4K3FA

Crystal structure of a putative tonb-dependent receptor (pa5505) from pseudomonas aeruginosa pao1 at 1.60 a resolution
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
240
structure length
240
Chain Sequence
GAESLTVAATPVPHAEILNVVKPLLAKEGVDLKIKEFTDYVQPNVQVSEKRLDANFFQHQPYLDEFNKAKGTDLVAVTGVHIEPLGAYSSKYKKLDELPSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKSITATPKDIVDNPKNIKIRELEAATLPRVLTQVDMALINTNYALEAKLNPTKDALAIEGSDSPYVNILVARPDNKDSDAMQKLAKALHSAEIKQFIQEKYKGAVVPAFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Probable TonB-dependent receptor
publication title Crystal structure of a putative TonB-dependent receptor (PA5505) from Pseudomonas aeruginosa PAO1 at 1.60 A resolution
rcsb
source organism Pseudomonas aeruginosa
total genus 72
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03180 Lipoprotein_9 NLPA lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4k3fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4k3fA02
1MH3A 3OSRA 1HSEA 2ZNUA 4ELOA 1IIWA 1ZKBA 1EH3A 4I1DA 4POWA 3OENA 1SI0A 4GL0A 4G4PA 3MQ9A 2DXRA 2Y84A 4EF1A 4E0WA 4HCWA 3DP8A 4IY5A 2DQVA 1PBQA 1UIVA 4NF4A 4NF5B 3S9MC 4RNSA 2ZYMA 4H5FA 3MWBA 5DT6A 5ELVA 1Q1KA 1S9TA 2OCUA 4YMBA 2O1LA 3EHTA 2ZNTA 4OMBA 5I57B 1LB9A 3TUSA 1HSJA 1EZ9A 3RTWB 2VP1A 3W9WA 3U72A 2UYFA 4ESXA 3ILUB 1B7HA 4KCDA 4KCCA 4YMAA 5TP9A 4PQJA 4EQ9A 1B3HA 1ZIUA 2O69A 3L6HA 4G2ZA 4R2BA 1DMBA 2E1SA 4FEDA 2I4BA 2GH9A 1URDA 2GHAA 1RYXA 4L17A 1ZBMA 4R6KA 3TCGA 4LZ8A 5KCJB 3OEMA 1UQWA 4F1UA 1PC3A 3PMWA 3K01A 1URGA 4F3SA 1LFIA 4F22A 2V3UA 1NNFA 1B58A 4MF3A 2O6AA 4XKNA 4LZ5A 1O7TA 5DYHA 3TTRA 1B6HA 3QIMA 1QJMA 3T96B 4RPNA 4XIGQ 3BBRA 3TTMA 1D4NA 5CMKA 4YB6A 4F19A 4U21A 4PFWA 1JVYA 2F6PA 5AA4A 5I56B 5CRYA 1B7UA 3UN6A 4H6DA 4IO4A 1UTHA 1L5TA 3V5AA 5JK4A 1US4A 4NF8B 1MXYA 4U1ZA 2PYYA 3SDFA 3G3KA 4BDMA 1FQDA 3RTFB 4EUOA 3HPIA 5IKBA 3VVEA 3B6TA 1Z7NE 3OMBA 3I6VA 1II5A 1MY2A 2GFEA 4JWYA 5H8FB 1B5IA 3FZVA 2RCBA 2QS4A 5FTIA 1FCKA 3O6HA 3PGFA 4R72A 3SKPA 2XHDA 4KYEA 3DELB 1Y9UA 4NTLA 5H8SA 3K6WA 3G7WA 1SDXA 2Q2AA 2O68A 4GF8A 3QK6A 4DZ1A 3B7DA 3TFLA 3CSBA 1OQGA 1NL5A 1MS7A 3EQ1A 1LSTA 1JQFA 2D5WA 1QW0A 4GOTA 3A3CA 1A40A 4F3BA 3KEIA 4NF6A 4QSCA 2I6EA 4YB7A 4ZEDA 5HBCA 4LZ7A 4OEUA 2O84X 1P99A 2PBWA 1VSOA 1FQEA 2DP8A 4ELQA 1TWYA 1Y3NA 3QXMA 2QSXA 3KSJA 3Q28A 3QAXA 2F35A 3K02A 4Z7EA 1VFDA 3IO4A 1B52A 3FD3A 1KWHA 5H8QB 4XTCQ 4QSDA 3PUVE 3MP1A 2VOZA 1IZ1A 1IXHA 1MPBA 4XKPA 5DTBA 4EF2A 1UTBB 2R71A 4N07A 4H0WA 2H25A 1OVTA 3O6GA 2HZLA 4LA9A 1FTLA 3A3UA 4X9TA 5KCJA 1P1UA 3T9VA 3N94A 2OZZA 2F8DA 1MXWA 2I3VA 4WXJA 5TU0A 3CR9A 4C1TA 3T22A 2F97A 4NF4B 1Q35A 3MPKA 3RLFE 4P0IA 3CSGA 4PETA 2Q2CA 1N3WA 3OO6A 2DWIA 4F3PA 2UVJA 3RN8A 4GWOA 3F11A 2OWSA 2QS2A 2YPNA 2R9JA 4OZ9A 4XXUA 5CMMA 3OSQA 3KBRA 5I56A 1FQFA 2HAVA 5DEXB 1BLFA 1M5CA 2H99A 2IA4A 3U92A 5TP9B 1NH8A 2DSFA 3IB2A 5CBRA 1MQHA 3K6UA 2DWJA 2F7BA 4ZDMA 4FIMA 1J1NA 1XS5A 1A54A 4NF8A 4U4SA 1NNKA 3EN3A 1OQHA 4FEBA 3EF7A 4AQ4A 2D3IA 2WKYA 1I6BA 3U1OA 4M4GA 2VGQA 3CI8A 2X7PA 2ZYOA 2ZMBA 1D9YA 3DP4A 2OLBA 4ZS9A 3MVXA 4F3GA 3H6VA 4YKKA 2D21A 1DPEA 2QMWA 4R73A 4H8IA 3IOVA 5ICTA 1GGGA 1FW0A 1ZU0A 2YJPA 4FATA 2F6GA 3N6TA 2F36A 4MLVA 3PMXA 3RQTA 2NWJA 5AA4B 2UXAA 1XVYA 1MDP1 4NWDA 3RPWA 1M5BA 5L9OA 1JEVA 1UTHB 2O1MA 4ESWA 3K00A 2V93A 1TXFA 4BDNA 4X48A 4DIGA 3QUFA 3IOUA 2GRVA 1EZPA 3KGCA 1B40A 1MDQA 2B65A 1N7WA 2Y7KA 3M3LA 5CC2A 1B4HA 3ECRA 3LUYA 3UGWA 3DP6A 3KJTA 1JW1A 3V89B 3H03A 1LCTA 1MQIA 4IO2A 1GTKA 3E13X 4YKIA 2FYIA 3VFJA 3Q27A 5JEIA 1SW5A 4JWOA 1GV8A 1LBCA 2REJA 2Q89A 2XXQA 2PX1A 4BDQA 3FVGA 1UTBA 3CRBA 1N3XA 4FJPA 1D9VA 3CVGA 4OFLA 2DE4A 5EHMA 3C32A 1MM7A 2QMXA 2Q9TA 3PUYE 2O7UA 4YKJA 4DLDA 4ND9A 2XX9A 4G68B 4H5GA 1H45A 4NF6B 3IB0A 4OEVA 3UA8A 2RKMA 2B3FA 3FVKA 2RC9A 3T9XB 4OVJA 1BTJA 4JDFA 3C35A 2DWAA 2V25A 3IOWA 4HTGA 5I84A 1VR5A 3I5OA 2G93A 3IK6B 4H65A 1D3KA 2OK2A 3SEYA 1I69A 3ODBA 1QUKA 2XXXA 3FV2A 5DEXA 4IO3A 4P0GA 2UVHA 1MH4A 2QRYA 4IO7A 4R9FA 1JW4A 4M1VA 1I6AA 2Q88A 5ITOA 1P1NA 3S9NC 3IL1B 3W9VA 4AB5A 1NKXA 3OELA 2NXOA 1HSLA 4P11A 1O64A 3H7MA 4JWXA 4MH5A 3GZGA 3WAFA 3PPOA 4ZEIA 3VDFA 2RINA 1RYOA 3IB1A 5AA2A 3HCQA 2HAUA 5AE4A 4EQBA 3EPEA 3KSXA 2FNCA 5I58A 1XT8A 4NEDA 3KZGA 4PE5B 5KZTA 3IO6A 4LATA 5CMCA 3OD7A 4ONYA 4EXLA 1Z7ME 4OERA 1H43A 3H3GA 3D4GA 3R6UA 1IQ7A 4QFPA 3MVZA 4IGRA 3TQLA 4O3BA 3LSFB 4RK2A 3G3GA 2DOJA 3MZ9A 1QULA 4DXUA 3VE1B 1LAFE 2HFBA 3Q26A 1A7LA 2XD3A 2R6GE 4OESA 2W7YA 1DTGA 1OLCA 1PB7A 1TFAA 4IY6A 3OEKA 5CM6A 1FQCA 3CG1A 2AIXA 4F2OA 4TLMB 4ZZEA 1NNPA 1I6QA 4GQOA 1DPPA 5EYFA 4KI0E 4KR5A 4IB2A 1UIUA 3IOTA 3DM0A 3C31A 3OO7A 2YLNA 1B51A 2B3BA 1MQDA 1B7ZA 4PFYA 1JNFA 1MXZA 3MVYA 3IORA 4XKQA 2NVUB 4QRZA 1FTKA 1NFTA 3VV5A 1POTA 2X7QA 5L8DA 2ONSA 4GRKA 3VLWA 1QKBA 3K2DA 2DYXA 4F39A 3HN0A 4WEDA 4UA8A 2V84A 2Y7IA 3OO9A 1ZTYA 2QL3A 4G68A 3VXCA 5JTYA 2HZKA 1P1QA 3TTKA 3FVOA 2X26A 1SW4A 1MXUA 1QKAA 2CMOA 4G8NA 2HCAA 5K2YA 3KOSA 4OYVA 2XXIA 1LFHA 3O97A 4KD5A 3U93A 1B05A 4FAJA 2PMSA 4K3FA 4ZECA 4YICA 3PD8A 4OTEA 2DS9A 4R6HA 1WVJA 3TCHA 1B4ZA 2XXYA 3TODA 4GXSB 2QS1A 4OFJA 3CG3A 1R9LA 2H4IA 4LUBA 1LFGA 2NOOA 2H5YA 1IITA 2Z23A 1BIYA 5ICQA 3CFLA 2O7IA 5H8HB 5I2NB 3KJ7A 1PB9A 5ITPA 1IEJA 3HV1A 3JV9A 2XXWA 1B0LA 2PT2A 1AIVA 2HEUA 3TDJA 1MRPA 1YCJA 1XVXA 1SI1A 2XX7A 2FA7A 4QFNA 2RC7A 2E0SA 4OFOA 1TFDA 4F18A 1AH5A 5AA3A 1BP5A 1H3DA 4DE8A 1N84A 3B6QA 4Q30B 5HPQA 1YTVA 3E9XA 3H06B 3ZKKA 2RCAA 4WEPA 1OVBA 3T93B 4QF9A 2DVCA 1OIBA 3H6WA 4G8MA 3C34A 3FVNA 4MBPA 4XKRA 1N7XA 1LLSA 1JVXA 3RUMA 3KN3A 4O3AA 2QJEA 4GFRA 4LQ2A 2NUVA 3HO7A 1RKMA 3UIFA 2ONRA 3K1PA 3FXQA 1B32A 2UVIA 1ZMGA 1ZLQA 5TPAB 5AA2B 3TKDA 5L9SA 3O9PA 2Y7RA 1LGBC 4G8HA 1S7YA 1SW1A 5I58B 3PUZE 5FHOA 3TQWA 1OLAA 1P1WA 4IO6A 4U4XA 4ZEFA 4IGTA 3TEPA 3SEXA 5I59A 2BJJX 2ALUA 3KFMA 1LCFA 3FXUA 4DDDA 4KYSA 1MQGA 1Y20A 3TELA 2RC8A 3IR1A 3PU5A 3SEUA 2XXHA 1MY3A 4PFTA 2F7CA 3TPAA 3IAZA 3MZ1A 5A5XA 1POY1 3SESA 1PBPA 3MBPA 4X1BA 1ELJA 2IEEA 3FIRA 3U94A 4R74A 1XC1A 2I0CA 5J1DA 4TLLB 3CIJA 1TT1A 4RYAA 1MPDA 4YZZA 3QYTA 1R9QA 4QSEA 4KPTA 3FUZA 2H98A 3O6IA 3ONMA 4H67A 3UORA 4N6PA 4OETA 4GIZA 4KFQA 2Y7PA 4U23A 4QFKA 3K4UA 3FJMA 2AYSA 2H9BA 5F1QA 4R75A 3R7XA 1B9JA 4RY1A 4LP2B 1JW5A 3HHGA 3MP6A 4ZE8A 1T0KA 3MP8A 3BFUA 1GVCA 3H6UA 3MC2A 1N76A 1MXVA 4G77A 3ZS6A 4Q0CA 3BFTA 4Q5TA 4QFLA 5H8HA 1AOVA 5I2NA 3ZSFA 1URSA 1IXGA 2I48A 4ZEBA 4F1VA 1NNTA 4BDLA 5JTYB 4YKPA 3RT6B 2OBGA 4GVOA 4F2QA 1B3EA 5CMBA 1ATGA 2GHBA 4THIA 3GBBA 3PPQA 1B1HA 2XXUA 3I3VA 3S9EA 3T9UA 1F9BA 2Q8JA 2QS3A 1Y4CA 1LAXA 2RF1A 5B70A 3KG2A 2VHAA 3WAEA 3H4ZA 3O2AA 2UYEA 1A8FA 2OJTA 3PV0E 1SQYA 2ZYKA 1H76A 4Q8RA 3N26A 3G3IA 4LQ5A 4WKMA 4G68C 4QHQA 4YAHX 4F31B 1VFEA 5FTHA 3CFXA 1LBBA 1SYIA 2VD3A 4ZZAA 4H1XA 5HM4B 4F1YA 1MQJA 4NWCA 2Y7WA 5TPAA 3TZAA 1LAHE 2A5TA 4I8CA 1N0TA 5I2KB 3C9HA 3RGYA 1ZJLA 4PFUA 4TQUQ 3VXBA 1MXXA 3SEWA 4QFOA 4TOZA 4OWDA 4MFIA 4R6YA 3RNNA 2Z8DA 1O63A 5CBSA 1Y1ZA 4Z0IA 1BKAA 5IAIA 4O3CA 4HS7A 3LSWA 4X1DA 1YAEA 5BWJA 1DOTA 5H8NA 3MJNA 4FECA 3O28A 3IX1A 1FTMA 4ZE9A 3EHUA 2O51A 3FASA 1XHYA 3FXRA 3MPLA 1M5DA 2LAOA 1S50A 2G29A 1MY1A 1A99A 2CZLA 3USDA 4I62A 3C33A 4R2FA 1ANFA 2P1SA 3VVFA 4DXBA 3DLNA 1QUJA 3PPNA 5M2VA 5BUUA 3GBAA 4U1OA 3TYHA 5FHNA 2F34A 4JXIA 4N13A 1Y3QA 1US5A 3HHFA 1B2HA 2F5XA 3K1MA 3K6VA 3JYRA 1EU8A 2DXYA 3GLBA 3D4CA 3LBSA 1QVSA 2ANJA 2ESNA 5AA1A 1MY0A 4HCYA 3VLVA 5I59B 3TCFA 3M3KA 3OXNA 1M5FA 2THIA 3N6UA 1FQAA 1B1XA 3H6TA 4MLQA 2OWTA 3LC8A 1A55A 3PUXE 2M8CA 3R26A 4JSOA 5F7VA 3L6GA 4ISUA 5K2XA 5A5XB 3OO8A 3CFZA 1IXIA 1MM6A 2ZNSA 1AL3A 1SVXB 3ZKLA 3G3FA 2F78A 4GD5A 3S9LC 1IUDA 5KDTB 2ONKE 4BDRA 3THIA 2ABHA 3IJOB 4NF5A 3TAJA 1A8EA 5B7DA 3TTLA 2UVGA 3N5LA 2F7AA 2A5SA 1PB8A 2XXTA 3C36A 3KN8A 1Y1MA 1USYH 3T66A 2QPQA 2DE2A 5FHMA 3E4RA 5I57A 4OENA 2I58A 1QUIA 3IJXB 3UK4A 4OQOA 1LAGE 2PVUA 3BKIB 2XD2A 2ZYNA 3LSLA 4C1UA 3EHSA 3E3KA 1MG1A 3FJ7A 1LB8A 2PT1A 5DVFA 3SEVA 1JEUA 1WODA 3O29A 2P0SA 2DWHA 4GL8A 3SETA 4JB7A 3QSLA 3U8QA 4YU0A 1DSNA 3PMVA 4C0RA 3KN7A 1FQBA 4DCXA 4KYDA 5AA2D 1SBPA 1VE4A 2HQ0A 5I2KA 2Z22A 4RK9A 3RY3A 4EXKA 3UP9A 4HW8A 4DXCA 1B46A 3P7IA 4POXA 2VD2A 4BDOA 4EQ7A 1USYE 3FJGA 3OOAA 2KLFA 3K0VA 3A09A 1H44A 1MPCA 4KHZE 5DVJA 1P1OA 2REGA 1B0HA 4FORA 2V3TA 1DTZA 2DVZA 1Y3PA 2ZXTA 3HSTA 4YB5A 1SW2A 1NMUA 4JSDA 3B6WA 3JZJA 1AMFA 1XOCA 4KQPA 2DE3A 1B5HA 2HXWA 4LVQA 3QUJA 3MUQA 3AXFA 3PPPA 4EDPA 3S4UA 1EZOA 3MW0A 3KOTA 4FE8A 5CI5A 3W15C 1SD3A 4ZEKA 1B3GA 3RT8A 2Z8FA 2I3WA 4DCYA 5ISUA 4H8JA 4R9GA 5L9MA 4GXAA 1NH7A 1FTJA 2A5TB 4IO5A 1FTOA 4ECFA 4UACA 1B3FA 2I0BA 3K1NA 3V83A 5H8FA 1Y4TA 3TTNA 3M8UA 3S2VA 2Z8EA 1PEBA 2AL4A 3TMGA 4NE4A 1OMPA 4JBZA 1YPNA 3VVDA 2I4CA 1MY4A 3ILTB 3MAMA 2XX8A 4OXVA 4U2RA 3O66A 5H8NB 5EHSA 3PD9A 5DVIA 3MVWA 1R1NA 3VLUA 1WDNA 2XXRA 4ELRA 4RA1A 4PP0A 3Q29A 2V3QA 4OHNA 1CE2A 4I9DA 2P2AA 5KDTA 3V8XB 3SERA 4AB6A 3G3JA 5LOMA 3LSXA 1GR2A 2AL5A 1SYHA 4RJZA 4RPOA 1PDAA 3PPRA 3FV1A 4GLIA 1JETA 3FATA 1N04A 1B3LA 3Q25A 4NMYA 2XXPA 4BLAA 4LONB 4U22A 4F29A 3C4MA 3G3HA 2I49A 1CB6A 4ELPA 1IXCA 1R6ZA 1M5EA 4RXLA 5H8QA 4E0XA 2XXVA 3PUWE 3FGSA 3LR1A 3MZBA 3T9HB 3M3FA 3K6XA 1B5JA 3GXAA
