4LQ2A

Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium in complex with effector ligand, o-acetylserine
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium in complex with effector ligand, O-acetylserine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
total genus 62
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lq2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lq2A02
2XXRA 4Q8RA 3R6UA 4XXUA 5TU0A 2XX8A 1IEJA 5IKBA 4ISUA 3K6UA 3KJTA 3PMVA 1PC3A 1XS5A 5I2NB 3SEVA 1USYH 2V3UA 1UTBA 3OMBA 5H8HA 2QJEA 4F2QA 4F1VA 1OQHA 4H6DA 5H8NB 1IXGA 4WEDA 5K2YA 2DWHA 4G68B 2I4BA 3KGCA 4ELRA 2DWJA 4ESXA 2AL4A 3OELA 4GRKA 1H43A 4F39A 1MY3A 4YB5A 4L17A 2I3VA 3IK6B 3ZKKA 2FA7A 3QK6A 3QUFA 4FIMA 4JDFA 4NEDA 4RNSA 1EZPA 1EZOA 1A8FA 2HXWA 2DE4A 4ESWA 2H99A 1MY4A 3MVXA 4OERA 3KZGA 2V3TA 3SEXA 2GH9A 4DXBA 3LBSA 2D3IA 1UTBB 1OVBA 1LAGE 2DP8A 4FORA 4O3AA 2Q89A 4ZS9A 5H8HB 4ONYA 3RNNA 2XD2A 4GXAA 4H8JA 2UVHA 1B3GA 1D4NA 2O69A 4IY6A 3FXRA 3QAXA 3K00A 4G8MA 3BKIB 4U1ZA 4YKIA 1YTVA 3H6WA 3TTLA 1AIVA 3FV1A 5FHOA 1NMUA 4EQBA 1AMFA 4OHNA 4PP0A 4U1OA 4HTGA 4JWOA 2HZLA 3EN3A 4ND9A 1JW1A 2DSFA 2UVGA 2V84A 3DLNA 1GVCA 1B1HA 1CE2A 4EF1A 4LATA 5AA4A 1B05A 2AL5A 3C34A 3C4MA 3IJXB 4GFRA 1LB8A 3VVFA 3FXUA 3C36A 4RY1A 4R9FA 2Y7WA 3K1PA 1OMPA 2OWTA 3TQLA 5A5XB 1MDP1 1RYXA 3SDFA 3C33A 1LAHE 4WKMA 2F34A 1MPDA 2Y7RA 3FZVA 3IOTA 5L8DA 1DPPA 4U2RA 4LZ5A 3S9MC 3L6HA 3PPPA 3T9HB 3PUWE 1P1UA 5TPAB 4PFYA 3IORA 1QKBA 2NOOA 4ZDMA 4ZE9A 2XXIA 3Q26A 1B1XA 4BDRA 1LSTA 1TXFA 2Z23A 3EPEA 1FTJA 2O1LA 3T66A 3WAFA 1FW0A 2UXAA 4NMYA 4H0WA 1D9YA 2FNCA 2YJPA 5JK4A 5I59A 2Z8FA 3JZJA 4KYEA 3G7WA 4QFKA 1USYE 1SW2A 1N84A 4G4PA 4LA9A 5L9SA 5CI5A 4OYVA 4RPOA 5KZTA 3E4RA 3MW0A 2Y84A 3ILTB 2NWJA 5HPQA 1EH3A 5I56A 3MAMA 2O68A 2Q2CA 1HSJA 2Y7KA 4U22A 1XC1A 4RJZA 5AA4B 1EU8A 3KSJA 2PT2A 1IQ7A 1LGBC 2REJA 4N6PA 4Q30B 5DVIA 4JWXA 2I0CA 3TAJA 3GBBA 1NNKA 3HCQA 4IY5A 1JW5A 1XHYA 2AIXA 1N04A 3K4UA 4OEUA 1B5JA 2R9JA 4N07A 4QFPA 3O6HA 1JVXA 2PVUA 2UVIA 4BDMA 1FQBA 1FTLA 1WODA 3K0VA 4IO3A 1FCKA 3VVDA 3TTNA 1SD3A 2VOZA 5CBSA 1MY0A 1NL5A 2H5YA 3O9PA 2P0SA 5CM6A 5IAIA 4P11A 1SI0A 2F78A 4F1YA 1H45A 1ATGA 2ZYKA 3TCFA 2DYXA 3A3CA 1XT8A 4MLQA 5H8SA 1MS7A 1NNPA 2OBGA 4ELPA 3UA8A 4HW8A 4LQ5A 4FEBA 4EDPA 2GFEA 1GR2A 1L5TA 1MQDA 1SYIA 3E9XA 5H8NA 2ALUA 4Q5TA 5AA2B 4Z7EA 2I6EA 4H8IA 4NF6B 4KQPA 5I2NA 2I3WA 1ZKBA 4G77A 1Y4TA 2XXPA 4POXA 2DOJA 3CFLA 3H03A 1UIUA 5JTYB 4GL0A 5I58B 3MPLA 3FVKA 3DM0A 3WAEA 1SDXA 4POWA 1KWHA 5CC2A 1JEVA 3K2DA 3MQ9A 3PMWA 4KCDA 1IXCA 2ZNTA 3K6WA 3O97A 4MBPA 3DP6A 4BDOA 1LFIA 1YPNA 5BUUA 1P1NA 4E0WA 4DIGA 3OEKA 4ELOA 4F1UA 3O28A 3ILUB 4H1XA 1FQFA 4I62A 3SETA 2H4IA 3IAZA 1B4ZA 1M5CA 4PFUA 5H8FB 3PPOA 1QUIA 1B9JA 5BWJA 3EQ1A 3CRBA 2V25A 3LSFB 4ELQA 4NE4A 1UIVA 3B6QA 5EYFA 3H6TA 2DE3A 3CSGA 2X26A 3O2AA 4TQUQ 1N7WA 3ZKLA 2I0BA 4ZZAA 1DTGA 3FASA 3PGFA 4QSEA 3O6IA 3IOWA 1QKAA 3MZ9A 1B46A 4GL8A 4H5FA 1QUKA 2DVCA 1QW0A 4KD5A 2F7CA 4NF6A 2XXWA 2XXUA 5AA2A 2BJJX 4FAJA 1B7UA 2QS4A 1LLSA 3MVYA 3O29A 1R9QA 3OO6A 5B70A 2W7YA 3S9LC 3EF7A 5DYHA 3T9VA 4F29A 3RTWB 3U8QA 2RF1A 3CIJA 2OZZA 3OO8A 1Y20A 1B3EA 1XOCA 2I4CA 3IX1A 1B7HA 3VXBA 3DP8A 2QPQA 4WEPA 3CVGA 1FTOA 1B0HA 2DXYA 2O51A 4R73A 3SERA 3OSRA 5ICQA 3IOUA 4YICA 1F9BA 1MXYA 3IB0A 5ICTA 2OJTA 3KOSA 4XTCQ 4NF8B 3EHSA 2NVUB 3T9UA 1VFEA 4RK2A 2RC7A 3C35A 3TCHA 3OEMA 2XXQA 4LQ2A 3FATA 5JTYA 3MP6A 1SW1A 3K1NA 4PFTA 1AOVA 1M5FA 4ZZEA 1S9TA 3QUJA 3QYTA 4WXJA 3UN6A 3K02A 4F19A 4YMBA 4JSOA 5I57B 1N76A 1VSOA 1PB7A 3FUZA 3IO4A 4IB2A 3O6GA 4JB7A 4QFNA 4YB6A 1DTZA 4OQOA 5CMCA 4NF8A 3PMXA 4C1UA 3G3HA 3U94A 3SESA 3VLVA 4DDDA 1H76A 1ZTYA 5I56B 2Q88A 2QMWA 4JSDA 3TZAA 3KBRA 2R71A 3KG2A 4E0XA 1UTHA 3DP4A 4NWCA 5AE4A 1BIYA 4ZE8A 1QVSA 3OO9A 4M1VA 2ZNUA 2F7AA 3W15C 4F3GA 2Y7IA 1I6AA 4QHQA 5M2VA 2F35A 3LUYA 3N6UA 3U1OA 4NWDA 2UYEA 3MPKA 5DT6A 1OLAA 1P99A 2VGQA 3JYRA 2UVJA 3USDA 3D4GA 4RPNA 4DXCA 3M3KA 3V8XB 3MBPA 1DPEA 4KHZE 4R2BA 3SKPA 1B5IA 2DVZA 3IOVA 3MVZA 4GF8A 4LP2B 4ZEDA 5ITOA 3RPWA 4KPTA 1JEUA 4O3CA 5A5XA 4MF3A 3H06B 3MP8A 2QS1A 3A09A 3GXAA 2HQ0A 4OVJA 1BKAA 4F3PA 3LR1A 2B65A 2F36A 1MDQA 2RKMA 4OFOA 3LSWA 5I2KA 1ZLQA 2V3QA 3FD3A 1MM7A 1B2HA 3VFJA 3QIMA 2PYYA 3DELB 1QULA 1FQDA 4JXIA 3GLBA 1MXVA 4QSCA 2ABHA 3UK4A 4LZ8A 1SQYA 1TWYA 3G3KA 5AA3A 3RN8A 1M5DA 1Y3PA 3S4UA 4X1BA 4EQ7A 2QS3A 1RYOA 4ZECA 1LFHA 2E1SA 2PT1A 1QJMA 1MH4A 2VP1A 3KFMA 3TPAA 3V89B 1Y9UA 2O7IA 4EXLA 3VXCA 4QFLA 3UGWA 1JVYA 5F1QA 5TP9A 3KN3A 4LUBA 3IO6A 4U21A 1MQIA 5ITPA 4G8HA 2ZYOA 3OXNA 4MLVA 1Y3NA 4TLLB 1IITA 5ELVA 4G68C 1LCFA 2IA4A 2RCAA 2ZYNA 3B6TA 1MH3A 1TT1A 1ZMGA 3FJGA 2G93A 1N3WA 3KEIA 1P1QA 1R9LA 2M8CA 4NF5A 5KCJB 3VLWA 2GHBA 3G3GA 3PD8A 4F3BA 1WDNA 4K3FA 2QL3A 4Q0CA 3ZS6A 4AB6A 5KCJA 1URGA 1D3KA 1MM6A 1N7XA 4H67A 4MFIA 4PE5B 1R6ZA 5DEXB 1SYHA 2A5SA 3TKDA 1MG1A 1NKXA 1Q1KA 4GIZA 5HBCA 4GVOA 3E13X 3Q29A 2XX9A 3G3IA 5EHMA 4ZEKA 5TP9B 3H7MA 3S9NC 5L9OA 1DSNA 3QSLA 1SVXB 2B3FA 2XXYA 1Q35A 3HSTA 1MPBA 4OESA 1IUDA 3K01A 1DOTA 2D5WA 4X48A 4BDQA 3FXQA 1IIWA 2F6GA 1SBPA 2E0SA 3MJNA 4H5GA 2YLNA 1I6BA 2A5TB 1EZ9A 2HEUA 1JW4A 3OENA 5H8QA 3MUQA 3RUMA 3MC2A 1A40A 1PB8A 1NNFA 1S50A 4I9DA 3PUZE 2O6AA 4FATA 2KLFA 1QUJA 5I2KB 4OEVA 2OK2A 2D21A 3LC8A 4R2FA 4OZ9A 3RLFE 1Y1MA 3N26A 4OMBA 1DMBA 2NUVA 3R26A 4U4XA 5DVFA 3ECRA 1A55A 3LSLA 1B7ZA 3MZ1A 3RQTA 2IEEA 3TELA 3TTMA 3VLUA 3HPIA 2RINA 2Y7PA 3KN8A 3MP1A 4HCWA 5I59B 3U92A 1BP5A 2B3BA 4OTEA 4YKPA 3K6VA 1A8EA 1GTKA 2PMSA 4I8CA 5F7VA 1N3XA 1PBQA 1S7YA 4DE8A 3IB1A 1RKMA 2P2AA 4XKRA 4OETA 1A54A 4ZEBA 4F31B 3TMGA 1WVJA 1P1OA 2HFBA 3M3FA 3OSQA 1ZU0A 4XKPA 3HHGA 3TUSA 4P0IA 1LB9A 1US5A 1NH7A 2XXXA 4UACA 3IJOB 1A99A 3TTKA 5CBRA 1HSEA 1VFDA 3ONMA 4IGTA 1GV8A 3FJMA 4F22A 3UORA 4H65A 2CZLA 4R72A 1UTHB 4OENA 4XKNA 1ELJA 3S2VA 1CB6A 1VE4A 3V83A 1POTA 4DCYA 1ANFA 3PUVE 4HS7A 3MWBA 4YAHX 4DXUA 3E3KA 3HO7A 1MY1A 4EXKA 5AA2D 4IGRA 4DLDA 4LONB 1PDAA 4IO4A 3PUYE 4GQOA 3V5AA 2A5TA 4BDNA 3UIFA 3IR1A 4XIGQ 1ZJLA 2DS9A 1Z7NE 1MQJA 1R1NA 2F8DA 2G29A 3TYHA 3BFUA 3CSBA 4R9GA 4FEDA 1OVTA 1LBBA 4U4SA 2O84X 2X7QA 2V93A 3THIA 1B4HA 4RA1A 5LOMA 4OFJA 2XX7A 1OQGA 4NF4B 4R6HA 4X1DA 1JQFA 5HM4B 2Q9TA 5DTBA 3HHFA 4QSDA 2GHAA 2F6PA 4JWYA 2H9BA 4GXSB 2DXRA 5DEXA 4I1DA 2R6GE 3BBRA 1MXZA 1ZIUA 3B7DA 4PFWA 1URDA 3N5LA 4LZ7A 2ANJA 4RK9A 3HN0A 4C0RA 2OLBA 1MXWA 2YPNA 3G3FA 3TFLA 3Q28A 4ECFA 4NF5B 1JETA 4ZEFA 5L9MA 3UP9A 4BDLA 3PUXE 4G68A 3TQWA 3MZBA 1TFDA 3I3VA 1MQHA 3KSXA 2O7UA 2GRVA 2OWSA 4MH5A 4QF9A 3CI8A 2I58A 3W9VA 2ONSA 4IO6A 4YKKA 1OIBA 5FHNA 3FJ7A 3FVGA 1B51A 1B3HA 1A7LA 4OWDA 1YCJA 1NFTA 3CFXA 5JEIA 3RY3A 3ZSFA 1LCTA 2THIA 3CFZA 1PB9A 2HAVA 3FGSA 3M8UA 3I6VA 5AA1A 3TDJA 4YMAA 1O7TA 2REGA 4G8NA 1H44A 1PBPA 2I48A 3A3UA 3BFTA 3N6TA 1UQWA 4R6KA 4XKQA 2UYFA 3B6WA 1B52A 3K1MA 3U72A 2QMXA 1MXXA 1NH8A 2WKYA 3VVEA 5I84A 4KYDA 2X7PA 3TCGA 2Z22A 3GZGA 1T0KA 2ZXTA 3S9EA 4IO7A 2XXTA 1O63A 4QFOA 4O3BA 3SEYA 1N0TA 2Q2AA 1D9VA 5ISUA 3D4CA 1MPCA 4TLMB 3EHTA 4R75A 5I58A 4IO5A 3RT8A 1M5BA 2ONRA 4YU0A 2Q8JA 3M3LA 3PPQA 3L6GA 4OXVA 3RT6B 1P1WA 1SW5A 1SW4A 1VR5A 1Y3QA 1MY2A 4M4GA 2HZKA 2QSXA 4X9TA 1FTKA 2F97A 1YAEA 3EHUA 1OLCA 1B3FA 4OFLA 3T9XB 4EQ9A 3VDFA 4TOZA 4DCXA 4THIA 1XVYA 1IZ1A 2PBWA 4KCCA 5CMBA 2XXVA 3TEPA 1B40A 1SI1A 1Z7ME 4GLIA 4RXLA 1LAFE 3P7IA 1AL3A 1B6HA 4GWOA 4KYSA 2VD3A 5CMKA 4GD5A 3JV9A 4GOTA 5KDTB 1I69A 2ZNSA 3PPNA 4JBZA 2H25A 4NF4A 5CMMA 3U93A 1MQGA 3H4ZA 1XVXA 3TODA 3IL1B 3OO7A 1PEBA 2DQVA 1MXUA 4IO2A 1I6QA 4NTLA 4HCYA 1MRPA 1IXIA 1LFGA 2P1SA 3MVWA 2NXOA 4KI0E 4N13A 3RGYA 2ZMBA 1J1NA 2XHDA 3I5OA 3H6UA 4FECA 3F11A 3AXFA 4QRZA 2XXHA 3Q25A 2RC8A 3T96B 1Y4CA 1ZBMA 4EF2A 5FTIA 3RTFB 1IXHA 2Z8DA 1LAXA 4FE8A 3H6VA 5DVJA 2ESNA 3CR9A 2RCBA 3HV1A 4C1TA 3FVOA 2HAUA 4KR5A 5EHSA 1BLFA 4YZZA 1B0LA 2QRYA 4F2OA 3GBAA 2FYIA 3CG3A 5KDTA 4ZEIA 3R7XA 4BLAA 1M5EA 2RC9A 2DWAA 3IB2A 2DWIA 4Z0IA 3T93B 2QS2A 1O64A 4U23A 1URSA 2ZYMA 3C32A 1POY1 5I57A 1BTJA 3OOAA 3G3JA 3KOTA 5B7DA 5J1DA 1B3LA 5FTHA 2VD2A 1B58A 1H3DA 1FQEA 2AYSA 3QXMA 2PX1A 3FV2A 3KJ7A 3SEWA 1B5HA 1TFAA 4G2ZA 3C31A 3K6XA 3N94A 1B32A 3W9WA 1HSLA 3PU5A 4EUOA 3PD9A 5TPAA 4YB7A 3H3GA 5CRYA 1JNFA 2VHAA 3ODBA 4DZ1A 2F7BA 1AH5A 1Y1ZA 3C9HA 4KFQA 4PETA 3O66A 4P0GA 4R6YA 2HCAA 1US4A 3LSXA 4PQJA 4RYAA 1FTMA 2H98A 2OCUA 3PV0E 4YKJA 3FVNA 1LBCA 3PPRA 5FHMA 3SEUA 3T22A 2CMOA 3Q27A 3VV5A 4F18A 1GGGA 4LVQA 3VE1B 2DE2A 2XD3A 3FIRA 3KN7A 4AQ4A 2Z8EA 5H8FA 2I49A 4FJPA 1FQAA 4AB5A 3CG1A 4F3SA 3TTRA 3OD7A 1FQCA 4R74A 5H8QB 4UA8A 2ONKE 2F5XA 1II5A 1NNTA 2O1MA 2LAOA 5K2XA
