2VPNA

High-resolution structure of the periplasmic ectoine-binding protein from teaabc trap-transporter of halomonas elongata
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
310
structure length
306
Chain Sequence
DNWRYAHEEYEGDVQDVFAQAFKGYVEDNSDHTVQVYRFGELDIMEQTQNGILQFVNQSPGFTGSLIPSAQIFFIPYLMPTDMDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVTADEPITSPEDFDNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQENPIFWIESGGLYEVSPNLTFTSHGWFTTAMMANQDFYEGLSEEDQQLVQDAADAAYDHTIEHIKGLSEESLEKIKAASDEVTVTRLNDEQIQAFKERAPQVEEKFIEMTGEQGQELLDQFKADLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.55 A Structure of the Ectoine Binding Protein Teaa of the Osmoregulated Trap-Transporter Teaabc from Halomonas Elongata.
pubmed doi rcsb
source organism Halomonas elongata
molecule tags Transport
molecule keywords PERIPLASMIC SUBSTRATE BINDING PROTEIN
total genus 115
structure length 306
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2vpnA00
5IZZA 4NG7A 2HPGA 2ZZXA 4PFIA 5CM6A 2XXKA 4NGUA 4MMPA 4OVPA 2VPNA 4N91A 4DI4B 4P3LA 4N17A 3U65A 5LTCA 2PFYA 4OA4A 2PFZA 4N8YA 4N6DA 4MHFA 2HZLA 4O94A 4PDDA 4PGPA 4OVRA 2HZKA 3B50A 4NN3A 2XWVA 4MIJA 4OANA 4P47A 2WX9A 4YICA 4PF8A 4N8GA 4UABA 4X04A 4PFBA 4P1EA 5IM2A 4P56A 4MNCA 4O7MA 4PFRA 4MNPA 4LN5A 4P9KA 4PBQA 4N15A 2XWKA 2ZZVA 4OVSA 2WYPA 4PBHA 4PAFA 4OVQA 4P8BA 4O8MA 4MX6A 4N4UA 2XWIA 4PC9A 4PGNA 4OVTA 2CEXA 2WYKA 4X8RA 4N6KA 4NAPA 2V4CA 4YZZA 5I7IA 2XA5A 4XFEA 4MEVA 4NHBA 4PE3A 4MNIA 4NQ8A 4P1LA 2CEYA 5I5PA 4DI3D 4PDHA 2VPOA 4NF0A 4PF6A 4MAGA 4XF5A 4NX1A 4PCDA 5IGAA 3GYYA 2ZZWA 4MCOA 4PETA 4PAIA 4PAKA 3FXBA 2XWOA 4XEQA
chains in the Genus database with same CATH superfamily
2F7AA 1B3HA 3K00A 2DWJA 4BDNA 5K2XA 5H8HA 1B7UA 1SD3A 3U93A 3SKPA 3U1OA 5H8NB 1FQFA 3T0JA 2XD3A 1SI0A 3TQWA 1S9TA 4ZEKA 4G8NA 3VLVA 5AA1A 1ZIUA 4IY6A 1KA1A 3A09A 1N04A 5IZ1A 3N6TA 2Y7IA 2QMXA 5EQAA 4LONB 3N5LA 4PP0A 1MXXA 2DP8A 1G0HA 3PD9A 3VFJA 5CMBA 3H3GA 3PU5A 1II5A 1B3EA 4U2RA 1LCFA 2QS1A 4Q0CA 3O97A 5L9SA 2I49A 5ISUA 2ABHA 3T22A 2E1SA 4U4XA 1N3XA 3B6WA 2UVJA 4ELPA 2ZYNA 4FAJA 3RPWA 3LSWA 4YB7A 3KN7A 4X8RA 5K2YA 4NHBA 2VGQA 2XXVA 2PVUA 2ALUA 3KBZA 2B3FA 4F3BA 4JB7A 1VDWA 1WVJA 4AS4A 1B2HA 4HXVA 1QULA 3W15C 3K2DA 4FIMA 2UXAA 2RF1A 1B0HA 3PUYE 1UTBB 1L5TA 3FJMA 1DCUA 4ZE9A 4NEDA 1LBZA 4MMPA 1MQHA 3GLBA 3C9HA 4GWOA 2P1SA 4GWWA 3B6QA 5KDTA 4IO3A 1INPA 1EZ9A 4NE4A 3K6VA 1B46A 3IAZA 4X9TA 1NNTA 1MY3A 4YU0A 5H8QB 3VLUA 4BDMA 3GBAA 4QHQA 4JSDA 1PB9A 3USDA 4NF5A 2A5SA 1M5CA 2HZKA 3KSXA 4EXLA 1XVYA 1Z7ME 5DVFA 4UABA 1FTOA 3I5OA 2XX7A 1SPIA 2BJJX 2F6GA 2AYSA 2XXUA 3OMBA 2F6PA 4XXUA 4DCYA 2OWSA 1BP5A 2GQ1A 1EYIA 3C4MA 5AE4A 4P9KA 1ZBMA 2WYPA 3B8BA 5EYGA 1P1WA 3VXCA 4FORA 3FXUA 1SDXA 1JNFA 2PT2A 3CFLA 3M3KA 3IX1A 2XXWA 4ESWA 3DP8A 4FEBA 4ZS9A 4JBZA 1MDP1 2PYYA 4F31B 1UIVA 1LSTA 5BUUA 1B1XA 1MRPA 1UTHA 3KOTA 4IO2A 4BDRA 3I3VA 4LUBA 2A5TA 4KCCA 3FXBA 1B51A 3H6UA 4F3PA 1FW0A 2QFLA 1PBPA 3KEIA 1MM6A 4EDPA 4NF6B 4R6YA 3O6HA 3VV5A 3T93B 4EXKA 3EHUA 5L9OA 1IMBA 4F3GA 2RINA 4QSDA 3K6UA 4DI4B 5H8FA 5B70A 4MLQA 2IEEA 2Q2CA 5EYHA 3PPQA 1B6HA 2HZLA 1IMFA 1NFTA 4LATA 4F3SA 2Q74A 3PTYA 5CMCA 5CI5A 1VSOA 2OWTA 5J16A 3KG2A 1MQJA 4GD5A 3KSJA 3A3UA 4P56A 3HO7A 2KQZA 2ZNUA 3KC0A 5KCJB 4O7MA 3E9XA 2HQ0A 4M4GA 3TDJA 2B3BA 2VD2A 3PMXA 4MBPA 1ZLQA 4KI0E 3ZKLA 2HEUA 4OVQA 4Z0IA 1YZ0A 2D3IA 1MH4A 3ZS6A 1EZOA 4OFLA 4MX6A 4PC9A 3S9MC 3HHFA 1P1NA 1B5HA 4ZEBA 4MNIA 5FHOA 4JWXA 4PFYA 3PPRA 4P1LA 4NF5B 4PDHA 4NX1A 2IA4A 2HCAA 3G3FA 3MZ1A 2V84A 4RXLA 4RYAA 4LQ2A 3RYDA 4EF2A 4PAKA 1FBGA 4JDFA 3OD7A 4PFTA 3E79A 4TLLB 5CC2A 2MKZA 3QK6A 3W9WA 4DXBA 5I3SA 3MVXA 3B7DA 3PUXE 4DDDA 2F7BA 3U65A 4O3CA 2YPNA 3MP8A 3RT8A 4AS5A 1G0IA 3QXMA 3RLFE 4GWYA 5ET7A 4FEDA 3JV9A 1Q1KA 3WAFA 3IORA 4ESXA 4MIJA 5J1DA 4HS7A 1A40A 1FPBA 3KBRA 5DT6A 3RN8A 2ESNA 1FPKA 3IO4A 2F97A 5IKBA 4GL8A 4G61A 5DYHA 3C33A 4GWUA 5I58A 4R72A 4UA8A 3LV0A 3TUSA 4AB6A 1N84A 3P7IA 1I6AA 1IEJA 2PCRA 2FBPA 4PBQA 4KPTA 3G3KA 2ZZVA 2QVUA 1MXVA 1YPNA 4KYDA 3IOVA 5A5LA 2RCAA 3R6UA 3THIA 4GL0A 1FPJA 5ELVA 3TKDA 3EKIA 1QUKA 2E0SA 4N6KA 1HSLA 3IJXB 1SI1A 4PE3A 