4LQ2A

Crystal structure of ligand binding domain of cysb, a lysr member from salmonella typhimurium in complex with effector ligand, o-acetylserine
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium in complex with effector ligand, O-acetylserine
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 62
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lq2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lq2A02
4JSDA 4DCXA 3IOVA 5HPQA 4GOTA 3FASA 1B0LA 4PFTA 1EH3A 4IY6A 2NUVA 2A5TB 3MVYA 3DP6A 1R9QA 3OD7A 4PP0A 4OEVA 4KHZE 1Y9UA 4R9FA 3C36A 2M8CA 1H43A 3O29A 2ZNSA 1QKAA 3ZKLA 2CMOA 4QHQA 3IR1A 1TWYA 1EZOA 1LB8A 2PYYA 4IGRA 4G8HA 2DXYA 3FV1A 2O6AA 2F6GA 4R6KA 2RC8A 5CMBA 3TTKA 2Z23A 3OO6A 4EDPA 5CRYA 5I84A 1WODA 1I69A 4DE8A 1IXIA 5I59A 1J1NA 3VV5A 2Y7IA 3O2AA 4X1DA 4H8IA 2Y7KA 1JEVA 3Q25A 4WEDA 3TMGA 5A5XB 1Q1KA 3IORA 4YZZA 3U1OA 3IK6B 2UXAA 3FVOA 3SDFA 4TQUQ 1UIUA 1B3FA 4OHNA 2XXYA 4OETA 2H25A 3U92A 3OO8A 1BP5A 1UQWA 1B3HA 2I4BA 3OEKA 2I0CA 2Z8EA 3KZGA 2Q2CA 1YTVA 4R75A 4R6YA 3MP6A 1B7UA 1H76A 3I6VA 1RYOA 4R2FA 4XXUA 3PPOA 1BLFA 2RC7A 4OTEA 5F1QA 1DTGA 3O9PA 3TAJA 4YAHX 3TDJA 2OLBA 4NF4A 4YB6A 3T66A 4ECFA 3S9LC 3KN3A 3AXFA 4KR5A 1QKBA 2H98A 4BDLA 3RGYA 1FCKA 4F3GA 4O3BA 5CBRA 2REJA 2DSFA 1LCTA 3EPEA 1SBPA 3K6WA 2AIXA 1R1NA 2DE2A 3ZKKA 2RINA 4X48A 4AB6A 2G93A 5FHOA 5ICQA 3KEIA 2Q9TA 4LP2B 4YB7A 2DQVA 1MXYA 3LC8A 1WDNA 3S4UA 3S9MC 5DT6A 1O7TA 4P0IA 4ZEFA 4ZZAA 1UTBA 2UYEA 4EQ7A 5CI5A 3LSWA 4KPTA 1MXXA 2F6PA 2ESNA 3OSQA 1A40A 2DWJA 3W9VA 1I6BA 4OFOA 3TQWA 2O68A 3WAFA 3UK4A 1P1QA 4LATA 1T0KA 3U94A 1POTA 3B7DA 4F29A 3OELA 5LOMA 4FAJA 5AE4A 1P1NA 5DEXA 2ZYKA 4LQ5A 4AQ4A 5I2NB 2DWHA 3SEXA 4TLMB 1S9TA 3OOAA 3K02A 4N07A 4U4XA 4LUBA 3RUMA 4GIZA 1B6HA 1DOTA 3MUQA 4RXLA 1ZJLA 3MVXA 1MS7A 2E1SA 2O69A 4IB2A 3QYTA 1L5TA 1N3XA 1QUKA 1PDAA 1B05A 1VFEA 1WVJA 4H0WA 1ZIUA 1B0HA 2QRYA 2XXTA 3DLNA 3CFZA 2D3IA 5CMKA 1MQHA 3VE1B 3V89B 1MH4A 2VOZA 2UVGA 1A7LA 1NL5A 2F97A 5H8NB 5I56B 1JVXA 3MPKA 3ECRA 4H5GA 1XVYA 3RPWA 2VP1A 4ELPA 1D4NA 2Q88A 2XX7A 4ZZEA 4ZS9A 4OWDA 3PUYE 2V3QA 3K2DA 1URGA 4XKRA 1TXFA 3O28A 3MBPA 4F3SA 1B51A 3KOTA 2V3TA 1Y1MA 3K1MA 1JW5A 2GFEA 4WXJA 1B52A 2Y84A 5BUUA 2P2AA 4U4SA 2ZYNA 4KCDA 3BKIB 3MZBA 3RTFB 1MXVA 3PD9A 3CIJA 2WKYA 5JEIA 4BDNA 1N76A 3QUFA 2OJTA 1LFHA 3EF7A 2V3UA 3RLFE 1P1WA 3I3VA 3UGWA 3IJOB 3GXAA 3KN7A 2OZZA 5I2KB 2I3VA 4F39A 3UA8A 1I6QA 2I49A 3KJ7A 4NEDA 2I6EA 1US4A 3PD8A 3PUVE 3DP4A 2X7QA 2I4CA 4BDQA 4IO7A 3SEYA 4KQPA 3IO6A 3O6IA 2O51A 3CFXA 4EQ9A 4BDOA 2YLNA 4ONYA 1B58A 3TEPA 3MVWA 1FTKA 1Y20A 1JQFA 4H67A 4RA1A 1FQEA 3H6VA 2XXHA 2XXPA 5L9SA 4U1ZA 1IQ7A 3O6HA 3C9HA 4IY5A 1USYH 1BKAA 3R26A 4GD5A 1LBCA 3QAXA 3GZGA 2Z8DA 2X7PA 1JW4A 1XS5A 4KCCA 4Z0IA 5I57B 3G3JA 3VVEA 2XX8A 4H5FA 4F19A 3H06B 3WAEA 2O7UA 3T9HB 5TPAA 3PMXA 4DLDA 1OLAA 3FJ7A 5H8FA 4E0XA 1YAEA 4H8JA 3D4CA 1NNPA 2REGA 4XIGQ 3FJGA 4F2OA 1NNKA 4JBZA 1KWHA 1OQHA 2QSXA 3G3IA 1QULA 2HAVA 3MZ1A 1LCFA 2YPNA 1DMBA 4X1BA 2XXUA 4KI0E 1JEUA 1S50A 1BTJA 3TYHA 4F22A 3TCFA 3EN3A 4U22A 4LZ7A 2DOJA 3CG3A 3E13X 4HTGA 3PUXE 4MH5A 1B1XA 4FE8A 1B7HA 4KYSA 1D9VA 2DYXA 1A54A 5DTBA 2NXOA 3MAMA 4MFIA 4RPNA 2D21A 2DVCA 2GRVA 3LSLA 2XD3A 3IOWA 3USDA 5ITOA 1URSA 1A99A 1Y3NA 2HZKA 5H8HB 4KYDA 3ODBA 2DVZA 3RY3A 5KDTB 5JK4A 1POY1 1H45A 5DEXB 1CE2A 3PPQA 1D3KA 2DS9A 3VLUA 3C34A 1MRPA 4U23A 1N7XA 1ANFA 4ZE8A 4QFPA 1IITA 4NF5A 4I62A 1UTHB 3KJTA 3R7XA 4POXA 2F78A 2ZNTA 1LFIA 3TQLA 3Q29A 3GBBA 4XKPA 1LLSA 3MC2A 4RPOA 5DVJA 2F7CA 2H9BA 4ZDMA 2ZYOA 4FEDA 1LB9A 1MM6A 3IB0A 1ZMGA 3ONMA 3S2VA 4NF6A 2H99A 1IXGA 4O3CA 4RYAA 5ICTA 2Y7WA 2H5YA 2IEEA 2ANJA 3MJNA 4WEPA 2F7AA 4R9GA 2HCAA 1P99A 4YMBA 1H3DA 3EHSA 3UN6A 5K2XA 3IB2A 1US5A 2P1SA 5DYHA 5KCJB 3HHGA 3KN8A 3RQTA 5CM6A 3TCGA 1B32A 3C31A 3B6WA 4F18A 4EF1A 3RN8A 1Z7ME 3PPPA 4O3AA 4GQOA 5AA4A 5AA2B 3JV9A 4JWXA 5FTHA 3LR1A 5TP9B 3VLVA 4OZ9A 5I58B 4EXLA 1NKXA 1YCJA 4LONB 4PFYA 4ZEBA 4GWOA 4JSOA 1QUIA 3KG2A 3K6VA 1Y4TA 4MF3A 3E9XA 3T93B 4OXVA 4U1OA 3ILUB 4RK2A 4C0RA 4ZECA 2A5TA 4FORA 1XVXA 1B5IA 1HSLA 1B3EA 1Y3PA 4F1VA 4MLVA 3DM0A 2R71A 2DWAA 4OFLA 4IO3A 4QSEA 2NWJA 1B7ZA 5ISUA 3JZJA 4IO6A 4IO5A 3CR9A 3HV1A 3VDFA 1TFDA 1LAXA 3VXCA 3QK6A 4E0WA 5HM4B 3PUWE 1PB7A 4GFRA 3MPLA 5FHMA 1LAHE 1NH7A 3FZVA 4GF8A 2HQ0A 1O64A 3CRBA 1MY3A 2UVJA 1OIBA 3T22A 1Q35A 5AA1A 2Y7RA 3N6UA 3CVGA 3T9UA 2OWSA 1MPCA 4EF2A 4TOZA 1MXZA 1H44A 1B1HA 3W9WA 4GLIA 1SW2A 3FIRA 3BFTA 4DZ1A 3LUYA 3S9EA 5DVIA 1N0TA 4KFQA 4F3PA 2DE3A 3O6GA 5A5XA 2F36A 1N84A 1M5DA 1JW1A 4R74A 4YKJA 1XHYA 4YU0A 2UVIA 2XXIA 3UIFA 2QPQA 1B4HA 4PE5B 3FV2A 4Z7EA 4MBPA 5H8QB 5KZTA 4HCYA 2PMSA 2PT1A 4BDRA 1MXWA 3SEUA 4OERA 3MWBA 1B3GA 3QSLA 2QL3A 4NF8B 3HCQA 3GBAA 4ISUA 3SERA 1MH3A 2D5WA 4ESWA 3SEWA 3MP1A 3FXRA 3CSGA 2HXWA 1P1OA 3N6TA 4H1XA 3DP8A 4DXCA 4EXKA 1VSOA 3K00A 2QS1A 1PB9A 5BWJA 1M5EA 3FXUA 1MM7A 2ZYMA 2HAUA 2V93A 1MPDA 3E4RA 1QJMA 1PBQA 3TUSA 2HZLA 5L9OA 4XTCQ 1QUJA 4GRKA 4IO4A 3H6WA 5ITPA 2VGQA 4ND9A 1ELJA 1OVTA 3G3FA 3R6UA 1LAGE 2XXWA 3HSTA 4KYEA 5HBCA 2PT2A 4M1VA 1AIVA 3N26A 4KD5A 5DVFA 4HCWA 1B5HA 3P7IA 3IB1A 2PVUA 1B3LA 1SQYA 4IO2A 3K6XA 1EU8A 1ATGA 4OVJA 2QS4A 1TT1A 2UYFA 2VD3A 4L17A 3BFUA 3PPNA 4QSDA 4OYVA 2HEUA 4XKQA 3FVNA 4G68A 4DIGA 2AYSA 1PB8A 1FQDA 3M3FA 5I59B 5CMMA 3K1NA 2DWIA 2ONKE 3FATA 3U72A 4F3BA 1NH8A 4H65A 5FTIA 3G7WA 1HSEA 2UVHA 1IXHA 1IIWA 5JTYA 2RF1A 1B9JA 2F7BA 1ZU0A 2F34A 1FQAA 1AH5A 4U21A 3LBSA 3PMWA 4Q8RA 4R6HA 3ZSFA 3TTRA 5I2NA 1FTLA 2Z22A 2O84X 3MZ9A 5IAIA 4DDDA 1FQBA 3M8UA 4QSCA 3H6TA 4FATA 2GHBA 5L9MA 3KOSA 4G4PA 4GXSB 2HFBA 1IUDA 4HS7A 2R6GE 3SETA 4NF4B 3M3KA 3OEMA 3QUJA 4M4GA 1FTMA 3HHFA 4HW8A 4LZ5A 2AL4A 1NNTA 4AB5A 4OENA 5AA4B 3N5LA 1ZTYA 2F8DA 5H8NA 5I56A 4BLAA 2VD2A 3SKPA 3FJMA 3C32A 4Q0CA 3TPAA 1FW0A 1B2HA 4EUOA 3K6UA 2ONRA 1DTZA 3OXNA 1HSJA 3K1PA 2F5XA 4ZEDA 4X9TA 1LFGA 4PQJA 1MQJA 4JWYA 2FNCA 3PGFA 3VVFA 2FA7A 2KLFA 1LBBA 3TFLA 1SI1A 3FGSA 4TLLB 1UTBB 4QFNA 2ZMBA 3O97A 4ELRA 1R9LA 3FD3A 1MXUA 2XHDA 2DE4A 2RCBA 3QIMA 5H8SA 4OFJA 3L6HA 4NTLA 3KBRA 2XD2A 3PPRA 4JXIA 2DP8A 3KGCA 1AMFA 4F2QA 1LGBC 4DXBA 4C1UA 3HN0A 4P0GA 1CB6A 1GGGA 3LSXA 4OQOA 2ZXTA 1USYE 5I2KA 4RY1A 3PMVA 1FTJA 2RC9A 5F7VA 4NMYA 1A8EA 1MDP1 3GLBA 4QFLA 2B3BA 1ZKBA 4RNSA 2B3FA 2G29A 3FVGA 1NNFA 2Q8JA 3RNNA 1SVXB 3Q27A 1MQIA 1SW5A 3FVKA 2H4IA 1SI0A 4LZ8A 2NVUB 4G2ZA 1I6AA 3TZAA 3VVDA 1F9BA 1OLCA 1YPNA 3Q26A 4FEBA 3I5OA 1R6ZA 1MQDA 3IL1B 2O1MA 3OO9A 3IAZA 1XC1A 3U93A 2ABHA 3TELA 3PV0E 4I9DA 2Y7PA 2O1LA 4QFKA 1GVCA 5I57A 3TCHA 4YKIA 2FYIA 1SD3A 3U8QA 3TODA 5CBSA 3K4UA 2XXRA 1SW1A 1SYHA 4N6PA 1MG1A 4GVOA 1OVBA 4YKKA 1AOVA 3CSBA 4ELQA 4I8CA 2I48A 3G3KA 3MP8A 1TFAA 1MY0A 3H4ZA 5AA2D 1GV8A 1MY4A 1VFDA 4OEUA 2OCUA 3HPIA 1FQCA 4JWOA 2O7IA 2ONSA 3BBRA 4RJZA 1Y3QA 4DCYA 2XXXA 2CZLA 2Q2AA 1PC3A 1NFTA 3Q28A 3K01A 3OENA 2THIA 3M3LA 5ELVA 2PBWA 1N04A 3CG1A 3IX1A 5FHNA 1NMUA 4R2BA 4LA9A 4QF9A 4YB5A 3OSRA 5M2VA 4PFWA 1IXCA 2PX1A 1MY1A 1N7WA 1O63A 1RYXA 4MLQA 3C4MA 4K3FA 1MY2A 3ZS6A 2E0SA 3V8XB 3H3GA 1JNFA 4G68B 3G3GA 4ELOA 3QXMA 3K0VA 4LQ2A 4G8NA 4F31B 1XT8A 3B6TA 5H8HA 1QW0A 4RK9A 1MPBA 2YJPA 5KDTA 5TU0A 3VLWA 5JTYB 4NE4A 2W7YA 1Y1ZA 1DSNA 4FIMA 2I58A 3IJXB 5B7DA 4ZE9A 4F1YA 1MDQA 2V25A 4G8MA 2A5SA 3OMBA 2GH9A 2QJEA 3E3KA 1UTHA 5EHMA 4GL8A 2ALUA 2BJJX 3C35A 4G68C 4FJPA 3EHTA 4H6DA 4I1DA 2RKMA 5L8DA 4YKPA 4JB7A 2XXVA 3D4GA 3C33A 1IEJA 5TPAB 1B4ZA 1M5CA 4OMBA 4WKMA 5J1DA 2R9JA 5H8FB 3TTMA 4F1UA 1Z7NE 4GL0A 1B40A 4OESA 2AL5A 1FQFA 3KFMA 3H03A 1SW4A 2QS2A 4ESXA 3KSXA 3H6UA 1XOCA 3RT6B 1VR5A 1OQGA 3EQ1A 3G3HA 2VHAA 1FTOA 4PFUA 3CI8A 1PEBA 1JVYA 3THIA 3ILTB 4JDFA 1A55A 5KCJA 3SESA 3TTNA 2QMXA 3RT8A 2IA4A 3HO7A 1VE4A 1II5A 3UORA 1GTKA 5AA2A 1UIVA 2OWTA 3L6GA 4YMAA 3OO7A 2V84A 1ZBMA 5TP9A 4R73A 3B6QA 3IO4A 4Q30B 1N3WA 2B65A 4UACA 3FXQA 5I58A 3IOTA 2LAOA 2OBGA 1D9YA 4G77A 3T96B 3DELB 2QMWA 2ZNUA 4THIA 3CFLA 1ZLQA 1M5FA 3LSFB 4PETA 2Q89A 1S7YA 1JETA 1PBPA 4NWCA 4GXAA 3EHUA 3V5AA 3KSJA 1M5BA 4QFOA 2XX9A 1P1UA 1BIYA 2RCAA 4NF5B 4UA8A 4R72A 3IOUA 4ZEIA 4DXUA 1SDXA 3JYRA 3MVZA 4EQBA 3FUZA 1AL3A 5K2YA 3VFJA 2P0SA 3SEVA 2I3WA 4ZEKA 3T9XB 5IKBA 3T9VA 1URDA 1RKMA 4LVQA 1SYIA 4NF6B 2QS3A 2X26A 2XXQA 3VXBA 5CC2A 3S9NC 3UP9A 4POWA 3V83A 3F11A 3MQ9A 1B46A 1LAFE 3PU5A 4U2RA 1EZPA 4P11A 4NWDA 1A8FA 2DXRA 1LSTA 1GR2A 1B5JA 3O66A 4QRZA 5H8QA 1EZ9A 2I0BA 5EHSA 3A09A 1OMPA 4N13A 1MQGA 3W15C 4IGTA 2NOOA 2F35A 3TKDA 4XKNA 5AA3A 1IZ1A 3A3CA 3PUZE 4C1TA 4NF8A 4Q5TA 4BDMA 3A3UA 1Y4CA 3H7MA 5B70A 4FECA 3TTLA 2GHAA 5CMCA 5EYFA 4YICA 2OK2A 2Z8FA 1DPPA 1QVSA 1DPEA 3RTWB 3MW0A 3N94A
