4F3SA

Crystal structure of periplasmic d-alanine abc transporter from salmonella enterica
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
231
structure length
231
Chain Sequence
SIVEGRTLNVAVSPASPPMLFKSADGKLQGIDLELFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVIDFSEPYYINSFYLVSMANHKITLNNLNELNKYSIGYPRGMAYSDLIKNDLEPKGYYSLSKVKLYPTYNETMADLKNGNLDLAFIEEPVYFTFKNKKKMPIESRYVFKNVDQLGIAFKKGSPVRDDFNLWLKEQGPQKISGIVDSWMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Putative periplasmic binding protein
publication title Crystal structure of periplasmic D-alanine ABC transporter from Salmonella enterica
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 72
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3sA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3sA02
3FV2A 3CG3A 4KYSA 4EQ9A 3CG1A 4RJZA 1EU8A 2ZYNA 1N3WA 4ZE9A 1B40A 3VDFA 4YKPA 3MQ9A 3PPNA 2A5TA 3RT6B 1B05A 1S9TA 3V89B 1QKBA 2NXOA 3W15C 1IQ7A 3C31A 3TMGA 3C33A 2DVZA 4FECA 4F31B 2Y7WA 1R9LA 3K00A 5H8NB 3ZS6A 3TPAA 5L9OA 4XKRA 2A5SA 2YJPA 4ELPA 4PETA 4DXBA 1YTVA 4O3CA 3FVOA 1QKAA 4XKQA 4TQUQ 3OXNA 3O6GA 4KQPA 2AL4A 1LAXA 3IK6B 3DM0A 4OMBA 3C4MA 3K02A 1N0TA 2WKYA 3ILUB 2DQVA 1LB9A 5FHOA 1LCTA 4R9GA 3LBSA 1Q1KA 1YPNA 1MQHA 1A55A 1JETA 4ELOA 1MXYA 4ECFA 4LZ8A 2OCUA 1DOTA 1Y4CA 3TODA 3T93B 4OFOA 3HCQA 4ND9A 5ISUA 4FEDA 5B70A 3OO7A 4FORA 2Y7KA 1MY2A 4C0RA 1B5HA 2O51A 3DLNA 4NF8A 1UTBA 4FE8A 4NWCA 2F78A 5FTIA 1ELJA 3RY3A 4PQJA 3GBBA 4KD5A 3T9XB 2F34A 4OEVA 1L5TA 3TAJA 3KGCA 3FV1A 5I2NB 4Z0IA 4QFLA 1DPPA 2O1MA 4POXA 4OXVA 3HN0A 2UVHA 5I57B 3W9WA 2HAUA 1Y4TA 4ELQA 3EHTA 4IGRA 5J1DA 3FZVA 2DOJA 4WEPA 3CFZA 1AMFA 5CM6A 4K3FA 3FJ7A 4R73A 5DYHA 3B6WA 4G68A 1UTHA 1MXUA 4RPOA 1GR2A 1ZKBA 3PUZE 1BTJA 4F19A 2I0BA 3G3JA 4QF9A 3EPEA 1H43A 1B1XA 5AA3A 3IOUA 1XVYA 3TDJA 3IO4A 3WAFA 4TOZA 3K6XA 4KCCA 1IXCA 4EF2A 3I5OA 4RY1A 5ITPA 4BDMA 1M5CA 4C1UA 3LC8A 3VVDA 2D3IA 2DWAA 4X1DA 5AE4A 5KCJA 4NWDA 4ZECA 4GF8A 3S9MC 4KFQA 1MQDA 4U23A 4U2RA 2FA7A 3MPLA 4LQ5A 1SDXA 4Q8RA 1QW0A 5ICTA 3TCHA 3SEXA 3GLBA 3MAMA 4R6HA 2X7QA 3FASA 1P1UA 3K6UA 1MG1A 3OO9A 4NF5A 2P2AA 3IJXB 3WAEA 4UACA 4RYAA 4XXUA 3TCFA 3MP6A 3H03A 4OERA 3IOVA 1FQDA 2F7BA 2Q9TA 1LSTA 2VOZA 2Q2AA 1JEUA 4DIGA 3IOTA 3L6HA 4QSCA 1QULA 4OENA 2XXWA 1IXGA 1A40A 5TPAB 1Y3QA 2RKMA 1LBBA 5H8NA 5HM4B 4JSOA 1H3DA 2DXRA 4BDQA 3TKDA 3VXCA 1GV8A 3THIA 3RLFE 2RC8A 4N6PA 2YPNA 2CMOA 1POY1 1P1NA 4GRKA 3UGWA 1ZU0A 2QL3A 4IY5A 1SW1A 3TQWA 4KYEA 1UIUA 1VFDA 2Q2CA 3Q25A 3R6UA 4Z7EA 3O9PA 2G29A 2Z23A 2AYSA 5LOMA 3K0VA 3EN3A 3K6WA 1N7WA 2VGQA 2NOOA 4LP2B 5TP9B 4P0GA 2PT2A 3T9VA 2H9BA 1USYH 2I3VA 4EQ7A 5DTBA 4FATA 2E1SA 1LAFE 1SW4A 2OBGA 4G8NA 4LUBA 2ZYMA 2Y7IA 3KSXA 2IEEA 4YICA 4IO4A 2O68A 3UORA 5DVIA 4H8IA 3G3FA 4Q0CA 3UN6A 1D4NA 1OQHA 2I6EA 1LCFA 2DWJA 1JW4A 1MDQA 3USDA 4AQ4A 4Q30B 5HPQA 2XXUA 1VE4A 5H8HB 1KWHA 3GBAA 1HSEA 4FIMA 2Q89A 3E9XA 4IO3A 3H6UA 1HSJA 1LAGE 4YB7A 1N04A 4I8CA 3MP1A 1F9BA 3ZSFA 1LGBC 1B7ZA 4GQOA 2LAOA 2O69A 2F7AA 1SI1A 3JYRA 3KN3A 3KBRA 1JQFA 4QFOA 2DE4A 4E0XA 3LSXA 2DVCA 1DSNA 3VVEA 3DELB 1QJMA 1CE2A 2KLFA 3T66A 3S9NC 5ELVA 1MPBA 1M5EA 3IJOB 2IA4A 2XXYA 4H0WA 3L6GA 3H3GA 2PYYA 3OO6A 1XC1A 2ZNUA 2DE3A 1MDP1 2GHBA 2F97A 1MH3A 3FD3A 4F1YA 3CVGA 2QSXA 4GXSB 3P7IA 2YLNA 1FQAA 3KZGA 2XXQA 4OVJA 5K2XA 4IO5A 2P1SA 1B3LA 4KHZE 5H8FB 4MLQA 2I48A 3E13X 1FW0A 5K2YA 1XOCA 3OO8A 4LQ2A 4ESWA 1Y3PA 3FUZA 4R72A 3S9EA 3KOTA 1Y1MA 3DP8A 2X7PA 4FEBA 3SESA 2G93A 3TTRA 2Z8FA 4NF6B 1URGA 1US5A 3QIMA 3MVYA 1S7YA 2HQ0A 3G3KA 4DCYA 4GOTA 5ICQA 2XXRA 2HXWA 1UIVA 2Z8EA 4IO6A 1TXFA 5L8DA 1SYIA 2XX9A 1JNFA 4MLVA 2R71A 1ZBMA 4F3GA 3RT8A 2DE2A 3IB2A 3H06B 3Q27A 4X1BA 3H6TA 3F11A 3CSBA 1MY4A 3FGSA 5IKBA 1A8EA 3LUYA 1N84A 3M8UA 1FTMA 3SDFA 4ESXA 4NF4B 4QFPA 1ZIUA 2DWHA 1O63A 1MS7A 3TEPA 1NKXA 4F39A 3Q26A 4F3SA 1PC3A 1FCKA 1MPCA 1LBCA 2XXHA 1MY3A 3U1OA 4ZEFA 1URDA 1H76A 5TP9A 4EF1A 1URSA 1XVXA 1B3FA 3RPWA 3K01A 3N5LA 4ZEKA 2XXTA 5I59B 3KEIA 5ITOA 2B65A 3TZAA 4RA1A 4I62A 4JBZA 2XXXA 1FTKA 3KN7A 1OMPA 2UVJA 2I0CA 3IORA 3C9HA 1POTA 1RYXA 4M1VA 3R7XA 2DS9A 1JEVA 2REGA 1ZJLA 2R9JA 4AB5A 3FATA 3AXFA 1MM7A 1PBPA 3TCGA 1SW5A 2O7IA 4OWDA 2ZNSA 4MFIA 4ZS9A 1SBPA 5H8HA 3H6VA 5H8QB 5CMKA 3K1NA 3PU5A 3KJ7A 3U8QA 4QSDA 3G7WA 1I6QA 1NH8A 5L9MA 3CR9A 3ZKLA 3LR1A 2QMXA 1TFDA 2RCBA 2B3FA 2QS2A 3ILTB 5DVJA 1OVBA 4ZZAA 4IO2A 3OSQA 3K1MA 4IGTA 2UVGA 4G4PA 3KSJA 4F18A 1IXHA 3C34A 2GRVA 5A5XB 3RN8A 1D9VA 4G77A 1Z7ME 3TFLA 5CBSA 4GXAA 3OELA 1GVCA 1O7TA 3FXUA 4F22A 3T96B 3MW0A 3FIRA 3N6UA 1B4HA 3PUYE 3MJNA 5AA2D 5AA2B 4JWOA 4EUOA 2H98A 2CZLA 4JDFA 3K1PA 3QK6A 1MQIA 4R6KA 4DLDA 3M3LA 3V8XB 1R1NA 1ANFA 3LSLA 1OIBA 4R6YA 1Y1ZA 3KOSA 2HFBA 2RCAA 2XXPA 4F1VA 1MY1A 4X48A 3OEKA 1LFGA 1N7XA 2PBWA 4U1ZA 5CBRA 4EDPA 2P0SA 3EF7A 3N94A 2XHDA 2XXIA 5JTYA 1R9QA 4PFTA 4GIZA 2F5XA 5H8FA 2V3UA 3D4GA 1OVTA 3FXRA 3RTFB 2A5TB 3BBRA 4EXKA 3PPQA 2AL5A 4I9DA 4P11A 1FTOA 3ODBA 1RKMA 1EH3A 4R9FA 3SEVA 1P1WA 4NF6A 2OWTA 4OQOA 1BKAA 2Y7PA 1N3XA 3UK4A 4FJPA 3OD7A 4U4SA 2VP1A 1NNPA 4C1TA 3KFMA 1JW5A 4ELRA 3JZJA 3PUVE 1IEJA 4F1UA 3H4ZA 2ZYKA 4GFRA 3PPOA 1OQGA 4RK9A 5JEIA 1ZMGA 4OETA 4NEDA 3M3KA 4KPTA 3B7DA 1EZOA 2RC9A 3QUJA 4XIGQ 4NE4A 5FHNA 4NMYA 3U93A 1FQFA 4F2QA 1SVXB 1PB9A 4NF4A 1B46A 3VXBA 4HTGA 2I49A 4RXLA 2GHAA 3T9UA 1LAHE 2UXAA 4F29A 1EZ9A 1O64A 3R26A 3O6IA 4IO7A 4QHQA 1VR5A 3ONMA 2ONKE 1NFTA 2DYXA 4THIA 3S2VA 2I4CA 5I2KB 1II5A 3E4RA 3IB0A 4PE5B 4DXCA 4NF8B 1CB6A 2GH9A 3SEUA 2ZNTA 1P99A 5I59A 3K2DA 1QUJA 3RUMA 4PFUA 4QFNA 3S4UA 2QS3A 1WVJA 3SERA 4BDNA 2HCAA 1MY0A 5I2NA 4HW8A 4X9TA 2REJA 1MXWA 2THIA 1MRPA 1B52A 5CC2A 4M4GA 3JV9A 5I57A 2B3BA 2XX7A 1A99A 3UIFA 4ZEBA 1USYE 4U1OA 1A8FA 2RF1A 4N13A 5DT6A 2E0SA 4QRZA 4XTCQ 1XS5A 2F7CA 2VD2A 5H8QA 4LA9A 4G68C 4PFWA 4G68B 5L9SA 1YCJA 1US4A 1OLCA 4YB6A 5HBCA 4UA8A 1PB7A 2H5YA 3PUWE 2OZZA 3V5AA 1MXVA 3PUXE 4LATA 1NNTA 1RYOA 3A3CA 3MZ1A 3IL1B 1B9JA 2XD2A 4XKNA 3TTKA 2QMWA 3E3KA 4JXIA 4U22A 5FTHA 2F35A 1JVYA 3IX1A 4LZ7A 3PMWA 1B3GA 2I58A 5AA2A 1HSLA 3B6TA 2V93A 5KCJB 1EZPA 3CFLA 3D4CA 4KYDA 3K4UA 4RPNA 4MH5A 2Q88A 3PMVA 3KJTA 3Q29A 1B58A 2OWSA 5CMCA 3O66A 1P1QA 4TLMB 4AB6A 1Q35A 1FTJA 5CI5A 3DP4A 2RC7A 1T0KA 4I1DA 2O7UA 3G3IA 4GL8A 3QAXA 2Y7RA 3ECRA 2D21A 2DSFA 1WODA 3O97A 4R2FA 4QSEA 1DTZA 3CRBA 1SD3A 4YKIA 3HV1A 1JW1A 2DWIA 2OK2A 4H8JA 3UP9A 4BDLA 1BP5A 2DXYA 5TPAA 1LFIA 4BDOA 1FQBA 4RK2A 1MXXA 2ONRA 2Y84A 2O6AA 4YZZA 3BFTA 5KDTB 2UVIA 4LZ5A 3OSRA 1B2HA 4OEUA 1PBQA 3MC2A 4HS7A 3GXAA 2NUVA 4ZEIA 5FHMA 1TFAA 3EHSA 3GZGA 4L17A 1DMBA 4RNSA 4DCXA 1I6AA 3IB1A 4F3PA 2H4IA 4KI0E 4YU0A 2DP8A 1MQGA 2VD3A 3S9LC 3QUFA 5B7DA 1MXZA 3IOWA 3C32A 1IUDA 3RGYA 5I56B 2D5WA 4OHNA 5I2KA 3O2AA 1M5DA 5H8SA 2QS4A 2ALUA 2H99A 1B7HA 3MUQA 4OYVA 2F6GA 1D9YA 3C35A 5JK4A 1FQCA 4NTLA 2Z8DA 1H44A 3OEMA 4ZZEA 2V25A 1FTLA 3CI8A 4FAJA 5AA4B 3PD9A 4O3BA 2ONSA 5KZTA 3RNNA 4GL0A 2UYEA 4H6DA 2I4BA 5CRYA 4Q5TA 5EHMA 3SKPA 1A7LA 1NNFA 2X26A 3PV0E 4O3AA 3IR1A 1B3HA 2NWJA 1AIVA 4N07A 4JWYA 3K6VA 2O84X 2QRYA 3A3UA 3CIJA 4WKMA 1OLAA 4LVQA 4DDDA 1B7UA 3VVFA 4HCYA 3PGFA 4H65A 3TQLA 1B3EA 1B0HA 1B5JA 3MVZA 5F7VA 3I3VA 1M5BA 4OFLA 3HHFA 3HHGA 5DEXB 3HPIA 1QUKA 1I69A 2PVUA 2RINA 3W9VA 3QSLA 3BFUA 2HEUA 3O6HA 4OESA 3G3GA 3U94A 4JWXA 1WDNA 3CFXA 1BIYA 4POWA 1YAEA 3VV5A 4U21A 3SEYA 1XT8A 3SETA 1IITA 5BUUA 2Z22A 1JVXA 4HCWA 2QPQA 1DPEA 3M3FA 1SW2A 2OLBA 3N6TA 1IIWA 3VLUA 1PEBA 4KR5A 1I6BA 3PPPA 4BDRA 2UYFA 4G2ZA 3FXQA 4BLAA 3LSFB 3MVXA 1GTKA 4YKJA 1ZTYA 3VFJA 2VHAA 1MH4A 5I58B 3U72A 4TLLB 3C36A 1DTGA 3QXMA 4DZ1A 3EQ1A 3O28A 2ESNA 2HAVA 3OENA 1UQWA 5AA1A 2HZKA 4XKPA 3TTLA 2ZMBA 4WEDA 3BKIB 1LFHA 4ONYA 3MPKA 3O29A 3PPRA 5CMBA 3TTNA 1BLFA 1MPDA 1AOVA 4GD5A 3T22A 1N76A 4H67A 2QS1A 3TUSA 3FVNA 3FJGA 2ANJA 1B1HA 3I6VA 4G8MA 3MBPA 3TELA 1MQJA 2OJTA 3HSTA 4R74A 4IY6A 2F6PA 3H7MA 4WXJA 1D3KA 4YB5A 2H25A 4LONB 3PD8A 1A54A 4DXUA 5KDTA 4P0IA 4E0WA 1MM6A 1Y3NA 1B32A 2PMSA 1LB8A 1Z7NE 3OOAA 4OZ9A 3MVWA 2W7YA 2R6GE 1PB8A 5F1QA 5TU0A 4IB2A 3SEWA 1B0LA 3MZ9A 5M2VA 1QVSA 3FVKA 1PDAA 4H1XA 1NNKA 1UTBB 3IAZA 3MP8A 1J1NA 3TYHA 2Q8JA 1H45A 1ATGA 3TTMA 4YKKA 2V3TA 5I56A 3RTWB 1VSOA 2I3WA 1B4ZA 3G3HA 3VE1B 1TWYA 5BWJA 3Q28A 5DVFA 1AL3A 3PMXA 1QUIA 2GFEA 2M8CA 3U92A 4EQBA 4YMBA 1P1OA 3CSGA 5AA4A 4H5GA 2XD3A 4GVOA 3KG2A 4EXLA 4ZE8A 2FYIA 1NL5A 4QFKA 4PFYA 3ZKKA 4R75A 4YMAA 1TT1A 2PT1A 2AIXA 1B51A 4MBPA 2FNCA 1UTHB 4GWOA 3OMBA 3V83A 4R2BA 1Y9UA 4PP0A 4ZEDA 4ZDMA 3B6QA 1IXIA 1GGGA 1R6ZA 3FVGA 2V3QA 3FJMA 2HZLA 3RQTA 3A09A 4JSDA 5A5XA 5CMMA 4U4XA 4OFJA 2O1LA 5EYFA 1ZLQA 3T9HB 3N26A 3IO6A 2PX1A 3LSWA 2V84A 2F8DA 5I84A 3H6WA 3UA8A 2NVUB 4F3BA 3KN8A 3MZBA 4OTEA 2ABHA 2ZXTA 1LLSA 1FQEA 1M5FA 4H5FA 5DEXA 1SYHA 4MF3A 2QJEA 1Y20A 1XHYA 1IZ1A 2XX8A 4KCDA 1SQYA 2ZYOA 2XXVA 1NMUA 3MWBA 1B6HA 4JB7A 1AH5A 1NH7A 4YAHX 1VFEA 5IAIA 1B5IA 4GLIA 2F36A 4NF5B 3EHUA 1SI0A 3DP6A 4DE8A 3QYTA 2BJJX 3VLVA 3VLWA 4G8HA 5EHSA 3HO7A 5JTYB 4F2OA 4ISUA 1S50A 5I58A
