4BDOA 1N3WA 3CG1A 4X1BA 3FVKA 3MVYA 1NNKA 5HM4B 5FHOA 2FA7A 3DP6A 1D4NA 1OQHA 3KG2A 1IXCA 3OD7A 4G77A 5H8FB 3D4CA 5DVIA 1ELJA 3T22A 4NTLA 2DE3A 3K6VA 3OEMA 1B6HA 1NMUA 1VFDA 4WXJA 3SERA 1B58A 1IZ1A 3PGFA 3VVDA 3HO7A 5CBSA 1UIUA 3FVGA 3Q25A 4XXUA 2ZXTA 1B5IA 4FJPA 1R6ZA 4U1ZA 1BTJA 5AA2B 4EDPA 5HBCA 4XKRA 3N26A 3ECRA 3MP8A 3DLNA 4K3FA 3TCHA 3K00A 3MZ1A 1PEBA 4N6PA 3IR1A 1II5A 2GFEA 4R75A 4DE8A 1B1HA 5KDTB 1P1NA 4YB7A 4UACA 4C1UA 3VLWA 2OJTA 2HFBA 5JTYA 2O1LA 3U94A 1L5TA 3MUQA 1GGGA 3LSXA 3KOSA 3IJOB 2DOJA 5JEIA 1AIVA 4OTEA 1B52A 1MDP1 3O9PA 4LA9A 5DEXB 1BKAA 2VGQA 3UGWA 4ELRA 1PB8A 3ZKLA 3PUVE 3T9XB 3MC2A 4EXKA 2XXXA 3T9UA 2Q8JA 4KI0E 5I59A 1YTVA 3O2AA 1YAEA 4YKPA 3Q28A 3T93B 1XC1A 1R9QA 4QHQA 4GOTA 3K01A 4FEDA 2HZKA 1AMFA 3U8QA 3C32A 2V3TA 5F7VA 2XXRA 4Z0IA 2DVCA 1ZLQA 2XXPA 4M4GA 2AL4A 3S9EA 1MQHA 5AA2A 2DWJA 1XVXA 4LP2B 1B3EA 3TTKA 3MW0A 2ONRA 4G4PA 4KYDA 3CIJA 4U4SA 3SEXA 2G29A 1JQFA 1Y3QA 5ISUA 3PPNA 3KGCA 5KDTA 3DM0A 2QS3A 3K6WA 1Y9UA 3THIA 4THIA 4BDMA 2I3WA 2B3FA 3HN0A 2F7BA 1A8EA 3QUFA 3OOAA 4F3PA 1BP5A 1EU8A 5DEXA 1MQGA 5H8SA 1MPCA 4ZECA 1I6BA 1N3XA 2NUVA 5CMCA 3C36A 4KCDA 3M3FA 4P0IA 1YCJA 2Y7IA 1MY4A 2F7CA 1B3LA 4QRZA 3M3LA 1EZ9A 3CSGA 3MVZA 3MBPA 4U21A 3OMBA 3IAZA 3H6TA 4ND9A 3SEWA 3JV9A 4DXBA 1SD3A 3KBRA 2H99A 2XXTA 1B0HA 3TAJA 5I2NB 1FQEA 1QUKA 1JW4A 5CMBA 4DZ1A 1ZMGA 3S4UA 4C1TA 4YU0A 1MY1A 3IO4A 4E0XA 4F1UA 4IO6A 3TFLA 3H06B 1B0LA 4POXA 3PV0E 3O28A 1PC3A 1N7WA 2VD2A 4ZEFA 4O3BA 1PBQA 1IUDA 1MQJA 1NNFA 2E0SA 4YB6A 1MDQA 3RNNA 1I6QA 3PD8A 3C33A 3PMWA 1B9JA 3K02A 2UVIA 3CRBA 4N07A 2DP8A 1SQYA 1WODA 3CR9A 4FATA 3G3KA 3K1MA 4R72A 3FV2A 1DOTA 1JW1A 1QW0A 3C31A 2REJA 4RXLA 3OO6A 3OO9A 1RYOA 3B7DA 4LUBA 4F3GA 4QF9A 1B7ZA 3K1PA 1R9LA 1XT8A 3CFXA 2XHDA 3H7MA 3QK6A 1D3KA 2XXHA 1QUIA 3B6QA 5CM6A 5M2VA 3FZVA 4YMBA 2V84A 1S50A 2W7YA 2GHAA 5ITPA 1ZU0A 2WKYA 1Q1KA 3ZKKA 4JB7A 1A8FA 2O69A 2ANJA 1UQWA 1LLSA 4QFNA 4OXVA 4BDQA 2ZNUA 4TOZA 3MZ9A 2RC7A 3KN3A 1IIWA 4ZE9A 2PT2A 1P1WA 1SI0A 4G2ZA 5DT6A 2OWTA 4MF3A 2XXWA 1UTBB 4X48A 4BDLA 2ZNSA 4LZ7A 1FTKA 4BDNA 3RQTA 4DXCA 3TQLA 3PPPA 5DTBA 1B7HA 2DXYA 1R1NA 3EN3A 1Z7ME 2V25A 3GZGA 4C0RA 4H5GA 3Q29A 4RNSA 1ZBMA 2RC9A 3FIRA 1MM7A 2HQ0A 2DWIA 3L6GA 1PBPA 1M5CA 2F34A 3IB2A 2FNCA 2RF1A 3KFMA 3PUWE 4U4XA 1OQGA 4U2RA 4IY6A 4JBZA 2A5TA 2O68A 2ZYOA 3CVGA 1VE4A 4XIGQ 3V8XB 3I5OA 4X9TA 4AB6A 1XHYA 4QFOA 3FXUA 3OO8A 3R7XA 1MXYA 5ICTA 4GWOA 2M8CA 4OHNA 4ZDMA 1QJMA 1LB8A 4G8MA 3TEPA 4JSOA 4RK2A 1ANFA 3U92A 1WDNA 1A7LA 4GFRA 4WKMA 1A99A 1LCFA 1DPEA 4ECFA 3P7IA 3UIFA 3W9VA 3MP1A 3G3FA 2Z8FA 4JXIA 3FASA 5IKBA 4H5FA 2I4CA 3FGSA 4KD5A 3R26A 4PQJA 1UTBA 5AA1A 4R2FA 3SESA 3RGYA 1IXGA 3VV5A 5I59B 4I9DA 4G68C 4RPOA 2BJJX 2XXIA 2X26A 3KJTA 4F3SA 1FTMA 1KWHA 4JWOA 3I3VA 2ALUA 1SW5A 3KN8A 4RPNA 4U22A 4RYAA 5CMMA 4IY5A 3KSXA 4OVJA 2A5SA 1QVSA 5I58B 1M5DA 4XTCQ 4R6KA 5DYHA 1B3HA
chains in the Genus database with same CATH superfamily
2KQZA 4G68A 4YAHX 4TLLB 3FD3A 4NWCA 3IOUA 3EHTA 3LR1A 1IQ7A 5DW8A 4PCDA 3B8BA 2QMXA 1TXFA 1F9BA 2HPGA 4YKJA 5IZ3B 3TPAA 1PDAA 1B7UA 3FUZA 3H3GA 1FJ6A 5IZZA 4P47A 4ESXA 2GHBA 4OEVA 2XXQA 1A40A 4YMAA 1UTHA 4E0WA 1LEVA 4PFYA 2HZLA 3E4RA 3CFLA 1NNPA 4EQ7A 1LFGA 1SVXB 4HE2A 4O3CA 2PYYA 4JVCA 2LAOA 3W9WA 4HS7A 1A54A 4R2BA 1B32A 1DTGA 3FJ7A 4DDDA 4U23A 3MAMA 4IO7A 1Y4TA 4N13A 3KJ7A 2H4IA 3TCGA 2WBBA 3MPKA 3QSLA 3O6HA 1LAGE 1VSOA 3TTLA 4NF6B 2DVZA 2HCAA 1OVTA 3RUMA 4ELPA 1UIVA 1IITA 1ZJLA 2VOZA 1QKAA 2QVUA 3Q26A 1B05A 1SDXA 3EHUA 2R71A 1US5A 2QVRA 3OEKA 4YZZA 1MQIA 3NOHA 3A09A 4GWWA 2F5XA 2OCUA 3GLBA 1QKBA 2NVUB 1FQDA 5I58A 1D9QA 2VPOA 3T9VA 3UP9A 2Y7WA 4OMBA 2Y7PA 3DP4A 3USDA 1FPIA 1FSAA 2NXOA 4F22A 3UORA 4IO3A 4IGTA 2OLBA 5IAIA 5AA3A 4GWXA 4LZ8A 2QS2A 1FTOA 4OYVA 2AIXA 2DS9A 4YB5A 3MZBA 1GVCA 1RDXA 2F8DA 2CZLA 1H43A 1NV0A 2XWOA 3JZJA 4GXSB 3FBPA 4ZEDA 4WEPA 3E9XA 4M1VA 2O51A 2OWSA 3K6XA 4IB2A 3WAFA 5TU0A 3JYRA 2Z22A 1EZOA 4QBAA 2NWJA 1K9ZA 3RT8A 3UK4A 5K2XA 2ZYNA 4PBQA 2ZYMA 3OENA 4ZZAA 2ZZVA 2DQVA 4Q8RA 4NF6A 4F1VA 2I49A 3RLFE 4GQOA 1IMBA 4OA4A 2ABHA 3CFZA 2Z23A 1TWYA 3VXBA 5TPAB 2F6GA 3PUZE 3O6GA 4QFKA 5KCJB 3IX1A 1JVXA 2XXVA 1TFAA 2RC8A 3K4UA 4Z7EA 2P2AA 4MIJA 1KZ8A 2Q2AA 5HPQA 3IOTA 4KHZE 2XX9A 3U1OA 4KYEA 3G7WA 4PGNA 1SW1A 4FEBA 3SEYA 1JW5A 1NV4A 1P99A 4TLMB 1FJ9A 4F18A 3PUXE 1FPDA 1B1XA 3N5LA 3VDFA 4PE3A 1I6AA 1POY1 1MM6A 4H45A 4XKNA 4JDFA 4XKPA 3G3JA 3KC0A 3IB0A 1SYHA 1P1OA 2D21A 3ISPA 1Y3PA 4JSDA 4NF8B 4F3BA 3H6UA 3KZGA 1BK4A 1NV2A 3WAEA 1FBHA 5FHMA 1LSTA 3MP6A 2O7UA 2BJIA 4G8NA 2QMWA 4F1YA 1HSLA 5AA2D 4O8MA 4I1DA 1EZPA 1PB7A 4ZEKA 2O6AA 2F36A 4OVRA 3A3UA 3IFCA 3K0VA 2Y5LA 1LBWA 1B5HA 2NOOA 1LBYA 4H8JA 3E13X 3HV1A 1XOCA 2V93A 3ILUB 5TPAA 1OLAA 5BUUA 4GLIA 2QL3A 1URGA 5KCJA 1MH4A 3OELA 4Q5TA 5ET6A 1RKMA 1OIBA 5CRYA 1NFTA 2O7IA 5H8QA 3O29A 4DCXA 3BBRA 1NH7A 3UA8A 4XFEA 1Q9DA 2REGA 2CZHA 2A5TB 4N6DA 5ITOA 2Y7KA 1FBFA 3FJMA 3LSFB 1CNQA 3FXRA 5I3SA 1FBDA 2GH9A 3VLUA 1FQBA 5J1DA 1BIYA 1MXVA 4LZ5A 2ZYKA 3TQWA 3MYUA 3M3KA 1FTLA 1MRPA 3G3HA 3N94A 4FIMA 4MFIA 4NF8A 1EH3A 4F29A 3CSBA 2Q88A 1IMDA 4OFOA 1DBZA 4AQ4A 3PMXA 1ATGA 2F78A 1G0IA 4PFUA 4HCWA 5ET5A 5CC2A 1B3FA 1MQDA 1NV5A 4ZE8A 3ROJA 2PX1A 5F1QA 4BDRA 5JK4A 2ESNA 2Q2CA 4P11A 1FQCA 1FPBA 4HCYA 3LSWA 1MY3A 1MH3A 1VR5A 5AA4A 3GBAA 4ISUA 4NMYA 1FPGA 2ZZXA 1NH8A 3M8UA 2VD3A 4GRKA 4GWZA 1OMPA 1B46A 1O7TA 2F97A 4KFQA 4OETA 2I0BA 3FXQA 1P1QA 2Q9TA 4NGUA 3QUJA 4AS4A 2D5WA 2DE2A 2Z8DA 4YICA 1VFEA 3C35A 4H6DA 4R74A 2HXWA 1S7YA 3RT6B 3HCQA 4G68B 1LBXA 4H67A 2B3BA 4MLQA 2AYSA 4GX6A 1N84A 3G3IA 5ELVA 4EQ9A 5TP9B 4FBPA 1IMFA 4N91A 1G0HA 3FJGA 4FORA 5CMKA 1UTHB 3HHFA 5FTIA 1OLCA 3IJXB 5ICQA 1DMBA 5ET7A 1HSJA 1FCKA 3IOVA 4I62A 3EQ1A 3ILTB 4O7IA 4F19A 5ET8A 2QPQA 2ZZWA 4N15A 3TMGA 4R6HA 4EXLA 1DPPA 2DWHA 1LBBA 4G61A 3EPEA 2QS4A 1OVBA 1M5FA 3TYHA 2O84X 3A3CA 3RTWB 3TKDA 2XXYA 5L9SA 1NUZA 4LQ2A 1O64A 3V83A 3OO7A 2P3NA 2XXKA 3IO6A 4GBVA 3MPLA 4XTCQ 2YLNA 1D9YA 1DCUA 3BKIB 4OFLA 1DSNA 3CG3A 4KCCA 5IGAA 4AS5A 4F39A 4DI4B 4PF8A 2ONSA 4KXPA 3SEUA 5F24A 3EHSA 4TQUQ 1FPFA 1FQFA 4G8HA 3FVOA 5EHMA 4N81A 1FTJA 3LUYA 3HPIA 1PB9A 4QSEA 5CI5A 3BFTA 4OQOA 4KPTA 4XF5A 2UXAA 1BLFA 4NN3A 2I4BA 2DXRA 2UYFA 1NL5A 1S9TA 4ZZEA 1JNFA 3I6VA 3LUZA 2PFZA 3SDFA 5TP9A 1YPNA 1CE2A 3VFJA 3O97A 2THIA 1AOVA 2VP1A 4NX1A 1Z7NE 3FV1A 4ELQA 4PDHA 5I84A 1J1NA 5I7IA 3FVNA 1NV7A 2XXUA 2HAVA 2IA4A 3O6IA 2R9JA 1FBPA 5H8HB 3OXNA 1MXWA 1JEUA 1FBGA 1XI6A 4GWUA 1URSA 3OSRA 5KZTA 1SBPA 5K2YA 2UVHA 2E1SA 1LBCA 4WEDA 3B50A 1TFDA 4JWXA 3IORA 4OEUA 4F31B 2H9BA 5L9MA 3G3GA 3UN6A 3CI8A 1B5JA 4NE4A 4O3AA 1US4A 2PBWA 2O1MA 4GX4A 2XX8A 2Q8MA 4ZEBA 3GBBA 3QAXA 4Q30B 1B4ZA 3E78A 4OERA 2R8TA 2QS1A 4QSDA 4AB5A 3S9NC 4P9KA 2I0CA 4P0GA 3VVFA 5H8FA 1LAFE 4KYSA 4OVSA 3S2VA 5IZ1A 4ONYA 4OFJA 1ZTYA 4OWDA 1H3DA 3VVEA 1M5EA 4GVOA 4JVDA 1Y1ZA 1KA0A 3QIMA 3MQ9A 4PDDA 4X1DA 3E3KA 4RJZA 3TUSA 3CHGA 3KSJA 1AH5A 1I69A 4U1OA 2IEEA 1Y3NA 3K2DA 3QXMA 1H44A 3IOWA 2H25A 4NF0A 3D4GA 1IMAA 1JVYA 2F35A 1H45A 1YZ0A 5EHSA 5I2KB 5A5LA 3ONMA 4EF1A 4R6YA 4PFTA 5H8HA 3TTNA 4NQ8A 2JJKA 1USYH 1FW0A 3N6TA 2ZMBA 2P1SA 2OBGA 3MJNA 2H98A 1NKXA 1B4HA 3VE1B 2OK2A 4ZS9A 2UYEA 1LB9A 1ZIUA 1N76A 3F11A 4HTGA 4MJOA 3VLVA 2F6PA 4MNIA 2UVGA 3PUYE 4ESWA 4IGRA 4MH5A 3U65A 5FTHA 3RY3A 4QFPA 1MPBA 2CMOA 3A29A 1Y20A 3U93A 4IO5A 3RN8A 1QULA 3IK6B 2HAUA 1IEJA 4GWSA 2DE4A 5LOMA 3GYYA 5EQ9A 4GD5A 2RCAA 1POTA 4HXVA 4HW8A 4PFWA 3KBZA 5H8QB 1O63A 1LAHE 2WYKA 2H5YA 4H65A 1XS5A 4PE5B 5BWJA 3KOTA 3RYDA 4UA8A 3IL1B 2QSXA 3H6VA 3T66A 1URDA 4OVPA 3KC1A 3PD9A 4RA1A 2PVUA 4DIGA 5L9OA 3C34A 1RDZA 3AXFA 2DYXA 1SW4A 5LTCA 5DVFA 2DSFA 4MBPA 4ZEIA 2RCBA 2XD2A 3H6WA 3T96B 3S9MC 5EYFA 2HEUA 1B2HA 4P8BA 3TDJA 1USYE 4OESA 5I2KA 1GTKA 3PPQA 4Q0CA 3C9HA 4EUOA 1LCTA 2ONKE 3K6UA 3DP8A 4IO2A 3KEIA 3TELA 4PP0A 1Q35A 1MS7A 2RINA 1MXUA 1NUXA 3ZS6A 4RK9A 5L8DA 3K1NA 3W15C 2R6GE 1P1UA 2DDKA 2G93A 3H4ZA 3DELB 4F2QA 5AA4B 4H8IA 2YPNA 1CB6A 2XX7A 4H1XA 5FHNA 4NEDA 4PAFA 3S9LC 3Q27A 1SPIA 1LAXA 1XVYA 3V5AA 4H0WA 4R73A 3SETA 1ZKBA 4DXUA 5EYGA 3O66A 3R6UA 4OZ9A 1B40A 4PAKA 4QFLA 2RKMA 2I3VA 2Q89A 1MY0A 1Y4CA 1K9YA 5DVJA 1RYXA 3RPWA 4GXAA 2VHAA 5H8NB 1SYIA 1A55A 4GIZA 1H76A 1EYJA 2P0SA 4PBHA 4NF5B 2GQ1A 2CZKA 3LBSA 3IB1A 5A5XB 2B4MA 3SEVA 1MG1A 4NF4B 1LGBC 3ODBA 3H03A 4KR5A 4DLDA 4BLAA 4NWDA 1MPDA 4FE8A 4LONB 3MVXA 3PU5A 4PFRA 3FATA 5CBRA 4KQPA 5I2NA 5ESYA 3HHGA 1EYKA 3PPOA 3LSLA 2I48A 4N6KA 1WVJA 3LC8A 1B3GA 4LQ5A 5AE4A 2P3VA 2I58A 1GV8A 1VDWA 2DWAA 1SW2A 4YKKA 5I56B 4OENA 2FYIA 2WEFA 3QYTA 1LFHA 3TZAA 1QUJA 4GL0A 1JEVA 4RY1A 1N0TA 2V3UA 2FHYA 4I8CA 2VPNA 2UVJA 2Z8EA 4GL8A 3TCFA 2WBDA 2KLFA 3HSTA 1TT1A 3PMVA 5I57B 2ZNTA 5B7DA 4I3YA 3GXAA 5B70A 4JWYA 2XD3A 4P1LA 3B6TA 4YKIA 1JETA 4EQBA 1YXIA 4GX3A 1HSEA 4L17A 3TTMA 4POWA 1NV6A 4FAJA 5H8NA 3ZSFA 1NV3A 4GBWA 3V89B 3N6UA 3B6WA 4NF5A 2QJEA 4EF2A 4QSCA 5A5XA 4GF8A 3T9HB 2B65A 1Y1MA 1IXHA 4NF4A 1NNTA 1T0KA 2OZZA 3MVWA 1MXXA 3BFUA 2CZIA 1B51A 1IXIA 1GR2A 4LVQA 4PFIA 2QRYA 2V3QA 3KN7A 2PT1A 4IO4A 1MXZA 1N7XA 3L6HA 4N8YA 2PMSA 3PPRA 2F7AA 2YJPA 3MWBA 4MLVA 4FECA 1AL3A 5I5PA 2X7PA 4F2OA 5FBPA 3TODA 3OSQA 4ELOA 2L5VA 2I6EA 2X7QA 1NUWA 1LFIA 2D3IA 4XKQA 2AL5A 5JTYB 4N8GA 4DCYA 2Y84A 4LATA 1M5BA 4R9GA 5I56A 3D1RA 3TTRA 2GRVA 1DTZA 3C4MA 4R9FA 3VXCA 1D9VA 1MY2A 2Y7RA 3BIGA 4MX6A 4PETA 3RTFB 2V4CA 4H46A 1N04A 1SI1A 1FPKA 1FQAA 3U72A 3SKPA 5I57A 4BDOA 1N3WA 3CG1A 4X1BA 1KA1A 3FVKA 3MVYA 1NNKA 5HM4B 5FHOA 2FA7A 1FBCA 3DP6A 1D4NA 1OQHA 3KG2A 1IXCA 3OD7A 4G77A 5H8FB 2F3BA 3D4CA 5EQ7A 5DVIA 1ELJA 3T22A 4NTLA 2DE3A 3K6VA 3OEMA 1B6HA 1NMUA 1VFDA 1FPLA 4WXJA 3SERA 4P3LA 1B58A 1IZ1A 3PGFA 3VVDA 3HO7A 5CBSA 1UIUA 3FVGA 3Q25A 4XXUA 2ZXTA 3RPLB 1B5IA 4FJPA 3QMFA 1R6ZA 4PAIA 2WX9A 4U1ZA 4NAPA 2Q74A 5EQ8A 1BTJA 5AA2B 4EDPA 2XWKA 5HBCA 2FBPA 4XKRA 3N26A 3ECRA 3MP8A 3DLNA 1LBZA 4K3FA 3TCHA 3K00A 3MZ1A 1PEBA 4N6PA 4MCOA 3IR1A 1II5A 2GFEA 4R75A 4DE8A 1B1HA 4O7MA 5KDTB 1P1NA 4YB7A 4UACA 4C1UA 3VLWA 2OJTA 2HFBA 5JTYA 2O1LA 3U94A 1L5TA 3MUQA 1GGGA 4MMPA 3LSXA 3KOSA 3IJOB 2DOJA 5JEIA 1AIVA 4OTEA 1B52A 1MDP1 3O9PA 4LA9A 5DEXB 1BKAA 2VGQA 3UGWA 4ELRA 1PB8A 3ZKLA 3PUVE 3T9XB 3MC2A 4EXKA 2XXXA 3T9UA 2Q8JA 4KI0E 5I59A 1YTVA 3O2AA 1YAEA 4YKPA 3Q28A 3T93B 1XC1A 1R9QA 4QHQA 4PGPA 4GOTA 4P56A 5LDZA 3K01A 4FEDA 2PCRA 2HZKA 4GWYA 1AMFA 3U8QA 3C32A 3RPLA 2V3TA 5F7VA 2XXRA 4Z0IA 2DVCA 1ZLQA 2XXPA 4M4GA 2AL4A 3S9EA 1MQHA 5AA2A 2DWJA 1XVXA 4LP2B 1B3EA 3TTKA 2HXRA 3MW0A 2ONRA 4G4PA 4KYDA 5T3JA 3CIJA 4U4SA 3SEXA 2G29A 1JQFA 5IZ3A 1Y3QA 5ISUA 3PPNA 3KGCA 5KDTA 3DM0A 2QS3A 4HE0A 3K6WA 1FRPA 1Y9UA 3THIA 4THIA 4BDMA 2QVVA 2I3WA 5J16A 2B3FA 3HN0A 4X8RA 2F7BA 4NHBA 1A8EA 3QUFA 3OOAA 4F3PA 2XWIA 1BP5A 1EU8A 5DEXA 1MQGA 5H8SA 1AWBA 2PFYA 1MPCA 4ZECA 4I40A 5EYHA 1I6BA 1N3XA 4P1EA 2NUVA 5CMCA 3C36A 4KCDA 3M3FA 4P0IA 1YCJA 2Y7IA 1MY4A 2F7CA 1B3LA 4QRZA 3M3LA 1EZ9A 3CSGA 3MVZA 1FBEA 3MBPA 4U21A 3OMBA 3IAZA 3H6TA 4ND9A 3SEWA 3JV9A 4DXBA 1SD3A 3KBRA 1EYIA 2H99A 2XXTA 1B0HA 3TAJA 5I2NB 2Y5KA 1FQEA 1QUKA 1JW4A 5CMBA 2MKZA 4DZ1A 1ZMGA 3S4UA 4C1TA 4YU0A 1MY1A 3IO4A 4E0XA 4F1UA 4IO6A 3TFLA 3H06B 1B0LA 4POXA 4MHFA 3PV0E 3O28A 3LV0A 2OX3A 1PC3A 4XEQA 1N7WA 2VD2A 4ZEFA 4MNCA 4MEVA 4O3BA 4O94A 1PBQA 1IUDA 1MQJA 1NNFA 2E0SA 1INPA 1JP4A 4YB6A 1MDQA 1RDYA 2VT5A 3RNNA 1I6QA 3SZPA 3PD8A 5IM2A 3C33A 3PMWA 1B9JA 3K02A 2UVIA 2F3DA 4IR8A 3CRBA 4N07A 1NI9A 4PF6A 2DP8A 1SQYA 1WODA 3CR9A 4FATA 3G3KA 2CEYA 3K1MA 4R72A 3FV2A 1DOTA 1JW1A 1QW0A 1LBVA 2REJA 3C31A 4RXLA 3OO6A 2FIEA 3OO9A 1RYOA 4PFBA 3B7DA 4LUBA 4F3GA 4QF9A 1B7ZA 3K1PA 1R9LA 1XT8A 3CFXA 4LN5A 2XHDA 3H7MA 3QK6A 1D3KA 2XXHA 1QUIA 3B6QA 5CM6A 5M2VA 3FZVA 4YMBA 2V84A 1S50A 2W7YA 2FVZA 2GHAA 3E79A 5ITPA 1ZU0A 2WKYA 1Q1KA 3ZKKA 4JB7A 1A8FA 2O69A 2ANJA 1UQWA 1LLSA 3T1BA 3BIHA 4N4UA 4QFNA 4OXVA 2KR0A 4BDQA 2FIXA 2ZNUA 4TOZA 3MZ9A 2OWZA 2RC7A 3KN3A 4N17A 1IIWA 4ZE9A 2PT2A 1P1WA 1FPEA 1SI0A 4G2ZA 5DT6A 2OWTA 2XA5A 4MF3A 2XXWA 1UTBB 4X48A 4BDLA 2ZNSA 4LZ7A 1FTKA 4BDNA 3RQTA 2HHMA 2B4LA 4DXCA 4QXDA 3TQLA 3PPPA 5DTBA 1B7HA 2DXYA 1R1NA 3EN3A 1Z7ME 2V25A 3GZGA 4C0RA 4H5GA 3Q29A 4RNSA 1DK4A 4OVQA 4OVTA 1ZBMA 2RC9A 3FIRA 1MM7A 2QFLA 2CEXA 2HQ0A 2DWIA 4HE1A 4NG7A 3L6GA 1PBPA 1M5CA 2F34A 3IB2A 2FNCA 2RF1A 3KFMA 5EQAA 1IMCA 3PUWE 4U4XA 3MSTA 1OQGA 4U2RA 4IY6A 4JBZA 2A5TA 2O68A 2ZYOA 3CVGA 1VE4A 4XIGQ 1NV1A 3V8XB 3I5OA 4X9TA 4AB6A 1XHYA 4QFOA 3FXUA 3T0JA 3OO8A 3R7XA 1MXYA 1YYZA 5ICTA 1IMEA 4GWOA 2M8CA 1FTAA 4OHNA 4ZDMA 1QJMA 1FPJA 1LB8A 4G8MA 3TEPA 4JSOA 4OANA 4RK2A 1ANFA 3U92A 1WDNA 1A7LA 4GFRA 4WKMA 1A99A 1LCFA 1DPEA 4ECFA 3P7IA 3UIFA 3W9VA 3MP1A 3G3FA 2Z8FA 4JXIA 3FASA 4JVIA 4MNPA 4I3EA 5IKBA 4H5FA 2I4CA 3FGSA 4KD5A 3R26A 4PQJA 1UTBA 5AA1A 4R2FA 3SESA 3RGYA 1IXGA 4PTKA 3VV5A 5I59B 3IFAA 4I9DA 1NUYA 4G68C 1QGXA 4PC9A 4RPOA 3HFUA 2BJJX 2XXIA 2X26A 2XWVA 3EKIA 3KJTA 4F3SA 1FTMA 1KWHA 3FXBA 4JWOA 3I3VA 4MAGA 2ALUA 4UABA 1SW5A 3KN8A 4RPNA 4U22A 4RYAA 2WYPA 5CMMA 4IY5A 3KSXA 4OVJA 4X04A 2A5SA 3PTYA 1QVSA 5I58B 1M5DA 4DI3D 3EF7A 4R6KA 5DYHA 1B3HA
chains in the Genus database with same CATH topology
4G68A 4YAHX 4TLLB 3FD3A 4NWCA 3IOUA 3EHTA 3LR1A 1IQ7A 2QMXA 1TXFA 1F9BA 4YKJA 3TPAA 1PDAA 1B7UA 3FUZA 3H3GA 4ESXA 2GHBA 4OEVA 2XXQA 1A40A 4YMAA 1UTHA 4E0WA 4PFYA 2HZLA 3E4RA 3CFLA 1NNPA 4EQ7A 1LFGA 1SVXB 4O3CA 2PYYA 2LAOA 3W9WA 4HS7A 1A54A 4R2BA 1B32A 1DTGA 3FJ7A 4DDDA 4U23A 3MAMA 4IO7A 1Y4TA 4N13A 3KJ7A 2H4IA 3TCGA 3MPKA 3QSLA 3O6HA 1LAGE 1VSOA 3TTLA 4NF6B 2DVZA 2HCAA 1OVTA 3RUMA 4ELPA 1UIVA 1IITA 1ZJLA 2VOZA 1QKAA 3Q26A 1B05A 1SDXA 3EHUA 2R71A 1US5A 3OEKA 4YZZA 1MQIA 3A09A 2F5XA 2OCUA 3GLBA 1QKBA 2NVUB 1FQDA 5I58A 3T9VA 3UP9A 2Y7WA 4OMBA 2Y7PA 3DP4A 3USDA 4F22A 2NXOA 3UORA 4IO3A 4IGTA 2OLBA 5IAIA 5AA3A 4LZ8A 2QS2A 1FTOA 4OYVA 2AIXA 2DS9A 4YB5A 3MZBA 1GVCA 2F8DA 2CZLA 1H43A 4GXSB 3JZJA 4ZEDA 4WEPA 3E9XA 4M1VA 2O51A 2OWSA 3K6XA 4IB2A 3WAFA 5TU0A 3JYRA 2Z22A 1EZOA 2NWJA 3RT8A 3UK4A 5K2XA 2ZYNA 2ZYMA 3OENA 4ZZAA 2DQVA 4Q8RA 4NF6A 4F1VA 2I49A 3RLFE 4GQOA 2ABHA 3CFZA 2Z23A 1TWYA 3VXBA 5TPAB 2F6GA 3PUZE 3O6GA 4QFKA 5KCJB 3IX1A 1JVXA 2XXVA 1TFAA 2RC8A 3K4UA 4Z7EA 2P2AA 2Q2AA 5HPQA 3IOTA 4KHZE 2XX9A 3U1OA 4KYEA 3G7WA 1SW1A 4FEBA 3SEYA 1JW5A 1P99A 4TLMB 4F18A 3PUXE 1B1XA 3N5LA 3VDFA 1I6AA 1POY1 1MM6A 4XKNA 4JDFA 4XKPA 3G3JA 3IB0A 1SYHA 1P1OA 2D21A 4JSDA 1Y3PA 4NF8B 4F3BA 3H6UA 3KZGA 3WAEA 5FHMA 1LSTA 3MP6A 2O7UA 4G8NA 2QMWA 4F1YA 1HSLA 5AA2D 4I1DA 1EZPA 1PB7A 4ZEKA 2O6AA 2F36A 3A3UA 3K0VA 1B5HA 2NOOA 4H8JA 3E13X 3HV1A 1XOCA 2V93A 3ILUB 5TPAA 1OLAA 5BUUA 4GLIA 2QL3A 1URGA 5KCJA 1MH4A 3OELA 4Q5TA 1RKMA 1OIBA 5CRYA 1NFTA 2O7IA 5H8QA 3O29A 4DCXA 3BBRA 1NH7A 3UA8A 2REGA 2A5TB 5ITOA 2Y7KA 3FJMA 3LSFB 3FXRA 2GH9A 3VLUA 1FQBA 5J1DA 1BIYA 1MXVA 4LZ5A 2ZYKA 3TQWA 3M3KA 1FTLA 1MRPA 3G3HA 3N94A 4FIMA 4MFIA 4NF8A 1EH3A 4F29A 3CSBA 2Q88A 4OFOA 4AQ4A 3PMXA 1ATGA 2F78A 4PFUA 4HCWA 5CC2A 1B3FA 1MQDA 4ZE8A 2PX1A 5F1QA 4BDRA 5JK4A 2ESNA 2Q2CA 4P11A 1FQCA 4HCYA 3LSWA 1MY3A 1MH3A 1VR5A 5AA4A 3GBAA 4ISUA 4NMYA 1NH8A 3M8UA 2VD3A 4GRKA 1OMPA 1B46A 1O7TA 2F97A 4KFQA 4OETA 2I0BA 3FXQA 1P1QA 2Q9TA 3QUJA 2D5WA 2DE2A 2Z8DA 4YICA 1VFEA 3C35A 4H6DA 4R74A 2HXWA 1S7YA 3RT6B 3HCQA 4G68B 4H67A 2B3BA 4MLQA 2AYSA 1N84A 3G3IA 5ELVA 4EQ9A 5TP9B 3FJGA 