2H98A

Crystal structure of the effector binding domain of a catm variant, catm(v158m)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
216
structure length
216
Chain Sequence
SQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRRIMLHKEQLKLAIHKHHHLNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the altered regulatory roles of three LysR-type transcritional variants of CatM and BenM: CatM(V158M), CatM(R156H) and BenM(R156H/T157S)
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator catM
total genus 59
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h98A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h98A02
3DLNA 1MQIA 1OQHA 2I0CA 3IORA 3Q28A 1MH4A 2I0BA 3PV0E 1KWHA 4DXUA 1T0KA 1LSTA 4Q0CA 2ABHA 2DXRA 1UIVA 3P7IA 4ZZEA 3VDFA 1NFTA 2I49A 3H6UA 4OHNA 1YPNA 4AB5A 2O69A 1ATGA 3MZ1A 5EYFA 3TPAA 3TCGA 1IIWA 1WDNA 4YB7A 4EDPA 2B3BA 5CI5A 3PMWA 3LBSA 3TZAA 4PP0A 2M8CA 1LFGA 2O1MA 1S7YA 2F7BA 2XXVA 2Y7RA 2Y84A 3SETA 3MQ9A 3VVDA 4HTGA 4G8MA 2HXWA 2QSXA 1MXWA 2V93A 3CR9A 1FTKA 3DP4A 3TAJA 3V83A 4DDDA 4JWXA 4N6PA 4RNSA 1UQWA 3Q29A 5AA2B 2RCAA 4C1UA 4KQPA 3T9XB 1VE4A 2ZNUA 3LR1A 3O6GA 3HHGA 2DWHA 1P1QA 2F5XA 3CIJA 4POXA 4BLAA 4F29A 2OCUA 1OLAA 4C0RA 4KYEA 2A5SA 4RA1A 3PPQA 2I4CA 3RT8A 1CB6A 1A8FA 4EXKA 1MY2A 2ONRA 2ONKE 1Y3QA 4F2QA 1VFEA 4ESWA 2F36A 3V5AA 1JW1A 1QW0A 3ODBA 2XX7A 3H3GA 5DTBA 1B3LA 1LCFA 4FECA 5A5XA 3VVFA 3IAZA 1B5IA 2Z22A 3CG3A 4PE5B 1RKMA 1MM6A 2DP8A 4BDNA 5HM4B 3MZ9A 2RC8A 1DPEA 1QVSA 2VHAA 1B32A 3BBRA 1IXCA 3C35A 3DP8A 4H8JA 2AYSA 3R26A 3K6VA 4HCWA 4WEPA 3LSXA 5M2VA 4F2OA 4ND9A 5DVFA 1SD3A 1FQEA 1POTA 3G3GA 1YAEA 2UVHA 2D5WA 1MXYA 2H5YA 2UVIA 3CSGA 3VVEA 3S9LC 4GL8A 2X7QA 3V89B 3TEPA 5K2YA 1TWYA 4I1DA 4YKJA 3VE1B 1PB9A 2QPQA 3OMBA 1MDQA 2ZNTA 1SDXA 5H8HA 1MY4A 3ZS6A 3HSTA 3O6IA 1WVJA 1IXHA 2ZYOA 3FV1A 1MXVA 2IA4A 4RYAA 4WXJA 2XD3A 4Z7EA 3KGCA 3FATA 1JW5A 2VD3A 1ZU0A 1ANFA 4YKPA 2D3IA 5CBSA 4GFRA 1A54A 1JETA 2NOOA 2HCAA 4WKMA 1PDAA 3IOWA 4QFOA 4YB5A 4F18A 3U92A 1II5A 3VLWA 2ALUA 3CI8A 3E4RA 1US5A 4NTLA 5H8FB 2V25A 2AL5A 3KFMA 4DE8A 2HAUA 3IOTA 1D9YA 3ONMA 4G4PA 1B1HA 2VGQA 2ZYKA 2I4BA 4AB6A 4X1DA 4Z0IA 3IO4A 4H6DA 3RTFB 1ZIUA 2I6EA 5AE4A 3C4MA 4OETA 1B0HA 3O28A 2XXQA 1XHYA 3KN8A 4QSCA 3SEVA 4RJZA 4H65A 3N6TA 1XT8A 3OOAA 4H5GA 1HSJA 1B51A 3VV5A 2Y7IA 1F9BA 1MQHA 1MXUA 3LSFB 1LAFE 3R7XA 3RY3A 3T66A 4EXLA 4YICA 1ZLQA 1VSOA 2DE4A 2XXXA 1EU8A 4JWYA 4KPTA 1ZKBA 3MWBA 4NF5A 4U4XA 1USYE 5FTHA 1Q35A 5TU0A 2Q8JA 3PUZE 1JQFA 4GXAA 4ZDMA 5I2NA 3MP8A 1D9VA 3DELB 1I6BA 2H9BA 2UYFA 5CMKA 1RYXA 1R6ZA 1CE2A 4M4GA 3CFXA 4G68B 3RLFE 1B7UA 4DCXA 5I57B 1DSNA 4JXIA 1PBPA 1LB8A 1QJMA 2Z8EA 3TELA 4HCYA 2XXUA 4YU0A 3U1OA 5JEIA 4QSEA 3G3HA 5DEXA 1S9TA 4U4SA 4OQOA 4X9TA 4ZEBA 3LC8A 4XXUA 3RN8A 1B5HA 3IB0A 2OJTA 3C9HA 3QAXA 5H8NB 2I48A 3K6XA 1FTMA 2CZLA 1BKAA 1MQDA 3O2AA 2UXAA 1B0LA 4YKKA 5FHMA 1MY0A 5ITPA 1UTBB 4LUBA 1FQFA 3CRBA 4NWCA 1QKAA 2RF1A 2I3VA 1P1UA 1LFIA 3S9NC 1Y4CA 4F1UA 4QF9A 3DP6A 1MY1A 1XS5A 2YJPA 4G8HA 4XKPA 1IXIA 1LCTA 4N07A 4NF4B 4EUOA 1AH5A 4H1XA 3K4UA 5ITOA 4ZEKA 1NH8A 1OIBA 3MJNA 4OENA 2ZNSA 3HHFA 1MY3A 3T93B 3TTLA 1B3GA 3IR1A 4THIA 4BDOA 2R6GE 3PUXE 2XD2A 2DE2A 3M8UA 1MXZA 2F97A 3PD8A 1SI1A 3QXMA 2HQ0A 3KZGA 1MG1A 4NWDA 3TCFA 3G3FA 4DIGA 1MM7A 3N5LA 4U21A 4YMBA 2OBGA 3EF7A 1LAGE 4KD5A 4XKNA 3B6WA 3HPIA 2XXRA 3WAFA 3MP6A 5FTIA 4F1YA 4IO2A 4LATA 2F8DA 3A09A 3MBPA 3N26A 1XVYA 1SBPA 4LONB 4RK9A 2LAOA 2Q2CA 2R9JA 3S2VA 5I58A 2B3FA 2CMOA 1H45A 2FA7A 1DTZA 1LBCA 1ZTYA 3KJ7A 3LUYA 1MPDA 4OMBA 3FJ7A 4R2BA 3S4UA 1J1NA 4TOZA 5CMCA 3VXCA 2RKMA 4JWOA 4R74A 2B65A 4ZZAA 3C32A 4O3BA 4NF6A 3Q27A 3ZSFA 1JEVA 5L9SA 3E3KA 3GZGA 4YAHX 5ELVA 3OXNA 3IJXB 1Y20A 2P2AA 1ZBMA 3IB1A 4G2ZA 4MBPA 4NEDA 4GOTA 3QYTA 2NWJA 2Q88A 4IO5A 2NVUB 3SDFA 4OXVA 5K2XA 4BDMA 4F39A 5H8SA 5HPQA 3KOSA 3MVXA 4IY6A 1AIVA 3M3FA 3PUWE 2O68A 1NNPA 2O51A 3SEXA 3PUYE 4F3SA 3PPNA 5TP9B 3H6TA 4PETA 3TFLA 1WODA 2O7IA 2F7CA 3MW0A 4H8IA 1LFHA 1B2HA 3UORA 1O7TA 1IITA 4QHQA 3UGWA 1QUKA 4ESXA 5ICQA 4LA9A 1BP5A 4JBZA 2X26A 3I6VA 3PPPA 4FEDA 2W7YA 5I2KB 1SYHA 3MAMA 4ZEFA 4ELOA 4F3BA 3AXFA 1MPCA 1HSLA 3T96B 4K3FA 4X48A 1B7HA 3PD9A 5I84A 1PB7A 3C33A 2X7PA 1OMPA 3FGSA 4R72A 4P0GA 3TKDA 3U8QA 3N6UA 5AA4A 2REGA 1SVXB 4IO3A 1NKXA 2UYEA 5L9OA 4U1ZA 4X1BA 3FJGA 3UN6A 2NUVA 4TLMB 1DOTA 1LGBC 1M5FA 3CFLA 3RQTA 4PFTA 3D4GA 5H8HB 3VFJA 1US4A 5FHOA 4R6YA 3TQWA 5I2KA 2UVGA 5ICTA 2Q9TA 2F6GA 3ILUB 4MH5A 1IXGA 2Z23A 1TFAA 1LAHE 4ELQA 1JVXA 1NNTA 4FIMA 2H98A 2F78A 1URSA 4OVJA 1PEBA 4R2FA 2DYXA 2RC9A 5DVJA 2DOJA 4ONYA 3PPOA 5DEXB 5EHSA 1L5TA 3H06B 1ZMGA 3EHUA 1SI0A 2F6PA 3T9UA 4NF8B 1I69A 5I59A 1B40A 3TODA 2G29A 1P1WA 5A5XB 5DVIA 2DXYA 4LP2B 1QUIA 3PMVA 3PU5A 1GVCA 2OZZA 1P99A 1S50A 4ZE9A 2F35A 4LZ7A 4DCYA 5CM6A 1FW0A 3M3KA 4U22A 4P11A 1I6AA 3O6HA 4BDLA 3MUQA 3RT6B 1EZOA 3FD3A 4H67A 3WAEA 1MDP1 3FV2A 2DS9A 1OVTA 3MVYA 3SERA 2HZLA 1B1XA 1PB8A 4OEVA 5TP9A 3CFZA 3RTWB 1Y9UA 3THIA 5KCJB 1OVBA 2RCBA 1Y1ZA 3FVGA 1H43A 3TTRA 1R9QA 5B7DA 2BJJX 1M5BA 5ISUA 2I3WA 3FZVA 1XOCA 3ILTB 3MVWA 3QK6A 4GD5A 3K2DA 3PMXA 1LBBA 3H6WA 3K02A 4KR5A 2QMXA 1IQ7A 1P1OA 5DYHA 4GLIA 4RY1A 2XXYA 4OYVA 3UIFA 4UACA 2NXOA 2RINA 3C31A 3OO6A 2XHDA 4ELRA 2Q89A 4QRZA 1NH7A 2F7AA 3TYHA 2XXWA 1YCJA 4KCDA 3B6TA 4KYSA 1PBQA 4MFIA 3QSLA 1URDA 1LB9A 4OERA 4GWOA 3SEUA 1YTVA 4WEDA 3TDJA 3TMGA 4PFUA 3W9WA 4AQ4A 2AL4A 4LZ8A 3DM0A 4NF6B 2O84X 2DVCA 1B5JA 2PMSA 2ZYNA 1ZJLA 1GGGA 2ZXTA 3G7WA 4DLDA 4H0WA 3LSLA 1M5EA 3MC2A 2ESNA 3UP9A 5IKBA 1Q1KA 1R9LA 2DWIA 2XX8A 3HN0A 4RK2A 3KOTA 4O3AA 1B46A 1B3FA 1Z7NE 3A3UA 2VP1A 3FXUA 2H99A 2O7UA 4RPNA 4YKIA 1B3HA 4JB7A 1GR2A 4JDFA 4QSDA 1EZPA 1MRPA 4GXSB 2H25A 1URGA 4NF8A 4OFJA 2GRVA 3KBRA 3G3JA 1N04A 4FAJA 2ANJA 2Z8FA 1FQAA 1A7LA 2ZMBA 4OZ9A 1DPPA 2A5TB 3KEIA 1FTJA 1FQDA 3TTMA 4GVOA 4UA8A 2DQVA 3EPEA 4ELPA 4ISUA 3OSRA 1N7WA 2QMWA 4NMYA 3A3CA 1D4NA 2PX1A 4E0WA 4I62A 3K1MA 4BDRA 2GH9A 4GRKA 3C36A 3QIMA 4ZEIA 3IB2A 2D21A 3OO7A 4FE8A 4R9FA 3KN7A 3RGYA 3VLUA 3U72A 1B4ZA 2XXPA 3QUJA 4IO4A 4Q5TA 3SESA 4G68C 2UVJA 4F31B 1POY1 2G93A 1MXXA 4R9GA 5JTYB 4F19A 4ZECA 5AA2A 1VFDA 5H8NA 3H4ZA 4OESA 2REJA 3D4CA 3OO9A 5JTYA 5F7VA 1PC3A 2HEUA 1OQGA 1UTBA 1QULA 3E9XA 4H5FA 4N13A 4DZ1A 4EF2A 1I6QA 3KSJA 1EH3A 1UTHA 1FTOA 1FTLA 1O63A 1SYIA 3TTKA 1MPBA 3CG1A 4EQBA 1B7ZA 3N94A 4M1VA 3C34A 3VXBA 1USYH 5AA1A 1A40A 4LZ5A 1H44A 1SW1A 4Q8RA 3OD7A 1N84A 3K6WA 4GL0A 2A5TA 3S9EA 1MQJA 1SW2A 2O6AA 1TT1A 4JSDA 2P0SA 4YB6A 5HBCA 5I56B 4G68A 5I57A 4MLQA 5FHNA 1R1NA 3KJTA 3OELA 4EQ9A 3IK6B 1XC1A 3QUFA 4OWDA 4I9DA 3SEWA 1ELJA 2FYIA 3TQLA 2PT1A 1D3KA 1UTHB 4KYDA 2F34A 4DXCA 3ECRA 4G77A 4KFQA 4IB2A 4NE4A 1SQYA 2XXTA 4P0IA 3TTNA 3G3KA 3F11A 2H4IA 4LQ5A 3B7DA 2XXIA 2Y7KA 4Q30B 4RXLA 2HFBA 1NMUA 2DWAA 4KHZE 4U23A 3V8XB 4F22A 1LLSA 2HAVA 3O66A 5LOMA 2ONSA 3MPLA 5B70A 4HW8A 3ZKKA 3GBBA 5CBRA 1H76A 5JK4A 1QKBA 3FVKA 4C1TA 4ECFA 5CMBA 4MF3A 1A8EA 2DSFA 1FCKA 2FNCA 5L9MA 2GHBA 5KDTB 3B6QA 4QFNA 1MQGA 1XVXA 5L8DA 2OWSA 2PBWA 2V84A 3PPRA 5KDTA 3HO7A 3K1PA 4OFOA 3FVNA 1SW4A 1Y3NA 3OEMA 3MZBA 5H8FA 1Y1MA 3HV1A 3O97A 1GV8A 3FXRA 4QFPA 1B05A 3MP1A 4R73A 5I56A 3TUSA 3K6UA 5KCJA 1HSEA 3FVOA 4OFLA 3FIRA 1JW4A 1RYOA 3FJMA 4MLVA 4HS7A 4G8NA 4O3CA 5CMMA 3USDA 1AOVA 3T9HB 1NNFA 1SW5A 1B9JA 5DT6A 4YMAA 2OWTA 1N76A 4L17A 3KG2A 2QL3A 3BFTA 4FJPA 1O64A 4FEBA 3EN3A 1JEUA 4PFYA 1Y4TA 2DE3A 2HZKA 3K0VA 4GQOA 4NF4A 2YLNA 4XKRA 3S9MC 3SKPA 4F3PA 3EHSA 4YZZA 5KZTA 4IGRA 4I8CA 5TPAB 3IX1A 4OTEA 4KCCA 2AIXA 1M5CA 2I58A 3U94A 4LVQA 3LSWA 1MS7A 2P1SA 5BUUA 5AA3A 5I58B 1TFDA 3UK4A 2QS4A 4TQUQ 2XX9A 4ZE8A 2E1SA 5BWJA 1N7XA 3BFUA 1NL5A 3L6HA 3OSQA 3GLBA 4E0XA 2Y7WA 3CSBA 3EHTA 3Q25A 3VLVA 3GBAA 4QFLA 2VOZA 3SEYA 5H8QB 2RC7A 1N3WA 4F1VA 2V3UA 3K01A 3TCHA 1BTJA 1NNKA 3MVZA 5EHMA 5TPAA 1DMBA 1B4HA 5H8QA 3RPWA 2V3TA 4EQ7A 2PT2A 3Q26A 5I59B 3FXQA 1M5DA 4R6KA 2QS1A 3O9PA 1FQBA 3OENA 4IO6A 3UA8A 1B6HA 4IO7A 3OO8A 4FORA 3EQ1A 3OEKA 5I2NB 1P1NA 2XXHA 4IGTA 1IEJA 2O1LA 2QS2A 3FASA 2E0SA 4R6HA 4ZEDA 3H6VA 3ZKLA 3E13X 2Q2AA 4LQ2A 3R6UA 1EZ9A 3BKIB 4POWA 2IEEA 3FUZA 3H03A 3L6GA 3G3IA 2GHAA 1BIYA 4TLLB 1MH3A 1Z7ME 3GXAA 1OLCA 1BLFA 1TXFA 1N0TA 1UIUA 2THIA 2WKYA 3IJOB 4IY5A 2OLBA 4PFWA 3K1NA 1VR5A 2YPNA 3MPKA 2ZYMA 3JV9A 3T22A 3JYRA 5AA4B 5J1DA 1IZ1A 3RNNA 2PYYA 3W9VA 2QS3A 2GFEA 4R75A 1B58A 3RUMA 4ZS9A 1H3DA 4GIZA 3KSXA 2DWJA 3U93A 3I3VA 3IOUA 3M3LA 2V3QA 2R71A 1JVYA 3CVGA 3H7MA 3I5OA 4XTCQ 5CRYA 1IUDA 2QRYA 3IOVA 4BDQA 3T9VA 1LAXA 4XIGQ 4GF8A 4U2RA 5F1QA 5AA2D 1B52A 5CC2A 4KI0E 2KLFA 2VD2A 1FQCA 3IL1B 1JNFA 2DVZA 4RPOA 4OEUA 3PGFA 1AL3A 4U1OA 4XKQA 3W15C 4F3GA 4FATA 5IAIA 1B3EA 3HCQA 1AMFA 3IO6A 4NF5B 4EF1A 1QUJA 4QFKA 1DTGA 1A99A 1GTKA 1N3XA 4JSOA 2QJEA 3O29A 4DXBA 3JZJA 2Y7PA 1A55A 2Z8DA 3K00A 3PUVE 4PQJA 3KN3A 1Y3PA 2OK2A 2PVUA
