2H98A

Crystal structure of the effector binding domain of a catm variant, catm(v158m)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
216
structure length
216
Chain Sequence
SQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRRIMLHKEQLKLAIHKHHHLNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator catM
publication title Structural basis for the altered regulatory roles of three LysR-type transcritional variants of CatM and BenM: CatM(V158M), CatM(R156H) and BenM(R156H/T157S)
rcsb
source organism Acinetobacter sp.
total genus 59
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h98A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h98A02
5HPQA 1BKAA 4NF5B 1ANFA 4OESA 3T66A 4P11A 1N7XA 3KSXA 4KYEA 3H06B 4PFTA 1LAFE 4AQ4A 1QUJA 1B5HA 1SYHA 3U93A 2F97A 3ILUB 2F6GA 3KEIA 3N6UA 4EQ7A 2UYFA 4WXJA 3JV9A 1Y20A 5H8NB 5AA2B 1MY3A 2DQVA 2RC7A 4G8HA 1OQHA 4F19A 3MP8A 2RC8A 3PUWE 5AA1A 4HCWA 5H8HB 1HSJA 4MF3A 2DWJA 3TEPA 2AL4A 1B4HA 1Y1ZA 2H5YA 2F6PA 3EHUA 5H8FB 1ZIUA 4BDMA 3G3FA 3IOUA 1RYOA 4OQOA 5ITOA 1POTA 1N3XA 2RF1A 3MZBA 1LB9A 3FV1A 3PD8A 1URSA 3DELB 1POY1 3PUZE 1AL3A 1NKXA 3LC8A 4KQPA 4IO2A 2UVIA 3CI8A 4RK2A 2GFEA 4R9GA 2HXWA 2QS3A 4JWYA 4XKNA 1AH5A 1OLAA 3T22A 3CRBA 2XD2A 3LBSA 3KN7A 4GF8A 4G8NA 2Z8EA 5I59A 2I58A 2HCAA 4RY1A 1PB8A 3S4UA 4NWDA 4GWOA 1SW2A 3PMXA 4XTCQ 2PT1A 4H0WA 3HV1A 3H4ZA 4LP2B 3W9WA 4PP0A 1I6QA 1Y9UA 2GRVA 5TP9A 3M3LA 1SW4A 3LSWA 2VD3A 3O6GA 4JDFA 4Q8RA 1QJMA 4F3BA 1BP5A 2PX1A 2ALUA 2OK2A 1B1XA 1SBPA 1Z7NE 3JZJA 1A99A 5B70A 2OLBA 4OFOA 2RCAA 1MY1A 4ECFA 4ZECA 3N6TA 2D5WA 3MP1A 3OENA 3O6IA 4O3BA 2Q88A 2GHBA 4FATA 3UIFA 2V3TA 5EYFA 5CMCA 2ZMBA 4WKMA 1HSEA 1URDA 3ZS6A 2GH9A 4L17A 3I6VA 5H8QB 4M1VA 3IOVA 3BBRA 1ELJA 1SW1A 2HFBA 3GLBA 2YLNA 4U23A 4ZEBA 1R6ZA 2ABHA 3RUMA 4R2BA 3MJNA 3H7MA 2ZYOA 3EPEA 4R72A 4H5GA 4LQ2A 5DVIA 4UA8A 4NF4B 4TLMB 4H1XA 4F2QA 3UGWA 3IB2A 4PFYA 4IGTA 3RLFE 1FTOA 4OXVA 3S9NC 4PQJA 1DTZA 4OHNA 2RC9A 2BJJX 1A8EA 4R6KA 4X48A 5DEXA 1IZ1A 3IO4A 2QMWA 1MXZA 4YKKA 4UACA 2Y7IA 2F34A 3C4MA 4RNSA 4IO7A 1PB7A 3RY3A 2ZYMA 1M5FA 3K01A 3PPOA 4G68C 3FVOA 4LVQA 5JTYA 4Z0IA 3TQLA 1SI1A 3MUQA 1T0KA 2DWAA 1JW1A 2DXYA 2H4IA 2ESNA 2FNCA 4JXIA 4F1UA 2Z8FA 2XXWA 3T93B 3FV2A 1B4ZA 1B5IA 4I8CA 3S9LC 2DXRA 3T9VA 4H67A 2O6AA 4NTLA 3OSRA 5ELVA 1JW4A 1B51A 3MC2A 3G3JA 3IJXB 1I6BA 2DOJA 1Z7ME 5DT6A 4Q30B 3V8XB 4FAJA 4YZZA 1NNFA 3VXBA 3UN6A 2Y7KA 5A5XA 1FTMA 3H03A 2ONKE 1A55A 3OO6A 1B3GA 3TCHA 4C1TA 1S9TA 4ELRA 4R74A 1QW0A 4XXUA 2DE3A 1OLCA 2O69A 1VFEA 3TCGA 3GZGA 5I58A 3PD9A 1MRPA 4GFRA 4AB5A 2I49A 4QFLA 2OWSA 2Z8DA 3LR1A 3IB0A 1Y1MA 4BDQA 4G68A 3PPRA 2X26A 1N0TA 2ZNTA 3PUYE 5EHSA 4NF6B 3PUVE 2AL5A 1URGA 4ZZEA 2AIXA 1PEBA 1PBQA 1XHYA 4YB6A 3G3GA 3KOSA 5AA4B 5I2KA 1RKMA 4YICA 2HZLA 4QFPA 2OCUA 3V89B 5FHNA 2E0SA 3E9XA 1TXFA 1ZU0A 2PT2A 4KHZE 1RYXA 5I57A 3VDFA 1B32A 4JB7A 4OMBA 1MPCA 1OVBA 4PFWA 2XXIA 2F36A 4GXAA 4KPTA 3CFLA 2HZKA 4XKPA 5EHMA 3HCQA 5FHOA 5ISUA 3BFTA 3M8UA 2CZLA 1IEJA 3Q29A 5H8SA 4EF1A 2THIA 3MQ9A 2B3BA 2DWHA 3HPIA 2E1SA 4PETA 2D21A 1MDP1 3T9XB 2PYYA 2KLFA 5CI5A 2F7CA 3SEWA 4JWXA 2R9JA 1WVJA 2F8DA 4YAHX 2I4CA 1LAXA 3MBPA 5CMMA 1IIWA 3K4UA 1LCFA 2P0SA 4BDNA 4FEDA 5L9OA 4LUBA 3CFZA 4QRZA 4LZ8A 1MH3A 1ZMGA 2WKYA 3HSTA 2LAOA 1N3WA 4FECA 3QYTA 3SEYA 4QFNA 5K2YA 2UXAA 2Y7RA 4FE8A 1O64A 3IR1A 1LAHE 3OELA 1VSOA 1DPPA 4NF5A 4YMAA 3EN3A 4N6PA 2O84X 4OEVA 5F1QA 1YCJA 1MQDA 3G3HA 3ZKKA 3QAXA 1J1NA 4OERA 2Q89A 4GRKA 2DS9A 1XOCA 3TMGA 3O28A 5L8DA 3K6UA 3TTLA 2HQ0A 4I62A 4EF2A 2OJTA 4F1VA 1FW0A 3MPLA 2G93A 3R7XA 1MQJA 2P1SA 1A40A 2Z23A 1MY4A 5H8NA 4ZDMA 5AA2A 1B7UA 1FTKA 1XVXA 1S50A 3K1MA 3MVWA 4Z7EA 4EDPA 2XXHA 2X7PA 3Q28A 4HS7A 4F2OA 2HEUA 1N76A 5H8HA 1TT1A 2RKMA 4KFQA 1QVSA 3H3GA 1VR5A 4ONYA 5I56B 1D9YA 2FA7A 5H8FA 5DVFA 3USDA 1CB6A 4H8IA 3H6WA 4P0IA 5CMBA 1LGBC 2I4BA 3OSQA 4IGRA 1VFDA 4IY6A 3VLWA 4ZEKA 3GXAA 4F18A 1MXUA 2O51A 2Y84A 3HO7A 4RYAA 1H76A 1US4A 4EXKA 4OWDA 4ISUA 4JSDA 1QKAA 3H6VA 3TELA 3EHSA 3QUFA 1MY0A 1LFHA 4RPNA 3C36A 1LBCA 2X7QA 3O6HA 2XXYA 3DM0A 3UP9A 3O97A 3LSFB 1MPBA 2F5XA 4H65A 3FATA 3F11A 1Y4CA 5L9MA 5CM6A 4QSDA 5KCJB 4MFIA 4EXLA 2Z22A 3IL1B 3SETA 1B40A 4NF8B 3MZ9A 5TU0A 1IQ7A 5KDTB 5AA3A 3K0VA 3OMBA 2OBGA 3W15C 3G3KA 3OEKA 2I3VA 3CVGA 3OD7A 3WAFA 4POXA 2ZXTA 5ICTA 4GQOA 3D4GA 1EZPA 1MH4A 2QRYA 4BDLA 4ESWA 3AXFA 5HBCA 4BDRA 3KJ7A 1M5EA 3B7DA 5H8QA 1B05A 4OENA 3TPAA 2ZYKA 1MY2A 1SW5A 5AA2D 3CG1A 1Y3QA 2GHAA 2DVZA 2O68A 1H43A 2D3IA 3TTMA 4R75A 2VOZA 1LSTA 2QSXA 2DYXA 4PE5B 3TCFA 1B0LA 4DDDA 1UTHB 4U22A 1MQIA 1UTBB 4E0XA 3FJ7A 4ZZAA 2Q8JA 4M4GA 2I48A 3PUXE 1MXVA 4JBZA 1MXYA 4G2ZA 3VVDA 3U94A 4NF4A 4H5FA 4GOTA 1O63A 1NNPA 2HAUA 4ZEFA 1GTKA 3MAMA 3FZVA 2H9BA 4KYSA 3UORA 2DE4A 3FXRA 1ZTYA 1QUKA 3KFMA 3Q27A 1B46A 3LSXA 3RN8A 4U21A 2F7AA 5I2NB 3TZAA 2NOOA 4GL8A 1NH7A 3ZKLA 1JVYA 1GV8A 1R9LA 3U72A 4NE4A 3A09A 3MPKA 1LLSA 4I9DA 5ITPA 2Y7WA 3B6TA 3T9HB 2A5TB 3TTNA 2UVJA 3G7WA 4OETA 4GIZA 2REGA 4OVJA 1QKBA 1MXWA 3K1PA 3TODA 4ELQA 4H8JA 3TYHA 4R2FA 3PMVA 1H3DA 2O7UA 1B52A 2XXUA 1AIVA 3K6XA 3IOTA 2DSFA 2HAVA 1SD3A 3IO6A 3TFLA 1Y4TA 3OOAA 3CSGA 3ONMA 3HN0A 2XX7A 3VFJA 1IXIA 4U2RA 2XX9A 2XXXA 1FQFA 4OEUA 1IXCA 5CMKA 3THIA 3VLUA 3H6TA 1A7LA 4DE8A 2V25A 1DPEA 3DP8A 3SEUA 3RQTA 4QFOA 4X9TA 5FTIA 1EZOA 4DZ1A 2DVCA 1JVXA 3FVGA 4DCYA 1ZBMA 3BFUA 4R6HA 2Q2CA 3T9UA 2Q9TA 1ZLQA 4QF9A 3KZGA 3SEXA 4ELPA 3MVZA 4TLLB 3U8QA 4DXUA 1OMPA 4YKJA 1MDQA 5DTBA 4DCXA 3I5OA 3TTRA 1UIUA 1LCTA 3DP6A 4IO6A 4XKQA 2V93A 1I69A 1ZKBA 3B6WA 1NH8A 3IAZA 3QXMA 1WDNA 1NFTA 3A3UA 3TKDA 4IO4A 5BWJA 4NF6A 4TOZA 2F35A 4YMBA 3IJOB 1D3KA 4FEBA 3FJGA 1NL5A 5AA4A 5TPAB 3PMWA 1LB8A 1TFDA 3FXUA 4DXBA 1MXXA 4IO5A 4O3AA 1LFGA 4YB5A 4OZ9A 4THIA 2IEEA 3UA8A 2PBWA 3OO9A 3FXQA 3N26A 3PU5A 4KCDA 1M5BA 5JEIA 1IUDA 2Y7PA 3K6VA 4F39A 1B2HA 1B6HA 3TQWA 3FASA 4U4SA 1DOTA 5F7VA 4WEPA 3RTFB 1XT8A 4DLDA 2QPQA 3TUSA 2NVUB 3LUYA 4KCCA 4F1YA 4YKPA 2O1LA 3OO8A 2NXOA 3VVFA 2XX8A 4EUOA 4NWCA 1JW5A 5J1DA 1LAGE 1B5JA 3CR9A 5B7DA 1B1HA 3RT8A 3SERA 1B3LA 3QK6A 2PMSA 1B7HA 2H25A 1D9VA 3E4RA 4F3GA 3O29A 1EU8A 2G29A 2QS1A 3L6GA 1JQFA 1HSLA 4OTEA 4ZS9A 2XXPA 2ANJA 3C9HA 2I0CA 2H99A 1SI0A 4KD5A 4C0RA 2XD3A 2UYEA 4YB7A 2DWIA 3KSJA 2O1MA 1NNKA 4R73A 1I6AA 4F3PA 3RT6B 4JWOA 3C34A 3EHTA 1FTJA 3PV0E 4YU0A 2OWTA 3U1OA 4YKIA 3TDJA 1N84A 5I84A 5I59B 4GLIA 4ND9A 4QHQA 3B6QA 4GL0A 3SEVA 3RTWB 4Q0CA 2PVUA 1SYIA 5CBRA 1GGGA 4X1BA 1PDAA 2H98A 3O9PA 1B0HA 4HCYA 4GVOA 4X1DA 3KN3A 5TP9B 4JSOA 3ECRA 3VE1B 5CC2A 3U92A 1DTGA 2VHAA 2RCBA 4K3FA 1IXHA 4AB6A 1DSNA 3IK6B 3C33A 5I56A 4PFUA 3FGSA 3T96B 4I1DA 4LATA 1PB9A 3QUJA 3VXCA 4LZ7A 4G8MA 3BKIB 3MVXA 3DLNA 3FD3A 3EF7A 3FJMA 1P1QA 1TWYA 2I0BA 4LA9A 1MG1A 2VD2A 1GR2A 1B58A 3QSLA 1NMUA 1BIYA 1FQDA 5DYHA 2XHDA 2F78A 4F22A 1Y3PA 5BUUA 3CFXA 3PPPA 1FQCA 4XIGQ 3G3IA 4O3CA 1Y3NA 4LZ5A 3Q25A 3Q26A 2R71A 5KCJA 1USYH 4IY5A 2VGQA 2QJEA 2NWJA 3KN8A 2AYSA 1EZ9A 4G77A 1R9QA 5IKBA 3ILTB 4NF8A 3MW0A 3HHGA 5KDTA 1IITA 3KJTA 4IB2A 2VP1A 1SDXA 4MH5A 1LFIA 3GBBA 4IO3A 1MM7A 5DEXB 2CMOA 3MWBA 4ZE9A 1OVTA 4HW8A 2FYIA 4MLQA 3L6HA 3O2AA 4OYVA 3FUZA 1MQHA 5IAIA 1A8FA 3FVNA 3M3KA 1H45A 3C32A 2OZZA 3QIMA 3A3CA 1US5A 5M2VA 4BDOA 3IX1A 1IXGA 3PGFA 3FVKA 3RGYA 2B65A 1F9BA 1MPDA 4ELOA 2ZYNA 4GXSB 2R6GE 1B7ZA 1SVXB 2P2AA 5JTYB 1UTHA 2IA4A 1UTBA 4QFKA 1P99A 3R26A 2YJPA 2ONSA 2Q2AA 3UK4A 4F3SA 3O66A 2NUVA 3I3VA 4NEDA 3VVEA 1MQGA 4Q5TA 3H6UA 4C1UA 1LBBA 3KGCA 5JK4A 3KBRA 1FQBA 1P1WA 4KR5A 1YAEA 3KOTA 3CIJA 4FJPA 1N7WA 4RXLA 3C31A 4F29A 1JETA 4N07A 4ZEIA 3KG2A 1B3EA 1FQEA 4U1ZA 1AOVA 1YPNA 3IB1A 4U1OA 1SQYA 4U4XA 1TFAA 1H44A 5A5XB 1BLFA 5LOMA 4NMYA 5I2NA 3OEMA 2DE2A 4KYDA 3ODBA 1FCKA 1ATGA 4GD5A 3OXNA 2A5TA 5DVJA 1II5A 1JEVA 3N94A 5FTHA 4RK9A 4DIGA 5I58B 3WAEA 1QULA 3LSLA 1JEUA 3P7IA 3S9MC 2V3QA 1UIVA 3W9VA 1M5CA 1FQAA 3MP6A 4G68B 4OFLA 5CRYA 1MS7A 3K00A 2UVGA 4FIMA 5AE4A 1JNFA 3M3FA 3GBAA 3S2VA 3V83A 1P1NA 3E3KA 3PPNA 4RPOA 4MBPA 1PBPA 1EH3A 2A5SA 3JYRA 3PPQA 1ZJLA 4HTGA 5I2KB 2ONRA 3D4CA 3CG3A 4XKRA 5FHMA 4POWA 1XS5A 1OIBA 2O7IA 3VV5A 1A54A 4TQUQ 4ZE8A 1P1OA 3MZ1A 5KZTA 4LQ5A 2ZNSA 1WODA 3TAJA 3TTKA 5I57B 2QS2A 2XXRA 4QSCA 1S7YA 3SDFA 1XVYA 4H6DA 3SESA 3K2DA 3C35A 4MLVA 1AMFA 3N5LA 4LONB 1FTLA 2V84A 3V5AA 3RPWA 1USYE 3K6WA 1B3FA 4EQBA 1P1UA 1UQWA 3CSBA 4G4PA 1Q1KA 3FIRA 2F7BA 1VE4A 3HHFA 2V3UA 2QMXA 2QS4A 2B3FA 3IOWA 4E0WA 2W7YA 4F31B 3SKPA 1KWHA 3K02A 1B3HA 4N13A 4RA1A 2XXQA 1NNTA 1Q35A 4BLAA 1CE2A 4RJZA 1R1NA 1QUIA 1PC3A 5TPAA 1D4NA 2ZNUA 1DMBA 2XXVA 5CBSA 3RNNA 4ESXA 3IORA 5L9SA 2YPNA 3E13X 4OFJA 3K1NA 3OO7A 2DP8A 2RINA 4EQ9A 5ICQA 4DXCA 2QL3A 1GVCA 2M8CA 1B9JA 4QSEA 3DP4A 4ZEDA 4P0GA 2REJA 2I3WA 4R9FA 1BTJA 3ZSFA 5K2XA 2I6EA 2XXTA 4FORA 1L5TA 1YTVA 3S9EA 4R6YA 3VLVA 1M5DA 5HM4B 1XC1A 4KI0E 1N04A 1OQGA 2UVHA 1MM6A 3MVYA 1O7TA 3EQ1A 3R6UA 4WEDA