chains in the Genus database with same CATH superfamily
1MH3A 3OSRA 1HSEA 2ZNUA 3EKIA 4ELOA 5ESYA 1IIWA 4HE2A 1ZKBA 1EH3A 3B8BA 4I1DA 4POWA 3OENA 1SI0A 4GL0A 4G4PA 3MQ9A 2DXRA 1IMEA 1RDYA 2Y84A 4EF1A 4E0WA 4HCWA 3DP8A 4IY5A 2DQVA 1PBQA 1UIVA 4NF4A 4NF5B 3S9MC 4RNSA 2ZYMA 2ZZWA 4H5FA 3MWBA 5DT6A 5ELVA 1Q1KA 1S9TA 2OCUA 4YMBA 2O1LA 3EHTA 2ZNTA 4OMBA 5I57B 1LB9A 3TUSA 1HSJA 1EZ9A 3RTWB 2VP1A 3W9WA 3U72A 2UYFA 4ESXA 3ILUB 1B7HA 4KCDA 4KCCA 4N4UA 4YMAA 4N91A 4PFIA 1NV7A 3MSTA 5TP9A 4HE1A 4PQJA 4EQ9A 1B3HA 1ZIUA 2O69A 3L6HA 4G2ZA 4NQ8A 4R2BA 2HXRA 4H45A 1DMBA 2E1SA 1NV1A 4FEDA 1FBDA 2I4BA 2GH9A 1URDA 2GHAA 1RYXA 4L17A 1ZBMA 4R6KA 3TCGA 4LZ8A 5KCJB 3OEMA 1UQWA 4XF5A 4F1UA 1PC3A 3PMWA 3K01A 4PAFA 1URGA 4F3SA 1LFIA 4F22A 2V3UA 1NNFA 4MNIA 1B58A 4MF3A 1RDXA 2O6AA 4XKNA 4LZ5A 1O7TA 5DYHA 3TTRA 1B6HA 3QIMA 1QJMA 3T96B 4RPNA 4XIGQ 3BBRA 3TTMA 1D4NA 5CMKA 4YB6A 4F19A 4U21A 2OWZA 4PFWA 1JVYA 2F6PA 1SPIA 1IMAA 5AA4A 5I56B 5CRYA 1B7UA 3UN6A 3T0JA 4H6DA 4IO4A 2B4MA 1UTHA 2WX9A 1L5TA 3V5AA 5JK4A 1US4A 3RYDA 4NF8B 4P9KA 4P1EA 1MXYA 4U1ZA 2PYYA 3SDFA 5F24A 3G3KA 4BDMA 1FQDA 3RTFB 1NUXA 4EUOA 3HPIA 5IKBA 3VVEA 3B6TA 1Z7NE 3OMBA 3I6VA 1II5A 1MY2A 2GFEA 4JWYA 4N81A 5H8FB 1B5IA 3FZVA 2RCBA 2QS4A 5FTIA 1FCKA 3O6HA 3PGFA 4R72A 3SKPA 2XHDA 4KYEA 3IFAA 3DELB 5LTCA 2FHYA 1Y9UA 4NTLA 4N6DA 5H8SA 3K6WA 3G7WA 1SDXA 1LEVA 2Q2AA 4UABA 2O68A 4GF8A 3QK6A 4DZ1A 3B7DA 3TFLA 3CSBA 1OQGA 1NL5A 1MS7A 3EQ1A 1LSTA 1JQFA 2D5WA 1QW0A 4GOTA 3A3CA 1A40A 4F3BA 3KC0A 3KEIA 4NF6A 4QSCA 2I6EA 4YB7A 4ZEDA 1LBWA 5HBCA 4LZ7A 3D1RA 4OEUA 2O84X 3B50A 1P99A 2PBWA 1VSOA 1FQEA 2DP8A 1FPKA 4ELQA 1TWYA 1Y3NA 3QXMA 2QSXA 3KSJA 3Q28A 3QAXA 2F35A 3K02A 4Z7EA 4QXDA 4H46A 2XWVA 1VFDA 3IO4A 1B52A 3FD3A 2HHMA 1KWHA 5H8QB 4XTCQ 4QSDA 1XI6A 3PUVE 2Y5KA 3MP1A 4NHBA 4OVQA 2VOZA 1IZ1A 1IXHA 1MPBA 2VPOA 4XKPA 5DTBA 4EF2A 1UTBB 2R71A 4N07A 1LBYA 4H0WA 2H25A 4LN5A 1OVTA 3O6GA 2HZLA 2XWKA 4LA9A 1IMDA 1FTLA 3A3UA 4X9TA 1NV5A 5KCJA 1P1UA 3LUZA 3T9VA 3E78A 3N94A 2OZZA 2F8DA 2F3BA 1MXWA 3KBZA 2I3VA 4WXJA 5TU0A 2VT5A 3CR9A 4C1TA 3T22A 3T1BA 2F97A 4NF4B 1Q35A 3MPKA 3RLFE 4P0IA 3CSGA 2R8TA 4PETA 2Q2CA 1N3WA 3OO6A 2DWIA 4F3PA 4N8GA 3KC1A 2UVJA 3RN8A 4GWOA 3F11A 2KR0A 2OWSA 2QS2A 2YPNA 2R9JA 4OZ9A 4XXUA 5CMMA 3OSQA 3KBRA 5I56A 2FIXA 1FQFA 2HAVA 5DEXB 1BLFA 1M5CA 2H99A 2IA4A 3U92A 5TP9B 1NH8A 3FBPA 2DSFA 3IB2A 5CBRA 1MQHA 3K6UA 2DWJA 2F7BA 4ZDMA 2CZIA 4FIMA 3ROJA 1J1NA 1XS5A 1A54A 4NF8A 4U4SA 1NNKA 3EN3A 1OQHA 4FEBA 3EF7A 4PF8A 4AQ4A 2D3IA 2WKYA 1I6BA 3U1OA 4M4GA 2VGQA 3CI8A 2X7PA 4GBVA 2ZYOA 2ZMBA 1D9YA 5FBPA 3DP4A 2OLBA 4ZS9A 1NV0A 3MVXA 4F3GA 2P3VA 3H6VA 4YKKA 1AWBA 2D21A 1DPEA 2QMWA 4R73A 1NI9A 4N8YA 4H8IA 3IOVA 5ICTA 4MHFA 1GGGA 1FW0A 1ZU0A 2YJPA 4FATA 2F6GA 3N6TA 2F36A 4MLVA 3PMXA 3RQTA 2NWJA 5AA4B 2UXAA 1XVYA 4GBWA 1MDP1 4NWDA 5ET6A 3RPWA 1M5BA 5L9OA 1JEVA 1UTHB 4GX4A 2O1MA 4ESWA 3K00A 2V93A 1TXFA 4BDNA 4X48A 2ZZVA 4DIGA 3QUFA 3IOUA 2GRVA 1EZPA 3KGCA 1B40A 1MDQA 2B65A 1N7WA 2Y7KA 3M3LA 5CC2A 1B4HA 3ECRA 3LUYA 3UGWA 3DP6A 3KJTA 1NV3A 1JW1A 3V89B 3H03A 1LCTA 2DDKA 1MQIA 4IO2A 5ET8A 1GTKA 3E13X 4YKIA 2FYIA 3VFJA 3Q27A 5JEIA 1SW5A 4JWOA 1GV8A 2QVVA 1LBCA 2REJA 4GX3A 2Q89A 3A29A 2XXQA 2PX1A 4BDQA 3FVGA 1UTBA 3CRBA 1N3XA 4FJPA 1D9VA 3CVGA 4OFLA 2DE4A 5EHMA 3C32A 1MM7A 2QMXA 2Q9TA 3PUYE 2O7UA 4YKJA 2XA5A 4DLDA 4ND9A 2XX9A 4G68B 4H5GA 1H45A 4NF6B 3IB0A 4PBQA 4OEVA 3UA8A 2RKMA 2B3FA 3FVKA 2RC9A 4XEQA 3T9XB 4OVJA 1BTJA 4JDFA 3C35A 2DWAA 2V25A 3IOWA 4HTGA 5I84A 1VR5A 3I5OA 2PFYA 2G93A 3IK6B 4H65A 1D3KA 2OK2A 3SEYA 1I69A 3ODBA 1QUKA 1NUZA 2CZKA 2XXXA 3FV2A 3PTYA 4IR8A 2KQZA 5DEXA 4IO3A 4P0GA 2UVHA 1MH4A 2QRYA 4IO7A 3GYYA 4R9FA 1JW4A 4M1VA 1I6AA 2Q88A 1LBVA 5ITOA 1P1NA 3S9NC 3IL1B 3W9VA 4AB5A 1NKXA 3OELA 2NXOA 1FSAA 1HSLA 4P11A 1O64A 1Q9DA 3H7MA 4JWXA 4MH5A 3GZGA 3WAFA 3PPOA 1DCUA 5IZ1A 4ZEIA 3VDFA 2RINA 1RYOA 3IB1A 5AA2A 3HCQA 2HAUA 5AE4A 1NUYA 4MMPA 4EQBA 3EPEA 3CHGA 3KSXA 2FNCA 4I3EA 5I58A 1XT8A 4NEDA 3KZGA 4PE5B 5KZTA 3IO6A 4LATA 4OVSA 5CMCA 3OD7A 4ONYA 4EXLA 1Z7ME 4OERA 1H43A 3H3GA 3R6UA 3D4GA 1IQ7A 1VDWA 4PDDA 4QFPA 3MVZA 4IGRA 3TQLA 4O3BA 3LSFB 4RK2A 3G3GA 2ZZXA 2DOJA 3MZ9A 2XWOA 1QULA 4DXUA 3VE1B 1LAFE 4GWWA 2HFBA 3Q26A 1D9QA 1A7LA 2XD3A 2R6GE 4OESA 2W7YA 1DTGA 5IZ3B 1OLCA 1PB7A 1TFAA 4IY6A 3OEKA 5CM6A 1FQCA 3CG1A 2AIXA 4MAGA 4F2OA 4TLMB 4HE0A 4ZZEA 1NNPA 1I6QA 4GQOA 1DPPA 5EYFA 4KI0E 4KR5A 4IB2A 1UIUA 3IOTA 1KA1A 3DM0A 3C31A 3OO7A 2YLNA 1B51A 2B3BA 2GQ1A 1MQDA 4OVPA 1B7ZA 4PFYA 4PGPA 1JNFA 1MXZA 4PC9A 3MVYA 3IORA 4XKQA 2NVUB 4QRZA 1FTKA 1NFTA 3VV5A 1POTA 2X7QA 5L8DA 2ONSA 4GRKA 5EQ9A 3VLWA 1QKBA 3K2DA 2DYXA 4F39A 3HN0A 2QVRA 4WEDA 4UA8A 2V84A 1YZ0A 5IZZA 1FJ9A 1K9YA 2Y7IA 3OO9A 1ZTYA 2QL3A 4G68A 3VXCA 1K9ZA 5JTYA 2HZKA 1P1QA 1LBXA 2PCRA 4O94A 1FPDA 3TTKA 3FVOA 2X26A 1SW4A 4MCOA 1MXUA 1QKAA 2CMOA 4G8NA 4NAPA 4P1LA 2HCAA 5K2YA 3KOSA 4OYVA 2XXIA 4N15A 5ET5A 1LFHA 3O97A 4KD5A 3U93A 4O8MA 1B05A 4FAJA 2PMSA 4K3FA 4ZECA 4YICA 3PD8A 2WYKA 4OTEA 2DS9A 4R6HA 4P3LA 4X04A 1WVJA 1IMCA 3MYUA 3TCHA 3ISPA 4PGNA 3QMFA 1B4ZA 2XXYA 3TODA 4GXSB 2QS1A 4OFJA 3CG3A 1R9LA 2H4IA 4LUBA 1LFGA 2NOOA 2H5YA 1IITA 2Z23A 1BIYA 4PBHA 5ICQA 4DI3D 5J16A 3CFLA 1DK4A 4O7IA 2O7IA 2CEYA 5H8HB 1FBFA 5I2NB 1NV6A 3KJ7A 5DW8A 1PB9A 1EYJA 5ITPA 1IEJA 3HV1A 3JV9A 2XXWA 1YXIA 1B0LA 2PT2A 1AIVA 2HEUA 3TDJA 1MRPA 1YCJA 5EQ7A 5EYHA 1XVXA 4OVTA 4MJOA 1SI1A 2FBPA 2XX7A 2FA7A 4X8RA 4QFNA 2RC7A 2E0SA 4OFOA 1TFDA 4F18A 1AH5A 5AA3A 1BK4A 1BP5A 5EQAA 1H3DA 4DE8A 1N84A 3B6QA 4Q30B 5HPQA 4MNPA 1YTVA 3E9XA 4JVDA 2WYPA 3H06B 3ZKKA 1FBGA 2RCAA 4WEPA 1OVBA 3T93B 4KXPA 5IZ3A 4QF9A 4NF0A 2DVCA 1OIBA 3H6WA 4G8MA 3C34A 4P47A 3FVNA 4MBPA 4XKRA 1N7XA 1LLSA 1JVXA 2CZHA 3RUMA 3KN3A 4O3AA 2QJEA 4GFRA 3LV0A 4LQ2A 2NUVA 3HO7A 1RKMA 3UIFA 2ONRA 4PFBA 3K1PA 3FXQA 1EYKA 1B32A 2UVIA 4PAKA 1ZMGA 1ZLQA 5TPAB 5EQ8A 5AA2B 3TKDA 5L9SA 3O9PA 4AS5A 4MNCA 2Y7RA 5T3JA 1LGBC 2Q8MA 2P3NA 4G8HA 1S7YA 1SW1A 5I58B 3PUZE 5FHOA 3TQWA 1OLAA 2B4LA 1P1WA 4IO6A 4U4XA 1FPJA 4ZEFA 4IGTA 4GWZA 3TEPA 3SEXA 5I59A 2BJJX 2ALUA 3KFMA 1LCFA 3FXUA 1FPLA 4DDDA 4KYSA 1MQGA 4PFRA 1Y20A 3TELA 2RC8A 3IR1A 3PU5A 3SEUA 2XXHA 1MY3A 4PFTA 5I3SA 2F7CA 3TPAA 3IAZA 3MZ1A 5A5XA 1POY1 3SESA 1PBPA 3MBPA 4X1BA 1ELJA 2IEEA 3FIRA 3U94A 4R74A 1XC1A 2WEFA 2I0CA 5J1DA 4TLLB 3CIJA 1TT1A 4PF6A 3RPLA 4RYAA 1FBHA 1MPDA 4YZZA 3QYTA 1R9QA 4QSEA 4KPTA 3FUZA 3U65A 2H98A 3O6IA 3ONMA 4H67A 3UORA 4N6PA 4OETA 4GIZA 4KFQA 2Y7PA 4U23A 4QFKA 3K4UA 3FJMA 2AYSA 2H9BA 5F1QA 4R75A 3R7XA 1B9JA 4RY1A 2Y5LA 4LP2B 1JW5A 3HHGA 3MP6A 4ZE8A 5ET7A 1T0KA 3MP8A 3BFUA 4G61A 1GVCA 1NV2A 3H6UA 5A5LA 1IMBA 3MC2A 2BJIA 4AS4A 1N76A 1MXVA 4G77A 3ZS6A 4Q0CA 3BFTA 1FPGA 4Q5TA 4QFLA 5H8HA 2JJKA 1AOVA 5I2NA 3ZSFA 1URSA 1IXGA 2I48A 4ZEBA 4F1VA 1NNTA 4BDLA 5JTYB 4YKPA 4NGUA 3RT6B 2OBGA 4GVOA 4F2QA 1B3EA 5CMBA 1ATGA 4I3YA 2GHBA 4THIA 3GBBA 5LDZA 3PPQA 1B1HA 2XXUA 3I3VA 3S9EA 3T9UA 4N6KA 1F9BA 2Q8JA 2QS3A 1Y4CA 1LAXA 2RF1A 5B70A 3BIHA 3KG2A 2VHAA 4N17A 2F3DA 3WAEA 3H4ZA 3O2AA 4NG7A 1KZ8A 2UYEA 1A8FA 2OJTA 2XWIA 3PV0E 1SQYA 2HPGA 2QVUA 2ZYKA 1EYIA 1H76A 4Q8RA 3N26A 3G3IA 4OVRA 4LQ5A 4WKMA 4G68C 4QHQA 4YAHX 5I7IA 4F31B 1VFEA 5FTHA 3CFXA 1LBBA 1SYIA 2VD3A 4ZZAA 4H1XA 5HM4B 4F1YA 4PCDA 1MQJA 1YYZA 4NWCA 2Y7WA 5TPAA 2VPNA 4P8BA 3TZAA 1LAHE 2A5TA 4I8CA 1N0TA 5I2KB 4QBAA 3C9HA 4NX1A 4NN3A 4JVCA 1ZJLA 3RGYA 4PFUA 5IGAA 4TQUQ 1FPBA 3VXBA 2MKZA 1MXXA 3SEWA 4QFOA 4TOZA 4OWDA 4MFIA 4R6YA 1FPFA 3RNNA 2Z8DA 1O63A 5CBSA 5I5PA 1Y1ZA 3BIGA 4Z0IA 1BKAA 4GWSA 5IAIA 4GX6A 4O3CA 3IFCA 4HS7A 3LSWA 4X1DA 1YAEA 5BWJA 1DOTA 5H8NA 3MJNA 4FECA 3O28A 3IX1A 1FTMA 4ZE9A 