3TTMA 3TZAA 1FPLA 4GWXA 5I57B 4G4PA 2VHAA 3TAJA 3FVGA 5HPQA 2GH9A 2H99A 2OBGA 1CE2A 4EQ9A 1Y20A 3O29A 4GLIA 4IY5A 5H8HB 4KYSA 2NUVA 3E13X 3BIHA 3FUZA 2ZZXA 4XIGQ 3DM0A 2H9BA 3K1MA 4NGUA 3MVYA 4H5GA 2Z8FA 5I59A 2FVZA 2XXYA 1QJMA 2Y7RA 4OA4A 3MQ9A 4PQJA 2H98A 2O7UA 4YKKA 4NWDA 3BIGA 3O2AA 1B32A 5I57A 2Z22A 5TP9B 3MP1A 4F39A 1OQGA 1USYH 1JETA 2O1LA 1NV5A 2XXIA 1OVBA 1CNQA 4P1EA 4F2QA 2CZIA 1BKAA 3KC1A 3KFMA 3PUVE 1LBYA 1LB8A 3RY3A 2RCBA 3QMFA 1DK4A 3A29A 3TTLA 1OMPA 2Y84A 3RQTA 3C31A 2DQVA 3RT6B 3S4UA 4ELQA 4ELRA 1F9BA 2XX9A 4N4UA 5DEXB 3NOHA 2FHYA 1Y4TA 1TWYA 1Y3NA 2D21A 4KR5A 3SEXA 3RPLB 5I58B 2HAUA 2CMOA 4KCDA 4ND9A 1B0LA 2R9JA 4ISUA 3C32A 4PCDA 4RK9A 2XXXA 1Y3PA 2Z23A 5EHMA 4GF8A 1WDNA 4NF8A 1N7XA 4THIA 2UYFA 4R2BA 4XEQA 5ITPA 4OFOA 3Q28A 3VDFA 1K9ZA 2CZHA 1B7HA 1ZJLA 4H65A 4YKIA 5IZ3A 3ECRA 3FVNA 3CFZA 3H6WA 3R26A 4OEVA 1R6ZA 1B4HA 3CG3A 3IK6B 4OWDA 4JVCA 5ITOA 3ODBA 4PDDA 3VVFA 3FVOA 1Y3QA 2AL4A 2XXHA 1Y1ZA 2QRYA 4RPOA 1ZU0A 2I4BA 2I0CA 2OCUA 3BFUA 4POWA 4LZ5A 5IM2A 4BDOA 1FTKA 2P3NA 3RGYA 1WODA 4GWSA 2XD2A 1OVTA 1O63A 1IMAA 4PFRA 1FTMA 3IO6A 5IZ3B 3V89B 4MNPA 3RTWB 3G7WA 1PB7A 4LN5A 1R9LA 5EQ7A 2REGA 3CRBA 2FNCA 4Q5TA 1LBWA 1N76A 5AA4A 4PFUA 3Q27A 4YKPA 2ZNSA 3FZVA 4PE5B 5I2KA 4ELOA 3MZ9A 2WBBA 1Q9DA 2P2AA 1ANFA 2QSXA 2QS3A 1QUIA 3CSGA 2CEXA 1NV1A 3Q25A 4XKPA 3SERA 4DE8A 1NNPA 3SZPA 2PT1A 5I5PA 4GOTA 3VE1B 1URSA 1K9YA 1IXHA 3W9VA 3PPNA 3JYRA 2ZYKA 4H1XA 1FJ9A 2O69A 1NI9A 3H6TA 2I0BA 3G3IA 5CM6A 3L6GA 4ZE8A 2Q89A 1UQWA 2DWIA 2DVZA 1SQYA 5DW8A 3MVWA 4P3LA 2QL3A 1D3KA 1M5BA 4C1UA 3OXNA 3CFXA 3UP9A 4N8YA 4N6DA 4MHFA 4JSOA 2XXPA 4NF6A 1YXIA 1P1UA 1LCTA 1XC1A 1VR5A 4Q8RA 3PUZE 2GFEA 4X04A 4RPNA 5FBPA 4QFNA 5JK4A 4ZEFA 4MNCA 3MYUA 1MQGA 2RKMA 1DMBA 2VOZA 2F34A 1A55A 1D9QA 2V3QA 4GX6A 1IQ7A 3IB2A 4OVSA 3LSLA 1A99A 3MP6A 2LAOA 3OO7A 1B3LA 1VE4A 3HSTA 1MS7A 3FATA 4HE1A 5I7IA 2Q8JA 2Q88A 2F3DA 1NV7A 3MWBA 3S9LC 2HXWA 3G3GA 4FATA 4JXIA 5EYFA 4F1VA 3LC8A 3EN3A 4G8HA 4N6PA 3RPLA 2THIA 3H7MA 4H8IA 3H6VA 3O66A 4KXPA 2UVIA 2V93A 1OIBA 1LAXA 2HAVA 2FA7A 1KA0A 4GX3A 4R2FA 2VPNA 2O84X 5F24A 2P3VA 4YKJA 2F3BA 1S7YA 2DS9A 4ZZEA 2ZYMA 5I84A 1POTA 1JQFA 1UIUA 5AA2D 4HE0A 4U4SA 3WAEA 3T1BA 3CVGA 1GVCA 3LUYA 2OZZA 3B6TA 3HV1A 3IOWA 1J1NA 2I3VA 4X1BA 3AXFA 1DBZA 3MBPA 1JP4A 4H8JA 2HXRA 1IMDA 4G8MA 2Z8DA 1IIWA 1B7ZA 4F18A 5DEXA 2Y7KA 4JWOA 3E78A 5AA4B 4F19A 1I6QA 4F22A 4P8BA 5H8SA 4QF9A 1N3WA 1MG1A 4RK2A 3FBPA 4OVTA 1JVXA 3MUQA 4FBPA 3KJ7A 3VVEA 3S2VA 3OSQA 3TCGA 4MEVA 5KZTA 1FBFA 2KLFA 3M8UA 1SBPA 1FPIA 3MC2A 1PC3A 3DLNA 3QAXA 2UVGA 3GYYA 4I1DA 2GRVA 1IMCA 1FRPA 4OESA 3OELA 2G93A 3IR1A 4R74A 2NWJA 1IITA 1MXYA 3PGFA 1MY0A 2ONSA 1LAHE 1XVXA 3K0VA 4X48A 4QFLA 4PFIA 1XI6A 4H45A 3O9PA 3MSTA 4OMBA 4POXA 3KJTA 4RNSA 5L8DA 3S9EA 4Q30B 5ET6A 2HFBA 2Z8EA 4IO7A 5CMMA 1SYIA 3FJ7A 3G3JA 4IO4A 1SW5A 1US4A 2I48A 1Y9UA 3OO6A 1NV3A 2L5VA 3B50A 1MDQA 2XWVA 3H03A 4GX4A 2F78A 1URDA 4O7IA 4N8GA 1H45A 3C35A 4IGTA 4PFBA 3GBBA 1Q35A 1B52A 1B5IA 5IAIA 3MW0A 4LP2B 2DE4A 5I2NA 1NUYA 2NXOA 3QYTA 1URGA 2OX3A 3MJNA 4GRKA 4C1TA 1D4NA 1IUDA 3LR1A 3CI8A 4WEDA 3TTRA 3CSBA 1LFIA 1YAEA 3EQ1A 4PGNA 2O1MA 2Y5KA 3T66A 3BBRA 1B1HA 4H46A 4LQ5A 2HHMA 4DXCA 1XS5A 3KZGA 4OZ9A 1I69A 2JJKA 4XKNA 3E4RA 3OEKA 5TP9A 1OLCA 2DE2A 1ELJA 3U94A 2RC7A 4EF1A 4XKQA 1O64A 3G3HA 4BDLA 4QSEA 1NKXA 5I2KB 1DTZA 3O6GA 5ET8A 4N91A 4TLMB 1DPPA 4IO5A 1H43A 1HSJA 2XXRA 1YCJA 2QVRA 2Q8MA 2I58A 2PFYA 4LA9A 1DTGA 1RYXA 3GZGA 1GTKA 5ESYA 2ZXTA 4FECA 3FIRA 4OVRA 4XTCQ 1JW5A 2B4MA 1B40A 1B9JA 4YICA 1A8EA 1N0TA 3U8QA 1B5JA 2X26A 3DELB 3N26A 5T3JA 2ANJA 3T9XB 3EHSA 3CG1A 5H8QA 3SEYA 1RKMA 3PPPA 3S9NC 1M5EA 2DOJA 3TMGA 1NV2A 3T9UA 5KDTB 1XT8A 1FBHA 4PAFA 2B65A 3ZKKA 1FBCA 3UORA 1S50A 2KR0A 4P11A 2R71A 3CHGA 1MXZA 1B4ZA 2V4CA 2NOOA 3V83A 3JZJA 5AA2B 3TPAA 1JW4A 1RDZA 4XF5A 1SYHA 1JEUA 1FQAA 3QUJA 3BKIB 2M8CA 1RDYA 1VFEA 1N7WA 4OERA 3A3CA 3MAMA 3FGSA 2H25A 4KHZE 2XXKA 3N6UA 5A5XA 1AOVA 4NWCA 3V5AA 1IXIA 4Z7EA 3ILTB 5ET5A 4I3YA 1BLFA 4ZECA 2DE3A 1JEVA 2F36A 3RTFB 3RUMA 1FJ6A 4YMBA 4NN3A 1AWBA 1LBXA 2PBWA 1XOCA 4U23A 3CR9A 2Y5LA 5I56B 2CZLA 4I3EA 5H8NA 1FBPA 4YB5A 2G29A 