chains in the Genus database with same CATH superfamily
1OQHA 1MH4A 4PFRA 1LBWA 2ABHA 4ZZEA 3H6UA 3TPAA 4N6KA 1JP4A 3PMWA 3LBSA 4PP0A 2O1MA 2F7BA 2XXVA 3MQ9A 3CR9A 3TAJA 4JWXA 3T9XB 2ZNUA 1P1QA 4F29A 4BLAA 4C0RA 3PPQA 2I4CA 3KC0A 1FPEA 3V5AA 3BIGA 1B3LA 3IAZA 2DP8A 4BDNA 3MZ9A 1QVSA 2CEXA 2VHAA 1B32A 4WEPA 4MNCA 5M2VA 1IMAA 1Q9DA 4YKJA 3VE1B 1PB9A 2ZNTA 1MY4A 2B4MA 2IA4A 2VD3A 2WYPA 1JETA 3RPLA 2ALUA 1US5A 2AL5A 3IOTA 3ONMA 4AB6A 1B1HA 2VGQA 2ZYKA 3RPLB 4X1DA 4XFEA 5AE4A 4HXVA 1G0HA 3NOHA 1HSJA 1CNQA 4EXLA 1VSOA 4U4XA 1QGXA 1Q35A 3PUZE 2GQ1A 3MP8A 1I6BA 4N91A 2H9BA 5LTCA 4G68B 5I57B 4JXIA 1LBVA 1FPIA 3TELA 4PC9A 1S9TA 1B5HA 3IB0A 3QAXA 2CZLA 3O2AA 1UTBB 1FQFA 1P1UA 1Y4CA 3U65A 4NF4B 4I40A 3SZPA 4THIA 2R6GE 2DE2A 1SI1A 2HQ0A 3N5LA 3MP6A 4F1YA 4IO2A 4LATA 3N26A 1KA1A 1XVYA 4OMBA 5TP9B 1DTZA 4R2BA 5CMCA 2RKMA 4JWOA 4O3BA 5ELVA 1Y20A 4G2ZA 4MBPA 3SERA 4GOTA 2NVUB 4NF0A 3M3FA 3SEXA 3H6TA 3IFAA 3MW0A 1LFHA 1O7TA 4ESXA 2R8TA 1BP5A 3I6VA 3PPPA 2W7YA 4F3BA 4ZEFA 4ELOA 5I84A 2VT5A 1HSLA 4X48A 2X7PA 1OMPA 2QVVA 4P0GA 3N6UA 1NUXA 5L9OA 3UN6A 3RQTA 4R6YA 2Q9TA 2F6GA 1JVXA 1NNTA 4GBVA 4N17A 2RC9A 2DOJA 1L5TA 3H06B 2F6PA 3T9UA 1B40A 3TODA 5EYGA 3LV0A 2P3VA 1FRPA 2CEYA 5A5XB 1IMBA 3KC1A 4LP2B 3PMVA 2F35A 5CM6A 1I6AA 3MUQA 1NV0A 2DS9A 2HZLA 5TP9A 4N8YA 3RTWB 3CFZA 1Y9UA 4OVSA 1Y1ZA 4P56A 2BJJX 2I3WA 5ET7A 3QK6A 4GD5A 1NUYA 4KR5A 1LEVA 3UIFA 1YYZA 2NXOA 2XHDA 2Q89A 2XXWA 4MFIA 3SEUA 1NUZA 3DM0A 4H45A 2DVCA 1B5JA 4GWSA 1M5EA 2XX8A 3KOTA 4O3AA 1B46A 4YKIA 1EZPA 4GXSB 4OFJA 1K9YA 3KBRA 3G3JA 4FAJA 2ZMBA 2Z8FA 2A5TB 1FTJA 2ZZXA 4O7IA 4UA8A 2DQVA 1N7WA 1D4NA 2PX1A 1NUWA 2GH9A 4GRKA 1FPGA 2D21A 4FE8A 1B4ZA 3QUJA 3SESA 2G93A 4F19A 4ZECA 5JTYA 2HEUA 1I6QA 1SYIA 3OD7A 4GL0A 2A5TA 1SW2A 4YB6A 1TT1A 2P0SA 5I56B 5FHNA 3KJTA 4EQ9A 4N4UA 4DXCA 4IB2A 1SQYA 3TTNA 4LQ5A 3B7DA 4Q30B 1NMUA 2FIEA 1LLSA 2HAVA 5B70A 3ROJA 2FNCA 1MQGA 2V84A 3HO7A 3HV1A 4QFPA 3TUSA 5KCJA 1JW4A 3FJMA 3USDA 1AOVA 1NNFA 5DT6A 4L17A 2QL3A 3BFTA 5ET5A 4FEBA 3S9MC 2AIXA 4LVQA 3LSWA 5BUUA 4TQUQ 4ZE8A 2XX9A 5BWJA 4XEQA 2RC7A 2V3UA 3K01A 3MVZA 1DMBA 1B4HA 3RPWA 2V3TA 5I59B 3FXQA 1M5DA 2QS1A 1FTAA 2Q2AA 1EZ9A 3L6GA 3H03A 3G3IA 3GXAA 4IY5A 4DI4B 3MPKA 3JYRA 1IZ1A 3W9VA 4ZS9A 4GIZA 3U93A 3IOUA 3M3LA 2R71A 1JVYA 3CVGA 4XTCQ 5CRYA 1IUDA 2QRYA 4I3EA 4U2RA 1B52A 2KLFA 3IL1B 4RPOA 3W15C 1FBPA 3HCQA 1AMFA 4EF1A 1N3XA 4DXBA 2XWOA 3JZJA 2Z8DA 3K00A 3DLNA 2I0CA 3P7IA 1NFTA 4OHNA 2O69A 3MZ1A 5EYFA 3TCGA 2ZZWA 1WDNA 4FBPA 4YB7A 4EDPA 3TZAA 5CI5A 2M8CA 4G8MA 2HXWA 4RNSA 1NV6A 4OVPA 3CIJA 4POXA 3RT8A 2A5SA 4RA1A 4JVIA 1CB6A 1A8FA 4EXKA 2ONKE 1Y3QA 3ODBA 2P3NA 4FECA 5A5XA 2ZZVA 4PE5B 1RKMA 3PTYA 1MM6A 2KR0A 1NV2A 4H8JA 4YMAA 3TCFA 3BBRA 1IXCA 4F2OA 2AYSA 5IZ1A 1FPFA 2L5VA 1POTA 1YAEA 2H5YA 3CSGA 2UVIA 5A5LA 4GL8A 3V89B 5K2YA 1TWYA 3OMBA 1MDQA 3HSTA 1IXHA 4WXJA 4Z7EA 1ZU0A 4XF5A 4YKPA 2D3IA 4GFRA 2NOOA 4PDDA 4QFOA 3U92A 1II5A 5H8FB 2V25A 2HAUA 3T0JA 1D9YA 3RTFB 1ZIUA 1B0HA 3O28A 2XXQA 3SEVA 1B51A 5T3JA 2Y7IA 1MQHA 1MXUA 3RY3A 3R7XA 3T66A 2XXXA 4JWYA 1EU8A 4KPTA 1ZKBA 5FTHA 5TU0A 4GXAA 4ZDMA 5ESYA 2UYFA 5CMKA 1R6ZA 4DCXA 3CFXA 2HXRA 1PBPA 2Z8EA 4HCYA 5JEIA 5DEXA 4ZEBA 1FBCA 2OJTA 3S9NC 4QF9A 1MY1A 1XS5A 4G8HA 1LCTA 1AH5A 1NH8A 3T93B 2ZNSA 3IR1A 3PUXE 2XD2A 1MXZA 3QXMA 3KZGA 4U21A 4YMBA 2OBGA 4PAIA 4XKNA 1SBPA 4PGNA 2Q2CA 2R9JA 1H45A 3T22A 1LBCA 1MPDA 1J1NA 4R74A 4MJOA 1JEVA 3GZGA 1ZBMA 2Q88A 4IO5A 4BDMA 3SDFA 4OXVA 4F39A 3KOSA 3MVXA 2O68A 1NNPA 3PUYE 3PPNA 3UORA 4OVRA 1IITA 3UGWA 4JBZA 2X26A 5I2KB 4K3FA 5I7IA 3TKDA 3U8QA 1SVXB 4IO3A 4U1ZA 4HE0A 2NUVA 3D4GA 5H8HB 3VFJA 5LDZA 1EYKA 2UVGA 2Z23A 4ELQA 4O8MA 4FIMA 2F78A 4OVJA 1FPDA 5DVJA 5EHSA 3EHUA 1LBZA 2XXKA 1QUIA 3PU5A 1P99A 1S50A 1FW0A 4U22A 1EZOA 4G61A 3MVYA 1B1XA 3THIA 3FVGA 3TTRA 4MNIA 4OVTA 2FBPA 5ISUA 4KXPA 3PMXA 3H6WA 3K02A 2QMXA 4GWUA 4RY1A 4UACA 2RINA 1FPJA 2F7AA 3TYHA 4KYSA 4OERA 4GWOA 4PFUA 4AQ4A 4LZ8A 2O84X 2ZYNA 1GGGA 3G7WA 4DLDA 1Q1KA 2VP1A 2H99A 1B3HA 2H25A 4PTKA 2ANJA 3KEIA 1FBDA 1FQDA 2XWIA 1FBHA 3TTMA 4MIJA 1G0IA 3IB2A 4R9FA 3KN7A 3U72A 2XXPA 4Q5TA 4G68C 2UVJA 4F31B 1MXXA 1VFDA 4OESA 3D4CA 3OO9A 5F7VA 1PC3A 1UTBA 3RYDA 4N13A 4EF2A 1FTLA 2KQZA 3CG1A 4EQBA 1USYH 1IMEA 3K6WA 1MQJA 4JSDA 5HBCA 1NV4A 3QUFA 4OWDA 4I9DA 3TQLA 2PT1A 1UTHB 4G77A 4P0IA 3F11A 2H4IA 5ET8A 1D9QA 2XXIA 4RXLA 3O66A 5LOMA 5CBRA 3GBBA 1QKBA 4ECFA 1A8EA 3T1BA 5KDTB 3B6QA 4QFNA 3PPRA 1Y3NA 3O97A 1GV8A 3FXRA 4R73A 1AWBA 1HSEA 3FIRA 4PCDA 1O64A 4PFYA 3VXCA 4GQOA 3K0VA 3MYUA 3EHSA 4MMPA 2HPGA 2I58A 3U94A 1MS7A 2P1SA 4NX1A 5AA3A 5I58B 2QFLA 3BFUA 1NL5A 4E0XA 3Q25A 4MX6A 5IZZA 1FBEA 5H8QB 1N3WA 3TCHA 4NG7A 5H8QA 4R6KA 3O9PA 1FQBA 3UA8A 1B6HA 4IO7A 3OO8A 4FORA 3EQ1A 5I2NB 1FBFA 2JJKA 2V4CA 1IEJA 2O1LA 2QS2A 3BKIB 2IEEA 3FUZA 2GHAA 1BLFA 2THIA 1LBXA 4PFWA 4PAKA 1VR5A 5AA4B 2PYYA 4MCOA 2GFEA 1B58A 3RUMA 3I3VA 2V3QA 4NQ8A 3I5OA 4BDQA 5AA2D 4KI0E 1FQCA 2WEFA 1FBGA 4DI3D 4FATA 3O29A 1A55A 1Y3PA 5I56A 2PVUA 3IORA 3PV0E 4DXUA 1LSTA 4Q0CA 3VDFA 4OA4A 1YPNA 4AB5A 1ATGA 1IIWA 2CZIA 2Y7RA 1S7YA 3SETA 2Y84A 1KZ8A 3VVDA 4HTGA 2QSXA 1MXWA 2V93A 3V83A 4N6PA 1UQWA 2RCAA 4C1UA 4KQPA 1VE4A 3LR1A 3O6GA 3HHGA 2DWHA 4F2QA 2F36A 2VPOA 2WBBA 1JW1A 1QW0A 5DTBA 3VVFA 1B5IA 4GWXA 1FPBA 5HM4B 2RC8A 1DPEA 4HCWA 3R26A 4ND9A 5DVFA 1MXYA 2X7QA 4I1DA 4GBWA 4PBHA 5H8HA 3ZS6A 4RYAA 1WVJA 2ZYOA 1MXVA 3KGCA 3FATA 1ANFA 5CBSA 1A54A 4P8BA 2HCAA 4WKMA 1PDAA 4YB5A 1FSAA 3VLWA 3E4RA 1FJ6A 4P9KA 2FIXA 2HHMA 3C4MA 4OETA 1XHYA 3KN8A 3N6TA 3OOAA 4H5GA 3VV5A 4YICA 1ZLQA 2DE4A 4NF5A 2Q8JA 1JQFA 1RYXA 1CE2A 1DSNA 2CZHA 1NV7A 2XXUA 4QSEA 4H46A 4X9TA 3LC8A 4XXUA 5H8NB 2I48A 2UXAA 1BK4A 4LUBA 3CRBA 2RF1A 1EYIA 2I3VA 1LFIA 3DP6A 2YJPA 4XKPA 1IXIA 4EUOA 4H1XA 3K4UA 4ZEKA 4OENA 3MJNA 3HHFA 4BDOA 4HE1A 4PF8A 4NWDA 4NAPA 4DIGA 3HPIA 1LBYA 3A09A 3MBPA 4RK9A 5I58A 2CMOA 2FA7A 3LUYA 4PBQA 1ZTYA 1INPA 3FJ7A 3S4UA 4GX6A 4ZZAA 4NF6A 3Q27A 4X8RA 3ZSFA 3KBZA 4YAHX 3OXNA 2P2AA 3IB1A 2NWJA 4NEDA 1SPIA 5H8SA 4IY6A 4F3SA 4PETA 3TFLA 1WODA 2F7CA 4H8IA 5ICQA 4AS4A 4FEDA 1SYHA 3MAMA 3AXFA 3PD9A 1PB7A 3FBPA 3C33A 3FGSA 5AA4A 1NKXA 4PDHA 4X1BA 3FJGA 4TLMB 1DOTA 1M5FA 3CFLA 4N15A 4PFTA 1KA0A 5FHOA 3TQWA 3ILUB 4MH5A 2H98A 1URSA 1ZMGA 5IM2A 1SI0A 4NF8B 1I69A 1DK4A 1P1WA 5DVIA 2DXYA 1GVCA 2OZZA 4P11A 4BDLA 3O6HA 3RT6B 3FV2A 1OVTA 4P47A 4OEVA 5DW8A 1OVBA 3ILTB 3K2DA 4MAGA 1LBBA 1P1OA 4GLIA 4ELRA 3OO6A 4QRZA 1YCJA 4KCDA 3B6TA 3QSLA 1URDA 1LB9A 3TDJA 3W9WA 1YTVA 4WEDA 2AL4A 4NF6B 2ZXTA 3LSLA 2ESNA 1R9LA 3HN0A 4RK2A 3A3UA 1B3FA 1Z7NE 3FXUA 4JB7A 4JDFA 4QSDA 1MRPA 1URGA 4NF8A 2GRVA 1N04A 1FQAA 1A7LA 1DPPA 1RDXA 4GVOA 4ELPA 3E78A 4ISUA 1NV1A 4NMYA 3A3CA 4I62A 2B4LA 3C36A 3A29A 4ZEIA 3VLUA 4IO4A 5AA2A 5H8NA 3HFUA 4NHBA 1OQGA 3E9XA 2F3DA 3KSJA 1EH3A 1UTHA 1O63A 1FTOA 5I59A 3TTKA 1MPBA 1B7ZA 3N94A 5AA1A 1H44A 4Q8RA 3S9EA 2O6AA 1R1NA 3IK6B 1XC1A 3SEWA 2FYIA 4KYDA 3ECRA 4KFQA 4NE4A 2XXTA 3G3KA 4PAFA 2Y7KA 2DWAA 4KHZE 4U23A 3V8XB 2ONSA 5JK4A 2DSFA 1EYJA 5L9MA 2GHBA 4AS5A 1XVXA 2PBWA 2PFZA 3K1PA 1SW4A 2OWZA 3OEMA 4X04A 3MZBA 5H8FA 1Y1MA 5EQ8A 1B05A 3FVOA 4MLVA 4G8NA 2OWTA 3B8BA 1N76A 3MSTA 5I5PA 3EN3A 1Y4TA 2HZKA 4F3PA 4YZZA 4IGRA 4I8CA 4N8GA 4KCCA 1M5CA 2FHYA 2QS4A 4O7MA 2E1SA 3L6HA 3GLBA 3CSBA 1YZ0A 3GBAA 4QFLA 2VOZA 4F1VA 1DBZA 1BTJA 1NNKA 5TPAA 1IMDA 2PT2A 3Q26A 2DDKA 3OENA 4IO6A 3OEKA 1P1NA 1NV5A 3FASA 4R6HA 2E0SA 3H6VA 4N81A 3ZKLA 4TLLB 1BIYA 1MH3A 1UIUA 2WKYA 3BIHA 3IJOB 2OLBA 3K1NA 2ZYMA 4OVQA 5J1DA 2QS3A 4R75A 1H3DA 3KSXA 4IR8A 1RDYA 3H7MA 2Q8MA 3IOVA 3T9VA 1LAXA 4XIGQ 4GF8A 5F1QA 5KZTA 1JNFA 2DVZA 1AL3A 1B3EA 4NF5B 3IO6A 5ET6A 1QUJA 1DTGA 4JSOA 2QJEA 2Y7PA 4PQJA 2OK2A 1MQIA 3Q28A 2I0BA 1KWHA 2Y5LA 1T0KA 3LUZA 4LN5A 2DXRA 1UIVA 2I49A 1XI6A 2B3BA 1LFGA 1FTKA 3DP4A 4DDDA 5AA2B 3Q29A 2WX9A 5FBPA 2F5XA 2OCUA 1OLAA 4KYEA 1MY2A 2ONRA 1VFEA 4ESWA 2XX7A 3H3GA 1LCFA 2Z22A 