4F3SA

Crystal structure of periplasmic d-alanine abc transporter from salmonella enterica
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
231
structure length
231
Chain Sequence
SIVEGRTLNVAVSPASPPMLFKSADGKLQGIDLELFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVIDFSEPYYINSFYLVSMANHKITLNNLNELNKYSIGYPRGMAYSDLIKNDLEPKGYYSLSKVKLYPTYNETMADLKNGNLDLAFIEEPVYFTFKNKKKMPIESRYVFKNVDQLGIAFKKGSPVRDDFNLWLKEQGPQKISGIVDSWMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative periplasmic binding protein
publication title Crystal structure of periplasmic D-alanine ABC transporter from Salmonella enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transport protein
total genus 72
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3sA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3sA02
1B3FA 4U23A 1SI1A 4M4GA 4EQ9A 1B7ZA 4C1UA 4O3CA 1XHYA 4DIGA 4FEBA 3OOAA 1IXGA 3LBSA 3ECRA 4U1OA 5TPAB 1GTKA 2I3WA 5DT6A 4NF5B 4THIA 4EDPA 3VVDA 2B3FA 3L6GA 2NUVA 3P7IA 3LR1A 5FTIA 1AH5A 1R9LA 3TEPA 3N26A 3S9EA 3G3IA 4YB6A 4YKIA 3SEYA 4PETA 3GBAA 4OQOA 2XXXA 3MW0A 1TT1A 2FNCA 3VXCA 1YAEA 1MS7A 2V3UA 1XT8A 2RINA 3V5AA 3QYTA 3CFLA 2DOJA 4NF6B 5F7VA 1KWHA 2QS2A 4G68C 1N7XA 4R74A 2H98A 2I3VA 4N07A 2ZYOA 3B6TA 4BDMA 1IEJA 2UVIA 5CI5A 4C1TA 3IORA 4EQBA 4JB7A 4ELRA 5H8HB 1B3EA 4H5GA 1NNKA 5H8QA 3FATA 1MQIA 1URSA 2PVUA 4F22A 5I57B 3PPRA 4ELPA 2F6PA 3B6QA 2P1SA 1MXWA 1SDXA 4DXBA 5CMBA 3RY3A 1YCJA 3DELB 3A3CA 1MH4A 3THIA 2Z22A 2UVJA 5JEIA 2VD3A 4H8JA 2PMSA 4IO6A 2OCUA 1Y3QA 3TQWA 1M5CA 4H1XA 2BJJX 2XXWA 4ECFA 3G3GA 4IO5A 2HCAA 4KYDA 3K6WA 3H06B 3MZ9A 1OQGA 4Z7EA 2HZKA 5HM4B 3QUJA 1FQCA 1UQWA 3N5LA 2V93A 3T9UA 1P1QA 3FVKA 4OYVA 1HSJA 3JYRA 4U22A 1LAXA 1NNFA 4LZ7A 4OFOA 1SYIA 3KJ7A 2Y84A 1MQJA 1BTJA 1H3DA 2XXUA 2DYXA 2ZYKA 3F11A 1GGGA 4LVQA 2DXRA 1JEVA 5K2XA 5CBRA 3PPOA 4RXLA 1N7WA 2RC9A 3W15C 5DVIA 3PD8A 4G68A 2HQ0A 3FD3A 2ALUA 3TZAA 5I58B 4R9GA 2RC7A 1B3LA 1CB6A 3O6GA 1BKAA 3KJTA 3WAEA 4PE5B 3RT6B 4YZZA 3PUVE 3DP6A 1BLFA 4DDDA 1FQAA 3PPPA 1SW2A 2I4BA 2XX8A 1R1NA 3TCHA 3IO4A 3KN7A 4GVOA 4R6HA 2I0BA 1FTLA 2A5TB 4ZS9A 2XX9A 3VXBA 3LSWA 2H4IA 2F8DA 2NVUB 3LC8A 3CG3A 2O6AA 4PFYA 2ONRA 4LUBA 2REJA 1P1OA 5JK4A 4GOTA 4YMBA 1NKXA 4YKKA 1A54A 3RUMA 3QXMA 3S4UA 2I0CA 4WEDA 1H44A 1MXUA 1F9BA 5IKBA 4E0WA 1JW4A 3H6VA 1B2HA 5L8DA 3E3KA 4H67A 4NE4A 3IOWA 3Q29A 4GL0A 1LB9A 4OVJA 3M3FA 4Q30B 1VFEA 3MVZA 3M3KA 2B3BA 4YKJA 4LP2B 2OK2A 4RPNA 1SVXB 4XKQA 3VLWA 4F31B 1URGA 3H6WA 4X1DA 3SEWA 3S9LC 4ZEIA 3FV2A 3FXRA 1I6QA 1B46A 1ZKBA 1JNFA 4IGTA 2XXQA 1FQEA 3BFTA 1ZTYA 4EF1A 4ONYA 5AA4A 4MLQA 4I9DA 4JWOA 3S9MC 3EHSA 5FHNA 1POTA 3K01A 3CI8A 1QKAA 3RLFE 4ZE8A 4O3AA 1MQHA 2UYEA 4C0RA 2YJPA 3SERA 4XIGQ 3G3FA 4JXIA 3H7MA 1B5IA 2I58A 5BUUA 2UYFA 2RC8A 5AE4A 3KN3A 4MLVA 3C4MA 1IXCA 3D4GA 5TP9A 2HFBA 1YTVA 1JVXA 3PV0E 3HCQA 3C32A 4NF8A 4IY5A 1NH8A 3U72A 2RF1A 4WKMA 1II5A 4Z0IA 1XVYA 1S9TA 4YKPA 2QSXA 2OLBA 1LBBA 4F3GA 2O1LA 3IB1A 1PBQA 3S9NC 2XXIA 2OZZA 2OWTA 1VE4A 1MXZA 3SETA 2P0SA 3KGCA 1ZMGA 4YMAA 4QFKA 4KFQA 3V83A 2UVHA 3CRBA 1LFHA 4OXVA 3TUSA 1RYOA 3ODBA 4GD5A 1LAFE 1DTGA 5DTBA 3K6XA 5FHMA 2YPNA 4OFLA 4NTLA 4Q5TA 4YB5A 2I48A 4KYSA 1S50A 3E9XA 4TQUQ 1FQBA 4GXSB 3MPLA 3FJ7A 3PMXA 3Q27A 1EZOA 1O64A 1LGBC 2DVCA 5H8FA 4PFTA 1DOTA 1ZU0A 2FYIA 3ONMA 1B58A 1B40A 2P2AA 3FVOA 4F3SA 2IA4A 3KSXA 2REGA 4U4SA 2PBWA 1WVJA 4TLLB 2Q89A 3I3VA 5AA2A 1B3GA 1IUDA 4DXUA 1B7UA 3TFLA 2XHDA 2XXHA 4XTCQ 1LFIA 3K0VA 1LAHE 3V8XB 3Q28A 3H4ZA 3OO9A 2F36A 4LA9A 3HN0A 4R6YA 2VGQA 1OLCA 1ZJLA 4QFPA 4JWXA 4EXKA 3TELA 4MBPA 3UP9A 3TTMA 1H45A 1Y1ZA 4ZEFA 2O68A 5TPAA 1EZPA 3GLBA 1ZBMA 4IO4A 4NF5A 2XXVA 2OBGA 4KI0E 4P11A 4X9TA 4U2RA 2KLFA 4PFUA 1P99A 1JW1A 4AB6A 2I49A 2XD3A 4OENA 2V25A 1B3HA 4EF2A 1LCFA 4OTEA 2ZNSA 3UA8A 1T0KA 3L6HA 2Y7WA 3OSQA 3DLNA 1M5EA 3MZ1A 4WEPA 1CE2A 5KCJB 2H9BA 3TYHA 2M8CA 2Q88A 3N6UA 5EHMA 3Q26A 4NF6A 4ZZEA 2I6EA 4IO2A 4UACA 1VR5A 1R6ZA 4P0GA 1FQFA 3KN8A 1JVYA 1MG1A 4E0XA 4AQ4A 1N3WA 2Y7IA 1SW1A 1DTZA 1GVCA 1UTHB 2ANJA 5H8HA 4MH5A 4ZECA 4U21A 4BDLA 3O28A 4LQ5A 5I57A 5AA2D 3BKIB 2UXAA 2B65A 1LLSA 1IXHA 1J1NA 2XD2A 1N3XA 4FECA 4FATA 4JSDA 2CZLA 1B6HA 4QHQA 3BBRA 3O2AA 1MH3A 3IL1B 1A8FA 3H6TA 4KYEA 2AL4A 3FV1A 4DZ1A 2F35A 2O84X 3HPIA 1ELJA 1MY0A 2D3IA 3N94A 4NMYA 3KZGA 4UA8A 3G3HA 4TLMB 2ZXTA 3E4RA 3IK6B 2GH9A 1LCTA 3QAXA 4LZ8A 3UGWA 4L17A 3PPNA 2ZYMA 4OESA 2Q2AA 2YLNA 3T93B 4BDNA 3G3JA 5EHSA 4NF4B 5DVJA 4RK2A 1MPBA 3W9WA 1OVBA 3K2DA 3PPQA 4LQ2A 2DE4A 4F3PA 1I6BA 3MVXA 3HO7A 1SQYA 3ILTB 3UORA 3EQ1A 4FJPA 1HSLA 4KCCA 3FXUA 3DP8A 2F7BA 4P0IA 1TXFA 1N0TA 2Y7RA 4RYAA 1Q35A 5CMKA 3IJOB 1JETA 3O97A 3OMBA 3C31A 2PX1A 3QSLA 5JTYB 2DE2A 5B7DA 4LZ5A 3PUXE 1QUKA 5L9SA 3IR1A 2Q9TA 4RNSA 1IIWA 2A5TA 1Y4TA 4G8HA 1OVTA 1XS5A 2CMOA 4JBZA 5I59B 2O7UA 1PDAA 1P1UA 5CRYA 3G3KA 4ZEBA 1A55A 1AL3A 5I56B 1US5A 5I2KB 3KFMA 2PT1A 2DXYA 4HS7A 2ZNTA 5I2NB 3QUFA 4QFLA 4F18A 1PB9A 2OWSA 3FJGA 3RPWA 4R2FA 3S2VA 1B1HA 4H8IA 3VVFA 2F5XA 4DLDA 3GBBA 4XKPA 3VE1B 3K00A 3VDFA 2DQVA 5KDTB 2DSFA 4AB5A 1B5HA 3T9XB 2X7PA 3TTRA 1NNPA 1IZ1A 4QSEA 2ABHA 4H65A 1USYE 1B1XA 2DWJA 1FCKA 4OZ9A 1Q1KA 2ONSA 2PYYA 4GL8A 3RTWB 1B05A 1P1NA 2E1SA 4XKRA 3UN6A 4F29A 5M2VA 4QSCA 1A40A 3PMVA 3VVEA 2G93A 3C36A 3HSTA 3OO8A 3TAJA 1QKBA 2DWIA 2WKYA 2GRVA 1QVSA 1GR2A 3ILUB 2DE3A 4QFNA 3OELA 4DXCA 1TFAA 3SEUA 1USYH 1IITA 1A99A 3FGSA 2THIA 3D4CA 3H3GA 3FASA 3M3LA 5ITOA 4GXAA 5CC2A 5H8NB 1ATGA 3IOTA 4G8MA 1XC1A 4DE8A 2DS9A 3V89B 4OEVA 3R7XA 3T22A 1NH7A 4F1VA 4RA1A 2D5WA 1SW4A 3C34A 3WAFA 1JW5A 3ZS6A 3U94A 3MWBA 1ZIUA 4I1DA 5DEXB 3U93A 1RYXA 1FTMA 1NFTA 1SYHA 3PU5A 1N76A 2XXRA 4BDQA 3JV9A 1EZ9A 5CM6A 4DCYA 3DP4A 1OQHA 3CIJA 3T9VA 2DWAA 4G2ZA 3A09A 4BDRA 3O29A 3O6IA 1D9VA 1LB8A 5DYHA 1BIYA 5A5XB 3VV5A 2G29A 3TTNA 4GFRA 4X1BA 2HZLA 1YPNA 1VFDA 5TU0A 3ZKKA 4TOZA 1FW0A 2X7QA 4F2OA 3KEIA 2QS1A 1NNTA 4I62A 2GHAA 5BWJA 4ELOA 1R9QA 5CBSA 1PB8A 4BLAA 4XKNA 3TCFA 2I4CA 3TMGA 3IO6A 5B70A 1MPCA 4GIZA 3KSJA 2A5SA 3FXQA 1MXYA 1DSNA 1D4NA 4LATA 2QPQA 2AIXA 2O51A 3K1PA 4RPOA 2XXTA 4ISUA 3HHFA 2Q2CA 4GLIA 1US4A 4R72A 4EUOA 4YB7A 3VFJA 1I6AA 4MFIA 3PMWA 1O63A 4JWYA 1QUIA 1N84A 4PP0A 2XXPA 3IOVA 3PD9A 3R26A 4RY1A 1A8EA 1B5JA 3FJMA 3ZSFA 3RNNA 2HXWA 2H5YA 4OMBA 4DCXA 1QJMA 5L9MA 3LSFB 1B9JA 1BP5A 1MPDA 1UTBB 4G77A 2O69A 4YU0A 5AA2B 5DVFA 2RCBA 2Z23A 3OSRA 3RTFB 1FTKA 3R6UA 4NEDA 1QW0A 1QUJA 4ND9A 5ISUA 4QRZA 3RGYA 2VOZA 2F78A 5FHOA 3SEXA 3PUZE 4YICA 3A3UA 5ICQA 5AA1A 3AXFA 3EHTA 3MVYA 3K02A 3U92A 1FTJA 1PC3A 3TCGA 2O7IA 4KQPA 1ANFA 4XXUA 1MDQA 4F2QA 1IXIA 5KCJA 2NWJA 2QS4A 2Z8DA 3IB2A 3Q25A 5HPQA 2GHBA 3RQTA 5AA3A 2O1MA 3MP6A 3TDJA 3C9HA 4IGRA 4R6KA 3ZKLA 3B6WA 4OETA 1IQ7A 4QF9A 3K4UA 2AL5A 1UTHA 3CSGA 3H6UA 3HV1A 3PUYE 3IAZA 3OO6A 1NMUA 5H8QB 5LOMA 2Y7PA 5ELVA 2HEUA 5K2YA 3K1MA 2H25A 4F19A 2Y7KA 2ZYNA 4F3BA 1AMFA 2XX7A 2R6GE 4Q8RA 4HW8A 1AIVA 1H43A 1ZLQA 2HAVA 3TTLA 5KZTA 4IB2A 1RKMA 1WDNA 5CMCA 2GFEA 3MUQA 3FIRA 4QFOA 3TQLA 3IB0A 4H5FA 3M8UA 1LBCA 1SBPA 1LFGA 3O9PA 3TODA 1LSTA 3MQ9A 4RK9A 4ZEKA 5IAIA 1SD3A 1MY2A 5J1DA 3RT8A 5CMMA 1VSOA 3N6TA 5ITPA 4R9FA 3FVNA 1EU8A 4EQ7A 1MM7A 4ZDMA 4NF4A 2F97A 2F7AA 2DWHA 4HCYA 3K1NA 3MVWA 1Y9UA 3MZBA 1B52A 1Y3NA 5L9OA 4U4XA 5I58A 1M5DA 1I69A 2F7CA 4HTGA 4NWCA 3USDA 1B4HA 1S7YA 3C35A 4G68B 1H76A 3EPEA 4ELQA 1PB7A 2VHAA 3SESA 1UIVA 2Q8JA 3TPAA 3U8QA 4YAHX 4F1UA 4OEUA 1N04A 3U1OA 3TKDA 1DMBA 3OD7A 4POWA 3E13X 4IO7A 5JTYA 4X48A 1WODA 1P1WA 3LSLA 1B7HA 1PBPA 1TWYA 3MJNA 4R73A 4GWOA 4Q0CA 3I5OA 2Z8FA 4ESWA 2QRYA 3C33A 4G4PA 2NOOA 5FTHA 5I59A 3T96B 4JSOA 4KHZE 3VLUA 4OERA 5I56A 5I2KA 1TFDA 4ESXA 1QULA 1MQGA 1EH3A 4FORA 4OWDA 5I2NA 4QSDA 2E0SA 4PQJA 3K6VA 2QL3A 4PFWA 4U1ZA 2NXOA 3CG1A 3DM0A 4HCWA 4H0WA 2QS3A 1B4ZA 3QIMA 2UVGA 1UIUA 5KDTA 4KD5A 1XVXA 2VP1A 4FAJA 2LAOA 1B0HA 4R2BA 3KG2A 1MXVA 5H8SA 4IY6A 4FE8A 1Y1MA 1MQDA 5F1QA 1A7LA 3H03A 1SI0A 1MM6A 2R71A 4FEDA 4KR5A 3T9HB 4JDFA 4F1YA 4KPTA 3CFXA 3SKPA 4ZE9A 3SDFA 5EYFA 1NL5A 4BDOA 2V84A 3KOTA 1Z7ME 3LUYA 3KOSA 3OO7A 1O7TA 5AA4B 3EN3A 3KBRA 1D9YA 1Y4CA 3FVGA 2QMXA 2V3QA 1OMPA 3PGFA 3HHGA 3PUWE 5I84A 2ONKE 3IX1A 3MP1A 4MF3A 5ICTA 3FUZA 3LSXA 4GQOA 1B0LA 3CSBA 3O6HA 5H8NA 3GXAA 3G7WA 4FIMA 3GZGA 4R75A 1MY3A 3FZVA 2IEEA 5HBCA 3RN8A 1POY1 5TP9B 2DP8A 2XXYA 5DEXA 1FTOA 1SW5A 1MXXA 2QMWA 2RCAA 1DPEA 3OEKA 1L5TA 3EHUA 2Z8EA 2ZNUA 3I6VA 4NF8B 3T66A 1Y3PA 1FQDA 3UIFA 1Y20A 1B51A 2HAUA 4N6PA 5A5XA 4ZEDA 2X26A 4EXLA 3BFUA 3CFZA 2VD2A 3O66A 3MPKA 4NWDA 1PEBA 3SEVA 4I8CA 3OENA 3OXNA 1HSEA 3TTKA 1DPPA 1MY1A 3QK6A 4O3BA 1JEUA 3MP8A 1MY4A 3MBPA 2D21A 3IOUA 2OJTA 2RKMA 1OIBA 2ESNA 4H6DA 1AOVA 1D3KA 4N13A 3EF7A 1MRPA 4OHNA 2F34A 1Z7NE 1M5BA 4KCDA 3JZJA 2AYSA 4OFJA 4F39A 4M1VA 3VLVA 4IO3A 3K6UA 4POXA 2PT2A 2R9JA 3MC2A 1LAGE 1XOCA 3UK4A 3W9VA 3B7DA 3CVGA 1JQFA 4RJZA 2F6GA 4GRKA 5H8FB 1B32A 2DVZA 1MDP1 2ZMBA 1GV8A 3CR9A 2H99A 1URDA 3MAMA 2QJEA 4LONB 2V3TA 1UTBA 4WXJA 2FA7A 1OLAA 4K3FA 3IJXB 3OEMA 4ZZAA 4GF8A 4G8NA 1M5FA 2W7YA