3EHUA 2O51A 3FASA 1RDZA 1XHYA 3FXRA 3MPLA 3HFUA 4GWXA 1M5DA 1FPIA 2LAOA 1S50A 2G29A 1MY1A 1A99A 2CZLA 3USDA 4I62A 3C33A 4R2FA 1ANFA 2P1SA 3VVFA 4DXBA 1FPEA 3DLNA 4MX6A 1QUJA 3PPNA 5M2VA 5BUUA 3GBAA 4U1OA 1FBCA 3TYHA 5FHNA 2F34A 4JXIA 4N13A 1Y3QA 3E79A 1US5A 3HHFA 1B2HA 2F5XA 3K1MA 1JP4A 1G0HA 3K6VA 3JYRA 1EU8A 2DXYA 3GLBA 4OANA 3D4CA 3LBSA 1QVSA 2ANJA 2ESNA 5AA1A 1MY0A 4HCYA 3VLVA 5I59B 3TCFA 3M3KA 3OXNA 1M5FA 2THIA 3N6UA 1FQAA 1B1XA 2WBDA 3H6TA 4MLQA 2OWTA 3LC8A 1CNQA 1G0IA 1A55A 3PUXE 2M8CA 3R26A 1NUWA 4JSOA 5F7VA 3L6GA 4ISUA 5K2XA 4PE3A 2QFLA 4PAIA 5A5XB 3OO8A 3CFZA 1FRPA 1IXIA 1MM6A 2ZNSA 1AL3A 1SVXB 5IM2A 3ZKLA 1FBPA 3G3FA 2F78A 4GD5A 3S9LC 1IUDA 5KDTB 2ONKE 4BDRA 3THIA 3RPLB 2ABHA 3IJOB 4NF5A 3TAJA 1A8EA 5B7DA 3TTLA 2UVGA 3N5LA 2F7AA 2A5SA 1PB8A 2XXTA 4P56A 3C36A 3KN8A 1QGXA 1Y1MA 1USYH 3T66A 2QPQA 2DE2A 5FHMA 3E4RA 5I57A 2V4CA 4OENA 2I58A 1QUIA 3IJXB 3UK4A 4OQOA 1LAGE 2PVUA 3BKIB 2XD2A 2ZYNA 5EYGA 1FTAA 3LSLA 4C1UA 3EHSA 2XXKA 3E3KA 1MG1A 4PTKA 3FJ7A 1LB8A 2PT1A 5DVFA 3SEVA 1JEUA 1WODA 3O29A 2P0SA 2DWHA 4GL8A 3SETA 4JB7A 3QSLA 1KA0A 3U8QA 4YU0A 1DSNA 3PMVA 4C0RA 3KN7A 1FQBA 4DCXA 1LBZA 4KYDA 5AA2D 1SBPA 1VE4A 2HQ0A 4XFEA 5I2KA 2Z22A 4RK9A 3RY3A 3NOHA 4EXKA 3UP9A 3FXBA 4HW8A 4DXCA 1B46A 3P7IA 2FVZA 4POXA 2VD2A 4BDOA 4EQ7A 1USYE 3FJGA 3OOAA 2KLFA 3K0VA 3A09A 1H44A 1MPCA 2PFZA 4KHZE 5DVJA 1P1OA 2REGA 1B0HA 2CEXA 4FORA 2V3TA 1DTZA 2DVZA 1INPA 1Y3PA 2ZXTA 3HSTA 4YB5A 1SW2A 4O7MA 1NMUA 4JSDA 3B6WA 3JZJA 4OA4A 1AMFA 1XOCA 4KQPA 2DE3A 1B5HA 2HXWA 4LVQA 3QUJA 3MUQA 3AXFA 3PPPA 4EDPA 3S4UA 1EZOA 3MW0A 1DBZA 3KOTA 4FE8A 5CI5A 3W15C 1SD3A 4ZEKA 1B3GA 3RT8A 2Z8FA 2I3WA 2OX3A 4DCYA 5ISUA 4H8JA 4R9GA 5L9MA 4GXAA 1NH7A 1FTJA 2A5TB 4IO5A 1FTOA 4DI4B 4ECFA 4UACA 1B3FA 1NV4A 2FIEA 2I0BA 3K1NA 3V83A 5H8FA 1Y4TA 3TTNA 3M8UA 4MEVA 3S2VA 2Z8EA 1PEBA 2AL4A 3TMGA 4NE4A 1OMPA 4JBZA 1YPNA 4JVIA 2I4CA 3VVDA 1MY4A 4I40A 3ILTB 3MAMA 4GWYA 2XX8A 4OXVA 2L5VA 4FBPA 4U2RA 3O66A 5H8NB 5EHSA 3PD9A 5DVIA 3MVWA 1R1NA 3VLUA 1WDNA 2XXRA 4ELRA 4RA1A 4PP0A 1FJ6A 3Q29A 2V3QA 4OHNA 1CE2A 4I9DA 2P2AA 5KDTA 3V8XB 3SERA 3SZPA 4AB6A 3G3JA 5LOMA 1FBEA 3LSXA 1GR2A 2AL5A 4GWUA 1SYHA 4RJZA 4RPOA 1PDAA 3PPRA 3FV1A 4GLIA 1JETA 3FATA 1N04A 4HXVA 1B3LA 3Q25A 4NMYA 2XXPA 4BLAA 4LONB 4U22A 1IMFA 4F29A 3C4MA 3G3HA 2I49A 1CB6A 4ELPA 1IXCA 4MIJA 1R6ZA 1M5EA 4RXLA 4PDHA 5H8QA 4E0XA 2XXVA 2WBBA 3PUWE 3FGSA 3LR1A 3MZBA 3T9HB 3M3FA 2Q74A 3K6XA 1B5JA 3GXAA
chains in the Genus database with same CATH topology
1MH3A 3OSRA 1HSEA 2ZNUA 4ELOA 1IIWA 1ZKBA 1EH3A 4I1DA 4POWA 3OENA 1SI0A 4GL0A 4G4PA 3MQ9A 2DXRA 2Y84A 4EF1A 4E0WA 4HCWA 3DP8A 4IY5A 2DQVA 1PBQA 1UIVA 4NF4A 4NF5B 3S9MC 4RNSA 2ZYMA 4H5FA 3MWBA 5DT6A 5ELVA 1Q1KA 1S9TA 2OCUA 4YMBA 2O1LA 3EHTA 2ZNTA 4OMBA 5I57B 1LB9A 3TUSA 1HSJA 1EZ9A 3RTWB 2VP1A 3W9WA 3U72A 2UYFA 4ESXA 3ILUB 1B7HA 4KCDA 4KCCA 4YMAA 5TP9A 4PQJA 4EQ9A 1B3HA 1ZIUA 2O69A 3L6HA 4G2ZA 4R2BA 1DMBA 2E1SA 4FEDA 2I4BA 2GH9A 1URDA 2GHAA 1RYXA 4L17A 1ZBMA 4R6KA 3TCGA 4LZ8A 5KCJB 3OEMA 1UQWA 4F1UA 1PC3A 3PMWA 3K01A 1URGA 4F3SA 1LFIA 4F22A 2V3UA 1NNFA 1B58A 4MF3A 2O6AA 4XKNA 4LZ5A 1O7TA 5DYHA 3TTRA 1B6HA 3QIMA 1QJMA 3T96B 4RPNA 4XIGQ 3BBRA 3TTMA 1D4NA 5CMKA 4YB6A 4F19A 4U21A 4PFWA 1JVYA 2F6PA 5AA4A 5I56B 5CRYA 1B7UA 3UN6A 4H6DA 4IO4A 1UTHA 1L5TA 3V5AA 5JK4A 1US4A 4NF8B 1MXYA 4U1ZA 2PYYA 3SDFA 3G3KA 4BDMA 1FQDA 3RTFB 4EUOA 3HPIA 5IKBA 3VVEA 3B6TA 1Z7NE 3OMBA 3I6VA 1II5A 1MY2A 2GFEA 4JWYA 5H8FB 1B5IA 3FZVA 2RCBA 2QS4A 5FTIA 1FCKA 3O6HA 3PGFA 4R72A 3SKPA 2XHDA 4KYEA 3DELB 1Y9UA 4NTLA 5H8SA 3K6WA 3G7WA 1SDXA 2Q2AA 2O68A 4GF8A 3QK6A 4DZ1A 3B7DA 3TFLA 3CSBA 1OQGA 1NL5A 1MS7A 3EQ1A 1LSTA 1JQFA 2D5WA 1QW0A 4GOTA 3A3CA 1A40A 4F3BA 3KEIA 4NF6A 4QSCA 2I6EA 4YB7A 4ZEDA 5HBCA 4LZ7A 4OEUA 2O84X 1P99A 2PBWA 1VSOA 1FQEA 2DP8A 4ELQA 1TWYA 1Y3NA 3QXMA 2QSXA 3KSJA 3Q28A 3QAXA 2F35A 3K02A 4Z7EA 1VFDA 3IO4A 1B52A 3FD3A 1KWHA 5H8QB 4XTCQ 4QSDA 3PUVE 3MP1A 2VOZA 1IZ1A 1IXHA 1MPBA 4XKPA 5DTBA 4EF2A 1UTBB 2R71A 4N07A 4H0WA 2H25A 1OVTA 3O6GA 2HZLA 4LA9A 1FTLA 3A3UA 4X9TA 5KCJA 1P1UA 3T9VA 3N94A 2OZZA 2F8DA 1MXWA 2I3VA 4WXJA 5TU0A 3CR9A 4C1TA 3T22A 2F97A 4NF4B 1Q35A 3MPKA 3RLFE 4P0IA 3CSGA 4PETA 2Q2CA 1N3WA 3OO6A 2DWIA 4F3PA 2UVJA 3RN8A 4GWOA 3F11A 2OWSA 2QS2A 2YPNA 2R9JA 4OZ9A 4XXUA 5CMMA 3OSQA 3KBRA 5I56A 1FQFA 2HAVA 5DEXB 1BLFA 1M5CA 2H99A 2IA4A 3U92A 5TP9B 1NH8A 2DSFA 3IB2A 5CBRA 1MQHA 3K6UA 2DWJA 2F7BA 4ZDMA 4FIMA 1J1NA 1XS5A 1A54A 4NF8A 4U4SA 1NNKA 3EN3A 1OQHA 4FEBA 3EF7A 4AQ4A 2D3IA 2WKYA 1I6BA 3U1OA 4M4GA 2VGQA 3CI8A 2X7PA 2ZYOA 2ZMBA 1D9YA 3DP4A 2OLBA 4ZS9A 3MVXA 4F3GA 3H6VA 4YKKA 2D21A 1DPEA 2QMWA 4R73A 4H8IA 3IOVA 5ICTA 1GGGA 1FW0A 1ZU0A 2YJPA 4FATA 2F6GA 3N6TA 2F36A 4MLVA 3PMXA 3RQTA 2NWJA 5AA4B 2UXAA 1XVYA 1MDP1 4NWDA 3RPWA 1M5BA 5L9OA 1JEVA 1UTHB 2O1MA 4ESWA 3K00A 2V93A 1TXFA 4BDNA 4X48A 4DIGA 3QUFA 3IOUA 2GRVA 1EZPA 3KGCA 1B40A 1MDQA 2B65A 1N7WA 2Y7KA 3M3LA 5CC2A 1B4HA 3ECRA 3LUYA 3UGWA 3DP6A 3KJTA 1JW1A 3V89B 3H03A 1LCTA 1MQIA 4IO2A 1GTKA 3E13X 4YKIA 2FYIA 3VFJA 3Q27A 5JEIA 1SW5A 4JWOA 1GV8A 1LBCA 2REJA 2Q89A 2XXQA 2PX1A 4BDQA 3FVGA 1UTBA 3CRBA 1N3XA 4FJPA 1D9VA 3CVGA 4OFLA 2DE4A 5EHMA 3C32A 1MM7A 2QMXA 2Q9TA 3PUYE 2O7UA 4YKJA 4DLDA 4ND9A 2XX9A 4G68B 4H5GA 1H45A 4NF6B 3IB0A 4OEVA 3UA8A 2RKMA 2B3FA 3FVKA 2RC9A 3T9XB 4OVJA 1BTJA 4JDFA 3C35A 2DWAA 2V25A 3IOWA 4HTGA 5I84A 1VR5A 3I5OA 2G93A 3IK6B 4H65A 1D3KA 2OK2A 3SEYA 1I69A 3ODBA 1QUKA 2XXXA 3FV2A 5DEXA 4IO3A 4P0GA 2UVHA 1MH4A 2QRYA 4IO7A 4R9FA 1JW4A 4M1VA 1I6AA 2Q88A 5ITOA 1P1NA 3S9NC 3IL1B 3W9VA 4AB5A 1NKXA 3OELA 2NXOA 1HSLA 4P11A 1O64A 3H7MA 4JWXA 4MH5A 3GZGA 3WAFA 3PPOA 4ZEIA 3VDFA 2RINA 1RYOA 3IB1A 5AA2A 3HCQA 2HAUA 5AE4A 4EQBA 3EPEA 3KSXA 2FNCA 5I58A 1XT8A 4NEDA 3KZGA 4PE5B 5KZTA 3IO6A 4LATA 5CMCA 3OD7A 4ONYA 4EXLA 1Z7ME 4OERA 1H43A 3H3GA 3D4GA 3R6UA 1IQ7A 4QFPA 3MVZA 4IGRA 3TQLA 4O3BA 3LSFB 4RK2A 3G3GA 2DOJA 3MZ9A 1QULA 4DXUA 3VE1B 1LAFE 2HFBA 3Q26A 1A7LA 2XD3A 2R6GE 4OESA 2W7YA 1DTGA 1OLCA 1PB7A 1TFAA 4IY6A 3OEKA 5CM6A 1FQCA 3CG1A 2AIXA 4F2OA 4TLMB 4ZZEA 1NNPA 1I6QA 4GQOA 1DPPA 5EYFA 4KI0E 4KR5A 4IB2A 1UIUA 3IOTA 3DM0A 3C31A 3OO7A 2YLNA 1B51A 2B3BA 1MQDA 1B7ZA 4PFYA 1JNFA 1MXZA 3MVYA 3IORA 4XKQA 2NVUB 4QRZA 1FTKA 1NFTA 3VV5A 1POTA 2X7QA 5L8DA 2ONSA 4GRKA 3VLWA 1QKBA 3K2DA 2DYXA 4F39A 3HN0A 4WEDA 4UA8A 2V84A 2Y7IA 3OO9A 1ZTYA 2QL3A 4G68A 3VXCA 5JTYA 2HZKA 1P1QA 3TTKA 3FVOA 2X26A 1SW4A 1MXUA 1QKAA 2CMOA 4G8NA 2HCAA 5K2YA 3KOSA 4OYVA 2XXIA 1LFHA 3O97A 4KD5A 3U93A 1B05A 4FAJA 2PMSA 4K3FA 4ZECA 4YICA 3PD8A 4OTEA 2DS9A 4R6HA 1WVJA 3TCHA 1B4ZA 2XXYA 3TODA 4GXSB 2QS1A 4OFJA 3CG3A 1R9LA 2H4IA 4LUBA 1LFGA 2NOOA 2H5YA 1IITA 2Z23A 1BIYA 5ICQA 3CFLA 2O7IA 5H8HB 5I2NB 3KJ7A 1PB9A 5ITPA 1IEJA 3HV1A 3JV9A 2XXWA 1B0LA 2PT2A 1AIVA 2HEUA 3TDJA 1MRPA 1YCJA 1XVXA 1SI1A 2XX7A 2FA7A 4QFNA 2RC7A 2E0SA 4OFOA 1TFDA 4F18A 1AH5A 5AA3A 1BP5A 1H3DA 4DE8A 1N84A 3B6QA 4Q30B 5HPQA 1YTVA 3E9XA 3H06B 3ZKKA 2RCAA 4WEPA 1OVBA 3T93B 4QF9A 2DVCA 1OIBA 3H6WA 4G8MA 3C34A 3FVNA 4MBPA 4XKRA 1N7XA 1LLSA 1JVXA 3RUMA 3KN3A 4O3AA 2QJEA 4GFRA 4LQ2A 2NUVA 3HO7A 1RKMA 3UIFA 2ONRA 3K1PA 3FXQA 1B32A 2UVIA 1ZMGA 1ZLQA 5TPAB 5AA2B 3TKDA 5L9SA 3O9PA 2Y7RA 1LGBC 4G8HA 1S7YA 1SW1A 5I58B 3PUZE 5FHOA 3TQWA 1OLAA 1P1WA 4IO6A 4U4XA 4ZEFA 4IGTA 3TEPA 3SEXA 5I59A 2BJJX 2ALUA 3KFMA 1LCFA 3FXUA 4DDDA 4KYSA 1MQGA 1Y20A 3TELA 2RC8A 3IR1A 3PU5A 3SEUA 2XXHA 1MY3A 4PFTA 2F7CA 3TPAA 3IAZA 3MZ1A 5A5XA 1POY1 3SESA 1PBPA 3MBPA 4X1BA 1ELJA 2IEEA 3FIRA 3U94A 4R74A 1XC1A 2I0CA 5J1DA 4TLLB 3CIJA 1TT1A 4RYAA 1MPDA 4YZZA 3QYTA 1R9QA 4QSEA 4KPTA 3FUZA 2H98A 3O6IA 3ONMA 4H67A 3UORA 4N6PA 4OETA 4GIZA 4KFQA 2Y7PA 4U23A 4QFKA 3K4UA 3FJMA 2AYSA 2H9BA 5F1QA 4R75A 3R7XA 1B9JA 4RY1A 4LP2B 1JW5A 3HHGA 3MP6A 4ZE8A 1T0KA 3MP8A 3BFUA 1GVCA 3H6UA 3MC2A 1N76A 1MXVA 4G77A 3ZS6A 4Q0CA 3BFTA 4Q5TA 4QFLA 5H8HA 1AOVA 5I2NA 3ZSFA 1URSA 1IXGA 2I48A 4ZEBA 4F1VA 1NNTA 4BDLA 5JTYB 4YKPA 3RT6B 2OBGA 4GVOA 4F2QA 1B3EA 5CMBA 1ATGA 2GHBA 4THIA 3GBBA 3PPQA 1B1HA 2XXUA 3I3VA 3S9EA 3T9UA 1F9BA 2Q8JA 2QS3A 1Y4CA 1LAXA 2RF1A 5B70A 3KG2A 2VHAA 3WAEA 3H4ZA 3O2AA 2UYEA 1A8FA 2OJTA 3PV0E 1SQYA 2ZYKA 1H76A 4Q8RA 3N26A 3G3IA 4LQ5A 4WKMA 4G68C 4QHQA 4YAHX 4F31B 1VFEA 5FTHA 3CFXA 1LBBA 1SYIA 2VD3A 4ZZAA 4H1XA 5HM4B 4F1YA 1MQJA 4NWCA 2Y7WA 5TPAA 3TZAA 1LAHE 2A5TA 4I8CA 1N0TA 5I2KB 3C9HA 3RGYA 1ZJLA 4PFUA 4TQUQ 3VXBA 