3CG3A 3DP8A 3C35A 4JVDA 4EQ7A 5ITPA 3K6VA 4HE2A 3LSXA 1SD3A 1FQEA 3G3GA 2UVHA 2D5WA 3VVEA 3S9LC 3TEPA 2QPQA 1SDXA 3O6IA 3FV1A 2XD3A 4GWYA 1JW5A 3IOWA 4F18A 4NGUA 3CI8A 4DE8A 4NTLA 3KFMA 4G4PA 2I4BA 4Z0IA 3IO4A 2BJIA 4H6DA 2I6EA 4QSCA 4PF6A 4RJZA 4H65A 1XT8A 1FPKA 4UABA 1F9BA 4GX3A 3LSFB 1LAFE 3MWBA 1USYE 5I2NA 1D9VA 3DELB 3ISPA 4M4GA 3RLFE 1B7UA 1YXIA 1LB8A 1QJMA 4MEVA 4YU0A 3U1OA 1IMFA 3G3HA 4N6DA 4U4SA 4OQOA 3RN8A 3C9HA 1RDZA 4PGPA 3K6XA 1FTMA 4YKKA 1BKAA 1MQDA 1VDWA 5FHMA 1B0LA 1MY0A 4NWCA 1QKAA 1DCUA 4F1UA 4N07A 3FXBA 5ITOA 1OIBA 2XWKA 2Y5KA 3TTLA 1MY3A 1B3GA 3M8UA 3PD8A 2F97A 1MG1A 3G3FA 1MM7A 3EF7A 1LAGE 4KD5A 3B6WA 2XXRA 3WAFA 5FTIA 2F8DA 3D1RA 4LONB 2LAOA 3S2VA 2B3FA 3KJ7A 4TOZA 2B65A 4GX4A 2F3BA 3C32A 5L9SA 3E3KA 3IJXB 3SEYA 3QYTA 5K2XA 5HPQA 1AIVA 3PUWE 2O51A 2O7IA 1B2HA 4QHQA 1QUKA 4LA9A 5I3SA 5F24A 4GWZA 1MPCA 3T96B 1B7HA 1K9ZA 4R72A 2REGA 4MNPA 2UYEA 3QMFA 1LGBC 1US4A 3GYYA 5I2KA 5ICTA 1IXGA 1TFAA 1LAHE 5IZ3A 4GWWA 4PFIA 1PEBA 4R2FA 2DYXA 4ONYA 3PPOA 5DEXB 4QXDA 4JVCA 4MHFA 2G29A 3B50A 5EQ9A 4ZE9A 4LZ7A 2CZKA 4DCYA 3M3KA 3FD3A 4O94A 4H67A 3WAEA 1MDP1 1PB8A 4PFBA 5KCJB 2RCBA 5EQ7A 1H43A 1R9QA 5B7DA 3E79A 1M5BA 3FZVA 1XOCA 3MVWA 1FPLA 1IQ7A 5DYHA 2XXYA 4OYVA 3C31A 1NH7A 1PBQA 3TMGA 2OX3A 5EYHA 3IFCA 2PMSA 1ZJLA 4P1LA 3CHGA 4H0WA 5IKBA 3MC2A 3UP9A 2DWIA 2O7UA 4RPNA 5IGAA 1GR2A 1NV3A 2PCRA 4OZ9A 4QBAA 2QVRA 3EPEA 3OSRA 2QMWA 2XWVA 4E0WA 3K1MA 4BDRA 3QIMA 3OO7A 3RGYA 1POY1 5JTYB 4R9GA 3H4ZA 4P3LA 2REJA 2FVZA 1QULA 4H5FA 4M1VA 3VXBA 3C34A 2WYKA 1A40A 4LZ5A 1SW1A 1N84A 4G68A 5I57A 4MLQA 3OELA 1ELJA 1D3KA 2F34A 5IZ3B 2HFBA 4F22A 3MPLA 4HW8A 3ZKKA 1H76A 3FVKA 4C1TA 5CMBA 4MF3A 1FCKA 4P1EA 5L8DA 4OANA 2OWSA 5KDTA 4OFOA 3FVNA 4I3YA 2QVUA 3MP1A 3K6UA 4OFLA 1RYOA 2WBDA 4HS7A 5CMMA 4O3CA 3T9HB 1SW5A 1B9JA 3KG2A 4FJPA 1JEUA 4XKRA 2DE3A 4NF4A 2YLNA 3SKPA 1NI9A 5TPAB 3IX1A 4OTEA 1TFDA 3UK4A 1N7XA 3OSQA 4DZ1A 5J16A 2Y7WA 3EHTA 2Q74A 5EHMA 5EQAA 4PE3A 4NN3A 1IMCA 2XXHA 4IGTA 4ZEDA 3E13X 4LQ2A 3R6UA 4POWA 1Z7ME 1OLCA 1TXFA 3VLVA 1N0TA 2PFYA 2YPNA 3JV9A 3RNNA 3EKIA 2DWJA 2XA5A 1FJ9A 2VPNA 2MKZA 5CC2A 2VD2A 4XKQA 4OEUA 3PGFA 4U1OA 5IAIA 4F3GA 4QFKA 1A99A 3PUVE 3KN3A 1GTKA
chains in the Genus database with same CATH topology
3DLNA 1MQIA 1OQHA 2I0CA 3IORA 3Q28A 1MH4A 2I0BA 3PV0E 1KWHA 4DXUA 1T0KA 1LSTA 4Q0CA 2ABHA 2DXRA 1UIVA 3P7IA 4ZZEA 3VDFA 1NFTA 2I49A 3H6UA 4OHNA 1YPNA 4AB5A 2O69A 1ATGA 3MZ1A 5EYFA 3TPAA 3TCGA 1IIWA 1WDNA 4YB7A 4EDPA 2B3BA 5CI5A 3PMWA 3LBSA 3TZAA 4PP0A 2M8CA 1LFGA 2O1MA 1S7YA 2F7BA 2XXVA 2Y7RA 2Y84A 3SETA 3MQ9A 3VVDA 4HTGA 4G8MA 2HXWA 2QSXA 1MXWA 2V93A 3CR9A 1FTKA 3DP4A 3TAJA 3V83A 4DDDA 4JWXA 4N6PA 4RNSA 1UQWA 3Q29A 5AA2B 2RCAA 4C1UA 4KQPA 3T9XB 1VE4A 2ZNUA 3LR1A 3O6GA 3HHGA 2DWHA 1P1QA 2F5XA 3CIJA 4POXA 4BLAA 4F29A 2OCUA 1OLAA 4C0RA 4KYEA 2A5SA 4RA1A 3PPQA 2I4CA 3RT8A 1CB6A 1A8FA 4EXKA 1MY2A 2ONRA 2ONKE 1Y3QA 4F2QA 1VFEA 4ESWA 2F36A 3V5AA 1JW1A 1QW0A 3ODBA 2XX7A 3H3GA 5DTBA 1B3LA 1LCFA 4FECA 5A5XA 3VVFA 3IAZA 1B5IA 2Z22A 3CG3A 4PE5B 1RKMA 1MM6A 2DP8A 4BDNA 5HM4B 3MZ9A 2RC8A 1DPEA 1QVSA 2VHAA 1B32A 3BBRA 1IXCA 3C35A 3DP8A 4H8JA 2AYSA 3R26A 3K6VA 4HCWA 4WEPA 3LSXA 5M2VA 4F2OA 4ND9A 5DVFA 1SD3A 1FQEA 1POTA 3G3GA 1YAEA 2UVHA 2D5WA 1MXYA 2H5YA 2UVIA 3CSGA 3VVEA 3S9LC 4GL8A 2X7QA 3V89B 3TEPA 5K2YA 1TWYA 4I1DA 4YKJA 3VE1B 1PB9A 2QPQA 3OMBA 1MDQA 2ZNTA 1SDXA 5H8HA 1MY4A 3ZS6A 3HSTA 3O6IA 1WVJA 1IXHA 2ZYOA 3FV1A 1MXVA 2IA4A 4RYAA 4WXJA 2XD3A 4Z7EA 3KGCA 3FATA 1JW5A 2VD3A 1ZU0A 1ANFA 4YKPA 2D3IA 5CBSA 4GFRA 1A54A 1JETA 2NOOA 2HCAA 4WKMA 1PDAA 3IOWA 4QFOA 4YB5A 4F18A 3U92A 1II5A 3VLWA 2ALUA 3CI8A 3E4RA 1US5A 4NTLA 5H8FB 2V25A 2AL5A 3KFMA 4DE8A 2HAUA 3IOTA 1D9YA 3ONMA 4G4PA 1B1HA 2VGQA 2ZYKA 2I4BA 4AB6A 4X1DA 4Z0IA 3IO4A 4H6DA 3RTFB 1ZIUA 2I6EA 5AE4A 3C4MA 4OETA 1B0HA 3O28A 2XXQA 1XHYA 3KN8A 4QSCA 3SEVA 4RJZA 4H65A 3N6TA 1XT8A 3OOAA 4H5GA 1HSJA 1B51A 3VV5A 2Y7IA 1F9BA 1MQHA 1MXUA 3LSFB 1LAFE 3R7XA 3RY3A 3T66A 4EXLA 4YICA 1ZLQA 1VSOA 2DE4A 2XXXA 1EU8A 4JWYA 4KPTA 1ZKBA 3MWBA 4NF5A 4U4XA 1USYE 5FTHA 1Q35A 5TU0A 2Q8JA 3PUZE 1JQFA 4GXAA 4ZDMA 5I2NA 3MP8A 1D9VA 3DELB 1I6BA 2H9BA 2UYFA 5CMKA 1RYXA 1R6ZA 1CE2A 4M4GA 3CFXA 4G68B 3RLFE 1B7UA 4DCXA 5I57B 1DSNA 4JXIA 1PBPA 1LB8A 1QJMA 2Z8EA 3TELA 4HCYA 2XXUA 4YU0A 3U1OA 5JEIA 4QSEA 3G3HA 5DEXA 1S9TA 4U4SA 4OQOA 4X9TA 4ZEBA 3LC8A 4XXUA 3RN8A 1B5HA 3IB0A 2OJTA 3C9HA 3QAXA 5H8NB 2I48A 3K6XA 1FTMA 2CZLA 1BKAA 1MQDA 3O2AA 2UXAA 1B0LA 4YKKA 5FHMA 1MY0A 5ITPA 1UTBB 4LUBA 1FQFA 3CRBA 4NWCA 1QKAA 2RF1A 2I3VA 1P1UA 1LFIA 3S9NC 1Y4CA 4F1UA 4QF9A 3DP6A 1MY1A 1XS5A 2YJPA 4G8HA 4XKPA 1IXIA 1LCTA 4N07A 4NF4B 4EUOA 1AH5A 4H1XA 3K4UA 5ITOA 4ZEKA 1NH8A 1OIBA 3MJNA 4OENA 2ZNSA 3HHFA 1MY3A 3T93B 3TTLA 1B3GA 3IR1A 4THIA 4BDOA 2R6GE 3PUXE 2XD2A 2DE2A 3M8UA 1MXZA 2F97A 3PD8A 1SI1A 3QXMA 2HQ0A 3KZGA 1MG1A 4NWDA 3TCFA 3G3FA 4DIGA 1MM7A 3N5LA 4U21A 4YMBA 2OBGA 3EF7A 1LAGE 4KD5A 4XKNA 3B6WA 3HPIA 2XXRA 3WAFA 3MP6A 5FTIA 4F1YA 4IO2A 4LATA 2F8DA 3A09A 3MBPA 3N26A 1XVYA 1SBPA 4LONB 4RK9A 2LAOA 2Q2CA 2R9JA 3S2VA 5I58A 2B3FA 2CMOA 1H45A 2FA7A 1DTZA 1LBCA 1ZTYA 3KJ7A 3LUYA 1MPDA 4OMBA 3FJ7A 4R2BA 3S4UA 1J1NA 4TOZA 5CMCA 3VXCA 2RKMA 4JWOA 4R74A 2B65A 4ZZAA 3C32A 4O3BA 4NF6A 3Q27A 3ZSFA 1JEVA 5L9SA 3E3KA 3GZGA 4YAHX 5ELVA 3OXNA 3IJXB 1Y20A 2P2AA 1ZBMA 3IB1A 4G2ZA 4MBPA 4NEDA 4GOTA 3QYTA 2NWJA 2Q88A 4IO5A 2NVUB 3SDFA 4OXVA 5K2XA 4BDMA 4F39A 5H8SA 5HPQA 3KOSA 3MVXA 4IY6A 1AIVA 3M3FA 3PUWE 2O68A 1NNPA 2O51A 3SEXA 3PUYE 4F3SA 3PPNA 5TP9B 3H6TA 4PETA 3TFLA 1WODA 2O7IA 2F7CA 3MW0A 4H8IA 1LFHA 1B2HA 3UORA 1O7TA 1IITA 4QHQA 3UGWA 1QUKA 4ESXA 5ICQA 4LA9A 1BP5A 4JBZA 2X26A 3I6VA 3PPPA 4FEDA 2W7YA 5I2KB 1SYHA 3MAMA 4ZEFA 4ELOA 4F3BA 3AXFA 1MPCA 1HSLA 3T96B 4K3FA 4X48A 1B7HA 3PD9A 5I84A 1PB7A 3C33A 2X7PA 1OMPA 3FGSA 4R72A 4P0GA 3TKDA 3U8QA 3N6UA 5AA4A 2REGA 1SVXB 4IO3A 1NKXA 2UYEA 5L9OA 4U1ZA 4X1BA 3FJGA 3UN6A 2NUVA 4TLMB 1DOTA 1LGBC 1M5FA 3CFLA 3RQTA 4PFTA 3D4GA 5H8HB 3VFJA 1US4A 5FHOA 4R6YA 3TQWA 5I2KA 2UVGA 5ICTA 2Q9TA 2F6GA 3ILUB 4MH5A 1IXGA 2Z23A 1TFAA 1LAHE 4ELQA 1JVXA 1NNTA 4FIMA 2H98A 2F78A 1URSA 4OVJA 1PEBA 4R2FA 2DYXA 2RC9A 5DVJA 2DOJA 4ONYA 3PPOA 5DEXB 5EHSA 1L5TA 3H06B 1ZMGA 3EHUA 1SI0A 2F6PA 3T9UA 4NF8B 1I69A 5I59A 1B40A 3TODA 2G29A 1P1WA 5A5XB 5DVIA 2DXYA 4LP2B 1QUIA 3PMVA 3PU5A 1GVCA 2OZZA 1P99A 1S50A 4ZE9A 2F35A 4LZ7A 4DCYA 5CM6A 1FW0A 3M3KA 4U22A 4P11A 1I6AA 3O6HA 4BDLA 3MUQA 3RT6B 1EZOA 3FD3A 4H67A 3WAEA 1MDP1 3FV2A 2DS9A 1OVTA 3MVYA 3SERA 2HZLA 1B1XA 1PB8A 4OEVA 5TP9A 3CFZA 3RTWB 1Y9UA 3THIA 5KCJB 1OVBA 2RCBA 1Y1ZA 3FVGA 1H43A 3TTRA 1R9QA 5B7DA 2BJJX 1M5BA 5ISUA 2I3WA 3FZVA 1XOCA 3ILTB 3MVWA 3QK6A 4GD5A 3K2DA 3PMXA 1LBBA 3H6WA 3K02A 4KR5A 2QMXA 1IQ7A 1P1OA 5DYHA 4GLIA 4RY1A 2XXYA 4OYVA 3UIFA 4UACA 2NXOA 2RINA 3C31A 3OO6A 2XHDA 4ELRA 2Q89A 4QRZA 1NH7A 2F7AA 3TYHA 2XXWA 1YCJA 4KCDA 3B6TA 4KYSA 1PBQA 4MFIA 3QSLA 1URDA 1LB9A 4OERA 4GWOA 3SEUA 1YTVA 4WEDA 3TDJA 3TMGA 4PFUA 3W9WA 4AQ4A 2AL4A 4LZ8A 3DM0A 4NF6B 2O84X 2DVCA 1B5JA 2PMSA 2ZYNA 1ZJLA 1GGGA 2ZXTA 3G7WA 4DLDA 4H0WA 3LSLA 1M5EA 3MC2A 2ESNA 3UP9A 5IKBA 1Q1KA 1R9LA 2DWIA 2XX8A 3HN0A 4RK2A 3KOTA 4O3AA 1B46A 1B3FA 1Z7NE 3A3UA 2VP1A 3FXUA 2H99A 2O7UA 4RPNA 4YKIA 1B3HA 4JB7A 1GR2A 4JDFA 4QSDA 1EZPA 1MRPA 4GXSB 2H25A 1URGA 4NF8A 4OFJA 2GRVA 3KBRA 3G3JA 1N04A 4FAJA 2ANJA 2Z8FA 1FQAA 1A7LA 2ZMBA 4OZ9A 1DPPA 2A5TB 3KEIA 1FTJA 1FQDA 3TTMA 4GVOA 4UA8A 2DQVA 3EPEA 4ELPA 4ISUA 3OSRA 1N7WA 2QMWA 4NMYA 3A3CA 1D4NA 2PX1A 4E0WA 4I62A 3K1MA 4BDRA 2GH9A 4GRKA 3C36A 3QIMA 4ZEIA 3IB2A 2D21A 3OO7A 4FE8A 4R9FA 3KN7A 3RGYA 3VLUA 3U72A 1B4ZA 2XXPA 3QUJA 4IO4A 4Q5TA 3SESA 4G68C 2UVJA 4F31B 1POY1 2G93A 1MXXA 4R9GA 5JTYB 4F19A 4ZECA 5AA2A 1VFDA 5H8NA 3H4ZA 4OESA 2REJA 3D4CA 3OO9A 5JTYA 5F7VA 1PC3A 2HEUA 1OQGA 1UTBA 1QULA 3E9XA 4H5FA 4N13A 4DZ1A 4EF2A 1I6QA 3KSJA 1EH3A 1UTHA 1FTOA 1FTLA 1O63A 1SYIA 3TTKA 1MPBA 3CG1A 4EQBA 1B7ZA 3N94A 4M1VA 3C34A 3VXBA 1USYH 5AA1A 1A40A 4LZ5A 1H44A 1SW1A 4Q8RA 3OD7A 1N84A 3K6WA 4GL0A 2A5TA 3S9EA 1MQJA 1SW2A 2O6AA 1TT1A 4JSDA 2P0SA 4YB6A 5HBCA 5I56B 4G68A 5I57A 4MLQA 5FHNA 1R1NA 3KJTA 3OELA 4EQ9A 3IK6B 1XC1A 3QUFA 4OWDA 4I9DA 3SEWA 1ELJA 2FYIA 3TQLA 2PT1A 1D3KA 1UTHB 4KYDA 2F34A 4DXCA 3ECRA 4G77A 4KFQA 4IB2A 4NE4A 1SQYA 2XXTA 4P0IA 3TTNA 3G3KA 3F11A 2H4IA 4LQ5A 3B7DA 2XXIA 2Y7KA 4Q30B 