1KWHA 4N81A 1VFDA 4GIZA 4EQ7A 1MPCA 5L9MA 4BLAA 4G68C 1NNKA 3KN8A 1NH7A 2PMSA 2CZKA 4ONYA 1TXFA 2XWKA 1SW4A 3K02A 4EQBA 2FIXA 2ONKE 4LVQA 1SVXB 3T9HB 3HN0A 5F7VA 3K4UA 1H76A 2DWAA 1MXUA 4G68B 4K3FA 1NH8A 3D4GA 4R6KA 4GXAA 2WBDA 1JW1A 3K6XA 3QSLA 3F11A 3VLWA 1ATGA 4NAPA 4MH5A 1MM7A 1P1QA 4LZ8A 2B4LA 3T96B 2Q2AA 4ZEIA 5JTYB 2VPOA 4PFWA 1H44A 1LGBC 1EH3A 4N07A 3TFLA 3OO9A 5BWJA 3FVKA 5FTIA 3QIMA 1P1OA 2DWHA 3M3LA 3R7XA 4BDQA 1AMFA 3C36A 1EZPA 2HPGA 3ZSFA 4AB5A 3TELA 4HCYA 4NF8B 3MVZA 5LOMA 3IB1A 1IXGA 3VVDA 1SW1A 1MH3A 2D5WA 3EHTA 1FTJA 2YLNA 2F35A 1A54A 2PFZA 1DPEA 3UA8A 5DVIA 3TTNA 5CBSA 3OOAA 5FTHA 4HE2A 4OQOA 3HFUA 3D4CA 1NUWA 2O7IA 1B3FA 3LSXA 1IMEA 4GVOA 1MQDA 1KZ8A 2I6EA 1OLAA 3K6WA 1LBVA 4YAHX 2YJPA 2FYIA 3N94A 4KQPA 3ROJA 4N15A 4IB2A 1UTBA 4WKMA 4G2ZA 1RYOA 2O51A 3MPKA 2OK2A 5HM4B 1FBEA 4H67A 2I4CA 2ONRA 3PUWE 2H5YA 4G77A 3DP6A 2Y7WA 4WEPA 3HCQA 3I6VA 3LSFB 4NQ8A 3SDFA 4PF6A 2Q9TA 4MAGA 2O6AA 1HSEA 1IZ1A 4H6DA 4QFKA 5DVJA 2ZZWA 3GXAA 1B05A 1FSAA 3U92A 3BFTA 1DSNA 4DCXA 4NF4A 2DYXA 1LEVA 1Y4CA 4H0WA 4MF3A 4O3AA 1NMUA 1M5FA 1NUZA 2DVCA 3LUZA 5LTCA 4KD5A 1XHYA 1FBDA 4NTLA 2A5TB 1MPDA 1NV4A 1T0KA 3SEVA 4M1VA 4RJZA 2XXTA 3O6IA 3UIFA 4OFJA 3Q26A 5FHNA 5JEIA 4MFIA 3PMWA 1D9VA 3K1NA 4F1UA 1GV8A 4UACA 3FD3A 4RY1A 2V25A 5CRYA 1A8FA 1YYZA 2F8DA 2FIEA 2DXYA 2REJA 4I62A 3H4ZA 4PBHA 1ZKBA 3V8XB 1CB6A 1FQBA 4I40A 1QW0A 4TQUQ 3K1PA 2QS2A 4OENA 3O28A 4MLVA 2UVHA 5M2VA 2WYKA 5CMKA 4AQ4A 5HBCA 2X7QA 2V3UA 4U1OA 3EPEA 1NNFA 1LB9A 3VXBA 1EYJA 1FTLA 3FXQA 1D9YA 4DXUA 4PETA 1US5A 2R6GE 3OO8A 4NG7A 4H5FA 1FPFA 1O7TA 1MXWA 2ZNTA 5TPAB 1ZMGA 1SW2A 2XXQA 4I8CA 4E0XA 3K01A 3PV0E 1OQHA 4N17A 5ICQA 1NV0A 5KCJA 3E3KA 1PDAA 1POY1 2QPQA 3H06B 5AA3A 3FXRA 2RC9A 5EHSA 3SEWA 4U21A 4QXDA 4R75A 4GQOA 2QVVA 3TODA 3SESA 4ZEDA 4P47A 4U1ZA 1QKBA 4PF8A 3FV1A 2GHBA 3HHGA 2DXRA 2OWZA 1TFDA 1QKAA 1ZTYA 4OTEA 2AIXA 1NUXA 3Q29A 4XKRA 4FJPA 1EYKA 3TCHA 4OVJA 4WXJA 1Z7NE 3D1RA 1LLSA 2XWIA 4R9GA 5FHMA 2PX1A 1P99A 4XFEA 1LBCA 1NV6A 2AL5A 3EF7A 1FQEA 5F1QA 1EU8A 4OYVA 1MY4A 1BK4A 3IL1B 1FQCA 3FASA 4I9DA 4U22A 3ILUB 3IOTA 1A7LA 5ICTA 3RNNA 5AA2A 1B58A 2XWOA 1JVYA 5LDZA 3T9VA 4KYEA 4NMYA 1TFAA 2BJIA 4OETA 4OVPA 1R1NA 3KN3A 3DP4A 2GHAA 3TTKA 4ZZAA 4O3BA 1MPBA 2VP1A 5JTYA 2OJTA 4GXSB 2W7YA 2DSFA 4IGRA 4PGPA 4IO6A 1FPGA 1TT1A 4HTGA 5DTBA 4OANA 1FPEA 4N13A 5CBRA 3TYHA 4TOZA 1YTVA 1NL5A 1I6BA 1LBBA 3C34A 1FCKA 3KOSA 4HCWA 4KFQA 4ECFA 3FJGA 5A5XB 4C0RA 4NF4B 4G68A 4FE8A 3LBSA 4IR8A 2ZMBA 2UYEA 1FQDA 2P0SA 1MY1A 2I3WA 3PD8A 1Y1MA 2Y7PA 1H3DA 4QFPA 2VD3A 1AL3A 4MJOA 2XA5A 4F1YA 1M5DA 1UTHB 3TEPA 4QBAA 1LFHA 3IOUA 3UN6A 4JWYA 4OXVA 2RC8A 3OSRA 4GWZA 5I56A 1AH5A 2WKYA 3CIJA 4L17A 1MQIA 5TPAA 1BIYA 2V3TA 5IZZA 2H4IA 1FTAA 2F7CA 4E0WA 1QVSA 3TQLA 1MY2A 1BTJA 4YMAA 3IFCA 4GBVA 5B7DA 1GGGA 1FPDA 5EQ9A 1LAFE 1PB8A 3MZBA 1PBQA 3ISPA 3PPOA 4F29A 1R9QA 4R9FA 4YB6A 3IFAA 2OLBA 2F5XA 2O68A 4O94A 4R6HA 4QSCA 2QJEA 1PEBA 1QGXA 2WX9A 4GFRA 3SETA 3TCFA 3HPIA 2NVUB 1GR2A 4X1DA 3UGWA 4R73A 3SEUA 1B3GA 4QFOA 4JVDA 2DDKA 1RDXA 3M3FA 4OHNA 1QUJA 3OEMA 3ONMA 4P0IA 1LFGA 5I59B 4RA1A 2WEFA 3KGCA 3U72A 5H8FB 4PTKA 1LAGE 4QRZA 5TU0A 4ZDMA 1AIVA 1IXCA 4P0GA 4DZ1A 4O8MA 4LZ7A 4EUOA 4JVIA 3FV2A 2XX8A 4HW8A 3PMVA 2ZYOA 4YZZA 5I2NB 2QS4A 4DIGA 4F2OA 4DLDA 2R8TA 2CEYA 3L6HA 4DI3D 4NF0A 1DOTA 3OENA 2XHDA 3MPLA 4GBWA 3QUFA 5IGAA 5EQ8A 2X7PA 4OEUA 2VT5A 3UK4A 4MCOA 3IJOB 1USYE 2QMWA 4PAIA 3IB0A
chains in the Genus database with same CATH topology
5LDZA 5IZZA 1LEVA 1FTAA 1NI9A 2QFLA 4NG7A 3BIHA 4XF5A 1K9ZA 2CZHA 2HPGA 2ZZXA 3E79A 1FPFA 1DCUA 1KA0A 1XI6A 4PFIA 2BJIA 5CM6A 4GX3A 4H45A 4HCYA 5IZ3A 2XXKA 4NGUA 1LBZA 2DVZA 2MKZA 3IFCA 3MSTA 4GBVA 4MMPA 4OVPA 1IMBA 2VPNA 1NUZA 5DW8A 5ET8A 5F24A 3LUZA 2P3VA 4N91A 3W9WA 4GWWA 5I3SA 2F3BA 1FPDA 4P3LA 4DI4B 4N17A 3U65A 1NV0A 1INPA 2FVZA 5ET6A 5EQ9A 2QVRA 5ET5A 5LTCA 2Q8MA 3T0JA 4I3YA 2PFYA 4OA4A 4X9TA 4AS5A 1G0IA 2PFZA 4N8YA 5EYHA 4N6DA 2QPQA 4MHFA 4JVCA 1FBDA 2DE3A 3ISPA 4HE0A 5ESYA 4GWYA 1KA1A 1YXIA 2HZLA 5ET7A 3IFAA 1NV4A 4QXDA 2F5XA 1NV3A 4O94A 3BIGA 4PDDA 4PGPA 4OVRA 2L5VA 1FJ6A 3T1BA 1IMFA 2HZKA 3B50A 4HE2A 2QVVA 4M1VA 