2H98A

Crystal structure of the effector binding domain of a catm variant, catm(v158m)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
216
structure length
216
Chain Sequence
SQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRRIMLHKEQLKLAIHKHHHLNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNYIPKILACVQEVFATHHIRPLIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the altered regulatory roles of three LysR-type transcritional variants of CatM and BenM: CatM(V158M), CatM(R156H) and BenM(R156H/T157S)
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator catM
total genus 59
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h98A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h98A02
4OQOA 1B4ZA 5HBCA 4NWCA 2XD2A 1AOVA 2X7PA 5I2NB 2DWAA 5TU0A 3TFLA 1FCKA 5I58B 4GFRA 3KGCA 4QSDA 3FASA 1MY4A 1OLAA 1VFDA 3FATA 4G77A 4U23A 5H8QA 4F3GA 1B6HA 1D3KA 4JDFA 3PGFA 4KHZE 1HSEA 2XXIA 3RTFB 1M5EA 1MG1A 2ZYMA 5ISUA 2V25A 2AYSA 1JW5A 3Q26A 3T93B 3M3KA 1MQGA 4U4SA 2R6GE 3A3UA 3G3KA 4QFOA 1WDNA 3HHGA 4H0WA 4O3CA 1FTKA 3T9UA 3UN6A 1A99A 1P99A 4BDOA 1PEBA 2OBGA 4JSOA 3IJOB 3ILTB 1MXVA 1O63A 4FECA 5AA4A 3QUFA 1Y1ZA 1DTZA 2HXWA 5KDTA 1H76A 2FYIA 4TOZA 1O64A 2DE2A 2DS9A 2ONKE 4RK2A 1B05A 3PU5A 4X1DA 3TKDA 1UTBB 3KG2A 4NF4A 3FJGA 3PUWE 4LONB 3FXQA 4R74A 2F6GA 1LB8A 2I0CA 4YZZA 1TFDA 2D3IA 3F11A 1QW0A 4OYVA 4X1BA 2I4CA 3T9VA 2I6EA 2D5WA 3OSRA 3IL1B 3KZGA 1GVCA 3S4UA 4ELQA 1DSNA 4F29A 5B70A 1LLSA 2F34A 5A5XA 1OLCA 4RPNA 4NF8A 3HPIA 3EHSA 4JWOA 1B40A 4RJZA 3OELA 1S9TA 5DEXB 5K2XA 1B3GA 2CMOA 3GXAA 1II5A 3G3GA 5DYHA 1PC3A 2XX8A 3PUVE 2XXHA 5LOMA 1SDXA 3ZKKA 4OFLA 3RN8A 1NKXA 5CM6A 1LSTA 3MVWA 4GD5A 2Z22A 4I9DA 1USYH 4P0GA 2GHAA 2PMSA 5H8QB 3N6TA 3I3VA 4RPOA 1BLFA 1QUJA 2Y7KA 3SETA 5AA3A 2THIA 5H8FA 2OLBA 3B6TA 4JWXA 3Q29A 1DPEA 1POY1 4BDNA 4YKKA 4QFLA 4DXUA 4BDLA 3PPPA 2XHDA 3CFLA 4EF1A 4QF9A 4ZZEA 2VD3A 2UVJA 4AB6A 5CBRA 3UA8A 2A5TA 3FIRA 3TEPA 3VVDA 4QHQA 3CR9A 3H6UA 3U92A 2ZNUA 4F3SA 1I6BA 4Q5TA 4ZS9A 4LUBA 3DM0A 1R6ZA 3K6VA 1ZJLA 4F2QA 1XVXA 1N7WA 2V3TA 3MVYA 4NF6B 4YICA 1MM7A 1IQ7A 1POTA 1B7UA 4WXJA 1FQCA 5CI5A 2XXVA 3EF7A 5CRYA 4IO2A 3EHTA 3CG1A 1VFEA 3TQLA 4EXLA 4KCCA 4F3PA 4U1ZA 2XXYA 1MQHA 2RF1A 4H65A 3RUMA 4DLDA 4EDPA 4FATA 2ZYNA 4POXA 2Y7IA 4LQ5A 5H8NB 3W9VA 3CRBA 3K01A 5AA2A 1BKAA 2UYFA 2B65A 4IO6A 1D9YA 2FNCA 5H8FB 1PB8A 3K1MA 3HN0A 2OZZA 4OESA 5KCJA 5IAIA 1LB9A 3LC8A 3FJ7A 3HSTA 5I57A 3PPRA 2IA4A 4U22A 1OIBA 3K6UA 2QPQA 3S9NC 3TCHA 4EUOA 4XKRA 4G8MA 4PFTA 4X48A 3OO7A 3MAMA 3Q25A 3KJTA 5I2KA 1LCTA 2X7QA 1P1WA 4KI0E 3LSLA 1GGGA 1MRPA 4I8CA 3U8QA 4WEDA 2ABHA 4OFOA 3DELB 1M5CA 1TFAA 3G3JA 1B3LA 3JYRA 1UQWA 5I59A 5L8DA 3IX1A 1FQEA 1US4A 1UTBA 4LATA 3KJ7A 1KWHA 3KFMA 4MLVA 4U4XA 1B5IA 3OOAA 2ZNSA 5AA2D 1IZ1A 5DTBA 5L9MA 3H03A 4NEDA 3TQWA 5I84A 1D4NA 1R9QA 2IEEA 3ONMA 3CSGA 2NVUB 2P1SA 1B9JA 4K3FA 4F3BA 4ECFA 4GIZA 3VLVA 2RC9A 3VVEA 3TCFA 4JSDA 4NF4B 3TCGA 4ESWA 1NMUA 2PVUA 4GWOA 4LP2B 4XKNA 2RC8A 1EZOA 4G2ZA 1R1NA 1FTJA 3C9HA 2E0SA 3H7MA 4POWA 2ANJA 1ELJA 2QMXA 3MP8A 1NNPA 4EF2A 4KPTA 3HO7A 3R6UA 4OFJA 3FGSA 4R2BA 1F9BA 4R6YA 3TUSA 2OWTA 3U1OA 3E13X 1Z7NE 1SVXB 4G68B 2HZKA 4ISUA 1MH3A 1P1NA 2O51A 3FXRA 5CMBA 4EQBA 1WODA 1SW2A 2D21A 4IY5A 3E4RA 1N3XA 4C0RA 3VVFA 2X26A 1M5DA 2Q89A 4XTCQ 5KDTB 4OWDA 5FHOA 1HSJA 1A54A 4AQ4A 2F35A 2Q2AA 3L6HA 4DE8A 1B1HA 3K00A 4E0WA 2UVIA 3O2AA 3SKPA 4H1XA 1MDP1 4TLLB 4F31B 1OQGA 2VP1A 3TELA 4PFYA 3PMVA 1ATGA 3U93A 2VGQA 4FEBA 3T9HB 4F18A 2Q9TA 1URSA 3O6IA 1ZU0A 3MZBA 2O7IA 4KD5A 3T96B 1UTHA 1LAFE 4THIA 1H43A 1JQFA 4LQ2A 5HM4B 4YMBA 3MC2A 4ND9A 3VLUA 2Z8FA 2QRYA 3MPLA 1AH5A 2H98A 1SI0A 2R9JA 1MY2A 2XXQA 2DVZA 4LZ8A 3CIJA 1LBCA 1AL3A 2B3FA 1MPBA 2NUVA 3SEXA 1PBQA 2DXRA 1QUIA 5DVFA 2AL5A 4GF8A 4LZ5A 3VXBA 3Q27A 1Y20A 2O1LA 2PYYA 1M5FA 4YAHX 4F19A 3C31A 3G3FA 3OEMA 4KFQA 4NF6A 4NF5A 1GTKA 5AA1A 1N3WA 1UIVA 4XXUA 2YJPA 1B46A 5B7DA 5CMMA 2V3UA 3B7DA 3MZ9A 4KCDA 1Y4CA 4RY1A 5JTYA 3V8XB 3DLNA 1JNFA 1DTGA 1OVBA 2A5TB 4GLIA 2H4IA 3SEVA 3QYTA 5JK4A 1TT1A 1XVYA 4HTGA 5EYFA 1Q1KA 3IO6A 1MPCA 1JVYA 1IIWA 2QS1A 2V3QA 2RC7A 5TPAB 3PV0E 4NF8B 3KN8A 3V89B 1H3DA 3RTWB 3C34A 2Y7WA 4E0XA 1QKAA 3PMWA 2V93A 1XC1A 5HPQA 1B51A 1IXGA 1MH4A 2B3BA 4R6HA 2VOZA 3C35A 4NTLA 1Y9UA 1LFGA 4H5GA 4JBZA 3KBRA 3FVNA 5K2YA 4OZ9A 2H25A 5H8HB 1A8FA 4QSEA 1P1QA 1UIUA 3BFTA 5FHMA 4GL0A 3QIMA 1A55A 3K2DA 3VE1B 5IKBA 4OETA 5ITPA 2Q8JA 1TXFA 2QS4A 3AXFA 4GRKA 4I62A 1MQDA 1AMFA 2HFBA 3SDFA 5JEIA 1B3HA 4BDMA 1XT8A 2YLNA 1BIYA 3MVZA 5I2KB 4G4PA 1N0TA 1R9LA 2A5SA 4GL8A 3IOUA 4OEVA 4Q30B 4Q0CA 4DCXA 5F7VA 3TODA 4DDDA 2I0BA 5TPAA 4R9FA 1P1UA 1NNTA 1XHYA 1NNFA 2ONRA 3PUXE 1OMPA 4R9GA 3S9MC 2Y84A 4OTEA 3K6XA 1Z7ME 4PP0A 3GBBA 2XXPA 3TAJA 1HSLA 3H06B 4NE4A 2BJJX 4X9TA 1EH3A 2Y7RA 4L17A 4ELOA 4PETA 1A7LA 2Z23A 2ZYKA 4Z0IA 5CMKA 2ALUA 2DXYA 2O68A 2UVHA 4FEDA 5AA4B 3K0VA 1LAXA 5KCJB 3O9PA 4OHNA 1NL5A 4ELRA 1NH7A 3OEKA 3IO4A 4TQUQ 3U94A 3ZSFA 1B1XA 3RNNA 1Y3NA 2F5XA 3IB2A 4C1TA 2O6AA 4JWYA 4ELPA 1OQHA 2HZLA 3MP1A 4F1VA 2DP8A 2YPNA 3FVKA 2DE4A 1SQYA 5DT6A 2ZXTA 2DSFA 3IK6B 2O1MA 4G8HA 3HCQA 3N6UA 5FTIA 1YCJA 4NWDA 3TYHA 3T22A 1ZTYA 1FTLA 2HAUA 2XX9A 3FJMA 4P11A 1N04A 5A5XB 1AIVA 2LAOA 1ANFA 3EHUA 4DXCA 4IO5A 1MXYA 3R26A 5FHNA 1PDAA 3ODBA 4HCYA 4YB6A 3KSXA 3I5OA 3O6HA 2F78A 3TTKA 3K4UA 2KLFA 1FTMA 1SW4A 3DP8A 4QFPA 3N26A 3TMGA 1H45A 1MXWA 1EZ9A 1SW5A 2GHBA 3CSBA 3SEYA 1JVXA 1ZMGA 2Q88A 3DP6A 4XIGQ 3O97A 4DZ1A 5CC2A 1Q35A 3RT8A 5ITOA 4DIGA 3IOTA 1A40A 3MPKA 2AL4A 5BUUA 3GLBA 2WKYA 2R71A 3OXNA 2XXRA 4YKJA 3IB0A 1FTOA 1LBBA 3IR1A 4KYSA 4IY6A 5L9OA 4ZE9A 1NH8A 2HCAA 2OK2A 4MFIA 1TWYA 3K02A 4GQOA 4NMYA 3TTNA 3V5AA 4IGRA 3UIFA 3FV2A 1S50A 1QUKA 3USDA 4RA1A 5EHSA 4EQ9A 1SD3A 3MVXA 4ZEIA 3WAFA 1QULA 2GRVA 3TZAA 3PD8A 5ICQA 1VE4A 3DP4A 4DXBA 4H5FA 3PMXA 1VR5A 1FW0A 1MPDA 4R73A 4YB5A 1B52A 3BBRA 1T0KA 1M5BA 3PD9A 2QSXA 3IOWA 1MQIA 3SEWA 4P0IA 2I3VA 4H8JA 1B4HA 3R7XA 4U2RA 3RY3A 1H44A 1RKMA 1B7HA 1CB6A 1MM6A 1QKBA 3E3KA 4ZZAA 2I3WA 1EZPA 3FD3A 3LUYA 2RCAA 5H8HA 4ZEKA 1B58A 4GXAA 1MY3A 3Q28A 2F6PA 1SBPA 3H6TA 4UA8A 3V83A 3ZKLA 2QL3A 1PB7A 1B0HA 2DWHA 3KN7A 1URDA 3C32A 3MP6A 1B7ZA 3TTLA 1DOTA 2DVCA 3KEIA 4H6DA 4R6KA 1B3EA 5TP9B 1LGBC 3B6QA 3TDJA 3HHFA 3GZGA 5F1QA 5EHMA 3VV5A 4BDQA 3BFUA 3K1NA 2F8DA 4MF3A 4YU0A 1ZKBA 2F7AA 3BKIB 3C4MA 4N07A 4EQ7A 2DOJA 2OJTA 3S2VA 2PBWA 3O6GA 2XX7A 5JTYB 5I56A 1D9VA 2UYEA 4GVOA 4FE8A 5I2NA 2F97A 1CE2A 3S9EA 3SERA 2XXWA 3SEUA 3QK6A 2REJA 4RK9A 1YAEA 3HV1A 3GBAA 1YTVA 3OENA 2F7CA 1DPPA 1Y4TA 4ONYA 3P7IA 1FQBA 1MXZA 3D4CA 3D4GA 3ECRA 3H3GA 4ZEFA 3VDFA 1I6QA 3IOVA 3MUQA 1Y3PA 4RYAA 5FTHA 2I58A 4XKQA 1FQFA 3CG3A 1JW4A 1MXXA 3EQ1A 3H4ZA 3MZ1A 3QSLA 4LA9A 4QRZA 1OVTA 3FUZA 4AB5A 2E1SA 1FQDA 3LBSA 2HQ0A 2XXXA 1A8EA 3S9LC 4KQPA 4XKPA 2AIXA 2G29A 3OO6A 3O66A 3MWBA 2I48A 3UP9A 3OMBA 4WEPA 4KR5A 1LAGE 4IGTA 5DVIA 1SI1A 1B5HA 3KN3A 3QXMA 2NOOA 3C33A 3VXCA 4ZDMA 3UK4A 3M3LA 4HS7A 5L9SA 3LSFB 1I69A 3A3CA 2P2AA 3OD7A 4N13A 2HAVA 2O69A 3T9XB 1GR2A 3MBPA 4MBPA 4OENA 3B6WA 3G3HA 1WVJA 4U1OA 3L6GA 4ZEBA 2P0SA 1MQJA 2ZMBA 4R75A 4YMAA 3PUYE 1JW1A 1PB9A 2DWIA 3CFXA 1ZBMA 2PX1A 4HCWA 4UACA 1SYHA 5TP9A 4QFKA 3U72A 1Y1MA 2VHAA 3ZS6A 4IO4A 1MS7A 4H8IA 3SESA 4F1YA 3FV1A 4O3BA 4QFNA 1QJMA 1RYOA 1GV8A 2VD2A 2HEUA 3G3IA 2GH9A 5ELVA 2PT2A 3CVGA 1NFTA 2RKMA 1DMBA 2Y7PA 1XS5A 4ZEDA 5BWJA 4Z7EA 1LFHA 4OMBA 4R72A 1MXUA 4ZE8A 1P1OA 3OSQA 4FORA 1IEJA 1JEUA 4G8NA 3A09A 3I6VA 4F39A 1QVSA 3THIA 2DQVA 2I49A 1B5JA 1SW1A 1Y3QA 1B32A 2O84X 3LSWA 3MW0A 4OEUA 4OVJA 4F2OA 4IB2A 3C36A 2DYXA 4GXSB 1O7TA 5AE4A 2H5YA 4GOTA 4I1DA 4RNSA 4FAJA 3RGYA 5I59B 2OWSA 4G68A 3FZVA 2H9BA 4F22A 5CMCA 5I57B 4OXVA 3QUJA 4YKPA 5I56B 2DE3A 4YKIA 3PPOA 3RPWA 4H67A 5I58A 3M3FA 3KOTA 2GFEA 2NXOA 2O7UA 3CI8A 4OERA 3ILUB 1IITA 3MJNA 4RXLA 3T66A 2OCUA 4PFWA 2F36A 3PPNA 1LCFA 3IJXB 2UVGA 4JXIA 4WKMA 1URGA 4IO7A 3TTRA 2UXAA 3EPEA 5KZTA 3VFJA 2RINA 2V84A 2ESNA 1SYIA 1JEVA 1N76A 4MLQA 3TPAA 3FVOA 4TLMB 3O28A 4JB7A 2F7BA 1B0LA 2M8CA 4KYEA 3JV9A 4M4GA 2DWJA 3W15C 4C1UA 3QAXA 3WAEA 1UTHB 3G7WA 1FQAA 1J1NA 3IB1A 3K1PA 1BP5A 1IXIA 1PBPA 3N5LA 3FVGA 1LFIA 4O3AA 2ONSA 1VSOA 1XOCA 1N7XA 5H8SA 1NNKA 3JZJA 3RQTA 3VLWA 1ZLQA 1BTJA 1B3FA 1MDQA 1YPNA 4M1VA 2NWJA 1B2HA 2Q2CA 5M2VA 3W9WA 3EN3A 5AA2B 4KYDA 2QS2A 5H8NA 3CFZA 2ZYOA 3KOSA 3H6WA 4MH5A 3E9XA 2CZLA 3O29A 5DVJA 4BLAA 3K6WA 5ICTA 2I4BA 1US5A 5J1DA 1L5TA 4Q8RA 4ZECA 2Z8EA 2PT1A 4PE5B 2QS3A 2RCBA 3LSXA 1MY1A 3OO9A 3M8UA 4R2FA 2H99A 5CBSA 3OO8A 3PUZE 2G93A 4HW8A 2FA7A 4PQJA 1MY0A 3H6VA 1I6AA 4F1UA 4PFUA 2QJEA 3N94A 2XXTA 1N84A 3UORA 3UGWA 3FXUA 3MQ9A 5DEXA 3IORA 2Z8DA 4FJPA 4LVQA 1LAHE 1RYXA 2XXUA 3LR1A 4G68C 3IAZA 4LZ7A 3TTMA 4BDRA 4EXKA 4ESXA 2QMWA 1S7YA 3RLFE 4IO3A 4FIMA 1IXCA 1IXHA 4NF5B 3RT6B 4DCYA 4QSCA 1ZIUA 2REGA 3KSJA 4YB7A 3PPQA 1EU8A 4N6PA 4U21A 2XD3A 1JETA 2W7YA 1USYE 2ZNTA 1IUDA
