4LQ2A

Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium in complex with effector ligand, o-acetylserine
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium in complex with effector ligand, O-acetylserine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
total genus 62
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lq2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lq2A02
5H8QB 1UIUA 1SW5A 3C4MA 3OXNA 4MF3A 4QFOA 1N7WA 1S7YA 3OEKA 3ZKLA 5EYFA 1TT1A 3Q29A 4LUBA 5I2KA 2DQVA 1R6ZA 5ITOA 3PPQA 1RKMA 4YZZA 4ZEIA 3FGSA 5LOMA 3QIMA 4IO5A 2BJJX 4LZ8A 2V3TA 4O3BA 1MS7A 2Y84A 4ZEKA 1QUIA 4RA1A 5L9SA 1LFGA 1XVXA 2P1SA 3AXFA 3PMWA 1D3KA 4H65A 4I9DA 1IIWA 2D21A 4RXLA 4U2RA 1OLCA 5M2VA 2RKMA 5JEIA 1QKAA 2RC9A 2HCAA 2QMXA 4JWXA 3KGCA 4LONB 4NF5B 2HZLA 4Q0CA 2ONRA 3VLVA 2F7CA 3T93B 3PUXE 5TPAA 5JK4A 4OMBA 3P7IA 3RUMA 1Y1MA 2Q9TA 4AQ4A 1MQHA 3O97A 1B7ZA 3PGFA 4LZ5A 4R6HA 4BDOA 4DCYA 4H8IA 5AA1A 2ZYNA 5L9MA 2F6PA 3WAFA 4G2ZA 3IOUA 5I56B 3S4UA 2O7UA 3O2AA 5I59B 5DT6A 4F3PA 2V3UA 3OO7A 3G3IA 4LP2B 4OERA 1LAGE 3HV1A 1MQDA 1B4HA 3VDFA 4U21A 2FNCA 2DSFA 1JEVA 4C1TA 3S9MC 4DZ1A 1GVCA 3U1OA 4OFJA 3B6TA 3LSLA 4R72A 2Y7WA 1B32A 4E0WA 1UTHB 5A5XB 5J1DA 1LFHA 2DP8A 4JSOA 4JWOA 1A40A 3OO8A 3TODA 3IO4A 3HHFA 4ELOA 1AOVA 3ZKKA 1I69A 1SVXB 3TZAA 1FQFA 1N0TA 3PPPA 3Q28A 4NF4B 4XKPA 4JXIA 3D4GA 2I4CA 3FIRA 4LZ7A 5AA4B 5I2NA 2I4BA 3I5OA 4FJPA 1N3XA 1SDXA 3VVFA 5AA2D 3FXUA 5KDTB 1FTMA 1LBBA 2NWJA 1AL3A 1EU8A 3T9HB 1Z7NE 2Q88A 5FTHA 5I57A 4ZEDA 1OQHA 1Y4TA 2HEUA 2OWTA 3CIJA 5JTYA 2YLNA 1N7XA 3QSLA 2QPQA 4JSDA 1USYH 4R9FA 4U1OA 5ITPA 2HFBA 4LATA 3VVEA 1P1UA 3JZJA 4E0XA 1MH3A 3LC8A 3Q27A 1P99A 1GR2A 3DM0A 1Y3NA 2H98A 4OQOA 2ZMBA 3HPIA 1ZBMA 1NH8A 2Y7PA 3DELB 1SBPA 4GVOA 4ZS9A 4R6YA 1JEUA 1JW5A 4EQ7A 1POTA 5CC2A 2PT2A 3IK6B 1SI1A 1MXUA 1MPCA 3H6UA 3MVZA 4HS7A 5ICQA 2R71A 2V25A 3CVGA 4R2FA 1US4A 4TOZA 3K0VA 4F39A 1B0LA 1B2HA 4NMYA 2DXYA 2O68A 2PT1A 2Z23A 2DWIA 3K2DA 3KFMA 3KJ7A 5FHOA 4EXLA 1B7HA 3M8UA 3UP9A 2Z22A 1B3HA 2I49A 4NWCA 4RY1A 4G68C 3G3FA 3PPRA 1FQAA 5DVFA 5CBRA 4NF8B 3SESA 3TTNA 4BDQA 3IJOB 4TLLB 1NH7A 4IGRA 2XXIA 4ZE9A 4YKKA 4KCCA 1MQGA 2R9JA 4R2BA 3H7MA 4H8JA 3CG3A 2E0SA 2GHAA 4EUOA 5ISUA 2I3VA 4JB7A 3I3VA 1XT8A 2G29A 3CSGA 5HBCA 3ZSFA 1TWYA 2I0CA 4KPTA 1BKAA 4QSEA 1AMFA 2ANJA 2O7IA 1XOCA 1B3LA 4QHQA 3UIFA 3UN6A 1ZTYA 3SEWA 1D4NA 4YKJA 3BFTA 3KSXA 1MQJA 5DEXA 2P2AA 4MBPA 4AB6A 2O84X 5CBSA 3G3KA 2Y7KA 3KN7A 3TQWA 5KZTA 3M3KA 4OETA 5CMCA 1B6HA 2F78A 2XX7A 3MAMA 4KFQA 1ATGA 3O6IA 4OHNA 3B7DA 1YAEA 3MP1A 3RN8A 4NF6A 1IXIA 1P1WA 4XIGQ 2FYIA 4ZZEA 4KYDA 1MPBA 1B40A 1OMPA 2R6GE 5JTYB 2ZNTA 3SERA 1OQGA 1QVSA 1WDNA 3FJ7A 3PMVA 1N3WA 4I62A 4OESA 4PQJA 4XTCQ 4YKIA 1PBPA 3U93A 4K3FA 1B5IA 2M8CA 3VLUA 2REGA 4KYSA 5I84A 5KDTA 1QUKA 1VFEA 1MY1A 4U4SA 1MRPA 4U23A 2AYSA 3MP8A 2ESNA 4GF8A 3K00A 4NF4A 5CMBA 4GL8A 1B4ZA 1B58A 2PX1A 2VGQA 4GXAA 5TP9A 2A5TB 3MPLA 2OZZA 3K01A 4OEVA 4WEPA 1A99A 1L5TA 2DVCA 2I48A 4DE8A 3FXQA 4XKQA 3V83A 1MXXA 3MZBA 4F22A 4F1UA 2REJA 2VHAA 4N6PA 3LR1A 4IO2A 3QUJA 4F29A 2YPNA 3MZ9A 3WAEA 1TXFA 3IAZA 5I59A 2UVJA 1KWHA 3CFLA 1XC1A 2UVHA 2Z8FA 3QK6A 2XX8A 1IZ1A 1NMUA 4L17A 3TQLA 2UVIA 2E1SA 2GFEA 2I6EA 5CRYA 3PD9A 4PFWA 3HCQA 2I0BA 3FVKA 3IL1B 1CB6A 1URGA 3C33A 2NVUB 2ZXTA 3OMBA 4QFLA 1SW2A 1B46A 3RLFE 4F19A 3ECRA 2H4IA 1NNTA 2Q89A 4MH5A 4R75A 5IKBA 1AIVA 1FCKA 4Q8RA 1FTJA 1NL5A 4FEBA 4H6DA 1LAXA 2ZYMA 2F97A 3N5LA 4TLMB 2QL3A 1B5JA 2VP1A 4OYVA 3E4RA 1F9BA 4POXA 4O3AA 4OVJA 3L6HA 4H1XA 3H06B 3SKPA 2DOJA 3HHGA 1MPDA 1B51A 3OO6A 5B70A 3K6WA 4Q5TA 5AE4A 3FJGA 4OWDA 2OCUA 3C34A 4G68B 1Y3QA 3OD7A 1B3GA 5FHNA 4PE5B 2QS4A 4MLVA 3KSJA 3K6UA 3W9VA 4YMAA 4ELPA 2V93A 3VE1B 3M3FA 2XX9A 3TCGA 4F3GA 3GXAA 2HZKA 3FZVA 3TMGA 4DXUA 3MVWA 2Z8EA 1ZMGA 3D4CA 3CRBA 4U1ZA 3TYHA 2LAOA 4G8NA 4JWYA 5CM6A 3CSBA 5I58B 1ZJLA 2F5XA 3BFUA 4OFLA 4U4XA 1I6AA 1B3EA 3BKIB 4FE8A 2Q2AA 1Q35A 3PUYE 1SYIA 3OELA 1IXHA 2PBWA 2F34A 4GWOA 4IGTA 4QSCA 3SDFA 3S9NC 3TEPA 2IA4A 5DTBA 5H8HA 4M1VA 1ZU0A 3K1PA 1DTGA 5F7VA 1H43A 3OSQA 1URSA 2CZLA 3IO6A 1EZOA 3OOAA 1LAFE 1LGBC 4NE4A 4UACA 3G3GA 2D3IA 4NTLA 1B7UA 4QF9A 4FECA 4G8HA 4GRKA 2X7PA 3TDJA 4DCXA 1BP5A 5H8HB 2DWAA 3RTWB 2F8DA 2OWSA 3LUYA 3N94A 1PB8A 2XXUA 2B3FA 2Q8JA 4F3SA 3EHSA 3LBSA 4RK2A 4X1BA 2O6AA 1M5DA 2H5YA 1BTJA 3OO9A 3PD8A 4X1DA 4N07A 2X7QA 2XD3A 2Q2CA 3H03A 4QRZA 4H67A 3UA8A 3FVGA 1MDP1 3CI8A 1A54A 3G3HA 1PDAA 3ILUB 3EPEA 5H8NA 1LSTA 2F6GA 1IUDA 1MQIA 2WKYA 3O6HA 3A3UA 4G68A 2DE3A 3TCHA 4F18A 4P0GA 4IO6A 3SEUA 1B3FA 4MLQA 4R9GA 3T9XB 2NUVA 3IB2A 3MVXA 1SQYA 3RT6B 4HW8A 4LQ5A 3L6GA 4HCYA 4G8MA 1J1NA 2XXWA 1ZKBA 2D5WA 2QS3A 3N6UA 1US5A 3OENA 1NNKA 1FTLA 3GZGA 3KOSA 1NKXA 1A8EA 2QJEA 3DP6A 3O6GA 4KD5A 1XHYA 1T0KA 1A55A 2F7BA 5DVIA 3RTFB 3RPWA 1B52A 4RJZA 3VVDA 1LB8A 5DVJA 1HSEA 4DLDA 1P1QA 1S9TA 1FW0A 2DS9A 4ONYA 1TFDA 4YU0A 1M5BA 1LB9A 3MP6A 1O64A 1DOTA 4BLAA 1ELJA 3TTKA 4OXVA 1H44A 4EF1A 1FQDA 2XXQA 3UGWA 3H4ZA 1M5FA 3G7WA 4WXJA 4YB7A 2OJTA 1ZIUA 4Z0IA 2ONKE 3T22A 5CMKA 3ONMA 1D9YA 4KQPA 1S50A 3TTRA 3H6VA 4PETA 1UQWA 3RNNA 1MXWA 3VLWA 1BIYA 3HSTA 5K2XA 5ICTA 4DDDA 1QULA 1XVYA 4POWA 1GGGA 1EZPA 1OVBA 1DMBA 3MQ9A 3QUFA 2P0SA 3H6TA 1DPPA 4DIGA 3CFZA 1Y1ZA 3KG2A 3MWBA 4GD5A 2A5TA 2GH9A 2GHBA 3PUWE 5TP9B 4EF2A 1I6BA 3K1MA 4F2OA 2ONSA 3ILTB 3VV5A 1Z7ME 2AIXA 4GLIA 1MY4A 3IX1A 4XXUA 2VD3A 4C0RA 3HO7A 3F11A 1MDQA 1ANFA 2A5SA 3O28A 3PUVE 3FV1A 5H8FB 1WVJA 1PB7A 2VOZA 2Z8DA 3PPOA 3Q26A 3CFXA 3TPAA 1R9LA 4RYAA 4JBZA 4IO3A 1YCJA 1JVXA 1QJMA 2XXXA 4THIA 3FXRA 3U92A 3QYTA 3A3CA 3C36A 3S2VA 4X9TA 4YB5A 2YJPA 4NF6B 5CI5A 5B7DA 1IQ7A 4GXSB 2OK2A 2PMSA 3HN0A 1IXGA 3MW0A 4ZE8A 5TU0A 5EHMA 2H25A 1I6QA 3EQ1A 3GBAA 1UTBB 2OLBA 1N84A 3PV0E 4G77A 4NWDA 4XKNA 2DYXA 4KCDA 1OVTA 1MXVA 3KZGA 5DEXB 3PPNA 4ESXA 4F1YA 4X48A 3UORA 1VE4A 3SETA 3SEXA 2XHDA 4RK9A 4ZECA 4PFUA 4OEUA 3V5AA 3K6XA 3THIA 3RGYA 1R9QA 4WKMA 3S9LC 3LSWA 1MM6A 2ALUA 2QS1A 4EQBA 1JW1A 1PB9A 3B6QA 4OZ9A 4KYEA 4IB2A 1O63A 2XXTA 1MY3A 3DLNA 4G4PA 4LQ2A 4YKPA 1SYHA 3TKDA 3V8XB 2DE4A 4YMBA 3UK4A 5BUUA 4H0WA 4GOTA 2ZYOA 4BDMA 2O1MA 5KCJA 2I58A 2THIA 3H6WA 1USYE 3KBRA 1POY1 3CG1A 4FIMA 4NF8A 3TELA 5KCJB 1JETA 2QSXA 3E13X 1MXYA 2DWHA 4RPNA 1DSNA 1RYOA 1Y4CA 3VXCA 2V3QA 5F1QA 1UIVA 3B6WA 5H8FA 1B5HA 4P0IA 5BWJA 1URDA 3FVNA 4ZEBA 2NXOA 4EXKA 3FJMA 4ESWA 1H3DA 3U8QA 1HSLA 3W9WA 4BDRA 3R26A 3T66A 4UA8A 2UVGA 2XXYA 2FA7A 1QW0A 3JYRA 1D9VA 1FTOA 3MPKA 5CMMA 2B65A 2GRVA 2VD2A 4FORA 4YICA 3W15C 3TTMA 3TCFA 3E9XA 1QUJA 3GLBA 1GV8A 2Y7IA 1B9JA 1UTBA 1Q1KA 2CMOA 1SI0A 5L9OA 2HAUA 3IJXB 4LVQA 2UYEA 4QFNA 1IITA 2QS2A 3TUSA 2RCAA 4F3BA 1PC3A 4KI0E 4OENA 3EHTA 4ECFA 1N76A 2PYYA 4EDPA 4O3CA 1O7TA 4ELQA 1SW1A 1FTKA 3MZ1A 3Q25A 3ZS6A 4I8CA 3E3KA 4GIZA 1A8FA 4F2QA 5I57B 3N6TA 3FUZA 5AA3A 2DWJA 1CE2A 4R74A 3IOTA 3T96B 1HSJA 5HM4B 2AL5A 4YAHX 3S9EA 4IO4A 3SEYA 5AA4A 4I1DA 3PU5A 1XS5A 4KR5A 3A09A 4H5FA 2ZNUA 3FVOA 4MFIA 3FV2A 3RQTA 2O51A 1M5CA 3V89B 3U94A 4DXCA 5L8DA 3EHUA 3GBBA 5K2YA 1A7LA 4FATA 5I2NB 2HQ0A 4C1UA 1BLFA 1LCTA 1UTHA 3MVYA 5A5XA 4QFPA 1NFTA 4NEDA 1MM7A 1YTVA 2HXWA 2XXRA 3MBPA 1Y9UA 1M5EA 2XXVA 3LSXA 5FTIA 4HCWA 2OBGA 3BBRA 2QMWA 4YB6A 3TAJA 5DYHA 3FD3A 4RPOA 2RF1A 4FEDA 1IXCA 1IEJA 4HTGA 2AL4A 3T9UA 3USDA 1JQFA 4H5GA 5I56A 2H9BA 3DP4A 3O9PA 2I3WA 4WEDA 3IB0A 2UYFA 5HPQA 3K02A 1OLAA 3TFLA 1OIBA 4TQUQ 1SW4A 5IAIA 3EN3A 1Y3PA 2DVZA 4R6KA 1AH5A 4DXBA 4Z7EA 3SEVA 1P1OA 3QAXA 3RY3A 3DP8A 3IB1A 2X26A 3EF7A 3JV9A 4GL0A 4N13A 3R6UA 4QSDA 1LFIA 4ZDMA 1RYXA 1B1HA 1SD3A 1B05A 4NF5A 4BDNA 3VFJA 4ZEFA 4EQ9A 3OEMA 1PBQA 3KOTA 2UXAA 1LCFA 1YPNA 4IO7A 2DE2A 4GQOA 2ABHA 4ND9A 1FQCA 3IR1A 3OSRA 2NOOA 2QRYA 2RINA 3KN3A 4LA9A 3R7XA 2XXHA 5FHMA 4M4GA 1N04A 1JNFA 1P1NA 3KJTA 2Y7RA 5I2KB 4ZZAA 3U72A 3CR9A 3I6VA 3KN8A 2F36A 4Q30B 1MXZA 1MY2A 2F7AA 4F1VA 2KLFA 5H8SA 3T9VA 4F31B 4FAJA 5ELVA 3M3LA 1MY0A 1NNFA 1VFDA 4PP0A 5H8NB 3C35A 5H8QA 3TTLA 1NNPA 4U22A 1Y20A 5TPAB 1FQBA 1JVYA 3G3JA 3VXBA 2RC8A 4IY5A 2IEEA 1MG1A 3QXMA 3N26A 1LAHE 3C32A 3H3GA 3PMXA 4JDFA 1TFAA 1PEBA 1DTZA 1JW4A 3IOVA 2V84A 3K4UA 2HAVA 3KEIA 4KHZE 3IOWA 1MH4A 5AA2A 1EH3A 4R73A 3FASA 2XD2A 4ISUA 3MC2A 1QKBA 4RNSA 1II5A 1EZ9A 1VR5A 1ZLQA 3LSFB 1B1XA 2H99A 2PVUA 2G93A 1DPEA 3ODBA 3MUQA 1VSOA 3IORA 3O66A 3O29A 1H76A 4AB5A 2RC7A 1R1NA 4OFOA 4QFKA 2W7YA 1GTKA 3K1NA 2RCBA 4P11A 3C9HA 2XXPA 4GFRA 5EHSA 2DXRA 3RT8A 2O1LA 3PUZE 4XKRA 1FQEA 5AA2B 1LLSA 2O69A 4OTEA 4BDLA 2B3BA 3FATA 2ZYKA 1H45A 2F35A 3K6VA 3MJNA 3C31A 4ELRA 1B0HA 1LBCA 5I58A 1WODA 2ZNSA 4PFTA 4IY6A 4PFYA