1MXXA 3SEWA 4QFOA 4TOZA 4OWDA 4MFIA 4R6YA 3RNNA 2Z8DA 1O63A 5CBSA 1Y1ZA 4Z0IA 1BKAA 5IAIA 4O3CA 4HS7A 3LSWA 4X1DA 1YAEA 5BWJA 1DOTA 5H8NA 3MJNA 4FECA 3O28A 3IX1A 1FTMA 4ZE9A 3EHUA 2O51A 3FASA 1XHYA 3FXRA 3MPLA 1M5DA 2LAOA 1S50A 2G29A 1MY1A 1A99A 2CZLA 3USDA 4I62A 3C33A 4R2FA 1ANFA 2P1SA 3VVFA 4DXBA 3DLNA 1QUJA 3PPNA 5M2VA 5BUUA 3GBAA 4U1OA 3TYHA 5FHNA 2F34A 4JXIA 4N13A 1Y3QA 1US5A 3HHFA 1B2HA 2F5XA 3K1MA 3K6VA 3JYRA 1EU8A 2DXYA 3GLBA 3D4CA 3LBSA 1QVSA 2ANJA 2ESNA 5AA1A 1MY0A 4HCYA 3VLVA 5I59B 3TCFA 3M3KA 3OXNA 1M5FA 2THIA 3N6UA 1FQAA 1B1XA 3H6TA 4MLQA 2OWTA 3LC8A 1A55A 3PUXE 2M8CA 3R26A 4JSOA 5F7VA 3L6GA 4ISUA 5K2XA 5A5XB 3OO8A 3CFZA 1IXIA 1MM6A 2ZNSA 1AL3A 1SVXB 3ZKLA 3G3FA 2F78A 4GD5A 3S9LC 1IUDA 5KDTB 2ONKE 4BDRA 3THIA 2ABHA 3IJOB 4NF5A 3TAJA 1A8EA 5B7DA 3TTLA 2UVGA 3N5LA 2F7AA 2A5SA 1PB8A 2XXTA 3C36A 3KN8A 1Y1MA 1USYH 3T66A 2QPQA 2DE2A 5FHMA 3E4RA 5I57A 4OENA 2I58A 1QUIA 3IJXB 3UK4A 4OQOA 1LAGE 2PVUA 3BKIB 2XD2A 2ZYNA 3LSLA 4C1UA 3EHSA 3E3KA 1MG1A 3FJ7A 1LB8A 2PT1A 5DVFA 3SEVA 1JEUA 1WODA 3O29A 2P0SA 2DWHA 4GL8A 3SETA 4JB7A 3QSLA 3U8QA 4YU0A 1DSNA 3PMVA 4C0RA 3KN7A 1FQBA 4DCXA 4KYDA 5AA2D 1SBPA 1VE4A 2HQ0A 5I2KA 2Z22A 4RK9A 3RY3A 4EXKA 3UP9A 4HW8A 4DXCA 1B46A 3P7IA 4POXA 2VD2A 4BDOA 4EQ7A 1USYE 3FJGA 3OOAA 2KLFA 3K0VA 3A09A 1H44A 1MPCA 4KHZE 5DVJA 1P1OA 2REGA 1B0HA 4FORA 2V3TA 1DTZA 2DVZA 1Y3PA 2ZXTA 3HSTA 4YB5A 1SW2A 1NMUA 4JSDA 3B6WA 3JZJA 1AMFA 1XOCA 4KQPA 2DE3A 1B5HA 2HXWA 4LVQA 3QUJA 3MUQA 3AXFA 3PPPA 4EDPA 3S4UA 1EZOA 3MW0A 3KOTA 4FE8A 5CI5A 3W15C 1SD3A 4ZEKA 1B3GA 3RT8A 2Z8FA 2I3WA 4DCYA 5ISUA 4H8JA 4R9GA 5L9MA 4GXAA 1NH7A 1FTJA 2A5TB 4IO5A 1FTOA 4ECFA 4UACA 1B3FA 2I0BA 3K1NA 3V83A 5H8FA 1Y4TA 3TTNA 3M8UA 3S2VA 2Z8EA 1PEBA 2AL4A 3TMGA 4NE4A 1OMPA 4JBZA 1YPNA 3VVDA 2I4CA 1MY4A 3ILTB 3MAMA 2XX8A 4OXVA 4U2RA 3O66A 5H8NB 5EHSA 3PD9A 5DVIA 3MVWA 1R1NA 3VLUA 1WDNA 2XXRA 4ELRA 4RA1A 4PP0A 3Q29A 2V3QA 4OHNA 1CE2A 4I9DA 2P2AA 5KDTA 3V8XB 3SERA 4AB6A 3G3JA 5LOMA 3LSXA 1GR2A 2AL5A 1SYHA 4RJZA 4RPOA 1PDAA 3PPRA 3FV1A 4GLIA 1JETA 3FATA 1N04A 1B3LA 3Q25A 4NMYA 2XXPA 4BLAA 4LONB 4U22A 4F29A 3C4MA 3G3HA 2I49A 1CB6A 4ELPA 1IXCA 1R6ZA 1M5EA 4RXLA 5H8QA 4E0XA 2XXVA 3PUWE 3FGSA 3LR1A 3MZBA 3T9HB 3M3FA 3K6XA 1B5JA 3GXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH3 A;  3OSR A;  1HSE A;  2ZNU A;  4ELO A;  1IIW A;  1ZKB A;  1EH3 A;  4I1D A;  4POW A;  3OEN A;  1SI0 A;  4GL0 A;  4G4P A;  3MQ9 A;  2DXR A;  2Y84 A;  4EF1 A;  4E0W A;  4HCW A;  3DP8 A;  4IY5 A;  2DQV A;  1PBQ A;  1UIV A;  4NF4 A;  4NF5 B;  3S9M C;  4RNS A;  2ZYM A;  4H5F A;  3MWB A;  5DT6 A;  5ELV A;  1Q1K A;  1S9T A;  2OCU A;  4YMB A;  2O1L A;  3EHT A;  2ZNT A;  4OMB A;  5I57 B;  1LB9 A;  3TUS A;  1HSJ A;  1EZ9 A;  3RTW B;  2VP1 A;  3W9W A;  3U72 A;  2UYF A;  4ESX A;  3ILU B;  1B7H A;  4KCD A;  4KCC A;  4YMA A;  5TP9 A;  4PQJ A;  4EQ9 A;  1B3H A;  1ZIU A;  2O69 A;  3L6H A;  4G2Z A;  4R2B A;  1DMB A;  2E1S A;  4FED A;  2I4B A;  2GH9 A;  1URD A;  2GHA A;  1RYX A;  4L17 A;  1ZBM A;  4R6K A;  3TCG A;  4LZ8 A;  5KCJ B;  3OEM A;  1UQW A;  4F1U A;  1PC3 A;  3PMW A;  3K01 A;  1URG A;  4F3S A;  1LFI A;  4F22 A;  2V3U A;  1NNF A;  1B58 A;  4MF3 A;  2O6A A;  4XKN A;  4LZ5 A;  1O7T A;  5DYH A;  3TTR A;  1B6H A;  3QIM A;  1QJM A;  3T96 B;  4RPN A;  4XIG Q;  3BBR A;  3TTM A;  1D4N A;  5CMK A;  4YB6 A;  4F19 A;  4U21 A;  4PFW A;  1JVY A;  2F6P A;  5AA4 A;  5I56 B;  5CRY A;  1B7U A;  3UN6 A;  4H6D A;  4IO4 A;  1UTH A;  1L5T A;  3V5A A;  5JK4 A;  1US4 A;  4NF8 B;  1MXY A;  4U1Z A;  2PYY A;  3SDF A;  3G3K A;  4BDM A;  1FQD A;  3RTF B;  4EUO A;  3HPI A;  5IKB A;  3VVE A;  3B6T A;  1Z7N E;  3OMB A;  3I6V A;  1II5 A;  1MY2 A;  2GFE A;  4JWY A;  5H8F B;  1B5I A;  3FZV A;  2RCB A;  2QS4 A;  5FTI A;  1FCK A;  3O6H A;  3PGF A;  4R72 A;  3SKP A;  2XHD A;  4KYE A;  3DEL B;  1Y9U A;  4NTL A;  5H8S A;  3K6W A;  3G7W A;  1SDX A;  2Q2A A;  2O68 A;  4GF8 A;  3QK6 A;  4DZ1 A;  3B7D A;  3TFL A;  3CSB A;  1OQG A;  1NL5 A;  1MS7 A;  3EQ1 A;  1LST A;  1JQF A;  2D5W A;  1QW0 A;  4GOT A;  3A3C A;  1A40 A;  4F3B A;  3KEI A;  4NF6 A;  4QSC A;  2I6E A;  4YB7 A;  4ZED A;  5HBC A;  4LZ7 A;  4OEU A;  2O84 X;  1P99 A;  2PBW A;  1VSO A;  1FQE A;  2DP8 A;  4ELQ A;  1TWY A;  1Y3N A;  3QXM A;  2QSX A;  3KSJ A;  3Q28 A;  3QAX A;  2F35 A;  3K02 A;  4Z7E A;  1VFD A;  3IO4 A;  1B52 A;  3FD3 A;  1KWH A;  5H8Q B;  4XTC Q;  4QSD A;  3PUV E;  3MP1 A;  2VOZ A;  1IZ1 A;  1IXH A;  1MPB A;  4XKP A;  5DTB A;  4EF2 A;  1UTB B;  2R71 A;  4N07 A;  4H0W A;  2H25 A;  1OVT A;  3O6G A;  2HZL A;  4LA9 A;  1FTL A;  3A3U A;  4X9T A;  5KCJ A;  1P1U A;  3T9V A;  3N94 A;  2OZZ A;  2F8D A;  1MXW A;  2I3V A;  4WXJ A;  5TU0 A;  3CR9 A;  4C1T A;  3T22 A;  2F97 A;  4NF4 B;  1Q35 A;  3MPK A;  3RLF E;  4P0I A;  3CSG A;  4PET A;  2Q2C A;  1N3W A;  3OO6 A;  2DWI A;  4F3P A;  2UVJ A;  3RN8 A;  4GWO A;  3F11 A;  2OWS A;  2QS2 A;  2YPN A;  2R9J A;  4OZ9 A;  4XXU A;  5CMM A;  3OSQ A;  3KBR A;  5I56 A;  1FQF A;  2HAV A;  5DEX B;  1BLF A;  1M5C A;  2H99 A;  2IA4 A;  3U92 A;  5TP9 B;  1NH8 A;  2DSF A;  3IB2 A;  5CBR A;  1MQH A;  3K6U A;  2DWJ A;  2F7B A;  4ZDM A;  4FIM A;  1J1N A;  1XS5 A;  1A54 A;  4NF8 A;  4U4S A;  1NNK A;  3EN3 A;  1OQH A;  4FEB A;  3EF7 A;  4AQ4 A;  2D3I A;  2WKY A;  1I6B A;  3U1O A;  4M4G A;  2VGQ A;  3CI8 A;  2X7P A;  2ZYO A;  2ZMB A;  1D9Y A;  3DP4 A;  2OLB A;  4ZS9 A;  3MVX A;  4F3G A;  3H6V A;  4YKK A;  2D21 A;  1DPE A;  2QMW A;  4R73 A;  4H8I A;  3IOV A;  5ICT A;  1GGG A;  1FW0 A;  1ZU0 A;  2YJP A;  4FAT A;  2F6G A;  3N6T A;  2F36 A;  4MLV A;  3PMX A;  3RQT A;  2NWJ A;  5AA4 B;  2UXA A;  1XVY A;  1MDP 1;  4NWD A;  3RPW A;  1M5B A;  5L9O A;  1JEV A;  1UTH B;  2O1M A;  4ESW A;  3K00 A;  2V93 A;  1TXF A;  4BDN A;  4X48 A;  4DIG A;  3QUF A;  3IOU A;  2GRV A;  1EZP A;  3KGC A;  1B40 A;  1MDQ A;  2B65 A;  1N7W A;  2Y7K A;  3M3L A;  5CC2 A;  1B4H A;  3ECR A;  3LUY A;  3UGW A;  3DP6 A;  3KJT A;  1JW1 A;  3V89 B;  3H03 A;  1LCT A;  1MQI A;  4IO2 A;  1GTK A;  3E13 X;  4YKI A;  2FYI A;  3VFJ A;  3Q27 A;  5JEI A;  1SW5 A;  4JWO A;  1GV8 A;  1LBC A;  2REJ A;  2Q89 A;  2XXQ A;  2PX1 A;  4BDQ A;  3FVG A;  1UTB A;  3CRB A;  1N3X A;  4FJP A;  1D9V A;  3CVG A;  4OFL A;  2DE4 A;  5EHM A;  3C32 A;  1MM7 A;  2QMX A;  2Q9T A;  3PUY E;  2O7U A;  4YKJ A;  4DLD A;  4ND9 A;  2XX9 A;  4G68 B;  4H5G A;  1H45 A;  4NF6 B;  3IB0 A;  4OEV A;  3UA8 A;  2RKM A;  2B3F A;  3FVK A;  2RC9 A;  3T9X B;  4OVJ A;  1BTJ A;  4JDF A;  3C35 A;  2DWA A;  2V25 A;  3IOW A;  4HTG A;  5I84 A;  1VR5 A;  3I5O A;  2G93 A;  3IK6 B;  4H65 A;  1D3K A;  2OK2 A;  3SEY A;  1I69 A;  3ODB A;  1QUK A;  2XXX A;  3FV2 A;  5DEX A;  4IO3 A;  4P0G A;  2UVH A;  1MH4 A;  2QRY A;  4IO7 A;  4R9F A;  1JW4 A;  4M1V A;  1I6A A;  2Q88 A;  5ITO A;  1P1N A;  3S9N C;  3IL1 B;  3W9V A;  4AB5 A;  1NKX A;  3OEL A;  2NXO A;  1HSL A;  4P11 A;  1O64 A;  3H7M A;  4JWX A;  4MH5 A;  3GZG A;  3WAF A;  3PPO A;  4ZEI A;  3VDF A;  2RIN A;  1RYO A;  3IB1 A;  5AA2 A;  3HCQ A;  2HAU A;  5AE4 A;  4EQB A;  3EPE A;  3KSX A;  2FNC A;  5I58 A;  1XT8 A;  4NED A;  3KZG A;  4PE5 B;  5KZT A;  3IO6 A;  4LAT A;  5CMC A;  3OD7 A;  4ONY A;  4EXL A;  1Z7M E;  4OER A;  1H43 A;  3H3G A;  3D4G A;  3R6U A;  1IQ7 A;  4QFP A;  3MVZ A;  4IGR A;  3TQL A;  4O3B A;  3LSF B;  4RK2 A;  3G3G A;  2DOJ A;  3MZ9 A;  1QUL A;  4DXU A;  3VE1 B;  1LAF E;  2HFB A;  3Q26 A;  1A7L A;  2XD3 A;  2R6G E;  4OES A;  2W7Y A;  1DTG A;  1OLC A;  1PB7 A;  1TFA A;  4IY6 A;  3OEK A;  5CM6 A;  1FQC A;  3CG1 A;  2AIX A;  4F2O A;  4TLM B;  4ZZE A;  1NNP A;  1I6Q A;  4GQO A;  1DPP A;  5EYF A;  4KI0 E;  4KR5 A;  4IB2 A;  1UIU A;  3IOT A;  3DM0 A;  3C31 A;  3OO7 A;  2YLN A;  1B51 A;  2B3B A;  1MQD A;  1B7Z A;  4PFY A;  1JNF A;  1MXZ A;  3MVY A;  3IOR A;  4XKQ A;  2NVU B;  4QRZ A;  1FTK A;  1NFT A;  3VV5 A;  1POT A;  2X7Q A;  5L8D A;  2ONS A;  4GRK A;  3VLW A;  1QKB A;  3K2D A;  2DYX A;  4F39 A;  3HN0 A;  4WED A;  4UA8 A;  2V84 A;  2Y7I A;  3OO9 A;  1ZTY A;  2QL3 A;  4G68 A;  3VXC A;  5JTY A;  2HZK A;  1P1Q A;  3TTK A;  3FVO A;  2X26 A;  1SW4 A;  1MXU A;  1QKA A;  2CMO A;  4G8N A;  2HCA A;  5K2Y A;  3KOS A;  4OYV A;  2XXI A;  1LFH A;  3O97 A;  4KD5 A;  3U93 A;  1B05 A;  4FAJ A;  2PMS A;  4K3F A;  4ZEC A;  4YIC A;  3PD8 A;  4OTE A;  2DS9 A;  