2XXWA

Crystal structure of the gluk2 (glur6) d776k lbd dimer in complex with glutamate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
250
structure length
250
Chain Sequence
RSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRKKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
total genus 78
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxwA02
5JK4A 4QSCA 3FJGA 4ZZEA 1MXXA 3PUZE 4JWYA 3W9WA 1NNTA 4BDRA 3H06B 3MPLA 4THIA 2PYYA 4EQ9A 4F3SA 3FUZA 3V83A 1ZIUA 3O6GA 2DYXA 4KI0E 5JEIA 5BUUA 3FVGA 2ZXTA 1M5DA 3IL1B 1O7TA 1LAXA 3M8UA 4NF6A 3RTWB 4HS7A 1UTHB 4FE8A 4POXA 2O7UA 2UYFA 4G8MA 3F11A 4DXUA 4QFOA 2IEEA 4ZEBA 1FQDA 3N6UA 5CMCA 3O28A 2YLNA 3PMVA 5H8FA 4TQUQ 4C1UA 3OELA 4KYDA 4O3CA 5H8NB 1H44A 1LFHA 1TFAA 5A5XA 1B9JA 4KCCA 1FQAA 4F3BA 5F1QA 5TPAA 3KGCA 1H76A 2H98A 3PMWA 3TZAA 2ESNA 1VSOA 4HCYA 4XKPA 1NNKA 1JW1A 3MW0A 5AA1A 2Q8JA 3N6TA 2XXIA 2DE2A 1POY1 1H3DA 2I3WA 5DYHA 3TFLA 5ITOA 1MPCA 4DZ1A 4FEDA 4GQOA 2Y7WA 1LCFA 4WEPA 1DPPA 2ALUA 1A8EA 3O6HA 2R71A 2XXXA 1TFDA 3G3FA 1Y3NA 3KFMA 4Z0IA 4DLDA 5L9SA 1B58A 4H1XA 2XXYA 2UVGA 4KR5A 3TTKA 5B70A 3CG1A 1AH5A 1ANFA 4N07A 2Q89A 1DPEA 1UTBA 4IO2A 4OFOA 3U92A 1BTJA 1MXZA 2I0BA 3K02A 4OEUA 3K1MA 4YKIA 2ZMBA 2IA4A 1LAGE 5H8FB 2QS1A 4PFWA 3TEPA 2REJA 3G3HA 1SD3A 3KJTA 2Y7RA 2H9BA 3RT6B 3R7XA 3RN8A 3WAFA 2LAOA 4H67A 4Z7EA 5IAIA 2OWTA 1NNFA 2Y7KA 3OO7A 2RKMA 5CM6A 3A3UA 3MP6A 1T0KA 2ZNTA 1B5HA 4ZEDA 4JSDA 3N94A 2F78A 4G4PA 3D4CA 4IB2A 4KD5A 4U22A 2ONKE 3VXBA 1FTLA 1Y1ZA 3HV1A 4LZ7A 1GTKA 1JW5A 3FVOA 3KSJA 1LB9A 1N7XA 1NH8A 1P1WA 4H65A 4JDFA 1B3LA 2DE4A 3FGSA 1OLAA 4R6HA 4RYAA 4ZDMA 3H6TA 3TYHA 2Z23A 4BDNA 4DXBA 1LAHE 2VGQA 3FVNA 3PPRA 3PV0E 4C0RA 5H8QA 1UTBB 2I58A 3H6VA 3HSTA 1S7YA 2UVHA 3FJ7A 4PFTA 3QUJA 3I6VA 1N3XA 2A5TA 1MXUA 2RCBA 4XTCQ 3SEXA 3T9UA 4EQBA 1UIVA 3V89B 1MY4A 4X9TA 5EHMA 1AMFA 1EU8A 3LSWA 4RY1A 1OLCA 1QVSA 2OCUA 2Z8FA 3CSGA 3PUXE 1FQCA 4HTGA 5FHNA 4LZ8A 4RXLA 1DSNA 1SI1A 4NWDA 4R73A 3UK4A 1GV8A 3ZKKA 1SW5A 1UQWA 1B3GA 1LFGA 3UA8A 1NKXA 3BBRA 4OXVA 1XC1A 1MDQA 3HHFA 1BP5A 1D9VA 3IR1A 2I3VA 5FTHA 4N6PA 4RA1A 1B46A 3MZBA 4EXKA 4R2BA 4LVQA 4YB5A 3Q27A 3U72A 1A8FA 2I49A 5DVFA 5AA2A 1R9QA 5CBRA 1P1QA 1SQYA 1QULA 1L5TA 1Y4CA 1ZLQA 5I58B 4X1DA 4PFUA 3QK6A 1Z7NE 2NWJA 3G7WA 5I84A 4E0WA 1QKBA 1AIVA 1YPNA 2PBWA 1JETA 1FQFA 4IY6A 3IOTA 3EHSA 5H8HB 3KN3A 4OMBA 2V84A 1B3EA 3UGWA 1Y3QA 2H99A 5I59B 3TTNA 4KPTA 3TTRA 4XKRA 1VE4A 2Z8DA 3V8XB 1FCKA 4IO5A 5TU0A 1LCTA 3FATA 2ZNUA 4IO6A 2F36A 3D4GA 2V93A 1H43A 5AA2D 3CFXA 3FXQA 4F1YA 1OQGA 3O9PA 1VFEA 3IJXB 3IAZA 3IB0A 2H4IA 1JEUA 4ONYA 2GH9A 4QRZA 4P11A 1IIWA 5CI5A 2RC8A 2VD2A 1B40A 2O84X 3GLBA 4RK2A 3FZVA 2NVUB 1B5IA 1B51A 4EF1A 4H0WA 3TPAA 1D9YA 2QRYA 2REGA 2X7QA 2BJJX 2DP8A 4PP0A 2NOOA 1Y1MA 2O51A 5CMKA 1VFDA 2I0CA 3S9MC 2PMSA 3RTFB 1Y3PA 3MZ1A 1IXCA 3SERA 4H8JA 5L8DA 2XXVA 2RC7A 1IQ7A 3M3FA 1MQDA 2XXHA 4FEBA 3LBSA 1D4NA 1GGGA 2V3QA 1P1NA 3GZGA 4DE8A 4ELRA 4OZ9A 3VVDA 4I9DA 4OQOA 3IORA 4GL8A 2Q88A 4G68A 1SW1A 3KZGA 3RY3A 1MQHA 4MF3A 3CVGA 2QSXA 4U4SA 3E3KA 1B4HA 1SW2A 1URSA 3KOSA 3DP4A 4GF8A 2FNCA 4I1DA 1IXGA 1FTMA 1MY2A 3GXAA 1D3KA 4FECA 4DDDA 3OO8A 1MS7A 4QFPA 3K6VA 2X7PA 3K1NA 2G93A 2P0SA 5KCJA 5DVJA 2OLBA 2XHDA 2AL5A 3CG3A 1LFIA 2RCAA 3ILTB 3IOUA 3MJNA 3SKPA 1US4A 2HQ0A 3IO6A 1JVYA 3VDFA 2QPQA 5ICTA 3T9HB 3S9LC 1YAEA 3OO9A 3PUYE 4JXIA 2OK2A 1H45A 2QMXA 2DXRA 3BFTA 2F97A 3JZJA 3ODBA 3OXNA 4ISUA 3OSQA 4KHZE 1FTOA 1LGBC 1QUJA 3OO6A 3M3LA 2B65A 1XOCA 2DVZA 2UXAA 5I2KA 4JBZA 1N84A 2FA7A 1IEJA 2F34A 2ABHA 3K6XA 3K4UA 3SESA 3TELA 1MY1A 3PD8A 3DELB 4G2ZA 4OEVA 2G29A 4R72A 4U2RA 3MP8A 5DTBA 3VVEA 4PQJA 2NUVA 2B3BA 4JWXA 3FJMA 1MH3A 3W9VA 3OEKA 3SEYA 2F7CA 1IXIA 2F6PA 1PDAA 4QSEA 4KYEA 2GHAA 2GHBA 3MUQA 2ZYNA 3C34A 3N5LA 1XVXA 4F2QA 5I58A 3SEVA 3MBPA 1EZ9A 1JNFA 3RGYA 3UIFA 1NL5A 4XKNA 4F18A 1CB6A 5HM4B 3SDFA 4UACA 5AA3A 2B3FA 2DWJA 2DXYA 1OVBA 3HCQA 4KYSA 2DWHA 5H8HA 4GXAA 3TUSA 1OVTA 1DMBA 2PT2A 3TTMA 3C33A 3LSFB 1AOVA 3T22A 3O2AA 1I6AA 1MPBA 4NWCA 3ILUB 5I2KB 4BDOA 1N3WA 4I8CA 2DOJA 2GFEA 2ONRA 2Q9TA 3C9HA 2O68A 4EUOA 2XX7A 1URDA 4U4XA 1O64A 4ELPA 1A55A 1ELJA 1A40A 2ZNSA 4GD5A 4GL0A 4IY5A 4Q30B 5JTYB 2XX8A 2E0SA 1KWHA 2OWSA 1USYH 2D21A 1HSEA 3Q29A 3IB2A 4OYVA 1A99A 4YAHX 5EHSA 5M2VA 4EDPA 4ESXA 1OMPA 4H6DA 2F5XA 3KN8A 4YKPA 4IGTA 2O1LA 1XHYA 3T66A 2XD3A 4R6KA 4M4GA 4DCXA 1PB7A 4GXSB 4ZECA 4FATA 2ANJA 3BFUA 3USDA 3VXCA 2HXWA 1MXWA 3EF7A 2H5YA 3K1PA 3WAEA 1LSTA 5FTIA 4LATA 4MBPA 2QS2A 3S9EA 1FQEA 1NNPA 2HFBA 3PPPA 2HAUA 2RINA 3LR1A 4OFJA 1BKAA 4O3BA 1ZMGA 5DVIA 4NF8A 1JQFA 1IXHA 3P7IA 4FORA 1M5FA 4AQ4A 1SVXB 2HAVA 4E0XA 1FTKA 3EPEA 3PUVE 1N04A 3K00A 3S9NC 4Q8RA 3R26A 1S9TA 3MVZA 4ZEKA 1M5CA 2Z8EA 3PU5A 3M3KA 2QL3A 3OSRA 1QUKA 1R1NA 2I4CA 2WKYA 3ZSFA 4DXCA 5B7DA 2UVJA 3QIMA 1FTJA 1WDNA 2Q2CA 3KOTA 1LAFE 1EH3A 1M5EA 1TXFA 2V3TA 1QW0A 3PPNA 4IGRA 4YKKA 3VFJA 4H5FA 2HZLA 3HHGA 5I2NA 3VLWA 1BLFA 2GRVA 4IO3A 1B7UA 3TMGA 2XXUA 1ZU0A 1MXYA 1MQJA 2DQVA 1WVJA 4F3GA 2OZZA 2DE3A 2QMWA 3N26A 2ZYKA 4F31B 3HO7A 1HSLA 5ICQA 4HCWA 4FJPA 1P1OA 3O97A 5AA2B 5K2XA 1B1XA 4GWOA 4F1VA 1TT1A 2ZYOA 3LC8A 2DSFA 1Q35A 1ZJLA 4WXJA 3Q28A 1SBPA 5F7VA 3G3KA 3PD9A 4TLLB 3TQLA 3MVWA 3FASA 2FYIA 5I56A 2OJTA 4EF2A 5BWJA 4EQ7A 4PE5B 2E1SA 5TP9A 4JWOA 3MVYA 4U23A 2XXWA 3H6WA 4YKJA 2R9JA 4NF4B 4ESWA 3K0VA 1II5A 1AL3A 3MVXA 4WEDA 3FXUA 3I3VA 3MWBA 3U93A 3V5AA 5LOMA 3EHTA 4R2FA 3KSXA 4QHQA 2AYSA 4RJZA 1MDP1 5I57A 4IO7A 1PB9A 4RNSA 4U1OA 1EZPA 4LZ5A 3OOAA 5CRYA 5DT6A 5KDTA 3LUYA 1LB8A 4NTLA 2O7IA 3O66A 3IK6B 4QFLA 3T93B 3C36A 3RQTA 5JTYA 3G3JA 1TWYA 1MXVA 2AL4A 3PMXA 4ZZAA 3C31A 3Q25A 3UP9A 2O69A 4AB5A 2I4BA 4GFRA 4NF6B 5HPQA 4UA8A 4NE4A 1SYHA 2W7YA 3A09A 3IJOB 1ZBMA 3DM0A 3ONMA 3SEWA 4DCYA 4LONB 1MQIA 4X1BA 1WODA 4QSDA 1EZOA 3MP1A 1B7ZA 2Y7IA 3DP8A 4NF4A 3A3CA 1DOTA 1B3FA 4R75A 