chains in the Genus database with same CATH superfamily
5F24A 1B3FA 4U23A 1SI1A 4M4GA 4PGPA 4EQ9A 1B7ZA 4C1UA 4O3CA 1XHYA 4DIGA 4FEBA 3OOAA 1IXGA 5I7IA 3LBSA 3ECRA 3QMFA 4U1OA 5TPAB 1GTKA 2I3WA 5DT6A 4NF5B 2XA5A 4THIA 4EDPA 3VVDA 2B3FA 3L6GA 2NUVA 3P7IA 3LR1A 5FTIA 1AH5A 1R9LA 3TEPA 3N26A 3S9EA 3G3IA 4YB6A 4N17A 4YKIA 3SEYA 4PETA 3GBAA 4OQOA 4I3YA 2XXXA 3FXBA 3MW0A 1TT1A 2FNCA 3VXCA 1YAEA 1MS7A 2V3UA 3BIHA 1XT8A 2RINA 1SPIA 3V5AA 3QYTA 3CFLA 2DOJA 2XWOA 4NF6B 5F7VA 4QBAA 1KWHA 2QS2A 4G68C 1N7XA 4R74A 2H98A 4N07A 2I3VA 1EYKA 2ZYOA 3B6TA 4BDMA 1IEJA 2UVIA 5CI5A 4C1TA 3IORA 4EQBA 2VT5A 4JB7A 4ELRA 5H8HB 1B3EA 4H5GA 1NNKA 5H8QA 3FATA 1MQIA 1URSA 1DK4A 2PVUA 4F22A 5I57B 3PPRA 4ELPA 2F6PA 2Q74A 3B6QA 4GX4A 2P1SA 1MXWA 1SDXA 1BK4A 5IM2A 5CMBA 4DXBA 3RY3A 1YCJA 2QVUA 3DELB 3A3CA 1MH4A 3THIA 2HXRA 2Z22A 2UVJA 5JEIA 2VD3A 4H8JA 2PMSA 4IO6A 4PDHA 2OCUA 3CHGA 2VPOA 1Y3QA 3TQWA 1M5CA 4H1XA 2BJJX 4XEQA 2XXWA 4ECFA 3G3GA 4IO5A 2HCAA 4KYDA 3K6WA 3H06B 3MZ9A 1OQGA 3LUZA 4Z7EA 2HZKA 2HHMA 3KBZA 5HM4B 3QUJA 1FQCA 1UQWA 3N5LA 2V93A 3T9UA 1P1QA 3FVKA 4IR8A 5LDZA 4OYVA 1HSJA 3JYRA 4U22A 1LAXA 1NNFA 4LZ7A 4OFOA 1SYIA 4H46A 1NV4A 3KJ7A 2Y84A 1MQJA 1BTJA 1H3DA 2XXUA 2DYXA 1IMBA 2ZYKA 3F11A 1GGGA 4LVQA 3T1BA 2DXRA 4NG7A 1JEVA 2JJKA 1FBCA 5K2XA 4GWZA 4GX3A 5CBRA 1FJ6A 5IZ3A 3PPOA 4RXLA 1N7WA 1FPIA 2RC9A 3W15C 5DVIA 1YXIA 3PD8A 4G68A 2HQ0A 3FD3A 2ALUA 3TZAA 5I58B 4GWWA 5LTCA 1KA1A 4R9GA 2RC7A 1B3LA 1CB6A 3O6GA 1FPEA 1BKAA 4I3EA 3KJTA 4PCDA 3WAEA 4PE5B 2PFYA 3RT6B 4YZZA 3PUVE 4MEVA 3DP6A 1BLFA 4DDDA 1FQAA 3PPPA 1SW2A 2I4BA 2ZZVA 2XX8A 1R1NA 1FPJA 3TCHA 3IO4A 3KN7A 4GVOA 4R6HA 2I0BA 4P3LA 1FTLA 2A5TB 4ZS9A 2XX9A 5IZ1A 3VXBA 3LSWA 4P56A 2H4IA 2F8DA 2NVUB 3LC8A 3CG3A 2Q8MA 2HPGA 2O6AA 4PFYA 2ONRA 4MAGA 4LUBA 2REJA 1P1OA 5JK4A 4GOTA 4OVTA 4YMBA 1NKXA 4YKKA 1A54A 3RUMA 3QXMA 3S4UA 2I0CA 1KZ8A 4WEDA 1H44A 1MXUA 1F9BA 5IKBA 4E0WA 1JW4A 3H6VA 1B2HA 5L8DA 4MNIA 3E3KA 4H67A 4NE4A 5EYHA 3IOWA 3Q29A 4GL0A 1LB9A 4OVJA 3M3FA 4Q30B 4MNPA 1VFEA 3MVZA 3M3KA 5ET5A 2B3BA 4YKJA 4LP2B 2OK2A 4RPNA 1SVXB 1INPA 4XKQA 3VLWA 4F31B 1URGA 3H6WA 4X1DA 3SEWA 4OA4A 3S9LC 4ZEIA 3FV2A 3ROJA 3FXRA 1I6QA 1B46A 4XFEA 1ZKBA 1JNFA 4IGTA 4P1LA 2XXQA 1FQEA 1K9YA 3BFTA 1ZTYA 4EF1A 4ONYA 3NOHA 5AA4A 4MLQA 4QXDA 4N6DA 3A29A 1IMFA 4HE0A 5IZZA 4I9DA 4JWOA 3S9MC 3EHSA 5FHNA 1POTA 3K01A 3CI8A 1QKAA 3RLFE 4ZE8A 4O3AA 1MQHA 2UYEA 4C0RA 2YJPA 3SERA 4XIGQ 1NV1A 3G3FA 4JXIA 3H7MA 1B5IA 3RPLA 1FPGA 4OVSA 4HE2A 2I58A 5BUUA 2UYFA 2RC8A 5AE4A 3KN3A 4MLVA 3C4MA 1IXCA 1IMDA 4JVDA 3D4GA 4PGNA 5TP9A 2HFBA 4N8YA 4PF6A 1YTVA 4GBWA 1JVXA 5I5PA 3PV0E 3HCQA 3C32A 4NF8A 4IY5A 1NH8A 3U72A 2RF1A 4WKMA 1II5A 4Z0IA 1XVYA 1FBHA 1S9TA 4YKPA 2QSXA 2OLBA 1LBBA 4NAPA 5EQ7A 4F3GA 1KA0A 2O1LA 4MNCA 3IB1A 1PBQA 3S9NC 2XXIA 2OZZA 2OWTA 1VE4A 1G0HA 1MXZA 3SETA 2P0SA 3KGCA 1ZMGA 4YMAA 4QFKA 4KFQA 3V83A 2UVHA 3CRBA 4UABA 1LFHA 4OXVA 3TUSA 1RYOA 3ODBA 4GD5A 1LAFE 3E78A 4NF0A 1DTGA 5DTBA 3K6XA 5FHMA 2YPNA 4OFLA 4NTLA 4G61A 4Q5TA 4YB5A 2I48A 4KYSA 1S50A 3E9XA 4TQUQ 1FQBA 4MCOA 4GXSB 3MPLA 3FJ7A 3PMXA 5ET8A 3Q27A 1EZOA 1O64A 1LGBC 1IMAA 2DVCA 5H8FA 4PFTA 1DOTA 1ZU0A 2FYIA 3D1RA 2WX9A 4XF5A 3ONMA 1B58A 1B40A 2P2AA 4I40A 3FVOA 3EKIA 4F3SA 2IA4A 3KSXA 1NV0A 2REGA 4U4SA 5ET7A 2PBWA 1WVJA 4TLLB 2Q89A 3I3VA 5AA2A 1B3GA 1IUDA 1B7UA 3TFLA 4DXUA 2XHDA 2XXHA 4XTCQ 1LFIA 3K0VA 1LAHE 3V8XB 4OANA 4N81A 3Q28A 1FBPA 3H4ZA 2WYKA 3OO9A 3ISPA 2F36A 4LA9A 3HN0A 4R6YA 2VGQA 1OLCA 1ZJLA 4QFPA 4JWXA 3KC1A 4EXKA 3TELA 4MBPA 3UP9A 3TTMA 1H45A 1Y1ZA 4ZEFA 5A5LA 2O68A 5TPAA 1EZPA 3GLBA 1NUYA 1ZBMA 4IO4A 4N8GA 4NF5A 1IMEA 2XXVA 2OBGA 4KI0E 4P11A 1QGXA 4PFBA 3U65A 4PFRA 4X9TA 4U2RA 2KLFA 4PFUA 1AWBA 1P99A 1JW1A 4AB6A 2I49A 1EYIA 2XD3A 4MX6A 4OENA 2V25A 3PTYA 1B3HA 1LCFA 4OTEA 2P3VA 4EF2A 2ZNSA 3UA8A 1T0KA 3L6HA 2Y7WA 3OSQA 3DLNA 1M5EA 3MZ1A 4WEPA 1CE2A 5KCJB 1LBYA 2H9BA 3TYHA 4NHBA 2M8CA 2Q88A 3N6UA 5EHMA 3Q26A 4NF6A 4ZZEA 2I6EA 4IO2A 2WBDA 4UACA 1VR5A 1R6ZA 4P0GA 1FQFA 3KN8A 1JVYA 1MG1A 4E0XA 4AQ4A 1N3WA 2Y7IA 1SW1A 1DTZA 1GVCA 1UTHB 2ANJA 5H8HA 4MH5A 4ZECA 4U21A 4BDLA 3O28A 4PC9A 4LQ5A 5I57A 5AA2D 1FRPA 3BKIB 2UXAA 2B65A 1LLSA 1IXHA 1J1NA 2XD2A 1FBFA 1N3XA 4FECA 4PAFA 4FATA 4JSDA 2CZLA 1B6HA 4QHQA 3BBRA 4NGUA 3O2AA 1MH3A 3IL1B 1A8FA 4PAIA 3H6TA 4KYEA 2AL4A 3FV1A 4DZ1A 3BIGA 2F35A 2O84X 3HPIA 1ELJA 1MY0A 2D3IA 3N94A 4NMYA 3KZGA 4UA8A 3G3HA 4TLMB 2ZXTA 3E4RA 3IK6B 1LBZA 2GH9A 1NV6A 1LCTA 3QAXA 4LZ8A 3UGWA 4L17A 3PPNA 2ZYMA 4OESA 2Q2AA 2YLNA 3T93B 4BDNA 3G3JA 5EHSA 4NF4B 5DVJA 4RK2A 1MPBA 3W9WA 1OVBA 3K2DA 3PPQA 4LQ2A 2DE4A 4F3PA 2CEYA 1I6BA 3MVXA 2CZIA 3HO7A 1SQYA 3ILTB 3UORA 4N91A 1K9ZA 3EQ1A 4FJPA 1HSLA 3MSTA 4KCCA 5IGAA 3FXUA 3DP8A 2F7BA 4P0IA 5EYGA 1TXFA 1N0TA 2Y7RA 4RYAA 1Q35A 5CMKA 3IJOB 1JETA 3O97A 3OMBA 3C31A 2DDKA 1FPKA 5T3JA 2PX1A 3QSLA 5JTYB 2DE2A 4O7MA 5B7DA 4LZ5A 3PUXE 1QUKA 5L9SA 3IR1A 2Q9TA 4RNSA 1IIWA 2A5TA 1Y4TA 1LBXA 4G8HA 1EYJA 1OVTA 1XS5A 2CMOA 4JBZA 5I59B 4GWYA 1NV3A 2O7UA 1PDAA 1P1UA 5CRYA 3G3KA 4ZEBA 1A55A 1AL3A 5I56B 1US5A 4O94A 5I2KB 3KFMA 2PT1A 2DXYA 2WYPA 4PF8A 4HS7A 2ZNTA 4PBQA 5I2NB 3QUFA 4QFLA 4F18A 1PB9A 1FPDA 2OWSA 3FJGA 3RPWA 4R2FA 4MIJA 4N4UA 4O7IA 1FTAA 3S2VA 1B1HA 4H8IA 2OWZA 3VVFA 2F5XA 4DLDA 3GBBA 4XKPA 3VE1B 3FBPA 3K00A 3VDFA 2DQVA 5KDTB 2DSFA 4AB5A 1B5HA 3T9XB 2X7PA 3TTRA 1NNPA 1IZ1A 4QSEA 2ABHA 4H65A 1USYE 1B1XA 2DWJA 1FCKA 4OZ9A 1Q1KA 2FIEA 2ONSA 5ESYA 2Y5LA 2PYYA 4GL8A 3RTWB 4OVRA 1B05A 1P1NA 2E1SA 4XKRA 3UN6A 1LBVA 1D9QA 4F29A 5M2VA 4QSCA 1A40A 1NUWA 3PMVA 3VVEA 2G93A 3C36A 3HSTA 3OO8A 3TAJA 1QKBA 2DWIA 2WKYA 2F3DA 2GRVA 1QVSA 1GR2A 3ILUB 2DE3A 4MMPA 4QFNA 3OELA 4DXCA 1TFAA 1YYZA 3SEUA 1USYH 1IITA 1A99A 3FGSA 2XXKA 2THIA 4MJOA 3D4CA 3H3GA 3FASA 3M3LA 1FPFA 5ITOA 4GXAA 1NV5A 5CC2A 5H8NB 1ATGA 3IOTA 4G8MA 1LBWA 1XC1A 4DE8A 2DS9A 3V89B 4OEVA 3R7XA 2KQZA 3T22A 2Y5KA 1NH7A 4F1VA 4RA1A 2D5WA 1SW4A 3C34A 3WAFA 3IFCA 1JW5A 3ZS6A 3U94A 3MWBA 1ZIUA 4I1DA 5DEXB 3U93A 1RYXA 1FTMA 1NFTA 1SYHA 3PU5A 1N76A 4N15A 2XXRA 4BDQA 4P47A 3JV9A 1EZ9A 5CM6A 4DCYA 3MYUA 3DP4A 1OQHA 3CIJA 3T9VA 2DWAA 4G2ZA 3A09A 4BDRA 3O29A 3O6IA 1D9VA 1LB8A 4FBPA 5DYHA 1BIYA 5A5XB 3VV5A 4DI3D 2G29A 3TTNA 4GFRA 4X1BA 2HZLA 1YPNA 1VFDA 5TU0A 3ZKKA 4TOZA 1FW0A 2X7QA 4F2OA 3B8BA 3KEIA 2QS1A 1NNTA 4I62A 2GHAA 5BWJA 4ELOA 1R9QA 4DI4B 5CBSA 1PB8A 4BLAA 4XKNA 3TCFA 2I4CA 3TMGA 3IO6A 5B70A 1MPCA 4GIZA 3KSJA 2A5SA 3FXQA 1MXYA 1DSNA 1D4NA 4JVCA 4LATA 2QPQA 2AIXA 2O51A 3K1PA 4GBVA 4RPOA 2XXTA 4ISUA 3HHFA 2Q2CA 4GLIA 1US4A 4R72A 4EUOA 4YB7A 3VFJA 1I6AA 4MFIA 3PMWA 1O63A 4JWYA 1QUIA 1N84A 4PP0A 2F3BA 2XXPA 3IOVA 3PD9A 3R26A 4RY1A 1A8EA 1B5JA 3FJMA 3ZSFA 3RNNA 2HXWA 2H5YA 4OMBA 4DCXA 1QJMA 5L9MA 3LSFB 1B9JA 1BP5A 2CZKA 1MPDA 1UTBB 4G77A 2O69A 1IMCA 4YU0A 5AA2B 5DVFA 1FJ9A 2RCBA 2Z23A 3OSRA 1FPBA 3RTFB 1FTKA 3R6UA 4NEDA 1QW0A 1QUJA 4ND9A 2MKZA 5ISUA 5EQAA 4QRZA 3RGYA 2VOZA 3T0JA 2F78A 5FHOA 3SEXA 3PUZE 4YICA 3A3UA 5ICQA 5AA1A 3AXFA 3EHTA 3MVYA 3K02A 3U92A 1FTJA 2XWKA 1PC3A 3TCGA 2QVVA 2O7IA 1G0IA 4KQPA 5FBPA 2ZZWA 1ANFA 4XXUA 1MDQA 4F2QA 1IXIA 5KCJA 2NWJA 2QS4A 2Z8DA 3IB2A 4AS5A 3Q25A 5HPQA 2GHBA 4GWSA 3RQTA 5AA3A 2O1MA 3MP6A 3TDJA 3C9HA 4IGRA 4R6KA 3ZKLA 3B6WA 4OETA 1IQ7A 4QF9A 2L5VA 3K4UA 2AL5A 1UTHA 3CSGA 3H6UA 3HV1A 3PUYE 4PFIA 3IAZA 3OO6A 1NMUA 3E79A 5H8QB 5LOMA 2Y7PA 5ELVA 2HEUA 5K2YA 3K1MA 2H25A 4F19A 2Y7KA 2ZYNA 4F3BA 1AMFA 4P9KA 2XX7A 2R6GE 4Q8RA 4HW8A 1VDWA 4HE1A 2WEFA 2PCRA 1AIVA 1H43A 1ZLQA 4PTKA 2HAVA 2CZHA 3TTLA 5KZTA 2VPNA 4GWUA 1RKMA 4IB2A 4X8RA 1RDXA 1WDNA 5CMCA 2GFEA 2CEXA 3MUQA 3FIRA 4QFOA 3TQLA 3IB0A 4H5FA 3M8UA 4PE3A 1LBCA 1SBPA 1LFGA 3O9PA 3RYDA 3TODA 1LSTA 3MQ9A 4RK9A 4ZEKA 5IAIA 1SD3A 1MY2A 5J1DA 3RT8A 5CMMA 2GQ1A 1VSOA 3N6TA 4P8BA 