chains in the Genus database with same CATH superfamily
2XXRA 4Q8RA 3HFUA 2XX8A 4MEVA 3PMVA 3SEVA 1USYH 1OQHA 4WEDA 5K2YA 3OELA 1MY3A 4YB5A 3IK6B 3ZKKA 3QK6A 4FIMA 4NEDA 4ESWA 2H99A 2V3TA 4N8YA 2GH9A 1FJ9A 1LAGE 2Q89A 4ONYA 4GXAA 2XA5A 5FHOA 4PC9A 1RDYA 4PP0A 4ND9A 2HZLA 2UVGA 1CE2A 2AL5A 2ZZVA 3C34A 4I3EA 5T3JA 2CZKA 3K1PA 5A5XB 2F34A 3IOTA 3IORA 4ZDMA 4ZE9A 3Q26A 1B1XA 1LSTA 2Z23A 4NMYA 1D9YA 2FNCA 5JK4A 5I59A 5CI5A 2Y84A 3ILTB 5HPQA 4MNIA 5AA4B 4IY5A 2AIXA 5ESYA 4PAIA 1JVXA 2PVUA 1FQBA 4IR8A 4IO3A 1FBGA 4GWYA 1MY0A 1NL5A 5IAIA 1SI0A 2F78A 3TCFA 4EDPA 1GR2A 5EQ9A 3E9XA 5H8NA 2ALUA 3B50A 2I3WA 1ZKBA 5JTYB 2XXPA 3DM0A 1KWHA 4KCDA 1IXCA 3K6WA 4MBPA 3DP6A 5BUUA 4ELOA 4F1UA 3O28A 1FQFA 2XWVA 1B9JA 3LSFB 1FPJA 2JJKA 2X26A 1N7WA 3ZKLA 2I0BA 1DTGA 5JTYA 1QKAA 5EQ7A 1QUKA 4KD5A 1JP4A 2F7CA 2Q8MA 2QS4A 5B70A 3T9VA 3RTWB 2RF1A 3CIJA 1Y20A 1B3EA 3PTYA 4WEPA 1B0HA 1VFEA 4RK2A 1FPIA 2XXKA 5IZ3B 5LDZA 1S9TA 3UN6A 4QFNA 3O6GA 3PMXA 2Q88A 4H46A 1FRPA 3TZAA 3KBRA 2R71A 1BIYA 4ZE8A 3OO9A 4M1VA 2ZNUA 1I6AA 4MHFA 2UYEA 3MPKA 1OLAA 3JYRA 3USDA 3D4GA 2Q74A 4KHZE 2DVZA 3IOVA 3RPWA 5A5XA 2HQ0A 1BKAA 2B65A 2F36A 3QIMA 5LTCA 1QULA 4QSCA 3G3KA 4EQ7A 2QS3A 4ZECA 1MH4A 1Y9UA 3VXCA 4QFLA 4N6KA 5TP9A 4LUBA 4NHBA 4U21A 4G8HA 1YXIA 2IA4A 3M3FA 1MH3A 2FIEA 2GHBA 3G3GA 3PD8A 4Q0CA 1MM6A 4PE5B 2A5SA 1NKXA 1NUXA 5HBCA 1QGXA 1SVXB 2OX3A 2F3BA 1Q35A 3K01A 1DOTA 1IMDA 2D5WA 4X48A 4BDOA 3MJNA 2F6GA 1I6BA 3OENA 1A40A 1PB8A 1NNFA 4I9DA 2O6AA 2FVZA 2WYKA 2KLFA 5I2KB 2OK2A 4OZ9A 3RLFE 1Y1MA 1A55A 5IZZA 3VLUA 3HPIA 2Y7PA 5ET5A 5I59B 1BP5A 2PCRA 4YKPA 3K6VA 3NOHA 5I3SA 1WVJA 4P3LA 3HHGA 3TUSA 4UABA 1LB9A 1NH7A 3IJOB 1A99A 5I57B 4F22A 1IMAA 4R72A 1K9ZA 2VPOA 4XKNA 1ELJA 1FPKA 1VE4A 3V83A 4DCYA 1ANFA 2XWOA 3PUVE 4YAHX 5AA3A 1FPLA 1FPDA 4DLDA 4LONB 3SZPA 1EYKA 1R1NA 3CSBA 2V93A 1B4HA 4RA1A 5LOMA 2Q9TA 5DTBA 4OA4A 2GHAA 3B7DA 4PFWA 4PFIA 3BIGA 4RK9A 5KZTA 4P56A 4ECFA 4NF5B 5L9MA 3IFCA 2O7UA 2GRVA 3KSXA 4MH5A 3W9VA 2I58A 4N81A 2HHMA 1B51A 1YCJA 2HAVA 2HXRA 4YMAA 3A3UA 4R6KA 3B6WA 1MXXA 3VVEA 2X7PA 2FHYA 3GZGA 2XXTA 4O3BA 2Q2AA 4I40A 1D9VA 5ISUA 3D4CA 5ET7A 3EHTA 3RT8A 2ONRA 2Q8JA 4KXPA 1VR5A 1Y3QA 1MY2A 2QSXA 4QBAA 2F97A 1B3FA 3VDFA 4DCXA 2FIXA 5CMBA 3TEPA 4GLIA 4GWOA 2VD3A 2ZNSA 2KQZA 1YYZA 4NF4A 5EYGA 1MQGA 4HCYA 3MVWA 2NXOA 4GWXA 3AXFA 1ZBMA 4KR5A 1LBXA 4ZEIA 2QS2A 2ZYMA 3C32A 3KOTA 4PTKA 3SEWA 3QXMA 1B5HA 3MYUA 3K6XA 3PU5A 5TPAA 1FPEA 4QXDA 3KC0A 1AH5A 1Y1ZA 3D1RA 3O66A 4P0GA 2HCAA 1FTMA 2WBDA 4LVQA 3VE1B 3FIRA 4FJPA 4AB5A 4F3SA 3OD7A 4R74A 1NUZA 5H8QB 1II5A 3KN3A 5TU0A 1IEJA 3QMFA 2V3UA 5H8HA 4ELRA 4F39A 1H43A 2FA7A 4JDFA 1EZPA 1A8FA 3KZGA 1UTBB 1OVBA 2DP8A 4FORA 1D4NA 3FXRA 3QAXA 4OANA 2CZHA 1AMFA 4OHNA 2DSFA 1GVCA 4LATA 4GFRA 4N91A 2OWTA 1RYXA 3SDFA 1LAHE 4AS4A 1DPPA 4U2RA 4LZ5A 3L6HA 3PPPA 3T9HB 3PUWE 2NOOA 1TXFA 1FW0A 4N4UA 1XI6A 1USYE 1N84A 3MW0A 5I56A 3MAMA 2O68A 1HSJA 4RJZA 4O94A 2PT2A 1IQ7A 4JWXA 3GBBA 1IMFA 1JW5A 1XHYA 4I3YA 1B5JA 2R9JA 3O6HA 2UVIA 1FTLA 3VVDA 4P11A 2KR0A 2ZYKA 5HM4B 3UA8A 4FEBA 2GFEA 1L5TA 5AA2B 4Z7EA 3CFLA 3H03A 2FBPA 2CEXA 5CC2A 1SDXA 3O97A 4N8GA 1YPNA 4E0WA 4DIGA 3SETA 3PPOA 1QUIA 5BWJA 3EQ1A 3CRBA 4ELQA 4NE4A 2CZIA 3B6QA 4TQUQ 4ZZAA 2WBBA 4QSEA 1B46A 5F24A 4NF6A 2XWIA 2XXWA 2BJJX 4FAJA 5EQ8A 3O29A 3OO6A 3S9LC 5DYHA 2OZZA 2I4CA 4DI4B 3CVGA 2DXYA 1LBZA 4R73A 5ICQA 4YICA 5ICTA 4XTCQ 3EHSA 3TCHA 4LQ2A 4P1LA 3IFAA 3MP6A 1VDWA 3QUJA 3QYTA 4WXJA 4NG7A 4YMBA 4JSOA 1N76A 1PB7A 1FPGA 4NF8A 3U94A 4MJOA 3SESA 4DDDA 4GBWA 4E0XA 1CNQA 5AE4A 3W15C 4F3GA 2F7AA 4PAKA 2Y7IA 4NWDA 1P99A 1KA0A 4R2BA 4AS5A 3SKPA 3MVZA 4ZEDA 5ITOA 1K9YA 4O3CA 3H06B 3MP8A 4PFRA 2QS1A 3A09A 1NUYA 3GXAA 4F3PA 2RKMA 2V3QA 3FD3A 1B2HA 3DELB 3GLBA 3UK4A 1SQYA 1Y3PA 3S4UA 3T1BA 1RYOA 1LFHA 2PT1A 4EXLA 3UGWA 5F1QA 5ITPA 1MQIA 2ZYOA 3OXNA 4MLVA 4TLLB 4HS7A 3FJGA 3B6TA 3KSJA 1ZMGA 2G93A 4NF5A 4G61A 1WDNA 4K3FA 4MMPA 1N7XA 1R6ZA 4P9KA 1Q1KA 4GIZA 3H7MA 3S9NC 5L9OA 1IUDA 4BDQA 4H5GA 2HEUA 4H45A 1FSAA 3LC8A 2CEYA 1B7ZA 3TELA 3KN8A 4HCWA 2B3BA 4DE8A 4I8CA 5F7VA 1PBQA 4XKRA 1A54A 4ZEBA 1P1OA 2HFBA 4PE3A 2XXXA 5CBRA 1VFDA 3ONMA 4IGTA 1GV8A 3FJMA 4H65A 1CB6A 3MWBA 3E3KA 3HO7A 4IO4A 3PUYE 4GQOA 4N17A 1ZJLA 1Z7NE 2F8DA 4FEDA 1OVTA 4U4SA 4X1DA 2DXRA 4I1DA 1MXZA 1URDA 3N5LA 4LZ7A 3HN0A 2OLBA 3G3FA 3TFLA 3Q28A 1JETA 3UP9A 3PUXE 4G68A 3I3VA 4QF9A 1OIBA 3FJ7A 4OWDA 1NFTA 4X8RA 3RY3A 2THIA 3CFZA 3FGSA 5AA1A 1G0HA 2REGA 4PAFA 1H44A 1UQWA 4XKQA 3K1MA 5ET8A 1YZ0A 4KYDA 2R8TA 1KZ8A 2VT5A 4IO7A 4GWZA 3SEYA 1MPCA 3RT6B 3PPQA 4OXVA 2HZKA 4X9TA 3EHUA 4TOZA 4THIA 2PBWA 1IZ1A 4KCCA 1B40A 1Z7ME 4RXLA 1LAFE 4PF8A 4GOTA 3FBPA 3PPNA 4JBZA 4PCDA 3OO7A 1I6QA 4KI0E 1LFGA 3RGYA 1J1NA 4FECA 4NGUA 4EF2A 5FTIA 1IXHA 5DVJA 4FE8A 2Y5LA 2RCBA 3CR9A 2HAUA 5EHSA 1BLFA 3MSTA 1B0LA 5EQAA 2FYIA 3CG3A 5KDTA 4LN5A 3IB2A 2RC9A 2DWAA 4Z0IA 2DWIA 1BTJA 4PGPA 3G3JA 4PDHA 3LUZA 3C31A 3N94A 4YB7A 4PBHA 3H3GA 1JNFA 3ODBA 2F7BA 1NI9A 4PQJA 4NAPA 3PV0E 4YKJA 3FVNA 3PPRA 3VV5A 2CMOA 4F18A 2I49A 3U65A 1FQAA 4UA8A 2ONKE 2LAOA 5IKBA 3K6UA 2L5VA 1DBZA 1UTBA 2QJEA 5I7IA 4F1VA 4H6DA 4GX4A 1NV0A 1IXGA 5H8NB 2DWHA 2AL4A 4GRKA 1EZOA 3MVXA 4DXBA 4ZS9A 5H8HB 4O3AA 4MX6A 2XD2A 4H8JA 1LBYA 4IY6A 4G8MA 3K00A 1YTVA 3H6WA 3TTLA 3FV1A 4U1OA 2P3VA 4JWOA 3EN3A 1JW1A 2V84A 4EF1A 2BJIA 5AA4A 3C4MA 3IJXB 3VVFA 3FXUA 1BK4A 4RY1A 4R9FA 2Y7WA 1OMPA 3C33A 2Y7RA 1MPDA 3FXBA 1P1UA 5TPAB 4PFYA 1QKBA 4MNCA 4C0RA 1NV3A 4BDRA 1FTJA 2UXAA 2YJPA 4QFKA 4G4PA 5L9SA 4OYVA 4RPOA 2Y7KA 4U22A 1XC1A 1FBPA 1EU8A 1LGBC 2REJA 4N6PA 4Q30B 5DVIA 3HCQA 1N04A 4OEUA 4QFPA 4GWUA 1FTAA 1FCKA 2VOZA 2H5YA 2P0SA 4F1YA 1H45A 2WEFA 1ATGA 2DYXA 4MLQA 5H8SA 1NNPA 2P3NA 1SYIA 2I6EA 4POXA 1Y4TA 2DOJA 1UIUA 3FVKA 1JEVA 3MQ9A 2ZNTA 1RDZA 1P1NA 3ILUB 3E79A 2H4IA 3IAZA 5H8FB 2V25A 5EYFA 3H6TA 3O2AA 3KC1A 3FASA 4GWSA 3O6IA 3IOWA 4H5FA 2DVCA 1QW0A 2XXUA 3MVYA 1LLSA 1R9QA 2W7YA 4F29A 3U8QA 4PBQA 1XOCA 1B7HA 3DP8A 2ZZXA 2QPQA 1FTOA 3IB0A 3KOSA 2RC7A 3OEMA 3K1NA 4P47A 3K02A 1VSOA 4JB7A 4IB2A 4OQOA 3G3HA 3VLVA 1IMBA 1H76A 1ZTYA 2QMWA 4JSDA 2QFLA 3DP4A 1QVSA 5M2VA 4FBPA 3U1OA 2VGQA 2UVJA 3RPLB 4RPNA 4DXCA 3M3KA 1B5IA 4LP2B 1IMCA 4KPTA 3LR1A 5I2KA 4OFOA 1ZLQA 2PYYA 1FQDA 4JXIA 1MXVA 1TWYA 4GX6A 1M5DA 4X1BA 3KFMA 3TPAA 1FJ6A 1EYIA 3IO6A 5ELVA 4G68C 1LCFA 2ZYNA 2RCAA 3KEIA 1P1QA 4F3BA 4AB6A 1URGA 2GQ1A 5I5PA 3TKDA 4GVOA 3E13X 3Q29A 2XX9A 5EHMA 4ZEKA 5TP9B 1DSNA 3HSTA 3ROJA 1MPBA 4OESA 1IIWA 4PGNA 2YLNA 1EZ9A 3MC2A 4FATA 2D21A 4R2FA 5DVFA 4OMBA 2NUVA 4PDDA 3ECRA 4XEQA 3MZ1A 3RQTA 2IEEA 2RINA 3MP1A 3U92A 4OTEA 2QVUA 3IB1A 1RKMA 2P2AA 4F31B 4OETA 3OSQA 4XKPA 1ZU0A 5ET6A 4P0IA 1US5A 3TTKA 4OVTA 2CZLA 4NX1A 5AA2D 4EXKA 1PDAA 1SPIA 3V5AA 2A5TA 3UIFA 3IR1A 4XIGQ 2DS9A 5DW8A 4XF5A 5IZ3A 3THIA 2Y5KA 4R6HA 2XX7A 1OQGA 2ZZWA 3HHFA 4QSDA 4JWYA 2H9BA 5DEXA 2R6GE 1ZIUA 2ANJA 1MXWA 4MIJA 4ZEFA 3TQWA 3MZBA 1MQHA 2OWSA 4IO6A 4YKKA 5FHNA 1PB9A 3M8UA 3I6VA 1O7TA 4G8NA 2I48A 1PBPA 3BFTA 3GYYA 1B52A 3U72A 2QMXA 2WKYA 3TCGA 2Z22A 2ZXTA 4XFEA 4IO5A 3SEXA 3L6GA 1P1WA 2XWKA 4EQ9A 4OFLA 1OLCA 1XVYA 4JVCA 3P7IA 1AL3A 1B6HA 1FBCA 5KDTB 1I69A 2H25A 3E78A 3U93A 1FBHA 3IL1B 1MXUA 1MRPA 1IXIA 4N13A 2ZMBA 2XHDA 2XXHA 2RC8A 3T96B 3HV1A 4C1TA 3FVOA 4F2OA 2QRYA 3GBAA 4MCOA 4BLAA 3T93B 1O64A 4U23A 1URSA 1POY1 3OOAA 5FTHA 2VD2A 1H3DA 1FQEA 2AYSA 2PX1A 3FV2A 1TFAA 3W9WA 1HSLA 3RYDA 4KFQA 4PETA 4R6YA 3LSXA 1US4A 4RYAA 2OCUA 5FHMA 3Q27A 4OVQA 1GGGA 2DE2A 2XD3A 4AQ4A 2Z8EA 5IZ1A 3CG1A 4GBVA 2F5XA 2O1MA 1FBFA 3R6UA 4XXUA 4ISUA 3KJTA 1PC3A 1XS5A 2WYPA 5I2NB 3OMBA 4F2QA 5EYHA 4G68B 2I4BA 3KGCA 4ESXA 2DWJA 4L17A 2I3VA 3QUFA 4RNSA 2HXWA 2DE4A 2HPGA 1MY4A 1FBEA 4OERA 3LBSA 2D3IA 3RNNA 3T66A 2UVHA 1B3GA 2O69A 4U1ZA 3BKIB 4YKIA 1AIVA 1NMUA 4EQBA 1RDXA 4HTGA 2WX9A 3DLNA 1B1HA 1B05A 1LB8A 3C36A 3TQLA 1MDP1 4MAGA 5FBPA 4WKMA 3FZVA 3S9MC 5L8DA 1LBVA 2XXIA 3WAFA 3EPEA 2O1LA 4HE2A 4H0WA 2Z8FA 3JZJA 4KYEA 3G7WA 1SW2A 4LA9A 2OWZA 4JVIA 3E4RA 2NWJA 1EH3A 2Q2CA 2I0CA 3TAJA 1NNKA 3K4UA 3KBZA 4N07A 4OVSA 4BDMA 1WODA 3K0VA 1KA1A 3TTNA 3LV0A 1SD3A 5CBSA 