1RYXA 1URGA 1LBBA 1Y4TA 1OIBA 3B6QA 3FXRA 4LP2B 1RYOA 2F7BA 4IO4A 3VV5A 1Z7ME 1B32A 4MFIA 3VE1B 2XXPA 5HBCA 1J1NA 1Q1KA 2A5SA 4FIMA 5K2YA 3C35A 3HN0A 2PT1A 4OTEA 4WKMA 5FHOA 3RNNA 3TCGA 3OENA 3U94A 4DIGA 1ZTYA 4ZE8A 5J1DA 4QF9A 5KDTB 2CMOA 3C32A 3O6IA 4F29A 5EYFA 1ATGA 1O63A 3S4UA 1MY0A 3OD7A 3HPIA 3LSXA 1YTVA 3E4RA 3IOVA 3K6WA 5CMMA 4ND9A 4RPOA 3QXMA 5IKBA 1P1UA 4P0GA 1B0LA 2PVUA 2Q2AA 3CSBA 3T96B 3EQ1A 2V3UA 1B52A 2DWIA 3CFZA 3RUMA 2I48A 3THIA 3VLVA 2O6AA 1CE2A 4FAJA 3VVFA 4ELQA 4NF5B 3KEIA 2Y84A 3R6UA 3B6WA 3BKIB 4LQ5A 4OESA 1NMUA 4H5GA 2UYEA 1SYIA 2Z22A 4KCDA 4YICA 1NH7A 1FW0A 1MY3A 2F35A 2OBGA 3H6UA 1IITA 3L6GA 2Y7PA 3QAXA 4G8HA 4GOTA 4RPNA 1LBCA 3RLFE 3W15C 3EN3A 3MQ9A 2XXTA 1SDXA 3I5OA 4M1VA 1B0HA 1B1HA 3GBBA 2V25A 4R9GA 4ELOA 1Y20A 2DWAA 3QSLA 3SETA 2P1SA 1US5A 4LA9A 3H4ZA 1YCJA 4OENA 1MRPA 3SEUA 1QJMA 5ISUA 1SI0A 3FD3A 5I59A 1M5BA 2KLFA 5TP9B 1PEBA 2QJEA 4MLQA 1N0TA 1GR2A 3PUWE 4ZEIA 5I2NB 4NEDA 1B6HA 2YPNA 1A7LA 2VD3A 1PC3A 3TTLA 5DEXA 1VR5A 3E9XA 5ITPA 2HEUA 4GRKA 3DLNA 4H8IA 4BLAA 1MG1A 4XXUA 1QKAA 4NF5A 2AIXA 1R6ZA 1BIYA 5I57B 2CZLA 3T9XB 2F8DA 4X48A 5AE4A 3PPOA 3CI8A 1B7HA 1XT8A 4GIZA 4OVJA 3E13X 3G3GA 3TCFA 2NXOA 2R6GE 3FV2A 3JYRA 4P0IA 3FIRA 4JB7A 2QS4A 3EHUA 1POTA 4LUBA 1GVCA 3MC2A 4OERA 4GLIA 4OFLA 4F22A 3AXFA 1I6BA 2VP1A 3IX1A 4OHNA 1B3HA 4POWA 2UVIA 2D5WA 5ELVA 3UN6A 4AB6A 4KQPA 3IO4A 4F2OA 3CFLA 2D3IA 1UIUA 2X26A 4HW8A 5KZTA 2THIA 3S2VA 3RPWA 2VHAA 4BDLA 3IB1A 3PPQA 5L9OA 4U1ZA 1B4ZA 2XXQA 1LLSA 1B2HA 1N76A 2VOZA 4GVOA 3KJ7A 4PETA 4YB6A 5DEXB 5AA4A 1PB8A 3C4MA 2RC9A 5A5XB 5H8SA 1B05A 2HZKA 3L6HA 2ONSA 4YU0A 5FHMA 3B6TA 3RT8A 3JV9A 5AA4B 2XD2A 4G68C 1MPDA 3TAJA 1HSJA 3G3IA 3PGFA 4TOZA 3OMBA 3QYTA 4ZS9A 4L17A 4NF8B 3K2DA 3TCHA 4YMBA 4LQ2A 3K6UA 4G77A 4PFYA 2ZYMA 4F1UA 1SW4A 2RF1A 1PBQA 4XIGQ 1MM7A 1USYE 3LSLA 3K01A 3TDJA 4K3FA 1QUIA 1B5JA 1IZ1A 1UTHA 3VLUA 3KBRA 1F9BA 5L9MA 3ECRA 3MAMA 4TLMB 4ZE9A 1JW4A 3FV1A 4C1TA 1I69A 1S50A 1XVYA 2I6EA 3MZ9A 4F39A 1IUDA 1P99A 1FQBA 3H3GA 4N13A 1A54A 1NFTA 2PX1A 2YJPA 3QUFA 3H7MA 5H8NA 2DS9A 4JSOA 1OQHA 2F7AA 4NMYA 2F6GA 3KG2A 2QS3A 2XX9A 3CRBA 5TPAB 3H03A 2P2AA 4RK9A 1RKMA 4YZZA 3TKDA 4YMAA 3B7DA 4YB7A 5CBSA 4XKQA 3FVKA 5CMBA 4EXLA 4G68B 4MLVA 4BDQA 1DTZA 1MM6A 1DTGA 3GBAA 3U8QA 1I6QA 3UORA 4ECFA 1MQGA 4U21A 1ZKBA 4Q0CA 3ZS6A 5I56B 3KN7A 3T9VA 3CIJA 4ZEFA 1JEVA 3OEMA 2HCAA 4F3PA 3Q26A 4Q5TA 3TODA 3CR9A 3DP6A 5CC2A 4MH5A 1R9LA 1MH4A 3O29A 4QFKA 2DVCA 4R74A 4QFNA 4R9FA 1JVXA 4OWDA 5KCJB 2XXRA 1Y9UA 3ZKLA 4OETA 2O1MA 4G8NA 4O3AA 5H8QB 4R6YA 3IOWA 4BDMA 1PBPA 1N7WA 1XS5A 2H25A 2M8CA 2A5TB 3MPKA 4I62A 4KFQA 3U1OA 4F19A 3TQWA
chains in the Genus database with same CATH superfamily
3FJGA 4JWYA 4BDRA 4F3SA 1ZIUA 3O6GA 4X04A 5BUUA 4I3YA 4QXDA 4FE8A 4POXA 5CMCA 4H45A 4TQUQ 4N91A 5A5XA 1B9JA 4F3BA 1KZ8A 5F1QA 1H76A 2CEXA 5EQ8A 1NNKA 3MW0A 2Q8JA 3N6TA 4IR8A 5DYHA 1MPCA 4FEDA 4WEPA 2ALUA 3O6HA 3KFMA 1FBCA 4Z0IA 4DLDA 3TTKA 5B70A 3CG1A 3U92A 4YKIA 3RPLB 2QS1A 3TEPA 1FPIA 5CM6A 1B5HA 2KR0A 4JSDA 4G4PA 3VXBA 4U22A 4H65A 1RDXA 4GBWA 3FGSA 4DXBA 3FVNA 3PV0E 4PFTA 5ET5A 2RCBA 1MXUA 3SEXA 1UIVA 1MY4A 3CSGA 4HTGA 2OCUA 1DSNA 4NWDA 1GV8A 1LFGA 2P3VA 3HHFA 1P1QA 4GWSA 1YPNA 1JETA 3EHSA 2V84A 4PAIA 1VE4A 3V8XB 1FCKA 5TU0A 3D4GA 2V93A 2VT5A 4F1YA 4QRZA 3IJXB 4C0RA 3IB0A 5AA3A 2GH9A 2DP8A 5CMKA 5L8DA 2XXVA 1MQDA 4FEBA 4OZ9A 4GL8A 4G68A 5IGAA 1EYIA 3CVGA 1B4HA 3KOSA 3DP4A 4GF8A 3GXAA 1D3KA 4DDDA 5DVJA 2XHDA 1US4A 5ICTA 2XWVA 1YAEA 3OO9A 3PUYE 4JXIA 2OK2A 4RNSA 3OXNA 1FTOA 1LGBC 3OO6A 2DVZA 1N84A 1IEJA 2F34A 2ABHA 1NV0A 4G2ZA 3DELB 5DTBA 3VVEA 4PQJA 4JWXA 5I3SA 3FJMA 1EYJA 3BIGA 4KYEA 2GHAA 2GHBA 1AWBA 2Y5LA 3UIFA 5HM4B 3SDFA 4UACA 2B3FA 3HCQA 2WEFA 3TUSA 4N17A 1MPBA 1G0HA 4BDOA 4OVQA 2QVUA 1A55A 4GD5A 5JTYB 2XX8A 2D21A 4OYVA 5M2VA 1OMPA 1Q9DA 5EQAA 2XD3A 4R6KA 3B8BA 4GXSB 2ANJA 1FJ9A 2HXWA 1MXWA 5IZ1A 4MBPA 2QS2A 4PDDA 3HFUA 2RINA 1YYZA 1JQFA 1IXHA 4FORA 1FTKA 3K00A 1M5CA 1QUKA 1R1NA 3ZSFA 4DXCA 2F3DA 1EH3A 1M5EA 3ROJA 3NOHA 4MNCA 5I2NA 4MEVA 3VLWA 1BLFA 1ZU0A 2OZZA 2DE3A 3HO7A 1HSLA 3O97A 5K2XA 3T0JA 4WXJA 3TQLA 2FYIA 4EF2A 4U23A 3MVXA 4WEDA 5LOMA 3I3VA 3MWBA 3EHTA 4QHQA 2AYSA 2B4MA 2MKZA 5I57A 5CRYA 5DT6A 4NTLA 3T93B 1IMAA 3C36A 3RQTA 4PF8A 5JTYA 1TWYA 1MXVA 4ZZAA 4NF6B 1LEVA 1DK4A 1ZBMA 1WODA 4QSDA 4X1BA 3A3CA 1LBBA 3FXRA 4LP2B 4OTEA 4DIGA 3U94A 4QF9A 2CMOA 3IOVA 3K6WA 3QXMA 1P1UA 4P0GA 1NV6A 5F24A 3CFZA 3THIA 2I48A 3SZPA 1FPDA 3B6WA 1NH7A 2OBGA 4RPNA 3RLFE 4M1VA 3I5OA 1B1HA 4KXPA 1SI0A 5I59A 4MCOA 2KLFA 1PEBA 3PUWE 3TTLA 4GWWA 1FTAA 3E9XA 5ITPA 4BLAA 1MG1A 5EQ9A 3KBZA 3TCFA 2R6GE 3FV2A 2B4LA 3MC2A 4OFLA 4F22A 2VP1A 3IO4A 2PFZA 3IB1A 5L9OA 4U1ZA 3C4MA 2RC9A 2HZKA 5AA4B 2XWIA 3B6TA 4YMBA 2RF1A 1QUIA 3KBRA 5L9MA 3ECRA 4F39A 1IUDA 5J16A 2DS9A 5TPAB 3H03A 1RKMA 4YMAA 4PFIA 5CBSA 5CMBA 1DTZA 4ECFA 3GBAA 1ZKBA 3KN7A 4ZEFA 2HCAA 3Q26A 4Q5TA 5IZ3B 4MH5A 3O29A 4OETA 2O1MA 4O3AA 2H25A 3U1OA 2A5TB 4QSCA 1MXXA 3PUZE 2CEYA 3H06B 2ZZWA 2PYYA 4LN5A 4EQ9A 4JVCA 2DDKA 1O7TA 4G8MA 1KA0A 2UYFA 4DXUA 1FQDA 5H8FA 2YLNA 4C1UA 3OELA 4KYDA 4O3CA 2P3NA 4NX1A 2H98A 2ESNA 2XXIA 2I3WA 4GQOA 2Y7WA 1DPPA 1A8EA 3G3FA 1TFDA 1Y3NA 5L9SA 4PTKA 2UVGA 4N07A 1ANFA 4OFOA 2I0BA 4OEUA 3T9VA 1LAGE 5H8FB 2REJA 3KJTA 3RT6B 3R7XA 2LAOA 5IAIA 4Z7EA 2OWTA 2Y7KA 3MP6A 1T0KA 2F78A 2ONKE 1N7XA 2DE4A 4RYAA 4R6HA 3H6TA 3E79A 1LAHE 2VGQA 3H6VA 2UVHA 3QUJA 2A5TA 2L5VA 3T9UA 4EQBA 4X9TA 5EHMA 1AMFA 1EU8A 3LSWA 1OLCA 5FHNA 3KC1A 2VPNA 3UA8A 2HPGA 4GX6A 4OXVA 1XC1A 1D9VA 2I3VA 5FTHA 4EXKA 4LVQA 4YB5A 3Q27A 5DVFA 1LBZA 1SQYA 4GX4A 4X1DA 5ESYA 3G7WA 5I84A 1QKBA 2PBWA 3IOTA 3KN3A 1B3EA 3UGWA 2H99A 4XKRA 2Z8DA 4UABA 3FATA 2ZNUA 2F36A 5AA2D 3CFXA 3O9PA 1VFEA 3IAZA 2RC8A 2VD2A 3FZVA 1B5IA 2QRYA 2REGA 2X7QA 4PP0A 2WX9A 1Y3PA 3MZ1A 1IXCA 1IQ7A 3M3FA 2XXHA 4N4UA 2Q74A 