chains in the Genus database with same CATH superfamily
3FV2A 2DDKA 2XWOA 3CG3A 4KYSA 4EQ9A 3CG1A 4RJZA 1EU8A 2ZYNA 1N3WA 4ZE9A 1B40A 3VDFA 4YKPA 3MQ9A 3PPNA 2A5TA 3RT6B 1DCUA 1B05A 1S9TA 3V89B 1IMFA 1QKBA 2NXOA 3W15C 1IQ7A 3C31A 2QFLA 3TMGA 3C33A 2DVZA 4AS4A 4FECA 4F31B 2Y7WA 1R9LA 3K00A 5H8NB 3ZS6A 3TPAA 5L9OA 4XKRA 2A5SA 2YJPA 4ELPA 4PETA 3MYUA 4AS5A 4DXBA 1YTVA 4GBWA 4O3CA 3FVOA 1QKAA 4XKQA 2Q74A 4TQUQ 3OXNA 3O6GA 1JP4A 4KQPA 2AL4A 1LAXA 3IK6B 3DM0A 4OMBA 3C4MA 3K02A 1N0TA 2WKYA 3ILUB 2Y5LA 2DQVA 1LB9A 5FHOA 1LCTA 4R9GA 3LBSA 1Q1KA 4PDDA 1YPNA 1MQHA 1A55A 1JETA 4ELOA 1MXYA 4ECFA 2QVUA 4LZ8A 2OCUA 1DOTA 1Y4CA 2P3NA 3TODA 1YYZA 3T93B 4OFOA 3HCQA 4ND9A 5ISUA 2QVVA 1CNQA 4FEDA 5B70A 2WYKA 4PAKA 3OO7A 4FORA 2Y7KA 1MY2A 4C0RA 1B5HA 2O51A 3DLNA 4NF8A 2HXRA 1UTBA 4FE8A 4NWCA 2F78A 5FTIA 1ELJA 3RY3A 4PQJA 3RPLA 3GBBA 4KD5A 3T9XB 2CEXA 3B8BA 2F34A 4OEVA 1L5TA 1FPKA 3TAJA 3KGCA 3FV1A 5I2NB 4Z0IA 4QFLA 1EYIA 4N17A 1DPPA 2O1MA 4POXA 4OXVA 3HN0A 2UVHA 5I57B 3W9WA 1IMAA 2HAUA 1Y4TA 4ELQA 3EHTA 4IGRA 5J1DA 3FZVA 2DOJA 4OVRA 4GWSA 4WEPA 3CFZA 1AMFA 5CM6A 4K3FA 3FJ7A 4R73A 5DYHA 3B6WA 4P9KA 4MMPA 4G68A 1UTHA 1FPFA 1MXUA 5ET8A 4RPOA 3A29A 1GR2A 1ZKBA 3PUZE 1FPDA 1BTJA 4F19A 2I0BA 2PFZA 3G3JA 4QF9A 3EPEA 1H43A 1AWBA 1B1XA 5AA3A 3IOUA 1XVYA 3TDJA 3IO4A 3WAFA 2BJIA 4TOZA 3K6XA 4KCCA 1IXCA 4EF2A 3I5OA 4H46A 1NV2A 4RY1A 5ITPA 4BDMA 1M5CA 3CHGA 2CEYA 4C1UA 3LC8A 3VVDA 4MHFA 2D3IA 2DWAA 4X1DA 5AE4A 5KCJA 4NWDA 4OANA 4ZECA 4GF8A 2CZHA 3S9MC 4KFQA 1MQDA 4U23A 4U2RA 2FA7A 3MPLA 4LQ5A 1SDXA 4Q8RA 1QW0A 5ICTA 3TCHA 5IGAA 3SEXA 1FBFA 3GLBA 3MAMA 4R6HA 1FTAA 2X7QA 3FASA 1P1UA 3K6UA 1MG1A 3OO9A 4NF5A 2P2AA 3IJXB 2XXKA 3WAEA 4UACA 4RYAA 4P56A 4XXUA 3TCFA 5F24A 3MP6A 3H03A 4OERA 2F3BA 3IOVA 1FQDA 2F7BA 2Q9TA 4GX6A 1LSTA 4PF6A 2VOZA 2Q2AA 1JEUA 4PE3A 4DIGA 3IOTA 3L6HA 4QSCA 1NV3A 1QULA 4OENA 1VDWA 2XXWA 1IXGA 1A40A 2P3VA 5TPAB 1Y3QA 3KC0A 2RKMA 1LBBA 5H8NA 5HM4B 4JSOA 1H3DA 2DXRA 3HFUA 4BDQA 3TKDA 3VXCA 1GV8A 3THIA 2ZZWA 3KBZA 3RLFE 2RC8A 4N6PA 4PFRA 4KXPA 2CZKA 2YPNA 2CMOA 1POY1 1P1NA 4GRKA 4GX3A 3UGWA 1ZU0A 2QL3A 4IY5A 1SW1A 3TQWA 4KYEA 1UIUA 1VFDA 2Q2CA 3Q25A 3R6UA 4Z7EA 3O9PA 2G29A 2Z23A 2AYSA 1KA0A 5LOMA 3K0VA 3EN3A 3K6WA 1N7WA 2VGQA 4OA4A 2NOOA 4LP2B 5TP9B 4P0GA 1FPBA 4MAGA 2PT2A 3T9VA 4PC9A 2H9BA 3PTYA 1USYH 2I3VA 4EQ7A 5DTBA 4FATA 4XEQA 4N91A 2E1SA 1LAFE 1SW4A 2OBGA 4G8NA 2VPNA 5I5PA 4LUBA 2ZYMA 2PFYA 2Y7IA 3KSXA 2IEEA 4YICA 4IO4A 4P1EA 2O68A 3UORA 5DVIA 2FBPA 4H8IA 3G3FA 4Q0CA 3UN6A 4I3YA 1D4NA 1OQHA 2I6EA 1LCFA 2DWJA 1JW4A 1MDQA 3USDA 4AQ4A 2XWKA 4Q30B 5HPQA 2XXUA 1VE4A 5H8HB 4XFEA 1KWHA 3GBAA 1HSEA 4FIMA 2Q89A 3E9XA 4IO3A 3H6UA 3MSTA 1HSJA 4NGUA 1LAGE 4YB7A 1N04A 4I8CA 3MP1A 2V4CA 1F9BA 4I3EA 3ZSFA 1LGBC 1B7ZA 4GQOA 2LAOA 2CZIA 2O69A 2F7AA 3IFAA 4PGPA 1SI1A 3JYRA 3KN3A 3KBRA 1JQFA 4QFOA 2DE4A 4E0XA 4QXDA 3LSXA 5IZZA 2DVCA 1DSNA 3VVEA 3DELB 1QJMA 1CE2A 2KLFA 4N81A 3T66A 3S9NC 2MKZA 5ELVA 4IR8A 4PGNA 1MPBA 1M5EA 1IMCA 4PAFA 3IJOB 2IA4A 2XXYA 4H0WA 3L6GA 3H3GA 2PYYA 3OO6A 1DK4A 1XC1A 1LBWA 4PF8A 2ZNUA 2DE3A 1MDP1 2GHBA 2F97A 1MH3A 3FD3A 4F1YA 3CVGA 2QSXA 2FIEA 4GXSB 3P7IA 2YLNA 1FQAA 3KZGA 2XXQA 4OVJA 2OX3A 5K2XA 4IO5A 2P1SA 4PBHA 1B3LA 4KHZE 5H8FB 4MLQA 2I48A 1FRPA 3E13X 1FW0A 3FBPA 5K2YA 4OVSA 1XOCA 4LQ2A 1IMDA 3BIHA 3OO8A 4ESWA 1FBEA 1Y3PA 3FUZA 4R72A 3S9EA 3KOTA 1NV6A 1Y1MA 3DP8A 2X7PA 4FEBA 3SESA 2G93A 3TTRA 2Z8FA 4NF6B 1URGA 1US5A 3QIMA 3MVYA 1S7YA 2HQ0A 3G3KA 4DCYA 3T1BA 4GOTA 5ICQA 4DI4B 2XXRA 2HXWA 3NOHA 1UIVA 2Z8EA 4IO6A 1TXFA 5L8DA 1SYIA 2XX9A 1JNFA 4MLVA 2R71A 1ZBMA 4F3GA 3RT8A 2DE2A 3IB2A 3H06B 3Q27A 4X1BA 3H6TA 3F11A 3CSBA 1MY4A 4X8RA 3FGSA 5IKBA 1A8EA 3LUYA 1N84A 3M8UA 5ET7A 1FTMA 3SDFA 4ESXA 4NF4B 4QFPA 1ZIUA 2DWHA 2L5VA 1FBGA 1O63A 1MS7A 3TEPA 1NKXA 5ET6A 4F39A 3Q26A 4F3SA 1PC3A 1FCKA 1MPCA 1LBCA 2XXHA 1MY3A 3U1OA 4ZEFA 1URDA 1H76A 2WEFA 5TP9A 4EF1A 1URSA 1XVXA 1B3FA 3RPWA 3K01A 3N5LA 4N6DA 4ZEKA 2XXTA 5I59B 3KEIA 5ITOA 2B65A 3TZAA 4RA1A 4I62A 4JBZA 2XXXA 1FTKA 5J16A 2WBBA 3KN7A 1FBDA 1OMPA 2UVJA 2I0CA 3IORA 3C9HA 1POTA 1RYXA 4M1VA 3R7XA 2DS9A 1JEVA 2REGA 1ZJLA 2R9JA 4HXVA 4AB5A 3FATA 3AXFA 1MM7A 1PBPA 2Q8MA 3TCGA 1SW5A 2O7IA 4OWDA 2ZNSA 4MFIA 4ZS9A 4NG7A 1SBPA 5H8HA 4HE2A 3H6VA 5H8QB 5CMKA 3K1NA 1NV7A 3PU5A 3KJ7A 3U8QA 4QSDA 3LUZA 3G7WA 1FPJA 1I6QA 1NH8A 5L9MA 3CR9A 3ZKLA 3LR1A 2QMXA 1TFDA 2RCBA 2B3FA 4XF5A 2QS2A 3ILTB 5LTCA 5DVJA 1OVBA 4ZZAA 4IO2A 3OSQA 3K1MA 4IGTA 2UVGA 2PCRA 4G4PA 1K9YA 3KSJA 4F18A 5A5LA 1IXHA 3C34A 2GRVA 5A5XB 3RN8A 4HE0A 1D9VA 4G77A 1Z7ME 3TFLA 5CBSA 5EYHA 4GXAA 5IZ3A 3OELA 1GVCA 1O7TA 3FXUA 4F22A 3T96B 1RDXA 2ZZXA 3MW0A 3FIRA 3N6UA 1B4HA 3PUYE 3MJNA 5FBPA 5AA2D 5AA2B 2WBDA 4JWOA 4EUOA 2H98A 3BIGA 2CZLA 4MNPA 4JDFA 3K1PA 3QK6A 4JVIA 1MQIA 3B50A 4R6KA 4DLDA 3M3LA 3V8XB 1R1NA 1ANFA 3LSLA 1OIBA 4R6YA 4GWZA 5EYGA 1Y1ZA 3KOSA 2HFBA 1FPGA 2RCAA 2XXPA 4PDHA 3D1RA 4F1VA 1MY1A 4X48A 3OEKA 1LFGA 4U1ZA 1N7XA 2PBWA 5CBRA 4EDPA 4PCDA 2P0SA 3EF7A 5DW8A 3N94A 2XHDA 2XXIA 5JTYA 1RDZA 1R9QA 4PFTA 4GIZA 2F5XA 5H8FA 2V3UA 3D4GA 1OVTA 3FXRA 3RTFB 2A5TB 5EQ8A 1NUXA 3BBRA 4EXKA 4MEVA 2GQ1A 3PPQA 2AL5A 4I9DA 4P11A 1FTOA 3ODBA 1RKMA 1EH3A 3RYDA 4R9FA 3SEVA 1P1WA 4NF6A 2OWTA 4OQOA 1BKAA 3ROJA 1NUYA 2Y7PA 1N3XA 3UK4A 2VPOA 4FJPA 3OD7A 4N8YA 4U4SA 2VP1A 1NNPA 4C1TA 3KFMA 4GX4A 1JW5A 4ELRA 3JZJA 3PUVE 1IEJA 4MJOA 4F1UA 1FPEA 3H4ZA 2ZYKA 4GFRA 3PPOA 1OQGA 4RK9A 5JEIA 1ZMGA 4OETA 4NEDA 2XWVA 3M3KA 4KPTA 3B7DA 3GYYA 1EZOA 2RC9A 3QUJA 4XIGQ 4NE4A 1NUZA 5FHNA 4NMYA 3U93A 1FQFA 4F2QA 1SVXB 1PB9A 4NF4A 1B46A 3VXBA 4HTGA 2I49A 4RXLA 2GHAA 3T9UA 1LAHE 2UXAA 4F29A 1EZ9A 4GWUA 5I3SA 1O64A 3R26A 3O6IA 4IO7A 4QHQA 1VR5A 4JVCA 1D9QA 3ONMA 2ONKE 1NFTA 2WYPA 2DYXA 4THIA 3S2VA 1NI9A 2I4CA 5I2KB 4I40A 1II5A 3E4RA 3IB0A 4PE5B 4DXCA 4NF8B 1CB6A 2GH9A 4QBAA 3SEUA 2ZNTA 3RPLB 1P99A 5I59A 3K2DA 1QUJA 3RUMA 4PFUA 4QFNA 3S4UA 2QS3A 1WVJA 4O8MA 3SERA 4BDNA 5IM2A 4PTKA 2HCAA 1MY0A 4PAIA 5I2NA 4HW8A 4GBVA 4X9TA 2REJA 1MXWA 2THIA 1MRPA 1B52A 5CC2A 4M4GA 3JV9A 5I57A 2B3BA 2XX7A 1A99A 3UIFA 4ZEBA 1USYE 4U1OA 1A8FA 2RF1A 4N13A 5DT6A 2E0SA 2XWIA 4QRZA 1YZ0A 4XTCQ 1XS5A 2F7CA 2VD2A 5H8QA 4LA9A 5LDZA 4G68C 4PFWA 4G68B 5L9SA 3LV0A 1YCJA 1US4A 1OLCA 4YB6A 5HBCA 1SPIA 4P1LA 4UA8A 1PB7A 2H5YA 4N8GA 3PUWE 2OZZA 3V5AA 2JJKA 1MXVA 3PUXE 4LATA 1NNTA 1RYOA 3A3CA 2R8TA 3MZ1A 3IL1B 1B9JA 2XD2A 4XKNA 3TTKA 2QMWA 3E3KA 4JXIA 4U22A 5FTHA 2F35A 1JVYA 3IX1A 4LZ7A 3PMWA 4PFIA 1B3GA 2I58A 1FPLA 5AA2A 1HSLA 3B6TA 2V93A 5KCJB 1EZPA 3CFLA 3D4CA 4KYDA 1RDYA 3K4UA 4H45A 4RPNA 4MH5A 2Q88A 3PMVA 4O94A 3KJTA 3Q29A 1B58A 2OWSA 5CMCA 3O66A 1P1QA 4TLMB 4AB6A 1Q35A 1FTJA 5CI5A 3DP4A 2RC7A 2FHYA 1T0KA 4I1DA 2O7UA 3G3IA 4GL8A 3QAXA 2Y7RA 1FBPA 1FBCA 3ECRA 2D21A 2DSFA 1WODA 3O97A 4R2FA 4QSEA 1DTZA 3CRBA 1SD3A 4YKIA 3HV1A 1JW1A 2DWIA 2OK2A 4H8JA 3UP9A 4BDLA 1BP5A 2DXYA 5TPAA 1LFIA 4BDOA 4OVTA 1FQBA 4RK2A 1DBZA 1MXXA 3FXBA 3ISPA 1LEVA 4N15A 1KZ8A 2ONRA 2Y84A 2O6AA 4YZZA 3BFTA 5KDTB 2UVIA 4LZ5A 5EQ7A 3OSRA 1B2HA 4OEUA 1PBQA 3MC2A 4HS7A 3GXAA 4P8BA 2NUVA 4ZEIA 5FHMA 1TFAA 3EHSA 1IMBA 1NV5A 3GZGA 4L17A 1DMBA 4RNSA 4DCXA 1I6AA 3IB1A 4F3PA 5I7IA 2H4IA 4O7IA 4GWWA 4KI0E 1NV4A 4NX1A 4YU0A 2DP8A 1MQGA 1EYKA 2VD3A 3S9LC 3T0JA 3QUFA 5B7DA 1MXZA 3IOWA 3C32A 1IUDA 4P47A 3RGYA 5I56B 2D5WA 4OHNA 5I2KA 3O2AA 2KR0A 1M5DA 5H8SA 2QS4A 3U65A 2ALUA 2H99A 4MCOA 1B7HA 3MUQA 4OYVA 2F6GA 1D9YA 3C35A 4MNCA 5JK4A 1FQCA 4NTLA 2Z8DA 1H44A 3OEMA 4ZZEA 4GWXA 2V25A 1FTLA 3CI8A 4FAJA 5AA4B 3PD9A 4O3BA 5IZ1A 2ONSA 5KZTA 1BK4A 3RNNA 4GL0A 4MX6A 2UYEA 4H6DA 2I4BA 5CRYA 4Q5TA 5EHMA 3SKPA 1A7LA 1NNFA 2X26A 3PV0E 1Q9DA 4O3AA 3IR1A 1XI6A 1B3HA 2NWJA 1AIVA 4N07A 4DI3D 4JWYA 3K6VA 2VT5A 4NN3A 2O84X 2QRYA 4JVDA 3A3UA 3CIJA 4WKMA 1OLAA 4LVQA 