5ITPA 4R9FA 3FVNA 1EU8A 4HXVA 4EQ7A 1MM7A 4ZDMA 4NF4A 2F97A 2F7AA 2DWHA 4HCYA 3K1NA 3MVWA 1Y9UA 3MZBA 1B52A 1Y3NA 5I3SA 5L9OA 4U4XA 1DBZA 5IZ3B 5I58A 1M5DA 1I69A 2F7CA 4H45A 4HTGA 4NWCA 3USDA 1B4HA 1S7YA 1NUXA 3C35A 4G68B 1H76A 3EPEA 4ELQA 1PB7A 1XI6A 2VHAA 3SESA 3SZPA 1UIVA 2Q8JA 3TPAA 3U8QA 4LN5A 4YAHX 4F1UA 2OX3A 4OEUA 2R8TA 1N04A 3U1OA 3TKDA 5DW8A 1DMBA 3OD7A 4POWA 3E13X 4IO7A 5JTYA 5EQ9A 4X48A 1WODA 1P1WA 3LSLA 1B7HA 1PBPA 4P1EA 1TWYA 3B50A 3MJNA 1RDYA 4R73A 4GWOA 4NX1A 4Q0CA 3I5OA 2B4LA 2Z8FA 4ESWA 2QRYA 3C33A 4G4PA 2NOOA 2PFZA 5FTHA 1JP4A 5I59A 3T96B 4JSOA 4KHZE 4N6KA 3VLUA 4OERA 5I56A 5I2KA 1TFDA 4ESXA 1QULA 1MQGA 2FHYA 2WBBA 1EH3A 4FORA 4OWDA 5I2NA 4QSDA 2E0SA 4PQJA 4GX6A 3K6VA 2QL3A 1Q9DA 4PFWA 4U1ZA 4AS4A 2NXOA 4MHFA 3CG1A 3DM0A 4HCWA 4H0WA 2QS3A 2XWIA 1B4ZA 1NI9A 3QIMA 2UVGA 1UIUA 5KDTA 4KD5A 1XVXA 2VP1A 4FAJA 2LAOA 1B0HA 4R2BA 3KG2A 2BJIA 1MXVA 5H8SA 4IY6A 4FE8A 1Y1MA 1MQDA 5F1QA 2B4MA 2QFLA 1A7LA 3H03A 1SI0A 2XWVA 1MM6A 2R71A 4FEDA 4KR5A 3T9HB 1YZ0A 4JDFA 4F1YA 4KPTA 3CFXA 3SKPA 4ZE9A 3SDFA 5EYFA 1NL5A 4BDOA 2V84A 3KOTA 1Z7ME 3LUYA 3KOSA 3OO7A 1NV7A 4OVPA 1O7TA 3LV0A 5AA4B 3EN3A 3KBRA 1D9YA 1Y4CA 3FVGA 2QMXA 2V3QA 1OMPA 3PGFA 3HHGA 1FBDA 3PUWE 5I84A 2ONKE 1FPLA 3IX1A 3MP1A 4MF3A 2QVRA 5ICTA 3FUZA 1FBEA 1NV2A 2FIXA 3LSXA 4GQOA 1B0LA 3CSBA 3O6HA 5H8NA 1FSAA 3GXAA 3G7WA 3RPLB 1RDZA 2P3NA 4FIMA 3GZGA 4R75A 1MY3A 3FZVA 2IEEA 5HBCA 3RN8A 1FBGA 1POY1 4O8MA 5TP9B 2DP8A 2XXYA 5DEXA 1FTOA 1SW5A 1MXXA 2QMWA 2RCAA 1DPEA 2FBPA 3OEKA 1L5TA 3EHUA 2Z8EA 2ZNUA 4JVIA 3I6VA 4NF8B 3T66A 3KC0A 1Y3PA 1FQDA 3UIFA 1Y20A 1B51A 4OVQA 4PBHA 2HAUA 4NN3A 4N6PA 5A5XA 4ZEDA 2X26A 4EXLA 2KR0A 3BFUA 3CFZA 2VD2A 3O66A 3MPKA 4NWDA 1PEBA 3SEVA 4GWXA 4I8CA 3OENA 3HFUA 3GYYA 3OXNA 1HSEA 3TTKA 1DPPA 1MY1A 3QK6A 4O3BA 1JEUA 3MP8A 1CNQA 1MY4A 3MBPA 2D21A 3IOUA 2OJTA 2RKMA 2V4CA 1OIBA 2ESNA 4H6DA 1AOVA 1D3KA 4N13A 3EF7A 1MRPA 4OHNA 2F34A 1NUZA 1Z7NE 1M5BA 4KCDA 3JZJA 2ZZXA 2AYSA 4OFJA 4F39A 4M1VA 3VLVA 4PAKA 4IO3A 3K6UA 2FVZA 4POXA 2PT2A 2R9JA 4PDDA 3MC2A 1LAGE 1XOCA 3UK4A 3W9VA 3B7DA 3CVGA 5EQ8A 5ET6A 3IFAA 1JQFA 4RJZA 2F6GA 4GRKA 4KXPA 5H8FB 1LEVA 1B32A 2DVZA 1MDP1 1DCUA 2ZMBA 1GV8A 3CR9A 2H99A 1URDA 4NQ8A 3MAMA 2QJEA 4LONB 2V3TA 1UTBA 4WXJA 2FA7A 1OLAA 4K3FA 3IJXB 5J16A 4X04A 3OEMA 4ZZAA 4GF8A 4G8NA 1M5FA 2W7YA
chains in the Genus database with same CATH topology
1B3FA 4U23A 1SI1A 4M4GA 4EQ9A 1B7ZA 4C1UA 4O3CA 1XHYA 4DIGA 4FEBA 3OOAA 1IXGA 3LBSA 3ECRA 4U1OA 5TPAB 1GTKA 2I3WA 5DT6A 4NF5B 4THIA 4EDPA 3VVDA 2B3FA 3L6GA 2NUVA 3P7IA 3LR1A 5FTIA 1AH5A 1R9LA 3TEPA 3N26A 3S9EA 3G3IA 4YB6A 4YKIA 3SEYA 4PETA 3GBAA 4OQOA 2XXXA 3MW0A 1TT1A 2FNCA 3VXCA 1YAEA 1MS7A 2V3UA 1XT8A 2RINA 3V5AA 3QYTA 3CFLA 2DOJA 4NF6B 5F7VA 1KWHA 2QS2A 4G68C 1N7XA 4R74A 2H98A 2I3VA 4N07A 2ZYOA 3B6TA 4BDMA 1IEJA 2UVIA 5CI5A 4C1TA 3IORA 4EQBA 4JB7A 4ELRA 5H8HB 1B3EA 4H5GA 1NNKA 5H8QA 3FATA 1MQIA 1URSA 2PVUA 4F22A 5I57B 3PPRA 4ELPA 2F6PA 3B6QA 2P1SA 1MXWA 1SDXA 4DXBA 5CMBA 3RY3A 1YCJA 3DELB 3A3CA 1MH4A 3THIA 2Z22A 2UVJA 5JEIA 2VD3A 4H8JA 2PMSA 4IO6A 2OCUA 1Y3QA 3TQWA 1M5CA 4H1XA 2BJJX 2XXWA 4ECFA 3G3GA 4IO5A 2HCAA 4KYDA 3K6WA 3H06B 3MZ9A 1OQGA 4Z7EA 2HZKA 5HM4B 3QUJA 1FQCA 1UQWA 3N5LA 2V93A 3T9UA 1P1QA 3FVKA 4OYVA 1HSJA 3JYRA 4U22A 1LAXA 1NNFA 4LZ7A 4OFOA 1SYIA 3KJ7A 2Y84A 1MQJA 1BTJA 1H3DA 2XXUA 2DYXA 2ZYKA 3F11A 1GGGA 4LVQA 2DXRA 1JEVA 5K2XA 5CBRA 3PPOA 4RXLA 1N7WA 2RC9A 3W15C 5DVIA 3PD8A 4G68A 2HQ0A 3FD3A 2ALUA 3TZAA 5I58B 4R9GA 2RC7A 1B3LA 1CB6A 3O6GA 1BKAA 3KJTA 3WAEA 4PE5B 3RT6B 4YZZA 3PUVE 3DP6A 1BLFA 4DDDA 1FQAA 3PPPA 1SW2A 2I4BA 2XX8A 1R1NA 3TCHA 3IO4A 3KN7A 4GVOA 4R6HA 2I0BA 1FTLA 2A5TB 4ZS9A 2XX9A 3VXBA 3LSWA 2H4IA 2F8DA 2NVUB 3LC8A 3CG3A 2O6AA 4PFYA 2ONRA 4LUBA 2REJA 1P1OA 5JK4A 4GOTA 4YMBA 1NKXA 4YKKA 1A54A 3RUMA 3QXMA 3S4UA 2I0CA 4WEDA 1H44A 1MXUA 1F9BA 5IKBA 4E0WA 1JW4A 3H6VA 1B2HA 5L8DA 3E3KA 4H67A 4NE4A 3IOWA 3Q29A 4GL0A 1LB9A 4OVJA 3M3FA 4Q30B 1VFEA 3MVZA 3M3KA 2B3BA 4YKJA 4LP2B 2OK2A 4RPNA 1SVXB 4XKQA 3VLWA 4F31B 1URGA 3H6WA 4X1DA 3SEWA 3S9LC 4ZEIA 3FV2A 3FXRA 1I6QA 1B46A 1ZKBA 1JNFA 4IGTA 2XXQA 1FQEA 3BFTA 1ZTYA 4EF1A 4ONYA 5AA4A 4MLQA 4I9DA 4JWOA 3S9MC 3EHSA 5FHNA 1POTA 3K01A 3CI8A 1QKAA 3RLFE 4ZE8A 4O3AA 1MQHA 2UYEA 4C0RA 2YJPA 3SERA 4XIGQ 3G3FA 4JXIA 3H7MA 1B5IA 2I58A 5BUUA 2UYFA 2RC8A 5AE4A 3KN3A 4MLVA 3C4MA 1IXCA 3D4GA 5TP9A 2HFBA 1YTVA 1JVXA 3PV0E 3HCQA 3C32A 4NF8A 4IY5A 1NH8A 3U72A 2RF1A 4WKMA 1II5A 4Z0IA 1XVYA 1S9TA 4YKPA 2QSXA 2OLBA 1LBBA 4F3GA 2O1LA 3IB1A 1PBQA 3S9NC 2XXIA 2OZZA 2OWTA 1VE4A 1MXZA 3SETA 2P0SA 3KGCA 1ZMGA 4YMAA 4QFKA 4KFQA 3V83A 2UVHA 3CRBA 1LFHA 4OXVA 3TUSA 1RYOA 3ODBA 4GD5A 1LAFE 1DTGA 5DTBA 3K6XA 5FHMA 2YPNA 4OFLA 4NTLA 4Q5TA 4YB5A 2I48A 4KYSA 1S50A 3E9XA 4TQUQ 1FQBA 4GXSB 3MPLA 3FJ7A 3PMXA 3Q27A 1EZOA 1O64A 1LGBC 2DVCA 5H8FA 4PFTA 1DOTA 1ZU0A 2FYIA 3ONMA 1B58A 1B40A 2P2AA 3FVOA 4F3SA 2IA4A 3KSXA 2REGA 4U4SA 2PBWA 1WVJA 4TLLB 2Q89A 3I3VA 5AA2A 1B3GA 1IUDA 4DXUA 1B7UA 3TFLA 2XHDA 2XXHA 4XTCQ 1LFIA 3K0VA 1LAHE 3V8XB 3Q28A 3H4ZA 3OO9A 2F36A 4LA9A 3HN0A 4R6YA 2VGQA 1OLCA 1ZJLA 4QFPA 4JWXA 4EXKA 3TELA 4MBPA 3UP9A 3TTMA 1H45A 1Y1ZA 4ZEFA 2O68A 5TPAA 1EZPA 3GLBA 1ZBMA 4IO4A 4NF5A 2XXVA 2OBGA 4KI0E 4P11A 4X9TA 4U2RA 2KLFA 4PFUA 1P99A 1JW1A 4AB6A 2I49A 2XD3A 4OENA 2V25A 1B3HA 4EF2A 1LCFA 4OTEA 2ZNSA 3UA8A 1T0KA 3L6HA 2Y7WA 3OSQA 3DLNA 1M5EA 3MZ1A 4WEPA 1CE2A 5KCJB 2H9BA 3TYHA 2M8CA 2Q88A 3N6UA 5EHMA 3Q26A 4NF6A 4ZZEA 2I6EA 4IO2A 4UACA 1VR5A 1R6ZA 4P0GA 1FQFA 3KN8A 1JVYA 1MG1A 4E0XA 4AQ4A 1N3WA 2Y7IA 1SW1A 1DTZA 1GVCA 1UTHB 2ANJA 5H8HA 4MH5A 4ZECA 4U21A 4BDLA 3O28A 4LQ5A 5I57A 5AA2D 3BKIB 2UXAA 2B65A 1LLSA 1IXHA 1J1NA 2XD2A 1N3XA 4FECA 4FATA 4JSDA 2CZLA 1B6HA 4QHQA 3BBRA 3O2AA 1MH3A 3IL1B 1A8FA 3H6TA 4KYEA 2AL4A 3FV1A 4DZ1A 2F35A 2O84X 3HPIA 1ELJA 1MY0A 2D3IA 3N94A 4NMYA 3KZGA 4UA8A 3G3HA 4TLMB 2ZXTA 3E4RA 3IK6B 2GH9A 1LCTA 3QAXA 4LZ8A 3UGWA 4L17A 3PPNA 2ZYMA 4OESA 2Q2AA 2YLNA 3T93B 4BDNA 3G3JA 5EHSA 4NF4B 5DVJA 4RK2A 1MPBA 3W9WA 1OVBA 3K2DA 3PPQA 4LQ2A 2DE4A 4F3PA 1I6BA 3MVXA 3HO7A 1SQYA 3ILTB 3UORA 3EQ1A 4FJPA 1HSLA 4KCCA 3FXUA 3DP8A 2F7BA 4P0IA 1TXFA 1N0TA 2Y7RA 4RYAA 1Q35A 5CMKA 3IJOB 1JETA 3O97A 3OMBA 3C31A 2PX1A 3QSLA 5JTYB 2DE2A 5B7DA 4LZ5A 3PUXE 1QUKA 5L9SA 3IR1A 2Q9TA 4RNSA 1IIWA 2A5TA 1Y4TA 4G8HA 1OVTA 1XS5A 2CMOA 4JBZA 5I59B 2O7UA 1PDAA 1P1UA 5CRYA 3G3KA 4ZEBA 1A55A 1AL3A 5I56B 1US5A 5I2KB 3KFMA 2PT1A 2DXYA 4HS7A 2ZNTA 5I2NB 3QUFA 4QFLA 4F18A 1PB9A 2OWSA 3FJGA 3RPWA 4R2FA 3S2VA 1B1HA 4H8IA 3VVFA 2F5XA 4DLDA 3GBBA 4XKPA 3VE1B 3K00A 3VDFA 2DQVA 5KDTB 2DSFA 4AB5A 1B5HA 3T9XB 2X7PA 3TTRA 1NNPA 1IZ1A 4QSEA 2ABHA 4H65A 1USYE 1B1XA 2DWJA 1FCKA 4OZ9A 1Q1KA 2ONSA 2PYYA 4GL8A 3RTWB 1B05A 1P1NA 2E1SA 4XKRA 3UN6A 4F29A 5M2VA 4QSCA 1A40A 3PMVA 3VVEA 2G93A 3C36A 3HSTA 3OO8A 3TAJA 1QKBA 2DWIA 2WKYA 2GRVA 1QVSA 1GR2A 3ILUB 2DE3A 4QFNA 3OELA 4DXCA 1TFAA 3SEUA 1USYH 1IITA 1A99A 3FGSA 2THIA 3D4CA 3H3GA 3FASA 3M3LA 5ITOA 4GXAA 5CC2A 5H8NB 1ATGA 3IOTA 4G8MA 1XC1A 4DE8A 2DS9A 3V89B 4OEVA 3R7XA 3T22A 1NH7A 4F1VA 4RA1A 2D5WA 1SW4A 3C34A 3WAFA 1JW5A 3ZS6A 3U94A 3MWBA 1ZIUA 4I1DA 5DEXB 3U93A 1RYXA 1FTMA 1NFTA 1SYHA 3PU5A 1N76A 2XXRA 4BDQA 3JV9A 1EZ9A 5CM6A 4DCYA 3DP4A 1OQHA 3CIJA 3T9VA 2DWAA 4G2ZA 3A09A 4BDRA 3O29A 3O6IA 1D9VA 1LB8A 5DYHA 1BIYA 5A5XB 3VV5A 2G29A 3TTNA 4GFRA 4X1BA 2HZLA 1YPNA 1VFDA 5TU0A 3ZKKA 4TOZA 1FW0A 2X7QA 4F2OA 3KEIA 2QS1A 1NNTA 4I62A 2GHAA 5BWJA 4ELOA 1R9QA 5CBSA 1PB8A 4BLAA 4XKNA 3TCFA 2I4CA 3TMGA 3IO6A 5B70A 1MPCA 4GIZA 3KSJA 2A5SA 3FXQA 1MXYA 1DSNA 1D4NA 4LATA 2QPQA 2AIXA 2O51A 3K1PA 4RPOA 2XXTA 4ISUA 3HHFA 2Q2CA 4GLIA 1US4A 4R72A 4EUOA 4YB7A 3VFJA 1I6AA 4MFIA 3PMWA 1O63A 4JWYA 1QUIA 1N84A 4PP0A 2XXPA 3IOVA 3PD9A 3R26A 4RY1A 1A8EA 1B5JA 3FJMA 3ZSFA 3RNNA 2HXWA 2H5YA 4OMBA 4DCXA 1QJMA 5L9MA 3LSFB 1B9JA 1BP5A 1MPDA 1UTBB 4G77A 2O69A 4YU0A 5AA2B 5DVFA 2RCBA 2Z23A 3OSRA 3RTFB 1FTKA 3R6UA 4NEDA 1QW0A 1QUJA 4ND9A 5ISUA 4QRZA 3RGYA 2VOZA 2F78A 5FHOA 3SEXA 3PUZE 4YICA 3A3UA 5ICQA 5AA1A 3AXFA 3EHTA 3MVYA 3K02A 3U92A 1FTJA 1PC3A 3TCGA 2O7IA 4KQPA 1ANFA 4XXUA 1MDQA 4F2QA 1IXIA 5KCJA 2NWJA 2QS4A 2Z8DA 3IB2A 3Q25A 5HPQA 2GHBA 3RQTA 5AA3A 2O1MA 3MP6A 3TDJA 3C9HA 4IGRA 4R6KA 3ZKLA 3B6WA 4OETA 1IQ7A 4QF9A 3K4UA 2AL5A 1UTHA 3CSGA 3H6UA 3HV1A 3PUYE 3IAZA 3OO6A 1NMUA 5H8QB 5LOMA 2Y7PA 5ELVA 2HEUA 5K2YA 