4R6H A;  1WVJ A;  3TCH A;  1B4Z A;  2XXY A;  3TOD A;  4GXS B;  2QS1 A;  4OFJ A;  3CG3 A;  1R9L A;  2H4I A;  4LUB A;  1LFG A;  2NOO A;  2H5Y A;  1IIT A;  2Z23 A;  1BIY A;  5ICQ A;  3CFL A;  2O7I A;  5H8H B;  5I2N B;  3KJ7 A;  1PB9 A;  5ITP A;  1IEJ A;  3HV1 A;  3JV9 A;  2XXW A;  1B0L A;  2PT2 A;  1AIV A;  2HEU A;  3TDJ A;  1MRP A;  1YCJ A;  1XVX A;  1SI1 A;  2XX7 A;  2FA7 A;  4QFN A;  2RC7 A;  2E0S A;  4OFO A;  1TFD A;  4F18 A;  1AH5 A;  5AA3 A;  1BP5 A;  1H3D A;  4DE8 A;  1N84 A;  3B6Q A;  4Q30 B;  5HPQ A;  1YTV A;  3E9X A;  3H06 B;  3ZKK A;  2RCA A;  4WEP A;  1OVB A;  3T93 B;  4QF9 A;  2DVC A;  1OIB A;  3H6W A;  4G8M A;  3C34 A;  3FVN A;  4MBP A;  4XKR A;  1N7X A;  1LLS A;  1JVX A;  3RUM A;  3KN3 A;  4O3A A;  2QJE A;  4GFR A;  4LQ2 A;  2NUV A;  3HO7 A;  1RKM A;  3UIF A;  2ONR A;  3K1P A;  3FXQ A;  1B32 A;  2UVI A;  1ZMG A;  1ZLQ A;  5TPA B;  5AA2 B;  3TKD A;  5L9S A;  3O9P A;  2Y7R A;  1LGB C;  4G8H A;  1S7Y A;  1SW1 A;  5I58 B;  3PUZ E;  5FHO A;  3TQW A;  1OLA A;  1P1W A;  4IO6 A;  4U4X A;  4ZEF A;  4IGT A;  3TEP A;  3SEX A;  5I59 A;  2BJJ X;  2ALU A;  3KFM A;  1LCF A;  3FXU A;  4DDD A;  4KYS A;  1MQG A;  1Y20 A;  3TEL A;  2RC8 A;  3IR1 A;  3PU5 A;  3SEU A;  2XXH A;  1MY3 A;  4PFT A;  2F7C A;  3TPA A;  3IAZ A;  3MZ1 A;  5A5X A;  1POY 1;  3SES A;  1PBP A;  3MBP A;  4X1B A;  1ELJ A;  2IEE A;  3FIR A;  3U94 A;  4R74 A;  1XC1 A;  2I0C A;  5J1D A;  4TLL B;  3CIJ A;  1TT1 A;  4RYA A;  1MPD A;  4YZZ A;  3QYT A;  1R9Q A;  4QSE A;  4KPT A;  3FUZ A;  2H98 A;  3O6I A;  3ONM A;  4H67 A;  3UOR A;  4N6P A;  4OET A;  4GIZ A;  4KFQ A;  2Y7P A;  4U23 A;  4QFK A;  3K4U A;  3FJM A;  2AYS A;  2H9B A;  5F1Q A;  4R75 A;  3R7X A;  1B9J A;  4RY1 A;  4LP2 B;  1JW5 A;  3HHG A;  3MP6 A;  4ZE8 A;  1T0K A;  3MP8 A;  3BFU A;  1GVC A;  3H6U A;  3MC2 A;  1N76 A;  1MXV A;  4G77 A;  3ZS6 A;  4Q0C A;  3BFT A;  4Q5T A;  4QFL A;  5H8H A;  1AOV A;  5I2N A;  3ZSF A;  1URS A;  1IXG A;  2I48 A;  4ZEB A;  4F1V A;  1NNT A;  4BDL A;  5JTY B;  4YKP A;  3RT6 B;  2OBG A;  4GVO A;  4F2Q A;  1B3E A;  5CMB A;  1ATG A;  2GHB A;  4THI A;  3GBB A;  3PPQ A;  1B1H A;  2XXU A;  3I3V A;  3S9E A;  3T9U A;  1F9B A;  2Q8J A;  2QS3 A;  1Y4C A;  1LAX A;  2RF1 A;  5B70 A;  3KG2 A;  2VHA A;  3WAE A;  3H4Z A;  3O2A A;  2UYE A;  1A8F A;  2OJT A;  3PV0 E;  1SQY A;  2ZYK A;  1H76 A;  4Q8R A;  3N26 A;  3G3I A;  4LQ5 A;  4WKM A;  4G68 C;  4QHQ A;  4YAH X;  4F31 B;  1VFE A;  5FTH A;  3CFX A;  1LBB A;  1SYI A;  2VD3 A;  4ZZA A;  4H1X A;  5HM4 B;  4F1Y A;  1MQJ A;  4NWC A;  2Y7W A;  5TPA A;  3TZA A;  1LAH E;  2A5T A;  4I8C A;  1N0T A;  5I2K B;  3C9H A;  3RGY A;  1ZJL A;  4PFU A;  4TQU Q;  3VXB A;  1MXX A;  3SEW A;  4QFO A;  4TOZ A;  4OWD A;  4MFI A;  4R6Y A;  3RNN A;  2Z8D A;  1O63 A;  5CBS A;  1Y1Z A;  4Z0I A;  1BKA A;  5IAI A;  4O3C A;  4HS7 A;  3LSW A;  4X1D A;  1YAE A;  5BWJ A;  1DOT A;  5H8N A;  3MJN A;  4FEC A;  3O28 A;  3IX1 A;  1FTM A;  4ZE9 A;  3EHU A;  2O51 A;  3FAS A;  1XHY A;  3FXR A;  3MPL A;  1M5D A;  2LAO A;  1S50 A;  2G29 A;  1MY1 A;  1A99 A;  2CZL A;  3USD A;  4I62 A;  3C33 A;  4R2F A;  1ANF A;  2P1S A;  3VVF A;  4DXB A;  3DLN A;  1QUJ A;  3PPN A;  5M2V A;  5BUU A;  3GBA A;  4U1O A;  3TYH A;  5FHN A;  2F34 A;  4JXI A;  4N13 A;  1Y3Q A;  1US5 A;  3HHF A;  1B2H A;  2F5X A;  3K1M A;  3K6V A;  3JYR A;  1EU8 A;  2DXY A;  3GLB A;  3D4C A;  3LBS A;  1QVS A;  2ANJ A;  2ESN A;  5AA1 A;  1MY0 A;  4HCY A;  3VLV A;  5I59 B;  3TCF A;  3M3K A;  3OXN A;  1M5F A;  2THI A;  3N6U A;  1FQA A;  1B1X A;  3H6T A;  4MLQ A;  2OWT A;  3LC8 A;  1A55 A;  3PUX E;  2M8C A;  3R26 A;  4JSO A;  5F7V A;  3L6G A;  4ISU A;  5K2X A;  5A5X B;  3OO8 A;  3CFZ A;  1IXI A;  1MM6 A;  2ZNS A;  1AL3 A;  1SVX B;  3ZKL A;  3G3F A;  2F78 A;  4GD5 A;  3S9L C;  1IUD A;  5KDT B;  2ONK E;  4BDR A;  3THI A;  2ABH A;  3IJO B;  4NF5 A;  3TAJ A;  1A8E A;  5B7D A;  3TTL A;  2UVG A;  3N5L A;  2F7A A;  2A5S A;  1PB8 A;  2XXT A;  3C36 A;  3KN8 A;  1Y1M A;  1USY H;  3T66 A;  2QPQ A;  2DE2 A;  5FHM A;  3E4R A;  5I57 A;  4OEN A;  2I58 A;  1QUI A;  3IJX B;  3UK4 A;  4OQO A;  1LAG E;  2PVU A;  3BKI B;  2XD2 A;  2ZYN A;  3LSL A;  4C1U A;  3EHS A;  3E3K A;  1MG1 A;  3FJ7 A;  1LB8 A;  2PT1 A;  5DVF A;  3SEV A;  1JEU A;  1WOD A;  3O29 A;  2P0S A;  2DWH A;  4GL8 A;  3SET A;  4JB7 A;  3QSL A;  3U8Q A;  4YU0 A;  1DSN A;  3PMV A;  4C0R A;  3KN7 A;  1FQB A;  4DCX A;  4KYD A;  5AA2 D;  1SBP A;  1VE4 A;  2HQ0 A;  5I2K A;  2Z22 A;  4RK9 A;  3RY3 A;  4EXK A;  3UP9 A;  4HW8 A;  4DXC A;  1B46 A;  3P7I A;  4POX A;  2VD2 A;  4BDO A;  4EQ7 A;  1USY E;  3FJG A;  3OOA A;  2KLF A;  3K0V A;  3A09 A;  1H44 A;  1MPC A;  4KHZ E;  5DVJ A;  1P1O A;  2REG A;  1B0H A;  4FOR A;  2V3T A;  1DTZ A;  2DVZ A;  1Y3P A;  2ZXT A;  3HST A;  4YB5 A;  1SW2 A;  1NMU A;  4JSD A;  3B6W A;  3JZJ A;  1AMF A;  1XOC A;  4KQP A;  2DE3 A;  1B5H A;  2HXW A;  4LVQ A;  3QUJ A;  3MUQ A;  3AXF A;  3PPP A;  4EDP A;  3S4U A;  1EZO A;  3MW0 A;  3KOT A;  4FE8 A;  5CI5 A;  3W15 C;  1SD3 A;  4ZEK A;  1B3G A;  3RT8 A;  2Z8F A;  2I3W A;  4DCY A;  5ISU A;  4H8J A;  4R9G A;  5L9M A;  4GXA A;  1NH7 A;  1FTJ A;  2A5T B;  4IO5 A;  1FTO A;  4ECF A;  4UAC A;  1B3F A;  2I0B A;  3K1N A;  3V83 A;  5H8F A;  1Y4T A;  3TTN A;  3M8U A;  3S2V A;  2Z8E A;  1PEB A;  2AL4 A;  3TMG A;  4NE4 A;  1OMP A;  4JBZ A;  1YPN A;  3VVD A;  2I4C A;  1MY4 A;  3ILT B;  3MAM A;  2XX8 A;  4OXV A;  4U2R A;  3O66 A;  5H8N B;  5EHS A;  3PD9 A;  5DVI A;  3MVW A;  1R1N A;  3VLU A;  1WDN A;  2XXR A;  4ELR A;  4RA1 A;  4PP0 A;  3Q29 A;  2V3Q A;  4OHN A;  1CE2 A;  4I9D A;  2P2A A;  5KDT A;  3V8X B;  3SER A;  4AB6 A;  3G3J A;  5LOM A;  3LSX A;  1GR2 A;  2AL5 A;  1SYH A;  4RJZ A;  4RPO A;  1PDA A;  3PPR A;  3FV1 A;  4GLI A;  1JET A;  3FAT A;  1N04 A;  1B3L A;  3Q25 A;  4NMY A;  2XXP A;  4BLA A;  4LON B;  4U22 A;  4F29 A;  3C4M A;  3G3H A;  2I49 A;  1CB6 A;  4ELP A;  1IXC A;  1R6Z A;  1M5E A;  4RXL A;  5H8Q A;  4E0X A;  2XXV A;  3PUW E;  3FGS A;  3LR1 A;  3MZB A;  3T9H B;  3M3F A;  3K6X A;  1B5J A;  3GXA A; 
#chains in the Genus database with same CATH topology
 1MH3 A;  3OSR A;  1HSE A;  2ZNU A;  3EKI A;  4ELO A;  5ESY A;  1IIW A;  4HE2 A;  1ZKB A;  1EH3 A;  3B8B A;  4I1D A;  4POW A;  3OEN A;  1SI0 A;  4GL0 A;  4G4P A;  3MQ9 A;  2DXR A;  1IME A;  1RDY A;  2Y84 A;  4EF1 A;  4E0W A;  4HCW A;  3DP8 A;  4IY5 A;  2DQV A;  1PBQ A;  1UIV A;  4NF4 A;  4NF5 B;  3S9M C;  4RNS A;  2ZYM A;  2ZZW A;  4H5F A;  3MWB A;  5DT6 A;  5ELV A;  1Q1K A;  1S9T A;  2OCU A;  4YMB A;  2O1L A;  3EHT A;  2ZNT A;  4OMB A;  5I57 B;  1LB9 A;  3TUS A;  1HSJ A;  1EZ9 A;  3RTW B;  2VP1 A;  3W9W A;  3U72 A;  2UYF A;  4ESX A;  3ILU B;  1B7H A;  4KCD A;  4KCC A;  4N4U A;  4YMA A;  4N91 A;  4PFI A;  1NV7 A;  3MST A;  5TP9 A;  4HE1 A;  4PQJ A;  4EQ9 A;  1B3H A;  1ZIU A;  2O69 A;  3L6H A;  4G2Z A;  4NQ8 A;  4R2B A;  2HXR A;  4H45 A;  1DMB A;  2E1S A;  1NV1 A;  4FED A;  1FBD A;  2I4B A;  2GH9 A;  1URD A;  2GHA A;  1RYX A;  4L17 A;  1ZBM A;  4R6K A;  3TCG A;  4LZ8 A;  5KCJ B;  3OEM A;  1UQW A;  4XF5 A;  4F1U A;  1PC3 A;  3PMW A;  3K01 A;  4PAF A;  1URG A;  4F3S A;  1LFI A;  4F22 A;  2V3U A;  1NNF A;  4MNI A;  1B58 A;  4MF3 A;  1RDX A;  2O6A A;  4XKN A;  4LZ5 A;  1O7T A;  5DYH A;  3TTR A;  1B6H A;  3QIM A;  1QJM A;  3T96 B;  4RPN A;  4XIG Q;  3BBR A;  3TTM A;  1D4N A;  5CMK A;  4YB6 A;  4F19 A;  4U21 A;  2OWZ A;  4PFW A;  1JVY A;  2F6P A;  1SPI A;  1IMA A;  5AA4 A;  5I56 B;  5CRY A;  1B7U A;  3UN6 A;  3T0J A;  4H6D A;  4IO4 A;  2B4M A;  1UTH A;  2WX9 A;  1L5T A;  3V5A A;  5JK4 A;  1US4 A;  3RYD A;  4NF8 B;  4P9K A;  4P1E A;  1MXY A;  4U1Z A;  2PYY A;  3SDF A;  5F24 A;  3G3K A;  4BDM A;  1FQD A;  3RTF B;  1NUX A;  4EUO A;  3HPI A;  5IKB A;  3VVE A;  3B6T A;  1Z7N E;  3OMB A;  3I6V A;  1II5 A;  1MY2 A;  2GFE A;  4JWY A;  4N81 A;  5H8F B;  1B5I A;  3FZV A;  2RCB A;  2QS4 A;  5FTI A;  1FCK A;  3O6H A;  3PGF A;  4R72 A;  3SKP A;  2XHD A;  4KYE A;  3IFA A;  3DEL B;  5LTC A;  2FHY A;  1Y9U A;  4NTL A;  4N6D A;  5H8S A;  3K6W A;  3G7W A;  1SDX A;  1LEV A;  2Q2A A;  4UAB A;  2O68 A;  4GF8 A;  3QK6 A;  4DZ1 A;  3B7D A;  3TFL A;  3CSB A;  1OQG A;  1NL5 A;  1MS7 A;  3EQ1 A;  1LST A;  1JQF A;  2D5W A;  1QW0 A;  4GOT A;  3A3C A;  1A40 A;  4F3B A;  3KC0 A;  3KEI A;  4NF6 