4DDDA 1B7UA 3VVFA 4MNIA 4HCYA 3PGFA 4H65A 3TQLA 1B3EA 1B0HA 4N4UA 1B5JA 2FIXA 3MVZA 5F7VA 3I3VA 1LBXA 1M5BA 4OFLA 3HHFA 3HHGA 5DEXB 3HPIA 1QUKA 1I69A 2PVUA 2RINA 3W9VA 3QSLA 3BFUA 2HEUA 3O6HA 4NF0A 4OESA 3G3GA 3U94A 4JWXA 1WDNA 3CFXA 1BIYA 4POWA 1YAEA 3VV5A 4U21A 3SEYA 1LBVA 1XT8A 3SETA 1IITA 5BUUA 2Z22A 1JVXA 4HCWA 2QPQA 1DPEA 3M3FA 1SW2A 1QGXA 2OLBA 3N6TA 1IIWA 3VLUA 1PEBA 4KR5A 1I6BA 3PPPA 5EQ9A 4BDRA 2UYFA 4G2ZA 3FXQA 4BLAA 3LSFB 3MVXA 1GTKA 4YKJA 1ZTYA 3VFJA 2B4LA 2VHAA 1MH4A 5I58B 4MIJA 3U72A 4TLLB 3C36A 1DTGA 3QXMA 4DZ1A 3EQ1A 2HHMA 3O28A 2ESNA 2HAVA 1FJ9A 3OENA 1UQWA 5AA1A 4X04A 2HZKA 4XKPA 4NAPA 3TTLA 2WX9A 2ZMBA 4WEDA 3BKIB 1LFHA 4ONYA 3MPKA 1FJ6A 3O29A 3PPRA 5CMBA 3TTNA 1BLFA 1MPDA 1AOVA 1FPIA 4GD5A 3T22A 1N76A 4NQ8A 4H67A 2QS1A 3TUSA 4P3LA 3FVNA 3FJGA 2ANJA 1B1HA 3I6VA 4G8MA 3MBPA 4O7MA 1K9ZA 5EQAA 3TELA 1MQJA 2OJTA 3HSTA 4R74A 4IY6A 2F6PA 1INPA 2XA5A 3H7MA 4WXJA 1D3KA 4YB5A 2Y5KA 2H25A 4LONB 3PD8A 1A54A 4DXUA 5KDTA 4P0IA 4E0WA 1MM6A 1Y3NA 1B32A 2PMSA 1LB8A 1Z7NE 3OOAA 4OZ9A 3MVWA 2F3DA 2W7YA 2R6GE 1PB8A 5F1QA 4OVPA 3KC1A 5TU0A 4IB2A 3SEWA 1B0LA 3MZ9A 5M2VA 1EYJA 1QVSA 3FVKA 1PDAA 4H1XA 1NNKA 1UTBB 3IAZA 3MP8A 1J1NA 3TYHA 2Q8JA 1G0IA 4PBQA 1H45A 1ATGA 3TTMA 2FVZA 4HE1A 1YXIA 4YKKA 2V3TA 5I56A 3RTWB 2HPGA 1VSOA 4UABA 2I3WA 1B4ZA 3G3HA 3VE1B 1TWYA 1NV1A 5BWJA 3Q28A 2ZZVA 5DVFA 1AL3A 3PMXA 1LBYA 1QUIA 2GFEA 2M8CA 3U92A 5ET5A 4EQBA 4YMBA 1P1OA 3CSGA 3E79A 4FBPA 5AA4A 4H5GA 2XD3A 4GVOA 3KG2A 4EXLA 4ZE8A 2FYIA 1NL5A 4QFKA 4G61A 1KA1A 4PFYA 2OWZA 4PFBA 3ZKKA 4R75A 1TT1A 4YMAA 2PT1A 2AIXA 5ESYA 1B51A 4MBPA 2FNCA 1UTHB 4GWOA 3OMBA 3V83A 4R2BA 1Y9UA 4PP0A 4ZEDA 4ZDMA 3B6QA 1IXIA 1GGGA 1R6ZA 3FVGA 2V3QA 3FJMA 2HZLA 3RQTA 3A09A 4JSDA 5A5XA 3QMFA 5CMMA 4U4XA 5IZ3B 4OVQA 4OFJA 2O1LA 5EYFA 1ZLQA 3T9HB 3N26A 3IO6A 2PX1A 3LSWA 2V84A 3E78A 2F8DA 5I84A 3H6WA 3UA8A 2NVUB 3KN8A 4F3BA 3MZBA 4OTEA 2ABHA 1FBHA 1LLSA 2ZXTA 1FQEA 1M5FA 4H5FA 5DEXA 1LBZA 1SYHA 4N6KA 2QVRA 4MF3A 1FSAA 2QJEA 1Y20A 3EKIA 1XHYA 1IZ1A 2XX8A 4GWYA 4KCDA 1IMEA 1SQYA 2ZYOA 2XXVA 4NHBA 1NMUA 2B4MA 1B6HA 3MWBA 4JB7A 1AH5A 5T3JA 1NH7A 4YAHX 1VFEA 5IAIA 1B5IA 4GLIA 2F36A 4NF5B 3EHUA 1SI0A 3DP6A 4DE8A 2KQZA 3QYTA 1NUWA 2BJJX 4G8HA 5EHSA 3SZPA 3VLVA 4LN5A 3VLWA 3HO7A 5JTYB 3IFCA 4F2OA 4ISUA 1G0HA 1S50A 1NV0A 5I58A
chains in the Genus database with same CATH topology
3FV2A 3CG3A 4KYSA 4EQ9A 3CG1A 4RJZA 1EU8A 2ZYNA 1N3WA 4ZE9A 1B40A 3VDFA 4YKPA 3MQ9A 3PPNA 2A5TA 3RT6B 1B05A 1S9TA 3V89B 1QKBA 2NXOA 3W15C 1IQ7A 3C31A 3TMGA 3C33A 2DVZA 4FECA 4F31B 2Y7WA 1R9LA 3K00A 5H8NB 3ZS6A 3TPAA 5L9OA 4XKRA 2A5SA 2YJPA 4ELPA 4PETA 4DXBA 1YTVA 4O3CA 3FVOA 1QKAA 4XKQA 4TQUQ 3OXNA 3O6GA 4KQPA 2AL4A 1LAXA 3IK6B 3DM0A 4OMBA 3C4MA 3K02A 1N0TA 2WKYA 3ILUB 2DQVA 1LB9A 5FHOA 1LCTA 4R9GA 3LBSA 1Q1KA 1YPNA 1MQHA 1A55A 1JETA 4ELOA 1MXYA 4ECFA 4LZ8A 2OCUA 1DOTA 1Y4CA 3TODA 3T93B 4OFOA 3HCQA 4ND9A 5ISUA 4FEDA 5B70A 3OO7A 4FORA 2Y7KA 1MY2A 4C0RA 1B5HA 2O51A 3DLNA 4NF8A 1UTBA 4FE8A 4NWCA 2F78A 5FTIA 1ELJA 3RY3A 4PQJA 3GBBA 4KD5A 3T9XB 2F34A 4OEVA 1L5TA 3TAJA 3KGCA 3FV1A 5I2NB 4Z0IA 4QFLA 1DPPA 2O1MA 4POXA 4OXVA 3HN0A 2UVHA 5I57B 3W9WA 2HAUA 1Y4TA 4ELQA 3EHTA 4IGRA 5J1DA 3FZVA 2DOJA 4WEPA 3CFZA 1AMFA 5CM6A 4K3FA 3FJ7A 4R73A 5DYHA 3B6WA 4G68A 1UTHA 1MXUA 4RPOA 1GR2A 1ZKBA 3PUZE 1BTJA 4F19A 2I0BA 3G3JA 4QF9A 3EPEA 1H43A 1B1XA 5AA3A 3IOUA 1XVYA 3TDJA 3IO4A 3WAFA 4TOZA 3K6XA 4KCCA 1IXCA 4EF2A 3I5OA 4RY1A 5ITPA 4BDMA 1M5CA 4C1UA 3LC8A 3VVDA 2D3IA 2DWAA 4X1DA 5AE4A 5KCJA 4NWDA 4ZECA 4GF8A 3S9MC 4KFQA 1MQDA 4U23A 4U2RA 2FA7A 3MPLA 4LQ5A 1SDXA 4Q8RA 1QW0A 5ICTA 3TCHA 3SEXA 3GLBA 3MAMA 4R6HA 2X7QA 3FASA 1P1UA 3K6UA 1MG1A 3OO9A 4NF5A 2P2AA 3IJXB 3WAEA 4UACA 4RYAA 4XXUA 3TCFA 3MP6A 3H03A 4OERA 3IOVA 1FQDA 2F7BA 2Q9TA 1LSTA 2VOZA 2Q2AA 1JEUA 4DIGA 3IOTA 3L6HA 4QSCA 1QULA 4OENA 2XXWA 1IXGA 1A40A 5TPAB 1Y3QA 2RKMA 1LBBA 5H8NA 5HM4B 4JSOA 1H3DA 2DXRA 4BDQA 3TKDA 3VXCA 1GV8A 3THIA 3RLFE 2RC8A 4N6PA 2YPNA 2CMOA 1POY1 1P1NA 4GRKA 3UGWA 1ZU0A 2QL3A 4IY5A 1SW1A 3TQWA 4KYEA 1UIUA 1VFDA 2Q2CA 3Q25A 3R6UA 4Z7EA 3O9PA 2G29A 2Z23A 2AYSA 5LOMA 3K0VA 3EN3A 3K6WA 1N7WA 2VGQA 2NOOA 4LP2B 5TP9B 4P0GA 2PT2A 3T9VA 2H9BA 1USYH 2I3VA 4EQ7A 5DTBA 4FATA 2E1SA 1LAFE 1SW4A 2OBGA 4G8NA 4LUBA 2ZYMA 2Y7IA 3KSXA 2IEEA 4YICA 4IO4A 2O68A 3UORA 5DVIA 4H8IA 3G3FA 4Q0CA 3UN6A 1D4NA 1OQHA 2I6EA 1LCFA 2DWJA 1JW4A 1MDQA 3USDA 4AQ4A 4Q30B 5HPQA 2XXUA 1VE4A 5H8HB 1KWHA 3GBAA 1HSEA 4FIMA 2Q89A 3E9XA 4IO3A 3H6UA 1HSJA 1LAGE 4YB7A 1N04A 4I8CA 3MP1A 1F9BA 3ZSFA 1LGBC 1B7ZA 4GQOA 2LAOA 2O69A 2F7AA 1SI1A 3JYRA 3KN3A 3KBRA 1JQFA 4QFOA 2DE4A 4E0XA 3LSXA 2DVCA 1DSNA 3VVEA 3DELB 1QJMA 1CE2A 2KLFA 3T66A 3S9NC 5ELVA 1MPBA 1M5EA 3IJOB 2IA4A 2XXYA 4H0WA 3L6GA 3H3GA 2PYYA 3OO6A 1XC1A 2ZNUA 2DE3A 1MDP1 2GHBA 2F97A 1MH3A 3FD3A 4F1YA 3CVGA 2QSXA 4GXSB 3P7IA 2YLNA 1FQAA 3KZGA 2XXQA 4OVJA 5K2XA 4IO5A 2P1SA 1B3LA 4KHZE 5H8FB 4MLQA 2I48A 3E13X 1FW0A 5K2YA 1XOCA 3OO8A 4LQ2A 4ESWA 1Y3PA 3FUZA 4R72A 3S9EA 3KOTA 1Y1MA 3DP8A 2X7PA 4FEBA 3SESA 2G93A 3TTRA 2Z8FA 4NF6B 1URGA 1US5A 3QIMA 3MVYA 1S7YA 2HQ0A 3G3KA 4DCYA 4GOTA 5ICQA 2XXRA 2HXWA 1UIVA 2Z8EA 4IO6A 1TXFA 5L8DA 1SYIA 2XX9A 1JNFA 4MLVA 2R71A 1ZBMA 4F3GA 3RT8A 2DE2A 3IB2A 3H06B 3Q27A 4X1BA 3H6TA 3F11A 3CSBA 1MY4A 3FGSA 5IKBA 1A8EA 3LUYA 1N84A 3M8UA 1FTMA 3SDFA 4ESXA 4NF4B 4QFPA 1ZIUA 2DWHA 1O63A 1MS7A 3TEPA 1NKXA 4F39A 3Q26A 4F3SA 1PC3A 1FCKA 1MPCA 1LBCA 2XXHA 1MY3A 3U1OA 4ZEFA 1URDA 1H76A 5TP9A 4EF1A 1URSA 1XVXA 1B3FA 3RPWA 3K01A 3N5LA 4ZEKA 2XXTA 5I59B 3KEIA 5ITOA 2B65A 3TZAA 4RA1A 4I62A 4JBZA 2XXXA 1FTKA 3KN7A 1OMPA 2UVJA 2I0CA 3IORA 3C9HA 1POTA 1RYXA 4M1VA 3R7XA 2DS9A 1JEVA 2REGA 1ZJLA 2R9JA 4AB5A 3FATA 3AXFA 1MM7A 1PBPA 3TCGA 1SW5A 2O7IA 4OWDA 2ZNSA 4MFIA 4ZS9A 1SBPA 5H8HA 3H6VA 5H8QB 5CMKA 3K1NA 3PU5A 3KJ7A 3U8QA 4QSDA 3G7WA 1I6QA 1NH8A 5L9MA 3CR9A 3ZKLA 3LR1A 2QMXA 1TFDA 2RCBA 2B3FA 2QS2A 3ILTB 5DVJA 1OVBA 4ZZAA 4IO2A 3OSQA 3K1MA 4IGTA 2UVGA 4G4PA 3KSJA 4F18A 1IXHA 3C34A 2GRVA 5A5XB 3RN8A 1D9VA 4G77A 1Z7ME 3TFLA 5CBSA 4GXAA 3OELA 1GVCA 1O7TA 3FXUA 4F22A 3T96B 3MW0A 3FIRA 3N6UA 1B4HA 3PUYE 3MJNA 5AA2D 5AA2B 4JWOA 4EUOA 2H98A 2CZLA 4JDFA 3K1PA 3QK6A 1MQIA 4R6KA 4DLDA 3M3LA 3V8XB 1R1NA 1ANFA 3LSLA 1OIBA 4R6YA 1Y1ZA 3KOSA 2HFBA 2RCAA 2XXPA 4F1VA 1MY1A 4X48A 3OEKA 1LFGA 1N7XA 2PBWA 4U1ZA 5CBRA 4EDPA 2P0SA 3EF7A 3N94A 2XHDA 2XXIA 5JTYA 1R9QA 4PFTA 4GIZA 2F5XA 5H8FA 2V3UA 3D4GA 1OVTA 3FXRA 3RTFB 2A5TB 3BBRA 4EXKA 3PPQA 2AL5A 4I9DA 4P11A 1FTOA 3ODBA 1RKMA 1EH3A 4R9FA 3SEVA 1P1WA 4NF6A 2OWTA 4OQOA 1BKAA 2Y7PA 1N3XA 3UK4A 4FJPA 3OD7A 4U4SA 2VP1A 1NNPA 4C1TA 3KFMA 1JW5A 4ELRA 3JZJA 3PUVE 1IEJA 4F1UA 3H4ZA 2ZYKA 4GFRA 3PPOA 1OQGA 4RK9A 5JEIA 1ZMGA 4OETA 4NEDA 3M3KA 4KPTA 3B7DA 1EZOA 2RC9A 3QUJA 4XIGQ 4NE4A 5FHNA 4NMYA 3U93A 1FQFA 4F2QA 1SVXB 1PB9A 4NF4A 1B46A 3VXBA 4HTGA 2I49A 4RXLA 2GHAA 3T9UA 1LAHE 2UXAA 4F29A 1EZ9A 1O64A 3R26A 3O6IA 4IO7A 4QHQA 1VR5A 3ONMA 2ONKE 1NFTA 2DYXA 4THIA 3S2VA 2I4CA 5I2KB 1II5A 3E4RA 3IB0A 4PE5B 4DXCA 4NF8B 1CB6A 2GH9A 3SEUA 2ZNTA 1P99A 5I59A 3K2DA 1QUJA 3RUMA 4PFUA 4QFNA 3S4UA 2QS3A 1WVJA 3SERA 4BDNA 2HCAA 1MY0A 5I2NA 4HW8A 4X9TA 2REJA 1MXWA 2THIA 1MRPA 1B52A 5CC2A 4M4GA 3JV9A 5I57A 2B3BA 2XX7A 1A99A 3UIFA 4ZEBA 1USYE 4U1OA 1A8FA 2RF1A 4N13A 5DT6A 2E0SA 4QRZA 4XTCQ 1XS5A 2F7CA 2VD2A 5H8QA 4LA9A 4G68C 4PFWA 4G68B 5L9SA 1YCJA 1US4A 1OLCA 4YB6A 5HBCA 4UA8A 1PB7A 2H5YA 3PUWE 2OZZA 3V5AA 1MXVA 3PUXE 4LATA 1NNTA 1RYOA 3A3CA 3MZ1A 3IL1B 1B9JA 2XD2A 4XKNA 3TTKA 2QMWA 3E3KA 4JXIA 4U22A 5FTHA 2F35A 1JVYA 3IX1A 4LZ7A 3PMWA 1B3GA 2I58A 5AA2A 1HSLA 3B6TA 2V93A 5KCJB 1EZPA 3CFLA 3D4CA 4KYDA 3K4UA 4RPNA 4MH5A 2Q88A 3PMVA 3KJTA 3Q29A 1B58A 2OWSA 5CMCA 3O66A 1P1QA 4TLMB 4AB6A 1Q35A 1FTJA 5CI5A 3DP4A 2RC7A 1T0KA 4I1DA 2O7UA 3G3IA 4GL8A 3QAXA 2Y7RA 3ECRA 2D21A 2DSFA 1WODA 3O97A 4R2FA 4QSEA 1DTZA 3CRBA 1SD3A 4YKIA 3HV1A 1JW1A 2DWIA 2OK2A 4H8JA 3UP9A 4BDLA 1BP5A 2DXYA 5TPAA 1LFIA 4BDOA 1FQBA 4RK2A 1MXXA 2ONRA 2Y84A 2O6AA 4YZZA 3BFTA 5KDTB 2UVIA 4LZ5A 3OSRA 1B2HA 4OEUA 1PBQA 3MC2A 4HS7A 3GXAA 2NUVA 4ZEIA 5FHMA 1TFAA 3EHSA 3GZGA 4L17A 1DMBA 4RNSA 4DCXA 1I6AA 3IB1A 4F3PA 2H4IA 4KI0E 4YU0A 2DP8A 1MQGA 2VD3A 3S9LC 3QUFA 5B7DA 1MXZA 3IOWA 3C32A 1IUDA 3RGYA 5I56B 2D5WA 4OHNA 5I2KA 3O2AA 1M5DA 5H8SA 2QS4A 2ALUA 2H99A 1B7HA 3MUQA 4OYVA 2F6GA 1D9YA 3C35A 5JK4A 1FQCA 4NTLA 2Z8DA 