3O9PA 5CM6A 1FBDA 4DI3D 3A3CA 1XT8A 1MS7A 2OBGA 4ELPA 4HW8A 4LQ5A 1MQDA 4HE0A 4Q5TA 4H8IA 4NF6B 5I2NA 4G77A 5I58B 4GL0A 3MPLA 3WAEA 4POWA 3K2DA 3PMWA 1LFIA 4GX3A 3OEKA 3EKIA 4I62A 4H1XA 4NF0A 1B4ZA 1M5CA 4NN3A 4PFUA 1UIVA 2DE3A 3CSGA 3PGFA 3MZ9A 4GL8A 5AA2A 1B7UA 2B4LA 4X04A 3EF7A 4PF6A 3OO8A 4P1EA 3ISPA 3IX1A 4JVDA 3VXBA 3A29A 2VPNA 2O51A 3SERA 3OSRA 2PFYA 3IOUA 1F9BA 1MXYA 2OJTA 4NF8B 1NV5A 2NVUB 3T9UA 1LEVA 3C35A 2XXQA 3FATA 1SW1A 4PFTA 1AOVA 1M5FA 4ZZEA 4F19A 2F3DA 2QVRA 3FUZA 3IO4A 4YB6A 1DTZA 5CMCA 4P8BA 4C1UA 5I56B 3KG2A 1UTHA 4NWCA 5A5LA 1IMEA 4QHQA 2F35A 3LUYA 2MKZA 3N6UA 5DT6A 4OVRA 3V8XB 3MBPA 1DPEA 4GF8A 1JEUA 4MF3A 4OVJA 1NV1A 1MDQA 3LSWA 1MM7A 3VFJA 2PFZA 2ABHA 4LZ8A 3RN8A 2E1SA 1NV4A 1QJMA 2VP1A 1LBWA 3V89B 2O7IA 1JVYA 1DCUA 1Q9DA 1Y3NA 5J16A 1IITA 1DK4A 4PFBA 3R26A 4KYSA 1TT1A 1N3WA 2B4MA 1R9LA 2M8CA 5KCJB 3VLWA 2QL3A 1D9QA 3ZS6A 5KCJA 1D3KA 4MFIA 4H67A 5DEXB 1SYHA 1MG1A 3G3IA 3QSLA 2B3FA 2XXYA 3FXQA 4KQPA 1SBPA 2E0SA 2A5TB 1JW4A 3RUMA 5H8QA 3MUQA 1S50A 3PUZE 1EYJA 1QUJA 4OEVA 3N26A 4U4XA 1DMBA 3LSLA 3TTMA 1A8EA 1GTKA 2PMSA 3T0JA 1N3XA 1S7YA 3B8BA 5IGAA 3TMGA 4UACA 1HSEA 4HE1A 3UORA 3S2VA 1UTHB 4OENA 1POTA 4DXUA 1MY1A 4IGRA 4O7MA 4BDNA 1MQJA 2G29A 3TYHA 1INPA 1NV7A 3BFUA 4R9GA 1LBBA 2O84X 2X7QA 1G0IA 4OFJA 4NF4B 2V4CA 1JQFA 2F6PA 1AWBA 4GXSB 3BBRA 2YPNA 4BDLA 1NUWA 1TFDA 3CI8A 2ONSA 3FVGA 1B3HA 1A7LA 5JEIA 3CFXA 3ZSFA 1LCTA 3TDJA 3N6TA 2UYFA 1NH8A 4NQ8A 5I84A 4MNPA 1T0KA 3S9EA 1O63A 4QFOA 4N6DA 4N15A 2DDKA 1N0TA 4TLMB 4R75A 5I58A 1M5BA 4YU0A 3M3LA 5IM2A 1SW5A 1SW4A 4M4GA 3RPLA 1FTKA 4OVPA 1YAEA 3T9XB 2XXVA 1SI1A 4O8MA 5CMKA 4GD5A 2QVVA 3JV9A 3CHGA 3BIHA 5CMMA 3H4ZA 1XVXA 3TODA 4NTLA 1PEBA 2DQVA 4IO2A 2P1SA 4HXVA 1NV6A 3I5OA 3H6UA 3F11A 4QRZA 4GWWA 3Q25A 1Y4CA 3RTFB 2Z8DA 1LAXA 3H6VA 2ESNA 4YZZA 1FPFA 3R7XA 1M5EA 5I57A 5J1DA 5B7DA 1B3LA 1B58A 1NV2A 3KJ7A 4G2ZA 4O7IA 1B32A 4EUOA 3PD9A 5CRYA 2VHAA 4DZ1A 3C9HA 2H98A 3SEUA 3T22A 1LBCA 3KN7A 1FPBA 5H8FA 3TTRA 1FQCA 1NNTA 5K2XA
chains in the Genus database with same CATH topology
2XXRA 4Q8RA 3R6UA 4XXUA 5TU0A 2XX8A 1IEJA 5IKBA 4ISUA 3K6UA 3KJTA 3PMVA 1PC3A 1XS5A 5I2NB 3SEVA 1USYH 2V3UA 1UTBA 3OMBA 5H8HA 2QJEA 4F2QA 4F1VA 1OQHA 4H6DA 5H8NB 1IXGA 4WEDA 5K2YA 2DWHA 4G68B 2I4BA 3KGCA 4ELRA 2DWJA 4ESXA 2AL4A 3OELA 4GRKA 1H43A 4F39A 1MY3A 4YB5A 4L17A 2I3VA 3IK6B 3ZKKA 2FA7A 3QK6A 3QUFA 4FIMA 4JDFA 4NEDA 4RNSA 1EZPA 1EZOA 1A8FA 2HXWA 2DE4A 4ESWA 2H99A 1MY4A 3MVXA 4OERA 3KZGA 2V3TA 3SEXA 2GH9A 4DXBA 3LBSA 2D3IA 1UTBB 1OVBA 1LAGE 2DP8A 4FORA 4O3AA 2Q89A 4ZS9A 5H8HB 4ONYA 3RNNA 2XD2A 4GXAA 4H8JA 2UVHA 1B3GA 1D4NA 2O69A 4IY6A 3FXRA 3QAXA 3K00A 4G8MA 3BKIB 4U1ZA 4YKIA 1YTVA 3H6WA 3TTLA 1AIVA 3FV1A 5FHOA 1NMUA 4EQBA 1AMFA 4OHNA 4PP0A 4U1OA 4HTGA 4JWOA 2HZLA 3EN3A 4ND9A 1JW1A 2DSFA 2UVGA 2V84A 3DLNA 1GVCA 1B1HA 1CE2A 4EF1A 4LATA 5AA4A 1B05A 2AL5A 3C34A 3C4MA 3IJXB 4GFRA 1LB8A 3VVFA 3FXUA 3C36A 4RY1A 4R9FA 2Y7WA 3K1PA 1OMPA 2OWTA 3TQLA 5A5XB 1MDP1 1RYXA 3SDFA 3C33A 1LAHE 4WKMA 2F34A 1MPDA 2Y7RA 3FZVA 3IOTA 5L8DA 1DPPA 4U2RA 4LZ5A 3S9MC 3L6HA 3PPPA 3T9HB 3PUWE 1P1UA 5TPAB 4PFYA 3IORA 1QKBA 2NOOA 4ZDMA 4ZE9A 2XXIA 3Q26A 1B1XA 4BDRA 1LSTA 1TXFA 2Z23A 3EPEA 1FTJA 2O1LA 3T66A 3WAFA 1FW0A 2UXAA 4NMYA 4H0WA 1D9YA 2FNCA 2YJPA 5JK4A 5I59A 2Z8FA 3JZJA 4KYEA 3G7WA 4QFKA 1USYE 1SW2A 1N84A 4G4PA 4LA9A 5L9SA 5CI5A 4OYVA 4RPOA 5KZTA 3E4RA 3MW0A 2Y84A 3ILTB 2NWJA 5HPQA 1EH3A 5I56A 3MAMA 2O68A 2Q2CA 1HSJA 2Y7KA 4U22A 1XC1A 4RJZA 5AA4B 1EU8A 3KSJA 2PT2A 1IQ7A 1LGBC 2REJA 4N6PA 4Q30B 5DVIA 4JWXA 2I0CA 3TAJA 3GBBA 1NNKA 3HCQA 4IY5A 1JW5A 1XHYA 2AIXA 1N04A 3K4UA 4OEUA 1B5JA 2R9JA 4N07A 4QFPA 3O6HA 1JVXA 2PVUA 2UVIA 4BDMA 1FQBA 1FTLA 1WODA 3K0VA 4IO3A 1FCKA 3VVDA 3TTNA 1SD3A 2VOZA 5CBSA 1MY0A 1NL5A 2H5YA 3O9PA 2P0SA 5CM6A 5IAIA 4P11A 1SI0A 2F78A 4F1YA 1H45A 1ATGA 2ZYKA 3TCFA 2DYXA 3A3CA 1XT8A 4MLQA 5H8SA 1MS7A 1NNPA 2OBGA 4ELPA 3UA8A 4HW8A 4LQ5A 4FEBA 4EDPA 2GFEA 1GR2A 1L5TA 1MQDA 1SYIA 3E9XA 5H8NA 2ALUA 4Q5TA 5AA2B 4Z7EA 2I6EA 4H8IA 4NF6B 4KQPA 5I2NA 2I3WA 1ZKBA 4G77A 1Y4TA 2XXPA 4POXA 2DOJA 3CFLA 3H03A 1UIUA 5JTYB 4GL0A 5I58B 3MPLA 3FVKA 3DM0A 3WAEA 1SDXA 4POWA 1KWHA 5CC2A 1JEVA 3K2DA 3MQ9A 3PMWA 4KCDA 1IXCA 2ZNTA 3K6WA 3O97A 4MBPA 3DP6A 4BDOA 1LFIA 1YPNA 5BUUA 1P1NA 4E0WA 4DIGA 3OEKA 4ELOA 4F1UA 3O28A 3ILUB 4H1XA 1FQFA 4I62A 3SETA 2H4IA 3IAZA 1B4ZA 1M5CA 4PFUA 5H8FB 3PPOA 1QUIA 1B9JA 5BWJA 3EQ1A 3CRBA 2V25A 3LSFB 4ELQA 4NE4A 1UIVA 3B6QA 5EYFA 3H6TA 2DE3A 3CSGA 2X26A 3O2AA 4TQUQ 1N7WA 3ZKLA 2I0BA 4ZZAA 1DTGA 3FASA 3PGFA 4QSEA 3O6IA 3IOWA 1QKAA 3MZ9A 1B46A 4GL8A 4H5FA 1QUKA 2DVCA 1QW0A 4KD5A 2F7CA 4NF6A 2XXWA 2XXUA 5AA2A 2BJJX 4FAJA 1B7UA 2QS4A 1LLSA 3MVYA 3O29A 1R9QA 3OO6A 5B70A 2W7YA 3S9LC 3EF7A 5DYHA 3T9VA 4F29A 3RTWB 3U8QA 2RF1A 3CIJA 2OZZA 3OO8A 1Y20A 1B3EA 1XOCA 2I4CA 3IX1A 1B7HA 3VXBA 3DP8A 2QPQA 4WEPA 3CVGA 1FTOA 1B0HA 2DXYA 2O51A 4R73A 3SERA 3OSRA 5ICQA 3IOUA 4YICA 1F9BA 1MXYA 3IB0A 5ICTA 2OJTA 3KOSA 4XTCQ 4NF8B 3EHSA 2NVUB 3T9UA 1VFEA 4RK2A 2RC7A 3C35A 3TCHA 3OEMA 2XXQA 4LQ2A 3FATA 5JTYA 3MP6A 1SW1A 3K1NA 4PFTA 1AOVA 1M5FA 4ZZEA 1S9TA 3QUJA 3QYTA 4WXJA 3UN6A 3K02A 4F19A 4YMBA 4JSOA 5I57B 1N76A 1VSOA 1PB7A 3FUZA 3IO4A 4IB2A 3O6GA 4JB7A 4QFNA 4YB6A 1DTZA 4OQOA 5CMCA 4NF8A 3PMXA 4C1UA 3G3HA 3U94A 3SESA 3VLVA 4DDDA 1H76A 1ZTYA 5I56B 2Q88A 2QMWA 4JSDA 3TZAA 3KBRA 2R71A 3KG2A 4E0XA 1UTHA 3DP4A 4NWCA 5AE4A 1BIYA 4ZE8A 1QVSA 3OO9A 4M1VA 2ZNUA 2F7AA 3W15C 4F3GA 2Y7IA 1I6AA 4QHQA 5M2VA 2F35A 3LUYA 3N6UA 3U1OA 4NWDA 2UYEA 3MPKA 5DT6A 1OLAA 1P99A 2VGQA 3JYRA 2UVJA 3USDA 3D4GA 4RPNA 4DXCA 3M3KA 3V8XB 3MBPA 1DPEA 4KHZE 4R2BA 3SKPA 1B5IA 2DVZA 3IOVA 3MVZA 4GF8A 4LP2B 4ZEDA 5ITOA 3RPWA 4KPTA 1JEUA 4O3CA 5A5XA 4MF3A 3H06B 3MP8A 2QS1A 3A09A 3GXAA 2HQ0A 4OVJA 1BKAA 4F3PA 3LR1A 2B65A 2F36A 1MDQA 2RKMA 4OFOA 3LSWA 5I2KA 1ZLQA 2V3QA 3FD3A 1MM7A 1B2HA 3VFJA 3QIMA 2PYYA 3DELB 1QULA 1FQDA 4JXIA 3GLBA 1MXVA 4QSCA 2ABHA 3UK4A 4LZ8A 1SQYA 1TWYA 3G3KA 5AA3A 3RN8A 1M5DA 1Y3PA 3S4UA 4X1BA 4EQ7A 2QS3A 1RYOA 4ZECA 1LFHA 2E1SA 2PT1A 1QJMA 1MH4A 2VP1A 3KFMA 3TPAA 3V89B 1Y9UA 2O7IA 4EXLA 3VXCA 4QFLA 3UGWA 1JVYA 5F1QA 5TP9A 3KN3A 4LUBA 3IO6A 4U21A 1MQIA 5ITPA 4G8HA 2ZYOA 3OXNA 4MLVA 1Y3NA 4TLLB 1IITA 5ELVA 4G68C 1LCFA 2IA4A 2RCAA 2ZYNA 3B6TA 1MH3A 1TT1A 1ZMGA 3FJGA 2G93A 1N3WA 3KEIA 1P1QA 1R9LA 2M8CA 4NF5A 5KCJB 3VLWA 2GHBA 3G3GA 3PD8A 4F3BA 1WDNA 4K3FA 2QL3A 4Q0CA 3ZS6A 4AB6A 5KCJA 1URGA 1D3KA 1MM6A 1N7XA 4H67A 4MFIA 4PE5B 1R6ZA 5DEXB 1SYHA 2A5SA 3TKDA 1MG1A 1NKXA 1Q1KA 4GIZA 5HBCA 4GVOA 3E13X 3Q29A 2XX9A 3G3IA 5EHMA 4ZEKA 5TP9B 3H7MA 3S9NC 5L9OA 1DSNA 3QSLA 1SVXB 2B3FA 2XXYA 1Q35A 3HSTA 1MPBA 4OESA 1IUDA 3K01A 1DOTA 2D5WA 4X48A 4BDQA 3FXQA 1IIWA 2F6GA 1SBPA 2E0SA 3MJNA 4H5GA 2YLNA 1I6BA 2A5TB 1EZ9A 2HEUA 1JW4A 3OENA 5H8QA 3MUQA 3RUMA 3MC2A 1A40A 1PB8A 1NNFA 1S50A 4I9DA 3PUZE 2O6AA 4FATA 2KLFA 1QUJA 5I2KB 4OEVA 2OK2A 2D21A 3LC8A 4R2FA 4OZ9A 3RLFE 1Y1MA 3N26A 4OMBA 1DMBA 2NUVA 3R26A 4U4XA 5DVFA 3ECRA 1A55A 3LSLA 1B7ZA 3MZ1A 3RQTA 2IEEA 3TELA 3TTMA 3VLUA 3HPIA 2RINA 2Y7PA 3KN8A 3MP1A 4HCWA 5I59B 3U92A 1BP5A 2B3BA 4OTEA 4YKPA 3K6VA 1A8EA 1GTKA 2PMSA 4I8CA 5F7VA 1N3XA 1PBQA 1S7YA 4DE8A 3IB1A 1RKMA 2P2AA 4XKRA 4OETA 1A54A 4ZEBA 4F31B 3TMGA 1WVJA 1P1OA 2HFBA 3M3FA 3OSQA 1ZU0A 4XKPA 3HHGA 3TUSA 4P0IA 1LB9A 1US5A 1NH7A 2XXXA 4UACA 3IJOB 1A99A 3TTKA 5CBRA 1HSEA 1VFDA 3ONMA 4IGTA 1GV8A 3FJMA 4F22A 3UORA 4H65A 2CZLA 4R72A 1UTHB 4OENA 4XKNA 1ELJA 3S2VA 1CB6A 1VE4A 3V83A 1POTA 4DCYA 1ANFA 3PUVE 4HS7A 3MWBA 4YAHX 4DXUA 3E3KA 3HO7A 1MY1A 4EXKA 5AA2D 4IGRA 4DLDA 4LONB 1PDAA 4IO4A 3PUYE 4GQOA 3V5AA 2A5TA 4BDNA 3UIFA 3IR1A 4XIGQ 1ZJLA 2DS9A 1Z7NE 1MQJA 1R1NA 2F8DA 2G29A 3TYHA 3BFUA 3CSBA 4R9GA 4FEDA 1OVTA 1LBBA 4U4SA 2O84X 2X7QA 2V93A 3THIA 1B4HA 4RA1A 5LOMA 4OFJA 2XX7A 1OQGA 4NF4B 4R6HA 4X1DA 1JQFA 5HM4B 2Q9TA 5DTBA 3HHFA 4QSDA 2GHAA 2F6PA 4JWYA 2H9BA 4GXSB 2DXRA 5DEXA 4I1DA 2R6GE 3BBRA 1MXZA 1ZIUA 3B7DA 4PFWA 1URDA 3N5LA 4LZ7A 2ANJA 4RK9A 3HN0A 4C0RA 2OLBA 1MXWA 2YPNA 3G3FA 3TFLA 3Q28A 4ECFA 4NF5B 1JETA 4ZEFA 5L9MA 3UP9A 4BDLA 3PUXE 4G68A 3TQWA 3MZBA 1TFDA 3I3VA 1MQHA 3KSXA 2O7UA 2GRVA 2OWSA 4MH5A 4QF9A 3CI8A 2I58A 3W9VA 2ONSA 4IO6A 4YKKA 1OIBA 5FHNA 3FJ7A 3FVGA 1B51A 1B3HA 1A7LA 4OWDA 1YCJA 1NFTA 3CFXA 5JEIA 3RY3A 3ZSFA 1LCTA 2THIA 3CFZA 