4R2FA

Crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
394
structure length
394
Chain Sequence
GAIKFWDMPWATPAYNDAAKKIAEGFSGANSKATYQIIQWNNFYQTFSSAIASKTGPAVSTGGGFQAFQFEEQGQIAYADKVIEKLKSNGQFDDFLPGVVEPFKTSKGYVAVPWQLDIRPLWYRKSLFEKAGVGVPTDWASLLEAGKKLKGVGAVGFATGSGAGNNIGNHLMIMMMLNNGGGVFTKDGELDVLNDRNVEAVEFLLELVSNGVIDPAAVSYTTDNLNAQWKDSKAAYGMLTLGVPERVGDTSGDIVVASPIAGPHGDKAALIFPNNIMMYTNTPSQEASEEFVVYYLGKLKELWQQKLMNALPVFKSITEMPEFTADPNNVKIVNEYVPIAKTFASQGTALSANLAALDGGQALNQFTQTVLTGKTDAKSALTAFDTGLKSVLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Extracellular solute-binding protein family 1
publication title Crystal structure of sugar transporter ACHL_0255 from Arthrobacter chlorophenolicus, target EFI-510633
rcsb
source organism Arthrobacter chlorophenolicus
total genus 135
structure length 394
sequence length 394
ec nomenclature
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r2fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4r2fA02
1L5TA 2RC7A 1MG1A 2QS1A 5CMMA 5DEXA 4P0GA 1MY1A 4E0XA 1SD3A 1RYXA 4GOTA 1JEUA 2IEEA 1JVYA 3CR9A 3VVEA 2Z8EA 1LB9A 5M2VA 3VVFA 4N6PA 3PMXA 2H25A 3RT6B 4OFOA 1SYIA 4G68C 2R71A 1OIBA 2F35A 3RNNA 3MZ9A 3RT8A 4H8IA 3IAZA 2VGQA 1R1NA 4FAJA 3T66A 2V93A 4XKQA 4NF4A 5KZTA 5L9OA 1FW0A 3KOTA 4OWDA 2XXPA 3PPOA 2ZNSA 4LQ5A 2X7PA 1QUKA 1IITA 4X48A 4LONB 4FATA 4NF8A 1JW1A 3LC8A 3M3FA 3QUFA 4C1UA 3CVGA 1B6HA 2QMWA 1B40A 2F78A 3H6UA 1USYH 3ZKLA 3C32A 3VLWA 4OXVA 1LGBC 1SVXB 3GBAA 3U72A 3T9UA 4ZDMA 2Q8JA 4ZE9A 2UVJA 3UA8A 5F7VA 5I2NA 3BKIB 1XVXA 3O97A 4C1TA 1BKAA 5L9SA 1SW5A 1SDXA 4RK2A 1MQDA 2O1MA 3K6VA 3K02A 3G3KA 5I58B 5FHMA 4OZ9A 5F1QA 4Q0CA 4BDMA 2E0SA 1S7YA 3H6VA 3DP8A 4YKJA 4O3BA 5CMCA 4KCDA 2OZZA 4YB5A 3VXCA 3KBRA 2PYYA 4F39A 5I2KB 4IO3A 2RC9A 1UIVA 3IJXB 1MDQA 4HS7A 1B1XA 3HO7A 3O6IA 2KLFA 3PU5A 4KI0E 2XX8A 1QKBA 2XD3A 3IOUA 2ZYOA 2ONSA 1JVXA 4IO7A 2P2AA 4M4GA 4BDQA 3T9HB 1AH5A 1JETA 3MW0A 3EN3A 2THIA 1PEBA 3K2DA 3FV2A 1LFIA 2A5SA 4FECA 5I59B 3ILUB 4POXA 2P1SA 2XX7A 2F36A 1GGGA 1POTA 4R6HA 3KZGA 1IZ1A 4UA8A 1PBQA 2G93A 3O6GA 1LFHA 4GF8A 3TTKA 1B52A 1AIVA 2IA4A 1N3WA 3IX1A 3WAFA 3PV0E 1OMPA 5I56A 1Y3PA 1AMFA 3Q29A 2REGA 1A40A 3PMWA 2H98A 1GVCA 2Q89A 4EXLA 1HSLA 1Y3QA 1B2HA 1LAXA 3S9NC 3E13X 3UGWA 3VLVA 2Q2CA 3EQ1A 5A5XB 1B0LA 2VD2A 3HCQA 4JWYA 3PUWE 3MVYA 2I3WA 3O9PA 1Y4TA 1ZLQA 4HCYA 4YZZA 2B65A 3QUJA 2B3FA 3HSTA 1B5HA 3RLFE 3S2VA 4XKNA 2I6EA 3A3CA 3FZVA 4C0RA 3TQLA 3VV5A 3SEVA 3SEUA 3S9LC 1N76A 3MQ9A 1A55A 1ZIUA 3K0VA 5IAIA 4QFLA 2UYFA 2F7BA 3EHSA 4GRKA 5K2YA 2ZYNA 4G8MA 1WDNA 3WAEA 1A54A 1B05A 4GXAA 3MZBA 2UVIA 2ZXTA 3KN8A 5TU0A 2ONRA 4BDOA 1AOVA 1MXYA 1QUJA 4R2FA 1MM6A 4POWA 3QSLA 1IXCA 1UTHA 4G8NA 3N26A 1B1HA 3CSBA 3E4RA 2ZMBA 4PETA 1Y4CA 3FVNA 1IIWA 3C31A 5ITOA 4U4XA 3GLBA 3SERA 1GR2A 3EHUA 3G3FA 2UVHA 1EZOA 1D9VA 4U21A 2I4BA 1H43A 3FXRA 4MBPA 1ATGA 4OETA 5FHOA 4ISUA 4F29A 2CZLA 4M1VA 4OENA 1EH3A 2I48A 4Z0IA 4E0WA 4ZZAA 4F2OA 3H6TA 4PE5B 3BFTA 5TPAA 4TLLB 3I3VA 3P7IA 1J1NA 2Z23A 4DXUA 1JW5A 1JEVA 2D3IA 2Q88A 3T22A 2F97A 4DLDA 2G29A 1T0KA 4OERA 3AXFA 5JTYB 4LA9A 1I6BA 4FE8A 2OWTA 3SKPA 3K6UA 5BUUA 4HCWA 2PMSA 2ONKE 1DSNA 4R6KA 4ZE8A 1DMBA 2GFEA 3D4GA 2OJTA 1IUDA 3FD3A 5CBRA 1TFDA 5I57B 1MH3A 4ELRA 2D5WA 3OD7A 3W15C 3H03A 1USYE 3B6WA 4F3SA 4DDDA 1N7WA 2Z8DA 3N6UA 2QSXA 1OVBA 1FQCA 4G68A 4R9GA 4YU0A 4FORA 3SESA 4YAHX 1MPCA 1AL3A 1LCFA 5DVIA 4ZZEA 1NMUA 1OQHA 3RQTA 2O51A 3SEXA 3ZSFA 5AA2D 3IK6B 4XKRA 3V8XB 3TYHA 4YMBA 4NEDA 1EU8A 2OCUA 4RPOA 4DCYA 4PFYA 3K6WA 3MJNA 1B7UA 5TP9B 3IO4A 4QF9A 1BIYA 3CFZA 3A09A 3LUYA 5FHNA 3PPRA 3C36A 5HM4B 4G4PA 1FQEA 3N94A 3V5AA 2XXVA 4F1UA 2PT2A 3PMVA 4QFPA 3C33A 1RKMA 3FATA 4QHQA 4F3PA 2OK2A 4GXSB 4O3CA 3U94A 4NWCA 2Z22A 1ZKBA 4PP0A 3KN3A 4QSCA 5H8FB 3JYRA 4MFIA 3CFLA 3MZ1A 3K1MA 4G77A 4G2ZA 3KEIA 4OESA 2R9JA 3THIA 4XTCQ 3RY3A 4OVJA 4F3GA 4GLIA 4NF5B 3FXUA 4OEVA 5B7DA 2NVUB 3TDJA 4ZEIA 3MPLA 2V25A 1P1UA 3OSQA 1Y3NA 5I84A 3TELA 4RNSA 3ZKKA 4YB6A 2RCBA 4XKPA 1LBCA 3IORA 3DLNA 2M8CA 3LSXA 3Q25A 4F1YA 1B46A 3I6VA 4R72A 4NMYA 4TOZA 3KFMA 3KSJA 2RINA 1B0HA 3ONMA 1HSJA 1N7XA 1NNPA 3ODBA 2I0BA 3U92A 3FJMA 4YB7A 3SETA 4H6DA 4QSEA 5EHMA 4U4SA 4PFWA 4ELPA 3GBBA 3IB0A 1MQHA 4KYEA 5I58A 4ECFA 1M5CA 4RA1A 4KR5A 1B3HA 3HHGA 3CG3A 4ESWA 1XVYA 2H99A 3USDA 1LBBA 5CC2A 1D3KA 3IOTA 3H6WA 4KQPA 5H8QB 1H3DA 3H7MA 2YLNA 4U1ZA 4ZECA 1I6AA 2RKMA 4F19A 5KDTB 1M5DA 5I2KA 2HZLA 2QS2A 1R9QA 1Q35A 5CMBA 3TZAA 2XXRA 4NF6B 3TMGA 3L6GA 4EQ9A 2A5TB 2F5XA 5H8NB 5AA2B 3H3GA 3TTMA 3B7DA 4MLVA 4PQJA 1POY1 1ZTYA 1DPPA 1FCKA 1OVTA 1VR5A 3MWBA 1KWHA 1MQJA 2XXTA 2ZYKA 1QUIA 5ICQA 5DVFA 3MVXA 4WEPA 4FIMA 1DTGA 3TTRA 1UQWA 3N5LA 3FVGA 4GFRA 4QSDA 5AA3A 1TT1A 1FQDA 1O63A 5H8SA 5I59A 3U93A 2I58A 2ZNTA 2DVZA 1A8EA 4R75A 3TODA 4U22A 1URSA 3UN6A 2WKYA 2DXYA 3TTLA 3TFLA 1F9BA 1XT8A 1GTKA 5CMKA 1H45A 4RJZA 3G3IA 4YKIA 3RTWB 5JEIA 4H5FA 3K00A 2XXHA 2HAUA 4KCCA 2O7IA 3UORA 3TPAA 3VVDA 4YMAA 5KCJA 1MQGA 1MQIA 1TFAA 3B6TA 3MBPA 1IQ7A 2QRYA 3SEWA 1SBPA 2PBWA 3FVKA 5FTIA 1FQBA 1MY4A 5CBSA 2GRVA 4Q30B 1YCJA 5KCJB 2DVCA 5A5XA 4XXUA 3T93B 3KJTA 2QMXA 3BFUA 4X1DA 1NFTA 3FXQA 3O29A 2BJJX 3DP4A 2W7YA 4DCXA 2F7CA 4LATA 1BP5A 4R74A 1S50A 1URDA 3M3LA 1XC1A 1M5FA 3IL1B 1B58A 2UYEA 4FEBA 4I62A 2F6PA 1NKXA 3OO9A 3OEMA 2DOJA 4QRZA 2XD2A 1MXXA 1CE2A 4EF2A 4IGRA 1URGA 3OXNA 2AYSA 3E3KA 4OYVA 3VE1B 4H0WA 3OO7A 2FYIA 3Q28A 1MXVA 4QFKA 1HSEA 1ANFA 4PFUA 2NWJA 1I69A 4ELQA 5ICTA 2VHAA 2QL3A 4JXIA 2PT1A 1R6ZA 1LB8A 3QAXA 1SI1A 2REJA 3O2AA 2QS4A 3G3HA 3LSLA 3RN8A 1MS7A 1M5EA 1PB7A 1NH7A 3RGYA 4WKMA 3K01A 4JB7A 4KYSA 1Y9UA 4KHZE 3M8UA 4EF1A 5AA4A 4FEDA 2VP1A 3FIRA 3JZJA 2RF1A 3MAMA 4LUBA 4IO4A 5AA4B 2Y7WA 3FV1A 1N3XA 5CI5A 1I6QA 1MXWA 3MVWA 2F7AA 2F34A 1BLFA 4N13A 5JTYA 3SDFA 4ZEBA 1XHYA 2DXRA 3EPEA 3S9EA 2DSFA 3CI8A 2V3TA 4LZ7A 3MP6A 3EHTA 1PB8A 5CM6A 2PX1A 3OSRA 5I57A 2XXXA 2DS9A 2OWSA 3RPWA 1B5JA 2VD3A 4LZ5A 1US5A 2CMOA 4ZEDA 3IOWA 1OLAA 4I8CA 1B51A 1Y20A 4ONYA 1GV8A 2HQ0A 5H8HB 4GQOA 4JSDA 2DE2A 4ZEFA 4BDNA 3PPPA 2H4IA 1SW2A 1Q1KA 4KYDA 4R6YA 2YJPA 1A7LA 3HHFA 3IOVA 4Q5TA 2HZKA 1R9LA 4NTLA 3M3KA 1MPDA 3U8QA 3LBSA 3K6XA 5DTBA 2I4CA 1MRPA 3BBRA 5TP9A 3C34A 1B7HA 2O84X 1Y1MA 4EXKA 1QJMA 3G3JA 3Q26A 4DIGA 1LAHE 4IB2A 5DVJA 3OO6A 3A3UA 4H1XA 4I1DA 5DYHA 4UACA 1FQAA 5ISUA 2UVGA 1SI0A 2O69A 4K3FA 3V83A 3O28A 1IXIA 3KG2A 4F3BA 1SW1A 2O68A 1B9JA 4EQBA 4AQ4A 4I9DA 1UTBB 5H8FA 1VFEA 1NNFA 1LFGA 1VE4A 2AL5A 2HFBA 2Z8FA 1B5IA 1FTOA 4F31B 2VOZA 5ITPA 4OHNA 4GIZA 4OEUA 3DELB 1EZ9A 3HV1A 2RC8A 4AB6A 3PUXE 2DWJA 4OFLA 4NF5A 4ELOA 3Q27A 3S4UA 2DE4A 4MF3A 5BWJA 4BDLA 2I3VA 3TEPA 4IGTA 2OBGA 1DTZA 1B4HA 2UXAA 5LOMA 4H5GA 4MH5A 4YKKA 1LCTA 5L9MA 2HXWA 3FVOA 2ABHA 2Y7KA 5DEXB 3MP8A 4OQOA 4OFJA 2Y7RA 1A8FA 2XXWA 1MY3A 4DZ1A 3PGFA 1FTMA 3TAJA 3PD9A 3KN7A 4JDFA 2QS3A 1TXFA 2YPNA 2F6GA 1B3GA 4HTGA 3O66A 3TQWA 2Y7IA 3R26A 3EF7A 2R6GE 1MXZA 4RY1A 4JWOA 3LSWA 4LZ8A 2DWIA 4JSOA 5EYFA 1P1WA 4EDPA 1O64A 4OTEA 1SYHA 3JV9A 3QXMA 2H9BA 2V3QA 2AIXA 4NF4B 1ZMGA 5K2XA 4QFOA 1P1OA 2DWAA 4DE8A 2ESNA 1B3LA 4KFQA 3D4CA 4TLMB 3PPNA 4NF8B 1MPBA 5H8QA 1NNKA 3OELA 3MVZA 5KDTA 4ND9A 2ZYMA 4NE4A 3C4MA 4MLQA 4NF6A 1B32A 1IXGA 1MXUA 5B70A 4XIGQ 2A5TA 3TCFA 5H8NA 5AA2A 2AL4A 4F2QA 3W9VA 5I2NB 1XS5A 1NH8A 2XXUA 5DT6A 3LR1A 1TWYA 3PUVE 1JQFA 4AB5A 1PDAA 3LSFB 3OMBA 2XXQA 3MPKA 4GWOA 5CRYA 1QVSA 3FASA 2D21A 2LAOA 4EQ7A 1VSOA 4DXBA 4TQUQ 4H65A 1H76A 4DXCA 2I49A 3QIMA 4IO6A 1MY2A 1FTLA 3FJGA 3L6HA 4KPTA 3OENA 5EHSA 4U2RA 4RPNA 1WODA 3S9MC 4ZS9A 4WEDA 4LQ2A 3RTFB 4JBZA 2ALUA 1OLCA 4P11A 3R7XA 4ESXA 2QPQA 1PB9A 2XHDA 3F11A 3FGSA 2HAVA 2F8DA 3W9WA 4IO2A 2O6AA 1NL5A 1DOTA 3VXBA 4X1BA 2OLBA 3T9VA 1XOCA 3K1PA 3MUQA 3MC2A 3TCHA 2XXIA 3CSGA 3ZS6A 2PVUA 4IY6A 3CRBA 1YPNA 3UP9A 4R2BA 3C9HA 2O7UA 1N0TA 1RYOA 2O1LA 4GD5A 3GXAA 3KGCA 3VLUA 4U1OA 3IO6A 2H5YA 2NXOA 4GL8A 3UIFA 2Q2AA 2P0SA 1QKAA 1S9TA 5I56B 1Y1ZA 1CB6A 3U1OA 2E1SA 4G8HA 2NUVA 1FTKA 3OEKA 4WXJA 1ZBMA 1ZU0A 4HW8A 1LSTA 2V3UA 2FA7A 2ZNUA 3DM0A 1B3FA 1JW4A 3HN0A 2NOOA 1DPEA 3C35A 4LVQA 2ANJA 2DWHA 2V84A 3T96B 2Y84A 5IKBA 3TTNA 3HPIA 4H8JA 1MDP1 1M5BA 1US4A 4R73A 3V89B 3GZGA 1QULA 5HPQA 4F1VA 1B7ZA 1ZJLA 3PD8A 3VFJA 2GHAA 2GH9A 5ELVA 3B6QA 1N04A 4IY5A 1YTVA 3IJOB 1BTJA 3QYTA 3H4ZA 4KD5A 4LP2B 2I0CA 2Q9TA 4IO5A 4JWXA 4BLAA 3DP6A 1FQFA 2DE3A 4QFNA 2B3BA 5FTHA 3FUZA 3G7WA 3ECRA 1IEJA 1UTHB 1D4NA 2X7QA 4RXLA 3TCGA 3RUMA 3SEYA 1II5A 1O7TA 3H06B 1H44A 4YICA 3R6UA 4FJPA 4PFTA 4RK9A 2XX9A 1VFDA 1SQYA 3K4UA 3I5OA 5JK4A 1A99A 2XXYA 1SW4A 4ZEKA 1LLSA 1N84A 4R9FA 1Z7NE 1MH4A 5AA1A 3ILTB 5L8DA 2DQVA 3OOAA 5TPAB 3CG1A 3QK6A 5H8HA 2FNCA 1LAGE 4THIA 4O3AA 1UIUA 4EUOA 1YAEA 3IB1A 3CFXA 1OQGA 5AE4A 3KOSA 3PUYE 5HBCA 3E9XA 4F22A 4RYAA 2QJEA 3PPQA 4N07A 4P0IA 1B4ZA 1B3EA 1Z7ME 4OMBA 3IB2A 2DYXA 1P1QA 1P1NA 2RCAA 1NNTA 3O6HA 1MY0A 3OO8A 2HCAA 1MM7A 1FTJA 1ELJA 4U23A 1PBPA 4NWDA 4GVOA 4G68B 1D9YA 3G3GA 3K1NA 4Q8RA 2DP8A 3FJ7A 2GHBA 3VDFA 1UTBA 5J1DA 4F18A 3KJ7A 4BDRA 3N6TA 3MP1A 2Y7PA 3TKDA 1PC3A 3PUZE 2HEUA 3CIJA 4YKPA 1JNFA 3T9XB 3TUSA 2X26A 1P99A 4GL0A 1EZPA 4Z7EA 3KSXA 3UK4A 4X9TA 1IXHA 3IR1A 1WVJA 1QW0A 1LAFE 4H67A 4L17A