chains in the Genus database with same CATH superfamily
3OXNA 4MF3A 4NHBA 3ZKLA 3Q29A 5I2KA 5ITOA 4YZZA 3FGSA 5LOMA 2BJJX 5L9SA 4U2RA 1D3KA 1IIWA 5M2VA 1OLCA 1NUYA 2HCAA 4LONB 4NF5B 4Q0CA 5BWJA 3VLVA 4PF6A 4LN5A 2Q9TA 4H8IA 3WAFA 2O7UA 1LAGE 3HV1A 4C1TA 2DSFA 1JEVA 1JP4A 4E0WA 5A5XB 1LFHA 3OO8A 3IO4A 1AOVA 4NF4B 4JXIA 3D4GA 2I4BA 4FJPA 1N3XA 3FXUA 3LV0A 2OWTA 3E78A 1N7XA 1USYH 4U1OA 3VVEA 4N8GA 1MH3A 3LC8A 3DM0A 4OQOA 2FHYA 1ZBMA 2CEXA 4GVOA 1JEUA 1JW5A 2PT2A 3IK6B 5IM2A 4R2FA 3CVGA 3K0VA 4G61A 2PT1A 3KFMA 1IMCA 2DWIA 4EXLA 3M8UA 4NWCA 3IFCA 3PPRA 5CBRA 4KCCA 2R9JA 4R2BA 2E0SA 5ISUA 2G29A 5HBCA 2I0CA 1BKAA 1AMFA 2ANJA 2R8TA 1B3LA 3BFTA 1MQJA 4PDDA 4MBPA 5DEXA 4GX3A 3TQWA 4GWSA 2Y5KA 4OETA 2XX7A 3MAMA 1FPJA 5A5LA 2FYIA 1OMPA 5JTYB 1QVSA 3FJ7A 4YKIA 1PBPA 4N6KA 1VFEA 3K00A 2V4CA 3MPLA 4OEVA 4MIJA 1A99A 2DVCA 3E79A 4DE8A 3FXQA 4F1UA 4IO2A 1RDZA 3MZ9A 1TXFA 2UVJA 4L17A 2Z8FA 1IMFA 3PD9A 1CB6A 1URGA 2ZXTA 3OMBA 3RLFE 3ECRA 2H4IA 2Q89A 4FEBA 3N5LA 5EQ7A 2VP1A 3T0JA 3FJGA 4OWDA 5FHNA 1B3GA 2V93A 4F3GA 3FZVA 3D4CA 3CRBA 4U1ZA 3TYHA 3CSBA 3BFUA 2DDKA 1B3EA 4FE8A 1Q35A 4GWOA 4QSCA 3TEPA 5H8HA 1ZU0A 5F7VA 5IZZA 3OSQA 4JVIA 4NE4A 4NTLA 1B7UA 4PF8A 4G8HA 4PGPA 5H8HB 3RTWB 4MNCA 2Q8JA 1FPFA 4X1BA 3PD8A 4X1DA 4N07A 2X7QA 5IGAA 4X04A 1QGXA 3CI8A 4FBPA 5H8NA 4F18A 3O6HA 4MLQA 3T9XB 3MVXA 4HW8A 3RT6B 3L6GA 1J1NA 1FPBA 3DP6A 1XHYA 1T0KA 3VVDA 3RTFB 3RPWA 1B52A 1HSEA 1P1QA 2DS9A 1M5BA 2P3VA 1DOTA 4BLAA 4OXVA 2XXQA 3UGWA 4Z0IA 3TTRA 4PETA 1MXWA 3VLWA 3HSTA 5K2XA 1EZPA 1GGGA 1OVBA 1DMBA 3QUFA 3H6TA 3MWBA 4GD5A 3PUWE 2GH9A 1I6BA 3K1MA 4F2OA 1MY4A 3IX1A 3HO7A 1ANFA 2A5SA 3O28A 2Z8DA 3RYDA 1R9LA 1YYZA 4IO3A 1QJMA 4YB5A 3MW0A 5TU0A 1I6QA 1UTBB 2XXKA 2OLBA 4NWDA 4N15A 5DEXB 3UORA 2XHDA 4PAFA 4ZECA 3S9LC 1MM6A 2QS1A 1JW1A 3B6QA 5H8FB 4YKPA 3T9HB 1O63A 3TKDA 1MY3A 3V8XB 4H0WA 5KCJA 3TELA 3CG1A 3E13X 3B6WA 1FPGA 4EXKA 3FJMA 3U8QA 5EYGA 4BDRA 2GRVA 1LBYA 4FORA 1QUJA 3GLBA 1SI0A 2UYEA 2QS2A 3TUSA 4F3BA 1PC3A 3EHTA 1O7TA 1SW1A 3ZS6A 1NUZA 3E3KA 5AA3A 3S9EA 4YAHX 4PBHA 1XS5A 2ZNUA 3FVOA 3U94A 4FATA 5I2NB 1BLFA 1UTHA 1NUXA 3LSXA 1LBXA 3BBRA 2QMWA 4YB6A 2F3BA 4FEDA 2AL4A 3USDA 1JQFA 4H5GA 4NN3A 5I56A 3DP4A 3IB0A 4R6KA 1K9ZA 1P1OA 3QAXA 4GL0A 3R6UA 4ZDMA 1NV6A 1B1HA 1B05A 3VFJA 3OEMA 3KOTA 2DE2A 4GQOA 4ND9A 2NOOA 5I2KB 4ZZAA 1MXZA 4F1VA 2KLFA 3M3LA 1MY0A 1NNFA 1VFDA 4PP0A 3VXBA 4IY5A 1NV5A 3PMXA 1LAHE 3IOVA 1DTZA 3K4UA 1MH4A 4R73A 3ODBA 1G0HA 2WBDA 4AB5A 2XA5A 2RCBA 3PUZE 1FQEA 5AA2B 2O69A 1H45A 2F35A 3MJNA 1WODA 2ZNSA 4IY6A 1N7WA 1S7YA 5EYFA 1RKMA 4ZEIA 4IO5A 1MS7A 2Y84A 1LFGA 1XVXA 2P1SA 5I3SA 2D21A 3A29A 4JWXA 4PAIA 3RUMA 1MQHA 3O97A 1B7ZA 3PGFA 4R6HA 4BDOA 4G2ZA 1RDYA 3O2AA 4NAPA 4F3PA 3OO7A 4OERA 1MQDA 4I3EA 4U21A 2FNCA 3NOHA 1GVCA 4OFJA 3B6TA 3LSLA 2Y7WA 5J1DA 2DP8A 1A40A 2Q8MA 3TODA 3HHFA 1FPEA 3ZKKA 3GYYA 1FQFA 2QVVA 4LZ7A 4OVQA 2QVUA 3VVFA 2NWJA 1LBBA 1AL3A 1Z7NE 1Y4TA 2HEUA 2YLNA 3QSLA 2QPQA 5ITPA 4R9FA 4LATA 3JZJA 4E0XA 1P99A 1GR2A 4HXVA 4QBAA 1NH8A 2Y7PA 5HPQA 4ZS9A 1POTA 1FPKA 5CC2A 3MYUA 3H6UA 3MVZA 2DXYA 2O68A 3KJ7A 4IR8A 4G68C 5ET6A 4P1LA 3TTNA 3IJOB 1NH7A 2XXIA 4GX4A 4H8JA 2I3VA 4N6DA 4JB7A 3CSGA 2GQ1A 4QSEA 2O7IA 3UN6A 1ZTYA 1D4NA 4HE1A 4DI3D 2O84X 3KN7A 1B6HA 4KFQA 3O6IA 3RN8A 3B7DA 1IXIA 1P1WA 4ZZEA 4KYDA 3FBPA 1B40A 5J16A 1OQGA 1WDNA 2WBBA 3PMVA 1N3WA 4I62A 4ZE9A 4JVCA 1B5IA 2M8CA 2WEFA 1QUKA 4O7IA 4I3YA 2ESNA 4GL8A 2VGQA 1D9QA 3K01A 3KC0A 4XKQA 2VT5A 3MZBA 2REJA 2VHAA 2YPNA 3IAZA 1FTAA 1KWHA 2UVHA 3QK6A 2XX8A 1IZ1A 1NMUA 3TQLA 2GFEA 2I6EA 5CRYA 4PFWA 3HCQA 1NV1A 4QFLA 1NNTA 5IKBA 1FTJA 4H6DA 1LAXA 2QL3A 1B5JA 3L6HA 4H1XA 3SKPA 2ZZVA 4MHFA 1MPDA 3K6WA 4Q5TA 2OCUA 1Y3QA 4MLVA 3KSJA 3K6UA 4ELPA 3VE1B 2XX9A 4DXUA 3MVWA 5I58B 4OFLA 1I6AA 4PBQA 3OELA 3S9NC 4IGTA 3SDFA 3K1PA 1DTGA 1EZOA 3OOAA 1LGBC 4QF9A 5EQ8A 2XWOA 2X7PA 4P47A 3TDJA 4DCXA 1AWBA 4RK2A 4OVSA 4QRZA 1MDP1 1PDAA 2F6GA 3A3UA 4G68A 2DE3A 4GWZA 1SQYA 5EQAA 1ZKBA 2D5WA 2QS3A 3N6UA 3OENA 1NNKA 3KOSA 1A8EA 2QJEA 4KD5A 4N81A 4RJZA 1LB8A 1TFDA 1ELJA 2FBPA 4WXJA 1ZIUA 3T22A 2ONKE 1NUWA 1S50A 1UQWA 2JJKA 5ICTA 4DDDA 3MQ9A 2P0SA 3KG2A 1Q9DA 2GHBA 2PFYA 4GLIA 2VD3A 4C0RA 1MDQA 1WVJA 2VOZA 3PPOA 3Q26A 3CFXA 3TPAA 4RYAA 1YCJA 4THIA 3U92A 3QYTA 3A3CA 2YJPA 1IQ7A 4ZE8A 2H25A 2WX9A 1N84A 3KZGA 3PPNA 4X48A 4N8YA 3SETA 4OEUA 3THIA 3RGYA 3QMFA 3LSWA 4IB2A 4G4PA 5BUUA 5JK4A 4I40A 5KCJB 2QSXA 4RPNA 2DWHA 1RYOA 1Y4CA 2VPOA 5F1QA 5H8FA 1B5HA 3FVNA 3W9WA 1QW0A 4P3LA 3W15C 4GWUA 2PCRA 2HAUA 4LVQA 4QFNA 4EDPA 4O3CA 4I8CA 1A8FA 5I57B 3N6TA 3FUZA 1CE2A 4R74A 1HSJA 1FBHA 4IO4A 3SEYA 5AA4A 3BIGA 3PU5A 3A09A 4GBVA 3FV2A 4AS5A 4DXCA 1A7LA 2PFZA 2HQ0A 4NEDA 2HXWA 2XXRA 5FTIA 1M5EA 4HCWA 4JVDA 3TAJA 3FD3A 1FPIA 3T9UA 2H9BA 1OIBA 3EN3A 1AH5A 4Z7EA 3TCFA 3RY3A 3IB1A 1IMEA 3EF7A 4QSDA 4BDNA 1SD3A 5DW8A 1LCFA 1FQCA 5ESYA 3R7XA 2XXHA 5FHMA 3V5AA 2Y7RA 3CR9A 2F7AA 5H8SA 5H8NB 4GWXA 3C35A 5H8QA 2RC8A 5IZ3A 3N26A 4KHZE 5AA2A 4PFRA 2XD2A 1NV0A 3MC2A 1QKBA 1VR5A 2PVUA 1VDWA 2RC7A 1DBZA 4OFOA 1GTKA 4P11A 4GFRA 4KXPA 4XKRA 4BDLA 3K6VA 1B0HA 1LBCA 4PFTA 4PFYA 3UP9A 1UIUA 1SW5A 3C4MA 1TT1A 3PPQA 4LZ8A 2V3TA 4O3BA 1QUIA 3AXFA 3PMWA 4I9DA 4RXLA 1FBGA 2RC9A 2QMXA 2ONRA 2F7CA 3T93B 3PUXE 5TPAA 4OMBA 3P7IA 1Y1MA 4LZ5A 3RPLA 1CNQA 4DCYA 2F6PA 5I56B 3S4UA 5I59B 3G3IA 4EUOA 1B4HA 3S9MC 4DZ1A 3U1OA 4R72A 1UTHB 4JSOA 1SVXB 3Q28A 4XKPA 2QVRA 2I4CA 3FIRA 5FTHA 4XF5A 4ZEDA 1OQHA 3CIJA 5JTYA 4JSDA 2HFBA 1FJ6A 3Q27A 2H98A 4EQ7A 1SBPA 4R6YA 1FPLA 1MXUA 5ICQA 2V25A 4TOZA 1US4A 4F39A 1B2HA 3K2DA 2Z23A 5FHOA 1B7HA 2I49A 4MX6A 5DVFA 1INPA 4NF8B 3SESA 4TLLB 1MQGA 3CG3A 2GHAA 3FXBA 3ZSFA 1XOCA 4QHQA 3KSXA 1NV2A 3G3KA 5CMCA 4OHNA 1ATGA 1YAEA 2ZNTA 3U93A 5I84A 1MY1A 4U4SA 1MRPA 4U23A 2AYSA 4GF8A 4NF4A 4GXAA 5TP9A 1KA1A 2WYKA 2F3DA 4N6PA 3LR1A 5I59A 3CFLA 4HE2A 2UVIA 2E1SA 3RPLB 3FVKA 3IL1B 5EYHA 2NVUB 1SW2A 1B46A 1EYJA 4F19A 4R75A 4P1EA 2F97A 4PGNA 4TLMB 3E4RA 1F9BA 4POXA 3H06B 2DOJA 3HHGA 3OO6A 2MKZA 5AE4A 2L5VA 3C34A 3OD7A 4PE5B 3W9VA 4YMAA 3ROJA 3M3FA 3TCGA 3TMGA 2Z8EA 1ZMGA 4JWYA 2CEYA 3BKIB 2Q2AA 4PTKA 2F34A 1DCUA 4HE0A 2IA4A 5DTBA 4M1VA 1URSA 1FBDA 4UACA 2D3IA 2DWAA 3N94A 1PB8A 2XXUA 3LBSA 1M5DA 5IZ3B 4H67A 3FVGA 3CHGA 1A54A 1MQIA 2WKYA 4P0GA 1B3FA 4R9GA 2NUVA 3HFUA 3IB2A 4GWWA 4LQ5A 4G8MA 2XXWA 1US5A 1YZ0A 2F7BA 4MNPA 1LBVA 1H44A 4EF1A 3H4ZA 1LEVA 3G7WA 2OJTA 2FIEA 5CMKA 4KQPA 3RNNA 1XVYA 2OWZA 1DPPA 1Y1ZA 5TP9B 3ILTB 1Z7ME 4XXUA 3PUVE 3FV1A 2P3NA 1JVXA 2CZHA 1FBFA 2PMSA 3HN0A 1IXGA 3EQ1A 3GBAA 4PAKA 4P8BA 4G77A 1OVTA 4F1YA 1EYIA 1NV3A 4PE3A 1DK4A 1LBZA 1VE4A 3SEXA 4RK9A 1IMBA 1SPIA 3K6XA 1R9QA 4WKMA 3B50A 1PB9A 1FBEA 4KYEA 4LQ2A 4OZ9A 3DLNA 2B4LA 4YMBA 2DE4A 1FRPA 2ZYOA 4BDMA 4FIMA 1USYE 4NF8A 3VXCA 1MXYA 1DSNA 1UIVA 4P0IA 1H3DA 5IZ1A 4UA8A 2XXYA 2FA7A 1KA0A 1D9VA 1FTOA 3MPKA 2B65A 4YICA 5L9OA 2CMOA 4O7MA 1Q1KA 3IJXB 2RCAA 2OX3A 4OENA 4KI0E 1N76A 1NI9A 1FJ9A 4PC9A 4F2QA 1IMDA 1NV7A 4I1DA 4KR5A 4H5FA 2O51A 1M5CA 5L8DA 3GBBA 5K2YA 5A5XA 3MVYA 4QFPA 2OBGA 5I5PA 2RF1A 1IXCA 1IEJA 4HTGA 4WEDA 2QFLA 3TFLA 4TQUQ 3DP8A 5TPAB 2X26A 2ZZXA 1RYXA 4NF5A 4ZEFA 1PBQA 1YPNA 3IR1A 2HPGA 2RINA 4LA9A 3KN3A 4M4GA 5I7IA 1JNFA 1P1NA 3KJTA 1MY2A 1FSAA 2FVZA 4F31B 3TTLA 4U22A 1Y20A 4P56A 3G3JA 3C32A 1JW4A 3IOWA 4ISUA 4RNSA 4GX6A 4P9KA 3LSFB 1B1XA 2H99A 2G93A 1DPEA 1VSOA 4NG7A 3O66A 3O29A 1R1NA 3K1NA 3C9HA 2XXPA 3RT8A 1LLSA 4PDHA 2ZYKA 1G0IA 3C31A 5I58A 4H46A 3WAEA 5H8QB 4QFOA 3OEKA 4OVRA 4LUBA 2DQVA 1R6ZA 3QIMA 4ZEKA 5CI5A 4H65A 5JEIA 2RKMA 1QKAA 3KGCA 1XI6A 2HZLA 2XWIA 4H45A 4AQ4A 5AA1A 2ZYNA 5L9MA 3IOUA 3LUZA 5DT6A 2V3UA 4LP2B 4PCDA 3VDFA 2CZIA 1B32A 4JWOA 4ELOA 1I69A 3TZAA 1N0TA 3PPPA 5AA4B 1RDXA 3I5OA 1SDXA 5AA2D 2WYPA 5KDTB 1FTMA 1EU8A 2Q88A 5I57A 2KR0A 2XWKA 1P1UA 5ET8A 3SZPA 1Y3NA 2ZMBA 3HPIA 3DELB 1SI1A 1FPDA 1MPCA 4HS7A 2R71A 3D1RA 1B0LA 4NMYA 1IMAA 2Z22A 1B3HA 4RY1A 4UABA 3G3FA 1FQAA 4BDQA 4GWYA 4IGRA 4O8MA 4YKKA 3H7MA 1FBCA 3I3VA 1XT8A 1BK4A 1TWYA 4KPTA 3UIFA 3SEWA 4YKJA 4AB6A 2P2AA 5CBSA 3PTYA 2Y7KA 5KZTA 3M3KA 2F78A 3MP1A 4NF6A 4XIGQ 