2VPNA

High-resolution structure of the periplasmic ectoine-binding protein from teaabc trap-transporter of halomonas elongata
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
310
structure length
306
Chain Sequence
DNWRYAHEEYEGDVQDVFAQAFKGYVEDNSDHTVQVYRFGELDIMEQTQNGILQFVNQSPGFTGSLIPSAQIFFIPYLMPTDMDTVLEFFDESKAINEMFPKLYAEHGLELLKMYPEGEMVVTADEPITSPEDFDNKKIRTMTNPLLAETYKAFGATPTPLPWGEVYGGLQTGIIDGQENPIFWIESGGLYEVSPNLTFTSHGWFTTAMMANQDFYEGLSEEDQQLVQDAADAAYDHTIEHIKGLSEESLEKIKAASDEVTVTRLNDEQIQAFKERAPQVEEKFIEMTGEQGQELLDQFKADLKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport
molecule keywords PERIPLASMIC SUBSTRATE BINDING PROTEIN
publication title 1.55 A Structure of the Ectoine Binding Protein Teaa of the Osmoregulated Trap-Transporter Teaabc from Halomonas Elongata.
pubmed doi rcsb
source organism Halomonas elongata
total genus 115
structure length 306
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2vpnA00
4OA4A 4P8BA 4NAPA 4NX1A 4N4UA 4MCOA 4P56A 4PCDA 4OVTA 2VPOA 4OVSA 4N15A 2PFZA 4NQ8A 2CEXA 4MAGA 5CM6A 4MMPA 4UABA 5IGAA 4DI3D 4PDHA 2CEYA 2HZKA 4XFEA 4DI4B 2WYPA 2XWOA 4PFBA 4MEVA 4PGNA 4MNIA 2WYKA 4P47A 4XF5A 4NN3A 4PGPA 2ZZXA 4MNCA 4N6KA 4LN5A 5LTCA 4NF0A 2XWVA 2XXKA 2XA5A 2XWIA 4PFIA 5I5PA 4PBHA 4YZZA 4YICA 4PDDA 2HPGA 2WX9A 4PAKA 4X8RA 3B50A 4PAIA 2PFYA 3U65A 5I7IA 4O8MA 2V4CA 4XEQA 4OANA 2HZLA 4PAFA 4O7MA 5IM2A 4NHBA 4OVRA 2ZZWA 4O94A 4PFRA 4N17A 4OVQA 4PE3A 4P1LA 4MX6A 4P1EA 4NG7A 4MNPA 4PF6A 3FXBA 2XWKA 5IZZA 4OVPA 4PC9A 4PBQA 4N8YA 2ZZVA 2VPNA 4NGUA 4PF8A 4X04A 4N91A 3GYYA 4P9KA 4MIJA 4N8GA 4PETA 4N6DA 4P3LA 4MHFA
chains in the Genus database with same CATH superfamily
1N0TA 2F5XA 4PCDA 3HPIA 1LBVA 3T93B 2X7PA 1LBZA 1MPCA 1LCTA 4Z0IA 4G68A 1MY2A 1D4NA 1GVCA 3SEWA 4KCDA 1FPJA 3CVGA 2B4LA 2DE4A 1Y1ZA 3C33A 3Q29A 2YJPA 1QW0A 3DELB 1FPFA 4MEVA 1TXFA 1MXZA 1P1QA 1XI6A 3WAEA 1URGA 4RA1A 3C4MA 4QFLA 2WYKA 4G8HA 5F24A 1S50A 1B0HA 1EZOA 1MXVA 2XX7A 1YYZA 2CZIA 1B40A 1Y3NA 2Y7PA 4PGPA 4DZ1A 1LFHA 5LTCA 3MAMA 5FBPA 4ZEDA 2RCAA 1TFAA 3RGYA 3VVFA 4DXUA 4C1UA 2Y5LA 3ROJA 1B5JA 4WEPA 3PV0E 5DT6A 1VFDA 1SI0A 1SI1A 1Y4CA 4ZS9A 3ILUB 4ZDMA 3RPLA 3SKPA 4KCCA 1UQWA 2ONRA 3VVEA 4QSEA 1AWBA 3S9NC 2ZYOA 1MRPA 2WBDA 3TPAA 2P1SA 1O7TA 2VPNA 2CMOA 2H9BA 4Q5TA 1CE2A 1ZKBA 4MLVA 1FJ9A 5BWJA 5CBRA 2QVVA 1UTBA 2OJTA 2W7YA 1YCJA 4NE4A 4EXKA 1NV6A 3LR1A 2O84X 1B3FA 2FNCA 4MMPA 3LBSA 4RK2A 3KOTA 3TYHA 2ALUA 4DI4B 4LZ7A 3O97A 1FSAA 1SD3A 4OFOA 2ONKE 1YAEA 4OFJA 1VR5A 1A99A 3DM0A 4U2RA 3B6WA 4R9GA 1INPA 1MH4A 3KOSA 4OHNA 2BJJX 2QMXA 3BIGA 1P1WA 1MQGA 3CG3A 5KDTA 2VP1A 5M2VA 4MF3A 1EZPA 1QKAA 2QMWA 5I5PA 1SW5A 5CRYA 3CR9A 4WKMA 3MVYA 3QIMA 3Q28A 1ZLQA 1RYXA 4F3SA 1B3HA 3E79A 4PAIA 5ICTA 5I7IA 1QKBA 3TUSA 3PD8A 1G0IA 1NNTA 3CSGA 2V4CA 1N76A 3T9XB 1IMFA 1LBBA 1N3XA 1K9YA 5LOMA 1FQCA 4O94A 4PE3A 2PVUA 2D5WA 1JEVA 3B8BA 3SERA 4KXPA 3V5AA 1FPEA 4KR5A 4IO3A 4OXVA 2O1LA 4BDRA 4X04A 1CNQA 4PETA 2DWHA 3OO6A 4U1OA 1PC3A 1OLCA 2F3DA 1IMDA 2QRYA 4GX3A 4KYEA 5DEXB 1H45A 2I4BA 4XKPA 1USYE 2R6GE 3GXAA 2I48A 1YTVA 1R1NA 4X48A 1N3WA 2Q2AA 1JNFA 3PU5A 3DP4A 3ONMA 1UIUA 3PUVE 5IZ3A 4DI3D 3IL1B 4BDMA 4IO7A 3LC8A 4NF6A 2HFBA 4R75A 4PGNA 4EF1A 1LFGA 2QJEA 2R9JA 5ITOA 2E0SA 2FHYA 3C36A 5I58A 5KCJA 3P7IA 4OZ9A 4HCWA 4G77A 1FBDA 4NMYA 4DDDA 1URSA 1NV0A 1LBYA 1VDWA 2O68A 2V3TA 1PB7A 1B4HA 3N6UA 4NF0A 3KJ7A 4O3CA 1R9QA 4MJOA 5H8QA 2R71A 1I6BA 1FBEA 4GFRA 3Q26A 2XX9A 1BLFA 3OSQA 1US4A 1FW0A 2B3FA 4HE1A 4JWXA 1GR2A 4M4GA 3MP1A 1T0KA 5EQAA 5L9MA 2REGA 5EYHA 5JK4A 1MQHA 3KC1A 4N17A 4NF4A 3S4UA 3IFCA 5IZ1A 2DE2A 2PCRA 1KA1A 2XXXA 4IY5A 3VXBA 2QS4A 4YKIA 5DYHA 3K6UA 4ZECA 1B32A 3U93A 3HFUA 2QS3A 1JVXA 2NVUB 4P3LA 5JTYB 4AS4A 3E4RA 1Q9DA 3KGCA 3OO7A 1D9VA 4N4UA 1IXGA 1QJMA 1XS5A 3UA8A 1NUWA 4OVSA 3LUZA 4I3EA 4NQ8A 3M3FA 3U72A 4F1VA 3FXRA 2I3VA 4C0RA 5CM6A 2AIXA 2O69A 1KA0A 4GQOA 1M5EA 4IR8A 4FJPA 3FVGA 3E78A 3UIFA 2GQ1A 4YU0A 1UIVA 4EDPA 1TFDA 4XTCQ 2XXVA 4FORA 4N13A 3A29A 3O2AA 1DK4A 1DMBA 2OCUA 4MLQA 1ZTYA 4LN5A 4R6YA 4GWWA 3H6VA 4KYDA 3K1PA 4ELPA 2V3QA 4H6DA 4GWSA 4JWOA 4R72A 5AA4A 4OQOA 3PUWE 4PFIA 3QK6A 3SEYA 3CRBA 