1PB9A 2HAVA 3FGSA 3M8UA 3I6VA 5AA1A 3TDJA 4YMAA 1O7TA 2REGA 4G8NA 1H44A 1PBPA 2I48A 3A3UA 3BFTA 3N6TA 1UQWA 4R6KA 4XKQA 2UYFA 3B6WA 1B52A 3K1MA 3U72A 2QMXA 1MXXA 1NH8A 2WKYA 3VVEA 5I84A 4KYDA 2X7PA 3TCGA 2Z22A 3GZGA 1T0KA 2ZXTA 3S9EA 4IO7A 2XXTA 1O63A 4QFOA 4O3BA 3SEYA 1N0TA 2Q2AA 1D9VA 5ISUA 3D4CA 1MPCA 4TLMB 3EHTA 4R75A 5I58A 4IO5A 3RT8A 1M5BA 2ONRA 4YU0A 2Q8JA 3M3LA 3PPQA 3L6GA 4OXVA 3RT6B 1P1WA 1SW5A 1SW4A 1VR5A 1Y3QA 1MY2A 4M4GA 2HZKA 2QSXA 4X9TA 1FTKA 2F97A 1YAEA 3EHUA 1OLCA 1B3FA 4OFLA 3T9XB 4EQ9A 3VDFA 4TOZA 4DCXA 4THIA 1XVYA 1IZ1A 2PBWA 4KCCA 5CMBA 2XXVA 3TEPA 1B40A 1SI1A 1Z7ME 4GLIA 4RXLA 1LAFE 3P7IA 1AL3A 1B6HA 4GWOA 4KYSA 2VD3A 5CMKA 4GD5A 3JV9A 4GOTA 5KDTB 1I69A 2ZNSA 3PPNA 4JBZA 2H25A 4NF4A 5CMMA 3U93A 1MQGA 3H4ZA 1XVXA 3TODA 3IL1B 3OO7A 1PEBA 2DQVA 1MXUA 4IO2A 1I6QA 4NTLA 4HCYA 1MRPA 1IXIA 1LFGA 2P1SA 3MVWA 2NXOA 4KI0E 4N13A 3RGYA 2ZMBA 1J1NA 2XHDA 3I5OA 3H6UA 4FECA 3F11A 3AXFA 4QRZA 2XXHA 3Q25A 2RC8A 3T96B 1Y4CA 1ZBMA 4EF2A 5FTIA 3RTFB 1IXHA 2Z8DA 1LAXA 4FE8A 3H6VA 5DVJA 2ESNA 3CR9A 2RCBA 3HV1A 4C1TA 3FVOA 2HAUA 4KR5A 5EHSA 1BLFA 4YZZA 1B0LA 2QRYA 4F2OA 3GBAA 2FYIA 3CG3A 5KDTA 4ZEIA 3R7XA 4BLAA 1M5EA 2RC9A 2DWAA 3IB2A 2DWIA 4Z0IA 3T93B 2QS2A 1O64A 4U23A 1URSA 2ZYMA 3C32A 1POY1 5I57A 1BTJA 3OOAA 3G3JA 3KOTA 5B7DA 5J1DA 1B3LA 5FTHA 2VD2A 1B58A 1H3DA 1FQEA 2AYSA 3QXMA 2PX1A 3FV2A 3KJ7A 3SEWA 1B5HA 1TFAA 4G2ZA 3C31A 3K6XA 3N94A 1B32A 3W9WA 1HSLA 3PU5A 4EUOA 3PD9A 5TPAA 4YB7A 3H3GA 5CRYA 1JNFA 2VHAA 3ODBA 4DZ1A 2F7BA 1AH5A 1Y1ZA 3C9HA 4KFQA 4PETA 3O66A 4P0GA 4R6YA 2HCAA 1US4A 3LSXA 4PQJA 4RYAA 1FTMA 2H98A 2OCUA 3PV0E 4YKJA 3FVNA 1LBCA 3PPRA 5FHMA 3SEUA 3T22A 2CMOA 3Q27A 3VV5A 4F18A 1GGGA 4LVQA 3VE1B 2DE2A 2XD3A 3FIRA 3KN7A 4AQ4A 2Z8EA 5H8FA 2I49A 4FJPA 1FQAA 4AB5A 3CG1A 4F3SA 3TTRA 3OD7A 1FQCA 4R74A 5H8QB 4UA8A 2ONKE 2F5XA 1II5A 1NNTA 2O1MA 2LAOA 5K2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXR A;  4Q8R A;  3R6U A;  4XXU A;  5TU0 A;  2XX8 A;  1IEJ A;  5IKB A;  4ISU A;  3K6U A;  3KJT A;  3PMV A;  1PC3 A;  1XS5 A;  5I2N B;  3SEV A;  1USY H;  2V3U A;  1UTB A;  3OMB A;  5H8H A;  2QJE A;  4F2Q A;  4F1V A;  1OQH A;  4H6D A;  5H8N B;  1IXG A;  4WED A;  5K2Y A;  2DWH A;  4G68 B;  2I4B A;  3KGC A;  4ELR A;  2DWJ A;  4ESX A;  2AL4 A;  3OEL A;  4GRK A;  1H43 A;  4F39 A;  1MY3 A;  4YB5 A;  4L17 A;  2I3V A;  3IK6 B;  3ZKK A;  2FA7 A;  3QK6 A;  3QUF A;  4FIM A;  4JDF A;  4NED A;  4RNS A;  1EZP A;  1EZO A;  1A8F A;  2HXW A;  2DE4 A;  4ESW A;  2H99 A;  1MY4 A;  3MVX A;  4OER A;  3KZG A;  2V3T A;  3SEX A;  2GH9 A;  4DXB A;  3LBS A;  2D3I A;  1UTB B;  1OVB A;  1LAG E;  2DP8 A;  4FOR A;  4O3A A;  2Q89 A;  4ZS9 A;  5H8H B;  4ONY A;  3RNN A;  2XD2 A;  4GXA A;  4H8J A;  2UVH A;  1B3G A;  1D4N A;  2O69 A;  4IY6 A;  3FXR A;  3QAX A;  3K00 A;  4G8M A;  3BKI B;  4U1Z A;  4YKI A;  1YTV A;  3H6W A;  3TTL A;  1AIV A;  3FV1 A;  5FHO A;  1NMU A;  4EQB A;  1AMF A;  4OHN A;  4PP0 A;  4U1O A;  4HTG A;  4JWO A;  2HZL A;  3EN3 A;  4ND9 A;  1JW1 A;  2DSF A;  2UVG A;  2V84 A;  3DLN A;  1GVC A;  1B1H A;  1CE2 A;  4EF1 A;  4LAT A;  5AA4 A;  1B05 A;  2AL5 A;  3C34 A;  3C4M A;  3IJX B;  4GFR A;  1LB8 A;  3VVF A;  3FXU A;  3C36 A;  4RY1 A;  4R9F A;  2Y7W A;  3K1P A;  1OMP A;  2OWT A;  3TQL A;  5A5X B;  1MDP 1;  1RYX A;  3SDF A;  3C33 A;  1LAH E;  4WKM A;  2F34 A;  1MPD A;  2Y7R A;  3FZV A;  3IOT A;  5L8D A;  1DPP A;  4U2R A;  4LZ5 A;  3S9M C;  3L6H A;  3PPP A;  3T9H B;  3PUW E;  1P1U A;  5TPA B;  4PFY A;  3IOR A;  1QKB A;  2NOO A;  4ZDM A;  4ZE9 A;  2XXI A;  3Q26 A;  1B1X A;  4BDR A;  1LST A;  1TXF A;  2Z23 A;  3EPE A;  1FTJ A;  2O1L A;  3T66 A;  3WAF A;  1FW0 A;  2UXA A;  4NMY A;  4H0W A;  1D9Y A;  2FNC A;  2YJP A;  5JK4 A;  5I59 A;  2Z8F A;  3JZJ A;  4KYE A;  3G7W A;  4QFK A;  1USY E;  1SW2 A;  1N84 A;  4G4P A;  4LA9 A;  5L9S A;  5CI5 A;  4OYV A;  4RPO A;  5KZT A;  3E4R A;  3MW0 A;  2Y84 A;  3ILT B;  2NWJ A;  5HPQ A;  1EH3 A;  5I56 A;  3MAM A;  2O68 A;  2Q2C A;  1HSJ A;  2Y7K A;  4U22 A;  1XC1 A;  4RJZ A;  5AA4 B;  1EU8 A;  3KSJ A;  2PT2 A;  1IQ7 A;  1LGB C;  2REJ A;  4N6P A;  4Q30 B;  5DVI A;  4JWX A;  2I0C A;  3TAJ A;  3GBB A;  1NNK A;  3HCQ A;  4IY5 A;  1JW5 A;  1XHY A;  2AIX A;  1N04 A;  3K4U A;  4OEU A;  1B5J A;  2R9J A;  4N07 A;  4QFP A;  3O6H A;  1JVX A;  2PVU A;  2UVI A;  4BDM A;  1FQB A;  1FTL A;  1WOD A;  3K0V A;  4IO3 A;  1FCK A;  3VVD A;  3TTN A;  1SD3 A;  2VOZ A;  5CBS A;  1MY0 A;  1NL5 A;  2H5Y A;  3O9P A;  2P0S A;  5CM6 A;  5IAI A;  4P11 A;  1SI0 A;  2F78 A;  4F1Y A;  1H45 A;  1ATG A;  2ZYK A;  3TCF A;  2DYX A;  3A3C A;  1XT8 A;  4MLQ A;  5H8S A;  1MS7 A;  1NNP A;  2OBG A;  4ELP A;  3UA8 A;  4HW8 A;  4LQ5 A;  4FEB A;  4EDP A;  2GFE A;  1GR2 A;  1L5T A;  1MQD A;  1SYI A;  3E9X A;  5H8N A;  2ALU A;  4Q5T A;  5AA2 B;  4Z7E A;  2I6E A;  4H8I A;  4NF6 B;  4KQP A;  5I2N A;  2I3W A;  1ZKB A;  4G77 A;  1Y4T A;  2XXP A;  4POX A;  2DOJ A;  3CFL A;  3H03 A;  1UIU A;  5JTY B;  4GL0 A;  5I58 B;  3MPL A;  3FVK A;  3DM0 A;  3WAE A;  1SDX A;  4POW A;  1KWH A;  5CC2 A;  1JEV A;  3K2D A;  3MQ9 A;  3PMW A;  4KCD A;  1IXC A;  2ZNT A;  3K6W A;  3O97 A;  4MBP A;  3DP6 A;  4BDO A;  1LFI A;  1YPN A;  5BUU A;  1P1N A;  4E0W A;  4DIG A;  3OEK A;  4ELO A;  4F1U A;  3O28 A;  3ILU B;  4H1X A;  1FQF A;  4I62 A;  3SET A;  2H4I A;  3IAZ A;  1B4Z A;  1M5C A;  4PFU A;  5H8F B;  3PPO A;  1QUI A;  1B9J A;  5BWJ A;  3EQ1 A;  3CRB A;  2V25 A;  3LSF B;  4ELQ A;  4NE4 A;  1UIV A;  3B6Q A;  5EYF A;  3H6T A;  2DE3 A;  3CSG A;  2X26 A;  3O2A A;  4TQU Q;  1N7W A;  3ZKL A;  2I0B A;  4ZZA A;  1DTG A;  3FAS A;  3PGF A;  4QSE A;  3O6I A;  3IOW A;  1QKA A;  3MZ9 A;  1B46 A;  4GL8 A;  4H5F A;  1QUK A;  2DVC A;  1QW0 A;  4KD5 A;  2F7C A;  4NF6 A;  2XXW A;  2XXU A;  5AA2 A;  2BJJ X;  4FAJ A;  1B7U A;  2QS4 A;  1LLS A;  3MVY A;  3O29 A;  1R9Q A;  3OO6 A;  5B70 A;  2W7Y A;  3S9L C;  3EF7 A;  5DYH A;  3T9V A;  4F29 A;  3RTW B;  3U8Q A;  2RF1 A;  3CIJ A;  2OZZ A;  3OO8 A;  1Y20 A;  1B3E A;  1XOC A;  2I4C A;  3IX1 A;  1B7H A;  3VXB A;  3DP8 A;  2QPQ A;  4WEP A;  3CVG A;  1FTO A;  1B0H A;  2DXY A;  2O51 A;  4R73 A;  3SER A;  3OSR A;  5ICQ A;  3IOU A;  4YIC A;  1F9B A;  1MXY A;  3IB0 A;  5ICT A;  2OJT A;  3KOS A;  4XTC Q;  4NF8 B;  3EHS A;  2NVU B;  3T9U A;  1VFE A;  4RK2 A;  2RC7 A;  3C35 A;  3TCH A;  3OEM A;  2XXQ A;  4LQ2 A;  3FAT A;  5JTY A;  3MP6 A;  1SW1 A;  3K1N A;  4PFT A;  1AOV A;  1M5F A;  4ZZE A;  1S9T A;  3QUJ A;  3QYT A;  4WXJ A;  3UN6 A;  3K02 A;  4F19 A;  4YMB A;  4JSO A;  5I57 B;  1N76 A;  1VSO A;  1PB7 A;  3FUZ A;  3IO4 A;  4IB2 A;  3O6G A;  4JB7 A;  4QFN A;  4YB6 A;  1DTZ A;  4OQO A;  5CMC A;  4NF8 A;  3PMX A;  4C1U A;  3G3H A;  3U94 A;  3SES A;  3VLV A;  4DDD A;  1H76 A;  1ZTY A;  5I56 B;  2Q88 A;  2QMW A;  4JSD A;  3TZA A;  3KBR A;  2R71 A;  3KG2 A;  4E0X A;  1UTH A;  3DP4 A;  4NWC A;  5AE4 A;  1BIY A;  4ZE8 A;  1QVS A;  3OO9 A;  4M1V A;  2ZNU A;  2F7A A;  3W15 C;  4F3G A;  2Y7I A;  1I6A A;  4QHQ A;  5M2V A;  2F35 A;  3LUY A;  3N6U A;  3U1O A;  4NWD A;  2UYE A;  3MPK A;  5DT6 A;  1OLA A;  1P99 A;  2VGQ A;  3JYR A;  2UVJ A;  3USD A;  3D4G A;  4RPN A;  4DXC A;  3M3K A;  3V8X B;  3MBP A;  1DPE A;  4KHZ E;  4R2B A;  3SKP A;  1B5I A;  2DVZ A;  3IOV A;  3MVZ A;  4GF8 A;  4LP2 B;  4ZED A;  5ITO A;  3RPW A;  4KPT A;  1JEU A;  4O3C A;  5A5X A;  4MF3 A;  3H06 B;  3MP8 A;  2QS1 A;  3A09 A;  3GXA A;  2HQ0 A;  4OVJ A;  1BKA A;  4F3P A;  3LR1 A;  2B65 A;  2F36 A;  1MDQ A;  2RKM A;  4OFO A;  3LSW A;  5I2K A;  1ZLQ A;  2V3Q A;  3FD3 A;  1MM7 A;  1B2H A;  3VFJ A;  3QIM A;  2PYY A;  3DEL B;  1QUL A;  1FQD A;  4JXI A;  3GLB A;  1MXV A;  4QSC A;  2ABH A;  3UK4 A;  4LZ8 A;  1SQY A;  1TWY A;  3G3K A;  5AA3 A;  3RN8 A;  1M5D A;  1Y3P A;  3S4U A;  4X1B A;  4EQ7 A;  2QS3 A;  1RYO A;  4ZEC A;  1LFH A;  2E1S A;  2PT1 A;  1QJM A;  1MH4 A;  2VP1 A;  3KFM A;  3TPA A;  3V89 B;  1Y9U A;  2O7I A;  4EXL A;  3VXC A;  4QFL A;  3UGW A;  1JVY A;  5F1Q A;  5TP9 A;  3KN3 A;  4LUB A;  3IO6 A;  4U21 A;  1MQI A;  5ITP A;  4G8H A;  2ZYO A;  3OXN A;  4MLV A;  1Y3N A;  4TLL B;  1IIT A;  5ELV A;  4G68 C;  1LCF A;  2IA4 A;  2RCA A;  2ZYN A;  3B6T A;  1MH3 A;  1TT1 A;  1ZMG A;  3FJG A;  2G93 A;  1N3W A;  3KEI