chains in the Genus database with same CATH superfamily
1L5TA 2RC7A 1MG1A 2QS1A 5CMMA 4PGNA 2BJIA 5DEXA 1JP4A 4P0GA 1MY1A 4I40A 4E0XA 1SD3A 1RYXA 4GOTA 1JEUA 4I3EA 2IEEA 1LBXA 1JVYA 2B4MA 3CR9A 3VVEA 2Z8EA 1LB9A 5M2VA 5J16A 3VVFA 4N6PA 3PMXA 2H25A 3RT6B 4OFOA 1SYIA 1FPGA 1K9YA 4G68C 3IFCA 2R71A 4MAGA 1OIBA 2F35A 3QMFA 4JVCA 5ET8A 3RNNA 3MZ9A 2WYPA 3RT8A 4H8IA 3IAZA 2VGQA 1CNQA 1R1NA 4FAJA 3T66A 2V93A 4XKQA 4NF4A 5KZTA 2OX3A 5L9OA 1FW0A 3KOTA 4OWDA 2XXPA 3PPOA 2ZNSA 4LQ5A 2X7PA 1QUKA 1YXIA 1IITA 4X48A 1FPJA 4LONB 4FATA 4NF8A 1JW1A 3LC8A 3M3FA 3QUFA 1DCUA 4C1UA 3CVGA 1IMFA 1B6HA 2QMWA 4UABA 1B40A 2F78A 5DW8A 3H6UA 1USYH 3ZKLA 3C32A 3VLWA 1EYIA 2GQ1A 2WX9A 4OXVA 1LGBC 1SVXB 3GBAA 3U72A 3T9UA 4ZDMA 2Q8JA 4ZE9A 2UVJA 3UA8A 5F7VA 3B8BA 5I2NA 3BKIB 4NQ8A 1XVXA 3O97A 4C1TA 1BKAA 5L9SA 1SW5A 1SDXA 4RK2A 1MQDA 1KA0A 2O1MA 3K6VA 3K02A 2WYKA 3G3KA 5I58B 5FHMA 4OZ9A 5F1QA 2MKZA 4IR8A 4Q0CA 4BDMA 2E0SA 1S7YA 3H6VA 3DP8A 4YKJA 1RDZA 4O3BA 1LBZA 5CMCA 4KCDA 2OZZA 5EYGA 4YB5A 3VXCA 3KBRA 2PYYA 4F39A 5I2KB 4IO3A 2RC9A 1UIVA 3IJXB 1MDQA 4HS7A 1B1XA 3HO7A 3O6IA 2KLFA 3PU5A 4KI0E 2XX8A 1QKBA 2XD3A 5IZ1A 4NG7A 5LDZA 4N91A 3IOUA 2ZYOA 2ONSA 1JVXA 4IO7A 2P2AA 4M4GA 4BDQA 3T9HB 1AH5A 4PCDA 1JETA 3RPLB 2HXRA 5ET6A 3MW0A 3EN3A 2THIA 1PEBA 4O94A 3K2DA 3FV2A 1LFIA 4HE2A 2A5SA 2WBBA 4FECA 5I59B 3ILUB 4POXA 2P1SA 2XX7A 4DI4B 4H45A 3BIGA 2F36A 1GGGA 1POTA 4R6HA 2VPNA 3KZGA 1IZ1A 4UA8A 1PBQA 2G93A 3O6GA 4PDDA 1LFHA 4GF8A 4GWZA 3TTKA 1B52A 1AIVA 2IA4A 3D1RA 1N3WA 3IX1A 3WAFA 3PV0E 1OMPA 1RDYA 5I56A 1Y3PA 1AMFA 3Q29A 2REGA 1A40A 3PMWA 2H98A 1GVCA 2Q89A 4EXLA 1HSLA 1Y3QA 1B2HA 1LAXA 1AWBA 1FPDA 2KR0A 3S9NC 3E13X 3UGWA 3VLVA 2Q2CA 3EQ1A 5A5XB 2DDKA 1B0LA 2VD2A 3HCQA 4N15A 4JWYA 3PUWE 3MVYA 2I3WA 1FBFA 3O9PA 1Y4TA 1ZLQA 4HCYA 4YZZA 2B65A 3QUJA 2B3FA 3HSTA 1B5HA 3B50A 3RLFE 3S2VA 4XKNA 2I6EA 4LN5A 2CZHA 3A3CA 3FZVA 4C0RA 3TQLA 3VV5A 3SEVA 3SEUA 3S9LC 1N76A 3NOHA 3MQ9A 1A55A 1ZIUA 3K0VA 5IAIA 4QFLA 2UYFA 2F7BA 3EHSA 4GRKA 2Q8MA 1FBDA 5K2YA 2ZYNA 4G8MA 1WDNA 3WAEA 1A54A 1B05A 4GXAA 3MZBA 4PFRA 2UVIA 3T1BA 2ZXTA 3KN8A 5TU0A 2ONRA 1FBHA 5EQ7A 4BDOA 1AOVA 1MXYA 1QUJA 1Q9DA 4R2FA 1MM6A 4POWA 3QSLA 1IXCA 5IZZA 1UTHA 4PTKA 4G8NA 3N26A 1B1HA 3CSBA 3E4RA 2ZMBA 4PETA 1Y4CA 3FVNA 4OVRA 1IIWA 3C31A 5ITOA 4U4XA 3GLBA 3SERA 1GR2A 1NV6A 3EHUA 2PFZA 3G3FA 5LTCA 2UVHA 1EZOA 1D9VA 4U21A 5IZ3A 2I4BA 1H43A 3FXRA 1DBZA 4MBPA 1ATGA 4OETA 5FHOA 4ISUA 5A5LA 4F29A 2CZLA 4M1VA 4OENA 1EH3A 2I48A 4Z0IA 4ZZAA 4E0WA 4F2OA 3H6TA 4PE5B 3BFTA 5TPAA 4TLLB 3I3VA 3P7IA 2CZIA 1J1NA 2Z23A 4DXUA 1JW5A 1JEVA 2D3IA 2Q88A 4GX4A 2F97A 3T22A 2G29A 4DLDA 1T0KA 4OERA 3AXFA 5JTYB 4LA9A 1I6BA 4FE8A 2OWTA 3SKPA 1LBVA 3K6UA 4OVTA 5BUUA 4HCWA 2PMSA 3SZPA 2ONKE 1DSNA 4R6KA 4ZE8A 1FBGA 1DMBA 2GFEA 2VPOA 3D4GA 2OJTA 1IUDA 3FD3A 3MYUA 5CBRA 1TFDA 5I57B 1MH3A 4N6DA 4ELRA 2D5WA 3OD7A 3W15C 3H03A 1USYE 3B6WA 4F3SA 4DDDA 1KZ8A 1N7WA 2Z8DA 3N6UA 1LBYA 2QSXA 1OVBA 1FQCA 4G68A 4NHBA 4R9GA 4YU0A 4FORA 3SESA 2CZKA 1FBPA 4YAHX 1MPCA 1AL3A 1LCFA 5DVIA 4ZZEA 1NMUA 1OQHA 5ET7A 3RQTA 2O51A 3SEXA 3ZSFA 5AA2D 3IK6B 4XKRA 3V8XB 5I3SA 3TYHA 4MJOA 4YMBA 4NEDA 1EU8A 2OCUA 4RPOA 4DCYA 4PFYA 3K6WA 3MJNA 1B7UA 5TP9B 3IO4A 4QF9A 1BIYA 3CFZA 3A09A 3LUYA 5FHNA 3PPRA 3C36A 5HM4B 2B4LA 3A29A 4G4PA 1FQEA 3N94A 3V5AA 4NX1A 2XXVA 4F1UA 2PT2A 3PMVA 4MIJA 4QFPA 3EKIA 3C33A 1RKMA 3FATA 4QHQA 4F3PA 2OK2A 4GXSB 2FHYA 4O3CA 3U94A 4NWCA 2Z22A 1NV1A 1ZKBA 4PP0A 3KN3A 4QSCA 5H8FB 3JYRA 4MFIA 3CFLA 3MZ1A 3K1MA 4G77A 4G2ZA 1VDWA 3KEIA 5ESYA 4OESA 2R9JA 3THIA 4XTCQ 4N4UA 3RY3A 1LEVA 4OVJA 4F3GA 4GLIA 2ZZVA 4NF5B 3FXUA 4OEVA 5B7DA 2NVUB 3TDJA 1NUZA 4ZEIA 3MPLA 2V25A 1P1UA 3OSQA 1Y3NA 5I84A 3TELA 4RNSA 4PDHA 3ZKKA 4X8RA 4YB6A 2RCBA 4XKPA 1LBCA 3IORA 3DLNA 2M8CA 3LSXA 3Q25A 4F1YA 4NF0A 2XWIA 1B46A 1FPBA 3I6VA 4R72A 4GWWA 4NMYA 4TOZA 3KFMA 3KSJA 2RINA 1B0HA 4QBAA 3ONMA 1HSJA 1N7XA 1NNPA 3ODBA 4HE0A 2I0BA 3U92A 3FJMA 4YB7A 3FBPA 4H6DA 3SETA 4QSEA 5EHMA 2JJKA 4N8GA 4U4SA 4PFWA 4ELPA 3GBBA 3IB0A 1MQHA 2ZZWA 4KYEA 5I58A 4ECFA 4O7MA 4PFBA 1M5CA 4RA1A 4KR5A 1B3HA 3HHGA 3CG3A 4ESWA 1XVYA 3KBZA 2H99A 3USDA 1LBBA 5CC2A 1D3KA 3IOTA 3H6WA 1NV5A 4KQPA 5H8QB 1H3DA 1SPIA 3H7MA 2YLNA 4U1ZA 4ZECA 1I6AA 2RKMA 1NV2A 4F19A 5KDTB 2VT5A 1M5DA 5I2KA 2HZLA 2QS2A 1R9QA 1Q35A 5CMBA 3TZAA 1IMCA 2XXRA 4NF6B 5I7IA 3TMGA 3L6GA 4EQ9A 2A5TB 2F5XA 5H8NB 5AA2B 3H3GA 3TTMA 4OVSA 4JVIA 2Y5LA 3B7DA 4MLVA 4PQJA 1POY1 1ZTYA 1DPPA 2P3VA 1FCKA 1OVTA 1VR5A 3MWBA 1KWHA 1MQJA 2XXTA 2PCRA 2ZYKA 1QUIA 3RPLA 5ICQA 5DVFA 3MVXA 4WEPA 4FIMA 1DTGA 3TTRA 1UQWA 3N5LA 3FVGA 4GFRA 4QSDA 5AA3A 1TT1A 1FQDA 1O63A 5H8SA 2R8TA 5I59A 4MMPA 3U93A 2I58A 2ZNTA 2DVZA 1A8EA 1KA1A 4R75A 1EYJA 4U22A 1URSA 3TODA 3UN6A 2WKYA 2DXYA 3TTLA 3TFLA 1F9BA 1XT8A 2F3BA 1GTKA 5CMKA 1H45A 4RJZA 3G3IA 1RDXA 4YKIA 1LBWA 3RTWB 5JEIA 2P3NA 4H5FA 3K00A 2XXHA 2HAUA 4KCCA 2O7IA 4XF5A 3UORA 3TPAA 3HFUA 3VVDA 4JVDA 4YMAA 5KCJA 4N81A 1MQGA 1MQIA 1TFAA 3B6TA 3MBPA 1IQ7A 2QRYA 3SEWA 1SBPA 2PBWA 3FVKA 5FTIA 1FQBA 1MY4A 5EQ8A 4P9KA 4GX6A 5CBSA 2GRVA 4Q30B 1YCJA 5KCJB 2DVCA 5A5XA 4XXUA 3T93B 3KJTA 2QMXA 3BFUA 4X1DA 1NFTA 3FXQA 3O29A 4OVPA 2V4CA 2BJJX 3DP4A 2W7YA 4DCXA 2F7CA 4LATA 1BP5A 4R74A 1S50A 1URDA 3M3LA 1XC1A 1M5FA 1FPFA 3IL1B 1B58A 2UYEA 3LUZA 4X04A 4FEBA 4I62A 5EYHA 2F6PA 1NKXA 3OO9A 3OEMA 2DOJA 4QRZA 2XD2A 3LV0A 1MXXA 1CE2A 4EF2A 3CHGA 4IGRA 1URGA 3OXNA 2AYSA 3E3KA 4OYVA 3VE1B 4H0WA 3OO7A 2FYIA 3Q28A 1MXVA 4QFKA 1HSEA 2XWOA 1ANFA 4PFUA 2NWJA 1I69A 4ELQA 5ICTA 2VHAA 2QL3A 4JXIA 2PT1A 1R6ZA 1LB8A 4O8MA 4MHFA 3QAXA 1SI1A 2REJA 3O2AA 2QS4A 2FBPA 3G3HA 2XWVA 3LSLA 3RN8A 1MS7A 1M5EA 2OWZA 1PB7A 4N8YA 1NH7A 3RGYA 4WKMA 3K01A 4JB7A 4KYSA 4AS4A 1Y9UA 1NUWA 4KHZE 3M8UA 4EF1A 5AA4A 4H46A 4XEQA 1NV3A 4I3YA 4FEDA 2VP1A 4MNCA 2XXKA 4GBWA 3FIRA 3JZJA 2RF1A 3MAMA 4LUBA 4IO4A 5AA4B 2Y7WA 3FV1A 1N3XA 5CI5A 1I6QA 1MXWA 3MVWA 2F7AA 2F34A 1BLFA 4N13A 5JTYA 3SDFA 4ZEBA 1XHYA 2DXRA 3EPEA 5EQAA 3S9EA 2DSFA 1BK4A 3CI8A 2V3TA 4LZ7A 3MP6A 3EHTA 1PB8A 5CM6A 4NN3A 4GWSA 2PX1A 4XFEA 4P47A 3OSRA 5I57A 2XXXA 2DS9A 2OWSA 3RPWA 1B5JA 2VD3A 4LZ5A 1US5A 2CMOA 4ZEDA 3IOWA 1OLAA 2PFYA 4I8CA 1B51A 1Y20A 4ONYA 1GV8A 2HQ0A 5H8HB 1IMDA 4GQOA 4JSDA 2DE2A 4ZEFA 4BDNA 3PPPA 2H4IA 1SW2A 1Q1KA 4KYDA 4R6YA 1EYKA 2YJPA 1A7LA 1NV0A 2WBDA 3HHFA 3IOVA 4Q5TA 2HZKA 1R9LA 4NTLA 3M3KA 3KC0A 1MPDA 3U8QA 3LBSA 3K6XA 5IM2A 5DTBA 2I4CA 1MRPA 3BBRA 4PF8A 1DK4A 5TP9A 3C34A 1B7HA 4OA4A 2O84X 1INPA 1Y1MA 4EXKA 1QJMA 3G3JA 2QVRA 1QGXA 3Q26A 4DIGA 1LAHE 4IB2A 5DVJA 3OO6A 3A3UA 4H1XA 4I1DA 5DYHA 4HXVA 5EQ9A 4UACA 1FQAA 5ISUA 2UVGA 1SI0A 2O69A 4K3FA 3V83A 3O28A 1IXIA 4KXPA 4P1LA 3KG2A 3FXBA 4F3BA 1SW1A 1IMBA 2O68A 1B9JA 2Q74A 4EQBA 4AQ4A 4I9DA 1UTBB 5H8FA 1FRPA 4HE1A 1VFEA 1NNFA 1LFGA 1VE4A 2AL5A 2HFBA 2Z8FA 1B5IA 1FTOA 4PC9A 4F31B 2VOZA 5ITPA 4OHNA 4GIZA 4OEUA 3DELB 1EZ9A 3HV1A 2RC8A 4AB6A 3PUXE 4OFLA 2DWJA 4NF5A 4ELOA 3Q27A 3S4UA 2DE4A 4MF3A 5BWJA 4BDLA 2I3VA 3TEPA 4IGTA 2OBGA 1DTZA 3RYDA 1B4HA 2UXAA 5LOMA 4MNPA 1FPIA 4H5GA 4MH5A 4YKKA 1LCTA 5L9MA 2HXWA 3FVOA 2ABHA 2Y7KA 5DEXB 3MP8A 4OQOA 4OFJA 2Y7RA 1A8FA 2XXWA 1MY3A 4DZ1A 3PGFA 1FTMA 3TAJA 3PD9A 3KN7A 4JDFA 3E79A 2QS3A 1TXFA 2YPNA 2F6GA 1B3GA 4HTGA 3O66A 3TQWA 2Y7IA 3R26A 3EF7A 1NUYA 2R6GE 1XI6A 1MXZA 4RY1A 4JWOA 3LSWA 4LZ8A 2DWIA 4JSOA 5EYFA 1P1WA 4EDPA 1O64A 4OTEA 1SYHA 3JV9A 4GWUA 3QXMA 2H9BA 2V3QA 2AIXA 4GWYA 4NF4B 1ZMGA 5K2XA 4QFOA 1P1OA 2DWAA 4PBHA 4N17A 4DE8A 2ESNA 1B3LA 4KFQA 3D4CA 4DI3D 4TLMB 5FBPA 1NV7A 3PPNA 4NF8B 3BIHA 1MPBA 5H8QA 1NNKA 3OELA 3MVZA 5KDTA 1D9QA 4ND9A 2ZYMA 4NE4A 3C4MA 4MLQA 4NF6A 1B32A 1IXGA 1MXUA 5B70A 