4FORA 5CMKA 1UTHB 3HHFA 5FTIA 1OLCA 3IJXB 5ICQA 1DMBA 1HSJA 1FCKA 3IOVA 4I62A 3EQ1A 3ILTB 4F19A 2QPQA 3TMGA 4R6HA 4EXLA 1DPPA 2DWHA 1LBBA 3EPEA 2QS4A 1OVBA 1M5FA 3TYHA 2O84X 3A3CA 3RTWB 3TKDA 2XXYA 5L9SA 4LQ2A 1O64A 3V83A 3OO7A 3IO6A 3MPLA 2YLNA 1D9YA 3BKIB 4OFLA 1DSNA 3CG3A 4KCCA 4F39A 2ONSA 3SEUA 3EHSA 4TQUQ 1FQFA 4G8HA 3FVOA 5EHMA 1FTJA 3LUYA 3HPIA 1PB9A 4QSEA 5CI5A 3BFTA 4OQOA 4KPTA 2UXAA 1BLFA 2I4BA 2DXRA 2UYFA 1NL5A 1S9TA 4ZZEA 1JNFA 3I6VA 3SDFA 5TP9A 1YPNA 1CE2A 3VFJA 3O97A 2THIA 1AOVA 2VP1A 1Z7NE 3FV1A 4ELQA 5I84A 1J1NA 3FVNA 2XXUA 2HAVA 2IA4A 3O6IA 2R9JA 5H8HB 3OXNA 1MXWA 1JEUA 1URSA 3OSRA 5KZTA 1SBPA 5K2YA 2UVHA 2E1SA 1LBCA 4WEDA 1TFDA 4JWXA 3IORA 4OEUA 4F31B 2H9BA 5L9MA 3G3GA 3UN6A 3CI8A 1B5JA 4NE4A 4O3AA 1US4A 2PBWA 2O1MA 2XX8A 4ZEBA 3GBBA 3QAXA 4Q30B 1B4ZA 4OERA 2QS1A 4QSDA 4AB5A 3S9NC 2I0CA 4P0GA 3VVFA 5H8FA 1LAFE 4KYSA 3S2VA 4ONYA 4OFJA 1ZTYA 4OWDA 1H3DA 3VVEA 1M5EA 4GVOA 1Y1ZA 3QIMA 3MQ9A 4X1DA 3E3KA 4RJZA 3TUSA 3KSJA 1AH5A 1I69A 4U1OA 2IEEA 1Y3NA 3K2DA 3QXMA 1H44A 3IOWA 2H25A 3D4GA 1JVYA 2F35A 1H45A 5EHSA 5I2KB 3ONMA 4EF1A 4R6YA 4PFTA 5H8HA 3TTNA 1USYH 1FW0A 3N6TA 2ZMBA 2P1SA 2OBGA 3MJNA 2H98A 1NKXA 1B4HA 3VE1B 2OK2A 4ZS9A 2UYEA 1LB9A 1ZIUA 1N76A 3F11A 4HTGA 3VLVA 2F6PA 2UVGA 3PUYE 4ESWA 4IGRA 4MH5A 5FTHA 3RY3A 4QFPA 1MPBA 2CMOA 1Y20A 3U93A 4IO5A 3RN8A 1QULA 3IK6B 2HAUA 1IEJA 2DE4A 5LOMA 4GD5A 2RCAA 1POTA 4HW8A 4PFWA 5H8QB 1O63A 1LAHE 2H5YA 4H65A 1XS5A 4PE5B 5BWJA 3KOTA 4UA8A 3IL1B 2QSXA 3H6VA 3T66A 1URDA 3PD9A 4RA1A 2PVUA 4DIGA 5L9OA 3C34A 3AXFA 2DYXA 1SW4A 5DVFA 2DSFA 4MBPA 4ZEIA 2RCBA 2XD2A 3H6WA 3T96B 3S9MC 5EYFA 2HEUA 1B2HA 3TDJA 1USYE 4OESA 5I2KA 1GTKA 3PPQA 4Q0CA 4EUOA 3C9HA 1LCTA 2ONKE 3K6UA 3DP8A 4IO2A 3KEIA 3TELA 4PP0A 1Q35A 1MS7A 2RINA 1MXUA 3ZS6A 4RK9A 5L8DA 3K1NA 3W15C 2R6GE 1P1UA 2G93A 3H4ZA 3DELB 4F2QA 5AA4B 4H8IA 2YPNA 1CB6A 2XX7A 4H1XA 5FHNA 4NEDA 3S9LC 3Q27A 1LAXA 1XVYA 3V5AA 4H0WA 4R73A 3SETA 1ZKBA 4DXUA 3O66A 3R6UA 4OZ9A 1B40A 4QFLA 2RKMA 2I3VA 2Q89A 1MY0A 1Y4CA 5DVJA 1RYXA 3RPWA 4GXAA 2VHAA 5H8NB 1SYIA 1A55A 4GIZA 1H76A 2P0SA 4NF5B 3LBSA 3IB1A 5A5XB 3SEVA 1MG1A 4NF4B 1LGBC 3ODBA 3H03A 4KR5A 4DLDA 4BLAA 4NWDA 1MPDA 4FE8A 4LONB 3MVXA 3PU5A 3FATA 5CBRA 4KQPA 5I2NA 3HHGA 3PPOA 3LSLA 2I48A 1WVJA 3LC8A 1B3GA 4LQ5A 5AE4A 2I58A 1GV8A 2DWAA 1SW2A 4YKKA 5I56B 4OENA 2FYIA 3QYTA 1LFHA 3TZAA 1QUJA 4GL0A 1JEVA 4RY1A 1N0TA 2V3UA 4I8CA 2UVJA 2Z8EA 4GL8A 3TCFA 2KLFA 3HSTA 1TT1A 3PMVA 5I57B 2ZNTA 5B7DA 3GXAA 5B70A 4JWYA 2XD3A 3B6TA 4YKIA 1JETA 4EQBA 1HSEA 4L17A 3TTMA 4POWA 4FAJA 5H8NA 3ZSFA 3V89B 3N6UA 3B6WA 4NF5A 2QJEA 4EF2A 4QSCA 5A5XA 4GF8A 3T9HB 2B65A 1Y1MA 1IXHA 4NF4A 1NNTA 1T0KA 2OZZA 3MVWA 1MXXA 3BFUA 1B51A 1IXIA 1GR2A 4LVQA 2QRYA 2V3QA 3KN7A 2PT1A 4IO4A 1MXZA 1N7XA 3L6HA 2PMSA 3PPRA 2F7AA 2YJPA 3MWBA 4MLVA 4FECA 1AL3A 2X7PA 4F2OA 3TODA 3OSQA 4ELOA 2I6EA 2X7QA 1LFIA 2D3IA 4XKQA 2AL5A 5JTYB 4DCYA 2Y84A 4LATA 1M5BA 4R9GA 5I56A 3TTRA 3EF7A 2GRVA 1DTZA 3C4MA 4R9FA 3VXCA 1D9VA 1MY2A 2Y7RA 4PETA 3RTFB 1N04A 1SI1A 1FQAA 3U72A 3SKPA 5I57A 4BDOA 1N3WA 3CG1A 4X1BA 3FVKA 3MVYA 1NNKA 5HM4B 5FHOA 2FA7A 3DP6A 1D4NA 1OQHA 3KG2A 1IXCA 3OD7A 4G77A 5H8FB 3D4CA 5DVIA 1ELJA 3T22A 4NTLA 2DE3A 3K6VA 3OEMA 1B6HA 1NMUA 1VFDA 4WXJA 3SERA 1B58A 1IZ1A 3PGFA 3VVDA 3HO7A 5CBSA 1UIUA 3FVGA 3Q25A 4XXUA 2ZXTA 1B5IA 4FJPA 1R6ZA 4U1ZA 1BTJA 5AA2B 4EDPA 5HBCA 4XKRA 3N26A 3ECRA 3MP8A 3DLNA 4K3FA 3TCHA 3K00A 3MZ1A 1PEBA 4N6PA 3IR1A 1II5A 2GFEA 4R75A 4DE8A 1B1HA 5KDTB 1P1NA 4YB7A 4UACA 4C1UA 3VLWA 2OJTA 2HFBA 5JTYA 2O1LA 3U94A 1L5TA 3MUQA 1GGGA 3LSXA 3KOSA 3IJOB 2DOJA 5JEIA 1AIVA 4OTEA 1B52A 1MDP1 3O9PA 4LA9A 5DEXB 1BKAA 2VGQA 3UGWA 4ELRA 1PB8A 3ZKLA 3PUVE 3T9XB 3MC2A 4EXKA 2XXXA 3T9UA 2Q8JA 4KI0E 5I59A 1YTVA 3O2AA 1YAEA 4YKPA 3Q28A 3T93B 1XC1A 1R9QA 4QHQA 4GOTA 3K01A 4FEDA 2HZKA 1AMFA 3U8QA 3C32A 2V3TA 5F7VA 2XXRA 4Z0IA 2DVCA 1ZLQA 2XXPA 4M4GA 2AL4A 3S9EA 1MQHA 5AA2A 2DWJA 1XVXA 4LP2B 1B3EA 3TTKA 3MW0A 2ONRA 4G4PA 4KYDA 3CIJA 4U4SA 3SEXA 2G29A 1JQFA 1Y3QA 5ISUA 3PPNA 3KGCA 5KDTA 3DM0A 2QS3A 3K6WA 1Y9UA 3THIA 4THIA 4BDMA 2I3WA 2B3FA 3HN0A 2F7BA 1A8EA 3QUFA 3OOAA 4F3PA 1BP5A 1EU8A 5DEXA 1MQGA 5H8SA 1MPCA 4ZECA 1I6BA 1N3XA 2NUVA 5CMCA 3C36A 4KCDA 3M3FA 4P0IA 1YCJA 2Y7IA 1MY4A 2F7CA 1B3LA 4QRZA 3M3LA 1EZ9A 3CSGA 3MVZA 3MBPA 4U21A 3OMBA 3IAZA 3H6TA 4ND9A 3SEWA 3JV9A 4DXBA 1SD3A 3KBRA 2H99A 2XXTA 1B0HA 3TAJA 5I2NB 1FQEA 1QUKA 1JW4A 5CMBA 4DZ1A 1ZMGA 3S4UA 4C1TA 4YU0A 1MY1A 3IO4A 4E0XA 4F1UA 4IO6A 3TFLA 3H06B 1B0LA 4POXA 3PV0E 3O28A 1PC3A 1N7WA 2VD2A 4ZEFA 4O3BA 1PBQA 1IUDA 1MQJA 1NNFA 2E0SA 4YB6A 1MDQA 3RNNA 1I6QA 3PD8A 3C33A 3PMWA 1B9JA 3K02A 2UVIA 3CRBA 4N07A 2DP8A 1SQYA 1WODA 3CR9A 4FATA 3G3KA 3K1MA 4R72A 3FV2A 1DOTA 1JW1A 1QW0A 3C31A 2REJA 4RXLA 3OO6A 3OO9A 1RYOA 3B7DA 4LUBA 4F3GA 4QF9A 1B7ZA 3K1PA 1R9LA 1XT8A 3CFXA 2XHDA 3H7MA 3QK6A 1D3KA 2XXHA 1QUIA 3B6QA 5CM6A 5M2VA 3FZVA 4YMBA 2V84A 1S50A 2W7YA 2GHAA 5ITPA 1ZU0A 2WKYA 1Q1KA 3ZKKA 4JB7A 1A8FA 2O69A 2ANJA 1UQWA 1LLSA 4QFNA 4OXVA 4BDQA 2ZNUA 4TOZA 3MZ9A 2RC7A 3KN3A 1IIWA 4ZE9A 2PT2A 1P1WA 1SI0A 4G2ZA 5DT6A 2OWTA 4MF3A 2XXWA 1UTBB 4X48A 4BDLA 2ZNSA 4LZ7A 1FTKA 4BDNA 3RQTA 4DXCA 3TQLA 3PPPA 5DTBA 1B7HA 2DXYA 1R1NA 3EN3A 1Z7ME 2V25A 3GZGA 4C0RA 4H5GA 3Q29A 4RNSA 1ZBMA 2RC9A 3FIRA 1MM7A 2HQ0A 2DWIA 3L6GA 1PBPA 1M5CA 2F34A 3IB2A 2FNCA 2RF1A 3KFMA 3PUWE 4U4XA 1OQGA 4U2RA 4IY6A 4JBZA 2A5TA 2O68A 2ZYOA 3CVGA 1VE4A 4XIGQ 3V8XB 3I5OA 4X9TA 4AB6A 1XHYA 4QFOA 3FXUA 3OO8A 3R7XA 1MXYA 5ICTA 4GWOA 2M8CA 4OHNA 4ZDMA 1QJMA 1LB8A 4G8MA 3TEPA 4JSOA 4RK2A 1ANFA 3U92A 1WDNA 1A7LA 4GFRA 4WKMA 1A99A 1LCFA 1DPEA 4ECFA 3P7IA 3UIFA 3W9VA 3MP1A 3G3FA 2Z8FA 4JXIA 3FASA 5IKBA 4H5FA 2I4CA 3FGSA 4KD5A 3R26A 4PQJA 1UTBA 5AA1A 4R2FA 3SESA 3RGYA 1IXGA 3VV5A 5I59B 4I9DA 4G68C 4RPOA 2BJJX 2XXIA 2X26A 3KJTA 4F3SA 1FTMA 1KWHA 4JWOA 3I3VA 2ALUA 1SW5A 3KN8A 4RPNA 4U22A 4RYAA 5CMMA 4IY5A 3KSXA 4OVJA 2A5SA 1QVSA 5I58B 1M5DA 4XTCQ 4R6KA 5DYHA 1B3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G68 A;  4YAH X;  4TLL B;  3FD3 A;  4NWC A;  3IOU A;  3EHT A;  3LR1 A;  1IQ7 A;  2QMX A;  1TXF A;  1F9B A;  4YKJ A;  3TPA A;  1PDA A;  1B7U A;  3FUZ A;  3H3G A;  4ESX A;  2GHB A;  4OEV A;  2XXQ A;  1A40 A;  4YMA A;  1UTH A;  4E0W A;  4PFY A;  2HZL A;  3E4R A;  3CFL A;  1NNP A;  4EQ7 A;  1LFG A;  1SVX B;  4O3C A;  2PYY A;  2LAO A;  3W9W A;  4HS7 A;  1A54 A;  4R2B A;  1B32 A;  1DTG A;  3FJ7 A;  4DDD A;  4U23 A;  3MAM A;  4IO7 A;  1Y4T A;  4N13 A;  3KJ7 A;  2H4I A;  3TCG A;  3MPK A;  3QSL A;  3O6H A;  1LAG E;  1VSO A;  3TTL A;  4NF6 B;  2DVZ A;  2HCA A;  1OVT A;  3RUM A;  4ELP A;  1UIV A;  1IIT A;  1ZJL A;  2VOZ A;  1QKA A;  3Q26 A;  1B05 A;  1SDX A;  3EHU A;  2R71 A;  1US5 A;  3OEK A;  4YZZ A;  1MQI A;  3A09 A;  2F5X A;  2OCU A;  3GLB A;  1QKB A;  2NVU B;  1FQD A;  5I58 A;  3T9V A;  3UP9 A;  2Y7W A;  4OMB A;  2Y7P A;  3DP4 A;  3USD A;  4F22 A;  2NXO A;  3UOR A;  4IO3 A;  4IGT A;  2OLB A;  5IAI A;  5AA3 A;  4LZ8 A;  2QS2 A;  1FTO A;  4OYV A;  2AIX A;  2DS9 A;  4YB5 A;  3MZB A;  1GVC A;  2F8D A;  2CZL A;  1H43 A;  4GXS B;  3JZJ A;  4ZED A;  4WEP A;  3E9X A;  4M1V A;  2O51 A;  2OWS A;  3K6X A;  4IB2 A;  3WAF A;  5TU0 A;  3JYR A;  2Z22 A;  1EZO A;  2NWJ A;  3RT8 A;  3UK4 A;  5K2X A;  2ZYN A;  2ZYM A;  3OEN A;  4ZZA A;  2DQV A;  4Q8R A;  4NF6 A;  4F1V A;  2I49 A;  3RLF E;  4GQO A;  2ABH A;  3CFZ A;  2Z23 A;  1TWY A;  3VXB A;  5TPA B;  2F6G A;  3PUZ E;  3O6G A;  4QFK A;  5KCJ B;  3IX1 A;  1JVX A;  2XXV A;  1TFA A;  2RC8 A;  3K4U A;  4Z7E A;  2P2A A;  2Q2A A;  5HPQ A;  3IOT A;  4KHZ E;  2XX9 A;  3U1O A;  4KYE A;  3G7W A;  1SW1 A;  4FEB A;  3SEY A;  1JW5 A;  1P99 A;  4TLM B;  4F18 A;  3PUX E;  1B1X A;  3N5L A;  3VDF A;  1I6A A;  1POY 1;  1MM6 A;  4XKN A;  4JDF A;  4XKP A;  3G3J A;  3IB0 A;  1SYH A;  1P1O A;  2D21 A;  4JSD A;  1Y3P A;  4NF8 B;  4F3B A;  3H6U A;  3KZG A;  3WAE A;  5FHM A;  1LST A;  3MP6 A;  2O7U A;  4G8N A;  2QMW A;  4F1Y A;  1HSL A;  5AA2 D;  4I1D A;  1EZP A;  1PB7 A;  4ZEK A;  2O6A A;  2F36 A;  3A3U A;  3K0V A;  1B5H A;  2NOO A;  4H8J A;  3E13 X;  3HV1 A;  1XOC A;  2V93 A;  3ILU B;  5TPA A;  1OLA A;  5BUU A;  4GLI A;  2QL3 A;  1URG A;  5KCJ A;  1MH4 A;  3OEL A;  4Q5T A;  1RKM A;  1OIB A;  5CRY A;  1NFT A;  2O7I A;  5H8Q A;  3O29 A;  4DCX A;  3BBR A;  1NH7 A;  3UA8 A;  2REG A;  2A5T B;  5ITO A;  2Y7K A;  3FJM A;  3LSF B;  3FXR A;  2GH9 A;  3VLU A;  1FQB A;  5J1D A;  1BIY A;  1MXV A;  4LZ5 A;  2ZYK A;  3TQW A;  3M3K A;  1FTL A;  1MRP A;  3G3H A;  3N94 A;  4FIM A;  4MFI A;  4NF8 A;  1EH3 A;  4F29 A;  3CSB A;  2Q88 A;  4OFO A;  4AQ4 A;  3PMX A;  1ATG A;  2F78 A;  4PFU A;  4HCW A;  5CC2 A;  1B3F A;  1MQD A;  4ZE8 A;  2PX1 A;  5F1Q A;  4BDR A;  5JK4 A;  2ESN A;  2Q2C A;  4P11 A;  1FQC A;  4HCY A;  3LSW A;  1MY3 A;  1MH3 A;  1VR5 A;  5AA4 A;  3GBA A;  4ISU A;  4NMY A;  1NH8 A;  3M8U A;  2VD3 A;  4GRK A;  1OMP A;  1B46 A;  1O7T A;  2F97 A;  4KFQ A;  4OET A;  2I0B A;  3FXQ A;  1P1Q A;  2Q9T A;  3QUJ A;  2D5W A;  2DE2 A;  2Z8D A;  4YIC A;  1VFE A;  3C35 A;  4H6D A;  4R74 A;  2HXW A;  1S7Y A;  3RT6 B;  3HCQ A;  4G68 B;  4H67 A;  2B3B A;  4MLQ A;  2AYS A;  1N84 A;  3G3I A;  5ELV A;  4EQ9 A;  5TP9 B;  3FJG A;  4FOR A;  5CMK A;  1UTH B;  3HHF A;  5FTI A;  1OLC A;  3IJX B;  5ICQ A;  1DMB A;  1HSJ A;  1FCK A;  3IOV A;  4I62 A;  3EQ1 A;  3ILT B;  4F19 A;  2QPQ A;  3TMG A;  4R6H A;  4EXL A;  1DPP A;  2DWH A;  1LBB A;  3EPE A;  2QS4 A;  1OVB A;  1M5F A;  3TYH A;  2O84 X;  3A3C A;  3RTW B;  3TKD A;  2XXY A;  5L9S A;  4LQ2 A;  1O64 A;  3V83 A;  3OO7 A;  3IO6 A;  3MPL A;  2YLN A;  1D9Y A;  3BKI B;  4OFL A;  1DSN A;  3CG3 A;  4KCC A;  4F39 A;  2ONS A;  3SEU A;  3EHS A;  4TQU Q;  1FQF A;  4G8H A;  3FVO A;  5EHM A;  1FTJ A;  3LUY A;  3HPI A;  1PB9 A;  4QSE A;  5CI5 A;  3BFT A;  4OQO A;  4KPT A;  2UXA A;  1BLF A;  2I4B A;  2DXR A;  2UYF A;  1NL5 A;  1S9T A;  4ZZE A;  1JNF A;  3I6V A;  3SDF A;  5TP9 A;  1YPN A;  1CE2 A;  3VFJ A;  3O97 A;  2THI A;  1AOV A;  2VP1 A;  1Z7N E;  3FV1 A;  4ELQ A;  5I84 A;  1J1N A;  3FVN A;  2XXU A;  2HAV A;  2IA4 A;  3O6I A;  2R9J A;  5H8H B;  3OXN A;  1MXW A;  1JEU A;  1URS A;  3OSR A;  5KZT A;  1SBP A;  5K2Y A;  2UVH A;  2E1S A;  1LBC A;  4WED A;  1TFD A;  4JWX A;  3IOR A;  4OEU A;  4F31 B;  2H9B A;  5L9M A;  3G3G A;  3UN6 A;  3CI8 A;  1B5J A;  4NE4 A;  4O3A A;  1US4 A;  2PBW A;  2O1M A;  2XX8 A;  4ZEB A;  3GBB A;  3QAX A;  4Q30 B;  1B4Z A;  4OER A;  2QS1 A;  4QSD A;  4AB5 A;  3S9N C;  2I0C A;  4P0G A;  3VVF A;  5H8F A;  1LAF E;  4KYS A;  3S2V A;  4ONY A;  4OFJ A;  1ZTY A;  4OWD A;  1H3D A;  3VVE A;  1M5E A;  4GVO A;  1Y1Z A;  3QIM A;  3MQ9 A;  4X1D A;  3E3K A;  4RJZ A;  3TUS A;  3KSJ A;  1AH5 A;  1I69 A;  4U1O A;  2IEE A;  1Y3N A;  3K2D A;  3QXM A;  1H44 A;  3IOW A;  2H25 A;  3D4G A;  1JVY A;  2F35 A;  1H45 A;  5EHS A;  5I2K B;  3ONM A;  4EF1 A;  4R6Y A;  4PFT A;  5H8H A;  3TTN A;  1USY H;  1FW0 A;  3N6T A;  2ZMB A;  2P1S A;  2OBG A;  3MJN A;  2H98 A;  1NKX A;  1B4H A;  3VE1 B;  2OK2 A;  4ZS9 A;  2UYE A;  1LB9 A;  1ZIU A;  1N76 A;  3F11 A;  4HTG A;  3VLV A;  2F6P A;  2UVG A;  3PUY E;  4ESW A;  4IGR A;  4MH5 A;  5FTH A;  3RY3 A;  4QFP A;  1MPB A;  2CMO A;  1Y20 A;  3U93 A;  4IO5 A;  3RN8 A;  1QUL A;  3IK6 B;  2HAU A;  1IEJ A;  2DE4 A;  5LOM A;  4GD5 A;  2RCA A;  1POT A;  4HW8 A;  4PFW A;  5H8Q B;  1O63 A;  1LAH E;  2H5Y A;  4H65 A;  1XS5 A;  4PE5 B;  5BWJ A;  3KOT A;  4UA8 A;  3IL1 B;  2QSX A;  3H6V A;  3T66 A;  1URD A;  3PD9 A;  4RA1 A;  2PVU A;  4DIG A;  5L9O A;  3C34 A;  3AXF A;  2DYX A;  1SW4 A;  5DVF A;  2DSF A;  4MBP A;  4ZEI A;  2RCB A;  2XD2 A;  3H6W A;  3T96 B;  3S9M C;  5EYF A;  2HEU A;  1B2H A;  3TDJ A;  1USY E;  4OES A;  5I2K A;  1GTK A;  3PPQ A;  4Q0C A;  4EUO A;  3C9H A;  1LCT A;  2ONK E;  3K6U A;  3DP8 A;  4IO2 A;  3KEI A;  3TEL A;  4PP0 A;  1Q35 A;  1MS7 A;  2RIN A;  1MXU A;  3ZS6 A;  4RK9 A;  5L8D A;  3K1N A;  3W15 C;  2R6G E;  1P1U A;  2G93 A;  3H4Z A;  3DEL B;  4F2Q A;  5AA4 B;  4H8I A;  2YPN A;  1CB6 A;  2XX7 A;  4H1X A;  5FHN A;  4NED A;  3S9L C;  3Q27 A;  1LAX A;  1XVY A;  3V5A A;  4H0W A;  4R73 A;  3SET A;  1ZKB A;  4DXU A;  3O66 A;  3R6U A;  4OZ9 A;  1B40 A;  4QFL A;  2RKM A;  2I3V A;  2Q89 A;  1MY0 A;  1Y4C A;  5DVJ A;  1RYX A;  3RPW A;  4GXA A;  2VHA A;  5H8N B;  1SYI A;  1A55 A;  4GIZ A;  1H76 A;  2P0S A;  4NF5 B;  3LBS A;  3IB1 A;  5A5X B;  3SEV A;  1MG1 A;  4NF4 B;  1LGB C;  3ODB A;  3H03 A;  4KR5 A;  4DLD A;  4BLA A;  4NWD A;  1MPD A;  4FE8 A;  4LON B;  3MVX A;  3PU5 A;  3FAT A;  5CBR A;  4KQP A;  5I2N A;  3HHG A;  3PPO A;  3LSL A;  2I48 A;  1WVJ A;  3LC8 A;  1B3G A;  4LQ5 A;  5AE4 A;  2I58 A;  1GV8 A;  2DWA A;  1SW2 A;  4YKK A;  5I56 B;  4OEN A;  2FYI A;  3QYT A;  1LFH A;  3TZA A;  1QUJ A;  4GL0 A;  1JEV A;  4RY1 A;  1N0T A;  2V3U A;  4I8C A;  2UVJ A;  2Z8E A;  4GL8 A;  3TCF A;  2KLF A;  3HST A;  1TT1 A;  3PMV A;  5I57 B;  2ZNT A;  5B7D A;  3GXA A;  5B70 A;  4JWY A;  2XD3 A;  3B6T A;  4YKI A;  1JET A;  4EQB A;  1HSE A;  4L17 A;  3TTM A;  4POW A;  4FAJ A;  5H8N A;  3ZSF A;  3V89 B;  3N6U A;  3B6W A;  4NF5 A;  2QJE A;  4EF2 A;  4QSC A;  5A5X A;  4GF8 A;  3T9H B;  2B65 A;  1Y1M A;  1IXH A;  4NF4 A;  1NNT A;  1T0K A;  2OZZ A;  3MVW A;  1MXX A;  3BFU A;  1B51 A;  1IXI A;  1GR2 A;  4LVQ A;  2QRY A;  2V3Q A;  3KN7 A;  2PT1 A;  4IO4 A;  1MXZ A;  1N7X A;  3L6H A;  2PMS A;  3PPR A;  2F7A A;  2YJP A;  3MWB A;  4MLV A;  4FEC A;  1AL3 A;  2X7P A;  4F2O A;  3TOD A;  3OSQ A;  4ELO A;  2I6E A;  2X7Q A;  1LFI A;  2D3I A;  4XKQ A;  2AL5 A;  5JTY B;  4DCY A;  2Y84 A;  4LAT A;  1M5B A;  4R9G A;  5I56 A;  3TTR A;  3EF7 A;  2GRV A;  1DTZ A;  3C4M A;  4R9F A;  3VXC A;  1D9V A;  1MY2 A;  2Y7R A;  4PET A;  3RTF B;  1N04 A;  1SI1 A;  1FQA A;  3U72 A;  3SKP A;  5I57 A;  4BDO A;  1N3W A;  3CG1 A;  4X1B A;  3FVK A;  3MVY A;  1NNK A;  5HM4 B;  5FHO A;  2FA7 A;  3DP6 A;  1D4N A;  1OQH A;  3KG2 A;  1IXC A;  3OD7 A;  4G77 A;  5H8F B;  3D4C A;  5DVI A;  1ELJ A;  3T22 A;  4NTL A;  2DE3 A;  3K6V A;  3OEM A;  1B6H A;  1NMU A;  1VFD A;  4WXJ A;  3SER A;  1B58 A;  1IZ1 A;  3PGF A;  3VVD A;  3HO7 A;  5CBS A;  1UIU A;  3FVG A;  3Q25 A;  4XXU A;  2ZXT A;  1B5I A;  4FJP A;  1R6Z A;  4U1Z A;  1BTJ A;  5AA2 B;  4EDP A;  5HBC A;  4XKR A;  3N26 A;  3ECR A;  3MP8 A;  3DLN A;  4K3F A;  3TCH A;  3K00 A;  3MZ1 A;  1PEB A;  4N6P A;  3IR1 A;  1II5 A;  2GFE A;  4R75 A;  4DE8 A;  1B1H A;  5KDT B;  1P1N A;  4YB7 A;  4UAC A;  4C1U A;  3VLW A;  2OJT A;  2HFB A;  5JTY A;  2O1L A;  3U94 A;  1L5T A;  3MUQ A;  1GGG A;  3LSX A;  3KOS A;  3IJO B;  2DOJ A;  5JEI A;  1AIV A;  4OTE A;  1B52 A;  1MDP 1;  3O9P A;  4LA9 A;  5DEX B;  1BKA A;  2VGQ A;  3UGW A;  4ELR A;  1PB8 A;  3ZKL A;  3PUV E;  3T9X B;  3MC2 A;  4EXK A;  2XXX A;  3T9U A;  2Q8J A;  4KI0 E;  5I59 A;  1YTV A;  3O2A A;  1YAE A;  4YKP A;  3Q28 A;  3T93 B;  1XC1 A;  1R9Q A;  4QHQ A;  4GOT A;  3K01 A;  4FED A;  2HZK A;  1AMF A;  3U8Q A;  3C32 A;  2V3T A;  5F7V A;  2XXR A;  4Z0I A;  2DVC A;  1ZLQ A;  2XXP A;  4M4G A;  2AL4 A;  3S9E A;  1MQH A;  5AA2 A;  2DWJ A;  1XVX A;  4LP2 B;  1B3E A;  3TTK A;  3MW0 