chains in the Genus database with same CATH superfamily
4JSDA 4DCXA 3IOVA 5HPQA 4GOTA 3FASA 1B0LA 1FJ9A 4PFTA 3RYDA 1EH3A 4IY6A 2NUVA 2A5TB 2MKZA 3DP6A 1R9QA 3MVYA 3OD7A 4PP0A 5LDZA 4OEVA 4KHZE 1Y9UA 4R9FA 3C36A 2M8CA 1H43A 3O29A 2ZNSA 1QKAA 3ZKLA 2CMOA 4QHQA 3IR1A 1TWYA 1EZOA 1LB8A 5IZ1A 2PYYA 4IGRA 4GWXA 5ET8A 4G8HA 4MX6A 2DXYA 3FV1A 2O6AA 2F6GA 4R6KA 2RC8A 5CMBA 3TTKA 2Z23A 3OO6A 4EDPA 5CRYA 5I84A 1WODA 1I69A 4PF6A 4DE8A 1IXIA 5I59A 1J1NA 3KC0A 3VV5A 2Y7IA 3O2AA 3ISPA 4X1DA 1FPKA 4H8IA 2Y7KA 1JEVA 3Q25A 4WEDA 3TMGA 5A5XB 1Q1KA 4NGUA 3IORA 4YZZA 3U1OA 3IK6B 2UXAA 3FVOA 3SDFA 4TQUQ 1FBEA 3LV0A 1UIUA 1CNQA 1B3FA 4OHNA 2XXYA 4OETA 4GX4A 2H25A 3U92A 3OO8A 1YZ0A 1BP5A 1UQWA 1B3HA 2I4BA 3OEKA 2I0CA 2Z8EA 2VPOA 3KZGA 2Q2CA 1YTVA 4R75A 4R6YA 3MP6A 2WEFA 1B7UA 1H76A 3I6VA 1RYOA 4R2FA 4MIJA 3PPOA 4XXUA 1BLFA 2RC7A 1NUYA 4OTEA 5F1QA 1DTGA 3O9PA 3TAJA 4YAHX 3TDJA 2OLBA 4NF4A 4YB6A 1FSAA 1LEVA 1FPLA 3T66A 4ECFA 3S9LC 3KN3A 3AXFA 4KR5A 2F3DA 1QKBA 2H98A 3QMFA 4BDLA 3RGYA 1FCKA 4F3GA 4O3BA 5CBRA 2REJA 4I40A 2DSFA 1LCTA 3EPEA 1SBPA 3K6WA 1VDWA 1K9YA 2AIXA 2Y5LA 1R1NA 2DE2A 3LUZA 3ZKKA 2RINA 4X48A 4GBVA 4AB6A 2G93A 3RPLA 5FHOA 5ICQA 3KEIA 2Q9TA 2VT5A 4LP2B 4YB7A 2DQVA 1MXYA 3LC8A 1WDNA 2ZZXA 2R8TA 3S4UA 3S9MC 5DT6A 1O7TA 4P0IA 4ZEFA 4ZZAA 1UTBA 2UYEA 4EQ7A 5CI5A 3LSWA 4KPTA 1MXXA 2F6PA 2ESNA 3OSQA 1A40A 2DWJA 3W9VA 2QVRA 1I6BA 4OFOA 3E78A 3TQWA 2O68A 3WAFA 3UK4A 1P1QA 4LATA 1T0KA 5ET5A 3U94A 1POTA 3B7DA 4F29A 3OELA 2P3NA 1FJ6A 5LOMA 4FAJA 5AE4A 1P1NA 5DEXA 2ZYKA 4LQ5A 4OVQA 4AQ4A 5I2NB 4PBHA 1NV4A 2DWHA 3SEXA 4TLMB 1S9TA 3OOAA 2ZZVA 3IFCA 3K02A 4N07A 4U4XA 4LUBA 3RUMA 4GIZA 1B6HA 1DOTA 3MUQA 4RXLA 1ZJLA 3MVXA 1MS7A 2E1SA 2O69A 4IB2A 3QYTA 1L5TA 1N3XA 1QUKA 1PDAA 1B05A 1VFEA 1WVJA 4H0WA 1ZIUA 1B0HA 2QRYA 2KQZA 2XXTA 3DLNA 1FPDA 3CFZA 2D3IA 5CMKA 1MQHA 1NV1A 3VE1B 1FBDA 3V89B 1G0IA 1MH4A 2VOZA 2UVGA 1A7LA 1NL5A 3KBZA 2B4LA 2F97A 5H8NB 5I56B 1JVXA 3MPKA 3ECRA 4H5GA 1XVYA 3RPWA 2VP1A 4ELPA 1D4NA 4OVPA 2Q88A 5IGAA 2XX7A 4ZZEA 4ZS9A 3EKIA 4OWDA 2QVVA 3PUYE 1FPFA 2V3QA 3K2DA 1URGA 4XKRA 1TXFA 3O28A 4PAKA 3MBPA 3CHGA 4F3SA 1B51A 4XF5A 4JVDA 3KOTA 2V3TA 1Y1MA 3K1MA 1JW5A 2GFEA 1JP4A 4WXJA 1B52A 2Y84A 5BUUA 2P2AA 4U4SA 2ZYNA 4KCDA 4GWZA 3BKIB 3MZBA 3RTFB 1MXVA 3PTYA 3PD9A 3CIJA 1AWBA 2WKYA 5JEIA 4BDNA 1N76A 3QUFA 2OJTA 1LFHA 3EF7A 2V3UA 3RLFE 1P1WA 3I3VA 3UGWA 3T0JA 3IJOB 3GXAA 4MMPA 4O7IA 3KN7A 2OZZA 5I2KB 1FPJA 2I3VA 4F39A 3T1BA 1FPIA 3UA8A 1I6QA 2I49A 2Q8MA 3KJ7A 4NEDA 4DI4B 2I6EA 1US4A 3PD8A 3PUVE 3DP4A 2X7QA 2I4CA 4BDQA 4IO7A 2GQ1A 3SEYA 4KQPA 3IO6A 3O6IA 2O51A 4NAPA 3CFXA 4EQ9A 1NV6A 4PBQA 4BDOA 2YLNA 4ONYA 2QVUA 1B58A 4OA4A 3TEPA 3MVWA 1FTKA 2FIXA 1Y20A 1JQFA 2WYPA 4H67A 4RA1A 1FQEA 3H6VA 2XXHA 2XXPA 5L9SA 4U1ZA 1IQ7A 3O6HA 3C9HA 4IY5A 1USYH 1BKAA 2CZIA 3R26A 4GD5A 1XI6A 1LBCA 3QAXA 3GZGA 2Z8DA 2X7PA 1JW4A 1XS5A 4KCCA 5T3JA 4Z0IA 5I57B 3G3JA 3VVEA 2XX8A 4H5FA 4F19A 3H06B 3WAEA 2O7UA 3T9HB 4H46A 5TPAA 3PMXA 4DLDA 1EYIA 1OLAA 3FJ7A 5H8FA 4E0XA 1YAEA 4H8JA 3D4CA 1NNPA 2REGA 4XIGQ 3FJGA 4F2OA 1NNKA 4JBZA 1KWHA 4N91A 1OQHA 2QSXA 3G3IA 1QULA 2ZZWA 4P1EA 3MSTA 2HAVA 3MZ1A 1LCFA 2YPNA 4NHBA 4FBPA 1DMBA 4X1BA 2XXUA 4KI0E 1JEUA 1S50A 1BTJA 3TYHA 5EQAA 4F22A 4H45A 3TCFA 3EN3A 4O8MA 1LBXA 4U22A 4LZ7A 2DOJA 3CG3A 3E13X 4HTGA 4MNPA 3PUXE 4MH5A 1B1XA 4XEQA 4FE8A 1B7HA 4KYSA 1D9VA 2DYXA 1A54A 5DTBA 2NXOA 3MAMA 4MFIA 4RPNA 2D21A 2DVCA 4PFRA 2GRVA 3LSLA 2XD3A 3IOWA 3USDA 5ITOA 1URSA 1A99A 1Y3NA 2HZKA 5H8HB 4KYDA 3ODBA 2DVZA 3RY3A 5KDTB 5JK4A 1POY1 1H45A 5DEXB 1CE2A 3PPQA 1D3KA 2DS9A 4N6DA 3VLUA 3C34A 1MRPA 4U23A 1N7XA 1ANFA 4ZE8A 4QFPA 1IITA 4NF5A 4I62A 1UTHB 3KJTA 1NV5A 3R7XA 2FBPA 4POXA 2F78A 2ZNTA 1LFIA 3TQLA 3Q29A 5EQ8A 3GBBA 4XKPA 2L5VA 1LLSA 3MC2A 4RPOA 5DVJA 2F3BA 2HPGA 1FBPA 2F7CA 5EYGA 2H9BA 3GYYA 4ZDMA 2ZYOA 4FEDA 1IMEA 1LB9A 4PFBA 1MM6A 3IB0A 1ZMGA 3ONMA 3S2VA 2VPNA 4NF6A 2H99A 1IXGA 1BK4A 4O3CA 4RYAA 2XWVA 5ICTA 2FHYA 2Y7WA 2H5YA 2IEEA 2ANJA 3MJNA 4WEPA 2F7AA 4R9GA 2HCAA 1P99A 4YMBA 1H3DA 3EHSA 3UN6A 5K2XA 5IZ3B 3IB2A 2WX9A 1EYKA 1US5A 2P1SA 4N8GA 5DYHA 5KCJB 3HHGA 3KN8A 3RQTA 5CM6A 3TCGA 1IMFA 4OVTA 1B32A 2PFZA 3C31A 3B6WA 4F18A 4EF1A 3RN8A 5LTCA 1DCUA 1Z7ME 1RDXA 3PPPA 4O3AA 4GQOA 5AA4A 5AA2B 3JV9A 4JWXA 5FTHA 3LR1A 5J16A 5TP9B 3VLVA 5EQ9A 2P3VA 4OZ9A 5I58B 4EXLA 1NKXA 1YCJA 4LONB 4PFYA 4PC9A 4ZEBA 4GWOA 4JSOA 1QUIA 3KG2A 3K6VA 1Y4TA 4MF3A 3E9XA 3T93B 1SPIA 4OXVA 4OANA 4U1OA 2PFYA 3ILUB 4RK2A 4C0RA 4ZECA 2A5TA 4FORA 5A5LA 1XVXA 1B5IA 1HSLA 1B3EA 4NX1A 1Y3PA 4F1VA 4MLVA 3DM0A 2R71A 1FRPA 1DBZA 2DWAA 4OFLA 4IO3A 4QSEA 1FBHA 2NWJA 1B7ZA 5ISUA 3JZJA 4IO6A 4IO5A 3CR9A 3HV1A 3VDFA 1TFDA 1LAXA 3VXCA 3QK6A 4E0WA 5HM4B 3PUWE 1PB7A 4GFRA 3MPLA 5FHMA 1LAHE 1NH7A 3FZVA 4GF8A 2HQ0A 2CEYA 1O64A 3CRBA 1DK4A 1MY3A 2FVZA 2UVJA 1OIBA 4MNCA 3T22A 1Q35A 5AA1A 2Y7RA 2XWOA 3N6UA 4N15A 3CVGA 3T9UA 2OWSA 1MPCA 4PAFA 4EF2A 4TOZA 1MXZA 1H44A 1B1HA 3W9WA 4GLIA 1SW2A 3FIRA 3BFTA 4DZ1A 3LUYA 3S9EA 5DVIA 1N0TA 4KFQA 4F3PA 2DE3A 3O6GA 5A5XA 2F36A 1FPBA 1N84A 1M5DA 1JW1A 4R74A 4YKJA 5ET6A 1XHYA 4YU0A 2UVIA 2XXIA 3UIFA 2QPQA 2OWZA 1B4HA 4PE5B 3FV2A 4Z7EA 4QBAA 4MBPA 5H8QB 5KZTA 4HCYA 2PMSA 2PT1A 4BDRA 1MXWA 3SEUA 4OERA 3MWBA 1B3GA 3QSLA 2FIEA 2QL3A 4NF8B 3HCQA 3GBAA 4ISUA 3SERA 4HE1A 1MH3A 2D5WA 4ESWA 3SEWA 3MP1A 2PCRA 3FXRA 3CSGA 2HXWA 1P1OA 3MYUA 3N6TA 4H1XA 3DP8A 4DXCA 3FXBA 4EXKA 1VSOA 1IMCA 3K00A 2QS1A 4I3YA 5I5PA 1IMAA 1PB9A 5BWJA 1M5EA 3FXUA 1MM7A 4O94A 2ZYMA 4NN3A 4HXVA 2HAUA 2XWKA 2V93A 3NOHA 1NV0A 4P56A 1MPDA 3E4RA 1QJMA 1LBWA 1PBQA 3TUSA 2HZLA 5L9OA 4XTCQ 1FPEA 1QUJA 4GRKA 1KA1A 4IO4A 3H6WA 4X04A 2VGQA 5ITPA 4ND9A 1ELJA 4OVRA 1OVTA 3G3FA 3R6UA 1LAGE 2XXWA 3HSTA 4KYEA 5HBCA 2PT2A 1G0HA 4M1VA 1AIVA 1FPGA 3N26A 4KD5A 5DVFA 4HCWA 1B5HA 3P7IA 3IB1A 2PVUA 1B3LA 1SQYA 4IO2A 3K6XA 1EU8A 1ATGA 4N4UA 2HXRA 4OVJA 4PTKA 2QS4A 1TT1A 2UYFA 2VD3A 2CZKA 3E79A 4NG7A 4L17A 3BFUA 3PPNA 4QSDA 4OYVA 2HEUA 4XKQA 3FVNA 4G68A 4DIGA 2AYSA 3ROJA 1PB8A 1FQDA 3M3FA 5I59B 5CMMA 3K1NA 2DWIA 2ONKE 3FATA 3U72A 4F3BA 1IMBA 1NH8A 4JVIA 4H65A 5FTIA 3G7WA 1HSEA 2UVHA 1IXHA 1IIWA 5JTYA 2RF1A 1B9JA 2F7BA 1ZU0A 2F34A 1FQAA 1AH5A 4U21A 3LBSA 3PMWA 4Q8RA 4R6HA 3ZSFA 4X8RA 3TTRA 5I2NA 1FTLA 2Z22A 2O84X 3MZ9A 5IAIA 4DDDA 1FQBA 3M8UA 4MNIA 4QSCA 4GWUA 3H6TA 4FATA 2GHBA 5L9MA 1FBFA 4JVCA 3KOSA 4G4PA 4GXSB 2HFBA 1IUDA 4HS7A 1NV2A 2R6GE 3SETA 4NF0A 4NF4B 3M3KA 3OEMA 2XWIA 3QUJA 4M4GA 2QFLA 1FTMA 1NI9A 3HHFA 4HW8A 4LZ5A 4N81A 4P3LA 2AL4A 1NNTA 1LBZA 4AB5A 4OENA 3N5LA 5AA4B 1ZTYA 2F8DA 5H8NA 5I56A 4BLAA 2VD2A 4P8BA 3SKPA 3FJMA 3C32A 4MHFA 4Q0CA 3TPAA 1FW0A 1B2HA 4EUOA 3RPLB 3K6UA 2ONRA 1DTZA 3OXNA 1HSJA 1NUXA 3K1PA 2F5XA 4ZEDA 4X9TA 1LFGA 4PQJA 1MQJA 4JWYA 2FNCA 4AS4A 3PGFA 4PDHA 3VVFA 2FA7A 2KLFA 1LBBA 3TFLA 1SI1A 1NUZA 3FGSA 4TLLB 1UTBB 4QFNA 1D9QA 2ZMBA 3O97A 4ELRA 1R9LA 3FD3A 1MXUA 2XHDA 2B4MA 1YYZA 1FBCA 2DE4A 2RCBA 3QIMA 5H8SA 4OFJA 3L6HA 4NTLA 3KBRA 2XD2A 5FBPA 4MCOA 2CEXA 3PPRA 4JXIA 2BJIA 2DP8A 3KGCA 1AMFA 4F2QA 1LGBC 4DXBA 4C1UA 3HN0A 4P0GA 1CB6A 1GGGA 4UABA 3LSXA 3D1RA 4OQOA 2ZXTA 1USYE 5I2KA 4RY1A 3PMVA 1FTJA 2RC9A 3HFUA 5F7VA 4NMYA 1A8EA 4N8YA 4PGPA 4PDDA 4GWYA 1MDP1 3GLBA 4QFLA 2B3BA 1ZKBA 4RNSA 2B3FA 2G29A 3FVGA 5EQ7A 1NNFA 2Q8JA 3RNNA 1SVXB 3Q27A 1MQIA 1SW5A 4P1LA 3FVKA 2H4IA 1SI0A 4LZ8A 2NVUB 4G2ZA 1I6AA 3TZAA 3VVDA 1YXIA 1F9BA 1OLCA 1YPNA 3Q26A 4FEBA 3I5OA 1R6ZA 1MQDA 3IL1B 2O1MA 3OO9A 3IAZA 1XC1A 2ABHA 3U93A 3TELA 3PV0E 4I9DA 3IFAA 2Y7PA 2O1LA 4QFKA 5F24A 1GVCA 5I57A 3TCHA 4P9KA 4NQ8A 4YKIA 2FYIA 1SD3A 3U8QA 3TODA 4OVSA 5CBSA 3K4UA 2XXRA 1SW1A 4MEVA 1SYHA 2WBDA 4N6PA 1MG1A 4GVOA 1OVBA 4YKKA 4DI3D 1AOVA 3CSBA 4ELQA 4I8CA 2I48A 3G3KA 3MP8A 1TFAA 1MY0A 4GX3A 3H4ZA 5ESYA 5AA2D 1GV8A 1MY4A 1VFDA 4GWWA 4OEUA 2OCUA 3HPIA 1FQCA 4AS5A 4JWOA 2O7IA 2ONSA 4MJOA 5IZZA 3BBRA 4RJZA 2JJKA 1Y3QA 4DCYA 2XXXA 2CZLA 2Q2AA 1EYJA 1PC3A 1NFTA 3Q28A 3K01A 1FTAA 3OENA 2THIA 3M3LA 1QGXA 5ELVA 2PBWA 1N04A 3CG1A 3IX1A 5FHNA 1NMUA 4R2BA 4LA9A 4QF9A 4YB5A 3OSRA 5M2VA 4MAGA 4PFWA 1IXCA 