A;  1P1Q A;  1R9L A;  2M8C A;  4NF5 A;  5KCJ B;  3VLW A;  2GHB A;  3G3G A;  3PD8 A;  4F3B A;  1WDN A;  4K3F A;  2QL3 A;  4Q0C A;  3ZS6 A;  4AB6 A;  5KCJ A;  1URG A;  1D3K A;  1MM6 A;  1N7X A;  4H67 A;  4MFI A;  4PE5 B;  1R6Z A;  5DEX B;  1SYH A;  2A5S A;  3TKD A;  1MG1 A;  1NKX A;  1Q1K A;  4GIZ A;  5HBC A;  4GVO A;  3E13 X;  3Q29 A;  2XX9 A;  3G3I A;  5EHM A;  4ZEK A;  5TP9 B;  3H7M A;  3S9N C;  5L9O A;  1DSN A;  3QSL A;  1SVX B;  2B3F A;  2XXY A;  1Q35 A;  3HST A;  1MPB A;  4OES A;  1IUD A;  3K01 A;  1DOT A;  2D5W A;  4X48 A;  4BDQ A;  3FXQ A;  1IIW A;  2F6G A;  1SBP A;  2E0S A;  3MJN A;  4H5G A;  2YLN A;  1I6B A;  2A5T B;  1EZ9 A;  2HEU A;  1JW4 A;  3OEN A;  5H8Q A;  3MUQ A;  3RUM A;  3MC2 A;  1A40 A;  1PB8 A;  1NNF A;  1S50 A;  4I9D A;  3PUZ E;  2O6A A;  4FAT A;  2KLF A;  1QUJ A;  5I2K B;  4OEV A;  2OK2 A;  2D21 A;  3LC8 A;  4R2F A;  4OZ9 A;  3RLF E;  1Y1M A;  3N26 A;  4OMB A;  1DMB A;  2NUV A;  3R26 A;  4U4X A;  5DVF A;  3ECR A;  1A55 A;  3LSL A;  1B7Z A;  3MZ1 A;  3RQT A;  2IEE A;  3TEL A;  3TTM A;  3VLU A;  3HPI A;  2RIN A;  2Y7P A;  3KN8 A;  3MP1 A;  4HCW A;  5I59 B;  3U92 A;  1BP5 A;  2B3B A;  4OTE A;  4YKP A;  3K6V A;  1A8E A;  1GTK A;  2PMS A;  4I8C A;  5F7V A;  1N3X A;  1PBQ A;  1S7Y A;  4DE8 A;  3IB1 A;  1RKM A;  2P2A A;  4XKR A;  4OET A;  1A54 A;  4ZEB A;  4F31 B;  3TMG A;  1WVJ A;  1P1O A;  2HFB A;  3M3F A;  3OSQ A;  1ZU0 A;  4XKP A;  3HHG A;  3TUS A;  4P0I A;  1LB9 A;  1US5 A;  1NH7 A;  2XXX A;  4UAC A;  3IJO B;  1A99 A;  3TTK A;  5CBR A;  1HSE A;  1VFD A;  3ONM A;  4IGT A;  1GV8 A;  3FJM A;  4F22 A;  3UOR A;  4H65 A;  2CZL A;  4R72 A;  1UTH B;  4OEN A;  4XKN A;  1ELJ A;  3S2V A;  1CB6 A;  1VE4 A;  3V83 A;  1POT A;  4DCY A;  1ANF A;  3PUV E;  4HS7 A;  3MWB A;  4YAH X;  4DXU A;  3E3K A;  3HO7 A;  1MY1 A;  4EXK A;  5AA2 D;  4IGR A;  4DLD A;  4LON B;  1PDA A;  4IO4 A;  3PUY E;  4GQO A;  3V5A A;  2A5T A;  4BDN A;  3UIF A;  3IR1 A;  4XIG Q;  1ZJL A;  2DS9 A;  1Z7N E;  1MQJ A;  1R1N A;  2F8D A;  2G29 A;  3TYH A;  3BFU A;  3CSB A;  4R9G A;  4FED A;  1OVT A;  1LBB A;  4U4S A;  2O84 X;  2X7Q A;  2V93 A;  3THI A;  1B4H A;  4RA1 A;  5LOM A;  4OFJ A;  2XX7 A;  1OQG A;  4NF4 B;  4R6H A;  4X1D A;  1JQF A;  5HM4 B;  2Q9T A;  5DTB A;  3HHF A;  4QSD A;  2GHA A;  2F6P A;  4JWY A;  2H9B A;  4GXS B;  2DXR A;  5DEX A;  4I1D A;  2R6G E;  3BBR A;  1MXZ A;  1ZIU A;  3B7D A;  4PFW A;  1URD A;  3N5L A;  4LZ7 A;  2ANJ A;  4RK9 A;  3HN0 A;  4C0R A;  2OLB A;  1MXW A;  2YPN A;  3G3F A;  3TFL A;  3Q28 A;  4ECF A;  4NF5 B;  1JET A;  4ZEF A;  5L9M A;  3UP9 A;  4BDL A;  3PUX E;  4G68 A;  3TQW A;  3MZB A;  1TFD A;  3I3V A;  1MQH A;  3KSX A;  2O7U A;  2GRV A;  2OWS A;  4MH5 A;  4QF9 A;  3CI8 A;  2I58 A;  3W9V A;  2ONS A;  4IO6 A;  4YKK A;  1OIB A;  5FHN A;  3FJ7 A;  3FVG A;  1B51 A;  1B3H A;  1A7L A;  4OWD A;  1YCJ A;  1NFT A;  3CFX A;  5JEI A;  3RY3 A;  3ZSF A;  1LCT A;  2THI A;  3CFZ A;  1PB9 A;  2HAV A;  3FGS A;  3M8U A;  3I6V A;  5AA1 A;  3TDJ A;  4YMA A;  1O7T A;  2REG A;  4G8N A;  1H44 A;  1PBP A;  2I48 A;  3A3U A;  3BFT A;  3N6T A;  1UQW A;  4R6K A;  4XKQ A;  2UYF A;  3B6W A;  1B52 A;  3K1M A;  3U72 A;  2QMX A;  1MXX A;  1NH8 A;  2WKY A;  3VVE A;  5I84 A;  4KYD A;  2X7P A;  3TCG A;  2Z22 A;  3GZG A;  1T0K A;  2ZXT A;  3S9E A;  4IO7 A;  2XXT A;  1O63 A;  4QFO A;  4O3B A;  3SEY A;  1N0T A;  2Q2A A;  1D9V A;  5ISU A;  3D4C A;  1MPC A;  4TLM B;  3EHT A;  4R75 A;  5I58 A;  4IO5 A;  3RT8 A;  1M5B A;  2ONR A;  4YU0 A;  2Q8J A;  3M3L A;  3PPQ A;  3L6G A;  4OXV A;  3RT6 B;  1P1W A;  1SW5 A;  1SW4 A;  1VR5 A;  1Y3Q A;  1MY2 A;  4M4G A;  2HZK A;  2QSX A;  4X9T A;  1FTK A;  2F97 A;  1YAE A;  3EHU A;  1OLC A;  1B3F A;  4OFL A;  3T9X B;  4EQ9 A;  3VDF A;  4TOZ A;  4DCX A;  4THI A;  1XVY A;  1IZ1 A;  2PBW A;  4KCC A;  5CMB A;  2XXV A;  3TEP A;  1B40 A;  1SI1 A;  1Z7M E;  4GLI A;  4RXL A;  1LAF E;  3P7I A;  1AL3 A;  1B6H A;  4GWO A;  4KYS A;  2VD3 A;  5CMK A;  4GD5 A;  3JV9 A;  4GOT A;  5KDT B;  1I69 A;  2ZNS A;  3PPN A;  4JBZ A;  2H25 A;  4NF4 A;  5CMM A;  3U93 A;  1MQG A;  3H4Z A;  1XVX A;  3TOD A;  3IL1 B;  3OO7 A;  1PEB A;  2DQV A;  1MXU A;  4IO2 A;  1I6Q A;  4NTL A;  4HCY A;  1MRP A;  1IXI A;  1LFG A;  2P1S A;  3MVW A;  2NXO A;  4KI0 E;  4N13 A;  3RGY A;  2ZMB A;  1J1N A;  2XHD A;  3I5O A;  3H6U A;  4FEC A;  3F11 A;  3AXF A;  4QRZ A;  2XXH A;  3Q25 A;  2RC8 A;  3T96 B;  1Y4C A;  1ZBM A;  4EF2 A;  5FTI A;  3RTF B;  1IXH A;  2Z8D A;  1LAX A;  4FE8 A;  3H6V A;  5DVJ A;  2ESN A;  3CR9 A;  2RCB A;  3HV1 A;  4C1T A;  3FVO A;  2HAU A;  4KR5 A;  5EHS A;  1BLF A;  4YZZ A;  1B0L A;  2QRY A;  4F2O A;  3GBA A;  2FYI A;  3CG3 A;  5KDT A;  4ZEI A;  3R7X A;  4BLA A;  1M5E A;  2RC9 A;  2DWA A;  3IB2 A;  2DWI A;  4Z0I A;  3T93 B;  2QS2 A;  1O64 A;  4U23 A;  1URS A;  2ZYM A;  3C32 A;  1POY 1;  5I57 A;  1BTJ A;  3OOA A;  3G3J A;  3KOT A;  5B7D A;  5J1D A;  1B3L A;  5FTH A;  2VD2 A;  1B58 A;  1H3D A;  1FQE A;  2AYS A;  3QXM A;  2PX1 A;  3FV2 A;  3KJ7 A;  3SEW A;  1B5H A;  1TFA A;  4G2Z A;  3C31 A;  3K6X A;  3N94 A;  1B32 A;  3W9W A;  1HSL A;  3PU5 A;  4EUO A;  3PD9 A;  5TPA A;  4YB7 A;  3H3G A;  5CRY A;  1JNF A;  2VHA A;  3ODB A;  4DZ1 A;  2F7B A;  1AH5 A;  1Y1Z A;  3C9H A;  4KFQ A;  4PET A;  3O66 A;  4P0G A;  4R6Y A;  2HCA A;  1US4 A;  3LSX A;  4PQJ A;  4RYA A;  1FTM A;  2H98 A;  2OCU A;  3PV0 E;  4YKJ A;  3FVN A;  1LBC A;  3PPR A;  5FHM A;  3SEU A;  3T22 A;  2CMO A;  3Q27 A;  3VV5 A;  4F18 A;  1GGG A;  4LVQ A;  3VE1 B;  2DE2 A;  2XD3 A;  3FIR A;  3KN7 A;  4AQ4 A;  2Z8E A;  5H8F A;  2I49 A;  4FJP A;  1FQA A;  4AB5 A;  3CG1 A;  4F3S A;  3TTR A;  3OD7 A;  1FQC A;  4R74 A;  5H8Q B;  4UA8 A;  2ONK E;  2F5X A;  1II5 A;  1NNT A;  2O1M A;  2LAO A;  5K2X A; 
#chains in the Genus database with same CATH topology
 2XXR A;  4Q8R A;  3HFU A;  2XX8 A;  4MEV A;  3PMV A;  3SEV A;  1USY H;  1OQH A;  4WED A;  5K2Y A;  3OEL A;  1MY3 A;  4YB5 A;  3IK6 B;  3ZKK A;  3QK6 A;  4FIM A;  4NED A;  4ESW A;  2H99 A;  2V3T A;  4N8Y A;  2GH9 A;  1FJ9 A;  1LAG E;  2Q89 A;  4ONY A;  4GXA A;  2XA5 A;  5FHO A;  4PC9 A;  1RDY A;  4PP0 A;  4ND9 A;  2HZL A;  2UVG A;  1CE2 A;  2AL5 A;  2ZZV A;  3C34 A;  4I3E A;  5T3J A;  2CZK A;  3K1P A;  5A5X B;  2F34 A;  3IOT A;  3IOR A;  4ZDM A;  4ZE9 A;  3Q26 A;  1B1X A;  1LST A;  2Z23 A;  4NMY A;  1D9Y A;  2FNC A;  5JK4 A;  5I59 A;  5CI5 A;  2Y84 A;  3ILT B;  5HPQ A;  4MNI A;  5AA4 B;  4IY5 A;  2AIX A;  5ESY A;  4PAI A;  1JVX A;  2PVU A;  1FQB A;  4IR8 A;  4IO3 A;  1FBG A;  4GWY A;  1MY0 A;  1NL5 A;  5IAI A;  1SI0 A;  2F78 A;  3TCF A;  4EDP A;  1GR2 A;  5EQ9 A;  3E9X A;  5H8N A;  2ALU A;  3B50 A;  2I3W A;  1ZKB A;  5JTY B;  2XXP A;  3DM0 A;  1KWH A;  4KCD A;  1IXC A;  3K6W A;  4MBP A;  3DP6 A;  5BUU A;  4ELO A;  4F1U A;  3O28 A;  1FQF A;  2XWV A;  1B9J A;  3LSF B;  1FPJ A;  2JJK A;  2X26 A;  1N7W A;  3ZKL A;  2I0B A;  1DTG A;  5JTY A;  1QKA A;  5EQ7 A;  1QUK A;  4KD5 A;  1JP4 A;  2F7C A;  2Q8M A;  2QS4 A;  5B70 A;  3T9V A;  3RTW B;  2RF1 A;  3CIJ A;  1Y20 A;  1B3E A;  3PTY A;  4WEP A;  1B0H A;  1VFE A;  4RK2 A;  1FPI A;  2XXK A;  5IZ3 B;  5LDZ A;  1S9T A;  3UN6 A;  4QFN A;  3O6G A;  3PMX A;  2Q88 A;  4H46 A;  1FRP A;  3TZA A;  3KBR A;  2R71 A;  1BIY A;  4ZE8 A;  3OO9 A;  4M1V A;  2ZNU A;  1I6A A;  4MHF A;  2UYE A;  3MPK A;  1OLA A;  3JYR A;  3USD A;  3D4G A;  2Q74 A;  4KHZ E;  2DVZ A;  3IOV A;  3RPW A;  5A5X A;  2HQ0 A;  1BKA A;  2B65 A;  2F36 A;  3QIM A;  5LTC A;  1QUL A;  4QSC A;  3G3K A;  4EQ7 A;  2QS3 A;  4ZEC A;  1MH4 A;  1Y9U A;  3VXC A;  4QFL A;  4N6K A;  5TP9 A;  4LUB A;  4NHB A;  4U21 A;  4G8H A;  1YXI A;  2IA4 A;  3M3F A;  1MH3 A;  2FIE A;  2GHB A;  3G3G A;  3PD8 A;  4Q0C A;  1MM6 A;  4PE5 B;  2A5S A;  1NKX A;  1NUX A;  5HBC A;  1QGX A;  1SVX B;  2OX3 A;  2F3B A;  1Q35 A;  3K01 A;  1DOT A;  1IMD A;  2D5W A;  4X48 A;  4BDO A;  3MJN A;  2F6G A;  1I6B A;  3OEN A;  1A40 A;  1PB8 A;  1NNF A;  4I9D A;  2O6A A;  2FVZ A;  2WYK A;  2KLF A;  5I2K B;  2OK2 A;  4OZ9 A;  3RLF E;  1Y1M A;  1A55 A;  5IZZ A;  3VLU A;  3HPI A;  2Y7P A;  5ET5 A;  5I59 B;  1BP5 A;  2PCR A;  4YKP A;  3K6V A;  3NOH A;  5I3S A;  1WVJ A;  4P3L A;  3HHG A;  3TUS A;  4UAB A;  1LB9 A;  1NH7 A;  3IJO B;  1A99 A;  5I57 B;  4F22 A;  1IMA A;  4R72 A;  1K9Z A;  2VPO A;  4XKN A;  1ELJ A;  1FPK A;  1VE4 A;  3V83 A;  4DCY A;  1ANF A;  2XWO A;  3PUV E;  4YAH X;  5AA3 A;  1FPL A;  1FPD A;  4DLD A;  4LON B;  3SZP A;  1EYK A;  1R1N A;  3CSB A;  2V93 A;  1B4H A;  4RA1 A;  5LOM A;  2Q9T A;  5DTB A;  4OA4 A;  2GHA A;  3B7D A;  4PFW A;  4PFI A;  3BIG A;  4RK9 A;  5KZT A;  4P56 A;  4ECF A;  4NF5 B;  5L9M A;  3IFC A;  2O7U A;  2GRV A;  3KSX A;  4MH5 A;  3W9V A;  2I58 A;  4N81 A;  2HHM A;  1B51 A;  1YCJ A;  2HAV A;  2HXR A;  4YMA A;  3A3U A;  4R6K A;  3B6W A;  1MXX A;  3VVE A;  2X7P A;  2FHY A;  3GZG A;  2XXT A;  4O3B A;  2Q2A A;  4I40 A;  1D9V A;  5ISU A;  3D4C A;  5ET7 A;  3EHT A;  3RT8 A;  2ONR A;  2Q8J A;  4KXP A;  1VR5 A;  1Y3Q A;  1MY2 A;  2QSX A;  4QBA A;  2F97 A;  1B3F A;  3VDF A;  4DCX A;  2FIX A;  5CMB A;  3TEP A;  4GLI A;  4GWO A;  2VD3 A;  2ZNS A;  2KQZ A;  1YYZ A;  4NF4 A;  5EYG A;  1MQG A;  4HCY A;  3MVW A;  2NXO A;  4GWX A;  3AXF A;  1ZBM A;  4KR5 A;  1LBX A;  4ZEI A;  2QS2 A;  2ZYM A;  3C32 A;  3KOT A;  4PTK A;  3SEW A;  3QXM A;  1B5H A;  3MYU A;  3K6X A;  3PU5 A;  5TPA A;  1FPE A;  4QXD A;  3KC0 A;  1AH5 A;  1Y1Z A;  3D1R A;  3O66 A;  4P0G A;  2HCA A;  1FTM A;  2WBD A;  4LVQ A;  3VE1 B;  3FIR A;  4FJP A;  4AB5 A;  4F3S A;  3OD7 A;  4R74 A;  1NUZ A;  5H8Q B;  1II5 A;  3KN3 A;  5TU0 A;  1IEJ A;  3QMF A;  2V3U A;  5H8H A;  4ELR A;  4F39 A;  1H43 A;  2FA7 A;  4JDF A;  1EZP A;  1A8F A;  3KZG A;  1UTB B;  1OVB A;  2DP8 A;  4FOR A;  1D4N A;  3FXR A;  3QAX A;  4OAN A;  2CZH A;  1AMF A;  4OHN A;  2DSF A;  1GVC A;  4LAT A;  4GFR A;  4N91 A;  2OWT A;  1RYX A;  3SDF A;  1LAH E;  4AS4 A;  1DPP A;  4U2R A;  4LZ5 A;  3L6H A;  3PPP A;  3T9H B;  3PUW E;  2NOO A;  1TXF A;  1FW0 A;  4N4U A;  1XI6 A;  1USY E;  1N84 A;  3MW0 A;  5I56 A;  3MAM A;  2O68 A;  1HSJ A;  4RJZ A;  4O94 A;  2PT2 A;  1IQ7 A;  4JWX A;  3GBB A;  1IMF A;  1JW5 A;  1XHY A;  4I3Y A;  1B5J A;  2R9J A;  3O6H A;  2UVI A;  1FTL A;  3VVD A;  4P11 A;  2KR0 A;  2ZYK A;  5HM4 B;  3UA8 A;  4FEB A;  2GFE A;  1L5T A;  5AA2 B;  4Z7E A;  3CFL A;  3H03 A;  2FBP A;  2CEX A;  5CC2 A;  1SDX A;  3O97 A;  4N8G A;  1YPN A;  4E0W A;  4DIG A;  3SET A;  3PPO A;  1QUI A;  5BWJ A;  3EQ1 A;  3CRB A;  4ELQ A;  4NE4 A;  2CZI A;  3B6Q A;  4TQU Q;  4ZZA A;  2WBB A;  4QSE A;  1B46 A;  5F24 A;  4NF6 A;  2XWI A;  2XXW A;  2BJJ X;  4FAJ A;  5EQ8 A;  3O29 A;  3OO6 A;  3S9L C;  5DYH A;  2OZZ A;  2I4C A;  4DI4 B;  3CVG A;  2DXY A;  1LBZ A;  4R73 A;  5ICQ A;  4YIC A;  5ICT A;  4XTC Q;  3EHS A;  3TCH A;  4LQ2 A;  4P1L A;  3IFA A;  3MP6 A;  1VDW A;  3QUJ A;  3QYT A;  4WXJ A;  4NG7 A;  4YMB A;  4JSO A;  1N76 A;  1PB7 A;  1FPG A;  4NF8 A;  3U94 A;  4MJO A;  3SES A;  4DDD A;  4GBW A;  4E0X A;  1CNQ A;  5AE4 A;  3W15 C;  4F3G A;  2F7A A;  4PAK A;  2Y7I A;  4NWD A;  1P99 A;  1KA0 A;  4R2B A;  4AS5 A;  3SKP A;  3MVZ A;  4ZED A;  5ITO A;  1K9Y A;  4O3C A;  3H06 B;  3MP8 A;  4PFR A;  2QS1 A;  3A09 A;  1NUY A;  3GXA A;  4F3P A;  2RKM A;  2V3Q A;  3FD3 A;  1B2H A;  3DEL B;  3GLB A;  3UK4 A;  1SQY A;  1Y3P A;  3S4U A;  3T1B A;  1RYO A;  1LFH A;  2PT1 A;  4EXL A;  3UGW A;  5F1Q A;  5ITP A;  1MQI A;  2ZYO A;  3OXN A;  4MLV A;  4TLL B;  4HS7 A;  3FJG A;  3B6T A;  3KSJ A;  1ZMG A;  2G93 A;  4NF5 A;  4G61 A;  1WDN A;  4K3F A;  4MMP A;  1N7X A;  1R6Z A;  4P9K A;  1Q1K A;  4GIZ A;  3H7M A;  3S9N C;  5L9O A;  1IUD A;  4BDQ A;  4H5G A;  2HEU A;  4H45 A;  1FSA A;  3LC8 A;  2CEY A;  1B7Z A;  3TEL A;  3KN8 A;  4HCW A;  2B3B A;  4DE8 A;  4I8C A;  5F7V A;  1PBQ A;  4XKR A;  1A54 A;  4ZEB A;  1P1O A;  2HFB A;  4PE3 A;  2XXX A;  5CBR A;  1VFD A;  3ONM A;  4IGT A;  1GV8 A;  3FJM A;  4H65 A;  1CB6 A;  3MWB A;  3E3K A;  3HO7 A;  4IO4 A;  3PUY E;  4GQO A;  4N17 A;  1ZJL A;  1Z7N E;  2F8D A;  4FED A;  1OVT A;  4U4S A;  4X1D A;  2DXR A;  4I1D A;  1MXZ A;  1URD A;  3N5L A;  4LZ7 A;  3HN0 A;  2OLB A;  3G3F A;  3TFL A;  3Q28 A;  1JET A;  3UP9 A;  3PUX E;  4G68 A;  3I3V A;  4QF9 A;  1OIB A;  3FJ7 A;  4OWD A;  1NFT A;  4X8R A;  3RY3 A;  2THI A;  3CFZ A;  3FGS A;  5AA1 A;  1G0H A;  2REG A;  4PAF A;  1H44 A;  1UQW A;  4XKQ A;  3K1M A;  5ET8 A;  1YZ0 A;  4KYD A;  2R8T A;  1KZ8 A;  2VT5 A;  4IO7 A;  4GWZ A;  3SEY A;  1MPC A;  3RT6 B;  3PPQ A;  4OXV A;  2HZK A;  4X9T A;  3EHU A;  4TOZ A;  4THI A;  2PBW A;  1IZ1 A;  4KCC A;  1B40 A;  1Z7M E;  4RXL A;  1LAF E;  4PF8 A;  4GOT A;  3FBP A;  3PPN A;  4JBZ A;  4PCD A;  3OO7 A;  1I6Q A;  4KI0 E;  1LFG A;  3RGY A;  1J1N A;  4FEC A;  4NGU A;  4EF2 A;  5FTI A;  1IXH A;  5DVJ A;  4FE8 A;  2Y5L A;  2RCB A;  3CR9 A;  2HAU A;  5EHS A;  1BLF A;  3MST A;  1B0L A;  5EQA A;  2FYI A;  3CG3 A;  5KDT A;  4LN5 A;  3IB2 A;  2RC9 A;  2DWA A;  4Z0I A;  2DWI A;  1BTJ A;  4PGP A;  3G3J A;  4PDH A;  3LUZ A;  3C31 A;  3N94 A;  4YB7 A;  4PBH A;  3H3G A;  1JNF A;  3ODB A;  2F7B A;  1NI9 A;  4PQJ A;  4NAP A;  3PV0 E;  4YKJ A;  3FVN A;  3PPR A;  3VV5 A;  2CMO A;  4F18 A;  2I49 A;  3U65 A;  1FQA A;  4UA8 A;  2ONK E;  2LAO A;  5IKB A;  3K6U A;  2L5V A;  1DBZ A;  1UTB A;  2QJE A;  5I7I A;  4F1V A;  4H6D A;  4GX4 A;  1NV0 A;  1IXG A;  5H8N B;  2DWH A;  2AL4 A;  4GRK A;  1EZO A;  3MVX A;  4DXB A;  4ZS9 A;  5H8H B;  4O3A A;  4MX6 A;  2XD2 A;  4H8J A;  1LBY A;  4IY6 A;  4G8M A;  3K00 A;  1YTV A;  3H6W A;  3TTL A;  3FV1 A;  4U1O A;  2P3V A;  4JWO A;  3EN3 A;  1JW1 A;  2V84 A;  4EF1 A;  2BJI A;  5AA4 A;  3C4M A;  3IJX B;  3VVF A;  3FXU A;  1BK4 A;  4RY1 A;  4R9F A;  2Y7W A;  1OMP A;  3C33 A;  2Y7R A;  1MPD A;  3FXB A;  1P1U A;  5TPA B;  4PFY A;  1QKB A;  4MNC A;  4C0R A;  1NV3 A;  4BDR A;  1FTJ A;  2UXA A;  2YJP A;  4QFK A;  4G4P A;  5L9S A;  4OYV A;  4RPO A;  2Y7K A;  4U22 A;  1XC1 A;  1FBP A;  1EU8 A;  1LGB C;  2REJ A;  4N6P A;  4Q30 B;  5DVI A;  3HCQ A;  1N04 A;  4OEU A;  4QFP A;  4GWU A;  1FTA A;  1FCK A;  2VOZ A;  2H5Y A;  2P0S A;  4F1Y A;  1H45 A;  2WEF A;  1ATG A;  2DYX A;  4MLQ A;  5H8S A;  1NNP A;  2P3N A;  1SYI A;  2I6E A;  4POX A;  1Y4T A;  2DOJ A;  1UIU A;  3FVK A;  1JEV A;  3MQ9 A;  2ZNT A;  1RDZ A;  1P1N A;  3ILU B;  3E79 A;  2H4I A;  3IAZ A;  5H8F B;  2V25 A;  5EYF A;  3H6T A;  3O2A A;  3KC1 A;  3FAS A;  4GWS A;  3O6I A;  3IOW A;  4H5F A;  2DVC A;  1QW0 A;  2XXU A;  3MVY A;  1LLS A;  1R9Q A;  2W7Y A;  4F29 A;  3U8Q A;  4PBQ A;  1XOC A;  1B7H A;  3DP8 A;  2ZZX A;  2QPQ A;  1FTO A;  3IB0 A;  3KOS A;  2RC7 A;  3OEM A;  3K1N A;  4P47 A;  3K02 A;  1VSO A;  4JB7 A;  4IB2 A;  4OQO A;  3G3H A;  3VLV A;  1IMB A;  1H76 A;  1ZTY A;  2QMW A;  4JSD A;  2QFL A;  3DP4 A;  1QVS A;  5M2V A;  4FBP A;  3U1O A;  2VGQ A;  2UVJ A;  3RPL B;  4RPN A;  4DXC A;  3M3K A;  1B5I A;  4LP2 B;  1IMC A;  4KPT A;  3LR1 A;  5I2K A;  4OFO A;  1ZLQ A;  2PYY A;  1FQD A;  4JXI A;  1MXV A;  1TWY A;  4GX6 A;  1M5D A;  4X1B A;  3KFM A;  3TPA A;  1FJ6 A;  1EYI A;  3IO6 A;  5ELV A;  4G68 C;  1LCF A;  2ZYN A;  2RCA A;  3KEI A;  1P1Q A;  4F3B A;  4AB6 A;  1URG A;  2GQ1 A;  5I5P A;  3TKD A;  4GVO A;  3E13 X;  3Q29 A;  2XX9 A;  5EHM A;  4ZEK A;  5TP9 B;  1DSN A;  3HST A;  3ROJ A;  1MPB A;  4OES A;  1IIW A;  4PGN A;  2YLN A;  1EZ9 A;  3MC2 A;  4FAT A;  2D21 A;  4R2F A;  5DVF A;  4OMB A;  2NUV A;  4PDD A;  3ECR A;  4XEQ A;  3MZ1 A;  3RQT A;  2IEE A;  2RIN A;  3MP1 A;  3U92 A;  4OTE A;  2QVU A;  3IB1 A;  1RKM A;  2P2A A;  4F31 B;  4OET A;  3OSQ A;  4XKP A;  1ZU0 A;  5ET6 A;  4P0I A;  1US5 A;  3TTK A;  4OVT A;  2CZL A;  4NX1 A;  5AA2 D;  4EXK A;  1PDA A;  1SPI A;  3V5A A;  2A5T A;  3UIF A;  3IR1 A;  4XIG Q;  2DS9 A;  5DW8 A;  4XF5 A;  5IZ3 A;  3THI A;  2Y5K A;  4R6H A;  2XX7 A;  1OQG A;  2ZZW A;  3HHF A;  4QSD A;  4JWY A;  2H9B A;  5DEX A;  2R6G E;  1ZIU A;  2ANJ A;  1MXW A;  4MIJ A;  4ZEF A;  3TQW A;  3MZB A;  1MQH A;  2OWS A;  4IO6 A;  4YKK A;  5FHN A;  1PB9 A;  3M8U A;  3I6V A;  1O7T A;  4G8N A;  2I48 A;  1PBP A;  3BFT A;  3GYY A;  1B52 A;  3U72 A;  2QMX A;  2WKY A;  3TCG A;  2Z22 A;  2ZXT A;  4XFE A;  4IO5 A;  3SEX A;  3L6G A;  1P1W A;  2XWK A;  4EQ9 A;  4OFL A;  1OLC A;  1XVY A;  4JVC A;  3P7I A;  1AL3 A;  1B6H A;  1FBC A;  5KDT B;  1I69 A;  2H25 A;  3E78 A;  3U93 A;  1FBH A;  3IL1 B;  1MXU A;  1MRP A;  1IXI A;  4N13 A;  2ZMB A;  2XHD A;  2XXH A;  2RC8 A;  3T96 B;  