chains in the Genus database with same CATH superfamily
5HBCA 1AOVA 5IZ1A 5I58B 4GFRA 4QSDA 5DW8A 4U23A 4G77A 3G3KA 4O3CA 4O8MA 1PEBA 4FECA 5AA4A 3BIHA 1H76A 4RK2A 3FJGA 4LONB 2I0CA 1GVCA 1LLSA 5A5XA 4NF8A 4JWOA 5K2XA 1II5A 2XXHA 1NKXA 4I9DA 3I3VA 1BLFA 2Y7KA 5H8FA 5AA3A 2THIA 4YKKA 3CFLA 4PFIA 2VD3A 3A29A 2A5TA 3TEPA 3VVDA 4GWYA 1XVXA 4GX6A 4NF6B 1POTA 3EF7A 3EHTA 2HHMA 4FATA 4OANA 3CRBA 3K01A 4PF6A 2B65A 2OZZA 5EYGA 3LC8A 3HSTA 5I57A 3ROJA 4EUOA 4OVQA 4XKRA 3OO7A 3Q25A 2X7QA 1P1WA 1GGGA 2Y5KA 1EYKA 3JYRA 1FQEA 3OOAA 5AA2D 1IZ1A 1DK4A 5DTBA 3TQWA 1R9QA 4GWWA 1IMEA 2PCRA 4JSDA 4ESWA 1EZOA 1R1NA 1FTJA 3C9HA 2E0SA 4POWA 4X04A 1NNPA 4EF2A 4KPTA 3R6UA 4OFJA 3FGSA 1SVXB 2HZKA 4ISUA 2O51A 1WODA 3E4RA 4N15A 1HSJA 4JVCA 2Q2AA 3K00A 3TELA 1ATGA 2VGQA 4FEBA 4PC9A 2O7IA 1JQFA 5HM4B 4O94A 1AH5A 2DVZA 4LZ8A 1AL3A 2B3FA 1MPBA 2NUVA 2DXRA 5DVFA 2AL5A 2O1LA 2PFZA 3C31A 5AA1A 4GX3A 4NF5A 2QVRA 3MZ9A 3DLNA 1JNFA 1DTGA 2A5TB 4GLIA 1TT1A 2B4MA 1MPCA 3PV0E 3V89B 3RTWB 1QKAA 5HPQA 4R6HA 1LFGA 5K2YA 4OZ9A 4ELRA 1P1QA 3VE1B 5IKBA 3QIMA 4OETA 4I62A 1MQDA 4PTKA 4BDMA 2YLNA 1BIYA 4GL8A 3FXBA 3TODA 4DDDA 2I0BA 3PUXE 1OMPA 4OA4A 2Y84A 3MSTA 4OTEA 3GBBA 2XXPA 3TAJA 3H06B 4NE4A 4X9TA 2ZYKA 5CMKA 2DXYA 5AA4B 1AWBA 4AS4A 1B1XA 4ELPA 2HZLA 2YPNA 4GX4A 4NGUA 3N6UA 4P9KA 1ZTYA 2HAUA 1FSAA 1ANFA 4IO5A 1FBDA 4HCYA 5EQ8A 2F78A 4PAFA 1FTMA 3DP8A 1H45A 1EZ9A 3SEYA 1BK4A 4DZ1A 5CC2A 4DIGA 4PCDA 4O7MA 4N8GA 1YXIA 3GLBA 2XXRA 1FTOA 3IR1A 4KYSA 4MNPA 4IY6A 1FBGA 1NH8A 4MFIA 3V5AA 4NMYA 1S50A 3WAFA 4GBVA 4HE1A 3DP4A 4H5FA 1M5BA 4N6KA 2QSXA 4P0IA 2I3VA 4H8JA 5EQAA 1QKBA 4ZZAA 3FD3A 1B58A 3Q28A 2F6PA 5LTCA 3V83A 4HXVA 1DOTA 4FBPA 5TP9B 3B6QA 3GZGA 4YU0A 4N07A 1CNQA 2OJTA 1IMAA 3O6GA 3PTYA 2XX7A 4IR8A 4FE8A 1CE2A 1FPDA 4I40A 1G0HA 2XXWA 3SEUA 4RK9A 2REJA 3OENA 4AS5A 1Y4TA 3ECRA 1I6QA 5FTHA 1Y3PA 4RYAA 1LBYA 2I58A 4XKQA 1FQFA 3CG3A 1MXXA 2E1SA 3LBSA 2XXXA 1A8EA 4XKPA 3OO6A 2P3NA 4WEPA 5DVIA 1B5HA 3QXMA 4ZDMA 3LSFB 3A3CA 3OD7A 2O69A 3T9XB 1GR2A 3MBPA 3MYUA 4U1OA 2ZMBA 3PUYE 5TP9A 3ZS6A 1SYHA 4IO4A 3SESA 3D1RA 1QJMA 1RYOA 2VD2A 1KA1A 5ELVA 3CVGA 1XS5A 1NV2A 1LFHA 4OMBA 4G8NA 1SW1A 1Y3QA 4PE3A 4OEUA 3C36A 2DYXA 4GXSB 1O7TA 2H5YA 4RNSA 4FAJA 4YKPA 3QUJA 3PPOA 3KOTA 2O7UA 3CI8A 3IJXB 2QVUA 2UXAA 2RINA 3TPAA 3RPLA 3JV9A 4C1UA 3QAXA 1UTHB 4KXPA 1FQAA 3KC0A 1J1NA 3IB1A 1IXIA 3FVGA 2QFLA 1N7XA 3VLWA 1ZLQA 1MDQA 3GYYA 1YZ0A 3KOSA 5DVJA 1FPJA 2I4BA 4PE5B 4NG7A 4F1UA 4DI4B 3N94A 2XXTA 3MQ9A 4FJPA 1RYXA 3TTMA 4ESXA 4P1LA 4QSCA 2ZNTA 4OQOA 4NWCA 5I2NB 2DWAA 1VFDA 3FATA 4F3GA 1D3KA 4PDDA 1NV0A 2XXIA 3RTFB 2AYSA 1JW5A 3M3KA 1MQGA 4PFRA 2R6GE 4N6DA 4QFOA 1WDNA 4H0WA 3IJOB 3ILTB 1O63A 2MKZA 2HXWA 1O64A 2DS9A 4X1DA 1UTBB 3KG2A 4PAKA 1LB8A 3T9VA 4ELQA 4F29A 1NUWA 4RPNA 3HPIA 4RJZA 1B3GA 5DYHA 3G3GA 3PUVE 3ZKKA 3N6TA 4JWXA 4BDNA 4QFLA 4BDLA 3PPPA 4EF1A 2UVJA 3LV0A 3UA8A 2HXRA 4P47A 4QHQA 4F3SA 1I6BA 4Q5TA 4LUBA 3DM0A 1G0IA 1N7WA 3MVYA 4YICA 1IQ7A 1B7UA 5CI5A 4IO2A 4EXLA 4U1ZA 4DI3D 1MQHA 4H65A 2UYFA 5H8FB 2FNCA 3HN0A 4OESA 5KCJA 3PPRA 1OIBA 3K6UA 1FBHA 4G8MA 4PFTA 4MEVA 4X48A 1LCTA 1B3LA 5I59A 5L8DA 4LATA 1KWHA 1NV1A 4MLVA 4NEDA 3CSGA 2P1SA 1KA0A 4ECFA 4GWOA 4G2ZA 3H7MA 1ELJA 4P3LA 3HO7A 4R2BA 3U1OA 4G68B 5CMBA 4EQBA 4IY5A 2D21A 3HFUA 1N3XA 1RDZA 4OWDA 1A54A 2XWVA 2F35A 2WX9A 3L6HA 2UVIA 1MDP1 1OQGA 4F18A 3T9HB 2Q9TA 5I3SA 1ZU0A 1UTHA 4LQ2A 3MC2A 1SI0A 1MY2A 2XXKA 3SZPA 4GF8A 3VXBA 4YMBA 4KFQA 3OEMA 1GTKA 2YJPA 4RY1A 4GWUA 5JK4A 4HTGA 3T1BA 2QS1A 5ET7A 5TPAB 1LBXA 3KN8A 2Y7WA 1XC1A 1IXGA 2B3BA 2VOZA 4NTLA 1Y9UA 2ZZVA 5ET5A 1IMFA 1A8FA 3ZKLA 4NF0A 3BFTA 4PF8A 1A55A 2QS4A 3AXFA 4GRKA 1B3HA 4G4PA 1N0TA 4Q0CA 2A5SA 3IOUA 5F7VA 3U65A 1P1UA 1NNTA 1Q9DA 3K6XA 4PP0A 1HSLA 4L17A 2ALUA 2UVHA 4FEDA 3O9PA 4OHNA 1NL5A 3OEKA 4TQUQ 1FPGA 3IB2A 2O6AA 4LN5A 4F1VA 2DP8A 3FVKA 2DSFA 2O1MA 3IFAA 4G8HA 4OVSA 2XA5A 5IZ3A 3T22A 2VT5A 4P11A 5A5XB 1AIVA 3EHUA 3CHGA 4YB6A 3KSXA 3TTKA 3K4UA 1SW4A 4QFPA 4NHBA 3IFCA 1MXWA 1SW5A 3DP6A 2AL4A 5BUUA 2WKYA 3IB0A 4ZE9A 2HCAA 2OK2A 1TWYA 3K02A 4GQOA 3TTNA 4IGRA 4RA1A 4EQ9A 2CZIA 3E79A 3TZAA 3PD8A 4H45A 4P1EA 4DXBA 4PAIA 3RY3A 4U2RA 5IZZA 5I7IA 2RCAA 5H8HA 5T3JA 2QL3A 1PB7A 3KN7A 3C32A 4H6DA 1B3EA 3ISPA 1LGBC 5F1QA 4BDQA 3BFUA 3K1NA 2F8DA 1ZKBA 2F7AA 4EQ7A 3S2VA 2PBWA 5JTYB 5I56A 5I2NA 1YAEA 1YTVA 3P7IA 1FQBA 3D4CA 4ZEFA 3VDFA 3MUQA 3H4ZA 3QSLA 1IMDA 4LA9A 4P8BA 4QRZA 3S9LC 3OMBA 1LAGE 4IGTA 3KN3A 2NOOA 3C33A 5L9SA 3UK4A 3M3LA 2P2AA 2B4LA 4ZEBA 1MQJA 1PB9A 2DWIA 5ICQA 4HCWA 3RPLB 2XWOA 4H8IA 2FIEA 1LBZA 1GV8A 3E78A 1NFTA 2RKMA 2Y7PA 5BWJA 1MXUA 1JEUA 4F39A 3A09A 3I6VA 3THIA 4QFKA 2O84X 3MW0A 4F2OA 3KC1A 5AE4A 4I1DA 2OWSA 2H9BA 4F22A 4OVPA 2DE3A 3M3FA 2NXOA 2Q74A 4OERA 4P56A 2F36A 1LCFA 2KR0A 4IO7A 3EPEA 5ET8A 3VFJA 1SYIA 1N76A 3O28A 1B0LA 3W15C 2DWJA 3G7WA 3N5LA 4O3AA 2ONSA 3JZJA 1FRPA 4ELOA 2Q2CA 3W9WA 5A5LA 2QS2A 1FPLA 3CFZA 2ZYOA 4HE2A 4MH5A 3H6WA 1IMBA 2VPOA 5EYHA 4N17A 2WEFA 3M8UA 2H99A 3OO8A 2G93A 4HW8A 4PQJA 1MY0A 5IZ3B 4PGPA 3T0JA 2VPNA 3FXUA 2Z8DA 4N91A 1LAHE 4G68C 3IAZA 4PFBA 3RLFE 4FIMA 4DCYA 4NF5B 2REGA 3PPQA 2XD3A 1JETA 2X7PA 1FCKA 1MY4A 1B6HA 1HSEA 1MG1A 1IMCA 2ZYMA 2V25A 4U4SA 3A3UA 4H46A 3HHGA 4BDOA 1FTKA 1FTAA 3QUFA 5KDTA 2FYIA 4XFEA 2XWKA 1B05A 3PU5A 4GWXA 3FXQA 4R74A 2F6GA 4YZZA 3F11A 1QW0A 4OYVA 4X1BA 3OSRA 3IL1B 2HPGA 1FBEA 1DSNA 5B70A 1OLCA 1B40A 1LEVA 3GXAA 2XX8A 5LOMA 4OFLA 3RN8A 3MVWA 4GD5A 5H8QB 1USYH 2PMSA 1FPKA 4RPOA 2OLBA 1DPEA 1POY1 3U92A 2ZNUA 1MM7A 1FQCA 5CRYA 4G61A 3CG1A 3TQLA 4F3PA 4KCCA 2RF1A 3RUMA 5FBPA 2ZYNA 4POXA 1YYZA 1PB8A 3K1MA 1LB9A 3FJ7A 5IM2A 4U22A 2IA4A 2QPQA 3S9NC 3TCHA 4KI0E 3LSLA 3U8QA 2ABHA 4OFOA 3G3JA 3IX1A 1UTBA 1KZ8A 3KFMA 4U4XA 1B5IA 2ZNSA 3KBZA 5L9MA 5I84A 1D4NA 3ONMA 4F3BA 3VLVA 3VVEA 4NF4B 3TCGA 3QMFA 1NMUA 4LP2B 2QMXA 4R6YA 1F9BA 3FXRA 4JVDA 4C0RA 2X26A 2Q89A 4XTCQ 5KDTB 4AQ4A 1EYJA 1B1HA 3SKPA 4F31B 4TLLB 4PFYA 3PMVA 3O6IA 3T96B 3MZBA 2WYKA 4THIA 1H43A 5F24A 4ND9A 3VLUA 2Z8FA 3MPLA 2R9JA 3SEXA 3Q27A 1Y20A 2PYYA 3B8BA 1M5FA 4YAHX 4NF6A 1UIVA 5B7DA 1FPIA 5CMMA 2V3UA 5JTYA 3V8XB 1OVBA 2H4IA 3FBPA 3SEVA 1XVYA 1NV6A 1K9ZA 3IO6A 1IIWA 2RC7A 4NF8B 1H3DA 4E0XA 2V93A 1MH4A 3FVNA 5H8HB 4QSEA 5FHMA 1UIUA 4GL0A 1AMFA 2CZHA 5JEIA 2OX3A 3MVZA 4OEVA 2L5VA 1NV4A 1XHYA 1NNFA 4R9GA 2BJJX 1EH3A 2P3VA 5ESYA 4Z0IA 2O68A 1NH7A 3IO4A 3ZSFA 1Y3NA 1RDYA 3LUZA 1OQHA 2DE4A 2WYPA 3IK6B 4NWDA 1NV7A 1FTLA 2XX9A 4MMPA 5FHNA 1PDAA 3ODBA 2Q8MA 3I5OA 3TMGA 1JVXA 1ZMGA 2WBDA 3RT8A 3MPKA 1LBBA 3USDA 4MJOA 4ZEIA 3MVXA 4PDHA 1QULA 2GRVA 1VE4A 1VR5A 4YB5A 3BBRA 1T0KA 1B4HA 3R7XA 1RKMA 1CB6A 3E3KA 2Y5LA 2I3WA 1EZPA 4ZEKA 3H6TA 4UA8A 1B0HA 2DWHA 1URDA 3MP6A 4GBWA 3TTLA 2DVCA 3KEIA 4R6KA 3TDJA 3VV5A 4MF3A 3C4MA 2DOJA 4GVOA 2F97A 2PFYA 1K9YA 3SERA 2CEXA 4ONYA 1MXZA 3IOVA 3MZ1A 3NOHA 1QGXA 1OVTA 3FUZA 1FQDA 2HQ0A 4KQPA 2CEYA 3VXCA 4XF5A 2HAVA 4OENA 4YMAA 4R75A 1JW1A 4UACA 4I3EA 1Y1MA 4F1YA 3FV1A 2QVVA 2HEUA 2GH9A 2PT2A 1DMBA 4Z7EA 3TUSA 1P1OA 1QVSA 2DQVA 4OVJA 2I49A 1B5JA 1B32A 4IB2A 4GOTA 5I59B 3FZVA 1D9QA 5CMCA 4NX1A 1NV5A 4OXVA 5I56B 5I58A 4YKIA 4H67A 2GFEA 4GWSA 1LBVA 3ILUB 3T66A 2OCUA 3PPNA 4XEQA 5KZTA 2V84A 1JEVA 4M4GA 4KYEA 2M8CA 2R8TA 3WAEA 1LFIA 1VSOA 1BTJA 4M1VA 5AA2B 3EN3A 5H8NA 3E9XA 2CZLA 4BLAA 3K6WA 5ICTA 2RCBA 3LSXA 3OO9A 2FIXA 4R2FA 3PUZE 2FA7A 3H6VA 4NQ8A 1SPIA 4PFUA 1N84A 5DEXA 4NAPA 1FBPA 3IORA 3LR1A 2XXUA 4LZ7A 4OVTA 4EXKA 4BDRA 2QMWA 4IO3A 3RT6B 1ZIUA 4YB7A 3KSJA 1EU8A 4N6PA 4U21A 2W7YA 1USYE 1IUDA 2BJIA 1B4ZA 2XD2A 3TFLA 5TU0A 1NV3A 3KGCA 3FASA 1OLAA 5H8QA 4QXDA 4KHZE 4JDFA 3PGFA 1M5EA 5ISUA 3Q26A 3T93B 3T9UA 3UN6A 1A99A 1P99A 4JSOA 2OBGA 1MXVA 1Y1ZA 1DTZA 4TOZA 2DE2A 2ONKE 3BIGA 3TKDA 4NF4A 3PUWE 1TFDA 2D3IA 2I4CA 2I6EA 2D5WA 3S4UA 3KZGA 2F34A 3EHSA 2GQ1A 3OELA 1S9TA 5DEXB 2CMOA 1PC3A 