2PX1A 1MY1A 1N7WA 4PCDA 1O63A 1RYXA 4MLQA 3C4MA 4K3FA 1MY2A 3ZS6A 2E0SA 3V8XB 3H3GA 1JNFA 4G68B 3G3GA 4ELOA 3QXMA 3K0VA 4LQ2A 4G8NA 4F31B 1XT8A 3B6TA 2XXKA 5H8HA 1QW0A 4RK9A 1MPBA 2YJPA 1NV3A 5KDTA 4PF8A 5TU0A 3VLWA 5JTYB 4NE4A 2W7YA 1Y1ZA 1DSNA 4FIMA 2I58A 3IJXB 4PE3A 5B7DA 4ZE9A 4F1YA 1MDQA 2V25A 4G8MA 2A5SA 3OMBA 2GH9A 2QJEA 3E3KA 1UTHA 3FBPA 5EHMA 4GL8A 2ALUA 2BJJX 3C35A 3A29A 4G68C 4FJPA 3EHTA 4HE2A 4H6DA 4I1DA 2RKMA 4P47A 5L8DA 4YKPA 4JB7A 2XXVA 3D4GA 4PGNA 3C33A 1IEJA 5TPAB 1B4ZA 1M5CA 4OMBA 4WKMA 1KZ8A 5J1DA 2R9JA 5H8FB 3TTMA 4F1UA 1Z7NE 2XA5A 4N17A 4GL0A 1B40A 4OESA 1FBGA 2AL5A 1FQFA 3KFMA 3H03A 4GX6A 1SW4A 2QS2A 4ESXA 2DDKA 3BIHA 3KSXA 3H6UA 1XOCA 3RT6B 1VR5A 1OQGA 3EQ1A 5IZ3A 5EYHA 3G3HA 2VHAA 1FTOA 4PFUA 3CI8A 1PEBA 1JVYA 4IR8A 3THIA 3ILTB 4JDFA 4G61A 1A55A 5KCJA 3SESA 3TTNA 2QMXA 3RT8A 2IA4A 1NV7A 3HO7A 1VE4A 1II5A 3UORA 1GTKA 3BIGA 1Q9DA 5AA2A 1UIVA 2OWTA 3L6GA 4XFEA 4YMAA 4O7MA 4I3EA 3OO7A 2V84A 1ZBMA 3KC1A 5TP9A 4R73A 3B6QA 3IO4A 4Q30B 1N3WA 2B65A 4UACA 3FXQA 5DW8A 5I58A 3IOTA 2LAOA 2OBGA 1D9YA 4G77A 3T96B 4LN5A 3DELB 2QMWA 2ZNUA 4THIA 3CFLA 1ZLQA 1M5FA 3LSFB 4PETA 2Q89A 1S7YA 5I7IA 4GWSA 1IMDA 1JETA 1PBPA 3SZPA 5I3SA 4NWCA 4GXAA 3EHUA 3V5AA 3KSJA 1M5BA 4QFOA 4N6KA 2Y5KA 2XX9A 4PFIA 1P1UA 1BIYA 2RCAA 4NF5B 4UA8A 4HE0A 4R72A 3IOUA 4ZEIA 4DXUA 1SDXA 4PAIA 3JYRA 1LBYA 3MVZA 4EQBA 3FUZA 1AL3A 5K2YA 3VFJA 2HHMA 1K9ZA 2V4CA 2P0SA 3SEVA 2I3WA 2WYKA 4ZEKA 1RDZA 3T9XB 5IKBA 3T9VA 1URDA 1RKMA 4LVQA 3U65A 1SYIA 4NF6B 2QS3A 2X26A 2XXQA 3VXBA 2OX3A 5CC2A 3S9NC 3UP9A 4KXPA 4POWA 2Q74A 1INPA 3V83A 3F11A 3MQ9A 1B46A 2CZHA 1RDYA 1LAFE 3PU5A 4U2RA 1EZPA 4P11A 4NWDA 1A8FA 2DXRA 1LSTA 4GBWA 1GR2A 1B5JA 3O66A 4QRZA 5H8QA 1EZ9A 2I0BA 5EHSA 3A09A 1OMPA 4N13A 1MQGA 3W15C 4IGTA 1NUWA 2NOOA 4QXDA 2F35A 3TKDA 4XKNA 5AA3A 1IZ1A 3A3CA 3PUZE 4C1TA 5IM2A 4NF8A 4Q5TA 4BDMA 3A3UA 1Y4CA 5ET7A 1KA0A 3H7MA 3B50A 5B70A 4FECA 3TTLA 2GHAA 5CMCA 3B8BA 5EYFA 2WBBA 4YICA 2OK2A 2Z8FA 1DPPA 1QVSA 2KR0A 1DPEA 3RTWB 3MW0A 3N94A 1LBVA
chains in the Genus database with same CATH topology
4JSDA 4DCXA 3IOVA 5HPQA 4GOTA 3FASA 1B0LA 4PFTA 1EH3A 4IY6A 2NUVA 2A5TB 3MVYA 3DP6A 1R9QA 3OD7A 4PP0A 4OEVA 4KHZE 1Y9UA 4R9FA 3C36A 2M8CA 1H43A 3O29A 2ZNSA 1QKAA 3ZKLA 2CMOA 4QHQA 3IR1A 1TWYA 1EZOA 1LB8A 2PYYA 4IGRA 4G8HA 2DXYA 3FV1A 2O6AA 2F6GA 4R6KA 2RC8A 5CMBA 3TTKA 2Z23A 3OO6A 4EDPA 5CRYA 5I84A 1WODA 1I69A 4DE8A 1IXIA 5I59A 1J1NA 3VV5A 2Y7IA 3O2AA 4X1DA 4H8IA 2Y7KA 1JEVA 3Q25A 4WEDA 3TMGA 5A5XB 1Q1KA 3IORA 4YZZA 3U1OA 3IK6B 2UXAA 3FVOA 3SDFA 4TQUQ 1UIUA 1B3FA 4OHNA 2XXYA 4OETA 2H25A 3U92A 3OO8A 1BP5A 1UQWA 1B3HA 2I4BA 3OEKA 2I0CA 2Z8EA 3KZGA 2Q2CA 1YTVA 4R75A 4R6YA 3MP6A 1B7UA 1H76A 3I6VA 1RYOA 4R2FA 4XXUA 3PPOA 1BLFA 2RC7A 4OTEA 5F1QA 1DTGA 3O9PA 3TAJA 4YAHX 3TDJA 2OLBA 4NF4A 4YB6A 3T66A 4ECFA 3S9LC 3KN3A 3AXFA 4KR5A 1QKBA 2H98A 4BDLA 3RGYA 1FCKA 4F3GA 4O3BA 5CBRA 2REJA 2DSFA 1LCTA 3EPEA 1SBPA 3K6WA 2AIXA 1R1NA 2DE2A 3ZKKA 2RINA 4X48A 4AB6A 2G93A 5FHOA 5ICQA 3KEIA 2Q9TA 4LP2B 4YB7A 2DQVA 1MXYA 3LC8A 1WDNA 3S4UA 3S9MC 5DT6A 1O7TA 4P0IA 4ZEFA 4ZZAA 1UTBA 2UYEA 4EQ7A 5CI5A 3LSWA 4KPTA 1MXXA 2F6PA 2ESNA 3OSQA 1A40A 2DWJA 3W9VA 1I6BA 4OFOA 3TQWA 2O68A 3WAFA 3UK4A 1P1QA 4LATA 1T0KA 3U94A 1POTA 3B7DA 4F29A 3OELA 5LOMA 4FAJA 5AE4A 1P1NA 5DEXA 2ZYKA 4LQ5A 4AQ4A 5I2NB 2DWHA 3SEXA 4TLMB 1S9TA 3OOAA 3K02A 4N07A 4U4XA 4LUBA 3RUMA 4GIZA 1B6HA 1DOTA 3MUQA 4RXLA 1ZJLA 3MVXA 1MS7A 2E1SA 2O69A 4IB2A 3QYTA 1L5TA 1N3XA 1QUKA 1PDAA 1B05A 1VFEA 1WVJA 4H0WA 1ZIUA 1B0HA 2QRYA 2XXTA 3DLNA 3CFZA 2D3IA 5CMKA 1MQHA 3VE1B 3V89B 1MH4A 2VOZA 2UVGA 1A7LA 1NL5A 2F97A 5H8NB 5I56B 1JVXA 3MPKA 3ECRA 4H5GA 1XVYA 3RPWA 2VP1A 4ELPA 1D4NA 2Q88A 2XX7A 4ZZEA 4ZS9A 4OWDA 3PUYE 2V3QA 3K2DA 1URGA 4XKRA 1TXFA 3O28A 3MBPA 4F3SA 1B51A 3KOTA 2V3TA 1Y1MA 3K1MA 1JW5A 2GFEA 4WXJA 1B52A 2Y84A 5BUUA 2P2AA 4U4SA 2ZYNA 4KCDA 3BKIB 3MZBA 3RTFB 1MXVA 3PD9A 3CIJA 2WKYA 5JEIA 4BDNA 1N76A 3QUFA 2OJTA 1LFHA 3EF7A 2V3UA 3RLFE 1P1WA 3I3VA 3UGWA 3IJOB 3GXAA 3KN7A 2OZZA 5I2KB 2I3VA 4F39A 3UA8A 1I6QA 2I49A 3KJ7A 4NEDA 2I6EA 1US4A 3PD8A 3PUVE 3DP4A 2X7QA 2I4CA 4BDQA 4IO7A 3SEYA 4KQPA 3IO6A 3O6IA 2O51A 3CFXA 4EQ9A 4BDOA 2YLNA 4ONYA 1B58A 3TEPA 3MVWA 1FTKA 1Y20A 1JQFA 4H67A 4RA1A 1FQEA 3H6VA 2XXHA 2XXPA 5L9SA 4U1ZA 1IQ7A 3O6HA 3C9HA 4IY5A 1USYH 1BKAA 3R26A 4GD5A 1LBCA 3QAXA 3GZGA 2Z8DA 2X7PA 1JW4A 1XS5A 4KCCA 4Z0IA 5I57B 3G3JA 3VVEA 2XX8A 4H5FA 4F19A 3H06B 3WAEA 2O7UA 3T9HB 5TPAA 3PMXA 4DLDA 1OLAA 3FJ7A 5H8FA 4E0XA 1YAEA 4H8JA 3D4CA 1NNPA 2REGA 4XIGQ 3FJGA 4F2OA 1NNKA 4JBZA 1KWHA 1OQHA 2QSXA 3G3IA 1QULA 2HAVA 3MZ1A 1LCFA 2YPNA 1DMBA 4X1BA 2XXUA 4KI0E 1JEUA 1S50A 1BTJA 3TYHA 4F22A 3TCFA 3EN3A 4U22A 4LZ7A 2DOJA 3CG3A 3E13X 4HTGA 3PUXE 4MH5A 1B1XA 4FE8A 1B7HA 4KYSA 1D9VA 2DYXA 1A54A 5DTBA 2NXOA 3MAMA 4MFIA 4RPNA 2D21A 2DVCA 2GRVA 3LSLA 2XD3A 3IOWA 3USDA 5ITOA 1URSA 1A99A 1Y3NA 2HZKA 5H8HB 4KYDA 3ODBA 2DVZA 3RY3A 5KDTB 5JK4A 1POY1 1H45A 5DEXB 1CE2A 3PPQA 1D3KA 2DS9A 3VLUA 3C34A 1MRPA 4U23A 1N7XA 1ANFA 4ZE8A 4QFPA 1IITA 4NF5A 4I62A 1UTHB 3KJTA 3R7XA 4POXA 2F78A 2ZNTA 1LFIA 3TQLA 3Q29A 3GBBA 4XKPA 1LLSA 3MC2A 4RPOA 5DVJA 2F7CA 2H9BA 4ZDMA 2ZYOA 4FEDA 1LB9A 1MM6A 3IB0A 1ZMGA 3ONMA 3S2VA 4NF6A 2H99A 1IXGA 4O3CA 4RYAA 5ICTA 2Y7WA 2H5YA 2IEEA 2ANJA 3MJNA 4WEPA 2F7AA 4R9GA 2HCAA 1P99A 4YMBA 1H3DA 3EHSA 3UN6A 5K2XA 3IB2A 1US5A 2P1SA 5DYHA 5KCJB 3HHGA 3KN8A 3RQTA 5CM6A 3TCGA 1B32A 3C31A 3B6WA 4F18A 4EF1A 3RN8A 1Z7ME 3PPPA 4O3AA 4GQOA 5AA4A 5AA2B 3JV9A 4JWXA 5FTHA 3LR1A 5TP9B 3VLVA 4OZ9A 5I58B 4EXLA 1NKXA 1YCJA 4LONB 4PFYA 4ZEBA 4GWOA 4JSOA 1QUIA 3KG2A 3K6VA 1Y4TA 4MF3A 3E9XA 3T93B 4OXVA 4U1OA 3ILUB 4RK2A 4C0RA 4ZECA 2A5TA 4FORA 1XVXA 1B5IA 1HSLA 1B3EA 1Y3PA 4F1VA 4MLVA 3DM0A 2R71A 2DWAA 4OFLA 4IO3A 4QSEA 2NWJA 1B7ZA 5ISUA 3JZJA 4IO6A 4IO5A 3CR9A 3HV1A 3VDFA 1TFDA 1LAXA 3VXCA 3QK6A 4E0WA 5HM4B 3PUWE 1PB7A 4GFRA 3MPLA 5FHMA 1LAHE 1NH7A 3FZVA 4GF8A 2HQ0A 1O64A 3CRBA 1MY3A 2UVJA 1OIBA 3T22A 1Q35A 5AA1A 2Y7RA 3N6UA 3CVGA 3T9UA 2OWSA 1MPCA 4EF2A 4TOZA 1MXZA 1H44A 1B1HA 3W9WA 4GLIA 1SW2A 3FIRA 3BFTA 4DZ1A 3LUYA 3S9EA 5DVIA 1N0TA 4KFQA 4F3PA 2DE3A 3O6GA 5A5XA 2F36A 1N84A 1M5DA 1JW1A 4R74A 4YKJA 1XHYA 4YU0A 2UVIA 2XXIA 3UIFA 2QPQA 1B4HA 4PE5B 3FV2A 4Z7EA 4MBPA 5H8QB 5KZTA 4HCYA 2PMSA 2PT1A 4BDRA 1MXWA 3SEUA 4OERA 3MWBA 1B3GA 3QSLA 2QL3A 4NF8B 3HCQA 3GBAA 4ISUA 3SERA 1MH3A 2D5WA 4ESWA 3SEWA 3MP1A 3FXRA 3CSGA 2HXWA 1P1OA 3N6TA 4H1XA 3DP8A 4DXCA 4EXKA 1VSOA 3K00A 2QS1A 1PB9A 5BWJA 1M5EA 3FXUA 1MM7A 2ZYMA 2HAUA 2V93A 1MPDA 3E4RA 1QJMA 1PBQA 3TUSA 2HZLA 5L9OA 4XTCQ 1QUJA 4GRKA 4IO4A 3H6WA 5ITPA 2VGQA 4ND9A 1ELJA 1OVTA 3G3FA 3R6UA 1LAGE 2XXWA 3HSTA 4KYEA 5HBCA 2PT2A 4M1VA 1AIVA 3N26A 4KD5A 5DVFA 4HCWA 1B5HA 3P7IA 3IB1A 2PVUA 1B3LA 1SQYA 4IO2A 3K6XA 1EU8A 1ATGA 4OVJA 2QS4A 1TT1A 2UYFA 2VD3A 4L17A 3BFUA 3PPNA 4QSDA 4OYVA 2HEUA 4XKQA 3FVNA 4G68A 4DIGA 2AYSA 1PB8A 1FQDA 3M3FA 5I59B 5CMMA 3K1NA 2DWIA 2ONKE 3FATA 3U72A 4F3BA 1NH8A 4H65A 5FTIA 3G7WA 1HSEA 2UVHA 1IXHA 1IIWA 5JTYA 2RF1A 1B9JA 2F7BA 1ZU0A 2F34A 1FQAA 1AH5A 4U21A 3LBSA 3PMWA 4Q8RA 4R6HA 3ZSFA 3TTRA 5I2NA 1FTLA 2Z22A 2O84X 3MZ9A 5IAIA 4DDDA 1FQBA 3M8UA 4QSCA 3H6TA 4FATA 2GHBA 5L9MA 3KOSA 4G4PA 4GXSB 2HFBA 1IUDA 4HS7A 2R6GE 3SETA 4NF4B 3M3KA 3OEMA 3QUJA 4M4GA 1FTMA 3HHFA 4HW8A 4LZ5A 2AL4A 1NNTA 4AB5A 4OENA 5AA4B 3N5LA 1ZTYA 2F8DA 5H8NA 5I56A 4BLAA 2VD2A 3SKPA 3FJMA 3C32A 4Q0CA 3TPAA 1FW0A 1B2HA 4EUOA 3K6UA 2ONRA 1DTZA 3OXNA 1HSJA 3K1PA 2F5XA 4ZEDA 4X9TA 1LFGA 4PQJA 1MQJA 4JWYA 2FNCA 3PGFA 3VVFA 2FA7A 2KLFA 1LBBA 3TFLA 1SI1A 3FGSA 4TLLB 1UTBB 4QFNA 2ZMBA 3O97A 4ELRA 1R9LA 3FD3A 1MXUA 2XHDA 2DE4A 2RCBA 3QIMA 5H8SA 4OFJA 3L6HA 4NTLA 3KBRA 2XD2A 3PPRA 4JXIA 2DP8A 3KGCA 1AMFA 4F2QA 1LGBC 4DXBA 4C1UA 3HN0A 4P0GA 1CB6A 1GGGA 3LSXA 4OQOA 2ZXTA 1USYE 5I2KA 4RY1A 3PMVA 1FTJA 2RC9A 5F7VA 4NMYA 1A8EA 1MDP1 3GLBA 4QFLA 2B3BA 1ZKBA 4RNSA 2B3FA 2G29A 3FVGA 1NNFA 2Q8JA 3RNNA 1SVXB 3Q27A 1MQIA 1SW5A 3FVKA 2H4IA 1SI0A 4LZ8A 2NVUB 4G2ZA 1I6AA 3TZAA 3VVDA 1F9BA 1OLCA 1YPNA 3Q26A 4FEBA 3I5OA 1R6ZA 1MQDA 3IL1B 2O1MA 3OO9A 3IAZA 1XC1A 3U93A 2ABHA 3TELA 3PV0E 4I9DA 2Y7PA 2O1LA 4QFKA 1GVCA 5I57A 3TCHA 4YKIA 2FYIA 1SD3A 3U8QA 3TODA 5CBSA 3K4UA 2XXRA 1SW1A 1SYHA 4N6PA 1MG1A 4GVOA 1OVBA 4YKKA 1AOVA 3CSBA 4ELQA 4I8CA 2I48A 3G3KA 3MP8A 