1B9JA 2F8DA 3VVDA 3FASA 2OWZA 1CB6A 1B7ZA 1MY4A 3B50A 2HXWA 1HSEA 5HPQA 1SYIA 1OQGA 1OQHA 3IORA 3K6WA 4OEVA 5AA3A 1OVBA 2DVZA 2QVRA 3O6IA 4O3BA 3T0JA 2XHDA 1MY1A 3TDJA 1ANFA 5IZZA 4DXBA 1IXHA 4PBQA 4FAJA 2ZZVA 5ET8A 1LCFA 3GYYA 4HW8A 2ZYNA 2DQVA 1IMAA 4MCOA 1ZIUA 4P8BA 1JP4A 1NMUA 1FTJA 5L8DA 4R6KA 3KBZA 1TWYA 3TQWA 3IB0A 3VE1B 2PFZA 3MQ9A 1XC1A 5H8FA 1YPNA 3WAFA 3NOHA 2PX1A 1Y1MA 1ZMGA 4THIA 4L17A 1I6AA 2WKYA 3O66A 3BFUA 2PBWA 3SEUA 1LBCA 4RPNA 2KLFA 2DDKA 5A5XB 4I3YA 1LB9A 3VXCA 5I56A 1B58A 1SBPA 2F36A 3JV9A 5CBSA 2I58A 3RTWB 3KG2A 3KBRA 5F7VA 4GVOA 1BTJA 3IJXB 1MY0A 3GBAA 4G4PA 4ONYA 3VLUA 3FGSA 1RDYA 4QSCA 3W9WA 4GBWA 1JW5A 2QPQA 2GFEA 2ZYKA 3HN0A 5I2KB 5KZTA 3U65A 3ZKLA 2B65A 4JWYA 3S2VA 1FPLA 3FD3A 1B51A 4NF5B 4MX6A 4NG7A 4OETA 4LVQA 4OYVA 2UYEA 1IXIA 1FPDA 2QL3A 1LSTA 2D3IA 2VOZA 3H6UA 3EHTA 1A8FA 2DYXA 3LSLA 3LSFB 1HSLA 3V83A 1B5IA 4EQ9A 2ONSA 1LB8A 3G3FA 4BLAA 1P99A 4PFTA 4U4SA 1R9LA 5I84A 1IZ1A 1NNFA 4HXVA 1DOTA 2GRVA 4ESXA 3SESA 3B7DA 3BKIB 1H43A 1FRPA 5DVIA 4MNIA 2V84A 5AA2A 2MKZA 4ISUA 3PUZE 1LAHE 1XVYA 1RYOA 4ELQA 3AXFA 2P2AA 3TTMA 1FQEA 3H06B 3IK6B 1IMBA 1NV7A 3CFXA 3A3UA 2F7CA 2XA5A 2NWJA 4QFKA 2WBBA 2PYYA 2XXHA 3PPQA 1D9YA 2FVZA 1PDAA 1LAGE 3OELA 3FUZA 4O7IA 2OWTA 1FBHA 1HSJA 3K6VA 3TFLA 1AIVA 3DP8A 2XXWA 2E1SA 3CSBA 1OVTA 1P1NA 5IM2A 4GXAA 4NHBA 4F39A 2I49A 4OVQA 2RF1A 2RCBA 3O6HA 2RINA 4GLIA 1B0LA 2FIXA 4UA8A 2V3UA 4NGUA 5TP9A 3EHUA 2GHAA 4R74A 3U92A 5CMBA 3IOWA 4YMAA 1NKXA 2X7QA 1MXWA 5CI5A 1MXUA 2X26A 1LBWA 4HE2A 1P1OA 5TPAB 3H3GA 2H99A 4RYAA 1JQFA 5L9SA 4ZZAA 1NI9A 1KWHA 4QRZA 1US5A 2FBPA 4AQ4A 3MC2A 4H65A 1O63A 2PT1A 2F6PA 3FVNA 1NL5A 4JXIA 2QVUA 3U94A 3KSXA 3D4GA 1B46A 4KHZE 1UTHB 5FHMA 3L6HA 4ESWA 4WXJA 3MPLA 2DWJA 2HQ0A 4BDOA 3EN3A 3IO4A 2H4IA 5EHSA 1DTGA 4LATA 2P0SA 3MVWA 4YB7A 3TCFA 4YKPA 1USYH 3TELA 2Y5KA 1QGXA 1DCUA 4O7MA 2A5TB 4BDNA 2Y7IA 1O64A 5B70A 2ZNSA 3QYTA 3N94A 4DCYA 4H5GA 2KQZA 5CMKA 4PC9A 3MVZA 2DWAA 3KN3A 3ISPA 4YAHX 5ISUA 4I8CA 1BP5A 2M8CA 1SPIA 2Q9TA 2RC9A 3THIA 3C35A 2D21A 4NAPA 3FXQA 4QFPA 3PPNA 3RY3A 3C9HA 2AL5A 2VPOA 3IOUA 3PPPA 3RYDA 4GWZA 1FQAA 3ECRA 4PP0A 2O1MA 5H8NB 4ZE9A 2O51A 2YPNA 3ZKKA 4F2OA 5L9OA 3PPRA 1SW1A 4POWA 2CEYA 1QULA 1A55A 2HZKA 4M1VA 2DP8A 2HHMA 1B1XA 3UP9A 1LBXA 2Q74A 3MZBA 4F3PA 5K2YA 5ET5A 2B4MA 5I2NB 3CHGA 4PFYA 2ZZXA 5IAIA 2F78A 4TQUQ 1IUDA 4LONB 1FBPA 1OIBA 3O29A 4G8MA 5EYGA 4EQBA 1B05A 2OLBA 4XKRA 1A40A 3Q25A 2VGQA 3VDFA 2XD2A 1Y4TA 1NFTA 3G7WA 5I59B 2G93A 4GWOA 5ESYA 1I69A 5J1DA 2RC8A 4XEQA 3O9PA 4DXCA 2QS2A 4OANA 3MZ9A 1B3GA 5FHOA 4Q8RA 3V89B 4NF8A 1D3KA 2ZZWA 5ICQA 2O7UA 5J16A 4TLLB 2QS1A 4G68B 4X1DA 4GWUA 4PF6A 4OVPA 5CMMA 3TTRA 1EU8A 1SVXB 2XXIA 1WVJA 4P9KA 4GIZA 3QUFA 3IAZA 1WODA 4NX1A 1H44A 1NH7A 4Z7EA 4RY1A 3T9HB 2Z8EA 2FIEA 3ZSFA 1BKAA 1Y20A 3GZGA 4ZZEA 1VFEA 1NV4A 1FTKA 1MM7A 5CMCA 1P1UA 3OXNA 4MAGA 3OD7A 5EQ8A 3M3KA 4UABA 4EXLA 3R26A 3HCQA 1IITA 1N84A 4XFEA 1Z7NE 2FA7A 2UYFA 5I57A 5ET6A 3IO6A 3MWBA 3K6XA 5ET7A 4X1BA 3T96B 1PEBA 1ELJA 4U21A 4QBAA 4HE0A 3I5OA 2XX8A 5FTHA 3A09A 2OX3A 2UVJA 4NN3A 4R9FA 3I6VA 2YLNA 5CC2A 4PFWA 4E0XA 1MDP1 2XXKA 3UGWA 4I40A 4TOZA 3RN8A 4R2FA 1XHYA 3TTLA 4AS5A 4YICA 2THIA 1JETA 3K0VA 1AL3A 1NNPA 3B6TA 2PFYA 5DTBA 4ZEFA 1A54A 3H7MA 1B6HA 2HZLA 1UTBB 2HEUA 4FECA 2A5SA 3TAJA 3F11A 4OFLA 4ZEIA 3T22A 2G29A 3FXBA 3MUQA 3OSRA 4PF8A 4KPTA 2Z8DA 4N91A 2JJKA 1FPBA 3SDFA 4N6DA 1POY1 3MP8A 3MPKA 2ZMBA 3K4UA 2PMSA 1M5CA 3M8UA 4OVTA 1FBCA 3GLBA 4KFQA 1MM6A 3FJMA 3VFJA 1SW2A 3OMBA 1FBFA 3R6UA 3K00A 2F34A 5KDTB 1MQDA 1MXXA 3RLFE 4OESA 3FV1A 1IXCA 1DPPA 4OMBA 2CZHA 2WYPA 2DWIA 4F31B 1N7WA 4QFOA 3G3GA 5H8SA 3PGFA 1POTA 3G3HA 4GWXA 4P47A 1PBPA 4WEDA 1MH3A 3G3KA 1GTKA 1MQJA 2QSXA 2Z22A 2HCAA 4XKQA 2Q8MA 2XWIA 4DE8A 4RK9A 4C1TA 2Y7KA 2F6GA 1JW4A 1EZ9A 3E3KA 1FJ6A 4G8NA 4PDDA 2IEEA 2WX9A 4X8RA 4OERA 5I3SA 4DLDA 2L5VA 5DVFA 3VLWA 3IJOB 4PAFA 4G61A 5K2XA 4U22A 2XXRA 3EKIA 3QXMA 4MFIA 4FATA 3C31A 3K2DA 4F18A 2DOJA 3HHFA 5IZ3B 1QVSA 1ZU0A 1RKMA 4N07A 1OLAA 4F19A 1FTAA 4DIGA 3K02A 3SETA 3KZGA 4MHFA 2ANJA 1M5FA 4KD5A 4F2QA 1LGBC 1Y3PA 3FJGA 1YXIA 1L5TA 1KZ8A 2CEXA 4ZE8A 4I62A 2I0CA 2UVIA 