4XIGQ 2A5TA 4PF6A 3TCFA 5H8NA 5AA2A 2AL4A 4F2QA 3W9VA 5I2NB 4P1EA 4N6KA 1XS5A 1NH8A 2XXUA 5DT6A 3LR1A 1TWYA 3PUVE 4NAPA 1JQFA 4AB5A 3ISPA 1PDAA 3LSFB 3OMBA 2XXQA 3MPKA 4GWOA 5CRYA 1QVSA 3FASA 2D21A 2LAOA 4EQ7A 1VSOA 4DXBA 4TQUQ 4H65A 1H76A 4DXCA 2I49A 3QIMA 3PTYA 4IO6A 4QXDA 1MY2A 1FTLA 3FJGA 3L6HA 4KPTA 3OENA 1FBEA 5EHSA 4G61A 4U2RA 4PBQA 4RPNA 1NV4A 1WODA 3S9MC 4ZS9A 4WEDA 4LQ2A 3RTFB 4JBZA 2ALUA 1OLCA 4P11A 3R7XA 4ESXA 2QPQA 1PB9A 2XHDA 2L5VA 3F11A 3FGSA 2HAVA 2F8DA 2Y5KA 3W9WA 4IO2A 2O6AA 1NI9A 1NL5A 1DOTA 3VXBA 4X1BA 2OLBA 4MX6A 3T9VA 1XOCA 3K1PA 3MUQA 3MC2A 3TCHA 2XXIA 5IGAA 5T3JA 3CSGA 1FPEA 2PVUA 4IY6A 3CRBA 3ZS6A 1YPNA 3UP9A 4P8BA 4GBVA 4OANA 4R2BA 3C9HA 2O7UA 3U65A 1N0TA 1RYOA 2O1LA 4GD5A 3GXAA 3KGCA 3VLUA 4U1OA 3IO6A 2H5YA 2NXOA 4GL8A 3UIFA 2Q2AA 2P0SA 1IMEA 1QKAA 1S9TA 5I56B 2XA5A 1Y1ZA 1CB6A 3U1OA 2E1SA 4G8HA 2NUVA 1FTKA 3OEKA 4WXJA 2QFLA 1FSAA 1ZBMA 1ZU0A 4HW8A 3GYYA 1FBCA 1LSTA 2V3UA 2FA7A 2ZNUA 3DM0A 1B3FA 2HHMA 1JW4A 2FIXA 3HN0A 2NOOA 1DPEA 3C35A 4FBPA 4LVQA 4PAFA 2ANJA 2DWHA 2V84A 3T96B 2HPGA 2Y84A 5IKBA 2FVZA 3TTNA 3HPIA 4H8JA 2FIEA 2F3DA 1MDP1 1M5BA 1US4A 4R73A 3V89B 2CEXA 3GZGA 5F24A 1QULA 5HPQA 4F1VA 1B7ZA 1ZJLA 3PD8A 4PAKA 4GWXA 3VFJA 2GHAA 2GH9A 5ELVA 3B6QA 1N04A 4IY5A 1YTVA 3IJOB 1BTJA 3QYTA 3H4ZA 4KD5A 4LP2B 2I0CA 4PE3A 2Q9TA 4IO5A 4JWXA 1IMAA 4MEVA 4BLAA 3DP6A 1FQFA 2DE3A 4QFNA 2B3BA 5FTHA 1FPLA 3FUZA 3G7WA 3ECRA 1IEJA 1UTHB 1D4NA 1FTAA 2X7QA 4RXLA 3TCGA 1NUXA 3RUMA 3SEYA 1II5A 1O7TA 3H06B 1H44A 4YICA 3R6UA 4FJPA 4PFTA 4RK9A 1G0IA 2XX9A 1VFDA 1SQYA 3K4UA 5ET5A 4MCOA 3I5OA 5IZ3B 5JK4A 1A99A 2XXYA 1SW4A 4ZEKA 1LLSA 1N84A 4R9FA 1Z7NE 1MH4A 5AA1A 3ILTB 5L8DA 2DQVA 4NGUA 3OOAA 5TPAB 3CG1A 3QK6A 5H8HA 2FNCA 1LAGE 4THIA 4O3AA 1UIUA 4EUOA 1YAEA 3IB1A 3CFXA 1OQGA 3ROJA 5AE4A 3KOSA 3PUYE 5HBCA 3E9XA 4F22A 4RYAA 2QJEA 3PPQA 4N07A 4P0IA 1B4ZA 1B3EA 1YYZA 1Z7ME 3E78A 4OMBA 3IB2A 2DYXA 4GX3A 1P1QA 1P1NA 2RCAA 1NNTA 3O6HA 1MY0A 1K9ZA 3OO8A 2HCAA 4PFIA 1MM7A 2QVVA 4PAIA 4P56A 1FTJA 1ELJA 4U23A 1PBPA 4NWDA 4GVOA 4MNIA 4G68B 1D9YA 4O7IA 3KC1A 2WEFA 1FJ9A 3G3GA 3K1NA 2QVUA 3T0JA 4Q8RA 2DP8A 2CEYA 3FJ7A 2GHBA 3VDFA 1UTBA 5J1DA 4F18A 3KJ7A 4BDRA 3N6TA 3MP1A 3MSTA 4PGPA 2Y7PA 3TKDA 1PC3A 3IFAA 3PUZE 1YZ0A 2HEUA 3CIJA 5I5PA 2ZZXA 4YKPA 1JNFA 3T9XB 3TUSA 2KQZA 2X26A 1P99A 4P3LA 4GL0A 1EZPA 1FPKA 4Z7EA 3KSXA 3UK4A 4X9TA 1IXHA 2XWKA 3IR1A 1WVJA 1QW0A 1FJ6A 4AS5A 1LAFE 4H67A 4OVQA 4L17A 1G0HA
chains in the Genus database with same CATH topology
1L5TA 2RC7A 1MG1A 2QS1A 5CMMA 5DEXA 4P0GA 1MY1A 4E0XA 1SD3A 1RYXA 4GOTA 1JEUA 2IEEA 1JVYA 3CR9A 3VVEA 2Z8EA 1LB9A 5M2VA 3VVFA 4N6PA 3PMXA 2H25A 3RT6B 4OFOA 1SYIA 4G68C 2R71A 1OIBA 2F35A 3RNNA 3MZ9A 3RT8A 4H8IA 3IAZA 2VGQA 1R1NA 4FAJA 3T66A 2V93A 4XKQA 4NF4A 5KZTA 5L9OA 1FW0A 3KOTA 4OWDA 2XXPA 3PPOA 2ZNSA 4LQ5A 2X7PA 1QUKA 1IITA 4X48A 4LONB 4FATA 4NF8A 1JW1A 3LC8A 3M3FA 3QUFA 4C1UA 3CVGA 1B6HA 2QMWA 1B40A 2F78A 3H6UA 1USYH 3ZKLA 3C32A 3VLWA 4OXVA 1LGBC 1SVXB 3GBAA 3U72A 3T9UA 4ZDMA 2Q8JA 4ZE9A 2UVJA 3UA8A 5F7VA 5I2NA 3BKIB 1XVXA 3O97A 4C1TA 1BKAA 5L9SA 1SW5A 1SDXA 4RK2A 1MQDA 2O1MA 3K6VA 3K02A 3G3KA 5I58B 5FHMA 4OZ9A 5F1QA 4Q0CA 4BDMA 2E0SA 1S7YA 3H6VA 3DP8A 4YKJA 4O3BA 5CMCA 4KCDA 2OZZA 4YB5A 3VXCA 3KBRA 2PYYA 4F39A 5I2KB 4IO3A 2RC9A 1UIVA 3IJXB 1MDQA 4HS7A 1B1XA 3HO7A 3O6IA 2KLFA 3PU5A 4KI0E 2XX8A 1QKBA 2XD3A 3IOUA 2ZYOA 2ONSA 1JVXA 4IO7A 2P2AA 4M4GA 4BDQA 3T9HB 1AH5A 1JETA 3MW0A 3EN3A 2THIA 1PEBA 3K2DA 3FV2A 1LFIA 2A5SA 4FECA 5I59B 3ILUB 4POXA 2P1SA 2XX7A 2F36A 1GGGA 1POTA 4R6HA 3KZGA 1IZ1A 4UA8A 1PBQA 2G93A 3O6GA 1LFHA 4GF8A 3TTKA 1B52A 1AIVA 2IA4A 1N3WA 3IX1A 3WAFA 3PV0E 1OMPA 5I56A 1Y3PA 1AMFA 3Q29A 2REGA 1A40A 3PMWA 2H98A 1GVCA 2Q89A 4EXLA 1HSLA 1Y3QA 1B2HA 1LAXA 3S9NC 3E13X 3UGWA 3VLVA 2Q2CA 3EQ1A 5A5XB 1B0LA 2VD2A 3HCQA 4JWYA 3PUWE 3MVYA 2I3WA 3O9PA 1Y4TA 1ZLQA 4HCYA 4YZZA 2B65A 3QUJA 2B3FA 3HSTA 1B5HA 3RLFE 3S2VA 4XKNA 2I6EA 3A3CA 3FZVA 4C0RA 3TQLA 3VV5A 3SEVA 3SEUA 3S9LC 1N76A 3MQ9A 1A55A 1ZIUA 3K0VA 5IAIA 4QFLA 2UYFA 2F7BA 3EHSA 4GRKA 5K2YA 2ZYNA 4G8MA 1WDNA 3WAEA 1A54A 1B05A 4GXAA 3MZBA 2UVIA 2ZXTA 3KN8A 5TU0A 2ONRA 4BDOA 1AOVA 1MXYA 1QUJA 4R2FA 1MM6A 4POWA 3QSLA 1IXCA 1UTHA 4G8NA 3N26A 1B1HA 3CSBA 3E4RA 2ZMBA 4PETA 1Y4CA 3FVNA 1IIWA 3C31A 5ITOA 4U4XA 3GLBA 3SERA 1GR2A 3EHUA 3G3FA 2UVHA 1EZOA 1D9VA 4U21A 2I4BA 1H43A 3FXRA 4MBPA 1ATGA 4OETA 5FHOA 4ISUA 4F29A 2CZLA 4M1VA 4OENA 1EH3A 2I48A 4Z0IA 4E0WA 4ZZAA 4F2OA 3H6TA 4PE5B 3BFTA 5TPAA 4TLLB 3I3VA 3P7IA 1J1NA 2Z23A 4DXUA 1JW5A 1JEVA 2D3IA 2Q88A 3T22A 2F97A 4DLDA 2G29A 1T0KA 4OERA 3AXFA 5JTYB 4LA9A 1I6BA 4FE8A 2OWTA 3SKPA 3K6UA 5BUUA 4HCWA 2PMSA 2ONKE 1DSNA 4R6KA 4ZE8A 1DMBA 2GFEA 3D4GA 2OJTA 1IUDA 3FD3A 5CBRA 1TFDA 5I57B 1MH3A 4ELRA 2D5WA 3OD7A 3W15C 3H03A 1USYE 3B6WA 4F3SA 4DDDA 1N7WA 2Z8DA 3N6UA 2QSXA 1OVBA 1FQCA 4G68A 4R9GA 4YU0A 4FORA 3SESA 4YAHX 1MPCA 1AL3A 1LCFA 5DVIA 4ZZEA 1NMUA 1OQHA 3RQTA 2O51A 3SEXA 3ZSFA 5AA2D 3IK6B 4XKRA 3V8XB 3TYHA 4YMBA 4NEDA 1EU8A 2OCUA 4RPOA 4DCYA 4PFYA 3K6WA 3MJNA 1B7UA 5TP9B 3IO4A 4QF9A 1BIYA 3CFZA 3A09A 3LUYA 5FHNA 3PPRA 3C36A 5HM4B 4G4PA 1FQEA 3N94A 3V5AA 2XXVA 4F1UA 2PT2A 3PMVA 4QFPA 3C33A 1RKMA 3FATA 4QHQA 4F3PA 2OK2A 4GXSB 4O3CA 3U94A 4NWCA 2Z22A 1ZKBA 4PP0A 3KN3A 4QSCA 5H8FB 3JYRA 4MFIA 3CFLA 3MZ1A 3K1MA 4G77A 4G2ZA 3KEIA 4OESA 2R9JA 3THIA 4XTCQ 3RY3A 4OVJA 4F3GA 4GLIA 4NF5B 3FXUA 4OEVA 5B7DA 2NVUB 3TDJA 4ZEIA 3MPLA 2V25A 1P1UA 3OSQA 1Y3NA 5I84A 3TELA 4RNSA 3ZKKA 4YB6A 2RCBA 4XKPA 1LBCA 3IORA 3DLNA 2M8CA 3LSXA 3Q25A 4F1YA 1B46A 3I6VA 4R72A 4NMYA 4TOZA 3KFMA 3KSJA 2RINA 1B0HA 3ONMA 1HSJA 1N7XA 1NNPA 3ODBA 2I0BA 3U92A 3FJMA 4YB7A 3SETA 4H6DA 4QSEA 5EHMA 4U4SA 4PFWA 4ELPA 3GBBA 3IB0A 1MQHA 4KYEA 5I58A 4ECFA 1M5CA 4RA1A 4KR5A 1B3HA 3HHGA 3CG3A 4ESWA 1XVYA 2H99A 3USDA 1LBBA 5CC2A 1D3KA 3IOTA 3H6WA 4KQPA 5H8QB 1H3DA 3H7MA 2YLNA 4U1ZA 4ZECA 1I6AA 2RKMA 4F19A 5KDTB 1M5DA 5I2KA 2HZLA 2QS2A 1R9QA 1Q35A 5CMBA 3TZAA 2XXRA 4NF6B 3TMGA 3L6GA 4EQ9A 2A5TB 2F5XA 5H8NB 5AA2B 3H3GA 3TTMA 3B7DA 4MLVA 4PQJA 1POY1 1ZTYA 1DPPA 1FCKA 1OVTA 1VR5A 3MWBA 1KWHA 1MQJA 2XXTA 2ZYKA 1QUIA 5ICQA 5DVFA 3MVXA 4WEPA 4FIMA 1DTGA 3TTRA 1UQWA 3N5LA 3FVGA 4GFRA 4QSDA 5AA3A 1TT1A 1FQDA 1O63A 5H8SA 5I59A 3U93A 2I58A 2ZNTA 2DVZA 1A8EA 4R75A 3TODA 4U22A 1URSA 3UN6A 2WKYA 2DXYA 3TTLA 3TFLA 1F9BA 1XT8A 1GTKA 5CMKA 1H45A 4RJZA 3G3IA 4YKIA 3RTWB 5JEIA 4H5FA 3K00A 2XXHA 2HAUA 4KCCA 2O7IA 3UORA 3TPAA 3VVDA 4YMAA 5KCJA 1MQGA 1MQIA 1TFAA 3B6TA 3MBPA 1IQ7A 2QRYA 3SEWA 1SBPA 2PBWA 3FVKA 5FTIA 1FQBA 1MY4A 5CBSA 2GRVA 4Q30B 1YCJA 5KCJB 2DVCA 5A5XA 4XXUA 3T93B 3KJTA 2QMXA 3BFUA 4X1DA 1NFTA 3FXQA 3O29A 2BJJX 3DP4A 2W7YA 4DCXA 2F7CA 4LATA 1BP5A 4R74A 1S50A 1URDA 3M3LA 1XC1A 1M5FA 3IL1B 1B58A 2UYEA 4FEBA 4I62A 2F6PA 1NKXA 3OO9A 3OEMA 2DOJA 4QRZA 2XD2A 1MXXA 1CE2A 4EF2A 4IGRA 1URGA 3OXNA 2AYSA 3E3KA 4OYVA 3VE1B 4H0WA 3OO7A 2FYIA 3Q28A 1MXVA 4QFKA 1HSEA 1ANFA 4PFUA 2NWJA 1I69A 4ELQA 5ICTA 2VHAA 2QL3A 4JXIA 2PT1A 1R6ZA 1LB8A 3QAXA 1SI1A 2REJA 3O2AA 2QS4A 3G3HA 3LSLA 3RN8A 1MS7A 1M5EA 1PB7A 1NH7A 3RGYA 4WKMA 3K01A 4JB7A 4KYSA 1Y9UA 4KHZE 3M8UA 4EF1A 5AA4A 4FEDA 2VP1A 3FIRA 3JZJA 2RF1A 3MAMA 4LUBA 4IO4A 5AA4B 2Y7WA 3FV1A 1N3XA 5CI5A 1I6QA 1MXWA 3MVWA 2F7AA 2F34A 1BLFA 4N13A 5JTYA 3SDFA 4ZEBA 1XHYA 2DXRA 3EPEA 3S9EA 2DSFA 3CI8A 2V3TA 4LZ7A 3MP6A 3EHTA 1PB8A 5CM6A 2PX1A 3OSRA 5I57A 2XXXA 2DS9A 2OWSA 3RPWA 1B5JA 2VD3A 4LZ5A 1US5A 2CMOA 4ZEDA 3IOWA 1OLAA 4I8CA 1B51A 1Y20A 4ONYA 1GV8A 2HQ0A 5H8HB 4GQOA 4JSDA 2DE2A 4ZEFA 4BDNA 3PPPA 2H4IA 1SW2A 1Q1KA 4KYDA 4R6YA 2YJPA 1A7LA 3HHFA 3IOVA 4Q5TA 2HZKA 1R9LA 4NTLA 3M3KA 1MPDA 3U8QA 3LBSA 3K6XA 5DTBA 2I4CA 1MRPA 3BBRA 5TP9A 3C34A 1B7HA 2O84X 1Y1MA 4EXKA 1QJMA 3G3JA 3Q26A 4DIGA 1LAHE 4IB2A 5DVJA 3OO6A 3A3UA 4H1XA 4I1DA 5DYHA 4UACA 1FQAA 5ISUA 2UVGA 1SI0A 2O69A 4K3FA 3V83A 3O28A 1IXIA 3KG2A 4F3BA 1SW1A 2O68A 1B9JA 4EQBA 4AQ4A 4I9DA 1UTBB 5H8FA 1VFEA 1NNFA 1LFGA 1VE4A 2AL5A 2HFBA 2Z8FA 1B5IA 1FTOA 4F31B 2VOZA 5ITPA 4OHNA 4GIZA 4OEUA 3DELB 1EZ9A 3HV1A 2RC8A 4AB6A 3PUXE 2DWJA 4OFLA 4NF5A 4ELOA 3Q27A 3S4UA 2DE4A 4MF3A 5BWJA 4BDLA 2I3VA 3TEPA 4IGTA 2OBGA 1DTZA 1B4HA 2UXAA 5LOMA 4H5GA 4MH5A 4YKKA 1LCTA 5L9MA 2HXWA 3FVOA 2ABHA 2Y7KA 5DEXB 3MP8A 4OQOA 4OFJA 2Y7RA 1A8FA 2XXWA 1MY3A 4DZ1A 3PGFA 1FTMA 3TAJA 3PD9A 3KN7A 4JDFA 2QS3A 1TXFA 2YPNA 2F6GA 1B3GA 4HTGA 3O66A 3TQWA 2Y7IA 3R26A 