1TFAA 1MY0A 3H4ZA 5AA2D 1GV8A 1MY4A 1VFDA 4OEUA 2OCUA 3HPIA 1FQCA 4JWOA 2O7IA 2ONSA 3BBRA 4RJZA 1Y3QA 4DCYA 2XXXA 2CZLA 2Q2AA 1PC3A 1NFTA 3Q28A 3K01A 3OENA 2THIA 3M3LA 5ELVA 2PBWA 1N04A 3CG1A 3IX1A 5FHNA 1NMUA 4R2BA 4LA9A 4QF9A 4YB5A 3OSRA 5M2VA 4PFWA 1IXCA 2PX1A 1MY1A 1N7WA 1O63A 1RYXA 4MLQA 3C4MA 4K3FA 1MY2A 3ZS6A 2E0SA 3V8XB 3H3GA 1JNFA 4G68B 3G3GA 4ELOA 3QXMA 3K0VA 4LQ2A 4G8NA 4F31B 1XT8A 3B6TA 5H8HA 1QW0A 4RK9A 1MPBA 2YJPA 5KDTA 5TU0A 3VLWA 5JTYB 4NE4A 2W7YA 1Y1ZA 1DSNA 4FIMA 2I58A 3IJXB 5B7DA 4ZE9A 4F1YA 1MDQA 2V25A 4G8MA 2A5SA 3OMBA 2GH9A 2QJEA 3E3KA 1UTHA 5EHMA 4GL8A 2ALUA 2BJJX 3C35A 4G68C 4FJPA 3EHTA 4H6DA 4I1DA 2RKMA 5L8DA 4YKPA 4JB7A 2XXVA 3D4GA 3C33A 1IEJA 5TPAB 1B4ZA 1M5CA 4OMBA 4WKMA 5J1DA 2R9JA 5H8FB 3TTMA 4F1UA 1Z7NE 4GL0A 1B40A 4OESA 2AL5A 1FQFA 3KFMA 3H03A 1SW4A 2QS2A 4ESXA 3KSXA 3H6UA 1XOCA 3RT6B 1VR5A 1OQGA 3EQ1A 3G3HA 2VHAA 1FTOA 4PFUA 3CI8A 1PEBA 1JVYA 3THIA 3ILTB 4JDFA 1A55A 5KCJA 3SESA 3TTNA 2QMXA 3RT8A 2IA4A 3HO7A 1VE4A 1II5A 3UORA 1GTKA 5AA2A 1UIVA 2OWTA 3L6GA 4YMAA 3OO7A 2V84A 1ZBMA 5TP9A 4R73A 3B6QA 3IO4A 4Q30B 1N3WA 2B65A 4UACA 3FXQA 5I58A 3IOTA 2LAOA 2OBGA 1D9YA 4G77A 3T96B 3DELB 2QMWA 2ZNUA 4THIA 3CFLA 1ZLQA 1M5FA 3LSFB 4PETA 2Q89A 1S7YA 1JETA 1PBPA 4NWCA 4GXAA 3EHUA 3V5AA 3KSJA 1M5BA 4QFOA 2XX9A 1P1UA 1BIYA 2RCAA 4NF5B 4UA8A 4R72A 3IOUA 4ZEIA 4DXUA 1SDXA 3JYRA 3MVZA 4EQBA 3FUZA 1AL3A 5K2YA 3VFJA 2P0SA 3SEVA 2I3WA 4ZEKA 3T9XB 5IKBA 3T9VA 1URDA 1RKMA 4LVQA 1SYIA 4NF6B 2QS3A 2X26A 2XXQA 3VXBA 5CC2A 3S9NC 3UP9A 4POWA 3V83A 3F11A 3MQ9A 1B46A 1LAFE 3PU5A 4U2RA 1EZPA 4P11A 4NWDA 1A8FA 2DXRA 1LSTA 1GR2A 1B5JA 3O66A 4QRZA 5H8QA 1EZ9A 2I0BA 5EHSA 3A09A 1OMPA 4N13A 1MQGA 3W15C 4IGTA 2NOOA 2F35A 3TKDA 4XKNA 5AA3A 1IZ1A 3A3CA 3PUZE 4C1TA 4NF8A 4Q5TA 4BDMA 3A3UA 1Y4CA 3H7MA 5B70A 4FECA 3TTLA 2GHAA 5CMCA 5EYFA 4YICA 2OK2A 2Z8FA 1DPPA 1QVSA 1DPEA 3RTWB 3MW0A 3N94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSD A;  4DCX A;  3IOV A;  5HPQ A;  4GOT A;  3FAS A;  1B0L A;  4PFT A;  1EH3 A;  4IY6 A;  2NUV A;  2A5T B;  3MVY A;  3DP6 A;  1R9Q A;  3OD7 A;  4PP0 A;  4OEV A;  4KHZ E;  1Y9U A;  4R9F A;  3C36 A;  2M8C A;  1H43 A;  3O29 A;  2ZNS A;  1QKA A;  3ZKL A;  2CMO A;  4QHQ A;  3IR1 A;  1TWY A;  1EZO A;  1LB8 A;  2PYY A;  4IGR A;  4G8H A;  2DXY A;  3FV1 A;  2O6A A;  2F6G A;  4R6K A;  2RC8 A;  5CMB A;  3TTK A;  2Z23 A;  3OO6 A;  4EDP A;  5CRY A;  5I84 A;  1WOD A;  1I69 A;  4DE8 A;  1IXI A;  5I59 A;  1J1N A;  3VV5 A;  2Y7I A;  3O2A A;  4X1D A;  4H8I A;  2Y7K A;  1JEV A;  3Q25 A;  4WED A;  3TMG A;  5A5X B;  1Q1K A;  3IOR A;  4YZZ A;  3U1O A;  3IK6 B;  2UXA A;  3FVO A;  3SDF A;  4TQU Q;  1UIU A;  1B3F A;  4OHN A;  2XXY A;  4OET A;  2H25 A;  3U92 A;  3OO8 A;  1BP5 A;  1UQW A;  1B3H A;  2I4B A;  3OEK A;  2I0C A;  2Z8E A;  3KZG A;  2Q2C A;  1YTV A;  4R75 A;  4R6Y A;  3MP6 A;  1B7U A;  1H76 A;  3I6V A;  1RYO A;  4R2F A;  4XXU A;  3PPO A;  1BLF A;  2RC7 A;  4OTE A;  5F1Q A;  1DTG A;  3O9P A;  3TAJ A;  4YAH X;  3TDJ A;  2OLB A;  4NF4 A;  4YB6 A;  3T66 A;  4ECF A;  3S9L C;  3KN3 A;  3AXF A;  4KR5 A;  1QKB A;  2H98 A;  4BDL A;  3RGY A;  1FCK A;  4F3G A;  4O3B A;  5CBR A;  2REJ A;  2DSF A;  1LCT A;  3EPE A;  1SBP A;  3K6W A;  2AIX A;  1R1N A;  2DE2 A;  3ZKK A;  2RIN A;  4X48 A;  4AB6 A;  2G93 A;  5FHO A;  5ICQ A;  3KEI A;  2Q9T A;  4LP2 B;  4YB7 A;  2DQV A;  1MXY A;  3LC8 A;  1WDN A;  3S4U A;  3S9M C;  5DT6 A;  1O7T A;  4P0I A;  4ZEF A;  4ZZA A;  1UTB A;  2UYE A;  4EQ7 A;  5CI5 A;  3LSW A;  4KPT A;  1MXX A;  2F6P A;  2ESN A;  3OSQ A;  1A40 A;  2DWJ A;  3W9V A;  1I6B A;  4OFO A;  3TQW A;  2O68 A;  3WAF A;  3UK4 A;  1P1Q A;  4LAT A;  1T0K A;  3U94 A;  1POT A;  3B7D A;  4F29 A;  3OEL A;  5LOM A;  4FAJ A;  5AE4 A;  1P1N A;  5DEX A;  2ZYK A;  4LQ5 A;  4AQ4 A;  5I2N B;  2DWH A;  3SEX A;  4TLM B;  1S9T A;  3OOA A;  3K02 A;  4N07 A;  4U4X A;  4LUB A;  3RUM A;  4GIZ A;  1B6H A;  1DOT A;  3MUQ A;  4RXL A;  1ZJL A;  3MVX A;  1MS7 A;  2E1S A;  2O69 A;  4IB2 A;  3QYT A;  1L5T A;  1N3X A;  1QUK A;  1PDA A;  1B05 A;  1VFE A;  1WVJ A;  4H0W A;  1ZIU A;  1B0H A;  2QRY A;  2XXT A;  3DLN A;  3CFZ A;  2D3I A;  5CMK A;  1MQH A;  3VE1 B;  3V89 B;  1MH4 A;  2VOZ A;  2UVG A;  1A7L A;  1NL5 A;  2F97 A;  5H8N B;  5I56 B;  1JVX A;  3MPK A;  3ECR A;  4H5G A;  1XVY A;  3RPW A;  2VP1 A;  4ELP A;  1D4N A;  2Q88 A;  2XX7 A;  4ZZE A;  4ZS9 A;  4OWD A;  3PUY E;  2V3Q A;  3K2D A;  1URG A;  4XKR A;  1TXF A;  3O28 A;  3MBP A;  4F3S A;  1B51 A;  3KOT A;  2V3T A;  1Y1M A;  3K1M A;  1JW5 A;  2GFE A;  4WXJ A;  1B52 A;  2Y84 A;  5BUU A;  2P2A A;  4U4S A;  2ZYN A;  4KCD A;  3BKI B;  3MZB A;  3RTF B;  1MXV A;  3PD9 A;  3CIJ A;  2WKY A;  5JEI A;  4BDN A;  1N76 A;  3QUF A;  2OJT A;  1LFH A;  3EF7 A;  2V3U A;  3RLF E;  1P1W A;  3I3V A;  3UGW A;  3IJO B;  3GXA A;  3KN7 A;  2OZZ A;  5I2K B;  2I3V A;  4F39 A;  3UA8 A;  1I6Q A;  2I49 A;  3KJ7 A;  4NED A;  2I6E A;  1US4 A;  3PD8 A;  3PUV E;  3DP4 A;  2X7Q A;  2I4C A;  4BDQ A;  4IO7 A;  3SEY A;  4KQP A;  3IO6 A;  3O6I A;  2O51 A;  3CFX A;  4EQ9 A;  4BDO A;  2YLN A;  4ONY A;  1B58 A;  3TEP A;  3MVW A;  1FTK A;  1Y20 A;  1JQF A;  4H67 A;  4RA1 A;  1FQE A;  3H6V A;  2XXH A;  2XXP A;  5L9S A;  4U1Z A;  1IQ7 A;  3O6H A;  3C9H A;  4IY5 A;  1USY H;  1BKA A;  3R26 A;  4GD5 A;  1LBC A;  3QAX A;  3GZG A;  2Z8D A;  2X7P A;  1JW4 A;  1XS5 A;  4KCC A;  4Z0I A;  5I57 B;  3G3J A;  3VVE A;  2XX8 A;  4H5F A;  4F19 A;  3H06 B;  3WAE A;  2O7U A;  3T9H B;  5TPA A;  3PMX A;  4DLD A;  1OLA A;  3FJ7 A;  5H8F A;  4E0X A;  1YAE A;  4H8J A;  3D4C A;  1NNP A;  2REG A;  4XIG Q;  3FJG A;  4F2O A;  1NNK A;  4JBZ A;  1KWH A;  1OQH A;  2QSX A;  3G3I A;  1QUL A;  2HAV A;  3MZ1 A;  1LCF A;  2YPN A;  1DMB A;  4X1B A;  2XXU A;  4KI0 E;  1JEU A;  1S50 A;  1BTJ A;  3TYH A;  4F22 A;  3TCF A;  3EN3 A;  4U22 A;  4LZ7 A;  2DOJ A;  3CG3 A;  3E13 X;  4HTG A;  3PUX E;  4MH5 A;  1B1X A;  4FE8 A;  1B7H A;  4KYS A;  1D9V A;  2DYX A;  1A54 A;  5DTB A;  2NXO A;  3MAM A;  4MFI A;  4RPN A;  2D21 A;  2DVC A;  2GRV A;  3LSL A;  2XD3 A;  3IOW A;  3USD A;  5ITO A;  1URS A;  1A99 A;  1Y3N A;  2HZK A;  5H8H B;  4KYD A;  3ODB A;  2DVZ A;  3RY3 A;  5KDT B;  5JK4 A;  1POY 1;  1H45 A;  5DEX B;  1CE2 A;  3PPQ A;  1D3K A;  2DS9 A;  3VLU A;  3C34 A;  1MRP A;  4U23 A;  1N7X A;  1ANF A;  4ZE8 A;  4QFP A;  1IIT A;  4NF5 A;  4I62 A;  1UTH B;  3KJT A;  3R7X A;  4POX A;  2F78 A;  2ZNT A;  1LFI A;  3TQL A;  3Q29 A;  3GBB A;  4XKP A;  1LLS A;  3MC2 A;  4RPO A;  5DVJ A;  2F7C A;  2H9B A;  4ZDM A;  2ZYO A;  4FED A;  1LB9 A;  1MM6 A;  3IB0 A;  1ZMG A;  3ONM A;  3S2V A;  4NF6 A;  2H99 A;  1IXG A;  4O3C A;  4RYA A;  5ICT A;  2Y7W A;  2H5Y A;  2IEE A;  2ANJ A;  3MJN A;  4WEP A;  2F7A A;  4R9G A;  2HCA A;  1P99 A;  4YMB A;  1H3D A;  3EHS A;  3UN6 A;  5K2X A;  3IB2 A;  1US5 A;  2P1S A;  5DYH A;  5KCJ B;  3HHG A;  3KN8 A;  3RQT A;  5CM6 A;  3TCG A;  1B32 A;  3C31 A;  3B6W A;  4F18 A;  4EF1 A;  3RN8 A;  1Z7M E;  3PPP A;  4O3A A;  4GQO A;  5AA4 A;  5AA2 B;  3JV9 A;  4JWX A;  5FTH A;  3LR1 A;  5TP9 B;  3VLV A;  4OZ9 A;  5I58 B;  4EXL A;  1NKX A;  1YCJ A;  4LON B;  4PFY A;  4ZEB A;  4GWO A;  4JSO A;  1QUI A;  3KG2 A;  3K6V A;  1Y4T A;  4MF3 A;  3E9X A;  3T93 B;  4OXV A;  4U1O A;  3ILU B;  4RK2 A;  4C0R A;  4ZEC A;  2A5T A;  4FOR A;  1XVX A;  1B5I A;  1HSL A;  1B3E A;  1Y3P A;  4F1V A;  4MLV A;  3DM0 A;  2R71 A;  2DWA A;  4OFL A;  4IO3 A;  4QSE A;  2NWJ A;  1B7Z A;  5ISU A;  3JZJ A;  4IO6 A;  4IO5 A;  3CR9 A;  3HV1 A;  3VDF A;  1TFD A;  1LAX A;  3VXC A;  3QK6 A;  4E0W A;  5HM4 B;  3PUW E;  1PB7 A;  4GFR A;  3MPL A;  5FHM A;  1LAH E;  1NH7 A;  3FZV A;  4GF8 A;  2HQ0 A;  1O64 A;  3CRB A;  1MY3 A;  2UVJ A;  1OIB A;  3T22 A;  1Q35 A;  5AA1 A;  2Y7R A;  3N6U A;  3CVG A;  3T9U A;  2OWS A;  1MPC A;  4EF2 A;  4TOZ A;  1MXZ A;  1H44 A;  1B1H A;  3W9W A;  4GLI A;  1SW2 A;  3FIR A;  3BFT A;  4DZ1 A;  3LUY A;  3S9E A;  5DVI A;  1N0T A;  4KFQ A;  4F3P A;  2DE3 A;  3O6G A;  5A5X A;  2F36 A;  1N84 A;  1M5D A;  1JW1 A;  4R74 A;  4YKJ A;  1XHY A;  4YU0 A;  2UVI A;  2XXI A;  3UIF A;  2QPQ A;  1B4H A;  4PE5 B;  3FV2 A;  4Z7E A;  4MBP A;  5H8Q B;  5KZT A;  4HCY A;  2PMS A;  2PT1 A;  4BDR A;  1MXW A;  3SEU A;  4OER A;  3MWB A;  