1FPGA 4NN3A 2XWVA 3HFUA 5IZ1A 4GX4A 1NUWA 4MIJA 5J1DA 1AWBA 4OANA 1FPEA 1LBXA 1QGXA 1FPBA 2B4MA 2WX9A 4P47A 2Q74A 5EQAA 4O7IA 3ROJA 1FPKA 1IMEA 3PTYA 1NV5A 4YICA 4PF8A 5I5PA 4N8GA 4UABA 4X04A 5FBPA 1KZ8A 1CNQA 4G61A 4PFBA 2Y5LA 4P1EA 5J16A 1G0HA 4I3EA 1DBZA 5JK4A 1SPIA 5IM2A 4F1UA 1JP4A 2P3NA 1FBPA 2CZIA 2DDKA 1RDXA 4GWUA 4JVDA 4GWSA 4P56A 2OWZA 4N81A 2KQZA 2HXRA 1IMDA 2DE4A 4MNCA 3KC0A 3KC1A 5T3JA 1IMAA 3LV0A 3MYUA 4O7MA 1LBYA 4HCWA 4PFRA 1NUYA 5IZ3B 1LBVA 4F18A 2WEFA 4MNPA 1D9QA 2GQ1A 1EYIA 2CZKA 1YYZA 2OX3A 4LN5A 5EQ7A 1NUXA 2PCRA 2FIEA 2V3QA 3QMFA 4GX6A 2FBPA 4PTKA 4P9KA 4PBQA 3E78A 1DK4A 4F19A 1NV2A 3A29A 2XWKA 2ZZVA 4N15A 2WYPA 2QVUA 4OVSA 1LBWA 3B8BA 2FIXA 1FBHA 1EYKA 4IR8A 4PBHA 5EYGA 4PAFA 4OVQA 4P8BA 1YZ0A 5A5LA 1FBCA 4O8MA 4I40A 1FBEA 2KR0A 4MX6A 3D1RA 4JVIA 3FBPA 2WBBA 4N4UA 2XWIA 3CHGA 4PC9A 1Q9DA 4PGNA 4OVTA 1FPJA 2WBDA 3EKIA 4FBPA 2CEXA 2WYKA 1NV1A 2Y5KA 4N6KA 4NAPA 4H46A 3NOHA 4HE1A 4X8RA 2V4CA 4MJOA 4YZZA 2HHMA 2XA5A 5I7IA 2FHYA 4XFEA 4MEVA 4NHBA 1FBFA 4PE3A 2F3DA 4MNIA 1NV6A 1NV7A 2B4LA 3RPLB 2R8TA 4NQ8A 3SZPA 1FPLA 1RDZA 4P1LA 2CEYA 4GWXA 4DI3D 2VPOA 1FPIA 2JJKA 4NF0A 2Q9TA 4MAGA 4PDHA 4PF6A 4QBAA 4NX1A 1K9YA 3KBZA 1BK4A 4PCDA 4F1VA 4GBWA 4GWZA 5IGAA 3W9VA 5EQ8A 3GYYA 1VDWA 2DE2A 1RDYA 1IMCA 1FRPA 2ZZWA 1EYJA 4HXVA 2VT5A 3RPLA 4AS4A 4MCOA 3RYDA 1FJ9A 1FSAA 4PETA 4PAIA 4PAKA 4KXPA 3FXBA 2XWOA 4XEQA 1FBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZZ A;  4NG7 A;  2HPG A;  2ZZX A;  4PFI A;  5CM6 A;  2XXK A;  4NGU A;  4MMP A;  4OVP A;  2VPN A;  4N91 A;  4DI4 B;  4P3L A;  4N17 A;  3U65 A;  5LTC A;  2PFY A;  4OA4 A;  2PFZ A;  4N8Y A;  4N6D A;  4MHF A;  2HZL A;  4O94 A;  4PDD A;  4PGP A;  4OVR A;  2HZK A;  3B50 A;  4NN3 A;  2XWV A;  4MIJ A;  4OAN A;  4P47 A;  2WX9 A;  4YIC A;  4PF8 A;  4N8G A;  4UAB A;  4X04 A;  4PFB A;  4P1E A;  5IM2 A;  4P56 A;  4MNC A;  4O7M A;  4PFR A;  4MNP A;  4LN5 A;  4P9K A;  4PBQ A;  4N15 A;  2XWK A;  2ZZV A;  4OVS A;  2WYP A;  4PBH A;  4PAF A;  4OVQ A;  4P8B A;  4O8M A;  4MX6 A;  4N4U A;  2XWI A;  4PC9 A;  4PGN A;  4OVT A;  2CEX A;  2WYK A;  4X8R A;  4N6K A;  4NAP A;  2V4C A;  4YZZ A;  5I7I A;  2XA5 A;  4XFE A;  4MEV A;  4NHB A;  4PE3 A;  4MNI A;  4NQ8 A;  4P1L A;  2CEY A;  5I5P A;  4DI3 D;  4PDH A;  2VPO A;  4NF0 A;  4PF6 A;  4MAG A;  4XF5 A;  4NX1 A;  4PCD A;  5IGA A;  3GYY A;  2ZZW A;  4MCO A;  4PET A;  4PAI A;  4PAK A;  3FXB A;  2XWO A;  4XEQ A; 
#chains in the Genus database with same CATH topology
 2F7A A;  1B3H A;  3K00 A;  2DWJ A;  4BDN A;  5K2X A;  5H8H A;  1B7U A;  1SD3 A;  3U93 A;  3SKP A;  3U1O A;  5H8N B;  1FQF A;  3T0J A;  2XD3 A;  1SI0 A;  3TQW A;  1S9T A;  4ZEK A;  4G8N A;  3VLV A;  5AA1 A;  1ZIU A;  4IY6 A;  1KA1 A;  3A09 A;  1N04 A;  5IZ1 A;  3N6T A;  2Y7I A;  2QMX A;  5EQA A;  4LON B;  3N5L A;  4PP0 A;  1MXX A;  2DP8 A;  1G0H A;  3PD9 A;  3VFJ A;  5CMB A;  3H3G A;  3PU5 A;  1II5 A;  1B3E A;  4U2R A;  1LCF A;  2QS1 A;  4Q0C A;  3O97 A;  5L9S A;  2I49 A;  5ISU A;  2ABH A;  3T22 A;  2E1S A;  4U4X A;  1N3X A;  3B6W A;  2UVJ A;  4ELP A;  2ZYN A;  4FAJ A;  3RPW A;  3LSW A;  4YB7 A;  3KN7 A;  4X8R A;  5K2Y A;  4NHB A;  2VGQ A;  2XXV A;  2PVU A;  2ALU A;  3KBZ A;  2B3F A;  4F3B A;  4JB7 A;  1VDW A;  1WVJ A;  4AS4 A;  1B2H A;  4HXV A;  1QUL A;  3W15 C;  3K2D A;  4FIM A;  2UXA A;  2RF1 A;  1B0H A;  3PUY E;  1UTB B;  1L5T A;  3FJM A;  1DCU A;  4ZE9 A;  4NED A;  1LBZ A;  4MMP A;  1MQH A;  3GLB A;  3C9H A;  4GWO A;  2P1S A;  4GWW A;  3B6Q A;  5KDT A;  4IO3 A;  1INP A;  1EZ9 A;  4NE4 A;  3K6V A;  1B46 A;  3IAZ A;  4X9T A;  1NNT A;  1MY3 A;  4YU0 A;  5H8Q B;  3VLU A;  4BDM A;  3GBA A;  4QHQ A;  4JSD A;  1PB9 A;  3USD A;  4NF5 A;  2A5S A;  1M5C A;  2HZK A;  3KSX A;  4EXL A;  1XVY A;  1Z7M E;  5DVF A;  4UAB A;  1FTO A;  3I5O A;  2XX7 A;  1SPI A;  2BJJ X;  2F6G A;  2AYS A;  2XXU A;  3OMB A;  2F6P A;  4XXU A;  4DCY A;  2OWS A;  1BP5 A;  2GQ1 A;  1EYI A;  3C4M A;  5AE4 A;  4P9K A;  1ZBM A;  2WYP A;  3B8B A;  5EYG A;  1P1W A;  3VXC A;  4FOR A;  3FXU A;  1SDX A;  1JNF A;  2PT2 A;  3CFL A;  3M3K A;  3IX1 A;  2XXW A;  4ESW A;  3DP8 