3FVOA 1TT1A 1SDXA 1MPDA 3RPWA 4JDFA 5H8QB 4RNSA 5H8NA 4NEDA 4QFNA 1IMCA 3RTFB 4FEBA 4EF2A 2OK2A 3LV0A 3HHGA 4IO5A 4KYSA 1SW4A 2HAUA 2OWSA 3W9VA 4Q0CA 4U4XA 5DEXA 4EQ7A 1MPBA 1NV3A 1PBQA 3ODBA 2AYSA 4F1YA 4E0WA 3UORA 1FTLA 4JBZA 4HTGA 4H0WA 3OOAA 2F7AA 2ESNA 2O7IA 2P3VA 4GL8A 5LDZA 4O8MA 2RKMA 4POXA 1B5HA 3ZS6A 4H5FA 1FTOA 3PUYE 1LAFE 2F7BA 4BDLA 5T3JA 1NV2A 4PFUA 1FQDA 2DXYA 3JYRA 4XIGQ 3TCHA 4MNPA 4H67A 1S7YA 1IMEA 4X9TA 2CZLA 3IOVA 4FE8A 4H1XA 2I0BA 4QXDA 3LUYA 3TODA 3H6TA 1EYKA 4N8GA 3FVKA 4ND9A 2P3NA 4IO6A 2H98A 1OMPA 4I9DA 2RC7A 1FQFA 4N15A 3CIJA 3M3LA 4YB6A 1LFIA 1MG1A 2VD2A 5AA4B 1MQIA 2R8TA 2ABHA 4P11A 5JTYA 3E9XA 3Q27A 4F22A 2GH9A 2NXOA 2PT2A 3QUJA 4OEUA 4NWCA 4FIMA 4LQ5A 4NTLA 3TTNA 3K1MA 1QUIA 4H45A 4FBPA 4GXSB 4R73A 3H6WA 1FCKA 1JEUA 3G3JA 3S9EA 3CG1A 4YZZA 2DVCA 3OO9A 4GL0A 3TQLA 3KN8A 3FJ7A 2Q8JA 1ZJLA 3KN7A 3MSTA 4N81A 3IOTA 3H03A 4R6HA 2DSFA 3FATA 3RUMA 3V8XB 4TLMB 4OVJA 3N5LA 4P1LA 1URDA 2H5YA 4OENA 3C32A 5H8FB 4P0IA 1G0HA 2IA4A 3PMVA 2UVHA 1PB9A 4MIJA 4H46A 2BJIA 3DLNA 1FPIA 2I3WA 4GX6A 3EQ1A 4JVDA 1EYIA 4P56A 2DE3A 3EPEA 5I56B 1NNKA 3RNNA 3E13X 4K3FA 3ILTB 1A8EA 5BUUA 1B7UA 1RDXA 4MBPA 4PFBA 1H3DA 2FYIA 2HAVA 1FQBA 4ELOA 4JVCA 3D1RA 1JW1A 1DBZA 4U1ZA 3OO8A 4NWDA 1EYJA 1VSOA 4LP2B 3PTYA 4IGRA 3PMWA 3MBPA 4MNCA 5H8HB 3HO7A 4GBVA 1IEJA 1LAXA 1NUXA 3OEKA 4GWYA 3K01A 5HBCA 3IX1A 3USDA 2AL4A 3D4CA 3PMXA 2ZXTA 3N26A 5A5XA 4ELRA 1Q1KA 2XXQA 3LSXA 1JVYA 2I4CA 3RQTA 4OVRA 4XXUA 4YMBA 4PFRA 1B7HA 2F35A 4JSOA 4P1EA 1DTZA 2ZYMA 1DSNA 1II5A 1N04A 3S9MC 3T9VA 4RPOA 3OENA 4LQ2A 5DVJA 4GF8A 1F9BA 5JEIA 5I2KA 2DS9A 1WDNA 1N7XA 4OA4A 4PTKA 5AA2B 1PB8A 2Z23A 5F1QA 4JB7A 2Q2CA 1MS7A 4ZEBA 2F3BA 4OTEA 4NF5A 4Q30B 4DCXA 3K1NA 2V25A 1B4ZA 2Z8FA 5B7DA 3RT6B 3UN6A 4IO2A 2XXUA 1NV1A 3B6QA 1NH8A 1XVXA 3HSTA 3BFTA 4XF5A 2ZNUA 1ATGA 5EQ7A 3PD9A 4PE5B 4LA9A 2Q88A 3U1OA 2NOOA 1Y3QA 1SQYA 1K9ZA 2XXYA 4KQPA 3BBRA 4RXLA 3QSLA 1IIWA 2Y7WA 3SEVA 4PBHA 3PUXE 4F29A 5TP9B 1Q35A 1RDZA 3VV5A 2HPGA 1VE4A 2HXRA 3S9LC 3EHSA 3KFMA 1XT8A 2V93A 3RPLB 3FXUA 2CZKA 1Y9UA 4KI0E 2Y84A 1GV8A 3MJNA 4AB5A 2XD3A 3KJTA 1IQ7A 3TCGA 1B3LA 4IY6A 4F1UA 1MY3A 1NV5A 4N8YA 4F3BA 5AA1A 3KC0A 4JVIA 2WEFA 1FBGA 1S9TA 4BDQA 1BIYA 3RT8A 5EQ9A 4GOTA 3BIHA 3TMGA 2UXAA 3R7XA 3MZ1A 2F97A 4QHQA 1I6QA 1Z7ME 5IGAA 3FV2A 1LLSA 4U23A 4F3GA 4PDHA 4H8JA 3T1BA 2NUVA 5ELVA 3IFAA 1DPEA 3IB1A 1B3EA 1NUZA 1A7LA 1MDQA 4UACA 5TPAA 3SZPA 4H8IA 4EUOA 1MXYA 2QFLA 2H25A 3VLVA 4YKJA 3O28A 1EH3A 2I6EA 3A3CA 3U8QA 2GHBA 4HCYA 1ZBMA 3H4ZA 4IO4A 2UVGA 1M5BA 4PAKA 1D9QA 4G68C 3PPOA 2Q89A 4AB6A 3MW0A 3CFZA 1AH5A 4HS7A 1UTHA 1GGGA 3QMFA 2XXTA 1QUJA 3OEMA 4FEDA 4XKNA 4LUBA 2XXPA 1FTMA 5FTIA 3TTKA 5EYFA 4GX4A 3L6GA 5ITPA 3T66A 1FPGA 1H76A 3T9UA 4OWDA 3FZVA 5HM4B 4YKKA 2O6AA 5FHNA 1AOVA 2REJA 4ECFA 1AMFA 3LSWA 4IGTA 2OBGA 2A5TA 3MP6A 4R2BA 2VHAA 2VT5A 3IB2A 1LEVA 4MH5A 4PQJA 3TKDA 2Y7RA 4ZEKA 3FIRA 4NF6B 4N6PA 2XWOA 2B3BA 3QAXA 3UK4A 5I58B 5KCJB 3MVXA 4QF9A 2DXRA 1BK4A 1FPKA 3N6TA 1J1NA 1R6ZA 2LAOA 1B2HA 1XOCA 1NUYA 4N6KA 5IKBA 1QUKA 4NF8B 2KR0A 2XWVA 3EF7A 5H8HA 4JSDA 3IR1A 4G2ZA 5AA2D 2VD3A 3HV1A 2OZZA 3SEXA 1B52A 4LZ8A 3DP6A 4LZ5A 3CFLA 3JZJA 4GD5A 3W15C 5A5LA 4IB2A 5DW8A 1SYHA 3C34A 1M5DA 1YZ0A 1B1HA 3KEIA 5I2NA 4RJZA 4QSDA 3KSJA 4NF4B 4YB5A 3O6GA 5AE4A 4O3AA 3I3VA 3G3IA 4I1DA 5EHMA 3CI8A 2XWKA 3TEPA 4GRKA 3TZAA 5TU0A 3MYUA 2ZNTA 3GBBA 5I57B 4P0GA 5I59A 3FBPA
chains in the Genus database with same CATH topology
1FPIA 4P8BA 4GX6A 4NX1A 1JP4A 4JVDA 2F5XA 1EYIA 3KBZA 4P56A 4PCDA 2FIEA 1LBVA 2DE3A 1LBZA 1NV4A 2PFZA 4MAGA 5EQ8A 4UABA 1FPJA 2B4LA 1RDXA 2DE4A 4XFEA 3NOHA 4PFBA 5ET6A 1FPFA 4MEVA 1XI6A 5ET7A 4JVCA 2WYKA 3D1RA 5F24A 1DBZA 4QBAA 2DDKA 4HE0A 4I3YA 1YYZA 2CZIA 1EYJA 3PTYA 2OX3A 4NN3A 4PGPA 4MNCA 5LTCA 4GBVA 2XXKA 5FBPA 4I40A 1NUXA 4GWYA 4AS5A 1RDYA 4YICA 3W9WA 4GBWA 2Y5LA 3ROJA 2QPQA 2PFYA 3U65A 2HZLA 1FPLA 3RPLA 4OVRA 4PFRA 4MX6A 4P1EA 4NG7A 1AWBA 3FXBA 2WBDA 1FPDA 2VPNA 4PF8A 4N91A 2JJKA 1FPBA 4N6DA 4OA4A 4PTKA 1FJ9A 4OVTA 2QVVA 1FBCA 1NV6A 2F3BA 1FBFA 4MMPA 4HXVA 4DI4B 2CZHA 2WYPA 1FSAA 1NV1A 1FRPA 4MNIA 4GWXA 4P47A 2MKZA 4XF5A 5EQ7A 1INPA 