4GBWA 1MPBA 2R6GE 3SERA 4PQJA 4XTCQ 4OESA 2KQZA 3VLUA 4K3FA 2REGA 4KYSA 5KDTA 4N91A 4MEVA 3MP8A 5CMBA 1B4ZA 1B58A 2PX1A 2A5TB 2OZZA 1KZ8A 4OANA 4WEPA 1L5TA 2I48A 2ZZWA 4DI4B 3V83A 1MXXA 4F22A 4F29A 3QUJA 4MJOA 4AS4A 5F24A 2XWVA 2HHMA 1XC1A 2I0BA 3C33A 4MH5A 1AIVA 4QXDA 1FCKA 4Q8RA 4N4UA 1NL5A 2ZYMA 4OYVA 1NV4A 4O3AA 4OVJA 5EQ9A 1B51A 2FIXA 5B70A 1LBWA 4G68B 4MMPA 2QS4A 2Q74A 4MCOA 3GXAA 2HZKA 4OVTA 5CM6A 2LAOA 4G8NA 1ZJLA 2F5XA 4U4XA 3PUYE 1SYIA 1IXHA 2PBWA 4NQ8A 1H43A 5LTCA 2CZLA 3IO6A 1LAFE 4XFEA 3G3GA 5LDZA 4FECA 4GRKA 1BP5A 2B4MA 2F8DA 2OWSA 3KBZA 5T3JA 3LUYA 4F3SA 2B3FA 3EHSA 2O6AA 2H5YA 1BTJA 3OO9A 4OA4A 2XD3A 2Q2CA 3H03A 3UA8A 3G3HA 3ILUB 3EPEA 1LSTA 1IUDA 3TCHA 4IO6A 4PFBA 3SEUA 4HCYA 3BIHA 1FTLA 3GZGA 1NKXA 3O6GA 1A55A 5DVIA 5DVJA 4DLDA 1S9TA 1FW0A 4ONYA 4YU0A 1LB9A 3MP6A 1O64A 3TTKA 1FQDA 1M5FA 4YB7A 3ONMA 1D9YA 3H6VA 4MAGA 1BIYA 4NX1A 1QULA 4POWA 4DIGA 5I2NA 3CFZA 4EF2A 2A5TA 2ONSA 3VV5A 2AIXA 3F11A 4XEQA 3ISPA 1PB7A 4JBZA 2XXXA 3FXRA 4MNIA 3C36A 3S2VA 4X9TA 4NF6B 5B7DA 3IFAA 4GXSB 2OK2A 5EHMA 3PV0E 4XKNA 2DYXA 4KCDA 4ESXA 1MXVA 4PFUA 4N17A 2ALUA 4EQBA 1FBPA 2XXTA 1SYHA 3UK4A 4GOTA 2O1MA 2I58A 2THIA 3H6WA 3KBRA 4OVPA 1POY1 1JETA 2V3QA 1URDA 4ZEBA 2NXOA 4ESWA 1HSLA 3R26A 3T66A 2UVGA 3JYRA 5CMMA 2VD2A 3TTMA 3E9XA 1GV8A 4NF0A 3T1BA 2Y7IA 1B9JA 1UTBA 1IITA 4ECFA 2PYYA 4ELQA 1FTKA 3MZ1A 3Q25A 4GIZA 2DWJA 3IOTA 3T96B 5HM4B 2AL5A 1EYKA 4MFIA 3RQTA 4PFIA 3V89B 3EHUA 4C1UA 1LCTA 3KC1A 1NFTA 1MM7A 1YTVA 3MBPA 1Y9UA 2XXVA 3EKIA 2VPNA 5DYHA 4RPOA 4NGUA 3O9PA 2I3WA 2UYFA 3K02A 1OLAA 5IAIA 1SW4A 1Y3PA 2DVZA 4DXBA 3SEVA 2Y5LA 2HXRA 3JV9A 4N13A 2BJIA 1LFIA 4EQ9A 2UXAA 1K9YA 4IO7A 2ABHA 3OSRA 2QRYA 4O94A 1N04A 3U65A 3U72A 3I6VA 3KN8A 4Q30B 2F36A 3T9VA 4FAJA 5ELVA 5ET5A 1NNPA 1FQBA 1JVYA 2IEEA 4X8RA 1MG1A 3QXMA 3H3GA 4JDFA 4RA1A 1TFAA 1PEBA 3KEIA 2V84A 2HAVA 1EH3A 3FASA 1II5A 1EZ9A 2CZKA 1ZLQA 3MUQA 3IORA 3MSTA 5ET7A 1H76A 4QFKA 2W7YA 1YXIA 3B8BA 5EHSA 2DXRA 2O1LA 4OTEA 2B3BA 3FATA 5FBPA 4ELRA
chains in the Genus database with same CATH topology
5H8QB 1UIUA 1SW5A 3C4MA 3OXNA 4MF3A 4QFOA 1N7WA 1S7YA 3OEKA 3ZKLA 5EYFA 1TT1A 3Q29A 4LUBA 5I2KA 2DQVA 1R6ZA 5ITOA 3PPQA 1RKMA 4YZZA 4ZEIA 3FGSA 5LOMA 3QIMA 4IO5A 2BJJX 4LZ8A 2V3TA 4O3BA 1MS7A 2Y84A 4ZEKA 1QUIA 4RA1A 5L9SA 1LFGA 1XVXA 2P1SA 3AXFA 3PMWA 1D3KA 4H65A 4I9DA 1IIWA 2D21A 4RXLA 4U2RA 1OLCA 5M2VA 2RKMA 5JEIA 1QKAA 2RC9A 2HCAA 2QMXA 4JWXA 3KGCA 4LONB 4NF5B 2HZLA 4Q0CA 2ONRA 3VLVA 2F7CA 3T93B 3PUXE 5TPAA 5JK4A 4OMBA 3P7IA 3RUMA 1Y1MA 2Q9TA 4AQ4A 1MQHA 3O97A 1B7ZA 3PGFA 4LZ5A 4R6HA 4BDOA 4DCYA 4H8IA 5AA1A 2ZYNA 5L9MA 2F6PA 3WAFA 4G2ZA 3IOUA 5I56B 3S4UA 2O7UA 3O2AA 5I59B 5DT6A 4F3PA 2V3UA 3OO7A 3G3IA 4LP2B 4OERA 1LAGE 3HV1A 1MQDA 1B4HA 3VDFA 4U21A 2FNCA 2DSFA 1JEVA 4C1TA 3S9MC 4DZ1A 1GVCA 3U1OA 4OFJA 3B6TA 3LSLA 4R72A 2Y7WA 1B32A 4E0WA 1UTHB 5A5XB 5J1DA 1LFHA 2DP8A 4JSOA 4JWOA 1A40A 3OO8A 3TODA 3IO4A 3HHFA 4ELOA 1AOVA 3ZKKA 1I69A 1SVXB 3TZAA 1FQFA 1N0TA 3PPPA 3Q28A 4NF4B 4XKPA 4JXIA 3D4GA 2I4CA 3FIRA 4LZ7A 5AA4B 5I2NA 2I4BA 3I5OA 4FJPA 1N3XA 1SDXA 3VVFA 5AA2D 3FXUA 5KDTB 1FTMA 1LBBA 2NWJA 1AL3A 1EU8A 3T9HB 1Z7NE 2Q88A 5FTHA 5I57A 4ZEDA 1OQHA 1Y4TA 2HEUA 2OWTA 3CIJA 5JTYA 2YLNA 1N7XA 3QSLA 2QPQA 4JSDA 1USYH 4R9FA 4U1OA 5ITPA 2HFBA 4LATA 3VVEA 1P1UA 3JZJA 4E0XA 1MH3A 3LC8A 3Q27A 1P99A 1GR2A 3DM0A 1Y3NA 2H98A 4OQOA 2ZMBA 3HPIA 1ZBMA 1NH8A 2Y7PA 3DELB 1SBPA 4GVOA 4ZS9A 4R6YA 1JEUA 1JW5A 4EQ7A 1POTA 5CC2A 2PT2A 3IK6B 1SI1A 1MXUA 1MPCA 3H6UA 3MVZA 4HS7A 5ICQA 2R71A 2V25A 3CVGA 4R2FA 1US4A 4TOZA 3K0VA 4F39A 1B0LA 1B2HA 4NMYA 2DXYA 2O68A 2PT1A 2Z23A 2DWIA 3K2DA 3KFMA 3KJ7A 5FHOA 4EXLA 1B7HA 3M8UA 3UP9A 2Z22A 1B3HA 2I49A 4NWCA 4RY1A 4G68C 3G3FA 3PPRA 1FQAA 5DVFA 5CBRA 4NF8B 3SESA 3TTNA 4BDQA 3IJOB 4TLLB 1NH7A 4IGRA 2XXIA 4ZE9A 4YKKA 4KCCA 1MQGA 2R9JA 4R2BA 3H7MA 4H8JA 3CG3A 2E0SA 2GHAA 4EUOA 5ISUA 2I3VA 4JB7A 3I3VA 1XT8A 2G29A 3CSGA 5HBCA 3ZSFA 1TWYA 2I0CA 4KPTA 1BKAA 4QSEA 1AMFA 2ANJA 2O7IA 1XOCA 1B3LA 4QHQA 3UIFA 3UN6A 1ZTYA 3SEWA 1D4NA 4YKJA 3BFTA 3KSXA 1MQJA 5DEXA 2P2AA 4MBPA 4AB6A 2O84X 5CBSA 3G3KA 2Y7KA 3KN7A 3TQWA 5KZTA 3M3KA 4OETA 5CMCA 1B6HA 2F78A 2XX7A 3MAMA 4KFQA 1ATGA 3O6IA 4OHNA 3B7DA 1YAEA 3MP1A 3RN8A 4NF6A 1IXIA 1P1WA 4XIGQ 2FYIA 4ZZEA 4KYDA 1MPBA 1B40A 1OMPA 2R6GE 5JTYB 2ZNTA 3SERA 1OQGA 1QVSA 1WDNA 3FJ7A 3PMVA 1N3WA 4I62A 4OESA 4PQJA 4XTCQ 4YKIA 1PBPA 3U93A 4K3FA 1B5IA 2M8CA 3VLUA 2REGA 4KYSA 5I84A 5KDTA 1QUKA 1VFEA 1MY1A 4U4SA 1MRPA 4U23A 2AYSA 3MP8A 2ESNA 4GF8A 3K00A 4NF4A 5CMBA 4GL8A 1B4ZA 1B58A 2PX1A 2VGQA 4GXAA 5TP9A 2A5TB 3MPLA 2OZZA 3K01A 4OEVA 4WEPA 1A99A 1L5TA 2DVCA 2I48A 4DE8A 3FXQA 4XKQA 3V83A 1MXXA 3MZBA 4F22A 4F1UA 2REJA 2VHAA 4N6PA 3LR1A 4IO2A 3QUJA 4F29A 2YPNA 3MZ9A 3WAEA 1TXFA 3IAZA 5I59A 2UVJA 1KWHA 3CFLA 1XC1A 2UVHA 2Z8FA 3QK6A 2XX8A 1IZ1A 1NMUA 4L17A 3TQLA 2UVIA 2E1SA 2GFEA 2I6EA 5CRYA 3PD9A 4PFWA 3HCQA 2I0BA 3FVKA 3IL1B 1CB6A 1URGA 3C33A 2NVUB 2ZXTA 3OMBA 4QFLA 1SW2A 1B46A 3RLFE 4F19A 3ECRA 2H4IA 1NNTA 2Q89A 4MH5A 4R75A 5IKBA 1AIVA 1FCKA 4Q8RA 1FTJA 1NL5A 4FEBA 4H6DA 1LAXA 2ZYMA 2F97A 3N5LA 4TLMB 2QL3A 1B5JA 2VP1A 4OYVA 3E4RA 1F9BA 4POXA 4O3AA 4OVJA 3L6HA 4H1XA 3H06B 3SKPA 2DOJA 3HHGA 1MPDA 1B51A 3OO6A 5B70A 3K6WA 4Q5TA 5AE4A 3FJGA 4OWDA 2OCUA 3C34A 4G68B 1Y3QA 3OD7A 1B3GA 5FHNA 4PE5B 2QS4A 4MLVA 3KSJA 3K6UA 3W9VA 4YMAA 4ELPA 2V93A 3VE1B 3M3FA 2XX9A 3TCGA 4F3GA 3GXAA 2HZKA 3FZVA 3TMGA 4DXUA 3MVWA 2Z8EA 1ZMGA 3D4CA 3CRBA 4U1ZA 3TYHA 2LAOA 4G8NA 4JWYA 5CM6A 3CSBA 5I58B 1ZJLA 2F5XA 3BFUA 4OFLA 4U4XA 1I6AA 1B3EA 3BKIB 4FE8A 2Q2AA 1Q35A 3PUYE 1SYIA 3OELA 1IXHA 2PBWA 2F34A 4GWOA 4IGTA 4QSCA 3SDFA 3S9NC 3TEPA 2IA4A 5DTBA 5H8HA 4M1VA 1ZU0A 3K1PA 1DTGA 5F7VA 1H43A 3OSQA 1URSA 2CZLA 3IO6A 1EZOA 3OOAA 1LAFE 1LGBC 4NE4A 4UACA 3G3GA 2D3IA 4NTLA 1B7UA 4QF9A 4FECA 4G8HA 4GRKA 2X7PA 3TDJA 4DCXA 1BP5A 5H8HB 2DWAA 3RTWB 2F8DA 2OWSA 3LUYA 3N94A 1PB8A 2XXUA 2B3FA 2Q8JA 4F3SA 3EHSA 3LBSA 4RK2A 4X1BA 2O6AA 1M5DA 2H5YA 1BTJA 3OO9A 3PD8A 4X1DA 4N07A 2X7QA 2XD3A 2Q2CA 3H03A 4QRZA 4H67A 3UA8A 3FVGA 1MDP1 3CI8A 1A54A 3G3HA 1PDAA 3ILUB 3EPEA 5H8NA 1LSTA 2F6GA 1IUDA 1MQIA 2WKYA 3O6HA 3A3UA 4G68A 2DE3A 3TCHA 4F18A 4P0GA 4IO6A 3SEUA 1B3FA 4MLQA 4R9GA 3T9XB 2NUVA 3IB2A 3MVXA 1SQYA 3RT6B 4HW8A 4LQ5A 3L6GA 4HCYA 4G8MA 1J1NA 2XXWA 1ZKBA 2D5WA 2QS3A 3N6UA 1US5A 3OENA 1NNKA 1FTLA 3GZGA 3KOSA 1NKXA 1A8EA 2QJEA 3DP6A 3O6GA 4KD5A 1XHYA 1T0KA 1A55A 2F7BA 5DVIA 3RTFB 3RPWA 1B52A 4RJZA 3VVDA 1LB8A 5DVJA 1HSEA 4DLDA 1P1QA 1S9TA 1FW0A 2DS9A 4ONYA 1TFDA 4YU0A 1M5BA 1LB9A 3MP6A 1O64A 1DOTA 4BLAA 1ELJA 3TTKA 4OXVA 1H44A 4EF1A 1FQDA 2XXQA 3UGWA 3H4ZA 1M5FA 3G7WA 4WXJA 4YB7A 2OJTA 1ZIUA 4Z0IA 2ONKE 3T22A 5CMKA 3ONMA 1D9YA 4KQPA 1S50A 3TTRA 3H6VA 4PETA 1UQWA 3RNNA 1MXWA 3VLWA 1BIYA 3HSTA 5K2XA 5ICTA 4DDDA 1QULA 1XVYA 4POWA 1GGGA 1EZPA 1OVBA 1DMBA 3MQ9A 3QUFA 2P0SA 3H6TA 1DPPA 4DIGA 3CFZA 1Y1ZA 3KG2A 3MWBA 4GD5A 2A5TA 2GH9A 2GHBA 3PUWE 5TP9B 4EF2A 1I6BA 3K1MA 4F2OA 2ONSA 3ILTB 3VV5A 1Z7ME 2AIXA 4GLIA 1MY4A 3IX1A 4XXUA 2VD3A 4C0RA 3HO7A 3F11A 1MDQA 1ANFA 2A5SA 3O28A 3PUVE 3FV1A 5H8FB 1WVJA 1PB7A 2VOZA 2Z8DA 3PPOA 3Q26A 3CFXA 3TPAA 1R9LA 4RYAA 4JBZA 4IO3A 1YCJA 1JVXA 1QJMA 2XXXA 4THIA 3FXRA 3U92A 3QYTA 3A3CA 3C36A 3S2VA 4X9TA 4YB5A 2YJPA 4NF6B 5CI5A 5B7DA 1IQ7A 4GXSB 2OK2A 2PMSA 3HN0A 1IXGA 3MW0A 4ZE8A 5TU0A 5EHMA 2H25A 1I6QA 3EQ1A 3GBAA 1UTBB 2OLBA 1N84A 3PV0E 4G77A 4NWDA 4XKNA 2DYXA 4KCDA 1OVTA 1MXVA 3KZGA 5DEXB 3PPNA 4ESXA 4F1YA 4X48A 3UORA 1VE4A 3SETA 3SEXA 2XHDA 4RK9A 4ZECA 4PFUA 4OEUA 3V5AA 3K6XA 3THIA 3RGYA 1R9QA 4WKMA 3S9LC 3LSWA 1MM6A 2ALUA 2QS1A 4EQBA 1JW1A 1PB9A 3B6QA 4OZ9A 4KYEA 4IB2A 1O63A 2XXTA 1MY3A 3DLNA 4G4PA 4LQ2A 4YKPA 1SYHA 3TKDA 3V8XB 2DE4A 4YMBA 3UK4A 5BUUA 4H0WA 4GOTA 2ZYOA 4BDMA 2O1MA 5KCJA 2I58A 2THIA 3H6WA 1USYE 3KBRA 1POY1 3CG1A 4FIMA 4NF8A 3TELA 5KCJB 1JETA 2QSXA 3E13X 1MXYA 2DWHA 4RPNA 1DSNA 1RYOA 1Y4CA 3VXCA 2V3QA 5F1QA 1UIVA 3B6WA 5H8FA 1B5HA 4P0IA 5BWJA 1URDA 3FVNA 4ZEBA 2NXOA 4EXKA 3FJMA 4ESWA 1H3DA 3U8QA 1HSLA 3W9WA 4BDRA 3R26A 3T66A 4UA8A 2UVGA 2XXYA 2FA7A 1QW0A 3JYRA 1D9VA 1FTOA 3MPKA 5CMMA 2B65A 2GRVA 2VD2A 4FORA 4YICA 3W15C 3TTMA 3TCFA 3E9XA 1QUJA 3GLBA 1GV8A 2Y7IA 1B9JA 1UTBA 1Q1KA 2CMOA 1SI0A 5L9OA 2HAUA 3IJXB 4LVQA 2UYEA 4QFNA 1IITA 2QS2A 3TUSA 2RCAA 4F3BA 1PC3A 4KI0E 