3K1MA 2H25A 4F19A 2Y7KA 2ZYNA 4F3BA 1AMFA 2XX7A 2R6GE 4Q8RA 4HW8A 1AIVA 1H43A 1ZLQA 2HAVA 3TTLA 5KZTA 4IB2A 1RKMA 1WDNA 5CMCA 2GFEA 3MUQA 3FIRA 4QFOA 3TQLA 3IB0A 4H5FA 3M8UA 1LBCA 1SBPA 1LFGA 3O9PA 3TODA 1LSTA 3MQ9A 4RK9A 4ZEKA 5IAIA 1SD3A 1MY2A 5J1DA 3RT8A 5CMMA 1VSOA 3N6TA 5ITPA 4R9FA 3FVNA 1EU8A 4EQ7A 1MM7A 4ZDMA 4NF4A 2F97A 2F7AA 2DWHA 4HCYA 3K1NA 3MVWA 1Y9UA 3MZBA 1B52A 1Y3NA 5L9OA 4U4XA 5I58A 1M5DA 1I69A 2F7CA 4HTGA 4NWCA 3USDA 1B4HA 1S7YA 3C35A 4G68B 1H76A 3EPEA 4ELQA 1PB7A 2VHAA 3SESA 1UIVA 2Q8JA 3TPAA 3U8QA 4YAHX 4F1UA 4OEUA 1N04A 3U1OA 3TKDA 1DMBA 3OD7A 4POWA 3E13X 4IO7A 5JTYA 4X48A 1WODA 1P1WA 3LSLA 1B7HA 1PBPA 1TWYA 3MJNA 4R73A 4GWOA 4Q0CA 3I5OA 2Z8FA 4ESWA 2QRYA 3C33A 4G4PA 2NOOA 5FTHA 5I59A 3T96B 4JSOA 4KHZE 3VLUA 4OERA 5I56A 5I2KA 1TFDA 4ESXA 1QULA 1MQGA 1EH3A 4FORA 4OWDA 5I2NA 4QSDA 2E0SA 4PQJA 3K6VA 2QL3A 4PFWA 4U1ZA 2NXOA 3CG1A 3DM0A 4HCWA 4H0WA 2QS3A 1B4ZA 3QIMA 2UVGA 1UIUA 5KDTA 4KD5A 1XVXA 2VP1A 4FAJA 2LAOA 1B0HA 4R2BA 3KG2A 1MXVA 5H8SA 4IY6A 4FE8A 1Y1MA 1MQDA 5F1QA 1A7LA 3H03A 1SI0A 1MM6A 2R71A 4FEDA 4KR5A 3T9HB 4JDFA 4F1YA 4KPTA 3CFXA 3SKPA 4ZE9A 3SDFA 5EYFA 1NL5A 4BDOA 2V84A 3KOTA 1Z7ME 3LUYA 3KOSA 3OO7A 1O7TA 5AA4B 3EN3A 3KBRA 1D9YA 1Y4CA 3FVGA 2QMXA 2V3QA 1OMPA 3PGFA 3HHGA 3PUWE 5I84A 2ONKE 3IX1A 3MP1A 4MF3A 5ICTA 3FUZA 3LSXA 4GQOA 1B0LA 3CSBA 3O6HA 5H8NA 3GXAA 3G7WA 4FIMA 3GZGA 4R75A 1MY3A 3FZVA 2IEEA 5HBCA 3RN8A 1POY1 5TP9B 2DP8A 2XXYA 5DEXA 1FTOA 1SW5A 1MXXA 2QMWA 2RCAA 1DPEA 3OEKA 1L5TA 3EHUA 2Z8EA 2ZNUA 3I6VA 4NF8B 3T66A 1Y3PA 1FQDA 3UIFA 1Y20A 1B51A 2HAUA 4N6PA 5A5XA 4ZEDA 2X26A 4EXLA 3BFUA 3CFZA 2VD2A 3O66A 3MPKA 4NWDA 1PEBA 3SEVA 4I8CA 3OENA 3OXNA 1HSEA 3TTKA 1DPPA 1MY1A 3QK6A 4O3BA 1JEUA 3MP8A 1MY4A 3MBPA 2D21A 3IOUA 2OJTA 2RKMA 1OIBA 2ESNA 4H6DA 1AOVA 1D3KA 4N13A 3EF7A 1MRPA 4OHNA 2F34A 1Z7NE 1M5BA 4KCDA 3JZJA 2AYSA 4OFJA 4F39A 4M1VA 3VLVA 4IO3A 3K6UA 4POXA 2PT2A 2R9JA 3MC2A 1LAGE 1XOCA 3UK4A 3W9VA 3B7DA 3CVGA 1JQFA 4RJZA 2F6GA 4GRKA 5H8FB 1B32A 2DVZA 1MDP1 2ZMBA 1GV8A 3CR9A 2H99A 1URDA 3MAMA 2QJEA 4LONB 2V3TA 1UTBA 4WXJA 2FA7A 1OLAA 4K3FA 3IJXB 3OEMA 4ZZAA 4GF8A 4G8NA 1M5FA 2W7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3F A;  4U23 A;  1SI1 A;  4M4G A;  4EQ9 A;  1B7Z A;  4C1U A;  4O3C A;  1XHY A;  4DIG A;  4FEB A;  3OOA A;  1IXG A;  3LBS A;  3ECR A;  4U1O A;  5TPA B;  1GTK A;  2I3W A;  5DT6 A;  4NF5 B;  4THI A;  4EDP A;  3VVD A;  2B3F A;  3L6G A;  2NUV A;  3P7I A;  3LR1 A;  5FTI A;  1AH5 A;  1R9L A;  3TEP A;  3N26 A;  3S9E A;  3G3I A;  4YB6 A;  4YKI A;  3SEY A;  4PET A;  3GBA A;  4OQO A;  2XXX A;  3MW0 A;  1TT1 A;  2FNC A;  3VXC A;  1YAE A;  1MS7 A;  2V3U A;  1XT8 A;  2RIN A;  3V5A A;  3QYT A;  3CFL A;  2DOJ A;  4NF6 B;  5F7V A;  1KWH A;  2QS2 A;  4G68 C;  1N7X A;  4R74 A;  2H98 A;  2I3V A;  4N07 A;  2ZYO A;  3B6T A;  4BDM A;  1IEJ A;  2UVI A;  5CI5 A;  4C1T A;  3IOR A;  4EQB A;  4JB7 A;  4ELR A;  5H8H B;  1B3E A;  4H5G A;  1NNK A;  5H8Q A;  3FAT A;  1MQI A;  1URS A;  2PVU A;  4F22 A;  5I57 B;  3PPR A;  4ELP A;  2F6P A;  3B6Q A;  2P1S A;  1MXW A;  1SDX A;  4DXB A;  5CMB A;  3RY3 A;  1YCJ A;  3DEL B;  3A3C A;  1MH4 A;  3THI A;  2Z22 A;  2UVJ A;  5JEI A;  2VD3 A;  4H8J A;  2PMS A;  4IO6 A;  2OCU A;  1Y3Q A;  3TQW A;  1M5C A;  4H1X A;  2BJJ X;  2XXW A;  4ECF A;  3G3G A;  4IO5 A;  2HCA A;  4KYD A;  3K6W A;  3H06 B;  3MZ9 A;  1OQG A;  4Z7E A;  2HZK A;  5HM4 B;  3QUJ A;  1FQC A;  1UQW A;  3N5L A;  2V93 A;  3T9U A;  1P1Q A;  3FVK A;  4OYV A;  1HSJ A;  3JYR A;  4U22 A;  1LAX A;  1NNF A;  4LZ7 A;  4OFO A;  1SYI A;  3KJ7 A;  2Y84 A;  1MQJ A;  1BTJ A;  1H3D A;  2XXU A;  2DYX A;  2ZYK A;  3F11 A;  1GGG A;  4LVQ A;  2DXR A;  1JEV A;  5K2X A;  5CBR A;  3PPO A;  4RXL A;  1N7W A;  2RC9 A;  3W15 C;  5DVI A;  3PD8 A;  4G68 A;  2HQ0 A;  3FD3 A;  2ALU A;  3TZA A;  5I58 B;  4R9G A;  2RC7 A;  1B3L A;  1CB6 A;  3O6G A;  1BKA A;  3KJT A;  3WAE A;  4PE5 B;  3RT6 B;  4YZZ A;  3PUV E;  3DP6 A;  1BLF A;  4DDD A;  1FQA A;  3PPP A;  1SW2 A;  2I4B A;  2XX8 A;  1R1N A;  3TCH A;  3IO4 A;  3KN7 A;  4GVO A;  4R6H A;  2I0B A;  1FTL A;  2A5T B;  4ZS9 A;  2XX9 A;  3VXB A;  3LSW A;  2H4I A;  2F8D A;  2NVU B;  3LC8 A;  3CG3 A;  2O6A A;  4PFY A;  2ONR A;  4LUB A;  2REJ A;  1P1O A;  5JK4 A;  4GOT A;  4YMB A;  1NKX A;  4YKK A;  1A54 A;  3RUM A;  3QXM A;  3S4U A;  2I0C A;  4WED A;  1H44 A;  1MXU A;  1F9B A;  5IKB A;  4E0W A;  1JW4 A;  3H6V A;  1B2H A;  5L8D A;  3E3K A;  4H67 A;  4NE4 A;  3IOW A;  3Q29 A;  4GL0 A;  1LB9 A;  4OVJ A;  3M3F A;  4Q30 B;  1VFE A;  3MVZ A;  3M3K A;  2B3B A;  4YKJ A;  4LP2 B;  2OK2 A;  4RPN A;  1SVX B;  4XKQ A;  3VLW A;  4F31 B;  1URG A;  3H6W A;  4X1D A;  3SEW A;  3S9L C;  4ZEI A;  3FV2 A;  3FXR A;  1I6Q A;  1B46 A;  1ZKB A;  1JNF A;  4IGT A;  2XXQ A;  1FQE A;  3BFT A;  1ZTY A;  4EF1 A;  4ONY A;  5AA4 A;  4MLQ A;  4I9D A;  4JWO A;  3S9M C;  3EHS A;  5FHN A;  1POT A;  3K01 A;  3CI8 A;  1QKA A;  3RLF E;  4ZE8 A;  4O3A A;  1MQH A;  2UYE A;  4C0R A;  2YJP A;  3SER A;  4XIG Q;  3G3F A;  4JXI A;  3H7M A;  1B5I A;  2I58 A;  5BUU A;  2UYF A;  2RC8 A;  5AE4 A;  3KN3 A;  4MLV A;  3C4M A;  1IXC A;  3D4G A;  5TP9 A;  2HFB A;  1YTV A;  1JVX A;  3PV0 E;  3HCQ A;  3C32 A;  4NF8 A;  4IY5 A;  1NH8 A;  3U72 A;  2RF1 A;  4WKM A;  1II5 A;  4Z0I A;  1XVY A;  1S9T A;  4YKP A;  2QSX A;  2OLB A;  1LBB A;  4F3G A;  2O1L A;  3IB1 A;  1PBQ A;  3S9N C;  2XXI A;  2OZZ A;  2OWT A;  1VE4 A;  1MXZ A;  3SET A;  2P0S A;  3KGC A;  1ZMG A;  4YMA A;  4QFK A;  4KFQ A;  3V83 A;  2UVH A;  3CRB A;  1LFH A;  4OXV A;  3TUS A;  1RYO A;  3ODB A;  4GD5 A;  1LAF E;  1DTG A;  5DTB A;  3K6X A;  5FHM A;  2YPN A;  4OFL A;  4NTL A;  4Q5T A;  4YB5 A;  2I48 A;  4KYS A;  1S50 A;  3E9X A;  4TQU Q;  1FQB A;  4GXS B;  3MPL A;  3FJ7 A;  3PMX A;  3Q27 A;  1EZO A;  1O64 A;  1LGB C;  2DVC A;  5H8F A;  4PFT A;  1DOT A;  1ZU0 A;  2FYI A;  3ONM A;  1B58 A;  1B40 A;  2P2A A;  3FVO A;  4F3S A;  2IA4 A;  3KSX A;  2REG A;  4U4S A;  2PBW A;  1WVJ A;  4TLL B;  2Q89 A;  3I3V A;  5AA2 A;  1B3G A;  1IUD A;  4DXU A;  1B7U A;  3TFL A;  2XHD A;  2XXH A;  4XTC Q;  1LFI A;  3K0V A;  1LAH E;  3V8X B;  3Q28 A;  3H4Z A;  3OO9 A;  2F36 A;  4LA9 A;  3HN0 A;  4R6Y A;  2VGQ A;  1OLC A;  1ZJL A;  4QFP A;  4JWX A;  4EXK A;  3TEL A;  4MBP A;  3UP9 A;  3TTM A;  1H45 A;  1Y1Z A;  4ZEF A;  2O68 A;  5TPA A;  1EZP A;  3GLB A;  1ZBM A;  4IO4 A;  4NF5 A;  2XXV A;  2OBG A;  4KI0 E;  4P11 A;  4X9T A;  4U2R A;  2KLF A;  4PFU A;  1P99 A;  1JW1 A;  4AB6 A;  2I49 A;  2XD3 A;  4OEN A;  2V25 A;  1B3H A;  4EF2 A;  1LCF A;  4OTE A;  2ZNS A;  3UA8 A;  1T0K A;  3L6H A;  2Y7W A;  3OSQ A;  3DLN A;  1M5E A;  3MZ1 A;  4WEP A;  1CE2 A;  5KCJ B;  2H9B A;  3TYH A;  2M8C A;  2Q88 A;  3N6U A;  5EHM A;  3Q26 A;  4NF6 A;  4ZZE A;  2I6E A;  4IO2 A;  4UAC A;  1VR5 A;  1R6Z A;  4P0G A;  1FQF A;  3KN8 A;  1JVY A;  1MG1 A;  4E0X A;  4AQ4 A;  1N3W A;  2Y7I A;  1SW1 A;  1DTZ A;  1GVC A;  1UTH B;  2ANJ A;  5H8H A;  4MH5 A;  4ZEC A;  4U21 A;  4BDL A;  3O28 A;  4LQ5 A;  5I57 A;  5AA2 D;  3BKI B;  2UXA A;  2B65 A;  1LLS A;  1IXH A;  1J1N A;  2XD2 A;  1N3X A;  4FEC A;  4FAT A;  4JSD A;  2CZL A;  1B6H A;  4QHQ A;  3BBR A;  3O2A A;  1MH3 A;  3IL1 B;  1A8F A;  3H6T A;  4KYE A;  2AL4 A;  3FV1 A;  4DZ1 A;  2F35 A;  2O84 X;  3HPI A;  1ELJ A;  1MY0 A;  2D3I A;  3N94 A;  4NMY A;  3KZG A;  4UA8 A;  3G3H A;  4TLM B;  2ZXT A;  3E4R A;  3IK6 B;  2GH9 A;  1LCT A;  3QAX A;  4LZ8 A;  3UGW A;  4L17 A;  3PPN A;  2ZYM A;  4OES A;  2Q2A A;  2YLN A;  3T93 B;  4BDN A;  3G3J A;  5EHS A;  4NF4 B;  5DVJ A;  4RK2 A;  1MPB A;  3W9W A;  1OVB A;  3K2D A;  3PPQ A;  4LQ2 A;  2DE4 A;  4F3P A;  1I6B A;  3MVX A;  3HO7 A;  1SQY A;  3ILT B;  3UOR A;  3EQ1 A;  4FJP A;  1HSL A;  4KCC A;  3FXU A;  3DP8 A;  2F7B A;  4P0I A;  1TXF A;  1N0T A;  2Y7R A;  4RYA A;  1Q35 A;  5CMK A;  3IJO B;  1JET A;  3O97 A;  3OMB A;  3C31 A;  2PX1 A;  3QSL A;  5JTY B;  2DE2 A;  5B7D A;  4LZ5 A;  3PUX E;  1QUK A;  5L9S A;  3IR1 A;  2Q9T A;  4RNS A;  1IIW A;  2A5T A;  1Y4T A;  4G8H A;  1OVT A;  1XS5 A;  2CMO A;  4JBZ A;  5I59 B;  2O7U A;  1PDA A;  1P1U A;  5CRY A;  3G3K A;  4ZEB A;  1A55 A;  1AL3 A;  5I56 B;  1US5 A;  5I2K B;  3KFM A;  2PT1 A;  2DXY A;  4HS7 A;  2ZNT A;  5I2N B;  3QUF A;  4QFL A;  4F18 A;  1PB9 A;  2OWS A;  3FJG A;  