1SDXA 5CM6A 1LSTA 2Z22A 4P0GA 2GHAA 3SETA 1QUJA 4MNIA 3B6TA 3Q29A 4DXUA 2XHDA 4QF9A 4ZZEA 4AB6A 5CBRA 3FIRA 3CR9A 3H6UA 4ZS9A 5EQ9A 1R6ZA 3K6VA 1ZJLA 4F2QA 2V3TA 4WXJA 2XXVA 1DCUA 1VFEA 2XXYA 2V4CA 4DLDA 4EDPA 2Y7IA 4LQ5A 5H8NB 3W9VA 2ZZXA 5AA2A 1BKAA 4IO6A 1D9YA 5IAIA 4X8RA 3MAMA 5I2KA 3KJTA 1MRPA 4I8CA 4WEDA 3DELB 1M5CA 1TFAA 1UQWA 1US4A 3KJ7A 3B50A 3H03A 2IEEA 2NVUB 1B9JA 4K3FA 4GIZA 2RC9A 3TCFA 4MX6A 2PVUA 4XKNA 2RC8A 2ANJA 3MP8A 2FBPA 2OWTA 3E13X 1Z7NE 5J16A 1MH3A 1P1NA 1SW2A 3VVFA 5EQ7A 1M5DA 5FHOA 4DE8A 4E0WA 1EYIA 3O2AA 1NI9A 4H1XA 2VP1A 3U93A 1NUYA 1URSA 4KD5A 1LAFE 2ZZWA 2QRYA 2H98A 2XXQA 3CIJA 1LBCA 1FBFA 1PBQA 2F3BA 1QUIA 3EKIA 1LBWA 4LZ5A 4F19A 3G3FA 1N3WA 4JVIA 4XXUA 1B46A 1FPEA 3B7DA 4KCDA 1Y4CA 3QYTA 5EYFA 2WBBA 1Q1KA 1JVYA 2V3QA 4MNCA 3C34A 3PMWA 1B51A 1FPFA 3C35A 4H5GA 4JBZA 3KBRA 2H25A 5ITPA 3K2DA 2Q8JA 1TXFA 4PGNA 2HFBA 3SDFA 2XWIA 1XT8A 5I2KB 4Q30B 1R9LA 4DCXA 1NUXA 5TPAA 4R9FA 4N81A 3S9MC 2ONRA 1Z7ME 2Y7RA 4PETA 1A7LA 2Z23A 3K0VA 1LAXA 5KCJB 3U94A 3RNNA 2F5XA 4C1TA 4JWYA 2CZKA 3MP1A 1SQYA 5DT6A 2ZXTA 5FTIA 2F3DA 3HCQA 1YCJA 3TYHA 3FJMA 1N04A 2LAOA 4DXCA 1MXYA 3R26A 3O6HA 2KLFA 3N26A 4QBAA 2FVZA 2GHBA 3CSBA 2Q88A 4XIGQ 3O97A 4HE0A 1Q35A 5ITOA 3IOTA 1A40A 3OXNA 2R71A 4YKJA 2DDKA 5L9OA 4MIJA 3UIFA 3FV2A 1QUKA 5EHSA 1SD3A 4MAGA 1FPBA 3PMXA 5IGAA 1FW0A 2OWZA 1MPDA 4R73A 1B52A 1INPA 3PD9A 3IOWA 1MQIA 3SEWA 1H44A 1B7HA 1FJ6A 1MM6A 2FHYA 3LUYA 4MHFA 4GXAA 1MY3A 1SBPA 1B7ZA 4PBHA 4GWZA 3HHFA 5EHMA 3BKIB 1D9VA 2UYEA 3S9EA 3QK6A 3HV1A 3GBAA 2F7CA 1DPPA 3D4GA 3H3GA 1JW4A 3EQ1A 4I3YA 4AB5A 2AIXA 2G29A 3O66A 3MWBA 2I48A 3UP9A 4KR5A 1SI1A 4HS7A 1I69A 4N13A 4MBPA 3B6WA 3G3HA 1WVJA 3L6GA 2P0SA 3CFXA 1ZBMA 2PX1A 3U72A 2VHAA 4N8YA 1MS7A 4O3BA 4QFNA 4PBQA 3G3IA 5ET6A 4ZEDA 4R72A 4ZE8A 3OSQA 4FORA 1IEJA 4N4UA 3LSWA 3RGYA 4OVRA 4G68A 1NUZA 5I57B 3RPWA 4O7IA 3MJNA 1IITA 4RXLA 4PFWA 1VDWA 4JXIA 2UVGA 4WKMA 1URGA 3TTRA 2ESNA 5LDZA 4MLQA 1RDXA 3FVOA 4TLMB 4JB7A 2F7BA 5I5PA 3K1PA 1BP5A 1PBPA 1XI6A 1XOCA 5H8SA 1NNKA 3RQTA 1YPNA 1B3FA 2NWJA 1B2HA 5M2VA 4KYDA 1DBZA 2JJKA 3O29A 4MCOA 2KQZA 1US5A 5J1DA 1L5TA 4Q8RA 4ZECA 2Z8EA 2PT1A 2QS3A 1MY1A 5CBSA 4NN3A 1I6AA 4UABA 2QJEA 3UORA 3UGWA 3RYDA 1FBCA 4LVQA 1S7YA 1IXCA 1IXHA 1JP4A 1FJ9A
chains in the Genus database with same CATH topology
4OQOA 1B4ZA 5HBCA 4NWCA 2XD2A 1AOVA 2X7PA 5I2NB 2DWAA 5TU0A 3TFLA 1FCKA 5I58B 4GFRA 3KGCA 4QSDA 3FASA 1MY4A 1OLAA 1VFDA 3FATA 4G77A 4U23A 5H8QA 4F3GA 1B6HA 1D3KA 4JDFA 3PGFA 4KHZE 1HSEA 2XXIA 3RTFB 1M5EA 1MG1A 2ZYMA 5ISUA 2V25A 2AYSA 1JW5A 3Q26A 3T93B 3M3KA 1MQGA 4U4SA 2R6GE 3A3UA 3G3KA 4QFOA 1WDNA 3HHGA 4H0WA 4O3CA 1FTKA 3T9UA 3UN6A 1A99A 1P99A 4BDOA 1PEBA 2OBGA 4JSOA 3IJOB 3ILTB 1MXVA 1O63A 4FECA 5AA4A 3QUFA 1Y1ZA 1DTZA 2HXWA 5KDTA 1H76A 2FYIA 4TOZA 1O64A 2DE2A 2DS9A 2ONKE 4RK2A 1B05A 3PU5A 4X1DA 3TKDA 1UTBB 3KG2A 4NF4A 3FJGA 3PUWE 4LONB 3FXQA 4R74A 2F6GA 1LB8A 2I0CA 4YZZA 1TFDA 2D3IA 3F11A 1QW0A 4OYVA 4X1BA 2I4CA 3T9VA 2I6EA 2D5WA 3OSRA 3IL1B 3KZGA 1GVCA 3S4UA 4ELQA 1DSNA 4F29A 5B70A 1LLSA 2F34A 5A5XA 1OLCA 4RPNA 4NF8A 3HPIA 3EHSA 4JWOA 1B40A 4RJZA 3OELA 1S9TA 5DEXB 5K2XA 1B3GA 2CMOA 3GXAA 1II5A 3G3GA 5DYHA 1PC3A 2XX8A 3PUVE 2XXHA 5LOMA 1SDXA 3ZKKA 4OFLA 3RN8A 1NKXA 5CM6A 1LSTA 3MVWA 4GD5A 2Z22A 4I9DA 1USYH 4P0GA 2GHAA 2PMSA 5H8QB 3N6TA 3I3VA 4RPOA 1BLFA 1QUJA 2Y7KA 3SETA 5AA3A 2THIA 5H8FA 2OLBA 3B6TA 4JWXA 3Q29A 1DPEA 1POY1 4BDNA 4YKKA 4QFLA 4DXUA 4BDLA 3PPPA 2XHDA 3CFLA 4EF1A 4QF9A 4ZZEA 2VD3A 2UVJA 4AB6A 5CBRA 3UA8A 2A5TA 3FIRA 3TEPA 3VVDA 4QHQA 3CR9A 3H6UA 3U92A 2ZNUA 4F3SA 1I6BA 4Q5TA 4ZS9A 4LUBA 3DM0A 1R6ZA 3K6VA 1ZJLA 4F2QA 1XVXA 1N7WA 2V3TA 3MVYA 4NF6B 4YICA 1MM7A 1IQ7A 1POTA 1B7UA 4WXJA 1FQCA 5CI5A 2XXVA 3EF7A 5CRYA 4IO2A 3EHTA 3CG1A 1VFEA 3TQLA 4EXLA 4KCCA 4F3PA 4U1ZA 2XXYA 1MQHA 2RF1A 4H65A 3RUMA 4DLDA 4EDPA 4FATA 2ZYNA 4POXA 2Y7IA 4LQ5A 5H8NB 3W9VA 3CRBA 3K01A 5AA2A 1BKAA 2UYFA 2B65A 4IO6A 1D9YA 2FNCA 5H8FB 1PB8A 3K1MA 3HN0A 2OZZA 4OESA 5KCJA 5IAIA 1LB9A 3LC8A 3FJ7A 3HSTA 5I57A 3PPRA 2IA4A 4U22A 1OIBA 3K6UA 2QPQA 3S9NC 3TCHA 4EUOA 4XKRA 4G8MA 4PFTA 4X48A 3OO7A 3MAMA 3Q25A 3KJTA 5I2KA 1LCTA 2X7QA 1P1WA 4KI0E 3LSLA 1GGGA 1MRPA 4I8CA 3U8QA 4WEDA 2ABHA 4OFOA 3DELB 1M5CA 1TFAA 3G3JA 1B3LA 3JYRA 1UQWA 5I59A 5L8DA 3IX1A 1FQEA 1US4A 1UTBA 4LATA 3KJ7A 1KWHA 3KFMA 4MLVA 4U4XA 1B5IA 3OOAA 2ZNSA 5AA2D 1IZ1A 5DTBA 5L9MA 3H03A 4NEDA 3TQWA 5I84A 1D4NA 1R9QA 2IEEA 3ONMA 3CSGA 2NVUB 2P1SA 1B9JA 4K3FA 4F3BA 4ECFA 4GIZA 3VLVA 2RC9A 3VVEA 3TCFA 4JSDA 4NF4B 3TCGA 4ESWA 1NMUA 2PVUA 4GWOA 4LP2B 4XKNA 2RC8A 1EZOA 4G2ZA 1R1NA 1FTJA 3C9HA 2E0SA 3H7MA 4POWA 2ANJA 1ELJA 2QMXA 3MP8A 1NNPA 4EF2A 4KPTA 3HO7A 3R6UA 4OFJA 3FGSA 4R2BA 1F9BA 4R6YA 3TUSA 2OWTA 3U1OA 3E13X 1Z7NE 1SVXB 4G68B 2HZKA 4ISUA 1MH3A 1P1NA 2O51A 3FXRA 5CMBA 4EQBA 1WODA 1SW2A 2D21A 4IY5A 3E4RA 1N3XA 4C0RA 3VVFA 2X26A 1M5DA 2Q89A 4XTCQ 5KDTB 4OWDA 5FHOA 1HSJA 1A54A 4AQ4A 2F35A 2Q2AA 3L6HA 4DE8A 1B1HA 3K00A 4E0WA 2UVIA 3O2AA 3SKPA 4H1XA 1MDP1 4TLLB 4F31B 1OQGA 2VP1A 3TELA 4PFYA 3PMVA 1ATGA 3U93A 2VGQA 4FEBA 3T9HB 4F18A 2Q9TA 1URSA 3O6IA 1ZU0A 3MZBA 2O7IA 4KD5A 3T96B 1UTHA 1LAFE 4THIA 1H43A 1JQFA 4LQ2A 5HM4B 4YMBA 3MC2A 4ND9A 3VLUA 2Z8FA 2QRYA 3MPLA 1AH5A 2H98A 1SI0A 2R9JA 1MY2A 2XXQA 2DVZA 4LZ8A 3CIJA 1LBCA 1AL3A 2B3FA 1MPBA 2NUVA 3SEXA 1PBQA 2DXRA 1QUIA 5DVFA 2AL5A 4GF8A 4LZ5A 3VXBA 3Q27A 1Y20A 2O1LA 2PYYA 1M5FA 4YAHX 4F19A 3C31A 3G3FA 3OEMA 4KFQA 4NF6A 4NF5A 1GTKA 5AA1A 1N3WA 1UIVA 4XXUA 2YJPA 1B46A 5B7DA 5CMMA 2V3UA 3B7DA 3MZ9A 4KCDA 1Y4CA 4RY1A 5JTYA 3V8XB 3DLNA 1JNFA 1DTGA 1OVBA 2A5TB 4GLIA 2H4IA 3SEVA 3QYTA 5JK4A 1TT1A 1XVYA 4HTGA 5EYFA 1Q1KA 3IO6A 1MPCA 1JVYA 1IIWA 2QS1A 2V3QA 2RC7A 5TPAB 3PV0E 4NF8B 3KN8A 3V89B 1H3DA 3RTWB 3C34A 2Y7WA 4E0XA 1QKAA 3PMWA 2V93A 1XC1A 5HPQA 1B51A 1IXGA 1MH4A 2B3BA 4R6HA 2VOZA 3C35A 4NTLA 1Y9UA 1LFGA 4H5GA 4JBZA 3KBRA 3FVNA 5K2YA 4OZ9A 2H25A 5H8HB 1A8FA 4QSEA 1P1QA 1UIUA 3BFTA 5FHMA 4GL0A 3QIMA 1A55A 3K2DA 3VE1B 5IKBA 4OETA 5ITPA 2Q8JA 1TXFA 2QS4A 3AXFA 4GRKA 4I62A 1MQDA 1AMFA 2HFBA 3SDFA 5JEIA 1B3HA 4BDMA 1XT8A 2YLNA 1BIYA 3MVZA 5I2KB 4G4PA 1N0TA 1R9LA 2A5SA 4GL8A 3IOUA 4OEVA 4Q30B 4Q0CA 4DCXA 5F7VA 3TODA 4DDDA 2I0BA 5TPAA 4R9FA 1P1UA 1NNTA 1XHYA 1NNFA 2ONRA 3PUXE 1OMPA 4R9GA 3S9MC 2Y84A 4OTEA 3K6XA 1Z7ME 4PP0A 3GBBA 2XXPA 3TAJA 1HSLA 3H06B 4NE4A 2BJJX 4X9TA 1EH3A 2Y7RA 4L17A 4ELOA 4PETA 1A7LA 2Z23A 2ZYKA 4Z0IA 5CMKA 2ALUA 2DXYA 2O68A 2UVHA 4FEDA 5AA4B 3K0VA 1LAXA 5KCJB 3O9PA 4OHNA 1NL5A 4ELRA 1NH7A 3OEKA 3IO4A 4TQUQ 3U94A 3ZSFA 1B1XA 3RNNA 1Y3NA 2F5XA 3IB2A 4C1TA 2O6AA 4JWYA 4ELPA 1OQHA 2HZLA 3MP1A 4F1VA 2DP8A 2YPNA 3FVKA 2DE4A 1SQYA 5DT6A 2ZXTA 2DSFA 3IK6B 2O1MA 4G8HA 3HCQA 3N6UA 5FTIA 1YCJA 4NWDA 3TYHA 3T22A 1ZTYA 1FTLA 2HAUA 2XX9A 3FJMA 4P11A 1N04A 5A5XB 1AIVA 2LAOA 1ANFA 3EHUA 4DXCA 4IO5A 1MXYA 3R26A 5FHNA 1PDAA 3ODBA 4HCYA 4YB6A 3KSXA 3I5OA 3O6HA 2F78A 3TTKA 3K4UA 2KLFA 1FTMA 1SW4A 3DP8A 4QFPA 3N26A 3TMGA 1H45A 1MXWA 1EZ9A 1SW5A 2GHBA 3CSBA 3SEYA 1JVXA 1ZMGA 2Q88A 3DP6A 4XIGQ 3O97A 4DZ1A 5CC2A 1Q35A 3RT8A 5ITOA 4DIGA 3IOTA 1A40A 3MPKA 2AL4A 5BUUA 3GLBA 2WKYA 2R71A 3OXNA 2XXRA 4YKJA 3IB0A 1FTOA 1LBBA 3IR1A 4KYSA 4IY6A 5L9OA 4ZE9A 1NH8A 2HCAA 2OK2A 4MFIA 1TWYA 3K02A 4GQOA 4NMYA 3TTNA 3V5AA 4IGRA 3UIFA 3FV2A 1S50A 1QUKA 3USDA 4RA1A 5EHSA 4EQ9A 1SD3A 3MVXA 4ZEIA 3WAFA 1QULA 2GRVA 3TZAA 3PD8A 5ICQA 1VE4A 3DP4A 4DXBA 4H5FA 3PMXA 1VR5A 1FW0A 1MPDA 4R73A 4YB5A 1B52A 3BBRA 1T0KA 1M5BA 3PD9A 2QSXA 3IOWA 1MQIA 3SEWA 4P0IA 2I3VA 4H8JA 1B4HA 3R7XA 4U2RA 3RY3A 1H44A 1RKMA 1B7HA 1CB6A 1MM6A 1QKBA 3E3KA 4ZZAA 2I3WA 1EZPA 3FD3A 3LUYA 2RCAA 5H8HA 4ZEKA 1B58A 4GXAA 1MY3A 3Q28A 2F6PA 1SBPA 3H6TA 4UA8A 3V83A 3ZKLA 2QL3A 1PB7A 1B0HA 2DWHA 3KN7A 1URDA 3C32A 3MP6A 1B7ZA 3TTLA 1DOTA 2DVCA 3KEIA 4H6DA 4R6KA 1B3EA 5TP9B 1LGBC 3B6QA 3TDJA 3HHFA 3GZGA 5F1QA 5EHMA 3VV5A 4BDQA 3BFUA 3K1NA 2F8DA 4MF3A 4YU0A 1ZKBA 2F7AA 3BKIB 3C4MA 4N07A 4EQ7A 2DOJA 2OJTA 3S2VA 2PBWA 3O6GA 2XX7A 5JTYB 5I56A 1D9VA 2UYEA 4GVOA 4FE8A 5I2NA 2F97A 1CE2A 3S9EA 3SERA 2XXWA 3SEUA 3QK6A 2REJA 4RK9A 1YAEA 3HV1A 3GBAA 1YTVA 3OENA 2F7CA 1DPPA 1Y4TA 4ONYA 3P7IA 1FQBA 1MXZA 3D4CA 3D4GA 3ECRA 3H3GA 4ZEFA 3VDFA 1I6QA 3IOVA 3MUQA 1Y3PA 4RYAA 5FTHA 2I58A 4XKQA 1FQFA 3CG3A 1JW4A 1MXXA 3EQ1A 3H4ZA 3MZ1A 3QSLA 4LA9A 4QRZA 1OVTA 3FUZA 4AB5A 2E1SA 1FQDA 3LBSA 2HQ0A 2XXXA 