A;  2ONR A;  4G4P A;  4KYD A;  3CIJ A;  4U4S A;  3SEX A;  2G29 A;  1JQF A;  1Y3Q A;  5ISU A;  3PPN A;  3KGC A;  5KDT A;  3DM0 A;  2QS3 A;  3K6W A;  1Y9U A;  3THI A;  4THI A;  4BDM A;  2I3W A;  2B3F A;  3HN0 A;  2F7B A;  1A8E A;  3QUF A;  3OOA A;  4F3P A;  1BP5 A;  1EU8 A;  5DEX A;  1MQG A;  5H8S A;  1MPC A;  4ZEC A;  1I6B A;  1N3X A;  2NUV A;  5CMC A;  3C36 A;  4KCD A;  3M3F A;  4P0I A;  1YCJ A;  2Y7I A;  1MY4 A;  2F7C A;  1B3L A;  4QRZ A;  3M3L A;  1EZ9 A;  3CSG A;  3MVZ A;  3MBP A;  4U21 A;  3OMB A;  3IAZ A;  3H6T A;  4ND9 A;  3SEW A;  3JV9 A;  4DXB A;  1SD3 A;  3KBR A;  2H99 A;  2XXT A;  1B0H A;  3TAJ A;  5I2N B;  1FQE A;  1QUK A;  1JW4 A;  5CMB A;  4DZ1 A;  1ZMG A;  3S4U A;  4C1T A;  4YU0 A;  1MY1 A;  3IO4 A;  4E0X A;  4F1U A;  4IO6 A;  3TFL A;  3H06 B;  1B0L A;  4POX A;  3PV0 E;  3O28 A;  1PC3 A;  1N7W A;  2VD2 A;  4ZEF A;  4O3B A;  1PBQ A;  1IUD A;  1MQJ A;  1NNF A;  2E0S A;  4YB6 A;  1MDQ A;  3RNN A;  1I6Q A;  3PD8 A;  3C33 A;  3PMW A;  1B9J A;  3K02 A;  2UVI A;  3CRB A;  4N07 A;  2DP8 A;  1SQY A;  1WOD A;  3CR9 A;  4FAT A;  3G3K A;  3K1M A;  4R72 A;  3FV2 A;  1DOT A;  1JW1 A;  1QW0 A;  3C31 A;  2REJ A;  4RXL A;  3OO6 A;  3OO9 A;  1RYO A;  3B7D A;  4LUB A;  4F3G A;  4QF9 A;  1B7Z A;  3K1P A;  1R9L A;  1XT8 A;  3CFX A;  2XHD A;  3H7M A;  3QK6 A;  1D3K A;  2XXH A;  1QUI A;  3B6Q A;  5CM6 A;  5M2V A;  3FZV A;  4YMB A;  2V84 A;  1S50 A;  2W7Y A;  2GHA A;  5ITP A;  1ZU0 A;  2WKY A;  1Q1K A;  3ZKK A;  4JB7 A;  1A8F A;  2O69 A;  2ANJ A;  1UQW A;  1LLS A;  4QFN A;  4OXV A;  4BDQ A;  2ZNU A;  4TOZ A;  3MZ9 A;  2RC7 A;  3KN3 A;  1IIW A;  4ZE9 A;  2PT2 A;  1P1W A;  1SI0 A;  4G2Z A;  5DT6 A;  2OWT A;  4MF3 A;  2XXW A;  1UTB B;  4X48 A;  4BDL A;  2ZNS A;  4LZ7 A;  1FTK A;  4BDN A;  3RQT A;  4DXC A;  3TQL A;  3PPP A;  5DTB A;  1B7H A;  2DXY A;  1R1N A;  3EN3 A;  1Z7M E;  2V25 A;  3GZG A;  4C0R A;  4H5G A;  3Q29 A;  4RNS A;  1ZBM A;  2RC9 A;  3FIR A;  1MM7 A;  2HQ0 A;  2DWI A;  3L6G A;  1PBP A;  1M5C A;  2F34 A;  3IB2 A;  2FNC A;  2RF1 A;  3KFM A;  3PUW E;  4U4X A;  1OQG A;  4U2R A;  4IY6 A;  4JBZ A;  2A5T A;  2O68 A;  2ZYO A;  3CVG A;  1VE4 A;  4XIG Q;  3V8X B;  3I5O A;  4X9T A;  4AB6 A;  1XHY A;  4QFO A;  3FXU A;  3OO8 A;  3R7X A;  1MXY A;  5ICT A;  4GWO A;  2M8C A;  4OHN A;  4ZDM A;  1QJM A;  1LB8 A;  4G8M A;  3TEP A;  4JSO A;  4RK2 A;  1ANF A;  3U92 A;  1WDN A;  1A7L A;  4GFR A;  4WKM A;  1A99 A;  1LCF A;  1DPE A;  4ECF A;  3P7I A;  3UIF A;  3W9V A;  3MP1 A;  3G3F A;  2Z8F A;  4JXI A;  3FAS A;  5IKB A;  4H5F A;  2I4C A;  3FGS A;  4KD5 A;  3R26 A;  4PQJ A;  1UTB A;  5AA1 A;  4R2F A;  3SES A;  3RGY A;  1IXG A;  3VV5 A;  5I59 B;  4I9D A;  4G68 C;  4RPO A;  2BJJ X;  2XXI A;  2X26 A;  3KJT A;  4F3S A;  1FTM A;  1KWH A;  4JWO A;  3I3V A;  2ALU A;  1SW5 A;  3KN8 A;  4RPN A;  4U22 A;  4RYA A;  5CMM A;  4IY5 A;  3KSX A;  4OVJ A;  2A5S A;  1QVS A;  5I58 B;  1M5D A;  4XTC Q;  4R6K A;  5DYH A;  1B3H A; 
#chains in the Genus database with same CATH topology
 2KQZ A;  4G68 A;  4YAH X;  4TLL B;  3FD3 A;  4NWC A;  3IOU A;  3EHT A;  3LR1 A;  1IQ7 A;  5DW8 A;  4PCD A;  3B8B A;  2QMX A;  1TXF A;  1F9B A;  2HPG A;  4YKJ A;  5IZ3 B;  3TPA A;  1PDA A;  1B7U A;  3FUZ A;  3H3G A;  1FJ6 A;  5IZZ A;  4P47 A;  4ESX A;  2GHB A;  4OEV A;  2XXQ A;  1A40 A;  4YMA A;  1UTH A;  4E0W A;  1LEV A;  4PFY A;  2HZL A;  3E4R A;  3CFL A;  1NNP A;  4EQ7 A;  1LFG A;  1SVX B;  4HE2 A;  4O3C A;  2PYY A;  4JVC A;  2LAO A;  3W9W A;  4HS7 A;  1A54 A;  4R2B A;  1B32 A;  1DTG A;  3FJ7 A;  4DDD A;  4U23 A;  3MAM A;  4IO7 A;  1Y4T A;  4N13 A;  3KJ7 A;  2H4I A;  3TCG A;  2WBB A;  3MPK A;  3QSL A;  3O6H A;  1LAG E;  1VSO A;  3TTL A;  4NF6 B;  2DVZ A;  2HCA A;  1OVT A;  3RUM A;  4ELP A;  1UIV A;  1IIT A;  1ZJL A;  2VOZ A;  1QKA A;  2QVU A;  3Q26 A;  1B05 A;  1SDX A;  3EHU A;  2R71 A;  1US5 A;  2QVR A;  3OEK A;  4YZZ A;  1MQI A;  3NOH A;  3A09 A;  4GWW A;  2F5X A;  2OCU A;  3GLB A;  1QKB A;  2NVU B;  1FQD A;  5I58 A;  1D9Q A;  2VPO A;  3T9V A;  3UP9 A;  2Y7W A;  4OMB A;  2Y7P A;  3DP4 A;  3USD A;  1FPI A;  1FSA A;  2NXO A;  4F22 A;  3UOR A;  4IO3 A;  4IGT A;  2OLB A;  5IAI A;  5AA3 A;  4GWX A;  4LZ8 A;  2QS2 A;  1FTO A;  4OYV A;  2AIX A;  2DS9 A;  4YB5 A;  3MZB A;  1GVC A;  1RDX A;  2F8D A;  2CZL A;  1H43 A;  1NV0 A;  2XWO A;  3JZJ A;  4GXS B;  3FBP A;  4ZED A;  4WEP A;  3E9X A;  4M1V A;  2O51 A;  2OWS A;  3K6X A;  4IB2 A;  3WAF A;  5TU0 A;  3JYR A;  2Z22 A;  1EZO A;  4QBA A;  2NWJ A;  1K9Z A;  3RT8 A;  3UK4 A;  5K2X A;  2ZYN A;  4PBQ A;  2ZYM A;  3OEN A;  4ZZA A;  2ZZV A;  2DQV A;  4Q8R A;  4NF6 A;  4F1V A;  2I49 A;  3RLF E;  4GQO A;  1IMB A;  4OA4 A;  2ABH A;  3CFZ A;  2Z23 A;  1TWY A;  3VXB A;  5TPA B;  2F6G A;  3PUZ E;  3O6G A;  4QFK A;  5KCJ B;  3IX1 A;  1JVX A;  2XXV A;  1TFA A;  2RC8 A;  3K4U A;  4Z7E A;  2P2A A;  4MIJ A;  1KZ8 A;  2Q2A A;  5HPQ A;  3IOT A;  4KHZ E;  2XX9 A;  3U1O A;  4KYE A;  3G7W A;  4PGN A;  1SW1 A;  4FEB A;  3SEY A;  1JW5 A;  1NV4 A;  1P99 A;  4TLM B;  1FJ9 A;  4F18 A;  3PUX E;  1FPD A;  1B1X A;  3N5L A;  3VDF A;  4PE3 A;  1I6A A;  1POY 1;  1MM6 A;  4H45 A;  4XKN A;  4JDF A;  4XKP A;  3G3J A;  3KC0 A;  3IB0 A;  1SYH A;  1P1O A;  2D21 A;  3ISP A;  1Y3P A;  4JSD A;  4NF8 B;  4F3B A;  3H6U A;  3KZG A;  1BK4 A;  1NV2 A;  3WAE A;  1FBH A;  5FHM A;  1LST A;  3MP6 A;  2O7U A;  2BJI A;  4G8N A;  2QMW A;  4F1Y A;  1HSL A;  5AA2 D;  4O8M A;  4I1D A;  1EZP A;  1PB7 A;  4ZEK A;  2O6A A;  2F36 A;  4OVR A;  3A3U A;  3IFC A;  3K0V A;  2Y5L A;  1LBW A;  1B5H A;  2NOO A;  1LBY A;  4H8J A;  3E13 X;  3HV1 A;  1XOC A;  2V93 A;  3ILU B;  5TPA A;  1OLA A;  5BUU A;  4GLI A;  2QL3 A;  1URG A;  5KCJ A;  1MH4 A;  3OEL A;  4Q5T A;  5ET6 A;  1RKM A;  1OIB A;  5CRY A;  1NFT A;  2O7I A;  5H8Q A;  3O29 A;  4DCX A;  3BBR A;  1NH7 A;  3UA8 A;  4XFE A;  1Q9D A;  2REG A;  2CZH A;  2A5T B;  4N6D A;  5ITO A;  2Y7K A;  1FBF A;  3FJM A;  3LSF B;  1CNQ A;  3FXR A;  5I3S A;  1FBD A;  2GH9 A;  3VLU A;  1FQB A;  5J1D A;  1BIY A;  1MXV A;  4LZ5 A;  2ZYK A;  3TQW A;  3MYU A;  3M3K A;  1FTL A;  1MRP A;  3G3H A;  3N94 A;  4FIM A;  4MFI A;  4NF8 A;  1EH3 A;  4F29 A;  3CSB A;  2Q88 A;  1IMD A;  4OFO A;  1DBZ A;  4AQ4 A;  3PMX A;  1ATG A;  2F78 A;  1G0I A;  4PFU A;  4HCW A;  5ET5 A;  5CC2 A;  1B3F A;  1MQD A;  1NV5 A;  4ZE8 A;  3ROJ A;  2PX1 A;  5F1Q A;  4BDR A;  5JK4 A;  2ESN A;  2Q2C A;  4P11 A;  1FQC A;  1FPB A;  4HCY A;  3LSW A;  1MY3 A;  1MH3 A;  1VR5 A;  5AA4 A;  3GBA A;  4ISU A;  4NMY A;  1FPG A;  2ZZX A;  1NH8 A;  3M8U A;  2VD3 A;  4GRK A;  4GWZ A;  1OMP A;  1B46 A;  1O7T A;  2F97 A;  4KFQ A;  4OET A;  2I0B A;  3FXQ A;  1P1Q A;  2Q9T A;  4NGU A;  3QUJ A;  4AS4 A;  2D5W A;  2DE2 A;  2Z8D A;  4YIC A;  1VFE A;  3C35 A;  4H6D A;  4R74 A;  2HXW A;  1S7Y A;  3RT6 B;  3HCQ A;  4G68 B;  1LBX A;  4H67 A;  2B3B A;  4MLQ A;  2AYS A;  4GX6 A;  1N84 A;  3G3I A;  5ELV A;  4EQ9 A;  5TP9 B;  4FBP A;  1IMF A;  4N91 A;  1G0H A;  3FJG A;  4FOR A;  5CMK A;  1UTH B;  3HHF A;  5FTI A;  1OLC A;  3IJX B;  5ICQ A;  1DMB A;  5ET7 A;  1HSJ A;  1FCK A;  3IOV A;  4I62 A;  3EQ1 A;  3ILT B;  4O7I A;  4F19 A;  5ET8 A;  2QPQ A;  2ZZW A;  4N15 A;  3TMG A;  4R6H A;  4EXL A;  1DPP A;  2DWH A;  1LBB A;  4G61 A;  3EPE A;  2QS4 A;  1OVB A;  1M5F A;  3TYH A;  2O84 X;  3A3C A;  3RTW B;  3TKD A;  2XXY A;  5L9S A;  1NUZ A;  4LQ2 A;  1O64 A;  3V83 A;  3OO7 A;  2P3N A;  2XXK A;  3IO6 A;  4GBV A;  3MPL A;  4XTC Q;  2YLN A;  1D9Y A;  1DCU A;  3BKI B;  4OFL A;  1DSN A;  3CG3 A;  4KCC