4RXLA 2HFBA 1NMUA 2DWAA 4KHZE 4U23A 3V8XB 4F22A 1LLSA 2HAVA 3O66A 5LOMA 2ONSA 3MPLA 5B70A 4HW8A 3ZKKA 3GBBA 5CBRA 1H76A 5JK4A 1QKBA 3FVKA 4C1TA 4ECFA 5CMBA 4MF3A 1A8EA 2DSFA 1FCKA 2FNCA 5L9MA 2GHBA 5KDTB 3B6QA 4QFNA 1MQGA 1XVXA 5L8DA 2OWSA 2PBWA 2V84A 3PPRA 5KDTA 3HO7A 3K1PA 4OFOA 3FVNA 1SW4A 1Y3NA 3OEMA 3MZBA 5H8FA 1Y1MA 3HV1A 3O97A 1GV8A 3FXRA 4QFPA 1B05A 3MP1A 4R73A 5I56A 3TUSA 3K6UA 5KCJA 1HSEA 3FVOA 4OFLA 3FIRA 1JW4A 1RYOA 3FJMA 4MLVA 4HS7A 4G8NA 4O3CA 5CMMA 3USDA 1AOVA 3T9HB 1NNFA 1SW5A 1B9JA 5DT6A 4YMAA 2OWTA 1N76A 4L17A 3KG2A 2QL3A 3BFTA 4FJPA 1O64A 4FEBA 3EN3A 1JEUA 4PFYA 1Y4TA 2DE3A 2HZKA 3K0VA 4GQOA 4NF4A 2YLNA 4XKRA 3S9MC 3SKPA 4F3PA 3EHSA 4YZZA 5KZTA 4IGRA 4I8CA 5TPAB 3IX1A 4OTEA 4KCCA 2AIXA 1M5CA 2I58A 3U94A 4LVQA 3LSWA 1MS7A 2P1SA 5BUUA 5AA3A 5I58B 1TFDA 3UK4A 2QS4A 4TQUQ 2XX9A 4ZE8A 2E1SA 5BWJA 1N7XA 3BFUA 1NL5A 3L6HA 3OSQA 3GLBA 4E0XA 2Y7WA 3CSBA 3EHTA 3Q25A 3VLVA 3GBAA 4QFLA 2VOZA 3SEYA 5H8QB 2RC7A 1N3WA 4F1VA 2V3UA 3K01A 3TCHA 1BTJA 1NNKA 3MVZA 5EHMA 5TPAA 1DMBA 1B4HA 5H8QA 3RPWA 2V3TA 4EQ7A 2PT2A 3Q26A 5I59B 3FXQA 1M5DA 4R6KA 2QS1A 3O9PA 1FQBA 3OENA 4IO6A 3UA8A 1B6HA 4IO7A 3OO8A 4FORA 3EQ1A 3OEKA 5I2NB 1P1NA 2XXHA 4IGTA 1IEJA 2O1LA 2QS2A 3FASA 2E0SA 4R6HA 4ZEDA 3H6VA 3ZKLA 3E13X 2Q2AA 4LQ2A 3R6UA 1EZ9A 3BKIB 4POWA 2IEEA 3FUZA 3H03A 3L6GA 3G3IA 2GHAA 1BIYA 4TLLB 1MH3A 1Z7ME 3GXAA 1OLCA 1BLFA 1TXFA 1N0TA 1UIUA 2THIA 2WKYA 3IJOB 4IY5A 2OLBA 4PFWA 3K1NA 1VR5A 2YPNA 3MPKA 2ZYMA 3JV9A 3T22A 3JYRA 5AA4B 5J1DA 1IZ1A 3RNNA 2PYYA 3W9VA 2QS3A 2GFEA 4R75A 1B58A 3RUMA 4ZS9A 1H3DA 4GIZA 3KSXA 2DWJA 3U93A 3I3VA 3IOUA 3M3LA 2V3QA 2R71A 1JVYA 3CVGA 3H7MA 3I5OA 4XTCQ 5CRYA 1IUDA 2QRYA 3IOVA 4BDQA 3T9VA 1LAXA 4XIGQ 4GF8A 4U2RA 5F1QA 5AA2D 1B52A 5CC2A 4KI0E 2KLFA 2VD2A 1FQCA 3IL1B 1JNFA 2DVZA 4RPOA 4OEUA 3PGFA 1AL3A 4U1OA 4XKQA 3W15C 4F3GA 4FATA 5IAIA 1B3EA 3HCQA 1AMFA 3IO6A 4NF5B 4EF1A 1QUJA 4QFKA 1DTGA 1A99A 1GTKA 1N3XA 4JSOA 2QJEA 3O29A 4DXBA 3JZJA 2Y7PA 1A55A 2Z8DA 3K00A 3PUVE 4PQJA 3KN3A 1Y3PA 2OK2A 2PVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLN A;  1MQI A;  1OQH A;  2I0C A;  3IOR A;  3Q28 A;  1MH4 A;  2I0B A;  3PV0 E;  1KWH A;  4DXU A;  1T0K A;  1LST A;  4Q0C A;  2ABH A;  2DXR A;  1UIV A;  3P7I A;  4ZZE A;  3VDF A;  1NFT A;  2I49 A;  3H6U A;  4OHN A;  1YPN A;  4AB5 A;  2O69 A;  1ATG A;  3MZ1 A;  5EYF A;  3TPA A;  3TCG A;  1IIW A;  1WDN A;  4YB7 A;  4EDP A;  2B3B A;  5CI5 A;  3PMW A;  3LBS A;  3TZA A;  4PP0 A;  2M8C A;  1LFG A;  2O1M A;  1S7Y A;  2F7B A;  2XXV A;  2Y7R A;  2Y84 A;  3SET A;  3MQ9 A;  3VVD A;  4HTG A;  4G8M A;  2HXW A;  2QSX A;  1MXW A;  2V93 A;  3CR9 A;  1FTK A;  3DP4 A;  3TAJ A;  3V83 A;  4DDD A;  4JWX A;  4N6P A;  4RNS A;  1UQW A;  3Q29 A;  5AA2 B;  2RCA A;  4C1U A;  4KQP A;  3T9X B;  1VE4 A;  2ZNU A;  3LR1 A;  3O6G A;  3HHG A;  2DWH A;  1P1Q A;  2F5X A;  3CIJ A;  4POX A;  4BLA A;  4F29 A;  2OCU A;  1OLA A;  4C0R A;  4KYE A;  2A5S A;  4RA1 A;  3PPQ A;  2I4C A;  3RT8 A;  1CB6 A;  1A8F A;  4EXK A;  1MY2 A;  2ONR A;  2ONK E;  1Y3Q A;  4F2Q A;  1VFE A;  4ESW A;  2F36 A;  3V5A A;  1JW1 A;  1QW0 A;  3ODB A;  2XX7 A;  3H3G A;  5DTB A;  1B3L A;  1LCF A;  4FEC A;  5A5X A;  3VVF A;  3IAZ A;  1B5I A;  2Z22 A;  3CG3 A;  4PE5 B;  1RKM A;  1MM6 A;  2DP8 A;  4BDN A;  5HM4 B;  3MZ9 A;  2RC8 A;  1DPE A;  1QVS A;  2VHA A;  1B32 A;  3BBR A;  1IXC A;  3C35 A;  3DP8 A;  4H8J A;  2AYS A;  3R26 A;  3K6V A;  4HCW A;  4WEP A;  3LSX A;  5M2V A;  4F2O A;  4ND9 A;  5DVF A;  1SD3 A;  1FQE A;  1POT A;  3G3G A;  1YAE A;  2UVH A;  2D5W A;  1MXY A;  2H5Y A;  2UVI A;  3CSG A;  3VVE A;  3S9L C;  4GL8 A;  2X7Q A;  3V89 B;  3TEP A;  5K2Y A;  1TWY A;  4I1D A;  4YKJ A;  3VE1 B;  1PB9 A;  2QPQ A;  3OMB A;  1MDQ A;  2ZNT A;  1SDX A;  5H8H A;  1MY4 A;  3ZS6 A;  3HST A;  3O6I A;  1WVJ A;  1IXH A;  2ZYO A;  3FV1 A;  1MXV A;  2IA4 A;  4RYA A;  4WXJ A;  2XD3 A;  4Z7E A;  3KGC A;  3FAT A;  1JW5 A;  2VD3 A;  1ZU0 A;  1ANF A;  4YKP A;  2D3I A;  5CBS A;  4GFR A;  1A54 A;  1JET A;  2NOO A;  2HCA A;  4WKM A;  1PDA A;  3IOW A;  4QFO A;  4YB5 A;  4F18 A;  3U92 A;  1II5 A;  3VLW A;  2ALU A;  3CI8 A;  3E4R A;  1US5 A;  4NTL A;  5H8F B;  2V25 A;  2AL5 A;  3KFM A;  4DE8 A;  2HAU A;  3IOT A;  1D9Y A;  3ONM A;  4G4P A;  1B1H A;  2VGQ A;  2ZYK A;  2I4B A;  4AB6 A;  4X1D A;  4Z0I A;  3IO4 A;  4H6D A;  3RTF B;  1ZIU A;  2I6E A;  5AE4 A;  3C4M A;  4OET A;  1B0H A;  3O28 A;  2XXQ A;  1XHY A;  3KN8 A;  4QSC A;  3SEV A;  4RJZ A;  4H65 A;  3N6T A;  1XT8 A;  3OOA A;  4H5G A;  1HSJ A;  1B51 A;  3VV5 A;  2Y7I A;  1F9B A;  1MQH A;  1MXU A;  3LSF B;  1LAF E;  3R7X A;  3RY3 A;  3T66 A;  4EXL A;  4YIC A;  1ZLQ A;  1VSO A;  2DE4 A;  2XXX A;  1EU8 A;  4JWY A;  4KPT A;  1ZKB A;  3MWB A;  4NF5 A;  4U4X A;  1USY E;  5FTH A;  1Q35 A;  5TU0 A;  2Q8J A;  3PUZ E;  1JQF A;  4GXA A;  4ZDM A;  5I2N A;  3MP8 A;  1D9V A;  3DEL B;  1I6B A;  2H9B A;  2UYF A;  5CMK A;  1RYX A;  1R6Z A;  1CE2 A;  4M4G A;  3CFX A;  4G68 B;  3RLF E;  1B7U A;  4DCX A;  5I57 B;  1DSN A;  4JXI A;  1PBP A;  1LB8 A;  1QJM A;  2Z8E A;  3TEL A;  4HCY A;  2XXU A;  4YU0 A;  3U1O A;  5JEI A;  4QSE A;  3G3H A;  5DEX A;  1S9T A;  4U4S A;  4OQO A;  4X9T A;  4ZEB A;  3LC8 A;  4XXU A;  3RN8 A;  1B5H A;  3IB0 A;  2OJT A;  3C9H A;  3QAX A;  5H8N B;  2I48 A;  3K6X A;  1FTM A;  2CZL A;  1BKA A;  1MQD A;  3O2A A;  2UXA A;  1B0L A;  4YKK A;  5FHM A;  1MY0 A;  5ITP A;  1UTB B;  4LUB A;  1FQF A;  3CRB A;  4NWC A;  1QKA A;  2RF1 A;  2I3V A;  1P1U A;  1LFI A;  3S9N C;  1Y4C A;  4F1U A;  4QF9 A;  3DP6 A;  1MY1 A;  1XS5 A;  2YJP A;  4G8H A;  4XKP A;  1IXI A;  1LCT A;  4N07 A;  4NF4 B;  4EUO A;  1AH5 A;  4H1X A;  3K4U A;  5ITO A;  4ZEK A;  1NH8 A;  1OIB A;  3MJN A;  4OEN A;  2ZNS A;  3HHF A;  1MY3 A;  3T93 B;  3TTL A;  1B3G A;  3IR1 A;  4THI A;  4BDO A;  2R6G E;  3PUX E;  2XD2 A;  2DE2 A;  3M8U A;  1MXZ A;  2F97 A;  3PD8 A;  1SI1 A;  3QXM A;  2HQ0 A;  3KZG A;  1MG1 A;  4NWD A;  3TCF A;  3G3F A;  4DIG A;  1MM7 A;  3N5L A;  4U21 A;  4YMB A;  2OBG A;  3EF7 A;  1LAG E;  4KD5 A;  4XKN A;  3B6W A;  3HPI A;  2XXR A;  3WAF A;  3MP6 A;  5FTI A;  4F1Y A;  4IO2 A;  4LAT A;  2F8D A;  3A09 A;  3MBP A;  3N26 A;  1XVY A;  1SBP A;  4LON B;  4RK9 A;  2LAO A;  2Q2C A;  2R9J A;  3S2V A;  5I58 A;  2B3F A;  2CMO A;  1H45 A;  2FA7 A;  1DTZ A;  1LBC A;  1ZTY A;  3KJ7 A;  3LUY A;  1MPD A;  4OMB A;  3FJ7 A;  4R2B A;  3S4U A;  1J1N A;  4TOZ A;  5CMC A;  3VXC A;  2RKM A;  4JWO A;  4R74 A;  2B65 A;  4ZZA A;  3C32 A;  4O3B A;  4NF6 A;  3Q27 A;  3ZSF A;  1JEV A;  5L9S A;  3E3K A;  3GZG A;  4YAH X;  5ELV A;  3OXN A;  3IJX B;  1Y20 A;  2P2A A;  1ZBM A;  3IB1 A;  4G2Z A;  4MBP A;  4NED A;  4GOT A;  3QYT A;  2NWJ A;  2Q88 A;  4IO5 A;  2NVU B;  3SDF A;  4OXV A;  5K2X A;  4BDM A;  4F39 A;  5H8S A;  5HPQ A;  3KOS A;  3MVX A;  4IY6 A;  1AIV A;  3M3F A;  3PUW E;  2O68 A;  1NNP A;  2O51 A;  3SEX A;  3PUY E;  4F3S A;  3PPN A;  5TP9 B;  3H6T A;  4PET A;  3TFL A;  1WOD A;  2O7I A;  2F7C A;  3MW0 A;  4H8I A;  1LFH A;  1B2H A;  3UOR A;  1O7T A;  1IIT A;  4QHQ A;  3UGW A;  1QUK A;  4ESX A;  5ICQ A;  4LA9 A;  1BP5 A;  4JBZ A;  2X26 A;  3I6V A;  3PPP A;  4FED A;  2W7Y A;  5I2K B;  1SYH A;  3MAM A;  4ZEF A;  4ELO A;  4F3B A;  3AXF A;  1MPC A;  1HSL A;  3T96 B;  4K3F A;  4X48 A;  1B7H A;  3PD9 A;  5I84 A;  1PB7 A;  3C33 A;  2X7P A;  1OMP A;  3FGS A;  4R72 A;  4P0G A;  3TKD A;  3U8Q A;  3N6U A;  5AA4 A;  2REG A;  1SVX B;  4IO3 A;  1NKX A;  2UYE A;  5L9O A;  4U1Z A;  4X1B A;  3FJG A;  3UN6 A;  2NUV A;  4TLM B;  1DOT A;  1LGB C;  1M5F A;  3CFL A;  3RQT A;  4PFT A;  3D4G A;  5H8H B;  3VFJ A;  1US4 A;  5FHO A;  4R6Y A;  3TQW A;  5I2K A;  2UVG A;  5ICT A;  2Q9T A;  2F6G A;  3ILU B;  4MH5 A;  1IXG A;  2Z23 A;  1TFA A;  1LAH E;  4ELQ A;  1JVX A;  1NNT A;  4FIM A;  2H98 A;  2F78 A;  1URS A;  4OVJ A;  1PEB A;  4R2F A;  2DYX A;  2RC9 A;  5DVJ A;  2DOJ A;  4ONY A;  3PPO A;  5DEX B;  5EHS A;  1L5T A;  3H06 B;  1ZMG A;  3EHU A;  1SI0 A;  2F6P A;  3T9U A;  4NF8 B;  1I69 A;  5I59 A;  1B40 A;  3TOD A;  2G29 A;  1P1W A;  5A5X B;  5DVI A;  2DXY A;  4LP2 B;  1QUI A;  3PMV A;  3PU5 A;  1GVC A;  2OZZ A;  1P99 A;  1S50 A;  4ZE9 A;  2F35 A;  4LZ7 A;  4DCY A;  5CM6 A;  1FW0 A;  3M3K A;  4U22 A;  4P11 A;  1I6A A;  3O6H A;  