3EF7A 2R6GE 1MXZA 4RY1A 4JWOA 3LSWA 4LZ8A 2DWIA 4JSOA 5EYFA 1P1WA 4EDPA 1O64A 4OTEA 1SYHA 3JV9A 3QXMA 2H9BA 2V3QA 2AIXA 4NF4B 1ZMGA 5K2XA 4QFOA 1P1OA 2DWAA 4DE8A 2ESNA 1B3LA 4KFQA 3D4CA 4TLMB 3PPNA 4NF8B 1MPBA 5H8QA 1NNKA 3OELA 3MVZA 5KDTA 4ND9A 2ZYMA 4NE4A 3C4MA 4MLQA 4NF6A 1B32A 1IXGA 1MXUA 5B70A 4XIGQ 2A5TA 3TCFA 5H8NA 5AA2A 2AL4A 4F2QA 3W9VA 5I2NB 1XS5A 1NH8A 2XXUA 5DT6A 3LR1A 1TWYA 3PUVE 1JQFA 4AB5A 1PDAA 3LSFB 3OMBA 2XXQA 3MPKA 4GWOA 5CRYA 1QVSA 3FASA 2D21A 2LAOA 4EQ7A 1VSOA 4DXBA 4TQUQ 4H65A 1H76A 4DXCA 2I49A 3QIMA 4IO6A 1MY2A 1FTLA 3FJGA 3L6HA 4KPTA 3OENA 5EHSA 4U2RA 4RPNA 1WODA 3S9MC 4ZS9A 4WEDA 4LQ2A 3RTFB 4JBZA 2ALUA 1OLCA 4P11A 3R7XA 4ESXA 2QPQA 1PB9A 2XHDA 3F11A 3FGSA 2HAVA 2F8DA 3W9WA 4IO2A 2O6AA 1NL5A 1DOTA 3VXBA 4X1BA 2OLBA 3T9VA 1XOCA 3K1PA 3MUQA 3MC2A 3TCHA 2XXIA 3CSGA 3ZS6A 2PVUA 4IY6A 3CRBA 1YPNA 3UP9A 4R2BA 3C9HA 2O7UA 1N0TA 1RYOA 2O1LA 4GD5A 3GXAA 3KGCA 3VLUA 4U1OA 3IO6A 2H5YA 2NXOA 4GL8A 3UIFA 2Q2AA 2P0SA 1QKAA 1S9TA 5I56B 1Y1ZA 1CB6A 3U1OA 2E1SA 4G8HA 2NUVA 1FTKA 3OEKA 4WXJA 1ZBMA 1ZU0A 4HW8A 1LSTA 2V3UA 2FA7A 2ZNUA 3DM0A 1B3FA 1JW4A 3HN0A 2NOOA 1DPEA 3C35A 4LVQA 2ANJA 2DWHA 2V84A 3T96B 2Y84A 5IKBA 3TTNA 3HPIA 4H8JA 1MDP1 1M5BA 1US4A 4R73A 3V89B 3GZGA 1QULA 5HPQA 4F1VA 1B7ZA 1ZJLA 3PD8A 3VFJA 2GHAA 2GH9A 5ELVA 3B6QA 1N04A 4IY5A 1YTVA 3IJOB 1BTJA 3QYTA 3H4ZA 4KD5A 4LP2B 2I0CA 2Q9TA 4IO5A 4JWXA 4BLAA 3DP6A 1FQFA 2DE3A 4QFNA 2B3BA 5FTHA 3FUZA 3G7WA 3ECRA 1IEJA 1UTHB 1D4NA 2X7QA 4RXLA 3TCGA 3RUMA 3SEYA 1II5A 1O7TA 3H06B 1H44A 4YICA 3R6UA 4FJPA 4PFTA 4RK9A 2XX9A 1VFDA 1SQYA 3K4UA 3I5OA 5JK4A 1A99A 2XXYA 1SW4A 4ZEKA 1LLSA 1N84A 4R9FA 1Z7NE 1MH4A 5AA1A 3ILTB 5L8DA 2DQVA 3OOAA 5TPAB 3CG1A 3QK6A 5H8HA 2FNCA 1LAGE 4THIA 4O3AA 1UIUA 4EUOA 1YAEA 3IB1A 3CFXA 1OQGA 5AE4A 3KOSA 3PUYE 5HBCA 3E9XA 4F22A 4RYAA 2QJEA 3PPQA 4N07A 4P0IA 1B4ZA 1B3EA 1Z7ME 4OMBA 3IB2A 2DYXA 1P1QA 1P1NA 2RCAA 1NNTA 3O6HA 1MY0A 3OO8A 2HCAA 1MM7A 1FTJA 1ELJA 4U23A 1PBPA 4NWDA 4GVOA 4G68B 1D9YA 3G3GA 3K1NA 4Q8RA 2DP8A 3FJ7A 2GHBA 3VDFA 1UTBA 5J1DA 4F18A 3KJ7A 4BDRA 3N6TA 3MP1A 2Y7PA 3TKDA 1PC3A 3PUZE 2HEUA 3CIJA 4YKPA 1JNFA 3T9XB 3TUSA 2X26A 1P99A 4GL0A 1EZPA 4Z7EA 3KSXA 3UK4A 4X9TA 1IXHA 3IR1A 1WVJA 1QW0A 1LAFE 4H67A 4L17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L5T A;  2RC7 A;  1MG1 A;  2QS1 A;  5CMM A;  5DEX A;  4P0G A;  1MY1 A;  4E0X A;  1SD3 A;  1RYX A;  4GOT A;  1JEU A;  2IEE A;  1JVY A;  3CR9 A;  3VVE A;  2Z8E A;  1LB9 A;  5M2V A;  3VVF A;  4N6P A;  3PMX A;  2H25 A;  3RT6 B;  4OFO A;  1SYI A;  4G68 C;  2R71 A;  1OIB A;  2F35 A;  3RNN A;  3MZ9 A;  3RT8 A;  4H8I A;  3IAZ A;  2VGQ A;  1R1N A;  4FAJ A;  3T66 A;  2V93 A;  4XKQ A;  4NF4 A;  5KZT A;  5L9O A;  1FW0 A;  3KOT A;  4OWD A;  2XXP A;  3PPO A;  2ZNS A;  4LQ5 A;  2X7P A;  1QUK A;  1IIT A;  4X48 A;  4LON B;  4FAT A;  4NF8 A;  1JW1 A;  3LC8 A;  3M3F A;  3QUF A;  4C1U A;  3CVG A;  1B6H A;  2QMW A;  1B40 A;  2F78 A;  3H6U A;  1USY H;  3ZKL A;  3C32 A;  3VLW A;  4OXV A;  1LGB C;  1SVX B;  3GBA A;  3U72 A;  3T9U A;  4ZDM A;  2Q8J A;  4ZE9 A;  2UVJ A;  3UA8 A;  5F7V A;  5I2N A;  3BKI B;  1XVX A;  3O97 A;  4C1T A;  1BKA A;  5L9S A;  1SW5 A;  1SDX A;  4RK2 A;  1MQD A;  2O1M A;  3K6V A;  3K02 A;  3G3K A;  5I58 B;  5FHM A;  4OZ9 A;  5F1Q A;  4Q0C A;  4BDM A;  2E0S A;  1S7Y A;  3H6V A;  3DP8 A;  4YKJ A;  4O3B A;  5CMC A;  4KCD A;  2OZZ A;  4YB5 A;  3VXC A;  3KBR A;  2PYY A;  4F39 A;  5I2K B;  4IO3 A;  2RC9 A;  1UIV A;  3IJX B;  1MDQ A;  4HS7 A;  1B1X A;  3HO7 A;  3O6I A;  2KLF A;  3PU5 A;  4KI0 E;  2XX8 A;  1QKB A;  2XD3 A;  3IOU A;  2ZYO A;  2ONS A;  1JVX A;  4IO7 A;  2P2A A;  4M4G A;  4BDQ A;  3T9H B;  1AH5 A;  1JET A;  3MW0 A;  3EN3 A;  2THI A;  1PEB A;  3K2D A;  3FV2 A;  1LFI A;  2A5S A;  4FEC A;  5I59 B;  3ILU B;  4POX A;  2P1S A;  2XX7 A;  2F36 A;  1GGG A;  1POT A;  4R6H A;  3KZG A;  1IZ1 A;  4UA8 A;  1PBQ A;  2G93 A;  3O6G A;  1LFH A;  4GF8 A;  3TTK A;  1B52 A;  1AIV A;  2IA4 A;  1N3W A;  3IX1 A;  3WAF A;  3PV0 E;  1OMP A;  5I56 A;  1Y3P A;  1AMF A;  3Q29 A;  2REG A;  1A40 A;  3PMW A;  2H98 A;  1GVC A;  2Q89 A;  4EXL A;  1HSL A;  1Y3Q A;  1B2H A;  1LAX A;  3S9N C;  3E13 X;  3UGW A;  3VLV A;  2Q2C A;  3EQ1 A;  5A5X B;  1B0L A;  2VD2 A;  3HCQ A;  4JWY A;  3PUW E;  3MVY A;  2I3W A;  3O9P A;  1Y4T A;  1ZLQ A;  4HCY A;  4YZZ A;  2B65 A;  3QUJ A;  2B3F A;  3HST A;  1B5H A;  3RLF E;  3S2V A;  4XKN A;  2I6E A;  3A3C A;  3FZV A;  4C0R A;  3TQL A;  3VV5 A;  3SEV A;  3SEU A;  3S9L C;  1N76 A;  3MQ9 A;  1A55 A;  1ZIU A;  3K0V A;  5IAI A;  4QFL A;  2UYF A;  2F7B A;  3EHS A;  4GRK A;  5K2Y A;  2ZYN A;  4G8M A;  1WDN A;  3WAE A;  1A54 A;  1B05 A;  4GXA A;  3MZB A;  2UVI A;  2ZXT A;  3KN8 A;  5TU0 A;  2ONR A;  4BDO A;  1AOV A;  1MXY A;  1QUJ A;  4R2F A;  1MM6 A;  4POW A;  3QSL A;  1IXC A;  1UTH A;  4G8N A;  3N26 A;  1B1H A;  3CSB A;  3E4R A;  2ZMB A;  4PET A;  1Y4C A;  3FVN A;  1IIW A;  3C31 A;  5ITO A;  4U4X A;  3GLB A;  3SER A;  1GR2 A;  3EHU A;  3G3F A;  2UVH A;  1EZO A;  1D9V A;  4U21 A;  2I4B A;  1H43 A;  3FXR A;  4MBP A;  1ATG A;  4OET A;  5FHO A;  4ISU A;  4F29 A;  2CZL A;  4M1V A;  4OEN A;  1EH3 A;  2I48 A;  4Z0I A;  4E0W A;  4ZZA A;  4F2O A;  3H6T A;  4PE5 B;  3BFT A;  5TPA A;  4TLL B;  3I3V A;  3P7I A;  1J1N A;  2Z23 A;  4DXU A;  1JW5 A;  1JEV A;  2D3I A;  2Q88 A;  3T22 A;  2F97 A;  4DLD A;  2G29 A;  1T0K A;  4OER A;  3AXF A;  5JTY B;  4LA9 A;  1I6B A;  4FE8 A;  2OWT A;  3SKP A;  3K6U A;  5BUU A;  4HCW A;  2PMS A;  2ONK E;  1DSN A;  4R6K A;  4ZE8 A;  1DMB A;  2GFE A;  3D4G A;  2OJT A;  1IUD A;  3FD3 A;  5CBR A;  1TFD A;  5I57 B;  1MH3 A;  4ELR A;  2D5W A;  3OD7 A;  3W15 C;  3H03 A;  1USY E;  3B6W A;  4F3S A;  4DDD A;  1N7W A;  2Z8D A;  3N6U A;  2QSX A;  1OVB A;  1FQC A;  4G68 A;  4R9G A;  4YU0 A;  4FOR A;  3SES A;  4YAH X;  1MPC A;  1AL3 A;  1LCF A;  5DVI A;  4ZZE A;  1NMU A;  1OQH A;  3RQT A;  2O51 A;  3SEX A;  3ZSF A;  5AA2 D;  3IK6 B;  4XKR A;  3V8X B;  3TYH A;  4YMB A;  4NED A;  1EU8 A;  2OCU A;  4RPO A;  4DCY A;  4PFY A;  3K6W A;  3MJN A;  1B7U A;  5TP9 B;  3IO4 A;  4QF9 A;  1BIY A;  3CFZ A;  3A09 A;  3LUY A;  5FHN A;  3PPR A;  3C36 A;  5HM4 B;  4G4P A;  1FQE A;  3N94 A;  3V5A A;  2XXV A;  4F1U A;  2PT2 A;  3PMV A;  4QFP A;  3C33 A;  1RKM A;  3FAT A;  4QHQ A;  4F3P A;  2OK2 A;  4GXS B;  4O3C A;  3U94 A;  4NWC A;  2Z22 A;  1ZKB A;  4PP0 A;  3KN3 A;  4QSC A;  5H8F B;  3JYR A;  4MFI A;  3CFL A;  3MZ1 A;  3K1M A;  4G77 A;  4G2Z A;  3KEI A;  4OES A;  2R9J A;  3THI A;  4XTC Q;  3RY3 A;  4OVJ A;  4F3G A;  4GLI A;  4NF5 B;  3FXU A;  4OEV A;  5B7D A;  2NVU B;  3TDJ A;  4ZEI A;  3MPL A;  2V25 A;  1P1U A;  3OSQ A;  1Y3N A;  5I84 A;  3TEL A;  4RNS A;  3ZKK A;  4YB6 A;  2RCB A;  4XKP A;  1LBC A;  3IOR A;  3DLN A;  2M8C A;  3LSX A;  3Q25 A;  4F1Y A;  1B46 A;  3I6V A;  4R72 A;  4NMY A;  4TOZ A;  3KFM A;  3KSJ A;  2RIN A;  1B0H A;  3ONM A;  1HSJ A;  1N7X A;  1NNP A;  3ODB A;  2I0B A;  3U92 A;  3FJM A;  4YB7 A;  3SET A;  4H6D A;  4QSE A;  5EHM A;  4U4S A;  4PFW A;  4ELP A;  3GBB A;  3IB0 A;  1MQH A;  4KYE A;  5I58 A;  4ECF A;  1M5C A;  4RA1 A;  4KR5 A;  1B3H A;  3HHG A;  3CG3 A;  4ESW A;  1XVY A;  2H99 A;  3USD A;  1LBB A;  5CC2 A;  1D3K A;  3IOT A;  3H6W A;  4KQP A;  5H8Q B;  1H3D A;  3H7M A;  2YLN A;  4U1Z A;  4ZEC A;  1I6A A;  2RKM A;  4F19 A;  5KDT B;  1M5D A;  5I2K A;  2HZL A;  2QS2 A;  1R9Q A;  1Q35 A;  5CMB A;  3TZA A;  2XXR A;  4NF6 B;  3TMG A;  3L6G A;  4EQ9 A;  2A5T B;  2F5X A;  5H8N B;  5AA2 B;  3H3G A;  3TTM A;  3B7D A;  4MLV A;  4PQJ A;  1POY 1;  1ZTY A;  1DPP A;  1FCK A;  1OVT A;  1VR5 A;  3MWB A;  1KWH A;  1MQJ A;  2XXT A;  2ZYK A;  1QUI A;  5ICQ A;  5DVF A;  3MVX A;  4WEP A;  4FIM A;  1DTG A;  3TTR A;  1UQW A;  3N5L A;  3FVG A;  4GFR A;  4QSD A;  5AA3 A;  1TT1 A;  1FQD A;  1O63 A;  5H8S A;  5I59 A;  3U93 A;  2I58 A;  2ZNT A;  2DVZ A;  1A8E A;  4R75 A;  3TOD A;  4U22 A;  1URS A;  3UN6 A;  2WKY A;  2DXY A;  3TTL A;  3TFL A;  1F9B A;  1XT8 A;  1GTK A;  5CMK A;  1H45 A;  4RJZ A;  3G3I A;  4YKI A;  3RTW B;  5JEI A;  4H5F A;  3K00 A;  2XXH A;  2HAU A;  4KCC A;  2O7I A;  3UOR A;  3TPA A;  3VVD A;  4YMA A;  5KCJ A;  1MQG A;  1MQI A;  1TFA A;  3B6T A;  3MBP A;  1IQ7 A;  2QRY A;  3SEW A;  1SBP A;  2PBW A;  3FVK A;  5FTI A;  1FQB A;  1MY4 A;  5CBS A;  2GRV