3RPW A;  4R2F A;  3S2V A;  1B1H A;  4H8I A;  3VVF A;  2F5X A;  4DLD A;  3GBB A;  4XKP A;  3VE1 B;  3K00 A;  3VDF A;  2DQV A;  5KDT B;  2DSF A;  4AB5 A;  1B5H A;  3T9X B;  2X7P A;  3TTR A;  1NNP A;  1IZ1 A;  4QSE A;  2ABH A;  4H65 A;  1USY E;  1B1X A;  2DWJ A;  1FCK A;  4OZ9 A;  1Q1K A;  2ONS A;  2PYY A;  4GL8 A;  3RTW B;  1B05 A;  1P1N A;  2E1S A;  4XKR A;  3UN6 A;  4F29 A;  5M2V A;  4QSC A;  1A40 A;  3PMV A;  3VVE A;  2G93 A;  3C36 A;  3HST A;  3OO8 A;  3TAJ A;  1QKB A;  2DWI A;  2WKY A;  2GRV A;  1QVS A;  1GR2 A;  3ILU B;  2DE3 A;  4QFN A;  3OEL A;  4DXC A;  1TFA A;  3SEU A;  1USY H;  1IIT A;  1A99 A;  3FGS A;  2THI A;  3D4C A;  3H3G A;  3FAS A;  3M3L A;  5ITO A;  4GXA A;  5CC2 A;  5H8N B;  1ATG A;  3IOT A;  4G8M A;  1XC1 A;  4DE8 A;  2DS9 A;  3V89 B;  4OEV A;  3R7X A;  3T22 A;  1NH7 A;  4F1V A;  4RA1 A;  2D5W A;  1SW4 A;  3C34 A;  3WAF A;  1JW5 A;  3ZS6 A;  3U94 A;  3MWB A;  1ZIU A;  4I1D A;  5DEX B;  3U93 A;  1RYX A;  1FTM A;  1NFT A;  1SYH A;  3PU5 A;  1N76 A;  2XXR A;  4BDQ A;  3JV9 A;  1EZ9 A;  5CM6 A;  4DCY A;  3DP4 A;  1OQH A;  3CIJ A;  3T9V A;  2DWA A;  4G2Z A;  3A09 A;  4BDR A;  3O29 A;  3O6I A;  1D9V A;  1LB8 A;  5DYH A;  1BIY A;  5A5X B;  3VV5 A;  2G29 A;  3TTN A;  4GFR A;  4X1B A;  2HZL A;  1YPN A;  1VFD A;  5TU0 A;  3ZKK A;  4TOZ A;  1FW0 A;  2X7Q A;  4F2O A;  3KEI A;  2QS1 A;  1NNT A;  4I62 A;  2GHA A;  5BWJ A;  4ELO A;  1R9Q A;  5CBS A;  1PB8 A;  4BLA A;  4XKN A;  3TCF A;  2I4C A;  3TMG A;  3IO6 A;  5B70 A;  1MPC A;  4GIZ A;  3KSJ A;  2A5S A;  3FXQ A;  1MXY A;  1DSN A;  1D4N A;  4LAT A;  2QPQ A;  2AIX A;  2O51 A;  3K1P A;  4RPO A;  2XXT A;  4ISU A;  3HHF A;  2Q2C A;  4GLI A;  1US4 A;  4R72 A;  4EUO A;  4YB7 A;  3VFJ A;  1I6A A;  4MFI A;  3PMW A;  1O63 A;  4JWY A;  1QUI A;  1N84 A;  4PP0 A;  2XXP A;  3IOV A;  3PD9 A;  3R26 A;  4RY1 A;  1A8E A;  1B5J A;  3FJM A;  3ZSF A;  3RNN A;  2HXW A;  2H5Y A;  4OMB A;  4DCX A;  1QJM A;  5L9M A;  3LSF B;  1B9J A;  1BP5 A;  1MPD A;  1UTB B;  4G77 A;  2O69 A;  4YU0 A;  5AA2 B;  5DVF A;  2RCB A;  2Z23 A;  3OSR A;  3RTF B;  1FTK A;  3R6U A;  4NED A;  1QW0 A;  1QUJ A;  4ND9 A;  5ISU A;  4QRZ A;  3RGY A;  2VOZ A;  2F78 A;  5FHO A;  3SEX A;  3PUZ E;  4YIC A;  3A3U A;  5ICQ A;  5AA1 A;  3AXF A;  3EHT A;  3MVY A;  3K02 A;  3U92 A;  1FTJ A;  1PC3 A;  3TCG A;  2O7I A;  4KQP A;  1ANF A;  4XXU A;  1MDQ A;  4F2Q A;  1IXI A;  5KCJ A;  2NWJ A;  2QS4 A;  2Z8D A;  3IB2 A;  3Q25 A;  5HPQ A;  2GHB A;  3RQT A;  5AA3 A;  2O1M A;  3MP6 A;  3TDJ A;  3C9H A;  4IGR A;  4R6K A;  3ZKL A;  3B6W A;  4OET A;  1IQ7 A;  4QF9 A;  3K4U A;  2AL5 A;  1UTH A;  3CSG A;  3H6U A;  3HV1 A;  3PUY E;  3IAZ A;  3OO6 A;  1NMU A;  5H8Q B;  5LOM A;  2Y7P A;  5ELV A;  2HEU A;  5K2Y A;  3K1M A;  2H25 A;  4F19 A;  2Y7K A;  2ZYN A;  4F3B A;  1AMF A;  2XX7 A;  2R6G E;  4Q8R A;  4HW8 A;  1AIV A;  1H43 A;  1ZLQ A;  2HAV A;  3TTL A;  5KZT A;  4IB2 A;  1RKM A;  1WDN A;  5CMC A;  2GFE A;  3MUQ A;  3FIR A;  4QFO A;  3TQL A;  3IB0 A;  4H5F A;  3M8U A;  1LBC A;  1SBP A;  1LFG A;  3O9P A;  3TOD A;  1LST A;  3MQ9 A;  4RK9 A;  4ZEK A;  5IAI A;  1SD3 A;  1MY2 A;  5J1D A;  3RT8 A;  5CMM A;  1VSO A;  3N6T A;  5ITP A;  4R9F A;  3FVN A;  1EU8 A;  4EQ7 A;  1MM7 A;  4ZDM A;  4NF4 A;  2F97 A;  2F7A A;  2DWH A;  4HCY A;  3K1N A;  3MVW A;  1Y9U A;  3MZB A;  1B52 A;  1Y3N A;  5L9O A;  4U4X A;  5I58 A;  1M5D A;  1I69 A;  2F7C A;  4HTG A;  4NWC A;  3USD A;  1B4H A;  1S7Y A;  3C35 A;  4G68 B;  1H76 A;  3EPE A;  4ELQ A;  1PB7 A;  2VHA A;  3SES A;  1UIV A;  2Q8J A;  3TPA A;  3U8Q A;  4YAH X;  4F1U A;  4OEU A;  1N04 A;  3U1O A;  3TKD A;  1DMB A;  3OD7 A;  4POW A;  3E13 X;  4IO7 A;  5JTY A;  4X48 A;  1WOD A;  1P1W A;  3LSL A;  1B7H A;  1PBP A;  1TWY A;  3MJN A;  4R73 A;  4GWO A;  4Q0C A;  3I5O A;  2Z8F A;  4ESW A;  2QRY A;  3C33 A;  4G4P A;  2NOO A;  5FTH A;  5I59 A;  3T96 B;  4JSO A;  4KHZ E;  3VLU A;  4OER A;  5I56 A;  5I2K A;  1TFD A;  4ESX A;  1QUL A;  1MQG A;  1EH3 A;  4FOR A;  4OWD A;  5I2N A;  4QSD A;  2E0S A;  4PQJ A;  3K6V A;  2QL3 A;  4PFW A;  4U1Z A;  2NXO A;  3CG1 A;  3DM0 A;  4HCW A;  4H0W A;  2QS3 A;  1B4Z A;  3QIM A;  2UVG A;  1UIU A;  5KDT A;  4KD5 A;  1XVX A;  2VP1 A;  4FAJ A;  2LAO A;  1B0H A;  4R2B A;  3KG2 A;  1MXV A;  5H8S A;  4IY6 A;  4FE8 A;  1Y1M A;  1MQD A;  5F1Q A;  1A7L A;  3H03 A;  1SI0 A;  1MM6 A;  2R71 A;  4FED A;  4KR5 A;  3T9H B;  4JDF A;  4F1Y A;  4KPT A;  3CFX A;  3SKP A;  4ZE9 A;  3SDF A;  5EYF A;  1NL5 A;  4BDO A;  2V84 A;  3KOT A;  1Z7M E;  3LUY A;  3KOS A;  3OO7 A;  1O7T A;  5AA4 B;  3EN3 A;  3KBR A;  1D9Y A;  1Y4C A;  3FVG A;  2QMX A;  2V3Q A;  1OMP A;  3PGF A;  3HHG A;  3PUW E;  5I84 A;  2ONK E;  3IX1 A;  3MP1 A;  4MF3 A;  5ICT A;  3FUZ A;  3LSX A;  4GQO A;  1B0L A;  3CSB A;  3O6H A;  5H8N A;  3GXA A;  3G7W A;  4FIM A;  3GZG A;  4R75 A;  1MY3 A;  3FZV A;  2IEE A;  5HBC A;  3RN8 A;  1POY 1;  5TP9 B;  2DP8 A;  2XXY A;  5DEX A;  1FTO A;  1SW5 A;  1MXX A;  2QMW A;  2RCA A;  1DPE A;  3OEK A;  1L5T A;  3EHU A;  2Z8E A;  2ZNU A;  3I6V A;  4NF8 B;  3T66 A;  1Y3P A;  1FQD A;  3UIF A;  1Y20 A;  1B51 A;  2HAU A;  4N6P A;  5A5X A;  4ZED A;  2X26 A;  4EXL A;  3BFU A;  3CFZ A;  2VD2 A;  3O66 A;  3MPK A;  4NWD A;  1PEB A;  3SEV A;  4I8C A;  3OEN A;  3OXN A;  1HSE A;  3TTK A;  1DPP A;  1MY1 A;  3QK6 A;  4O3B A;  1JEU A;  3MP8 A;  1MY4 A;  3MBP A;  2D21 A;  3IOU A;  2OJT A;  2RKM A;  1OIB A;  2ESN A;  4H6D A;  1AOV A;  1D3K A;  4N13 A;  3EF7 A;  1MRP A;  4OHN A;  2F34 A;  1Z7N E;  1M5B A;  4KCD A;  3JZJ A;  2AYS A;  4OFJ A;  4F39 A;  4M1V A;  3VLV A;  4IO3 A;  3K6U A;  4POX A;  2PT2 A;  2R9J A;  3MC2 A;  1LAG E;  1XOC A;  3UK4 A;  3W9V A;  3B7D A;  3CVG A;  1JQF A;  4RJZ A;  2F6G A;  4GRK A;  5H8F B;  1B32 A;  2DVZ A;  1MDP 1;  2ZMB A;  1GV8 A;  3CR9 A;  2H99 A;  1URD A;  3MAM A;  2QJE A;  4LON B;  2V3T A;  1UTB A;  4WXJ A;  2FA7 A;  1OLA A;  4K3F A;  3IJX B;  3OEM A;  4ZZA A;  4GF8 A;  4G8N A;  1M5F A;  2W7Y A; 
#chains in the Genus database with same CATH topology
 5F24 A;  1B3F A;  4U23 A;  1SI1 A;  4M4G A;  4PGP A;  4EQ9 A;  1B7Z A;  4C1U A;  4O3C A;  1XHY A;  4DIG A;  4FEB A;  3OOA A;  1IXG A;  5I7I A;  3LBS A;  3ECR A;  3QMF A;  4U1O A;  5TPA B;  1GTK A;  2I3W A;  5DT6 A;  4NF5 B;  2XA5 A;  4THI A;  4EDP A;  3VVD A;  2B3F A;  3L6G A;  2NUV A;  3P7I A;  3LR1 A;  5FTI A;  1AH5 A;  1R9L A;  3TEP A;  3N26 A;  3S9E A;  3G3I A;  4YB6 A;  4N17 A;  4YKI A;  3SEY A;  4PET A;  3GBA A;  4OQO A;  4I3Y A;  2XXX A;  3FXB A;  3MW0 A;  1TT1 A;  2FNC A;  3VXC A;  1YAE A;  1MS7 A;  2V3U A;  3BIH A;  1XT8 A;  2RIN A;  1SPI A;  3V5A A;  3QYT A;  3CFL A;  2DOJ A;  2XWO A;  4NF6 B;  5F7V A;  4QBA A;  1KWH A;  2QS2 A;  4G68 C;  1N7X A;  4R74 A;  2H98 A;  4N07 A;  2I3V A;  1EYK A;  2ZYO A;  3B6T A;  4BDM A;  1IEJ A;  2UVI A;  5CI5 A;  4C1T A;  3IOR A;  4EQB A;  2VT5 A;  4JB7 A;  4ELR A;  5H8H B;  1B3E A;  4H5G A;  1NNK A;  5H8Q A;  3FAT A;  1MQI A;  1URS A;  1DK4 A;  2PVU A;  4F22 A;  5I57 B;  3PPR A;  4ELP A;  2F6P A;  2Q74 A;  3B6Q A;  4GX4 A;  2P1S A;  1MXW A;  1SDX A;  1BK4 A;  5IM2 A;  5CMB A;  4DXB A;  3RY3 A;  1YCJ A;  2QVU A;  3DEL B;  3A3C A;  1MH4 A;  3THI A;  2HXR A;  2Z22 A;  2UVJ A;  5JEI A;  2VD3 A;  4H8J A;  2PMS A;  4IO6 A;  4PDH A;  2OCU A;  3CHG A;  2VPO A;  1Y3Q A;  3TQW A;  1M5C A;  4H1X A;  2BJJ X;  4XEQ A;  2XXW A;  4ECF A;  3G3G A;  4IO5 A;  2HCA A;  4KYD A;  3K6W A;  3H06 B;  3MZ9 A;  1OQG A;  3LUZ A;  4Z7E A;  2HZK A;  2HHM A;  3KBZ A;  5HM4 B;  3QUJ A;  1FQC A;  1UQW A;  3N5L A;  2V93 A;  3T9U A;  1P1Q A;  3FVK A;  4IR8 A;  5LDZ A;  4OYV A;  1HSJ A;  3JYR A;  4U22 A;  1LAX A;  1NNF A;  4LZ7 A;  4OFO A;  1SYI A;  4H46 A;  1NV4 A;  3KJ7 A;  2Y84 A;  1MQJ A;  1BTJ A;  1H3D A;  2XXU A;  2DYX A;  1IMB A;  2ZYK A;  3F11 A;  1GGG A;  4LVQ A;  3T1B A;  2DXR A;  4NG7 A;  1JEV A;  2JJK A;  1FBC A;  5K2X A;  4GWZ A;  4GX3 A;  5CBR A;  1FJ6 A;  5IZ3 A;  3PPO A;  4RXL A;  1N7W A;  1FPI A;  2RC9 A;  3W15 C;  5DVI A;  1YXI A;  3PD8 A;  4G68 A;  2HQ0 A;  3FD3 A;  2ALU A;  3TZA A;  5I58 B;  4GWW A;  5LTC A;  1KA1 A;  4R9G A;  2RC7 A;  1B3L A;  1CB6 A;  3O6G A;  1FPE A;  1BKA A;  4I3E A;  3KJT A;  4PCD A;  3WAE A;  4PE5 B;  2PFY A;  3RT6 B;  4YZZ A;  3PUV E;  4MEV A;  3DP6 A;  1BLF A;  