4BDL A;  3MUQ A;  3RT6 B;  1EZO A;  3FD3 A;  4H67 A;  3WAE A;  1MDP 1;  3FV2 A;  2DS9 A;  1OVT A;  3MVY A;  3SER A;  2HZL A;  1B1X A;  1PB8 A;  4OEV A;  5TP9 A;  3CFZ A;  3RTW B;  1Y9U A;  3THI A;  5KCJ B;  1OVB A;  2RCB A;  1Y1Z A;  3FVG A;  1H43 A;  3TTR A;  1R9Q A;  5B7D A;  2BJJ X;  1M5B A;  5ISU A;  2I3W A;  3FZV A;  1XOC A;  3ILT B;  3MVW A;  3QK6 A;  4GD5 A;  3K2D A;  3PMX A;  1LBB A;  3H6W A;  3K02 A;  4KR5 A;  2QMX A;  1IQ7 A;  1P1O A;  5DYH A;  4GLI A;  4RY1 A;  2XXY A;  4OYV A;  3UIF A;  4UAC A;  2NXO A;  2RIN A;  3C31 A;  3OO6 A;  2XHD A;  4ELR A;  2Q89 A;  4QRZ A;  1NH7 A;  2F7A A;  3TYH A;  2XXW A;  1YCJ A;  4KCD A;  3B6T A;  4KYS A;  1PBQ A;  4MFI A;  3QSL A;  1URD A;  1LB9 A;  4OER A;  4GWO A;  3SEU A;  1YTV A;  4WED A;  3TDJ A;  3TMG A;  4PFU A;  3W9W A;  4AQ4 A;  2AL4 A;  4LZ8 A;  3DM0 A;  4NF6 B;  2O84 X;  2DVC A;  1B5J A;  2PMS A;  2ZYN A;  1ZJL A;  1GGG A;  2ZXT A;  3G7W A;  4DLD A;  4H0W A;  3LSL A;  1M5E A;  3MC2 A;  2ESN A;  3UP9 A;  5IKB A;  1Q1K A;  1R9L A;  2DWI A;  2XX8 A;  3HN0 A;  4RK2 A;  3KOT A;  4O3A A;  1B46 A;  1B3F A;  1Z7N E;  3A3U A;  2VP1 A;  3FXU A;  2H99 A;  2O7U A;  4RPN A;  4YKI A;  1B3H A;  4JB7 A;  1GR2 A;  4JDF A;  4QSD A;  1EZP A;  1MRP A;  4GXS B;  2H25 A;  1URG A;  4NF8 A;  4OFJ A;  2GRV A;  3KBR A;  3G3J A;  1N04 A;  4FAJ A;  2ANJ A;  2Z8F A;  1FQA A;  1A7L A;  2ZMB A;  4OZ9 A;  1DPP A;  2A5T B;  3KEI A;  1FTJ A;  1FQD A;  3TTM A;  4GVO A;  4UA8 A;  2DQV A;  3EPE A;  4ELP A;  4ISU A;  3OSR A;  1N7W A;  2QMW A;  4NMY A;  3A3C A;  1D4N A;  2PX1 A;  4E0W A;  4I62 A;  3K1M A;  4BDR A;  2GH9 A;  4GRK A;  3C36 A;  3QIM A;  4ZEI A;  3IB2 A;  2D21 A;  3OO7 A;  4FE8 A;  4R9F A;  3KN7 A;  3RGY A;  3VLU A;  3U72 A;  1B4Z A;  2XXP A;  3QUJ A;  4IO4 A;  4Q5T A;  3SES A;  4G68 C;  2UVJ A;  4F31 B;  1POY 1;  2G93 A;  1MXX A;  4R9G A;  5JTY B;  4F19 A;  4ZEC A;  5AA2 A;  1VFD A;  5H8N A;  3H4Z A;  4OES A;  2REJ A;  3D4C A;  3OO9 A;  5JTY A;  5F7V A;  1PC3 A;  2HEU A;  1OQG A;  1UTB A;  1QUL A;  3E9X A;  4H5F A;  4N13 A;  4DZ1 A;  4EF2 A;  1I6Q A;  3KSJ A;  1EH3 A;  1UTH A;  1FTO A;  1FTL A;  1O63 A;  1SYI A;  3TTK A;  1MPB A;  3CG1 A;  4EQB A;  1B7Z A;  3N94 A;  4M1V A;  3C34 A;  3VXB A;  1USY H;  5AA1 A;  1A40 A;  4LZ5 A;  1H44 A;  1SW1 A;  4Q8R A;  3OD7 A;  1N84 A;  3K6W A;  4GL0 A;  2A5T A;  3S9E A;  1MQJ A;  1SW2 A;  2O6A A;  1TT1 A;  4JSD A;  2P0S A;  4YB6 A;  5HBC A;  5I56 B;  4G68 A;  5I57 A;  4MLQ A;  5FHN A;  1R1N A;  3KJT A;  3OEL A;  4EQ9 A;  3IK6 B;  1XC1 A;  3QUF A;  4OWD A;  4I9D A;  3SEW A;  1ELJ A;  2FYI A;  3TQL A;  2PT1 A;  1D3K A;  1UTH B;  4KYD A;  2F34 A;  4DXC A;  3ECR A;  4G77 A;  4KFQ A;  4IB2 A;  4NE4 A;  1SQY A;  2XXT A;  4P0I A;  3TTN A;  3G3K A;  3F11 A;  2H4I A;  4LQ5 A;  3B7D A;  2XXI A;  2Y7K A;  4Q30 B;  4RXL A;  2HFB A;  1NMU A;  2DWA A;  4KHZ E;  4U23 A;  3V8X B;  4F22 A;  1LLS A;  2HAV A;  3O66 A;  5LOM A;  2ONS A;  3MPL A;  5B70 A;  4HW8 A;  3ZKK A;  3GBB A;  5CBR A;  1H76 A;  5JK4 A;  1QKB A;  3FVK A;  4C1T A;  4ECF A;  5CMB A;  4MF3 A;  1A8E A;  2DSF A;  1FCK A;  2FNC A;  5L9M A;  2GHB A;  5KDT B;  3B6Q A;  4QFN A;  1MQG A;  1XVX A;  5L8D A;  2OWS A;  2PBW A;  2V84 A;  3PPR A;  5KDT A;  3HO7 A;  3K1P A;  4OFO A;  3FVN A;  1SW4 A;  1Y3N A;  3OEM A;  3MZB A;  5H8F A;  1Y1M A;  3HV1 A;  3O97 A;  1GV8 A;  3FXR A;  4QFP A;  1B05 A;  3MP1 A;  4R73 A;  5I56 A;  3TUS A;  3K6U A;  5KCJ A;  1HSE A;  3FVO A;  4OFL A;  3FIR A;  1JW4 A;  1RYO A;  3FJM A;  4MLV A;  4HS7 A;  4G8N A;  4O3C A;  5CMM A;  3USD A;  1AOV A;  3T9H B;  1NNF A;  1SW5 A;  1B9J A;  5DT6 A;  4YMA A;  2OWT A;  1N76 A;  4L17 A;  3KG2 A;  2QL3 A;  3BFT A;  4FJP A;  1O64 A;  4FEB A;  3EN3 A;  1JEU A;  4PFY A;  1Y4T A;  2DE3 A;  2HZK A;  3K0V A;  4GQO A;  4NF4 A;  2YLN A;  4XKR A;  3S9M C;  3SKP A;  4F3P A;  3EHS A;  4YZZ A;  5KZT A;  4IGR A;  4I8C A;  5TPA B;  3IX1 A;  4OTE A;  4KCC A;  2AIX A;  1M5C A;  2I58 A;  3U94 A;  4LVQ A;  3LSW A;  1MS7 A;  2P1S A;  5BUU A;  5AA3 A;  5I58 B;  1TFD A;  3UK4 A;  2QS4 A;  4TQU Q;  2XX9 A;  4ZE8 A;  2E1S A;  5BWJ A;  1N7X A;  3BFU A;  1NL5 A;  3L6H A;  3OSQ A;  3GLB A;  4E0X A;  2Y7W A;  3CSB A;  3EHT A;  3Q25 A;  3VLV A;  3GBA A;  4QFL A;  2VOZ A;  3SEY A;  5H8Q B;  2RC7 A;  1N3W A;  4F1V A;  2V3U A;  3K01 A;  3TCH A;  1BTJ A;  1NNK A;  3MVZ A;  5EHM A;  5TPA A;  1DMB A;  1B4H A;  5H8Q A;  3RPW A;  2V3T A;  4EQ7 A;  2PT2 A;  3Q26 A;  5I59 B;  3FXQ A;  1M5D A;  4R6K A;  2QS1 A;  3O9P A;  1FQB A;  3OEN A;  4IO6 A;  3UA8 A;  1B6H A;  4IO7 A;  3OO8 A;  4FOR A;  3EQ1 A;  3OEK A;  5I2N B;  1P1N A;  2XXH A;  4IGT A;  1IEJ A;  2O1L A;  2QS2 A;  3FAS A;  2E0S A;  4R6H A;  4ZED A;  3H6V A;  3ZKL A;  3E13 X;  2Q2A A;  4LQ2 A;  3R6U A;  1EZ9 A;  3BKI B;  4POW A;  2IEE A;  3FUZ A;  3H03 A;  3L6G A;  3G3I A;  2GHA A;  1BIY A;  4TLL B;  1MH3 A;  1Z7M E;  3GXA A;  1OLC A;  1BLF A;  1TXF A;  1N0T A;  1UIU A;  2THI A;  2WKY A;  3IJO B;  4IY5 A;  2OLB A;  4PFW A;  3K1N A;  1VR5 A;  2YPN A;  3MPK A;  2ZYM A;  3JV9 A;  3T22 A;  3JYR A;  5AA4 B;  5J1D A;  1IZ1 A;  3RNN A;  2PYY A;  3W9V A;  2QS3 A;  2GFE A;  4R75 A;  1B58 A;  3RUM A;  4ZS9 A;  1H3D A;  4GIZ A;  3KSX A;  2DWJ A;  3U93 A;  3I3V A;  3IOU A;  3M3L A;  2V3Q A;  2R71 A;  1JVY A;  3CVG A;  3H7M A;  3I5O A;  4XTC Q;  5CRY A;  1IUD A;  2QRY A;  3IOV A;  4BDQ A;  3T9V A;  1LAX A;  4XIG Q;  4GF8 A;  4U2R A;  5F1Q A;  5AA2 D;  1B52 A;  5CC2 A;  4KI0 E;  2KLF A;  2VD2 A;  1FQC A;  3IL1 B;  1JNF A;  2DVZ A;  4RPO A;  4OEU A;  3PGF A;  1AL3 A;  4U1O A;  4XKQ A;  3W15 C;  4F3G A;  4FAT A;  5IAI A;  1B3E A;  3HCQ A;  1AMF A;  3IO6 A;  4NF5 B;  4EF1 A;  1QUJ A;  4QFK A;  1DTG A;  1A99 A;  1GTK A;  1N3X A;  4JSO A;  2QJE A;  3O29 A;  4DXB A;  3JZJ A;  2Y7P A;  1A55 A;  2Z8D A;  3K00 A;  3PUV E;  4PQJ A;  3KN3 A;  1Y3P A;  2OK2 A;  2PVU A; 
#chains in the Genus database with same CATH topology
 1OQH A;  1MH4 A;  4PFR A;  1LBW A;  2ABH A;  4ZZE A;  3H6U A;  3TPA A;  4N6K A;  1JP4 A;  3PMW A;  3LBS A;  4PP0 A;  2O1M A;  2F7B A;  2XXV A;  3MQ9 A;  3CR9 A;  3TAJ A;  4JWX A;  3T9X B;  2ZNU A;  1P1Q A;  4F29 A;  4BLA A;  4C0R A;  3PPQ A;  2I4C A;  3KC0 A;  1FPE A;  3V5A A;  3BIG A;  1B3L A;  3IAZ A;  2DP8 A;  4BDN A;  3MZ9 A;  1QVS A;  2CEX A;  2VHA A;  1B32 A;  4WEP A;  4MNC A;  5M2V A;  1IMA A;  1Q9D A;  4YKJ A;  3VE1 B;  1PB9 A;  2ZNT A;  1MY4 A;  2B4M A;  2IA4 A;  2VD3 A;  2WYP A;  1JET A;  3RPL A;  2ALU A;  1US5 A;  2AL5 A;  3IOT A;  3ONM A;  4AB6 A;  1B1H A;  2VGQ A;  2ZYK A;  3RPL B;  4X1D A;  4XFE A;  5AE4 A;  4HXV A;  1G0H A;  3NOH A;  1HSJ A;  1CNQ A;  4EXL A;  1VSO A;  4U4X A;  1QGX A;  1Q35 A;  3PUZ E;  2GQ1 A;  3MP8 A;  1I6B A;  4N91 A;  2H9B A;  5LTC A;  4G68 B;  5I57 B;  4JXI A;  1LBV A;  1FPI A;  3TEL A;  4PC9 A;  1S9T A;  1B5H A;  3IB0 A;  3QAX A;  2CZL A;  3O2A A;  1UTB B;  1FQF A;  1P1U A;  1Y4C A;  3U65 A;  4NF4 B;  4I40 A;  3SZP A;  4THI A;  2R6G E;  2DE2 A;  1SI1 A;  2HQ0 A;  3N5L A;  3MP6 A;  4F1Y A;  4IO2 A;  4LAT A;  3N26 A;  1KA1 A;  1XVY A;  4OMB A;  5TP9 B;  1DTZ A;  4R2B A;  5CMC A;  2RKM A;  4JWO A;  4O3B A;  5ELV A;  1Y20 A;  4G2Z A;  4MBP A;  3SER A;  4GOT A;  2NVU B;  4NF0 A;  3M3F A;  3SEX A;  3H6T A;  3IFA A;  3MW0 A;  1LFH A;  1O7T A;  4ESX A;  2R8T A;  1BP5 A;  3I6V A;  3PPP A;  2W7Y A;  4F3B A;  4ZEF A;  4ELO A;  5I84 A;  2VT5 A;  1HSL A;  4X48 A;  2X7P A;  1OMP A;  2QVV A;  4P0G A;  3N6U A;  1NUX A;  5L9O A;  3UN6 A;  3RQT A;  4R6Y A;  2Q9T A;  2F6G A;  1JVX A;  1NNT A;  4GBV A;  4N17 A;  2RC9 A;  2DOJ A;  1L5T A;  3H06 B;  2F6P A;  3T9U A;  1B40 A;  3TOD A;  5EYG A;  3LV0 A;  2P3V A;  1FRP A;  2CEY A;  5A5X B;  1IMB A;  3KC1 A;  4LP2 B;  3PMV A;  2F35 A;  5CM6 A;  1I6A A;  3MUQ A;  1NV0 A;  2DS9 A;  2HZL A;  5TP9 A;  4N8Y A;  3RTW B;  3CFZ A;  1Y9U A;  4OVS A;  1Y1Z A;  4P56 A;  2BJJ X;  2I3W A;  5ET7 A;  3QK6 A;  4GD5 A;  1NUY A;  4KR5 A;  1LEV A;  3UIF A;  1YYZ A;  2NXO A;  2XHD A;  2Q89 A;  2XXW A;  4MFI A;  3SEU A;  1NUZ A;  3DM0 A;  4H45 A;  2DVC A;  1B5J A;  4GWS A;  1M5E A;  2XX8 A;  3KOT A;  4O3A A;  1B46 A;  4YKI A;  1EZP A;  4GXS B;  4OFJ A;  1K9Y A;  3KBR A;  3G3J A;  4FAJ A;  2ZMB A;  2Z8F A;  2A5T B;  1FTJ A;  2ZZX