4OENA 3EHTA 4ECFA 1N76A 2PYYA 4EDPA 4O3CA 1O7TA 4ELQA 1SW1A 1FTKA 3MZ1A 3Q25A 3ZS6A 4I8CA 3E3KA 4GIZA 1A8FA 4F2QA 5I57B 3N6TA 3FUZA 5AA3A 2DWJA 1CE2A 4R74A 3IOTA 3T96B 1HSJA 5HM4B 2AL5A 4YAHX 3S9EA 4IO4A 3SEYA 5AA4A 4I1DA 3PU5A 1XS5A 4KR5A 3A09A 4H5FA 2ZNUA 3FVOA 4MFIA 3FV2A 3RQTA 2O51A 1M5CA 3V89B 3U94A 4DXCA 5L8DA 3EHUA 3GBBA 5K2YA 1A7LA 4FATA 5I2NB 2HQ0A 4C1UA 1BLFA 1LCTA 1UTHA 3MVYA 5A5XA 4QFPA 1NFTA 4NEDA 1MM7A 1YTVA 2HXWA 2XXRA 3MBPA 1Y9UA 1M5EA 2XXVA 3LSXA 5FTIA 4HCWA 2OBGA 3BBRA 2QMWA 4YB6A 3TAJA 5DYHA 3FD3A 4RPOA 2RF1A 4FEDA 1IXCA 1IEJA 4HTGA 2AL4A 3T9UA 3USDA 1JQFA 4H5GA 5I56A 2H9BA 3DP4A 3O9PA 2I3WA 4WEDA 3IB0A 2UYFA 5HPQA 3K02A 1OLAA 3TFLA 1OIBA 4TQUQ 1SW4A 5IAIA 3EN3A 1Y3PA 2DVZA 4R6KA 1AH5A 4DXBA 4Z7EA 3SEVA 1P1OA 3QAXA 3RY3A 3DP8A 3IB1A 2X26A 3EF7A 3JV9A 4GL0A 4N13A 3R6UA 4QSDA 1LFIA 4ZDMA 1RYXA 1B1HA 1SD3A 1B05A 4NF5A 4BDNA 3VFJA 4ZEFA 4EQ9A 3OEMA 1PBQA 3KOTA 2UXAA 1LCFA 1YPNA 4IO7A 2DE2A 4GQOA 2ABHA 4ND9A 1FQCA 3IR1A 3OSRA 2NOOA 2QRYA 2RINA 3KN3A 4LA9A 3R7XA 2XXHA 5FHMA 4M4GA 1N04A 1JNFA 1P1NA 3KJTA 2Y7RA 5I2KB 4ZZAA 3U72A 3CR9A 3I6VA 3KN8A 2F36A 4Q30B 1MXZA 1MY2A 2F7AA 4F1VA 2KLFA 5H8SA 3T9VA 4F31B 4FAJA 5ELVA 3M3LA 1MY0A 1NNFA 1VFDA 4PP0A 5H8NB 3C35A 5H8QA 3TTLA 1NNPA 4U22A 1Y20A 5TPAB 1FQBA 1JVYA 3G3JA 3VXBA 2RC8A 4IY5A 2IEEA 1MG1A 3QXMA 3N26A 1LAHE 3C32A 3H3GA 3PMXA 4JDFA 1TFAA 1PEBA 1DTZA 1JW4A 3IOVA 2V84A 3K4UA 2HAVA 3KEIA 4KHZE 3IOWA 1MH4A 5AA2A 1EH3A 4R73A 3FASA 2XD2A 4ISUA 3MC2A 1QKBA 4RNSA 1II5A 1EZ9A 1VR5A 1ZLQA 3LSFB 1B1XA 2H99A 2PVUA 2G93A 1DPEA 3ODBA 3MUQA 1VSOA 3IORA 3O66A 3O29A 1H76A 4AB5A 2RC7A 1R1NA 4OFOA 4QFKA 2W7YA 1GTKA 3K1NA 2RCBA 4P11A 3C9HA 2XXPA 4GFRA 5EHSA 2DXRA 3RT8A 2O1LA 3PUZE 4XKRA 1FQEA 5AA2B 1LLSA 2O69A 4OTEA 4BDLA 2B3BA 3FATA 2ZYKA 1H45A 2F35A 3K6VA 3MJNA 3C31A 4ELRA 1B0HA 1LBCA 5I58A 1WODA 2ZNSA 4PFTA 4IY6A 4PFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H8Q B;  1UIU A;  1SW5 A;  3C4M A;  3OXN A;  4MF3 A;  4QFO A;  1N7W A;  1S7Y A;  3OEK A;  3ZKL A;  5EYF A;  1TT1 A;  3Q29 A;  4LUB A;  5I2K A;  2DQV A;  1R6Z A;  5ITO A;  3PPQ A;  1RKM A;  4YZZ A;  4ZEI A;  3FGS A;  5LOM A;  3QIM A;  4IO5 A;  2BJJ X;  4LZ8 A;  2V3T A;  4O3B A;  1MS7 A;  2Y84 A;  4ZEK A;  1QUI A;  4RA1 A;  5L9S A;  1LFG A;  1XVX A;  2P1S A;  3AXF A;  3PMW A;  1D3K A;  4H65 A;  4I9D A;  1IIW A;  2D21 A;  4RXL A;  4U2R A;  1OLC A;  5M2V A;  2RKM A;  5JEI A;  1QKA A;  2RC9 A;  2HCA A;  2QMX A;  4JWX A;  3KGC A;  4LON B;  4NF5 B;  2HZL A;  4Q0C A;  2ONR A;  3VLV A;  2F7C A;  3T93 B;  3PUX E;  5TPA A;  5JK4 A;  4OMB A;  3P7I A;  3RUM A;  1Y1M A;  2Q9T A;  4AQ4 A;  1MQH A;  3O97 A;  1B7Z A;  3PGF A;  4LZ5 A;  4R6H A;  4BDO A;  4DCY A;  4H8I A;  5AA1 A;  2ZYN A;  5L9M A;  2F6P A;  3WAF A;  4G2Z A;  3IOU A;  5I56 B;  3S4U A;  2O7U A;  3O2A A;  5I59 B;  5DT6 A;  4F3P A;  2V3U A;  3OO7 A;  3G3I A;  4LP2 B;  4OER A;  1LAG E;  3HV1 A;  1MQD A;  1B4H A;  3VDF A;  4U21 A;  2FNC A;  2DSF A;  1JEV A;  4C1T A;  3S9M C;  4DZ1 A;  1GVC A;  3U1O A;  4OFJ A;  3B6T A;  3LSL A;  4R72 A;  2Y7W A;  1B32 A;  4E0W A;  1UTH B;  5A5X B;  5J1D A;  1LFH A;  2DP8 A;  4JSO A;  4JWO A;  1A40 A;  3OO8 A;  3TOD A;  3IO4 A;  3HHF A;  4ELO A;  1AOV A;  3ZKK A;  1I69 A;  1SVX B;  3TZA A;  1FQF A;  1N0T A;  3PPP A;  3Q28 A;  4NF4 B;  4XKP A;  4JXI A;  3D4G A;  2I4C A;  3FIR A;  4LZ7 A;  5AA4 B;  5I2N A;  2I4B A;  3I5O A;  4FJP A;  1N3X A;  1SDX A;  3VVF A;  5AA2 D;  3FXU A;  5KDT B;  1FTM A;  1LBB A;  2NWJ A;  1AL3 A;  1EU8 A;  3T9H B;  1Z7N E;  2Q88 A;  5FTH A;  5I57 A;  4ZED A;  1OQH A;  1Y4T A;  2HEU A;  2OWT A;  3CIJ A;  5JTY A;  2YLN A;  1N7X A;  3QSL A;  2QPQ A;  4JSD A;  1USY H;  4R9F A;  4U1O A;  5ITP A;  2HFB A;  4LAT A;  3VVE A;  1P1U A;  3JZJ A;  4E0X A;  1MH3 A;  3LC8 A;  3Q27 A;  1P99 A;  1GR2 A;  3DM0 A;  1Y3N A;  2H98 A;  4OQO A;  2ZMB A;  3HPI A;  1ZBM A;  1NH8 A;  2Y7P A;  3DEL B;  1SBP A;  4GVO A;  4ZS9 A;  4R6Y A;  1JEU A;  1JW5 A;  4EQ7 A;  1POT A;  5CC2 A;  2PT2 A;  3IK6 B;  1SI1 A;  1MXU A;  1MPC A;  3H6U A;  3MVZ A;  4HS7 A;  5ICQ A;  2R71 A;  2V25 A;  3CVG A;  4R2F A;  1US4 A;  4TOZ A;  3K0V A;  4F39 A;  1B0L A;  1B2H A;  4NMY A;  2DXY A;  2O68 A;  2PT1 A;  2Z23 A;  2DWI A;  3K2D A;  3KFM A;  3KJ7 A;  5FHO A;  4EXL A;  1B7H A;  3M8U A;  3UP9 A;  2Z22 A;  1B3H A;  2I49 A;  4NWC A;  4RY1 A;  4G68 C;  3G3F A;  3PPR A;  1FQA A;  5DVF A;  5CBR A;  4NF8 B;  3SES A;  3TTN A;  4BDQ A;  3IJO B;  4TLL B;  1NH7 A;  4IGR A;  2XXI A;  4ZE9 A;  4YKK A;  4KCC A;  1MQG A;  2R9J A;  4R2B A;  3H7M A;  4H8J A;  3CG3 A;  2E0S A;  2GHA A;  4EUO A;  5ISU A;  2I3V A;  4JB7 A;  3I3V A;  1XT8 A;  2G29 A;  3CSG A;  5HBC A;  3ZSF A;  1TWY A;  2I0C A;  4KPT A;  1BKA A;  4QSE A;  1AMF A;  2ANJ A;  2O7I A;  1XOC A;  1B3L A;  4QHQ A;  3UIF A;  3UN6 A;  1ZTY A;  3SEW A;  1D4N A;  4YKJ A;  3BFT A;  3KSX A;  1MQJ A;  5DEX A;  2P2A A;  4MBP A;  4AB6 A;  2O84 X;  5CBS A;  3G3K A;  2Y7K A;  3KN7 A;  3TQW A;  5KZT A;  3M3K A;  4OET A;  5CMC A;  1B6H A;  2F78 A;  2XX7 A;  3MAM A;  4KFQ A;  1ATG A;  3O6I A;  4OHN A;  3B7D A;  1YAE A;  3MP1 A;  3RN8 A;  4NF6 A;  1IXI A;  1P1W A;  4XIG Q;  2FYI A;  4ZZE A;  4KYD A;  1MPB A;  1B40 A;  1OMP A;  2R6G E;  5JTY B;  2ZNT A;  3SER A;  1OQG A;  1QVS A;  1WDN A;  3FJ7 A;  3PMV A;  1N3W A;  4I62 A;  4OES A;  4PQJ A;  4XTC Q;  4YKI A;  1PBP A;  3U93 A;  4K3F A;  1B5I A;  2M8C A;  3VLU A;  2REG A;  4KYS A;  5I84 A;  5KDT A;  1QUK A;  1VFE A;  1MY1 A;  4U4S A;  1MRP A;  4U23 A;  2AYS A;  3MP8 A;  2ESN A;  4GF8 A;  3K00 A;  4NF4 A;  5CMB A;  4GL8 A;  1B4Z A;  1B58 A;  2PX1 A;  2VGQ A;  4GXA A;  5TP9 A;  2A5T B;  3MPL A;  2OZZ A;  3K01 A;  4OEV A;  4WEP A;  1A99 A;  1L5T A;  2DVC A;  2I48 A;  4DE8 A;  3FXQ A;  4XKQ A;  3V83 A;  1MXX A;  3MZB A;  4F22 A;  4F1U A;  2REJ A;  2VHA A;  4N6P A;  3LR1 A;  4IO2 A;  3QUJ A;  4F29 A;  2YPN A;  3MZ9 A;  3WAE A;  1TXF A;  3IAZ A;  5I59 A;  2UVJ A;  1KWH A;  3CFL A;  1XC1 A;  2UVH A;  2Z8F A;  3QK6 A;  2XX8 A;  1IZ1 A;  1NMU A;  4L17 A;  3TQL A;  2UVI A;  2E1S A;  2GFE A;  2I6E A;  5CRY A;  3PD9 A;  4PFW A;  3HCQ A;  2I0B A;  3FVK A;  3IL1 B;  1CB6 A;  1URG A;  3C33 A;  2NVU B;  2ZXT A;  3OMB A;  4QFL A;  1SW2 A;  1B46 A;  3RLF E;  4F19 A;  3ECR A;  2H4I A;  1NNT A;  2Q89 A;  4MH5 A;  4R75 A;  5IKB A;  1AIV A;  1FCK A;  4Q8R A;  1FTJ A;  1NL5 A;  4FEB A;  4H6D A;  1LAX A;  2ZYM A;  2F97 A;  3N5L A;  4TLM B;  2QL3 A;  1B5J A;  2VP1 A;  4OYV A;  3E4R A;  1F9B A;  4POX A;  4O3A A;  4OVJ A;  3L6H A;  4H1X A;  3H06 B;  3SKP A;  2DOJ A;  3HHG A;  1MPD A;  1B51 A;  3OO6 A;  5B70 A;  3K6W A;  4Q5T A;  5AE4 A;  3FJG A;  4OWD A;  2OCU A;  3C34 A;  4G68 B;  1Y3Q A;  3OD7 A;  1B3G A;  5FHN A;  4PE5 B;  2QS4 A;  4MLV A;  3KSJ A;  3K6U A;  3W9V A;  4YMA A;  4ELP A;  2V93 A;  3VE1 B;  3M3F A;  2XX9 A;  3TCG A;  4F3G A;  3GXA A;  2HZK A;  3FZV A;  3TMG A;  4DXU A;  3MVW A;  2Z8E A;  1ZMG A;  3D4C A;  3CRB A;  4U1Z A;  3TYH A;  2LAO A;  4G8N A;  4JWY A;  5CM6 A;  3CSB A;  5I58 B;  1ZJL A;  2F5X A;  3BFU A;  4OFL A;  4U4X A;  1I6A A;  1B3E A;  3BKI B;  4FE8 A;  2Q2A A;  1Q35 A;  3PUY E;  1SYI A;  3OEL A;  1IXH A;  2PBW A;  2F34 A;  4GWO A;  4IGT A;  4QSC A;  3SDF A;  3S9N C;  3TEP A;  2IA4 A;  5DTB A;  5H8H A;  4M1V A;  1ZU0 A;  3K1P A;  1DTG A;  5F7V A;  1H43 A;  3OSQ A;  1URS A;  2CZL A;  3IO6 A;  1EZO A;  3OOA A;  1LAF E;  1LGB C;  4NE4 A;  4UAC A;  3G3G A;  2D3I A;  4NTL A;  1B7U A;  4QF9 A;  4FEC A;  4G8H A;  4GRK A;  2X7P A;  3TDJ A;  4DCX A;  1BP5 A;  5H8H B;  2DWA A;  3RTW B;  2F8D A;  2OWS A;  3LUY A;  3N94 A;  1PB8 A;  2XXU A;  2B3F A;  2Q8J A;  4F3S A;  3EHS A;  3LBS A;  4RK2 A;  4X1B A;  2O6A A;  1M5D A;  2H5Y A;  1BTJ A;  3OO9 A;  3PD8 A;  4X1D A;  4N07 A;  2X7Q A;  2XD3 A;  2Q2C A;  3H03 A;  4QRZ A;  4H67 A;  3UA8 A;  3FVG A;  1MDP 1;  3CI8 A;  1A54 A;  3G3H A;  1PDA A;  3ILU B;  3EPE A;  5H8N A;  1LST A;  2F6G A;  1IUD A;  1MQI A;  2WKY A;  3O6H A;  3A3U A;  4G68 A;  2DE3 A;  3TCH A;  4F18 A;  4P0G A;  4IO6 A;  3SEU A;  1B3F A;  4MLQ A;  4R9G A;  3T9X B;  2NUV A;  3IB2 A;  3MVX A;  1SQY A;  3RT6 B;  4HW8 A;  4LQ5 A;  3L6G A;  4HCY A;  4G8M A;  1J1N A;  2XXW A;  1ZKB A;  2D5W A;  2QS3 