A;  4FEB A;  4ZS9 A;  4JBZ A;  1MDP 1;  2PYY A;  4F31 B;  1UIV A;  1LST A;  5BUU A;  1B1X A;  1MRP A;  1UTH A;  3KOT A;  4IO2 A;  4BDR A;  3I3V A;  4LUB A;  2A5T A;  4KCC A;  3FXB A;  1B51 A;  3H6U A;  4F3P A;  1FW0 A;  2QFL A;  1PBP A;  3KEI A;  1MM6 A;  4EDP A;  4NF6 B;  4R6Y A;  3O6H A;  3VV5 A;  3T93 B;  4EXK A;  3EHU A;  5L9O A;  1IMB A;  4F3G A;  2RIN A;  4QSD A;  3K6U A;  4DI4 B;  5H8F A;  5B70 A;  4MLQ A;  2IEE A;  2Q2C A;  5EYH A;  3PPQ A;  1B6H A;  2HZL A;  1IMF A;  1NFT A;  4LAT A;  4F3S A;  2Q74 A;  3PTY A;  5CMC A;  5CI5 A;  1VSO A;  2OWT A;  5J16 A;  3KG2 A;  1MQJ A;  4GD5 A;  3KSJ A;  3A3U A;  4P56 A;  3HO7 A;  2KQZ A;  2ZNU A;  3KC0 A;  5KCJ B;  4O7M A;  3E9X A;  2HQ0 A;  4M4G A;  3TDJ A;  2B3B A;  2VD2 A;  3PMX A;  4MBP A;  1ZLQ A;  4KI0 E;  3ZKL A;  2HEU A;  4OVQ A;  4Z0I A;  1YZ0 A;  2D3I A;  1MH4 A;  3ZS6 A;  1EZO A;  4OFL A;  4MX6 A;  4PC9 A;  3S9M C;  3HHF A;  1P1N A;  1B5H A;  4ZEB A;  4MNI A;  5FHO A;  4JWX A;  4PFY A;  3PPR A;  4P1L A;  4NF5 B;  4PDH A;  4NX1 A;  2IA4 A;  2HCA A;  3G3F A;  3MZ1 A;  2V84 A;  4RXL A;  4RYA A;  4LQ2 A;  3RYD A;  4EF2 A;  4PAK A;  1FBG A;  4JDF A;  3OD7 A;  4PFT A;  3E79 A;  4TLL B;  5CC2 A;  2MKZ A;  3QK6 A;  3W9W A;  4DXB A;  5I3S A;  3MVX A;  3B7D A;  3PUX E;  4DDD A;  2F7B A;  3U65 A;  4O3C A;  2YPN A;  3MP8 A;  3RT8 A;  4AS5 A;  1G0I A;  3QXM A;  3RLF E;  4GWY A;  5ET7 A;  4FED A;  3JV9 A;  1Q1K A;  3WAF A;  3IOR A;  4ESX A;  4MIJ A;  5J1D A;  4HS7 A;  1A40 A;  1FPB A;  3KBR A;  5DT6 A;  3RN8 A;  2ESN A;  1FPK A;  3IO4 A;  2F97 A;  5IKB A;  4GL8 A;  4G61 A;  5DYH A;  3C33 A;  4GWU A;  5I58 A;  4R72 A;  4UA8 A;  3LV0 A;  3TUS A;  4AB6 A;  1N84 A;  3P7I A;  1I6A A;  1IEJ A;  2PCR A;  2FBP A;  4PBQ A;  4KPT A;  3G3K A;  2ZZV A;  2QVU A;  1MXV A;  1YPN A;  4KYD A;  3IOV A;  5A5L A;  2RCA A;  3R6U A;  3THI A;  4GL0 A;  1FPJ A;  5ELV A;  3TKD A;  3EKI A;  1QUK A;  2E0S A;  4N6K A;  1HSL A;  3IJX B;  1SI1 A;  4PE3 A;  3TTM A;  3TZA A;  1FPL A;  4GWX A;  5I57 B;  4G4P A;  2VHA A;  3TAJ A;  3FVG A;  5HPQ A;  2GH9 A;  2H99 A;  2OBG A;  1CE2 A;  4EQ9 A;  1Y20 A;  3O29 A;  4GLI A;  4IY5 A;  5H8H B;  4KYS A;  2NUV A;  3E13 X;  3BIH A;  3FUZ A;  2ZZX A;  4XIG Q;  3DM0 A;  2H9B A;  3K1M A;  4NGU A;  3MVY A;  4H5G A;  2Z8F A;  5I59 A;  2FVZ A;  2XXY A;  1QJM A;  2Y7R A;  4OA4 A;  3MQ9 A;  4PQJ A;  2H98 A;  2O7U A;  4YKK A;  4NWD A;  3BIG A;  3O2A A;  1B32 A;  5I57 A;  2Z22 A;  5TP9 B;  3MP1 A;  4F39 A;  1OQG A;  1USY H;  1JET A;  2O1L A;  1NV5 A;  2XXI A;  1OVB A;  1CNQ A;  4P1E A;  4F2Q A;  2CZI A;  1BKA A;  3KC1 A;  3KFM A;  3PUV E;  1LBY A;  1LB8 A;  3RY3 A;  2RCB A;  3QMF A;  1DK4 A;  3A29 A;  3TTL A;  1OMP A;  2Y84 A;  3RQT A;  3C31 A;  2DQV A;  3RT6 B;  3S4U A;  4ELQ A;  4ELR A;  1F9B A;  2XX9 A;  4N4U A;  5DEX B;  3NOH A;  2FHY A;  1Y4T A;  1TWY A;  1Y3N A;  2D21 A;  4KR5 A;  3SEX A;  3RPL B;  5I58 B;  2HAU A;  2CMO A;  4KCD A;  4ND9 A;  1B0L A;  2R9J A;  4ISU A;  3C32 A;  4PCD A;  4RK9 A;  2XXX A;  1Y3P A;  2Z23 A;  5EHM A;  4GF8 A;  1WDN A;  4NF8 A;  1N7X A;  4THI A;  2UYF A;  4R2B A;  4XEQ A;  5ITP A;  4OFO A;  3Q28 A;  3VDF A;  1K9Z A;  2CZH A;  1B7H A;  1ZJL A;  4H65 A;  4YKI A;  5IZ3 A;  3ECR A;  3FVN A;  3CFZ A;  3H6W A;  3R26 A;  4OEV A;  1R6Z A;  1B4H A;  3CG3 A;  3IK6 B;  4OWD A;  4JVC A;  5ITO A;  3ODB A;  4PDD A;  3VVF A;  3FVO A;  1Y3Q A;  2AL4 A;  2XXH A;  1Y1Z A;  2QRY A;  4RPO A;  1ZU0 A;  2I4B A;  2I0C A;  2OCU A;  3BFU A;  4POW A;  4LZ5 A;  5IM2 A;  4BDO A;  1FTK A;  2P3N A;  3RGY A;  1WOD A;  4GWS A;  2XD2 A;  1OVT A;  1O63 A;  1IMA A;  4PFR A;  1FTM A;  3IO6 A;  5IZ3 B;  3V89 B;  4MNP A;  3RTW B;  3G7W A;  1PB7 A;  4LN5 A;  1R9L A;  5EQ7 A;  2REG A;  3CRB A;  2FNC A;  4Q5T A;  1LBW A;  1N76 A;  5AA4 A;  4PFU A;  3Q27 A;  4YKP A;  2ZNS A;  3FZV A;  4PE5 B;  5I2K A;  4ELO A;  3MZ9 A;  2WBB A;  1Q9D A;  2P2A A;  1ANF A;  2QSX A;  2QS3 A;  1QUI A;  3CSG A;  2CEX A;  1NV1 A;  3Q25 A;  4XKP A;  3SER A;  4DE8 A;  1NNP A;  3SZP A;  2PT1 A;  5I5P A;  4GOT A;  3VE1 B;  1URS A;  1K9Y A;  1IXH A;  3W9V A;  3PPN