1H44A 3OEMA 4ZZEA 2V25A 1FTLA 3CI8A 4FAJA 5AA4B 3PD9A 4O3BA 2ONSA 5KZTA 3RNNA 4GL0A 2UYEA 4H6DA 2I4BA 5CRYA 4Q5TA 5EHMA 3SKPA 1A7LA 1NNFA 2X26A 3PV0E 4O3AA 3IR1A 1B3HA 2NWJA 1AIVA 4N07A 4JWYA 3K6VA 2O84X 2QRYA 3A3UA 3CIJA 4WKMA 1OLAA 4LVQA 4DDDA 1B7UA 3VVFA 4HCYA 3PGFA 4H65A 3TQLA 1B3EA 1B0HA 1B5JA 3MVZA 5F7VA 3I3VA 1M5BA 4OFLA 3HHFA 3HHGA 5DEXB 3HPIA 1QUKA 1I69A 2PVUA 2RINA 3W9VA 3QSLA 3BFUA 2HEUA 3O6HA 4OESA 3G3GA 3U94A 4JWXA 1WDNA 3CFXA 1BIYA 4POWA 1YAEA 3VV5A 4U21A 3SEYA 1XT8A 3SETA 1IITA 5BUUA 2Z22A 1JVXA 4HCWA 2QPQA 1DPEA 3M3FA 1SW2A 2OLBA 3N6TA 1IIWA 3VLUA 1PEBA 4KR5A 1I6BA 3PPPA 4BDRA 2UYFA 4G2ZA 3FXQA 4BLAA 3LSFB 3MVXA 1GTKA 4YKJA 1ZTYA 3VFJA 2VHAA 1MH4A 5I58B 3U72A 4TLLB 3C36A 1DTGA 3QXMA 4DZ1A 3EQ1A 3O28A 2ESNA 2HAVA 3OENA 1UQWA 5AA1A 2HZKA 4XKPA 3TTLA 2ZMBA 4WEDA 3BKIB 1LFHA 4ONYA 3MPKA 3O29A 3PPRA 5CMBA 3TTNA 1BLFA 1MPDA 1AOVA 4GD5A 3T22A 1N76A 4H67A 2QS1A 3TUSA 3FVNA 3FJGA 2ANJA 1B1HA 3I6VA 4G8MA 3MBPA 3TELA 1MQJA 2OJTA 3HSTA 4R74A 4IY6A 2F6PA 3H7MA 4WXJA 1D3KA 4YB5A 2H25A 4LONB 3PD8A 1A54A 4DXUA 5KDTA 4P0IA 4E0WA 1MM6A 1Y3NA 1B32A 2PMSA 1LB8A 1Z7NE 3OOAA 4OZ9A 3MVWA 2W7YA 2R6GE 1PB8A 5F1QA 5TU0A 4IB2A 3SEWA 1B0LA 3MZ9A 5M2VA 1QVSA 3FVKA 1PDAA 4H1XA 1NNKA 1UTBB 3IAZA 3MP8A 1J1NA 3TYHA 2Q8JA 1H45A 1ATGA 3TTMA 4YKKA 2V3TA 5I56A 3RTWB 1VSOA 2I3WA 1B4ZA 3G3HA 3VE1B 1TWYA 5BWJA 3Q28A 5DVFA 1AL3A 3PMXA 1QUIA 2GFEA 2M8CA 3U92A 4EQBA 4YMBA 1P1OA 3CSGA 5AA4A 4H5GA 2XD3A 4GVOA 3KG2A 4EXLA 4ZE8A 2FYIA 1NL5A 4QFKA 4PFYA 3ZKKA 4R75A 4YMAA 1TT1A 2PT1A 2AIXA 1B51A 4MBPA 2FNCA 1UTHB 4GWOA 3OMBA 3V83A 4R2BA 1Y9UA 4PP0A 4ZEDA 4ZDMA 3B6QA 1IXIA 1GGGA 1R6ZA 3FVGA 2V3QA 3FJMA 2HZLA 3RQTA 3A09A 4JSDA 5A5XA 5CMMA 4U4XA 4OFJA 2O1LA 5EYFA 1ZLQA 3T9HB 3N26A 3IO6A 2PX1A 3LSWA 2V84A 2F8DA 5I84A 3H6WA 3UA8A 2NVUB 4F3BA 3KN8A 3MZBA 4OTEA 2ABHA 2ZXTA 1LLSA 1FQEA 1M5FA 4H5FA 5DEXA 1SYHA 4MF3A 2QJEA 1Y20A 1XHYA 1IZ1A 2XX8A 4KCDA 1SQYA 2ZYOA 2XXVA 1NMUA 3MWBA 1B6HA 4JB7A 1AH5A 1NH7A 4YAHX 1VFEA 5IAIA 1B5IA 4GLIA 2F36A 4NF5B 3EHUA 1SI0A 3DP6A 4DE8A 3QYTA 2BJJX 3VLVA 3VLWA 4G8HA 5EHSA 3HO7A 5JTYB 4F2OA 4ISUA 1S50A 5I58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FV2 A;  3CG3 A;  4KYS A;  4EQ9 A;  3CG1 A;  4RJZ A;  1EU8 A;  2ZYN A;  1N3W A;  4ZE9 A;  1B40 A;  3VDF A;  4YKP A;  3MQ9 A;  3PPN A;  2A5T A;  3RT6 B;  1B05 A;  1S9T A;  3V89 B;  1QKB A;  2NXO A;  3W15 C;  1IQ7 A;  3C31 A;  3TMG A;  3C33 A;  2DVZ A;  4FEC A;  4F31 B;  2Y7W A;  1R9L A;  3K00 A;  5H8N B;  3ZS6 A;  3TPA A;  5L9O A;  4XKR A;  2A5S A;  2YJP A;  4ELP A;  4PET A;  4DXB A;  1YTV A;  4O3C A;  3FVO A;  1QKA A;  4XKQ A;  4TQU Q;  3OXN A;  3O6G A;  4KQP A;  2AL4 A;  1LAX A;  3IK6 B;  3DM0 A;  4OMB A;  3C4M A;  3K02 A;  1N0T A;  2WKY A;  3ILU B;  2DQV A;  1LB9 A;  5FHO A;  1LCT A;  4R9G A;  3LBS A;  1Q1K A;  1YPN A;  1MQH A;  1A55 A;  1JET A;  4ELO A;  1MXY A;  4ECF A;  4LZ8 A;  2OCU A;  1DOT A;  1Y4C A;  3TOD A;  3T93 B;  4OFO A;  3HCQ A;  4ND9 A;  5ISU A;  4FED A;  5B70 A;  3OO7 A;  4FOR A;  2Y7K A;  1MY2 A;  4C0R A;  1B5H A;  2O51 A;  3DLN A;  4NF8 A;  1UTB A;  4FE8 A;  4NWC A;  2F78 A;  5FTI A;  1ELJ A;  3RY3 A;  4PQJ A;  3GBB A;  4KD5 A;  3T9X B;  2F34 A;  4OEV A;  1L5T A;  3TAJ A;  3KGC A;  3FV1 A;  5I2N B;  4Z0I A;  4QFL A;  1DPP A;  2O1M A;  4POX A;  4OXV A;  3HN0 A;  2UVH A;  5I57 B;  3W9W A;  2HAU A;  1Y4T A;  4ELQ A;  3EHT A;  4IGR A;  5J1D A;  3FZV A;  2DOJ A;  4WEP A;  3CFZ A;  1AMF A;  5CM6 A;  4K3F A;  3FJ7 A;  4R73 A;  5DYH A;  3B6W A;  4G68 A;  1UTH A;  1MXU A;  4RPO A;  1GR2 A;  1ZKB A;  3PUZ E;  1BTJ A;  4F19 A;  2I0B A;  3G3J A;  4QF9 A;  3EPE A;  1H43 A;  1B1X A;  5AA3 A;  3IOU A;  1XVY A;  3TDJ A;  3IO4 A;  3WAF A;  4TOZ A;  3K6X A;  4KCC A;  1IXC A;  4EF2 A;  3I5O A;  4RY1 A;  5ITP A;  4BDM A;  1M5C A;  4C1U A;  3LC8 A;  3VVD A;  2D3I A;  2DWA A;  4X1D A;  5AE4 A;  5KCJ A;  4NWD A;  4ZEC A;  4GF8 A;  3S9M C;  4KFQ A;  1MQD A;  4U23 A;  4U2R A;  2FA7 A;  3MPL A;  4LQ5 A;  1SDX A;  4Q8R A;  1QW0 A;  5ICT A;  3TCH A;  3SEX A;  3GLB A;  3MAM A;  4R6H A;  2X7Q A;  3FAS A;  1P1U A;  3K6U A;  1MG1 A;  3OO9 A;  4NF5 A;  2P2A A;  3IJX B;  3WAE A;  4UAC A;  4RYA A;  4XXU A;  3TCF A;  3MP6 A;  3H03 A;  4OER A;  3IOV A;  1FQD A;  2F7B A;  2Q9T A;  1LST A;  2VOZ A;  2Q2A A;  1JEU A;  4DIG A;  3IOT A;  3L6H A;  4QSC A;  1QUL A;  4OEN A;  2XXW A;  1IXG A;  1A40 A;  5TPA B;  1Y3Q A;  2RKM A;  1LBB A;  5H8N A;  5HM4 B;  4JSO A;  1H3D A;  2DXR A;  4BDQ A;  3TKD A;  3VXC A;  1GV8 A;  3THI A;  3RLF E;  2RC8 A;  4N6P A;  2YPN A;  2CMO A;  1POY 1;  1P1N A;  4GRK A;  3UGW A;  1ZU0 A;  2QL3 A;  4IY5 A;  1SW1 A;  3TQW A;  4KYE A;  1UIU A;  1VFD A;  2Q2C A;  3Q25 A;  3R6U A;  4Z7E A;  3O9P A;  2G29 A;  2Z23 A;  2AYS A;  5LOM A;  3K0V A;  3EN3 A;  3K6W A;  1N7W A;  2VGQ A;  2NOO A;  4LP2 B;  5TP9 B;  4P0G A;  2PT2 A;  3T9V A;  2H9B A;  1USY H;  2I3V A;  4EQ7 A;  5DTB A;  4FAT A;  2E1S A;  1LAF E;  1SW4 A;  2OBG A;  4G8N A;  4LUB A;  2ZYM A;  2Y7I A;  3KSX A;  2IEE A;  4YIC A;  4IO4 A;  2O68 A;  3UOR A;  5DVI A;  4H8I A;  3G3F A;  4Q0C A;  3UN6 A;  1D4N A;  1OQH A;  2I6E A;  1LCF A;  2DWJ A;  1JW4 A;  1MDQ A;  3USD A;  4AQ4 A;  4Q30 B;  5HPQ A;  2XXU A;  1VE4 A;  5H8H B;  1KWH A;  3GBA A;  1HSE A;  4FIM A;  2Q89 A;  3E9X A;  4IO3 A;  3H6U A;  1HSJ A;  1LAG E;  4YB7 A;  1N04 A;  4I8C A;  3MP1 A;  1F9B A;  3ZSF A;  1LGB C;  1B7Z A;  4GQO A;  2LAO A;  2O69 A;  2F7A A;  1SI1 A;  3JYR A;  3KN3 A;  3KBR A;  1JQF A;  4QFO A;  2DE4 A;  4E0X A;  3LSX A;  2DVC A;  1DSN A;  3VVE A;  3DEL B;  1QJM A;  1CE2 A;  2KLF A;  3T66 A;  3S9N C;  5ELV A;  1MPB A;  1M5E A;  3IJO B;  2IA4 A;  2XXY A;  4H0W A;  3L6G A;  3H3G A;  2PYY A;  3OO6 A;  1XC1 A;  2ZNU A;  2DE3 A;  1MDP 1;  2GHB A;  2F97 A;  1MH3 A;  3FD3 A;  4F1Y A;  3CVG A;  2QSX A;  4GXS B;  3P7I A;  2YLN A;  1FQA A;  3KZG A;  2XXQ A;  4OVJ A;  5K2X A;  4IO5 A;  2P1S A;  1B3L A;  4KHZ E;  5H8F B;  4MLQ A;  2I48 A;  3E13 X;  1FW0 A;  5K2Y A;  1XOC A;  3OO8 A;  4LQ2 A;  4ESW A;  1Y3P A;  3FUZ A;  4R72 A;  3S9E A;  3KOT A;  1Y1M A;  3DP8 A;  2X7P A;  4FEB A;  3SES A;  2G93 A;  3TTR A;  2Z8F A;  4NF6 B;  1URG A;  1US5 A;  3QIM A;  3MVY A;  1S7Y A;  2HQ0 A;  3G3K A;  4DCY A;  4GOT A;  5ICQ A;  2XXR A;  2HXW A;  1UIV A;  2Z8E A;  4IO6 A;  1TXF A;  5L8D A;  1SYI A;  2XX9 A;  1JNF A;  4MLV A;  2R71 A;  1ZBM A;  4F3G A;  3RT8 A;  2DE2 A;  3IB2 A;  3H06 B;  3Q27 A;  4X1B A;  3H6T A;  3F11 A;  3CSB A;  1MY4 A;  3FGS A;  5IKB A;  1A8E A;  3LUY A;  1N84 A;  3M8U A;  1FTM A;  3SDF A;  4ESX A;  4NF4 B;  4QFP A;  1ZIU A;  2DWH A;  1O63 A;  1MS7 A;  3TEP A;  1NKX A;  4F39 A;  3Q26 A;  4F3S A;  1PC3 A;  1FCK A;  1MPC A;  1LBC A;  2XXH A;  1MY3 A;  3U1O A;  4ZEF A;  1URD A;  1H76 A;  5TP9 A;  4EF1 A;  1URS A;  1XVX A;  1B3F A;  3RPW A;  3K01 A;  3N5L A;  4ZEK A;  2XXT A;  5I59 B;  3KEI A;  5ITO A;  2B65 A;  3TZA A;  4RA1 A;  4I62 A;  4JBZ A;  2XXX A;  1FTK A;  3KN7 A;  1OMP A;  2UVJ A;  2I0C A;  3IOR A;  3C9H A;  1POT A;  1RYX A;  4M1V A;  3R7X A;  2DS9 A;  1JEV A;  2REG A;  1ZJL A;  2R9J A;  4AB5 A;  3FAT A;  3AXF A;  1MM7 A;  1PBP A;  3TCG A;  1SW5 A;  2O7I A;  4OWD A;  2ZNS A;  4MFI A;  4ZS9 A;  1SBP A;  5H8H A;  3H6V A;  5H8Q B;  5CMK A;  3K1N A;  3PU5 A;  3KJ7 A;  3U8Q A;  4QSD A;  3G7W A;  1I6Q A;  1NH8 A;  5L9M A;  3CR9 A;  3ZKL A;  3LR1 A;  2QMX A;  1TFD A;  2RCB A;  2B3F A;  2QS2 A;  3ILT B;  5DVJ A;  1OVB A;  4ZZA A;  4IO2 A;  3OSQ A;  3K1M A;  4IGT A;  2UVG A;  4G4P A;  3KSJ A;  4F18 A;  1IXH A;  3C34 A;  2GRV A;  5A5X B;  3RN8 A;  1D9V A;  4G77 A;  1Z7M E;  3TFL A;  5CBS A;  4GXA A;  3OEL A;  1GVC A;  1O7T A;  3FXU A;  4F22 A;  3T96 B;  3MW0 A;  3FIR A;  3N6U A;  1B4H A;  3PUY E;  3MJN A;  5AA2 D;  5AA2 B;  4JWO A;  4EUO A;  2H98 A;  2CZL A;  4JDF A;  3K1P A;  3QK6 A;  1MQI A;  4R6K A;  4DLD A;  3M3L A;  3V8X B;  1R1N A;  1ANF A;  3LSL A;  1OIB A;  4R6Y A;  1Y1Z A;  3KOS A;  2HFB A;  2RCA A;  2XXP A;  4F1V A;  1MY1 A;  4X48 A;  3OEK A;  1LFG A;  1N7X A;  2PBW A;  4U1Z A;  5CBR A;  4EDP A;  2P0S A;  3EF7 A;  3N94 A;  2XHD A;  2XXI A;  5JTY A;  1R9Q A;  4PFT A;  4GIZ A;  2F5X A;  5H8F A;  2V3U A;  3D4G A;  1OVT A;  3FXR A;  3RTF B;  2A5T B;  3BBR A;  4EXK A;  3PPQ A;  2AL5 A;  4I9D A;  4P11 A;  