chains in the Genus database with same CATH superfamily
5HPQA 1BKAA 4NF5B 1ANFA 4OESA 3T66A 4P11A 1N7XA 3KSXA 4KYEA 2FHYA 4N91A 4XFEA 3H06B 4PFTA 1LAFE 5T3JA 4AQ4A 1QUJA 1B5HA 4H45A 1SYHA 3U93A 2MKZA 1YYZA 2F97A 4QXDA 3ILUB 2F6GA 3RYDA 1DK4A 3KEIA 1FPLA 1NUYA 3N6UA 4EQ7A 2UYFA 4WXJA 3JV9A 3B50A 1Y20A 5H8NB 5AA2B 1MY3A 5IZ3A 2DQVA 2RC7A 3RPLA 4G8HA 1OQHA 4F19A 3MP8A 2RC8A 3PUWE 5AA1A 4HCWA 5H8HB 4P56A 1HSJA 4MF3A 2DWJA 3TEPA 4MJOA 2AL4A 1B4HA 1Y1ZA 2H5YA 2F6PA 3EHUA 5H8FB 2WEFA 1ZIUA 4BDMA 3G3FA 3IOUA 1RYOA 4OQOA 5ITOA 1POTA 1N3XA 2RF1A 3MZBA 1LB9A 3FV1A 3PD8A 1URSA 3DELB 1FSAA 1POY1 3PUZE 1AL3A 1NKXA 3LC8A 4KQPA 4IO2A 2UVIA 3CI8A 4RK2A 2GFEA 4R9GA 2HXWA 2QS3A 4JWYA 4XKNA 1AH5A 1OLAA 3T22A 3CRBA 2QFLA 2XD2A 3LBSA 5EQ9A 3KN7A 4GF8A 4G8NA 2Z8EA 5I59A 2I58A 2FIEA 2HCAA 4RY1A 1PB8A 3S4UA 4NWDA 4GWOA 4PGPA 1SW2A 3PMXA 4XTCQ 2PT1A 4H0WA 3HV1A 3H4ZA 4LP2B 3W9WA 4PP0A 1I6QA 1Y9UA 4PAFA 1K9YA 2GRVA 5TP9A 3T0JA 3M3LA 1SW4A 3LSWA 2VD3A 3O6GA 4JDFA 4Q8RA 1QJMA 1RDZA 4F3BA 1BP5A 2PX1A 2ALUA 2OK2A 1B1XA 1SBPA 1Z7NE 3JZJA 1D9QA 1A99A 5B70A 2OLBA 4OFOA 2VPOA 4I3YA 2RCAA 1MY1A 4ECFA 4ZECA 3N6TA 2D5WA 3MP1A 3OENA 3O6IA 4O3BA 2Q88A 1LBXA 2GHBA 4FATA 3UIFA 2V3TA 5EYFA 5CMCA 2ZMBA 4WKMA 1HSEA 1URDA 3ZS6A 2GH9A 4L17A 3I6VA 5H8QB 2XWVA 4M1VA 2BJIA 3IOVA 3BBRA 1ELJA 1SW1A 2HFBA 4MNPA 4O7MA 3GLBA 2CEYA 2YLNA 2QVRA 4U23A 4ZEBA 5EQ8A 1R6ZA 2ABHA 3RUMA 4R2BA 3MJNA 3H7MA 1FPFA 2ZYOA 3EPEA 4R72A 4H5GA 4LQ2A 4G61A 5DVIA 3ROJA 1IMFA 4UA8A 4NF4B 4TLMB 4H1XA 4F2QA 3UGWA 3IB2A 4PFYA 4IGTA 3RLFE 1FTOA 4OXVA 4PC9A 3S9NC 4PQJA 1DTZA 4OHNA 2RC9A 2BJJX 1A8EA 4R6KA 1XI6A 4X48A 5DEXA 1IZ1A 5IGAA 3IO4A 2QMWA 4UABA 1MXZA 4YKKA 4UACA 4PF8A 2Y7IA 2F34A 3C4MA 4RNSA 1LEVA 4IO7A 1PB7A 3RY3A 4PCDA 1NV6A 2ZYMA 1M5FA 3K01A 3PPOA 4G68C 2L5VA 1LBWA 3FVOA 2CZIA 4LVQA 5JTYA 4N4UA 4Z0IA 3TQLA 1SI1A 3MUQA 1T0KA 2DWAA 1JW1A 2DXYA 2H4IA 2ESNA 2FNCA 4JXIA 2Y5KA 5EYHA 1QGXA 1LBVA 4F1UA 2Z8FA 1NI9A 2XXWA 3T93B 3ISPA 4I3EA 3FV2A 1B4ZA 1B5IA 1FJ6A 4I8CA 3S9LC 2DXRA 3T9VA 4H67A 2O6AA 4NTLA 4OVQA 3OSRA 5ELVA 1JW4A 1B51A 3MC2A 3G3JA 3IJXB 1I6BA 2DOJA 1FJ9A 1Z7ME 5DT6A 4PAKA 4Q30B 3V8XB 4FAJA 4YZZA 1NNFA 3VXBA 2DDKA 4PF6A 3UN6A 2Y7KA 5A5XA 1FTMA 3H03A 2ONKE 1A55A 3OO6A 1B3GA 3TCHA 4C1TA 1S9TA 4ELRA 4R74A 1QW0A 4XXUA 2DE3A 1OLCA 2O69A 1VFEA 3TCGA 3GZGA 5I58A 3PD9A 1MRPA 4GFRA 4AB5A 2I49A 5I5PA 4QFLA 2OWSA 2Z8DA 5J16A 3LR1A 3IB0A 4GX3A 1Y1MA 1IMAA 4BDQA 4G68A 3PPRA 2X26A 1N0TA 1NV7A 2ZNTA 3PUYE 5EHSA 3BIHA 4NF6B 3PUVE 2AL5A 1URGA 4OVTA 4ZZEA 2AIXA 1PEBA 1PBQA 1XHYA 4YB6A 5ET5A 3G3GA 3KOSA 5AA4B 4AS5A 4PE3A 5I2KA 1RKMA 4YICA 2HZLA 4QFPA 2OCUA 3V89B 5FHNA 2E0SA 3E9XA 1TXFA 1ZU0A 2PT2A 4KHZE 1RYXA 5I57A 3VDFA 1B32A 2WBDA 3KBZA 4JB7A 4OMBA 1MPCA 1OVBA 4HXVA 3EKIA 4PFWA 2XXIA 2F36A 4GXAA 1NV5A 3CFLA 4KPTA 2HZKA 4XKPA 5EHMA 3HCQA 1NV0A 5FHOA 5ISUA 3BFTA 3M8UA 2CZLA 1IEJA 4MNCA 3Q29A 2KR0A 5H8SA 4EF1A 2THIA 3MQ9A 2B3BA 4GX6A 2DWHA 2FBPA 3HPIA 2E1SA 4PETA 2D21A 1DBZA 1MDP1 3T9XB 2PYYA 2KLFA 5CI5A 5F24A 2F7CA 4PTKA 3T1BA 1FBPA 3SEWA 4JWXA 2PFYA 4MX6A 2R9JA 1WVJA 4PDHA 2F8DA 4YAHX 2XWKA 1LBZA 2I4CA 1LAXA 3MBPA 1NUWA 5CMMA 1IIWA 4NQ8A 3K4UA 1LCFA 2P0SA 4BDNA 4FEDA 5L9OA 4LUBA 3CFZA 4QRZA 4LZ8A 1MH3A 1ZMGA 2WKYA 4GBWA 3HSTA 2LAOA 1N3WA 4FECA 4MHFA 2WYKA 3QYTA 3SEYA 4QFNA 5K2YA 2UXAA 2Y7RA 4FE8A 1O64A 3IR1A 1LAHE 5IZZA 3OELA 1VSOA 1DPPA 4NF5A 4YMAA 3EN3A 4AS4A 4N6PA 2O84X 4OEVA 5F1QA 1YCJA 1MQDA 3G3HA 3ZKKA 1G0HA 1J1NA 3QAXA 5A5LA 1G0IA 4OERA 2Q89A 4GRKA 2DS9A 1XOCA 4PGNA 3TMGA 3O28A 5I7IA 5L8DA 3K6UA 3TTLA 5DW8A 2HQ0A 4I62A 4EF2A 2OJTA 4F1VA 1FW0A 3MPLA 5FBPA 2G93A 3R7XA 1MQJA 4PFRA 2P1SA 4NX1A 1A40A 3U65A 2Z23A 1MY4A 2Q8MA 5H8NA 4ZDMA 5AA2A 1B7UA 1FTKA 1XVXA 1S50A 3K1MA 3MVWA 4Z7EA 4EDPA 2XXHA 2X7PA 1FPIA 3Q28A 4HS7A 4F2OA 2HEUA 1N76A 5H8HA 1TT1A 2RKMA 4KFQA 1QVSA 3H3GA 1VR5A 4ONYA 5I56B 1D9YA 2FA7A 2PFZA 5H8FA 5DVFA 3USDA 1CB6A 4H8IA 2ZZVA 3H6WA 4P0IA 5CMBA 1LGBC 4NN3A 2I4BA 3OSQA 4IGRA 5EQAA 1VFDA 4IY6A 3VLWA 4ZEKA 3GXAA 4F18A 2FVZA 1MXUA 2O51A 2Y84A 3HO7A 4RYAA 1H76A 1US4A 4EXKA 4OWDA 4ISUA 4JSDA 2QVVA 2JJKA 1K9ZA 1QKAA 3H6VA 3TELA 3EHSA 3QUFA 1MY0A 2KQZA 1LFHA 4RPNA 3C36A 1LBCA 2X7QA 3O6HA 2XXYA 3DM0A 3UP9A 3O97A 3LSFB 1MPBA 1FBCA 2F5XA 3IFCA 2P3VA 4H65A 3FATA 3F11A 1Y4CA 3PTYA 5L9MA 4N17A 4H46A 5CM6A 4QSDA 5KCJB 4PDDA 4MFIA 4EXLA 2Z22A 3IL1B 1IMDA 4XF5A 3SETA 1B40A 4NF8B 3MZ9A 5TU0A 1IQ7A 5KDTB 5AA3A 3K0VA 3OMBA 1FTAA 2OBGA 3W15C 3G3KA 3OEKA 2I3VA 3CVGA 3OD7A 5LDZA 2B4LA 3WAFA 4POXA 2ZXTA 5ICTA 4GQOA 4GBVA 3D4GA 1EZPA 3BIGA 1MH4A 2QRYA 4BDLA 4ESWA 2PCRA 3AXFA 3FXBA 5HBCA 4BDRA 4HE1A 3KJ7A 1M5EA 2F3DA 3B7DA 4FBPA 5H8QA 1B05A 4OENA 2ZYKA 3CG1A 1MY2A 1SW5A 3TPAA 5AA2D 1FBHA 1Y3QA 2GHAA 2DVZA 2O68A 4MEVA 4N15A 1H43A 2D3IA 3TTMA 4R75A 2VOZA 1LSTA 2F3BA 2QSXA 2DYXA 4PE5B 3TCFA 1B0LA 4DDDA 1UTHB 4U22A 1MQIA 1UTBB 4OA4A 4E0XA 3FJ7A 1FPJA 4ZZAA 2Q8JA 4M4GA 2I48A 3PUXE 1MXVA 4JBZA 1FPBA 1MXYA 4G2ZA 3VVDA 3U94A 4NF4A 4H5FA 4GOTA 2CZKA 1O63A 1NNPA 2HAUA 4ZEFA 1VDWA 1GTKA 1FPDA 3MAMA 3FZVA 2H9BA 4P47A 4KYSA 3UORA 2DE4A 4P1EA 3FXRA 1ZTYA 3A29A 1QUKA 3KFMA 3Q27A 1B46A 3LSXA 3RN8A 4U21A 2F7AA 5I2NB 3TZAA 2NOOA 4GL8A 1NH7A 1KA1A 2CEXA 3ZKLA 4N6KA 1IMEA 3FBPA 1JVYA 1GV8A 1R9LA 3U72A 4NE4A 3A09A 3MPKA 4O8MA 1LLSA 4I9DA 5ITPA 2Y7WA 3B6TA 3T9HB 3IFAA 2A5TB 3TTNA 2UVJA 3G7WA 4OETA 4GIZA 4NG7A 4O7IA 2REGA 4OVJA 1QKBA 1MXWA 3K1PA 3TODA 4ELQA 4H8JA 4GWXA 4OANA 3TYHA 3SZPA 4R2FA 3PMVA 1H3DA 2O7UA 1B52A 2XXUA 1AIVA 3K6XA 3IOTA 2DSFA 2HAVA 1SD3A 4GWZA 3IO6A 3TFLA 1Y4TA 3OOAA 3CSGA 3ONMA 3HN0A 2XX7A 1KA0A 3VFJA 1IXIA 4U2RA 2XX9A 2XXXA 1FQFA 4OEUA 1IXCA 5CMKA 3THIA 3VLUA 3H6TA 1A7LA 4DE8A 2V25A 1DPEA 3DP8A 3SEUA 3RQTA 4QFOA 4X9TA 5FTIA 1EZOA 4DZ1A 2DVCA 1JVXA 3FVGA 4DCYA 1RDXA 1ZBMA 3BFUA 4R6HA 1LBYA 2Q2CA 3T9UA 2Q9TA 1ZLQA 4QF9A 3KZGA 3SEXA 4ELPA 3MVZA 4TLLB 3U8QA 4DXUA 1OMPA 4YKJA 1MDQA 5ET8A 5DTBA 4DCXA 3I5OA 3TTRA 1UIUA 1LCTA 3DP6A 4IO6A 4GWWA 4XKQA 2V93A 1I69A 1ZKBA 3B6WA 1NH8A 3IAZA 3QXMA 1WDNA 1NFTA 5IM2A 3CHGA 2HPGA 3A3UA 3TKDA 4PBQA 4IO4A 5BWJA 4NF6A 4TOZA 2F35A 4YMBA 3IJOB 1D3KA 4FEBA 3FJGA 4PBHA 4MMPA 4N8GA 1NL5A 5AA4A 5TPAB 3PMWA 1LB8A 1TFDA 3FXUA 4DXBA 1MXXA 4NAPA 4P1LA 4IO5A 4O3AA 1LFGA 1IMCA 4YB5A 4OZ9A 4THIA 2IEEA 3UA8A 2PBWA 3OO9A 1YZ0A 3FXQA 3N26A 3PU5A 4KCDA 1M5BA 5JEIA 1IUDA 2Y7PA 3K6VA 3D1RA 4F39A 1B2HA 1B6HA 3TQWA 3FASA 4U4SA 1DOTA 5F7VA 4WEPA 3RTFB 2XWOA 5EYGA 1XT8A 4DLDA 2QPQA 3TUSA 2NVUB 3LUYA 1KZ8A 4KCCA 4F1YA 4YKPA 2O1LA 3OO8A 2NXOA 4N6DA 3GYYA 4P9KA 3VVFA 2XX8A 1JP4A 4EUOA 4NWCA 1JW5A 5J1DA 1Q9DA 1LAGE 1B5JA 3CR9A 5B7DA 1B1HA 3RT8A 3SERA 1B3LA 3QK6A 2PMSA 1B7HA 2H25A 1D9VA 3E4RA 4PFIA 5I3SA 4F3GA 3O29A 1EU8A 5IZ3B 2B4MA 3RPLB 2G29A 4PAIA 4HE2A 2QS1A 2OX3A 3L6GA 3MYUA 1JQFA 1HSLA 4OTEA 4ZS9A 2XXPA 2Y5LA 2ANJA 4OVRA 2FIXA 3C9HA 2I0CA 4GWSA 2H99A 1SI0A 4KD5A 4C0RA 2XD3A 1AWBA 1YXIA 2UYEA 2QVUA 4YB7A 2R8TA 2DWIA 3KSJA 2O1MA 1NNKA 4R73A 1I6AA 4F3PA 4X8RA 3RT6B 4JWOA 3C34A 3EHTA 1FTJA 3PV0E 4YU0A 2OWTA 3U1OA 4YKIA 3TDJA 1N84A 5I84A 5I59B 4GLIA 4ND9A 1IMBA 4QHQA 4XEQA 3B6QA 4GL0A 3E78A 3SEVA 3RTWB 4Q0CA 2PVUA 1SYIA 5CBRA 3LV0A 1GGGA 4X1BA 1PDAA 5ET7A 2H98A 3O9PA 1B0HA 4HCYA 3B8BA 4GVOA 4NGUA 4X1DA 1FPEA 3KN3A 5TP9B 4JSOA 3ECRA 3VE1B 5CC2A 3U92A 4GWUA 1DTGA 2VHAA 4P8BA 1FBEA 2RCBA 4K3FA 1IXHA 4AB6A 1DSNA 3IK6B 4OVPA 3C33A 5I56A 4PFUA 1FPKA 3FGSA 3T96B 2XWIA 4I1DA 1FRPA 4LATA 1PB9A 3QUJA 3VXCA 4LZ7A 4G8MA 3BKIB 3MVXA 3DLNA 3FD3A 3EF7A 3FJMA 1P1QA 4NHBA 2ZZWA 1FBFA 1TWYA 2I0BA 4LA9A 1MG1A 2VD2A 2WBBA 1GR2A 1B58A 3QSLA 1NMUA 1BIYA 1FBDA 1FQDA 5DYHA 2XHDA 2F78A 4F22A 1Y3PA 4N8YA 2ZZXA 4MIJA 5BUUA 3CFXA 3PPPA 1FQCA 4XIGQ 3G3IA 4O3CA 1Y3NA 4LZ5A 3Q25A 3Q26A 2R71A 5KCJA 1USYH 4IY5A 1EYKA 2VGQA 2XA5A 1NV3A 2QJEA 2NWJA 3KN8A 2AYSA 1EZ9A 4G77A 1R9QA 5IZ1A 4JVIA 5IKBA 3ILTB 4NF8A 3MW0A 3HHGA 5KDTA 1IITA 