3HV1 A;  4C1T A;  3FVO A;  4F2O A;  2QRY A;  3GBA A;  4MCO A;  4BLA A;  3T93 B;  1O64 A;  4U23 A;  1URS A;  1POY 1;  3OOA A;  5FTH A;  2VD2 A;  1H3D A;  1FQE A;  2AYS A;  2PX1 A;  3FV2 A;  1TFA A;  3W9W A;  1HSL A;  3RYD A;  4KFQ A;  4PET A;  4R6Y A;  3LSX A;  1US4 A;  4RYA A;  2OCU A;  5FHM A;  3Q27 A;  4OVQ A;  1GGG A;  2DE2 A;  2XD3 A;  4AQ4 A;  2Z8E A;  5IZ1 A;  3CG1 A;  4GBV A;  2F5X A;  2O1M A;  1FBF A;  3R6U A;  4XXU A;  4ISU A;  3KJT A;  1PC3 A;  1XS5 A;  2WYP A;  5I2N B;  3OMB A;  4F2Q A;  5EYH A;  4G68 B;  2I4B A;  3KGC A;  4ESX A;  2DWJ A;  4L17 A;  2I3V A;  3QUF A;  4RNS A;  2HXW A;  2DE4 A;  2HPG A;  1MY4 A;  1FBE A;  4OER A;  3LBS A;  2D3I A;  3RNN A;  3T66 A;  2UVH A;  1B3G A;  2O69 A;  4U1Z A;  3BKI B;  4YKI A;  1AIV A;  1NMU A;  4EQB A;  1RDX A;  4HTG A;  2WX9 A;  3DLN A;  1B1H A;  1B05 A;  1LB8 A;  3C36 A;  3TQL A;  1MDP 1;  4MAG A;  5FBP A;  4WKM A;  3FZV A;  3S9M C;  5L8D A;  1LBV A;  2XXI A;  3WAF A;  3EPE A;  2O1L A;  4HE2 A;  4H0W A;  2Z8F A;  3JZJ A;  4KYE A;  3G7W A;  1SW2 A;  4LA9 A;  2OWZ A;  4JVI A;  3E4R A;  2NWJ A;  1EH3 A;  2Q2C A;  2I0C A;  3TAJ A;  1NNK A;  3K4U A;  3KBZ A;  4N07 A;  4OVS A;  4BDM A;  1WOD A;  3K0V A;  1KA1 A;  3TTN A;  3LV0 A;  1SD3 A;  5CBS A;  3O9P A;  5CM6 A;  1FBD A;  4DI3 D;  3A3C A;  1XT8 A;  1MS7 A;  2OBG A;  4ELP A;  4HW8 A;  4LQ5 A;  1MQD A;  4HE0 A;  4Q5T A;  4H8I A;  4NF6 B;  5I2N A;  4G77 A;  5I58 B;  4GL0 A;  3MPL A;  3WAE A;  4POW A;  3K2D A;  3PMW A;  1LFI A;  4GX3 A;  3OEK A;  3EKI A;  4I62 A;  4H1X A;  4NF0 A;  1B4Z A;  1M5C A;  4NN3 A;  4PFU A;  1UIV A;  2DE3 A;  3CSG A;  3PGF A;  3MZ9 A;  4GL8 A;  5AA2 A;  1B7U A;  2B4L A;  4X04 A;  3EF7 A;  4PF6 A;  3OO8 A;  4P1E A;  3ISP A;  3IX1 A;  4JVD A;  3VXB A;  3A29 A;  2VPN A;  2O51 A;  3SER A;  3OSR A;  2PFY A;  3IOU A;  1F9B A;  1MXY A;  2OJT A;  4NF8 B;  1NV5 A;  2NVU B;  3T9U A;  1LEV A;  3C35 A;  2XXQ A;  3FAT A;  1SW1 A;  4PFT A;  1AOV A;  1M5F A;  4ZZE A;  4F19 A;  2F3D A;  2QVR A;  3FUZ A;  3IO4 A;  4YB6 A;  1DTZ A;  5CMC A;  4P8B A;  4C1U A;  5I56 B;  3KG2 A;  1UTH A;  4NWC A;  5A5L A;  1IME A;  4QHQ A;  2F35 A;  3LUY A;  2MKZ A;  3N6U A;  5DT6 A;  4OVR A;  3V8X B;  3MBP A;  1DPE A;  4GF8 A;  1JEU A;  4MF3 A;  4OVJ A;  1NV1 A;  1MDQ A;  3LSW A;  1MM7 A;  3VFJ A;  2PFZ A;  2ABH A;  4LZ8 A;  3RN8 A;  2E1S A;  1NV4 A;  1QJM A;  2VP1 A;  1LBW A;  3V89 B;  2O7I A;  1JVY A;  1DCU A;  1Q9D A;  1Y3N A;  5J16 A;  1IIT A;  1DK4 A;  4PFB A;  3R26 A;  4KYS A;  1TT1 A;  1N3W A;  2B4M A;  1R9L A;  2M8C A;  5KCJ B;  3VLW A;  2QL3 A;  1D9Q A;  3ZS6 A;  5KCJ A;  1D3K A;  4MFI A;  4H67 A;  5DEX B;  1SYH A;  1MG1 A;  3G3I A;  3QSL A;  2B3F A;  2XXY A;  3FXQ A;  4KQP A;  1SBP A;  2E0S A;  2A5T B;  1JW4 A;  3RUM A;  5H8Q A;  3MUQ A;  1S50 A;  3PUZ E;  1EYJ A;  1QUJ A;  4OEV A;  3N26 A;  4U4X A;  1DMB A;  3LSL A;  3TTM A;  1A8E A;  1GTK A;  2PMS A;  3T0J A;  1N3X A;  1S7Y A;  3B8B A;  5IGA A;  3TMG A;  4UAC A;  1HSE A;  4HE1 A;  3UOR A;  3S2V A;  1UTH B;  4OEN A;  1POT A;  4DXU A;  1MY1 A;  4IGR A;  4O7M A;  4BDN A;  1MQJ A;  2G29 A;  3TYH A;  1INP A;  1NV7 A;  3BFU A;  4R9G A;  1LBB A;  2O84 X;  2X7Q A;  1G0I A;  4OFJ A;  4NF4 B;  2V4C A;  1JQF A;  2F6P A;  1AWB A;  4GXS B;  3BBR A;  2YPN A;  4BDL A;  1NUW A;  1TFD A;  3CI8 A;  2ONS A;  3FVG A;  1B3H A;  1A7L A;  5JEI A;  3CFX A;  3ZSF A;  1LCT A;  3TDJ A;  3N6T A;  2UYF A;  1NH8 A;  4NQ8 A;  5I84 A;  4MNP A;  1T0K A;  3S9E A;  1O63 A;  4QFO A;  4N6D A;  4N15 A;  2DDK A;  1N0T A;  4TLM B;  4R75 A;  5I58 A;  1M5B A;  4YU0 A;  3M3L A;  5IM2 A;  1SW5 A;  1SW4 A;  4M4G A;  3RPL A;  1FTK A;  4OVP A;  1YAE A;  3T9X B;  2XXV A;  1SI1 A;  4O8M A;  5CMK A;  4GD5 A;  2QVV A;  3JV9 A;  3CHG A;  3BIH A;  5CMM A;  3H4Z A;  1XVX A;  3TOD A;  4NTL A;  1PEB A;  2DQV A;  4IO2 A;  2P1S A;  4HXV A;  1NV6 A;  3I5O A;  3H6U A;  3F11 A;  4QRZ A;  4GWW A;  3Q25 A;  1Y4C A;  3RTF B;  2Z8D A;  1LAX A;  3H6V A;  2ESN A;  4YZZ A;  1FPF A;  3R7X A;  1M5E A;  5I57 A;  5J1D A;  5B7D A;  1B3L A;  1B58 A;  1NV2 A;  3KJ7 A;  4G2Z A;  4O7I A;  1B32 A;  4EUO A;  3PD9 A;  5CRY A;  2VHA A;  4DZ1 A;  3C9H A;  2H98 A;  3SEU A;  3T22 A;  1LBC A;  3KN7 A;  1FPB A;  5H8F A;  3TTR A;  1FQC A;  1NNT A;  5K2X A; 
#chains in the Genus database with same CATH homology
 2XXR A;  4Q8R A;  3R6U A;  4XXU A;  5TU0 A;  2XX8 A;  1IEJ A;  5IKB A;  4ISU A;  3K6U A;  3KJT A;  3PMV A;  1PC3 A;  1XS5 A;  5I2N B;  3SEV A;  1USY H;  2V3U A;  1UTB A;  3OMB A;  5H8H A;  2QJE A;  4F2Q A;  4F1V A;  1OQH A;  4H6D A;  5H8N B;  1IXG A;  4WED A;  5K2Y A;  2DWH A;  4G68 B;  2I4B A;  3KGC A;  4ELR A;  2DWJ A;  4ESX A;  2AL4 A;  3OEL A;  4GRK A;  1H43 A;  4F39 A;  1MY3 A;  4YB5 A;  4L17 A;  2I3V A;  3IK6 B;  3ZKK A;  2FA7 A;  3QK6 A;  3QUF A;  4FIM A;  4JDF A;  4NED A;  4RNS A;  1EZP A;  1EZO A;  1A8F A;  2HXW A;  2DE4 A;  4ESW A;  2H99 A;  1MY4 A;  3MVX A;  4OER A;  3KZG A;  2V3T A;  3SEX A;  2GH9 A;  4DXB A;  3LBS A;  2D3I A;  1UTB B;  1OVB A;  1LAG E;  2DP8 A;  4FOR A;  4O3A A;  2Q89 A;  4ZS9 A;  5H8H B;  4ONY A;  3RNN A;  2XD2 A;  4GXA A;  4H8J A;  2UVH A;  1B3G A;  1D4N A;  2O69 A;  4IY6 A;  3FXR A;  3QAX A;  3K00 A;  4G8M A;  3BKI B;  4U1Z A;  4YKI A;  1YTV A;  3H6W A;  3TTL A;  1AIV A;  3FV1 A;  5FHO A;  1NMU A;  4EQB A;  1AMF A;  4OHN A;  4PP0 A;  4U1O A;  4HTG A;  4JWO A;  2HZL A;  3EN3 A;  4ND9 A;  1JW1 A;  2DSF A;  2UVG A;  2V84 A;  3DLN A;  1GVC A;  1B1H A;  1CE2 A;  4EF1 A;  4LAT A;  5AA4 A;  1B05 A;  2AL5 A;  3C34 A;  3C4M A;  3IJX B;  4GFR A;  1LB8 A;  3VVF A;  3FXU A;  3C36 A;  4RY1 A;  4R9F A;  2Y7W A;  3K1P A;  1OMP A;  2OWT A;  3TQL A;  5A5X B;  1MDP 1;  1RYX A;  3SDF A;  3C33 A;  1LAH E;  4WKM A;  2F34 A;  1MPD A;  2Y7R A;  3FZV A;  3IOT A;  5L8D A;  1DPP A;  4U2R A;  4LZ5 A;  3S9M C;  3L6H A;  3PPP A;  3T9H B;  3PUW E;  1P1U A;  5TPA B;  4PFY A;  3IOR A;  1QKB A;  2NOO A;  4ZDM A;  4ZE9 A;  2XXI A;  3Q26 A;  1B1X A;  4BDR A;  1LST A;  1TXF A;  2Z23 A;  3EPE A;  1FTJ A;  2O1L A;  3T66 A;  3WAF A;  1FW0 A;  2UXA A;  4NMY A;  4H0W A;  1D9Y A;  2FNC A;  2YJP A;  5JK4 A;  5I59 A;  2Z8F A;  3JZJ A;  4KYE A;  3G7W A;  4QFK A;  1USY E;  1SW2 A;  1N84 A;  4G4P A;  4LA9 A;  5L9S A;  5CI5 A;  4OYV A;  4RPO A;  5KZT A;  3E4R A;  3MW0 A;  2Y84 A;  3ILT B;  2NWJ A;  5HPQ A;  1EH3 A;  5I56 A;  3MAM A;  2O68 A;  2Q2C A;  1HSJ A;  2Y7K A;  4U22 A;  1XC1 A;  4RJZ A;  5AA4 B;  1EU8 A;  3KSJ A;  2PT2 A;  1IQ7 A;  1LGB C;  2REJ A;  4N6P A;  4Q30 B;  5DVI A;  4JWX A;  2I0C A;  3TAJ A;  3GBB A;  1NNK A;  3HCQ A;  4IY5 A;  1JW5 A;  1XHY A;  2AIX A;  1N04 A;  3K4U A;  4OEU A;  1B5J A;  2R9J A;  4N07 A;  4QFP A;  3O6H A;  1JVX A;  2PVU A;  2UVI A;  4BDM A;  1FQB A;  1FTL A;  1WOD A;  3K0V A;  4IO3 A;  1FCK A;  3VVD A;  3TTN A;  1SD3 A;  2VOZ A;  5CBS A;  1MY0 A;  1NL5 A;  2H5Y A;  3O9P A;  2P0S A;  5CM6 A;  5IAI A;  4P11 A;  1SI0 A;  2F78 A;  4F1Y A;  1H45 A;  1ATG A;  2ZYK A;  3TCF A;  2DYX A;  3A3C A;  1XT8 A;  4MLQ A;  5H8S A;  1MS7 A;  1NNP A;  2OBG A;  4ELP A;  3UA8 A;  4HW8 A;  4LQ5 A;  4FEB A;  4EDP A;  2GFE A;  1GR2 A;  1L5T A;  1MQD A;  1SYI A;  3E9X A;  5H8N A;  2ALU A;  4Q5T A;  5AA2 B;  4Z7E A;  2I6E A;  4H8I A;  4NF6 B;  4KQP A;  5I2N A;  2I3W A;  1ZKB A;  4G77 A;  1Y4T A;  2XXP A;  4POX A;  2DOJ A;  3CFL A;  3H03 A;  1UIU A;  5JTY B;  4GL0 A;  5I58 B;  3MPL A;  3FVK A;  3DM0 A;  3WAE A;  1SDX A;  4POW A;  1KWH A;  5CC2 A;  1JEV A;  3K2D A;  3MQ9 A;  3PMW A;  4KCD A;  1IXC A;  2ZNT A;  3K6W A;  3O97 A;  4MBP A;  3DP6 A;  4BDO A;  1LFI A;  1YPN A;  5BUU A;  1P1N A;  4E0W A;  4DIG A;  3OEK A;  4ELO A;  4F1U A;  3O28 A;  3ILU B;  4H1X A;  1FQF A;  4I62 A;  3SET A;  2H4I A;  3IAZ A;  1B4Z A;  1M5C A;  4PFU A;  5H8F B;  3PPO A;  1QUI A;  1B9J A;  5BWJ A;  3EQ1 A;  3CRB A;  2V25 A;  3LSF B;  4ELQ A;  4NE4 A;  1UIV A;  3B6Q A;  5EYF A;  3H6T A;  2DE3 A;  3CSG A;  2X26 A;  3O2A A;  4TQU Q;  1N7W A;  3ZKL A;  2I0B A;  4ZZA A;  1DTG A;  3FAS A;  3PGF A;  4QSE A;  3O6I A;  3IOW A;  1QKA A;  3MZ9 A;  1B46 A;  4GL8 A;  4H5F A;  1QUK A;  2DVC A;  1QW0 A;  4KD5 A;  2F7C A;  4NF6 A;  2XXW A;  2XXU A;  5AA2 A;  2BJJ X;  4FAJ A;  1B7U A;  2QS4 A;  