1FTO A;  3ODB A;  1RKM A;  1EH3 A;  4R9F A;  3SEV A;  1P1W A;  4NF6 A;  2OWT A;  4OQO A;  1BKA A;  2Y7P A;  1N3X A;  3UK4 A;  4FJP A;  3OD7 A;  4U4S A;  2VP1 A;  1NNP A;  4C1T A;  3KFM A;  1JW5 A;  4ELR A;  3JZJ A;  3PUV E;  1IEJ A;  4F1U A;  3H4Z A;  2ZYK A;  4GFR A;  3PPO A;  1OQG A;  4RK9 A;  5JEI A;  1ZMG A;  4OET A;  4NED A;  3M3K A;  4KPT A;  3B7D A;  1EZO A;  2RC9 A;  3QUJ A;  4XIG Q;  4NE4 A;  5FHN A;  4NMY A;  3U93 A;  1FQF A;  4F2Q A;  1SVX B;  1PB9 A;  4NF4 A;  1B46 A;  3VXB A;  4HTG A;  2I49 A;  4RXL A;  2GHA A;  3T9U A;  1LAH E;  2UXA A;  4F29 A;  1EZ9 A;  1O64 A;  3R26 A;  3O6I A;  4IO7 A;  4QHQ A;  1VR5 A;  3ONM A;  2ONK E;  1NFT A;  2DYX A;  4THI A;  3S2V A;  2I4C A;  5I2K B;  1II5 A;  3E4R A;  3IB0 A;  4PE5 B;  4DXC A;  4NF8 B;  1CB6 A;  2GH9 A;  3SEU A;  2ZNT A;  1P99 A;  5I59 A;  3K2D A;  1QUJ A;  3RUM A;  4PFU A;  4QFN A;  3S4U A;  2QS3 A;  1WVJ A;  3SER A;  4BDN A;  2HCA A;  1MY0 A;  5I2N A;  4HW8 A;  4X9T A;  2REJ A;  1MXW A;  2THI A;  1MRP A;  1B52 A;  5CC2 A;  4M4G A;  3JV9 A;  5I57 A;  2B3B A;  2XX7 A;  1A99 A;  3UIF A;  4ZEB A;  1USY E;  4U1O A;  1A8F A;  2RF1 A;  4N13 A;  5DT6 A;  2E0S A;  4QRZ A;  4XTC Q;  1XS5 A;  2F7C A;  2VD2 A;  5H8Q A;  4LA9 A;  4G68 C;  4PFW A;  4G68 B;  5L9S A;  1YCJ A;  1US4 A;  1OLC A;  4YB6 A;  5HBC A;  4UA8 A;  1PB7 A;  2H5Y A;  3PUW E;  2OZZ A;  3V5A A;  1MXV A;  3PUX E;  4LAT A;  1NNT A;  1RYO A;  3A3C A;  3MZ1 A;  3IL1 B;  1B9J A;  2XD2 A;  4XKN A;  3TTK A;  2QMW A;  3E3K A;  4JXI A;  4U22 A;  5FTH A;  2F35 A;  1JVY A;  3IX1 A;  4LZ7 A;  3PMW A;  1B3G A;  2I58 A;  5AA2 A;  1HSL A;  3B6T A;  2V93 A;  5KCJ B;  1EZP A;  3CFL A;  3D4C A;  4KYD A;  3K4U A;  4RPN A;  4MH5 A;  2Q88 A;  3PMV A;  3KJT A;  3Q29 A;  1B58 A;  2OWS A;  5CMC A;  3O66 A;  1P1Q A;  4TLM B;  4AB6 A;  1Q35 A;  1FTJ A;  5CI5 A;  3DP4 A;  2RC7 A;  1T0K A;  4I1D A;  2O7U A;  3G3I A;  4GL8 A;  3QAX A;  2Y7R A;  3ECR A;  2D21 A;  2DSF A;  1WOD A;  3O97 A;  4R2F A;  4QSE A;  1DTZ A;  3CRB A;  1SD3 A;  4YKI A;  3HV1 A;  1JW1 A;  2DWI A;  2OK2 A;  4H8J A;  3UP9 A;  4BDL A;  1BP5 A;  2DXY A;  5TPA A;  1LFI A;  4BDO A;  1FQB A;  4RK2 A;  1MXX A;  2ONR A;  2Y84 A;  2O6A A;  4YZZ A;  3BFT A;  5KDT B;  2UVI A;  4LZ5 A;  3OSR A;  1B2H A;  4OEU A;  1PBQ A;  3MC2 A;  4HS7 A;  3GXA A;  2NUV A;  4ZEI A;  5FHM A;  1TFA A;  3EHS A;  3GZG A;  4L17 A;  1DMB A;  4RNS A;  4DCX A;  1I6A A;  3IB1 A;  4F3P A;  2H4I A;  4KI0 E;  4YU0 A;  2DP8 A;  1MQG A;  2VD3 A;  3S9L C;  3QUF A;  5B7D A;  1MXZ A;  3IOW A;  3C32 A;  1IUD A;  3RGY A;  5I56 B;  2D5W A;  4OHN A;  5I2K A;  3O2A A;  1M5D A;  5H8S A;  2QS4 A;  2ALU A;  2H99 A;  1B7H A;  3MUQ A;  4OYV A;  2F6G A;  1D9Y A;  3C35 A;  5JK4 A;  1FQC A;  4NTL A;  2Z8D A;  1H44 A;  3OEM A;  4ZZE A;  2V25 A;  1FTL A;  3CI8 A;  4FAJ A;  5AA4 B;  3PD9 A;  4O3B A;  2ONS A;  5KZT A;  3RNN A;  4GL0 A;  2UYE A;  4H6D A;  2I4B A;  5CRY A;  4Q5T A;  5EHM A;  3SKP A;  1A7L A;  1NNF A;  2X26 A;  3PV0 E;  4O3A A;  3IR1 A;  1B3H A;  2NWJ A;  1AIV A;  4N07 A;  4JWY A;  3K6V A;  2O84 X;  2QRY A;  3A3U A;  3CIJ A;  4WKM A;  1OLA A;  4LVQ A;  4DDD A;  1B7U A;  3VVF A;  4HCY A;  3PGF A;  4H65 A;  3TQL A;  1B3E A;  1B0H A;  1B5J A;  3MVZ A;  5F7V A;  3I3V A;  1M5B A;  4OFL A;  3HHF A;  3HHG A;  5DEX B;  3HPI A;  1QUK A;  1I69 A;  2PVU A;  2RIN A;  3W9V A;  3QSL A;  3BFU A;  2HEU A;  3O6H A;  4OES A;  3G3G A;  3U94 A;  4JWX A;  1WDN A;  3CFX A;  1BIY A;  4POW A;  1YAE A;  3VV5 A;  4U21 A;  3SEY A;  1XT8 A;  3SET A;  1IIT A;  5BUU A;  2Z22 A;  1JVX A;  4HCW A;  2QPQ A;  1DPE A;  3M3F A;  1SW2 A;  2OLB A;  3N6T A;  1IIW A;  3VLU A;  1PEB A;  4KR5 A;  1I6B A;  3PPP A;  4BDR A;  2UYF A;  4G2Z A;  3FXQ A;  4BLA A;  3LSF B;  3MVX A;  1GTK A;  4YKJ A;  1ZTY A;  3VFJ A;  2VHA A;  1MH4 A;  5I58 B;  3U72 A;  4TLL B;  3C36 A;  1DTG A;  3QXM A;  4DZ1 A;  3EQ1 A;  3O28 A;  2ESN A;  2HAV A;  3OEN A;  1UQW A;  5AA1 A;  2HZK A;  4XKP A;  3TTL A;  2ZMB A;  4WED A;  3BKI B;  1LFH A;  4ONY A;  3MPK A;  3O29 A;  3PPR A;  5CMB A;  3TTN A;  1BLF A;  1MPD A;  1AOV A;  4GD5 A;  3T22 A;  1N76 A;  4H67 A;  2QS1 A;  3TUS A;  3FVN A;  3FJG A;  2ANJ A;  1B1H A;  3I6V A;  4G8M A;  3MBP A;  3TEL A;  1MQJ A;  2OJT A;  3HST A;  4R74 A;  4IY6 A;  2F6P A;  3H7M A;  4WXJ A;  1D3K A;  4YB5 A;  2H25 A;  4LON B;  3PD8 A;  1A54 A;  4DXU A;  5KDT A;  4P0I A;  4E0W A;  1MM6 A;  1Y3N A;  1B32 A;  2PMS A;  1LB8 A;  1Z7N E;  3OOA A;  4OZ9 A;  3MVW A;  2W7Y A;  2R6G E;  1PB8 A;  5F1Q A;  5TU0 A;  4IB2 A;  3SEW A;  1B0L A;  3MZ9 A;  5M2V A;  1QVS A;  3FVK A;  1PDA A;  4H1X A;  1NNK A;  1UTB B;  3IAZ A;  3MP8 A;  1J1N A;  3TYH A;  2Q8J A;  1H45 A;  1ATG A;  3TTM A;  4YKK A;  2V3T A;  5I56 A;  3RTW B;  1VSO A;  2I3W A;  1B4Z A;  3G3H A;  3VE1 B;  1TWY A;  5BWJ A;  3Q28 A;  5DVF A;  1AL3 A;  3PMX A;  1QUI A;  2GFE A;  2M8C A;  3U92 A;  4EQB A;  4YMB A;  1P1O A;  3CSG A;  5AA4 A;  4H5G A;  2XD3 A;  4GVO A;  3KG2 A;  4EXL A;  4ZE8 A;  2FYI A;  1NL5 A;  4QFK A;  4PFY A;  3ZKK A;  4R75 A;  4YMA A;  1TT1 A;  2PT1 A;  2AIX A;  1B51 A;  4MBP A;  2FNC A;  1UTH B;  4GWO A;  3OMB A;  3V83 A;  4R2B A;  1Y9U A;  4PP0 A;  4ZED A;  4ZDM A;  3B6Q A;  1IXI A;  1GGG A;  1R6Z A;  3FVG A;  2V3Q A;  3FJM A;  2HZL A;  3RQT A;  3A09 A;  4JSD A;  5A5X A;  5CMM A;  4U4X A;  4OFJ A;  2O1L A;  5EYF A;  1ZLQ A;  3T9H B;  3N26 A;  3IO6 A;  2PX1 A;  3LSW A;  2V84 A;  2F8D A;  5I84 A;  3H6W A;  3UA8 A;  2NVU B;  4F3B A;  3KN8 A;  3MZB A;  4OTE A;  2ABH A;  2ZXT A;  1LLS A;  1FQE A;  1M5F A;  4H5F A;  5DEX A;  1SYH A;  4MF3 A;  2QJE A;  1Y20 A;  1XHY A;  1IZ1 A;  2XX8 A;  4KCD A;  1SQY A;  2ZYO A;  2XXV A;  1NMU A;  3MWB A;  1B6H A;  4JB7 A;  1AH5 A;  1NH7 A;  4YAH X;  1VFE A;  5IAI A;  1B5I A;  4GLI A;  2F36 A;  4NF5 B;  3EHU A;  1SI0 A;  3DP6 A;  4DE8 A;  3QYT A;  2BJJ X;  3VLV A;  3VLW A;  4G8H A;  5EHS A;  3HO7 A;  5JTY B;  4F2O A;  4ISU A;  1S50 A;  5I58 A; 
#chains in the Genus database with same CATH topology
 3FV2 A;  2DDK A;  2XWO A;  3CG3 A;  4KYS A;  4EQ9 A;  3CG1 A;  4RJZ A;  1EU8 A;  2ZYN A;  1N3W A;  4ZE9 A;  1B40 A;  3VDF A;  4YKP A;  3MQ9 A;  3PPN A;  2A5T A;  3RT6 B;  1DCU A;  1B05 A;  1S9T A;  3V89 B;  1IMF A;  1QKB A;  2NXO A;  3W15 C;  1IQ7 A;  3C31 A;  2QFL A;  3TMG A;  3C33 A;  2DVZ A;  4AS4 A;  4FEC A;  4F31 B;  2Y7W A;  1R9L A;  3K00 A;  5H8N B;  3ZS6 A;  3TPA A;  5L9O A;  4XKR A;  2A5S A;  2YJP A;  4ELP A;  4PET A;  3MYU A;  4AS5 A;  4DXB A;  1YTV A;  4GBW A;  4O3C A;  3FVO A;  1QKA A;  4XKQ A;  2Q74 A;  4TQU Q;  3OXN A;  3O6G A;  1JP4 A;  4KQP A;  2AL4 A;  1LAX A;  3IK6 B;  3DM0 A;  4OMB A;  3C4M A;  3K02 A;  1N0T A;  2WKY A;  3ILU B;  2Y5L A;  2DQV A;  1LB9 A;  5FHO A;  1LCT A;  4R9G A;  3LBS A;  1Q1K A;  4PDD A;  1YPN A;  1MQH A;  1A55 A;  1JET A;  4ELO A;  1MXY A;  4ECF A;  2QVU A;  4LZ8 A;  2OCU A;  1DOT A;  1Y4C A;  2P3N A;  3TOD A;  1YYZ A;  3T93 B;  4OFO A;  3HCQ A;  4ND9 A;  5ISU A;  2QVV A;  1CNQ A;  4FED A;  5B70 A;  2WYK A;  4PAK A;  3OO7 A;  4FOR A;  2Y7K A;  1MY2 A;  4C0R A;  1B5H A;  2O51 A;  3DLN A;  4NF8 A;  2HXR A;  1UTB A;  4FE8 A;  4NWC A;  2F78 A;  5FTI A;  1ELJ A;  3RY3 A;  4PQJ A;  3RPL A;  3GBB A;  4KD5 A;  3T9X B;  2CEX A;  3B8B A;  2F34 A;  4OEV A;  1L5T A;  1FPK A;  3TAJ A;  3KGC A;  3FV1 A;  5I2N B;  4Z0I A;  4QFL A;  1EYI A;  4N17 A;  1DPP A;  2O1M A;  4POX A;  4OXV A;  3HN0 A;  2UVH A;  5I57 B;  3W9W A;  1IMA A;  2HAU A;  1Y4T A;  4ELQ A;  3EHT A;  4IGR A;  5J1D A;  3FZV A;  2DOJ A;  4OVR A;  4GWS A;  4WEP A;  3CFZ A;  1AMF A;  5CM6 A;  4K3F A;  3FJ7 A;  4R73 A;  5DYH A;  3B6W A;  4P9K A;  4MMP A;  4G68 A;  1UTH A;  1FPF A;  1MXU A;  5ET8 A;  4RPO A;  3A29 A;  1GR2 A;  1ZKB A;  3PUZ E;  1FPD A;  1BTJ A;  4F19 A;  2I0B A;  2PFZ A;  3G3J A;  4QF9 A;  3EPE A;  1H43 A;  1AWB A;  1B1X A;  5AA3 A;  3IOU A;  1XVY A;  3TDJ A;  3IO4 A;  3WAF A;  2BJI A;  4TOZ A;  3K6X A;  4KCC A;  1IXC A;  4EF2 A;  3I5O A;  4H46 A;  1NV2 A;  4RY1 A;  5ITP A;  4BDM A;  1M5C A;  3CHG A;  2CEY A;  4C1U A;  3LC8 A;  3VVD A;  4MHF A;  2D3I A;  2DWA A;  4X1D A;  5AE4 A;  5KCJ A;  4NWD A;  4OAN A;  4ZEC A;  4GF8 A;  2CZH A;  3S9M C;  4KFQ A;  1MQD A;  4U23 A;  4U2R A;  2FA7 A;  3MPL A;  4LQ5 A;  1SDX A;  4Q8R