3BIGA 1IMBA 1NV7A 1K9ZA 2Q8MA 2XA5A 2XWIA 2WBBA 5I5PA 4PBHA 1FJ6A 4PDDA 1RDZA 2FVZA 2HPGA 2HXRA 2WX9A 3E79A 4X8RA 5I3SA 4PAIA 5I7IA 2L5VA 4O7IA 1G0IA 1FBHA 2V4CA 3RPLB 1IMFA 2CZKA 4PAFA 4G61A 5IM2A 1K9YA 4NHBA 3EKIA 4O94A 4OVQA 4PE3A 4F1UA 3B8BA 4KXPA 1NV5A 4F18A 1FPEA 5IZ3B 2FIXA 4N8YA 3KC0A 4JVIA 4NGUA 4F19A 4X04A 2WEFA 1FBGA 1FTAA 1CNQA 4PETA 4MHFA 5EQ9A 2F3DA 3BIHA 1IMDA 4GX3A 1LBWA 4HE2A 1YXIA 1KZ8A 2CEXA 5IGAA 4DI3D 5IZ3A 4PDHA 3T1BA 1NI9A 1IMCA 3IFAA 4PGNA 2FBPA 3LV0A 3W9VA 1NUZA 2FHYA 4HCWA 2QVUA 1FBDA 1NV3A 1NV0A 3SZPA 1LBYA 1VDWA 2QFLA 4NF0A 4MJOA 1FBEA 4HCYA 4PAKA 4HE1A 1D9QA 2P3VA 5LDZA 2Y5KA 4O8MA 5EQAA 1QGXA 1DCUA 4O7MA 5EYHA 3QMFA 5JK4A 3KC1A 4N17A 1NV2A 5T3JA 3IFCA 5IZ1A 2KQZA 2DE2A 2PCRA 4MNPA 1KA1A 1IMEA 4X9TA 4PC9A 4GX4A 3ISPA 4QXDA 1FPGA 3HFUA 1SPIA 2Q9TA 1EYKA 4N8GA 4P3LA 4AS4A 2P3NA 4NAPA 1Q9DA 4N4UA 2VPOA 1NUWA 4OVSA 3RYDA 4GWZA 3LUZA 4I3EA 4N15A 2VT5A 4NQ8A 1LEVA 4F1VA 5CM6A 1KA0A 2CEYA 2R8TA 2HZKA 2XWOA 4M1VA 4IR8A 2HHMA 3E78A 1BK4A 1FPKA 2GQ1A 1LBXA 2Q74A 3A29A 5ET5A 1DK4A 2B4MA 3CHGA 1NUYA 2ZZXA 4N6KA 4LN5A 4GWWA 4H45A 4FBPA 2KR0A 2XWVA 2V3QA 4GWSA 1FBPA 4PFIA 5EYGA 4YZZA 2OWZA 3B50A 5ESYA 3MSTA 5J1DA 5A5LA 4N81A 5DW8A 4XEQA 1YZ0A 4OANA 2ZZWA 2DVZA 5J16A 4P1LA 2QVRA 3T0JA 4GWUA 4PF6A 2XWKA 5IZZA 4OVPA 3MYUA 4PBQA 1G0HA 2ZZVA 5ET8A 3GYYA 4P9KA 4MIJA 4H46A 1IMAA 2BJIA 4MCOA 3FBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OA4 A;  4P8B A;  4NAP A;  4NX1 A;  4N4U A;  4MCO A;  4P56 A;  4PCD A;  4OVT A;  2VPO A;  4OVS A;  4N15 A;  2PFZ A;  4NQ8 A;  2CEX A;  4MAG A;  5CM6 A;  4MMP A;  4UAB A;  5IGA A;  4DI3 D;  4PDH A;  2CEY A;  2HZK A;  4XFE A;  4DI4 B;  2WYP A;  2XWO A;  4PFB A;  4MEV A;  4PGN A;  4MNI A;  2WYK A;  4P47 A;  4XF5 A;  4NN3 A;  4PGP A;  2ZZX A;  4MNC A;  4N6K A;  4LN5 A;  5LTC A;  4NF0 A;  2XWV A;  2XXK A;  2XA5 A;  2XWI A;  4PFI A;  5I5P A;  4PBH A;  4YZZ A;  4YIC A;  4PDD A;  2HPG A;  2WX9 A;  4PAK A;  4X8R A;  3B50 A;  4PAI A;  2PFY A;  3U65 A;  5I7I A;  4O8M A;  2V4C A;  4XEQ A;  4OAN A;  2HZL A;  4PAF A;  4O7M A;  5IM2 A;  4NHB A;  4OVR A;  2ZZW A;  4O94 A;  4PFR A;  4N17 A;  4OVQ A;  4PE3 A;  4P1L A;  4MX6 A;  4P1E A;  4NG7 A;  4MNP A;  4PF6 A;  3FXB A;  2XWK A;  5IZZ A;  4OVP A;  4PC9 A;  4PBQ A;  4N8Y A;  2ZZV A;  2VPN A;  4NGU A;  4PF8 A;  4X04 A;  4N91 A;  3GYY A;  4P9K A;  4MIJ A;  4N8G A;  4PET A;  4N6D A;  4P3L A;  4MHF A; 
#chains in the Genus database with same CATH topology
 1N0T A;  2F5X A;  4PCD A;  3HPI A;  1LBV A;  3T93 B;  2X7P A;  1LBZ A;  1MPC A;  1LCT A;  4Z0I A;  4G68 A;  1MY2 A;  1D4N A;  1GVC A;  3SEW A;  4KCD A;  1FPJ A;  3CVG A;  2B4L A;  2DE4 A;  1Y1Z A;  3C33 A;  3Q29 A;  2YJP A;  1QW0 A;  3DEL B;  1FPF A;  4MEV A;  1TXF A;  1MXZ A;  1P1Q A;  1XI6 A;  3WAE A;  1URG A;  4RA1 A;  3C4M A;  4QFL A;  2WYK A;  4G8H A;  5F24 A;  1S50 A;  1B0H A;  1EZO A;  1MXV A;  2XX7 A;  1YYZ A;  2CZI A;  1B40 A;  1Y3N A;  2Y7P A;  4PGP A;  4DZ1 A;  1LFH A;  5LTC A;  3MAM A;  5FBP A;  4ZED A;  2RCA A;  1TFA A;  3RGY A;  3VVF A;  4DXU A;  4C1U A;  2Y5L A;  3ROJ A;  1B5J A;  4WEP A;  3PV0 E;  5DT6 A;  1VFD A;  1SI0 A;  1SI1 A;  1Y4C A;  4ZS9 A;  3ILU B;  4ZDM A;  3RPL A;  3SKP A;  4KCC A;  1UQW A;  2ONR A;  3VVE A;  4QSE A;  1AWB A;  3S9N C;  2ZYO A;  1MRP A;  2WBD A;  3TPA A;  2P1S A;  1O7T A;  2VPN A;  2CMO A;  2H9B A;  4Q5T A;  1CE2 A;  1ZKB A;  4MLV A;  1FJ9 A;  5BWJ A;  5CBR A;  2QVV A;  1UTB A;  2OJT A;  2W7Y A;  1YCJ A;  4NE4 A;  4EXK A;  1NV6 A;  3LR1 A;  2O84 X;  1B3F A;  2FNC A;  4MMP A;  3LBS A;  4RK2 A;  3KOT A;  3TYH A;  2ALU A;  4DI4 B;  4LZ7 A;  3O97 A;  1FSA A;  1SD3 A;  4OFO A;  2ONK E;  1YAE A;  4OFJ A;  1VR5 A;  1A99 A;  3DM0 A;  4U2R A;  3B6W A;  4R9G A;  1INP A;  1MH4 A;  3KOS A;  4OHN A;  2BJJ X;  2QMX A;  3BIG A;  1P1W A;  1MQG A;  3CG3 A;  5KDT A;  2VP1 A;  5M2V A;  4MF3 A;  1EZP A;  1QKA A;  2QMW A;  5I5P A;  1SW5 A;  5CRY A;  3CR9 A;  4WKM A;  3MVY A;  3QIM A;  3Q28 A;  1ZLQ A;  1RYX A;  4F3S A;  1B3H A;  3E79 A;  4PAI A;  5ICT A;  5I7I A;  1QKB A;  3TUS A;  3PD8 A;  1G0I A;  1NNT A;  3CSG A;  