A;  3N6U A;  1US5 A;  3OEN A;  1NNK A;  1FTL A;  3GZG A;  3KOS A;  1NKX A;  1A8E A;  2QJE A;  3DP6 A;  3O6G A;  4KD5 A;  1XHY A;  1T0K A;  1A55 A;  2F7B A;  5DVI A;  3RTF B;  3RPW A;  1B52 A;  4RJZ A;  3VVD A;  1LB8 A;  5DVJ A;  1HSE A;  4DLD A;  1P1Q A;  1S9T A;  1FW0 A;  2DS9 A;  4ONY A;  1TFD A;  4YU0 A;  1M5B A;  1LB9 A;  3MP6 A;  1O64 A;  1DOT A;  4BLA A;  1ELJ A;  3TTK A;  4OXV A;  1H44 A;  4EF1 A;  1FQD A;  2XXQ A;  3UGW A;  3H4Z A;  1M5F A;  3G7W A;  4WXJ A;  4YB7 A;  2OJT A;  1ZIU A;  4Z0I A;  2ONK E;  3T22 A;  5CMK A;  3ONM A;  1D9Y A;  4KQP A;  1S50 A;  3TTR A;  3H6V A;  4PET A;  1UQW A;  3RNN A;  1MXW A;  3VLW A;  1BIY A;  3HST A;  5K2X A;  5ICT A;  4DDD A;  1QUL A;  1XVY A;  4POW A;  1GGG A;  1EZP A;  1OVB A;  1DMB A;  3MQ9 A;  3QUF A;  2P0S A;  3H6T A;  1DPP A;  4DIG A;  3CFZ A;  1Y1Z A;  3KG2 A;  3MWB A;  4GD5 A;  2A5T A;  2GH9 A;  2GHB A;  3PUW E;  5TP9 B;  4EF2 A;  1I6B A;  3K1M A;  4F2O A;  2ONS A;  3ILT B;  3VV5 A;  1Z7M E;  2AIX A;  4GLI A;  1MY4 A;  3IX1 A;  4XXU A;  2VD3 A;  4C0R A;  3HO7 A;  3F11 A;  1MDQ A;  1ANF A;  2A5S A;  3O28 A;  3PUV E;  3FV1 A;  5H8F B;  1WVJ A;  1PB7 A;  2VOZ A;  2Z8D A;  3PPO A;  3Q26 A;  3CFX A;  3TPA A;  1R9L A;  4RYA A;  4JBZ A;  4IO3 A;  1YCJ A;  1JVX A;  1QJM A;  2XXX A;  4THI A;  3FXR A;  3U92 A;  3QYT A;  3A3C A;  3C36 A;  3S2V A;  4X9T A;  4YB5 A;  2YJP A;  4NF6 B;  5CI5 A;  5B7D A;  1IQ7 A;  4GXS B;  2OK2 A;  2PMS A;  3HN0 A;  1IXG A;  3MW0 A;  4ZE8 A;  5TU0 A;  5EHM A;  2H25 A;  1I6Q A;  3EQ1 A;  3GBA A;  1UTB B;  2OLB A;  1N84 A;  3PV0 E;  4G77 A;  4NWD A;  4XKN A;  2DYX A;  4KCD A;  1OVT A;  1MXV A;  3KZG A;  5DEX B;  3PPN A;  4ESX A;  4F1Y A;  4X48 A;  3UOR A;  1VE4 A;  3SET A;  3SEX A;  2XHD A;  4RK9 A;  4ZEC A;  4PFU A;  4OEU A;  3V5A A;  3K6X A;  3THI A;  3RGY A;  1R9Q A;  4WKM A;  3S9L C;  3LSW A;  1MM6 A;  2ALU A;  2QS1 A;  4EQB A;  1JW1 A;  1PB9 A;  3B6Q A;  4OZ9 A;  4KYE A;  4IB2 A;  1O63 A;  2XXT A;  1MY3 A;  3DLN A;  4G4P A;  4LQ2 A;  4YKP A;  1SYH A;  3TKD A;  3V8X B;  2DE4 A;  4YMB A;  3UK4 A;  5BUU A;  4H0W A;  4GOT A;  2ZYO A;  4BDM A;  2O1M A;  5KCJ A;  2I58 A;  2THI A;  3H6W A;  1USY E;  3KBR A;  1POY 1;  3CG1 A;  4FIM A;  4NF8 A;  3TEL A;  5KCJ B;  1JET A;  2QSX A;  3E13 X;  1MXY A;  2DWH A;  4RPN A;  1DSN A;  1RYO A;  1Y4C A;  3VXC A;  2V3Q A;  5F1Q A;  1UIV A;  3B6W A;  5H8F A;  1B5H A;  4P0I A;  5BWJ A;  1URD A;  3FVN A;  4ZEB A;  2NXO A;  4EXK A;  3FJM A;  4ESW A;  1H3D A;  3U8Q A;  1HSL A;  3W9W A;  4BDR A;  3R26 A;  3T66 A;  4UA8 A;  2UVG A;  2XXY A;  2FA7 A;  1QW0 A;  3JYR A;  1D9V A;  1FTO A;  3MPK A;  5CMM A;  2B65 A;  2GRV A;  2VD2 A;  4FOR A;  4YIC A;  3W15 C;  3TTM A;  3TCF A;  3E9X A;  1QUJ A;  3GLB A;  1GV8 A;  2Y7I A;  1B9J A;  1UTB A;  1Q1K A;  2CMO A;  1SI0 A;  5L9O A;  2HAU A;  3IJX B;  4LVQ A;  2UYE A;  4QFN A;  1IIT A;  2QS2 A;  3TUS A;  2RCA A;  4F3B A;  1PC3 A;  4KI0 E;  4OEN A;  3EHT A;  4ECF A;  1N76 A;  2PYY A;  4EDP A;  4O3C A;  1O7T A;  4ELQ A;  1SW1 A;  1FTK A;  3MZ1 A;  3Q25 A;  3ZS6 A;  4I8C A;  3E3K A;  4GIZ A;  1A8F A;  4F2Q A;  5I57 B;  3N6T A;  3FUZ A;  5AA3 A;  2DWJ A;  1CE2 A;  4R74 A;  3IOT A;  3T96 B;  1HSJ A;  5HM4 B;  2AL5 A;  4YAH X;  3S9E A;  4IO4 A;  3SEY A;  5AA4 A;  4I1D A;  3PU5 A;  1XS5 A;  4KR5 A;  3A09 A;  4H5F A;  2ZNU A;  3FVO A;  4MFI A;  3FV2 A;  3RQT A;  2O51 A;  1M5C A;  3V89 B;  3U94 A;  4DXC A;  5L8D A;  3EHU A;  3GBB A;  5K2Y A;  1A7L A;  4FAT A;  5I2N B;  2HQ0 A;  4C1U A;  1BLF A;  1LCT A;  1UTH A;  3MVY A;  5A5X A;  4QFP A;  1NFT A;  4NED A;  1MM7 A;  1YTV A;  2HXW A;  2XXR A;  3MBP A;  1Y9U A;  1M5E A;  2XXV A;  3LSX A;  5FTI A;  4HCW A;  2OBG A;  3BBR A;  2QMW A;  4YB6 A;  3TAJ A;  5DYH A;  3FD3 A;  4RPO A;  2RF1 A;  4FED A;  1IXC A;  1IEJ A;  4HTG A;  2AL4 A;  3T9U A;  3USD A;  1JQF A;  4H5G A;  5I56 A;  2H9B A;  3DP4 A;  3O9P A;  2I3W A;  4WED A;  3IB0 A;  2UYF A;  5HPQ A;  3K02 A;  1OLA A;  3TFL A;  1OIB A;  4TQU Q;  1SW4 A;  5IAI A;  3EN3 A;  1Y3P A;  2DVZ A;  4R6K A;  1AH5 A;  4DXB A;  4Z7E A;  3SEV A;  1P1O A;  3QAX A;  3RY3 A;  3DP8 A;  3IB1 A;  2X26 A;  3EF7 A;  3JV9 A;  4GL0 A;  4N13 A;  3R6U A;  4QSD A;  1LFI A;  4ZDM A;  1RYX A;  1B1H A;  1SD3 A;  1B05 A;  4NF5 A;  4BDN A;  3VFJ A;  4ZEF A;  4EQ9 A;  3OEM A;  1PBQ A;  3KOT A;  2UXA A;  1LCF A;  1YPN A;  4IO7 A;  2DE2 A;  4GQO A;  2ABH A;  4ND9 A;  1FQC A;  3IR1 A;  3OSR A;  2NOO A;  2QRY A;  2RIN A;  3KN3 A;  4LA9 A;  3R7X A;  2XXH A;  5FHM A;  4M4G A;  1N04 A;  1JNF A;  1P1N A;  3KJT A;  2Y7R A;  5I2K B;  4ZZA A;  3U72 A;  3CR9 A;  3I6V A;  3KN8 A;  2F36 A;  4Q30 B;  1MXZ A;  1MY2 A;  2F7A A;  4F1V A;  2KLF A;  5H8S A;  3T9V A;  4F31 B;  4FAJ A;  5ELV A;  3M3L A;  1MY0 A;  1NNF A;  1VFD A;  4PP0 A;  5H8N B;  3C35 A;  5H8Q A;  3TTL A;  1NNP A;  4U22 A;  1Y20 A;  5TPA B;  1FQB A;  1JVY A;  3G3J A;  3VXB A;  2RC8 A;  4IY5 A;  2IEE A;  1MG1 A;  3QXM A;  3N26 A;  1LAH E;  3C32 A;  3H3G A;  3PMX A;  4JDF A;  1TFA A;  1PEB A;  1DTZ A;  1JW4 A;  3IOV A;  2V84 A;  3K4U A;  2HAV A;  3KEI A;  4KHZ E;  3IOW A;  1MH4 A;  5AA2 A;  1EH3 A;  4R73 A;  3FAS A;  2XD2 A;  4ISU A;  3MC2 A;  1QKB A;  4RNS A;  1II5 A;  1EZ9 A;  1VR5 A;  1ZLQ A;  3LSF B;  1B1X A;  2H99 A;  2PVU A;  2G93 A;  1DPE A;  3ODB A;  3MUQ A;  1VSO A;  3IOR A;  3O66 A;  3O29 A;  1H76 A;  4AB5 A;  2RC7 A;  1R1N A;  4OFO A;  4QFK A;  2W7Y A;  1GTK A;  3K1N A;  2RCB A;  4P11 A;  3C9H A;  2XXP A;  4GFR A;  5EHS A;  2DXR A;  3RT8 A;  2O1L A;  3PUZ E;  4XKR A;  1FQE A;  5AA2 B;  1LLS A;  2O69 A;  4OTE A;  4BDL A;  2B3B A;  3FAT A;  2ZYK A;  1H45 A;  2F35 A;  3K6V A;  3MJN A;  3C31 A;  4ELR A;  1B0H A;  1LBC A;  5I58 A;  1WOD A;  2ZNS A;  4PFT A;  4IY6 A;  4PFY A; 
#chains in the Genus database with same CATH topology
 3OXN A;  4MF3 A;  4NHB A;  3ZKL A;  3Q29 A;  5I2K A;  5ITO A;  4YZZ A;  3FGS A;  5LOM A;  2BJJ X;  5L9S A;  4U2R A;  1D3K A;  1IIW A;  5M2V A;  1OLC A;  1NUY A;  2HCA A;  4LON B;  4NF5 B;  4Q0C A;  5BWJ A;  3VLV A;  4PF6 A;  4LN5 A;  2Q9T A;  4H8I A;  3WAF A;  2O7U A;  1LAG E;  3HV1 A;  4C1T A;  2DSF A;  1JEV A;  1JP4 A;  4E0W A;  5A5X B;  1LFH A;  3OO8 A;  3IO4 A;  1AOV A;  4NF4 B;  4JXI A;  3D4G A;  2I4B A;  4FJP A;  1N3X A;  3FXU A;  3LV0 A;  2OWT A;  3E78 A;  1N7X A;  1USY H;  4U1O A;  3VVE A;  4N8G A;  1MH3 A;  3LC8 A;  3DM0 A;  4OQO A;  2FHY A;  1ZBM A;  2CEX A;  4GVO A;  1JEU A;  1JW5 A;  2PT2 A;  3IK6 B;  5IM2 A;  4R2F A;  3CVG A;  3K0V A;  4G61 A;  2PT1 A;  3KFM A;  1IMC A;  2DWI A;  4EXL A;  3M8U A;  4NWC A;  3IFC A;  3PPR A;  5CBR A;  4KCC A;  2R9J A;  4R2B A;  2E0S A;  5ISU A;  2G29 A;  5HBC A;  2I0C A;  1BKA A;  1AMF A;  2ANJ A;  2R8T A;  1B3L A;  3BFT A;  1MQJ A;  4PDD A;  4MBP A;  5DEX A;  4GX3 A;  3TQW A;  4GWS A;  2Y5K A;  4OET A;  2XX7 A;  3MAM A;  1FPJ A;  5A5L A;  2FYI A;  1OMP A;  5JTY B;  1QVS A;  3FJ7 A;  4YKI A;  1PBP A;  4N6K A;  1VFE A;  3K00 A;  2V4C A;  3MPL A;  4OEV A;  4MIJ A;  1A99 A;  2DVC A;  3E79 A;  4DE8 A;  3FXQ A;  4F1U A;  4IO2 A;  1RDZ A;  3MZ9 A;  1TXF A;  2UVJ A;  4L17 A;  2Z8F A;  1IMF A;  3PD9 A;  1CB6 A;  1URG A;  2ZXT A;  3OMB A;  3RLF E;  3ECR A;  2H4I A;  2Q89 A;  4FEB A;  3N5L A;  5EQ7 A;  2VP1 A;  3T0J A;  3FJG A;  4OWD A;  5FHN A;  1B3G A;  2V93 A;  4F3G A;  3FZV A;  3D4C A;  3CRB A;  4U1Z A;  3TYH A;  3CSB A;  3BFU A;  2DDK A;  1B3E A;  4FE8 A;  1Q35 A;  4GWO A;  4QSC A;  3TEP A;  5H8H A;  1ZU0 A;  5F7V A;  5IZZ A;  3OSQ A;  4JVI A;  4NE4 A;  4NTL A;  1B7U A;  4PF8 A;  4G8H A;  4PGP A;  5H8H B;  3RTW B;  4MNC A;  2Q8J A;  1FPF A;  4X1B A;  3PD8 A;  4X1D A;  4N07 A;  2X7Q A;  5IGA A;  4X04 A;  1QGX A;  3CI8 A;  4FBP A;  5H8N A;  4F18 A;  3O6H A;  4MLQ A;  3T9X B;  3MVX A;  4HW8 A;  3RT6 B;  3L6G A;  1J1N A;  1FPB A;  3DP6 A;  1XHY A;  1T0K A;  3VVD A;  3RTF B;  3RPW A;  1B52 A;  1HSE A;  1P1Q A;  2DS9 A;  1M5B A;  2P3V A;  1DOT A;  4BLA A;  4OXV A;  2XXQ A;  3UGW A;  4Z0I A;  3TTR A;  4PET A;  1MXW A;  3VLW A;  3HST A;  5K2X A;  1EZP A;  1GGG A;  1OVB A;  1DMB A;  3QUF A;  3H6T A;  3MWB A;  4GD5 A;  3PUW E;  2GH9 A;  1I6B A;  3K1M A;  4F2O A;  1MY4 A;  3IX1 A;  3HO7 A;  1ANF A;  2A5S A;  3O28 A;  2Z8D A;  3RYD