4I9DA 2Q88A 1SW1A 3KZGA 4MF3A 1URSA 5FBPA 2FNCA 4I1DA 1MS7A 3K1NA 5KCJA 2OLBA 2RCAA 4AS4A 2HQ0A 4P11A 2DXRA 5I2NB 1LBVA 3M3LA 2B65A 1XOCA 2UXAA 5I2KA 4JBZA 1MY1A 3PD8A 4OEVA 2G29A 1FSAA 1MH3A 4F2QA 3MBPA 3RGYA 1NL5A 1CB6A 4NHBA 2DWJA 1OVBA 5H8HA 3C33A 3T22A 3ILUB 5I2KB 4I8CA 2GFEA 1ELJA 4GL0A 3ISPA 1KWHA 2OWSA 5IM2A 2FIXA 4EDPA 4YAHX 4H6DA 4IGTA 4M4GA 4DCXA 4HE1A 3VXCA 3K1PA 4LATA 2HFBA 3PPPA 2HAUA 3LR1A 4OFJA 1BKAA 4O3BA 5DVIA 4NF8A 1BK4A 3P7IA 1M5FA 4E0XA 3PUVE 3EPEA 3S9NC 3R26A 2NWJA 2Z8EA 5B7DA 3QIMA 1FTJA 1WDNA 2Q2CA 1LAFE 1TXFA 4IGRA 2XXUA 4HE0A 2DQVA 1WVJA 4F3GA 4F31B 5ICQA 1P1OA 3LC8A 2DSFA 3MVWA 3FASA 5I56A 2OJTA 4EQ7A 2E1SA 5TP9A 2XXWA 2R9JA 4NF4B 4ESWA 1II5A 1AL3A 3KSXA 4IO7A 4X8RA 1JP4A 3OOAA 3LUYA 1LB8A 2O7IA 3O66A 3MSTA 3G3JA 3PMXA 1D9QA 4GFRA 5HPQA 4UA8A 4QBAA 4NE4A 2ZZVA 4G61A 3IJOB 3DM0A 4LONB 3MP1A 4NF4A 3TCGA 4R75A 1URGA 1OIBA 1RYOA 2F7BA 4IO4A 4MFIA 3LUZA 1J1NA 5HBCA 3C35A 5FHOA 2PT1A 1NUYA 1ZTYA 4ZE8A 4NAPA 4F29A 1ATGA 1CNQA 1O63A 2PFYA 3E4RA 3T96B 1B52A 2F3BA 4NF5B 1NMUA 4H5GA 2Z22A 4YICA 3H6UA 4PC9A 5AA2A 1LBCA 3W15C 1B0HA 1Y20A 3SETA 4LA9A 1YCJA 1MRPA 1QJMA 5IZ3A 5TP9B 4ZEIA 1B6HA 1FPEA 4PFBA 2HEUA 4H8IA 2FVZA 4GWUA 4NF5A 4X48A 5AE4A 3PPOA 4MNPA 4OVJA 4GIZA 4OVSA 4P0IA 4LUBA 3EHUA 1IMBA 3AXFA 1I6BA 4OHNA 5ELVA 4KQPA 5ET8A 4HW8A 3RPWA 3PPQA 1INPA 2XXQA 4N6KA 4MJOA 4PETA 3KJ7A 1NV7A 5H8SA 1B05A 4P8BA 2PCRA 2XD2A 4TOZA 3K2DA 3B50A 4G77A 4GWYA 2ZYMA 1SW4A 1USYE 3LSLA 3K01A 3MAMA 4ZE9A 1JW4A 4C1TA 1RDYA 1P99A 1FQBA 4N13A 1NFTA 4NMYA 2QS3A 2XX9A 3CRBA 2P2AA 4NF0A 4YZZA 4YB7A 4G68B 1MM6A 1DTGA 3UORA 4U21A 1DCUA 4Q0CA 3D1RA 4F3PA 1JEVA 3CR9A 1R9LA 1MH4A 4R74A 2DVCA 4OWDA 2XXRA 4I62A 3OSRA 2VPOA 5JK4A 2CZIA 4ZZEA 1NNTA 3MPLA 3V83A 5IZZA 1M5DA 1LAXA 3M8UA 1UTHB 2O7UA 3F11A 2IEEA 4ZEBA 3N6UA 5H8NB 1K9ZA 1TFAA 4KCCA 1FQAA 3KGCA 3PMWA 1VSOA 4HCYA 1POY1 5ITOA 4DZ1A 1LCFA 4XEQA 2R71A 1FPGA 2XXXA 3IFAA 5I5PA 4H1XA 4KR5A 1NV5A 2Q89A 1UTBA 1MXZA 3K02A 4P1LA 3K1MA 2IA4A 2H9BA 2XWKA 1NNFA 3OO7A 3A3UA 2ZNTA 4H46A 4ZEDA 3D4CA 1FTLA 1Y1ZA 4LZ7A 3FVOA 4JDFA 1P1WA 1NH8A 3RUMA 1B3LA 1LBYA 1OLAA 3PPRA 5H8QA 1UTBB 2I58A 3FJ7A 2JJKA 5EYHA 2Z8FA 3FXBA 4LZ8A 2OX3A 3BIHA 1FPKA 3UK4A 1UQWA 1FBGA 5I7IA 4N6PA 3U72A 1A8FA 5CBRA 1QULA 1L5TA 1Y4CA 3IFCA 4I40A 3QK6A 4OA4A 1Z7NE 1LBWA 2XXKA 4P56A 5H8HB 4OMBA 3TTNA 5ET7A 1K9YA 4IO5A 4IO6A 4PGPA 3FXQA 4ESXA 2H4IA 1JEUA 5CI5A 1IIWA 4RK2A 2NVUB 1B51A 4H0WA 3TPAA 1D9YA 2BJJX 4O7IA 1Y1MA 2O51A 2XA5A 3SERA 4H8JA 2RC7A 4DE8A 4ELRA 1P1NA 3IORA 1QGXA 4U4SA 3E3KA 1SW2A 4PE3A 1IXGA 1FTMA 2FIEA 3K6VA 2G93A 2P0SA 2AL5A 3ILTB 3MJNA 1JVYA 3VDFA 2QPQA 3T9HB 4FBPA 2QMXA 3BFTA 3JZJA 2F97A 1QUJA 3K6XA 3MP8A 2NUVA 2B3BA 3W9VA 2F7CA 1IXIA 2F6PA 2CZKA 3MUQA 5I58A 1XVXA 1EZ9A 4F18A 4NG7A 1FJ6A 2FBPA 2OWZA 2DXYA 4KYSA 1NV4A 2DWHA 1FBDA 5LTCA 1OVTA 1DMBA 3TTMA 1AOVA 3O2AA 1I6AA 1N3WA 2ONRA 2Q9TA 4EUOA 3C9HA 1URDA 4U4XA 1O64A 4ELPA 3Q29A 1USYH 3IB2A 5EHSA 1A99A 2F5XA 2O1LA 1YZ0A 2FHYA 3BFUA 3USDA 3EF7A 1RDZA 5FTIA 4PAKA 3S9EA 1FQEA 1NNPA 1ZMGA 4AQ4A 1SVXB 1N04A 3MVZA 4ZEKA 3PU5A 2QL3A 2WKYA 2UVJA 3KOTA 3PPNA 1QW0A 4IO3A 2GRVA 3TMGA 1MXYA 1MQJA 3LV0A 3N26A 2QMWA 2ZYKA 4HCWA 4FJPA 5AA2B 1TT1A 5F7VA 3PD9A 4JWOA 3T1BA 1IMFA 3K0VA 3V5AA 3FXUA 4GBVA 3U93A 4R2FA 1MDP1 1VDWA 2BJIA 3IK6B 4MHFA 2AL4A 3UP9A 1IMEA 3A09A 1EZOA 1B7ZA 4BDLA 1B3FA 3VV5A 1Z7ME 3VE1B 2XXPA 3HN0A 4WKMA 5KDTB 3OENA 5J1DA 5DW8A 1FPFA 3C32A 3O6IA 3S4UA 3HPIA 3LSXA 1YTVA 4I3EA 4RPOA 4GWZA 2V4CA 1B0LA 2PVUA 4N81A 2Q2AA 3CSBA 2V3UA 2O6AA 4AS5A 1CE2A 3VVFA 4MNIA 1SYIA 3A29A 4KCDA 1FW0A 1MY3A 4P1EA 5JEIA 2Y7PA 4Q8RA 2XXTA 1SDXA 4ELOA 3GBBA 2V25A 1US5A 3H4ZA 5ISUA 3FD3A 4MLQA 4NEDA 1A7LA 1PC3A 2ZZXA 5DEXA 1VR5A 4XXUA 1QKAA 4DI3D 4MAGA 4N15A 4N6DA 3CI8A 3G3GA 2NXOA 2CZHA 2QS4A 1GVCA 2UVIA 4AB6A 3UN6A 4F2OA 3CFLA 4NGUA 5KZTA 1B4ZA 1LLSA 5DEXB 4YB6A 1B2HA 2VOZA 4GVOA 5AA4A 5T3JA 3RT8A 2ONSA 4G68C 3TAJA 1HSJA 3G3IA 3PGFA 3OMBA 3QYTA 1DBZA 4L17A 4NF8B 4LQ2A 4F1UA 1PBQA 1UTHA 1IZ1A 1F9BA 4TLMB 3FV1A 1I69A 1XVYA 3MZ9A 1A54A 2PX1A 2YJPA 3QUFA 1OQHA 3KG2A 3B7DA 4XKQA 3FVKA 1MQGA 4MX6A 2WBDA 3CIJA 3OEMA 3TODA 5KCJB 1JVXA 1Y9UA 5H8QB 3IOWA 1PBPA 1XS5A 2M8CA 4KFQA 4ZECA 3U65A 3W9WA 4THIA 4PCDA 3FUZA 1NUZA 2DYXA 4KI0E 3FVGA 2ZXTA 3IL1B 1EYKA 4NF6A 3RTWB 4HXVA 4HS7A 1FPBA 4QFOA 3O28A 3PMVA 1LFHA 1H44A 5TPAA 1KA1A 2GQ1A 3TZAA 1NUXA 4XKPA 1JW1A 5AA1A 2DE2A 1H3DA 3TFLA 4O8MA 1B58A 1NV2A 2XXYA 1AH5A 1DPEA 4IO2A 1BTJA 2ZMBA 4PFWA 3G3HA 1SD3A 2Y7RA 3RN8A 3WAFA 4H67A 2RKMA 3N94A 4IB2A 4KD5A 3HV1A 1GTKA 1JW5A 3KSJA 5I59B 1LB9A 4ZDMA 3TYHA 4BDNA 2Z23A 2QVRA 3EKIA 4PBQA 3HSTA 1S7YA 3I6VA 1N3XA 4XTCQ 3V89B 4RY1A 1QVSA 3PUXE 1NI9A 1FQCA 4RXLA 3ZKKA 1SI1A 4R73A 1SW5A 1B3GA 1NKXA 3BBRA 1NV1A 1MDQA 1BP5A 3IR1A 4RA1A 1B46A 3MZBA 4R2BA 2I49A 1R9QA 1LBXA 1ZLQA 5I58B 4PFUA 1NV3A 4E0WA 1AIVA 4IY6A 1FQFA 3CHGA 1Y3QA 4KPTA 3TTRA 1LCTA 2QFLA 4PBHA 3FBPA 1H43A 1OQGA 3GYYA 4U1OA 4ZS9A 4ONYA 3GLBA 1B40A 2O84X 2WYKA 4GX3A 4MIJA 4EF1A 2NOOA 3S9MC 1VFDA 2I0CA 4HE2A 2PMSA 2XWOA 3RTFB 4XF5A 3LBSA 1D4NA 1GGGA 2V3QA 3GZGA 3VVDA 4OQOA 4O94A 5EQ7A 4PGNA 3PTYA 1MQHA 3RY3A 2QSXA 4NQ8A 1FBFA 1MY2A 4FECA 3OO8A 4QFPA 2X7PA 3CG3A 1EZPA 1LFIA 2Y5KA 3IOUA 3SKPA 3S9LC 3IO6A 4MMPA 1H45A 3ODBA 4ND9A 4ISUA 4KHZE 3OSQA 3E78A 2FA7A 3SESA 3K4UA 3TELA 4U2RA 4R72A 4JVIA 3QMFA 3OEKA 3SEYA 1PDAA 4QSEA 2ZYNA 3C34A 3N5LA 4OVRA 3SEVA 1JNFA 4XKNA 4GXAA 2PT2A 3LSFB 4NWCA 4N8YA 2DOJA 2O68A 2XX7A 3KC0A 2ZNSA 1A40A 4IY5A 4Q30B 1XI6A 2E0SA 1HSEA 3MYUA 4PDHA 3KN8A 1XHYA 3T66A 1PB7A 4FATA 4NN3A 2H5YA 3WAEA 1LSTA 4N8GA 2HAVA 1S9TA 3M3KA 2I4CA 2V3TA 4YKKA 3VFJA 1FBHA 4H5FA 2HZLA 3HHGA 1B7UA 1FBPA 2WBBA 5EYGA 1B1XA 4GWOA 4F1VA 2ZYOA 1Q35A 1ZJLA 2HHMA 3Q28A 1SBPA 3G3KA 4TLLB 5BWJA 4PE5B 3MVYA 3H6WA 4RJZA 4OVTA 1PB9A 4LZ5A 5KDTA 4QFLA 3C31A 3Q25A 2O69A 4AB5A 