2V4C A;  1N76 A;  3T9X B;  1IMF A;  1LBB A;  1N3X A;  1K9Y A;  5LOM A;  1FQC A;  4O94 A;  4PE3 A;  2PVU A;  2D5W A;  1JEV A;  3B8B A;  3SER A;  4KXP A;  3V5A A;  1FPE A;  4KR5 A;  4IO3 A;  4OXV A;  2O1L A;  4BDR A;  4X04 A;  1CNQ A;  4PET A;  2DWH A;  3OO6 A;  4U1O A;  1PC3 A;  1OLC A;  2F3D A;  1IMD A;  2QRY A;  4GX3 A;  4KYE A;  5DEX B;  1H45 A;  2I4B A;  4XKP A;  1USY E;  2R6G E;  3GXA A;  2I48 A;  1YTV A;  1R1N A;  4X48 A;  1N3W A;  2Q2A A;  1JNF A;  3PU5 A;  3DP4 A;  3ONM A;  1UIU A;  3PUV E;  5IZ3 A;  4DI3 D;  3IL1 B;  4BDM A;  4IO7 A;  3LC8 A;  4NF6 A;  2HFB A;  4R75 A;  4PGN A;  4EF1 A;  1LFG A;  2QJE A;  2R9J A;  5ITO A;  2E0S A;  2FHY A;  3C36 A;  5I58 A;  5KCJ A;  3P7I A;  4OZ9 A;  4HCW A;  4G77 A;  1FBD A;  4NMY A;  4DDD A;  1URS A;  1NV0 A;  1LBY A;  1VDW A;  2O68 A;  2V3T A;  1PB7 A;  1B4H A;  3N6U A;  4NF0 A;  3KJ7 A;  4O3C A;  1R9Q A;  4MJO A;  5H8Q A;  2R71 A;  1I6B A;  1FBE A;  4GFR A;  3Q26 A;  2XX9 A;  1BLF A;  3OSQ A;  1US4 A;  1FW0 A;  2B3F A;  4HE1 A;  4JWX A;  1GR2 A;  4M4G A;  3MP1 A;  1T0K A;  5EQA A;  5L9M A;  2REG A;  5EYH A;  5JK4 A;  1MQH A;  3KC1 A;  4N17 A;  4NF4 A;  3S4U A;  3IFC A;  5IZ1 A;  2DE2 A;  2PCR A;  1KA1 A;  2XXX A;  4IY5 A;  3VXB A;  2QS4 A;  4YKI A;  5DYH A;  3K6U A;  4ZEC A;  1B32 A;  3U93 A;  3HFU A;  2QS3 A;  1JVX A;  2NVU B;  4P3L A;  5JTY B;  4AS4 A;  3E4R A;  1Q9D A;  3KGC A;  3OO7 A;  1D9V A;  4N4U A;  1IXG A;  1QJM A;  1XS5 A;  3UA8 A;  1NUW A;  4OVS A;  3LUZ A;  4I3E A;  4NQ8 A;  3M3F A;  3U72 A;  4F1V A;  3FXR A;  2I3V A;  4C0R A;  5CM6 A;  2AIX A;  2O69 A;  1KA0 A;  4GQO A;  1M5E A;  4IR8 A;  4FJP A;  3FVG A;  3E78 A;  3UIF A;  2GQ1 A;  4YU0 A;  1UIV A;  4EDP A;  1TFD A;  4XTC Q;  2XXV A;  4FOR A;  4N13 A;  3A29 A;  3O2A A;  1DK4 A;  1DMB A;  2OCU A;  4MLQ A;  1ZTY A;  4LN5 A;  4R6Y A;  4GWW A;  3H6V A;  4KYD A;  3K1P A;  4ELP A;  2V3Q A;  4H6D A;  4GWS A;  4JWO A;  4R72 A;  5AA4 A;  4OQO A;  3PUW E;  4PFI A;  3QK6 A;  3SEY A;  3CRB A;  1B9J A;  2F8D A;  3VVD A;  3FAS A;  2OWZ A;  1CB6 A;  1B7Z A;  1MY4 A;  3B50 A;  2HXW A;  1HSE A;  5HPQ A;  1SYI A;  1OQG A;  1OQH A;  3IOR A;  3K6W A;  4OEV A;  5AA3 A;  1OVB A;  2DVZ A;  2QVR A;  3O6I A;  4O3B A;  3T0J A;  2XHD A;  1MY1 A;  3TDJ A;  1ANF A;  5IZZ A;  4DXB A;  1IXH A;  4PBQ A;  4FAJ A;  2ZZV A;  5ET8 A;  1LCF A;  3GYY A;  4HW8 A;  2ZYN A;  2DQV A;  1IMA A;  4MCO A;  1ZIU A;  4P8B A;  1JP4 A;  1NMU A;  1FTJ A;  5L8D A;  4R6K A;  3KBZ A;  1TWY A;  3TQW A;  3IB0 A;  3VE1 B;  2PFZ A;  3MQ9 A;  1XC1 A;  5H8F A;  1YPN A;  3WAF A;  3NOH A;  2PX1 A;  1Y1M A;  1ZMG A;  4THI A;  4L17 A;  1I6A A;  2WKY A;  3O66 A;  3BFU A;  2PBW A;  3SEU A;  1LBC A;  4RPN A;  2KLF A;  2DDK A;  5A5X B;  4I3Y A;  1LB9 A;  3VXC A;  5I56 A;  1B58 A;  1SBP A;  2F36 A;  3JV9 A;  5CBS A;  2I58 A;  3RTW B;  3KG2 A;  3KBR A;  5F7V A;  4GVO A;  1BTJ A;  3IJX B;  1MY0 A;  3GBA A;  4G4P A;  4ONY A;  3VLU A;  3FGS A;  1RDY A;  4QSC A;  3W9W A;  4GBW A;  1JW5 A;  2QPQ A;  2GFE A;  2ZYK A;  3HN0 A;  5I2K B;  5KZT A;  3U65 A;  3ZKL A;  2B65 A;  4JWY A;  3S2V A;  1FPL A;  3FD3 A;  1B51 A;  4NF5 B;  4MX6 A;  4NG7 A;  4OET A;  4LVQ A;  4OYV A;  2UYE A;  1IXI A;  1FPD A;  2QL3 A;  1LST A;  2D3I A;  2VOZ A;  3H6U A;  3EHT A;  1A8F A;  2DYX A;  3LSL A;  3LSF B;  1HSL A;  3V83 A;  1B5I A;  4EQ9 A;  2ONS A;  1LB8 A;  3G3F A;  4BLA A;  1P99 A;  4PFT A;  4U4S A;  1R9L A;  5I84 A;  1IZ1 A;  1NNF A;  4HXV A;  1DOT A;  2GRV A;  4ESX A;  3SES A;  3B7D A;  3BKI B;  1H43 A;  1FRP A;  5DVI A;  4MNI A;  2V84 A;  5AA2 A;  2MKZ A;  4ISU A;  3PUZ E;  1LAH E;  1XVY A;  1RYO A;  4ELQ A;  3AXF A;  2P2A A;  3TTM A;  1FQE A;  3H06 B;  3IK6 B;  1IMB A;  1NV7 A;  3CFX A;  3A3U A;  2F7C A;  2XA5 A;  2NWJ A;  4QFK A;  2WBB A;  2PYY A;  2XXH A;  3PPQ A;  1D9Y A;  2FVZ A;  1PDA A;  1LAG E;  3OEL A;  3FUZ A;  4O7I A;  2OWT A;  1FBH A;  1HSJ A;  3K6V A;  3TFL A;  1AIV A;  3DP8 A;  2XXW A;  2E1S A;  3CSB A;  1OVT A;  1P1N A;  5IM2 A;  4GXA A;  4NHB A;  4F39 A;  2I49 A;  4OVQ A;  2RF1 A;  2RCB A;  3O6H A;  2RIN A;  4GLI A;  1B0L A;  2FIX A;  