A;  4QSC A;  2I6E A;  4YB7 A;  4ZED A;  1LBW A;  5HBC A;  4LZ7 A;  3D1R A;  4OEU A;  2O84 X;  3B50 A;  1P99 A;  2PBW A;  1VSO A;  1FQE A;  2DP8 A;  1FPK A;  4ELQ A;  1TWY A;  1Y3N A;  3QXM A;  2QSX A;  3KSJ A;  3Q28 A;  3QAX A;  2F35 A;  3K02 A;  4Z7E A;  4QXD A;  4H46 A;  2XWV A;  1VFD A;  3IO4 A;  1B52 A;  3FD3 A;  2HHM A;  1KWH A;  5H8Q B;  4XTC Q;  4QSD A;  1XI6 A;  3PUV E;  2Y5K A;  3MP1 A;  4NHB A;  4OVQ A;  2VOZ A;  1IZ1 A;  1IXH A;  1MPB A;  2VPO A;  4XKP A;  5DTB A;  4EF2 A;  1UTB B;  2R71 A;  4N07 A;  1LBY A;  4H0W A;  2H25 A;  4LN5 A;  1OVT A;  3O6G A;  2HZL A;  2XWK A;  4LA9 A;  1IMD A;  1FTL A;  3A3U A;  4X9T A;  1NV5 A;  5KCJ A;  1P1U A;  3LUZ A;  3T9V A;  3E78 A;  3N94 A;  2OZZ A;  2F8D A;  2F3B A;  1MXW A;  3KBZ A;  2I3V A;  4WXJ A;  5TU0 A;  2VT5 A;  3CR9 A;  4C1T A;  3T22 A;  3T1B A;  2F97 A;  4NF4 B;  1Q35 A;  3MPK A;  3RLF E;  4P0I A;  3CSG A;  2R8T A;  4PET A;  2Q2C A;  1N3W A;  3OO6 A;  2DWI A;  4F3P A;  4N8G A;  3KC1 A;  2UVJ A;  3RN8 A;  4GWO A;  3F11 A;  2KR0 A;  2OWS A;  2QS2 A;  2YPN A;  2R9J A;  4OZ9 A;  4XXU A;  5CMM A;  3OSQ A;  3KBR A;  5I56 A;  2FIX A;  1FQF A;  2HAV A;  5DEX B;  1BLF A;  1M5C A;  2H99 A;  2IA4 A;  3U92 A;  5TP9 B;  1NH8 A;  3FBP A;  2DSF A;  3IB2 A;  5CBR A;  1MQH A;  3K6U A;  2DWJ A;  2F7B A;  4ZDM A;  2CZI A;  4FIM A;  3ROJ A;  1J1N A;  1XS5 A;  1A54 A;  4NF8 A;  4U4S A;  1NNK A;  3EN3 A;  1OQH A;  4FEB A;  3EF7 A;  4PF8 A;  4AQ4 A;  2D3I A;  2WKY A;  1I6B A;  3U1O A;  4M4G A;  2VGQ A;  3CI8 A;  2X7P A;  4GBV A;  2ZYO A;  2ZMB A;  1D9Y A;  5FBP A;  3DP4 A;  2OLB A;  4ZS9 A;  1NV0 A;  3MVX A;  4F3G A;  2P3V A;  3H6V A;  4YKK A;  1AWB A;  2D21 A;  1DPE A;  2QMW A;  4R73 A;  1NI9 A;  4N8Y A;  4H8I A;  3IOV A;  5ICT A;  4MHF A;  1GGG A;  1FW0 A;  1ZU0 A;  2YJP A;  4FAT A;  2F6G A;  3N6T A;  2F36 A;  4MLV A;  3PMX A;  3RQT A;  2NWJ A;  5AA4 B;  2UXA A;  1XVY A;  4GBW A;  1MDP 1;  4NWD A;  5ET6 A;  3RPW A;  1M5B A;  5L9O A;  1JEV A;  1UTH B;  4GX4 A;  2O1M A;  4ESW A;  3K00 A;  2V93 A;  1TXF A;  4BDN A;  4X48 A;  2ZZV A;  4DIG A;  3QUF A;  3IOU A;  2GRV A;  1EZP A;  3KGC A;  1B40 A;  1MDQ A;  2B65 A;  1N7W A;  2Y7K A;  3M3L A;  5CC2 A;  1B4H A;  3ECR A;  3LUY A;  3UGW A;  3DP6 A;  3KJT A;  1NV3 A;  1JW1 A;  3V89 B;  3H03 A;  1LCT A;  2DDK A;  1MQI A;  4IO2 A;  5ET8 A;  1GTK A;  3E13 X;  4YKI A;  2FYI A;  3VFJ A;  3Q27 A;  5JEI A;  1SW5 A;  4JWO A;  1GV8 A;  2QVV A;  1LBC A;  2REJ A;  4GX3 A;  2Q89 A;  3A29 A;  2XXQ A;  2PX1 A;  4BDQ A;  3FVG A;  1UTB A;  3CRB A;  1N3X A;  4FJP A;  1D9V A;  3CVG A;  4OFL A;  2DE4 A;  5EHM A;  3C32 A;  1MM7 A;  2QMX A;  2Q9T A;  3PUY E;  2O7U A;  4YKJ A;  2XA5 A;  4DLD A;  4ND9 A;  2XX9 A;  4G68 B;  4H5G A;  1H45 A;  4NF6 B;  3IB0 A;  4PBQ A;  4OEV A;  3UA8 A;  2RKM A;  2B3F A;  3FVK A;  2RC9 A;  4XEQ A;  3T9X B;  4OVJ A;  1BTJ A;  4JDF A;  3C35 A;  2DWA A;  2V25 A;  3IOW A;  4HTG A;  5I84 A;  1VR5 A;  3I5O A;  2PFY A;  2G93 A;  3IK6 B;  4H65 A;  1D3K A;  2OK2 A;  3SEY A;  1I69 A;  3ODB A;  1QUK A;  1NUZ A;  2CZK A;  2XXX A;  3FV2 A;  3PTY A;  4IR8 A;  2KQZ A;  5DEX A;  4IO3 A;  4P0G A;  2UVH A;  1MH4 A;  2QRY A;  4IO7 A;  3GYY A;  4R9F A;  1JW4 A;  4M1V A;  1I6A A;  2Q88 A;  1LBV A;  5ITO A;  1P1N A;  3S9N C;  3IL1 B;  3W9V A;  4AB5 A;  1NKX A;  3OEL A;  2NXO A;  1FSA A;  1HSL A;  4P11 A;  1O64 A;  1Q9D A;  3H7M A;  4JWX A;  4MH5 A;  3GZG A;  3WAF A;  3PPO A;  1DCU A;  5IZ1 A;  4ZEI A;  3VDF A;  2RIN A;  1RYO A;  3IB1 A;  5AA2 A;  3HCQ A;  2HAU A;  5AE4 A;  1NUY A;  4MMP A;  4EQB A;  3EPE A;  3CHG A;  3KSX A;  2FNC A;  4I3E A;  5I58 A;  1XT8 A;  4NED A;  3KZG A;  4PE5 B;  5KZT A;  3IO6 A;  4LAT A;  4OVS A;  5CMC A;  3OD7 A;  4ONY A;  4EXL A;  1Z7M E;  4OER A;  1H43 A;  3H3G A;  3R6U A;  3D4G A;  1IQ7 A;  1VDW A;  4PDD A;  4QFP A;  3MVZ A;  4IGR A;  3TQL A;  4O3B A;  3LSF B;  4RK2 A;  3G3G A;  2ZZX A;  2DOJ A;  3MZ9 A;  2XWO A;  1QUL A;  4DXU A;  3VE1 B;  1LAF E;  4GWW A;  2HFB A;  3Q26 A;  1D9Q A;  1A7L A;  2XD3 A;  2R6G E;  4OES A;  2W7Y A;  1DTG A;  5IZ3 B;  1OLC A;  1PB7 A;  1TFA A;  4IY6 A;  3OEK A;  5CM6 A;  1FQC A;  3CG1 A;  2AIX A;  4MAG A;  4F2O A;  4TLM B;  4HE0 A;  4ZZE A;  1NNP A;  1I6Q A;  4GQO A;  1DPP A;  5EYF A;  4KI0 E;  4KR5 A;  4IB2 A;  1UIU A;  3IOT A;  1KA1 A;  3DM0 A;  3C31 A;  3OO7 A;  2YLN A;  1B51 A;  2B3B A;  2GQ1 A;  1MQD A;  4OVP A;  1B7Z A;  4PFY A;  4PGP A;  1JNF A;  1MXZ A;  4PC9 A;  3MVY A;  3IOR A;  4XKQ A;  2NVU B;  4QRZ A;  1FTK A;  1NFT A;  3VV5 A;  1POT A;  2X7Q A;  5L8D A;  2ONS A;  4GRK A;  5EQ9 A;  3VLW A;  1QKB A;  3K2D A;  2DYX A;  4F39 A;  3HN0 A;  2QVR A;  4WED A;  4UA8 A;  2V84 A;  1YZ0 A;  5IZZ A;  1FJ9 A;  1K9Y A;  2Y7I A;  3OO9 A;  1ZTY A;  2QL3 A;  4G68 A;  3VXC A;  1K9Z A;  5JTY A;  2HZK A;  1P1Q A;  1LBX A;  2PCR A;  4O94 A;  1FPD A;  3TTK A;  3FVO A;  2X26 A;  1SW4 A;  4MCO A;  1MXU A;  1QKA A;  2CMO A;  4G8N A;  4NAP A;  4P1L A;  2HCA A;  5K2Y A;  3KOS A;  4OYV A;  2XXI A;  4N15 A;  5ET5 A;  1LFH A;  3O97 A;  4KD5 A;  3U93 A;  4O8M A;  1B05 A;  4FAJ A;  2PMS A;  4K3F A;  4ZEC A;  4YIC A;  3PD8 A;  2WYK A;  4OTE A;  2DS9 A;  4R6H A;  4P3L A;  4X04 A;  1WVJ A;  1IMC A;  3MYU A;  3TCH A;  3ISP A;  4PGN A;  3QMF A;  1B4Z A;  2XXY A;  3TOD A;  4GXS B;  2QS1 A;  4OFJ A;  3CG3 A;  1R9L A;  2H4I A;  4LUB A;  1LFG A;  2NOO A;  2H5Y A;  1IIT A;  2Z23 A;  1BIY A;  4PBH A;  5ICQ A;  4DI3 D;  5J16 A;  3CFL A;  1DK4 A;  4O7I A;  2O7I A;  2CEY A;  5H8H B;  1FBF A;  5I2N B;  1NV6 A;  3KJ7 A;  5DW8 A;  1PB9 A;  1EYJ A;  5ITP A;  1IEJ A;  3HV1 A;  3JV9 A;  2XXW A;  1YXI A;  1B0L A;  2PT2 A;  1AIV A;  2HEU A;  3TDJ A;  1MRP A;  1YCJ A;  5EQ7 A;  5EYH A;  1XVX A;  4OVT A;  4MJO A;  1SI1 A;  2FBP A;  2XX7 A;  2FA7 A;  4X8R A;  4QFN A;  2RC7 A;  2E0S A;  4OFO A;  1TFD A;  4F18 A;  1AH5 A;  5AA3 A;  1BK4 A;  1BP5 A;  5EQA A;  1H3D A;  4DE8 A;  1N84 A;  3B6Q A;  4Q30 B;  5HPQ A;  4MNP A;  1YTV A;  3E9X A;  4JVD A;  2WYP A;  3H06 B;  3ZKK A;  1FBG A;  2RCA A;  4WEP A;  1OVB A;  3T93 B;  4KXP A;  5IZ3 A;  4QF9 A;  4NF0 A;  2DVC A;  1OIB A;  3H6W A;  4G8M A;  3C34 A;  4P47 A;  3FVN A;  4MBP A;  4XKR A;  1N7X A;  1LLS A;  1JVX A;  2CZH A;  3RUM A;  3KN3 A;  4O3A A;  2QJE A;  4GFR A;  3LV0 A;  4LQ2 A;  2NUV A;  3HO7 A;  1RKM A;  3UIF A;  2ONR A;  4PFB A;  3K1P A;  3FXQ A;  1EYK A;  1B32 A;  2UVI A;  4PAK A;  1ZMG A;  1ZLQ A;  5TPA B;  5EQ8 A;  5AA2 B;  3TKD A;  5L9S A;  3O9P A;  4AS5 A;  4MNC A;  2Y7R A;  5T3J A;  1LGB C;  2Q8M A;  2P3N A;  4G8H A;  1S7Y A;  1SW1 A;  5I58 B;  3PUZ E;  5FHO A;  3TQW A;  1OLA A;  2B4L A;  1P1W A;  4IO6 A;  4U4X A;  1FPJ A;  4ZEF A;  4IGT A;  4GWZ A;  3TEP A;  3SEX A;  5I59 A;  2BJJ X;  2ALU A;  3KFM A;  1LCF A;  3FXU A;  1FPL A;  4DDD A;  4KYS A;  1MQG A;  4PFR A;  1Y20 A;  3TEL A;  2RC8 A;  3IR1 A;  3PU5 A;  3SEU A;  2XXH A;  1MY3 A;  4PFT A;  5I3S A;  2F7C A;  3TPA A;  3IAZ A;  3MZ1 A;  5A5X A;  1POY 1;  3SES A;  1PBP A;  3MBP A;  4X1B A;  1ELJ A;  2IEE A;  3FIR A;  3U94 A;  4R74 A;  1XC1 A;  2WEF A;  2I0C A;  5J1D A;  4TLL B;  3CIJ A;  1TT1 A;  4PF6 A;  3RPL A;  4RYA A;  1FBH A;  1MPD A;  4YZZ A;  3QYT A;  1R9Q A;  4QSE A;  4KPT A;  3FUZ A;  3U65 A;  2H98 A;  3O6I A;  3ONM A;  4H67 A;  3UOR A;  4N6P A;  4OET A;  4GIZ A;  4KFQ A;  2Y7P A;  4U23 A;  4QFK A;  3K4U A;  3FJM A;  2AYS A;  2H9B A;  5F1Q A;  4R75 A;  3R7X A;  1B9J A;  4RY1 A;  2Y5L A;  4LP2 B;  1JW5 A;  3HHG A;  3MP6 A;  4ZE8 A;  5ET7 A;  1T0K A;  3MP8 A;  3BFU A;  4G61 A;  1GVC A;  1NV2 A;  3H6U A;  5A5L A;  1IMB A;  3MC2 A;  2BJI A;  4AS4 A;  1N76 A;  1MXV A;  4G77 A;  3ZS6 A;  4Q0C A;  3BFT A;  1FPG A;  4Q5T A;  4QFL A;  5H8H A;  2JJK A;  1AOV A;  5I2N A;  3ZSF A;  1URS A;  1IXG A;  2I48 A;  4ZEB A;  4F1V A;  1NNT A;  4BDL A;  5JTY B;  4YKP A;  4NGU A;  3RT6 B;  2OBG A;  4GVO A;  4F2Q A;  1B3E A;  5CMB A;  1ATG A;  4I3Y A;  2GHB A;  4THI A;  3GBB A;  5LDZ A;  3PPQ A;  1B1H A;  2XXU A;  3I3V A;  3S9E A;  3T9U A;  4N6K A;  1F9B A;  2Q8J A;  2QS3 A;  1Y4C A;  1LAX A;  2RF1 A;  5B70 A;  3BIH A;  3KG2 A;  2VHA A;  4N17 A;  2F3D A;  3WAE A;  3H4Z A;  3O2A A;  4NG7 A;  1KZ8 A;  2UYE A;  1A8F A;  2OJT A;  2XWI A;  3PV0 E;  1SQY A;  2HPG A;  2QVU A;  2ZYK A;  1EYI A;  1H76 A;  4Q8R A;  3N26 A;  3G3I