A;  1R9L A;  1YYZ A;  4IO3 A;  1QJM A;  4YB5 A;  3MW0 A;  5TU0 A;  1I6Q A;  1UTB B;  2XXK A;  2OLB A;  4NWD A;  4N15 A;  5DEX B;  3UOR A;  2XHD A;  4PAF A;  4ZEC A;  3S9L C;  1MM6 A;  2QS1 A;  1JW1 A;  3B6Q A;  5H8F B;  4YKP A;  3T9H B;  1O63 A;  3TKD A;  1MY3 A;  3V8X B;  4H0W A;  5KCJ A;  3TEL A;  3CG1 A;  3E13 X;  3B6W A;  1FPG A;  4EXK A;  3FJM A;  3U8Q A;  5EYG A;  4BDR A;  2GRV A;  1LBY A;  4FOR A;  1QUJ A;  3GLB A;  1SI0 A;  2UYE A;  2QS2 A;  3TUS A;  4F3B A;  1PC3 A;  3EHT A;  1O7T A;  1SW1 A;  3ZS6 A;  1NUZ A;  3E3K A;  5AA3 A;  3S9E A;  4YAH X;  4PBH A;  1XS5 A;  2ZNU A;  3FVO A;  3U94 A;  4FAT A;  5I2N B;  1BLF A;  1UTH A;  1NUX A;  3LSX A;  1LBX A;  3BBR A;  2QMW A;  4YB6 A;  2F3B A;  4FED A;  2AL4 A;  3USD A;  1JQF A;  4H5G A;  4NN3 A;  5I56 A;  3DP4 A;  3IB0 A;  4R6K A;  1K9Z A;  1P1O A;  3QAX A;  4GL0 A;  3R6U A;  4ZDM A;  1NV6 A;  1B1H A;  1B05 A;  3VFJ A;  3OEM A;  3KOT A;  2DE2 A;  4GQO A;  4ND9 A;  2NOO A;  5I2K B;  4ZZA A;  1MXZ A;  4F1V A;  2KLF A;  3M3L A;  1MY0 A;  1NNF A;  1VFD A;  4PP0 A;  3VXB A;  4IY5 A;  1NV5 A;  3PMX A;  1LAH E;  3IOV A;  1DTZ A;  3K4U A;  1MH4 A;  4R73 A;  3ODB A;  1G0H A;  2WBD A;  4AB5 A;  2XA5 A;  2RCB A;  3PUZ E;  1FQE A;  5AA2 B;  2O69 A;  1H45 A;  2F35 A;  3MJN A;  1WOD A;  2ZNS A;  4IY6 A;  1N7W A;  1S7Y A;  5EYF A;  1RKM A;  4ZEI A;  4IO5 A;  1MS7 A;  2Y84 A;  1LFG A;  1XVX A;  2P1S A;  5I3S A;  2D21 A;  3A29 A;  4JWX A;  4PAI A;  3RUM A;  1MQH A;  3O97 A;  1B7Z A;  3PGF A;  4R6H A;  4BDO A;  4G2Z A;  1RDY A;  3O2A A;  4NAP A;  4F3P A;  3OO7 A;  4OER A;  1MQD A;  4I3E A;  4U21 A;  2FNC A;  3NOH A;  1GVC A;  4OFJ A;  3B6T A;  3LSL A;  2Y7W A;  5J1D A;  2DP8 A;  1A40 A;  2Q8M A;  3TOD A;  3HHF A;  1FPE A;  3ZKK A;  3GYY A;  1FQF A;  2QVV A;  4LZ7 A;  4OVQ A;  2QVU A;  3VVF A;  2NWJ A;  1LBB A;  1AL3 A;  1Z7N E;  1Y4T A;  2HEU A;  2YLN A;  3QSL A;  2QPQ A;  5ITP A;  4R9F A;  4LAT A;  3JZJ A;  4E0X A;  1P99 A;  1GR2 A;  4HXV A;  4QBA A;  1NH8 A;  2Y7P A;  5HPQ A;  4ZS9 A;  1POT A;  1FPK A;  5CC2 A;  3MYU A;  3H6U A;  3MVZ A;  2DXY A;  2O68 A;  3KJ7 A;  4IR8 A;  4G68 C;  5ET6 A;  4P1L A;  3TTN A;  3IJO B;  1NH7 A;  2XXI A;  4GX4 A;  4H8J A;  2I3V A;  4N6D A;  4JB7 A;  3CSG A;  2GQ1 A;  4QSE A;  2O7I A;  3UN6 A;  1ZTY A;  1D4N A;  4HE1 A;  4DI3 D;  2O84 X;  3KN7 A;  1B6H A;  4KFQ A;  3O6I A;  3RN8 A;  3B7D A;  1IXI A;  1P1W A;  4ZZE A;  4KYD A;  3FBP A;  1B40 A;  5J16 A;  1OQG A;  1WDN A;  2WBB A;  3PMV A;  1N3W A;  4I62 A;  4ZE9 A;  4JVC A;  1B5I A;  2M8C A;  2WEF A;  1QUK A;  4O7I A;  4I3Y A;  2ESN A;  4GL8 A;  2VGQ A;  1D9Q A;  3K01 A;  3KC0 A;  4XKQ A;  2VT5 A;  3MZB A;  2REJ A;  2VHA A;  2YPN A;  3IAZ A;  1FTA A;  1KWH A;  2UVH A;  3QK6 A;  2XX8 A;  1IZ1 A;  1NMU A;  3TQL A;  2GFE A;  2I6E A;  5CRY A;  4PFW A;  3HCQ A;  1NV1 A;  4QFL A;  1NNT A;  5IKB A;  1FTJ A;  4H6D A;  1LAX A;  2QL3 A;  1B5J A;  3L6H A;  4H1X A;  3SKP A;  2ZZV A;  4MHF A;  1MPD A;  3K6W A;  4Q5T A;  2OCU A;  1Y3Q A;  4MLV A;  3KSJ A;  3K6U A;  4ELP A;  3VE1 B;  2XX9 A;  4DXU A;  3MVW A;  5I58 B;  4OFL A;  1I6A A;  4PBQ A;  3OEL A;  3S9N C;  4IGT A;  3SDF A;  3K1P A;  1DTG A;  1EZO A;  3OOA A;  1LGB C;  4QF9 A;  5EQ8 A;  2XWO A;  2X7P A;  4P47 A;  3TDJ A;  4DCX A;  1AWB A;  4RK2 A;  4OVS A;  4QRZ A;  1MDP 1;  1PDA A;  2F6G A;  3A3U A;  4G68 A;  2DE3 A;  4GWZ A;  1SQY A;  5EQA A;  1ZKB A;  2D5W A;  2QS3 A;  3N6U A;  3OEN A;  1NNK A;  3KOS A;  1A8E A;  2QJE A;  4KD5 A;  4N81 A;  4RJZ A;  1LB8 A;  1TFD A;  1ELJ A;  2FBP A;  4WXJ A;  1ZIU A;  3T22 A;  2ONK E;  1NUW A;  1S50 A;  1UQW A;  2JJK A;  5ICT A;  4DDD A;  3MQ9 A;  2P0S A;  3KG2 A;  1Q9D A;  2GHB A;  2PFY A;  4GLI A;  2VD3 A;  4C0R A;  1MDQ A;  1WVJ A;  2VOZ A;  3PPO A;  3Q26 A;  3CFX A;  3TPA A;  4RYA A;  1YCJ A;  4THI A;  3U92 A;  3QYT A;  3A3C A;  2YJP A;  1IQ7 A;  4ZE8 A;  2H25 A;  2WX9 A;  1N84 A;  3KZG A;  3PPN A;  4X48 A;  4N8Y A;  3SET A;  4OEU A;  3THI A;  3RGY A;  3QMF A;  3LSW A;  4IB2 A;  4G4P A;  5BUU A;  5JK4 A;  4I40 A;  5KCJ B;  2QSX A;  4RPN A;  2DWH A;  1RYO A;  1Y4C A;  2VPO A;  5F1Q A;  5H8F A;  1B5H A;  3FVN A;  3W9W A;  1QW0 A;  4P3L A;  3W15 C;  4GWU A;  2PCR A;  2HAU A;  4LVQ A;  4QFN A;  4EDP A;  4O3C A;  4I8C A;  1A8F A;  5I57 B;  3N6T A;  3FUZ A;  1CE2 A;  4R74 A;  1HSJ A;  1FBH A;  4IO4 A;  3SEY A;  5AA4 A;  3BIG A;  3PU5 A;  3A09 A;  4GBV A;  3FV2 A;  4AS5 A;  4DXC A;  1A7L A;  2PFZ A;  2HQ0 A;  4NED A;  2HXW A;  2XXR A;  5FTI A;  1M5E A;  4HCW A;  4JVD A;  3TAJ A;  3FD3 A;  1FPI A;  3T9U A;  2H9B A;  1OIB A;  3EN3 A;  1AH5 A;  4Z7E A;  3TCF A;  3RY3 A;  3IB1 A;  1IME A;  3EF7 A;  4QSD A;  4BDN A;  1SD3 A;  5DW8 A;  1LCF A;  1FQC A;  5ESY A;  3R7X A;  2XXH A;  5FHM A;  3V5A A;  2Y7R A;  3CR9 A;  2F7A A;  5H8S A;  5H8N B;  4GWX A;  3C35 A;  5H8Q A;  2RC8 A;  5IZ3 A;  3N26 A;  4KHZ E;  5AA2 A;  4PFR A;  2XD2 A;  1NV0 A;  3MC2 A;  1QKB A;  1VR5 A;  2PVU A;  1VDW A;  2RC7 A;  1DBZ A;  4OFO A;  1GTK A;  4P11 A;  4GFR A;  4KXP A;  4XKR A;  4BDL A;  3K6V A;  1B0H A;  1LBC A;  4PFT A;  4PFY A;  3UP9 A;  1UIU A;  1SW5 A;  3C4M A;  1TT1 A;  3PPQ A;  4LZ8 A;  2V3T A;  4O3B A;  1QUI A;  3AXF A;  3PMW A;  4I9D A;  4RXL A;  1FBG A;  2RC9 A;  2QMX A;  2ONR A;  2F7C A;  3T93 B;  3PUX E;  5TPA A;  4OMB A;  3P7I A;  1Y1M A;  4LZ5 A;  3RPL A;  1CNQ A;  4DCY A;  2F6P A;  5I56 B;  3S4U A;  5I59 B;  3G3I A;  4EUO A;  1B4H A;  3S9M C;  4DZ1 A;  3U1O A;  4R72 A;  1UTH B;  4JSO A;  1SVX B;  3Q28 A;  4XKP A;  2QVR A;  2I4C A;  3FIR A;  5FTH A;  4XF5 A;  4ZED A;  1OQH A;  3CIJ A;  5JTY A;  4JSD A;  2HFB A;  1FJ6 A;  3Q27 A;  2H98 A;  4EQ7 A;  1SBP A;  4R6Y A;  1FPL A;  1MXU A;  5ICQ A;  2V25 A;  4TOZ A;  1US4 A;  4F39 A;  1B2H A;  3K2D A;  2Z23 A;  5FHO A;  1B7H A;  2I49 A;  4MX6 A;  5DVF A;  1INP A;  4NF8 B;  3SES A;  4TLL B;  1MQG A;  3CG3 A;  2GHA A;  3FXB A;  3ZSF A;  1XOC A;  4QHQ A;  3KSX A;  1NV2 A;  3G3K A;  5CMC A;  4OHN A;  1ATG A;  1YAE A;  2ZNT A;  3U93 A;  5I84 A;  1MY1 A;  4U4S A;  1MRP A;  4U23 A;  2AYS A;  4GF8 A;  4NF4 A;  4GXA A;  5TP9 A;  1KA1 A;  2WYK A;  2F3D A;  4N6P A;  3LR1 A;  5I59 A;  3CFL A;  4HE2 A;  2UVI A;  2E1S A;  3RPL B;  3FVK A;  3IL1 B;  5EYH A;  2NVU B;  1SW2 A;  1B46 A;  1EYJ A;  4F19 A;  4R75 A;  4P1E A;  2F97 A;  4PGN A;  4TLM B;  3E4R A;  1F9B A;  4POX A;  3H06 B;  2DOJ A;  3HHG A;  3OO6 A;  2MKZ A;  5AE4 A;  2L5V A;  3C34 A;  3OD7 A;  4PE5 B;  3W9V A;  4YMA A;  3ROJ A;  3M3F A;  3TCG A;  3TMG A;  2Z8E A;  1ZMG A;  4JWY A;  2CEY A;  3BKI B;  2Q2A A;  4PTK A;  2F34 A;  1DCU A;  4HE0 A;  2IA4 A;  5DTB A;  4M1V A;  1URS A;  1FBD A;  4UAC A;  2D3I A;  2DWA A;  3N94 A;  1PB8 A;  2XXU A;  3LBS A;  1M5D A;  5IZ3 B;  4H67 A;  3FVG A;  3CHG A;  1A54 A;  1MQI A;  2WKY A;  4P0G A;  1B3F A;  4R9G A;  2NUV A;  3HFU A;  3IB2 A;  4GWW A;  4LQ5 A;  4G8M A;  2XXW A;  1US5 A;  1YZ0 A;  2F7B A;  4MNP A;  1LBV A;  1H44 A;  4EF1 A;  3H4Z A;  1LEV A;  3G7W A;  2OJT A;  2FIE A;  5CMK A;  4KQP A;  3RNN A;  1XVY A;  2OWZ A;  1DPP A;  1Y1Z A;  5TP9 B;  3ILT B;  1Z7M E;  4XXU A;  3PUV E;  3FV1 A;  2P3N A;  1JVX A;  2CZH A;  1FBF A;  2PMS A;  3HN0 A;  1IXG A;  3EQ1 A;  3GBA A;  4PAK A;  4P8B A;  4G77 A;  1OVT A;  4F1Y A;  1EYI A;  1NV3 A;  4PE3 A;  1DK4 A;  1LBZ A;  1VE4 A;  3SEX A;  4RK9 A;  1IMB A;  1SPI A;  3K6X A;  1R9Q A;  4WKM A;  3B50 A;  1PB9 A;  1FBE A;  4KYE A;  4LQ2 A;  4OZ9 A;  3DLN A;  2B4L A;  4YMB A;  2DE4 A;  1FRP A;  2ZYO A;  4BDM A;  4FIM A;  1USY E;  4NF8 A;  3VXC A;  1MXY A;  1DSN A;  1UIV A;  4P0I A;  1H3D A;  5IZ1 A;  4UA8 A;  2XXY A;  2FA7 A;  1KA0 A;  1D9V A;  1FTO A;  3MPK A;  2B65 A;  4YIC A;  5L9O A;  2CMO A;  4O7M A;  1Q1K A;  3IJX B;  2RCA A;  2OX3 A;  4OEN A;  4KI0 E;  1N76 A;  1NI9 A;  1FJ9 A;  4PC9 A;  4F2Q A;  1IMD A;  1NV7 A;  4I1D A;  4KR5 A;  4H5F A;  2O51 A;  1M5C A;  5L8D A;  3GBB A;  5K2Y A;  5A5X A;  3MVY A;  4QFP A;  2OBG A;  5I5P A;  2RF1 A;  1IXC A;  1IEJ A;  4HTG A;  4WED A;  2QFL A;  3TFL A;  4TQU Q;  3DP8 A;  5TPA B;  2X26 A;  2ZZX A;  1RYX A;  4NF5 A;  4ZEF A;  1PBQ A;  1YPN A;  3IR1 A;  2HPG A;  2RIN A;  4LA9 A;  3KN3 A;  4M4G A;  5I7I A;  1JNF A;  1P1N A;  3KJT A;  1MY2 A;  1FSA A;  