4UA8 A;  2V3U A;  4NGU A;  5TP9 A;  3EHU A;  2GHA A;  4R74 A;  3U92 A;  5CMB A;  3IOW A;  4YMA A;  1NKX A;  2X7Q A;  1MXW A;  5CI5 A;  1MXU A;  2X26 A;  1LBW A;  4HE2 A;  1P1O A;  5TPA B;  3H3G A;  2H99 A;  4RYA A;  1JQF A;  5L9S A;  4ZZA A;  1NI9 A;  1KWH A;  4QRZ A;  1US5 A;  2FBP A;  4AQ4 A;  3MC2 A;  4H65 A;  1O63 A;  2PT1 A;  2F6P A;  3FVN A;  1NL5 A;  4JXI A;  2QVU A;  3U94 A;  3KSX A;  3D4G A;  1B46 A;  4KHZ E;  1UTH B;  5FHM A;  3L6H A;  4ESW A;  4WXJ A;  3MPL A;  2DWJ A;  2HQ0 A;  4BDO A;  3EN3 A;  3IO4 A;  2H4I A;  5EHS A;  1DTG A;  4LAT A;  2P0S A;  3MVW A;  4YB7 A;  3TCF A;  4YKP A;  1USY H;  3TEL A;  2Y5K A;  1QGX A;  1DCU A;  4O7M A;  2A5T B;  4BDN A;  2Y7I A;  1O64 A;  5B70 A;  2ZNS A;  3QYT A;  3N94 A;  4DCY A;  4H5G A;  2KQZ A;  5CMK A;  4PC9 A;  3MVZ A;  2DWA A;  3KN3 A;  3ISP A;  4YAH X;  5ISU A;  4I8C A;  1BP5 A;  2M8C A;  1SPI A;  2Q9T A;  2RC9 A;  3THI A;  3C35 A;  2D21 A;  4NAP A;  3FXQ A;  4QFP A;  3PPN A;  3RY3 A;  3C9H A;  2AL5 A;  2VPO A;  3IOU A;  3PPP A;  3RYD A;  4GWZ A;  1FQA A;  3ECR A;  4PP0 A;  2O1M A;  5H8N B;  4ZE9 A;  2O51 A;  2YPN A;  3ZKK A;  4F2O A;  5L9O A;  3PPR A;  1SW1 A;  4POW A;  2CEY A;  1QUL A;  1A55 A;  2HZK A;  4M1V A;  2DP8 A;  2HHM A;  1B1X A;  3UP9 A;  1LBX A;  2Q74 A;  3MZB A;  4F3P A;  5K2Y A;  5ET5 A;  2B4M A;  5I2N B;  3CHG A;  4PFY A;  2ZZX A;  5IAI A;  2F78 A;  4TQU Q;  1IUD A;  4LON B;  1FBP A;  1OIB A;  3O29 A;  4G8M A;  5EYG A;  4EQB A;  1B05 A;  2OLB A;  4XKR A;  1A40 A;  3Q25 A;  2VGQ A;  3VDF A;  2XD2 A;  1Y4T A;  1NFT A;  3G7W A;  5I59 B;  2G93 A;  4GWO A;  5ESY A;  1I69 A;  5J1D A;  2RC8 A;  4XEQ A;  3O9P A;  4DXC A;  2QS2 A;  4OAN A;  3MZ9 A;  1B3G A;  5FHO A;  4Q8R A;  3V89 B;  4NF8 A;  1D3K A;  2ZZW A;  5ICQ A;  2O7U A;  5J16 A;  4TLL B;  2QS1 A;  4G68 B;  4X1D A;  4GWU A;  4PF6 A;  4OVP A;  5CMM A;  3TTR A;  1EU8 A;  1SVX B;  2XXI A;  1WVJ A;  4P9K A;  4GIZ A;  3QUF A;  3IAZ A;  1WOD A;  4NX1 A;  1H44 A;  1NH7 A;  4Z7E A;  4RY1 A;  3T9H B;  2Z8E A;  2FIE A;  3ZSF A;  1BKA A;  1Y20 A;  3GZG A;  4ZZE A;  1VFE A;  1NV4 A;  1FTK A;  1MM7 A;  5CMC A;  1P1U A;  3OXN A;  4MAG A;  3OD7 A;  5EQ8 A;  3M3K A;  4UAB A;  4EXL A;  3R26 A;  3HCQ A;  1IIT A;  1N84 A;  4XFE A;  1Z7N E;  2FA7 A;  2UYF A;  5I57 A;  5ET6 A;  3IO6 A;  3MWB A;  3K6X A;  5ET7 A;  4X1B A;  3T96 B;  1PEB A;  1ELJ A;  4U21 A;  4QBA A;  4HE0 A;  3I5O A;  2XX8 A;  5FTH A;  3A09 A;  2OX3 A;  2UVJ A;  4NN3 A;  4R9F A;  3I6V A;  2YLN A;  5CC2 A;  4PFW A;  4E0X A;  1MDP 1;  2XXK A;  3UGW A;  4I40 A;  4TOZ A;  3RN8 A;  4R2F A;  1XHY A;  3TTL A;  4AS5 A;  4YIC A;  2THI A;  1JET A;  3K0V A;  1AL3 A;  1NNP A;  3B6T A;  2PFY A;  5DTB A;  4ZEF A;  1A54 A;  3H7M A;  1B6H A;  2HZL A;  1UTB B;  2HEU A;  4FEC A;  2A5S A;  3TAJ A;  3F11 A;  4OFL A;  4ZEI A;  3T22 A;  2G29 A;  3FXB A;  3MUQ A;  3OSR A;  4PF8 A;  4KPT A;  2Z8D A;  4N91 A;  2JJK A;  1FPB A;  3SDF A;  4N6D A;  1POY 1;  3MP8 A;  3MPK A;  2ZMB A;  3K4U A;  2PMS A;  1M5C A;  3M8U A;  4OVT A;  1FBC A;  3GLB A;  4KFQ A;  1MM6 A;  3FJM A;  3VFJ A;  1SW2 A;  3OMB A;  1FBF A;  3R6U A;  3K00 A;  2F34 A;  5KDT B;  1MQD A;  1MXX A;  3RLF E;  4OES A;  3FV1 A;  1IXC A;  1DPP A;  4OMB A;  2CZH A;  2WYP A;  2DWI A;  4F31 B;  1N7W A;  4QFO A;  3G3G A;  5H8S A;  3PGF A;  1POT A;  3G3H A;  4GWX A;  4P47 A;  1PBP A;  4WED A;  1MH3 A;  3G3K A;  1GTK A;  1MQJ A;  2QSX A;  2Z22 A;  2HCA A;  4XKQ A;  2Q8M A;  2XWI A;  4DE8 A;  4RK9 A;  4C1T A;  2Y7K A;  2F6G A;  1JW4 A;  1EZ9 A;  3E3K A;  1FJ6 A;  4G8N A;  4PDD A;  2IEE A;  2WX9 A;  4X8R A;  4OER A;  5I3S A;  4DLD A;  2L5V A;  5DVF A;  3VLW A;  3IJO B;  4PAF A;  4G61 A;  5K2X A;  4U22 A;  2XXR A;  3EKI A;  3QXM A;  4MFI A;  4FAT A;  3C31 A;  3K2D A;  4F18 A;  2DOJ A;  3HHF A;  5IZ3 B;  1QVS A;  1ZU0 A;  1RKM A;  4N07 A;  1OLA A;  4F19 A;  1FTA A;  4DIG A;  3K02 A;  3SET A;  3KZG A;  4MHF A;  2ANJ A;  1M5F A;  4KD5 A;  4F2Q A;  1LGB C;  1Y3P A;  3FJG A;  1YXI A;  1L5T A;  1KZ8 A;  2CEX A;  4ZE8 A;  4I62 A;  2I0C A;  2UVI A;  3FVO A;  1TT1 A;  1SDX A;  1MPD A;  3RPW