4DDD A;  1FQA A;  3PPP A;  1SW2 A;  2I4B A;  2ZZV A;  2XX8 A;  1R1N A;  1FPJ A;  3TCH A;  3IO4 A;  3KN7 A;  4GVO A;  4R6H A;  2I0B A;  4P3L A;  1FTL A;  2A5T B;  4ZS9 A;  2XX9 A;  5IZ1 A;  3VXB A;  3LSW A;  4P56 A;  2H4I A;  2F8D A;  2NVU B;  3LC8 A;  3CG3 A;  2Q8M A;  2HPG A;  2O6A A;  4PFY A;  2ONR A;  4MAG A;  4LUB A;  2REJ A;  1P1O A;  5JK4 A;  4GOT A;  4OVT A;  4YMB A;  1NKX A;  4YKK A;  1A54 A;  3RUM A;  3QXM A;  3S4U A;  2I0C A;  1KZ8 A;  4WED A;  1H44 A;  1MXU A;  1F9B A;  5IKB A;  4E0W A;  1JW4 A;  3H6V A;  1B2H A;  5L8D A;  4MNI A;  3E3K A;  4H67 A;  4NE4 A;  5EYH A;  3IOW A;  3Q29 A;  4GL0 A;  1LB9 A;  4OVJ A;  3M3F A;  4Q30 B;  4MNP A;  1VFE A;  3MVZ A;  3M3K A;  5ET5 A;  2B3B A;  4YKJ A;  4LP2 B;  2OK2 A;  4RPN A;  1SVX B;  1INP A;  4XKQ A;  3VLW A;  4F31 B;  1URG A;  3H6W A;  4X1D A;  3SEW A;  4OA4 A;  3S9L C;  4ZEI A;  3FV2 A;  3ROJ A;  3FXR A;  1I6Q A;  1B46 A;  4XFE A;  1ZKB A;  1JNF A;  4IGT A;  4P1L A;  2XXQ A;  1FQE A;  1K9Y A;  3BFT A;  1ZTY A;  4EF1 A;  4ONY A;  3NOH A;  5AA4 A;  4MLQ A;  4QXD A;  4N6D A;  3A29 A;  1IMF A;  4HE0 A;  5IZZ A;  4I9D A;  4JWO A;  3S9M C;  3EHS A;  5FHN A;  1POT A;  3K01 A;  3CI8 A;  1QKA A;  3RLF E;  4ZE8 A;  4O3A A;  1MQH A;  2UYE A;  4C0R A;  2YJP A;  3SER A;  4XIG Q;  1NV1 A;  3G3F A;  4JXI A;  3H7M A;  1B5I A;  3RPL A;  1FPG A;  4OVS A;  4HE2 A;  2I58 A;  5BUU A;  2UYF A;  2RC8 A;  5AE4 A;  3KN3 A;  4MLV A;  3C4M A;  1IXC A;  1IMD A;  4JVD A;  3D4G A;  4PGN A;  5TP9 A;  2HFB A;  4N8Y A;  4PF6 A;  1YTV A;  4GBW A;  1JVX A;  5I5P A;  3PV0 E;  3HCQ A;  3C32 A;  4NF8 A;  4IY5 A;  1NH8 A;  3U72 A;  2RF1 A;  4WKM A;  1II5 A;  4Z0I A;  1XVY A;  1FBH A;  1S9T A;  4YKP A;  2QSX A;  2OLB A;  1LBB A;  4NAP A;  5EQ7 A;  4F3G A;  1KA0 A;  2O1L A;  4MNC A;  3IB1 A;  1PBQ A;  3S9N C;  2XXI A;  2OZZ A;  2OWT A;  1VE4 A;  1G0H A;  1MXZ A;  3SET A;  2P0S A;  3KGC A;  1ZMG A;  4YMA A;  4QFK A;  4KFQ A;  3V83 A;  2UVH A;  3CRB A;  4UAB A;  1LFH A;  4OXV A;  3TUS A;  1RYO A;  3ODB A;  4GD5 A;  1LAF E;  3E78 A;  4NF0 A;  1DTG A;  5DTB A;  3K6X A;  5FHM A;  2YPN A;  4OFL A;  4NTL A;  4G61 A;  4Q5T A;  4YB5 A;  2I48 A;  4KYS A;  1S50 A;  3E9X A;  4TQU Q;  1FQB A;  4MCO A;  4GXS B;  3MPL A;  3FJ7 A;  3PMX A;  5ET8 A;  3Q27 A;  1EZO A;  1O64 A;  1LGB C;  1IMA A;  2DVC A;  5H8F A;  4PFT A;  1DOT A;  1ZU0 A;  2FYI A;  3D1R A;  2WX9 A;  4XF5 A;  3ONM A;  1B58 A;  1B40 A;  2P2A A;  4I40 A;  3FVO A;  3EKI A;  4F3S A;  2IA4 A;  3KSX A;  1NV0 A;  2REG A;  4U4S A;  5ET7 A;  2PBW A;  1WVJ A;  4TLL B;  2Q89 A;  3I3V A;  5AA2 A;  1B3G A;  1IUD A;  1B7U A;  3TFL A;  4DXU A;  2XHD A;  2XXH A;  4XTC Q;  1LFI A;  3K0V A;  1LAH E;  3V8X B;  4OAN A;  4N81 A;  3Q28 A;  1FBP A;  3H4Z A;  2WYK A;  3OO9 A;  3ISP A;  2F36 A;  4LA9 A;  3HN0 A;  4R6Y A;  2VGQ A;  1OLC A;  1ZJL A;  4QFP A;  4JWX A;  3KC1 A;  4EXK A;  3TEL A;  4MBP A;  3UP9 A;  3TTM A;  1H45 A;  1Y1Z A;  4ZEF A;  5A5L A;  2O68 A;  5TPA A;  1EZP A;  3GLB A;  1NUY A;  1ZBM A;  4IO4 A;  4N8G A;  4NF5 A;  1IME A;  2XXV A;  2OBG A;  4KI0 E;  4P11 A;  1QGX A;  4PFB A;  3U65 A;  4PFR A;  4X9T A;  4U2R A;  2KLF A;  4PFU A;  1AWB A;  1P99 A;  1JW1 A;  4AB6 A;  2I49 A;  1EYI A;  2XD3 A;  4MX6 A;  4OEN A;  2V25 A;  3PTY A;  1B3H A;  1LCF A;  4OTE A;  2P3V A;  4EF2 A;  2ZNS A;  3UA8 A;  1T0K A;  3L6H A;  2Y7W A;  3OSQ A;  3DLN A;  1M5E A;  3MZ1 A;  4WEP A;  1CE2 A;  5KCJ B;  1LBY A;  2H9B A;  3TYH A;  4NHB A;  2M8C A;  2Q88 A;  3N6U A;  5EHM A;  3Q26 A;  4NF6 A;  4ZZE A;  2I6E A;  4IO2 A;  2WBD A;  4UAC A;  1VR5 A;  1R6Z A;  4P0G A;  1FQF A;  3KN8 A;  1JVY A;  1MG1 A;  4E0X A;  4AQ4 A;  1N3W A;  2Y7I A;  1SW1 A;  1DTZ A;  1GVC A;  1UTH B;  2ANJ A;  5H8H A;  4MH5 A;  4ZEC A;  4U21 A;  4BDL A;  3O28 A;  4PC9 A;  4LQ5 A;  5I57 A;  5AA2 D;  1FRP A;  3BKI B;  2UXA A;  2B65 A;  1LLS A;  1IXH A;  1J1N A;  2XD2 A;  1FBF A;  1N3X A;  4FEC A;  4PAF A;  4FAT A;  4JSD A;  2CZL A;  1B6H A;  4QHQ A;  3BBR A;  4NGU A;  3O2A A;  1MH3 A;  3IL1 B;  1A8F A;  4PAI A;  3H6T A;  4KYE A;  2AL4 A;  3FV1 A;  4DZ1 A;  3BIG A;  2F35 A;  2O84 X;  3HPI A;  1ELJ A;  1MY0 A;  2D3I A;  3N94 A;  4NMY A;  3KZG A;  4UA8 A;  3G3H A;  4TLM B;  2ZXT A;  3E4R A;  3IK6 B;  1LBZ A;  2GH9 A;  1NV6 A;  1LCT A;  3QAX A;  4LZ8 A;  3UGW A;  4L17 A;  3PPN A;  2ZYM A;  4OES A;  2Q2A A;  2YLN A;  3T93 B;  4BDN A;  3G3J A;  5EHS A;  4NF4 B;  5DVJ A;  4RK2 A;  1MPB A;  3W9W A;  1OVB A;  3K2D A;  3PPQ A;  4LQ2 A;  2DE4 A;  4F3P A;  2CEY A;  1I6B A;  3MVX A;  2CZI A;  3HO7 A;  1SQY A;  3ILT B;  3UOR A;  4N91 A;  1K9Z A;  3EQ1 A;  4FJP A;  1HSL A;  3MST A;  4KCC A;  5IGA A;  3FXU A;  3DP8 A;  2F7B A;  4P0I A;  5EYG A;  1TXF A;  1N0T A;  2Y7R A;  4RYA A;  1Q35 A;  5CMK A;  3IJO B;  1JET A;  3O97 A;  3OMB A;  3C31 A;  2DDK A;  1FPK A;  5T3J A;  2PX1 A;  3QSL A;  5JTY B;  2DE2 A;  4O7M A;  5B7D A;  4LZ5 A;  3PUX E;  1QUK A;  5L9S A;  3IR1 A;  2Q9T A;  4RNS A;  1IIW A;  2A5T A;  1Y4T A;  1LBX A;  4G8H A;  1EYJ A;  1OVT A;  1XS5 A;  2CMO A;  4JBZ A;  5I59 B;  4GWY A;  1NV3 A;  2O7U A;  1PDA A;  1P1U A;  5CRY A;  3G3K A;  4ZEB A;  1A55 A;  1AL3 A;  5I56 B;  1US5 A;  4O94 A;  5I2K B;  3KFM A;  2PT1 A;  2DXY A;  2WYP A;  4PF8 A;  4HS7 A;  2ZNT A;  4PBQ A;  5I2N B;  3QUF A;  4QFL A;  4F18 A;  1PB9 A;  1FPD A;  2OWS A;  3FJG A;  3RPW A;  4R2F A;  4MIJ A;  4N4U A;  4O7I A;  1FTA A;  3S2V A;  1B1H A;  4H8I A;  2OWZ A;  3VVF A;  2F5X A;  4DLD A;  3GBB A;  4XKP A;  3VE1 B;  3FBP A;  3K00 A;  3VDF A;  2DQV A;  5KDT B;  2DSF A;  4AB5 A;  1B5H A;  3T9X B;  2X7P A;  3TTR A;  1NNP A;  1IZ1 A;  4QSE A;  2ABH A;  4H65 A;  1USY E;  1B1X A;  2DWJ A;  1FCK A;  4OZ9 A;  1Q1K A;  2FIE A;  2ONS A;  5ESY A;  2Y5L A;  2PYY A;  4GL8 A;  3RTW B;  4OVR A;  1B05 A;  1P1N A;  2E1S A;  4XKR A;  3UN6 A;  1LBV A;  1D9Q A;  4F29 A;  5M2V A;  4QSC A;  1A40 A;  1NUW A;  3PMV A;  3VVE A;  2G93 A;  3C36 A;  3HST A;  3OO8 A;  3TAJ A;  1QKB A;  2DWI A;  2WKY A;  2F3D A;  2GRV A;  1QVS A;  1GR2 A;  3ILU B;  2DE3 A;  4MMP A;  4QFN A;  3OEL A;  4DXC A;  1TFA A;  1YYZ A;  3SEU A;  1USY H;  1IIT A;  1A99 A;  3FGS A;  2XXK A;  2THI A;  4MJO A;  3D4C A;  3H3G A;  3FAS A;  3M3L A;  1FPF A;  5ITO A;  4GXA A;  1NV5 A;  5CC2 A;  5H8N B;  1ATG A;  3IOT A;  4G8M A;  1LBW A;  1XC1 A;  4DE8 A;  2DS9 A;  3V89 B;  4OEV A;  3R7X A;  2KQZ A;  3T22 A;  2Y5K A;  1NH7 A;  4F1V A;  4RA1 A;  2D5W A;  1SW4 A;  3C34 A;  3WAF A;  3IFC A;  1JW5 A;  3ZS6 A;  3U94 A;  3MWB A;  1ZIU A;  4I1D A;  5DEX B;  3U93 A;  1RYX A;  1FTM A;  1NFT A;  1SYH A;  3PU5 A;  1N76 A;  4N15 A;  2XXR A;  4BDQ A;  4P47 A;  3JV9 A;  1EZ9 A;  5CM6 A;  4DCY A;  3MYU A;  3DP4 A;  1OQH A;  3CIJ A;  3T9V A;  2DWA A;  4G2Z A;  3A09 A;  4BDR A;  3O29 A;  3O6I A;  1D9V A;  1LB8 A;  4FBP A;  5DYH A;  1BIY A;  5A5X B;  3VV5 A;  4DI3 D;  2G29 A;  3TTN A;  4GFR A;  4X1B A;  2HZL A;  1YPN A;  1VFD A;  5TU0 A;  3ZKK A;  4TOZ A;  1FW0 A;  2X7Q A;  4F2O A;  3B8B A;  3KEI A;  2QS1 A;  1NNT A;  4I62 A;  2GHA A;  5BWJ A;  4ELO A;  1R9Q A;  4DI4 B;  5CBS A;  1PB8 A;  4BLA A;  4XKN A;  3TCF A;  2I4C A;  3TMG A;  3IO6 A;  5B70 A;  1MPC A;  4GIZ A;  3KSJ A;  2A5S A;  3FXQ A;  1MXY A;  1DSN A;  1D4N A;  4JVC A;  4LAT A;  2QPQ A;  2AIX A;  2O51 A;  3K1P A;  4GBV A;  4RPO A;  2XXT A;  4ISU A;  3HHF A;  2Q2C A;  4GLI A;  1US4 A;  4R72 A;  4EUO A;  4YB7 A;  3VFJ A;  1I6A A;  4MFI A;  3PMW A;  1O63 A;  4JWY A;  1QUI A;  1N84 A;  4PP0 A;  2F3B A;  2XXP A;  3IOV A;  3PD9 A;  3R26 A;  4RY1 A;  1A8E A;  1B5J A;  3FJM A;  3ZSF A;  3RNN A;  2HXW A;  2H5Y A;  4OMB A;  4DCX A;  1QJM A;  5L9M A;  3LSF B;  1B9J A;  1BP5 A;  2CZK A;  1MPD A;  1UTB B;  4G77 A;  2O69 A;  1IMC A;  4YU0 A;  5AA2 B;  5DVF A;  1FJ9 A;  2RCB A;  2Z23 A;  3OSR A;  1FPB A;  3RTF B;  1FTK A;  3R6U A;  4NED A;  1QW0 A;  1QUJ A;  4ND9 A;  2MKZ A;  5ISU A;  5EQA A;  4QRZ A;  3RGY A;  2VOZ A;  3T0J A;  2F78 A;  5FHO A;  3SEX A;  3PUZ E;  4YIC A;  3A3U A;  5ICQ A;  5AA1 A;  3AXF A;  3EHT A;  3MVY A;  3K02 A;  3U92 A;  1FTJ A;  2XWK A;  1PC3 A;  3TCG A;  2QVV A;  2O7I A;  1G0I A;  4KQP A;  5FBP A;  2ZZW A;  1ANF A;  4XXU A;  1MDQ A;  4F2Q A;  1IXI A;  5KCJ A;  2NWJ A;  2QS4 A;  2Z8D A;  3IB2 A;  4AS5 A;  3Q25 A;  5HPQ A;  2GHB