A;  4O7I A;  4UA8 A;  2DQV A;  1N7W A;  1D4N A;  2PX1 A;  1NUW A;  2GH9 A;  4GRK A;  1FPG A;  2D21 A;  4FE8 A;  1B4Z A;  3QUJ A;  3SES A;  2G93 A;  4F19 A;  4ZEC A;  5JTY A;  2HEU A;  1I6Q A;  1SYI A;  3OD7 A;  4GL0 A;  2A5T A;  1SW2 A;  4YB6 A;  1TT1 A;  2P0S A;  5I56 B;  5FHN A;  3KJT A;  4EQ9 A;  4N4U A;  4DXC A;  4IB2 A;  1SQY A;  3TTN A;  4LQ5 A;  3B7D A;  4Q30 B;  1NMU A;  2FIE A;  1LLS A;  2HAV A;  5B70 A;  3ROJ A;  2FNC A;  1MQG A;  2V84 A;  3HO7 A;  3HV1 A;  4QFP A;  3TUS A;  5KCJ A;  1JW4 A;  3FJM A;  3USD A;  1AOV A;  1NNF A;  5DT6 A;  4L17 A;  2QL3 A;  3BFT A;  5ET5 A;  4FEB A;  3S9M C;  2AIX A;  4LVQ A;  3LSW A;  5BUU A;  4TQU Q;  4ZE8 A;  2XX9 A;  5BWJ A;  4XEQ A;  2RC7 A;  2V3U A;  3K01 A;  3MVZ A;  1DMB A;  1B4H A;  3RPW A;  2V3T A;  5I59 B;  3FXQ A;  1M5D A;  2QS1 A;  1FTA A;  2Q2A A;  1EZ9 A;  3L6G A;  3H03 A;  3G3I A;  3GXA A;  4IY5 A;  4DI4 B;  3MPK A;  3JYR A;  1IZ1 A;  3W9V A;  4ZS9 A;  4GIZ A;  3U93 A;  3IOU A;  3M3L A;  2R71 A;  1JVY A;  3CVG A;  4XTC Q;  5CRY A;  1IUD A;  2QRY A;  4I3E A;  4U2R A;  1B52 A;  2KLF A;  3IL1 B;  4RPO A;  3W15 C;  1FBP A;  3HCQ A;  1AMF A;  4EF1 A;  1N3X A;  4DXB A;  2XWO A;  3JZJ A;  2Z8D A;  3K00 A;  3DLN A;  2I0C A;  3P7I A;  1NFT A;  4OHN A;  2O69 A;  3MZ1 A;  5EYF A;  3TCG A;  2ZZW A;  1WDN A;  4FBP A;  4YB7 A;  4EDP A;  3TZA A;  5CI5 A;  2M8C A;  4G8M A;  2HXW A;  4RNS A;  1NV6 A;  4OVP A;  3CIJ A;  4POX A;  3RT8 A;  2A5S A;  4RA1 A;  4JVI A;  1CB6 A;  1A8F A;  4EXK A;  2ONK E;  1Y3Q A;  3ODB A;  2P3N A;  4FEC A;  5A5X A;  2ZZV A;  4PE5 B;  1RKM A;  3PTY A;  1MM6 A;  2KR0 A;  1NV2 A;  4H8J A;  4YMA A;  3TCF A;  3BBR A;  1IXC A;  4F2O A;  2AYS A;  5IZ1 A;  1FPF A;  2L5V A;  1POT A;  1YAE A;  2H5Y A;  3CSG A;  2UVI A;  5A5L A;  4GL8 A;  3V89 B;  5K2Y A;  1TWY A;  3OMB A;  1MDQ A;  3HST A;  1IXH A;  4WXJ A;  4Z7E A;  1ZU0 A;  4XF5 A;  4YKP A;  2D3I A;  4GFR A;  2NOO A;  4PDD A;  4QFO A;  3U92 A;  1II5 A;  5H8F B;  2V25 A;  2HAU A;  3T0J A;  1D9Y A;  3RTF B;  1ZIU A;  1B0H A;  3O28 A;  2XXQ A;  3SEV A;  1B51 A;  5T3J A;  2Y7I A;  1MQH A;  1MXU A;  3RY3 A;  3R7X A;  3T66 A;  2XXX A;  4JWY A;  1EU8 A;  4KPT A;  1ZKB A;  5FTH A;  5TU0 A;  4GXA A;  4ZDM A;  5ESY A;  2UYF A;  5CMK A;  1R6Z A;  4DCX A;  3CFX A;  2HXR A;  1PBP A;  2Z8E A;  4HCY A;  5JEI A;  5DEX A;  4ZEB A;  1FBC A;  2OJT A;  3S9N C;  4QF9 A;  1MY1 A;  1XS5 A;  4G8H A;  1LCT A;  1AH5 A;  1NH8 A;  3T93 B;  2ZNS A;  3IR1 A;  3PUX E;  2XD2 A;  1MXZ A;  3QXM A;  3KZG A;  4U21 A;  4YMB A;  2OBG A;  4PAI A;  4XKN A;  1SBP A;  4PGN A;  2Q2C A;  2R9J A;  1H45 A;  3T22 A;  1LBC A;  1MPD A;  1J1N A;  4R74 A;  4MJO A;  1JEV A;  3GZG A;  1ZBM A;  2Q88 A;  4IO5 A;  4BDM A;  3SDF A;  4OXV A;  4F39 A;  3KOS A;  3MVX A;  2O68 A;  1NNP A;  3PUY E;  3PPN A;  3UOR A;  4OVR A;  1IIT A;  3UGW A;  4JBZ A;  2X26 A;  5I2K B;  4K3F A;  5I7I A;  3TKD A;  3U8Q A;  1SVX B;  4IO3 A;  4U1Z A;  4HE0 A;  2NUV A;  3D4G A;  5H8H B;  3VFJ A;  5LDZ A;  1EYK A;  2UVG A;  2Z23 A;  4ELQ A;  4O8M A;  4FIM A;  2F78 A;  4OVJ A;  1FPD A;  5DVJ A;  5EHS A;  3EHU A;  1LBZ A;  2XXK A;  1QUI A;  3PU5 A;  1P99 A;  1S50 A;  1FW0 A;  4U22 A;  1EZO A;  4G61 A;  3MVY A;  1B1X A;  3THI A;  3FVG A;  3TTR A;  4MNI A;  4OVT A;  2FBP A;  5ISU A;  4KXP A;  3PMX A;  3H6W A;  3K02 A;  2QMX A;  4GWU A;  4RY1 A;  4UAC A;  2RIN A;  1FPJ A;  2F7A A;  3TYH A;  4KYS A;  4OER A;  4GWO A;  4PFU A;  4AQ4 A;  4LZ8 A;  2O84 X;  2ZYN A;  1GGG A;  3G7W A;  4DLD A;  1Q1K A;  2VP1 A;  2H99 A;  1B3H A;  2H25 A;  4PTK A;  2ANJ A;  3KEI A;  1FBD A;  1FQD A;  2XWI A;  1FBH A;  3TTM A;  4MIJ A;  1G0I A;  3IB2 A;  4R9F A;  3KN7 A;  3U72 A;  2XXP A;  4Q5T A;  4G68 C;  2UVJ A;  4F31 B;  1MXX A;  1VFD A;  4OES A;  3D4C A;  3OO9 A;  5F7V A;  1PC3 A;  1UTB A;  3RYD A;  4N13 A;  4EF2 A;  1FTL A;  2KQZ A;  3CG1 A;  4EQB A;  1USY H;  1IME A;  3K6W A;  1MQJ A;  4JSD A;  5HBC A;  1NV4 A;  3QUF A;  4OWD A;  4I9D A;  3TQL A;  2PT1 A;  1UTH B;  4G77 A;  4P0I A;  3F11 A;  2H4I A;  5ET8 A;  1D9Q A;  2XXI A;  4RXL A;  3O66 A;  5LOM A;  5CBR A;  3GBB A;  1QKB A;  4ECF A;  1A8E A;  3T1B A;  5KDT B;  3B6Q A;  4QFN A;  3PPR A;  1Y3N A;  3O97 A;  1GV8 A;  3FXR A;  4R73 A;  1AWB A;  1HSE A;  3FIR A;  4PCD A;  1O64 A;  4PFY A;  3VXC A;  4GQO A;  3K0V A;  3MYU A;  3EHS A;  4MMP A;  2HPG A;  2I58 A;  3U94 A;  1MS7 A;  2P1S A;  4NX1 A;  5AA3 A;  5I58 B;  2QFL A;  3BFU A;  1NL5 A;  4E0X A;  3Q25 A;  4MX6 A;  5IZZ A;  1FBE A;  5H8Q B;  1N3W A;  3TCH A;  4NG7 A;  5H8Q A;  4R6K A;  3O9P A;  1FQB A;  3UA8 A;  1B6H A;  4IO7 A;  3OO8 A;  4FOR A;  3EQ1 A;  5I2N B;  1FBF A;  2JJK A;  2V4C A;  1IEJ A;  2O1L A;  2QS2 A;  3BKI B;  2IEE A;  3FUZ A;  2GHA A;  1BLF A;  2THI A;  1LBX A;  4PFW A;  4PAK A;  1VR5 A;  5AA4 B;  2PYY A;  4MCO A;  2GFE A;  1B58 A;  3RUM A;  3I3V A;  2V3Q A;  4NQ8 A;  3I5O A;  4BDQ A;  5AA2 D;  4KI0 E;  1FQC A;  2WEF A;  1FBG A;  4DI3 D;  4FAT A;  3O29 A;  1A55 A;  1Y3P A;  5I56 A;  2PVU A;  3IOR A;  3PV0 E;  4DXU A;  1LST A;  4Q0C A;  3VDF A;  4OA4 A;  1YPN A;  4AB5 A;  1ATG A;  1IIW A;  2CZI A;  2Y7R A;  1S7Y A;  3SET A;  2Y84 A;  1KZ8 A;  3VVD A;  4HTG A;  2QSX A;  1MXW A;  2V93 A;  3V83 A;  4N6P A;  1UQW A;  2RCA A;  4C1U A;  4KQP A;  1VE4 A;  3LR1 A;  3O6G A;  3HHG A;  2DWH A;  4F2Q A;  2F36 A;  2VPO A;  2WBB A;  1JW1 A;  1QW0 A;  5DTB A;  3VVF A;  1B5I A;  4GWX A;  1FPB A;  5HM4 B;  2RC8 A;  1DPE A;  4HCW A;  3R26 A;  4ND9 A;  5DVF A;  1MXY A;  2X7Q A;  4I1D A;  4GBW A;  4PBH A;  5H8H A;  3ZS6 A;  4RYA A;  1WVJ A;  2ZYO A;  1MXV A;  3KGC A;  3FAT A;  1ANF A;  5CBS A;  1A54 A;  4P8B A;  2HCA A;  4WKM A;  1PDA A;  4YB5 A;  1FSA A;  3VLW A;  3E4R A;  1FJ6 A;  4P9K A;  2FIX A;  2HHM A;  3C4M A;  4OET A;  1XHY A;  3KN8 A;  3N6T A;  3OOA A;  4H5G A;  3VV5 A;  4YIC A;  1ZLQ A;  2DE4 A;  4NF5 A;  2Q8J A;  1JQF A;  1RYX A;  1CE2 A;  1DSN A;  2CZH A;  1NV7 A;  2XXU A;  4QSE A;  4H46 A;  4X9T A;  3LC8 A;  4XXU A;  5H8N B;  2I48 A;  2UXA A;  1BK4 A;  4LUB A;  3CRB A;  2RF1 A;  1EYI A;  2I3V A;  1LFI A;  3DP6 A;  2YJP A;  4XKP A;  1IXI A;  4EUO A;  4H1X A;  3K4U A;  4ZEK A;  4OEN A;  3MJN A;  3HHF A;  4BDO A;  4HE1 A;  4PF8 A;  4NWD A;  4NAP A;  4DIG A;  3HPI A;  1LBY A;  3A09 A;  3MBP A;  4RK9 A;  5I58 A;  2CMO A;  2FA7 A;  3LUY A;  4PBQ A;  1ZTY A;  1INP A;  3FJ7 A;  3S4U A;  4GX6 A;  4ZZA A;  4NF6 A;  3Q27 A;  4X8R A;  3ZSF A;  3KBZ A;  4YAH X;  3OXN A;  2P2A A;  3IB1 A;  2NWJ A;  4NED A;  1SPI A;  5H8S A;  4IY6 A;  4F3S A;  4PET A;  3TFL A;  1WOD A;  2F7C A;  4H8I A;  5ICQ A;  4AS4 A;  4FED A;  1SYH A;  3MAM A;  3AXF A;  3PD9 A;  1PB7 A;  3FBP A;  3C33 A;  3FGS A;  5AA4 A;  1NKX A;  4PDH A;  4X1B A;  3FJG A;  4TLM B;  1DOT A;  1M5F A;  3CFL A;  4N15 A;  4PFT A;  1KA0 A;  5FHO A;  3TQW A;  3ILU B;  4MH5 A;  2H98 A;  1URS A;  1ZMG A;  5IM2 A;  1SI0 A;  4NF8 B;  1I69 A;  1DK4 A;  1P1W A;  5DVI A;  2DXY A;  1GVC A;  2OZZ A;  4P11 A;  4BDL A;  3O6H A;  3RT6 B;  3FV2 A;  1OVT A;  4P47 A;  4OEV A;  5DW8 A;  1OVB A;  3ILT B;  3K2D A;  4MAG A;  1LBB A;  1P1O A;  4GLI A;  4ELR A;  3OO6 A;  4QRZ A;  1YCJ A;  4KCD A;  3B6T A;  3QSL A;  1URD A;  1LB9 A;  3TDJ A;  3W9W A;  1YTV A;  4WED A;  2AL4 A;  4NF6 B;  2ZXT A;  3LSL A;  2ESN A;  1R9L A;  3HN0 A;  4RK2 A;  3A3U A;  1B3F A;  1Z7N E;  3FXU A;  4JB7 A;  4JDF A;  4QSD A;  1MRP A;  1URG A;  4NF8 A;  2GRV A;  1N04 A;  1FQA A;  1A7L A;  1DPP A;  1RDX A;  4GVO A;  4ELP A;  3E78 A;  4ISU A;  1NV1 A;  4NMY A;  3A3C A;  4I62 A;  2B4L A;  3C36 A;  3A29 A;  4ZEI A;  3VLU A;  4IO4 A;  5AA2 A;  5H8N A;  3HFU A;  4NHB A;  1OQG A;  3E9X A;  2F3D A;  3KSJ A;  1EH3 A;  1UTH A;  1O63 A;  1FTO A;  5I59 A;  3TTK A;  1MPB A;  1B7Z A;  3N94 A;  5AA1 A;  1H44 A;  4Q8R A;  3S9E A;  2O6A A;  1R1N A;  3IK6 B;  1XC1 A;  3SEW A;  2FYI A;  4KYD A;  3ECR A;  4KFQ A;  4NE4 A;  2XXT A;  3G3K A;  4PAF A;  2Y7K A;  2DWA A;  4KHZ E;  4U23 A;  3V8X B;  2ONS A;  5JK4 A;  2DSF A;  1EYJ A;  5L9M A;  2GHB A;  4AS5 A;  1XVX A;  2PBW A;  2PFZ A;  3K1P A;  1SW4 A;  2OWZ A;  3OEM A;  4X04 A;  3MZB A;  5H8F A;  1Y1M A;  5EQ8 A;  1B05 A;  3FVO A;  4MLV A;  4G8N A;  2OWT A;  3B8B A;  1N76 A;  3MST A;  5I5P A;  3EN3 A;  1Y4T A;  2HZK A;  4F3P