3KJTA 4IB2A 2VP1A 1SDXA 4MH5A 1LFIA 3GBBA 4IO3A 1MM7A 4GWYA 4X04A 5DEXB 2CMOA 3MWBA 4ZE9A 1OVTA 4HW8A 2FYIA 4MLQA 3L6HA 4MCOA 4DI4B 3O2AA 5ESYA 4OYVA 3FUZA 4DI3D 1MQHA 5IAIA 1A8FA 3FVNA 1EYIA 3M3KA 1H45A 3C32A 4MAGA 2OZZA 3QIMA 3A3CA 1US5A 5M2VA 4BDOA 3IX1A 1IXGA 2V4CA 3PGFA 2OWZA 3FVKA 3RGYA 2B65A 1FBGA 1F9BA 1MPDA 4ELOA 2ZYNA 4GXSB 2R6GE 1B7ZA 1SVXB 2P2AA 5JTYB 4KXPA 1UTHA 2IA4A 1UTBA 2Q74A 1P99A 4QFKA 3R26A 2YJPA 2ONSA 2Q2AA 1BK4A 3UK4A 4F3SA 3O66A 2NUVA 3I3VA 2XXKA 4NEDA 3VVEA 1NUZA 1MQGA 4Q5TA 3H6UA 4C1UA 1LBBA 3KGCA 5JK4A 3KBRA 1FQBA 3KC1A 1P1WA 4KR5A 1YAEA 3KOTA 3CIJA 4FJPA 1N7WA 4RXLA 3C31A 4F29A 4N81A 4JVDA 1JETA 4GX4A 4N07A 4ZEIA 3KG2A 1B3EA 1FQEA 4U1ZA 1AOVA 1YPNA 3IB1A 2VT5A 4U1OA 4IR8A 1SQYA 4U4XA 1H44A 1TFAA 5A5XB 1BLFA 5LOMA 4NMYA 5I2NA 3OEMA 1EYJA 2DE2A 4KYDA 4OVSA 3ODBA 1CNQA 1FCKA 1ATGA 4GD5A 3OXNA 2A5TA 5DVJA 1II5A 1JEVA 3N94A 5FTHA 4RK9A 4DIGA 5I58B 3WAEA 1QULA 3LSLA 1JEUA 3P7IA 3S9MC 3E79A 2V3QA 1NV1A 1UIVA 3W9VA 1M5CA 1FQAA 3MP6A 4G68B 4OFLA 5CRYA 1MS7A 3K00A 2UVGA 2CZHA 4FIMA 4JVCA 5AE4A 1RDYA 1JNFA 3M3FA 3GBAA 3S2VA 2P3NA 3V83A 1P1NA 3E3KA 3PPNA 2HXRA 4RPOA 4MBPA 1PBPA 1EH3A 2A5SA 2WYPA 3JYRA 2GQ1A 3PPQA 1ZJLA 4HTGA 5I2KB 2ONRA 3D4CA 3CG3A 4XKRA 5FHMA 4POWA 1XS5A 1OIBA 2O7IA 3MSTA 3VV5A 1A54A 4TQUQ 4ZE8A 1P1OA 3MZ1A 5KZTA 4LQ5A 2ZNSA 1WODA 3TAJA 4O94A 3TTKA 1SPIA 5I57B 2QS2A 2XXRA 4QSCA 1S7YA 3NOHA 3SDFA 1XVYA 4H6DA 3SESA 3K2DA 3C35A 4MLVA 4PFBA 1AMFA 3N5LA 4LONB 1NV2A 1FTLA 2V84A 3V5AA 3RPWA 1USYE 3K6WA 1B3FA 2VPNA 4EQBA 1P1UA 1UQWA 3CSBA 4G4PA 1Q1KA 4LN5A 3QMFA 3FIRA 2F7BA 1VE4A 3HHFA 2V3UA 2QMXA 2QS4A 2B3FA 3IOWA 4E0WA 2W7YA 4F31B 5LTCA 3SKPA 1KWHA 3K02A 1FPGA 4MNIA 1B3HA 4N13A 4RA1A 2XXQA 1NNTA 1Q35A 4BLAA 4P3LA 1CE2A 4RJZA 1R1NA 1QUIA 1NV4A 1PC3A 5TPAA 4QBAA 1D4NA 4HE0A 2ZNUA 1DMBA 2XXVA 5CBSA 3RNNA 4ESXA 3IORA 5L9SA 2YPNA 4NF0A 3E13X 4OFJA 3HFUA 3K1NA 3OO7A 2DP8A 2RINA 4EQ9A 2WX9A 5ICQA 4DXCA 2QL3A 3KC0A 1GVCA 2M8CA 1B9JA 4QSEA 3DP4A 5ET6A 4ZEDA 1NUXA 4P0GA 2REJA 2I3WA 4R9FA 1BTJA 4I40A 3ZSFA 5K2XA 3LUZA 1DCUA 2I6EA 2XXTA 4FORA 1L5TA 1YTVA 3S9EA 4R6YA 3VLVA 1M5DA 5HM4B 1XC1A 4KI0E 1N04A 1OQGA 2UVHA 1MM6A 2HHMA 3MVYA 5EQ7A 1INPA 1O7TA 3EQ1A 3R6UA 4WEDA
chains in the Genus database with same CATH topology
5HPQA 1BKAA 4NF5B 1ANFA 4OESA 3T66A 4P11A 1N7XA 3KSXA 4KYEA 3H06B 4PFTA 1LAFE 4AQ4A 1QUJA 1B5HA 1SYHA 3U93A 2F97A 3ILUB 2F6GA 3KEIA 3N6UA 4EQ7A 2UYFA 4WXJA 3JV9A 1Y20A 5H8NB 5AA2B 1MY3A 2DQVA 2RC7A 4G8HA 1OQHA 4F19A 3MP8A 2RC8A 3PUWE 5AA1A 4HCWA 5H8HB 1HSJA 4MF3A 2DWJA 3TEPA 2AL4A 1B4HA 1Y1ZA 2H5YA 2F6PA 3EHUA 5H8FB 1ZIUA 4BDMA 3G3FA 3IOUA 1RYOA 4OQOA 5ITOA 1POTA 1N3XA 2RF1A 3MZBA 1LB9A 3FV1A 3PD8A 1URSA 3DELB 1POY1 3PUZE 1AL3A 1NKXA 3LC8A 4KQPA 4IO2A 2UVIA 3CI8A 4RK2A 2GFEA 4R9GA 2HXWA 2QS3A 4JWYA 4XKNA 1AH5A 1OLAA 3T22A 3CRBA 2XD2A 3LBSA 3KN7A 4GF8A 4G8NA 2Z8EA 5I59A 2I58A 2HCAA 4RY1A 1PB8A 3S4UA 4NWDA 4GWOA 1SW2A 3PMXA 4XTCQ 2PT1A 4H0WA 3HV1A 3H4ZA 4LP2B 3W9WA 4PP0A 1I6QA 1Y9UA 2GRVA 5TP9A 3M3LA 1SW4A 3LSWA 2VD3A 3O6GA 4JDFA 4Q8RA 1QJMA 4F3BA 1BP5A 2PX1A 2ALUA 2OK2A 1B1XA 1SBPA 1Z7NE 3JZJA 1A99A 5B70A 2OLBA 4OFOA 2RCAA 1MY1A 4ECFA 4ZECA 3N6TA 2D5WA 3MP1A 3OENA 3O6IA 4O3BA 2Q88A 2GHBA 4FATA 3UIFA 2V3TA 5EYFA 5CMCA 2ZMBA 4WKMA 1HSEA 1URDA 3ZS6A 2GH9A 4L17A 3I6VA 5H8QB 4M1VA 3IOVA 3BBRA 1ELJA 1SW1A 2HFBA 3GLBA 2YLNA 4U23A 4ZEBA 1R6ZA 2ABHA 3RUMA 4R2BA 3MJNA 3H7MA 2ZYOA 3EPEA 4R72A 4H5GA 4LQ2A 5DVIA 4UA8A 4NF4B 4TLMB 4H1XA 4F2QA 3UGWA 3IB2A 4PFYA 4IGTA 3RLFE 1FTOA 4OXVA 3S9NC 4PQJA 1DTZA 4OHNA 2RC9A 2BJJX 1A8EA 4R6KA 4X48A 5DEXA 1IZ1A 3IO4A 2QMWA 1MXZA 4YKKA 4UACA 2Y7IA 2F34A 3C4MA 4RNSA 4IO7A 1PB7A 3RY3A 2ZYMA 1M5FA 3K01A 3PPOA 4G68C 3FVOA 4LVQA 5JTYA 4Z0IA 3TQLA 1SI1A 3MUQA 1T0KA 2DWAA 1JW1A 2DXYA 2H4IA 2ESNA 2FNCA 4JXIA 4F1UA 2Z8FA 2XXWA 3T93B 3FV2A 1B4ZA 1B5IA 4I8CA 3S9LC 2DXRA 3T9VA 4H67A 2O6AA 4NTLA 3OSRA 5ELVA 1JW4A 1B51A 3MC2A 3G3JA 3IJXB 1I6BA 2DOJA 1Z7ME 5DT6A 4Q30B 3V8XB 4FAJA 4YZZA 1NNFA 3VXBA 3UN6A 2Y7KA 5A5XA 1FTMA 3H03A 2ONKE 1A55A 3OO6A 1B3GA 3TCHA 4C1TA 1S9TA 4ELRA 4R74A 1QW0A 4XXUA 2DE3A 1OLCA 2O69A 1VFEA 3TCGA 3GZGA 5I58A 3PD9A 1MRPA 4GFRA 4AB5A 2I49A 4QFLA 2OWSA 2Z8DA 3LR1A 3IB0A 1Y1MA 4BDQA 4G68A 3PPRA 2X26A 1N0TA 2ZNTA 3PUYE 5EHSA 4NF6B 3PUVE 2AL5A 1URGA 4ZZEA 2AIXA 1PEBA 1PBQA 1XHYA 4YB6A 3G3GA 3KOSA 5AA4B 5I2KA 1RKMA 4YICA 2HZLA 4QFPA 2OCUA 3V89B 5FHNA 2E0SA 3E9XA 1TXFA 1ZU0A 2PT2A 4KHZE 1RYXA 5I57A 3VDFA 1B32A 4JB7A 4OMBA 1MPCA 1OVBA 4PFWA 2XXIA 2F36A 4GXAA 4KPTA 3CFLA 2HZKA 4XKPA 5EHMA 3HCQA 5FHOA 5ISUA 3BFTA 3M8UA 2CZLA 1IEJA 3Q29A 5H8SA 4EF1A 2THIA 3MQ9A 2B3BA 2DWHA 3HPIA 2E1SA 4PETA 2D21A 1MDP1 3T9XB 2PYYA 2KLFA 5CI5A 2F7CA 3SEWA 4JWXA 2R9JA 1WVJA 2F8DA 4YAHX 2I4CA 1LAXA 3MBPA 5CMMA 1IIWA 3K4UA 1LCFA 2P0SA 4BDNA 4FEDA 5L9OA 4LUBA 3CFZA 4QRZA 4LZ8A 1MH3A 1ZMGA 2WKYA 3HSTA 2LAOA 1N3WA 4FECA 3QYTA 3SEYA 4QFNA 5K2YA 2UXAA 2Y7RA 4FE8A 1O64A 3IR1A 1LAHE 3OELA 1VSOA 1DPPA 4NF5A 4YMAA 3EN3A 4N6PA 2O84X 4OEVA 5F1QA 1YCJA 1MQDA 3G3HA 3ZKKA 3QAXA 1J1NA 4OERA 2Q89A 4GRKA 2DS9A 1XOCA 3TMGA 3O28A 5L8DA 3K6UA 3TTLA 2HQ0A 4I62A 4EF2A 2OJTA 4F1VA 1FW0A 3MPLA 2G93A 3R7XA 1MQJA 2P1SA 1A40A 2Z23A 1MY4A 5H8NA 4ZDMA 5AA2A 1B7UA 1FTKA 1XVXA 1S50A 3K1MA 3MVWA 4Z7EA 4EDPA 2XXHA 2X7PA 3Q28A 4HS7A 4F2OA 2HEUA 1N76A 5H8HA 1TT1A 2RKMA 4KFQA 1QVSA 3H3GA 1VR5A 4ONYA 5I56B 1D9YA 2FA7A 5H8FA 5DVFA 3USDA 1CB6A 4H8IA 3H6WA 4P0IA 5CMBA 1LGBC 2I4BA 3OSQA 4IGRA 1VFDA 4IY6A 3VLWA 4ZEKA 3GXAA 4F18A 1MXUA 2O51A 2Y84A 3HO7A 4RYAA 1H76A 1US4A 4EXKA 4OWDA 4ISUA 4JSDA 1QKAA 3H6VA 3TELA 3EHSA 3QUFA 1MY0A 1LFHA 4RPNA 3C36A 1LBCA 2X7QA 3O6HA 2XXYA 3DM0A 3UP9A 3O97A 3LSFB 1MPBA 2F5XA 4H65A 3FATA 3F11A 1Y4CA 5L9MA 5CM6A 4QSDA 5KCJB 4MFIA 4EXLA 2Z22A 3IL1B 3SETA 1B40A 4NF8B 3MZ9A 5TU0A 1IQ7A 5KDTB 5AA3A 3K0VA 3OMBA 2OBGA 3W15C 3G3KA 3OEKA 2I3VA 3CVGA 3OD7A 3WAFA 4POXA 2ZXTA 5ICTA 4GQOA 3D4GA 1EZPA 1MH4A 2QRYA 4BDLA 4ESWA 3AXFA 5HBCA 4BDRA 3KJ7A 1M5EA 3B7DA 5H8QA 1B05A 4OENA 3TPAA 2ZYKA 1MY2A 1SW5A 5AA2D 3CG1A 1Y3QA 2GHAA 2DVZA 2O68A 1H43A 2D3IA 3TTMA 4R75A 2VOZA 1LSTA 2QSXA 2DYXA 4PE5B 3TCFA 1B0LA 4DDDA 1UTHB 4U22A 1MQIA 1UTBB 4E0XA 3FJ7A 4ZZAA 2Q8JA 4M4GA 2I48A 3PUXE 1MXVA 4JBZA 1MXYA 4G2ZA 3VVDA 3U94A 4NF4A 4H5FA 4GOTA 1O63A 1NNPA 2HAUA 4ZEFA 1GTKA 3MAMA 3FZVA 2H9BA 4KYSA 3UORA 2DE4A 3FXRA 1ZTYA 1QUKA 3KFMA 3Q27A 1B46A 3LSXA 3RN8A 4U21A 2F7AA 5I2NB 3TZAA 2NOOA 4GL8A 1NH7A 3ZKLA 1JVYA 1GV8A 1R9LA 3U72A 4NE4A 3A09A 3MPKA 1LLSA 4I9DA 5ITPA 2Y7WA 3B6TA 3T9HB 2A5TB 3TTNA 2UVJA 3G7WA 4OETA 4GIZA 2REGA 4OVJA 1QKBA 1MXWA 3K1PA 3TODA 4ELQA 4H8JA 3TYHA 4R2FA 3PMVA 1H3DA 2O7UA 1B52A 2XXUA 1AIVA 3K6XA 3IOTA 2DSFA 2HAVA 1SD3A 3IO6A 3TFLA 1Y4TA 3OOAA 3CSGA 3ONMA 3HN0A 2XX7A 3VFJA 1IXIA 4U2RA 2XX9A 2XXXA 1FQFA 4OEUA 1IXCA 5CMKA 3THIA 3VLUA 3H6TA 1A7LA 4DE8A 2V25A 1DPEA 3DP8A 3SEUA 3RQTA 4QFOA 4X9TA 5FTIA 1EZOA 4DZ1A 2DVCA 1JVXA 3FVGA 4DCYA 1ZBMA 3BFUA 4R6HA 2Q2CA 3T9UA 2Q9TA 1ZLQA 4QF9A 3KZGA 3SEXA 4ELPA 3MVZA 4TLLB 3U8QA 4DXUA 1OMPA 4YKJA 1MDQA 5DTBA 4DCXA 3I5OA 3TTRA 1UIUA 1LCTA 3DP6A 4IO6A 4XKQA 2V93A 1I69A 1ZKBA 3B6WA 1NH8A 3IAZA 3QXMA 1WDNA 1NFTA 3A3UA 3TKDA 4IO4A 5BWJA 4NF6A 4TOZA 2F35A 4YMBA 3IJOB 1D3KA 4FEBA 3FJGA 1NL5A 5AA4A 5TPAB 3PMWA 1LB8A 1TFDA 3FXUA 4DXBA 1MXXA 4IO5A 4O3AA 1LFGA 4YB5A 4OZ9A 4THIA 2IEEA 3UA8A 2PBWA 3OO9A 3FXQA 3N26A 3PU5A 4KCDA 1M5BA 5JEIA 1IUDA 2Y7PA 3K6VA 4F39A 1B2HA 1B6HA 3TQWA 3FASA 4U4SA 1DOTA 5F7VA 4WEPA 3RTFB 1XT8A 4DLDA 2QPQA 3TUSA 2NVUB 3LUYA 4KCCA 4F1YA 4YKPA 2O1LA 3OO8A 2NXOA 3VVFA 2XX8A 4EUOA 4NWCA 1JW5A 5J1DA 1LAGE 1B5JA 3CR9A 5B7DA 1B1HA 3RT8A 3SERA 1B3LA 3QK6A 2PMSA 1B7HA 2H25A 1D9VA 3E4RA 4F3GA 3O29A 1EU8A 2G29A 2QS1A 3L6GA 1JQFA 1HSLA 4OTEA 4ZS9A 2XXPA 2ANJA 3C9HA 2I0CA 2H99A 1SI0A 4KD5A 4C0RA 2XD3A 2UYEA 4YB7A 2DWIA 3KSJA 2O1MA 1NNKA 4R73A 1I6AA 4F3PA 3RT6B 4JWOA 3C34A 3EHTA 1FTJA 3PV0E 4YU0A 2OWTA 3U1OA 4YKIA 3TDJA 1N84A 5I84A 5I59B 4GLIA 4ND9A 4QHQA 3B6QA 4GL0A 3SEVA 3RTWB 4Q0CA 2PVUA 1SYIA 5CBRA 1GGGA 4X1BA 1PDAA 2H98A 3O9PA 1B0HA 4HCYA 4GVOA 4X1DA 3KN3A 5TP9B 4JSOA 3ECRA 3VE1B 5CC2A 3U92A 1DTGA 2VHAA 2RCBA 4K3FA 1IXHA 4AB6A 1DSNA 3IK6B 3C33A 5I56A 4PFUA 3FGSA 3T96B 4I1DA 4LATA 1PB9A 3QUJA 3VXCA 4LZ7A 4G8MA 3BKIB 3MVXA 3DLNA 3FD3A 3EF7A 3FJMA 1P1QA 1TWYA 2I0BA 4LA9A 1MG1A 2VD2A 1GR2A 1B58A 3QSLA 1NMUA 1BIYA 