A;  3JYR A;  2ZYK A;  4H1X A;  1FJ9 A;  2O69 A;  1NI9 A;  3H6T A;  2I0B A;  3G3I A;  5CM6 A;  3L6G A;  4ZE8 A;  2Q89 A;  1UQW A;  2DWI A;  2DVZ A;  1SQY A;  5DW8 A;  3MVW A;  4P3L A;  2QL3 A;  1D3K A;  1M5B A;  4C1U A;  3OXN A;  3CFX A;  3UP9 A;  4N8Y A;  4N6D A;  4MHF A;  4JSO A;  2XXP A;  4NF6 A;  1YXI A;  1P1U A;  1LCT A;  1XC1 A;  1VR5 A;  4Q8R A;  3PUZ E;  2GFE A;  4X04 A;  4RPN A;  5FBP A;  4QFN A;  5JK4 A;  4ZEF A;  4MNC A;  3MYU A;  1MQG A;  2RKM A;  1DMB A;  2VOZ A;  2F34 A;  1A55 A;  1D9Q A;  2V3Q A;  4GX6 A;  1IQ7 A;  3IB2 A;  4OVS A;  3LSL A;  1A99 A;  3MP6 A;  2LAO A;  3OO7 A;  1B3L A;  1VE4 A;  3HST A;  1MS7 A;  3FAT A;  4HE1 A;  5I7I A;  2Q8J A;  2Q88 A;  2F3D A;  1NV7 A;  3MWB A;  3S9L C;  2HXW A;  3G3G A;  4FAT A;  4JXI A;  5EYF A;  4F1V A;  3LC8 A;  3EN3 A;  4G8H A;  4N6P A;  3RPL A;  2THI A;  3H7M A;  4H8I A;  3H6V A;  3O66 A;  4KXP A;  2UVI A;  2V93 A;  1OIB A;  1LAX A;  2HAV A;  2FA7 A;  1KA0 A;  4GX3 A;  4R2F A;  2VPN A;  2O84 X;  5F24 A;  2P3V A;  4YKJ A;  2F3B A;  1S7Y A;  2DS9 A;  4ZZE A;  2ZYM A;  5I84 A;  1POT A;  1JQF A;  1UIU A;  5AA2 D;  4HE0 A;  4U4S A;  3WAE A;  3T1B A;  3CVG A;  1GVC A;  3LUY A;  2OZZ A;  3B6T A;  3HV1 A;  3IOW A;  1J1N A;  2I3V A;  4X1B A;  3AXF A;  1DBZ A;  3MBP A;  1JP4 A;  4H8J A;  2HXR A;  1IMD A;  4G8M A;  2Z8D A;  1IIW A;  1B7Z A;  4F18 A;  5DEX A;  2Y7K A;  4JWO A;  3E78 A;  5AA4 B;  4F19 A;  1I6Q A;  4F22 A;  4P8B A;  5H8S A;  4QF9 A;  1N3W A;  1MG1 A;  4RK2 A;  3FBP A;  4OVT A;  1JVX A;  3MUQ A;  4FBP A;  3KJ7 A;  3VVE A;  3S2V A;  3OSQ A;  3TCG A;  4MEV A;  5KZT A;  1FBF A;  2KLF A;  3M8U A;  1SBP A;  1FPI A;  3MC2 A;  1PC3 A;  3DLN A;  3QAX A;  2UVG A;  3GYY A;  4I1D A;  2GRV A;  1IMC A;  1FRP A;  4OES A;  3OEL A;  2G93 A;  3IR1 A;  4R74 A;  2NWJ A;  1IIT A;  1MXY A;  3PGF A;  1MY0 A;  2ONS A;  1LAH E;  1XVX A;  3K0V A;  4X48 A;  4QFL A;  4PFI A;  1XI6 A;  4H45 A;  3O9P A;  3MST A;  4OMB A;  4POX A;  3KJT A;  4RNS A;  5L8D A;  3S9E A;  4Q30 B;  5ET6 A;  2HFB A;  2Z8E A;  4IO7 A;  5CMM A;  1SYI A;  3FJ7 A;  3G3J A;  4IO4 A;  1SW5 A;  1US4 A;  2I48 A;  1Y9U A;  3OO6 A;  1NV3 A;  2L5V A;  3B50 A;  1MDQ A;  2XWV A;  3H03 A;  4GX4 A;  2F78 A;  1URD A;  4O7I A;  4N8G A;  1H45 A;  3C35 A;  4IGT A;  4PFB A;  3GBB A;  1Q35 A;  1B52 A;  1B5I A;  5IAI A;  3MW0 A;  4LP2 B;  2DE4 A;  5I2N A;  1NUY A;  2NXO A;  3QYT A;  1URG A;  2OX3 A;  3MJN A;  4GRK A;  4C1T A;  1D4N A;  1IUD A;  3LR1 A;  3CI8 A;  4WED A;  3TTR A;  3CSB A;  1LFI A;  1YAE A;  3EQ1 A;  4PGN A;  2O1M A;  2Y5K A;  3T66 A;  3BBR A;  1B1H A;  4H46 A;  4LQ5 A;  2HHM A;  4DXC A;  1XS5 A;  3KZG A;  4OZ9 A;  1I69 A;  2JJK A;  4XKN A;  3E4R A;  3OEK A;  5TP9 A;  1OLC A;  2DE2 A;  1ELJ A;  3U94 A;  2RC7 A;  4EF1 A;  4XKQ A;  1O64 A;  3G3H A;  4BDL A;  4QSE A;  1NKX A;  5I2K B;  1DTZ A;  3O6G A;  5ET8 A;  4N91 A;  4TLM B;  1DPP A;  4IO5 A;  1H43 A;  1HSJ A;  2XXR A;  1YCJ A;  2QVR A;  2Q8M A;  2I58 A;  2PFY A;  4LA9 A;  1DTG A;  1RYX A;  3GZG A;  1GTK A;  5ESY A;  2ZXT A;  4FEC A;  3FIR A;  4OVR A;  4XTC Q;  1JW5 A;  2B4M A;  1B40 A;  1B9J A;  4YIC A;  1A8E A;  1N0T A;  3U8Q A;  1B5J A;  2X26 A;  3DEL B;  3N26 A;  5T3J A;  2ANJ A;  3T9X B;  3EHS A;  3CG1 A;  5H8Q A;  3SEY A;  1RKM A;  3PPP A;  3S9N C;  1M5E A;  2DOJ A;  3TMG A;  1NV2 A;  3T9U A;  5KDT B;  1XT8 A;  1FBH A;  4PAF A;  2B65 A;  3ZKK A;  1FBC A;  3UOR A;  1S50 A;  2KR0 A;  4P11 A;  2R71 A;  3CHG A;  1MXZ A;  1B4Z A;  2V4C A;  2NOO A;  3V83 A;  3JZJ A;  5AA2 B;  3TPA A;  1JW4 A;  1RDZ A;  4XF5 A;  1SYH A;  1JEU A;  1FQA A;  3QUJ A;  3BKI B;  2M8C A;  1RDY A;  1VFE A;  1N7W A;  4OER A;  3A3C A;  3MAM A;  3FGS A;  2H25 A;  4KHZ E;  2XXK A;  3N6U A;  5A5X A;  1AOV A;  4NWC A;  3V5A A;  1IXI A;  4Z7E A;  3ILT B;  5ET5 A;  4I3Y A;  1BLF A;  4ZEC A;  2DE3 A;  1JEV A;  2F36 A;  3RTF B;  3RUM A;  1FJ6 A;  4YMB A;  4NN3 A;  1AWB A;  1LBX A;  2PBW A;  1XOC A;  4U23 A;  3CR9 A;  2Y5L A;  5I56 B;  2CZL A;  4I3E A;  5H8N A;  1FBP A;  4YB5 A;  2G29 A;  1KWH A;  4N81 A;  1VFD A;  4GIZ A;  4EQ7 A;  1MPC A;  5L9M A;  4BLA A;  