A;  4YZZ A;  4IGR A;  4I8C A;  4N8G A;  4KCC A;  1M5C A;  2FHY A;  2QS4 A;  4O7M A;  2E1S A;  3L6H A;  3GLB A;  3CSB A;  1YZ0 A;  3GBA A;  4QFL A;  2VOZ A;  4F1V A;  1DBZ A;  1BTJ A;  1NNK A;  5TPA A;  1IMD A;  2PT2 A;  3Q26 A;  2DDK A;  3OEN A;  4IO6 A;  3OEK A;  1P1N A;  1NV5 A;  3FAS A;  4R6H A;  2E0S A;  3H6V A;  4N81 A;  3ZKL A;  4TLL B;  1BIY A;  1MH3 A;  1UIU A;  2WKY A;  3BIH A;  3IJO B;  2OLB A;  3K1N A;  2ZYM A;  4OVQ A;  5J1D A;  2QS3 A;  4R75 A;  1H3D A;  3KSX A;  4IR8 A;  1RDY A;  3H7M A;  2Q8M A;  3IOV A;  3T9V A;  1LAX A;  4XIG Q;  4GF8 A;  5F1Q A;  5KZT A;  1JNF A;  2DVZ A;  1AL3 A;  1B3E A;  4NF5 B;  3IO6 A;  5ET6 A;  1QUJ A;  1DTG A;  4JSO A;  2QJE A;  2Y7P A;  4PQJ A;  2OK2 A;  1MQI A;  3Q28 A;  2I0B A;  1KWH A;  2Y5L A;  1T0K A;  3LUZ A;  4LN5 A;  2DXR A;  1UIV A;  2I49 A;  1XI6 A;  2B3B A;  1LFG A;  1FTK A;  3DP4 A;  4DDD A;  5AA2 B;  3Q29 A;  2WX9 A;  5FBP A;  2F5X A;  2OCU A;  1OLA A;  4KYE A;  1MY2 A;  2ONR A;  1VFE A;  4ESW A;  2XX7 A;  3H3G A;  1LCF A;  2Z22 A;  3CG3 A;  3DP8 A;  3C35 A;  4JVD A;  4EQ7 A;  5ITP A;  3K6V A;  4HE2 A;  3LSX A;  1SD3 A;  1FQE A;  3G3G A;  2UVH A;  2D5W A;  3VVE A;  3S9L C;  3TEP A;  2QPQ A;  1SDX A;  3O6I A;  3FV1 A;  2XD3 A;  4GWY A;  1JW5 A;  3IOW A;  4F18 A;  4NGU A;  3CI8 A;  4DE8 A;  4NTL A;  3KFM A;  4G4P A;  2I4B A;  4Z0I A;  3IO4 A;  2BJI A;  4H6D A;  2I6E A;  4QSC A;  4PF6 A;  4RJZ A;  4H65 A;  1XT8 A;  1FPK A;  4UAB A;  1F9B A;  4GX3 A;  3LSF B;  1LAF E;  3MWB A;  1USY E;  5I2N A;  1D9V A;  3DEL B;  3ISP A;  4M4G A;  3RLF E;  1B7U A;  1YXI A;  1LB8 A;  1QJM A;  4MEV A;  4YU0 A;  3U1O A;  1IMF A;  3G3H A;  4N6D A;  4U4S A;  4OQO A;  3RN8 A;  3C9H A;  1RDZ A;  4PGP A;  3K6X A;  1FTM A;  4YKK A;  1BKA A;  1MQD A;  1VDW A;  5FHM A;  1B0L A;  1MY0 A;  4NWC A;  1QKA A;  1DCU A;  4F1U A;  4N07 A;  3FXB A;  5ITO A;  1OIB A;  2XWK A;  2Y5K A;  3TTL A;  1MY3 A;  1B3G A;  3M8U A;  3PD8 A;  2F97 A;  1MG1 A;  3G3F A;  1MM7 A;  3EF7 A;  1LAG E;  4KD5 A;  3B6W A;  2XXR A;  3WAF A;  5FTI A;  2F8D A;  3D1R A;  4LON B;  2LAO A;  3S2V A;  2B3F A;  3KJ7 A;  4TOZ A;  2B65 A;  4GX4 A;  2F3B A;  3C32 A;  5L9S A;  3E3K A;  3IJX B;  3SEY A;  3QYT A;  5K2X A;  5HPQ A;  1AIV A;  3PUW E;  2O51 A;  2O7I A;  1B2H A;  4QHQ A;  1QUK A;  4LA9 A;  5I3S A;  5F24 A;  4GWZ A;  1MPC A;  3T96 B;  1B7H A;  1K9Z A;  4R72 A;  2REG A;  4MNP A;  2UYE A;  3QMF A;  1LGB C;  1US4 A;  3GYY A;  5I2K A;  5ICT A;  1IXG A;  1TFA A;  1LAH E;  5IZ3 A;  4GWW A;  4PFI A;  1PEB A;  4R2F A;  2DYX A;  4ONY A;  3PPO A;  5DEX B;  4QXD A;  4JVC A;  4MHF A;  2G29 A;  3B50 A;  5EQ9 A;  4ZE9 A;  4LZ7 A;  2CZK A;  4DCY A;  3M3K A;  3FD3 A;  4O94 A;  4H67 A;  3WAE A;  1MDP 1;  1PB8 A;  4PFB A;  5KCJ B;  2RCB A;  5EQ7 A;  1H43 A;  1R9Q A;  5B7D A;  3E79 A;  1M5B A;  3FZV A;  1XOC A;  3MVW A;  1FPL A;  1IQ7 A;  5DYH A;  2XXY A;  4OYV A;  3C31 A;  1NH7 A;  1PBQ A;  3TMG A;  2OX3 A;  5EYH A;  3IFC A;  2PMS A;  1ZJL A;  4P1L A;  3CHG A;  4H0W A;  5IKB A;  3MC2 A;  3UP9 A;  2DWI A;  2O7U A;  4RPN A;  5IGA A;  1GR2 A;  1NV3 A;  2PCR A;  4OZ9 A;  4QBA A;  2QVR A;  3EPE A;  3OSR A;  2QMW A;  2XWV A;  4E0W A;  3K1M A;  4BDR A;  3QIM A;  3OO7 A;  3RGY A;  1POY 1;  5JTY B;  4R9G A;  3H4Z A;  4P3L A;  2REJ A;  2FVZ A;  1QUL A;  4H5F A;  4M1V A;  3VXB A;  3C34 A;  2WYK A;  1A40 A;  4LZ5 A;  1SW1 A;  1N84 A;  4G68 A;  5I57 A;  4MLQ A;  3OEL A;  1ELJ A;  1D3K A;  2F34 A;  5IZ3 B;  2HFB A;  4F22 A;  3MPL A;  4HW8 A;  3ZKK A;  1H76 A;  3FVK A;  4C1T A;  5CMB A;  4MF3 A;  1FCK A;  4P1E A;  5L8D A;  4OAN A;  2OWS A;  5KDT A;  4OFO A;  3FVN A;  4I3Y A;  2QVU A;  3MP1 A;  3K6U A;  4OFL A;  1RYO A;  2WBD A;  4HS7 A;  5CMM A;  4O3C A;  3T9H B;  1SW5 A;  1B9J A;  3KG2 A;  4FJP A;  1JEU A;  4XKR A;  2DE3 A;  4NF4 A;  2YLN A;  3SKP A;  1NI9 A;  5TPA B;  3IX1 A;  4OTE A;  1TFD A;  3UK4 A;  1N7X A;  3OSQ A;  4DZ1 A;  5J16 A;  2Y7W A;  3EHT A;  2Q74 A;  5EHM A;  5EQA A;  4PE3 A;  4NN3 A;  1IMC A;  2XXH A;  4IGT A;  4ZED A;  3E13 X;  4LQ2 A;  3R6U A;  4POW A;  1Z7M E;  1OLC A;  1TXF A;  3VLV A;  1N0T A;  2PFY A;  2YPN A;  3JV9 A;  3RNN A;  3EKI A;  2DWJ A;  2XA5 A;  1FJ9 A;  2VPN A;  2MKZ A;  5CC2 A;  2VD2 A;  4XKQ A;  4OEU A;  3PGF A;  4U1O A;  5IAI A;  4F3G A;  4QFK A;  1A99 A;  3PUV E;  3KN3 A;  1GTK A; 
#chains in the Genus database with same CATH homology
 3DLN A;  1MQI A;  1OQH A;  2I0C A;  3IOR A;  3Q28 A;  1MH4 A;  2I0B A;  3PV0 E;  1KWH A;  4DXU A;  1T0K A;  1LST A;  4Q0C A;  2ABH A;  2DXR A;  1UIV A;  3P7I A;  4ZZE A;  3VDF A;  1NFT A;  2I49 A;  3H6U A;  4OHN A;  1YPN A;  4AB5 A;  2O69 A;  1ATG A;  3MZ1 A;  5EYF A;  3TPA A;  3TCG A;  1IIW A;  1WDN A;  4YB7 A;  4EDP A;  2B3B A;  5CI5 A;  3PMW A;  3LBS A;  3TZA A;  4PP0 A;  2M8C A;  1LFG A;  2O1M A;  1S7Y A;  2F7B A;  2XXV A;  2Y7R A;  2Y84 A;  3SET A;  3MQ9 A;  3VVD A;  4HTG A;  4G8M A;  2HXW A;  2QSX A;  1MXW A;  2V93 A;  3CR9 A;  1FTK A;  3DP4 A;  3TAJ A;  3V83 A;  4DDD A;  4JWX A;  4N6P A;  4RNS A;  1UQW A;  3Q29 A;  5AA2 B;  2RCA A;  4C1U A;  4KQP A;  3T9X B;  1VE4 A;  2ZNU A;  3LR1 A;  3O6G A;  3HHG A;  2DWH A;  1P1Q A;  2F5X A;  3CIJ A;  4POX A;  4BLA A;  4F29 A;  2OCU A;  1OLA A;  4C0R A;  4KYE A;  2A5S A;  4RA1 A;  3PPQ A;  2I4C A;  3RT8 A;  1CB6 A;  1A8F A;  4EXK A;  1MY2 A;  2ONR A;  2ONK E;  1Y3Q A;  4F2Q A;  1VFE A;  4ESW A;  2F36 A;  3V5A A;  1JW1 A;  1QW0 A;  3ODB A;  2XX7 A;  3H3G A;  5DTB A;  1B3L A;  1LCF A;  4FEC A;  5A5X A;  3VVF A;  3IAZ A;  1B5I A;  2Z22 A;  3CG3 A;  4PE5 B;  1RKM A;  1MM6 A;  2DP8 A;  4BDN A;  5HM4 B;  3MZ9 A;  2RC8 A;  1DPE A;  1QVS A;  2VHA A;  1B32 A;  3BBR A;  1IXC A;  3C35 A;  3DP8 A;  4H8J A;  2AYS A;  3R26 A;  3K6V A;  4HCW A;  4WEP A;  3LSX A;  5M2V A;  4F2O A;  4ND9 A;  5DVF A;  1SD3 A;  1FQE A;  1POT A;  3G3G A;  1YAE A;  2UVH A;  2D5W A;  1MXY A;  2H5Y A;  2UVI A;  3CSG A;  3VVE A;  3S9L C;  4GL8 A;  2X7Q A;  3V89 B;  3TEP A;  5K2Y A;  1TWY A;  4I1D A;  4YKJ A;  3VE1 B;  1PB9 A;  2QPQ A;  3OMB A;  1MDQ A;  2ZNT A;  1SDX A;  5H8H A;  1MY4 A;  3ZS6 A;  3HST A;  3O6I A;  1WVJ A;  1IXH A;  2ZYO A;  3FV1 A;  1MXV A;  2IA4 A;  4RYA A;  4WXJ A;  2XD3 A;  4Z7E A;  3KGC A;  3FAT A;  1JW5 A;  2VD3 A;  1ZU0 A;  1ANF A;  4YKP A;  2D3I A;  5CBS A;  4GFR A;  1A54 A;  1JET A;  2NOO A;  2HCA A;  4WKM A;  1PDA A;  3IOW A;  4QFO A;  4YB5 A;  4F18 A;  3U92 A;  1II5 A;  3VLW A;  2ALU A;  3CI8 A;  3E4R A;  1US5 A;  4NTL A;  5H8F B;  2V25 A;  2AL5 A;  3KFM A;  4DE8 A;  2HAU A;  3IOT A;  1D9Y A;  3ONM A;  4G4P A;  1B1H A;  2VGQ A;  2ZYK A;  2I4B A;  4AB6 A;  4X1D A;  4Z0I A;  3IO4 A;  4H6D A;  3RTF B;  1ZIU A;  2I6E A;  5AE4 A;  3C4M A;  4OET A;  1B0H A;  3O28 A;  2XXQ A;  1XHY A;  3KN8 A;  4QSC A;  3SEV A;  4RJZ A;  4H65 A;  3N6T A;  1XT8 A;  3OOA A;  4H5G A;  1HSJ A;  1B51 A;  3VV5 A;  2Y7I A;  1F9B A;  1MQH A;  1MXU A;  3LSF B;  1LAF E;  3R7X A;  3RY3 A;  3T66 A;  4EXL A;  4YIC A;  1ZLQ A;  1VSO A;  2DE4 A;  2XXX A;  1EU8 A;  4JWY A;  4KPT A;  1ZKB A;  3MWB A;  4NF5 A;  4U4X A;  1USY E;  5FTH A;  1Q35 A;  5TU0 A;  2Q8J A;  3PUZ E;  1JQF A;  4GXA A;  4ZDM A;  5I2N A;  3MP8 A;  1D9V A;  3DEL B;  1I6B A;  2H9B A;  2UYF A;  5CMK A;  1RYX A;  1R6Z A;  1CE2 A;  4M4G A;  3CFX A;  4G68 B;  3RLF E;  1B7U A;  4DCX A;  5I57 B;  1DSN A;  4JXI A;  1PBP A;  1LB8 A;  1QJM A;  2Z8E A;  3TEL A;  4HCY A;  2XXU A;  4YU0 A;  3U1O A;  5JEI A;  4QSE A;  3G3H A;  5DEX A;  1S9T A;  4U4S A;  4OQO A;  4X9T A;  4ZEB A;  3LC8 A;  4XXU A;  3RN8 A;  1B5H A;  3IB0 A;  2OJT A;  3C9H A;  3QAX A;  5H8N B;  2I48 A;  3K6X A;  1FTM A;  2CZL A;  1BKA A;  1MQD A;  3O2A A;  2UXA A;  1B0L A;  4YKK A;  5FHM A;  1MY0 A;  5ITP A;  1UTB B;  4LUB A;  1FQF A;  3CRB A;  4NWC A;  1QKA A;  2RF1 A;  2I3V A;  1P1U A;  1LFI A;  3S9N C;  1Y4C A;  4F1U A;  4QF9 A;  3DP6 A;  1MY1 A;  1XS5 A;  2YJP A;  4G8H A;  4XKP A;  1IXI A;  1LCT A;  4N07 A;  4NF4 B;  4EUO A;  1AH5 A;  4H1X A;  3K4U A;  5ITO A;  4ZEK A;  1NH8 A;  1OIB A;  3MJN A;  4OEN A;  2ZNS A;  3HHF A;  1MY3 A;  3T93 B;  3TTL A;  1B3G A;  3IR1 A;  4THI A;  4BDO A;  2R6G E;  3PUX E;  2XD2 A;  2DE2 A;  3M8U A;  1MXZ A;  2F97 A;  3PD8 A;  1SI1 A;  3QXM A;  2HQ0 A;  3KZG A;  1MG1 A;  4NWD A;  