A;  1QW0 A;  5ICT A;  3TCH A;  5IGA A;  3SEX A;  1FBF A;  3GLB A;  3MAM A;  4R6H A;  1FTA A;  2X7Q A;  3FAS A;  1P1U A;  3K6U A;  1MG1 A;  3OO9 A;  4NF5 A;  2P2A A;  3IJX B;  2XXK A;  3WAE A;  4UAC A;  4RYA A;  4P56 A;  4XXU A;  3TCF A;  5F24 A;  3MP6 A;  3H03 A;  4OER A;  2F3B A;  3IOV A;  1FQD A;  2F7B A;  2Q9T A;  4GX6 A;  1LST A;  4PF6 A;  2VOZ A;  2Q2A A;  1JEU A;  4PE3 A;  4DIG A;  3IOT A;  3L6H A;  4QSC A;  1NV3 A;  1QUL A;  4OEN A;  1VDW A;  2XXW A;  1IXG A;  1A40 A;  2P3V A;  5TPA B;  1Y3Q A;  3KC0 A;  2RKM A;  1LBB A;  5H8N A;  5HM4 B;  4JSO A;  1H3D A;  2DXR A;  3HFU A;  4BDQ A;  3TKD A;  3VXC A;  1GV8 A;  3THI A;  2ZZW A;  3KBZ A;  3RLF E;  2RC8 A;  4N6P A;  4PFR A;  4KXP A;  2CZK A;  2YPN A;  2CMO A;  1POY 1;  1P1N A;  4GRK A;  4GX3 A;  3UGW A;  1ZU0 A;  2QL3 A;  4IY5 A;  1SW1 A;  3TQW A;  4KYE A;  1UIU A;  1VFD A;  2Q2C A;  3Q25 A;  3R6U A;  4Z7E A;  3O9P A;  2G29 A;  2Z23 A;  2AYS A;  1KA0 A;  5LOM A;  3K0V A;  3EN3 A;  3K6W A;  1N7W A;  2VGQ A;  4OA4 A;  2NOO A;  4LP2 B;  5TP9 B;  4P0G A;  1FPB A;  4MAG A;  2PT2 A;  3T9V A;  4PC9 A;  2H9B A;  3PTY A;  1USY H;  2I3V A;  4EQ7 A;  5DTB A;  4FAT A;  4XEQ A;  4N91 A;  2E1S A;  1LAF E;  1SW4 A;  2OBG A;  4G8N A;  2VPN A;  5I5P A;  4LUB A;  2ZYM A;  2PFY A;  2Y7I A;  3KSX A;  2IEE A;  4YIC A;  4IO4 A;  4P1E A;  2O68 A;  3UOR A;  5DVI A;  2FBP A;  4H8I A;  3G3F A;  4Q0C A;  3UN6 A;  4I3Y A;  1D4N A;  1OQH A;  2I6E A;  1LCF A;  2DWJ A;  1JW4 A;  1MDQ A;  3USD A;  4AQ4 A;  2XWK A;  4Q30 B;  5HPQ A;  2XXU A;  1VE4 A;  5H8H B;  4XFE A;  1KWH A;  3GBA A;  1HSE A;  4FIM A;  2Q89 A;  3E9X A;  4IO3 A;  3H6U A;  3MST A;  1HSJ A;  4NGU A;  1LAG E;  4YB7 A;  1N04 A;  4I8C A;  3MP1 A;  2V4C A;  1F9B A;  4I3E A;  3ZSF A;  1LGB C;  1B7Z A;  4GQO A;  2LAO A;  2CZI A;  2O69 A;  2F7A A;  3IFA A;  4PGP A;  1SI1 A;  3JYR A;  3KN3 A;  3KBR A;  1JQF A;  4QFO A;  2DE4 A;  4E0X A;  4QXD A;  3LSX A;  5IZZ A;  2DVC A;  1DSN A;  3VVE A;  3DEL B;  1QJM A;  1CE2 A;  2KLF A;  4N81 A;  3T66 A;  3S9N C;  2MKZ A;  5ELV A;  4IR8 A;  4PGN A;  1MPB A;  1M5E A;  1IMC A;  4PAF A;  3IJO B;  2IA4 A;  2XXY A;  4H0W A;  3L6G A;  3H3G A;  2PYY A;  3OO6 A;  1DK4 A;  1XC1 A;  1LBW A;  4PF8 A;  2ZNU A;  2DE3 A;  1MDP 1;  2GHB A;  2F97 A;  1MH3 A;  3FD3 A;  4F1Y A;  3CVG A;  2QSX A;  2FIE A;  4GXS B;  3P7I A;  2YLN A;  1FQA A;  3KZG A;  2XXQ A;  4OVJ A;  2OX3 A;  5K2X A;  4IO5 A;  2P1S A;  4PBH A;  1B3L A;  4KHZ E;  5H8F B;  4MLQ A;  2I48 A;  1FRP A;  3E13 X;  1FW0 A;  3FBP A;  5K2Y A;  4OVS A;  1XOC A;  4LQ2 A;  1IMD A;  3BIH A;  3OO8 A;  4ESW A;  1FBE A;  1Y3P A;  3FUZ A;  4R72 A;  3S9E A;  3KOT A;  1NV6 A;  1Y1M A;  3DP8 A;  2X7P A;  4FEB A;  3SES A;  2G93 A;  3TTR A;  2Z8F A;  4NF6 B;  1URG A;  1US5 A;  3QIM A;  3MVY A;  1S7Y A;  2HQ0 A;  3G3K A;  4DCY A;  3T1B A;  4GOT A;  5ICQ A;  4DI4 B;  2XXR A;  2HXW A;  3NOH A;  1UIV A;  2Z8E A;  4IO6 A;  1TXF A;  5L8D A;  1SYI A;  2XX9 A;  1JNF A;  4MLV A;  2R71 A;  1ZBM A;  4F3G A;  3RT8 A;  2DE2 A;  3IB2 A;  3H06 B;  3Q27 A;  4X1B A;  3H6T A;  3F11 A;  3CSB A;  1MY4 A;  4X8R A;  3FGS A;  5IKB A;  1A8E A;  3LUY A;  1N84 A;  3M8U A;  5ET7 A;  1FTM A;  3SDF A;  4ESX A;  4NF4 B;  4QFP A;  1ZIU A;  2DWH A;  2L5V A;  1FBG A;  1O63 A;  1MS7 A;  3TEP A;  1NKX A;  5ET6 A;  4F39 A;  3Q26 A;  4F3S A;  1PC3 A;  1FCK A;  1MPC A;  1LBC A;  2XXH A;  1MY3 A;  3U1O A;  4ZEF A;  1URD A;  1H76 A;  2WEF A;  5TP9 A;  4EF1 A;  1URS A;  1XVX A;  1B3F A;  3RPW A;  3K01 A;  3N5L A;  4N6D A;  4ZEK A;  2XXT A;  5I59 B;  3KEI A;  5ITO A;  2B65 A;  3TZA A;  4RA1 A;  4I62 A;  4JBZ A;  2XXX A;  1FTK A;  5J16 A;  2WBB A;  3KN7 A;  1FBD A;  1OMP A;  2UVJ A;  2I0C A;  3IOR A;  3C9H A;  1POT A;  1RYX A;  4M1V A;  3R7X A;  2DS9 A;  1JEV A;  2REG A;  1ZJL A;  2R9J A;  4HXV A;  4AB5 A;  3FAT A;  3AXF A;  1MM7 A;  1PBP A;  2Q8M A;  3TCG A;  1SW5 A;  2O7I A;  4OWD A;  2ZNS A;  4MFI A;  4ZS9 A;  4NG7 A;  1SBP A;  5H8H A;  4HE2 A;  3H6V A;  5H8Q B;  5CMK A;  3K1N A;  1NV7 A;  3PU5 A;  3KJ7 A;  3U8Q A;  4QSD A;  3LUZ A;  3G7W A;  1FPJ A;  1I6Q A;  1NH8 A;  5L9M A;  3CR9 A;  3ZKL A;  3LR1 A;  2QMX A;  1TFD A;  2RCB A;  2B3F A;  4XF5 A;  2QS2 A;  3ILT B;  5LTC A;  5DVJ A;  1OVB A;  4ZZA A;  4IO2 A;  3OSQ A;  3K1M A;  4IGT A;  2UVG A;  2PCR A;  4G4P A;  1K9Y A;  3KSJ A;  4F18 A;  5A5L A;  1IXH A;  3C34 A;  2GRV A;  5A5X B;  3RN8 A;  4HE0 A;  1D9V A;  4G77 A;  1Z7M E;  3TFL A;  5CBS A;  5EYH A;  4GXA A;  5IZ3 A;  3OEL A;  1GVC A;  1O7T A;  3FXU A;  4F22 A;  3T96 B;  1RDX A;  2ZZX A;  3MW0 A;  3FIR A;  3N6U A;  1B4H A;  3PUY E;  3MJN A;  5FBP A;  5AA2 D;  5AA2 B;  2WBD A;  4JWO A;  4EUO A;  2H98 A;  3BIG A;  2CZL A;  4MNP A;  4JDF A;  3K1P A;  3QK6 A;  4JVI A;  1MQI A;  3B50 A;  4R6K A;  4DLD A;  3M3L A;  3V8X B;  1R1N A;  1ANF A;  3LSL A;  1OIB A;  4R6Y A;  4GWZ A;  5EYG A;  1Y1Z A;  3KOS A;  2HFB A;  1FPG A;  2RCA A;  2XXP A;  4PDH A;  3D1R A;  4F1V A;  1MY1 A;  4X48 A;  3OEK A;  1LFG A;  4U1Z A;  1N7X A;  2PBW A;  5CBR A;  4EDP A;  4PCD A;  2P0S A;  3EF7 A;  5DW8 A;  3N94 A;  2XHD A;  2XXI A;  5JTY A;  1RDZ A;  1R9Q A;  4PFT A;  4GIZ A;  2F5X A;  5H8F A;  2V3U A;  3D4G A;  1OVT A;  3FXR A;  3RTF B;  2A5T B;  5EQ8 A;  1NUX A;  3BBR A;  4EXK A;  4MEV A;  2GQ1 A;  3PPQ A;  2AL5 A;  4I9D A;  4P11 A;  1FTO A;  3ODB A;  1RKM A;  1EH3 A;  3RYD A;  4R9F A;  3SEV A;  1P1W A;  4NF6 A;  2OWT A;  4OQO A;  1BKA A;  3ROJ A;  1NUY A;  2Y7P A;  1N3X A;  3UK4 A;  2VPO A;  4FJP A;  3OD7 A;  4N8Y A;  4U4S A;  2VP1 A;  1NNP A;  4C1T A;  3KFM A;  4GX4 A;  1JW5 A;  4ELR A;  3JZJ A;  3PUV E;  1IEJ A;  4MJO A;  4F1U A;  1FPE A;  3H4Z A;  2ZYK A;  4GFR A;  3PPO A;  1OQG A;  4RK9 A;  5JEI A;  1ZMG A;  4OET A;  4NED A;  2XWV A;  3M3K A;  4KPT A;  3B7D A;  3GYY A;  1EZO A;  2RC9 A;  3QUJ A;  4XIG Q;  4NE4 A;  1NUZ A;  5FHN A;  4NMY A;  3U93 A;  1FQF A;  4F2Q A;  1SVX B;  1PB9 A;  4NF4 A;  1B46 A;  3VXB A;  4HTG A;  2I49 A;  4RXL A;  2GHA A;  3T9U A;  1LAH E;  2UXA A;  4F29 A;  1EZ9 A;  4GWU A;  5I3S A;  1O64 A;  3R26 A;  3O6I A;  4IO7 A;  4QHQ A;  1VR5 A;  4JVC A;  1D9Q A;  3ONM A;  2ONK E;  1NFT A;  2WYP A;  2DYX A;  4THI A;  3S2V A;  1NI9 A;  2I4C A;  5I2K B;  4I40 A;  1II5 A;  3E4R A;  3IB0 A;  4PE5 B;  4DXC A;  4NF8 B;  1CB6 A;  2GH9 A;  4QBA A;  3SEU A;  2ZNT A;  3RPL B;  1P99 A;  5I59 A;  3K2D A;  1QUJ A;  3RUM A;  4PFU A;  4QFN A;  3S4U A;  2QS3 A;  1WVJ A;  4O8M A;  3SER A;  4BDN A;  5IM2 A;  4PTK A;  2HCA A;  1MY0 A;  4PAI A;  5I2N A;  4HW8 A;  4GBV A;  4X9T A;  2REJ A;  1MXW A;  2THI A;  1MRP A;  1B52 A;  5CC2 A;  4M4G A;  3JV9 A;  5I57 A;  2B3B A;  2XX7 A;  1A99 A;  3UIF A;  4ZEB A;  1USY E;  4U1O A;  1A8F A;  2RF1 A;  4N13 A;  5DT6 A;  2E0S A;  2XWI A;  4QRZ A;  1YZ0 A;  4XTC Q;  1XS5 A;  2F7C A;  2VD2 A;  5H8Q A;  4LA9 A;  5LDZ A;  4G68 C;  4PFW A;  4G68 B;  5L9S A;  3LV0 A;  1YCJ A;  1US4 A;  1OLC A;  4YB6 A;  5HBC A;  1SPI A;  4P1L A;  4UA8 A;  1PB7 A;  2H5Y A;  4N8G A;  3PUW E;  2OZZ A;  3V5A A;  2JJK A;  1MXV A;  3PUX E;  4LAT A;  1NNT A;  1RYO A;  3A3C A;  2R8T A;  3MZ1 A;  3IL1 B;  1B9J A;  2XD2 A;  4XKN A;  3TTK A;  2QMW A;  3E3K A;  4JXI A;  4U22 A;  5FTH A;  2F35 A;  1JVY A;  3IX1 A;  4LZ7 A;  3PMW A;  4PFI A;  1B3G A;  2I58 A;  1FPL A;  5AA2 A;  1HSL A;  3B6T A;  2V93 A;  5KCJ B;  1EZP A;  3CFL A;  3D4C A;  4KYD A;  1RDY A;  3K4U A;  4H45 A;  4RPN A;  4MH5 A;  2Q88 A;  3PMV A;  4O94 A;  3KJT A;  3Q29 A;  1B58 A;  2OWS A;  5CMC A;  3O66 A;  1P1Q A;  4TLM B;  4AB6 A;  1Q35 A;  1FTJ A;  5CI5 A;  3DP4 A;  2RC7 A;  2FHY A;  1T0K A;  4I1D A;  2O7U A;  3G3I A;  4GL8 A;  3QAX A;  2Y7R A;  1FBP A;  1FBC A;  3ECR A;  2D21 A;  2DSF A;  1WOD A;  3O97 A;  4R2F A;  4QSE A;  1DTZ A;  3CRB A;  1SD3 A;  4YKI A;  3HV1 A;  1JW1 A;  2DWI A;  2OK2 A;  4H8J A;  3UP9 A;  4BDL A;  1BP5 A;  2DXY A;  5TPA A;  1LFI A;  4BDO A;  4OVT A;  1FQB A;  4RK2 A;  1DBZ A;  1MXX A;  3FXB A;  3ISP A;  1LEV A;  4N15 A;  1KZ8 A;  2ONR A;  2Y84 A;  2O6A A;  4YZZ A;  3BFT A;  5KDT B;  2UVI A;  4LZ5 A;  5EQ7 A;  3OSR A;  1B2H A;  4OEU A;  1PBQ A;  3MC2 A;  4HS7 A;  3GXA A;  4P8B A;  2NUV A;  4ZEI A;  5FHM A;  1TFA A;  3EHS A;  1IMB A;  1NV5 A;  3GZG A;  4L17 A;  1DMB A;  4RNS A;  4DCX A;  1I6A A;  3IB1 