1B3G A;  3QSL A;  2QL3 A;  4NF8 B;  3HCQ A;  3GBA A;  4ISU A;  3SER A;  1MH3 A;  2D5W A;  4ESW A;  3SEW A;  3MP1 A;  3FXR A;  3CSG A;  2HXW A;  1P1O A;  3N6T A;  4H1X A;  3DP8 A;  4DXC A;  4EXK A;  1VSO A;  3K00 A;  2QS1 A;  1PB9 A;  5BWJ A;  1M5E A;  3FXU A;  1MM7 A;  2ZYM A;  2HAU A;  2V93 A;  1MPD A;  3E4R A;  1QJM A;  1PBQ A;  3TUS A;  2HZL A;  5L9O A;  4XTC Q;  1QUJ A;  4GRK A;  4IO4 A;  3H6W A;  5ITP A;  2VGQ A;  4ND9 A;  1ELJ A;  1OVT A;  3G3F A;  3R6U A;  1LAG E;  2XXW A;  3HST A;  4KYE A;  5HBC A;  2PT2 A;  4M1V A;  1AIV A;  3N26 A;  4KD5 A;  5DVF A;  4HCW A;  1B5H A;  3P7I A;  3IB1 A;  2PVU A;  1B3L A;  1SQY A;  4IO2 A;  3K6X A;  1EU8 A;  1ATG A;  4OVJ A;  2QS4 A;  1TT1 A;  2UYF A;  2VD3 A;  4L17 A;  3BFU A;  3PPN A;  4QSD A;  4OYV A;  2HEU A;  4XKQ A;  3FVN A;  4G68 A;  4DIG A;  2AYS A;  1PB8 A;  1FQD A;  3M3F A;  5I59 B;  5CMM A;  3K1N A;  2DWI A;  2ONK E;  3FAT A;  3U72 A;  4F3B A;  1NH8 A;  4H65 A;  5FTI A;  3G7W A;  1HSE A;  2UVH A;  1IXH A;  1IIW A;  5JTY A;  2RF1 A;  1B9J A;  2F7B A;  1ZU0 A;  2F34 A;  1FQA A;  1AH5 A;  4U21 A;  3LBS A;  3PMW A;  4Q8R A;  4R6H A;  3ZSF A;  3TTR A;  5I2N A;  1FTL A;  2Z22 A;  2O84 X;  3MZ9 A;  5IAI A;  4DDD A;  1FQB A;  3M8U A;  4QSC A;  3H6T A;  4FAT A;  2GHB A;  5L9M A;  3KOS A;  4G4P A;  4GXS B;  2HFB A;  1IUD A;  4HS7 A;  2R6G E;  3SET A;  4NF4 B;  3M3K A;  3OEM A;  3QUJ A;  4M4G A;  1FTM A;  3HHF A;  4HW8 A;  4LZ5 A;  2AL4 A;  1NNT A;  4AB5 A;  4OEN A;  5AA4 B;  3N5L A;  1ZTY A;  2F8D A;  5H8N A;  5I56 A;  4BLA A;  2VD2 A;  3SKP A;  3FJM A;  3C32 A;  4Q0C A;  3TPA A;  1FW0 A;  1B2H A;  4EUO A;  3K6U A;  2ONR A;  1DTZ A;  3OXN A;  1HSJ A;  3K1P A;  2F5X A;  4ZED A;  4X9T A;  1LFG A;  4PQJ A;  1MQJ A;  4JWY A;  2FNC A;  3PGF A;  3VVF A;  2FA7 A;  2KLF A;  1LBB A;  3TFL A;  1SI1 A;  3FGS A;  4TLL B;  1UTB B;  4QFN A;  2ZMB A;  3O97 A;  4ELR A;  1R9L A;  3FD3 A;  1MXU A;  2XHD A;  2DE4 A;  2RCB A;  3QIM A;  5H8S A;  4OFJ A;  3L6H A;  4NTL A;  3KBR A;  2XD2 A;  3PPR A;  4JXI A;  2DP8 A;  3KGC A;  1AMF A;  4F2Q A;  1LGB C;  4DXB A;  4C1U A;  3HN0 A;  4P0G A;  1CB6 A;  1GGG A;  3LSX A;  4OQO A;  2ZXT A;  1USY E;  5I2K A;  4RY1 A;  3PMV A;  1FTJ A;  2RC9 A;  5F7V A;  4NMY A;  1A8E A;  1MDP 1;  3GLB A;  4QFL A;  2B3B A;  1ZKB A;  4RNS A;  2B3F A;  2G29 A;  3FVG A;  1NNF A;  2Q8J A;  3RNN A;  1SVX B;  3Q27 A;  1MQI A;  1SW5 A;  3FVK A;  2H4I A;  1SI0 A;  4LZ8 A;  2NVU B;  4G2Z A;  1I6A A;  3TZA A;  3VVD A;  1F9B A;  1OLC A;  1YPN A;  3Q26 A;  4FEB A;  3I5O A;  1R6Z A;  1MQD A;  3IL1 B;  2O1M A;  3OO9 A;  3IAZ A;  1XC1 A;  3U93 A;  2ABH A;  3TEL A;  3PV0 E;  4I9D A;  2Y7P A;  2O1L A;  4QFK A;  1GVC A;  5I57 A;  3TCH A;  4YKI A;  2FYI A;  1SD3 A;  3U8Q A;  3TOD A;  5CBS A;  3K4U A;  2XXR A;  1SW1 A;  1SYH A;  4N6P A;  1MG1 A;  4GVO A;  1OVB A;  4YKK A;  1AOV A;  3CSB A;  4ELQ A;  4I8C A;  2I48 A;  3G3K A;  3MP8 A;  1TFA A;  1MY0 A;  3H4Z A;  5AA2 D;  1GV8 A;  1MY4 A;  1VFD A;  4OEU A;  2OCU A;  3HPI A;  1FQC A;  4JWO A;  2O7I A;  2ONS A;  3BBR A;  4RJZ A;  1Y3Q A;  4DCY A;  2XXX A;  2CZL A;  2Q2A A;  1PC3 A;  1NFT A;  3Q28 A;  3K01 A;  3OEN A;  2THI A;  3M3L A;  5ELV A;  2PBW A;  1N04 A;  3CG1 A;  3IX1 A;  5FHN A;  1NMU A;  4R2B A;  4LA9 A;  4QF9 A;  4YB5 A;  3OSR A;  5M2V A;  4PFW A;  1IXC A;  2PX1 A;  1MY1 A;  1N7W A;  1O63 A;  1RYX A;  4MLQ A;  3C4M A;  4K3F A;  1MY2 A;  3ZS6 A;  2E0S A;  3V8X B;  3H3G A;  1JNF A;  4G68 B;  3G3G A;  4ELO A;  3QXM A;  3K0V A;  4LQ2 A;  4G8N A;  4F31 B;  1XT8 A;  3B6T A;  5H8H A;  1QW0 A;  4RK9 A;  1MPB A;  2YJP A;  5KDT A;  5TU0 A;  3VLW A;  5JTY B;  4NE4 A;  2W7Y A;  1Y1Z A;  1DSN A;  4FIM A;  2I58 A;  3IJX B;  5B7D A;  4ZE9 A;  4F1Y A;  1MDQ A;  2V25 A;  4G8M A;  2A5S A;  3OMB A;  2GH9 A;  2QJE A;  3E3K A;  1UTH A;  5EHM A;  4GL8 A;  2ALU A;  2BJJ X;  3C35 A;  4G68 C;  4FJP A;  3EHT A;  4H6D A;  4I1D A;  2RKM A;  5L8D A;  4YKP A;  4JB7 A;  2XXV A;  3D4G A;  3C33 A;  1IEJ A;  5TPA B;  1B4Z A;  1M5C A;  4OMB A;  4WKM A;  5J1D A;  2R9J A;  5H8F B;  3TTM A;  4F1U A;  1Z7N E;  4GL0 A;  1B40 A;  4OES A;  2AL5 A;  1FQF A;  3KFM A;  3H03 A;  1SW4 A;  2QS2 A;  4ESX A;  3KSX A;  3H6U A;  1XOC A;  3RT6 B;  1VR5 A;  1OQG A;  3EQ1 A;  3G3H A;  2VHA A;  1FTO A;  4PFU A;  3CI8 A;  1PEB A;  1JVY A;  3THI A;  3ILT B;  4JDF A;  1A55 A;  5KCJ A;  3SES A;  3TTN A;  2QMX A;  3RT8 A;  2IA4 A;  3HO7 A;  1VE4 A;  1II5 A;  3UOR A;  1GTK A;  5AA2 A;  1UIV A;  2OWT A;  3L6G A;  4YMA A;  3OO7 A;  2V84 A;  1ZBM A;  5TP9 A;  4R73 A;  3B6Q A;  3IO4 A;  4Q30 B;  1N3W A;  2B65 A;  4UAC A;  3FXQ A;  5I58 A;  3IOT A;  2LAO A;  2OBG A;  1D9Y A;  4G77 A;  3T96 B;  3DEL B;  2QMW A;  2ZNU A;  4THI A;  3CFL A;  1ZLQ A;  1M5F A;  3LSF B;  4PET A;  2Q89 A;  1S7Y A;  1JET A;  1PBP A;  4NWC A;  4GXA A;  3EHU A;  3V5A A;  3KSJ A;  1M5B A;  4QFO A;  2XX9 A;  1P1U A;  1BIY A;  2RCA A;  4NF5 B;  4UA8 A;  4R72 A;  3IOU A;  4ZEI A;  4DXU A;  1SDX A;  3JYR A;  3MVZ A;  4EQB A;  3FUZ A;  1AL3 A;  5K2Y A;  3VFJ A;  2P0S A;  3SEV A;  2I3W A;  4ZEK A;  3T9X B;  5IKB A;  3T9V A;  1URD A;  1RKM A;  4LVQ A;  1SYI A;  4NF6 B;  2QS3 A;  2X26 A;  2XXQ A;  3VXB A;  5CC2 A;  3S9N C;  3UP9 A;  4POW A;  3V83 A;  3F11 A;  3MQ9 A;  1B46 A;  1LAF E;  3PU5 A;  4U2R A;  1EZP A;  4P11 A;  4NWD A;  1A8F A;  2DXR A;  1LST A;  1GR2 A;  1B5J A;  3O66 A;  4QRZ A;  5H8Q A;  1EZ9 A;  2I0B A;  5EHS A;  3A09 A;  1OMP A;  4N13 A;  1MQG A;  3W15 C;  4IGT A;  2NOO A;  2F35 A;  3TKD A;  4XKN A;  5AA3 A;  1IZ1 A;  3A3C A;  3PUZ E;  4C1T A;  4NF8 A;  4Q5T A;  4BDM A;  3A3U A;  1Y4C A;  3H7M A;  5B70 A;  4FEC A;  3TTL A;  2GHA A;  5CMC A;  5EYF A;  4YIC A;  2OK2 A;  2Z8F A;  1DPP A;  1QVS A;  1DPE A;  3RTW B;  3MW0 A;  3N94 A; 
#chains in the Genus database with same CATH topology
 4JSD A;  4DCX A;  3IOV A;  5HPQ A;  4GOT A;  3FAS A;  1B0L A;  1FJ9 A;  4PFT A;  3RYD A;  1EH3 A;  4IY6 A;  2NUV A;  2A5T B;  2MKZ A;  3DP6 A;  1R9Q A;  3MVY A;  3OD7 A;  4PP0 A;  5LDZ A;  4OEV A;  4KHZ E;  1Y9U A;  4R9F A;  3C36 A;  2M8C A;  1H43 A;  3O29 A;  2ZNS A;  1QKA A;  3ZKL A;  2CMO A;  4QHQ A;  3IR1 A;  1TWY A;  1EZO A;  1LB8 A;  5IZ1 A;  2PYY A;  4IGR A;  4GWX A;  5ET8 A;  4G8H A;  4MX6 A;  2DXY A;  3FV1 A;  2O6A A;  2F6G A;  4R6K A;  2RC8 A;  5CMB A;  3TTK A;  2Z23 A;  3OO6 A;  4EDP A;  5CRY A;  5I84 A;  1WOD A;  1I69 A;  4PF6 A;  4DE8 A;  1IXI A;  5I59 A;  1J1N A;  3KC0 A;  3VV5 A;  2Y7I A;  3O2A A;  3ISP A;  4X1D A;  1FPK A;  4H8I A;  2Y7K A;  1JEV A;  3Q25 A;  4WED A;  3TMG A;  5A5X B;  1Q1K A;  4NGU A;  3IOR A;  4YZZ A;  3U1O A;  3IK6 B;  2UXA A;  3FVO A;  3SDF A;  4TQU Q;  1FBE A;  3LV0 A;  1UIU A;  1CNQ A;  1B3F A;  4OHN A;  2XXY A;  4OET A;  4GX4 A;  2H25 A;  3U92 A;  3OO8 A;  1YZ0 A;  1BP5 A;  1UQW A;  1B3H A;  2I4B A;  3OEK A;  2I0C A;  2Z8E A;  2VPO A;  3KZG A;  2Q2C A;  1YTV A;  4R75 A;  4R6Y A;  3MP6 A;  2WEF A;  1B7U A;  1H76 A;  3I6V A;  1RYO A;  4R2F A;  4MIJ A;  3PPO A;  4XXU A;  1BLF A;  2RC7 A;  1NUY A;  4OTE A;  5F1Q A;  1DTG A;  3O9P A;  3TAJ A;  4YAH X;  3TDJ A;  2OLB A;  4NF4 A;  4YB6 A;  1FSA A;  1LEV A;  1FPL A;  3T66 A;  4ECF A;  3S9L C;  3KN3 A;  3AXF A;  4KR5 A;  2F3D A;  1QKB A;  2H98 A;  3QMF A;  4BDL A;  3RGY A;  1FCK A;  4F3G A;  4O3B A;  5CBR A;  2REJ A;  4I40 A;  2DSF A;  1LCT A;  3EPE A;  1SBP A;  3K6W A;  1VDW A;  1K9Y A;  2AIX A;  2Y5L A;  1R1N A;  2DE2 A;  3LUZ A;  3ZKK A;  2RIN A;  4X48 A;  4GBV A;  4AB6 A;  2G93 A;  3RPL A;  5FHO A;  5ICQ A;  3KEI A;  2Q9T A;  2VT5 A;  4LP2 B;  4YB7 A;  2DQV A;  1MXY A;  3LC8 A;  1WDN A;  2ZZX A;  2R8T A;  3S4U A;  3S9M C;  5DT6 A;  1O7T A;  4P0I A;  4ZEF A;  4ZZA A;  1UTB A;  2UYE A;  4EQ7 A;  5CI5 A;  3LSW A;  4KPT A;  1MXX A;  2F6P A;  2ESN A;  3OSQ A;  1A40 A;  2DWJ A;  3W9V A;  2QVR A;  1I6B A;  4OFO A;  3E78 A;  3TQW A;  2O68 A;  3WAF A;  3UK4 A;  1P1Q A;  4LAT A;  1T0K A;  5ET5 A;  3U94 A;  1POT A;  3B7D A;  4F29 A;  3OEL A;  2P3N A;  1FJ6 A;  5LOM A;  4FAJ A;  5AE4 A;  1P1N A;  5DEX A;  2ZYK A;  4LQ5 A;  4OVQ A;  4AQ4 A;  5I2N B;  4PBH A;  1NV4 A;  2DWH A;  3SEX A;  4TLM B;  1S9T A;  3OOA A;  2ZZV A;  3IFC A;  3K02 A;  4N07 A;  4U4X A;  4LUB A;  3RUM A;  4GIZ A;  1B6H A;  1DOT A;  3MUQ A;  4RXL A;  1ZJL A;  3MVX A;  1MS7 A;  2E1S A;  2O69 A;  4IB2 A;  3QYT A;  1L5T A;  1N3X A;  1QUK A;  1PDA A;  1B05 A;  1VFE A;  1WVJ A;  4H0W A;  1ZIU A;  1B0H A;  2QRY A;  2KQZ A;  2XXT A;  3DLN A;  1FPD A;  3CFZ A;  2D3I A;  5CMK A;  1MQH A;  1NV1 A;  3VE1 B;  1FBD A;  3V89 B;  1G0I A;  1MH4 A;  2VOZ A;  2UVG A;  1A7L A;  1NL5 A;  3KBZ A;  2B4L A;  2F97 A;  5H8N B;  5I56 B;  1JVX A;  3MPK A;  3ECR A;  4H5G A;  1XVY A;  3RPW A;  2VP1 A;  4ELP A;  1D4N A;  4OVP A;  2Q88 A;  5IGA A;  2XX7 A;  4ZZE A;  4ZS9 A;  3EKI A;  4OWD A;  2QVV A;  3PUY E;  1FPF A;  2V3Q A;  3K2D A;  1URG A;  4XKR A;  1TXF A;  3O28 A;  4PAK A;  3MBP A;  3CHG A;  4F3S A;  1B51 A;  4XF5 A;  4JVD A;  3KOT A;  2V3T A;  1Y1M A;  3K1M A;  1JW5 A;  2GFE A;  1JP4 A;  4WXJ A;  1B52 A;  2Y84 A;  5BUU A;  2P2A A;  4U4S A;  2ZYN A;  4KCD A;  4GWZ A;  3BKI B;  3MZB A;  3RTF B;  1MXV A;  3PTY A;  3PD9 A;  3CIJ A;  1AWB A;  2WKY A;  5JEI A;  4BDN A;  1N76 A;  3QUF A;  2OJT A;  1LFH A;  3EF7 A;  2V3U A;  3RLF E;  1P1W A;  3I3V A;  3UGW A;  3T0J A;  3IJO B;  3GXA A;  4MMP A;  4O7I A;  3KN7 A;  2OZZ A;  5I2K B;  1FPJ A;  2I3V A;  4F39 A;  3T1B A;  1FPI A;  3UA8 A;  1I6Q A;  2I49 A;  2Q8M A;  3KJ7 A;  4NED A;  4DI4 B;  2I6E A;  1US4 A;  3PD8 A;  3PUV E;  3DP4 A;  2X7Q A;  2I4C A;  4BDQ A;  4IO7 A;  2GQ1 A;  3SEY A;  4KQP A;  3IO6 A;  3O6I A;  2O51 A;  4NAP A;  3CFX A;  4EQ9 A;  1NV6 A;  4PBQ A;  4BDO A;  2YLN A;  4ONY A;  2QVU A;  1B58 A;  4OA4 A;  3TEP A;  3MVW A;  1FTK A;  2FIX A;  1Y20 A;  1JQF A;  2WYP A;  4H67 A;  4RA1 A;  1FQE A;  3H6V A;  2XXH A;  2XXP A;  5L9S A;  4U1Z A;  1IQ7 A;  3O6H A;  3C9H A;  4IY5 A;  1USY H;  1BKA A;  2CZI A;  3R26 A;  4GD5 A;  1XI6 A;  1LBC A;  3QAX A;  3GZG A;  2Z8D A;  2X7P A;  1JW4 A;  1XS5 A;  4KCC A;  5T3J A;  4Z0I A;  5I57 B;  3G3J A;  3VVE A;  2XX8 A;  4H5F A;  4F19 A;  3H06 B;  3WAE A;  2O7U A;  3T9H B;  4H46 A;  5TPA A;  3PMX A;  4DLD A;  1EYI A;  1OLA A;  3FJ7 A;  5H8F A;  4E0X A;  1YAE A;  4H8J A;  3D4C A;  1NNP A;  2REG A;  4XIG Q;  3FJG A;  4F2O A;  1NNK A;  4JBZ A;  1KWH A;  4N91 A;  1OQH A;  2QSX A;  3G3I A;  1QUL A;  2ZZW A;  4P1E A;  3MST A;  2HAV A;  3MZ1 A;  1LCF A;  2YPN A;  4NHB A;  4FBP A;  1DMB A;  4X1B A;  2XXU A;  4KI0 E;  1JEU A;  1S50 A;  1BTJ A;  3TYH A;  5EQA A;  4F22 A;  4H45 A;  3TCF A;  3EN3 A;  4O8M A;  1LBX A;  4U22 A;  4LZ7 A;  2DOJ A;  3CG3 A;  3E13 X;  4HTG A;  4MNP A;  3PUX E;  4MH5 A;  1B1X A;  4XEQ A;  4FE8 A;  1B7H A;  4KYS A;  1D9V A;  2DYX A;  1A54 A;  5DTB A;  2NXO A;  3MAM A;  4MFI A;  4RPN A;  2D21 A;  2DVC A;  4PFR A;  2GRV A;  3LSL A;  2XD3 A;  3IOW A;  3USD A;  5ITO A;  1URS A;  1A99 A;  1Y3N A;  2HZK A;  5H8H B;  4KYD A;  3ODB A;  2DVZ A;  3RY3 A;  5KDT B;  5JK4 A;  1POY 1;  1H45 A;  5DEX B;  1CE2 A;  3PPQ A;  1D3K A;  2DS9 A;  4N6D A;  3VLU A;  3C34 A;  1MRP A;  4U23 A;  1N7X A;  1ANF A;  4ZE8 A;  4QFP A;  1IIT A;  4NF5 A;  4I62 A;  1UTH B;  3KJT A;  1NV5 A;  3R7X A;  2FBP A;  4POX A;  2F78 A;  2ZNT A;  1LFI A;  3TQL A;  3Q29 A;  5EQ8 A;  3GBB A;  4XKP A;  2L5V A;  1LLS A;  3MC2 A;  4RPO A;  5DVJ A;  2F3B A;  2HPG A;  1FBP A;  2F7C A;  5EYG A;  2H9B A;  3GYY A;  4ZDM A;  2ZYO A;  4FED A;  1IME A;  1LB9 A;  4PFB A;  1MM6 A;  3IB0 A;  1ZMG A;  3ONM A;  3S2V A;  2VPN A;  4NF6 A;  2H99 A;  1IXG A;  1BK4 A;  4O3C A;  4RYA A;  2XWV A;  5ICT A;  2FHY A;  2Y7W A;  2H5Y A;  2IEE A;  2ANJ A;  3MJN A;  4WEP A;  2F7A A;  4R9G A;  2HCA A;  1P99 A;  4YMB A;  1H3D A;  3EHS A;  3UN6 A;  5K2X A;  5IZ3 B;  3IB2 A;  2WX9 A;  1EYK A;  1US5 A;  2P1S A;  4N8G A;  5DYH A;  5KCJ B;  3HHG A;  3KN8 A;  3RQT A;  5CM6 A;  3TCG A;  1IMF A;  4OVT A;  1B32 A;  2PFZ A;  3C31 A;  3B6W A;  4F18 A;  4EF1 A;  3RN8 A;  5LTC A;  1DCU A;  1Z7M E;  1RDX A;  3PPP A;  4O3A A;  4GQO A;  5AA4 A;  5AA2 B;  3JV9 A;  4JWX A;  5FTH A;  3LR1 A;  5J16 A;  5TP9 B;  3VLV A;  5EQ9 A;  2P3V A;  4OZ9 A;  5I58 B;  4EXL A;  1NKX A;  1YCJ A;  4LON B;  4PFY A;  4PC9 A;  4ZEB A;  4GWO A;  4JSO A;  1QUI A;  3KG2 A;  3K6V A;  1Y4T A;  4MF3 A;  3E9X A;  3T93 B;  1SPI A;  4OXV A;  4OAN A;  4U1O A;  2PFY A;  3ILU B;  4RK2 A;  4C0R A;  4ZEC A;  2A5T A;  4FOR A;  5A5L A;  1XVX A;  1B5I A;  1HSL A;  1B3E A;  4NX1 A;  1Y3P A;  4F1V A;  4MLV A;  3DM0 A;  2R71 A;  1FRP A;  1DBZ A;  2DWA A;  4OFL A;  4IO3 A;  4QSE A;  1FBH A;  2NWJ A;  1B7Z A;  5ISU A;  3JZJ A;  4IO6 A;  4IO5 A;  3CR9 A;  3HV1 A;  3VDF A;  1TFD A;  1LAX A;  3VXC A;  3QK6 A;  4E0W A;  5HM4 B;  3PUW E;  1PB7 A;  4GFR A;  3MPL A;  5FHM A;  1LAH E;  1NH7 A;  3FZV A;  4GF8 A;  2HQ0 A;  2CEY A;  1O64 A;  3CRB A;  1DK4 A;  1MY3 A;  2FVZ A;  2UVJ A;  1OIB A;  4MNC A;  3T22 A;  1Q35 A;  5AA1 A;  2Y7R A;  2XWO A;  3N6U A;  4N15 A;  3CVG A;  3T9U A;  2OWS A;  1MPC A;  4PAF A;  4EF2 A;  4TOZ A;  1MXZ A;  1H44 A;  1B1H A;  3W9W A;  4GLI A;  1SW2 A;  3FIR A;  3BFT A;  4DZ1 A;  3LUY A;  3S9E A;  5DVI A;  1N0T A;  4KFQ A;  4F3P A;  2DE3 A;  3O6G A;  5A5X A;  2F36 A;  1FPB A;  1N84 A;  1M5D A;  1JW1 A;  4R74 A;  4YKJ A;  5ET6 A;  1XHY A;  4YU0 A;  2UVI A;  2XXI A;  3UIF A;  2QPQ A;  2OWZ A;  1B4H A;  4PE5 B;  3FV2 A;  4Z7E A;  4QBA A;  4MBP A;  5H8Q B;  5KZT A;  4HCY A;  2PMS A;  2PT1 A;  4BDR A;  1MXW A;  3SEU A;  4OER A;  3MWB A;  1B3G A;  3QSL A;  2FIE A;  2QL3 A;  4NF8 B;  3HCQ A;  3GBA A;  4ISU A;  3SER A;  4HE1 A;  1MH3 A;  2D5W A;  4ESW A;  3SEW A;  3MP1 A;  2PCR A;  3FXR A;  3CSG A;  2HXW A;  1P1O A;  3MYU A;  3N6T A;  4H1X A;  3DP8 A;  4DXC A;  3FXB A;  4EXK A;  1VSO A;  1IMC A;  3K00 A;  2QS1 A;  4I3Y A;  5I5P A;  1IMA A;  1PB9 A;  5BWJ A;  1M5E A;  3FXU A;  1MM7 A;  4O94 A;  2ZYM A;  4NN3 A;  4HXV A;  2HAU A;  2XWK A;  2V93 A;  3NOH A;  1NV0 A;  4P56 A;  1MPD A;  3E4R A;  1QJM A;  1LBW A;  1PBQ A;  3TUS A;  2HZL A;  5L9O A;  4XTC Q;  1FPE A;  1QUJ A;  4GRK A;  1KA1 A;  4IO4 A;  3H6W A;  4X04 A;  2VGQ A;  5ITP A;  4ND9 A;  1ELJ A;  4OVR A;  1OVT A;  3G3F A;  3R6U A;  1LAG E;  2XXW A;  3HST A;  4KYE A;  5HBC A;  2PT2 A;  1G0H A;  4M1V A;  1AIV A;  1FPG A;  3N26 A;  4KD5 A;  5DVF A;  4HCW A;  1B5H A;  3P7I A;  3IB1 A;  2PVU A;  1B3L A;  1SQY A;  4IO2 A;  3K6X A;  1EU8 A;  1ATG A;  4N4U A;  2HXR A;  4OVJ A;  4PTK A;  2QS4 A;  1TT1 A;  2UYF A;  2VD3 A;  2CZK A;  3E79 A;  4NG7 A;  4L17 A;  3BFU A;  3PPN A;  4QSD A;  4OYV A;  2HEU A;  4XKQ A;  3FVN A;  4G68 A;  4DIG A;  2AYS A;  3ROJ A;  1PB8 A;  1FQD A;  3M3F A;  5I59 B;  5CMM A;  3K1N A;  2DWI A;  2ONK E;  3FAT A;  3U72 A;  4F3B A;  1IMB A;  1NH8 A;  4JVI A;  4H65 A;  5FTI A;  3G7W A;  1HSE A;  2UVH A;  1IXH A;  1IIW A;  5JTY A;  2RF1 A;  1B9J A;  2F7B A;  1ZU0 A;  2F34 A;  1FQA A;  1AH5 A;  4U21 A;  3LBS A;  3PMW A;  4Q8R A;  4R6H A;  3ZSF A;  4X8R A;  3TTR A;  5I2N A;  1FTL A;  2Z22 A;  2O84 X;  3MZ9 A;  5IAI A;  4DDD A;  1FQB A;  3M8U A;  4MNI A;  4QSC A;  4GWU A;  3H6T A;  4FAT A;  2GHB A;  5L9M A;  1FBF A;  4JVC A;  3KOS A;  4G4P A;  4GXS B;  2HFB A;  1IUD A;  4HS7 A;  1NV2 A;  2R6G E;  3SET A;  4NF0 A;  4NF4 B;  3M3K A;  3OEM A;  2XWI A;  3QUJ A;  4M4G A;  2QFL A;  1FTM A;  1NI9 A;  3HHF A;  4HW8 A;  4LZ5 A;  4N81 A;  4P3L A;  2AL4 A;  1NNT A;  1LBZ A;  4AB5 A;  4OEN A;  3N5L A;  5AA4 B;  1ZTY A;  2F8D A;  5H8N A;  5I56 A;  4BLA A;  2VD2 A;  4P8B A;  3SKP A;  3FJM A;  3C32 A;  4MHF A;  4Q0C A;  3TPA A;  1FW0 A;  1B2H A;  4EUO A;  3RPL B;  3K6U A;  2ONR A;  1DTZ A;  3OXN A;  1HSJ A;  1NUX A;  3K1P A;  2F5X A;  4ZED A;  4X9T A;  1LFG A;  4PQJ A;  1MQJ A;  4JWY A;  2FNC A;  4AS4 A;  3PGF A;  4PDH A;  3VVF A;  2FA7 A;  2KLF A;  1LBB A;  3TFL A;  1SI1 A;  1NUZ A;  3FGS A;  4TLL B;  1UTB B;  4QFN A;  1D9Q A;  2ZMB A;  3O97 A;  4ELR A;  1R9L A;  3FD3 A;  1MXU A;  2XHD A;  2B4M A;  1YYZ A;  1FBC A;  2DE4 A;  2RCB A;  3QIM A;  5H8S A;  4OFJ A;  3L6H A;  4NTL A;  3KBR A;  2XD2 A;  5FBP A;  4MCO A;  2CEX A;  3PPR A;  4JXI A;  2BJI A;  2DP8 A;  3KGC A;  1AMF A;  4F2Q A;  1LGB C;  4DXB A;  4C1U A;  3HN0 A;  4P0G A;  1CB6 A;  1GGG A;  4UAB A;  3LSX A;  3D1R A;  4OQO A;  2ZXT A;  1USY E;  5I2K A;  4RY1 A;  3PMV A;  1FTJ A;  2RC9 A;  3HFU A;  5F7V A;  4NMY A;  1A8E A;  4N8Y A;  4PGP A;  4PDD A;  4GWY A;  1MDP 1;  3GLB A;  4QFL A;  2B3B