3TCF A;  3G3F A;  4DIG A;  1MM7 A;  3N5L A;  4U21 A;  4YMB A;  2OBG A;  3EF7 A;  1LAG E;  4KD5 A;  4XKN A;  3B6W A;  3HPI A;  2XXR A;  3WAF A;  3MP6 A;  5FTI A;  4F1Y A;  4IO2 A;  4LAT A;  2F8D A;  3A09 A;  3MBP A;  3N26 A;  1XVY A;  1SBP A;  4LON B;  4RK9 A;  2LAO A;  2Q2C A;  2R9J A;  3S2V A;  5I58 A;  2B3F A;  2CMO A;  1H45 A;  2FA7 A;  1DTZ A;  1LBC A;  1ZTY A;  3KJ7 A;  3LUY A;  1MPD A;  4OMB A;  3FJ7 A;  4R2B A;  3S4U A;  1J1N A;  4TOZ A;  5CMC A;  3VXC A;  2RKM A;  4JWO A;  4R74 A;  2B65 A;  4ZZA A;  3C32 A;  4O3B A;  4NF6 A;  3Q27 A;  3ZSF A;  1JEV A;  5L9S A;  3E3K A;  3GZG A;  4YAH X;  5ELV A;  3OXN A;  3IJX B;  1Y20 A;  2P2A A;  1ZBM A;  3IB1 A;  4G2Z A;  4MBP A;  4NED A;  4GOT A;  3QYT A;  2NWJ A;  2Q88 A;  4IO5 A;  2NVU B;  3SDF A;  4OXV A;  5K2X A;  4BDM A;  4F39 A;  5H8S A;  5HPQ A;  3KOS A;  3MVX A;  4IY6 A;  1AIV A;  3M3F A;  3PUW E;  2O68 A;  1NNP A;  2O51 A;  3SEX A;  3PUY E;  4F3S A;  3PPN A;  5TP9 B;  3H6T A;  4PET A;  3TFL A;  1WOD A;  2O7I A;  2F7C A;  3MW0 A;  4H8I A;  1LFH A;  1B2H A;  3UOR A;  1O7T A;  1IIT A;  4QHQ A;  3UGW A;  1QUK A;  4ESX A;  5ICQ A;  4LA9 A;  1BP5 A;  4JBZ A;  2X26 A;  3I6V A;  3PPP A;  4FED A;  2W7Y A;  5I2K B;  1SYH A;  3MAM A;  4ZEF A;  4ELO A;  4F3B A;  3AXF A;  1MPC A;  1HSL A;  3T96 B;  4K3F A;  4X48 A;  1B7H A;  3PD9 A;  5I84 A;  1PB7 A;  3C33 A;  2X7P A;  1OMP A;  3FGS A;  4R72 A;  4P0G A;  3TKD A;  3U8Q A;  3N6U A;  5AA4 A;  2REG A;  1SVX B;  4IO3 A;  1NKX A;  2UYE A;  5L9O A;  4U1Z A;  4X1B A;  3FJG A;  3UN6 A;  2NUV A;  4TLM B;  1DOT A;  1LGB C;  1M5F A;  3CFL A;  3RQT A;  4PFT A;  3D4G A;  5H8H B;  3VFJ A;  1US4 A;  5FHO A;  4R6Y A;  3TQW A;  5I2K A;  2UVG A;  5ICT A;  2Q9T A;  2F6G A;  3ILU B;  4MH5 A;  1IXG A;  2Z23 A;  1TFA A;  1LAH E;  4ELQ A;  1JVX A;  1NNT A;  4FIM A;  2H98 A;  2F78 A;  1URS A;  4OVJ A;  1PEB A;  4R2F A;  2DYX A;  2RC9 A;  5DVJ A;  2DOJ A;  4ONY A;  3PPO A;  5DEX B;  5EHS A;  1L5T A;  3H06 B;  1ZMG A;  3EHU A;  1SI0 A;  2F6P A;  3T9U A;  4NF8 B;  1I69 A;  5I59 A;  1B40 A;  3TOD A;  2G29 A;  1P1W A;  5A5X B;  5DVI A;  2DXY A;  4LP2 B;  1QUI A;  3PMV A;  3PU5 A;  1GVC A;  2OZZ A;  1P99 A;  1S50 A;  4ZE9 A;  2F35 A;  4LZ7 A;  4DCY A;  5CM6 A;  1FW0 A;  3M3K A;  4U22 A;  4P11 A;  1I6A A;  3O6H A;  4BDL A;  3MUQ A;  3RT6 B;  1EZO A;  3FD3 A;  4H67 A;  3WAE A;  1MDP 1;  3FV2 A;  2DS9 A;  1OVT A;  3MVY A;  3SER A;  2HZL A;  1B1X A;  1PB8 A;  4OEV A;  5TP9 A;  3CFZ A;  3RTW B;  1Y9U A;  3THI A;  5KCJ B;  1OVB A;  2RCB A;  1Y1Z A;  3FVG A;  1H43 A;  3TTR A;  1R9Q A;  5B7D A;  2BJJ X;  1M5B A;  5ISU A;  2I3W A;  3FZV A;  1XOC A;  3ILT B;  3MVW A;  3QK6 A;  4GD5 A;  3K2D A;  3PMX A;  1LBB A;  3H6W A;  3K02 A;  4KR5 A;  2QMX A;  1IQ7 A;  1P1O A;  5DYH A;  4GLI A;  4RY1 A;  2XXY A;  4OYV A;  3UIF A;  4UAC A;  2NXO A;  2RIN A;  3C31 A;  3OO6 A;  2XHD A;  4ELR A;  2Q89 A;  4QRZ A;  1NH7 A;  2F7A A;  3TYH A;  2XXW A;  1YCJ A;  4KCD A;  3B6T A;  4KYS A;  1PBQ A;  4MFI A;  3QSL A;  1URD A;  1LB9 A;  4OER A;  4GWO A;  3SEU A;  1YTV A;  4WED A;  3TDJ A;  3TMG A;  4PFU A;  3W9W A;  4AQ4 A;  2AL4 A;  4LZ8 A;  3DM0 A;  4NF6 B;  2O84 X;  2DVC A;  1B5J A;  2PMS A;  2ZYN A;  1ZJL A;  1GGG A;  2ZXT A;  3G7W A;  4DLD A;  4H0W A;  3LSL A;  1M5E A;  3MC2 A;  2ESN A;  3UP9 A;  5IKB A;  1Q1K A;  1R9L A;  2DWI A;  2XX8 A;  3HN0 A;  4RK2 A;  3KOT A;  4O3A A;  1B46 A;  1B3F A;  1Z7N E;  3A3U A;  2VP1 A;  3FXU A;  2H99 A;  2O7U A;  4RPN A;  4YKI A;  1B3H A;  4JB7 A;  1GR2 A;  4JDF A;  4QSD A;  1EZP A;  1MRP A;  4GXS B;  2H25 A;  1URG A;  4NF8 A;  4OFJ A;  2GRV A;  3KBR A;  3G3J A;  1N04 A;  4FAJ A;  2ANJ A;  2Z8F A;  1FQA A;  1A7L A;  2ZMB A;  4OZ9 A;  1DPP A;  2A5T B;  3KEI A;  1FTJ A;  1FQD A;  3TTM A;  4GVO A;  4UA8 A;  2DQV A;  3EPE A;  4ELP A;  4ISU A;  3OSR A;  1N7W A;  2QMW A;  4NMY A;  3A3C A;  1D4N A;  2PX1 A;  4E0W A;  4I62 A;  3K1M A;  4BDR A;  2GH9 A;  4GRK A;  3C36 A;  3QIM A;  4ZEI A;  3IB2 A;  2D21 A;  3OO7 A;  4FE8 A;  4R9F A;  3KN7 A;  3RGY A;  3VLU A;  3U72 A;  1B4Z A;  2XXP A;  3QUJ A;  4IO4 A;  4Q5T A;  3SES A;  4G68 C;  2UVJ A;  4F31 B;  1POY 1;  2G93 A;  1MXX A;  4R9G A;  5JTY B;  4F19 A;  4ZEC A;  5AA2 A;  1VFD A;  5H8N A;  3H4Z A;  4OES A;  2REJ A;  3D4C A;  3OO9 A;  5JTY A;  5F7V A;  1PC3 A;  2HEU A;  1OQG A;  1UTB A;  1QUL A;  3E9X A;  4H5F A;  4N13 A;  4DZ1 A;  4EF2 A;  1I6Q A;  3KSJ A;  1EH3 A;  1UTH A;  1FTO A;  1FTL A;  1O63 A;  1SYI A;  3TTK A;  1MPB A;  3CG1 A;  4EQB A;  1B7Z A;  3N94 A;  4M1V A;  3C34 A;  3VXB A;  1USY H;  5AA1 A;  1A40 A;  4LZ5 A;  1H44 A;  1SW1 A;  4Q8R A;  3OD7 A;  1N84 A;  3K6W A;  4GL0 A;  2A5T A;  3S9E A;  1MQJ A;  1SW2 A;  2O6A A;  1TT1 A;  4JSD A;  2P0S A;  4YB6 A;  5HBC A;  5I56 B;  4G68 A;  5I57 A;  4MLQ A;  5FHN A;  1R1N A;  3KJT A;  3OEL A;  4EQ9 A;  3IK6 B;  1XC1 A;  3QUF A;  4OWD A;  4I9D A;  3SEW A;  1ELJ A;  2FYI A;  3TQL A;  2PT1 A;  1D3K A;  1UTH B;  4KYD A;  2F34 A;  4DXC A;  3ECR A;  4G77 A;  4KFQ A;  4IB2 A;  4NE4 A;  1SQY A;  2XXT A;  4P0I A;  3TTN A;  3G3K A;  3F11 A;  2H4I A;  4LQ5 A;  3B7D A;  2XXI A;  2Y7K A;  4Q30 B;  4RXL A;  2HFB A;  1NMU A;  2DWA A;  4KHZ E;  4U23 A;  3V8X B;  4F22 A;  1LLS A;  2HAV A;  3O66 A;  5LOM A;  2ONS A;  3MPL A;  5B70 A;  4HW8 A;  3ZKK A;  3GBB A;  5CBR A;  1H76 A;  5JK4 A;  1QKB A;  3FVK A;  4C1T A;  4ECF A;  5CMB A;  4MF3 A;  1A8E A;  2DSF A;  1FCK A;  2FNC A;  5L9M A;  2GHB A;  5KDT B;  3B6Q A;  4QFN A;  1MQG A;  1XVX A;  5L8D A;  2OWS A;  2PBW A;  2V84 A;  3PPR A;  5KDT A;  3HO7 A;  3K1P A;  4OFO A;  3FVN A;  1SW4 A;  1Y3N A;  3OEM A;  3MZB A;  5H8F A;  1Y1M A;  3HV1 A;  3O97 A;  1GV8 A;  3FXR A;  4QFP A;  1B05 A;  3MP1 A;  4R73 A;  5I56 A;  3TUS A;  3K6U A;  5KCJ A;  1HSE A;  3FVO A;  4OFL A;  3FIR A;  1JW4 A;  1RYO A;  3FJM A;  4MLV A;  4HS7 A;  4G8N A;  4O3C A;  5CMM A;  3USD A;  1AOV A;  3T9H B;  1NNF A;  1SW5 A;  1B9J A;  5DT6 A;  4YMA A;  2OWT A;  1N76 A;  4L17 A;  3KG2 A;  2QL3 A;  3BFT A;  4FJP A;  1O64 A;  4FEB A;  3EN3 A;  1JEU A;  4PFY A;  1Y4T A;  2DE3 A;  2HZK A;  3K0V A;  4GQO A;  4NF4 A;  2YLN A;  4XKR A;  3S9M C;  3SKP A;  4F3P A;  3EHS A;  4YZZ A;  5KZT A;  4IGR A;  4I8C A;  5TPA B;  3IX1 A;  4OTE A;  4KCC A;  2AIX A;  1M5C A;  2I58 A;  3U94 A;  4LVQ A;  3LSW A;  1MS7 A;  2P1S A;  5BUU A;  5AA3 A;  5I58 B;  1TFD A;  3UK4 A;  2QS4 A;  4TQU Q;  2XX9 A;  4ZE8 A;  2E1S A;  5BWJ A;  1N7X A;  3BFU A;  1NL5 A;  3L6H A;  3OSQ A;  3GLB A;  4E0X A;  2Y7W A;  3CSB A;  3EHT A;  3Q25 A;  3VLV A;  3GBA A;  4QFL A;  2VOZ A;  3SEY A;  5H8Q B;  2RC7 A;  1N3W A;  4F1V A;  2V3U A;  3K01 A;  3TCH A;  1BTJ A;  1NNK A;  3MVZ A;  5EHM A;  5TPA A;  1DMB A;  1B4H A;  5H8Q A;  3RPW A;  2V3T A;  4EQ7 A;  2PT2 A;  3Q26 A;  5I59 B;  3FXQ A;  1M5D A;  4R6K A;  2QS1 A;  3O9P A;  1FQB A;  3OEN A;  4IO6 A;  3UA8 A;  1B6H A;  4IO7 A;  3OO8 A;  4FOR A;  3EQ1 A;  3OEK A;  5I2N B;  1P1N A;  2XXH A;  4IGT A;  1IEJ A;  2O1L A;  2QS2 A;  3FAS A;  2E0S A;  4R6H A;  4ZED A;  3H6V A;  3ZKL A;  3E13 X;  2Q2A A;  4LQ2 A;  3R6U A;  1EZ9 A;  3BKI B;  4POW A;  2IEE A;  3FUZ A;  3H03 A;  3L6G A;  3G3I A;  2GHA A;  1BIY A;  4TLL B;  1MH3 A;  1Z7M E;  3GXA A;  1OLC A;  1BLF A;  1TXF A;  1N0T A;  1UIU A;  2THI A;  2WKY A;  3IJO B;  4IY5 A;  2OLB A;  4PFW A;  3K1N A;  1VR5 A;  2YPN A;  3MPK A;  2ZYM A;  3JV9 A;  3T22 A;  3JYR A;  5AA4 B;  5J1D A;  1IZ1 A;  3RNN A;  2PYY A;  3W9V A;  2QS3 A;  2GFE A;  4R75 A;  1B58 A;  3RUM A;  4ZS9 A;  1H3D A;  4GIZ A;  3KSX A;  2DWJ A;  3U93 A;  3I3V A;  3IOU A;  3M3L A;  2V3Q A;  2R71 A;  1JVY A;  3CVG A;  3H7M A;  3I5O A;  4XTC Q;  5CRY A;  1IUD A;  2QRY A;  3IOV A;  4BDQ A;  3T9V A;  1LAX A;  4XIG Q;  4GF8 A;  4U2R A;  5F1Q A;  5AA2 D;  1B52 A;  5CC2 A;  4KI0 E;  2KLF A;  2VD2 A;  1FQC A;  3IL1 B;  1JNF A;  2DVZ A;  4RPO A;  4OEU A;  3PGF A;  1AL3 A;  4U1O A;  4XKQ A;  3W15 C;  4F3G A;  4FAT A;  5IAI A;  1B3E A;  3HCQ A;  1AMF A;  3IO6 A;  4NF5 B;  4EF1 A;  1QUJ A;  4QFK A;  1DTG A;  1A99 A;  1GTK A;  1N3X A;  4JSO A;  2QJE A;  3O29 A;  4DXB A;  3JZJ A;  2Y7P A;  1A55 A;  2Z8D A;  3K00 A;  3PUV E;  4PQJ A;  3KN3 A;  1Y3P A;  2OK2 A;  2PVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...