A;  5IGA A;  4AS5 A;  4F39 A;  4DI4 B;  4PF8 A;  2ONS A;  4KXP A;  3SEU A;  5F24 A;  3EHS A;  4TQU Q;  1FPF A;  1FQF A;  4G8H A;  3FVO A;  5EHM A;  4N81 A;  1FTJ A;  3LUY A;  3HPI A;  1PB9 A;  4QSE A;  5CI5 A;  3BFT A;  4OQO A;  4KPT A;  4XF5 A;  2UXA A;  1BLF A;  4NN3 A;  2I4B A;  2DXR A;  2UYF A;  1NL5 A;  1S9T A;  4ZZE A;  1JNF A;  3I6V A;  3LUZ A;  2PFZ A;  3SDF A;  5TP9 A;  1YPN A;  1CE2 A;  3VFJ A;  3O97 A;  2THI A;  1AOV A;  2VP1 A;  4NX1 A;  1Z7N E;  3FV1 A;  4ELQ A;  4PDH A;  5I84 A;  1J1N A;  5I7I A;  3FVN A;  1NV7 A;  2XXU A;  2HAV A;  2IA4 A;  3O6I A;  2R9J A;  1FBP A;  5H8H B;  3OXN A;  1MXW A;  1JEU A;  1FBG A;  1XI6 A;  4GWU A;  1URS A;  3OSR A;  5KZT A;  1SBP A;  5K2Y A;  2UVH A;  2E1S A;  1LBC A;  4WED A;  3B50 A;  1TFD A;  4JWX A;  3IOR A;  4OEU A;  4F31 B;  2H9B A;  5L9M A;  3G3G A;  3UN6 A;  3CI8 A;  1B5J A;  4NE4 A;  4O3A A;  1US4 A;  2PBW A;  2O1M A;  4GX4 A;  2XX8 A;  2Q8M A;  4ZEB A;  3GBB A;  3QAX A;  4Q30 B;  1B4Z A;  3E78 A;  4OER A;  2R8T A;  2QS1 A;  4QSD A;  4AB5 A;  3S9N C;  4P9K A;  2I0C A;  4P0G A;  3VVF A;  5H8F A;  1LAF E;  4KYS A;  4OVS A;  3S2V A;  5IZ1 A;  4ONY A;  4OFJ A;  1ZTY A;  4OWD A;  1H3D A;  3VVE A;  1M5E A;  4GVO A;  4JVD A;  1Y1Z A;  1KA0 A;  3QIM A;  3MQ9 A;  4PDD A;  4X1D A;  3E3K A;  4RJZ A;  3TUS A;  3CHG A;  3KSJ A;  1AH5 A;  1I69 A;  4U1O A;  2IEE A;  1Y3N A;  3K2D A;  3QXM A;  1H44 A;  3IOW A;  2H25 A;  4NF0 A;  3D4G A;  1IMA A;  1JVY A;  2F35 A;  1H45 A;  1YZ0 A;  5EHS A;  5I2K B;  5A5L A;  3ONM A;  4EF1 A;  4R6Y A;  4PFT A;  5H8H A;  3TTN A;  4NQ8 A;  2JJK A;  1USY H;  1FW0 A;  3N6T A;  2ZMB A;  2P1S A;  2OBG A;  3MJN A;  2H98 A;  1NKX A;  1B4H A;  3VE1 B;  2OK2 A;  4ZS9 A;  2UYE A;  1LB9 A;  1ZIU A;  1N76 A;  3F11 A;  4HTG A;  4MJO A;  3VLV A;  2F6P A;  4MNI A;  2UVG A;  3PUY E;  4ESW A;  4IGR A;  4MH5 A;  3U65 A;  5FTH A;  3RY3 A;  4QFP A;  1MPB A;  2CMO A;  3A29 A;  1Y20 A;  3U93 A;  4IO5 A;  3RN8 A;  1QUL A;  3IK6 B;  2HAU A;  1IEJ A;  4GWS A;  2DE4 A;  5LOM A;  3GYY A;  5EQ9 A;  4GD5 A;  2RCA A;  1POT A;  4HXV A;  4HW8 A;  4PFW A;  3KBZ A;  5H8Q B;  1O63 A;  1LAH E;  2WYK A;  2H5Y A;  4H65 A;  1XS5 A;  4PE5 B;  5BWJ A;  3KOT A;  3RYD A;  4UA8 A;  3IL1 B;  2QSX A;  3H6V A;  3T66 A;  1URD A;  4OVP A;  3KC1 A;  3PD9 A;  4RA1 A;  2PVU A;  4DIG A;  5L9O A;  3C34 A;  1RDZ A;  3AXF A;  2DYX A;  1SW4 A;  5LTC A;  5DVF A;  2DSF A;  4MBP A;  4ZEI A;  2RCB A;  2XD2 A;  3H6W A;  3T96 B;  3S9M C;  5EYF A;  2HEU A;  1B2H A;  4P8B A;  3TDJ A;  1USY E;  4OES A;  5I2K A;  1GTK A;  3PPQ A;  4Q0C A;  3C9H A;  4EUO A;  1LCT A;  2ONK E;  3K6U A;  3DP8 A;  4IO2 A;  3KEI A;  3TEL A;  4PP0 A;  1Q35 A;  1MS7 A;  2RIN A;  1MXU A;  1NUX A;  3ZS6 A;  4RK9 A;  5L8D A;  3K1N A;  3W15 C;  2R6G E;  1P1U A;  2DDK A;  2G93 A;  3H4Z A;  3DEL B;  4F2Q A;  5AA4 B;  4H8I A;  2YPN A;  1CB6 A;  2XX7 A;  4H1X A;  5FHN A;  4NED A;  4PAF A;  3S9L C;  3Q27 A;  1SPI A;  1LAX A;  1XVY A;  3V5A A;  4H0W A;  4R73 A;  3SET A;  1ZKB A;  4DXU A;  5EYG A;  3O66 A;  3R6U A;  4OZ9 A;  1B40 A;  4PAK A;  4QFL A;  2RKM A;  2I3V A;  2Q89 A;  1MY0 A;  1Y4C A;  1K9Y A;  5DVJ A;  1RYX A;  3RPW A;  4GXA A;  2VHA A;  5H8N B;  1SYI A;  1A55 A;  4GIZ A;  1H76 A;  1EYJ A;  2P0S A;  4PBH A;  4NF5 B;  2GQ1 A;  2CZK A;  3LBS A;  3IB1 A;  5A5X B;  2B4M A;  3SEV A;  1MG1 A;  4NF4 B;  1LGB C;  3ODB A;  3H03 A;  4KR5 A;  4DLD A;  4BLA A;  4NWD A;  1MPD A;  4FE8 A;  4LON B;  3MVX A;  3PU5 A;  4PFR A;  3FAT A;  5CBR A;  4KQP A;  5I2N A;  5ESY A;  3HHG A;  1EYK A;  3PPO A;  3LSL A;  2I48 A;  4N6K A;  1WVJ A;  3LC8 A;  1B3G A;  4LQ5 A;  5AE4 A;  2P3V A;  2I58 A;  1GV8 A;  1VDW A;  2DWA A;  1SW2 A;  4YKK A;  5I56 B;  4OEN A;  2FYI A;  2WEF A;  3QYT A;  1LFH A;  3TZA A;  1QUJ A;  4GL0 A;  1JEV A;  4RY1 A;  1N0T A;  2V3U A;  2FHY A;  4I8C A;  2VPN A;  2UVJ A;  2Z8E A;  4GL8 A;  3TCF A;  2WBD A;  2KLF A;  3HST A;  1TT1 A;  3PMV A;  5I57 B;  2ZNT A;  5B7D A;  4I3Y A;  3GXA A;  5B70 A;  4JWY A;  2XD3 A;  4P1L A;  3B6T A;  4YKI A;  1JET A;  4EQB A;  1YXI A;  4GX3 A;  1HSE A;  4L17 A;  3TTM A;  4POW A;  1NV6 A;  4FAJ A;  5H8N A;  3ZSF A;  1NV3 A;  4GBW A;  3V89 B;  3N6U A;  3B6W A;  4NF5 A;  2QJE A;  4EF2 A;  4QSC A;  5A5X A;  4GF8 A;  3T9H B;  2B65 A;  1Y1M A;  1IXH A;  4NF4 A;  1NNT A;  1T0K A;  2OZZ A;  3MVW A;  1MXX A;  3BFU A;  2CZI A;  1B51 A;  1IXI A;  1GR2 A;  4LVQ A;  4PFI A;  2QRY A;  2V3Q A;  3KN7 A;  2PT1 A;  4IO4 A;  1MXZ A;  1N7X A;  3L6H A;  4N8Y A;  2PMS A;  3PPR A;  2F7A A;  2YJP A;  3MWB A;  4MLV A;  4FEC A;  1AL3 A;  5I5P A;  2X7P A;  4F2O A;  5FBP A;  3TOD A;  3OSQ A;  4ELO A;  2L5V A;  2I6E A;  2X7Q A;  1NUW A;  1LFI A;  2D3I A;  4XKQ A;  2AL5 A;  5JTY B;  4N8G A;  4DCY A;  2Y84 A;  4LAT A;  1M5B A;  4R9G A;  5I56 A;  3D1R A;  3TTR A;  2GRV A;  1DTZ A;  3C4M A;  4R9F A;  3VXC A;  1D9V A;  1MY2 A;  2Y7R A;  3BIG A;  4MX6 A;  4PET A;  3RTF B;  2V4C A;  4H46 A;  1N04 A;  1SI1 A;  1FPK A;  1FQA A;  3U72 A;  3SKP A;  5I57 A;  4BDO A;  1N3W A;  3CG1 A;  4X1B A;  1KA1 A;  3FVK A;  3MVY A;  1NNK A;  5HM4 B;  5FHO A;  2FA7 A;  1FBC A;  3DP6 A;  1D4N A;  1OQH A;  3KG2 A;  1IXC A;  3OD7 A;  4G77 A;  5H8F B;  2F3B A;  3D4C A;  5EQ7 A;  5DVI A;  1ELJ A;  3T22 A;  4NTL A;  2DE3 A;  3K6V A;  3OEM A;  1B6H A;  1NMU A;  1VFD A;  1FPL A;  4WXJ A;  3SER A;  4P3L A;  1B58 A;  1IZ1 A;  3PGF A;  3VVD A;  3HO7 A;  5CBS A;  1UIU A;  3FVG A;  3Q25 A;  4XXU A;  2ZXT A;  3RPL B;  1B5I A;  4FJP A;  3QMF A;  1R6Z A;  4PAI A;  2WX9 A;  4U1Z A;  4NAP A;  2Q74 A;  5EQ8 A;  1BTJ A;  5AA2 B;  4EDP A;  2XWK A;  5HBC A;  2FBP A;  4XKR A;  3N26 A;  3ECR A;  3MP8 A;  3DLN A;  1LBZ A;  4K3F A;  3TCH A;  3K00 A;  3MZ1 A;  1PEB A;  4N6P A;  4MCO A;  3IR1 A;  1II5 A;  2GFE A;  4R75 A;  4DE8 A;  1B1H A;  4O7M A;  5KDT B;  1P1N A;  4YB7 A;  4UAC A;  4C1U A;  3VLW A;  2OJT A;  2HFB A;  5JTY A;  2O1L A;  3U94 A;  1L5T A;  3MUQ A;  1GGG A;  4MMP A;  3LSX A;  3KOS A;  3IJO B;  2DOJ A;  5JEI A;  1AIV A;  4OTE A;  1B52 A;  1MDP 1;  3O9P A;  4LA9 A;  5DEX B;  1BKA A;  2VGQ A;  3UGW A;  4ELR A;  1PB8 A;  3ZKL A;  3PUV E;  3T9X B;  3MC2 A;  4EXK A;  2XXX A;  3T9U A;  2Q8J A;  4KI0 E;  5I59 A;  1YTV A;  3O2A A;  1YAE A;  4YKP A;  3Q28 A;  3T93 B;  1XC1 A;  1R9Q A;  4QHQ A;  4PGP A;  4GOT A;  4P56 A;  5LDZ A;  3K01 A;  4FED A;  2PCR A;  2HZK A;  4GWY A;  1AMF A;  3U8Q A;  3C32 A;  3RPL A;  2V3T A;  5F7V A;  2XXR A;  4Z0I A;  2DVC A;  1ZLQ A;  2XXP A;  4M4G A;  2AL4 A;  3S9E A;  1MQH A;  5AA2 A;  2DWJ A;  1XVX A;  4LP2 B;  1B3E A;  3TTK A;  2HXR A;  3MW0 A;  2ONR A;  4G4P A;  4KYD A;  5T3J A;  3CIJ A;  4U4S A;  3SEX A;  2G29 A;  1JQF A;  5IZ3 A;  1Y3Q A;  5ISU A;  3PPN A;  3KGC A;  5KDT A;  3DM0 A;  2QS3 A;  4HE0 A;  3K6W A;  1FRP A;  1Y9U A;  3THI A;  4THI A;  4BDM A;  2QVV A;  2I3W A;  5J16 A;  2B3F A;  3HN0 A;  4X8R A;  2F7B A;  4NHB A;  1A8E A;  3QUF A;  3OOA A;  4F3P A;  2XWI A;  1BP5 A;  1EU8 A;  5DEX A;  1MQG A;  5H8S A;  1AWB A;  2PFY A;  1MPC A;  4ZEC A;  4I40 A;  5EYH A;  1I6B A;  1N3X A;  4P1E A;  2NUV A;  5CMC A;  3C36 A;  4KCD A;  3M3F A;  4P0I A;  1YCJ A;  2Y7I A;  1MY4 A;  2F7C A;  1B3L A;  4QRZ A;  3M3L A;  1EZ9 A;  3CSG A;  3MVZ A;  1FBE A;  3MBP A;  4U21 A;  3OMB A;  3IAZ A;  3H6T A;  4ND9 A;  3SEW A;  3JV9 A;  4DXB A;  1SD3 A;  3KBR A;  1EYI A;  2H99 A;  2XXT A;  1B0H A;  3TAJ A;  5I2N B;  2Y5K A;  1FQE A;  1QUK A;  1JW4 A;  5CMB A;  2MKZ A;  4DZ1 A;  1ZMG A;  3S4U A;  4C1T A;  4YU0 A;  1MY1 A;  3IO4 A;  4E0X A;  4F1U A;  4IO6 A;  3TFL A;  3H06 B;  1B0L A;  4POX A;  4MHF A;  3PV0 E;  3O28 A;  3LV0 A;  2OX3 A;  1PC3 A;  4XEQ A;  1N7W A;  2VD2 A;  4ZEF A;  4MNC A;  4MEV A;  4O3B A;  4O94 A;  1PBQ A;  1IUD A;  1MQJ A;  1NNF A;  2E0S A;  1INP A;  1JP4 A;  4YB6 A;  1MDQ A;  1RDY A;  2VT5 A;  3RNN A;  1I6Q A;  3SZP A;  3PD8 A;  5IM2 A;  3C33 A;  3PMW A;  1B9J A;  3K02 A;  2UVI A;  2F3D A;  4IR8 A;  3CRB A;  4N07 A;  1NI9 A;  4PF6 A;  2DP8 A;  1SQY A;  1WOD A;  3CR9 A;  4FAT A;  3G3K A;  2CEY A;  3K1M A;  4R72 A;  3FV2 A;  1DOT A;  1JW1 A;  1QW0 A;  1LBV A;  2REJ A;  3C31 A;  4RXL A;  3OO6 A;  2FIE A;  3OO9 A;  1RYO A;  4PFB A;  3B7D A;  4LUB A;  4F3G A;  4QF9 A;  1B7Z A;  3K1P A;  1R9L A;  1XT8 A;  3CFX A;  4LN5 A;  2XHD A;  3H7M A;  3QK6 A;  1D3K A;  2XXH A;  1QUI A;  3B6Q A;  5CM6 A;  5M2V A;  3FZV A;  4YMB A;  2V84 A;  1S50 A;  2W7Y A;  2FVZ A;  2GHA A;  3E79 A;  5ITP A;  1ZU0 A;  2WKY A;  1Q1K A;  3ZKK A;  4JB7 A;  1A8F A;  2O69 A;  2ANJ A;  1UQW A;  1LLS A;  3T1B A;  3BIH A;  4N4U A;  4QFN A;  4OXV A;  2KR0 A;  4BDQ A;  2FIX A;  2ZNU A;  4TOZ A;  3MZ9 A;  2OWZ A;  2RC7 A;  3KN3 A;  4N17 A;  1IIW A;  4ZE9 A;  2PT2 A;  1P1W A;  1FPE A;  1SI0 A;  4G2Z A;  5DT6 A;  2OWT A;  2XA5 A;  4MF3 A;  2XXW A;  1UTB B;  4X48 A;  4BDL A;  2ZNS A;  4LZ7 A;  1FTK A;  4BDN A;  3RQT A;  2HHM A;  2B4L A;  4DXC A;  4QXD A;  3TQL A;  3PPP A;  5DTB A;  1B7H A;  2DXY A;  1R1N A;  3EN3 A;  1Z7M E;  2V25 A;  3GZG A;  4C0R A;  4H5G A;  3Q29 A;  4RNS A;  1DK4 A;  4OVQ A;  4OVT A;  1ZBM A;  2RC9 A;  3FIR A;  1MM7 A;  2QFL A;  2CEX A;  2HQ0 A;  2DWI A;  4HE1 A;  4NG7 A;  3L6G A;  1PBP A;  1M5C A;  2F34 A;  3IB2 A;  2FNC A;  2RF1 A;  3KFM A;  5EQA A;  1IMC A;  3PUW E;  4U4X A;  3MST A;  1OQG A;  4U2R A;  4IY6 A;  4JBZ A;  2A5T A;  2O68 A;  2ZYO A;  3CVG A;  1VE4 A;  4XIG Q;  1NV1 A;  3V8X B;  3I5O A;  4X9T A;  4AB6 A;  1XHY A;  4QFO A;  3FXU A;  3T0J A;  3OO8 A;  3R7X A;  1MXY A;  1YYZ A;  5ICT A;  1IME A;  4GWO A;  2M8C A;  1FTA A;  4OHN A;  4ZDM A;  1QJM A;  1FPJ A;  1LB8 A;  4G8M A;  3TEP A;  4JSO A;  4OAN A;  4RK2 A;  1ANF A;  3U92 A;  1WDN A;  1A7L A;  4GFR A;  4WKM A;  1A99 A;  1LCF A;  1DPE A;  4ECF A;  3P7I A;  3UIF A;  3W9V A;  3MP1 A;  3G3F A;  2Z8F A;  4JXI A;  3FAS A;  4JVI A;  4MNP A;  4I3E A;  5IKB A;  4H5F A;  2I4C A;  3FGS A;  4KD5 A;  3R26 A;  4PQJ A;  1UTB A;  5AA1 A;  4R2F A;  3SES A;  3RGY A;  1IXG A;  4PTK A;  3VV5 A;  5I59 B;  3IFA A;  4I9D A;  1NUY A;  4G68 C;  1QGX A;  4PC9 A;  4RPO A;  3HFU A;  2BJJ X;  2XXI A;  2X26 A;  2XWV A;  3EKI A;  3KJT A;  4F3S A;  1FTM A;  1KWH A;  3FXB A;  4JWO A;  3I3V A;  4MAG A;  2ALU A;  4UAB A;  1SW5 A;  3KN8 A;  4RPN A;  4U22 A;  4RYA A;  2WYP A;  5CMM A;  4IY5 A;  3KSX A;  4OVJ A;  4X04 A;  2A5S A;  3PTY A;  1QVS A;  5I58 B;  1M5D A;  4DI3 D;  3EF7 A;  4R6K A;  5DYH A;  1B3H A; 
#chains in the Genus database with same CATH homology
 4G68 A;  4YAH X;  4TLL B;  3FD3 A;  4NWC A;  3IOU A;  3EHT A;  3LR1 A;  1IQ7 A;  2QMX A;  1TXF A;  1F9B A;  4YKJ A;  3TPA A;  1PDA A;  1B7U A;  3FUZ A;  3H3G A;  4ESX A;  2GHB A;  4OEV A;  2XXQ A;  1A40 A;  4YMA A;  1UTH A;  4E0W A;  4PFY A;  2HZL A;  3E4R A;  3CFL A;  1NNP A;  4EQ7 A;  1LFG A;  1SVX B;  4O3C A;  2PYY A;  2LAO A;  3W9W A;  4HS7 A;  1A54 A;  4R2B A;  1B32 A;  1DTG A;  3FJ7 A;  4DDD A;  4U23 A;  3MAM A;  4IO7 A;  1Y4T A;  4N13 A;  3KJ7 A;  2H4I A;  3TCG A;  3MPK A;  3QSL A;  3O6H A;  1LAG E;  1VSO A;  3TTL A;  4NF6 B;  2DVZ A;  2HCA A;  1OVT A;  3RUM A;  4ELP A;  1UIV A;  1IIT A;  1ZJL A;  2VOZ A;  1QKA A;  3Q26 A;  1B05 A;  1SDX A;  3EHU A;  2R71 A;  1US5 A;  3OEK A;  4YZZ A;  1MQI A;  3A09 A;  2F5X A;  2OCU A;  3GLB A;  1QKB A;  2NVU B;  1FQD A;  5I58 A;  3T9V A;  3UP9 A;  2Y7W A;  4OMB A;  2Y7P A;  3DP4 A;  3USD A;  4F22 A;  2NXO A;  3UOR A;  4IO3 A;  4IGT A;  2OLB A;  5IAI A;  5AA3 A;  4LZ8 A;  2QS2 A;  1FTO A;  4OYV A;  2AIX A;  2DS9 A;  4YB5 A;  3MZB A;  1GVC A;  2F8D A;  2CZL A;  1H43 A;  4GXS B;  3JZJ A;  4ZED A;  4WEP A;  3E9X A;  4M1V A;  2O51 A;  2OWS A;  3K6X A;  4IB2 A;  3WAF A;  5TU0 A;  3JYR A;  2Z22 A;  1EZO A;  2NWJ A;  3RT8 A;  3UK4 A;  5K2X A;  2ZYN A;  2ZYM A;  3OEN A;  4ZZA A;  2DQV A;  4Q8R A;  4NF6 A;  4F1V A;  2I49 A;  3RLF E;  4GQO A;  2ABH A;  3CFZ A;  2Z23 A;  1TWY A;  3VXB A;  5TPA B;  2F6G A;  3PUZ E;  3O6G A;  4QFK A;  5KCJ B;  3IX1 A;  1JVX A;  2XXV A;  1TFA A;  2RC8 A;  3K4U A;  4Z7E A;  2P2A A;  2Q2A A;  5HPQ A;  3IOT A;  4KHZ E;  2XX9 A;  3U1O A;  4KYE A;  3G7W A;  1SW1 A;  4FEB A;  3SEY A;  1JW5 A;  1P99 A;  4TLM B;  4F18 A;  3PUX E;  1B1X A;  3N5L A;  3VDF A;  1I6A A;  1POY 1;  1MM6 A;  4XKN A;  4JDF A;  4XKP A;  3G3J A;  3IB0 A;  1SYH A;  1P1O A;  2D21 A;  4JSD A;  1Y3P A;  4NF8 B;  4F3B A;  3H6U A;  3KZG A;  3WAE A;  5FHM A;  1LST A;  3MP6 A;  2O7U A;  4G8N A;  2QMW A;  4F1Y A;  1HSL A;  5AA2 D;  4I1D A;  1EZP A;  1PB7 A;  4ZEK A;  2O6A A;  2F36 A;  3A3U A;  3K0V A;  1B5H A;  2NOO A;  4H8J A;  3E13 X;  3HV1 A;  1XOC A;  2V93 A;  3ILU B;  5TPA A;  1OLA A;  5BUU A;  4GLI A;  2QL3 A;  1URG A;  5KCJ A;  1MH4 A;  3OEL A;  4Q5T A;  1RKM A;  1OIB A;  5CRY A;  1NFT A;  2O7I A;  5H8Q A;  3O29 A;  4DCX A;  3BBR A;  1NH7 A;  3UA8 A;  2REG A;  2A5T B;  5ITO A;  2Y7K A;  3FJM A;  3LSF B;  3FXR A;  2GH9 A;  3VLU A;  1FQB A;  5J1D A;  1BIY A;  1MXV A;  4LZ5 A;  2ZYK A;  3TQW A;  3M3K A;  1FTL A;  1MRP A;  3G3H A;  3N94 A;  4FIM A;  4MFI A;  4NF8 A;  1EH3 A;  4F29 A;  3CSB A;  2Q88 A;  4OFO A;  4AQ4 A;  3PMX A;  1ATG A;  2F78 A;  4PFU A;  4HCW A;  5CC2 A;  1B3F A;  1MQD A;  4ZE8 A;  2PX1 A;  5F1Q A;  4BDR A;  5JK4 A;  2ESN A;  2Q2C A;  4P11 A;  1FQC A;  4HCY A;  3LSW A;  1MY3 A;  1MH3 A;  1VR5 A;  5AA4 A;  3GBA A;  4ISU A;  4NMY A;  1NH8 A;  3M8U A;  2VD3 A;  4GRK A;  1OMP A;  1B46 A;  1O7T A;  2F97 A;  4KFQ A;  4OET A;  2I0B A;  3FXQ A;  1P1Q A;  2Q9T A;  3QUJ A;  2D5W A;  2DE2 A;  2Z8D A;  4YIC A;  1VFE A;  3C35 A;  4H6D A;  4R74 A;  2HXW A;  1S7Y A;  3RT6 B;  3HCQ A;  4G68 B;  4H67 A;  2B3B A;  4MLQ A;  2AYS A;  1N84 A;  3G3I A;  5ELV A;  4EQ9 A;  5TP9 B;  3FJG A;  4FOR A;  5CMK A;  1UTH B;  3HHF A;  5FTI A;  1OLC A;  3IJX B;  5ICQ A;  1DMB A;  1HSJ A;  1FCK A;  3IOV A;  4I62 A;  3EQ1 A;  3ILT B;  4F19 A;  2QPQ A;  3TMG A;  4R6H A;  4EXL A;  1DPP A;  2DWH A;  1LBB A;  3EPE A;  2QS4 A;  1OVB A;  1M5F A;  3TYH A;  2O84 X;  3A3C A;  3RTW B;  3TKD A;  2XXY A;  5L9S A;  4LQ2 A;  1O64 A;  3V83 A;  3OO7 A;  3IO6 A;  3MPL A;  2YLN A;  1D9Y A;  3BKI B;  4OFL A;  1DSN A;  3CG3 A;  4KCC A;  4F39 A;  2ONS A;  3SEU A;  3EHS A;  4TQU Q;  1FQF A;  4G8H A;  3FVO A;  5EHM A;  1FTJ A;  3LUY A;  3HPI A;  1PB9 A;  4QSE A;  5CI5 A;  3BFT A;  4OQO A;  4KPT A;  2UXA A;  1BLF A;  2I4B A;  2DXR A;  2UYF A;  1NL5 A;  1S9T A;  4ZZE A;  1JNF A;  3I6V A;  3SDF A;  5TP9 A;  1YPN A;  1CE2 A;  3VFJ A;  3O97 A;  2THI A;  1AOV A;  2VP1 A;  1Z7N E;  3FV1 A;  4ELQ A;  5I84 A;  1J1N A;  3FVN A;  2XXU A;  2HAV A;  2IA4 A;  3O6I A;  2R9J A;  5H8H B;  3OXN A;  1MXW A;  1JEU A;  1URS A;  3OSR A;  5KZT A;  1SBP A;  5K2Y A;  2UVH A;  2E1S A;  1LBC A;  4WED A;  1TFD A;  4JWX A;  3IOR A;  4OEU A;  4F31 B;  2H9B A;  5L9M A;  3G3G A;  3UN6 A;  3CI8 A;  1B5J A;  4NE4 A;  4O3A A;  1US4 A;  2PBW A;  2O1M A;  2XX8 A;  4ZEB A;  3GBB A;  3QAX A;  4Q30 B;  1B4Z A;  4OER A;  2QS1 A;  4QSD A;  4AB5 A;  3S9N C;  2I0C A;  4P0G A;  3VVF A;  5H8F A;  1LAF E;  4KYS A;  3S2V A;  4ONY A;  4OFJ A;  1ZTY A;  4OWD A;  1H3D A;  3VVE