1A8EA 3S9LC 4KQPA 4XKPA 2AIXA 2G29A 3OO6A 3O66A 3MWBA 2I48A 3UP9A 3OMBA 4WEPA 4KR5A 1LAGE 4IGTA 5DVIA 1SI1A 1B5HA 3KN3A 3QXMA 2NOOA 3C33A 3VXCA 4ZDMA 3UK4A 3M3LA 4HS7A 5L9SA 3LSFB 1I69A 3A3CA 2P2AA 3OD7A 4N13A 2HAVA 2O69A 3T9XB 1GR2A 3MBPA 4MBPA 4OENA 3B6WA 3G3HA 1WVJA 4U1OA 3L6GA 4ZEBA 2P0SA 1MQJA 2ZMBA 4R75A 4YMAA 3PUYE 1JW1A 1PB9A 2DWIA 3CFXA 1ZBMA 2PX1A 4HCWA 4UACA 1SYHA 5TP9A 4QFKA 3U72A 1Y1MA 2VHAA 3ZS6A 4IO4A 1MS7A 4H8IA 3SESA 4F1YA 3FV1A 4O3BA 4QFNA 1QJMA 1RYOA 1GV8A 2VD2A 2HEUA 3G3IA 2GH9A 5ELVA 2PT2A 3CVGA 1NFTA 2RKMA 1DMBA 2Y7PA 1XS5A 4ZEDA 5BWJA 4Z7EA 1LFHA 4OMBA 4R72A 1MXUA 4ZE8A 1P1OA 3OSQA 4FORA 1IEJA 1JEUA 4G8NA 3A09A 3I6VA 4F39A 1QVSA 3THIA 2DQVA 2I49A 1B5JA 1SW1A 1Y3QA 1B32A 2O84X 3LSWA 3MW0A 4OEUA 4OVJA 4F2OA 4IB2A 3C36A 2DYXA 4GXSB 1O7TA 5AE4A 2H5YA 4GOTA 4I1DA 4RNSA 4FAJA 3RGYA 5I59B 2OWSA 4G68A 3FZVA 2H9BA 4F22A 5CMCA 5I57B 4OXVA 3QUJA 4YKPA 5I56B 2DE3A 4YKIA 3PPOA 3RPWA 4H67A 5I58A 3M3FA 3KOTA 2GFEA 2NXOA 2O7UA 3CI8A 4OERA 3ILUB 1IITA 3MJNA 4RXLA 3T66A 2OCUA 4PFWA 2F36A 3PPNA 1LCFA 3IJXB 2UVGA 4JXIA 4WKMA 1URGA 4IO7A 3TTRA 2UXAA 3EPEA 5KZTA 3VFJA 2RINA 2V84A 2ESNA 1SYIA 1JEVA 1N76A 4MLQA 3TPAA 3FVOA 4TLMB 3O28A 4JB7A 2F7BA 1B0LA 2M8CA 4KYEA 3JV9A 4M4GA 2DWJA 3W15C 4C1UA 3QAXA 3WAEA 1UTHB 3G7WA 1FQAA 1J1NA 3IB1A 3K1PA 1BP5A 1IXIA 1PBPA 3N5LA 3FVGA 1LFIA 4O3AA 2ONSA 1VSOA 1XOCA 1N7XA 5H8SA 1NNKA 3JZJA 3RQTA 3VLWA 1ZLQA 1BTJA 1B3FA 1MDQA 1YPNA 4M1VA 2NWJA 1B2HA 2Q2CA 5M2VA 3W9WA 3EN3A 5AA2B 4KYDA 2QS2A 5H8NA 3CFZA 2ZYOA 3KOSA 3H6WA 4MH5A 3E9XA 2CZLA 3O29A 5DVJA 4BLAA 3K6WA 5ICTA 2I4BA 1US5A 5J1DA 1L5TA 4Q8RA 4ZECA 2Z8EA 2PT1A 4PE5B 2QS3A 2RCBA 3LSXA 1MY1A 3OO9A 3M8UA 4R2FA 2H99A 5CBSA 3OO8A 3PUZE 2G93A 4HW8A 2FA7A 4PQJA 1MY0A 3H6VA 1I6AA 4F1UA 4PFUA 2QJEA 3N94A 2XXTA 1N84A 3UORA 3UGWA 3FXUA 3MQ9A 5DEXA 3IORA 2Z8DA 4FJPA 4LVQA 1LAHE 1RYXA 2XXUA 3LR1A 4G68C 3IAZA 4LZ7A 3TTMA 4BDRA 4EXKA 4ESXA 2QMWA 1S7YA 3RLFE 4IO3A 4FIMA 1IXCA 1IXHA 4NF5B 3RT6B 4DCYA 4QSCA 1ZIUA 2REGA 3KSJA 4YB7A 3PPQA 1EU8A 4N6PA 4U21A 2XD3A 1JETA 2W7YA 1USYE 2ZNTA 1IUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQO A;  1B4Z A;  5HBC A;  4NWC A;  2XD2 A;  1AOV A;  2X7P A;  5I2N B;  2DWA A;  5TU0 A;  3TFL A;  1FCK A;  5I58 B;  4GFR A;  3KGC A;  4QSD A;  3FAS A;  1MY4 A;  1OLA A;  1VFD A;  3FAT A;  4G77 A;  4U23 A;  5H8Q A;  4F3G A;  1B6H A;  1D3K A;  4JDF A;  3PGF A;  4KHZ E;  1HSE A;  2XXI A;  3RTF B;  1M5E A;  1MG1 A;  2ZYM A;  5ISU A;  2V25 A;  2AYS A;  1JW5 A;  3Q26 A;  3T93 B;  3M3K A;  1MQG A;  4U4S A;  2R6G E;  3A3U A;  3G3K A;  4QFO A;  1WDN A;  3HHG A;  4H0W A;  4O3C A;  1FTK A;  3T9U A;  3UN6 A;  1A99 A;  1P99 A;  4BDO A;  1PEB A;  2OBG A;  4JSO A;  3IJO B;  3ILT B;  1MXV A;  1O63 A;  4FEC A;  5AA4 A;  3QUF A;  1Y1Z A;  1DTZ A;  2HXW A;  5KDT A;  1H76 A;  2FYI A;  4TOZ A;  1O64 A;  2DE2 A;  2DS9 A;  2ONK E;  4RK2 A;  1B05 A;  3PU5 A;  4X1D A;  3TKD A;  1UTB B;  3KG2 A;  4NF4 A;  3FJG A;  3PUW E;  4LON B;  3FXQ A;  4R74 A;  2F6G A;  1LB8 A;  2I0C A;  4YZZ A;  1TFD A;  2D3I A;  3F11 A;  1QW0 A;  4OYV A;  4X1B A;  2I4C A;  3T9V A;  2I6E A;  2D5W A;  3OSR A;  3IL1 B;  3KZG A;  1GVC A;  3S4U A;  4ELQ A;  1DSN A;  4F29 A;  5B70 A;  1LLS A;  2F34 A;  5A5X A;  1OLC A;  4RPN A;  4NF8 A;  3HPI A;  3EHS A;  4JWO A;  1B40 A;  4RJZ A;  3OEL A;  1S9T A;  5DEX B;  5K2X A;  1B3G A;  2CMO A;  3GXA A;  1II5 A;  3G3G A;  5DYH A;  1PC3 A;  2XX8 A;  3PUV E;  2XXH A;  5LOM A;  1SDX A;  3ZKK A;  4OFL A;  3RN8 A;  1NKX A;  5CM6 A;  1LST A;  3MVW A;  4GD5 A;  2Z22 A;  4I9D A;  1USY H;  4P0G A;  2GHA A;  2PMS A;  5H8Q B;  3N6T A;  3I3V A;  4RPO A;  1BLF A;  1QUJ A;  2Y7K A;  3SET A;  5AA3 A;  2THI A;  5H8F A;  2OLB A;  3B6T A;  4JWX A;  3Q29 A;  1DPE A;  1POY 1;  4BDN A;  4YKK A;  4QFL A;  4DXU A;  4BDL A;  3PPP A;  2XHD A;  3CFL A;  4EF1 A;  4QF9 A;  4ZZE A;  2VD3 A;  2UVJ A;  4AB6 A;  5CBR A;  3UA8 A;  2A5T A;  3FIR A;  3TEP A;  3VVD A;  4QHQ A;  3CR9 A;  3H6U A;  3U92 A;  2ZNU A;  4F3S A;  1I6B A;  4Q5T A;  4ZS9 A;  4LUB A;  3DM0 A;  1R6Z A;  3K6V A;  1ZJL A;  4F2Q A;  1XVX A;  1N7W A;  2V3T A;  3MVY A;  4NF6 B;  4YIC A;  1MM7 A;  1IQ7 A;  1POT A;  1B7U A;  4WXJ A;  1FQC A;  5CI5 A;  2XXV A;  3EF7 A;  5CRY A;  4IO2 A;  3EHT A;  3CG1 A;  1VFE A;  3TQL A;  4EXL A;  4KCC A;  4F3P A;  4U1Z A;  2XXY A;  1MQH A;  2RF1 A;  4H65 A;  3RUM A;  4DLD A;  4EDP A;  4FAT A;  2ZYN A;  4POX A;  2Y7I A;  4LQ5 A;  5H8N B;  3W9V A;  3CRB A;  3K01 A;  5AA2 A;  1BKA A;  2UYF A;  2B65 A;  4IO6 A;  1D9Y A;  2FNC A;  5H8F B;  1PB8 A;  3K1M A;  3HN0 A;  2OZZ A;  4OES A;  5KCJ A;  5IAI A;  1LB9 A;  3LC8 A;  3FJ7 A;  3HST A;  5I57 A;  3PPR A;  2IA4 A;  4U22 A;  1OIB A;  3K6U A;  2QPQ A;  3S9N C;  3TCH A;  4EUO A;  4XKR A;  4G8M A;  4PFT A;  4X48 A;  3OO7 A;  3MAM A;  3Q25 A;  3KJT A;  5I2K A;  1LCT A;  2X7Q A;  1P1W A;  4KI0 E;  3LSL A;  1GGG A;  1MRP A;  4I8C A;  3U8Q A;  4WED A;  2ABH A;  4OFO A;  3DEL B;  1M5C A;  1TFA A;  3G3J A;  1B3L A;  3JYR A;  1UQW A;  5I59 A;  5L8D A;  3IX1 A;  1FQE A;  1US4 A;  1UTB A;  4LAT A;  3KJ7 A;  1KWH A;  3KFM A;  4MLV A;  4U4X A;  1B5I A;  3OOA A;  2ZNS A;  5AA2 D;  1IZ1 A;  5DTB A;  5L9M A;  3H03 A;  4NED A;  3TQW A;  5I84 A;  1D4N A;  1R9Q A;  2IEE A;  3ONM A;  3CSG A;  2NVU B;  2P1S A;  1B9J A;  4K3F A;  4F3B A;  4ECF A;  4GIZ A;  3VLV A;  2RC9 A;  3VVE A;  3TCF A;  4JSD A;  4NF4 B;  3TCG A;  4ESW A;  1NMU A;  2PVU A;  4GWO A;  4LP2 B;  4XKN A;  2RC8 A;  1EZO A;  4G2Z A;  1R1N A;  1FTJ A;  3C9H A;  2E0S A;  3H7M A;  4POW A;  2ANJ A;  1ELJ A;  2QMX A;  3MP8 A;  1NNP A;  4EF2 A;  4KPT A;  3HO7 A;  3R6U A;  4OFJ A;  3FGS A;  4R2B A;  1F9B A;  4R6Y A;  3TUS A;  2OWT A;  3U1O A;  3E13 X;  1Z7N E;  1SVX B;  4G68 B;  2HZK A;  4ISU A;  1MH3 A;  1P1N A;  2O51 A;  3FXR A;  5CMB A;  4EQB A;  1WOD A;  1SW2 A;  2D21 A;  4IY5 A;  3E4R A;  1N3X A;  4C0R A;  3VVF A;  2X26 A;  1M5D A;  2Q89 A;  4XTC Q;  5KDT B;  4OWD A;  5FHO A;  1HSJ A;  1A54 A;  4AQ4 A;  2F35 A;  2Q2A A;  3L6H A;  4DE8 A;  1B1H A;  3K00 A;  4E0W A;  2UVI A;  3O2A A;  3SKP A;  4H1X A;  1MDP 1;  4TLL B;  4F31 B;  1OQG A;  2VP1 A;  3TEL A;  4PFY A;  3PMV A;  1ATG A;  3U93 A;  2VGQ A;  4FEB A;  3T9H B;  4F18 A;  2Q9T A;  1URS A;  3O6I A;  1ZU0 A;  3MZB A;  2O7I A;  4KD5 A;  3T96 B;  1UTH A;  1LAF E;  4THI A;  1H43 A;  1JQF A;  4LQ2 A;  5HM4 B;  4YMB A;  3MC2 A;  4ND9 A;  3VLU A;  2Z8F A;  2QRY A;  3MPL A;  1AH5 A;  2H98 A;  1SI0 A;  2R9J A;  1MY2 A;  2XXQ A;  2DVZ A;  4LZ8 A;  3CIJ A;  1LBC A;  1AL3 A;  2B3F A;  1MPB A;  2NUV A;  3SEX A;  1PBQ A;  2DXR A;  1QUI A;  5DVF A;  2AL5 A;  4GF8 A;  4LZ5 A;  3VXB A;  3Q27 A;  1Y20 A;  2O1L A;  2PYY A;  1M5F A;  4YAH X;  4F19 A;  3C31 A;  3G3F A;  3OEM A;  4KFQ A;  4NF6 A;  4NF5 A;  1GTK A;  5AA1 A;  1N3W A;  1UIV A;  4XXU A;  2YJP A;  1B46 A;  5B7D A;  5CMM A;  2V3U A;  3B7D A;  3MZ9 A;  4KCD A;  1Y4C A;  4RY1 A;  5JTY A;  3V8X B;  3DLN A;  1JNF A;  1DTG A;  1OVB A;  2A5T B;  4GLI A;  2H4I A;  3SEV A;  3QYT A;  5JK4 A;  1TT1 A;  1XVY A;  4HTG A;  5EYF A;  1Q1K A;  3IO6 A;  1MPC A;  1JVY A;  1IIW A;  2QS1 A;  2V3Q A;  2RC7 A;  5TPA B;  3PV0 E;  4NF8 B;  3KN8 A;  3V89 B;  1H3D A;  3RTW B;  3C34 A;  2Y7W A;  4E0X A;  1QKA A;  3PMW A;  2V93 A;  1XC1 A;  5HPQ A;  1B51 A;  1IXG A;  1MH4 A;  2B3B A;  4R6H A;  2VOZ A;  3C35 A;  4NTL A;  1Y9U A;  1LFG A;  4H5G A;  4JBZ A;  3KBR A;  3FVN A;  5K2Y A;  4OZ9 A;  2H25 A;  5H8H B;  1A8F A;  4QSE A;  1P1Q A;  1UIU A;  3BFT A;  5FHM A;  4GL0 A;  3QIM A;  1A55 A;  3K2D A;  3VE1 B;  5IKB A;  4OET A;  5ITP A;  2Q8J A;  1TXF A;  2QS4 A;  3AXF A;  4GRK A;  4I62 A;  1MQD A;  1AMF A;  2HFB A;  3SDF A;  5JEI A;  1B3H A;  4BDM A;  1XT8 A;  2YLN A;  1BIY A;  3MVZ A;  5I2K B;  4G4P A;  1N0T A;  1R9L A;  2A5S A;  4GL8 A;  3IOU A;  4OEV A;  4Q30 B;  4Q0C A;  4DCX A;  5F7V A;  3TOD A;  4DDD A;  2I0B A;  5TPA A;  4R9F A;  1P1U A;  1NNT A;  1XHY A;  1NNF A;  2ONR A;  3PUX E;  1OMP A;  4R9G A;  3S9M C;  2Y84 A;  4OTE A;  3K6X A;  1Z7M E;  4PP0 A;  3GBB A;  2XXP A;  3TAJ A;  1HSL A;  3H06 B;  4NE4 A;  2BJJ X;  4X9T A;  1EH3 A;  2Y7R A;  4L17 A;  4ELO A;  4PET A;  1A7L A;  2Z23 A;  2ZYK A;  4Z0I A;  5CMK A;  2ALU A;  2DXY A;  2O68 A;  2UVH A;  4FED A;  5AA4 B;  