4G68 C;  1NNK A;  3KN8 A;  1NH7 A;  2PMS A;  2CZK A;  4ONY A;  1TXF A;  2XWK A;  1SW4 A;  3K02 A;  4EQB A;  2FIX A;  2ONK E;  4LVQ A;  1SVX B;  3T9H B;  3HN0 A;  5F7V A;  3K4U A;  1H76 A;  2DWA A;  1MXU A;  4G68 B;  4K3F A;  1NH8 A;  3D4G A;  4R6K A;  4GXA A;  2WBD A;  1JW1 A;  3K6X A;  3QSL A;  3F11 A;  3VLW A;  1ATG A;  4NAP A;  4MH5 A;  1MM7 A;  1P1Q A;  4LZ8 A;  2B4L A;  3T96 B;  2Q2A A;  4ZEI A;  5JTY B;  2VPO A;  4PFW A;  1H44 A;  1LGB C;  1EH3 A;  4N07 A;  3TFL A;  3OO9 A;  5BWJ A;  3FVK A;  5FTI A;  3QIM A;  1P1O A;  2DWH A;  3M3L A;  3R7X A;  4BDQ A;  1AMF A;  3C36 A;  1EZP A;  2HPG A;  3ZSF A;  4AB5 A;  3TEL A;  4HCY A;  4NF8 B;  3MVZ A;  5LOM A;  3IB1 A;  1IXG A;  3VVD A;  1SW1 A;  1MH3 A;  2D5W A;  3EHT A;  1FTJ A;  2YLN A;  2F35 A;  1A54 A;  2PFZ A;  1DPE A;  3UA8 A;  5DVI A;  3TTN A;  5CBS A;  3OOA A;  5FTH A;  4HE2 A;  4OQO A;  3HFU A;  3D4C A;  1NUW A;  2O7I A;  1B3F A;  3LSX A;  1IME A;  4GVO A;  1MQD A;  1KZ8 A;  2I6E A;  1OLA A;  3K6W A;  1LBV A;  4YAH X;  2YJP A;  2FYI A;  3N94 A;  4KQP A;  3ROJ A;  4N15 A;  4IB2 A;  1UTB A;  4WKM A;  4G2Z A;  1RYO A;  2O51 A;  3MPK A;  2OK2 A;  5HM4 B;  1FBE A;  4H67 A;  2I4C A;  2ONR A;  3PUW E;  2H5Y A;  4G77 A;  3DP6 A;  2Y7W A;  4WEP A;  3HCQ A;  3I6V A;  3LSF B;  4NQ8 A;  3SDF A;  4PF6 A;  2Q9T A;  4MAG A;  2O6A A;  1HSE A;  1IZ1 A;  4H6D A;  4QFK A;  5DVJ A;  2ZZW A;  3GXA A;  1B05 A;  1FSA A;  3U92 A;  3BFT A;  1DSN A;  4DCX A;  4NF4 A;  2DYX A;  1LEV A;  1Y4C A;  4H0W A;  4MF3 A;  4O3A A;  1NMU A;  1M5F A;  1NUZ A;  2DVC A;  3LUZ A;  5LTC A;  4KD5 A;  1XHY A;  1FBD A;  4NTL A;  2A5T B;  1MPD A;  1NV4 A;  1T0K A;  3SEV A;  4M1V A;  4RJZ A;  2XXT A;  3O6I A;  3UIF A;  4OFJ A;  3Q26 A;  5FHN A;  5JEI A;  4MFI A;  3PMW A;  1D9V A;  3K1N A;  4F1U A;  1GV8 A;  4UAC A;  3FD3 A;  4RY1 A;  2V25 A;  5CRY A;  1A8F A;  1YYZ A;  2F8D A;  2FIE A;  2DXY A;  2REJ A;  4I62 A;  3H4Z A;  4PBH A;  1ZKB A;  3V8X B;  1CB6 A;  1FQB A;  4I40 A;  1QW0 A;  4TQU Q;  3K1P A;  2QS2 A;  4OEN A;  3O28 A;  4MLV A;  2UVH A;  5M2V A;  2WYK A;  5CMK A;  4AQ4 A;  5HBC A;  2X7Q A;  2V3U A;  4U1O A;  3EPE A;  1NNF A;  1LB9 A;  3VXB A;  1EYJ A;  1FTL A;  3FXQ A;  1D9Y A;  4DXU A;  4PET A;  1US5 A;  2R6G E;  3OO8 A;  4NG7 A;  4H5F A;  1FPF A;  1O7T A;  1MXW A;  2ZNT A;  5TPA B;  1ZMG A;  1SW2 A;  2XXQ A;  4I8C A;  4E0X A;  3K01 A;  3PV0 E;  1OQH A;  4N17 A;  5ICQ A;  1NV0 A;  5KCJ A;  3E3K A;  1PDA A;  1POY 1;  2QPQ A;  3H06 B;  5AA3 A;  3FXR A;  2RC9 A;  5EHS A;  3SEW A;  4U21 A;  4QXD A;  4R75 A;  4GQO A;  2QVV A;  3TOD A;  3SES A;  4ZED A;  4P47 A;  4U1Z A;  1QKB A;  4PF8 A;  3FV1 A;  2GHB A;  3HHG A;  2DXR A;  2OWZ A;  1TFD A;  1QKA A;  1ZTY A;  4OTE A;  2AIX A;  1NUX A;  3Q29 A;  4XKR A;  4FJP A;  1EYK A;  3TCH A;  4OVJ A;  4WXJ A;  1Z7N E;  3D1R A;  1LLS A;  2XWI A;  4R9G A;  5FHM A;  2PX1 A;  1P99 A;  4XFE A;  1LBC A;  1NV6 A;  2AL5 A;  3EF7 A;  1FQE A;  5F1Q A;  1EU8 A;  4OYV A;  1MY4 A;  1BK4 A;  3IL1 B;  1FQC A;  3FAS A;  4I9D A;  4U22 A;  3ILU B;  3IOT A;  1A7L A;  5ICT A;  3RNN A;  5AA2 A;  1B58 A;  2XWO A;  1JVY A;  5LDZ A;  3T9V A;  4KYE A;  4NMY A;  1TFA A;  2BJI A;  4OET A;  4OVP A;  1R1N A;  3KN3 A;  3DP4 A;  2GHA A;  3TTK A;  4ZZA A;  4O3B A;  1MPB A;  2VP1 A;  5JTY A;  2OJT A;  4GXS B;  2W7Y A;  2DSF A;  4IGR A;  4PGP A;  4IO6 A;  1FPG A;  1TT1 A;  4HTG A;  5DTB A;  4OAN A;  1FPE A;  4N13 A;  5CBR A;  3TYH A;  4TOZ A;  1YTV A;  1NL5 A;  1I6B A;  1LBB A;  3C34 A;  1FCK A;  3KOS A;  4HCW A;  4KFQ A;  4ECF A;  3FJG A;  5A5X B;  4C0R A;  4NF4 B;  4G68 A;  4FE8 A;  3LBS A;  4IR8 A;  2ZMB A;  2UYE A;  1FQD A;  2P0S A;  1MY1 A;  2I3W A;  3PD8 A;  1Y1M A;  2Y7P A;  1H3D A;  4QFP A;  2VD3 A;  1AL3 A;  4MJO A;  2XA5 A;  4F1Y A;  1M5D A;  1UTH B;  3TEP A;  4QBA A;  1LFH A;  3IOU A;  3UN6 A;  4JWY A;  4OXV A;  2RC8 A;  3OSR A;  4GWZ A;  5I56 A;  1AH5 A;  2WKY A;  3CIJ A;  4L17 A;  1MQI A;  5TPA A;  1BIY A;  2V3T A;  5IZZ A;  2H4I A;  1FTA A;  2F7C A;  4E0W A;  1QVS A;  3TQL A;  1MY2 A;  1BTJ A;  4YMA A;  3IFC A;  4GBV A;  5B7D A;  1GGG A;  1FPD