1FQDA 5DYHA 2XHDA 2F78A 4F22A 1Y3PA 5BUUA 3CFXA 3PPPA 1FQCA 4XIGQ 3G3IA 4O3CA 1Y3NA 4LZ5A 3Q25A 3Q26A 2R71A 5KCJA 1USYH 4IY5A 2VGQA 2QJEA 2NWJA 3KN8A 2AYSA 1EZ9A 4G77A 1R9QA 5IKBA 3ILTB 4NF8A 3MW0A 3HHGA 5KDTA 1IITA 3KJTA 4IB2A 2VP1A 1SDXA 4MH5A 1LFIA 3GBBA 4IO3A 1MM7A 5DEXB 2CMOA 3MWBA 4ZE9A 1OVTA 4HW8A 2FYIA 4MLQA 3L6HA 3O2AA 4OYVA 3FUZA 1MQHA 5IAIA 1A8FA 3FVNA 3M3KA 1H45A 3C32A 2OZZA 3QIMA 3A3CA 1US5A 5M2VA 4BDOA 3IX1A 1IXGA 3PGFA 3FVKA 3RGYA 2B65A 1F9BA 1MPDA 4ELOA 2ZYNA 4GXSB 2R6GE 1B7ZA 1SVXB 2P2AA 5JTYB 1UTHA 2IA4A 1UTBA 4QFKA 1P99A 3R26A 2YJPA 2ONSA 2Q2AA 3UK4A 4F3SA 3O66A 2NUVA 3I3VA 4NEDA 3VVEA 1MQGA 4Q5TA 3H6UA 4C1UA 1LBBA 3KGCA 5JK4A 3KBRA 1FQBA 1P1WA 4KR5A 1YAEA 3KOTA 3CIJA 4FJPA 1N7WA 4RXLA 3C31A 4F29A 1JETA 4N07A 4ZEIA 3KG2A 1B3EA 1FQEA 4U1ZA 1AOVA 1YPNA 3IB1A 4U1OA 1SQYA 4U4XA 1TFAA 1H44A 5A5XB 1BLFA 5LOMA 4NMYA 5I2NA 3OEMA 2DE2A 4KYDA 3ODBA 1FCKA 1ATGA 4GD5A 3OXNA 2A5TA 5DVJA 1II5A 1JEVA 3N94A 5FTHA 4RK9A 4DIGA 5I58B 3WAEA 1QULA 3LSLA 1JEUA 3P7IA 3S9MC 2V3QA 1UIVA 3W9VA 1M5CA 1FQAA 3MP6A 4G68B 4OFLA 5CRYA 1MS7A 3K00A 2UVGA 4FIMA 5AE4A 1JNFA 3M3FA 3GBAA 3S2VA 3V83A 1P1NA 3E3KA 3PPNA 4RPOA 4MBPA 1PBPA 1EH3A 2A5SA 3JYRA 3PPQA 1ZJLA 4HTGA 5I2KB 2ONRA 3D4CA 3CG3A 4XKRA 5FHMA 4POWA 1XS5A 1OIBA 2O7IA 3VV5A 1A54A 4TQUQ 4ZE8A 1P1OA 3MZ1A 5KZTA 4LQ5A 2ZNSA 1WODA 3TAJA 3TTKA 5I57B 2QS2A 2XXRA 4QSCA 1S7YA 3SDFA 1XVYA 4H6DA 3SESA 3K2DA 3C35A 4MLVA 1AMFA 3N5LA 4LONB 1FTLA 2V84A 3V5AA 3RPWA 1USYE 3K6WA 1B3FA 4EQBA 1P1UA 1UQWA 3CSBA 4G4PA 1Q1KA 3FIRA 2F7BA 1VE4A 3HHFA 2V3UA 2QMXA 2QS4A 2B3FA 3IOWA 4E0WA 2W7YA 4F31B 3SKPA 1KWHA 3K02A 1B3HA 4N13A 4RA1A 2XXQA 1NNTA 1Q35A 4BLAA 1CE2A 4RJZA 1R1NA 1QUIA 1PC3A 5TPAA 1D4NA 2ZNUA 1DMBA 2XXVA 5CBSA 3RNNA 4ESXA 3IORA 5L9SA 2YPNA 3E13X 4OFJA 3K1NA 3OO7A 2DP8A 2RINA 4EQ9A 5ICQA 4DXCA 2QL3A 1GVCA 2M8CA 1B9JA 4QSEA 3DP4A 4ZEDA 4P0GA 2REJA 2I3WA 4R9FA 1BTJA 3ZSFA 5K2XA 2I6EA 2XXTA 4FORA 1L5TA 1YTVA 3S9EA 4R6YA 3VLVA 1M5DA 5HM4B 1XC1A 4KI0E 1N04A 1OQGA 2UVHA 1MM6A 3MVYA 1O7TA 3EQ1A 3R6UA 4WEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HPQ A;  1BKA A;  4NF5 B;  1ANF A;  4OES A;  3T66 A;  4P11 A;  1N7X A;  3KSX A;  4KYE A;  3H06 B;  4PFT A;  1LAF E;  4AQ4 A;  1QUJ A;  1B5H A;  1SYH A;  3U93 A;  2F97 A;  3ILU B;  2F6G A;  3KEI A;  3N6U A;  4EQ7 A;  2UYF A;  4WXJ A;  3JV9 A;  1Y20 A;  5H8N B;  5AA2 B;  1MY3 A;  2DQV A;  2RC7 A;  4G8H A;  1OQH A;  4F19 A;  3MP8 A;  2RC8 A;  3PUW E;  5AA1 A;  4HCW A;  5H8H B;  1HSJ A;  4MF3 A;  2DWJ A;  3TEP A;  2AL4 A;  1B4H A;  1Y1Z A;  2H5Y A;  2F6P A;  3EHU A;  5H8F B;  1ZIU A;  4BDM A;  3G3F A;  3IOU A;  1RYO A;  4OQO A;  5ITO A;  1POT A;  1N3X A;  2RF1 A;  3MZB A;  1LB9 A;  3FV1 A;  3PD8 A;  1URS A;  3DEL B;  1POY 1;  3PUZ E;  1AL3 A;  1NKX A;  3LC8 A;  4KQP A;  4IO2 A;  2UVI A;  3CI8 A;  4RK2 A;  2GFE A;  4R9G A;  2HXW A;  2QS3 A;  4JWY A;  4XKN A;  1AH5 A;  1OLA A;  3T22 A;  3CRB A;  2XD2 A;  3LBS A;  3KN7 A;  4GF8 A;  4G8N A;  2Z8E A;  5I59 A;  2I58 A;  2HCA A;  4RY1 A;  1PB8 A;  3S4U A;  4NWD A;  4GWO A;  1SW2 A;  3PMX A;  4XTC Q;  2PT1 A;  4H0W A;  3HV1 A;  3H4Z A;  4LP2 B;  3W9W A;  4PP0 A;  1I6Q A;  1Y9U A;  2GRV A;  5TP9 A;  3M3L A;  1SW4 A;  3LSW A;  2VD3 A;  3O6G A;  4JDF A;  4Q8R A;  1QJM A;  4F3B A;  1BP5 A;  2PX1 A;  2ALU A;  2OK2 A;  1B1X A;  1SBP A;  1Z7N E;  3JZJ A;  1A99 A;  5B70 A;  2OLB A;  4OFO A;  2RCA A;  1MY1 A;  4ECF A;  4ZEC A;  3N6T A;  2D5W A;  3MP1 A;  3OEN A;  3O6I A;  4O3B A;  2Q88 A;  2GHB A;  4FAT A;  3UIF A;  2V3T A;  5EYF A;  5CMC A;  2ZMB A;  4WKM A;  1HSE A;  1URD A;  3ZS6 A;  2GH9 A;  4L17 A;  3I6V A;  5H8Q B;  4M1V A;  3IOV A;  3BBR A;  1ELJ A;  1SW1 A;  2HFB A;  3GLB A;  2YLN A;  4U23 A;  4ZEB A;  1R6Z A;  2ABH A;  3RUM A;  4R2B A;  3MJN A;  3H7M A;  2ZYO A;  3EPE A;  4R72 A;  4H5G A;  4LQ2 A;  5DVI A;  4UA8 A;  4NF4 B;  4TLM B;  4H1X A;  4F2Q A;  3UGW A;  3IB2 A;  4PFY A;  4IGT A;  3RLF E;  1FTO A;  4OXV A;  3S9N C;  4PQJ A;  1DTZ A;  4OHN A;  2RC9 A;  2BJJ X;  1A8E A;  4R6K A;  4X48 A;  5DEX A;  1IZ1 A;  3IO4 A;  2QMW A;  1MXZ A;  4YKK A;  4UAC A;  2Y7I A;  2F34 A;  3C4M A;  4RNS A;  4IO7 A;  1PB7 A;  3RY3 A;  2ZYM A;  1M5F A;  3K01 A;  3PPO A;  4G68 C;  3FVO A;  4LVQ A;  5JTY A;  4Z0I A;  3TQL A;  1SI1 A;  3MUQ A;  1T0K A;  2DWA A;  1JW1 A;  2DXY A;  2H4I A;  2ESN A;  2FNC A;  4JXI A;  4F1U A;  2Z8F A;  2XXW A;  3T93 B;  3FV2 A;  1B4Z A;  1B5I A;  4I8C A;  3S9L C;  2DXR A;  3T9V A;  4H67 A;  2O6A A;  4NTL A;  3OSR A;  5ELV A;  1JW4 A;  1B51 A;  3MC2 A;  3G3J A;  3IJX B;  1I6B A;  2DOJ A;  1Z7M E;  5DT6 A;  4Q30 B;  3V8X B;  4FAJ A;  4YZZ A;  1NNF A;  3VXB A;  3UN6 A;  2Y7K A;  5A5X A;  1FTM A;  3H03 A;  2ONK E;  1A55 A;  3OO6 A;  1B3G A;  3TCH A;  4C1T A;  1S9T A;  4ELR A;  4R74 A;  1QW0 A;  4XXU A;  2DE3 A;  1OLC A;  2O69 A;  1VFE A;  3TCG A;  3GZG A;  5I58 A;  3PD9 A;  1MRP A;  4GFR A;  4AB5 A;  2I49 A;  4QFL A;  2OWS A;  2Z8D A;  3LR1 A;  3IB0 A;  1Y1M A;  4BDQ A;  4G68 A;  3PPR A;  2X26 A;  1N0T A;  2ZNT A;  3PUY E;  5EHS A;  4NF6 B;  3PUV E;  2AL5 A;  1URG A;  4ZZE A;  2AIX A;  1PEB A;  1PBQ A;  1XHY A;  4YB6 A;  3G3G A;  3KOS A;  5AA4 B;  5I2K A;  1RKM A;  4YIC A;  2HZL A;  4QFP A;  2OCU A;  3V89 B;  5FHN A;  2E0S A;  3E9X A;  1TXF A;  1ZU0 A;  2PT2 A;  4KHZ E;  1RYX A;  5I57 A;  3VDF A;  1B32 A;  4JB7 A;  4OMB A;  1MPC A;  1OVB A;  4PFW A;  2XXI A;  2F36 A;  4GXA A;  4KPT A;  3CFL A;  2HZK A;  4XKP A;  5EHM A;  3HCQ A;  5FHO A;  5ISU A;  3BFT A;  3M8U A;  2CZL A;  1IEJ A;  3Q29 A;  5H8S A;  4EF1 A;  2THI A;  3MQ9 A;  2B3B A;  2DWH A;  3HPI A;  2E1S A;  4PET A;  2D21 A;  1MDP 1;  3T9X B;  2PYY A;  2KLF A;  5CI5 A;  2F7C A;  3SEW A;  4JWX A;  2R9J A;  1WVJ A;  2F8D A;  4YAH X;  2I4C A;  1LAX A;  3MBP A;  5CMM A;  1IIW A;  3K4U A;  1LCF A;  2P0S A;  4BDN A;  4FED A;  5L9O A;  4LUB A;  3CFZ A;  4QRZ A;  4LZ8 A;  1MH3 A;  1ZMG A;  2WKY A;  3HST A;  2LAO A;  1N3W A;  4FEC A;  3QYT A;  3SEY A;  4QFN A;  5K2Y A;  2UXA A;  2Y7R A;  4FE8 A;  1O64 A;  3IR1 A;  1LAH E;  3OEL A;  1VSO A;  1DPP A;  4NF5 A;  4YMA A;  3EN3 A;  4N6P A;  2O84 X;  4OEV A;  5F1Q A;  1YCJ A;  1MQD A;  3G3H A;  3ZKK A;  3QAX A;  1J1N A;  4OER A;  2Q89 A;  4GRK A;  2DS9 A;  1XOC A;  3TMG A;  3O28 A;  5L8D A;  3K6U A;  3TTL A;  2HQ0 A;  4I62 A;  4EF2 A;  2OJT A;  4F1V A;  1FW0 A;  3MPL A;  2G93 A;  3R7X A;  1MQJ A;  2P1S A;  1A40 A;  2Z23 A;  1MY4 A;  5H8N A;  4ZDM A;  5AA2 A;  1B7U A;  1FTK A;  1XVX A;  1S50 A;  3K1M A;  3MVW A;  4Z7E A;  4EDP A;  2XXH A;  2X7P A;  3Q28 A;  4HS7 A;  4F2O A;  2HEU A;  1N76 A;  5H8H A;  1TT1 A;  2RKM A;  4KFQ A;  1QVS A;  3H3G A;  1VR5 A;  4ONY A;  5I56 B;  1D9Y A;  2FA7 A;  5H8F A;  5DVF A;  3USD A;  1CB6 A;  4H8I A;  3H6W A;  4P0I A;  5CMB A;  1LGB C;  2I4B A;  3OSQ A;  4IGR A;  1VFD A;  4IY6 A;  3VLW A;  4ZEK A;  3GXA A;  4F18 A;  1MXU A;  2O51 A;  2Y84 A;  3HO7 A;  4RYA A;  1H76 A;  1US4 A;  4EXK A;  4OWD A;  4ISU A;  4JSD A;  1QKA A;  3H6V A;  3TEL A;  3EHS A;  3QUF A;  1MY0 A;  1LFH A;  4RPN A;  3C36 A;  1LBC A;  2X7Q A;  3O6H A;  2XXY A;  3DM0 A;  3UP9 A;  3O97 A;  3LSF B;  1MPB A;  2F5X A;  4H65 A;  3FAT A;  3F11 A;  1Y4C A;  5L9M A;  5CM6 A;  4QSD A;  5KCJ B;  4MFI A;  4EXL A;  2Z22 A;  3IL1 B;  3SET A;  1B40 A;  4NF8 B;  3MZ9 A;  5TU0 A;  1IQ7 A;  5KDT B;  5AA3 A;  3K0V A;  3OMB A;  2OBG A;  3W15 C;  3G3K A;  3OEK A;  2I3V A;  3CVG A;  3OD7 A;  3WAF A;  4POX A;  2ZXT A;  5ICT A;  4GQO A;  3D4G A;  1EZP A;  1MH4 A;  2QRY A;  4BDL A;  4ESW A;  3AXF A;  5HBC A;  4BDR A;  3KJ7 A;  1M5E A;  3B7D A;  5H8Q A;  1B05 A;  4OEN A;  3TPA A;  2ZYK A;  1MY2 A;  1SW5 A;  5AA2 D;  3CG1 A;  1Y3Q A;  2GHA A;  2DVZ A;  2O68 A;  1H43 A;  2D3I A;  3TTM A;  4R75 A;  2VOZ A;  1LST A;  2QSX A;  2DYX A;  4PE5 B;  3TCF A;  1B0L A;  4DDD A;  1UTH B;  4U22 A;  1MQI A;  1UTB B;  4E0X A;  3FJ7 A;  4ZZA A;  2Q8J A;  4M4G A;  2I48 A;  3PUX E;  1MXV A;  4JBZ A;  1MXY A;  4G2Z A;  3VVD A;  3U94 A;  4NF4 A;  4H5F A;  4GOT A;  1O63 A;  1NNP A;  2HAU A;  4ZEF A;  1GTK A;  3MAM A;  3FZV A;  2H9B A;  4KYS A;  3UOR A;  2DE4 A;  3FXR A;  1ZTY A;  1QUK A;  3KFM A;  3Q27 A;  1B46 A;  3LSX A;  3RN8 A;  4U21 A;  2F7A A;  5I2N B;  3TZA A;  2NOO A;  4GL8 A;  1NH7 A;  3ZKL