3K0V A;  1LAX A;  5KCJ B;  3O9P A;  4OHN A;  1NL5 A;  4ELR A;  1NH7 A;  3OEK A;  3IO4 A;  4TQU Q;  3U94 A;  3ZSF A;  1B1X A;  3RNN A;  1Y3N A;  2F5X A;  3IB2 A;  4C1T A;  2O6A A;  4JWY A;  4ELP A;  1OQH A;  2HZL A;  3MP1 A;  4F1V A;  2DP8 A;  2YPN A;  3FVK A;  2DE4 A;  1SQY A;  5DT6 A;  2ZXT A;  2DSF A;  3IK6 B;  2O1M A;  4G8H A;  3HCQ A;  3N6U A;  5FTI A;  1YCJ A;  4NWD A;  3TYH A;  3T22 A;  1ZTY A;  1FTL A;  2HAU A;  2XX9 A;  3FJM A;  4P11 A;  1N04 A;  5A5X B;  1AIV A;  2LAO A;  1ANF A;  3EHU A;  4DXC A;  4IO5 A;  1MXY A;  3R26 A;  5FHN A;  1PDA A;  3ODB A;  4HCY A;  4YB6 A;  3KSX A;  3I5O A;  3O6H A;  2F78 A;  3TTK A;  3K4U A;  2KLF A;  1FTM A;  1SW4 A;  3DP8 A;  4QFP A;  3N26 A;  3TMG A;  1H45 A;  1MXW A;  1EZ9 A;  1SW5 A;  2GHB A;  3CSB A;  3SEY A;  1JVX A;  1ZMG A;  2Q88 A;  3DP6 A;  4XIG Q;  3O97 A;  4DZ1 A;  5CC2 A;  1Q35 A;  3RT8 A;  5ITO A;  4DIG A;  3IOT A;  1A40 A;  3MPK A;  2AL4 A;  5BUU A;  3GLB A;  2WKY A;  2R71 A;  3OXN A;  2XXR A;  4YKJ A;  3IB0 A;  1FTO A;  1LBB A;  3IR1 A;  4KYS A;  4IY6 A;  5L9O A;  4ZE9 A;  1NH8 A;  2HCA A;  2OK2 A;  4MFI A;  1TWY A;  3K02 A;  4GQO A;  4NMY A;  3TTN A;  3V5A A;  4IGR A;  3UIF A;  3FV2 A;  1S50 A;  1QUK A;  3USD A;  4RA1 A;  5EHS A;  4EQ9 A;  1SD3 A;  3MVX A;  4ZEI A;  3WAF A;  1QUL A;  2GRV A;  3TZA A;  3PD8 A;  5ICQ A;  1VE4 A;  3DP4 A;  4DXB A;  4H5F A;  3PMX A;  1VR5 A;  1FW0 A;  1MPD A;  4R73 A;  4YB5 A;  1B52 A;  3BBR A;  1T0K A;  1M5B A;  3PD9 A;  2QSX A;  3IOW A;  1MQI A;  3SEW A;  4P0I A;  2I3V A;  4H8J A;  1B4H A;  3R7X A;  4U2R A;  3RY3 A;  1H44 A;  1RKM A;  1B7H A;  1CB6 A;  1MM6 A;  1QKB A;  3E3K A;  4ZZA A;  2I3W A;  1EZP A;  3FD3 A;  3LUY A;  2RCA A;  5H8H A;  4ZEK A;  1B58 A;  4GXA A;  1MY3 A;  3Q28 A;  2F6P A;  1SBP A;  3H6T A;  4UA8 A;  3V83 A;  3ZKL A;  2QL3 A;  1PB7 A;  1B0H A;  2DWH A;  3KN7 A;  1URD A;  3C32 A;  3MP6 A;  1B7Z A;  3TTL A;  1DOT A;  2DVC A;  3KEI A;  4H6D A;  4R6K A;  1B3E A;  5TP9 B;  1LGB C;  3B6Q A;  3TDJ A;  3HHF A;  3GZG A;  5F1Q A;  5EHM A;  3VV5 A;  4BDQ A;  3BFU A;  3K1N A;  2F8D A;  4MF3 A;  4YU0 A;  1ZKB A;  2F7A A;  3BKI B;  3C4M A;  4N07 A;  4EQ7 A;  2DOJ A;  2OJT A;  3S2V A;  2PBW A;  3O6G A;  2XX7 A;  5JTY B;  5I56 A;  1D9V A;  2UYE A;  4GVO A;  4FE8 A;  5I2N A;  2F97 A;  1CE2 A;  3S9E A;  3SER A;  2XXW A;  3SEU A;  3QK6 A;  2REJ A;  4RK9 A;  1YAE A;  3HV1 A;  3GBA A;  1YTV A;  3OEN A;  2F7C A;  1DPP A;  1Y4T A;  4ONY A;  3P7I A;  1FQB A;  1MXZ A;  3D4C A;  3D4G A;  3ECR A;  3H3G A;  4ZEF A;  3VDF A;  1I6Q A;  3IOV A;  3MUQ A;  1Y3P A;  4RYA A;  5FTH A;  2I58 A;  4XKQ A;  1FQF A;  3CG3 A;  1JW4 A;  1MXX A;  3EQ1 A;  3H4Z A;  3MZ1 A;  3QSL A;  4LA9 A;  4QRZ A;  1OVT A;  3FUZ A;  4AB5 A;  2E1S A;  1FQD A;  3LBS A;  2HQ0 A;  2XXX A;  1A8E A;  3S9L C;  4KQP A;  4XKP A;  2AIX A;  2G29 A;  3OO6 A;  3O66 A;  3MWB A;  2I48 A;  3UP9 A;  3OMB A;  4WEP A;  4KR5 A;  1LAG E;  4IGT A;  5DVI A;  1SI1 A;  1B5H A;  3KN3 A;  3QXM A;  2NOO A;  3C33 A;  3VXC A;  4ZDM A;  3UK4 A;  3M3L A;  4HS7 A;  5L9S A;  3LSF B;  1I69 A;  3A3C A;  2P2A A;  3OD7 A;  4N13 A;  2HAV A;  2O69 A;  3T9X B;  1GR2 A;  3MBP A;  4MBP A;  4OEN A;  3B6W A;  3G3H A;  1WVJ A;  4U1O A;  3L6G A;  4ZEB A;  2P0S A;  1MQJ A;  2ZMB A;  4R75 A;  4YMA A;  3PUY E;  1JW1 A;  1PB9 A;  2DWI A;  3CFX A;  1ZBM A;  2PX1 A;  4HCW A;  4UAC A;  1SYH A;  5TP9 A;  4QFK A;  3U72 A;  1Y1M A;  2VHA A;  3ZS6 A;  4IO4 A;  1MS7 A;  4H8I A;  3SES A;  4F1Y A;  3FV1 A;  4O3B A;  4QFN A;  1QJM A;  1RYO A;  1GV8 A;  2VD2 A;  2HEU A;  3G3I A;  2GH9 A;  5ELV A;  2PT2 A;  3CVG A;  1NFT A;  2RKM A;  1DMB A;  2Y7P A;  1XS5 A;  4ZED A;  5BWJ A;  4Z7E A;  1LFH A;  4OMB A;  4R72 A;  1MXU A;  4ZE8 A;  1P1O A;  3OSQ A;  4FOR A;  1IEJ A;  1JEU A;  4G8N A;  3A09 A;  3I6V A;  4F39 A;  1QVS A;  3THI A;  2DQV A;  2I49 A;  1B5J A;  1SW1 A;  1Y3Q A;  1B32 A;  2O84 X;  3LSW A;  3MW0 A;  4OEU A;  4OVJ A;  4F2O A;  4IB2 A;  3C36 A;  2DYX A;  4GXS B;  1O7T A;  5AE4 A;  2H5Y A;  4GOT A;  4I1D A;  4RNS A;  4FAJ A;  3RGY A;  5I59 B;  2OWS A;  4G68 A;  3FZV A;  2H9B A;  4F22 A;  5CMC A;  5I57 B;  4OXV A;  3QUJ A;  4YKP A;  5I56 B;  2DE3 A;  4YKI A;  3PPO A;  3RPW A;  4H67 A;  5I58 A;  3M3F A;  3KOT A;  2GFE A;  2NXO A;  2O7U A;  3CI8 A;  4OER A;  3ILU B;  1IIT A;  3MJN A;  4RXL A;  3T66 A;  2OCU A;  4PFW A;  2F36 A;  3PPN A;  1LCF A;  3IJX B;  2UVG A;  4JXI A;  4WKM A;  1URG A;  4IO7 A;  3TTR A;  2UXA A;  3EPE A;  5KZT A;  3VFJ A;  2RIN A;  2V84 A;  2ESN A;  1SYI A;  1JEV A;  1N76 A;  4MLQ A;  3TPA A;  3FVO A;  4TLM B;  3O28 A;  4JB7 A;  2F7B A;  1B0L A;  2M8C A;  4KYE A;  3JV9 A;  4M4G A;  2DWJ A;  3W15 C;  4C1U A;  3QAX A;  3WAE A;  1UTH B;  3G7W A;  1FQA A;  1J1N A;  3IB1 A;  3K1P A;  1BP5 A;  1IXI A;  1PBP A;  3N5L A;  3FVG A;  1LFI A;  4O3A A;  2ONS A;  1VSO A;  1XOC A;  1N7X A;  5H8S A;  1NNK A;  3JZJ A;  3RQT A;  3VLW A;  1ZLQ A;  1BTJ A;  1B3F A;  1MDQ A;  1YPN A;  4M1V A;  2NWJ A;  1B2H A;  2Q2C A;  5M2V A;  3W9W A;  3EN3 A;  5AA2 B;  4KYD A;  2QS2 A;  5H8N A;  3CFZ A;  2ZYO A;  3KOS A;  3H6W A;  4MH5 A;  3E9X A;  2CZL A;  3O29 A;  5DVJ A;  4BLA A;  3K6W A;  5ICT A;  2I4B A;  1US5 A;  5J1D A;  1L5T A;  4Q8R A;  4ZEC A;  2Z8E A;  2PT1 A;  4PE5 B;  2QS3 A;  2RCB A;  3LSX A;  1MY1 A;  3OO9 A;  3M8U A;  4R2F A;  2H99 A;  5CBS A;  3OO8 A;  3PUZ E;  2G93 A;  4HW8 A;  2FA7 A;  4PQJ A;  1MY0 A;  3H6V A;  1I6A A;  4F1U A;  4PFU A;  2QJE A;  3N94 A;  2XXT A;  1N84 A;  3UOR A;  3UGW A;  3FXU A;  3MQ9 A;  5DEX A;  3IOR A;  2Z8D A;  4FJP A;  4LVQ A;  1LAH E;  1RYX A;  2XXU A;  3LR1 A;  4G68 C;  3IAZ A;  4LZ7 A;  3TTM A;  4BDR A;  4EXK A;  4ESX A;  2QMW A;  1S7Y A;  3RLF E;  4IO3 A;  4FIM A;  1IXC A;  1IXH A;  4NF5 B;  3RT6 B;  4DCY A;  4QSC A;  1ZIU A;  2REG A;  3KSJ A;  4YB7 A;  3PPQ A;  1EU8 A;  4N6P A;  4U21 A;  2XD3 A;  1JET A;  2W7Y A;  1USY E;  2ZNT A;  1IUD A; 
#chains in the Genus database with same CATH topology
 5HBC A;  1AOV A;  5IZ1 A;  5I58 B;  4GFR A;  4QSD A;  5DW8 A;  4U23 A;  4G77 A;  3G3K A;  4O3C A;  4O8M A;  1PEB A;  4FEC A;  5AA4 A;  3BIH A;  1H76 A;  4RK2 A;  3FJG A;  4LON B;  2I0C A;  1GVC A;  1LLS A;  5A5X A;  4NF8 A;  4JWO A;  5K2X A;  1II5 A;  2XXH A;  1NKX A;  4I9D A;  3I3V A;  1BLF A;  2Y7K A;  5H8F A;  5AA3 A;  2THI A;  4YKK A;  3CFL A;  4PFI A;  2VD3 A;  3A29 A;  2A5T A;  3TEP A;  3VVD A;  4GWY A;  1XVX A;  4GX6 A;  4NF6 B;  1POT A;  3EF7 A;  3EHT A;  2HHM A;  4FAT A;  4OAN A;  3CRB A;  3K01 A;  4PF6 A;  2B65 A;  2OZZ A;  5EYG A;  3LC8 A;  3HST A;  5I57 A;  3ROJ A;  4EUO A;  4OVQ A;  4XKR A;  3OO7 A;  3Q25 A;  2X7Q A;  1P1W A;  1GGG A;  2Y5K A;  1EYK A;  3JYR A;  1FQE A;  3OOA A;  5AA2 D;  1IZ1 A;  1DK4 A;  5DTB A;  3TQW A;  1R9Q A;  4GWW A;  1IME A;  2PCR A;  4JSD A;  4ESW A;  1EZO A;  1R1N A;  1FTJ A;  3C9H A;  2E0S A;  4POW A;  4X04 A;  1NNP A;  4EF2 A;  4KPT A;  3R6U A;  4OFJ A;  3FGS A;  1SVX B;  2HZK A;  4ISU A;  2O51 A;  1WOD A;  3E4R A;  4N15 A;  1HSJ A;  4JVC A;  2Q2A A;  3K00 A;  3TEL A;  1ATG A;  2VGQ A;  4FEB A;  4PC9 A;  2O7I A;  1JQF A;  5HM4 B;  4O94 A;  1AH5 A;  2DVZ A;  4LZ8 A;  1AL3 A;  2B3F A;  1MPB A;  2NUV A;  2DXR A;  5DVF A;  2AL5 A;  2O1L A;  2PFZ A;  3C31 A;  5AA1 A;  4GX3 A;  4NF5 A;  2QVR A;  3MZ9 A;  3DLN A;  1JNF A;  1DTG A;  2A5T B;  4GLI A;  1TT1 A;  2B4M A;  1MPC A;  3PV0 E;  3V89 B;  3RTW B;  1QKA A;  5HPQ A;  4R6H A;  1LFG A;  5K2Y A;  4OZ9 A;  4ELR A;  1P1Q A;  3VE1 B;  5IKB A;  3QIM A;  4OET A;  4I62 A;  1MQD A;  4PTK A;  4BDM A;  2YLN A;  1BIY A;  4GL8 A;  3FXB A;  3TOD A;  4DDD A;  2I0B A;  3PUX E;  1OMP A;  4OA4 A;  2Y84 A;  3MST A;  4OTE A;  3GBB A;  2XXP A;  3TAJ A;  3H06 B;  4NE4 A;  4X9T A;  2ZYK A;  5CMK A;  2DXY A;  5AA4 B;  1AWB A;  4AS4 A;  1B1X A;  4ELP A;  2HZL A;  2YPN A;  4GX4 A;  4NGU A;  3N6U A;  4P9K A;  1ZTY A;  2HAU A;  1FSA A;  1ANF A;  4IO5 A;  1FBD A;  4HCY A;  5EQ8 A;  2F78 A;  4PAF A;  1FTM A;  3DP8 A;  1H45 A;  1EZ9 A;  3SEY A;  1BK4 A;  4DZ1 A;  5CC2 A;  4DIG A;  4PCD A;  4O7M A;  4N8G A;  1YXI A;  3GLB A;  2XXR A;  1FTO A;  3IR1 A;  4KYS A;  4MNP A;  4IY6 A;  1FBG A;  1NH8 A;  4MFI A;  3V5A A;  4NMY A;  1S50 A;  3WAF A;  4GBV A;  4HE1 A;  3DP4 A;  4H5F A;  1M5B A;  4N6K