2FVZ A;  4F31 B;  3TTL A;  4U22 A;  1Y20 A;  4P56 A;  3G3J A;  3C32 A;  1JW4 A;  3IOW A;  4ISU A;  4RNS A;  4GX6 A;  4P9K A;  3LSF B;  1B1X A;  2H99 A;  2G93 A;  1DPE A;  1VSO A;  4NG7 A;  3O66 A;  3O29 A;  1R1N A;  3K1N A;  3C9H A;  2XXP A;  3RT8 A;  1LLS A;  4PDH A;  2ZYK A;  1G0I A;  3C31 A;  5I58 A;  4H46 A;  3WAE A;  5H8Q B;  4QFO A;  3OEK A;  4OVR A;  4LUB A;  2DQV A;  1R6Z A;  3QIM A;  4ZEK A;  5CI5 A;  4H65 A;  5JEI A;  2RKM A;  1QKA A;  3KGC A;  1XI6 A;  2HZL A;  2XWI A;  4H45 A;  4AQ4 A;  5AA1 A;  2ZYN A;  5L9M A;  3IOU A;  3LUZ A;  5DT6 A;  2V3U A;  4LP2 B;  4PCD A;  3VDF A;  2CZI A;  1B32 A;  4JWO A;  4ELO A;  1I69 A;  3TZA A;  1N0T A;  3PPP A;  5AA4 B;  1RDX A;  3I5O A;  1SDX A;  5AA2 D;  2WYP A;  5KDT B;  1FTM A;  1EU8 A;  2Q88 A;  5I57 A;  2KR0 A;  2XWK A;  1P1U A;  5ET8 A;  3SZP A;  1Y3N A;  2ZMB A;  3HPI A;  3DEL B;  1SI1 A;  1FPD A;  1MPC A;  4HS7 A;  2R71 A;  3D1R A;  1B0L A;  4NMY A;  1IMA A;  2Z22 A;  1B3H A;  4RY1 A;  4UAB A;  3G3F A;  1FQA A;  4BDQ A;  4GWY A;  4IGR A;  4O8M A;  4YKK A;  3H7M A;  1FBC A;  3I3V A;  1XT8 A;  1BK4 A;  1TWY A;  4KPT A;  3UIF A;  3SEW A;  4YKJ A;  4AB6 A;  2P2A A;  5CBS A;  3PTY A;  2Y7K A;  5KZT A;  3M3K A;  2F78 A;  3MP1 A;  4NF6 A;  4XIG Q;  4GBW A;  1MPB A;  2R6G E;  3SER A;  4PQJ A;  4XTC Q;  4OES A;  2KQZ A;  3VLU A;  4K3F A;  2REG A;  4KYS A;  5KDT A;  4N91 A;  4MEV A;  3MP8 A;  5CMB A;  1B4Z A;  1B58 A;  2PX1 A;  2A5T B;  2OZZ A;  1KZ8 A;  4OAN A;  4WEP A;  1L5T A;  2I48 A;  2ZZW A;  4DI4 B;  3V83 A;  1MXX A;  4F22 A;  4F29 A;  3QUJ A;  4MJO A;  4AS4 A;  5F24 A;  2XWV A;  2HHM A;  1XC1 A;  2I0B A;  3C33 A;  4MH5 A;  1AIV A;  4QXD A;  1FCK A;  4Q8R A;  4N4U A;  1NL5 A;  2ZYM A;  4OYV A;  1NV4 A;  4O3A A;  4OVJ A;  5EQ9 A;  1B51 A;  2FIX A;  5B70 A;  1LBW A;  4G68 B;  4MMP A;  2QS4 A;  2Q74 A;  4MCO A;  3GXA A;  2HZK A;  4OVT A;  5CM6 A;  2LAO A;  4G8N A;  1ZJL A;  2F5X A;  4U4X A;  3PUY E;  1SYI A;  1IXH A;  2PBW A;  4NQ8 A;  1H43 A;  5LTC A;  2CZL A;  3IO6 A;  1LAF E;  4XFE A;  3G3G A;  5LDZ A;  4FEC A;  4GRK A;  1BP5 A;  2B4M A;  2F8D A;  2OWS A;  3KBZ A;  5T3J A;  3LUY A;  4F3S A;  2B3F A;  3EHS A;  2O6A A;  2H5Y A;  1BTJ A;  3OO9 A;  4OA4 A;  2XD3 A;  2Q2C A;  3H03 A;  3UA8 A;  3G3H A;  3ILU B;  3EPE A;  1LST A;  1IUD A;  3TCH A;  4IO6 A;  4PFB A;  3SEU A;  4HCY A;  3BIH A;  1FTL A;  3GZG A;  1NKX A;  3O6G A;  1A55 A;  5DVI A;  5DVJ A;  4DLD A;  1S9T A;  1FW0 A;  4ONY A;  4YU0 A;  1LB9 A;  3MP6 A;  1O64 A;  3TTK A;  1FQD A;  1M5F A;  4YB7 A;  3ONM A;  1D9Y A;  3H6V A;  4MAG A;  1BIY A;  4NX1 A;  1QUL A;  4POW A;  4DIG A;  5I2N A;  3CFZ A;  4EF2 A;  2A5T A;  2ONS A;  3VV5 A;  2AIX A;  3F11 A;  4XEQ A;  3ISP A;  1PB7 A;  4JBZ A;  2XXX A;  3FXR A;  4MNI A;  3C36 A;  3S2V A;  4X9T A;  4NF6 B;  5B7D A;  3IFA A;  4GXS B;  2OK2 A;  5EHM A;  3PV0 E;  4XKN A;  2DYX A;  4KCD A;  4ESX A;  1MXV A;  4PFU A;  4N17 A;  2ALU A;  4EQB A;  1FBP A;  2XXT A;  1SYH A;  3UK4 A;  4GOT A;  2O1M A;  2I58 A;  2THI A;  3H6W A;  3KBR A;  4OVP A;  1POY 1;  1JET A;  2V3Q A;  1URD A;  4ZEB A;  2NXO A;  4ESW A;  1HSL A;  3R26 A;  3T66 A;  2UVG A;  3JYR A;  5CMM A;  2VD2 A;  3TTM A;  3E9X A;  1GV8 A;  4NF0 A;  3T1B A;  2Y7I A;  1B9J A;  1UTB A;  1IIT A;  4ECF A;  2PYY A;  4ELQ A;  1FTK A;  3MZ1 A;  3Q25 A;  4GIZ A;  2DWJ A;  3IOT A;  3T96 B;  5HM4 B;  2AL5 A;  1EYK A;  4MFI A;  3RQT A;  4PFI A;  3V89 B;  3EHU A;  4C1U A;  1LCT A;  3KC1 A;  1NFT A;  1MM7 A;  1YTV A;  3MBP A;  1Y9U A;  2XXV A;  3EKI A;  2VPN A;  5DYH A;  4RPO A;  4NGU A;  3O9P A;  2I3W A;  2UYF A;  3K02 A;  1OLA A;  5IAI A;  1SW4 A;  1Y3P A;  2DVZ A;  4DXB A;  3SEV A;  2Y5L A;  2HXR A;  3JV9 A;  4N13 A;  2BJI A;  1LFI A;  4EQ9 A;  2UXA A;  1K9Y A;  4IO7 A;  2ABH A;  3OSR A;  2QRY A;  4O94 A;  1N04 A;  3U65 A;  3U72 A;  3I6V A;  3KN8 A;  4Q30 B;  2F36 A;  3T9V A;  4FAJ A;  5ELV A;  5ET5 A;  1NNP A;  1FQB A;  1JVY A;  2IEE A;  4X8R A;  1MG1 A;  3QXM A;  3H3G A;  4JDF A;  4RA1 A;  1TFA A;  1PEB A;  3KEI A;  2V84 A;  2HAV A;  1EH3 A;  3FAS A;  1II5 A;  1EZ9 A;  2CZK A;  1ZLQ A;  3MUQ A;  3IOR A;  3MST A;  5ET7 A;  1H76 A;  4QFK A;  2W7Y A;  1YXI A;  3B8B A;  5EHS A;  2DXR A;  2O1L A;  4OTE A;  2B3B A;  3FAT A;  5FBP A;  4ELR A; 
#chains in the Genus database with same CATH homology
 5H8Q B;  1UIU A;  1SW5 A;  3C4M A;  3OXN A;  4MF3 A;  4QFO A;  1N7W A;  1S7Y A;  3OEK A;  3ZKL A;  5EYF A;  1TT1 A;  3Q29 A;  4LUB A;  5I2K A;  2DQV A;  1R6Z A;  5ITO A;  3PPQ A;  1RKM A;  4YZZ A;  4ZEI A;  3FGS A;  5LOM A;  3QIM A;  4IO5 A;  2BJJ X;  4LZ8 A;  2V3T A;  4O3B A;  1MS7 A;  2Y84 A;  4ZEK A;  1QUI A;  4RA1 A;  5L9S A;  1LFG A;  1XVX A;  2P1S A;  3AXF A;  3PMW A;  1D3K A;  4H65 A;  4I9D A;  1IIW A;  2D21 A;  4RXL A;  4U2R A;  1OLC A;  5M2V A;  2RKM A;  5JEI A;  1QKA A;  2RC9 A;  2HCA A;  2QMX A;  4JWX A;  3KGC A;  4LON B;  4NF5 B;  2HZL A;  4Q0C A;  2ONR A;  3VLV A;  2F7C A;  3T93 B;  3PUX E;  5TPA A;  5JK4 A;  4OMB A;  3P7I A;  3RUM A;  1Y1M A;  2Q9T A;  4AQ4 A;  1MQH A;  3O97 A;  1B7Z A;  3PGF A;  4LZ5 A;  4R6H A;  4BDO A;  4DCY A;  4H8I A;  5AA1 A;  2ZYN A;  5L9M A;  2F6P A;  3WAF A;  4G2Z A;  3IOU A;  5I56 B;  3S4U A;  2O7U A;  3O2A A;  5I59 B;  5DT6 A;  4F3P A;  2V3U A;  3OO7 A;  3G3I A;  4LP2 B;  4OER A;  1LAG E;  3HV1 A;  1MQD A;  1B4H A;  3VDF A;  4U21 A;  2FNC A;  2DSF A;  1JEV A;  4C1T A;  3S9M C;  4DZ1 A;  1GVC A;  3U1O A;  4OFJ A;  3B6T A;  3LSL A;  4R72 A;  2Y7W A;  1B32 A;  4E0W A;  1UTH B;  5A5X B;  5J1D A;  1LFH A;  2DP8 A;  4JSO A;  4JWO A;  1A40 A;  3OO8 A;  3TOD A;  3IO4 A;  3HHF A;  4ELO A;  1AOV A;  3ZKK A;  1I69 A;  1SVX B;  3TZA A;  1FQF A;  1N0T A;  3PPP A;  3Q28 A;  4NF4 B;  4XKP A;  4JXI A;  3D4G A;  2I4C A;  3FIR A;  4LZ7 A;  5AA4 B;  5I2N A;  2I4B A;  3I5O A;  4FJP A;  1N3X A;  1SDX A;  3VVF A;  5AA2 D;  3FXU A;  5KDT B;  1FTM A;  1LBB A;  2NWJ A;  1AL3 A;  1EU8 A;  3T9H B;  1Z7N E;  2Q88 A;  5FTH A;  5I57 A;  4ZED A;  1OQH A;  1Y4T A;  2HEU A;  2OWT A;  3CIJ A;  5JTY A;  2YLN A;  1N7X A;  3QSL A;  2QPQ A;  4JSD A;  1USY H;  4R9F A;  4U1O A;  5ITP A;  2HFB A;  4LAT A;  3VVE A;  1P1U A;  3JZJ A;  4E0X A;  1MH3 A;  3LC8 A;  3Q27 A;  1P99 A;  1GR2 A;  3DM0 A;  1Y3N A;  2H98 A;  4OQO A;  2ZMB A;  3HPI A;  1ZBM A;  1NH8 A;  2Y7P A;  3DEL B;  1SBP A;  4GVO A;  4ZS9 A;  4R6Y A;  1JEU A;  1JW5 A;  4EQ7 A;  1POT A;  5CC2 A;  2PT2 A;  3IK6 B;  1SI1 A;  1MXU A;  1MPC A;  3H6U A;  3MVZ A;  4HS7 A;  5ICQ A;  2R71 A;  2V25 A;  3CVG A;  4R2F A;  1US4 A;  4TOZ A;  3K0V A;  4F39 A;  1B0L A;  1B2H A;  4NMY A;  2DXY A;  2O68 A;  2PT1 A;  2Z23 A;  2DWI A;  3K2D A;  3KFM A;  3KJ7 A;  5FHO A;  4EXL A;  1B7H A;  3M8U A;  3UP9 A;  2Z22 A;  1B3H A;  2I49 A;  4NWC A;  4RY1 A;  4G68 C;  3G3F A;  3PPR A;  1FQA A;  5DVF A;  5CBR A;  4NF8 B;  3SES A;  3TTN A;  4BDQ A;  3IJO B;  4TLL B;  1NH7 A;  4IGR A;  2XXI A;  4ZE9 A;  4YKK A;  4KCC A;  1MQG A;  2R9J A;  4R2B A;  3H7M A;  4H8J A;  3CG3 A;  2E0S A;  2GHA A;  4EUO A;  5ISU A;  2I3V A;  4JB7 A;  3I3V A;  1XT8 A;  2G29 A;  3CSG A;  5HBC A;  3ZSF A;  1TWY A;  2I0C A;  4KPT A;  1BKA A;  4QSE A;  1AMF A;  2ANJ A;  2O7I A;  1XOC A;  1B3L A;  4QHQ A;  3UIF A;  3UN6 A;  1ZTY A;  3SEW A;  1D4N A;  4YKJ A;  3BFT A;  3KSX A;  1MQJ A;  5DEX A;  2P2A A;  4MBP A;  4AB6 A;  2O84 X;  5CBS A;  3G3K A;  2Y7K A;  3KN7 A;  3TQW A;  5KZT A;  3M3K A;  4OET A;  5CMC A;  1B6H A;  2F78 A;  2XX7 A;  3MAM A;  4KFQ A;  1ATG A;  3O6I A;  4OHN A;  3B7D A;  1YAE A;  3MP1 A;  3RN8 A;  4NF6 A;  1IXI A;  1P1W A;  4XIG Q;  2FYI A;  4ZZE A;  4KYD A;  1MPB A;  1B40 A;  1OMP A;  2R6G E;  5JTY B;  2ZNT A;  3SER A;  1OQG A;  1QVS A;  1WDN A;  3FJ7 A;  3PMV A;  1N3W A;  4I62 A;  4OES A;  4PQJ A;  4XTC Q;  4YKI A;  1PBP A;  3U93 A;  4K3F A;  1B5I A;  2M8C A;  3VLU A;  2REG A;  4KYS A;  5I84 A;  5KDT A;  1QUK A;  1VFE A;  1MY1 A;  4U4S A;  1MRP A;  4U23 A;  2AYS A;  3MP8 A;  2ESN A;  4GF8 A;  3K00 A;  4NF4 A;  5CMB A;  4GL8 A;  1B4Z A;  1B58 A;  2PX1 A;  2VGQ A;  4GXA A;  5TP9 A;  2A5T B;  3MPL A;  2OZZ A;  3K01 A;  4OEV A;  4WEP A;  1A99 A;  1L5T A;  2DVC A;  2I48 A;  4DE8 A;  3FXQ A;  4XKQ A;  3V83 A;  1MXX A;  3MZB A;  4F22 A;  