A;  1JVY A;  1GV8 A;  1R9L A;  3U72 A;  4NE4 A;  3A09 A;  3MPK A;  1LLS A;  4I9D A;  5ITP A;  2Y7W A;  3B6T A;  3T9H B;  2A5T B;  3TTN A;  2UVJ A;  3G7W A;  4OET A;  4GIZ A;  2REG A;  4OVJ A;  1QKB A;  1MXW A;  3K1P A;  3TOD A;  4ELQ A;  4H8J A;  3TYH A;  4R2F A;  3PMV A;  1H3D A;  2O7U A;  1B52 A;  2XXU A;  1AIV A;  3K6X A;  3IOT A;  2DSF A;  2HAV A;  1SD3 A;  3IO6 A;  3TFL A;  1Y4T A;  3OOA A;  3CSG A;  3ONM A;  3HN0 A;  2XX7 A;  3VFJ A;  1IXI A;  4U2R A;  2XX9 A;  2XXX A;  1FQF A;  4OEU A;  1IXC A;  5CMK A;  3THI A;  3VLU A;  3H6T A;  1A7L A;  4DE8 A;  2V25 A;  1DPE A;  3DP8 A;  3SEU A;  3RQT A;  4QFO A;  4X9T A;  5FTI A;  1EZO A;  4DZ1 A;  2DVC A;  1JVX A;  3FVG A;  4DCY A;  1ZBM A;  3BFU A;  4R6H A;  2Q2C A;  3T9U A;  2Q9T A;  1ZLQ A;  4QF9 A;  3KZG A;  3SEX A;  4ELP A;  3MVZ A;  4TLL B;  3U8Q A;  4DXU A;  1OMP A;  4YKJ A;  1MDQ A;  5DTB A;  4DCX A;  3I5O A;  3TTR A;  1UIU A;  1LCT A;  3DP6 A;  4IO6 A;  4XKQ A;  2V93 A;  1I69 A;  1ZKB A;  3B6W A;  1NH8 A;  3IAZ A;  3QXM A;  1WDN A;  1NFT A;  3A3U A;  3TKD A;  4IO4 A;  5BWJ A;  4NF6 A;  4TOZ A;  2F35 A;  4YMB A;  3IJO B;  1D3K A;  4FEB A;  3FJG A;  1NL5 A;  5AA4 A;  5TPA B;  3PMW A;  1LB8 A;  1TFD A;  3FXU A;  4DXB A;  1MXX A;  4IO5 A;  4O3A A;  1LFG A;  4YB5 A;  4OZ9 A;  4THI A;  2IEE A;  3UA8 A;  2PBW A;  3OO9 A;  3FXQ A;  3N26 A;  3PU5 A;  4KCD A;  1M5B A;  5JEI A;  1IUD A;  2Y7P A;  3K6V A;  4F39 A;  1B2H A;  1B6H A;  3TQW A;  3FAS A;  4U4S A;  1DOT A;  5F7V A;  4WEP A;  3RTF B;  1XT8 A;  4DLD A;  2QPQ A;  3TUS A;  2NVU B;  3LUY A;  4KCC A;  4F1Y A;  4YKP A;  2O1L A;  3OO8 A;  2NXO A;  3VVF A;  2XX8 A;  4EUO A;  4NWC A;  1JW5 A;  5J1D A;  1LAG E;  1B5J A;  3CR9 A;  5B7D A;  1B1H A;  3RT8 A;  3SER A;  1B3L A;  3QK6 A;  2PMS A;  1B7H A;  2H25 A;  1D9V A;  3E4R A;  4F3G A;  3O29 A;  1EU8 A;  2G29 A;  2QS1 A;  3L6G A;  1JQF A;  1HSL A;  4OTE A;  4ZS9 A;  2XXP A;  2ANJ A;  3C9H A;  2I0C A;  2H99 A;  1SI0 A;  4KD5 A;  4C0R A;  2XD3 A;  2UYE A;  4YB7 A;  2DWI A;  3KSJ A;  2O1M A;  1NNK A;  4R73 A;  1I6A A;  4F3P A;  3RT6 B;  4JWO A;  3C34 A;  3EHT A;  1FTJ A;  3PV0 E;  4YU0 A;  2OWT A;  3U1O A;  4YKI A;  3TDJ A;  1N84 A;  5I84 A;  5I59 B;  4GLI A;  4ND9 A;  4QHQ A;  3B6Q A;  4GL0 A;  3SEV A;  3RTW B;  4Q0C A;  2PVU A;  1SYI A;  5CBR A;  1GGG A;  4X1B A;  1PDA A;  2H98 A;  3O9P A;  1B0H A;  4HCY A;  4GVO A;  4X1D A;  3KN3 A;  5TP9 B;  4JSO A;  3ECR A;  3VE1 B;  5CC2 A;  3U92 A;  1DTG A;  2VHA A;  2RCB A;  4K3F A;  1IXH A;  4AB6 A;  1DSN A;  3IK6 B;  3C33 A;  5I56 A;  4PFU A;  3FGS A;  3T96 B;  4I1D A;  4LAT A;  1PB9 A;  3QUJ A;  3VXC A;  4LZ7 A;  4G8M A;  3BKI B;  3MVX A;  3DLN A;  3FD3 A;  3EF7 A;  3FJM A;  1P1Q A;  1TWY A;  2I0B A;  4LA9 A;  1MG1 A;  2VD2 A;  1GR2 A;  1B58 A;  3QSL A;  1NMU A;  1BIY A;  1FQD A;  5DYH A;  2XHD A;  2F78 A;  4F22 A;  1Y3P A;  5BUU A;  3CFX A;  3PPP A;  1FQC A;  4XIG Q;  3G3I A;  4O3C A;  1Y3N A;  4LZ5 A;  3Q25 A;  3Q26 A;  2R71 A;  5KCJ A;  1USY H;  4IY5 A;  2VGQ A;  2QJE A;  2NWJ A;  3KN8 A;  2AYS A;  1EZ9 A;  4G77 A;  1R9Q A;  5IKB A;  3ILT B;  4NF8 A;  3MW0 A;  3HHG A;  5KDT A;  1IIT A;  3KJT A;  4IB2 A;  2VP1 A;  1SDX A;  4MH5 A;  1LFI A;  3GBB A;  4IO3 A;  1MM7 A;  5DEX B;  2CMO A;  3MWB A;  4ZE9 A;  1OVT A;  4HW8 A;  2FYI A;  4MLQ A;  3L6H A;  3O2A A;  4OYV A;  3FUZ A;  1MQH A;  5IAI A;  1A8F A;  3FVN A;  3M3K A;  1H45 A;  3C32 A;  2OZZ A;  3QIM A;  3A3C A;  1US5 A;  5M2V A;  4BDO A;  3IX1 A;  1IXG A;  3PGF A;  3FVK A;  3RGY A;  2B65 A;  1F9B A;  1MPD A;  4ELO A;  2ZYN A;  4GXS B;  2R6G E;  1B7Z A;  1SVX B;  2P2A A;  5JTY B;  1UTH A;  2IA4 A;  1UTB A;  4QFK A;  1P99 A;  3R26 A;  2YJP A;  2ONS A;  2Q2A A;  3UK4 A;  4F3S A;  3O66 A;  2NUV A;  3I3V A;  4NED A;  3VVE A;  1MQG A;  4Q5T A;  3H6U A;  4C1U A;  1LBB A;  3KGC A;  5JK4 A;  3KBR A;  1FQB A;  1P1W A;  4KR5 A;  1YAE A;  3KOT A;  3CIJ A;  4FJP A;  1N7W A;  4RXL A;  3C31 A;  4F29 A;  1JET A;  4N07 A;  4ZEI A;  3KG2 A;  1B3E A;  1FQE A;  4U1Z A;  1AOV A;  1YPN A;  3IB1 A;  4U1O A;  1SQY A;  4U4X A;  1TFA A;  1H44 A;  5A5X B;  1BLF A;  5LOM A;  4NMY A;  5I2N A;  3OEM A;  2DE2 A;  4KYD A;  3ODB A;  1FCK A;  1ATG A;  4GD5 A;  3OXN A;  2A5T A;  5DVJ A;  1II5 A;  1JEV A;  3N94 A;  5FTH A;  4RK9 A;  4DIG A;  5I58 B;  3WAE A;  1QUL A;  3LSL A;  1JEU A;  3P7I A;  3S9M C;  2V3Q A;  1UIV A;  3W9V A;  1M5C A;  1FQA A;  3MP6 A;  4G68 B;  4OFL A;  5CRY A;  1MS7 A;  3K00 A;  2UVG A;  4FIM A;  5AE4 A;  1JNF A;  3M3F A;  3GBA A;  3S2V A;  3V83 A;  1P1N A;  3E3K A;  3PPN A;  4RPO A;  4MBP A;  1PBP A;  1EH3 A;  2A5S A;  3JYR A;  3PPQ A;  1ZJL A;  4HTG A;  5I2K B;  2ONR A;  3D4C A;  3CG3 A;  4XKR A;  5FHM A;  4POW A;  1XS5 A;  1OIB A;  2O7I A;  3VV5 A;  1A54 A;  4TQU Q;  4ZE8 A;  1P1O A;  3MZ1 A;  5KZT A;  4LQ5 A;  2ZNS A;  1WOD A;  3TAJ A;  3TTK A;  5I57 B;  2QS2 A;  2XXR A;  4QSC A;  1S7Y A;  3SDF A;  1XVY A;  4H6D A;  3SES A;  3K2D A;  3C35 A;  4MLV A;  1AMF A;  3N5L A;  4LON B;  1FTL A;  2V84 A;  3V5A A;  3RPW A;  1USY E;  3K6W A;  1B3F A;  4EQB A;  1P1U A;  1UQW A;  3CSB A;  4G4P A;  1Q1K A;  3FIR A;  2F7B A;  1VE4 A;  3HHF A;  2V3U A;  2QMX A;  2QS4 A;  2B3F A;  3IOW A;  4E0W A;  2W7Y A;  4F31 B;  3SKP A;  1KWH A;  3K02 A;  1B3H A;  4N13 A;  4RA1 A;  2XXQ A;  1NNT A;  1Q35 A;  4BLA A;  1CE2 A;  4RJZ A;  1R1N A;  1QUI A;  1PC3 A;  5TPA A;  1D4N A;  2ZNU A;  1DMB A;  2XXV A;  5CBS A;  3RNN A;  4ESX A;  3IOR A;  5L9S A;  2YPN A;  3E13 X;  4OFJ A;  3K1N A;  3OO7 A;  2DP8 A;  2RIN A;  4EQ9 A;  5ICQ A;  4DXC A;  2QL3 A;  1GVC A;  2M8C A;  1B9J A;  4QSE A;  3DP4 A;  4ZED A;  4P0G A;  2REJ A;  2I3W A;  4R9F A;  1BTJ A;  3ZSF A;  5K2X A;  2I6E A;  2XXT A;  4FOR A;  1L5T A;  1YTV A;  3S9E A;  4R6Y A;  3VLV A;  1M5D A;  5HM4 B;  1XC1 A;  4KI0 E;  1N04 A;  1OQG A;  2UVH A;  1MM6 A;  3MVY A;  1O7T A;  3EQ1 A;  3R6U A;  4WED A; 
#chains in the Genus database with same CATH topology
 5HPQ A;  1BKA A;  4NF5 B;  1ANF A;  4OES A;  3T66 A;  4P11 A;  1N7X A;  3KSX A;  4KYE A;  2FHY A;  4N91 A;  4XFE A;  3H06 B;  4PFT A;  1LAF E;  5T3J A;  4AQ4 A;  1QUJ A;  1B5H A;  4H45 A;  1SYH A;  3U93 A;  2MKZ A;  1YYZ A;  2F97 A;  4QXD A;  3ILU B;  2F6G A;  3RYD A;  1DK4 A;  3KEI A;  1FPL A;  1NUY A;  3N6U A;  4EQ7 A;  2UYF A;  4WXJ A;  3JV9 A;  3B50 A;  1Y20 A;  5H8N B;  5AA2 B;  1MY3 A;  5IZ3 A;  2DQV A;  2RC7 A;  3RPL A;  4G8H A;  1OQH A;  4F19 A;  3MP8 A;  2RC8 A;  3PUW E;  5AA1 A;  4HCW A;  5H8H B;  4P56 A;  1HSJ A;  4MF3 A;  2DWJ A;  3TEP A;  4MJO A;  2AL4 A;  1B4H A;  1Y1Z A;  2H5Y A;  2F6P A;  3EHU A;  5H8F B;  2WEF A;  1ZIU A;  4BDM A;  3G3F A;  3IOU A;  1RYO A;  4OQO A;  5ITO A;  1POT A;  1N3X A;  2RF1 A;  3MZB A;  1LB9 A;  3FV1 A;  3PD8 A;  1URS A;  3DEL B;  1FSA A;  1POY 1;  3PUZ E;  1AL3 A;  1NKX A;  3LC8 A;  4KQP A;  4IO2 A;  2UVI A;  3CI8 A;  4RK2 A;  2GFE A;  4R9G A;  2HXW A;  2QS3 A;  4JWY A;  4XKN A;  1AH5 A;  1OLA A;  3T22 A;  3CRB A;  2QFL A;  2XD2 A;  3LBS A;  5EQ9 A;  3KN7 A;  4GF8 A;  4G8N A;  2Z8E A;  5I59 A;  2I58 A;  2FIE A;  2HCA A;  4RY1 A;  1PB8 A;  3S4U A;  4NWD A;  4GWO A;  4PGP A;  1SW2 A;  3PMX A;  4XTC Q;  2PT1 A;  4H0W A;  3HV1 A;  3H4Z A;  4LP2 B;  3W9W A;  4PP0 A;  1I6Q A;  1Y9U A;  4PAF A;  1K9Y A;  2GRV A;  5TP9 A;  3T0J A;  3M3L A;  1SW4 A;  3LSW A;  2VD3 A;  3O6G A;  4JDF A;  4Q8R A;  1QJM A;  1RDZ A;  4F3B A;  1BP5 A;  2PX1 A;  2ALU A;  2OK2 A;  1B1X A;  1SBP A;  1Z7N E;  3JZJ A;  1D9Q A;  1A99 A;  5B70 A;  2OLB A;  4OFO A;  2VPO A;  4I3Y A;  2RCA A;  1MY1 A;  4ECF A;  4ZEC A;  3N6T A;  2D5W A;  3MP1 A;  3OEN A;  3O6I A;  4O3B A;  2Q88 A;  1LBX A;  2GHB A;  4FAT A;  3UIF A;  2V3T A;  5EYF A;  5CMC A;  2ZMB A;  4WKM A;  1HSE A;  1URD A;  3ZS6 A;  2GH9 A;  4L17 A;  3I6V A;  5H8Q B;  2XWV A;  4M1V A;  2BJI A;  3IOV A;  3BBR A;  1ELJ A;  1SW1 A;  2HFB A;  4MNP A;  4O7M A;  3GLB A;  2CEY A;  2YLN A;  2QVR A;  4U23 A;  4ZEB A;  5EQ8 A;  1R6Z A;  2ABH A;  3RUM A;  4R2B A;  3MJN A;  3H7M A;  1FPF A;  2ZYO A;  3EPE A;  4R72 A;  4H5G A;  4LQ2 A;  4G61 A;  5DVI A;  3ROJ A;  1IMF A;  4UA8 A;  4NF4 B;  4TLM B;  4H1X A;  4F2Q A;  3UGW A;  3IB2 A;  4PFY A;  4IGT A;  3RLF E;  1FTO A;  4OXV A;  4PC9 A;  3S9N C;  4PQJ A;  1DTZ A;  4OHN