A;  2QSX A;  4P0I A;  2I3V A;  4H8J A;  5EQA A;  1QKB A;  4ZZA A;  3FD3 A;  1B58 A;  3Q28 A;  2F6P A;  5LTC A;  3V83 A;  4HXV A;  1DOT A;  4FBP A;  5TP9 B;  3B6Q A;  3GZG A;  4YU0 A;  4N07 A;  1CNQ A;  2OJT A;  1IMA A;  3O6G A;  3PTY A;  2XX7 A;  4IR8 A;  4FE8 A;  1CE2 A;  1FPD A;  4I40 A;  1G0H A;  2XXW A;  3SEU A;  4RK9 A;  2REJ A;  3OEN A;  4AS5 A;  1Y4T A;  3ECR A;  1I6Q A;  5FTH A;  1Y3P A;  4RYA A;  1LBY A;  2I58 A;  4XKQ A;  1FQF A;  3CG3 A;  1MXX A;  2E1S A;  3LBS A;  2XXX A;  1A8E A;  4XKP A;  3OO6 A;  2P3N A;  4WEP A;  5DVI A;  1B5H A;  3QXM A;  4ZDM A;  3LSF B;  3A3C A;  3OD7 A;  2O69 A;  3T9X B;  1GR2 A;  3MBP A;  3MYU A;  4U1O A;  2ZMB A;  3PUY E;  5TP9 A;  3ZS6 A;  1SYH A;  4IO4 A;  3SES A;  3D1R A;  1QJM A;  1RYO A;  2VD2 A;  1KA1 A;  5ELV A;  3CVG A;  1XS5 A;  1NV2 A;  1LFH A;  4OMB A;  4G8N A;  1SW1 A;  1Y3Q A;  4PE3 A;  4OEU A;  3C36 A;  2DYX A;  4GXS B;  1O7T A;  2H5Y A;  4RNS A;  4FAJ A;  4YKP A;  3QUJ A;  3PPO A;  3KOT A;  2O7U A;  3CI8 A;  3IJX B;  2QVU A;  2UXA A;  2RIN A;  3TPA A;  3RPL A;  3JV9 A;  4C1U A;  3QAX A;  1UTH B;  4KXP A;  1FQA A;  3KC0 A;  1J1N A;  3IB1 A;  1IXI A;  3FVG A;  2QFL A;  1N7X A;  3VLW A;  1ZLQ A;  1MDQ A;  3GYY A;  1YZ0 A;  3KOS A;  5DVJ A;  1FPJ A;  2I4B A;  4PE5 B;  4NG7 A;  4F1U A;  4DI4 B;  3N94 A;  2XXT A;  3MQ9 A;  4FJP A;  1RYX A;  3TTM A;  4ESX A;  4P1L A;  4QSC A;  2ZNT A;  4OQO A;  4NWC A;  5I2N B;  2DWA A;  1VFD A;  3FAT A;  4F3G A;  1D3K A;  4PDD A;  1NV0 A;  2XXI A;  3RTF B;  2AYS A;  1JW5 A;  3M3K A;  1MQG A;  4PFR A;  2R6G E;  4N6D A;  4QFO A;  1WDN A;  4H0W A;  3IJO B;  3ILT B;  1O63 A;  2MKZ A;  2HXW A;  1O64 A;  2DS9 A;  4X1D A;  1UTB B;  3KG2 A;  4PAK A;  1LB8 A;  3T9V A;  4ELQ A;  4F29 A;  1NUW A;  4RPN A;  3HPI A;  4RJZ A;  1B3G A;  5DYH A;  3G3G A;  3PUV E;  3ZKK A;  3N6T A;  4JWX A;  4BDN A;  4QFL A;  4BDL A;  3PPP A;  4EF1 A;  2UVJ A;  3LV0 A;  3UA8 A;  2HXR A;  4P47 A;  4QHQ A;  4F3S A;  1I6B A;  4Q5T A;  4LUB A;  3DM0 A;  1G0I A;  1N7W A;  3MVY A;  4YIC A;  1IQ7 A;  1B7U A;  5CI5 A;  4IO2 A;  4EXL A;  4U1Z A;  4DI3 D;  1MQH A;  4H65 A;  2UYF A;  5H8F B;  2FNC A;  3HN0 A;  4OES A;  5KCJ A;  3PPR A;  1OIB A;  3K6U A;  1FBH A;  4G8M A;  4PFT A;  4MEV A;  4X48 A;  1LCT A;  1B3L A;  5I59 A;  5L8D A;  4LAT A;  1KWH A;  1NV1 A;  4MLV A;  4NED A;  3CSG A;  2P1S A;  1KA0 A;  4ECF A;  4GWO A;  4G2Z A;  3H7M A;  1ELJ A;  4P3L A;  3HO7 A;  4R2B A;  3U1O A;  4G68 B;  5CMB A;  4EQB A;  4IY5 A;  2D21 A;  3HFU A;  1N3X A;  1RDZ A;  4OWD A;  1A54 A;  2XWV A;  2F35 A;  2WX9 A;  3L6H A;  2UVI A;  1MDP 1;  1OQG A;  4F18 A;  3T9H B;  2Q9T A;  5I3S A;  1ZU0 A;  1UTH A;  4LQ2 A;  3MC2 A;  1SI0 A;  1MY2 A;  2XXK A;  3SZP A;  4GF8 A;  3VXB A;  4YMB A;  4KFQ A;  3OEM A;  1GTK A;  2YJP A;  4RY1 A;  4GWU A;  5JK4 A;  4HTG A;  3T1B A;  2QS1 A;  5ET7 A;  5TPA B;  1LBX A;  3KN8 A;  2Y7W A;  1XC1 A;  1IXG A;  2B3B A;  2VOZ A;  4NTL A;  1Y9U A;  2ZZV A;  5ET5 A;  1IMF A;  1A8F A;  3ZKL A;  4NF0 A;  3BFT A;  4PF8 A;  1A55 A;  2QS4 A;  3AXF A;  4GRK A;  1B3H A;  4G4P A;  1N0T A;  4Q0C A;  2A5S A;  3IOU A;  5F7V A;  3U65 A;  1P1U A;  1NNT A;  1Q9D A;  3K6X A;  4PP0 A;  1HSL A;  4L17 A;  2ALU A;  2UVH A;  4FED A;  3O9P A;  4OHN A;  1NL5 A;  3OEK A;  4TQU Q;  1FPG A;  3IB2 A;  2O6A A;  4LN5 A;  4F1V A;  2DP8 A;  3FVK A;  2DSF A;  2O1M A;  3IFA A;  4G8H A;  4OVS A;  2XA5 A;  5IZ3 A;  3T22 A;  2VT5 A;  4P11 A;  5A5X B;  1AIV A;  3EHU A;  3CHG A;  4YB6 A;  3KSX A;  3TTK A;  3K4U A;  1SW4 A;  4QFP A;  4NHB A;  3IFC A;  1MXW A;  1SW5 A;  3DP6 A;  2AL4 A;  5BUU A;  2WKY A;  3IB0 A;  4ZE9 A;  2HCA A;  2OK2 A;  1TWY A;  3K02 A;  4GQO A;  3TTN A;  4IGR A;  4RA1 A;  4EQ9 A;  2CZI A;  3E79 A;  3TZA A;  3PD8 A;  4H45 A;  4P1E A;  4DXB A;  4PAI A;  3RY3 A;  4U2R A;  5IZZ A;  5I7I A;  2RCA A;  5H8H A;  5T3J A;  2QL3 A;  1PB7 A;  3KN7 A;  3C32 A;  4H6D A;  1B3E A;  3ISP A;  1LGB C;  5F1Q A;  4BDQ A;  3BFU A;  3K1N A;  2F8D A;  1ZKB A;  2F7A A;  4EQ7 A;  3S2V A;  2PBW A;  5JTY B;  5I56 A;  5I2N A;  1YAE A;  1YTV A;  3P7I A;  1FQB A;  3D4C A;  4ZEF A;  3VDF A;  3MUQ A;  3H4Z A;  3QSL A;  1IMD A;  4LA9 A;  4P8B A;  4QRZ A;  3S9L C;  3OMB A;  1LAG E;  4IGT A;  3KN3 A;  2NOO A;  3C33 A;  5L9S A;  3UK4 A;  3M3L A;  2P2A A;  2B4L A;  4ZEB A;  1MQJ A;  1PB9 A;  2DWI A;  5ICQ A;  4HCW A;  3RPL B;  2XWO A;  4H8I A;  2FIE A;  1LBZ A;  1GV8 A;  3E78 A;  1NFT A;  2RKM A;  2Y7P A;  5BWJ A;  1MXU A;  1JEU A;  4F39 A;  3A09 A;  3I6V A;  3THI A;  4QFK A;  2O84 X;  3MW0 A;  4F2O A;  3KC1 A;  5AE4 A;  4I1D A;  2OWS A;  2H9B A;  4F22 A;  4OVP A;  2DE3 A;  3M3F A;  2NXO A;  2Q74 A;  4OER A;  4P56 A;  2F36 A;  1LCF A;  2KR0 A;  4IO7 A;  3EPE A;  5ET8 A;  3VFJ A;  1SYI A;  1N76 A;  3O28 A;  1B0L A;  3W15 C;  2DWJ A;  3G7W A;  3N5L A;  4O3A A;  2ONS A;  3JZJ A;  1FRP A;  4ELO A;  2Q2C A;  3W9W A;  5A5L A;  2QS2 A;  1FPL A;  3CFZ A;  2ZYO A;  4HE2 A;  4MH5 A;  3H6W A;  1IMB A;  2VPO A;  5EYH A;  4N17 A;  2WEF A;  3M8U A;  2H99 A;  3OO8 A;  2G93 A;  4HW8 A;  4PQJ A;  1MY0 A;  5IZ3 B;  4PGP A;  3T0J A;  2VPN A;  3FXU A;  2Z8D A;  4N91 A;  1LAH E;  4G68 C;  3IAZ A;  4PFB A;  3RLF E;  4FIM A;  4DCY A;  4NF5 B;  2REG A;  3PPQ A;  2XD3 A;  1JET A;  2X7P A;  1FCK A;  1MY4 A;  1B6H A;  1HSE A;  1MG1 A;  1IMC A;  2ZYM A;  2V25 A;  4U4S A;  3A3U A;  4H46 A;  3HHG A;  4BDO A;  1FTK A;  1FTA A;  3QUF A;  5KDT A;  2FYI A;  4XFE A;  2XWK A;  1B05 A;  3PU5 A;  4GWX A;  3FXQ A;  4R74 A;  2F6G A;  4YZZ A;  3F11 A;  1QW0 A;  4OYV A;  4X1B A;  3OSR A;  3IL1 B;  2HPG A;  1FBE A;  1DSN A;  5B70 A;  1OLC A;  1B40 A;  1LEV A;  3GXA A;  2XX8 A;  5LOM A;  4OFL A;  3RN8 A;  3MVW A;  4GD5 A;  5H8Q B;  1USY H;  2PMS A;  1FPK A;  4RPO A;  2OLB A;  1DPE A;  1POY 1;  3U92 A;  2ZNU A;  1MM7 A;  1FQC A;  5CRY A;  4G61 A;  3CG1 A;  3TQL A;  4F3P A;  4KCC A;  2RF1 A;  3RUM A;  5FBP A;  2ZYN A;  4POX A;  1YYZ A;  1PB8 A;  3K1M A;  1LB9 A;  3FJ7 A;  5IM2 A;  4U22 A;  2IA4 A;  2QPQ A;  3S9N C;  3TCH A;  4KI0 E;  3LSL A;  3U8Q A;  2ABH A;  4OFO A;  3G3J A;  3IX1 A;  1UTB A;  1KZ8 A;  3KFM A;  4U4X A;  1B5I A;  2ZNS A;  3KBZ A;  5L9M A;  5I84 A;  1D4N A;  3ONM A;  4F3B A;  3VLV A;  3VVE A;  4NF4 B;  3TCG A;  3QMF A;  1NMU A;  4LP2 B;  2QMX A;  4R6Y A;  1F9B A;  3FXR A;  4JVD A;  4C0R A;  2X26 A;  2Q89 A;  4XTC Q;  5KDT B;  4AQ4 A;  1EYJ A;  1B1H A;  3SKP A;  4F31 B;  4TLL B;  4PFY A;  3PMV A;  3O6I A;  3T96 B;  3MZB A;  2WYK A;  4THI A;  1H43 A;  5F24 A;  4ND9 A;  3VLU A;  2Z8F A;  3MPL A;  2R9J A;  3SEX A;  3Q27 A;  1Y20 A;  2PYY A;  3B8B A;  1M5F A;  4YAH X;  4NF6 A;  1UIV A;  5B7D A;  1FPI A;  5CMM A;  2V3U A;  5JTY A;  3V8X B;  1OVB A;  2H4I A;  3FBP A;  3SEV A;  1XVY A;  1NV6 A;  1K9Z A;  3IO6 A;  1IIW A;  2RC7 A;  4NF8 B;  1H3D A;  4E0X A;  2V93 A;  1MH4 A;  3FVN A;  5H8H B;  4QSE A;  5FHM A;  1UIU A;  4GL0 A;  1AMF A;  2CZH A;  5JEI A;  2OX3 A;  3MVZ A;  4OEV A;  2L5V A;  1NV4 A;  1XHY A;  1NNF A;  4R9G A;  2BJJ X;  1EH3 A;  2P3V A;  5ESY A;  4Z0I A;  2O68 A;  1NH7 A;  3IO4 A;  3ZSF A;  1Y3N A;  1RDY A;  3LUZ A;  1OQH A;  2DE4 A;  2WYP A;  3IK6 B;  4NWD A;  1NV7 A;  1FTL A;  2XX9 A;  4MMP A;  5FHN A;  1PDA A;  3ODB A;  2Q8M A;  3I5O A;  3TMG A;  1JVX A;  1ZMG A;  2WBD A;  3RT8 A;  3MPK A;  1LBB A;  3USD A;  4MJO A;  4ZEI A;  3MVX A;  4PDH A;  1QUL A;  2GRV A;  1VE4 A;  1VR5 A;  4YB5 A;  3BBR A;  1T0K A;  1B4H A;  3R7X A;  1RKM A;  1CB6 A;  3E3K A;  2Y5L A;  2I3W A;  1EZP A;  4ZEK A;  3H6T A;  4UA8 A;  1B0H A;  2DWH A;  1URD A;  3MP6 A;  4GBW A;  3TTL A;  2DVC A;  3KEI A;  4R6K A;  3TDJ A;  3VV5 A;  4MF3 A;  3C4M A;  2DOJ A;  4GVO A;  2F97 A;  2PFY A;  1K9Y A;  3SER A;  2CEX A;  4ONY A;  1MXZ A;  3IOV A;  3MZ1 A;  3NOH A;  1QGX A;  1OVT A;  3FUZ A;  1FQD A;  2HQ0 A;  4KQP A;  2CEY A;  3VXC A;  4XF5 A;  2HAV A;  4OEN A;  4YMA A;  4R75 A;  1JW1 A;  4UAC A;  4I3E A;  1Y1M A;  4F1Y A;  3FV1 A;  2QVV A;  2HEU A;  2GH9 A;  2PT2 A;  1DMB A;  4Z7E A;  3TUS A;  1P1O A;  1QVS A;  2DQV A;  4OVJ A;  2I49 A;  1B5J A;  1B32 A;  4IB2 A;  4GOT A;  5I59 B;  3FZV A;  1D9Q A;  5CMC A;  4NX1 A;  1NV5 A;  4OXV A;  5I56 B;  5I58 A;  4YKI A;  4H67 A;  2GFE A;  4GWS A;  1LBV A;  3ILU B;  3T66 A;  2OCU A;  3PPN A;  