2I4BA 5A5LA 1SYHA 1NUWA 2W7YA 4P47A 4OVPA 3ONMA 3SEWA 4DCYA 1MQIA 2Y7IA 3DP8A 1DOTA 1RYXA 1Y4TA 3B6QA 1B32A 1Q1KA 2A5SA 4FIMA 5K2YA 3RNNA 5EYFA 1MY0A 3OD7A 5CMMA 5IKBA 3EQ1A 2KQZA 3VLVA 2DWIA 2HXRA 4FAJA 2WYPA 4ELQA 1G0IA 3KEIA 2Y84A 3R6UA 4P3LA 3BKIB 4LQ5A 4OESA 4PF6A 2UYEA 4PAFA 1FBEA 2R8TA 2F35A 3L6GA 4G8HA 1IITA 3QAXA 4GOTA 3EN3A 3MQ9A 2Q8MA 4R9GA 2DWAA 3QSLA 2P1SA 4OENA 3SEUA 1M5BA 1IMCA 2QJEA 1N0TA 1GR2A 4PFRA 2YPNA 2VD3A 1SPIA 4GRKA 3DLNA 2AIXA 1R6ZA 1BIYA 5I57B 2CZLA 3T9XB 2F8DA 3RYDA 1B7HA 1XT8A 3E13X 3JYRA 3FIRA 4JB7A 1POTA 1YXIA 4OERA 4GLIA 3IX1A 1B3HA 4POWA 2D5WA 2D3IA 1UIUA 2X26A 5LDZA 2THIA 3S2VA 2VHAA 4XFEA 1N76A 1FPJA 1PB8A 5A5XB 3L6HA 4YU0A 5FHMA 3JV9A 1MPDA 3TCHA 3K6UA 4PFYA 4O7MA 1FRPA 4XIGQ 1MM7A 3TDJA 4K3FA 4DI4B 1B5JA 3VLUA 1S50A 4P9KA 2I6EA 4GWXA 1IMDA 3RPLA 3H3GA 5H8NA 3H7MA 4JSOA 1FPLA 2F7AA 2F6GA 3TKDA 4RK9A 4OANA 2QVVA 4JVDA 4EXLA 4MLVA 4BDQA 3U8QA 1I6QA 3ZS6A 5I56B 5CC2A 3DP6A 4QFKA 5ET6A 4R9FA 3ZKLA 4G8NA 4R6YA 4BDMA 1N7WA 4F19A 3MPKA 4YKPA 4QFNA 4YKJA 3TQWA
chains in the Genus database with same CATH topology
5JK4A 4QSCA 3FJGA 4ZZEA 1MXXA 3PUZE 4JWYA 3W9WA 1NNTA 4BDRA 3H06B 3MPLA 4THIA 2PYYA 4EQ9A 4F3SA 3FUZA 3V83A 1ZIUA 3O6GA 2DYXA 4KI0E 5JEIA 5BUUA 3FVGA 2ZXTA 1M5DA 3IL1B 1O7TA 1LAXA 3M8UA 4NF6A 3RTWB 4HS7A 1UTHB 4FE8A 4POXA 2O7UA 2UYFA 4G8MA 3F11A 4DXUA 4QFOA 2IEEA 4ZEBA 1FQDA 3N6UA 5CMCA 3O28A 2YLNA 3PMVA 5H8FA 4TQUQ 4C1UA 3OELA 4KYDA 4O3CA 5H8NB 1H44A 1LFHA 1TFAA 5A5XA 1B9JA 4KCCA 1FQAA 4F3BA 5F1QA 5TPAA 3KGCA 1H76A 2H98A 3PMWA 3TZAA 2ESNA 1VSOA 4HCYA 4XKPA 1NNKA 1JW1A 3MW0A 5AA1A 2Q8JA 3N6TA 2XXIA 2DE2A 1POY1 1H3DA 2I3WA 5DYHA 3TFLA 5ITOA 1MPCA 4DZ1A 4FEDA 4GQOA 2Y7WA 1LCFA 4WEPA 1DPPA 2ALUA 1A8EA 3O6HA 2R71A 2XXXA 1TFDA 3G3FA 1Y3NA 3KFMA 4Z0IA 4DLDA 5L9SA 1B58A 4H1XA 2XXYA 2UVGA 4KR5A 3TTKA 5B70A 3CG1A 1AH5A 1ANFA 4N07A 2Q89A 1DPEA 1UTBA 4IO2A 4OFOA 3U92A 1BTJA 1MXZA 2I0BA 3K02A 4OEUA 3K1MA 4YKIA 2ZMBA 2IA4A 1LAGE 5H8FB 2QS1A 4PFWA 3TEPA 2REJA 3G3HA 1SD3A 3KJTA 2Y7RA 2H9BA 3RT6B 3R7XA 3RN8A 3WAFA 2LAOA 4H67A 4Z7EA 5IAIA 2OWTA 1NNFA 2Y7KA 3OO7A 2RKMA 5CM6A 3A3UA 3MP6A 1T0KA 2ZNTA 1B5HA 4ZEDA 4JSDA 3N94A 2F78A 4G4PA 3D4CA 4IB2A 4KD5A 4U22A 2ONKE 3VXBA 1FTLA 1Y1ZA 3HV1A 4LZ7A 1GTKA 1JW5A 3FVOA 3KSJA 1LB9A 1N7XA 1NH8A 1P1WA 4H65A 4JDFA 1B3LA 2DE4A 3FGSA 1OLAA 4R6HA 4RYAA 4ZDMA 3H6TA 3TYHA 2Z23A 4BDNA 4DXBA 1LAHE 2VGQA 3FVNA 3PPRA 3PV0E 4C0RA 5H8QA 1UTBB 2I58A 3H6VA 3HSTA 1S7YA 2UVHA 3FJ7A 4PFTA 3QUJA 3I6VA 1N3XA 2A5TA 1MXUA 2RCBA 4XTCQ 3SEXA 3T9UA 4EQBA 1UIVA 3V89B 1MY4A 4X9TA 5EHMA 1AMFA 1EU8A 3LSWA 4RY1A 1OLCA 1QVSA 2OCUA 2Z8FA 3CSGA 3PUXE 1FQCA 4HTGA 5FHNA 4LZ8A 4RXLA 1DSNA 1SI1A 4NWDA 4R73A 3UK4A 1GV8A 3ZKKA 1SW5A 1UQWA 1B3GA 1LFGA 3UA8A 1NKXA 3BBRA 4OXVA 1XC1A 1MDQA 3HHFA 1BP5A 1D9VA 3IR1A 2I3VA 5FTHA 4N6PA 4RA1A 1B46A 3MZBA 4EXKA 4R2BA 4LVQA 4YB5A 3Q27A 3U72A 1A8FA 2I49A 5DVFA 5AA2A 1R9QA 5CBRA 1P1QA 1SQYA 1QULA 1L5TA 1Y4CA 1ZLQA 5I58B 4X1DA 4PFUA 3QK6A 1Z7NE 2NWJA 3G7WA 5I84A 4E0WA 1QKBA 1AIVA 1YPNA 2PBWA 1JETA 1FQFA 4IY6A 3IOTA 3EHSA 5H8HB 3KN3A 4OMBA 2V84A 1B3EA 3UGWA 1Y3QA 2H99A 5I59B 3TTNA 4KPTA 3TTRA 4XKRA 1VE4A 2Z8DA 3V8XB 1FCKA 4IO5A 5TU0A 1LCTA 3FATA 2ZNUA 4IO6A 2F36A 3D4GA 2V93A 1H43A 5AA2D 3CFXA 3FXQA 4F1YA 1OQGA 3O9PA 1VFEA 3IJXB 3IAZA 3IB0A 2H4IA 1JEUA 4ONYA 2GH9A 4QRZA 4P11A 1IIWA 5CI5A 2RC8A 2VD2A 1B40A 2O84X 3GLBA 4RK2A 3FZVA 2NVUB 1B5IA 1B51A 4EF1A 4H0WA 3TPAA 1D9YA 2QRYA 2REGA 2X7QA 2BJJX 2DP8A 4PP0A 2NOOA 1Y1MA 2O51A 5CMKA 1VFDA 2I0CA 3S9MC 2PMSA 3RTFB 1Y3PA 3MZ1A 1IXCA 3SERA 4H8JA 5L8DA 2XXVA 2RC7A 1IQ7A 3M3FA 1MQDA 2XXHA 4FEBA 3LBSA 1D4NA 1GGGA 2V3QA 1P1NA 3GZGA 4DE8A 4ELRA 4OZ9A 3VVDA 4I9DA 4OQOA 3IORA 4GL8A 2Q88A 4G68A 1SW1A 3KZGA 3RY3A 1MQHA 4MF3A 3CVGA 2QSXA 4U4SA 3E3KA 1B4HA 1SW2A 1URSA 3KOSA 3DP4A 4GF8A 2FNCA 4I1DA 1IXGA 1FTMA 1MY2A 3GXAA 1D3KA 4FECA 4DDDA 3OO8A 1MS7A 4QFPA 3K6VA 2X7PA 3K1NA 2G93A 2P0SA 5KCJA 5DVJA 2OLBA 2XHDA 2AL5A 3CG3A 1LFIA 2RCAA 3ILTB 3IOUA 3MJNA 3SKPA 1US4A 2HQ0A 3IO6A 1JVYA 3VDFA 2QPQA 5ICTA 3T9HB 3S9LC 1YAEA 3OO9A 3PUYE 4JXIA 2OK2A 1H45A 2QMXA 2DXRA 3BFTA 2F97A 3JZJA 3ODBA 3OXNA 4ISUA 3OSQA 4KHZE 1FTOA 1LGBC 1QUJA 3OO6A 3M3LA 2B65A 1XOCA 2DVZA 2UXAA 5I2KA 4JBZA 1N84A 2FA7A 1IEJA 2F34A 2ABHA 3K6XA 3K4UA 3SESA 3TELA 1MY1A 3PD8A 3DELB 4G2ZA 4OEVA 2G29A 4R72A 4U2RA 3MP8A 5DTBA 3VVEA 4PQJA 2NUVA 2B3BA 4JWXA 3FJMA 1MH3A 3W9VA 3OEKA 3SEYA 2F7CA 1IXIA 2F6PA 1PDAA 4QSEA 4KYEA 2GHAA 2GHBA 3MUQA 2ZYNA 3C34A 3N5LA 1XVXA 4F2QA 5I58A 3SEVA 3MBPA 1EZ9A 1JNFA 3RGYA 3UIFA 1NL5A 4XKNA 4F18A 1CB6A 5HM4B 3SDFA 4UACA 5AA3A 2B3FA 2DWJA 2DXYA 1OVBA 3HCQA 4KYSA 2DWHA 5H8HA 4GXAA 3TUSA 1OVTA 1DMBA 2PT2A 3TTMA 3C33A 3LSFB 1AOVA 3T22A 3O2AA 1I6AA 1MPBA 4NWCA 3ILUB 5I2KB 4BDOA 1N3WA 4I8CA 2DOJA 2GFEA 2ONRA 2Q9TA 3C9HA 2O68A 4EUOA 2XX7A 1URDA 4U4XA 1O64A 4ELPA 1A55A 1ELJA 1A40A 2ZNSA 4GD5A 4GL0A 4IY5A 4Q30B 5JTYB 2XX8A 2E0SA 1KWHA 2OWSA 1USYH 2D21A 1HSEA 3Q29A 3IB2A 4OYVA 1A99A 4YAHX 5EHSA 5M2VA 4EDPA 4ESXA 1OMPA 4H6DA 2F5XA 3KN8A 4YKPA 4IGTA 2O1LA 1XHYA 3T66A 2XD3A 4R6KA 4M4GA 4DCXA 1PB7A 4GXSB 4ZECA 4FATA 2ANJA 3BFUA 3USDA 3VXCA 2HXWA 1MXWA 3EF7A 2H5YA 3K1PA 3WAEA 1LSTA 5FTIA 4LATA 4MBPA 2QS2A 3S9EA 1FQEA 1NNPA 2HFBA 3PPPA 2HAUA 2RINA 3LR1A 4OFJA 1BKAA 4O3BA 1ZMGA 5DVIA 4NF8A 1JQFA 1IXHA 3P7IA 4FORA 1M5FA 4AQ4A 1SVXB 2HAVA 4E0XA 1FTKA 3EPEA 3PUVE 1N04A 3K00A 3S9NC 4Q8RA 3R26A 1S9TA 3MVZA 4ZEKA 1M5CA 2Z8EA 3PU5A 3M3KA 2QL3A 3OSRA 1QUKA 1R1NA 2I4CA 2WKYA 3ZSFA 4DXCA 5B7DA 2UVJA 3QIMA 1FTJA 1WDNA 2Q2CA 3KOTA 1LAFE 1EH3A 1M5EA 1TXFA 2V3TA 1QW0A 3PPNA 4IGRA 4YKKA 3VFJA 4H5FA 2HZLA 3HHGA 5I2NA 3VLWA 1BLFA 2GRVA 4IO3A 1B7UA 3TMGA 2XXUA 1ZU0A 1MXYA 1MQJA 2DQVA 1WVJA 4F3GA 2OZZA 2DE3A 2QMWA 3N26A 2ZYKA 4F31B 3HO7A 1HSLA 5ICQA 4HCWA 4FJPA 1P1OA 3O97A 5AA2B 5K2XA 1B1XA 4GWOA 4F1VA 