A;  2RC9 A;  2BJJ X;  1A8E A;  4R6K A;  1XI6 A;  4X48 A;  5DEX A;  1IZ1 A;  5IGA A;  3IO4 A;  2QMW A;  4UAB A;  1MXZ A;  4YKK A;  4UAC A;  4PF8 A;  2Y7I A;  2F34 A;  3C4M A;  4RNS A;  1LEV A;  4IO7 A;  1PB7 A;  3RY3 A;  4PCD A;  1NV6 A;  2ZYM A;  1M5F A;  3K01 A;  3PPO A;  4G68 C;  2L5V A;  1LBW A;  3FVO A;  2CZI A;  4LVQ A;  5JTY A;  4N4U A;  4Z0I A;  3TQL A;  1SI1 A;  3MUQ A;  1T0K A;  2DWA A;  1JW1 A;  2DXY A;  2H4I A;  2ESN A;  2FNC A;  4JXI A;  2Y5K A;  5EYH A;  1QGX A;  1LBV A;  4F1U A;  2Z8F A;  1NI9 A;  2XXW A;  3T93 B;  3ISP A;  4I3E A;  3FV2 A;  1B4Z A;  1B5I A;  1FJ6 A;  4I8C A;  3S9L C;  2DXR A;  3T9V A;  4H67 A;  2O6A A;  4NTL A;  4OVQ A;  3OSR A;  5ELV A;  1JW4 A;  1B51 A;  3MC2 A;  3G3J A;  3IJX B;  1I6B A;  2DOJ A;  1FJ9 A;  1Z7M E;  5DT6 A;  4PAK A;  4Q30 B;  3V8X B;  4FAJ A;  4YZZ A;  1NNF A;  3VXB A;  2DDK A;  4PF6 A;  3UN6 A;  2Y7K A;  5A5X A;  1FTM A;  3H03 A;  2ONK E;  1A55 A;  3OO6 A;  1B3G A;  3TCH A;  4C1T A;  1S9T A;  4ELR A;  4R74 A;  1QW0 A;  4XXU A;  2DE3 A;  1OLC A;  2O69 A;  1VFE A;  3TCG A;  3GZG A;  5I58 A;  3PD9 A;  1MRP A;  4GFR A;  4AB5 A;  2I49 A;  5I5P A;  4QFL A;  2OWS A;  2Z8D A;  5J16 A;  3LR1 A;  3IB0 A;  4GX3 A;  1Y1M A;  1IMA A;  4BDQ A;  4G68 A;  3PPR A;  2X26 A;  1N0T A;  1NV7 A;  2ZNT A;  3PUY E;  5EHS A;  3BIH A;  4NF6 B;  3PUV E;  2AL5 A;  1URG A;  4OVT A;  4ZZE A;  2AIX A;  1PEB A;  1PBQ A;  1XHY A;  4YB6 A;  5ET5 A;  3G3G A;  3KOS A;  5AA4 B;  4AS5 A;  4PE3 A;  5I2K A;  1RKM A;  4YIC A;  2HZL A;  4QFP A;  2OCU A;  3V89 B;  5FHN A;  2E0S A;  3E9X A;  1TXF A;  1ZU0 A;  2PT2 A;  4KHZ E;  1RYX A;  5I57 A;  3VDF A;  1B32 A;  2WBD A;  3KBZ A;  4JB7 A;  4OMB A;  1MPC A;  1OVB A;  4HXV A;  3EKI A;  4PFW A;  2XXI A;  2F36 A;  4GXA A;  1NV5 A;  3CFL A;  4KPT A;  2HZK A;  4XKP A;  5EHM A;  3HCQ A;  1NV0 A;  5FHO A;  5ISU A;  3BFT A;  3M8U A;  2CZL A;  1IEJ A;  4MNC A;  3Q29 A;  2KR0 A;  5H8S A;  4EF1 A;  2THI A;  3MQ9 A;  2B3B A;  4GX6 A;  2DWH A;  2FBP A;  3HPI A;  2E1S A;  4PET A;  2D21 A;  1DBZ A;  1MDP 1;  3T9X B;  2PYY A;  2KLF A;  5CI5 A;  5F24 A;  2F7C A;  4PTK A;  3T1B A;  1FBP A;  3SEW A;  4JWX A;  2PFY A;  4MX6 A;  2R9J A;  1WVJ A;  4PDH A;  2F8D A;  4YAH X;  2XWK A;  1LBZ A;  2I4C A;  1LAX A;  3MBP A;  1NUW A;  5CMM A;  1IIW A;  4NQ8 A;  3K4U A;  1LCF A;  2P0S A;  4BDN A;  4FED A;  5L9O A;  4LUB A;  3CFZ A;  4QRZ A;  4LZ8 A;  1MH3 A;  1ZMG A;  2WKY A;  4GBW A;  3HST A;  2LAO A;  1N3W A;  4FEC A;  4MHF A;  2WYK A;  3QYT A;  3SEY A;  4QFN A;  5K2Y A;  2UXA A;  2Y7R A;  4FE8 A;  1O64 A;  3IR1 A;  1LAH E;  5IZZ A;  3OEL A;  1VSO A;  1DPP A;  4NF5 A;  4YMA A;  3EN3 A;  4AS4 A;  4N6P A;  2O84 X;  4OEV A;  5F1Q A;  1YCJ A;  1MQD A;  3G3H A;  3ZKK A;  1G0H A;  1J1N A;  3QAX A;  5A5L A;  1G0I A;  4OER A;  2Q89 A;  4GRK A;  2DS9 A;  1XOC A;  4PGN A;  3TMG A;  3O28 A;  5I7I A;  5L8D A;  3K6U A;  3TTL A;  5DW8 A;  2HQ0 A;  4I62 A;  4EF2 A;  2OJT A;  4F1V A;  1FW0 A;  3MPL A;  5FBP A;  2G93 A;  3R7X A;  1MQJ A;  4PFR A;  2P1S A;  4NX1 A;  1A40 A;  3U65 A;  2Z23 A;  1MY4 A;  2Q8M A;  5H8N A;  4ZDM A;  5AA2 A;  1B7U A;  1FTK A;  1XVX A;  1S50 A;  3K1M A;  3MVW A;  4Z7E A;  4EDP A;  2XXH A;  2X7P A;  1FPI A;  3Q28 A;  4HS7 A;  4F2O A;  2HEU A;  1N76 A;  5H8H A;  1TT1 A;  2RKM A;  4KFQ A;  1QVS A;  3H3G A;  1VR5 A;  4ONY A;  5I56 B;  1D9Y A;  2FA7 A;  2PFZ A;  5H8F A;  5DVF A;  3USD A;  1CB6 A;  4H8I A;  2ZZV A;  3H6W A;  4P0I A;  5CMB A;  1LGB C;  4NN3 A;  2I4B A;  3OSQ A;  4IGR A;  5EQA A;  1VFD A;  4IY6 A;  3VLW A;  4ZEK A;  3GXA A;  4F18 A;  2FVZ A;  1MXU A;  2O51 A;  2Y84 A;  3HO7 A;  4RYA A;  1H76 A;  1US4 A;  4EXK A;  4OWD A;  4ISU A;  4JSD A;  2QVV A;  2JJK A;  1K9Z A;  1QKA A;  3H6V A;  3TEL A;  3EHS A;  3QUF A;  1MY0 A;  2KQZ A;  1LFH A;  4RPN A;  3C36 A;  1LBC A;  2X7Q A;  3O6H A;  2XXY A;  3DM0 A;  3UP9 A;  3O97 A;  3LSF B;  1MPB A;  1FBC A;  2F5X A;  3IFC A;  2P3V A;  4H65 A;  3FAT A;  3F11 A;  1Y4C A;  3PTY A;  5L9M A;  4N17 A;  4H46 A;  5CM6 A;  4QSD A;  5KCJ B;  4PDD A;  4MFI A;  4EXL A;  2Z22 A;  3IL1 B;  1IMD A;  4XF5 A;  3SET A;  1B40 A;  4NF8 B;  3MZ9 A;  5TU0 A;  1IQ7 A;  5KDT B;  5AA3 A;  3K0V A;  3OMB A;  1FTA A;  2OBG A;  3W15 C;  3G3K A;  3OEK A;  2I3V A;  3CVG A;  3OD7 A;  5LDZ A;  2B4L A;  3WAF A;  4POX A;  2ZXT A;  5ICT A;  4GQO A;  4GBV A;  3D4G A;  1EZP A;  3BIG A;  1MH4 A;  2QRY A;  4BDL A;  4ESW A;  2PCR A;  3AXF A;  3FXB A;  5HBC A;  4BDR A;  4HE1 A;  3KJ7 A;  1M5E A;  2F3D A;  3B7D A;  4FBP A;  5H8Q A;  1B05 A;  4OEN A;  2ZYK A;  3CG1 A;  1MY2 A;  1SW5 A;  3TPA A;  5AA2 D;  1FBH A;  1Y3Q A;  2GHA A;  2DVZ A;  2O68 A;  4MEV A;  4N15 A;  1H43 A;  2D3I A;  3TTM A;  4R75 A;  2VOZ A;  1LST A;  2F3B A;  2QSX A;  2DYX A;  4PE5 B;  3TCF A;  1B0L A;  4DDD A;  1UTH B;  4U22 A;  1MQI A;  1UTB B;  4OA4 A;  4E0X A;  3FJ7 A;  1FPJ A;  4ZZA A;  2Q8J A;  4M4G A;  2I48 A;  3PUX E;  1MXV A;  4JBZ A;  1FPB A;  1MXY A;  4G2Z A;  3VVD A;  3U94 A;  4NF4 A;  4H5F A;  4GOT A;  2CZK A;  1O63 A;  1NNP A;  2HAU A;  4ZEF A;  1VDW A;  1GTK A;  1FPD A;  3MAM A;  3FZV A;  2H9B A;  4P47 A;  4KYS A;  3UOR A;  2DE4 A;  4P1E A;  3FXR A;  1ZTY A;  3A29 A;  1QUK A;  3KFM A;  3Q27 A;  1B46 A;  3LSX A;  3RN8 A;  4U21 A;  2F7A A;  5I2N B;  3TZA A;  2NOO A;  4GL8 A;  1NH7 A;  1KA1 A;  2CEX A;  3ZKL A;  4N6K A;  1IME A;  3FBP A;  1JVY A;  1GV8 A;  1R9L A;  3U72 A;  4NE4 A;  3A09 A;  3MPK A;  4O8M A;  1LLS A;  4I9D A;  5ITP A;  2Y7W A;  3B6T A;  3T9H B;  3IFA A;  2A5T B;  3TTN A;  2UVJ A;  3G7W A;  4OET A;  4GIZ A;  4NG7 A;  4O7I A;  2REG A;  4OVJ A;  1QKB A;  1MXW A;  3K1P A;  3TOD A;  4ELQ A;  4H8J A;  4GWX A;  4OAN A;  3TYH A;  3SZP A;  4R2F A;  3PMV A;  1H3D A;  2O7U A;  1B52 A;  2XXU A;  1AIV A;  3K6X A;  3IOT A;  2DSF A;  2HAV A;  1SD3 A;  4GWZ A;  3IO6 A;  3TFL A;  1Y4T A;  3OOA A;  3CSG A;  3ONM A;  3HN0 A;  2XX7 A;  1KA0 A;  3VFJ A;  1IXI A;  4U2R A;  2XX9 A;  2XXX A;  1FQF A;  4OEU A;  1IXC A;  5CMK A;  3THI A;  3VLU A;  3H6T A;  1A7L A;  4DE8 A;  2V25 A;  1DPE A;  3DP8 A;  3SEU A;  3RQT A;  4QFO A;  4X9T A;  5FTI A;  1EZO A;  4DZ1 A;  2DVC A;  1JVX A;  3FVG A;  4DCY A;  1RDX A;  1ZBM A;  3BFU A;  4R6H A;  1LBY A;  2Q2C A;  3T9U A;  2Q9T A;  1ZLQ A;  4QF9 A;  3KZG A;  3SEX A;  4ELP A;  3MVZ A;  4TLL B;  3U8Q A;  4DXU A;  1OMP A;  4YKJ A;  1MDQ A;  5ET8 A;  5DTB A;  4DCX A;  3I5O A;  3TTR A;  1UIU A;  1LCT A;  3DP6 A;  4IO6 A;  4GWW A;  4XKQ A;  2V93 A;  1I69 A;  1ZKB A;  3B6W A;  1NH8 A;  3IAZ A;  3QXM A;  1WDN A;  1NFT A;  5IM2 A;  3CHG A;  2HPG A;  3A3U A;  3TKD A;  4PBQ A;  4IO4 A;  5BWJ A;  4NF6 A;  4TOZ A;  2F35 A;  4YMB A;  3IJO B;  1D3K A;  4FEB A;  3FJG A;  4PBH A;  4MMP A;  4N8G A;  1NL5 A;  5AA4 A;  5TPA B;  3PMW A;  1LB8 A;  1TFD A;  3FXU A;  4DXB A;  1MXX A;  4NAP A;  4P1L A;  4IO5 A;  4O3A A;  1LFG A;  1IMC A;  4YB5 A;  4OZ9 A;  4THI A;  2IEE A;  3UA8 A;  2PBW A;  3OO9 A;  1YZ0 A;  3FXQ A;  3N26 A;  3PU5 A;  4KCD A;  1M5B A;  5JEI A;  1IUD A;  2Y7P A;  3K6V A;  3D1R A;  4F39 A;  1B2H A;  1B6H A;  3TQW A;  3FAS A;  4U4S A;  1DOT A;  5F7V A;  4WEP A;  3RTF B;  2XWO A;  5EYG A;  1XT8 A;  4DLD A;  2QPQ A;  3TUS A;  2NVU B;  3LUY A;  1KZ8 A;  4KCC A;  4F1Y A;  4YKP A;  2O1L A;  3OO8 A;  2NXO A;  4N6D A;  3GYY A;  4P9K A;  3VVF A;  2XX8 A;  1JP4 A;  4EUO A;  4NWC A;  1JW5 A;  5J1D A;  1Q9D A;  1LAG E;  1B5J A;  3CR9 A;  5B7D A;  1B1H A;  3RT8 A;  3SER A;  1B3L A;  3QK6 A;  2PMS A;  1B7H A;  2H25 A;  1D9V A;  3E4R A;  4PFI A;  5I3S A;  4F3G A;  3O29 A;  1EU8 A;  5IZ3 B;  2B4M A;  3RPL B;  2G29 A;  4PAI A;  4HE2 A;  2QS1 A;  2OX3 A;  3L6G A;  3MYU A;  1JQF A;  1HSL A;  4OTE A;  4ZS9 A;  2XXP A;  2Y5L A;  2ANJ A;  4OVR A;  2FIX A;  3C9H A;  2I0C A;  4GWS A;  2H99 A;  1SI0 A;  4KD5 A;  4C0R A;  2XD3 A;  1AWB A;  1YXI A;  2UYE A;  2QVU A;  4YB7 A;  2R8T A;  2DWI A;  3KSJ A;  2O1M A;  1NNK A;  4R73 A;  1I6A A;  4F3P A;  4X8R A;  3RT6 B;  4JWO A;  3C34 A;  3EHT A;  1FTJ A;  3PV0 E;  4YU0 A;  2OWT A;  3U1O A;  4YKI A;  3TDJ A;  1N84 A;  5I84 A;  5I59 B;  4GLI A;  4ND9 A;  1IMB A;  4QHQ A;  4XEQ A;  3B6Q A;  4GL0 A;  3E78 A;  3SEV A;  3RTW B;  4Q0C A;  2PVU A;  1SYI A;  5CBR A;  3LV0 A;  1GGG A;  4X1B A;  1PDA A;  5ET7 