4XEQ A;  5KZT A;  2V84 A;  1JEV A;  4M4G A;  4KYE A;  2M8C A;  2R8T A;  3WAE A;  1LFI A;  1VSO A;  1BTJ A;  4M1V A;  5AA2 B;  3EN3 A;  5H8N A;  3E9X A;  2CZL A;  4BLA A;  3K6W A;  5ICT A;  2RCB A;  3LSX A;  3OO9 A;  2FIX A;  4R2F A;  3PUZ E;  2FA7 A;  3H6V A;  4NQ8 A;  1SPI A;  4PFU A;  1N84 A;  5DEX A;  4NAP A;  1FBP A;  3IOR A;  3LR1 A;  2XXU A;  4LZ7 A;  4OVT A;  4EXK A;  4BDR A;  2QMW A;  4IO3 A;  3RT6 B;  1ZIU A;  4YB7 A;  3KSJ A;  1EU8 A;  4N6P A;  4U21 A;  2W7Y A;  1USY E;  1IUD A;  2BJI A;  1B4Z A;  2XD2 A;  3TFL A;  5TU0 A;  1NV3 A;  3KGC A;  3FAS A;  1OLA A;  5H8Q A;  4QXD A;  4KHZ E;  4JDF A;  3PGF A;  1M5E A;  5ISU A;  3Q26 A;  3T93 B;  3T9U A;  3UN6 A;  1A99 A;  1P99 A;  4JSO A;  2OBG A;  1MXV A;  1Y1Z A;  1DTZ A;  4TOZ A;  2DE2 A;  2ONK E;  3BIG A;  3TKD A;  4NF4 A;  3PUW E;  1TFD A;  2D3I A;  2I4C A;  2I6E A;  2D5W A;  3S4U A;  3KZG A;  2F34 A;  3EHS A;  2GQ1 A;  3OEL A;  1S9T A;  5DEX B;  2CMO A;  1PC3 A;  1SDX A;  5CM6 A;  1LST A;  2Z22 A;  4P0G A;  2GHA A;  3SET A;  1QUJ A;  4MNI A;  3B6T A;  3Q29 A;  4DXU A;  2XHD A;  4QF9 A;  4ZZE A;  4AB6 A;  5CBR A;  3FIR A;  3CR9 A;  3H6U A;  4ZS9 A;  5EQ9 A;  1R6Z A;  3K6V A;  1ZJL A;  4F2Q A;  2V3T A;  4WXJ A;  2XXV A;  1DCU A;  1VFE A;  2XXY A;  2V4C A;  4DLD A;  4EDP A;  2Y7I A;  4LQ5 A;  5H8N B;  3W9V A;  2ZZX A;  5AA2 A;  1BKA A;  4IO6 A;  1D9Y A;  5IAI A;  4X8R A;  3MAM A;  5I2K A;  3KJT A;  1MRP A;  4I8C A;  4WED A;  3DEL B;  1M5C A;  1TFA A;  1UQW A;  1US4 A;  3KJ7 A;  3B50 A;  3H03 A;  2IEE A;  2NVU B;  1B9J A;  4K3F A;  4GIZ A;  2RC9 A;  3TCF A;  4MX6 A;  2PVU A;  4XKN A;  2RC8 A;  2ANJ A;  3MP8 A;  2FBP A;  2OWT A;  3E13 X;  1Z7N E;  5J16 A;  1MH3 A;  1P1N A;  1SW2 A;  3VVF A;  5EQ7 A;  1M5D A;  5FHO A;  4DE8 A;  4E0W A;  1EYI A;  3O2A A;  1NI9 A;  4H1X A;  2VP1 A;  3U93 A;  1NUY A;  1URS A;  4KD5 A;  1LAF E;  2ZZW A;  2QRY A;  2H98 A;  2XXQ A;  3CIJ A;  1LBC A;  1FBF A;  1PBQ A;  2F3B A;  1QUI A;  3EKI A;  1LBW A;  4LZ5 A;  4F19 A;  3G3F A;  1N3W A;  4JVI A;  4XXU A;  1B46 A;  1FPE A;  3B7D A;  4KCD A;  1Y4C A;  3QYT A;  5EYF A;  2WBB A;  1Q1K A;  1JVY A;  2V3Q A;  4MNC A;  3C34 A;  3PMW A;  1B51 A;  1FPF A;  3C35 A;  4H5G A;  4JBZ A;  3KBR A;  2H25 A;  5ITP A;  3K2D A;  2Q8J A;  1TXF A;  4PGN A;  2HFB A;  3SDF A;  2XWI A;  1XT8 A;  5I2K B;  4Q30 B;  1R9L A;  4DCX A;  1NUX A;  5TPA A;  4R9F A;  4N81 A;  3S9M C;  2ONR A;  1Z7M E;  2Y7R A;  4PET A;  1A7L A;  2Z23 A;  3K0V A;  1LAX A;  5KCJ B;  3U94 A;  3RNN A;  2F5X A;  4C1T A;  4JWY A;  2CZK A;  3MP1 A;  1SQY A;  5DT6 A;  2ZXT A;  5FTI A;  2F3D A;  3HCQ A;  1YCJ A;  3TYH A;  3FJM A;  1N04 A;  2LAO A;  4DXC A;  1MXY A;  3R26 A;  3O6H A;  2KLF A;  3N26 A;  4QBA A;  2FVZ A;  2GHB A;  3CSB A;  2Q88 A;  4XIG Q;  3O97 A;  4HE0 A;  1Q35 A;  5ITO A;  3IOT A;  1A40 A;  3OXN A;  2R71 A;  4YKJ A;  2DDK A;  5L9O A;  4MIJ A;  3UIF A;  3FV2 A;  1QUK A;  5EHS A;  1SD3 A;  4MAG A;  1FPB A;  3PMX A;  5IGA A;  1FW0 A;  2OWZ A;  1MPD A;  4R73 A;  1B52 A;  1INP A;  3PD9 A;  3IOW A;  1MQI A;  3SEW A;  1H44 A;  1B7H A;  1FJ6 A;  1MM6 A;  2FHY A;  3LUY A;  4MHF A;  4GXA A;  1MY3 A;  1SBP A;  1B7Z A;  4PBH A;  4GWZ A;  3HHF A;  5EHM A;  3BKI B;  1D9V A;  2UYE A;  3S9E A;  3QK6 A;  3HV1 A;  3GBA A;  2F7C A;  1DPP A;  3D4G A;  3H3G A;  1JW4 A;  3EQ1 A;  4I3Y A;  4AB5 A;  2AIX A;  2G29 A;  3O66 A;  3MWB A;  2I48 A;  3UP9 A;  4KR5 A;  1SI1 A;  4HS7 A;  1I69 A;  4N13 A;  4MBP A;  3B6W A;  3G3H A;  1WVJ A;  3L6G A;  2P0S A;  3CFX A;  1ZBM A;  2PX1 A;  3U72 A;  2VHA A;  4N8Y A;  1MS7 A;  4O3B A;  4QFN A;  4PBQ A;  3G3I A;  5ET6 A;  4ZED A;  4R72 A;  4ZE8 A;  3OSQ A;  4FOR A;  1IEJ A;  4N4U A;  3LSW A;  3RGY A;  4OVR A;  4G68 A;  1NUZ A;  5I57 B;  3RPW A;  4O7I A;  3MJN A;  1IIT A;  4RXL A;  4PFW A;  1VDW A;  4JXI A;  2UVG A;  4WKM A;  1URG A;  3TTR A;  2ESN A;  5LDZ A;  4MLQ A;  1RDX A;  3FVO A;  4TLM B;  4JB7 A;  2F7B A;  5I5P A;  3K1P A;  1BP5 A;  1PBP A;  1XI6 A;  1XOC A;  5H8S A;  1NNK A;  3RQT A;  1YPN A;  1B3F A;  2NWJ A;  1B2H A;  5M2V A;  4KYD A;  1DBZ A;  2JJK A;  3O29 A;  4MCO A;  2KQZ A;  1US5 A;  5J1D A;  1L5T A;  4Q8R A;  4ZEC A;  2Z8E A;  2PT1 A;  2QS3 A;  1MY1 A;  5CBS A;  4NN3 A;  1I6A A;  4UAB A;  2QJE A;  3UOR A;  3UGW A;  3RYD A;  1FBC A;  4LVQ A;  1S7Y A;  1IXC A;  1IXH A;  1JP4 A;  1FJ9 A; 
#chains in the Genus database with same CATH homology
 4OQO A;  1B4Z A;  5HBC A;  4NWC A;  2XD2 A;  1AOV A;  2X7P A;  5I2N B;  2DWA A;  5TU0 A;  3TFL A;  1FCK A;  5I58 B;  4GFR A;  3KGC A;  4QSD A;  3FAS A;  1MY4 A;  1OLA A;  1VFD A;  3FAT A;  4G77 A;  4U23 A;  5H8Q A;  4F3G A;  1B6H A;  1D3K A;  4JDF A;  3PGF A;  4KHZ E;  1HSE A;  2XXI A;  3RTF B;  1M5E A;  1MG1 A;  2ZYM A;  5ISU A;  2V25 A;  2AYS A;  1JW5 A;  3Q26 A;  3T93 B;  3M3K A;  1MQG A;  4U4S A;  2R6G E;  3A3U A;  3G3K A;  4QFO A;  1WDN A;  3HHG A;  4H0W A;  4O3C A;  1FTK A;  3T9U A;  3UN6 A;  1A99 A;  1P99 A;  4BDO A;  1PEB A;  2OBG A;  4JSO A;  3IJO B;  3ILT B;  1MXV A;  1O63 A;  4FEC A;  5AA4 A;  3QUF A;  1Y1Z A;  1DTZ A;  2HXW A;  5KDT A;  1H76 A;  2FYI A;  4TOZ A;  1O64 A;  2DE2 A;  2DS9 A;  2ONK E;  4RK2 A;  1B05 A;  3PU5 A;  4X1D A;  3TKD A;  1UTB B;  3KG2 A;  4NF4 A;  3FJG A;  3PUW E;  4LON B;  3FXQ A;  4R74 A;  2F6G A;  1LB8 A;  2I0C A;  4YZZ A;  1TFD A;  2D3I A;  3F11 A;  1QW0 A;  4OYV A;  4X1B A;  2I4C A;  3T9V A;  2I6E A;  2D5W A;  3OSR A;  3IL1 B;  3KZG A;  1GVC A;  3S4U A;  4ELQ A;  1DSN A;  4F29 A;  5B70 A;  1LLS A;  2F34 A;  5A5X A;  1OLC A;  4RPN A;  4NF8 A;  3HPI A;  3EHS A;  4JWO A;  1B40 A;  4RJZ A;  3OEL A;  1S9T A;  5DEX B;  5K2X A;  1B3G A;  2CMO A;  3GXA A;  1II5 A;  3G3G A;  5DYH A;  1PC3 A;  2XX8 A;  3PUV E;  2XXH A;  5LOM A;  1SDX A;  3ZKK A;  4OFL A;  3RN8 A;  1NKX A;  5CM6 A;  1LST A;  3MVW A;  4GD5 A;  2Z22 A;  4I9D A;  1USY H;  4P0G A;  2GHA A;  2PMS A;  5H8Q B;  3N6T A;  3I3V A;  4RPO A;  1BLF A;  1QUJ A;  2Y7K A;  3SET A;  5AA3 A;  2THI A;  5H8F A;  2OLB A;  3B6T A;  4JWX A;  3Q29 A;  1DPE A;  1POY 1;  4BDN A;  4YKK A;  4QFL A;  4DXU A;  4BDL A;  3PPP A;  2XHD A;  3CFL A;  4EF1 A;  4QF9 A;  4ZZE A;  2VD3 A;  2UVJ A;  4AB6 A;  5CBR A;  3UA8 A;  2A5T A;  3FIR A;  3TEP A;  3VVD A;  4QHQ A;  3CR9 A;  3H6U A;  3U92 A;  2ZNU A;  4F3S A;  1I6B A;  4Q5T A;  4ZS9 A;  4LUB A;  3DM0 A;  1R6Z A;  3K6V A;  1ZJL A;  4F2Q A;  1XVX A;  1N7W A;  2V3T A;  3MVY A;  4NF6 B;  4YIC A;  1MM7 A;  1IQ7 A;  1POT A;  1B7U A;  4WXJ A;  1FQC A;  5CI5 A;  2XXV A;  3EF7 A;  5CRY A;  4IO2 A;  3EHT A;  3CG1 A;  1VFE A;  3TQL A;  4EXL A;  4KCC A;  4F3P A;  4U1Z A;  2XXY A;  1MQH A;  2RF1 A;  4H65 A;  3RUM A;  4DLD A;  4EDP A;  4FAT A;  2ZYN A;  4POX A;  2Y7I A;  4LQ5 A;  5H8N B;  3W9V A;  3CRB A;  3K01 A;  5AA2 A;  1BKA A;  2UYF A;  2B65 A;  4IO6 A;  1D9Y A;  2FNC A;  5H8F B;  1PB8 A;  3K1M A;  3HN0 A;  2OZZ A;  4OES A;  5KCJ A;  5IAI A;  1LB9 A;  3LC8 A;  3FJ7 A;  3HST A;  5I57 A;  3PPR A;  2IA4 A;  4U22 A;  1OIB A;  3K6U A;  2QPQ A;  3S9N C;  3TCH A;  4EUO A;  4XKR A;  4G8M A;  4PFT A;  4X48 A;  3OO7 A;  3MAM A;  3Q25 A;  3KJT A;  5I2K A;  1LCT A;  2X7Q A;  1P1W A;  4KI0 E;  3LSL A;  1GGG A;  1MRP A;  4I8C A;  3U8Q A;  4WED A;  2ABH A;  4OFO A;  3DEL B;  1M5C A;  1TFA A;  3G3J A;  1B3L A;  3JYR A;  1UQW A;  5I59 A;  5L8D A;  3IX1 A;  1FQE A;  1US4 A;  1UTB A;  4LAT A;  3KJ7 A;  1KWH A;  3KFM A;  4MLV A;  4U4X A;  1B5I A;  3OOA A;  2ZNS A;  5AA2 D;  1IZ1 A;  5DTB A;  5L9M A;  3H03 A;  4NED A;  3TQW A;  5I84 A;  1D4N A;  1R9Q A;  2IEE A;  3ONM A;  3CSG A;  2NVU B;  2P1S A;  1B9J A;  4K3F A;  4F3B A;  4ECF A;  4GIZ A;  3VLV A;  2RC9 A;  3VVE A;  3TCF A;  4JSD A;  4NF4 B;  3TCG A;  4ESW A;  1NMU A;  2PVU A;  4GWO A;  4LP2 B;  4XKN A;  2RC8 A;  1EZO A;  4G2Z A;  1R1N A;  1FTJ A;  3C9H A;  2E0S A;  3H7M A;  4POW A;  2ANJ A;  1ELJ A;  2QMX A;  3MP8 A;  1NNP A;  4EF2 A;  4KPT A;  3HO7 A;  3R6U A;  4OFJ A;  3FGS A;  4R2B A;  1F9B A;  4R6Y A;  3TUS A;  2OWT A;  3U1O A;  3E13 X;  1Z7N E;  1SVX B;  4G68 B;  2HZK A;  4ISU A;  1MH3 A;  1P1N A;  2O51 A;  3FXR A;  5CMB A;  4EQB A;  1WOD A;  1SW2 A;  2D21 A;  4IY5 A;  3E4R A;  1N3X A;  4C0R A;  3VVF A;  2X26 A;  1M5D A;  2Q89 A;  4XTC Q;  5KDT B;  4OWD A;  5FHO A;  1HSJ A;  1A54 A;  4AQ4 A;  2F35 A;  2Q2A A;  3L6H A;  4DE8 A;  1B1H A;  3K00 A;  4E0W A;  2UVI A;  3O2A A;  3SKP A;  4H1X A;  1MDP 1;  4TLL B;  4F31 B;  1OQG A;  2VP1 A;  3TEL A;  4PFY A;  3PMV A;  1ATG A;  3U93 A;  2VGQ A;  4FEB A;  3T9H B;  4F18 A;  2Q9T A;  1URS A;  3O6I A;  1ZU0 A;  3MZB A;  2O7I A;  4KD5 A;  3T96 B;  1UTH A;  1LAF E;  4THI A;  1H43 A;  1JQF A;  4LQ2 A;  5HM4 B;  4YMB A;  3MC2 A;  4ND9 A;  3VLU A;  2Z8F A;  2QRY A;  3MPL A;  1AH5 A;  2H98 A;  1SI0 A;  2R9J A;  1MY2 A;  2XXQ A;  2DVZ A;  4LZ8 A;  3CIJ A;  1LBC A;  1AL3 A;  2B3F A;  1MPB A;  2NUV A;  3SEX A;  1PBQ A;  2DXR A;  1QUI A;  5DVF A;  2AL5 A;  4GF8 A;  4LZ5 A;  3VXB A;  3Q27 A;  1Y20 A;  2O1L A;  2PYY A;  1M5F A;  4YAH X;  4F19 A;  3C31 A;  3G3F A;  3OEM A;  4KFQ A;  4NF6 A;  4NF5 A;  1GTK A;  5AA1 A;  1N3W A;  1UIV A;  4XXU A;  2YJP A;  1B46 A;  5B7D A;  5CMM A;  2V3U A;  3B7D A;  3MZ9 A;  4KCD A;  1Y4C A;  4RY1 A;  5JTY A;  3V8X B;  3DLN A;  1JNF A;  1DTG A;  1OVB A;  2A5T B;  4GLI A;  2H4I A;  3SEV A;  3QYT A;  5JK4 A;  1TT1 A;  1XVY A;  4HTG A;  5EYF A;  1Q1K A;  3IO6 A;  1MPC A;  1JVY A;  1IIW A;  2QS1 A;  2V3Q A;  2RC7 A;  5TPA B;  3PV0 E;  4NF8 B;  3KN8 A;  3V89 B;  1H3D A;  3RTW B;  3C34 A;  2Y7W A;  4E0X A;  1QKA A;  3PMW A;  2V93 A;  1XC1 A;  5HPQ A;  1B51 A;  1IXG A;  1MH4 A;  2B3B A;  4R6H A;  2VOZ A;  3C35 A;  4NTL A;  1Y9U A;  1LFG A;  4H5G A;  4JBZ A;  3KBR A;  3FVN A;  5K2Y A;  4OZ9 A;  2H25 A;  5H8H B;  1A8F A;  4QSE A;  1P1Q A;  1UIU A;  3BFT A;  5FHM A;  4GL0 A;  3QIM A;  1A55 A;  3K2D A;  3VE1 B;  5IKB A;  4OET A;  5ITP A;  2Q8J A;  1TXF A;  2QS4 A;  3AXF A;  4GRK A;  4I62 A;  1MQD A;  1AMF A;  2HFB A;  3SDF A;  5JEI A;  1B3H A;  4BDM A;  1XT8 A;  2YLN A;  1BIY A;  3MVZ A;  5I2K B;  4G4P A;  1N0T A;  1R9L A;  2A5S A;  4GL8 A;  3IOU A;  4OEV A;  4Q30 B;  4Q0C A;  4DCX A;  5F7V A;  3TOD A;  4DDD A;  2I0B A;  5TPA A;  4R9F A;  1P1U A;  1NNT A;  1XHY A;  1NNF A;  2ONR A;  3PUX E;  1OMP A;  4R9G A;  3S9M C;  2Y84 A;  4OTE A;  3K6X A;  1Z7M E;  4PP0 A;  3GBB A;  2XXP A;  3TAJ A;  1HSL A;  3H06 B;  4NE4 A;  2BJJ X;  4X9T A;  1EH3 A;  2Y7R A;  4L17 A;  4ELO A;  4PET A;  1A7L A;  2Z23 A;  2ZYK A;  4Z0I A;  5CMK A;  2ALU A;  2DXY A;  2O68 A;  2UVH A;  4FED A;  5AA4 B;  3K0V A;  1LAX A;  5KCJ B;  3O9P A;  4OHN A;  1NL5 A;  4ELR A;  1NH7 A;  3OEK A;  3IO4 A;  4TQU Q;  3U94 A;  3ZSF A;  1B1X A;  3RNN A;  1Y3N A;  2F5X A;  3IB2 A;  4C1T A;  2O6A A;  4JWY A;  4ELP A;  1OQH A;  2HZL A;  3MP1 A;  4F1V A;  2DP8 A;  2YPN A;  3FVK A;  2DE4 A;  1SQY A;  5DT6 A;  2ZXT A;  2DSF A;  3IK6 B;  2O1M A;  4G8H A;  3HCQ A;  3N6U A;  5FTI A;  1YCJ A;  4NWD A;  3TYH A;  3T22 A;  1ZTY A;  1FTL A;  2HAU A;  2XX9 A;  3FJM A;  4P11 A;  1N04 A;  5A5X B;  1AIV A;  2LAO A;  1ANF A;  3EHU A;  4DXC A;  4IO5 A;  1MXY A;  3R26 A;  5FHN A;  1PDA A;  3ODB A;  4HCY A;  4YB6 A;  3KSX A;  3I5O A;  3O6H A;  2F78 A;  3TTK A;  3K4U A;  2KLF A;  1FTM A;  1SW4 A;  3DP8 A;  4QFP A;  3N26 A;  3TMG A;  1H45 A;  1MXW A;  1EZ9 A;  1SW5 A;  2GHB A;  3CSB A;  3SEY A;  1JVX A;  1ZMG A;  2Q88 A;  3DP6 A;  4XIG Q;  3O97 A;  4DZ1 A;  5CC2 A;  1Q35 A;  3RT8 A;  5ITO A;  4DIG A;  3IOT A;  1A40 A;  3MPK A;  2AL4 A;  5BUU A;  3GLB A;  2WKY A;  2R71 A;  3OXN A;  2XXR A;  4YKJ A;  3IB0 A;  1FTO A;  1LBB A;  3IR1 A;  4KYS A;  4IY6 A;  5L9O A;  4ZE9 A;  1NH8 A;  2HCA A;  2OK2 A;  4MFI A;  1TWY A;  3K02 A;  4GQO A;  4NMY A;  3TTN A;  3V5A A;  4IGR A;  3UIF A;  3FV2 A;  1S50 A;  1QUK A;  3USD A;  4RA1 A;  5EHS A;  4EQ9 A;  1SD3 A;  3MVX A;  4ZEI A;  3WAF A;  1QUL A;  2GRV A;  3TZA A;  3PD8 A;  5ICQ A;  1VE4 A;  3DP4 A;  4DXB A;  4H5F A;  3PMX A;  1VR5 A;  1FW0 A;  1MPD A;  4R73 A;  4YB5 A;  1B52 A;  3BBR A;  1T0K A;  1M5B A;  3PD9 A;  2QSX A;  3IOW A;  1MQI A;  3SEW A;  4P0I A;  2I3V A;  4H8J A;  1B4H A;  3R7X A;  4U2R A;  3RY3 A;  1H44 A;  1RKM A;  1B7H A;  1CB6 A;  1MM6 A;  1QKB A;  3E3K A;  4ZZA A;  2I3W A;  1EZP A;  3FD3 A;  3LUY A;  2RCA A;  5H8H A;  4ZEK A;  1B58 A;  4GXA A;  1MY3 A;  3Q28 A;  2F6P A;  1SBP A;  3H6T A;  4UA8 A;  3V83 A;  3ZKL A;  2QL3 A;  1PB7 A;  1B0H A;  2DWH A;  3KN7 A;  1URD A;  3C32 A;  3MP6 A;  1B7Z A;  3TTL A;  1DOT A;  2DVC A;  3KEI A;  4H6D A;  4R6K A;  1B3E A;  5TP9 B;  1LGB C;  3B6Q A;  3TDJ A;  3HHF A;  3GZG A;  5F1Q A;  5EHM A;  3VV5 A;  4BDQ A;  3BFU A;  3K1N A;  2F8D A;  4MF3 A;  4YU0 A;  1ZKB A;  2F7A A;  3BKI B;  3C4M A;  4N07 A;  4EQ7 A;  2DOJ A;  2OJT A;  3S2V A;  2PBW A;  3O6G A;  2XX7 A;  5JTY B;  5I56 A;  1D9V A;  2UYE A;  4GVO A;  4FE8 A;  5I2N A;  2F97 A;  1CE2 A;  3S9E A;  3SER A;  2XXW A;  3SEU A;  3QK6 A;  2REJ A;  4RK9 A;  1YAE A;  3HV1 A;  3GBA A;  1YTV A;  3OEN A;  2F7C A;  1DPP A;  1Y4T A;  4ONY A;  3P7I A;  1FQB A;  1MXZ A;  3D4C A;  3D4G A;  3ECR A;  3H3G A;  4ZEF A;  3VDF A;  1I6Q A;  3IOV A;  3MUQ A;  1Y3P A;  4RYA A;  5FTH A;  2I58 A;  4XKQ A;  1FQF A;  3CG3 A;  1JW4 A;  1MXX A;  3EQ1 A;  3H4Z A;  3MZ1 A;  3QSL A;  4LA9 A;  4QRZ A;  1OVT A;  3FUZ A;  4AB5 A;  2E1S A;  1FQD A;  3LBS A;  2HQ0 A;  2XXX A;  1A8E A;  3S9L C;  4KQP A;  4XKP A;  2AIX A;  2G29 A;  3OO6 A;  3O66 A;  3MWB A;  2I48 A;  3UP9 A;  3OMB A;  4WEP A;  4KR5 A;  1LAG E;  4IGT A;  5DVI A;  1SI1 A;  1B5H A;  3KN3 A;  3QXM A;  2NOO A;  3C33 A;  3VXC A;  4ZDM A;  3UK4 A;  3M3L A;  4HS7 A;  5L9S A;  3LSF B;  1I69 A;  3A3C A;  2P2A A;  3OD7 A;  4N13 A;  2HAV A;  2O69 A;  3T9X B;  1GR2 A;  3MBP A;  4MBP A;  4OEN A;  3B6W A;  3G3H A;  1WVJ A;  4U1O A;  3L6G A;  4ZEB A;  2P0S A;  1MQJ A;  2ZMB A;  4R75 A;  4YMA A;  3PUY E;  1JW1 A;  1PB9 A;  2DWI A;  3CFX A;  1ZBM A;  2PX1 A;  4HCW A;  4UAC A;  1SYH A;  5TP9 A;  4QFK A;  3U72 A;  1Y1M A;  2VHA A;  3ZS6 A;  4IO4 A;  1MS7 A;  4H8I A;  3SES A;  4F1Y A;  3FV1 A;  4O3B A;  4QFN A;  1QJM A;  1RYO A;  1GV8 A;  2VD2 A;  2HEU A;  3G3I A;  2GH9 A;  5ELV A;  2PT2 A;  3CVG A;  1NFT A;  2RKM A;  1DMB A;  2Y7P A;  1XS5 A;  4ZED A;  5BWJ A;  4Z7E A;  1LFH A;  4OMB A;  4R72 A;  1MXU A;  4ZE8 A;  1P1O A;  3OSQ A;  4FOR A;  1IEJ A;  1JEU A;  4G8N A;  3A09 A;  3I6V A;  4F39 A;  1QVS A;  3THI A;  2DQV A;  2I49 A;  1B5J A;  1SW1 A;  1Y3Q A;  1B32 A;  2O84 X;  3LSW A;  3MW0 A;  4OEU A;  4OVJ A;  4F2O A;  4IB2 A;  3C36 A;  2DYX A;  4GXS B;  1O7T A;  5AE4 A;  2H5Y A;  4GOT A;  4I1D A;  4RNS A;  4FAJ A;  3RGY A;  5I59 B;  2OWS A;  4G68 A;  3FZV A;  2H9B A;  4F22 A;  5CMC A;  5I57 B;  4OXV A;  3QUJ A;  4YKP A;  5I56 B;  2DE3 A;  4YKI A;  3PPO A;  3RPW A;  4H67 A;  5I58 A;  3M3F A;  3KOT A;  2GFE A;  2NXO A;  2O7U A;  3CI8 A;  4OER A;  3ILU B;  1IIT A;  3MJN A;  4RXL A;  3T66 A;  2OCU A;  4PFW A;  2F36 A;  3PPN A;  1LCF A;  3IJX B;  2UVG A;  4JXI A;  4WKM A;  1URG A;  4IO7 A;  3TTR A;  2UXA A;  3EPE A;  5KZT A;  3VFJ A;  2RIN A;  2V84 A;  2ESN A;  1SYI A;  1JEV A;  1N76 A;  4MLQ A;  3TPA A;  3FVO A;  4TLM B;  3O28 A;  4JB7 A;  2F7B A;  1B0L A;  2M8C A;  4KYE A;  3JV9 A;  4M4G A;  2DWJ A;  3W15 C;  4C1U A;  3QAX A;  3WAE A;  1UTH B;  3G7W A;  1FQA A;  1J1N A;  3IB1 A;  3K1P A;  1BP5 A;  1IXI A;  1PBP A;  3N5L A;  3FVG A;  1LFI A;  4O3A A;  2ONS A;  1VSO A;  1XOC A;  1N7X A;  5H8S A;  1NNK A;  3JZJ A;  3RQT A;  3VLW A;  1ZLQ A;  1BTJ A;  1B3F A;  1MDQ A;  1YPN A;  4M1V A;  2NWJ A;  1B2H A;  2Q2C A;  5M2V A;  3W9W A;  3EN3 A;  5AA2 B;  4KYD A;  2QS2 A;  5H8N A;  3CFZ A;  2ZYO A;  3KOS A;  3H6W A;  4MH5 A;  3E9X A;  2CZL A;  3O29 A;  5DVJ A;  4BLA A;  3K6W A;  5ICT A;  2I4B A;  1US5 A;  5J1D A;  1L5T A;  4Q8R A;  4ZEC A;  2Z8E A;  2PT1 A;  4PE5 B;  2QS3 A;  2RCB A;  3LSX A;  1MY1 A;  3OO9 A;  3M8U A;  4R2F A;  2H99 A;  5CBS A;  3OO8 A;  3PUZ E;  2G93 A;  4HW8 A;  2FA7 A;  4PQJ A;  1MY0 A;  3H6V A;  1I6A A;  4F1U A;  4PFU A;  2QJE A;  3N94 A;  2XXT A;  1N84 A;  3UOR A;  3UGW A;  3FXU A;  3MQ9 A;  5DEX A;  3IOR A;  2Z8D A;  4FJP A;  4LVQ A;  1LAH E;  1RYX A;  2XXU A;  3LR1 A;  4G68 C;  3IAZ A;  4LZ7 A;  3TTM A;  4BDR A;  4EXK A;  4ESX A;  2QMW A;  1S7Y A;  3RLF E;  4IO3 A;  4FIM A;  1IXC A;  1IXH A;  4NF5 B;  3RT6 B;  4DCY A;  4QSC A;  1ZIU A;  2REG A;  3KSJ A;  4YB7 A;  3PPQ A;  1EU8 A;  4N6P A;  4U21 A;  2XD3 A;  1JET A;  2W7Y A;  1USY E;  2ZNT A;  1IUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...