1TT1A 2ZYOA 3LC8A 2DSFA 1Q35A 1ZJLA 4WXJA 3Q28A 1SBPA 5F7VA 3G3KA 3PD9A 4TLLB 3TQLA 3MVWA 3FASA 2FYIA 5I56A 2OJTA 4EF2A 5BWJA 4EQ7A 4PE5B 2E1SA 5TP9A 4JWOA 3MVYA 4U23A 2XXWA 3H6WA 4YKJA 2R9JA 4NF4B 4ESWA 3K0VA 1II5A 1AL3A 3MVXA 4WEDA 3FXUA 3I3VA 3MWBA 3U93A 3V5AA 5LOMA 3EHTA 4R2FA 3KSXA 4QHQA 2AYSA 4RJZA 1MDP1 5I57A 4IO7A 1PB9A 4RNSA 4U1OA 1EZPA 4LZ5A 3OOAA 5CRYA 5DT6A 5KDTA 3LUYA 1LB8A 4NTLA 2O7IA 3O66A 3IK6B 4QFLA 3T93B 3C36A 3RQTA 5JTYA 3G3JA 1TWYA 1MXVA 2AL4A 3PMXA 4ZZAA 3C31A 3Q25A 3UP9A 2O69A 4AB5A 2I4BA 4GFRA 4NF6B 5HPQA 4UA8A 4NE4A 1SYHA 2W7YA 3A09A 3IJOB 1ZBMA 3DM0A 3ONMA 3SEWA 4DCYA 4LONB 1MQIA 4X1BA 1WODA 4QSDA 1EZOA 3MP1A 1B7ZA 2Y7IA 3DP8A 4NF4A 3A3CA 1DOTA 1B3FA 4R75A 1RYXA 1URGA 1LBBA 1Y4TA 1OIBA 3B6QA 3FXRA 4LP2B 1RYOA 2F7BA 4IO4A 3VV5A 1Z7ME 1B32A 4MFIA 3VE1B 2XXPA 5HBCA 1J1NA 1Q1KA 2A5SA 4FIMA 5K2YA 3C35A 3HN0A 2PT1A 4OTEA 4WKMA 5FHOA 3RNNA 3TCGA 3OENA 3U94A 4DIGA 1ZTYA 4ZE8A 5J1DA 4QF9A 5KDTB 2CMOA 3C32A 3O6IA 4F29A 5EYFA 1ATGA 1O63A 3S4UA 1MY0A 3OD7A 3HPIA 3LSXA 1YTVA 3E4RA 3IOVA 3K6WA 5CMMA 4ND9A 4RPOA 3QXMA 5IKBA 1P1UA 4P0GA 1B0LA 2PVUA 2Q2AA 3CSBA 3T96B 3EQ1A 2V3UA 1B52A 2DWIA 3CFZA 3RUMA 2I48A 3THIA 3VLVA 2O6AA 1CE2A 4FAJA 3VVFA 4ELQA 4NF5B 3KEIA 2Y84A 3R6UA 3B6WA 3BKIB 4LQ5A 4OESA 1NMUA 4H5GA 2UYEA 1SYIA 2Z22A 4KCDA 4YICA 1NH7A 1FW0A 1MY3A 2F35A 2OBGA 3H6UA 1IITA 3L6GA 2Y7PA 3QAXA 4G8HA 4GOTA 4RPNA 1LBCA 3RLFE 3W15C 3EN3A 3MQ9A 2XXTA 1SDXA 3I5OA 4M1VA 1B0HA 1B1HA 3GBBA 2V25A 4R9GA 4ELOA 1Y20A 2DWAA 3QSLA 3SETA 2P1SA 1US5A 4LA9A 3H4ZA 1YCJA 4OENA 1MRPA 3SEUA 1QJMA 5ISUA 1SI0A 3FD3A 5I59A 1M5BA 2KLFA 5TP9B 1PEBA 2QJEA 4MLQA 1N0TA 1GR2A 3PUWE 4ZEIA 5I2NB 4NEDA 1B6HA 2YPNA 1A7LA 2VD3A 1PC3A 3TTLA 5DEXA 1VR5A 3E9XA 5ITPA 2HEUA 4GRKA 3DLNA 4H8IA 4BLAA 1MG1A 4XXUA 1QKAA 4NF5A 2AIXA 1R6ZA 1BIYA 5I57B 2CZLA 3T9XB 2F8DA 4X48A 5AE4A 3PPOA 3CI8A 1B7HA 1XT8A 4GIZA 4OVJA 3E13X 3G3GA 3TCFA 2NXOA 2R6GE 3FV2A 3JYRA 4P0IA 3FIRA 4JB7A 2QS4A 3EHUA 1POTA 4LUBA 1GVCA 3MC2A 4OERA 4GLIA 4OFLA 4F22A 3AXFA 1I6BA 2VP1A 3IX1A 4OHNA 1B3HA 4POWA 2UVIA 2D5WA 5ELVA 3UN6A 4AB6A 4KQPA 3IO4A 4F2OA 3CFLA 2D3IA 1UIUA 2X26A 4HW8A 5KZTA 2THIA 3S2VA 3RPWA 2VHAA 4BDLA 3IB1A 3PPQA 5L9OA 4U1ZA 1B4ZA 2XXQA 1LLSA 1B2HA 1N76A 2VOZA 4GVOA 3KJ7A 4PETA 4YB6A 5DEXB 5AA4A 1PB8A 3C4MA 2RC9A 5A5XB 5H8SA 1B05A 2HZKA 3L6HA 2ONSA 4YU0A 5FHMA 3B6TA 3RT8A 3JV9A 5AA4B 2XD2A 4G68C 1MPDA 3TAJA 1HSJA 3G3IA 3PGFA 4TOZA 3OMBA 3QYTA 4ZS9A 4L17A 4NF8B 3K2DA 3TCHA 4YMBA 4LQ2A 3K6UA 4G77A 4PFYA 2ZYMA 4F1UA 1SW4A 2RF1A 1PBQA 4XIGQ 1MM7A 1USYE 3LSLA 3K01A 3TDJA 4K3FA 1QUIA 1B5JA 1IZ1A 1UTHA 3VLUA 3KBRA 1F9BA 5L9MA 3ECRA 3MAMA 4TLMB 4ZE9A 1JW4A 3FV1A 4C1TA 1I69A 1S50A 1XVYA 2I6EA 3MZ9A 4F39A 1IUDA 1P99A 1FQBA 3H3GA 4N13A 1A54A 1NFTA 2PX1A 2YJPA 3QUFA 3H7MA 5H8NA 2DS9A 4JSOA 1OQHA 2F7AA 4NMYA 2F6GA 3KG2A 2QS3A 2XX9A 3CRBA 5TPAB 3H03A 2P2AA 4RK9A 1RKMA 4YZZA 3TKDA 4YMAA 3B7DA 4YB7A 5CBSA 4XKQA 3FVKA 5CMBA 4EXLA 4G68B 4MLVA 4BDQA 1DTZA 1MM6A 1DTGA 3GBAA 3U8QA 1I6QA 3UORA 4ECFA 1MQGA 4U21A 1ZKBA 4Q0CA 3ZS6A 5I56B 3KN7A 3T9VA 3CIJA 4ZEFA 1JEVA 3OEMA 2HCAA 4F3PA 3Q26A 4Q5TA 3TODA 3CR9A 3DP6A 5CC2A 4MH5A 1R9LA 1MH4A 3O29A 4QFKA 2DVCA 4R74A 4QFNA 4R9FA 1JVXA 4OWDA 5KCJB 2XXRA 1Y9UA 3ZKLA 4OETA 2O1MA 4G8NA 4O3AA 5H8QB 4R6YA 3IOWA 4BDMA 1PBPA 1N7WA 1XS5A 2H25A 2M8CA 2A5TB 3MPKA 4I62A 4KFQA 3U1OA 4F19A 3TQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JK4 A;  4QSC A;  3FJG A;  4ZZE A;  1MXX A;  3PUZ E;  4JWY A;  3W9W A;  1NNT A;  4BDR A;  3H06 B;  3MPL A;  4THI A;  2PYY A;  4EQ9 A;  4F3S A;  3FUZ A;  3V83 A;  1ZIU A;  3O6G A;  2DYX A;  4KI0 E;  5JEI A;  5BUU A;  3FVG A;  2ZXT A;  1M5D A;  3IL1 B;  1O7T A;  1LAX A;  3M8U A;  4NF6 A;  3RTW B;  4HS7 A;  1UTH B;  4FE8 A;  4POX A;  2O7U A;  2UYF A;  4G8M A;  3F11 A;  4DXU A;  4QFO A;  2IEE A;  4ZEB A;  1FQD A;  3N6U A;  5CMC A;  3O28 A;  2YLN A;  3PMV A;  5H8F A;  4TQU Q;  4C1U A;  3OEL A;  4KYD A;  4O3C A;  5H8N B;  1H44 A;  1LFH A;  1TFA A;  5A5X A;  1B9J A;  4KCC A;  1FQA A;  4F3B A;  5F1Q A;  5TPA A;  3KGC A;  1H76 A;  2H98 A;  3PMW A;  3TZA A;  2ESN A;  1VSO A;  4HCY A;  4XKP A;  1NNK A;  1JW1 A;  3MW0 A;  5AA1 A;  2Q8J A;  3N6T A;  2XXI A;  2DE2 A;  1POY 1;  1H3D A;  2I3W A;  5DYH A;  3TFL A;  5ITO A;  1MPC A;  4DZ1 A;  4FED A;  4GQO A;  2Y7W A;  1LCF A;  4WEP A;  1DPP A;  2ALU A;  1A8E A;  3O6H A;  2R71 A;  2XXX A;  1TFD A;  3G3F A;  1Y3N A;  3KFM A;  4Z0I A;  4DLD A;  5L9S A;  1B58 A;  4H1X A;  2XXY A;  2UVG A;  4KR5 A;  3TTK A;  5B70 A;  3CG1 A;  1AH5 A;  1ANF A;  4N07 A;  2Q89 A;  1DPE A;  1UTB A;  4IO2 A;  4OFO A;  3U92 A;  1BTJ A;  1MXZ A;  2I0B A;  3K02 A;  4OEU A;  3K1M A;  4YKI A;  2ZMB A;  2IA4 A;  1LAG E;  5H8F B;  2QS1 A;  4PFW A;  3TEP A;  2REJ A;  3G3H A;  1SD3 A;  3KJT A;  2Y7R A;  2H9B A;  3RT6 B;  3R7X A;  3RN8 A;  3WAF A;  2LAO A;  4H67 A;  4Z7E A;  5IAI A;  2OWT A;  1NNF A;  2Y7K A;  3OO7 A;  2RKM A;  5CM6 A;  3A3U A;  3MP6 A;  1T0K A;  2ZNT A;  1B5H A;  4ZED A;  4JSD A;  3N94 A;  2F78 A;  4G4P A;  3D4C A;  4IB2 A;  4KD5 A;  4U22 A;  2ONK E;  3VXB A;  1FTL A;  1Y1Z A;  3HV1 A;  4LZ7 A;  1GTK A;  1JW5 A;  3FVO A;  3KSJ A;  1LB9 A;  1N7X A;  1NH8 A;  1P1W A;  4H65 A;  4JDF A;  1B3L A;  2DE4 A;  3FGS A;  1OLA A;  4R6H A;  4RYA A;  4ZDM A;  3H6T A;  3TYH A;  2Z23 A;  4BDN A;  4DXB A;  1LAH E;  2VGQ A;  3FVN A;  3PPR A;  3PV0 E;  4C0R A;  5H8Q A;  1UTB B;  2I58 A;  3H6V A;  3HST A;  1S7Y A;  2UVH A;  3FJ7 A;  4PFT A;  3QUJ A;  3I6V A;  1N3X A;  2A5T A;  1MXU A;  2RCB A;  4XTC Q;  3SEX A;  3T9U A;  4EQB A;  1UIV A;  3V89 B;  1MY4 A;  4X9T A;  5EHM A;  1AMF A;  1EU8 A;  3LSW A;  4RY1 A;  1OLC A;  1QVS A;  2OCU A;  2Z8F A;  3CSG A;  3PUX E;  1FQC A;  4HTG A;  5FHN A;  4LZ8 A;  4RXL A;  1DSN A;  1SI1 A;  4NWD A;  4R73 A;  3UK4 A;  