A;  4F3P A;  5I7I A;  2H4I A;  4O7I A;  4GWW A;  4KI0 E;  1NV4 A;  4NX1 A;  4YU0 A;  2DP8 A;  1MQG A;  1EYK A;  2VD3 A;  3S9L C;  3T0J A;  3QUF A;  5B7D A;  1MXZ A;  3IOW A;  3C32 A;  1IUD A;  4P47 A;  3RGY A;  5I56 B;  2D5W A;  4OHN A;  5I2K A;  3O2A A;  2KR0 A;  1M5D A;  5H8S A;  2QS4 A;  3U65 A;  2ALU A;  2H99 A;  4MCO A;  1B7H A;  3MUQ A;  4OYV A;  2F6G A;  1D9Y A;  3C35 A;  4MNC A;  5JK4 A;  1FQC A;  4NTL A;  2Z8D A;  1H44 A;  3OEM A;  4ZZE A;  4GWX A;  2V25 A;  1FTL A;  3CI8 A;  4FAJ A;  5AA4 B;  3PD9 A;  4O3B A;  5IZ1 A;  2ONS A;  5KZT A;  1BK4 A;  3RNN A;  4GL0 A;  4MX6 A;  2UYE A;  4H6D A;  2I4B A;  5CRY A;  4Q5T A;  5EHM A;  3SKP A;  1A7L A;  1NNF A;  2X26 A;  3PV0 E;  1Q9D A;  4O3A A;  3IR1 A;  1XI6 A;  1B3H A;  2NWJ A;  1AIV A;  4N07 A;  4DI3 D;  4JWY A;  3K6V A;  2VT5 A;  4NN3 A;  2O84 X;  2QRY A;  4JVD A;  3A3U A;  3CIJ A;  4WKM A;  1OLA A;  4LVQ A;  4DDD A;  1B7U A;  3VVF A;  4MNI A;  4HCY A;  3PGF A;  4H65 A;  3TQL A;  1B3E A;  1B0H A;  4N4U A;  1B5J A;  2FIX A;  3MVZ A;  5F7V A;  3I3V A;  1LBX A;  1M5B A;  4OFL A;  3HHF A;  3HHG A;  5DEX B;  3HPI A;  1QUK A;  1I69 A;  2PVU A;  2RIN A;  3W9V A;  3QSL A;  3BFU A;  2HEU A;  3O6H A;  4NF0 A;  4OES A;  3G3G A;  3U94 A;  4JWX A;  1WDN A;  3CFX A;  1BIY A;  4POW A;  1YAE A;  3VV5 A;  4U21 A;  3SEY A;  1LBV A;  1XT8 A;  3SET A;  1IIT A;  5BUU A;  2Z22 A;  1JVX A;  4HCW A;  2QPQ A;  1DPE A;  3M3F A;  1SW2 A;  1QGX A;  2OLB A;  3N6T A;  1IIW A;  3VLU A;  1PEB A;  4KR5 A;  1I6B A;  3PPP A;  5EQ9 A;  4BDR A;  2UYF A;  4G2Z A;  3FXQ A;  4BLA A;  3LSF B;  3MVX A;  1GTK A;  4YKJ A;  1ZTY A;  3VFJ A;  2B4L A;  2VHA A;  1MH4 A;  5I58 B;  4MIJ A;  3U72 A;  4TLL B;  3C36 A;  1DTG A;  3QXM A;  4DZ1 A;  3EQ1 A;  2HHM A;  3O28 A;  2ESN A;  2HAV A;  1FJ9 A;  3OEN A;  1UQW A;  5AA1 A;  4X04 A;  2HZK A;  4XKP A;  4NAP A;  3TTL A;  2WX9 A;  2ZMB A;  4WED A;  3BKI B;  1LFH A;  4ONY A;  3MPK A;  1FJ6 A;  3O29 A;  3PPR A;  5CMB A;  3TTN A;  1BLF A;  1MPD A;  1AOV A;  1FPI A;  4GD5 A;  3T22 A;  1N76 A;  4NQ8 A;  4H67 A;  2QS1 A;  3TUS A;  4P3L A;  3FVN A;  3FJG A;  2ANJ A;  1B1H A;  3I6V A;  4G8M A;  3MBP A;  4O7M A;  1K9Z A;  5EQA A;  3TEL A;  1MQJ A;  2OJT A;  3HST A;  4R74 A;  4IY6 A;  2F6P A;  1INP A;  2XA5 A;  3H7M A;  4WXJ A;  1D3K A;  4YB5 A;  2Y5K A;  2H25 A;  4LON B;  3PD8 A;  1A54 A;  4DXU A;  5KDT A;  4P0I A;  4E0W A;  1MM6 A;  1Y3N A;  1B32 A;  2PMS A;  1LB8 A;  1Z7N E;  3OOA A;  4OZ9 A;  3MVW A;  2F3D A;  2W7Y A;  2R6G E;  1PB8 A;  5F1Q A;  4OVP A;  3KC1 A;  5TU0 A;  4IB2 A;  3SEW A;  1B0L A;  3MZ9 A;  5M2V A;  1EYJ A;  1QVS A;  3FVK A;  1PDA A;  4H1X A;  1NNK A;  1UTB B;  3IAZ A;  3MP8 A;  1J1N A;  3TYH A;  2Q8J A;  1G0I A;  4PBQ A;  1H45 A;  1ATG A;  3TTM A;  2FVZ A;  4HE1 A;  1YXI A;  4YKK A;  2V3T A;  5I56 A;  3RTW B;  2HPG A;  1VSO A;  4UAB A;  2I3W A;  1B4Z A;  3G3H A;  3VE1 B;  1TWY A;  1NV1 A;  5BWJ A;  3Q28 A;  2ZZV A;  5DVF A;  1AL3 A;  3PMX A;  1LBY A;  1QUI A;  2GFE A;  2M8C A;  3U92 A;  5ET5 A;  4EQB A;  4YMB A;  1P1O A;  3CSG A;  3E79 A;  4FBP A;  5AA4 A;  4H5G A;  2XD3 A;  4GVO A;  3KG2 A;  4EXL A;  4ZE8 A;  2FYI A;  1NL5 A;  4QFK A;  4G61 A;  1KA1 A;  4PFY A;  2OWZ A;  4PFB A;  3ZKK A;  4R75 A;  1TT1 A;  4YMA A;  2PT1 A;  2AIX A;  5ESY A;  1B51 A;  4MBP A;  2FNC A;  1UTH B;  4GWO A;  3OMB A;  3V83 A;  4R2B A;  1Y9U A;  4PP0 A;  4ZED A;  4ZDM A;  3B6Q A;  1IXI A;  1GGG A;  1R6Z A;  3FVG A;  2V3Q A;  3FJM A;  2HZL A;  3RQT A;  3A09 A;  4JSD A;  5A5X A;  3QMF A;  5CMM A;  4U4X A;  5IZ3 B;  4OVQ A;  4OFJ A;  2O1L A;  5EYF A;  1ZLQ A;  3T9H B;  3N26 A;  3IO6 A;  2PX1 A;  3LSW A;  2V84 A;  3E78 A;  2F8D A;  5I84 A;  3H6W A;  3UA8 A;  2NVU B;  3KN8 A;  4F3B A;  3MZB A;  4OTE A;  2ABH A;  1FBH A;  1LLS A;  2ZXT A;  1FQE A;  1M5F A;  4H5F A;  5DEX A;  1LBZ A;  1SYH A;  4N6K A;  2QVR A;  4MF3 A;  1FSA A;  2QJE A;  1Y20 A;  3EKI A;  1XHY A;  1IZ1 A;  2XX8 A;  4GWY A;  4KCD A;  1IME A;  1SQY A;  2ZYO A;  2XXV A;  4NHB A;  1NMU A;  2B4M A;  1B6H A;  3MWB A;  4JB7 A;  1AH5 A;  5T3J A;  1NH7 A;  4YAH X;  1VFE A;  5IAI A;  1B5I A;  4GLI A;  2F36 A;  4NF5 B;  3EHU A;  1SI0 A;  3DP6 A;  4DE8 A;  2KQZ A;  3QYT A;  1NUW A;  2BJJ X;  4G8H A;  5EHS A;  3SZP A;  3VLV A;  4LN5 A;  3VLW A;  3HO7 A;  5JTY B;  3IFC A;  4F2O A;  4ISU A;  1G0H A;  1S50 A;  1NV0 A;  5I58 A; 
#chains in the Genus database with same CATH homology
 3FV2 A;  3CG3 A;  4KYS A;  4EQ9 A;  3CG1 A;  4RJZ A;  1EU8 A;  2ZYN A;  1N3W A;  4ZE9 A;  1B40 A;  3VDF A;  4YKP A;  3MQ9 A;  3PPN A;  2A5T A;  3RT6 B;  1B05 A;  1S9T A;  3V89 B;  1QKB A;  2NXO A;  3W15 C;  1IQ7 A;  3C31 A;  3TMG A;  3C33 A;  2DVZ A;  4FEC A;  4F31 B;  2Y7W A;  1R9L A;  3K00 A;  5H8N B;  3ZS6 A;  3TPA A;  5L9O A;  4XKR A;  2A5S A;  2YJP A;  4ELP A;  4PET A;  4DXB A;  1YTV A;  4O3C A;  3FVO A;  1QKA A;  4XKQ A;  4TQU Q;  3OXN A;  3O6G A;  4KQP A;  2AL4 A;  1LAX A;  3IK6 B;  3DM0 A;  4OMB A;  3C4M A;  3K02 A;  1N0T A;  2WKY A;  3ILU B;  2DQV A;  1LB9 A;  5FHO A;  1LCT A;  4R9G A;  3LBS A;  1Q1K A;  1YPN A;  1MQH A;  1A55 A;  1JET A;  4ELO A;  1MXY A;  4ECF A;  4LZ8 A;  2OCU A;  1DOT A;  1Y4C A;  3TOD A;  3T93 B;  4OFO A;  3HCQ A;  4ND9 A;  5ISU A;  4FED A;  5B70 A;  3OO7 A;  4FOR A;  2Y7K A;  1MY2 A;  4C0R A;  1B5H A;  2O51 A;  3DLN A;  4NF8 A;  1UTB A;  4FE8 A;  4NWC A;  2F78 A;  5FTI A;  1ELJ A;  3RY3 A;  4PQJ A;  3GBB A;  4KD5 A;  3T9X B;  2F34 A;  4OEV A;  1L5T A;  3TAJ A;  3KGC A;  3FV1 A;  5I2N B;  4Z0I A;  4QFL A;  1DPP A;  2O1M A;  4POX A;  4OXV A;  3HN0 A;  2UVH A;  5I57 B;  3W9W A;  2HAU A;  1Y4T A;  4ELQ A;  3EHT A;  4IGR A;  5J1D A;  3FZV A;  2DOJ A;  4WEP A;  3CFZ A;  1AMF A;  5CM6 A;  4K3F A;  3FJ7 A;  4R73 A;  5DYH A;  3B6W A;  4G68 A;  1UTH A;  1MXU A;  4RPO A;  1GR2 A;  1ZKB A;  3PUZ E;  1BTJ A;  4F19 A;  2I0B A;  3G3J A;  4QF9 A;  3EPE A;  1H43 A;  1B1X A;  5AA3 A;  3IOU A;  1XVY A;  3TDJ A;  3IO4 A;  3WAF A;  4TOZ A;  3K6X A;  4KCC A;  1IXC A;  4EF2 A;  3I5O A;  4RY1 A;  5ITP A;  4BDM A;  1M5C A;  4C1U A;  3LC8 A;  3VVD A;  2D3I A;  2DWA A;  4X1D A;  5AE4 A;  5KCJ A;  4NWD A;  4ZEC A;  4GF8 A;  3S9M C;  4KFQ A;  1MQD A;  4U23 A;  4U2R A;  2FA7 A;  3MPL A;  4LQ5 A;  1SDX A;  4Q8R A;  1QW0 A;  5ICT A;  3TCH A;  3SEX A;  3GLB A;  3MAM A;  4R6H A;  2X7Q A;  3FAS A;  1P1U A;  3K6U A;  1MG1 A;  3OO9 A;  4NF5 A;  2P2A A;  3IJX B;  3WAE A;  4UAC A;  4RYA A;  4XXU A;  3TCF A;  3MP6 A;  3H03 A;  4OER A;  3IOV A;  1FQD A;  2F7B A;  2Q9T A;  1LST A;  2VOZ A;  2Q2A A;  1JEU A;  4DIG A;  3IOT A;  3L6H A;  4QSC A;  1QUL A;  4OEN A;  2XXW A;  1IXG A;  1A40 A;  5TPA B;  1Y3Q A;  2RKM A;  1LBB A;  5H8N A;  5HM4 B;  4JSO A;  1H3D A;  2DXR A;  4BDQ A;  3TKD A;  3VXC A;  1GV8 A;  3THI A;  3RLF E;  2RC8 A;  4N6P A;  2YPN A;  2CMO A;  1POY 1;  1P1N A;  4GRK A;  3UGW A;  1ZU0 A;  2QL3 A;  4IY5 A;  1SW1 A;  3TQW A;  4KYE A;  1UIU A;  1VFD A;  2Q2C A;  3Q25 A;  3R6U A;  4Z7E A;  3O9P A;  2G29 A;  2Z23 A;  2AYS A;  5LOM A;  3K0V A;  3EN3 A;  3K6W A;  1N7W A;  2VGQ A;  2NOO A;  4LP2 B;  5TP9 B;  4P0G A;  2PT2 A;  3T9V A;  2H9B A;  1USY H;  2I3V A;  4EQ7 A;  5DTB A;  4FAT A;  2E1S A;  1LAF E;  1SW4 A;  2OBG A;  4G8N A;  4LUB A;  2ZYM A;  2Y7I A;  3KSX A;  2IEE A;  4YIC A;  4IO4 A;  2O68 A;  3UOR A;  5DVI A;  4H8I A;  3G3F A;  4Q0C A;  3UN6 A;  1D4N A;  1OQH A;  2I6E A;  1LCF A;  2DWJ A;  1JW4 A;  1MDQ A;  3USD A;  4AQ4 A;  4Q30 B;  5HPQ A;  2XXU A;  1VE4 A;  5H8H B;  1KWH A;  3GBA A;  1HSE A;  4FIM A;  2Q89 A;  3E9X A;  4IO3 A;  3H6U A;  1HSJ A;  1LAG E;  4YB7 A;  1N04 A;  4I8C A;  3MP1 A;  1F9B A;  3ZSF A;  1LGB C;  1B7Z A;  4GQO A;  2LAO A;  2O69 A;  2F7A A;  1SI1 A;  3JYR A;  3KN3 A;  3KBR A;  1JQF A;  4QFO A;  2DE4 A;  4E0X A;  3LSX A;  2DVC A;  1DSN A;  3VVE A;  3DEL B;  1QJM A;  1CE2 A;  2KLF A;  3T66 A;  3S9N C;  5ELV A;  1MPB A;  1M5E A;  3IJO B;  2IA4 A;  2XXY A;  4H0W A;  3L6G A;  3H3G A;  2PYY A;  3OO6 A;  1XC1 A;  2ZNU A;  2DE3 A;  1MDP 1;  2GHB A;  2F97 A;  1MH3 A;  3FD3 A;  4F1Y A;  3CVG A;  2QSX A;  4GXS B;  3P7I A;  2YLN A;  1FQA A;  3KZG A;  2XXQ A;  4OVJ A;  5K2X A;  4IO5 A;  2P1S A;  1B3L A;  4KHZ E;  5H8F B;  4MLQ A;  2I48 A;  3E13 X;  1FW0 A;  5K2Y A;  1XOC A;  3OO8 A;  4LQ2 A;  