A;  4Q30 B;  1YCJ A;  5KCJ B;  2DVC A;  5A5X A;  4XXU A;  3T93 B;  3KJT A;  2QMX A;  3BFU A;  4X1D A;  1NFT A;  3FXQ A;  3O29 A;  2BJJ X;  3DP4 A;  2W7Y A;  4DCX A;  2F7C A;  4LAT A;  1BP5 A;  4R74 A;  1S50 A;  1URD A;  3M3L A;  1XC1 A;  1M5F A;  3IL1 B;  1B58 A;  2UYE A;  4FEB A;  4I62 A;  2F6P A;  1NKX A;  3OO9 A;  3OEM A;  2DOJ A;  4QRZ A;  2XD2 A;  1MXX A;  1CE2 A;  4EF2 A;  4IGR A;  1URG A;  3OXN A;  2AYS A;  3E3K A;  4OYV A;  3VE1 B;  4H0W A;  3OO7 A;  2FYI A;  3Q28 A;  1MXV A;  4QFK A;  1HSE A;  1ANF A;  4PFU A;  2NWJ A;  1I69 A;  4ELQ A;  5ICT A;  2VHA A;  2QL3 A;  4JXI A;  2PT1 A;  1R6Z A;  1LB8 A;  3QAX A;  1SI1 A;  2REJ A;  3O2A A;  2QS4 A;  3G3H A;  3LSL A;  3RN8 A;  1MS7 A;  1M5E A;  1PB7 A;  1NH7 A;  3RGY A;  4WKM A;  3K01 A;  4JB7 A;  4KYS A;  1Y9U A;  4KHZ E;  3M8U A;  4EF1 A;  5AA4 A;  4FED A;  2VP1 A;  3FIR A;  3JZJ A;  2RF1 A;  3MAM A;  4LUB A;  4IO4 A;  5AA4 B;  2Y7W A;  3FV1 A;  1N3X A;  5CI5 A;  1I6Q A;  1MXW A;  3MVW A;  2F7A A;  2F34 A;  1BLF A;  4N13 A;  5JTY A;  3SDF A;  4ZEB A;  1XHY A;  2DXR A;  3EPE A;  3S9E A;  2DSF A;  3CI8 A;  2V3T A;  4LZ7 A;  3MP6 A;  3EHT A;  1PB8 A;  5CM6 A;  2PX1 A;  3OSR A;  5I57 A;  2XXX A;  2DS9 A;  2OWS A;  3RPW A;  1B5J A;  2VD3 A;  4LZ5 A;  1US5 A;  2CMO A;  4ZED A;  3IOW A;  1OLA A;  4I8C A;  1B51 A;  1Y20 A;  4ONY A;  1GV8 A;  2HQ0 A;  5H8H B;  4GQO A;  4JSD A;  2DE2 A;  4ZEF A;  4BDN A;  3PPP A;  2H4I A;  1SW2 A;  1Q1K A;  4KYD A;  4R6Y A;  2YJP A;  1A7L A;  3HHF A;  3IOV A;  4Q5T A;  2HZK A;  1R9L A;  4NTL A;  3M3K A;  1MPD A;  3U8Q A;  3LBS A;  3K6X A;  5DTB A;  2I4C A;  1MRP A;  3BBR A;  5TP9 A;  3C34 A;  1B7H A;  2O84 X;  1Y1M A;  4EXK A;  1QJM A;  3G3J A;  3Q26 A;  4DIG A;  1LAH E;  4IB2 A;  5DVJ A;  3OO6 A;  3A3U A;  4H1X A;  4I1D A;  5DYH A;  4UAC A;  1FQA A;  5ISU A;  2UVG A;  1SI0 A;  2O69 A;  4K3F A;  3V83 A;  3O28 A;  1IXI A;  3KG2 A;  4F3B A;  1SW1 A;  2O68 A;  1B9J A;  4EQB A;  4AQ4 A;  4I9D A;  1UTB B;  5H8F A;  1VFE A;  1NNF A;  1LFG A;  1VE4 A;  2AL5 A;  2HFB A;  2Z8F A;  1B5I A;  1FTO A;  4F31 B;  2VOZ A;  5ITP A;  4OHN A;  4GIZ A;  4OEU A;  3DEL B;  1EZ9 A;  3HV1 A;  2RC8 A;  4AB6 A;  3PUX E;  2DWJ A;  4OFL A;  4NF5 A;  4ELO A;  3Q27 A;  3S4U A;  2DE4 A;  4MF3 A;  5BWJ A;  4BDL A;  2I3V A;  3TEP A;  4IGT A;  2OBG A;  1DTZ A;  1B4H A;  2UXA A;  5LOM A;  4H5G A;  4MH5 A;  4YKK A;  1LCT A;  5L9M A;  2HXW A;  3FVO A;  2ABH A;  2Y7K A;  5DEX B;  3MP8 A;  4OQO A;  4OFJ A;  2Y7R A;  1A8F A;  2XXW A;  1MY3 A;  4DZ1 A;  3PGF A;  1FTM A;  3TAJ A;  3PD9 A;  3KN7 A;  4JDF A;  2QS3 A;  1TXF A;  2YPN A;  2F6G A;  1B3G A;  4HTG A;  3O66 A;  3TQW A;  2Y7I A;  3R26 A;  3EF7 A;  2R6G E;  1MXZ A;  4RY1 A;  4JWO A;  3LSW A;  4LZ8 A;  2DWI A;  4JSO A;  5EYF A;  1P1W A;  4EDP A;  1O64 A;  4OTE A;  1SYH A;  3JV9 A;  3QXM A;  2H9B A;  2V3Q A;  2AIX A;  4NF4 B;  1ZMG A;  5K2X A;  4QFO A;  1P1O A;  2DWA A;  4DE8 A;  2ESN A;  1B3L A;  4KFQ A;  3D4C A;  4TLM B;  3PPN A;  4NF8 B;  1MPB A;  5H8Q A;  1NNK A;  3OEL A;  3MVZ A;  5KDT A;  4ND9 A;  2ZYM A;  4NE4 A;  3C4M A;  4MLQ A;  4NF6 A;  1B32 A;  1IXG A;  1MXU A;  5B70 A;  4XIG Q;  2A5T A;  3TCF A;  5H8N A;  5AA2 A;  2AL4 A;  4F2Q A;  3W9V A;  5I2N B;  1XS5 A;  1NH8 A;  2XXU A;  5DT6 A;  3LR1 A;  1TWY A;  3PUV E;  1JQF A;  4AB5 A;  1PDA A;  3LSF B;  3OMB A;  2XXQ A;  3MPK A;  4GWO A;  5CRY A;  1QVS A;  3FAS A;  2D21 A;  2LAO A;  4EQ7 A;  1VSO A;  4DXB A;  4TQU Q;  4H65 A;  1H76 A;  4DXC A;  2I49 A;  3QIM A;  4IO6 A;  1MY2 A;  1FTL A;  3FJG A;  3L6H A;  4KPT A;  3OEN A;  5EHS A;  4U2R A;  4RPN A;  1WOD A;  3S9M C;  4ZS9 A;  4WED A;  4LQ2 A;  3RTF B;  4JBZ A;  2ALU A;  1OLC A;  4P11 A;  3R7X A;  4ESX A;  2QPQ A;  1PB9 A;  2XHD A;  3F11 A;  3FGS A;  2HAV A;  2F8D A;  3W9W A;  4IO2 A;  2O6A A;  1NL5 A;  1DOT A;  3VXB A;  4X1B A;  2OLB A;  3T9V A;  1XOC A;  3K1P A;  3MUQ A;  3MC2 A;  3TCH A;  2XXI A;  3CSG A;  3ZS6 A;  2PVU A;  4IY6 A;  3CRB A;  1YPN A;  3UP9 A;  4R2B A;  3C9H A;  2O7U A;  1N0T A;  1RYO A;  2O1L A;  4GD5 A;  3GXA A;  3KGC A;  3VLU A;  4U1O A;  3IO6 A;  2H5Y A;  2NXO A;  4GL8 A;  3UIF A;  2Q2A A;  2P0S A;  1QKA A;  1S9T A;  5I56 B;  1Y1Z A;  1CB6 A;  3U1O A;  2E1S A;  4G8H A;  2NUV A;  1FTK A;  3OEK A;  4WXJ A;  1ZBM A;  1ZU0 A;  4HW8 A;  1LST A;  2V3U A;  2FA7 A;  2ZNU A;  3DM0 A;  1B3F A;  1JW4 A;  3HN0 A;  2NOO A;  1DPE A;  3C35 A;  4LVQ A;  2ANJ A;  2DWH A;  2V84 A;  3T96 B;  2Y84 A;  5IKB A;  3TTN A;  3HPI A;  4H8J A;  1MDP 1;  1M5B A;  1US4 A;  4R73 A;  3V89 B;  3GZG A;  1QUL A;  5HPQ A;  4F1V A;  1B7Z A;  1ZJL A;  3PD8 A;  3VFJ A;  2GHA A;  2GH9 A;  5ELV A;  3B6Q A;  1N04 A;  4IY5 A;  1YTV A;  3IJO B;  1BTJ A;  3QYT A;  3H4Z A;  4KD5 A;  4LP2 B;  2I0C A;  2Q9T A;  4IO5 A;  4JWX A;  4BLA A;  3DP6 A;  1FQF A;  2DE3 A;  4QFN A;  2B3B A;  5FTH A;  3FUZ A;  3G7W A;  3ECR A;  1IEJ A;  1UTH B;  1D4N A;  2X7Q A;  4RXL A;  3TCG A;  3RUM A;  3SEY A;  1II5 A;  1O7T A;  3H06 B;  1H44 A;  4YIC A;  3R6U A;  4FJP A;  4PFT A;  4RK9 A;  2XX9 A;  1VFD A;  1SQY A;  3K4U A;  3I5O A;  5JK4 A;  1A99 A;  2XXY A;  1SW4 A;  4ZEK A;  1LLS A;  1N84 A;  4R9F A;  1Z7N E;  1MH4 A;  5AA1 A;  3ILT B;  5L8D A;  2DQV A;  3OOA A;  5TPA B;  3CG1 A;  3QK6 A;  5H8H A;  2FNC A;  1LAG E;  4THI A;  4O3A A;  1UIU A;  4EUO A;  1YAE A;  3IB1 A;  3CFX A;  1OQG A;  5AE4 A;  3KOS A;  3PUY E;  5HBC A;  3E9X A;  4F22 A;  4RYA A;  2QJE A;  3PPQ A;  4N07 A;  4P0I A;  1B4Z A;  1B3E A;  1Z7M E;  4OMB A;  3IB2 A;  2DYX A;  1P1Q A;  1P1N A;  2RCA A;  1NNT A;  3O6H A;  1MY0 A;  3OO8 A;  2HCA A;  1MM7 A;  1FTJ A;  1ELJ A;  4U23 A;  1PBP A;  4NWD A;  4GVO A;  4G68 B;  1D9Y A;  3G3G A;  3K1N A;  4Q8R A;  2DP8 A;  3FJ7 A;  2GHB A;  3VDF A;  1UTB A;  5J1D A;  4F18 A;  3KJ7 A;  4BDR A;  3N6T A;  3MP1 A;  2Y7P A;  3TKD A;  1PC3 A;  3PUZ E;  2HEU A;  3CIJ A;  4YKP A;  1JNF A;  3T9X B;  3TUS A;  2X26 A;  1P99 A;  4GL0 A;  1EZP A;  4Z7E A;  3KSX A;  3UK4 A;  4X9T A;  1IXH A;  3IR1 A;  1WVJ A;  1QW0 A;  1LAF E;  4H67 A;  4L17 A; 
#chains in the Genus database with same CATH topology
 1L5T A;  2RC7 A;  1MG1 A;  2QS1 A;  5CMM A;  4PGN A;  2BJI A;  5DEX A;  1JP4 A;  4P0G A;  1MY1 A;  4I40 A;  4E0X A;  1SD3 A;  1RYX A;  4GOT A;  1JEU A;  4I3E A;  2IEE A;  1LBX A;  1JVY A;  2B4M A;  3CR9 A;  3VVE A;  2Z8E A;  1LB9 A;  5M2V A;  5J16 A;  3VVF A;  4N6P A;  3PMX A;  2H25 A;  3RT6 B;  4OFO A;  1SYI A;  1FPG A;  1K9Y A;  4G68 C;  3IFC A;  2R71 A;  4MAG A;  1OIB A;  2F35 A;  3QMF A;  4JVC A;  5ET8 A;  3RNN A;  3MZ9 A;  2WYP A;  3RT8 A;  4H8I A;  3IAZ A;  2VGQ A;  1CNQ A;  1R1N A;  4FAJ A;  3T66 A;  2V93 A;  4XKQ A;  4NF4 A;  5KZT A;  2OX3 A;  5L9O A;  1FW0 A;  3KOT A;  4OWD A;  2XXP A;  3PPO A;  2ZNS A;  4LQ5 A;  2X7P A;  1QUK A;  1YXI A;  1IIT A;  4X48 A;  1FPJ A;  4LON B;  4FAT A;  4NF8 A;  1JW1 A;  3LC8 A;  3M3F A;  3QUF A;  1DCU A;  4C1U A;  3CVG A;  1IMF A;  1B6H A;  2QMW A;  4UAB A;  1B40 A;  2F78 A;  5DW8 A;  3H6U A;  1USY H;  3ZKL A;  3C32 A;  3VLW A;  1EYI A;  2GQ1 A;  2WX9 A;  4OXV A;  1LGB C;  1SVX B;  3GBA A;  3U72 A;  3T9U A;  4ZDM A;  2Q8J A;  4ZE9 A;  2UVJ A;  3UA8 A;  5F7V A;  3B8B A;  5I2N A;  3BKI B;  4NQ8 A;  1XVX A;  3O97 A;  4C1T A;  1BKA A;  5L9S A;  1SW5 A;  1SDX A;  4RK2 A;  1MQD A;  1KA0 A;  2O1M A;  3K6V A;  3K02 A;  2WYK A;  3G3K A;  5I58 B;  5FHM A;  4OZ9 A;  5F1Q A;  2MKZ A;  4IR8 A;  4Q0C A;  4BDM A;  2E0S A;  1S7Y A;  3H6V A;  3DP8 A;  4YKJ A;  1RDZ A;  4O3B A;  1LBZ A;  5CMC A;  4KCD A;  2OZZ A;  5EYG A;  4YB5 A;  3VXC A;  3KBR A;  2PYY A;  4F39 A;  5I2K B;  4IO3 A;  2RC9 A;  1UIV A;  3IJX B;  1MDQ A;  4HS7 A;  1B1X A;  3HO7 A;  3O6I A;  2KLF A;  3PU5 A;  4KI0 E;  2XX8 A;  1QKB A;  2XD3 A;  5IZ1 A;  4NG7 A;  5LDZ A;  4N91 A;  3IOU A;  2ZYO A;  2ONS A;  1JVX A;  4IO7 A;  2P2A A;  4M4G A;  4BDQ A;  3T9H B;  1AH5 A;  4PCD A;  1JET A;  3RPL B;  2HXR A;  5ET6 A;  3MW0 A;  3EN3 A;  2THI A;  1PEB A;  4O94 A;  3K2D A;  3FV2 A;  1LFI A;  4HE2 A;  2A5S A;  2WBB A;  4FEC A;  5I59 B;  3ILU B;  4POX A;  2P1S A;  2XX7 A;  4DI4 B;  4H45 A;  3BIG A;  2F36 A;  1GGG A;  1POT A;  4R6H A;  2VPN A;  3KZG A;  1IZ1 A;  4UA8 A;  1PBQ A;  2G93 A;  3O6G A;  4PDD A;  1LFH A;  4GF8 A;  4GWZ A;  3TTK A;  1B52 A;  1AIV A;  2IA4 A;  3D1R A;  1N3W