1GV8 A;  3ZKK A;  1SW5 A;  1UQW A;  1B3G A;  1LFG A;  3UA8 A;  1NKX A;  3BBR A;  4OXV A;  1XC1 A;  1MDQ A;  3HHF A;  1BP5 A;  1D9V A;  3IR1 A;  2I3V A;  5FTH A;  4N6P A;  4RA1 A;  1B46 A;  3MZB A;  4EXK A;  4R2B A;  4LVQ A;  4YB5 A;  3Q27 A;  3U72 A;  1A8F A;  2I49 A;  5DVF A;  5AA2 A;  1R9Q A;  5CBR A;  1P1Q A;  1SQY A;  1QUL A;  1L5T A;  1Y4C A;  1ZLQ A;  5I58 B;  4X1D A;  4PFU A;  3QK6 A;  1Z7N E;  2NWJ A;  3G7W A;  5I84 A;  4E0W A;  1QKB A;  1AIV A;  1YPN A;  2PBW A;  1JET A;  1FQF A;  4IY6 A;  3IOT A;  3EHS A;  5H8H B;  3KN3 A;  4OMB A;  2V84 A;  1B3E A;  3UGW A;  1Y3Q A;  2H99 A;  5I59 B;  3TTN A;  4KPT A;  3TTR A;  4XKR A;  1VE4 A;  2Z8D A;  3V8X B;  1FCK A;  4IO5 A;  5TU0 A;  1LCT A;  3FAT A;  2ZNU A;  4IO6 A;  2F36 A;  3D4G A;  2V93 A;  1H43 A;  5AA2 D;  3CFX A;  3FXQ A;  4F1Y A;  1OQG A;  3O9P A;  1VFE A;  3IJX B;  3IAZ A;  3IB0 A;  2H4I A;  1JEU A;  4ONY A;  2GH9 A;  4QRZ A;  4P11 A;  1IIW A;  5CI5 A;  2RC8 A;  2VD2 A;  1B40 A;  2O84 X;  3GLB A;  4RK2 A;  3FZV A;  2NVU B;  1B5I A;  1B51 A;  4EF1 A;  4H0W A;  3TPA A;  1D9Y A;  2QRY A;  2REG A;  2X7Q A;  2BJJ X;  2DP8 A;  4PP0 A;  2NOO A;  1Y1M A;  2O51 A;  5CMK A;  1VFD A;  2I0C A;  3S9M C;  2PMS A;  3RTF B;  1Y3P A;  3MZ1 A;  1IXC A;  3SER A;  4H8J A;  5L8D A;  2XXV A;  2RC7 A;  1IQ7 A;  3M3F A;  1MQD A;  2XXH A;  4FEB A;  3LBS A;  1D4N A;  1GGG A;  2V3Q A;  1P1N A;  3GZG A;  4DE8 A;  4ELR A;  4OZ9 A;  3VVD A;  4I9D A;  4OQO A;  3IOR A;  4GL8 A;  2Q88 A;  4G68 A;  1SW1 A;  3KZG A;  3RY3 A;  1MQH A;  4MF3 A;  3CVG A;  2QSX A;  4U4S A;  3E3K A;  1B4H A;  1SW2 A;  1URS A;  3KOS A;  3DP4 A;  4GF8 A;  2FNC A;  4I1D A;  1IXG A;  1FTM A;  1MY2 A;  3GXA A;  1D3K A;  4FEC A;  4DDD A;  3OO8 A;  1MS7 A;  4QFP A;  3K6V A;  2X7P A;  3K1N A;  2G93 A;  2P0S A;  5KCJ A;  5DVJ A;  2OLB A;  2XHD A;  2AL5 A;  3CG3 A;  1LFI A;  2RCA A;  3ILT B;  3IOU A;  3MJN A;  3SKP A;  1US4 A;  2HQ0 A;  3IO6 A;  1JVY A;  3VDF A;  2QPQ A;  5ICT A;  3T9H B;  3S9L C;  1YAE A;  3OO9 A;  3PUY E;  4JXI A;  2OK2 A;  1H45 A;  2QMX A;  2DXR A;  3BFT A;  2F97 A;  3JZJ A;  3ODB A;  3OXN A;  4ISU A;  3OSQ A;  4KHZ E;  1FTO A;  1LGB C;  1QUJ A;  3OO6 A;  3M3L A;  2B65 A;  1XOC A;  2DVZ A;  2UXA A;  5I2K A;  4JBZ A;  1N84 A;  2FA7 A;  1IEJ A;  2F34 A;  2ABH A;  3K6X A;  3K4U A;  3SES A;  3TEL A;  1MY1 A;  3PD8 A;  3DEL B;  4G2Z A;  4OEV A;  2G29 A;  4R72 A;  4U2R A;  3MP8 A;  5DTB A;  3VVE A;  4PQJ A;  2NUV A;  2B3B A;  4JWX A;  3FJM A;  1MH3 A;  3W9V A;  3OEK A;  3SEY A;  2F7C A;  1IXI A;  2F6P A;  1PDA A;  4QSE A;  4KYE A;  2GHA A;  2GHB A;  3MUQ A;  2ZYN A;  3C34 A;  3N5L A;  1XVX A;  4F2Q A;  5I58 A;  3SEV A;  3MBP A;  1EZ9 A;  1JNF A;  3RGY A;  3UIF A;  1NL5 A;  4XKN A;  4F18 A;  1CB6 A;  5HM4 B;  3SDF A;  4UAC A;  5AA3 A;  2B3F A;  2DWJ A;  2DXY A;  1OVB A;  3HCQ A;  4KYS A;  2DWH A;  5H8H A;  4GXA A;  3TUS A;  1OVT A;  1DMB A;  2PT2 A;  3TTM A;  3C33 A;  3LSF B;  1AOV A;  3T22 A;  3O2A A;  1I6A A;  1MPB A;  4NWC A;  3ILU B;  5I2K B;  4BDO A;  1N3W A;  4I8C A;  2DOJ A;  2GFE A;  2ONR A;  2Q9T A;  3C9H A;  2O68 A;  4EUO A;  2XX7 A;  1URD A;  4U4X A;  1O64 A;  4ELP A;  1A55 A;  1ELJ A;  1A40 A;  2ZNS A;  4GD5 A;  4GL0 A;  4IY5 A;  4Q30 B;  5JTY B;  2XX8 A;  2E0S A;  1KWH A;  2OWS A;  1USY H;  2D21 A;  1HSE A;  3Q29 A;  3IB2 A;  4OYV A;  1A99 A;  4YAH X;  5EHS A;  5M2V A;  4EDP A;  4ESX A;  1OMP A;  4H6D A;  2F5X A;  3KN8 A;  4YKP A;  4IGT A;  2O1L A;  1XHY A;  3T66 A;  2XD3 A;  4R6K A;  4M4G A;  4DCX A;  1PB7 A;  4GXS B;  4ZEC A;  4FAT A;  2ANJ A;  3BFU A;  3USD A;  3VXC A;  2HXW A;  1MXW A;  3EF7 A;  2H5Y A;  3K1P A;  3WAE A;  1LST A;  5FTI A;  4LAT A;  4MBP A;  2QS2 A;  3S9E A;  1FQE A;  1NNP A;  2HFB A;  3PPP A;  2HAU A;  2RIN A;  3LR1 A;  4OFJ A;  1BKA A;  4O3B A;  1ZMG A;  5DVI A;  4NF8 A;  1JQF A;  1IXH A;  3P7I A;  4FOR A;  1M5F A;  4AQ4 A;  1SVX B;  2HAV A;  4E0X A;  1FTK A;  3EPE A;  3PUV E;  1N04 A;  3K00 A;  3S9N C;  4Q8R A;  3R26 A;  1S9T A;  3MVZ A;  4ZEK A;  1M5C A;  2Z8E A;  3PU5 A;  3M3K A;  2QL3 A;  3OSR A;  1QUK A;  1R1N A;  2I4C A;  2WKY A;  3ZSF A;  4DXC A;  5B7D A;  2UVJ A;  3QIM A;  1FTJ A;  1WDN A;  2Q2C A;  3KOT A;  1LAF E;  1EH3 A;  1M5E A;  1TXF A;  2V3T A;  1QW0 A;  3PPN A;  4IGR A;  4YKK A;  3VFJ A;  4H5F A;  2HZL A;  3HHG A;  5I2N A;  3VLW A;  1BLF A;  2GRV A;  4IO3 A;  1B7U A;  3TMG A;  2XXU A;  1ZU0 A;  1MXY A;  1MQJ A;  2DQV A;  1WVJ A;  4F3G A;  2OZZ A;  2DE3 A;  2QMW A;  3N26 A;  2ZYK A;  4F31 B;  3HO7 A;  1HSL A;  5ICQ A;  4HCW A;  4FJP A;  1P1O A;  3O97 A;  5AA2 B;  5K2X A;  1B1X A;  4GWO A;  4F1V A;  1TT1 A;  2ZYO A;  3LC8 A;  2DSF A;  1Q35 A;  1ZJL A;  4WXJ A;  3Q28 A;  1SBP A;  5F7V A;  3G3K A;  3PD9 A;  4TLL B;  3TQL A;  3MVW A;  3FAS A;  2FYI A;  5I56 A;  2OJT A;  4EF2 A;  5BWJ A;  4EQ7 A;  4PE5 B;  2E1S A;  5TP9 A;  4JWO A;  3MVY A;  4U23 A;  2XXW A;  3H6W A;  4YKJ A;  2R9J A;  4NF4 B;  4ESW A;  3K0V A;  1II5 A;  1AL3 A;  3MVX A;  4WED A;  3FXU A;  3I3V A;  3MWB A;  3U93 A;  3V5A A;  5LOM A;  3EHT A;  4R2F A;  3KSX A;  4QHQ A;  2AYS A;  4RJZ A;  1MDP 1;  5I57 A;  4IO7 A;  1PB9 A;  4RNS A;  4U1O A;  1EZP A;  4LZ5 A;  3OOA A;  5CRY A;  5DT6 A;  5KDT A;  3LUY A;  1LB8 A;  4NTL A;  2O7I A;  3O66 A;  3IK6 B;  4QFL A;  3T93 B;  3C36 A;  3RQT A;  5JTY A;  3G3J A;  1TWY A;  1MXV A;  2AL4 A;  3PMX A;  4ZZA A;  3C31 A;  3Q25 A;  3UP9 A;  2O69 A;  4AB5 A;  2I4B A;  4GFR A;  4NF6 B;  5HPQ A;  4UA8 A;  4NE4 A;  1SYH A;  2W7Y A;  3A09 A;  3IJO B;  1ZBM A;  3DM0 A;  3ONM A;  3SEW A;  4DCY A;  4LON B;  1MQI A;  4X1B A;  1WOD A;  4QSD A;  1EZO A;  3MP1 A;  1B7Z A;  2Y7I A;  3DP8 A;  4NF4 A;  3A3C A;  1DOT A;  1B3F A;  4R75 A;  1RYX A;  1URG A;  1LBB A;  1Y4T A;  1OIB A;  3B6Q A;  3FXR A;  4LP2 B;  1RYO A;  2F7B A;  4IO4 A;  3VV5 A;  1Z7M E;  1B32 A;  4MFI A;  3VE1 B;  2XXP A;  5HBC A;  1J1N A;  1Q1K A;  2A5S A;  4FIM A;  5K2Y A;  3C35 A;  3HN0 A;  2PT1 A;  4OTE A;  4WKM A;  5FHO A;  3RNN A;  3TCG A;  3OEN A;  3U94 A;  4DIG A;  1ZTY A;  4ZE8 A;  5J1D A;  4QF9 A;  5KDT B;  2CMO A;  3C32 A;  3O6I A;  4F29 A;  5EYF A;  1ATG A;  1O63 A;  3S4U A;  1MY0 A;  3OD7 A;  3HPI A;  3LSX A;  1YTV A;  3E4R A;  3IOV A;  3K6W A;  5CMM A;  4ND9 A;  4RPO A;  3QXM A;  5IKB A;  1P1U A;  4P0G A;  1B0L A;  2PVU A;  2Q2A A;  3CSB A;  3T96 B;  3EQ1 A;  2V3U A;  1B52 A;  2DWI A;  3CFZ A;  3RUM A;  2I48 A;  3THI A;  3VLV A;  2O6A A;  1CE2 A;  4FAJ A;  3VVF A;  4ELQ A;  4NF5 B;  3KEI A;  2Y84 A;  3R6U A;  3B6W A;  3BKI B;  4LQ5 A;  4OES A;  1NMU A;  4H5G A;  2UYE A;  1SYI A;  2Z22 A;  4KCD A;  4YIC A;  1NH7 A;  1FW0 A;  1MY3 A;  2F35 A;  2OBG A;  3H6U A;  1IIT A;  3L6G A;  2Y7P A;  3QAX A;  4G8H A;  4GOT A;  4RPN A;  1LBC A;  3RLF E;  3W15 C;  3EN3 A;  3MQ9 A;  2XXT A;  1SDX A;  3I5O A;  4M1V A;  1B0H A;  1B1H A;  3GBB A;  2V25 A;  4R9G A;  4ELO A;  1Y20 A;  2DWA A;  3QSL A;  3SET A;  2P1S A;  1US5 A;  4LA9 A;  3H4Z A;  1YCJ A;  4OEN A;  1MRP A;  3SEU A;  1QJM A;  5ISU A;  1SI0 A;  3FD3 A;  5I59 A;  1M5B A;  2KLF A;  5TP9 B;  1PEB A;  2QJE A;  4MLQ A;  1N0T A;  1GR2 A;  3PUW E;  4ZEI A;  5I2N B;  4NED A;  1B6H A;  2YPN A;  1A7L A;  2VD3 A;  1PC3 A;  3TTL A;  5DEX A;  1VR5 A;  3E9X A;  5ITP A;  2HEU A;  4GRK A;  3DLN A;  4H8I A;  4BLA A;  1MG1 A;  4XXU A;  1QKA A;  4NF5 A;  2AIX A;  1R6Z A;  1BIY A;  5I57 B;  2CZL A;  3T9X B;  2F8D A;  4X48 A;  5AE4 A;  3PPO A;  3CI8 A;  1B7H A;  1XT8 A;  4GIZ A;  4OVJ A;  3E13 X;  3G3G A;  3TCF A;  2NXO A;  2R6G E;  3FV2 A;  3JYR A;  4P0I A;  3FIR A;  4JB7 A;  2QS4 A;  3EHU A;  1POT A;  4LUB A;  1GVC A;  3MC2 A;  4OER A;  4GLI A;  4OFL A;  4F22 A;  3AXF A;  1I6B A;  2VP1 A;  3IX1 A;  4OHN A;  1B3H A;  4POW A;  2UVI A;  2D5W A;  5ELV A;  3UN6 A;  4AB6 A;  4KQP A;  3IO4 A;  4F2O A;  3CFL A;  2D3I A;  1UIU A;  2X26 A;  4HW8 A;  5KZT A;  2THI A;  3S2V A;  3RPW A;  2VHA A;  4BDL A;  3IB1 A;  3PPQ A;  5L9O A;  4U1Z A;  1B4Z A;  2XXQ A;  1LLS A;  1B2H A;  1N76 A;  2VOZ A;  4GVO A;  3KJ7 A;  4PET A;  4YB6 A;  5DEX B;  5AA4 A;  1PB8 A;  3C4M A;  2RC9 A;  5A5X B;  5H8S A;  1B05 A;  2HZK A;  3L6H A;  2ONS A;  4YU0 A;  5FHM A;  3B6T A;  3RT8 A;  3JV9 A;  5AA4 B;  2XD2 A;  4G68 C;  1MPD A;  3TAJ A;  1HSJ A;  3G3I A;  3PGF A;  4TOZ A;  3OMB A;  3QYT A;  4ZS9 A;  4L17 A;  4NF8 B;  3K2D A;  3TCH A;  4YMB A;  4LQ2 A;  3K6U A;  4G77 A;  4PFY A;  2ZYM A;  4F1U A;  1SW4 A;  2RF1 A;  1PBQ A;  4XIG Q;  1MM7 A;  1USY E;  3LSL A;  3K01 A;  3TDJ A;  4K3F A;  1QUI A;  1B5J A;  1IZ1 A;  1UTH A;  3VLU A;  3KBR A;  1F9B A;  5L9M A;  3ECR A;  3MAM A;  4TLM B;  4ZE9 A;  1JW4 A;  3FV1 A;  4C1T A;  1I69 A;  1S50 A;  1XVY A;  2I6E A;  3MZ9 A;  4F39 A;  1IUD A;  1P99 A;  1FQB A;  3H3G A;  4N13 A;  1A54 A;  1NFT A;  2PX1 A;  2YJP A;  3QUF A;  3H7M A;  5H8N A;  2DS9 A;  4JSO A;  1OQH A;  2F7A A;  4NMY A;  2F6G A;  3KG2 A;  2QS3 A;  2XX9 A;  3CRB A;  5TPA B;  3H03 A;  2P2A A;  4RK9 A;  1RKM A;  4YZZ A;  3TKD A;  4YMA A;  3B7D A;  4YB7 A;  5CBS A;  4XKQ A;  3FVK A;  5CMB A;  4EXL A;  4G68 B;  4MLV A;  4BDQ A;  1DTZ A;  1MM6 A;  1DTG A;  3GBA A;  3U8Q A;  1I6Q A;  3UOR A;  4ECF A;  1MQG A;  4U21 A;  1ZKB A;  4Q0C A;  3ZS6 A;  5I56 B;  3KN7 A;  3T9V A;  3CIJ A;  4ZEF A;  1JEV A;  3OEM A;  2HCA A;  4F3P A;  3Q26 A;  4Q5T A;  3TOD A;  3CR9 A;  3DP6 A;  5CC2 A;  4MH5 A;  1R9L A;  1MH4 A;  3O29 A;  4QFK A;  2DVC A;  4R74 A;  4QFN A;  4R9F A;  1JVX A;  4OWD A;  5KCJ B;  2XXR A;  1Y9U A;  3ZKL A;  4OET A;  2O1M A;  4G8N A;  4O3A A;  5H8Q B;  4R6Y A;  3IOW A;  4BDM A;  1PBP A;  1N7W A;  1XS5 A;  2H25 A;  2M8C A;  2A5T B;  3MPK A;  4I62 A;  4KFQ A;  3U1O A;  4F19 A;  3TQW A; 
#chains in the Genus database with same CATH topology
 3FJG A;  4JWY A;  4BDR A;  4F3S A;  1ZIU A;  3O6G A;  4X04 A;  5BUU A;  4I3Y A;  4QXD A;  4FE8 A;  4POX A;  5CMC A;  4H45 A;  4TQU Q;  4N91 A;  5A5X A;  1B9J A;  4F3B A;  1KZ8 A;  5F1Q A;  1H76 A;  2CEX A;  5EQ8 A;  1NNK A;  3MW0 A;  2Q8J A;  3N6T A;  4IR8 A;  5DYH A;  1MPC A;  4FED A;  4WEP A;  2ALU A;  3O6H A;  3KFM A;  1FBC A;  4Z0I A;  4DLD A;  3TTK A;  5B70 A;  3CG1 A;  3U92 A;  4YKI A;  3RPL B;  2QS1 A;  3TEP A;  1FPI A;  5CM6 A;  1B5H A;  2KR0 A;  4JSD A;  4G4P A;  3VXB A;  4U22 A;  4H65 A;  1RDX A;  4GBW A;  3FGS A;  4DXB A;  3FVN A;  3PV0 E;  4PFT A;  5ET5 A;  2RCB A;  1MXU A;  3SEX A;  1UIV A;  1MY4 A;  3CSG A;  4HTG A;  2OCU A;  1DSN A;  4NWD A;  1GV8 A;  1LFG A;  2P3V A;  3HHF A;  1P1Q A;  4GWS A;  1YPN A;  1JET A;  3EHS A;  2V84 A;  4PAI A;  1VE4 A;  3V8X B;  1FCK A;  5TU0 A;  3D4G A;  2V93 A;  2VT5 A;  4F1Y A;  4QRZ A;  3IJX B;  4C0R A;  3IB0 A;  5AA3 A;  2GH9 A;  2DP8 A;  5CMK A;  5L8D A;  2XXV A;  1MQD A;  4FEB A;  4OZ9 A;  4GL8 A;  4G68 A;  5IGA A;  1EYI A;  3CVG A;  1B4H A;  3KOS A;  3DP4 A;  4GF8 A;  3GXA A;  1D3K A;  4DDD A;  5DVJ A;  2XHD A;  1US4 A;  5ICT A;  2XWV A;  1YAE A;  3OO9 A;  3PUY E;  4JXI A;  2OK2 A;  4RNS A;  3OXN A;  1FTO A;  1LGB C;  3OO6 A;  2DVZ A;  1N84 A;  1IEJ A;  2F34 A;  2ABH A;  1NV0 A;  4G2Z A;  3DEL B;  5DTB A;  3VVE A;  4PQJ A;  4JWX A;  5I3S A;  3FJM A;  1EYJ A;  3BIG A;  4KYE A;  2GHA A;  2GHB A;  1AWB A;  2Y5L A;  3UIF A;  5HM4 B;  3SDF A;  4UAC A;  2B3F A;  3HCQ A;  2WEF A;  3TUS A;  4N17 A;  1MPB A;  1G0H A;  4BDO A;  4OVQ A;  2QVU A;  1A55 A;  4GD5 A;  5JTY B;  2XX8 A;  2D21 A;  4OYV A;  5M2V A;  1OMP A;  1Q9D A;  5EQA A;  2XD3 A;  4R6K A;  3B8B A;  4GXS B;  2ANJ A;  1FJ9 A;  2HXW A;  1MXW A;  5IZ1 A;  4MBP A;  2QS2 A;  4PDD A;  3HFU A;  2RIN A;  1YYZ A;  1JQF A;  1IXH A;  4FOR A;  1FTK A;  