4ESW A;  1Y3P A;  3FUZ A;  4R72 A;  3S9E A;  3KOT A;  1Y1M A;  3DP8 A;  2X7P A;  4FEB A;  3SES A;  2G93 A;  3TTR A;  2Z8F A;  4NF6 B;  1URG A;  1US5 A;  3QIM A;  3MVY A;  1S7Y A;  2HQ0 A;  3G3K A;  4DCY A;  4GOT A;  5ICQ A;  2XXR A;  2HXW A;  1UIV A;  2Z8E A;  4IO6 A;  1TXF A;  5L8D A;  1SYI A;  2XX9 A;  1JNF A;  4MLV A;  2R71 A;  1ZBM A;  4F3G A;  3RT8 A;  2DE2 A;  3IB2 A;  3H06 B;  3Q27 A;  4X1B A;  3H6T A;  3F11 A;  3CSB A;  1MY4 A;  3FGS A;  5IKB A;  1A8E A;  3LUY A;  1N84 A;  3M8U A;  1FTM A;  3SDF A;  4ESX A;  4NF4 B;  4QFP A;  1ZIU A;  2DWH A;  1O63 A;  1MS7 A;  3TEP A;  1NKX A;  4F39 A;  3Q26 A;  4F3S A;  1PC3 A;  1FCK A;  1MPC A;  1LBC A;  2XXH A;  1MY3 A;  3U1O A;  4ZEF A;  1URD A;  1H76 A;  5TP9 A;  4EF1 A;  1URS A;  1XVX A;  1B3F A;  3RPW A;  3K01 A;  3N5L A;  4ZEK A;  2XXT A;  5I59 B;  3KEI A;  5ITO A;  2B65 A;  3TZA A;  4RA1 A;  4I62 A;  4JBZ A;  2XXX A;  1FTK A;  3KN7 A;  1OMP A;  2UVJ A;  2I0C A;  3IOR A;  3C9H A;  1POT A;  1RYX A;  4M1V A;  3R7X A;  2DS9 A;  1JEV A;  2REG A;  1ZJL A;  2R9J A;  4AB5 A;  3FAT A;  3AXF A;  1MM7 A;  1PBP A;  3TCG A;  1SW5 A;  2O7I A;  4OWD A;  2ZNS A;  4MFI A;  4ZS9 A;  1SBP A;  5H8H A;  3H6V A;  5H8Q B;  5CMK A;  3K1N A;  3PU5 A;  3KJ7 A;  3U8Q A;  4QSD A;  3G7W A;  1I6Q A;  1NH8 A;  5L9M A;  3CR9 A;  3ZKL A;  3LR1 A;  2QMX A;  1TFD A;  2RCB A;  2B3F A;  2QS2 A;  3ILT B;  5DVJ A;  1OVB A;  4ZZA A;  4IO2 A;  3OSQ A;  3K1M A;  4IGT A;  2UVG A;  4G4P A;  3KSJ A;  4F18 A;  1IXH A;  3C34 A;  2GRV A;  5A5X B;  3RN8 A;  1D9V A;  4G77 A;  1Z7M E;  3TFL A;  5CBS A;  4GXA A;  3OEL A;  1GVC A;  1O7T A;  3FXU A;  4F22 A;  3T96 B;  3MW0 A;  3FIR A;  3N6U A;  1B4H A;  3PUY E;  3MJN A;  5AA2 D;  5AA2 B;  4JWO A;  4EUO A;  2H98 A;  2CZL A;  4JDF A;  3K1P A;  3QK6 A;  1MQI A;  4R6K A;  4DLD A;  3M3L A;  3V8X B;  1R1N A;  1ANF A;  3LSL A;  1OIB A;  4R6Y A;  1Y1Z A;  3KOS A;  2HFB A;  2RCA A;  2XXP A;  4F1V A;  1MY1 A;  4X48 A;  3OEK A;  1LFG A;  1N7X A;  2PBW A;  4U1Z A;  5CBR A;  4EDP A;  2P0S A;  3EF7 A;  3N94 A;  2XHD A;  2XXI A;  5JTY A;  1R9Q A;  4PFT A;  4GIZ A;  2F5X A;  5H8F A;  2V3U A;  3D4G A;  1OVT A;  3FXR A;  3RTF B;  2A5T B;  3BBR A;  4EXK A;  3PPQ A;  2AL5 A;  4I9D A;  4P11 A;  1FTO A;  3ODB A;  1RKM A;  1EH3 A;  4R9F A;  3SEV A;  1P1W A;  4NF6 A;  2OWT A;  4OQO A;  1BKA A;  2Y7P A;  1N3X A;  3UK4 A;  4FJP A;  3OD7 A;  4U4S A;  2VP1 A;  1NNP A;  4C1T A;  3KFM A;  1JW5 A;  4ELR A;  3JZJ A;  3PUV E;  1IEJ A;  4F1U A;  3H4Z A;  2ZYK A;  4GFR A;  3PPO A;  1OQG A;  4RK9 A;  5JEI A;  1ZMG A;  4OET A;  4NED A;  3M3K A;  4KPT A;  3B7D A;  1EZO A;  2RC9 A;  3QUJ A;  4XIG Q;  4NE4 A;  5FHN A;  4NMY A;  3U93 A;  1FQF A;  4F2Q A;  1SVX B;  1PB9 A;  4NF4 A;  1B46 A;  3VXB A;  4HTG A;  2I49 A;  4RXL A;  2GHA A;  3T9U A;  1LAH E;  2UXA A;  4F29 A;  1EZ9 A;  1O64 A;  3R26 A;  3O6I A;  4IO7 A;  4QHQ A;  1VR5 A;  3ONM A;  2ONK E;  1NFT A;  2DYX A;  4THI A;  3S2V A;  2I4C A;  5I2K B;  1II5 A;  3E4R A;  3IB0 A;  4PE5 B;  4DXC A;  4NF8 B;  1CB6 A;  2GH9 A;  3SEU A;  2ZNT A;  1P99 A;  5I59 A;  3K2D A;  1QUJ A;  3RUM A;  4PFU A;  4QFN A;  3S4U A;  2QS3 A;  1WVJ A;  3SER A;  4BDN A;  2HCA A;  1MY0 A;  5I2N A;  4HW8 A;  4X9T A;  2REJ A;  1MXW A;  2THI A;  1MRP A;  1B52 A;  5CC2 A;  4M4G A;  3JV9 A;  5I57 A;  2B3B A;  2XX7 A;  1A99 A;  3UIF A;  4ZEB A;  1USY E;  4U1O A;  1A8F A;  2RF1 A;  4N13 A;  5DT6 A;  2E0S A;  4QRZ A;  4XTC Q;  1XS5 A;  2F7C A;  2VD2 A;  5H8Q A;  4LA9 A;  4G68 C;  4PFW A;  4G68 B;  5L9S A;  1YCJ A;  1US4 A;  1OLC A;  4YB6 A;  5HBC A;  4UA8 A;  1PB7 A;  2H5Y A;  3PUW E;  2OZZ A;  3V5A A;  1MXV A;  3PUX E;  4LAT A;  1NNT A;  1RYO A;  3A3C A;  3MZ1 A;  3IL1 B;  1B9J A;  2XD2 A;  4XKN A;  3TTK A;  2QMW A;  3E3K A;  4JXI A;  4U22 A;  5FTH A;  2F35 A;  1JVY A;  3IX1 A;  4LZ7 A;  3PMW A;  1B3G A;  2I58 A;  5AA2 A;  1HSL A;  3B6T A;  2V93 A;  5KCJ B;  1EZP A;  3CFL A;  3D4C A;  4KYD A;  3K4U A;  4RPN A;  4MH5 A;  2Q88 A;  3PMV A;  3KJT A;  3Q29 A;  1B58 A;  2OWS A;  5CMC A;  3O66 A;  1P1Q A;  4TLM B;  4AB6 A;  1Q35 A;  1FTJ A;  5CI5 A;  3DP4 A;  2RC7 A;  1T0K A;  4I1D A;  2O7U A;  3G3I A;  4GL8 A;  3QAX A;  2Y7R A;  3ECR A;  2D21 A;  2DSF A;  1WOD A;  3O97 A;  4R2F A;  4QSE A;  1DTZ A;  3CRB A;  1SD3 A;  4YKI A;  3HV1 A;  1JW1 A;  2DWI A;  2OK2 A;  4H8J A;  3UP9 A;  4BDL A;  1BP5 A;  2DXY A;  5TPA A;  1LFI A;  4BDO A;  1FQB A;  4RK2 A;  1MXX A;  2ONR A;  2Y84 A;  2O6A A;  4YZZ A;  3BFT A;  5KDT B;  2UVI A;  4LZ5 A;  3OSR A;  1B2H A;  4OEU A;  1PBQ A;  3MC2 A;  4HS7 A;  3GXA A;  2NUV A;  4ZEI A;  5FHM A;  1TFA A;  3EHS A;  3GZG A;  4L17 A;  1DMB A;  4RNS A;  4DCX A;  1I6A A;  3IB1 A;  4F3P A;  2H4I A;  4KI0 E;  4YU0 A;  2DP8 A;  1MQG A;  2VD3 A;  3S9L C;  3QUF A;  5B7D A;  1MXZ A;  3IOW A;  3C32 A;  1IUD A;  3RGY A;  5I56 B;  2D5W A;  4OHN A;  5I2K A;  3O2A A;  1M5D A;  5H8S A;  2QS4 A;  2ALU A;  2H99 A;  1B7H A;  3MUQ A;  4OYV A;  2F6G A;  1D9Y A;  3C35 A;  5JK4 A;  1FQC A;  4NTL A;  2Z8D A;  1H44 A;  3OEM A;  4ZZE A;  2V25 A;  1FTL A;  3CI8 A;  4FAJ A;  5AA4 B;  3PD9 A;  4O3B A;  2ONS A;  5KZT A;  3RNN A;  4GL0 A;  2UYE A;  4H6D A;  2I4B A;  5CRY A;  4Q5T A;  5EHM A;  3SKP A;  1A7L A;  1NNF A;  2X26 A;  3PV0 E;  4O3A A;  3IR1 A;  1B3H A;  2NWJ A;  1AIV A;  4N07 A;  4JWY A;  3K6V A;  2O84 X;  2QRY A;  3A3U A;  3CIJ A;  4WKM A;  1OLA A;  4LVQ A;  4DDD A;  1B7U A;  3VVF A;  4HCY A;  3PGF A;  4H65 A;  3TQL A;  1B3E A;  1B0H A;  1B5J A;  3MVZ A;  5F7V A;  3I3V A;  1M5B A;  4OFL A;  3HHF A;  3HHG A;  5DEX B;  3HPI A;  1QUK A;  1I69 A;  2PVU A;  2RIN A;  3W9V A;  3QSL A;  3BFU A;  2HEU A;  3O6H A;  4OES A;  3G3G A;  3U94 A;  4JWX A;  1WDN A;  3CFX A;  1BIY A;  4POW A;  1YAE A;  3VV5 A;  4U21 A;  3SEY A;  1XT8 A;  3SET A;  1IIT A;  5BUU A;  2Z22 A;  1JVX A;  4HCW A;  2QPQ A;  1DPE A;  3M3F A;  1SW2 A;  2OLB A;  3N6T A;  1IIW A;  3VLU A;  1PEB A;  4KR5 A;  1I6B A;  3PPP A;  4BDR A;  2UYF A;  4G2Z A;  3FXQ A;  4BLA A;  3LSF B;  3MVX A;  1GTK A;  4YKJ A;  1ZTY A;  3VFJ A;  2VHA A;  1MH4 A;  5I58 B;  3U72 A;  4TLL B;  3C36 A;  1DTG A;  3QXM A;  4DZ1 A;  3EQ1 A;  3O28 A;  2ESN A;  2HAV A;  3OEN A;  1UQW A;  5AA1 A;  2HZK A;  4XKP A;  3TTL A;  2ZMB A;  4WED A;  3BKI B;  1LFH A;  4ONY A;  3MPK A;  3O29 A;  3PPR A;  5CMB A;  3TTN A;  1BLF A;  1MPD A;  1AOV A;  4GD5 A;  3T22 A;  1N76 A;  4H67 A;  2QS1 A;  3TUS A;  3FVN A;  3FJG A;  2ANJ A;  1B1H A;  3I6V A;  4G8M A;  3MBP A;  3TEL A;  1MQJ A;  2OJT A;  3HST A;  4R74 A;  4IY6 A;  2F6P A;  3H7M A;  4WXJ A;  1D3K A;  4YB5 A;  2H25 A;  4LON B;  3PD8 A;  1A54 A;  4DXU A;  5KDT A;  4P0I A;  4E0W A;  1MM6 A;  1Y3N A;  1B32 A;  2PMS A;  1LB8 A;  1Z7N E;  3OOA A;  4OZ9 A;  3MVW A;  2W7Y A;  2R6G E;  1PB8 A;  5F1Q A;  5TU0 A;  4IB2 A;  3SEW A;  1B0L A;  3MZ9 A;  5M2V A;  1QVS A;  3FVK A;  1PDA A;  4H1X A;  1NNK A;  1UTB B;  3IAZ A;  3MP8 A;  1J1N A;  3TYH A;  2Q8J A;  1H45 A;  1ATG A;  3TTM A;  4YKK A;  2V3T A;  5I56 A;  3RTW B;  1VSO A;  2I3W A;  1B4Z A;  3G3H A;  3VE1 B;  1TWY A;  5BWJ A;  3Q28 A;  5DVF A;  1AL3 A;  3PMX A;  1QUI A;  2GFE A;  2M8C A;  3U92 A;  4EQB A;  4YMB A;  1P1O A;  3CSG A;  5AA4 A;  4H5G A;  2XD3 A;  4GVO A;  3KG2 A;  4EXL A;  4ZE8 A;  2FYI A;  1NL5 A;  4QFK A;  4PFY A;  3ZKK A;  4R75 A;  4YMA A;  1TT1 A;  2PT1 A;  2AIX A;  1B51 A;  4MBP A;  2FNC A;  1UTH B;  4GWO A;  3OMB A;  3V83 A;  4R2B A;  1Y9U A;  4PP0 A;  4ZED A;  4ZDM A;  3B6Q A;  1IXI A;  1GGG A;  1R6Z A;  3FVG A;  2V3Q A;  3FJM A;  2HZL A;  3RQT A;  3A09 A;  4JSD A;  5A5X A;  5CMM A;  4U4X A;  4OFJ A;  2O1L A;  5EYF A;  1ZLQ A;  3T9H B;  3N26 A;  3IO6 A;  2PX1 A;  3LSW A;  2V84 A;  2F8D A;  5I84 A;  3H6W A;  3UA8 A;  2NVU B;  4F3B A;  3KN8 A;  3MZB A;  4OTE A;  2ABH A;  2ZXT A;  1LLS A;  1FQE A;  1M5F A;  4H5F A;  5DEX A;  1SYH A;  4MF3 A;  2QJE A;  1Y20 A;  1XHY A;  1IZ1 A;  2XX8 A;  4KCD A;  1SQY A;  2ZYO A;  2XXV A;  1NMU A;  3MWB A;  1B6H A;  4JB7 A;  1AH5 A;  1NH7 A;  4YAH X;  1VFE A;  5IAI A;  1B5I A;  4GLI A;  2F36 A;  4NF5 B;  3EHU A;  1SI0 A;  3DP6 A;  4DE8 A;  3QYT A;  2BJJ X;  3VLV A;  3VLW A;  4G8H A;  5EHS A;  3HO7 A;  5JTY B;  4F2O A;  4ISU A;  1S50 A;  5I58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...