A;  4GWS A;  3RQT A;  5AA3 A;  2O1M A;  3MP6 A;  3TDJ A;  3C9H A;  4IGR A;  4R6K A;  3ZKL A;  3B6W A;  4OET A;  1IQ7 A;  4QF9 A;  2L5V A;  3K4U A;  2AL5 A;  1UTH A;  3CSG A;  3H6U A;  3HV1 A;  3PUY E;  4PFI A;  3IAZ A;  3OO6 A;  1NMU A;  3E79 A;  5H8Q B;  5LOM A;  2Y7P A;  5ELV A;  2HEU A;  5K2Y A;  3K1M A;  2H25 A;  4F19 A;  2Y7K A;  2ZYN A;  4F3B A;  1AMF A;  4P9K A;  2XX7 A;  2R6G E;  4Q8R A;  4HW8 A;  1VDW A;  4HE1 A;  2WEF A;  2PCR A;  1AIV A;  1H43 A;  1ZLQ A;  4PTK A;  2HAV A;  2CZH A;  3TTL A;  5KZT A;  2VPN A;  4GWU A;  1RKM A;  4IB2 A;  4X8R A;  1RDX A;  1WDN A;  5CMC A;  2GFE A;  2CEX A;  3MUQ A;  3FIR A;  4QFO A;  3TQL A;  3IB0 A;  4H5F A;  3M8U A;  4PE3 A;  1LBC A;  1SBP A;  1LFG A;  3O9P A;  3RYD A;  3TOD A;  1LST A;  3MQ9 A;  4RK9 A;  4ZEK A;  5IAI A;  1SD3 A;  1MY2 A;  5J1D A;  3RT8 A;  5CMM A;  2GQ1 A;  1VSO A;  3N6T A;  4P8B A;  5ITP A;  4R9F A;  3FVN A;  1EU8 A;  4HXV A;  4EQ7 A;  1MM7 A;  4ZDM A;  4NF4 A;  2F97 A;  2F7A A;  2DWH A;  4HCY A;  3K1N A;  3MVW A;  1Y9U A;  3MZB A;  1B52 A;  1Y3N A;  5I3S A;  5L9O A;  4U4X A;  1DBZ A;  5IZ3 B;  5I58 A;  1M5D A;  1I69 A;  2F7C A;  4H45 A;  4HTG A;  4NWC A;  3USD A;  1B4H A;  1S7Y A;  1NUX A;  3C35 A;  4G68 B;  1H76 A;  3EPE A;  4ELQ A;  1PB7 A;  1XI6 A;  2VHA A;  3SES A;  3SZP A;  1UIV A;  2Q8J A;  3TPA A;  3U8Q A;  4LN5 A;  4YAH X;  4F1U A;  2OX3 A;  4OEU A;  2R8T A;  1N04 A;  3U1O A;  3TKD A;  5DW8 A;  1DMB A;  3OD7 A;  4POW A;  3E13 X;  4IO7 A;  5JTY A;  5EQ9 A;  4X48 A;  1WOD A;  1P1W A;  3LSL A;  1B7H A;  1PBP A;  4P1E A;  1TWY A;  3B50 A;  3MJN A;  1RDY A;  4R73 A;  4GWO A;  4NX1 A;  4Q0C A;  3I5O A;  2B4L A;  2Z8F A;  4ESW A;  2QRY A;  3C33 A;  4G4P A;  2NOO A;  2PFZ A;  5FTH A;  1JP4 A;  5I59 A;  3T96 B;  4JSO A;  4KHZ E;  4N6K A;  3VLU A;  4OER A;  5I56 A;  5I2K A;  1TFD A;  4ESX A;  1QUL A;  1MQG A;  2FHY A;  2WBB A;  1EH3 A;  4FOR A;  4OWD A;  5I2N A;  4QSD A;  2E0S A;  4PQJ A;  4GX6 A;  3K6V A;  2QL3 A;  1Q9D A;  4PFW A;  4U1Z A;  4AS4 A;  2NXO A;  4MHF A;  3CG1 A;  3DM0 A;  4HCW A;  4H0W A;  2QS3 A;  2XWI A;  1B4Z A;  1NI9 A;  3QIM A;  2UVG A;  1UIU A;  5KDT A;  4KD5 A;  1XVX A;  2VP1 A;  4FAJ A;  2LAO A;  1B0H A;  4R2B A;  3KG2 A;  2BJI A;  1MXV A;  5H8S A;  4IY6 A;  4FE8 A;  1Y1M A;  1MQD A;  5F1Q A;  2B4M A;  2QFL A;  1A7L A;  3H03 A;  1SI0 A;  2XWV A;  1MM6 A;  2R71 A;  4FED A;  4KR5 A;  3T9H B;  1YZ0 A;  4JDF A;  4F1Y A;  4KPT A;  3CFX A;  3SKP A;  4ZE9 A;  3SDF A;  5EYF A;  1NL5 A;  4BDO A;  2V84 A;  3KOT A;  1Z7M E;  3LUY A;  3KOS A;  3OO7 A;  1NV7 A;  4OVP A;  1O7T A;  3LV0 A;  5AA4 B;  3EN3 A;  3KBR A;  1D9Y A;  1Y4C A;  3FVG A;  2QMX A;  2V3Q A;  1OMP A;  3PGF A;  3HHG A;  1FBD A;  3PUW E;  5I84 A;  2ONK E;  1FPL A;  3IX1 A;  3MP1 A;  4MF3 A;  2QVR A;  5ICT A;  3FUZ A;  1FBE A;  1NV2 A;  2FIX A;  3LSX A;  4GQO A;  1B0L A;  3CSB A;  3O6H A;  5H8N A;  1FSA A;  3GXA A;  3G7W A;  3RPL B;  1RDZ A;  2P3N A;  4FIM A;  3GZG A;  4R75 A;  1MY3 A;  3FZV A;  2IEE A;  5HBC A;  3RN8 A;  1FBG A;  1POY 1;  4O8M A;  5TP9 B;  2DP8 A;  2XXY A;  5DEX A;  1FTO A;  1SW5 A;  1MXX A;  2QMW A;  2RCA A;  1DPE A;  2FBP A;  3OEK A;  1L5T A;  3EHU A;  2Z8E A;  2ZNU A;  4JVI A;  3I6V A;  4NF8 B;  3T66 A;  3KC0 A;  1Y3P A;  1FQD A;  3UIF A;  1Y20 A;  1B51 A;  4OVQ A;  4PBH A;  2HAU A;  4NN3 A;  4N6P A;  5A5X A;  4ZED A;  2X26 A;  4EXL A;  2KR0 A;  3BFU A;  3CFZ A;  2VD2 A;  3O66 A;  3MPK A;  4NWD A;  1PEB A;  3SEV A;  4GWX A;  4I8C A;  3OEN A;  3HFU A;  3GYY A;  3OXN A;  1HSE A;  3TTK A;  1DPP A;  1MY1 A;  3QK6 A;  4O3B A;  1JEU A;  3MP8 A;  1CNQ A;  1MY4 A;  3MBP A;  2D21 A;  3IOU A;  2OJT A;  2RKM A;  2V4C A;  1OIB A;  2ESN A;  4H6D A;  1AOV A;  1D3K A;  4N13 A;  3EF7 A;  1MRP A;  4OHN A;  2F34 A;  1NUZ A;  1Z7N E;  1M5B A;  4KCD A;  3JZJ A;  2ZZX A;  2AYS A;  4OFJ A;  4F39 A;  4M1V A;  3VLV A;  4PAK A;  4IO3 A;  3K6U A;  2FVZ A;  4POX A;  2PT2 A;  2R9J A;  4PDD A;  3MC2 A;  1LAG E;  1XOC A;  3UK4 A;  3W9V A;  3B7D A;  3CVG A;  5EQ8 A;  5ET6 A;  3IFA A;  1JQF A;  4RJZ A;  2F6G A;  4GRK A;  4KXP A;  5H8F B;  1LEV A;  1B32 A;  2DVZ A;  1MDP 1;  1DCU A;  2ZMB A;  1GV8 A;  3CR9 A;  2H99 A;  1URD A;  4NQ8 A;  3MAM A;  2QJE A;  4LON B;  2V3T A;  1UTB A;  4WXJ A;  2FA7 A;  1OLA A;  4K3F A;  3IJX B;  5J16 A;  4X04 A;  3OEM A;  4ZZA A;  4GF8 A;  4G8N A;  1M5F A;  2W7Y A; 
#chains in the Genus database with same CATH homology
 1B3F A;  4U23 A;  1SI1 A;  4M4G A;  4EQ9 A;  1B7Z A;  4C1U A;  4O3C A;  1XHY A;  4DIG A;  4FEB A;  3OOA A;  1IXG A;  3LBS A;  3ECR A;  4U1O A;  5TPA B;  1GTK A;  2I3W A;  5DT6 A;  4NF5 B;  4THI A;  4EDP A;  3VVD A;  2B3F A;  3L6G A;  2NUV A;  3P7I A;  3LR1 A;  5FTI A;  1AH5 A;  1R9L A;  3TEP A;  3N26 A;  3S9E A;  3G3I A;  4YB6 A;  4YKI A;  3SEY A;  4PET A;  3GBA A;  4OQO A;  2XXX A;  3MW0 A;  1TT1 A;  2FNC A;  3VXC A;  1YAE A;  1MS7 A;  2V3U A;  1XT8 A;  2RIN A;  3V5A A;  3QYT A;  3CFL A;  2DOJ A;  4NF6 B;  5F7V A;  1KWH A;  2QS2 A;  4G68 C;  1N7X A;  4R74 A;  2H98 A;  2I3V A;  4N07 A;  2ZYO A;  3B6T A;  4BDM A;  1IEJ A;  2UVI A;  5CI5 A;  4C1T A;  3IOR A;  4EQB A;  4JB7 A;  4ELR A;  5H8H B;  1B3E A;  4H5G A;  1NNK A;  5H8Q A;  3FAT A;  1MQI A;  1URS A;  2PVU A;  4F22 A;  5I57 B;  3PPR A;  4ELP A;  2F6P A;  3B6Q A;  2P1S A;  1MXW A;  1SDX A;  4DXB A;  5CMB A;  3RY3 A;  1YCJ A;  3DEL B;  3A3C A;  1MH4 A;  3THI A;  2Z22 A;  2UVJ A;  5JEI A;  2VD3 A;  4H8J A;  2PMS A;  4IO6 A;  2OCU A;  1Y3Q A;  3TQW A;  1M5C A;  4H1X A;  2BJJ X;  2XXW A;  4ECF A;  3G3G A;  4IO5 A;  2HCA A;  4KYD A;  3K6W A;  3H06 B;  3MZ9 A;  1OQG A;  4Z7E A;  2HZK A;  5HM4 B;  3QUJ A;  1FQC A;  1UQW A;  3N5L A;  2V93 A;  3T9U A;  1P1Q A;  3FVK A;  4OYV A;  1HSJ A;  3JYR A;  4U22 A;  1LAX A;  1NNF A;  4LZ7 A;  4OFO A;  1SYI A;  3KJ7 A;  2Y84 A;  1MQJ A;  1BTJ A;  1H3D A;  2XXU A;  2DYX A;  2ZYK A;  3F11 A;  1GGG A;  4LVQ A;  2DXR A;  1JEV A;  5K2X A;  5CBR A;  3PPO A;  4RXL A;  1N7W A;  2RC9 A;  3W15 C;  5DVI A;  3PD8 A;  4G68 A;  2HQ0 A;  3FD3 A;  2ALU A;  3TZA A;  5I58 B;  4R9G A;  2RC7 A;  1B3L A;  1CB6 A;  3O6G A;  1BKA A;  3KJT A;  3WAE A;  4PE5 B;  3RT6 B;  4YZZ A;  3PUV E;  3DP6 A;  1BLF A;  4DDD A;  1FQA A;  3PPP A;  1SW2 A;  2I4B A;  2XX8 A;  1R1N A;  3TCH A;  3IO4 A;  3KN7 A;  4GVO A;  4R6H A;  2I0B A;  1FTL A;  2A5T B;  4ZS9 A;  2XX9 A;  3VXB A;  3LSW A;  2H4I A;  2F8D A;  2NVU B;  3LC8 A;  3CG3 A;  2O6A A;  4PFY A;  2ONR A;  4LUB A;  2REJ A;  1P1O A;  5JK4 A;  4GOT A;  4YMB A;  1NKX A;  4YKK A;  1A54 A;  3RUM A;  3QXM A;  3S4U A;  2I0C A;  4WED A;  1H44 A;  1MXU A;  1F9B A;  5IKB A;  4E0W A;  1JW4 A;  3H6V A;  1B2H A;  5L8D A;  3E3K A;  4H67 A;  4NE4 A;  3IOW A;  3Q29 A;  4GL0 A;  1LB9 A;  4OVJ A;  3M3F A;  4Q30 B;  1VFE A;  3MVZ A;  3M3K A;  2B3B A;  4YKJ A;  4LP2 B;  2OK2 A;  4RPN A;  1SVX B;  4XKQ A;  3VLW A;  4F31 B;  1URG A;  3H6W A;  4X1D A;  3SEW A;  3S9L C;  4ZEI A;  3FV2 A;  3FXR A;  1I6Q A;  1B46 A;  1ZKB A;  1JNF A;  4IGT A;  2XXQ A;  1FQE A;  3BFT A;  1ZTY A;  4EF1 A;  4ONY A;  5AA4 A;  4MLQ A;  4I9D A;  4JWO A;  3S9M C;  3EHS A;  5FHN A;  1POT A;  3K01 A;  3CI8 A;  1QKA A;  3RLF E;  4ZE8 A;  4O3A A;  1MQH A;  2UYE A;  4C0R A;  2YJP A;  3SER A;  4XIG Q;  3G3F A;  4JXI A;  3H7M A;  1B5I A;  2I58 A;  5BUU A;  2UYF A;  2RC8 A;  5AE4 A;  3KN3 A;  4MLV A;  3C4M A;  1IXC A;  3D4G A;  5TP9 A;  2HFB A;  1YTV A;  1JVX A;  3PV0 E;  3HCQ A;  3C32 A;  4NF8 A;  4IY5 A;  1NH8 A;  3U72 A;  2RF1 A;  4WKM A;  1II5 A;  4Z0I A;  1XVY A;  1S9T A;  4YKP A;  2QSX A;  2OLB A;  1LBB A;  4F3G A;  2O1L A;  3IB1 A;  1PBQ A;  3S9N C;  2XXI A;  2OZZ A;  2OWT A;  1VE4 A;  1MXZ A;  3SET A;  2P0S A;  3KGC A;  1ZMG A;  4YMA A;  4QFK A;  4KFQ A;  3V83 A;  2UVH A;  3CRB A;  1LFH A;  4OXV A;  3TUS A;  1RYO A;  3ODB A;  4GD5 A;  1LAF E;  1DTG A;  5DTB A;  3K6X A;  5FHM A;  2YPN A;  4OFL A;  4NTL A;  4Q5T A;  4YB5 A;  2I48 A;  4KYS A;  1S50 A;  3E9X A;  4TQU Q;  1FQB A;  4GXS B;  3MPL A;  3FJ7 A;  3PMX A;  3Q27 A;  1EZO A;  1O64 A;  1LGB C;  2DVC A;  5H8F A;  4PFT A;  1DOT A;  1ZU0 A;  2FYI A;  3ONM A;  1B58 A;  1B40 A;  2P2A A;  3FVO A;  4F3S A;  2IA4 A;  3KSX A;  2REG A;  4U4S A;  2PBW A;  1WVJ A;  4TLL B;  2Q89 A;  3I3V A;  5AA2 A;  1B3G A;  1IUD