1LLS A;  3MVY A;  3O29 A;  1R9Q A;  3OO6 A;  5B70 A;  2W7Y A;  3S9L C;  3EF7 A;  5DYH A;  3T9V A;  4F29 A;  3RTW B;  3U8Q A;  2RF1 A;  3CIJ A;  2OZZ A;  3OO8 A;  1Y20 A;  1B3E A;  1XOC A;  2I4C A;  3IX1 A;  1B7H A;  3VXB A;  3DP8 A;  2QPQ A;  4WEP A;  3CVG A;  1FTO A;  1B0H A;  2DXY A;  2O51 A;  4R73 A;  3SER A;  3OSR A;  5ICQ A;  3IOU A;  4YIC A;  1F9B A;  1MXY A;  3IB0 A;  5ICT A;  2OJT A;  3KOS A;  4XTC Q;  4NF8 B;  3EHS A;  2NVU B;  3T9U A;  1VFE A;  4RK2 A;  2RC7 A;  3C35 A;  3TCH A;  3OEM A;  2XXQ A;  4LQ2 A;  3FAT A;  5JTY A;  3MP6 A;  1SW1 A;  3K1N A;  4PFT A;  1AOV A;  1M5F A;  4ZZE A;  1S9T A;  3QUJ A;  3QYT A;  4WXJ A;  3UN6 A;  3K02 A;  4F19 A;  4YMB A;  4JSO A;  5I57 B;  1N76 A;  1VSO A;  1PB7 A;  3FUZ A;  3IO4 A;  4IB2 A;  3O6G A;  4JB7 A;  4QFN A;  4YB6 A;  1DTZ A;  4OQO A;  5CMC A;  4NF8 A;  3PMX A;  4C1U A;  3G3H A;  3U94 A;  3SES A;  3VLV A;  4DDD A;  1H76 A;  1ZTY A;  5I56 B;  2Q88 A;  2QMW A;  4JSD A;  3TZA A;  3KBR A;  2R71 A;  3KG2 A;  4E0X A;  1UTH A;  3DP4 A;  4NWC A;  5AE4 A;  1BIY A;  4ZE8 A;  1QVS A;  3OO9 A;  4M1V A;  2ZNU A;  2F7A A;  3W15 C;  4F3G A;  2Y7I A;  1I6A A;  4QHQ A;  5M2V A;  2F35 A;  3LUY A;  3N6U A;  3U1O A;  4NWD A;  2UYE A;  3MPK A;  5DT6 A;  1OLA A;  1P99 A;  2VGQ A;  3JYR A;  2UVJ A;  3USD A;  3D4G A;  4RPN A;  4DXC A;  3M3K A;  3V8X B;  3MBP A;  1DPE A;  4KHZ E;  4R2B A;  3SKP A;  1B5I A;  2DVZ A;  3IOV A;  3MVZ A;  4GF8 A;  4LP2 B;  4ZED A;  5ITO A;  3RPW A;  4KPT A;  1JEU A;  4O3C A;  5A5X A;  4MF3 A;  3H06 B;  3MP8 A;  2QS1 A;  3A09 A;  3GXA A;  2HQ0 A;  4OVJ A;  1BKA A;  4F3P A;  3LR1 A;  2B65 A;  2F36 A;  1MDQ A;  2RKM A;  4OFO A;  3LSW A;  5I2K A;  1ZLQ A;  2V3Q A;  3FD3 A;  1MM7 A;  1B2H A;  3VFJ A;  3QIM A;  2PYY A;  3DEL B;  1QUL A;  1FQD A;  4JXI A;  3GLB A;  1MXV A;  4QSC A;  2ABH A;  3UK4 A;  4LZ8 A;  1SQY A;  1TWY A;  3G3K A;  5AA3 A;  3RN8 A;  1M5D A;  1Y3P A;  3S4U A;  4X1B A;  4EQ7 A;  2QS3 A;  1RYO A;  4ZEC A;  1LFH A;  2E1S A;  2PT1 A;  1QJM A;  1MH4 A;  2VP1 A;  3KFM A;  3TPA A;  3V89 B;  1Y9U A;  2O7I A;  4EXL A;  3VXC A;  4QFL A;  3UGW A;  1JVY A;  5F1Q A;  5TP9 A;  3KN3 A;  4LUB A;  3IO6 A;  4U21 A;  1MQI A;  5ITP A;  4G8H A;  2ZYO A;  3OXN A;  4MLV A;  1Y3N A;  4TLL B;  1IIT A;  5ELV A;  4G68 C;  1LCF A;  2IA4 A;  2RCA A;  2ZYN A;  3B6T A;  1MH3 A;  1TT1 A;  1ZMG A;  3FJG A;  2G93 A;  1N3W A;  3KEI A;  1P1Q A;  1R9L A;  2M8C A;  4NF5 A;  5KCJ B;  3VLW A;  2GHB A;  3G3G A;  3PD8 A;  4F3B A;  1WDN A;  4K3F A;  2QL3 A;  4Q0C A;  3ZS6 A;  4AB6 A;  5KCJ A;  1URG A;  1D3K A;  1MM6 A;  1N7X A;  4H67 A;  4MFI A;  4PE5 B;  1R6Z A;  5DEX B;  1SYH A;  2A5S A;  3TKD A;  1MG1 A;  1NKX A;  1Q1K A;  4GIZ A;  5HBC A;  4GVO A;  3E13 X;  3Q29 A;  2XX9 A;  3G3I A;  5EHM A;  4ZEK A;  5TP9 B;  3H7M A;  3S9N C;  5L9O A;  1DSN A;  3QSL A;  1SVX B;  2B3F A;  2XXY A;  1Q35 A;  3HST A;  1MPB A;  4OES A;  1IUD A;  3K01 A;  1DOT A;  2D5W A;  4X48 A;  4BDQ A;  3FXQ A;  1IIW A;  2F6G A;  1SBP A;  2E0S A;  3MJN A;  4H5G A;  2YLN A;  1I6B A;  2A5T B;  1EZ9 A;  2HEU A;  1JW4 A;  3OEN A;  5H8Q A;  3MUQ A;  3RUM A;  3MC2 A;  1A40 A;  1PB8 A;  1NNF A;  1S50 A;  4I9D A;  3PUZ E;  2O6A A;  4FAT A;  2KLF A;  1QUJ A;  5I2K B;  4OEV A;  2OK2 A;  2D21 A;  3LC8 A;  4R2F A;  4OZ9 A;  3RLF E;  1Y1M A;  3N26 A;  4OMB A;  1DMB A;  2NUV A;  3R26 A;  4U4X A;  5DVF A;  3ECR A;  1A55 A;  3LSL A;  1B7Z A;  3MZ1 A;  3RQT A;  2IEE A;  3TEL A;  3TTM A;  3VLU A;  3HPI A;  2RIN A;  2Y7P A;  3KN8 A;  3MP1 A;  4HCW A;  5I59 B;  3U92 A;  1BP5 A;  2B3B A;  4OTE A;  4YKP A;  3K6V A;  1A8E A;  1GTK A;  2PMS A;  4I8C A;  5F7V A;  1N3X A;  1PBQ A;  1S7Y A;  4DE8 A;  3IB1 A;  1RKM A;  2P2A A;  4XKR A;  4OET A;  1A54 A;  4ZEB A;  4F31 B;  3TMG A;  1WVJ A;  1P1O A;  2HFB A;  3M3F A;  3OSQ A;  1ZU0 A;  4XKP A;  3HHG A;  3TUS A;  4P0I A;  1LB9 A;  1US5 A;  1NH7 A;  2XXX A;  4UAC A;  3IJO B;  1A99 A;  3TTK A;  5CBR A;  1HSE A;  1VFD A;  3ONM A;  4IGT A;  1GV8 A;  3FJM A;  4F22 A;  3UOR A;  4H65 A;  2CZL A;  4R72 A;  1UTH B;  4OEN A;  4XKN A;  1ELJ A;  3S2V A;  1CB6 A;  1VE4 A;  3V83 A;  1POT A;  4DCY A;  1ANF A;  3PUV E;  4HS7 A;  3MWB A;  4YAH X;  4DXU A;  3E3K A;  3HO7 A;  1MY1 A;  4EXK A;  5AA2 D;  4IGR A;  4DLD A;  4LON B;  1PDA A;  4IO4 A;  3PUY E;  4GQO A;  3V5A A;  2A5T A;  4BDN A;  3UIF A;  3IR1 A;  4XIG Q;  1ZJL A;  2DS9 A;  1Z7N E;  1MQJ A;  1R1N A;  2F8D A;  2G29 A;  3TYH A;  3BFU A;  3CSB A;  4R9G A;  4FED A;  1OVT A;  1LBB A;  4U4S A;  2O84 X;  2X7Q A;  2V93 A;  3THI A;  1B4H A;  4RA1 A;  5LOM A;  4OFJ A;  2XX7 A;  1OQG A;  4NF4 B;  4R6H A;  4X1D A;  1JQF A;  5HM4 B;  2Q9T A;  5DTB A;  3HHF A;  4QSD A;  2GHA A;  2F6P A;  4JWY A;  2H9B A;  4GXS B;  2DXR A;  5DEX A;  4I1D A;  2R6G E;  3BBR A;  1MXZ A;  1ZIU A;  3B7D A;  4PFW A;  1URD A;  3N5L A;  4LZ7 A;  2ANJ A;  4RK9 A;  3HN0 A;  4C0R A;  2OLB A;  1MXW A;  2YPN A;  3G3F A;  3TFL A;  3Q28 A;  4ECF A;  4NF5 B;  1JET A;  4ZEF A;  5L9M A;  3UP9 A;  4BDL A;  3PUX E;  4G68 A;  3TQW A;  3MZB A;  1TFD A;  3I3V A;  1MQH A;  3KSX A;  2O7U A;  2GRV A;  2OWS A;  4MH5 A;  4QF9 A;  3CI8 A;  2I58 A;  3W9V A;  2ONS A;  4IO6 A;  4YKK A;  1OIB A;  5FHN A;  3FJ7 A;  3FVG A;  1B51 A;  1B3H A;  1A7L A;  4OWD A;  1YCJ A;  1NFT A;  3CFX A;  5JEI A;  3RY3 A;  3ZSF A;  1LCT A;  2THI A;  3CFZ A;  1PB9 A;  2HAV A;  3FGS A;  3M8U A;  3I6V A;  5AA1 A;  3TDJ A;  4YMA A;  1O7T A;  2REG A;  4G8N A;  1H44 A;  1PBP A;  2I48 A;  3A3U A;  3BFT A;  3N6T A;  1UQW A;  4R6K A;  4XKQ A;  2UYF A;  3B6W A;  1B52 A;  3K1M A;  3U72 A;  2QMX A;  1MXX A;  1NH8 A;  2WKY A;  3VVE A;  5I84 A;  4KYD A;  2X7P A;  3TCG A;  2Z22 A;  3GZG A;  1T0K A;  2ZXT A;  3S9E A;  4IO7 A;  2XXT A;  1O63 A;  4QFO A;  4O3B A;  3SEY A;  1N0T A;  2Q2A A;  1D9V A;  5ISU A;  3D4C A;  1MPC A;  4TLM B;  3EHT A;  4R75 A;  5I58 A;  4IO5 A;  3RT8 A;  1M5B A;  2ONR A;  4YU0 A;  2Q8J A;  3M3L A;  3PPQ A;  3L6G A;  4OXV A;  3RT6 B;  1P1W A;  1SW5 A;  1SW4 A;  1VR5 A;  1Y3Q A;  1MY2 A;  4M4G A;  2HZK A;  2QSX A;  4X9T A;  1FTK A;  2F97 A;  1YAE A;  3EHU A;  1OLC A;  1B3F A;  4OFL A;  3T9X B;  4EQ9 A;  3VDF A;  4TOZ A;  4DCX A;  4THI A;  1XVY A;  1IZ1 A;  2PBW A;  4KCC A;  5CMB A;  2XXV A;  3TEP A;  1B40 A;  1SI1 A;  1Z7M E;  4GLI A;  4RXL A;  1LAF E;  3P7I A;  1AL3 A;  1B6H A;  4GWO A;  4KYS A;  2VD3 A;  5CMK A;  4GD5 A;  3JV9 A;  4GOT A;  5KDT B;  1I69 A;  2ZNS A;  3PPN A;  4JBZ A;  2H25 A;  4NF4 A;  5CMM A;  3U93 A;  1MQG A;  3H4Z A;  1XVX A;  3TOD A;  3IL1 B;  3OO7 A;  1PEB A;  2DQV A;  1MXU A;  4IO2 A;  1I6Q A;  4NTL A;  4HCY A;  1MRP A;  1IXI A;  1LFG A;  2P1S A;  3MVW A;  2NXO A;  4KI0 E;  4N13 A;  3RGY A;  2ZMB A;  1J1N A;  2XHD A;  3I5O A;  3H6U A;  4FEC A;  3F11 A;  3AXF A;  4QRZ A;  2XXH A;  3Q25 A;  2RC8 A;  3T96 B;  1Y4C A;  1ZBM A;  4EF2 A;  5FTI A;  3RTF B;  1IXH A;  2Z8D A;  1LAX A;  4FE8 A;  3H6V A;  5DVJ A;  2ESN A;  3CR9 A;  2RCB A;  3HV1 A;  4C1T A;  3FVO A;  2HAU A;  4KR5 A;  5EHS A;  1BLF A;  4YZZ A;  1B0L A;  2QRY A;  4F2O A;  3GBA A;  2FYI A;  3CG3 A;  5KDT A;  4ZEI A;  3R7X A;  4BLA A;  1M5E A;  2RC9 A;  2DWA A;  3IB2 A;  2DWI A;  4Z0I A;  3T93 B;  2QS2 A;  1O64 A;  4U23 A;  1URS A;  2ZYM A;  3C32 A;  1POY 1;  5I57 A;  1BTJ A;  3OOA A;  3G3J A;  3KOT A;  5B7D A;  5J1D A;  1B3L A;  5FTH A;  2VD2 A;  1B58 A;  1H3D A;  1FQE A;  2AYS A;  3QXM A;  2PX1 A;  3FV2 A;  3KJ7 A;  3SEW A;  1B5H A;  1TFA A;  4G2Z A;  3C31 A;  3K6X A;  3N94 A;  1B32 A;  3W9W A;  1HSL A;  3PU5 A;  4EUO A;  3PD9 A;  5TPA A;  4YB7 A;  3H3G A;  5CRY A;  1JNF A;  2VHA A;  3ODB A;  4DZ1 A;  2F7B A;  1AH5 A;  1Y1Z A;  3C9H A;  4KFQ A;  4PET A;  3O66 A;  4P0G A;  4R6Y A;  2HCA A;  1US4 A;  3LSX A;  4PQJ A;  4RYA A;  1FTM A;  2H98 A;  2OCU A;  3PV0 E;  4YKJ A;  3FVN A;  1LBC A;  3PPR A;  5FHM A;  3SEU A;  3T22 A;  2CMO A;  3Q27 A;  3VV5 A;  4F18 A;  1GGG A;  4LVQ A;  3VE1 B;  2DE2 A;  2XD3 A;  3FIR A;  3KN7 A;  4AQ4 A;  2Z8E A;  5H8F A;  2I49 A;  4FJP A;  1FQA A;  4AB5 A;  3CG1 A;  4F3S A;  3TTR A;  3OD7 A;  1FQC A;  4R74 A;  5H8Q B;  4UA8 A;  2ONK E;  2F5X A;  1II5 A;  1NNT A;  2O1M A;  2LAO A;  5K2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...