A;  4JDF A;  5H8Q B;  4RNS A;  5H8N A;  4NED A;  4QFN A;  1IMC A;  3RTF B;  4FEB A;  4EF2 A;  2OK2 A;  3LV0 A;  3HHG A;  4IO5 A;  4KYS A;  1SW4 A;  2HAU A;  2OWS A;  3W9V A;  4Q0C A;  4U4X A;  5DEX A;  4EQ7 A;  1MPB A;  1NV3 A;  1PBQ A;  3ODB A;  2AYS A;  4F1Y A;  4E0W A;  3UOR A;  1FTL A;  4JBZ A;  4HTG A;  4H0W A;  3OOA A;  2F7A A;  2ESN A;  2O7I A;  2P3V A;  4GL8 A;  5LDZ A;  4O8M A;  2RKM A;  4POX A;  1B5H A;  3ZS6 A;  4H5F A;  1FTO A;  3PUY E;  1LAF E;  2F7B A;  4BDL A;  5T3J A;  1NV2 A;  4PFU A;  1FQD A;  2DXY A;  3JYR A;  4XIG Q;  3TCH A;  4MNP A;  4H67 A;  1S7Y A;  1IME A;  4X9T A;  2CZL A;  3IOV A;  4FE8 A;  4H1X A;  2I0B A;  4QXD A;  3LUY A;  3TOD A;  3H6T A;  1EYK A;  4N8G A;  3FVK A;  4ND9 A;  2P3N A;  4IO6 A;  2H98 A;  1OMP A;  4I9D A;  2RC7 A;  1FQF A;  4N15 A;  3CIJ A;  3M3L A;  4YB6 A;  1LFI A;  1MG1 A;  2VD2 A;  5AA4 B;  1MQI A;  2R8T A;  2ABH A;  4P11 A;  5JTY A;  3E9X A;  3Q27 A;  4F22 A;  2GH9 A;  2NXO A;  2PT2 A;  3QUJ A;  4OEU A;  4NWC A;  4FIM A;  4LQ5 A;  4NTL A;  3TTN A;  3K1M A;  1QUI A;  4H45 A;  4FBP A;  4GXS B;  4R73 A;  3H6W A;  1FCK A;  1JEU A;  3G3J A;  3S9E A;  3CG1 A;  4YZZ A;  2DVC A;  3OO9 A;  4GL0 A;  3TQL A;  3KN8 A;  3FJ7 A;  2Q8J A;  1ZJL A;  3KN7 A;  3MST A;  4N81 A;  3IOT A;  3H03 A;  4R6H A;  2DSF A;  3FAT A;  3RUM A;  3V8X B;  4TLM B;  4OVJ A;  3N5L A;  4P1L A;  1URD A;  2H5Y A;  4OEN A;  3C32 A;  5H8F B;  4P0I A;  1G0H A;  2IA4 A;  3PMV A;  2UVH A;  1PB9 A;  4MIJ A;  4H46 A;  2BJI A;  3DLN A;  1FPI A;  2I3W A;  4GX6 A;  3EQ1 A;  4JVD A;  1EYI A;  4P56 A;  2DE3 A;  3EPE A;  5I56 B;  1NNK A;  3RNN A;  3E13 X;  4K3F A;  3ILT B;  1A8E A;  5BUU A;  1B7U A;  1RDX A;  4MBP A;  4PFB A;  1H3D A;  2FYI A;  2HAV A;  1FQB A;  4ELO A;  4JVC A;  3D1R A;  1JW1 A;  1DBZ A;  4U1Z A;  3OO8 A;  4NWD A;  1EYJ A;  1VSO A;  4LP2 B;  3PTY A;  4IGR A;  3PMW A;  3MBP A;  4MNC A;  5H8H B;  3HO7 A;  4GBV A;  1IEJ A;  1LAX A;  1NUX A;  3OEK A;  4GWY A;  3K01 A;  5HBC A;  3IX1 A;  3USD A;  2AL4 A;  3D4C A;  3PMX A;  2ZXT A;  3N26 A;  5A5X A;  4ELR A;  1Q1K A;  2XXQ A;  3LSX A;  1JVY A;  2I4C A;  3RQT A;  4OVR A;  4XXU A;  4YMB A;  4PFR A;  1B7H A;  2F35 A;  4JSO A;  4P1E A;  1DTZ A;  2ZYM A;  1DSN A;  1II5 A;  1N04 A;  3S9M C;  3T9V A;  4RPO A;  3OEN A;  4LQ2 A;  5DVJ A;  4GF8 A;  1F9B A;  5JEI A;  5I2K A;  2DS9 A;  1WDN A;  1N7X A;  4OA4 A;  4PTK A;  5AA2 B;  1PB8 A;  2Z23 A;  5F1Q A;  4JB7 A;  2Q2C A;  1MS7 A;  4ZEB A;  2F3B A;  4OTE A;  4NF5 A;  4Q30 B;  4DCX A;  3K1N A;  2V25 A;  1B4Z A;  2Z8F A;  5B7D A;  3RT6 B;  3UN6 A;  4IO2 A;  2XXU A;  1NV1 A;  3B6Q A;  1NH8 A;  1XVX A;  3HST A;  3BFT A;  4XF5 A;  2ZNU A;  1ATG A;  5EQ7 A;  3PD9 A;  4PE5 B;  4LA9 A;  2Q88 A;  3U1O A;  2NOO A;  1Y3Q A;  1SQY A;  1K9Z A;  2XXY A;  4KQP A;  3BBR A;  4RXL A;  3QSL A;  1IIW A;  2Y7W A;  3SEV A;  4PBH A;  3PUX E;  4F29 A;  5TP9 B;  1Q35 A;  1RDZ A;  3VV5 A;  2HPG A;  1VE4 A;  2HXR A;  3S9L C;  3EHS A;  3KFM A;  1XT8 A;  2V93 A;  3RPL B;  3FXU A;  2CZK A;  1Y9U A;  4KI0 E;  2Y84 A;  1GV8 A;  3MJN A;  4AB5 A;  2XD3 A;  3KJT A;  1IQ7 A;  3TCG A;  1B3L A;  4IY6 A;  4F1U A;  1MY3 A;  1NV5 A;  4N8Y A;  4F3B A;  5AA1 A;  3KC0 A;  4JVI A;  2WEF A;  1FBG A;  1S9T A;  4BDQ A;  1BIY A;  3RT8 A;  5EQ9 A;  4GOT A;  3BIH A;  3TMG A;  2UXA A;  3R7X A;  3MZ1 A;  2F97 A;  4QHQ A;  1I6Q A;  1Z7M E;  5IGA A;  3FV2 A;  1LLS A;  4U23 A;  4F3G A;  4PDH A;  4H8J A;  3T1B A;  2NUV A;  5ELV A;  3IFA A;  1DPE A;  3IB1 A;  1B3E A;  1NUZ A;  1A7L A;  1MDQ A;  4UAC A;  5TPA A;  3SZP A;  4H8I A;  4EUO A;  1MXY A;  2QFL A;  2H25 A;  3VLV A;  4YKJ A;  3O28 A;  1EH3 A;  2I6E A;  3A3C A;  3U8Q A;  2GHB A;  4HCY A;  1ZBM A;  3H4Z A;  4IO4 A;  2UVG A;  1M5B A;  4PAK A;  1D9Q A;  4G68 C;  3PPO A;  2Q89 A;  4AB6 A;  3MW0 A;  3CFZ A;  1AH5 A;  4HS7 A;  1UTH A;  1GGG A;  3QMF A;  2XXT A;  1QUJ A;  3OEM A;  4FED A;  4XKN A;  4LUB A;  2XXP A;  1FTM A;  5FTI A;  3TTK A;  5EYF A;  4GX4 A;  3L6G A;  5ITP A;  3T66 A;  1FPG A;  1H76 A;  3T9U A;  4OWD A;  3FZV A;  5HM4 B;  4YKK A;  2O6A A;  5FHN A;  1AOV A;  2REJ A;  4ECF A;  1AMF A;  3LSW A;  4IGT A;  2OBG A;  2A5T A;  3MP6 A;  4R2B A;  2VHA A;  2VT5 A;  3IB2 A;  1LEV A;  4MH5 A;  4PQJ A;  3TKD A;  2Y7R A;  4ZEK A;  3FIR A;  4NF6 B;  4N6P A;  2XWO A;  2B3B A;  3QAX A;  3UK4 A;  5I58 B;  5KCJ B;  3MVX A;  4QF9 A;  2DXR A;  1BK4 A;  1FPK A;  3N6T A;  1J1N A;  1R6Z A;  2LAO A;  1B2H A;  1XOC A;  1NUY A;  4N6K A;  5IKB A;  1QUK A;  4NF8 B;  2KR0 A;  2XWV A;  3EF7 A;  5H8H A;  4JSD A;  3IR1 A;  4G2Z A;  5AA2 D;  2VD3 A;  3HV1 A;  2OZZ A;  3SEX A;  1B52 A;  4LZ8 A;  3DP6 A;  4LZ5 A;  3CFL A;  3JZJ A;  4GD5 A;  3W15 C;  5A5L A;  4IB2 A;  5DW8 A;  1SYH A;  3C34 A;  1M5D A;  1YZ0 A;  1B1H A;  3KEI A;  5I2N A;  4RJZ A;  4QSD A;  3KSJ A;  4NF4 B;  4YB5 A;  3O6G A;  5AE4 A;  4O3A A;  3I3V A;  3G3I A;  4I1D A;  5EHM A;  3CI8 A;  2XWK A;  3TEP A;  4GRK A;  3TZA A;  5TU0 A;  3MYU A;  2ZNT A;  3GBB A;  5I57 B;  4P0G A;  5I59 A;  3FBP A; 
#chains in the Genus database with same CATH homology
 1FPI A;  4P8B A;  4GX6 A;  4NX1 A;  1JP4 A;  4JVD A;  2F5X A;  1EYI A;  3KBZ A;  4P56 A;  4PCD A;  2FIE A;  1LBV A;  2DE3 A;  1LBZ A;  1NV4 A;  2PFZ A;  4MAG A;  5EQ8 A;  4UAB A;  1FPJ A;  2B4L A;  1RDX A;  2DE4 A;  4XFE A;  3NOH A;  4PFB A;  5ET6 A;  1FPF A;  4MEV A;  1XI6 A;  5ET7 A;  4JVC A;  2WYK A;  3D1R A;  5F24 A;  1DBZ A;  4QBA A;  2DDK A;  4HE0 A;  4I3Y A;  1YYZ A;  2CZI A;  1EYJ A;  3PTY A;  2OX3 A;  4NN3 A;  4PGP A;  4MNC A;  5LTC A;  4GBV A;  2XXK A;  5FBP A;  4I40 A;  1NUX A;  4GWY A;  4AS5 A;  1RDY A;  4YIC A;  3W9W A;  4GBW A;  2Y5L A;  3ROJ A;  2QPQ A;  2PFY A;  3U65 A;  2HZL A;  1FPL A;  3RPL A;  4OVR A;  4PFR A;  4MX6 A;  4P1E A;  4NG7 A;  1AWB A;  3FXB A;  2WBD A;  1FPD A;  2VPN A;  4PF8 A;  4N91 A;  2JJK A;  1FPB A;  4N6D A;  4OA4 A;  4PTK A;  1FJ9 A;  4OVT A;  2QVV A;  1FBC A;  1NV6 A;  2F3B A;  1FBF A;  4MMP A;  4HXV A;  4DI4 B;  2CZH A;  2WYP A;  1FSA A;  1NV1 A;  1FRP A;  4MNI A;  4GWX A;  4P47 A;  2MKZ A;  4XF5 A;  5EQ7 A;  1INP A;  3BIG A;  1IMB A;  1NV7 A;  1K9Z A;  2Q8M A;  2XA5 A;  2XWI A;  2WBB A;  5I5P A;  4PBH A;  1FJ6 A;  4PDD A;  1RDZ A;  2FVZ A;  2HPG A;  2HXR A;  2WX9 A;  3E79 A;  4X8R A;  5I3S A;  4PAI A;  5I7I A;  2L5V A;  4O7I A;  1G0I A;  1FBH A;  2V4C A;  3RPL B;  1IMF A;  2CZK A;  4PAF A;  4G61 A;  5IM2 A;  1K9Y A;  4NHB A;  3EKI A;  4O94 A;  4OVQ A;  4PE3 A;  4F1U A;  3B8B A;  4KXP A;  1NV5 A;  4F18 A;  1FPE A;  5IZ3 B;  2FIX A;  4N8Y A;  3KC0 A;  4JVI A;  4NGU A;  4F19 A;  4X04 A;  2WEF A;  1FBG A;  1FTA A;  1CNQ A;  4PET A;  4MHF A;  5EQ9 A;  2F3D A;  3BIH A;  1IMD A;  4GX3 A;  1LBW A;  4HE2 A;  1YXI A;  1KZ8 A;  2CEX A;  5IGA A;  4DI3 D;  5IZ3 A;  4PDH A;  3T1B A;  1NI9 A;  1IMC A;  3IFA A;  4PGN A;  2FBP A;  3LV0 A;  3W9V A;  1NUZ A;  2FHY A;  4HCW A;  2QVU A;  1FBD A;  1NV3 A;  1NV0 A;  3SZP A;  1LBY A;  1VDW A;  2QFL A;  4NF0 A;  4MJO A;  1FBE A;  4HCY A;  4PAK A;  4HE1 A;  1D9Q A;  2P3V A;  5LDZ A;  2Y5K A;  4O8M A;  5EQA A;  1QGX A;  1DCU A;  4O7M A;  5EYH A;  3QMF A;  5JK4 A;  3KC1 A;  4N17 A;  1NV2 A;  5T3J A;  3IFC A;  5IZ1 A;  2KQZ A;  2DE2 A;  2PCR A;  4MNP A;  1KA1 A;  1IME A;  4X9T A;  4PC9 A;  4GX4 A;  3ISP A;  4QXD A;  1FPG A;  3HFU A;  1SPI A;  2Q9T A;  1EYK A;  4N8G A;  4P3L A;  4AS4 A;  2P3N A;  4NAP A;  1Q9D A;  4N4U A;  2VPO A;  1NUW A;  4OVS A;  3RYD A;  4GWZ A;  3LUZ A;  4I3E A;  4N15 A;  2VT5 A;  4NQ8 A;  1LEV A;  4F1V A;  5CM6 A;  1KA0 A;  2CEY A;  2R8T A;  2HZK A;  2XWO A;  4M1V A;  4IR8 A;  2HHM A;  3E78 A;  1BK4 A;  1FPK A;  2GQ1 A;  1LBX A;  2Q74 A;  3A29 A;  5ET5 A;  1DK4 A;  2B4M A;  3CHG A;  1NUY A;  2ZZX A;  4N6K A;  4LN5 A;  4GWW A;  4H45 A;  4FBP A;  2KR0 A;  2XWV A;  2V3Q A;  4GWS A;  1FBP A;  4PFI A;  5EYG A;  4YZZ A;  2OWZ A;  3B50 A;  5ESY A;  3MST A;  5J1D A;  5A5L A;  4N81 A;  5DW8 A;  4XEQ A;  1YZ0 A;  4OAN A;  2ZZW A;  2DVZ A;  5J16 A;  4P1L A;  2QVR A;  3T0J A;  4GWU A;  4PF6 A;  2XWK A;  5IZZ A;  4OVP A;  3MYU A;  4PBQ A;  1G0H A;  2ZZV A;  5ET8 A;  3GYY A;  4P9K A;  4MIJ A;  4H46 A;  1IMA A;  2BJI A;  4MCO A;  3FBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...