A;  3IX1 A;  3WAF A;  3PV0 E;  1OMP A;  1RDY A;  5I56 A;  1Y3P A;  1AMF A;  3Q29 A;  2REG A;  1A40 A;  3PMW A;  2H98 A;  1GVC A;  2Q89 A;  4EXL A;  1HSL A;  1Y3Q A;  1B2H A;  1LAX A;  1AWB A;  1FPD A;  2KR0 A;  3S9N C;  3E13 X;  3UGW A;  3VLV A;  2Q2C A;  3EQ1 A;  5A5X B;  2DDK A;  1B0L A;  2VD2 A;  3HCQ A;  4N15 A;  4JWY A;  3PUW E;  3MVY A;  2I3W A;  1FBF A;  3O9P A;  1Y4T A;  1ZLQ A;  4HCY A;  4YZZ A;  2B65 A;  3QUJ A;  2B3F A;  3HST A;  1B5H A;  3B50 A;  3RLF E;  3S2V A;  4XKN A;  2I6E A;  4LN5 A;  2CZH A;  3A3C A;  3FZV A;  4C0R A;  3TQL A;  3VV5 A;  3SEV A;  3SEU A;  3S9L C;  1N76 A;  3NOH A;  3MQ9 A;  1A55 A;  1ZIU A;  3K0V A;  5IAI A;  4QFL A;  2UYF A;  2F7B A;  3EHS A;  4GRK A;  2Q8M A;  1FBD A;  5K2Y A;  2ZYN A;  4G8M A;  1WDN A;  3WAE A;  1A54 A;  1B05 A;  4GXA A;  3MZB A;  4PFR A;  2UVI A;  3T1B A;  2ZXT A;  3KN8 A;  5TU0 A;  2ONR A;  1FBH A;  5EQ7 A;  4BDO A;  1AOV A;  1MXY A;  1QUJ A;  1Q9D A;  4R2F A;  1MM6 A;  4POW A;  3QSL A;  1IXC A;  5IZZ A;  1UTH A;  4PTK A;  4G8N A;  3N26 A;  1B1H A;  3CSB A;  3E4R A;  2ZMB A;  4PET A;  1Y4C A;  3FVN A;  4OVR A;  1IIW A;  3C31 A;  5ITO A;  4U4X A;  3GLB A;  3SER A;  1GR2 A;  1NV6 A;  3EHU A;  2PFZ A;  3G3F A;  5LTC A;  2UVH A;  1EZO A;  1D9V A;  4U21 A;  5IZ3 A;  2I4B A;  1H43 A;  3FXR A;  1DBZ A;  4MBP A;  1ATG A;  4OET A;  5FHO A;  4ISU A;  5A5L A;  4F29 A;  2CZL A;  4M1V A;  4OEN A;  1EH3 A;  2I48 A;  4Z0I A;  4ZZA A;  4E0W A;  4F2O A;  3H6T A;  4PE5 B;  3BFT A;  5TPA A;  4TLL B;  3I3V A;  3P7I A;  2CZI A;  1J1N A;  2Z23 A;  4DXU A;  1JW5 A;  1JEV A;  2D3I A;  2Q88 A;  4GX4 A;  2F97 A;  3T22 A;  2G29 A;  4DLD A;  1T0K A;  4OER A;  3AXF A;  5JTY B;  4LA9 A;  1I6B A;  4FE8 A;  2OWT A;  3SKP A;  1LBV A;  3K6U A;  4OVT A;  5BUU A;  4HCW A;  2PMS A;  3SZP A;  2ONK E;  1DSN A;  4R6K A;  4ZE8 A;  1FBG A;  1DMB A;  2GFE A;  2VPO A;  3D4G A;  2OJT A;  1IUD A;  3FD3 A;  3MYU A;  5CBR A;  1TFD A;  5I57 B;  1MH3 A;  4N6D A;  4ELR A;  2D5W A;  3OD7 A;  3W15 C;  3H03 A;  1USY E;  3B6W A;  4F3S A;  4DDD A;  1KZ8 A;  1N7W A;  2Z8D A;  3N6U A;  1LBY A;  2QSX A;  1OVB A;  1FQC A;  4G68 A;  4NHB A;  4R9G A;  4YU0 A;  4FOR A;  3SES A;  2CZK A;  1FBP A;  4YAH X;  1MPC A;  1AL3 A;  1LCF A;  5DVI A;  4ZZE A;  1NMU A;  1OQH A;  5ET7 A;  3RQT A;  2O51 A;  3SEX A;  3ZSF A;  5AA2 D;  3IK6 B;  4XKR A;  3V8X B;  5I3S A;  3TYH A;  4MJO A;  4YMB A;  4NED A;  1EU8 A;  2OCU A;  4RPO A;  4DCY A;  4PFY A;  3K6W A;  3MJN A;  1B7U A;  5TP9 B;  3IO4 A;  4QF9 A;  1BIY A;  3CFZ A;  3A09 A;  3LUY A;  5FHN A;  3PPR A;  3C36 A;  5HM4 B;  2B4L A;  3A29 A;  4G4P A;  1FQE A;  3N94 A;  3V5A A;  4NX1 A;  2XXV A;  4F1U A;  2PT2 A;  3PMV A;  4MIJ A;  4QFP A;  3EKI A;  3C33 A;  1RKM A;  3FAT A;  4QHQ A;  4F3P A;  2OK2 A;  4GXS B;  2FHY A;  4O3C A;  3U94 A;  4NWC A;  2Z22 A;  1NV1 A;  1ZKB A;  4PP0 A;  3KN3 A;  4QSC A;  5H8F B;  3JYR A;  4MFI A;  3CFL A;  3MZ1 A;  3K1M A;  4G77 A;  4G2Z A;  1VDW A;  3KEI A;  5ESY A;  4OES A;  2R9J A;  3THI A;  4XTC Q;  4N4U A;  3RY3 A;  1LEV A;  4OVJ A;  4F3G A;  4GLI A;  2ZZV A;  4NF5 B;  3FXU A;  4OEV A;  5B7D A;  2NVU B;  3TDJ A;  1NUZ A;  4ZEI A;  3MPL A;  2V25 A;  1P1U A;  3OSQ A;  1Y3N A;  5I84 A;  3TEL A;  4RNS A;  4PDH A;  3ZKK A;  4X8R A;  4YB6 A;  2RCB A;  4XKP A;  1LBC A;  3IOR A;  3DLN A;  2M8C A;  3LSX A;  3Q25 A;  4F1Y A;  4NF0 A;  2XWI A;  1B46 A;  1FPB A;  3I6V A;  4R72 A;  4GWW A;  4NMY A;  4TOZ A;  3KFM A;  3KSJ A;  2RIN A;  1B0H A;  4QBA A;  3ONM A;  1HSJ A;  1N7X A;  1NNP A;  3ODB A;  4HE0 A;  2I0B A;  3U92 A;  3FJM A;  4YB7 A;  3FBP A;  4H6D A;  3SET A;  4QSE A;  5EHM A;  2JJK A;  4N8G A;  4U4S A;  4PFW A;  4ELP A;  3GBB A;  3IB0 A;  1MQH A;  2ZZW A;  4KYE A;  5I58 A;  4ECF A;  4O7M A;  4PFB A;  1M5C A;  4RA1 A;  4KR5 A;  1B3H A;  3HHG A;  3CG3 A;  4ESW A;  1XVY A;  3KBZ A;  2H99 A;  3USD A;  1LBB A;  5CC2 A;  1D3K A;  3IOT A;  3H6W A;  1NV5 A;  4KQP A;  5H8Q B;  1H3D A;  1SPI A;  3H7M A;  2YLN A;  4U1Z A;  4ZEC A;  1I6A A;  2RKM A;  1NV2 A;  4F19 A;  5KDT B;  2VT5 A;  1M5D A;  5I2K A;  2HZL A;  2QS2 A;  1R9Q A;  1Q35 A;  5CMB A;  3TZA A;  1IMC A;  2XXR A;  4NF6 B;  5I7I A;  3TMG A;  3L6G A;  4EQ9 A;  2A5T B;  2F5X A;  5H8N B;  5AA2 B;  3H3G A;  3TTM A;  4OVS A;  4JVI A;  2Y5L A;  3B7D A;  4MLV A;  4PQJ A;  1POY 1;  1ZTY A;  1DPP A;  2P3V A;  1FCK A;  1OVT A;  1VR5 A;  3MWB A;  1KWH A;  1MQJ A;  2XXT A;  2PCR A;  2ZYK A;  1QUI A;  3RPL A;  5ICQ A;  5DVF A;  3MVX A;  4WEP A;  4FIM A;  1DTG A;  3TTR A;  1UQW A;  3N5L A;  3FVG A;  4GFR A;  4QSD A;  5AA3 A;  1TT1 A;  1FQD A;  1O63 A;  5H8S A;  2R8T A;  5I59 A;  4MMP A;  3U93 A;  2I58 A;  2ZNT A;  2DVZ A;  1A8E A;  1KA1 A;  4R75 A;  1EYJ A;  4U22 A;  1URS A;  3TOD A;  3UN6 A;  2WKY A;  2DXY A;  3TTL A;  3TFL A;  1F9B A;  1XT8 A;  2F3B A;  1GTK A;  5CMK A;  1H45 A;  4RJZ A;  3G3I A;  1RDX A;  4YKI A;  1LBW A;  3RTW B;  5JEI A;  2P3N A;  4H5F A;  3K00 A;  2XXH A;  2HAU A;  4KCC A;  2O7I A;  4XF5 A;  3UOR A;  3TPA A;  3HFU A;  3VVD A;  4JVD A;  4YMA A;  5KCJ A;  4N81 A;  1MQG A;  1MQI A;  1TFA A;  3B6T A;  3MBP A;  1IQ7 A;  2QRY A;  3SEW A;  1SBP A;  2PBW A;  3FVK A;  5FTI A;  1FQB A;  1MY4 A;  5EQ8 A;  4P9K A;  4GX6 A;  5CBS A;  2GRV A;  4Q30 B;  1YCJ A;  5KCJ B;  2DVC A;  5A5X A;  4XXU A;  3T93 B;  3KJT A;  2QMX A;  3BFU A;  4X1D A;  1NFT A;  3FXQ A;  3O29 A;  4OVP A;  2V4C A;  2BJJ X;  3DP4 A;  2W7Y A;  4DCX A;  2F7C A;  4LAT A;  1BP5 A;  4R74 A;  1S50 A;  1URD A;  3M3L A;  1XC1 A;  1M5F A;  1FPF A;  3IL1 B;  1B58 A;  2UYE A;  3LUZ A;  4X04 A;  4FEB A;  4I62 A;  5EYH A;  2F6P A;  1NKX A;  3OO9 A;  3OEM A;  2DOJ A;  4QRZ A;  2XD2 A;  3LV0 A;  1MXX A;  1CE2 A;  4EF2 A;  3CHG A;  4IGR A;  1URG A;  3OXN A;  2AYS A;  3E3K A;  4OYV A;  3VE1 B;  4H0W A;  3OO7 A;  2FYI A;  3Q28 A;  1MXV A;  4QFK A;  1HSE A;  2XWO A;  1ANF A;  4PFU A;  2NWJ A;  1I69 A;  4ELQ A;  5ICT A;  2VHA A;  2QL3 A;  4JXI A;  2PT1 A;  1R6Z A;  1LB8 A;  4O8M A;  4MHF A;  3QAX A;  1SI1 A;  2REJ A;  3O2A A;  2QS4 A;  2FBP A;  3G3H A;  2XWV A;  3LSL A;  3RN8 A;  1MS7 A;  1M5E A;  2OWZ A;  1PB7 A;  4N8Y A;  1NH7 A;  3RGY A;  4WKM A;  3K01 A;  4JB7 A;  4KYS A;  4AS4 A;  1Y9U A;  1NUW A;  4KHZ E;  3M8U A;  4EF1 A;  5AA4 A;  4H46 A;  4XEQ A;  1NV3 A;  4I3Y A;  4FED A;  2VP1 A;  4MNC A;  2XXK A;  4GBW A;  3FIR A;  3JZJ A;  2RF1 A;  3MAM A;  4LUB A;  4IO4 A;  5AA4 B;  2Y7W A;  3FV1 A;  1N3X A;  5CI5 A;  1I6Q A;  1MXW A;  3MVW A;  2F7A A;  2F34 A;  1BLF A;  4N13 A;  5JTY A;  3SDF A;  4ZEB A;  1XHY A;  2DXR A;  3EPE A;  5EQA A;  3S9E A;  2DSF A;  1BK4 A;  3CI8 A;  2V3T A;  4LZ7 A;  3MP6 A;  3EHT A;  1PB8 A;  5CM6 A;  4NN3 A;  4GWS A;  2PX1 A;  4XFE A;  4P47 A;  3OSR A;  5I57 A;  2XXX A;  2DS9 A;  2OWS A;  3RPW A;  1B5J A;  2VD3 A;  4LZ5 A;  1US5 A;  2CMO A;  4ZED A;  3IOW A;  1OLA A;  2PFY A;  4I8C A;  1B51 A;  1Y20 A;  4ONY A;  1GV8 A;  2HQ0 A;  5H8H B;  1IMD A;  4GQO A;  4JSD A;  2DE2 A;  4ZEF A;  4BDN A;  3PPP A;  2H4I A;  1SW2 A;  1Q1K A;  4KYD A;  4R6Y A;  1EYK A;  2YJP A;  1A7L A;  1NV0 A;  2WBD A;  3HHF A;  3IOV A;  4Q5T A;  2HZK A;  1R9L A;  4NTL A;  3M3K A;  3KC0 A;  1MPD A;  3U8Q A;  3LBS A;  3K6X A;  5IM2 A;  5DTB A;  2I4C A;  1MRP A;  3BBR A;  4PF8 A;  1DK4 A;  5TP9 A;  3C34 A;  1B7H A;  4OA4 A;  2O84 X;  1INP A;  1Y1M A;  4EXK A;  1QJM A;  3G3J A;  2QVR A;  1QGX A;  3Q26 A;  4DIG A;  1LAH E;  4IB2 A;  5DVJ A;  3OO6 A;  3A3U A;  4H1X A;  4I1D A;  5DYH A;  4HXV A;  5EQ9 A;  4UAC A;  1FQA A;  5ISU A;  2UVG A;  1SI0 A;  2O69 A;  4K3F A;  3V83 A;  3O28 A;  1IXI A;  4KXP A;  4P1L A;  3KG2 A;  3FXB A;  4F3B A;  1SW1 A;  1IMB A;  2O68 A;  1B9J A;  2Q74 A;  4EQB A;  4AQ4 A;  4I9D A;  1UTB B;  5H8F A;  1FRP A;  4HE1 A;  1VFE A;  1NNF A;  1LFG A;  1VE4 A;  2AL5 A;  2HFB A;  2Z8F A;  1B5I A;  1FTO A;  4PC9 A;  4F31 B;  2VOZ A;  5ITP A;  4OHN A;  4GIZ A;  4OEU A;  3DEL B;  1EZ9 A;  3HV1 A;  2RC8 A;  4AB6 A;  3PUX E;  4OFL A;  2DWJ A;  4NF5 A;  4ELO A;  3Q27 A;  3S4U A;  2DE4 A;  4MF3 A;  5BWJ A;  4BDL A;  2I3V A;  3TEP A;  4IGT A;  2OBG A;  1DTZ A;  3RYD A;  1B4H A;  2UXA A;  5LOM A;  4MNP A;  1FPI A;  4H5G A;  4MH5 A;  4YKK A;  1LCT A;  5L9M A;  2HXW A;  3FVO A;  2ABH A;  2Y7K A;  5DEX B;  3MP8 A;  4OQO A;  4OFJ A;  2Y7R A;  1A8F