A;  1M5E A;  4GVO A;  1Y1Z A;  3QIM A;  3MQ9 A;  4X1D A;  3E3K A;  4RJZ A;  3TUS A;  3KSJ A;  1AH5 A;  1I69 A;  4U1O A;  2IEE A;  1Y3N A;  3K2D A;  3QXM A;  1H44 A;  3IOW A;  2H25 A;  3D4G A;  1JVY A;  2F35 A;  1H45 A;  5EHS A;  5I2K B;  3ONM A;  4EF1 A;  4R6Y A;  4PFT A;  5H8H A;  3TTN A;  1USY H;  1FW0 A;  3N6T A;  2ZMB A;  2P1S A;  2OBG A;  3MJN A;  2H98 A;  1NKX A;  1B4H A;  3VE1 B;  2OK2 A;  4ZS9 A;  2UYE A;  1LB9 A;  1ZIU A;  1N76 A;  3F11 A;  4HTG A;  3VLV A;  2F6P A;  2UVG A;  3PUY E;  4ESW A;  4IGR A;  4MH5 A;  5FTH A;  3RY3 A;  4QFP A;  1MPB A;  2CMO A;  1Y20 A;  3U93 A;  4IO5 A;  3RN8 A;  1QUL A;  3IK6 B;  2HAU A;  1IEJ A;  2DE4 A;  5LOM A;  4GD5 A;  2RCA A;  1POT A;  4HW8 A;  4PFW A;  5H8Q B;  1O63 A;  1LAH E;  2H5Y A;  4H65 A;  1XS5 A;  4PE5 B;  5BWJ A;  3KOT A;  4UA8 A;  3IL1 B;  2QSX A;  3H6V A;  3T66 A;  1URD A;  3PD9 A;  4RA1 A;  2PVU A;  4DIG A;  5L9O A;  3C34 A;  3AXF A;  2DYX A;  1SW4 A;  5DVF A;  2DSF A;  4MBP A;  4ZEI A;  2RCB A;  2XD2 A;  3H6W A;  3T96 B;  3S9M C;  5EYF A;  2HEU A;  1B2H A;  3TDJ A;  1USY E;  4OES A;  5I2K A;  1GTK A;  3PPQ A;  4Q0C A;  4EUO A;  3C9H A;  1LCT A;  2ONK E;  3K6U A;  3DP8 A;  4IO2 A;  3KEI A;  3TEL A;  4PP0 A;  1Q35 A;  1MS7 A;  2RIN A;  1MXU A;  3ZS6 A;  4RK9 A;  5L8D A;  3K1N A;  3W15 C;  2R6G E;  1P1U A;  2G93 A;  3H4Z A;  3DEL B;  4F2Q A;  5AA4 B;  4H8I A;  2YPN A;  1CB6 A;  2XX7 A;  4H1X A;  5FHN A;  4NED A;  3S9L C;  3Q27 A;  1LAX A;  1XVY A;  3V5A A;  4H0W A;  4R73 A;  3SET A;  1ZKB A;  4DXU A;  3O66 A;  3R6U A;  4OZ9 A;  1B40 A;  4QFL A;  2RKM A;  2I3V A;  2Q89 A;  1MY0 A;  1Y4C A;  5DVJ A;  1RYX A;  3RPW A;  4GXA A;  2VHA A;  5H8N B;  1SYI A;  1A55 A;  4GIZ A;  1H76 A;  2P0S A;  4NF5 B;  3LBS A;  3IB1 A;  5A5X B;  3SEV A;  1MG1 A;  4NF4 B;  1LGB C;  3ODB A;  3H03 A;  4KR5 A;  4DLD A;  4BLA A;  4NWD A;  1MPD A;  4FE8 A;  4LON B;  3MVX A;  3PU5 A;  3FAT A;  5CBR A;  4KQP A;  5I2N A;  3HHG A;  3PPO A;  3LSL A;  2I48 A;  1WVJ A;  3LC8 A;  1B3G A;  4LQ5 A;  5AE4 A;  2I58 A;  1GV8 A;  2DWA A;  1SW2 A;  4YKK A;  5I56 B;  4OEN A;  2FYI A;  3QYT A;  1LFH A;  3TZA A;  1QUJ A;  4GL0 A;  1JEV A;  4RY1 A;  1N0T A;  2V3U A;  4I8C A;  2UVJ A;  2Z8E A;  4GL8 A;  3TCF A;  2KLF A;  3HST A;  1TT1 A;  3PMV A;  5I57 B;  2ZNT A;  5B7D A;  3GXA A;  5B70 A;  4JWY A;  2XD3 A;  3B6T A;  4YKI A;  1JET A;  4EQB A;  1HSE A;  4L17 A;  3TTM A;  4POW A;  4FAJ A;  5H8N A;  3ZSF A;  3V89 B;  3N6U A;  3B6W A;  4NF5 A;  2QJE A;  4EF2 A;  4QSC A;  5A5X A;  4GF8 A;  3T9H B;  2B65 A;  1Y1M A;  1IXH A;  4NF4 A;  1NNT A;  1T0K A;  2OZZ A;  3MVW A;  1MXX A;  3BFU A;  1B51 A;  1IXI A;  1GR2 A;  4LVQ A;  2QRY A;  2V3Q A;  3KN7 A;  2PT1 A;  4IO4 A;  1MXZ A;  1N7X A;  3L6H A;  2PMS A;  3PPR A;  2F7A A;  2YJP A;  3MWB A;  4MLV A;  4FEC A;  1AL3 A;  2X7P A;  4F2O A;  3TOD A;  3OSQ A;  4ELO A;  2I6E A;  2X7Q A;  1LFI A;  2D3I A;  4XKQ A;  2AL5 A;  5JTY B;  4DCY A;  2Y84 A;  4LAT A;  1M5B A;  4R9G A;  5I56 A;  3TTR A;  3EF7 A;  2GRV A;  1DTZ A;  3C4M A;  4R9F A;  3VXC A;  1D9V A;  1MY2 A;  2Y7R A;  4PET A;  3RTF B;  1N04 A;  1SI1 A;  1FQA A;  3U72 A;  3SKP A;  5I57 A;  4BDO A;  1N3W A;  3CG1 A;  4X1B A;  3FVK A;  3MVY A;  1NNK A;  5HM4 B;  5FHO A;  2FA7 A;  3DP6 A;  1D4N A;  1OQH A;  3KG2 A;  1IXC A;  3OD7 A;  4G77 A;  5H8F B;  3D4C A;  5DVI A;  1ELJ A;  3T22 A;  4NTL A;  2DE3 A;  3K6V A;  3OEM A;  1B6H A;  1NMU A;  1VFD A;  4WXJ A;  3SER A;  1B58 A;  1IZ1 A;  3PGF A;  3VVD A;  3HO7 A;  5CBS A;  1UIU A;  3FVG A;  3Q25 A;  4XXU A;  2ZXT A;  1B5I A;  4FJP A;  1R6Z A;  4U1Z A;  1BTJ A;  5AA2 B;  4EDP A;  5HBC A;  4XKR A;  3N26 A;  3ECR A;  3MP8 A;  3DLN A;  4K3F A;  3TCH A;  3K00 A;  3MZ1 A;  1PEB A;  4N6P A;  3IR1 A;  1II5 A;  2GFE A;  4R75 A;  4DE8 A;  1B1H A;  5KDT B;  1P1N A;  4YB7 A;  4UAC A;  4C1U A;  3VLW A;  2OJT A;  2HFB A;  5JTY A;  2O1L A;  3U94 A;  1L5T A;  3MUQ A;  1GGG A;  3LSX A;  3KOS A;  3IJO B;  2DOJ A;  5JEI A;  1AIV A;  4OTE A;  1B52 A;  1MDP 1;  3O9P A;  4LA9 A;  5DEX B;  1BKA A;  2VGQ A;  3UGW A;  4ELR A;  1PB8 A;  3ZKL A;  3PUV E;  3T9X B;  3MC2 A;  4EXK A;  2XXX A;  3T9U A;  2Q8J A;  4KI0 E;  5I59 A;  1YTV A;  3O2A A;  1YAE A;  4YKP A;  3Q28 A;  3T93 B;  1XC1 A;  1R9Q A;  4QHQ A;  4GOT A;  3K01 A;  4FED A;  2HZK A;  1AMF A;  3U8Q A;  3C32 A;  2V3T A;  5F7V A;  2XXR A;  4Z0I A;  2DVC A;  1ZLQ A;  2XXP A;  4M4G A;  2AL4 A;  3S9E A;  1MQH A;  5AA2 A;  2DWJ A;  1XVX A;  4LP2 B;  1B3E A;  3TTK A;  3MW0 A;  2ONR A;  4G4P A;  4KYD A;  3CIJ A;  4U4S A;  3SEX A;  2G29 A;  1JQF A;  1Y3Q A;  5ISU A;  3PPN A;  3KGC A;  5KDT A;  3DM0 A;  2QS3 A;  3K6W A;  1Y9U A;  3THI A;  4THI A;  4BDM A;  2I3W A;  2B3F A;  3HN0 A;  2F7B A;  1A8E A;  3QUF A;  3OOA A;  4F3P A;  1BP5 A;  1EU8 A;  5DEX A;  1MQG A;  5H8S A;  1MPC A;  4ZEC A;  1I6B A;  1N3X A;  2NUV A;  5CMC A;  3C36 A;  4KCD A;  3M3F A;  4P0I A;  1YCJ A;  2Y7I A;  1MY4 A;  2F7C A;  1B3L A;  4QRZ A;  3M3L A;  1EZ9 A;  3CSG A;  3MVZ A;  3MBP A;  4U21 A;  3OMB A;  3IAZ A;  3H6T A;  4ND9 A;  3SEW A;  3JV9 A;  4DXB A;  1SD3 A;  3KBR A;  2H99 A;  2XXT A;  1B0H A;  3TAJ A;  5I2N B;  1FQE A;  1QUK A;  1JW4 A;  5CMB A;  4DZ1 A;  1ZMG A;  3S4U A;  4C1T A;  4YU0 A;  1MY1 A;  3IO4 A;  4E0X A;  4F1U A;  4IO6 A;  3TFL A;  3H06 B;  1B0L A;  4POX A;  3PV0 E;  3O28 A;  1PC3 A;  1N7W A;  2VD2 A;  4ZEF A;  4O3B A;  1PBQ A;  1IUD A;  1MQJ A;  1NNF A;  2E0S A;  4YB6 A;  1MDQ A;  3RNN A;  1I6Q A;  3PD8 A;  3C33 A;  3PMW A;  1B9J A;  3K02 A;  2UVI A;  3CRB A;  4N07 A;  2DP8 A;  1SQY A;  1WOD A;  3CR9 A;  4FAT A;  3G3K A;  3K1M A;  4R72 A;  3FV2 A;  1DOT A;  1JW1 A;  1QW0 A;  3C31 A;  2REJ A;  4RXL A;  3OO6 A;  3OO9 A;  1RYO A;  3B7D A;  4LUB A;  4F3G A;  4QF9 A;  1B7Z A;  3K1P A;  1R9L A;  1XT8 A;  3CFX A;  2XHD A;  3H7M A;  3QK6 A;  1D3K A;  2XXH A;  1QUI A;  3B6Q A;  5CM6 A;  5M2V A;  3FZV A;  4YMB A;  2V84 A;  1S50 A;  2W7Y A;  2GHA A;  5ITP A;  1ZU0 A;  2WKY A;  1Q1K A;  3ZKK A;  4JB7 A;  1A8F A;  2O69 A;  2ANJ A;  1UQW A;  1LLS A;  4QFN A;  4OXV A;  4BDQ A;  2ZNU A;  4TOZ A;  3MZ9 A;  2RC7 A;  3KN3 A;  1IIW A;  4ZE9 A;  2PT2 A;  1P1W A;  1SI0 A;  4G2Z A;  5DT6 A;  2OWT A;  4MF3 A;  2XXW A;  1UTB B;  4X48 A;  4BDL A;  2ZNS A;  4LZ7 A;  1FTK A;  4BDN A;  3RQT A;  4DXC A;  3TQL A;  3PPP A;  5DTB A;  1B7H A;  2DXY A;  1R1N A;  3EN3 A;  1Z7M E;  2V25 A;  3GZG A;  4C0R A;  4H5G A;  3Q29 A;  4RNS A;  1ZBM A;  2RC9 A;  3FIR A;  1MM7 A;  2HQ0 A;  2DWI A;  3L6G A;  1PBP A;  1M5C A;  2F34 A;  3IB2 A;  2FNC A;  2RF1 A;  3KFM A;  3PUW E;  4U4X A;  1OQG A;  4U2R A;  4IY6 A;  4JBZ A;  2A5T A;  2O68 A;  2ZYO A;  3CVG A;  1VE4 A;  4XIG Q;  3V8X B;  3I5O A;  4X9T A;  4AB6 A;  1XHY A;  4QFO A;  3FXU A;  3OO8 A;  3R7X A;  1MXY A;  5ICT A;  4GWO A;  2M8C A;  4OHN A;  4ZDM A;  1QJM A;  1LB8 A;  4G8M A;  3TEP A;  4JSO A;  4RK2 A;  1ANF A;  3U92 A;  1WDN A;  1A7L A;  4GFR A;  4WKM A;  1A99 A;  1LCF A;  1DPE A;  4ECF A;  3P7I A;  3UIF A;  3W9V A;  3MP1 A;  3G3F A;  2Z8F A;  4JXI A;  3FAS A;  5IKB A;  4H5F A;  2I4C A;  3FGS A;  4KD5 A;  3R26 A;  4PQJ A;  1UTB A;  5AA1 A;  4R2F A;  3SES A;  3RGY A;  1IXG A;  3VV5 A;  5I59 B;  4I9D A;  4G68 C;  4RPO A;  2BJJ X;  2XXI A;  2X26 A;  3KJT A;  4F3S A;  1FTM A;  1KWH A;  4JWO A;  3I3V A;  2ALU A;  1SW5 A;  3KN8 A;  4RPN A;  4U22 A;  4RYA A;  5CMM A;  4IY5 A;  3KSX A;  4OVJ A;  2A5S A;  1QVS A;  5I58 B;  1M5D A;  4XTC Q;  4R6K A;  5DYH A;  1B3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...