A;  1ZKB A;  4RNS A;  2B3F A;  2G29 A;  3FVG A;  5EQ7 A;  1NNF A;  2Q8J A;  3RNN A;  1SVX B;  3Q27 A;  1MQI A;  1SW5 A;  4P1L A;  3FVK A;  2H4I A;  1SI0 A;  4LZ8 A;  2NVU B;  4G2Z A;  1I6A A;  3TZA A;  3VVD A;  1YXI A;  1F9B A;  1OLC A;  1YPN A;  3Q26 A;  4FEB A;  3I5O A;  1R6Z A;  1MQD A;  3IL1 B;  2O1M A;  3OO9 A;  3IAZ A;  1XC1 A;  2ABH A;  3U93 A;  3TEL A;  3PV0 E;  4I9D A;  3IFA A;  2Y7P A;  2O1L A;  4QFK A;  5F24 A;  1GVC A;  5I57 A;  3TCH A;  4P9K A;  4NQ8 A;  4YKI A;  2FYI A;  1SD3 A;  3U8Q A;  3TOD A;  4OVS A;  5CBS A;  3K4U A;  2XXR A;  1SW1 A;  4MEV A;  1SYH A;  2WBD A;  4N6P A;  1MG1 A;  4GVO A;  1OVB A;  4YKK A;  4DI3 D;  1AOV A;  3CSB A;  4ELQ A;  4I8C A;  2I48 A;  3G3K A;  3MP8 A;  1TFA A;  1MY0 A;  4GX3 A;  3H4Z A;  5ESY A;  5AA2 D;  1GV8 A;  1MY4 A;  1VFD A;  4GWW A;  4OEU A;  2OCU A;  3HPI A;  1FQC A;  4AS5 A;  4JWO A;  2O7I A;  2ONS A;  4MJO A;  5IZZ A;  3BBR A;  4RJZ A;  2JJK A;  1Y3Q A;  4DCY A;  2XXX A;  2CZL A;  2Q2A A;  1EYJ A;  1PC3 A;  1NFT A;  3Q28 A;  3K01 A;  1FTA A;  3OEN A;  2THI A;  3M3L A;  1QGX A;  5ELV A;  2PBW A;  1N04 A;  3CG1 A;  3IX1 A;  5FHN A;  1NMU A;  4R2B A;  4LA9 A;  4QF9 A;  4YB5 A;  3OSR A;  5M2V A;  4MAG A;  4PFW A;  1IXC A;  2PX1 A;  1MY1 A;  1N7W A;  4PCD A;  1O63 A;  1RYX A;  4MLQ A;  3C4M A;  4K3F A;  1MY2 A;  3ZS6 A;  2E0S A;  3V8X B;  3H3G A;  1JNF A;  4G68 B;  3G3G A;  4ELO A;  3QXM A;  3K0V A;  4LQ2 A;  4G8N A;  4F31 B;  1XT8 A;  3B6T A;  2XXK A;  5H8H A;  1QW0 A;  4RK9 A;  1MPB A;  2YJP A;  1NV3 A;  5KDT A;  4PF8 A;  5TU0 A;  3VLW A;  5JTY B;  4NE4 A;  2W7Y A;  1Y1Z A;  1DSN A;  4FIM A;  2I58 A;  3IJX B;  4PE3 A;  5B7D A;  4ZE9 A;  4F1Y A;  1MDQ A;  2V25 A;  4G8M A;  2A5S A;  3OMB A;  2GH9 A;  2QJE A;  3E3K A;  1UTH A;  3FBP A;  5EHM A;  4GL8 A;  2ALU A;  2BJJ X;  3C35 A;  3A29 A;  4G68 C;  4FJP A;  3EHT A;  4HE2 A;  4H6D A;  4I1D A;  2RKM A;  4P47 A;  5L8D A;  4YKP A;  4JB7 A;  2XXV A;  3D4G A;  4PGN A;  3C33 A;  1IEJ A;  5TPA B;  1B4Z A;  1M5C A;  4OMB A;  4WKM A;  1KZ8 A;  5J1D A;  2R9J A;  5H8F B;  3TTM A;  4F1U A;  1Z7N E;  2XA5 A;  4N17 A;  4GL0 A;  1B40 A;  4OES A;  1FBG A;  2AL5 A;  1FQF A;  3KFM A;  3H03 A;  4GX6 A;  1SW4 A;  2QS2 A;  4ESX A;  2DDK A;  3BIH A;  3KSX A;  3H6U A;  1XOC A;  3RT6 B;  1VR5 A;  1OQG A;  3EQ1 A;  5IZ3 A;  5EYH A;  3G3H A;  2VHA A;  1FTO A;  4PFU A;  3CI8 A;  1PEB A;  1JVY A;  4IR8 A;  3THI A;  3ILT B;  4JDF A;  4G61 A;  1A55 A;  5KCJ A;  3SES A;  3TTN A;  2QMX A;  3RT8 A;  2IA4 A;  1NV7 A;  3HO7 A;  1VE4 A;  1II5 A;  3UOR A;  1GTK A;  3BIG A;  1Q9D A;  5AA2 A;  1UIV A;  2OWT A;  3L6G A;  4XFE A;  4YMA A;  4O7M A;  4I3E A;  3OO7 A;  2V84 A;  1ZBM A;  3KC1 A;  5TP9 A;  4R73 A;  3B6Q A;  3IO4 A;  4Q30 B;  1N3W A;  2B65 A;  4UAC A;  3FXQ A;  5DW8 A;  5I58 A;  3IOT A;  2LAO A;  2OBG A;  1D9Y A;  4G77 A;  3T96 B;  4LN5 A;  3DEL B;  2QMW A;  2ZNU A;  4THI A;  3CFL A;  1ZLQ A;  1M5F A;  3LSF B;  4PET A;  2Q89 A;  1S7Y A;  5I7I A;  4GWS A;  1IMD A;  1JET A;  1PBP A;  3SZP A;  5I3S A;  4NWC A;  4GXA A;  3EHU A;  3V5A A;  3KSJ A;  1M5B A;  4QFO A;  4N6K A;  2Y5K A;  2XX9 A;  4PFI A;  1P1U A;  1BIY A;  2RCA A;  4NF5 B;  4UA8 A;  4HE0 A;  4R72 A;  3IOU A;  4ZEI A;  4DXU A;  1SDX A;  4PAI A;  3JYR A;  1LBY A;  3MVZ A;  4EQB A;  3FUZ A;  1AL3 A;  5K2Y A;  3VFJ A;  2HHM A;  1K9Z A;  2V4C A;  2P0S A;  3SEV A;  2I3W A;  2WYK A;  4ZEK A;  1RDZ A;  3T9X B;  5IKB A;  3T9V A;  1URD A;  1RKM A;  4LVQ A;  3U65 A;  1SYI A;  4NF6 B;  2QS3 A;  2X26 A;  2XXQ A;  3VXB A;  2OX3 A;  5CC2 A;  3S9N C;  3UP9 A;  4KXP A;  4POW A;  2Q74 A;  1INP A;  3V83 A;  3F11 A;  3MQ9 A;  1B46 A;  2CZH A;  1RDY A;  1LAF E;  3PU5 A;  4U2R A;  1EZP A;  4P11 A;  4NWD A;  1A8F A;  2DXR A;  1LST A;  4GBW A;  1GR2 A;  1B5J A;  3O66 A;  4QRZ A;  5H8Q A;  1EZ9 A;  2I0B A;  5EHS A;  3A09 A;  1OMP A;  4N13 A;  1MQG A;  3W15 C;  4IGT A;  1NUW A;  2NOO A;  4QXD A;  2F35 A;  3TKD A;  4XKN A;  5AA3 A;  1IZ1 A;  3A3C A;  3PUZ E;  4C1T A;  5IM2 A;  4NF8 A;  4Q5T A;  4BDM A;  3A3U A;  1Y4C A;  5ET7 A;  1KA0 A;  3H7M A;  3B50 A;  5B70 A;  4FEC A;  3TTL A;  2GHA A;  5CMC A;  3B8B A;  5EYF A;  2WBB A;  4YIC A;  2OK2 A;  2Z8F A;  1DPP A;  1QVS A;  2KR0 A;  1DPE A;  3RTW B;  3MW0 A;  3N94 A;  1LBV A; 
#chains in the Genus database with same CATH homology
 4JSD A;  4DCX A;  3IOV A;  5HPQ A;  4GOT A;  3FAS A;  1B0L A;  4PFT A;  1EH3 A;  4IY6 A;  2NUV A;  2A5T B;  3MVY A;  3DP6 A;  1R9Q A;  3OD7 A;  4PP0 A;  4OEV A;  4KHZ E;  1Y9U A;  4R9F A;  3C36 A;  2M8C A;  1H43 A;  3O29 A;  2ZNS A;  1QKA A;  3ZKL A;  2CMO A;  4QHQ A;  3IR1 A;  1TWY A;  1EZO A;  1LB8 A;  2PYY A;  4IGR A;  4G8H A;  2DXY A;  3FV1 A;  2O6A A;  2F6G A;  4R6K A;  2RC8 A;  5CMB A;  3TTK A;  2Z23 A;  3OO6 A;  4EDP A;  5CRY A;  5I84 A;  1WOD A;  1I69 A;  4DE8 A;  1IXI A;  5I59 A;  1J1N A;  3VV5 A;  2Y7I A;  3O2A A;  4X1D A;  4H8I A;  2Y7K A;  1JEV A;  3Q25 A;  4WED A;  3TMG A;  5A5X B;  1Q1K A;  3IOR A;  4YZZ A;  3U1O A;  3IK6 B;  2UXA A;  3FVO A;  3SDF A;  4TQU Q;  1UIU A;  1B3F A;  4OHN A;  2XXY A;  4OET A;  2H25 A;  3U92 A;  3OO8 A;  1BP5 A;  1UQW A;  1B3H A;  2I4B A;  3OEK A;  2I0C A;  2Z8E A;  3KZG A;  2Q2C A;  1YTV A;  4R75 A;  4R6Y A;  3MP6 A;  1B7U A;  1H76 A;  3I6V A;  1RYO A;  4R2F A;  4XXU A;  3PPO A;  1BLF A;  2RC7 A;  4OTE A;  5F1Q A;  1DTG A;  3O9P A;  3TAJ A;  4YAH X;  3TDJ A;  2OLB A;  4NF4 A;  4YB6 A;  3T66 A;  4ECF A;  3S9L C;  3KN3 A;  3AXF A;  4KR5 A;  1QKB A;  2H98 A;  4BDL A;  3RGY A;  1FCK A;  4F3G A;  4O3B A;  5CBR A;  2REJ A;  2DSF A;  1LCT A;  3EPE A;  1SBP A;  3K6W A;  2AIX A;  1R1N A;  2DE2 A;  3ZKK A;  2RIN A;  4X48 A;  4AB6 A;  2G93 A;  5FHO A;  5ICQ A;  3KEI A;  2Q9T A;  4LP2 B;  4YB7 A;  2DQV A;  1MXY A;  3LC8 A;  1WDN A;  3S4U A;  3S9M C;  5DT6 A;  1O7T A;  4P0I A;  4ZEF A;  4ZZA A;  1UTB A;  2UYE A;  4EQ7 A;  5CI5 A;  3LSW A;  4KPT A;  1MXX A;  2F6P A;  2ESN A;  3OSQ A;  1A40 A;  2DWJ A;  3W9V A;  1I6B A;  4OFO A;  3TQW A;  2O68 A;  3WAF A;  3UK4 A;  1P1Q A;  4LAT A;  1T0K A;  3U94 A;  1POT A;  3B7D A;  4F29 A;  3OEL A;  5LOM A;  4FAJ A;  5AE4 A;  1P1N A;  5DEX A;  2ZYK A;  4LQ5 A;  4AQ4 A;  5I2N B;  2DWH A;  3SEX A;  4TLM B;  1S9T A;  3OOA A;  3K02 A;  4N07 A;  4U4X A;  4LUB A;  3RUM A;  4GIZ A;  1B6H A;  1DOT A;  3MUQ A;  4RXL A;  1ZJL A;  3MVX A;  1MS7 A;  2E1S A;  2O69 A;  4IB2 A;  3QYT A;  1L5T A;  1N3X A;  1QUK A;  1PDA A;  1B05 A;  1VFE A;  1WVJ A;  4H0W A;  1ZIU A;  1B0H A;  2QRY A;  2XXT A;  3DLN A;  3CFZ A;  2D3I A;  5CMK A;  1MQH A;  3VE1 B;  3V89 B;  1MH4 A;  2VOZ A;  2UVG A;  1A7L A;  1NL5 A;  2F97 A;  5H8N B;  5I56 B;  1JVX A;  3MPK A;  3ECR A;  4H5G A;  1XVY A;  3RPW A;  2VP1 A;  4ELP A;  1D4N A;  2Q88 A;  2XX7 A;  4ZZE A;  4ZS9 A;  4OWD A;  3PUY E;  2V3Q A;  3K2D A;  1URG A;  4XKR A;  1TXF A;  3O28 A;  3MBP A;  4F3S A;  1B51 A;  3KOT A;  2V3T A;  1Y1M A;  3K1M A;  1JW5 A;  2GFE A;  4WXJ A;  1B52 A;  2Y84 A;  5BUU A;  2P2A A;  4U4S A;  2ZYN A;  4KCD A;  3BKI B;  3MZB A;  3RTF B;  1MXV A;  3PD9 A;  3CIJ A;  2WKY A;  5JEI A;  4BDN A;  1N76 A;  3QUF A;  2OJT A;  1LFH A;  3EF7 A;  2V3U A;  3RLF E;  1P1W A;  3I3V A;  3UGW A;  3IJO B;  3GXA A;  3KN7 A;  2OZZ A;  5I2K B;  2I3V A;  4F39 A;  3UA8 A;  1I6Q A;  2I49 A;  3KJ7 A;  4NED A;  2I6E A;  1US4 A;  3PD8 A;  3PUV E;  3DP4 A;  2X7Q A;  2I4C A;  4BDQ A;  4IO7 A;  3SEY A;  4KQP A;  3IO6 A;  3O6I A;  2O51 A;  3CFX A;  4EQ9 A;  4BDO A;  2YLN A;  4ONY A;  1B58 A;  3TEP A;  3MVW A;  1FTK A;  1Y20 A;  1JQF A;  4H67 A;  4RA1 A;  1FQE A;  3H6V A;  2XXH A;  2XXP A;  5L9S A;  4U1Z A;  1IQ7 A;  3O6H A;  3C9H A;  4IY5 A;  1USY H;  1BKA A;  3R26 A;  4GD5 A;  1LBC A;  3QAX A;  3GZG A;  2Z8D A;  2X7P A;  1JW4 A;  1XS5 A;  4KCC A;  4Z0I A;  5I57 B;  3G3J A;  3VVE A;  2XX8 A;  4H5F A;  4F19 A;  3H06 B;  3WAE A;  2O7U A;  3T9H B;  5TPA A;  3PMX A;  4DLD A;  1OLA A;  3FJ7 A;  5H8F A;  4E0X A;  1YAE A;  4H8J A;  3D4C A;  1NNP A;  2REG A;  4XIG Q;  3FJG A;  4F2O A;  1NNK A;  4JBZ A;  1KWH A;  1OQH A;  2QSX A;  3G3I A;  1QUL A;  2HAV A;  3MZ1 A;  1LCF A;  2YPN A;  1DMB A;  4X1B A;  2XXU A;  4KI0 E;  1JEU A;  1S50 A;  1BTJ A;  3TYH A;  4F22 A;  3TCF A;  3EN3 A;  4U22 A;  