A;  4OVR A;  4LQ5 A;  4WKM A;  4G68 C;  4QHQ A;  4YAH X;  5I7I A;  4F31 B;  1VFE A;  5FTH A;  3CFX A;  1LBB A;  1SYI A;  2VD3 A;  4ZZA A;  4H1X A;  5HM4 B;  4F1Y A;  4PCD A;  1MQJ A;  1YYZ A;  4NWC A;  2Y7W A;  5TPA A;  2VPN A;  4P8B A;  3TZA A;  1LAH E;  2A5T A;  4I8C A;  1N0T A;  5I2K B;  4QBA A;  3C9H A;  4NX1 A;  4NN3 A;  4JVC A;  1ZJL A;  3RGY A;  4PFU A;  5IGA A;  4TQU Q;  1FPB A;  3VXB A;  2MKZ A;  1MXX A;  3SEW A;  4QFO A;  4TOZ A;  4OWD A;  4MFI A;  4R6Y A;  1FPF A;  3RNN A;  2Z8D A;  1O63 A;  5CBS A;  5I5P A;  1Y1Z A;  3BIG A;  4Z0I A;  1BKA A;  4GWS A;  5IAI A;  4GX6 A;  4O3C A;  3IFC A;  4HS7 A;  3LSW A;  4X1D A;  1YAE A;  5BWJ A;  1DOT A;  5H8N A;  3MJN A;  4FEC A;  3O28 A;  3IX1 A;  1FTM A;  4ZE9 A;  3EHU A;  2O51 A;  3FAS A;  1RDZ A;  1XHY A;  3FXR A;  3MPL A;  3HFU A;  4GWX A;  1M5D A;  1FPI A;  2LAO A;  1S50 A;  2G29 A;  1MY1 A;  1A99 A;  2CZL A;  3USD A;  4I62 A;  3C33 A;  4R2F A;  1ANF A;  2P1S A;  3VVF A;  4DXB A;  1FPE A;  3DLN A;  4MX6 A;  1QUJ A;  3PPN A;  5M2V A;  5BUU A;  3GBA A;  4U1O A;  1FBC A;  3TYH A;  5FHN A;  2F34 A;  4JXI A;  4N13 A;  1Y3Q A;  3E79 A;  1US5 A;  3HHF A;  1B2H A;  2F5X A;  3K1M A;  1JP4 A;  1G0H A;  3K6V A;  3JYR A;  1EU8 A;  2DXY A;  3GLB A;  4OAN A;  3D4C A;  3LBS A;  1QVS A;  2ANJ A;  2ESN A;  5AA1 A;  1MY0 A;  4HCY A;  3VLV A;  5I59 B;  3TCF A;  3M3K A;  3OXN A;  1M5F A;  2THI A;  3N6U A;  1FQA A;  1B1X A;  2WBD A;  3H6T A;  4MLQ A;  2OWT A;  3LC8 A;  1CNQ A;  1G0I A;  1A55 A;  3PUX E;  2M8C A;  3R26 A;  1NUW A;  4JSO A;  5F7V A;  3L6G A;  4ISU A;  5K2X A;  4PE3 A;  2QFL A;  4PAI A;  5A5X B;  3OO8 A;  3CFZ A;  1FRP A;  1IXI A;  1MM6 A;  2ZNS A;  1AL3 A;  1SVX B;  5IM2 A;  3ZKL A;  1FBP A;  3G3F A;  2F78 A;  4GD5 A;  3S9L C;  1IUD A;  5KDT B;  2ONK E;  4BDR A;  3THI A;  3RPL B;  2ABH A;  3IJO B;  4NF5 A;  3TAJ A;  1A8E A;  5B7D A;  3TTL A;  2UVG A;  3N5L A;  2F7A A;  2A5S A;  1PB8 A;  2XXT A;  4P56 A;  3C36 A;  3KN8 A;  1QGX A;  1Y1M A;  1USY H;  3T66 A;  2QPQ A;  2DE2 A;  5FHM A;  3E4R A;  5I57 A;  2V4C A;  4OEN A;  2I58 A;  1QUI A;  3IJX B;  3UK4 A;  4OQO A;  1LAG E;  2PVU A;  3BKI B;  2XD2 A;  2ZYN A;  5EYG A;  1FTA A;  3LSL A;  4C1U A;  3EHS A;  2XXK A;  3E3K A;  1MG1 A;  4PTK A;  3FJ7 A;  1LB8 A;  2PT1 A;  5DVF A;  3SEV A;  1JEU A;  1WOD A;  3O29 A;  2P0S A;  2DWH A;  4GL8 A;  3SET A;  4JB7 A;  3QSL A;  1KA0 A;  3U8Q A;  4YU0 A;  1DSN A;  3PMV A;  4C0R A;  3KN7 A;  1FQB A;  4DCX A;  1LBZ A;  4KYD A;  5AA2 D;  1SBP A;  1VE4 A;  2HQ0 A;  4XFE A;  5I2K A;  2Z22 A;  4RK9 A;  3RY3 A;  3NOH A;  4EXK A;  3UP9 A;  3FXB A;  4HW8 A;  4DXC A;  1B46 A;  3P7I A;  2FVZ A;  4POX A;  2VD2 A;  4BDO A;  4EQ7 A;  1USY E;  3FJG A;  3OOA A;  2KLF A;  3K0V A;  3A09 A;  1H44 A;  1MPC A;  2PFZ A;  4KHZ E;  5DVJ A;  1P1O A;  2REG A;  1B0H A;  2CEX A;  4FOR A;  2V3T A;  1DTZ A;  2DVZ A;  1INP A;  1Y3P A;  2ZXT A;  3HST A;  4YB5 A;  1SW2 A;  4O7M A;  1NMU A;  4JSD A;  3B6W A;  3JZJ A;  4OA4 A;  1AMF A;  1XOC A;  4KQP A;  2DE3 A;  1B5H A;  2HXW A;  4LVQ A;  3QUJ A;  3MUQ A;  3AXF A;  3PPP A;  4EDP A;  3S4U A;  1EZO A;  3MW0 A;  1DBZ A;  3KOT A;  4FE8 A;  5CI5 A;  3W15 C;  1SD3 A;  4ZEK A;  1B3G A;  3RT8 A;  2Z8F A;  2I3W A;  2OX3 A;  4DCY A;  5ISU A;  4H8J A;  4R9G A;  5L9M A;  4GXA A;  1NH7 A;  1FTJ A;  2A5T B;  4IO5 A;  1FTO A;  4DI4 B;  4ECF A;  4UAC A;  1B3F A;  1NV4 A;  2FIE A;  2I0B A;  3K1N A;  3V83 A;  5H8F A;  1Y4T A;  3TTN A;  3M8U A;  4MEV A;  3S2V A;  2Z8E A;  1PEB A;  2AL4 A;  3TMG A;  4NE4 A;  1OMP A;  4JBZ A;  1YPN A;  4JVI A;  2I4C A;  3VVD A;  1MY4 A;  4I40 A;  3ILT B;  3MAM A;  4GWY A;  2XX8 A;  4OXV A;  2L5V A;  4FBP A;  4U2R A;  3O66 A;  5H8N B;  5EHS A;  3PD9 A;  5DVI A;  3MVW A;  1R1N A;  3VLU A;  1WDN A;  2XXR A;  4ELR A;  4RA1 A;  4PP0 A;  1FJ6 A;  3Q29 A;  2V3Q A;  4OHN A;  1CE2 A;  4I9D A;  2P2A A;  5KDT A;  3V8X B;  3SER A;  3SZP A;  4AB6 A;  3G3J A;  5LOM A;  1FBE A;  3LSX A;  1GR2 A;  2AL5 A;  4GWU A;  1SYH A;  4RJZ A;  4RPO A;  1PDA A;  3PPR A;  3FV1 A;  4GLI A;  1JET A;  3FAT A;  1N04 A;  4HXV A;  1B3L A;  3Q25 A;  4NMY A;  2XXP A;  4BLA A;  4LON B;  4U22 A;  1IMF A;  4F29 A;  3C4M A;  3G3H A;  2I49 A;  1CB6 A;  4ELP A;  1IXC A;  4MIJ A;  1R6Z A;  1M5E A;  4RXL A;  4PDH A;  5H8Q A;  4E0X A;  2XXV A;  2WBB A;  3PUW E;  3FGS A;  3LR1 A;  3MZB A;  3T9H B;  3M3F A;  2Q74 A;  3K6X A;  1B5J A;  3GXA A; 
#chains in the Genus database with same CATH homology
 1MH3 A;  3OSR A;  1HSE A;  2ZNU A;  4ELO A;  1IIW A;  1ZKB A;  1EH3 A;  4I1D A;  4POW A;  3OEN A;  1SI0 A;  4GL0 A;  4G4P A;  3MQ9 A;  2DXR A;  2Y84 A;  4EF1 A;  4E0W A;  4HCW A;  3DP8 A;  4IY5 A;  2DQV A;  1PBQ A;  1UIV A;  4NF4 A;  4NF5 B;  3S9M C;  4RNS A;  2ZYM A;  4H5F A;  3MWB A;  5DT6 A;  5ELV A;  1Q1K A;  1S9T A;  2OCU A;  4YMB A;  2O1L A;  3EHT A;  2ZNT A;  4OMB A;  5I57 B;  1LB9 A;  3TUS A;  1HSJ A;  1EZ9 A;  3RTW B;  2VP1 A;  3W9W A;  3U72 A;  2UYF A;  4ESX A;  3ILU B;  1B7H A;  4KCD A;  4KCC A;  4YMA A;  5TP9 A;  4PQJ A;  4EQ9 A;  1B3H A;  1ZIU A;  2O69 A;  3L6H A;  4G2Z A;  4R2B A;  1DMB A;  2E1S A;  4FED A;  2I4B A;  2GH9 A;  1URD A;  2GHA A;  1RYX A;  4L17 A;  1ZBM A;  4R6K A;  3TCG A;  4LZ8 A;  5KCJ B;  3OEM A;  1UQW A;  4F1U A;  1PC3 A;  3PMW A;  3K01 A;  1URG A;  4F3S A;  1LFI A;  4F22 A;  2V3U A;  1NNF A;  1B58 A;  4MF3 A;  2O6A A;  4XKN A;  4LZ5 A;  1O7T A;  5DYH A;  3TTR A;  1B6H A;  3QIM A;  1QJM A;  3T96 B;  4RPN A;  4XIG Q;  3BBR A;  3TTM A;  1D4N A;  5CMK A;  4YB6 A;  4F19 A;  4U21 A;  4PFW A;  1JVY A;  2F6P A;  5AA4 A;  5I56 B;  5CRY A;  1B7U A;  3UN6 A;  4H6D A;  4IO4 A;  1UTH A;  1L5T A;  3V5A A;  5JK4 A;  1US4 A;  4NF8 B;  1MXY A;  4U1Z A;  2PYY A;  3SDF A;  3G3K A;  4BDM A;  1FQD A;  3RTF B;  4EUO A;  3HPI A;  5IKB A;  3VVE A;  3B6T A;  1Z7N E;  3OMB A;  3I6V A;  1II5 A;  1MY2 A;  2GFE A;  4JWY A;  5H8F B;  1B5I A;  3FZV A;  2RCB A;  2QS4 A;  5FTI A;  1FCK A;  3O6H A;  3PGF A;  4R72 A;  3SKP A;  2XHD A;  4KYE A;  3DEL B;  1Y9U A;  4NTL A;  5H8S A;  3K6W A;  3G7W A;  1SDX A;  2Q2A A;  2O68 A;  4GF8 A;  3QK6 A;  4DZ1 A;  3B7D A;  3TFL A;  3CSB A;  1OQG A;  1NL5 A;  1MS7 A;  3EQ1 A;  1LST A;  1JQF A;  2D5W A;  1QW0 A;  4GOT A;  3A3C A;  1A40 A;  4F3B A;  3KEI A;  4NF6 A;  4QSC A;  2I6E A;  4YB7 A;  4ZED A;  5HBC A;  4LZ7 A;  4OEU A;  2O84 X;  1P99 A;  2PBW A;  1VSO A;  1FQE A;  2DP8 A;  4ELQ A;  1TWY A;  1Y3N A;  3QXM A;  2QSX A;  3KSJ A;  3Q28 A;  3QAX A;  2F35 A;  3K02 A;  4Z7E A;  1VFD A;  3IO4 A;  1B52 A;  3FD3 A;  1KWH A;  5H8Q B;  4XTC Q;  4QSD A;  3PUV E;  3MP1 A;  2VOZ A;  1IZ1 A;  1IXH A;  1MPB A;  4XKP A;  5DTB A;  4EF2 A;  1UTB B;  2R71 A;  4N07 A;  4H0W A;  2H25 A;  1OVT A;  3O6G A;  2HZL A;  4LA9 A;  1FTL A;  3A3U A;  4X9T A;  5KCJ A;  1P1U A;  3T9V A;  3N94 A;  2OZZ A;  2F8D A;  1MXW A;  2I3V A;  4WXJ A;  5TU0 A;  3CR9 A;  4C1T A;  3T22 A;  2F97 A;  4NF4 B;  1Q35 A;  3MPK A;  3RLF E;  4P0I A;  3CSG A;  4PET A;  2Q2C A;  1N3W A;  3OO6 A;  2DWI A;  4F3P A;  2UVJ A;  3RN8 A;  4GWO A;  3F11 A;  2OWS A;  2QS2 A;  2YPN A;  2R9J A;  4OZ9 A;  4XXU A;  5CMM A;  3OSQ A;  3KBR A;  5I56 A;  1FQF A;  2HAV A;  5DEX B;  1BLF A;  1M5C A;  2H99 A;  2IA4 A;  3U92 A;  5TP9 B;  1NH8 A;  2DSF A;  3IB2 A;  5CBR A;  1MQH A;  3K6U A;  2DWJ A;  2F7B A;  4ZDM A;  4FIM A;  1J1N A;  1XS5 A;  1A54 A;  4NF8 A;  4U4S A;  1NNK A;  3EN3 A;  1OQH A;  4FEB A;  3EF7 A;  4AQ4 A;  2D3I A;  2WKY A;  1I6B A;  3U1O A;  4M4G A;  2VGQ A;  3CI8 A;  2X7P A;  2ZYO A;  2ZMB A;  1D9Y A;  3DP4 A;  2OLB A;  4ZS9 A;  3MVX A;  4F3G A;  3H6V A;  4YKK A;  2D21 A;  1DPE A;  2QMW A;  4R73 A;  4H8I A;  3IOV A;  5ICT A;  1GGG A;  1FW0 A;  1ZU0 A;  2YJP A;  4FAT A;  2F6G A;  3N6T A;  2F36 A;  4MLV A;  3PMX A;  3RQT A;  2NWJ A;  5AA4 B;  2UXA A;  1XVY A;  1MDP 1;  4NWD A;  3RPW A;  1M5B A;  5L9O A;  1JEV A;  1UTH B;  2O1M A;  4ESW A;  3K00 A;  2V93 A;  1TXF A;  4BDN A;  4X48 A;  4DIG A;  3QUF A;  3IOU A;  2GRV A;  1EZP A;  3KGC A;  1B40 A;  1MDQ A;  2B65 A;  1N7W A;  2Y7K A;  3M3L A;  5CC2 A;  1B4H A;  3ECR A;  3LUY A;  3UGW A;  3DP6 A;  3KJT A;  1JW1 A;  3V89 B;  3H03 A;  1LCT A;  1MQI A;  4IO2 A;  1GTK A;  3E13 X;  4YKI A;  2FYI A;  3VFJ A;  3Q27 A;  5JEI A;  1SW5 A;  4JWO A;  1GV8 A;  1LBC A;  2REJ A;  2Q89 A;  2XXQ A;  2PX1 A;  4BDQ A;  3FVG A;  1UTB A;  3CRB A;  1N3X A;  4FJP A;  1D9V A;  3CVG A;  4OFL A;  2DE4 A;  5EHM A;  3C32 A;  1MM7 A;  2QMX A;  2Q9T A;  3PUY E;  2O7U A;  4YKJ A;  4DLD A;  4ND9 A;  2XX9 A;  4G68 B;  4H5G A;  1H45 A;  4NF6 B;  3IB0 A;  4OEV A;  3UA8 A;  2RKM A;  2B3F A;  3FVK A;  2RC9 A;  3T9X B;  4OVJ A;  1BTJ A;  4JDF A;  3C35 A;  2DWA A;  2V25 A;  3IOW A;  4HTG A;  5I84 A;  1VR5 A;  3I5O A;  2G93 A;  3IK6 B;  4H65 A;  1D3K A;  2OK2 A;  3SEY A;  1I69 A;  3ODB A;  1QUK A;  2XXX A;  3FV2 A;  5DEX A;  4IO3 A;  4P0G A;  2UVH A;  1MH4 A;  2QRY A;  4IO7 A;  4R9F A;  1JW4 A;  4M1V A;  1I6A A;  2Q88 A;  5ITO A;  1P1N A;  3S9N C;  3IL1 B;  3W9V A;  4AB5 A;  1NKX A;  3OEL A;  2NXO A;  1HSL A;  4P11 A;  1O64 A;  3H7M A;  4JWX A;  4MH5 A;  3GZG A;  3WAF A;  3PPO A;  4ZEI A;  3VDF A;  2RIN A;  1RYO A;  3IB1 A;  5AA2 A;  3HCQ A;  2HAU A;  5AE4 A;  4EQB A;  3EPE A;  3KSX A;  2FNC A;  5I58 A;  1XT8 A;  4NED A;  3KZG A;  4PE5 B;  5KZT A;  3IO6 A;  4LAT A;  5CMC A;  3OD7 A;  4ONY A;  4EXL A;  1Z7M E;  4OER A;  1H43 A;  3H3G A;  3D4G A;  3R6U A;  1IQ7 A;  4QFP A;  3MVZ A;  4IGR A;  3TQL A;  4O3B A;  3LSF B;  4RK2 A;  3G3G A;  2DOJ A;  3MZ9 A;  1QUL A;  4DXU A;  3VE1 B;  1LAF E;  2HFB A;  3Q26 A;  1A7L A;  2XD3 A;  2R6G E;  4OES A;  2W7Y A;  1DTG A;  1OLC A;  1PB7 A;  1TFA A;  4IY6 A;  3OEK A;  5CM6 A;  1FQC A;  3CG1 A;  2AIX A;  4F2O A;  4TLM B;  4ZZE A;  1NNP A;  1I6Q A;  4GQO A;  1DPP A;  5EYF A;  4KI0 E;  4KR5 A;  4IB2 A;  1UIU A;  3IOT A;  3DM0 A;  3C31 A;  3OO7 A;  2YLN A;  1B51 A;  2B3B A;  1MQD A;  1B7Z A;  4PFY A;  1JNF A;  1MXZ A;  3MVY A;  3IOR A;  4XKQ A;  2NVU B;  4QRZ A;  1FTK A;  1NFT A;  3VV5 A;  1POT A;  2X7Q A;  5L8D A;  2ONS A;  4GRK A;  3VLW A;  1QKB A;  3K2D A;  2DYX A;  4F39 A;  3HN0 A;  4WED A;  4UA8 A;  2V84 A;  2Y7I A;  3OO9 A;  1ZTY A;  2QL3 A;  4G68 A;  3VXC A;  5JTY A;  2HZK A;  1P1Q A;  3TTK A;  3FVO A;  2X26 A;  1SW4 A;  1MXU A;  1QKA A;  2CMO A;  4G8N A;  2HCA A;  5K2Y A;  3KOS A;  4OYV A;  2XXI A;  1LFH A;  3O97 A;  4KD5 A;  3U93 A;  1B05 A;  4FAJ A;  2PMS A;  4K3F A;  4ZEC A;  4YIC A;  3PD8 A;  4OTE A;  2DS9 A;  4R6H A;  1WVJ A;  3TCH A;  1B4Z A;  2XXY A;  3TOD A;  4GXS B;  2QS1 A;  4OFJ A;  3CG3 A;  1R9L A;  2H4I A;  4LUB A;  1LFG A;  2NOO A;  2H5Y A;  1IIT A;  2Z23 A;  1BIY A;  5ICQ A;  3CFL A;  2O7I A;  5H8H B;  5I2N B;  3KJ7 A;  1PB9 A;  5ITP A;  1IEJ A;  3HV1 A;  3JV9 A;  2XXW A;  1B0L A;  2PT2 A;  1AIV A;  2HEU A;  3TDJ A;  1MRP A;  1YCJ A;  1XVX A;  1SI1 A;  2XX7 A;  2FA7 A;  4QFN A;  2RC7 A;  2E0S A;  4OFO A;  1TFD A;  4F18 A;  1AH5 A;  5AA3 A;  1BP5 A;  1H3D A;  4DE8 A;  1N84 A;  3B6Q A;  4Q30 B;  5HPQ A;  1YTV A;  3E9X A;  3H06 B;  3ZKK A;  2RCA A;  4WEP A;  1OVB A;  3T93 B;  4QF9 A;  2DVC A;  1OIB A;  3H6W A;  4G8M A;  3C34 A;  3FVN A;  4MBP A;  4XKR A;  1N7X A;  1LLS A;  1JVX A;  3RUM A;  3KN3 A;  4O3A A;  2QJE A;  4GFR A;  4LQ2 A;  2NUV A;  3HO7 A;  1RKM A;  3UIF A;  2ONR A;  3K1P A;  3FXQ A;  1B32 A;  2UVI A;  1ZMG A;  1ZLQ A;  5TPA B;  5AA2 B;  3TKD A;  5L9S A;  3O9P A;  2Y7R A;  1LGB C;  4G8H A;  1S7Y A;  1SW1 A;  5I58 B;  3PUZ E;  5FHO A;  3TQW A;  1OLA A;  1P1W A;  4IO6 A;  4U4X A;  4ZEF A;  4IGT A;  3TEP A;  3SEX A;  5I59 A;  2BJJ X;  2ALU A;  3KFM A;  1LCF A;  3FXU A;  4DDD A;  4KYS A;  1MQG A;  1Y20 A;  3TEL A;  2RC8 A;  3IR1 A;  3PU5 A;  3SEU A;  2XXH A;  1MY3 A;  4PFT A;  2F7C A;  3TPA A;  3IAZ A;  3MZ1 A;  5A5X A;  1POY 1;  3SES A;  1PBP A;  3MBP A;  4X1B A;  1ELJ A;  2IEE A;  3FIR A;  3U94 A;  4R74 A;  1XC1 A;  2I0C A;  5J1D A;  4TLL B;  3CIJ A;  1TT1 A;  4RYA A;  1MPD A;  4YZZ A;  3QYT A;  1R9Q A;  4QSE A;  4KPT A;  3FUZ A;  2H98 A;  3O6I A;  3ONM A;  4H67 A;  3UOR A;  4N6P A;  4OET A;  4GIZ A;  4KFQ A;  2Y7P A;  4U23 A;  4QFK A;  3K4U A;  3FJM A;  2AYS A;  2H9B A;  5F1Q A;  4R75 A;  3R7X A;  1B9J A;  4RY1 A;  4LP2 B;  1JW5 A;  3HHG A;  3MP6 A;  4ZE8 A;  1T0K A;  3MP8 A;  3BFU A;  1GVC A;  3H6U A;  3MC2 A;  1N76 A;  1MXV A;  4G77 A;  3ZS6 A;  4Q0C A;  3BFT A;  4Q5T A;  4QFL A;  5H8H A;  1AOV A;  5I2N A;  3ZSF A;  1URS A;  1IXG A;  2I48 A;  4ZEB A;  4F1V A;  1NNT A;  4BDL A;  5JTY B;  4YKP A;  3RT6 B;  2OBG A;  4GVO A;  4F2Q A;  1B3E A;  5CMB A;  1ATG A;  2GHB A;  4THI A;  3GBB A;  3PPQ A;  1B1H A;  2XXU A;  3I3V A;  3S9E A;  3T9U A;  1F9B A;  2Q8J A;  2QS3 A;  1Y4C A;  1LAX A;  2RF1 A;  5B70 A;  3KG2 A;  2VHA A;  3WAE A;  3H4Z A;  3O2A A;  2UYE A;  1A8F A;  2OJT A;  3PV0 E;  1SQY A;  2ZYK A;  1H76 A;  4Q8R A;  3N26 A;  3G3I A;  4LQ5 A;  4WKM A;  4G68 C;  4QHQ A;  4YAH X;  4F31 B;  1VFE A;  5FTH A;  3CFX A;  1LBB A;  1SYI A;  2VD3 A;  4ZZA A;  4H1X A;  5HM4 B;  4F1Y A;  1MQJ A;  4NWC A;  2Y7W A;  5TPA A;  3TZA A;  1LAH E;  2A5T A;  4I8C A;  1N0T A;  5I2K B;  3C9H A;  3RGY A;  1ZJL A;  4PFU A;  4TQU Q;  3VXB A;  1MXX A;  3SEW A;  4QFO A;  4TOZ A;  4OWD A;  4MFI A;  4R6Y A;  3RNN A;  2Z8D A;  1O63 A;  5CBS A;  1Y1Z A;  4Z0I A;  1BKA A;  5IAI A;  4O3C A;  4HS7 A;  3LSW A;  4X1D A;  1YAE A;  5BWJ A;  1DOT A;  5H8N A;  3MJN A;  4FEC A;  3O28 A;  3IX1 A;  1FTM A;  4ZE9 A;  3EHU A;  2O51 A;  3FAS A;  1XHY A;  3FXR A;  3MPL A;  1M5D A;  2LAO A;  1S50 A;  2G29 A;  1MY1 A;  1A99 A;  2CZL A;  3USD A;  4I62 A;  3C33 A;  4R2F A;  1ANF A;  2P1S A;  3VVF A;  4DXB A;  3DLN A;  1QUJ A;  3PPN A;  5M2V A;  5BUU A;  3GBA A;  4U1O A;  3TYH A;  5FHN A;  2F34 A;  4JXI A;  4N13 A;  1Y3Q A;  1US5 A;  3HHF A;  1B2H A;  2F5X A;  3K1M A;  3K6V A;  3JYR A;  1EU8 A;  2DXY A;  3GLB A;  3D4C A;  3LBS A;  1QVS A;  2ANJ A;  2ESN A;  5AA1 A;  1MY0 A;  4HCY A;  3VLV A;  5I59 B;  3TCF A;  3M3K A;  3OXN A;  1M5F A;  2THI A;  3N6U A;  1FQA A;  1B1X A;  3H6T A;  4MLQ A;  2OWT A;  3LC8 A;  1A55 A;  3PUX E;  2M8C A;  3R26 A;  4JSO A;  5F7V A;  3L6G A;  4ISU A;  5K2X A;  5A5X B;  3OO8 A;  3CFZ A;  1IXI A;  1MM6 A;  2ZNS A;  1AL3 A;  1SVX B;  3ZKL A;  3G3F A;  2F78 A;  4GD5 A;  3S9L C;  1IUD A;  5KDT B;  2ONK E;  4BDR A;  3THI A;  2ABH A;  3IJO B;  4NF5 A;  3TAJ A;  1A8E A;  5B7D A;  3TTL A;  2UVG A;  3N5L A;  2F7A A;  2A5S A;  1PB8 A;  2XXT A;  3C36 A;  3KN8 A;  1Y1M A;  1USY H;  3T66 A;  2QPQ A;  2DE2 A;  5FHM A;  3E4R A;  5I57 A;  4OEN A;  2I58 A;  1QUI A;  3IJX B;  3UK4 A;  4OQO A;  1LAG E;  2PVU A;  3BKI B;  2XD2 A;  2ZYN A;  3LSL A;  4C1U A;  3EHS A;  3E3K A;  1MG1 A;  3FJ7 A;  1LB8 A;  2PT1 A;  5DVF A;  3SEV A;  1JEU A;  1WOD A;  3O29 A;  2P0S A;  2DWH A;  4GL8 A;  3SET A;  4JB7 A;  3QSL A;  3U8Q A;  4YU0 A;  1DSN A;  3PMV A;  4C0R A;  3KN7 A;  1FQB A;  4DCX A;  4KYD A;  5AA2 D;  1SBP A;  1VE4 A;  2HQ0 A;  5I2K A;  2Z22 A;  4RK9 A;  3RY3 A;  4EXK A;  3UP9 A;  4HW8 A;  4DXC A;  1B46 A;  3P7I A;  4POX A;  2VD2 A;  4BDO A;  4EQ7 A;  1USY E;  3FJG A;  3OOA A;  2KLF A;  3K0V A;  3A09 A;  1H44 A;  1MPC A;  4KHZ E;  5DVJ A;  1P1O A;  2REG A;  1B0H A;  4FOR A;  2V3T A;  1DTZ A;  2DVZ A;  1Y3P A;  2ZXT A;  3HST A;  4YB5 A;  1SW2 A;  1NMU A;  4JSD A;  3B6W A;  3JZJ A;  1AMF A;  1XOC A;  4KQP A;  2DE3 A;  1B5H A;  2HXW A;  4LVQ A;  3QUJ A;  3MUQ A;  3AXF A;  3PPP A;  4EDP A;  3S4U A;  1EZO A;  3MW0 A;  3KOT A;  4FE8 A;  5CI5 A;  3W15 C;  1SD3 A;  4ZEK A;  1B3G A;  3RT8 A;  2Z8F A;  2I3W A;  4DCY A;  5ISU A;  4H8J A;  4R9G A;  5L9M A;  4GXA A;  1NH7 A;  1FTJ A;  2A5T B;  4IO5 A;  1FTO A;  4ECF A;  4UAC A;  1B3F A;  2I0B A;  3K1N A;  3V83 A;  5H8F A;  1Y4T A;  3TTN A;  3M8U A;  3S2V A;  2Z8E A;  1PEB A;  2AL4 A;  3TMG A;  4NE4 A;  1OMP A;  4JBZ A;  1YPN A;  3VVD A;  2I4C A;  1MY4 A;  3ILT B;  3MAM A;  2XX8 A;  4OXV A;  4U2R A;  3O66 A;  5H8N B;  5EHS A;  3PD9 A;  5DVI A;  3MVW A;  1R1N A;  3VLU A;  1WDN A;  2XXR A;  4ELR A;  4RA1 A;  4PP0 A;  3Q29 A;  2V3Q A;  4OHN A;  1CE2 A;  4I9D A;  2P2A A;  5KDT A;  3V8X B;  3SER A;  4AB6 A;  3G3J A;  5LOM A;  3LSX A;  1GR2 A;  2AL5 A;  1SYH A;  4RJZ A;  4RPO A;  1PDA A;  3PPR A;  3FV1 A;  4GLI A;  1JET A;  3FAT A;  1N04 A;  1B3L A;  3Q25 A;  4NMY A;  2XXP A;  4BLA A;  4LON B;  4U22 A;  4F29 A;  3C4M A;  3G3H A;  2I49 A;  1CB6 A;  4ELP A;  1IXC A;  1R6Z A;  1M5E A;  4RXL A;  5H8Q A;  4E0X A;  2XXV A;  3PUW E;  3FGS A;  3LR1 A;  3MZB A;  3T9H B;  3M3F A;  3K6X A;  1B5J A;  3GXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...