4F1U A;  2REJ A;  2VHA A;  4N6P A;  3LR1 A;  4IO2 A;  3QUJ A;  4F29 A;  2YPN A;  3MZ9 A;  3WAE A;  1TXF A;  3IAZ A;  5I59 A;  2UVJ A;  1KWH A;  3CFL A;  1XC1 A;  2UVH A;  2Z8F A;  3QK6 A;  2XX8 A;  1IZ1 A;  1NMU A;  4L17 A;  3TQL A;  2UVI A;  2E1S A;  2GFE A;  2I6E A;  5CRY A;  3PD9 A;  4PFW A;  3HCQ A;  2I0B A;  3FVK A;  3IL1 B;  1CB6 A;  1URG A;  3C33 A;  2NVU B;  2ZXT A;  3OMB A;  4QFL A;  1SW2 A;  1B46 A;  3RLF E;  4F19 A;  3ECR A;  2H4I A;  1NNT A;  2Q89 A;  4MH5 A;  4R75 A;  5IKB A;  1AIV A;  1FCK A;  4Q8R A;  1FTJ A;  1NL5 A;  4FEB A;  4H6D A;  1LAX A;  2ZYM A;  2F97 A;  3N5L A;  4TLM B;  2QL3 A;  1B5J A;  2VP1 A;  4OYV A;  3E4R A;  1F9B A;  4POX A;  4O3A A;  4OVJ A;  3L6H A;  4H1X A;  3H06 B;  3SKP A;  2DOJ A;  3HHG A;  1MPD A;  1B51 A;  3OO6 A;  5B70 A;  3K6W A;  4Q5T A;  5AE4 A;  3FJG A;  4OWD A;  2OCU A;  3C34 A;  4G68 B;  1Y3Q A;  3OD7 A;  1B3G A;  5FHN A;  4PE5 B;  2QS4 A;  4MLV A;  3KSJ A;  3K6U A;  3W9V A;  4YMA A;  4ELP A;  2V93 A;  3VE1 B;  3M3F A;  2XX9 A;  3TCG A;  4F3G A;  3GXA A;  2HZK A;  3FZV A;  3TMG A;  4DXU A;  3MVW A;  2Z8E A;  1ZMG A;  3D4C A;  3CRB A;  4U1Z A;  3TYH A;  2LAO A;  4G8N A;  4JWY A;  5CM6 A;  3CSB A;  5I58 B;  1ZJL A;  2F5X A;  3BFU A;  4OFL A;  4U4X A;  1I6A A;  1B3E A;  3BKI B;  4FE8 A;  2Q2A A;  1Q35 A;  3PUY E;  1SYI A;  3OEL A;  1IXH A;  2PBW A;  2F34 A;  4GWO A;  4IGT A;  4QSC A;  3SDF A;  3S9N C;  3TEP A;  2IA4 A;  5DTB A;  5H8H A;  4M1V A;  1ZU0 A;  3K1P A;  1DTG A;  5F7V A;  1H43 A;  3OSQ A;  1URS A;  2CZL A;  3IO6 A;  1EZO A;  3OOA A;  1LAF E;  1LGB C;  4NE4 A;  4UAC A;  3G3G A;  2D3I A;  4NTL A;  1B7U A;  4QF9 A;  4FEC A;  4G8H A;  4GRK A;  2X7P A;  3TDJ A;  4DCX A;  1BP5 A;  5H8H B;  2DWA A;  3RTW B;  2F8D A;  2OWS A;  3LUY A;  3N94 A;  1PB8 A;  2XXU A;  2B3F A;  2Q8J A;  4F3S A;  3EHS A;  3LBS A;  4RK2 A;  4X1B A;  2O6A A;  1M5D A;  2H5Y A;  1BTJ A;  3OO9 A;  3PD8 A;  4X1D A;  4N07 A;  2X7Q A;  2XD3 A;  2Q2C A;  3H03 A;  4QRZ A;  4H67 A;  3UA8 A;  3FVG A;  1MDP 1;  3CI8 A;  1A54 A;  3G3H A;  1PDA A;  3ILU B;  3EPE A;  5H8N A;  1LST A;  2F6G A;  1IUD A;  1MQI A;  2WKY A;  3O6H A;  3A3U A;  4G68 A;  2DE3 A;  3TCH A;  4F18 A;  4P0G A;  4IO6 A;  3SEU A;  1B3F A;  4MLQ A;  4R9G A;  3T9X B;  2NUV A;  3IB2 A;  3MVX A;  1SQY A;  3RT6 B;  4HW8 A;  4LQ5 A;  3L6G A;  4HCY A;  4G8M A;  1J1N A;  2XXW A;  1ZKB A;  2D5W A;  2QS3 A;  3N6U A;  1US5 A;  3OEN A;  1NNK A;  1FTL A;  3GZG A;  3KOS A;  1NKX A;  1A8E A;  2QJE A;  3DP6 A;  3O6G A;  4KD5 A;  1XHY A;  1T0K A;  1A55 A;  2F7B A;  5DVI A;  3RTF B;  3RPW A;  1B52 A;  4RJZ A;  3VVD A;  1LB8 A;  5DVJ A;  1HSE A;  4DLD A;  1P1Q A;  1S9T A;  1FW0 A;  2DS9 A;  4ONY A;  1TFD A;  4YU0 A;  1M5B A;  1LB9 A;  3MP6 A;  1O64 A;  1DOT A;  4BLA A;  1ELJ A;  3TTK A;  4OXV A;  1H44 A;  4EF1 A;  1FQD A;  2XXQ A;  3UGW A;  3H4Z A;  1M5F A;  3G7W A;  4WXJ A;  4YB7 A;  2OJT A;  1ZIU A;  4Z0I A;  2ONK E;  3T22 A;  5CMK A;  3ONM A;  1D9Y A;  4KQP A;  1S50 A;  3TTR A;  3H6V A;  4PET A;  1UQW A;  3RNN A;  1MXW A;  3VLW A;  1BIY A;  3HST A;  5K2X A;  5ICT A;  4DDD A;  1QUL A;  1XVY A;  4POW A;  1GGG A;  1EZP A;  1OVB A;  1DMB A;  3MQ9 A;  3QUF A;  2P0S A;  3H6T A;  1DPP A;  4DIG A;  3CFZ A;  1Y1Z A;  3KG2 A;  3MWB A;  4GD5 A;  2A5T A;  2GH9 A;  2GHB A;  3PUW E;  5TP9 B;  4EF2 A;  1I6B A;  3K1M A;  4F2O A;  2ONS A;  3ILT B;  3VV5 A;  1Z7M E;  2AIX A;  4GLI A;  1MY4 A;  3IX1 A;  4XXU A;  2VD3 A;  4C0R A;  3HO7 A;  3F11 A;  1MDQ A;  1ANF A;  2A5S A;  3O28 A;  3PUV E;  3FV1 A;  5H8F B;  1WVJ A;  1PB7 A;  2VOZ A;  2Z8D A;  3PPO A;  3Q26 A;  3CFX A;  3TPA A;  1R9L A;  4RYA A;  4JBZ A;  4IO3 A;  1YCJ A;  1JVX A;  1QJM A;  2XXX A;  4THI A;  3FXR A;  3U92 A;  3QYT A;  3A3C A;  3C36 A;  3S2V A;  4X9T A;  4YB5 A;  2YJP A;  4NF6 B;  5CI5 A;  5B7D A;  1IQ7 A;  4GXS B;  2OK2 A;  2PMS A;  3HN0 A;  1IXG A;  3MW0 A;  4ZE8 A;  5TU0 A;  5EHM A;  2H25 A;  1I6Q A;  3EQ1 A;  3GBA A;  1UTB B;  2OLB A;  1N84 A;  3PV0 E;  4G77 A;  4NWD A;  4XKN A;  2DYX A;  4KCD A;  1OVT A;  1MXV A;  3KZG A;  5DEX B;  3PPN A;  4ESX A;  4F1Y A;  4X48 A;  3UOR A;  1VE4 A;  3SET A;  3SEX A;  2XHD A;  4RK9 A;  4ZEC A;  4PFU A;  4OEU A;  3V5A A;  3K6X A;  3THI A;  3RGY A;  1R9Q A;  4WKM A;  3S9L C;  3LSW A;  1MM6 A;  2ALU A;  2QS1 A;  4EQB A;  1JW1 A;  1PB9 A;  3B6Q A;  4OZ9 A;  4KYE A;  4IB2 A;  1O63 A;  2XXT A;  1MY3 A;  3DLN A;  4G4P A;  4LQ2 A;  4YKP A;  1SYH A;  3TKD A;  3V8X B;  2DE4 A;  4YMB A;  3UK4 A;  5BUU A;  4H0W A;  4GOT A;  2ZYO A;  4BDM A;  2O1M A;  5KCJ A;  2I58 A;  2THI A;  3H6W A;  1USY E;  3KBR A;  1POY 1;  3CG1 A;  4FIM A;  4NF8 A;  3TEL A;  5KCJ B;  1JET A;  2QSX A;  3E13 X;  1MXY A;  2DWH A;  4RPN A;  1DSN A;  1RYO A;  1Y4C A;  3VXC A;  2V3Q A;  5F1Q A;  1UIV A;  3B6W A;  5H8F A;  1B5H A;  4P0I A;  5BWJ A;  1URD A;  3FVN A;  4ZEB A;  2NXO A;  4EXK A;  3FJM A;  4ESW A;  1H3D A;  3U8Q A;  1HSL A;  3W9W A;  4BDR A;  3R26 A;  3T66 A;  4UA8 A;  2UVG A;  2XXY A;  2FA7 A;  1QW0 A;  3JYR A;  1D9V A;  1FTO A;  3MPK A;  5CMM A;  2B65 A;  2GRV A;  2VD2 A;  4FOR A;  4YIC A;  3W15 C;  3TTM A;  3TCF A;  3E9X A;  1QUJ A;  3GLB A;  1GV8 A;  2Y7I A;  1B9J A;  1UTB A;  1Q1K A;  2CMO A;  1SI0 A;  5L9O A;  2HAU A;  3IJX B;  4LVQ A;  2UYE A;  4QFN A;  1IIT A;  2QS2 A;  3TUS A;  2RCA A;  4F3B A;  1PC3 A;  4KI0 E;  4OEN A;  3EHT A;  4ECF A;  1N76 A;  2PYY A;  4EDP A;  4O3C A;  1O7T A;  4ELQ A;  1SW1 A;  1FTK A;  3MZ1 A;  3Q25 A;  3ZS6 A;  4I8C A;  3E3K A;  4GIZ A;  1A8F A;  4F2Q A;  5I57 B;  3N6T A;  3FUZ A;  5AA3 A;  2DWJ A;  1CE2 A;  4R74 A;  3IOT A;  3T96 B;  1HSJ A;  5HM4 B;  2AL5 A;  4YAH X;  3S9E A;  4IO4 A;  3SEY A;  5AA4 A;  4I1D A;  3PU5 A;  1XS5 A;  4KR5 A;  3A09 A;  4H5F A;  2ZNU A;  3FVO A;  4MFI A;  3FV2 A;  3RQT A;  2O51 A;  1M5C A;  3V89 B;  3U94 A;  4DXC A;  5L8D A;  3EHU A;  3GBB A;  5K2Y A;  1A7L A;  4FAT A;  5I2N B;  2HQ0 A;  4C1U A;  1BLF A;  1LCT A;  1UTH A;  3MVY A;  5A5X A;  4QFP A;  1NFT A;  4NED A;  1MM7 A;  1YTV A;  2HXW A;  2XXR A;  3MBP A;  1Y9U A;  1M5E A;  2XXV A;  3LSX A;  5FTI A;  4HCW A;  2OBG A;  3BBR A;  2QMW A;  4YB6 A;  3TAJ A;  5DYH A;  3FD3 A;  4RPO A;  2RF1 A;  4FED A;  1IXC A;  1IEJ A;  4HTG A;  2AL4 A;  3T9U A;  3USD A;  1JQF A;  4H5G A;  5I56 A;  2H9B A;  3DP4 A;  3O9P A;  2I3W A;  4WED A;  3IB0 A;  2UYF A;  5HPQ A;  3K02 A;  1OLA A;  3TFL A;  1OIB A;  4TQU Q;  1SW4 A;  5IAI A;  3EN3 A;  1Y3P A;  2DVZ A;  4R6K A;  1AH5 A;  4DXB A;  4Z7E A;  3SEV A;  1P1O A;  3QAX A;  3RY3 A;  3DP8 A;  3IB1 A;  2X26 A;  3EF7 A;  3JV9 A;  4GL0 A;  4N13 A;  3R6U A;  4QSD A;  1LFI A;  4ZDM A;  1RYX A;  1B1H A;  1SD3 A;  1B05 A;  4NF5 A;  4BDN A;  3VFJ A;  4ZEF A;  4EQ9 A;  3OEM A;  1PBQ A;  3KOT A;  2UXA A;  1LCF A;  1YPN A;  4IO7 A;  2DE2 A;  4GQO A;  2ABH A;  4ND9 A;  1FQC A;  3IR1 A;  3OSR A;  2NOO A;  2QRY A;  2RIN A;  3KN3 A;  4LA9 A;  3R7X A;  2XXH A;  5FHM A;  4M4G A;  1N04 A;  1JNF A;  1P1N A;  3KJT A;  2Y7R A;  5I2K B;  4ZZA A;  3U72 A;  3CR9 A;  3I6V A;  3KN8 A;  2F36 A;  4Q30 B;  1MXZ A;  1MY2 A;  2F7A A;  4F1V A;  2KLF A;  5H8S A;  3T9V A;  4F31 B;  4FAJ A;  5ELV A;  3M3L A;  1MY0 A;  1NNF A;  1VFD A;  4PP0 A;  5H8N B;  3C35 A;  5H8Q A;  3TTL A;  1NNP A;  4U22 A;  1Y20 A;  5TPA B;  1FQB A;  1JVY A;  3G3J A;  3VXB A;  2RC8 A;  4IY5 A;  2IEE A;  1MG1 A;  3QXM A;  3N26 A;  1LAH E;  3C32 A;  3H3G A;  3PMX A;  4JDF A;  1TFA A;  1PEB A;  1DTZ A;  1JW4 A;  3IOV A;  2V84 A;  3K4U A;  2HAV A;  3KEI A;  4KHZ E;  3IOW A;  1MH4 A;  5AA2 A;  1EH3 A;  4R73 A;  3FAS A;  2XD2 A;  4ISU A;  3MC2 A;  1QKB A;  4RNS A;  1II5 A;  1EZ9 A;  1VR5 A;  1ZLQ A;  3LSF B;  1B1X A;  2H99 A;  2PVU A;  2G93 A;  1DPE A;  3ODB A;  3MUQ A;  1VSO A;  3IOR A;  3O66 A;  3O29 A;  1H76 A;  4AB5 A;  2RC7 A;  1R1N A;  4OFO A;  4QFK A;  2W7Y A;  1GTK A;  3K1N A;  2RCB A;  4P11 A;  3C9H A;  2XXP A;  4GFR A;  5EHS A;  2DXR A;  3RT8 A;  2O1L A;  3PUZ E;  4XKR A;  1FQE A;  5AA2 B;  1LLS A;  2O69 A;  4OTE A;  4BDL A;  2B3B A;  3FAT A;  2ZYK A;  1H45 A;  2F35 A;  3K6V A;  3MJN A;  3C31 A;  4ELR A;  1B0H A;  1LBC A;  5I58 A;  1WOD A;  2ZNS A;  4PFT A;  4IY6 A;  4PFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...