A;  2H98 A;  3O9P A;  1B0H A;  4HCY A;  3B8B A;  4GVO A;  4NGU A;  4X1D A;  1FPE A;  3KN3 A;  5TP9 B;  4JSO A;  3ECR A;  3VE1 B;  5CC2 A;  3U92 A;  4GWU A;  1DTG A;  2VHA A;  4P8B A;  1FBE A;  2RCB A;  4K3F A;  1IXH A;  4AB6 A;  1DSN A;  3IK6 B;  4OVP A;  3C33 A;  5I56 A;  4PFU A;  1FPK A;  3FGS A;  3T96 B;  2XWI A;  4I1D A;  1FRP A;  4LAT A;  1PB9 A;  3QUJ A;  3VXC A;  4LZ7 A;  4G8M A;  3BKI B;  3MVX A;  3DLN A;  3FD3 A;  3EF7 A;  3FJM A;  1P1Q A;  4NHB A;  2ZZW A;  1FBF A;  1TWY A;  2I0B A;  4LA9 A;  1MG1 A;  2VD2 A;  2WBB A;  1GR2 A;  1B58 A;  3QSL A;  1NMU A;  1BIY A;  1FBD A;  1FQD A;  5DYH A;  2XHD A;  2F78 A;  4F22 A;  1Y3P A;  4N8Y A;  2ZZX A;  4MIJ A;  5BUU A;  3CFX A;  3PPP A;  1FQC A;  4XIG Q;  3G3I A;  4O3C A;  1Y3N A;  4LZ5 A;  3Q25 A;  3Q26 A;  2R71 A;  5KCJ A;  1USY H;  4IY5 A;  1EYK A;  2VGQ A;  2XA5 A;  1NV3 A;  2QJE A;  2NWJ A;  3KN8 A;  2AYS A;  1EZ9 A;  4G77 A;  1R9Q A;  5IZ1 A;  4JVI A;  5IKB A;  3ILT B;  4NF8 A;  3MW0 A;  3HHG A;  5KDT A;  1IIT A;  3KJT A;  4IB2 A;  2VP1 A;  1SDX A;  4MH5 A;  1LFI A;  3GBB A;  4IO3 A;  1MM7 A;  4GWY A;  4X04 A;  5DEX B;  2CMO A;  3MWB A;  4ZE9 A;  1OVT A;  4HW8 A;  2FYI A;  4MLQ A;  3L6H A;  4MCO A;  4DI4 B;  3O2A A;  5ESY A;  4OYV A;  3FUZ A;  4DI3 D;  1MQH A;  5IAI A;  1A8F A;  3FVN A;  1EYI A;  3M3K A;  1H45 A;  3C32 A;  4MAG A;  2OZZ A;  3QIM A;  3A3C A;  1US5 A;  5M2V A;  4BDO A;  3IX1 A;  1IXG A;  2V4C A;  3PGF A;  2OWZ A;  3FVK A;  3RGY A;  2B65 A;  1FBG A;  1F9B A;  1MPD A;  4ELO A;  2ZYN A;  4GXS B;  2R6G E;  1B7Z A;  1SVX B;  2P2A A;  5JTY B;  4KXP A;  1UTH A;  2IA4 A;  1UTB A;  2Q74 A;  1P99 A;  4QFK A;  3R26 A;  2YJP A;  2ONS A;  2Q2A A;  1BK4 A;  3UK4 A;  4F3S A;  3O66 A;  2NUV A;  3I3V A;  2XXK A;  4NED A;  3VVE A;  1NUZ A;  1MQG A;  4Q5T A;  3H6U A;  4C1U A;  1LBB A;  3KGC A;  5JK4 A;  3KBR A;  1FQB A;  3KC1 A;  1P1W A;  4KR5 A;  1YAE A;  3KOT A;  3CIJ A;  4FJP A;  1N7W A;  4RXL A;  3C31 A;  4F29 A;  4N81 A;  4JVD A;  1JET A;  4GX4 A;  4N07 A;  4ZEI A;  3KG2 A;  1B3E A;  1FQE A;  4U1Z A;  1AOV A;  1YPN A;  3IB1 A;  2VT5 A;  4U1O A;  4IR8 A;  1SQY A;  4U4X A;  1H44 A;  1TFA A;  5A5X B;  1BLF A;  5LOM A;  4NMY A;  5I2N A;  3OEM A;  1EYJ A;  2DE2 A;  4KYD A;  4OVS A;  3ODB A;  1CNQ A;  1FCK A;  1ATG A;  4GD5 A;  3OXN A;  2A5T A;  5DVJ A;  1II5 A;  1JEV A;  3N94 A;  5FTH A;  4RK9 A;  4DIG A;  5I58 B;  3WAE A;  1QUL A;  3LSL A;  1JEU A;  3P7I A;  3S9M C;  3E79 A;  2V3Q A;  1NV1 A;  1UIV A;  3W9V A;  1M5C A;  1FQA A;  3MP6 A;  4G68 B;  4OFL A;  5CRY A;  1MS7 A;  3K00 A;  2UVG A;  2CZH A;  4FIM A;  4JVC A;  5AE4 A;  1RDY A;  1JNF A;  3M3F A;  3GBA A;  3S2V A;  2P3N A;  3V83 A;  1P1N A;  3E3K A;  3PPN A;  2HXR A;  4RPO A;  4MBP A;  1PBP A;  1EH3 A;  2A5S A;  2WYP A;  3JYR A;  2GQ1 A;  3PPQ A;  1ZJL A;  4HTG A;  5I2K B;  2ONR A;  3D4C A;  3CG3 A;  4XKR A;  5FHM A;  4POW A;  1XS5 A;  1OIB A;  2O7I A;  3MST A;  3VV5 A;  1A54 A;  4TQU Q;  4ZE8 A;  1P1O A;  3MZ1 A;  5KZT A;  4LQ5 A;  2ZNS A;  1WOD A;  3TAJ A;  4O94 A;  3TTK A;  1SPI A;  5I57 B;  2QS2 A;  2XXR A;  4QSC A;  1S7Y A;  3NOH A;  3SDF A;  1XVY A;  4H6D A;  3SES A;  3K2D A;  3C35 A;  4MLV A;  4PFB A;  1AMF A;  3N5L A;  4LON B;  1NV2 A;  1FTL A;  2V84 A;  3V5A A;  3RPW A;  1USY E;  3K6W A;  1B3F A;  2VPN A;  4EQB A;  1P1U A;  1UQW A;  3CSB A;  4G4P A;  1Q1K A;  4LN5 A;  3QMF A;  3FIR A;  2F7B A;  1VE4 A;  3HHF A;  2V3U A;  2QMX A;  2QS4 A;  2B3F A;  3IOW A;  4E0W A;  2W7Y A;  4F31 B;  5LTC A;  3SKP A;  1KWH A;  3K02 A;  1FPG A;  4MNI A;  1B3H A;  4N13 A;  4RA1 A;  2XXQ A;  1NNT A;  1Q35 A;  4BLA A;  4P3L A;  1CE2 A;  4RJZ A;  1R1N A;  1QUI A;  1NV4 A;  1PC3 A;  5TPA A;  4QBA A;  1D4N A;  4HE0 A;  2ZNU A;  1DMB A;  2XXV A;  5CBS A;  3RNN A;  4ESX A;  3IOR A;  5L9S A;  2YPN A;  4NF0 A;  3E13 X;  4OFJ A;  3HFU A;  3K1N A;  3OO7 A;  2DP8 A;  2RIN A;  4EQ9 A;  2WX9 A;  5ICQ A;  4DXC A;  2QL3 A;  3KC0 A;  1GVC A;  2M8C A;  1B9J A;  4QSE A;  3DP4 A;  5ET6 A;  4ZED A;  1NUX A;  4P0G A;  2REJ A;  2I3W A;  4R9F A;  1BTJ A;  4I40 A;  3ZSF A;  5K2X A;  3LUZ A;  1DCU A;  2I6E A;  2XXT A;  4FOR A;  1L5T A;  1YTV A;  3S9E A;  4R6Y A;  3VLV A;  1M5D A;  5HM4 B;  1XC1 A;  4KI0 E;  1N04 A;  1OQG A;  2UVH A;  1MM6 A;  2HHM A;  3MVY A;  5EQ7 A;  1INP A;  1O7T A;  3EQ1 A;  3R6U A;  4WED A; 
#chains in the Genus database with same CATH homology
 5HPQ A;  1BKA A;  4NF5 B;  1ANF A;  4OES A;  3T66 A;  4P11 A;  1N7X A;  3KSX A;  4KYE A;  3H06 B;  4PFT A;  1LAF E;  4AQ4 A;  1QUJ A;  1B5H A;  1SYH A;  3U93 A;  2F97 A;  3ILU B;  2F6G A;  3KEI A;  3N6U A;  4EQ7 A;  2UYF A;  4WXJ A;  3JV9 A;  1Y20 A;  5H8N B;  5AA2 B;  1MY3 A;  2DQV A;  2RC7 A;  4G8H A;  1OQH A;  4F19 A;  3MP8 A;  2RC8 A;  3PUW E;  5AA1 A;  4HCW A;  5H8H B;  1HSJ A;  4MF3 A;  2DWJ A;  3TEP A;  2AL4 A;  1B4H A;  1Y1Z A;  2H5Y A;  2F6P A;  3EHU A;  5H8F B;  1ZIU A;  4BDM A;  3G3F A;  3IOU A;  1RYO A;  4OQO A;  5ITO A;  1POT A;  1N3X A;  2RF1 A;  3MZB A;  1LB9 A;  3FV1 A;  3PD8 A;  1URS A;  3DEL B;  1POY 1;  3PUZ E;  1AL3 A;  1NKX A;  3LC8 A;  4KQP A;  4IO2 A;  2UVI A;  3CI8 A;  4RK2 A;  2GFE A;  4R9G A;  2HXW A;  2QS3 A;  4JWY A;  4XKN A;  1AH5 A;  1OLA A;  3T22 A;  3CRB A;  2XD2 A;  3LBS A;  3KN7 A;  4GF8 A;  4G8N A;  2Z8E A;  5I59 A;  2I58 A;  2HCA A;  4RY1 A;  1PB8 A;  3S4U A;  4NWD A;  4GWO A;  1SW2 A;  3PMX A;  4XTC Q;  2PT1 A;  4H0W A;  3HV1 A;  3H4Z A;  4LP2 B;  3W9W A;  4PP0 A;  1I6Q A;  1Y9U A;  2GRV A;  5TP9 A;  3M3L A;  1SW4 A;  3LSW A;  2VD3 A;  3O6G A;  4JDF A;  4Q8R A;  1QJM A;  4F3B A;  1BP5 A;  2PX1 A;  2ALU A;  2OK2 A;  1B1X A;  1SBP A;  1Z7N E;  3JZJ A;  1A99 A;  5B70 A;  2OLB A;  4OFO A;  2RCA A;  1MY1 A;  4ECF A;  4ZEC A;  3N6T A;  2D5W A;  3MP1 A;  3OEN A;  3O6I A;  4O3B A;  2Q88 A;  2GHB A;  4FAT A;  3UIF A;  2V3T A;  5EYF A;  5CMC A;  2ZMB A;  4WKM A;  1HSE A;  1URD A;  3ZS6 A;  2GH9 A;  4L17 A;  3I6V A;  5H8Q B;  4M1V A;  3IOV A;  3BBR A;  1ELJ A;  1SW1 A;  2HFB A;  3GLB A;  2YLN A;  4U23 A;  4ZEB A;  1R6Z A;  2ABH A;  3RUM A;  4R2B A;  3MJN A;  3H7M A;  2ZYO A;  3EPE A;  4R72 A;  4H5G A;  4LQ2 A;  5DVI A;  4UA8 A;  4NF4 B;  4TLM B;  4H1X A;  4F2Q A;  3UGW A;  3IB2 A;  4PFY A;  4IGT A;  3RLF E;  1FTO A;  4OXV A;  3S9N C;  4PQJ A;  1DTZ A;  4OHN A;  2RC9 A;  2BJJ X;  1A8E A;  4R6K A;  4X48 A;  5DEX A;  1IZ1 A;  3IO4 A;  2QMW A;  1MXZ A;  4YKK A;  4UAC A;  2Y7I A;  2F34 A;  3C4M A;  4RNS A;  4IO7 A;  1PB7 A;  3RY3 A;  2ZYM A;  1M5F A;  3K01 A;  3PPO A;  4G68 C;  3FVO A;  4LVQ A;  5JTY A;  4Z0I A;  3TQL A;  1SI1 A;  3MUQ A;  1T0K A;  2DWA A;  1JW1 A;  2DXY A;  2H4I A;  2ESN A;  2FNC A;  4JXI A;  4F1U A;  2Z8F A;  2XXW A;  3T93 B;  3FV2 A;  1B4Z A;  1B5I A;  4I8C A;  3S9L C;  2DXR A;  3T9V A;  4H67 A;  2O6A A;  4NTL A;  3OSR A;  5ELV A;  1JW4 A;  1B51 A;  3MC2 A;  3G3J A;  3IJX B;  1I6B A;  2DOJ A;  1Z7M E;  5DT6 A;  4Q30 B;  3V8X B;  4FAJ A;  4YZZ A;  1NNF A;  3VXB A;  3UN6 A;  2Y7K A;  5A5X A;  1FTM A;  3H03 A;  2ONK E;  1A55 A;  3OO6 A;  1B3G A;  3TCH A;  4C1T A;  1S9T A;  4ELR A;  4R74 A;  1QW0 A;  4XXU A;  2DE3 A;  1OLC A;  2O69 A;  1VFE A;  3TCG A;  3GZG A;  5I58 A;  3PD9 A;  1MRP A;  4GFR A;  4AB5 A;  2I49 A;  4QFL A;  2OWS A;  2Z8D A;  3LR1 A;  3IB0 A;  1Y1M A;  4BDQ A;  4G68 A;  3PPR A;  2X26 A;  1N0T A;  2ZNT A;  3PUY E;  5EHS A;  4NF6 B;  3PUV E;  2AL5 A;  1URG A;  4ZZE A;  2AIX A;  1PEB A;  1PBQ A;  1XHY A;  4YB6 A;  3G3G A;  3KOS A;  5AA4 B;  5I2K A;  1RKM A;  4YIC A;  2HZL A;  4QFP A;  2OCU A;  3V89 B;  5FHN A;  2E0S A;  3E9X A;  1TXF A;  1ZU0 A;  2PT2 A;  4KHZ E;  1RYX A;  5I57 A;  3VDF A;  1B32 A;  4JB7 A;  4OMB A;  1MPC A;  1OVB A;  4PFW A;  2XXI A;  2F36 A;  4GXA A;  4KPT A;  3CFL A;  2HZK A;  4XKP A;  5EHM A;  3HCQ A;  5FHO A;  5ISU A;  3BFT A;  3M8U A;  2CZL A;  1IEJ A;  3Q29 A;  5H8S A;  4EF1 A;  2THI A;  3MQ9 A;  2B3B A;  2DWH A;  3HPI A;  2E1S A;  4PET A;  2D21 A;  1MDP 1;  3T9X B;  2PYY A;  2KLF A;  5CI5 A;  2F7C A;  3SEW A;  4JWX A;  2R9J A;  1WVJ A;  2F8D A;  4YAH X;  2I4C A;  1LAX A;  3MBP A;  5CMM A;  1IIW A;  3K4U A;  1LCF A;  2P0S A;  4BDN A;  4FED A;  5L9O A;  4LUB A;  3CFZ A;  4QRZ A;  4LZ8 A;  1MH3 A;  1ZMG A;  2WKY A;  3HST A;  2LAO A;  1N3W A;  4FEC