A;  5EQ9 A;  1LAF E;  1PB8 A;  3MZB A;  1PBQ A;  3ISP A;  3PPO A;  4F29 A;  1R9Q A;  4R9F A;  4YB6 A;  3IFA A;  2OLB A;  2F5X A;  2O68 A;  4O94 A;  4R6H A;  4QSC A;  2QJE A;  1PEB A;  1QGX A;  2WX9 A;  4GFR A;  3SET A;  3TCF A;  3HPI A;  2NVU B;  1GR2 A;  4X1D A;  3UGW A;  4R73 A;  3SEU A;  1B3G A;  4QFO A;  4JVD A;  2DDK A;  1RDX A;  3M3F A;  4OHN A;  1QUJ A;  3OEM A;  3ONM A;  4P0I A;  1LFG A;  5I59 B;  4RA1 A;  2WEF A;  3KGC A;  3U72 A;  5H8F B;  4PTK A;  1LAG E;  4QRZ A;  5TU0 A;  4ZDM A;  1AIV A;  1IXC A;  4P0G A;  4DZ1 A;  4O8M A;  4LZ7 A;  4EUO A;  4JVI A;  3FV2 A;  2XX8 A;  4HW8 A;  3PMV A;  2ZYO A;  4YZZ A;  5I2N B;  2QS4 A;  4DIG A;  4F2O A;  4DLD A;  2R8T A;  2CEY A;  3L6H A;  4DI3 D;  4NF0 A;  1DOT A;  3OEN A;  2XHD A;  3MPL A;  4GBW A;  3QUF A;  5IGA A;  5EQ8 A;  2X7P A;  4OEU A;  2VT5 A;  3UK4 A;  4MCO A;  3IJO B;  1USY E;  2QMW A;  4PAI A;  3IB0 A; 
#chains in the Genus database with same CATH homology
 5LDZ A;  5IZZ A;  1LEV A;  1FTA A;  1NI9 A;  2QFL A;  4NG7 A;  3BIH A;  4XF5 A;  1K9Z A;  2CZH A;  2HPG A;  2ZZX A;  3E79 A;  1FPF A;  1DCU A;  1KA0 A;  1XI6 A;  4PFI A;  2BJI A;  5CM6 A;  4GX3 A;  4H45 A;  4HCY A;  5IZ3 A;  2XXK A;  4NGU A;  1LBZ A;  2DVZ A;  2MKZ A;  3IFC A;  3MST A;  4GBV A;  4MMP A;  4OVP A;  1IMB A;  2VPN A;  1NUZ A;  5DW8 A;  5ET8 A;  5F24 A;  3LUZ A;  2P3V A;  4N91 A;  3W9W A;  4GWW A;  5I3S A;  2F3B A;  1FPD A;  4P3L A;  4DI4 B;  4N17 A;  3U65 A;  1NV0 A;  1INP A;  2FVZ A;  5ET6 A;  5EQ9 A;  2QVR A;  5ET5 A;  5LTC A;  2Q8M A;  3T0J A;  4I3Y A;  2PFY A;  4OA4 A;  4X9T A;  4AS5 A;  1G0I A;  2PFZ A;  4N8Y A;  5EYH A;  4N6D A;  2QPQ A;  4MHF A;  4JVC A;  1FBD A;  2DE3 A;  3ISP A;  4HE0 A;  5ESY A;  4GWY A;  1KA1 A;  1YXI A;  2HZL A;  5ET7 A;  3IFA A;  1NV4 A;  4QXD A;  2F5X A;  1NV3 A;  4O94 A;  3BIG A;  4PDD A;  4PGP A;  4OVR A;  2L5V A;  1FJ6 A;  3T1B A;  1IMF A;  2HZK A;  3B50 A;  4HE2 A;  2QVV A;  4M1V A;  1FPG A;  4NN3 A;  2XWV A;  3HFU A;  5IZ1 A;  4GX4 A;  1NUW A;  4MIJ A;  5J1D A;  1AWB A;  4OAN A;  1FPE A;  1LBX A;  1QGX A;  1FPB A;  2B4M A;  2WX9 A;  4P47 A;  2Q74 A;  5EQA A;  4O7I A;  3ROJ A;  1FPK A;  1IME A;  3PTY A;  1NV5 A;  4YIC A;  4PF8 A;  5I5P A;  4N8G A;  4UAB A;  4X04 A;  5FBP A;  1KZ8 A;  1CNQ A;  4G61 A;  4PFB A;  2Y5L A;  4P1E A;  5J16 A;  1G0H A;  4I3E A;  1DBZ A;  5JK4 A;  1SPI A;  5IM2 A;  4F1U A;  1JP4 A;  2P3N A;  1FBP A;  2CZI A;  2DDK A;  1RDX A;  4GWU A;  4JVD A;  4GWS A;  4P56 A;  2OWZ A;  4N81 A;  2KQZ A;  2HXR A;  1IMD A;  2DE4 A;  4MNC A;  3KC0 A;  3KC1 A;  5T3J A;  1IMA A;  3LV0 A;  3MYU A;  4O7M A;  1LBY A;  4HCW A;  4PFR A;  1NUY A;  5IZ3 B;  1LBV A;  4F18 A;  2WEF A;  4MNP A;  1D9Q A;  2GQ1 A;  1EYI A;  2CZK A;  1YYZ A;  2OX3 A;  4LN5 A;  5EQ7 A;  1NUX A;  2PCR A;  2FIE A;  2V3Q A;  3QMF A;  4GX6 A;  2FBP A;  4PTK A;  4P9K A;  4PBQ A;  3E78 A;  1DK4 A;  4F19 A;  1NV2 A;  3A29 A;  2XWK A;  2ZZV A;  4N15 A;  2WYP A;  2QVU A;  4OVS A;  1LBW A;  3B8B A;  2FIX A;  1FBH A;  1EYK A;  4IR8 A;  4PBH A;  5EYG A;  4PAF A;  4OVQ A;  4P8B A;  1YZ0 A;  5A5L A;  1FBC A;  4O8M A;  4I40 A;  1FBE A;  2KR0 A;  4MX6 A;  3D1R A;  4JVI A;  3FBP A;  2WBB A;  4N4U A;  2XWI A;  3CHG A;  4PC9 A;  1Q9D A;  4PGN A;  4OVT A;  1FPJ A;  2WBD A;  3EKI A;  4FBP A;  2CEX A;  2WYK A;  1NV1 A;  2Y5K A;  4N6K A;  4NAP A;  4H46 A;  3NOH A;  4HE1 A;  4X8R A;  2V4C A;  4MJO A;  4YZZ A;  2HHM A;  2XA5 A;  5I7I A;  2FHY A;  4XFE A;  4MEV A;  4NHB A;  1FBF A;  4PE3 A;  2F3D A;  4MNI A;  1NV6 A;  1NV7 A;  2B4L A;  3RPL B;  2R8T A;  4NQ8 A;  3SZP A;  1FPL A;  1RDZ A;  4P1L A;  2CEY A;  4GWX A;  4DI3 D;  2VPO A;  1FPI A;  2JJK A;  4NF0 A;  2Q9T A;  4MAG A;  4PDH A;  4PF6 A;  4QBA A;  4NX1 A;  1K9Y A;  3KBZ A;  1BK4 A;  4PCD A;  4F1V A;  4GBW A;  4GWZ A;  5IGA A;  3W9V A;  5EQ8 A;  3GYY A;  1VDW A;  2DE2 A;  1RDY A;  1IMC A;  1FRP A;  2ZZW A;  1EYJ A;  4HXV A;  2VT5 A;  3RPL A;  4AS4 A;  4MCO A;  3RYD A;  1FJ9 A;  1FSA A;  4PET A;  4PAI A;  4PAK A;  4KXP A;  3FXB A;  2XWO A;  4XEQ A;  1FBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...