A;  4DXU A;  1B7U A;  3TFL A;  2XHD A;  2XXH A;  4XTC Q;  1LFI A;  3K0V A;  1LAH E;  3V8X B;  3Q28 A;  3H4Z A;  3OO9 A;  2F36 A;  4LA9 A;  3HN0 A;  4R6Y A;  2VGQ A;  1OLC A;  1ZJL A;  4QFP A;  4JWX A;  4EXK A;  3TEL A;  4MBP A;  3UP9 A;  3TTM A;  1H45 A;  1Y1Z A;  4ZEF A;  2O68 A;  5TPA A;  1EZP A;  3GLB A;  1ZBM A;  4IO4 A;  4NF5 A;  2XXV A;  2OBG A;  4KI0 E;  4P11 A;  4X9T A;  4U2R A;  2KLF A;  4PFU A;  1P99 A;  1JW1 A;  4AB6 A;  2I49 A;  2XD3 A;  4OEN A;  2V25 A;  1B3H A;  4EF2 A;  1LCF A;  4OTE A;  2ZNS A;  3UA8 A;  1T0K A;  3L6H A;  2Y7W A;  3OSQ A;  3DLN A;  1M5E A;  3MZ1 A;  4WEP A;  1CE2 A;  5KCJ B;  2H9B A;  3TYH A;  2M8C A;  2Q88 A;  3N6U A;  5EHM A;  3Q26 A;  4NF6 A;  4ZZE A;  2I6E A;  4IO2 A;  4UAC A;  1VR5 A;  1R6Z A;  4P0G A;  1FQF A;  3KN8 A;  1JVY A;  1MG1 A;  4E0X A;  4AQ4 A;  1N3W A;  2Y7I A;  1SW1 A;  1DTZ A;  1GVC A;  1UTH B;  2ANJ A;  5H8H A;  4MH5 A;  4ZEC A;  4U21 A;  4BDL A;  3O28 A;  4LQ5 A;  5I57 A;  5AA2 D;  3BKI B;  2UXA A;  2B65 A;  1LLS A;  1IXH A;  1J1N A;  2XD2 A;  1N3X A;  4FEC A;  4FAT A;  4JSD A;  2CZL A;  1B6H A;  4QHQ A;  3BBR A;  3O2A A;  1MH3 A;  3IL1 B;  1A8F A;  3H6T A;  4KYE A;  2AL4 A;  3FV1 A;  4DZ1 A;  2F35 A;  2O84 X;  3HPI A;  1ELJ A;  1MY0 A;  2D3I A;  3N94 A;  4NMY A;  3KZG A;  4UA8 A;  3G3H A;  4TLM B;  2ZXT A;  3E4R A;  3IK6 B;  2GH9 A;  1LCT A;  3QAX A;  4LZ8 A;  3UGW A;  4L17 A;  3PPN A;  2ZYM A;  4OES A;  2Q2A A;  2YLN A;  3T93 B;  4BDN A;  3G3J A;  5EHS A;  4NF4 B;  5DVJ A;  4RK2 A;  1MPB A;  3W9W A;  1OVB A;  3K2D A;  3PPQ A;  4LQ2 A;  2DE4 A;  4F3P A;  1I6B A;  3MVX A;  3HO7 A;  1SQY A;  3ILT B;  3UOR A;  3EQ1 A;  4FJP A;  1HSL A;  4KCC A;  3FXU A;  3DP8 A;  2F7B A;  4P0I A;  1TXF A;  1N0T A;  2Y7R A;  4RYA A;  1Q35 A;  5CMK A;  3IJO B;  1JET A;  3O97 A;  3OMB A;  3C31 A;  2PX1 A;  3QSL A;  5JTY B;  2DE2 A;  5B7D A;  4LZ5 A;  3PUX E;  1QUK A;  5L9S A;  3IR1 A;  2Q9T A;  4RNS A;  1IIW A;  2A5T A;  1Y4T A;  4G8H A;  1OVT A;  1XS5 A;  2CMO A;  4JBZ A;  5I59 B;  2O7U A;  1PDA A;  1P1U A;  5CRY A;  3G3K A;  4ZEB A;  1A55 A;  1AL3 A;  5I56 B;  1US5 A;  5I2K B;  3KFM A;  2PT1 A;  2DXY A;  4HS7 A;  2ZNT A;  5I2N B;  3QUF A;  4QFL A;  4F18 A;  1PB9 A;  2OWS A;  3FJG A;  3RPW A;  4R2F A;  3S2V A;  1B1H A;  4H8I A;  3VVF A;  2F5X A;  4DLD A;  3GBB A;  4XKP A;  3VE1 B;  3K00 A;  3VDF A;  2DQV A;  5KDT B;  2DSF A;  4AB5 A;  1B5H A;  3T9X B;  2X7P A;  3TTR A;  1NNP A;  1IZ1 A;  4QSE A;  2ABH A;  4H65 A;  1USY E;  1B1X A;  2DWJ A;  1FCK A;  4OZ9 A;  1Q1K A;  2ONS A;  2PYY A;  4GL8 A;  3RTW B;  1B05 A;  1P1N A;  2E1S A;  4XKR A;  3UN6 A;  4F29 A;  5M2V A;  4QSC A;  1A40 A;  3PMV A;  3VVE A;  2G93 A;  3C36 A;  3HST A;  3OO8 A;  3TAJ A;  1QKB A;  2DWI A;  2WKY A;  2GRV A;  1QVS A;  1GR2 A;  3ILU B;  2DE3 A;  4QFN A;  3OEL A;  4DXC A;  1TFA A;  3SEU A;  1USY H;  1IIT A;  1A99 A;  3FGS A;  2THI A;  3D4C A;  3H3G A;  3FAS A;  3M3L A;  5ITO A;  4GXA A;  5CC2 A;  5H8N B;  1ATG A;  3IOT A;  4G8M A;  1XC1 A;  4DE8 A;  2DS9 A;  3V89 B;  4OEV A;  3R7X A;  3T22 A;  1NH7 A;  4F1V A;  4RA1 A;  2D5W A;  1SW4 A;  3C34 A;  3WAF A;  1JW5 A;  3ZS6 A;  3U94 A;  3MWB A;  1ZIU A;  4I1D A;  5DEX B;  3U93 A;  1RYX A;  1FTM A;  1NFT A;  1SYH A;  3PU5 A;  1N76 A;  2XXR A;  4BDQ A;  3JV9 A;  1EZ9 A;  5CM6 A;  4DCY A;  3DP4 A;  1OQH A;  3CIJ A;  3T9V A;  2DWA A;  4G2Z A;  3A09 A;  4BDR A;  3O29 A;  3O6I A;  1D9V A;  1LB8 A;  5DYH A;  1BIY A;  5A5X B;  3VV5 A;  2G29 A;  3TTN A;  4GFR A;  4X1B A;  2HZL A;  1YPN A;  1VFD A;  5TU0 A;  3ZKK A;  4TOZ A;  1FW0 A;  2X7Q A;  4F2O A;  3KEI A;  2QS1 A;  1NNT A;  4I62 A;  2GHA A;  5BWJ A;  4ELO A;  1R9Q A;  5CBS A;  1PB8 A;  4BLA A;  4XKN A;  3TCF A;  2I4C A;  3TMG A;  3IO6 A;  5B70 A;  1MPC A;  4GIZ A;  3KSJ A;  2A5S A;  3FXQ A;  1MXY A;  1DSN A;  1D4N A;  4LAT A;  2QPQ A;  2AIX A;  2O51 A;  3K1P A;  4RPO A;  2XXT A;  4ISU A;  3HHF A;  2Q2C A;  4GLI A;  1US4 A;  4R72 A;  4EUO A;  4YB7 A;  3VFJ A;  1I6A A;  4MFI A;  3PMW A;  1O63 A;  4JWY A;  1QUI A;  1N84 A;  4PP0 A;  2XXP A;  3IOV A;  3PD9 A;  3R26 A;  4RY1 A;  1A8E A;  1B5J A;  3FJM A;  3ZSF A;  3RNN A;  2HXW A;  2H5Y A;  4OMB A;  4DCX A;  1QJM A;  5L9M A;  3LSF B;  1B9J A;  1BP5 A;  1MPD A;  1UTB B;  4G77 A;  2O69 A;  4YU0 A;  5AA2 B;  5DVF A;  2RCB A;  2Z23 A;  3OSR A;  3RTF B;  1FTK A;  3R6U A;  4NED A;  1QW0 A;  1QUJ A;  4ND9 A;  5ISU A;  4QRZ A;  3RGY A;  2VOZ A;  2F78 A;  5FHO A;  3SEX A;  3PUZ E;  4YIC A;  3A3U A;  5ICQ A;  5AA1 A;  3AXF A;  3EHT A;  3MVY A;  3K02 A;  3U92 A;  1FTJ A;  1PC3 A;  3TCG A;  2O7I A;  4KQP A;  1ANF A;  4XXU A;  1MDQ A;  4F2Q A;  1IXI A;  5KCJ A;  2NWJ A;  2QS4 A;  2Z8D A;  3IB2 A;  3Q25 A;  5HPQ A;  2GHB A;  3RQT A;  5AA3 A;  2O1M A;  3MP6 A;  3TDJ A;  3C9H A;  4IGR A;  4R6K A;  3ZKL A;  3B6W A;  4OET A;  1IQ7 A;  4QF9 A;  3K4U A;  2AL5 A;  1UTH A;  3CSG A;  3H6U A;  3HV1 A;  3PUY E;  3IAZ A;  3OO6 A;  1NMU A;  5H8Q B;  5LOM A;  2Y7P A;  5ELV A;  2HEU A;  5K2Y A;  3K1M A;  2H25 A;  4F19 A;  2Y7K A;  2ZYN A;  4F3B A;  1AMF A;  2XX7 A;  2R6G E;  4Q8R A;  4HW8 A;  1AIV A;  1H43 A;  1ZLQ A;  2HAV A;  3TTL A;  5KZT A;  4IB2 A;  1RKM A;  1WDN A;  5CMC A;  2GFE A;  3MUQ A;  3FIR A;  4QFO A;  3TQL A;  3IB0 A;  4H5F A;  3M8U A;  1LBC A;  1SBP A;  1LFG A;  3O9P A;  3TOD A;  1LST A;  3MQ9 A;  4RK9 A;  4ZEK A;  5IAI A;  1SD3 A;  1MY2 A;  5J1D A;  3RT8 A;  5CMM A;  1VSO A;  3N6T A;  5ITP A;  4R9F A;  3FVN A;  1EU8 A;  4EQ7 A;  1MM7 A;  4ZDM A;  4NF4 A;  2F97 A;  2F7A A;  2DWH A;  4HCY A;  3K1N A;  3MVW A;  1Y9U A;  3MZB A;  1B52 A;  1Y3N A;  5L9O A;  4U4X A;  5I58 A;  1M5D A;  1I69 A;  2F7C A;  4HTG A;  4NWC A;  3USD A;  1B4H A;  1S7Y A;  3C35 A;  4G68 B;  1H76 A;  3EPE A;  4ELQ A;  1PB7 A;  2VHA A;  3SES A;  1UIV A;  2Q8J A;  3TPA A;  3U8Q A;  4YAH X;  4F1U A;  4OEU A;  1N04 A;  3U1O A;  3TKD A;  1DMB A;  3OD7 A;  4POW A;  3E13 X;  4IO7 A;  5JTY A;  4X48 A;  1WOD A;  1P1W A;  3LSL A;  1B7H A;  1PBP A;  1TWY A;  3MJN A;  4R73 A;  4GWO A;  4Q0C A;  3I5O A;  2Z8F A;  4ESW A;  2QRY A;  3C33 A;  4G4P A;  2NOO A;  5FTH A;  5I59 A;  3T96 B;  4JSO A;  4KHZ E;  3VLU A;  4OER A;  5I56 A;  5I2K A;  1TFD A;  4ESX A;  1QUL A;  1MQG A;  1EH3 A;  4FOR A;  4OWD A;  5I2N A;  4QSD A;  2E0S A;  4PQJ A;  3K6V A;  2QL3 A;  4PFW A;  4U1Z A;  2NXO A;  3CG1 A;  3DM0 A;  4HCW A;  4H0W A;  2QS3 A;  1B4Z A;  3QIM A;  2UVG A;  1UIU A;  5KDT A;  4KD5 A;  1XVX A;  2VP1 A;  4FAJ A;  2LAO A;  1B0H A;  4R2B A;  3KG2 A;  1MXV A;  5H8S A;  4IY6 A;  4FE8 A;  1Y1M A;  1MQD A;  5F1Q A;  1A7L A;  3H03 A;  1SI0 A;  1MM6 A;  2R71 A;  4FED A;  4KR5 A;  3T9H B;  4JDF A;  4F1Y A;  4KPT A;  3CFX A;  3SKP A;  4ZE9 A;  3SDF A;  5EYF A;  1NL5 A;  4BDO A;  2V84 A;  3KOT A;  1Z7M E;  3LUY A;  3KOS A;  3OO7 A;  1O7T A;  5AA4 B;  3EN3 A;  3KBR A;  1D9Y A;  1Y4C A;  3FVG A;  2QMX A;  2V3Q A;  1OMP A;  3PGF A;  3HHG A;  3PUW E;  5I84 A;  2ONK E;  3IX1 A;  3MP1 A;  4MF3 A;  5ICT A;  3FUZ A;  3LSX A;  4GQO A;  1B0L A;  3CSB A;  3O6H A;  5H8N A;  3GXA A;  3G7W A;  4FIM A;  3GZG A;  4R75 A;  1MY3 A;  3FZV A;  2IEE A;  5HBC A;  3RN8 A;  1POY 1;  5TP9 B;  2DP8 A;  2XXY A;  5DEX A;  1FTO A;  1SW5 A;  1MXX A;  2QMW A;  2RCA A;  1DPE A;  3OEK A;  1L5T A;  3EHU A;  2Z8E A;  2ZNU A;  3I6V A;  4NF8 B;  3T66 A;  1Y3P A;  1FQD A;  3UIF A;  1Y20 A;  1B51 A;  2HAU A;  4N6P A;  5A5X A;  4ZED A;  2X26 A;  4EXL A;  3BFU A;  3CFZ A;  2VD2 A;  3O66 A;  3MPK A;  4NWD A;  1PEB A;  3SEV A;  4I8C A;  3OEN A;  3OXN A;  1HSE A;  3TTK A;  1DPP A;  1MY1 A;  3QK6 A;  4O3B A;  1JEU A;  3MP8 A;  1MY4 A;  3MBP A;  2D21 A;  3IOU A;  2OJT A;  2RKM A;  1OIB A;  2ESN A;  4H6D A;  1AOV A;  1D3K A;  4N13 A;  3EF7 A;  1MRP A;  4OHN A;  2F34 A;  1Z7N E;  1M5B A;  4KCD A;  3JZJ A;  2AYS A;  4OFJ A;  4F39 A;  4M1V A;  3VLV A;  4IO3 A;  3K6U A;  4POX A;  2PT2 A;  2R9J A;  3MC2 A;  1LAG E;  1XOC A;  3UK4 A;  3W9V A;  3B7D A;  3CVG A;  1JQF A;  4RJZ A;  2F6G A;  4GRK A;  5H8F B;  1B32 A;  2DVZ A;  1MDP 1;  2ZMB A;  1GV8 A;  3CR9 A;  2H99 A;  1URD A;  3MAM A;  2QJE A;  4LON B;  2V3T A;  1UTB A;  4WXJ A;  2FA7 A;  1OLA A;  4K3F A;  3IJX B;  3OEM A;  4ZZA A;  4GF8 A;  4G8N A;  1M5F A;  2W7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...