A;  2XXW A;  1MY3 A;  4DZ1 A;  3PGF A;  1FTM A;  3TAJ A;  3PD9 A;  3KN7 A;  4JDF A;  3E79 A;  2QS3 A;  1TXF A;  2YPN A;  2F6G A;  1B3G A;  4HTG A;  3O66 A;  3TQW A;  2Y7I A;  3R26 A;  3EF7 A;  1NUY A;  2R6G E;  1XI6 A;  1MXZ A;  4RY1 A;  4JWO A;  3LSW A;  4LZ8 A;  2DWI A;  4JSO A;  5EYF A;  1P1W A;  4EDP A;  1O64 A;  4OTE A;  1SYH A;  3JV9 A;  4GWU A;  3QXM A;  2H9B A;  2V3Q A;  2AIX A;  4GWY A;  4NF4 B;  1ZMG A;  5K2X A;  4QFO A;  1P1O A;  2DWA A;  4PBH A;  4N17 A;  4DE8 A;  2ESN A;  1B3L A;  4KFQ A;  3D4C A;  4DI3 D;  4TLM B;  5FBP A;  1NV7 A;  3PPN A;  4NF8 B;  3BIH A;  1MPB A;  5H8Q A;  1NNK A;  3OEL A;  3MVZ A;  5KDT A;  1D9Q A;  4ND9 A;  2ZYM A;  4NE4 A;  3C4M A;  4MLQ A;  4NF6 A;  1B32 A;  1IXG A;  1MXU A;  5B70 A;  4XIG Q;  2A5T A;  4PF6 A;  3TCF A;  5H8N A;  5AA2 A;  2AL4 A;  4F2Q A;  3W9V A;  5I2N B;  4P1E A;  4N6K A;  1XS5 A;  1NH8 A;  2XXU A;  5DT6 A;  3LR1 A;  1TWY A;  3PUV E;  4NAP A;  1JQF A;  4AB5 A;  3ISP A;  1PDA A;  3LSF B;  3OMB A;  2XXQ A;  3MPK A;  4GWO A;  5CRY A;  1QVS A;  3FAS A;  2D21 A;  2LAO A;  4EQ7 A;  1VSO A;  4DXB A;  4TQU Q;  4H65 A;  1H76 A;  4DXC A;  2I49 A;  3QIM A;  3PTY A;  4IO6 A;  4QXD A;  1MY2 A;  1FTL A;  3FJG A;  3L6H A;  4KPT A;  3OEN A;  1FBE A;  5EHS A;  4G61 A;  4U2R A;  4PBQ A;  4RPN A;  1NV4 A;  1WOD A;  3S9M C;  4ZS9 A;  4WED A;  4LQ2 A;  3RTF B;  4JBZ A;  2ALU A;  1OLC A;  4P11 A;  3R7X A;  4ESX A;  2QPQ A;  1PB9 A;  2XHD A;  2L5V A;  3F11 A;  3FGS A;  2HAV A;  2F8D A;  2Y5K A;  3W9W A;  4IO2 A;  2O6A A;  1NI9 A;  1NL5 A;  1DOT A;  3VXB A;  4X1B A;  2OLB A;  4MX6 A;  3T9V A;  1XOC A;  3K1P A;  3MUQ A;  3MC2 A;  3TCH A;  2XXI A;  5IGA A;  5T3J A;  3CSG A;  1FPE A;  2PVU A;  4IY6 A;  3CRB A;  3ZS6 A;  1YPN A;  3UP9 A;  4P8B A;  4GBV A;  4OAN A;  4R2B A;  3C9H A;  2O7U A;  3U65 A;  1N0T A;  1RYO A;  2O1L A;  4GD5 A;  3GXA A;  3KGC A;  3VLU A;  4U1O A;  3IO6 A;  2H5Y A;  2NXO A;  4GL8 A;  3UIF A;  2Q2A A;  2P0S A;  1IME A;  1QKA A;  1S9T A;  5I56 B;  2XA5 A;  1Y1Z A;  1CB6 A;  3U1O A;  2E1S A;  4G8H A;  2NUV A;  1FTK A;  3OEK A;  4WXJ A;  2QFL A;  1FSA A;  1ZBM A;  1ZU0 A;  4HW8 A;  3GYY A;  1FBC A;  1LST A;  2V3U A;  2FA7 A;  2ZNU A;  3DM0 A;  1B3F A;  2HHM A;  1JW4 A;  2FIX A;  3HN0 A;  2NOO A;  1DPE A;  3C35 A;  4FBP A;  4LVQ A;  4PAF A;  2ANJ A;  2DWH A;  2V84 A;  3T96 B;  2HPG A;  2Y84 A;  5IKB A;  2FVZ A;  3TTN A;  3HPI A;  4H8J A;  2FIE A;  2F3D A;  1MDP 1;  1M5B A;  1US4 A;  4R73 A;  3V89 B;  2CEX A;  3GZG A;  5F24 A;  1QUL A;  5HPQ A;  4F1V A;  1B7Z A;  1ZJL A;  3PD8 A;  4PAK A;  4GWX A;  3VFJ A;  2GHA A;  2GH9 A;  5ELV A;  3B6Q A;  1N04 A;  4IY5 A;  1YTV A;  3IJO B;  1BTJ A;  3QYT A;  3H4Z A;  4KD5 A;  4LP2 B;  2I0C A;  4PE3 A;  2Q9T A;  4IO5 A;  4JWX A;  1IMA A;  4MEV A;  4BLA A;  3DP6 A;  1FQF A;  2DE3 A;  4QFN A;  2B3B A;  5FTH A;  1FPL A;  3FUZ A;  3G7W A;  3ECR A;  1IEJ A;  1UTH B;  1D4N A;  1FTA A;  2X7Q A;  4RXL A;  3TCG A;  1NUX A;  3RUM A;  3SEY A;  1II5 A;  1O7T A;  3H06 B;  1H44 A;  4YIC A;  3R6U A;  4FJP A;  4PFT A;  4RK9 A;  1G0I A;  2XX9 A;  1VFD A;  1SQY A;  3K4U A;  5ET5 A;  4MCO A;  3I5O A;  5IZ3 B;  5JK4 A;  1A99 A;  2XXY A;  1SW4 A;  4ZEK A;  1LLS A;  1N84 A;  4R9F A;  1Z7N E;  1MH4 A;  5AA1 A;  3ILT B;  5L8D A;  2DQV A;  4NGU A;  3OOA A;  5TPA B;  3CG1 A;  3QK6 A;  5H8H A;  2FNC A;  1LAG E;  4THI A;  4O3A A;  1UIU A;  4EUO A;  1YAE A;  3IB1 A;  3CFX A;  1OQG A;  3ROJ A;  5AE4 A;  3KOS A;  3PUY E;  5HBC A;  3E9X A;  4F22 A;  4RYA A;  2QJE A;  3PPQ A;  4N07 A;  4P0I A;  1B4Z A;  1B3E A;  1YYZ A;  1Z7M E;  3E78 A;  4OMB A;  3IB2 A;  2DYX A;  4GX3 A;  1P1Q A;  1P1N A;  2RCA A;  1NNT A;  3O6H A;  1MY0 A;  1K9Z A;  3OO8 A;  2HCA A;  4PFI A;  1MM7 A;  2QVV A;  4PAI A;  4P56 A;  1FTJ A;  1ELJ A;  4U23 A;  1PBP A;  4NWD A;  4GVO A;  4MNI A;  4G68 B;  1D9Y A;  4O7I A;  3KC1 A;  2WEF A;  1FJ9 A;  3G3G A;  3K1N A;  2QVU A;  3T0J A;  4Q8R A;  2DP8 A;  2CEY A;  3FJ7 A;  2GHB A;  3VDF A;  1UTB A;  5J1D A;  4F18 A;  3KJ7 A;  4BDR A;  3N6T A;  3MP1 A;  3MST A;  4PGP A;  2Y7P A;  3TKD A;  1PC3 A;  3IFA A;  3PUZ E;  1YZ0 A;  2HEU A;  3CIJ A;  5I5P A;  2ZZX A;  4YKP A;  1JNF A;  3T9X B;  3TUS A;  2KQZ A;  2X26 A;  1P99 A;  4P3L A;  4GL0 A;  1EZP A;  1FPK A;  4Z7E A;  3KSX A;  3UK4 A;  4X9T A;  1IXH A;  2XWK A;  3IR1 A;  1WVJ A;  1QW0 A;  1FJ6 A;  4AS5 A;  1LAF E;  4H67 A;  4OVQ A;  4L17 A;  1G0H A; 
#chains in the Genus database with same CATH homology
 1L5T A;  2RC7 A;  1MG1 A;  2QS1 A;  5CMM A;  5DEX A;  4P0G A;  1MY1 A;  4E0X A;  1SD3 A;  1RYX A;  4GOT A;  1JEU A;  2IEE A;  1JVY A;  3CR9 A;  3VVE A;  2Z8E A;  1LB9 A;  5M2V A;  3VVF A;  4N6P A;  3PMX A;  2H25 A;  3RT6 B;  4OFO A;  1SYI A;  4G68 C;  2R71 A;  1OIB A;  2F35 A;  3RNN A;  3MZ9 A;  3RT8 A;  4H8I A;  3IAZ A;  2VGQ A;  1R1N A;  4FAJ A;  3T66 A;  2V93 A;  4XKQ A;  4NF4 A;  5KZT A;  5L9O A;  1FW0 A;  3KOT A;  4OWD A;  2XXP A;  3PPO A;  2ZNS A;  4LQ5 A;  2X7P A;  1QUK A;  1IIT A;  4X48 A;  4LON B;  4FAT A;  4NF8 A;  1JW1 A;  3LC8 A;  3M3F A;  3QUF A;  4C1U A;  3CVG A;  1B6H A;  2QMW A;  1B40 A;  2F78 A;  3H6U A;  1USY H;  3ZKL A;  3C32 A;  3VLW A;  4OXV A;  1LGB C;  1SVX B;  3GBA A;  3U72 A;  3T9U A;  4ZDM A;  2Q8J A;  4ZE9 A;  2UVJ A;  3UA8 A;  5F7V A;  5I2N A;  3BKI B;  1XVX A;  3O97 A;  4C1T A;  1BKA A;  5L9S A;  1SW5 A;  1SDX A;  4RK2 A;  1MQD A;  2O1M A;  3K6V A;  3K02 A;  3G3K A;  5I58 B;  5FHM A;  4OZ9 A;  5F1Q A;  4Q0C A;  4BDM A;  2E0S A;  1S7Y A;  3H6V A;  3DP8 A;  4YKJ A;  4O3B A;  5CMC A;  4KCD A;  2OZZ A;  4YB5 A;  3VXC A;  3KBR A;  2PYY A;  4F39 A;  5I2K B;  4IO3 A;  2RC9 A;  1UIV A;  3IJX B;  1MDQ A;  4HS7 A;  1B1X A;  3HO7 A;  3O6I A;  2KLF A;  3PU5 A;  4KI0 E;  2XX8 A;  1QKB A;  2XD3 A;  3IOU A;  2ZYO A;  2ONS A;  1JVX A;  4IO7 A;  2P2A A;  4M4G A;  4BDQ A;  3T9H B;  1AH5 A;  1JET A;  3MW0 A;  3EN3 A;  2THI A;  1PEB A;  3K2D A;  3FV2 A;  1LFI A;  2A5S A;  4FEC A;  5I59 B;  3ILU B;  4POX A;  2P1S A;  2XX7 A;  2F36 A;  1GGG A;  1POT A;  4R6H A;  3KZG A;  1IZ1 A;  4UA8 A;  1PBQ A;  2G93 A;  3O6G A;  1LFH A;  4GF8 A;  3TTK A;  1B52 A;  1AIV A;  2IA4 A;  1N3W A;  3IX1 A;  3WAF A;  3PV0 E;  1OMP A;  5I56 A;  1Y3P A;  1AMF A;  3Q29 A;  2REG A;  1A40 A;  3PMW A;  2H98 A;  1GVC A;  2Q89 A;  4EXL A;  1HSL A;  1Y3Q A;  1B2H A;  1LAX A;  3S9N C;  3E13 X;  3UGW A;  3VLV A;  2Q2C A;  3EQ1 A;  5A5X B;  1B0L A;  2VD2 A;  3HCQ A;  4JWY A;  3PUW E;  3MVY A;  2I3W A;  3O9P A;  1Y4T A;  1ZLQ A;  4HCY A;  4YZZ A;  2B65 A;  3QUJ A;  2B3F A;  3HST A;  1B5H A;  3RLF E;  3S2V A;  4XKN A;  2I6E A;  3A3C A;  3FZV A;  4C0R A;  3TQL A;  3VV5 A;  3SEV A;  3SEU A;  3S9L C;  1N76 A;  3MQ9 A;  1A55 A;  1ZIU A;  3K0V A;  5IAI A;  4QFL A;  2UYF A;  2F7B A;  3EHS A;  4GRK A;  5K2Y A;  2ZYN A;  4G8M A;  1WDN A;  3WAE A;  1A54 A;  1B05 A;  4GXA A;  3MZB A;  2UVI A;  2ZXT A;  3KN8 A;  5TU0 A;  2ONR A;  4BDO A;  1AOV A;  1MXY A;  1QUJ A;  4R2F A;  1MM6 A;  4POW A;  3QSL A;  1IXC A;  1UTH A;  4G8N A;  3N26 A;  1B1H A;  3CSB A;  3E4R A;  2ZMB A;  4PET A;  1Y4C A;  3FVN A;  1IIW A;  3C31 A;  5ITO A;  4U4X A;  3GLB A;  3SER A;  1GR2 A;  3EHU A;  3G3F A;  2UVH A;  1EZO A;  1D9V A;  4U21 A;  2I4B A;  1H43 A;  3FXR A;  4MBP A;  1ATG A;  4OET A;  5FHO A;  4ISU A;  4F29 A;  2CZL A;  4M1V A;  4OEN A;  1EH3 A;  2I48 A;  4Z0I A;  4E0W A;  4ZZA A;  4F2O A;  3H6T A;  4PE5 B;  3BFT A;  5TPA A;  4TLL B;  3I3V A;  3P7I A;  1J1N A;  2Z23 A;  4DXU A;  1JW5 A;  1JEV A;  2D3I A;  2Q88 A;  3T22 A;  2F97 A;  4DLD A;  2G29 A;  1T0K A;  4OER A;  3AXF A;  5JTY B;  4LA9 A;  1I6B A;  4FE8 A;  2OWT A;  3SKP A;  3K6U A;  5BUU A;  4HCW A;  2PMS A;  2ONK E;  1DSN A;  4R6K A;  4ZE8 A;  1DMB A;  2GFE A;  3D4G A;  2OJT A;  1IUD A;  3FD3 A;  5CBR A;  1TFD A;  5I57 B;  1MH3 A;  4ELR A;  2D5W A;  3OD7 A;  3W15 C;  3H03 A;  1USY E;  3B6W A;  4F3S A;  4DDD A;  1N7W A;  2Z8D A;  3N6U A;  2QSX A;  1OVB A;  1FQC A;  4G68 A;  4R9G A;  4YU0 A;  4FOR A;  3SES A;  4YAH X;  1MPC A;  1AL3 A;  1LCF A;  5DVI A;  4ZZE A;  1NMU A;  1OQH A;  3RQT A;  2O51 A;  3SEX A;  3ZSF A;  5AA2 D;  3IK6 B;  4XKR A;  3V8X B;  3TYH A;  4YMB A;  4NED A;  1EU8 A;  2OCU A;  4RPO A;  4DCY A;  4PFY A;  3K6W A;  3MJN A;  1B7U A;  5TP9 B;  3IO4 A;  4QF9 A;  1BIY A;  3CFZ A;  3A09 A;  3LUY A;  5FHN A;  3PPR A;  3C36 A;  5HM4 B;  4G4P A;  1FQE A;  3N94 A;  3V5A A;  2XXV A;  4F1U A;  2PT2 A;  3PMV A;  4QFP A;  3C33 A;  1RKM A;  3FAT A;  4QHQ A;  4F3P A;  2OK2 A;  4GXS B;  4O3C A;  3U94 A;  4NWC A;  2Z22 A;  1ZKB A;  4PP0 A;  3KN3 A;  4QSC A;  5H8F B;  3JYR A;  4MFI A;  3CFL A;  3MZ1 A;  3K1M A;  4G77 A;  4G2Z A;  3KEI A;  4OES A;  2R9J A;  3THI A;  4XTC Q;  3RY3 A;  4OVJ A;  4F3G A;  4GLI A;  4NF5 B;  3FXU A;  4OEV A;  5B7D A;  2NVU B;  3TDJ A;  4ZEI A;  3MPL A;  2V25 A;  1P1U A;  3OSQ A;  1Y3N A;  5I84 A;  3TEL A;  4RNS A;  3ZKK A;  4YB6 A;  2RCB A;  4XKP A;  1LBC A;  3IOR A;  3DLN A;  2M8C A;  3LSX A;  3Q25 A;  4F1Y A;  1B46 A;  3I6V A;  4R72 A;  4NMY A;  4TOZ A;  3KFM A;  3KSJ A;  2RIN A;  1B0H A;  3ONM A;  1HSJ A;  1N7X A;  1NNP A;  3ODB A;  2I0B A;  3U92 A;  3FJM A;  4YB7 A;  3SET A;  4H6D A;  4QSE A;  5EHM A;  4U4S A;  4PFW A;  4ELP A;  3GBB A;  3IB0 A;  1MQH A;  4KYE A;  5I58 A;  4ECF A;  1M5C A;  4RA1 A;  4KR5 A;  1B3H A;  3HHG A;  3CG3 A;  4ESW A;  1XVY A;  2H99 A;  3USD A;  1LBB A;  5CC2 A;  1D3K A;  3IOT A;  3H6W A;  4KQP A;  5H8Q B;  1H3D A;  3H7M A;  2YLN A;  4U1Z A;  4ZEC A;  1I6A A;  2RKM A;  4F19 A;  5KDT B;  1M5D A;  5I2K A;  2HZL A;  2QS2 A;  1R9Q A;  1Q35 A;  5CMB A;  3TZA A;  2XXR A;  4NF6 B;  3TMG A;  3L6G A;  4EQ9 A;  2A5T B;  2F5X A;  5H8N B;  5AA2 B;  3H3G A;  3TTM A;  3B7D A;  4MLV A;  4PQJ A;  1POY 1;  1ZTY A;  1DPP A;  1FCK A;  1OVT A;  1VR5 A;  3MWB A;  1KWH A;  1MQJ A;  2XXT A;  2ZYK A;  1QUI A;  5ICQ A;  5DVF A;  3MVX A;  4WEP A;  4FIM A;  1DTG A;  3TTR A;  1UQW A;  3N5L A;  3FVG A;  4GFR A;  4QSD A;  5AA3 A;  1TT1 A;  1FQD A;  1O63 A;  5H8S A;  5I59 A;  3U93 A;  2I58 A;  2ZNT A;  2DVZ A;  1A8E A;  4R75 A;  3TOD A;  4U22 A;  1URS A;  3UN6 A;  2WKY A;  2DXY A;  3TTL A;  3TFL A;  1F9B A;  1XT8 A;  1GTK A;  5CMK A;  1H45 A;  4RJZ A;  3G3I A;  4YKI A;  3RTW B;  5JEI A;  4H5F A;  3K00 A;  2XXH A;  2HAU A;  4KCC A;  2O7I A;  3UOR A;  3TPA A;  3VVD A;  4YMA A;  5KCJ A;  1MQG A;  1MQI A;  1TFA A;  3B6T A;  3MBP A;  1IQ7 A;  2QRY A;  3SEW A;  1SBP A;  2PBW A;  3FVK A;  5FTI A;  1FQB A;  1MY4 A;  5CBS A;  2GRV A;  4Q30 B;  1YCJ A;  5KCJ B;  2DVC A;  5A5X A;  4XXU A;  3T93 B;  3KJT A;  2QMX A;  3BFU A;  4X1D A;  1NFT A;  3FXQ A;  3O29 A;  2BJJ X;  3DP4 A;  2W7Y A;  4DCX A;  2F7C A;  4LAT A;  1BP5 A;  4R74 A;  1S50 A;  1URD A;  3M3L A;  1XC1 A;  1M5F A;  3IL1 B;  1B58 A;  2UYE A;  4FEB A;  4I62 A;  2F6P A;  1NKX A;  3OO9 A;  3OEM A;  2DOJ A;  4QRZ A;  2XD2 A;  1MXX A;  1CE2 A;  4EF2 A;  4IGR A;  1URG A;  3OXN A;  2AYS A;  3E3K A;  4OYV A;  3VE1 B;  4H0W A;  3OO7 A;  2FYI A;  3Q28 A;  1MXV A;  4QFK A;  1HSE A;  1ANF A;  4PFU A;  2NWJ A;  1I69 A;  4ELQ A;  5ICT A;  2VHA A;  2QL3 A;  4JXI A;  2PT1 A;  1R6Z A;  1LB8 A;  3QAX A;  1SI1 A;  2REJ A;  3O2A A;  2QS4 A;  3G3H A;  3LSL A;  3RN8 A;  1MS7 A;  1M5E A;  1PB7 A;  1NH7 A;  3RGY A;  4WKM A;  3K01 A;  4JB7 A;  4KYS A;  1Y9U A;  4KHZ E;  3M8U A;  4EF1 A;  5AA4 A;  4FED A;  2VP1 A;  3FIR A;  3JZJ A;  2RF1 A;  3MAM A;  4LUB A;  4IO4 A;  5AA4 B;  2Y7W A;  3FV1 A;  1N3X A;  5CI5 A;  1I6Q A;  1MXW A;  3MVW A;  2F7A A;  2F34 A;  1BLF A;  4N13 A;  5JTY A;  3SDF A;  4ZEB A;  1XHY A;  2DXR A;  3EPE A;  3S9E A;  2DSF A;  3CI8 A;  2V3T A;  4LZ7 A;  3MP6 A;  3EHT A;  1PB8 A;  5CM6 A;  2PX1 A;  3OSR A;  5I57 A;  2XXX A;  2DS9 A;  2OWS A;  3RPW A;  1B5J A;  2VD3 A;  4LZ5 A;  1US5 A;  2CMO A;  4ZED A;  3IOW A;  1OLA A;  4I8C A;  1B51 A;  1Y20 A;  4ONY A;  1GV8 A;  2HQ0 A;  5H8H B;  4GQO A;  4JSD A;  2DE2 A;  4ZEF A;  4BDN A;  3PPP A;  2H4I A;  1SW2 A;  1Q1K A;  4KYD A;  4R6Y A;  2YJP A;  1A7L A;  3HHF A;  3IOV A;  4Q5T A;  2HZK A;  1R9L A;  4NTL A;  3M3K A;  1MPD A;  3U8Q A;  3LBS A;  3K6X A;  5DTB A;  2I4C A;  1MRP A;  3BBR A;  5TP9 A;  3C34 A;  1B7H A;  2O84 X;  1Y1M A;  4EXK A;  1QJM A;  3G3J A;  3Q26 A;  4DIG A;  1LAH E;  4IB2 A;  5DVJ A;  3OO6 A;  3A3U A;  4H1X A;  4I1D A;  5DYH A;  4UAC A;  1FQA A;  5ISU A;  2UVG A;  1SI0 A;  2O69 A;  4K3F A;  3V83 A;  3O28 A;  1IXI A;  3KG2 A;  4F3B A;  1SW1 A;  2O68 A;  1B9J A;  4EQB A;  4AQ4 A;  4I9D A;  1UTB B;  5H8F A;  1VFE A;  1NNF A;  1LFG A;  1VE4 A;  2AL5 A;  2HFB A;  2Z8F A;  1B5I A;  1FTO A;  4F31 B;  2VOZ A;  5ITP A;  4OHN A;  4GIZ A;  4OEU A;  3DEL B;  1EZ9 A;  3HV1 A;  2RC8 A;  4AB6 A;  3PUX E;  2DWJ A;  4OFL A;  4NF5 A;  4ELO A;  3Q27 A;  3S4U A;  2DE4 A;  4MF3 A;  5BWJ A;  4BDL A;  2I3V A;  3TEP A;  4IGT A;  2OBG A;  1DTZ A;  1B4H A;  2UXA A;  5LOM A;  4H5G A;  4MH5 A;  4YKK A;  1LCT A;  5L9M A;  2HXW A;  3FVO A;  2ABH A;  2Y7K A;  5DEX B;  3MP8 A;  4OQO A;  4OFJ A;  2Y7R A;  1A8F A;  2XXW A;  1MY3 A;  4DZ1 A;  3PGF A;  1FTM A;  3TAJ A;  3PD9 A;  3KN7 A;  4JDF A;  2QS3 A;  1TXF A;  2YPN A;  2F6G A;  1B3G A;  4HTG A;  3O66 A;  3TQW A;  2Y7I A;  3R26 A;  3EF7 A;  2R6G E;  1MXZ A;  4RY1 A;  4JWO A;  3LSW A;  4LZ8 A;  2DWI A;  4JSO A;  5EYF A;  1P1W A;  4EDP A;  1O64 A;  4OTE A;  1SYH A;  3JV9 A;  3QXM A;  2H9B A;  2V3Q A;  2AIX A;  4NF4 B;  1ZMG A;  5K2X A;  4QFO A;  1P1O A;  2DWA A;  4DE8 A;  2ESN A;  1B3L A;  4KFQ A;  3D4C A;  4TLM B;  3PPN A;  4NF8 B;  1MPB A;  5H8Q A;  1NNK A;  3OEL A;  3MVZ A;  5KDT A;  4ND9 A;  2ZYM A;  4NE4 A;  3C4M A;  4MLQ A;  4NF6 A;  1B32 A;  1IXG A;  1MXU A;  5B70 A;  4XIG Q;  2A5T A;  3TCF A;  5H8N A;  5AA2 A;  2AL4 A;  4F2Q A;  3W9V A;  5I2N B;  1XS5 A;  1NH8 A;  2XXU A;  5DT6 A;  3LR1 A;  1TWY A;  3PUV E;  1JQF A;  4AB5 A;  1PDA A;  3LSF B;  3OMB A;  2XXQ A;  3MPK A;  4GWO A;  5CRY A;  1QVS A;  3FAS A;  2D21 A;  2LAO A;  4EQ7 A;  1VSO A;  4DXB A;  4TQU Q;  4H65 A;  1H76 A;  4DXC A;  2I49 A;  3QIM A;  4IO6 A;  1MY2 A;  1FTL A;  3FJG A;  3L6H A;  4KPT A;  3OEN A;  5EHS A;  4U2R A;  4RPN A;  1WOD A;  3S9M C;  4ZS9 A;  4WED A;  4LQ2 A;  3RTF B;  4JBZ A;  2ALU A;  1OLC A;  4P11 A;  3R7X A;  4ESX A;  2QPQ A;  1PB9 A;  2XHD A;  3F11 A;  3FGS A;  2HAV A;  2F8D A;  3W9W A;  4IO2 A;  2O6A A;  1NL5 A;  1DOT A;  3VXB A;  4X1B A;  2OLB A;  3T9V A;  1XOC A;  3K1P A;  3MUQ A;  3MC2 A;  3TCH A;  2XXI A;  3CSG A;  3ZS6 A;  2PVU A;  4IY6 A;  3CRB A;  1YPN A;  3UP9 A;  4R2B A;  3C9H A;  2O7U A;  1N0T A;  1RYO A;  2O1L A;  4GD5 A;  3GXA A;  3KGC A;  3VLU A;  4U1O A;  3IO6 A;  2H5Y A;  2NXO A;  4GL8 A;  3UIF A;  2Q2A A;  2P0S A;  1QKA A;  1S9T A;  5I56 B;  1Y1Z A;  1CB6 A;  3U1O A;  2E1S A;  4G8H A;  2NUV A;  1FTK A;  3OEK A;  4WXJ A;  1ZBM A;  1ZU0 A;  4HW8 A;  1LST A;  2V3U A;  2FA7 A;  2ZNU A;  3DM0 A;  1B3F A;  1JW4 A;  3HN0 A;  2NOO A;  1DPE A;  3C35 A;  4LVQ A;  2ANJ A;  2DWH A;  2V84 A;  3T96 B;  2Y84 A;  5IKB A;  3TTN A;  3HPI A;  4H8J A;  1MDP 1;  1M5B A;  1US4 A;  4R73 A;  3V89 B;  3GZG A;  1QUL A;  5HPQ A;  4F1V A;  1B7Z A;  1ZJL A;  3PD8 A;  3VFJ A;  2GHA A;  2GH9 A;  5ELV A;  3B6Q A;  1N04 A;  4IY5 A;  1YTV A;  3IJO B;  1BTJ A;  3QYT A;  3H4Z A;  4KD5 A;  4LP2 B;  2I0C A;  2Q9T A;  4IO5 A;  4JWX A;  4BLA A;  3DP6 A;  1FQF A;  2DE3 A;  4QFN A;  2B3B A;  5FTH A;  3FUZ A;  3G7W A;  3ECR A;  1IEJ A;  1UTH B;  1D4N A;  2X7Q A;  4RXL A;  3TCG A;  3RUM A;  3SEY A;  1II5 A;  1O7T A;  3H06 B;  1H44 A;  4YIC A;  3R6U A;  4FJP A;  4PFT A;  4RK9 A;  2XX9 A;  1VFD A;  1SQY A;  3K4U A;  3I5O A;  5JK4 A;  1A99 A;  2XXY A;  1SW4 A;  4ZEK A;  1LLS A;  1N84 A;  4R9F A;  1Z7N E;  1MH4 A;  5AA1 A;  3ILT B;  5L8D A;  2DQV A;  3OOA A;  5TPA B;  3CG1 A;  3QK6 A;  5H8H A;  2FNC A;  1LAG E;  4THI A;  4O3A A;  1UIU A;  4EUO A;  1YAE A;  3IB1 A;  3CFX A;  1OQG A;  5AE4 A;  3KOS A;  3PUY E;  5HBC A;  3E9X A;  4F22 A;  4RYA A;  2QJE A;  3PPQ A;  4N07 A;  4P0I A;  1B4Z A;  1B3E A;  1Z7M E;  4OMB A;  3IB2 A;  2DYX A;  1P1Q A;  1P1N A;  2RCA A;  1NNT A;  3O6H A;  1MY0 A;  3OO8 A;  2HCA A;  1MM7 A;  1FTJ A;  1ELJ A;  4U23 A;  1PBP A;  4NWD A;  4GVO A;  4G68 B;  1D9Y A;  3G3G A;  3K1N A;  4Q8R A;  2DP8 A;  3FJ7 A;  2GHB A;  3VDF A;  1UTB A;  5J1D A;  4F18 A;  3KJ7 A;  4BDR A;  3N6T A;  3MP1 A;  2Y7P A;  3TKD A;  1PC3 A;  3PUZ E;  2HEU A;  3CIJ A;  4YKP A;  1JNF A;  3T9X B;  3TUS A;  2X26 A;  1P99 A;  4GL0 A;  1EZP A;  4Z7E A;  3KSX A;  3UK4 A;  4X9T A;  1IXH A;  3IR1 A;  1WVJ A;  1QW0 A;  1LAF E;  4H67 A;  4L17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...