A;  3QYT A;  3SEY A;  4QFN A;  5K2Y A;  2UXA A;  2Y7R A;  4FE8 A;  1O64 A;  3IR1 A;  1LAH E;  3OEL A;  1VSO A;  1DPP A;  4NF5 A;  4YMA A;  3EN3 A;  4N6P A;  2O84 X;  4OEV A;  5F1Q A;  1YCJ A;  1MQD A;  3G3H A;  3ZKK A;  3QAX A;  1J1N A;  4OER A;  2Q89 A;  4GRK A;  2DS9 A;  1XOC A;  3TMG A;  3O28 A;  5L8D A;  3K6U A;  3TTL A;  2HQ0 A;  4I62 A;  4EF2 A;  2OJT A;  4F1V A;  1FW0 A;  3MPL A;  2G93 A;  3R7X A;  1MQJ A;  2P1S A;  1A40 A;  2Z23 A;  1MY4 A;  5H8N A;  4ZDM A;  5AA2 A;  1B7U A;  1FTK A;  1XVX A;  1S50 A;  3K1M A;  3MVW A;  4Z7E A;  4EDP A;  2XXH A;  2X7P A;  3Q28 A;  4HS7 A;  4F2O A;  2HEU A;  1N76 A;  5H8H A;  1TT1 A;  2RKM A;  4KFQ A;  1QVS A;  3H3G A;  1VR5 A;  4ONY A;  5I56 B;  1D9Y A;  2FA7 A;  5H8F A;  5DVF A;  3USD A;  1CB6 A;  4H8I A;  3H6W A;  4P0I A;  5CMB A;  1LGB C;  2I4B A;  3OSQ A;  4IGR A;  1VFD A;  4IY6 A;  3VLW A;  4ZEK A;  3GXA A;  4F18 A;  1MXU A;  2O51 A;  2Y84 A;  3HO7 A;  4RYA A;  1H76 A;  1US4 A;  4EXK A;  4OWD A;  4ISU A;  4JSD A;  1QKA A;  3H6V A;  3TEL A;  3EHS A;  3QUF A;  1MY0 A;  1LFH A;  4RPN A;  3C36 A;  1LBC A;  2X7Q A;  3O6H A;  2XXY A;  3DM0 A;  3UP9 A;  3O97 A;  3LSF B;  1MPB A;  2F5X A;  4H65 A;  3FAT A;  3F11 A;  1Y4C A;  5L9M A;  5CM6 A;  4QSD A;  5KCJ B;  4MFI A;  4EXL A;  2Z22 A;  3IL1 B;  3SET A;  1B40 A;  4NF8 B;  3MZ9 A;  5TU0 A;  1IQ7 A;  5KDT B;  5AA3 A;  3K0V A;  3OMB A;  2OBG A;  3W15 C;  3G3K A;  3OEK A;  2I3V A;  3CVG A;  3OD7 A;  3WAF A;  4POX A;  2ZXT A;  5ICT A;  4GQO A;  3D4G A;  1EZP A;  1MH4 A;  2QRY A;  4BDL A;  4ESW A;  3AXF A;  5HBC A;  4BDR A;  3KJ7 A;  1M5E A;  3B7D A;  5H8Q A;  1B05 A;  4OEN A;  3TPA A;  2ZYK A;  1MY2 A;  1SW5 A;  5AA2 D;  3CG1 A;  1Y3Q A;  2GHA A;  2DVZ A;  2O68 A;  1H43 A;  2D3I A;  3TTM A;  4R75 A;  2VOZ A;  1LST A;  2QSX A;  2DYX A;  4PE5 B;  3TCF A;  1B0L A;  4DDD A;  1UTH B;  4U22 A;  1MQI A;  1UTB B;  4E0X A;  3FJ7 A;  4ZZA A;  2Q8J A;  4M4G A;  2I48 A;  3PUX E;  1MXV A;  4JBZ A;  1MXY A;  4G2Z A;  3VVD A;  3U94 A;  4NF4 A;  4H5F A;  4GOT A;  1O63 A;  1NNP A;  2HAU A;  4ZEF A;  1GTK A;  3MAM A;  3FZV A;  2H9B A;  4KYS A;  3UOR A;  2DE4 A;  3FXR A;  1ZTY A;  1QUK A;  3KFM A;  3Q27 A;  1B46 A;  3LSX A;  3RN8 A;  4U21 A;  2F7A A;  5I2N B;  3TZA A;  2NOO A;  4GL8 A;  1NH7 A;  3ZKL A;  1JVY A;  1GV8 A;  1R9L A;  3U72 A;  4NE4 A;  3A09 A;  3MPK A;  1LLS A;  4I9D A;  5ITP A;  2Y7W A;  3B6T A;  3T9H B;  2A5T B;  3TTN A;  2UVJ A;  3G7W A;  4OET A;  4GIZ A;  2REG A;  4OVJ A;  1QKB A;  1MXW A;  3K1P A;  3TOD A;  4ELQ A;  4H8J A;  3TYH A;  4R2F A;  3PMV A;  1H3D A;  2O7U A;  1B52 A;  2XXU A;  1AIV A;  3K6X A;  3IOT A;  2DSF A;  2HAV A;  1SD3 A;  3IO6 A;  3TFL A;  1Y4T A;  3OOA A;  3CSG A;  3ONM A;  3HN0 A;  2XX7 A;  3VFJ A;  1IXI A;  4U2R A;  2XX9 A;  2XXX A;  1FQF A;  4OEU A;  1IXC A;  5CMK A;  3THI A;  3VLU A;  3H6T A;  1A7L A;  4DE8 A;  2V25 A;  1DPE A;  3DP8 A;  3SEU A;  3RQT A;  4QFO A;  4X9T A;  5FTI A;  1EZO A;  4DZ1 A;  2DVC A;  1JVX A;  3FVG A;  4DCY A;  1ZBM A;  3BFU A;  4R6H A;  2Q2C A;  3T9U A;  2Q9T A;  1ZLQ A;  4QF9 A;  3KZG A;  3SEX A;  4ELP A;  3MVZ A;  4TLL B;  3U8Q A;  4DXU A;  1OMP A;  4YKJ A;  1MDQ A;  5DTB A;  4DCX A;  3I5O A;  3TTR A;  1UIU A;  1LCT A;  3DP6 A;  4IO6 A;  4XKQ A;  2V93 A;  1I69 A;  1ZKB A;  3B6W A;  1NH8 A;  3IAZ A;  3QXM A;  1WDN A;  1NFT A;  3A3U A;  3TKD A;  4IO4 A;  5BWJ A;  4NF6 A;  4TOZ A;  2F35 A;  4YMB A;  3IJO B;  1D3K A;  4FEB A;  3FJG A;  1NL5 A;  5AA4 A;  5TPA B;  3PMW A;  1LB8 A;  1TFD A;  3FXU A;  4DXB A;  1MXX A;  4IO5 A;  4O3A A;  1LFG A;  4YB5 A;  4OZ9 A;  4THI A;  2IEE A;  3UA8 A;  2PBW A;  3OO9 A;  3FXQ A;  3N26 A;  3PU5 A;  4KCD A;  1M5B A;  5JEI A;  1IUD A;  2Y7P A;  3K6V A;  4F39 A;  1B2H A;  1B6H A;  3TQW A;  3FAS A;  4U4S A;  1DOT A;  5F7V A;  4WEP A;  3RTF B;  1XT8 A;  4DLD A;  2QPQ A;  3TUS A;  2NVU B;  3LUY A;  4KCC A;  4F1Y A;  4YKP A;  2O1L A;  3OO8 A;  2NXO A;  3VVF A;  2XX8 A;  4EUO A;  4NWC A;  1JW5 A;  5J1D A;  1LAG E;  1B5J A;  3CR9 A;  5B7D A;  1B1H A;  3RT8 A;  3SER A;  1B3L A;  3QK6 A;  2PMS A;  1B7H A;  2H25 A;  1D9V A;  3E4R A;  4F3G A;  3O29 A;  1EU8 A;  2G29 A;  2QS1 A;  3L6G A;  1JQF A;  1HSL A;  4OTE A;  4ZS9 A;  2XXP A;  2ANJ A;  3C9H A;  2I0C A;  2H99 A;  1SI0 A;  4KD5 A;  4C0R A;  2XD3 A;  2UYE A;  4YB7 A;  2DWI A;  3KSJ A;  2O1M A;  1NNK A;  4R73 A;  1I6A A;  4F3P A;  3RT6 B;  4JWO A;  3C34 A;  3EHT A;  1FTJ A;  3PV0 E;  4YU0 A;  2OWT A;  3U1O A;  4YKI A;  3TDJ A;  1N84 A;  5I84 A;  5I59 B;  4GLI A;  4ND9 A;  4QHQ A;  3B6Q A;  4GL0 A;  3SEV A;  3RTW B;  4Q0C A;  2PVU A;  1SYI A;  5CBR A;  1GGG A;  4X1B A;  1PDA A;  2H98 A;  3O9P A;  1B0H A;  4HCY A;  4GVO A;  4X1D A;  3KN3 A;  5TP9 B;  4JSO A;  3ECR A;  3VE1 B;  5CC2 A;  3U92 A;  1DTG A;  2VHA A;  2RCB A;  4K3F A;  1IXH A;  4AB6 A;  1DSN A;  3IK6 B;  3C33 A;  5I56 A;  4PFU A;  3FGS A;  3T96 B;  4I1D A;  4LAT A;  1PB9 A;  3QUJ A;  3VXC A;  4LZ7 A;  4G8M A;  3BKI B;  3MVX A;  3DLN A;  3FD3 A;  3EF7 A;  3FJM A;  1P1Q A;  1TWY A;  2I0B A;  4LA9 A;  1MG1 A;  2VD2 A;  1GR2 A;  1B58 A;  3QSL A;  1NMU A;  1BIY A;  1FQD A;  5DYH A;  2XHD A;  2F78 A;  4F22 A;  1Y3P A;  5BUU A;  3CFX A;  3PPP A;  1FQC A;  4XIG Q;  3G3I A;  4O3C A;  1Y3N A;  4LZ5 A;  3Q25 A;  3Q26 A;  2R71 A;  5KCJ A;  1USY H;  4IY5 A;  2VGQ A;  2QJE A;  2NWJ A;  3KN8 A;  2AYS A;  1EZ9 A;  4G77 A;  1R9Q A;  5IKB A;  3ILT B;  4NF8 A;  3MW0 A;  3HHG A;  5KDT A;  1IIT A;  3KJT A;  4IB2 A;  2VP1 A;  1SDX A;  4MH5 A;  1LFI A;  3GBB A;  4IO3 A;  1MM7 A;  5DEX B;  2CMO A;  3MWB A;  4ZE9 A;  1OVT A;  4HW8 A;  2FYI A;  4MLQ A;  3L6H A;  3O2A A;  4OYV A;  3FUZ A;  1MQH A;  5IAI A;  1A8F A;  3FVN A;  3M3K A;  1H45 A;  3C32 A;  2OZZ A;  3QIM A;  3A3C A;  1US5 A;  5M2V A;  4BDO A;  3IX1 A;  1IXG A;  3PGF A;  3FVK A;  3RGY A;  2B65 A;  1F9B A;  1MPD A;  4ELO A;  2ZYN A;  4GXS B;  2R6G E;  1B7Z A;  1SVX B;  2P2A A;  5JTY B;  1UTH A;  2IA4 A;  1UTB A;  4QFK A;  1P99 A;  3R26 A;  2YJP A;  2ONS A;  2Q2A A;  3UK4 A;  4F3S A;  3O66 A;  2NUV A;  3I3V A;  4NED A;  3VVE A;  1MQG A;  4Q5T A;  3H6U A;  4C1U A;  1LBB A;  3KGC A;  5JK4 A;  3KBR A;  1FQB A;  1P1W A;  4KR5 A;  1YAE A;  3KOT A;  3CIJ A;  4FJP A;  1N7W A;  4RXL A;  3C31 A;  4F29 A;  1JET A;  4N07 A;  4ZEI A;  3KG2 A;  1B3E A;  1FQE A;  4U1Z A;  1AOV A;  1YPN A;  3IB1 A;  4U1O A;  1SQY A;  4U4X A;  1TFA A;  1H44 A;  5A5X B;  1BLF A;  5LOM A;  4NMY A;  5I2N A;  3OEM A;  2DE2 A;  4KYD A;  3ODB A;  1FCK A;  1ATG A;  4GD5 A;  3OXN A;  2A5T A;  5DVJ A;  1II5 A;  1JEV A;  3N94 A;  5FTH A;  4RK9 A;  4DIG A;  5I58 B;  3WAE A;  1QUL A;  3LSL A;  1JEU A;  3P7I A;  3S9M C;  2V3Q A;  1UIV A;  3W9V A;  1M5C A;  1FQA A;  3MP6 A;  4G68 B;  4OFL A;  5CRY A;  1MS7 A;  3K00 A;  2UVG A;  4FIM A;  5AE4 A;  1JNF A;  3M3F A;  3GBA A;  3S2V A;  3V83 A;  1P1N A;  3E3K A;  3PPN A;  4RPO A;  4MBP A;  1PBP A;  1EH3 A;  2A5S A;  3JYR A;  3PPQ A;  1ZJL A;  4HTG A;  5I2K B;  2ONR A;  3D4C A;  3CG3 A;  4XKR A;  5FHM A;  4POW A;  1XS5 A;  1OIB A;  2O7I A;  3VV5 A;  1A54 A;  4TQU Q;  4ZE8 A;  1P1O A;  3MZ1 A;  5KZT A;  4LQ5 A;  2ZNS A;  1WOD A;  3TAJ A;  3TTK A;  5I57 B;  2QS2 A;  2XXR A;  4QSC A;  1S7Y A;  3SDF A;  1XVY A;  4H6D A;  3SES A;  3K2D A;  3C35 A;  4MLV A;  1AMF A;  3N5L A;  4LON B;  1FTL A;  2V84 A;  3V5A A;  3RPW A;  1USY E;  3K6W A;  1B3F A;  4EQB A;  1P1U A;  1UQW A;  3CSB A;  4G4P A;  1Q1K A;  3FIR A;  2F7B A;  1VE4 A;  3HHF A;  2V3U A;  2QMX A;  2QS4 A;  2B3F A;  3IOW A;  4E0W A;  2W7Y A;  4F31 B;  3SKP A;  1KWH A;  3K02 A;  1B3H A;  4N13 A;  4RA1 A;  2XXQ A;  1NNT A;  1Q35 A;  4BLA A;  1CE2 A;  4RJZ A;  1R1N A;  1QUI A;  1PC3 A;  5TPA A;  1D4N A;  2ZNU A;  1DMB A;  2XXV A;  5CBS A;  3RNN A;  4ESX A;  3IOR A;  5L9S A;  2YPN A;  3E13 X;  4OFJ A;  3K1N A;  3OO7 A;  2DP8 A;  2RIN A;  4EQ9 A;  5ICQ A;  4DXC A;  2QL3 A;  1GVC A;  2M8C A;  1B9J A;  4QSE A;  3DP4 A;  4ZED A;  4P0G A;  2REJ A;  2I3W A;  4R9F A;  1BTJ A;  3ZSF A;  5K2X A;  2I6E A;  2XXT A;  4FOR A;  1L5T A;  1YTV A;  3S9E A;  4R6Y A;  3VLV A;  1M5D A;  5HM4 B;  1XC1 A;  4KI0 E;  1N04 A;  1OQG A;  2UVH A;  1MM6 A;  3MVY A;  1O7T A;  3EQ1 A;  3R6U A;  4WED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...