4LZ7 A;  2DOJ A;  3CG3 A;  3E13 X;  4HTG A;  3PUX E;  4MH5 A;  1B1X A;  4FE8 A;  1B7H A;  4KYS A;  1D9V A;  2DYX A;  1A54 A;  5DTB A;  2NXO A;  3MAM A;  4MFI A;  4RPN A;  2D21 A;  2DVC A;  2GRV A;  3LSL A;  2XD3 A;  3IOW A;  3USD A;  5ITO A;  1URS A;  1A99 A;  1Y3N A;  2HZK A;  5H8H B;  4KYD A;  3ODB A;  2DVZ A;  3RY3 A;  5KDT B;  5JK4 A;  1POY 1;  1H45 A;  5DEX B;  1CE2 A;  3PPQ A;  1D3K A;  2DS9 A;  3VLU A;  3C34 A;  1MRP A;  4U23 A;  1N7X A;  1ANF A;  4ZE8 A;  4QFP A;  1IIT A;  4NF5 A;  4I62 A;  1UTH B;  3KJT A;  3R7X A;  4POX A;  2F78 A;  2ZNT A;  1LFI A;  3TQL A;  3Q29 A;  3GBB A;  4XKP A;  1LLS A;  3MC2 A;  4RPO A;  5DVJ A;  2F7C A;  2H9B A;  4ZDM A;  2ZYO A;  4FED A;  1LB9 A;  1MM6 A;  3IB0 A;  1ZMG A;  3ONM A;  3S2V A;  4NF6 A;  2H99 A;  1IXG A;  4O3C A;  4RYA A;  5ICT A;  2Y7W A;  2H5Y A;  2IEE A;  2ANJ A;  3MJN A;  4WEP A;  2F7A A;  4R9G A;  2HCA A;  1P99 A;  4YMB A;  1H3D A;  3EHS A;  3UN6 A;  5K2X A;  3IB2 A;  1US5 A;  2P1S A;  5DYH A;  5KCJ B;  3HHG A;  3KN8 A;  3RQT A;  5CM6 A;  3TCG A;  1B32 A;  3C31 A;  3B6W A;  4F18 A;  4EF1 A;  3RN8 A;  1Z7M E;  3PPP A;  4O3A A;  4GQO A;  5AA4 A;  5AA2 B;  3JV9 A;  4JWX A;  5FTH A;  3LR1 A;  5TP9 B;  3VLV A;  4OZ9 A;  5I58 B;  4EXL A;  1NKX A;  1YCJ A;  4LON B;  4PFY A;  4ZEB A;  4GWO A;  4JSO A;  1QUI A;  3KG2 A;  3K6V A;  1Y4T A;  4MF3 A;  3E9X A;  3T93 B;  4OXV A;  4U1O A;  3ILU B;  4RK2 A;  4C0R A;  4ZEC A;  2A5T A;  4FOR A;  1XVX A;  1B5I A;  1HSL A;  1B3E A;  1Y3P A;  4F1V A;  4MLV A;  3DM0 A;  2R71 A;  2DWA A;  4OFL A;  4IO3 A;  4QSE A;  2NWJ A;  1B7Z A;  5ISU A;  3JZJ A;  4IO6 A;  4IO5 A;  3CR9 A;  3HV1 A;  3VDF A;  1TFD A;  1LAX A;  3VXC A;  3QK6 A;  4E0W A;  5HM4 B;  3PUW E;  1PB7 A;  4GFR A;  3MPL A;  5FHM A;  1LAH E;  1NH7 A;  3FZV A;  4GF8 A;  2HQ0 A;  1O64 A;  3CRB A;  1MY3 A;  2UVJ A;  1OIB A;  3T22 A;  1Q35 A;  5AA1 A;  2Y7R A;  3N6U A;  3CVG A;  3T9U A;  2OWS A;  1MPC A;  4EF2 A;  4TOZ A;  1MXZ A;  1H44 A;  1B1H A;  3W9W A;  4GLI A;  1SW2 A;  3FIR A;  3BFT A;  4DZ1 A;  3LUY A;  3S9E A;  5DVI A;  1N0T A;  4KFQ A;  4F3P A;  2DE3 A;  3O6G A;  5A5X A;  2F36 A;  1N84 A;  1M5D A;  1JW1 A;  4R74 A;  4YKJ A;  1XHY A;  4YU0 A;  2UVI A;  2XXI A;  3UIF A;  2QPQ A;  1B4H A;  4PE5 B;  3FV2 A;  4Z7E A;  4MBP A;  5H8Q B;  5KZT A;  4HCY A;  2PMS A;  2PT1 A;  4BDR A;  1MXW A;  3SEU A;  4OER A;  3MWB A;  1B3G A;  3QSL A;  2QL3 A;  4NF8 B;  3HCQ A;  3GBA A;  4ISU A;  3SER A;  1MH3 A;  2D5W A;  4ESW A;  3SEW A;  3MP1 A;  3FXR A;  3CSG A;  2HXW A;  1P1O A;  3N6T A;  4H1X A;  3DP8 A;  4DXC A;  4EXK A;  1VSO A;  3K00 A;  2QS1 A;  1PB9 A;  5BWJ A;  1M5E A;  3FXU A;  1MM7 A;  2ZYM A;  2HAU A;  2V93 A;  1MPD A;  3E4R A;  1QJM A;  1PBQ A;  3TUS A;  2HZL A;  5L9O A;  4XTC Q;  1QUJ A;  4GRK A;  4IO4 A;  3H6W A;  5ITP A;  2VGQ A;  4ND9 A;  1ELJ A;  1OVT A;  3G3F A;  3R6U A;  1LAG E;  2XXW A;  3HST A;  4KYE A;  5HBC A;  2PT2 A;  4M1V A;  1AIV A;  3N26 A;  4KD5 A;  5DVF A;  4HCW A;  1B5H A;  3P7I A;  3IB1 A;  2PVU A;  1B3L A;  1SQY A;  4IO2 A;  3K6X A;  1EU8 A;  1ATG A;  4OVJ A;  2QS4 A;  1TT1 A;  2UYF A;  2VD3 A;  4L17 A;  3BFU A;  3PPN A;  4QSD A;  4OYV A;  2HEU A;  4XKQ A;  3FVN A;  4G68 A;  4DIG A;  2AYS A;  1PB8 A;  1FQD A;  3M3F A;  5I59 B;  5CMM A;  3K1N A;  2DWI A;  2ONK E;  3FAT A;  3U72 A;  4F3B A;  1NH8 A;  4H65 A;  5FTI A;  3G7W A;  1HSE A;  2UVH A;  1IXH A;  1IIW A;  5JTY A;  2RF1 A;  1B9J A;  2F7B A;  1ZU0 A;  2F34 A;  1FQA A;  1AH5 A;  4U21 A;  3LBS A;  3PMW A;  4Q8R A;  4R6H A;  3ZSF A;  3TTR A;  5I2N A;  1FTL A;  2Z22 A;  2O84 X;  3MZ9 A;  5IAI A;  4DDD A;  1FQB A;  3M8U A;  4QSC A;  3H6T A;  4FAT A;  2GHB A;  5L9M A;  3KOS A;  4G4P A;  4GXS B;  2HFB A;  1IUD A;  4HS7 A;  2R6G E;  3SET A;  4NF4 B;  3M3K A;  3OEM A;  3QUJ A;  4M4G A;  1FTM A;  3HHF A;  4HW8 A;  4LZ5 A;  2AL4 A;  1NNT A;  4AB5 A;  4OEN A;  5AA4 B;  3N5L A;  1ZTY A;  2F8D A;  5H8N A;  5I56 A;  4BLA A;  2VD2 A;  3SKP A;  3FJM A;  3C32 A;  4Q0C A;  3TPA A;  1FW0 A;  1B2H A;  4EUO A;  3K6U A;  2ONR A;  1DTZ A;  3OXN A;  1HSJ A;  3K1P A;  2F5X A;  4ZED A;  4X9T A;  1LFG A;  4PQJ A;  1MQJ A;  4JWY A;  2FNC A;  3PGF A;  3VVF A;  2FA7 A;  2KLF A;  1LBB A;  3TFL A;  1SI1 A;  3FGS A;  4TLL B;  1UTB B;  4QFN A;  2ZMB A;  3O97 A;  4ELR A;  1R9L A;  3FD3 A;  1MXU A;  2XHD A;  2DE4 A;  2RCB A;  3QIM A;  5H8S A;  4OFJ A;  3L6H A;  4NTL A;  3KBR A;  2XD2 A;  3PPR A;  4JXI A;  2DP8 A;  3KGC A;  1AMF A;  4F2Q A;  1LGB C;  4DXB A;  4C1U A;  3HN0 A;  4P0G A;  1CB6 A;  1GGG A;  3LSX A;  4OQO A;  2ZXT A;  1USY E;  5I2K A;  4RY1 A;  3PMV A;  1FTJ A;  2RC9 A;  5F7V A;  4NMY A;  1A8E A;  1MDP 1;  3GLB A;  4QFL A;  2B3B A;  1ZKB A;  4RNS A;  2B3F A;  2G29 A;  3FVG A;  1NNF A;  2Q8J A;  3RNN A;  1SVX B;  3Q27 A;  1MQI A;  1SW5 A;  3FVK A;  2H4I A;  1SI0 A;  4LZ8 A;  2NVU B;  4G2Z A;  1I6A A;  3TZA A;  3VVD A;  1F9B A;  1OLC A;  1YPN A;  3Q26 A;  4FEB A;  3I5O A;  1R6Z A;  1MQD A;  3IL1 B;  2O1M A;  3OO9 A;  3IAZ A;  1XC1 A;  3U93 A;  2ABH A;  3TEL A;  3PV0 E;  4I9D A;  2Y7P A;  2O1L A;  4QFK A;  1GVC A;  5I57 A;  3TCH A;  4YKI A;  2FYI A;  1SD3 A;  3U8Q A;  3TOD A;  5CBS A;  3K4U A;  2XXR A;  1SW1 A;  1SYH A;  4N6P A;  1MG1 A;  4GVO A;  1OVB A;  4YKK A;  1AOV A;  3CSB A;  4ELQ A;  4I8C A;  2I48 A;  3G3K A;  3MP8 A;  1TFA A;  1MY0 A;  3H4Z A;  5AA2 D;  1GV8 A;  1MY4 A;  1VFD A;  4OEU A;  2OCU A;  3HPI A;  1FQC A;  4JWO A;  2O7I A;  2ONS A;  3BBR A;  4RJZ A;  1Y3Q A;  4DCY A;  2XXX A;  2CZL A;  2Q2A A;  1PC3 A;  1NFT A;  3Q28 A;  3K01 A;  3OEN A;  2THI A;  3M3L A;  5ELV A;  2PBW A;  1N04 A;  3CG1 A;  3IX1 A;  5FHN A;  1NMU A;  4R2B A;  4LA9 A;  4QF9 A;  4YB5 A;  3OSR A;  5M2V A;  4PFW A;  1IXC A;  2PX1 A;  1MY1 A;  1N7W A;  1O63 A;  1RYX A;  4MLQ A;  3C4M A;  4K3F A;  1MY2 A;  3ZS6 A;  2E0S A;  3V8X B;  3H3G A;  1JNF A;  4G68 B;  3G3G A;  4ELO A;  3QXM A;  3K0V A;  4LQ2 A;  4G8N A;  4F31 B;  1XT8 A;  3B6T A;  5H8H A;  1QW0 A;  4RK9 A;  1MPB A;  2YJP A;  5KDT A;  5TU0 A;  3VLW A;  5JTY B;  4NE4 A;  2W7Y A;  1Y1Z A;  1DSN A;  4FIM A;  2I58 A;  3IJX B;  5B7D A;  4ZE9 A;  4F1Y A;  1MDQ A;  2V25 A;  4G8M A;  2A5S A;  3OMB A;  2GH9 A;  2QJE A;  3E3K A;  1UTH A;  5EHM A;  4GL8 A;  2ALU A;  2BJJ X;  3C35 A;  4G68 C;  4FJP A;  3EHT A;  4H6D A;  4I1D A;  2RKM A;  5L8D A;  4YKP A;  4JB7 A;  2XXV A;  3D4G A;  3C33 A;  1IEJ A;  5TPA B;  1B4Z A;  1M5C A;  4OMB A;  4WKM A;  5J1D A;  2R9J A;  5H8F B;  3TTM A;  4F1U A;  1Z7N E;  4GL0 A;  1B40 A;  4OES A;  2AL5 A;  1FQF A;  3KFM A;  3H03 A;  1SW4 A;  2QS2 A;  4ESX A;  3KSX A;  3H6U A;  1XOC A;  3RT6 B;  1VR5 A;  1OQG A;  3EQ1 A;  3G3H A;  2VHA A;  1FTO A;  4PFU A;  3CI8 A;  1PEB A;  1JVY A;  3THI A;  3ILT B;  4JDF A;  1A55 A;  5KCJ A;  3SES A;  3TTN A;  2QMX A;  3RT8 A;  2IA4 A;  3HO7 A;  1VE4 A;  1II5 A;  3UOR A;  1GTK A;  5AA2 A;  1UIV A;  2OWT A;  3L6G A;  4YMA A;  3OO7 A;  2V84 A;  1ZBM A;  5TP9 A;  4R73 A;  3B6Q A;  3IO4 A;  4Q30 B;  1N3W A;  2B65 A;  4UAC A;  3FXQ A;  5I58 A;  3IOT A;  2LAO A;  2OBG A;  1D9Y A;  4G77 A;  3T96 B;  3DEL B;  2QMW A;  2ZNU A;  4THI A;  3CFL A;  1ZLQ A;  1M5F A;  3LSF B;  4PET A;  2Q89 A;  1S7Y A;  1JET A;  1PBP A;  4NWC A;  4GXA A;  3EHU A;  3V5A A;  3KSJ A;  1M5B A;  4QFO A;  2XX9 A;  1P1U A;  1BIY A;  2RCA A;  4NF5 B;  4UA8 A;  4R72 A;  3IOU A;  4ZEI A;  4DXU A;  1SDX A;  3JYR A;  3MVZ A;  4EQB A;  3FUZ A;  1AL3 A;  5K2Y A;  3VFJ A;  2P0S A;  3SEV A;  2I3W A;  4ZEK A;  3T9X B;  5IKB A;  3T9V A;  1URD A;  1RKM A;  4LVQ A;  1SYI A;  4NF6 B;  2QS3 A;  2X26 A;  2XXQ A;  3VXB A;  5CC2 A;  3S9N C;  3UP9 A;  4POW A;  3V83 A;  3F11 A;  3MQ9 A;  1B46 A;  1LAF E;  3PU5 A;  4U2R A;  1EZP A;  4P11 A;  4NWD A;  1A8F A;  2DXR A;  1LST A;  1GR2 A;  1B5J A;  3O66 A;  4QRZ A;  5H8Q A;  1EZ9 A;  2I0B A;  5EHS A;  3A09 A;  1OMP A;  4N13 A;  1MQG A;  3W15 C;  4IGT A;  2NOO A;  2F35 A;  3TKD A;  4XKN A;  5AA3 A;  1IZ1 A;  3A3C A;  3PUZ E;  4C1T A;  4NF8 A;  4Q5T A;  4BDM A;  3A3U A;  1Y4C A;  3H7M A;  5B70 A;  4FEC A;  3TTL A;  2GHA A;  5CMC A;  5EYF A;  4YIC A;  2OK2 A;  2Z8F A;  1DPP A;  1QVS A;  1DPE A;  3RTW B;  3MW0 A;  3N94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...