3K00 A;  1M5C A;  1QUK A;  1R1N A;  3ZSF A;  4DXC A;  2F3D A;  1EH3 A;  1M5E A;  3ROJ A;  3NOH A;  4MNC A;  5I2N A;  4MEV A;  3VLW A;  1BLF A;  1ZU0 A;  2OZZ A;  2DE3 A;  3HO7 A;  1HSL A;  3O97 A;  5K2X A;  3T0J A;  4WXJ A;  3TQL A;  2FYI A;  4EF2 A;  4U23 A;  3MVX A;  4WED A;  5LOM A;  3I3V A;  3MWB A;  3EHT A;  4QHQ A;  2AYS A;  2B4M A;  2MKZ A;  5I57 A;  5CRY A;  5DT6 A;  4NTL A;  3T93 B;  1IMA A;  3C36 A;  3RQT A;  4PF8 A;  5JTY A;  1TWY A;  1MXV A;  4ZZA A;  4NF6 B;  1LEV A;  1DK4 A;  1ZBM A;  1WOD A;  4QSD A;  4X1B A;  3A3C A;  1LBB A;  3FXR A;  4LP2 B;  4OTE A;  4DIG A;  3U94 A;  4QF9 A;  2CMO A;  3IOV A;  3K6W A;  3QXM A;  1P1U A;  4P0G A;  1NV6 A;  5F24 A;  3CFZ A;  3THI A;  2I48 A;  3SZP A;  1FPD A;  3B6W A;  1NH7 A;  2OBG A;  4RPN A;  3RLF E;  4M1V A;  3I5O A;  1B1H A;  4KXP A;  1SI0 A;  5I59 A;  4MCO A;  2KLF A;  1PEB A;  3PUW E;  3TTL A;  4GWW A;  1FTA A;  3E9X A;  5ITP A;  4BLA A;  1MG1 A;  5EQ9 A;  3KBZ A;  3TCF A;  2R6G E;  3FV2 A;  2B4L A;  3MC2 A;  4OFL A;  4F22 A;  2VP1 A;  3IO4 A;  2PFZ A;  3IB1 A;  5L9O A;  4U1Z A;  3C4M A;  2RC9 A;  2HZK A;  5AA4 B;  2XWI A;  3B6T A;  4YMB A;  2RF1 A;  1QUI A;  3KBR A;  5L9M A;  3ECR A;  4F39 A;  1IUD A;  5J16 A;  2DS9 A;  5TPA B;  3H03 A;  1RKM A;  4YMA A;  4PFI A;  5CBS A;  5CMB A;  1DTZ A;  4ECF A;  3GBA A;  1ZKB A;  3KN7 A;  4ZEF A;  2HCA A;  3Q26 A;  4Q5T A;  5IZ3 B;  4MH5 A;  3O29 A;  4OET A;  2O1M A;  4O3A A;  2H25 A;  3U1O A;  2A5T B;  4QSC A;  1MXX A;  3PUZ E;  2CEY A;  3H06 B;  2ZZW A;  2PYY A;  4LN5 A;  4EQ9 A;  4JVC A;  2DDK A;  1O7T A;  4G8M A;  1KA0 A;  2UYF A;  4DXU A;  1FQD A;  5H8F A;  2YLN A;  4C1U A;  3OEL A;  4KYD A;  4O3C A;  2P3N A;  4NX1 A;  2H98 A;  2ESN A;  2XXI A;  2I3W A;  4GQO A;  2Y7W A;  1DPP A;  1A8E A;  3G3F A;  1TFD A;  1Y3N A;  5L9S A;  4PTK A;  2UVG A;  4N07 A;  1ANF A;  4OFO A;  2I0B A;  4OEU A;  3T9V A;  1LAG E;  5H8F B;  2REJ A;  3KJT A;  3RT6 B;  3R7X A;  2LAO A;  5IAI A;  4Z7E A;  2OWT A;  2Y7K A;  3MP6 A;  1T0K A;  2F78 A;  2ONK E;  1N7X A;  2DE4 A;  4RYA A;  4R6H A;  3H6T A;  3E79 A;  1LAH E;  2VGQ A;  3H6V A;  2UVH A;  3QUJ A;  2A5T A;  2L5V A;  3T9U A;  4EQB A;  4X9T A;  5EHM A;  1AMF A;  1EU8 A;  3LSW A;  1OLC A;  5FHN A;  3KC1 A;  2VPN A;  3UA8 A;  2HPG A;  4GX6 A;  4OXV A;  1XC1 A;  1D9V A;  2I3V A;  5FTH A;  4EXK A;  4LVQ A;  4YB5 A;  3Q27 A;  5DVF A;  1LBZ A;  1SQY A;  4GX4 A;  4X1D A;  5ESY A;  3G7W A;  5I84 A;  1QKB A;  2PBW A;  3IOT A;  3KN3 A;  1B3E A;  3UGW A;  2H99 A;  4XKR A;  2Z8D A;  4UAB A;  3FAT A;  2ZNU A;  2F36 A;  5AA2 D;  3CFX A;  3O9P A;  1VFE A;  3IAZ A;  2RC8 A;  2VD2 A;  3FZV A;  1B5I A;  2QRY A;  2REG A;  2X7Q A;  4PP0 A;  2WX9 A;  1Y3P A;  3MZ1 A;  1IXC A;  1IQ7 A;  3M3F A;  2XXH A;  4N4U A;  2Q74 A;  4I9D A;  2Q88 A;  1SW1 A;  3KZG A;  4MF3 A;  1URS A;  5FBP A;  2FNC A;  4I1D A;  1MS7 A;  3K1N A;  5KCJ A;  2OLB A;  2RCA A;  4AS4 A;  2HQ0 A;  4P11 A;  2DXR A;  5I2N B;  1LBV A;  3M3L A;  2B65 A;  1XOC A;  2UXA A;  5I2K A;  4JBZ A;  1MY1 A;  3PD8 A;  4OEV A;  2G29 A;  1FSA A;  1MH3 A;  4F2Q A;  3MBP A;  3RGY A;  1NL5 A;  1CB6 A;  4NHB A;  2DWJ A;  1OVB A;  5H8H A;  3C33 A;  3T22 A;  3ILU B;  5I2K B;  4I8C A;  2GFE A;  1ELJ A;  4GL0 A;  3ISP A;  1KWH A;  2OWS A;  5IM2 A;  2FIX A;  4EDP A;  4YAH X;  4H6D A;  4IGT A;  4M4G A;  4DCX A;  4HE1 A;  3VXC A;  3K1P A;  4LAT A;  2HFB A;  3PPP A;  2HAU A;  3LR1 A;  4OFJ A;  1BKA A;  4O3B A;  5DVI A;  4NF8 A;  1BK4 A;  3P7I A;  1M5F A;  4E0X A;  3PUV E;  3EPE A;  3S9N C;  3R26 A;  2NWJ A;  2Z8E A;  5B7D A;  3QIM A;  1FTJ A;  1WDN A;  2Q2C A;  1LAF E;  1TXF A;  4IGR A;  2XXU A;  4HE0 A;  2DQV A;  1WVJ A;  4F3G A;  4F31 B;  5ICQ A;  1P1O A;  3LC8 A;  2DSF A;  3MVW A;  3FAS A;  5I56 A;  2OJT A;  4EQ7 A;  2E1S A;  5TP9 A;  2XXW A;  2R9J A;  4NF4 B;  4ESW A;  1II5 A;  1AL3 A;  3KSX A;  4IO7 A;  4X8R A;  1JP4 A;  3OOA A;  3LUY A;  1LB8 A;  2O7I A;  3O66 A;  3MST A;  3G3J A;  3PMX A;  1D9Q A;  4GFR A;  5HPQ A;  4UA8 A;  4QBA A;  4NE4 A;  2ZZV A;  4G61 A;  3IJO B;  3DM0 A;  4LON B;  3MP1 A;  4NF4 A;  3TCG A;  4R75 A;  1URG A;  1OIB A;  1RYO A;  2F7B A;  4IO4 A;  4MFI A;  3LUZ A;  1J1N A;  5HBC A;  3C35 A;  5FHO A;  2PT1 A;  1NUY A;  1ZTY A;  4ZE8 A;  4NAP A;  4F29 A;  1ATG A;  1CNQ A;  1O63 A;  2PFY A;  3E4R A;  3T96 B;  1B52 A;  2F3B A;  4NF5 B;  1NMU A;  4H5G A;  2Z22 A;  4YIC A;  3H6U A;  4PC9 A;  5AA2 A;  1LBC A;  3W15 C;  1B0H A;  1Y20 A;  3SET A;  4LA9 A;  1YCJ A;  1MRP A;  1QJM A;  5IZ3 A;  5TP9 B;  4ZEI A;  1B6H A;  1FPE A;  4PFB A;  2HEU A;  4H8I A;  2FVZ A;  4GWU A;  4NF5 A;  4X48 A;  5AE4 A;  3PPO A;  4MNP A;  4OVJ A;  4GIZ A;  4OVS A;  4P0I A;  4LUB A;  3EHU A;  1IMB A;  3AXF A;  1I6B A;  4OHN A;  5ELV A;  4KQP A;  5ET8 A;  4HW8 A;  3RPW A;  3PPQ A;  1INP A;  2XXQ A;  4N6K A;  4MJO A;  4PET A;  3KJ7 A;  1NV7 A;  5H8S A;  1B05 A;  4P8B A;  2PCR A;  2XD2 A;  4TOZ A;  3K2D A;  3B50 A;  4G77 A;  4GWY A;  2ZYM A;  1SW4 A;  1USY E;  3LSL A;  3K01 A;  3MAM A;  4ZE9 A;  1JW4 A;  4C1T A;  1RDY A;  1P99 A;  1FQB A;  4N13 A;  1NFT A;  4NMY A;  2QS3 A;  2XX9 A;  3CRB A;  2P2A A;  4NF0 A;  4YZZ A;  4YB7 A;  4G68 B;  1MM6 A;  1DTG A;  3UOR A;  4U21 A;  1DCU A;  4Q0C A;  3D1R A;  4F3P A;  1JEV A;  3CR9 A;  1R9L A;  1MH4 A;  4R74 A;  2DVC A;  4OWD A;  2XXR A;  4I62 A;  3OSR A;  2VPO A;  5JK4 A;  2CZI A;  4ZZE A;  1NNT A;  3MPL A;  3V83 A;  5IZZ A;  1M5D A;  1LAX A;  3M8U A;  1UTH B;  2O7U A;  3F11 A;  2IEE A;  4ZEB A;  3N6U A;  5H8N B;  1K9Z A;  1TFA A;  4KCC A;  1FQA A;  3KGC A;  3PMW A;  1VSO A;  4HCY A;  1POY 1;  5ITO A;  4DZ1 A;  1LCF A;  4XEQ A;  2R71 A;  1FPG A;  2XXX A;  3IFA A;  5I5P A;  4H1X A;  4KR5 A;  1NV5 A;  2Q89 A;  1UTB A;  1MXZ A;  3K02 A;  4P1L A;  3K1M A;  2IA4 A;  2H9B A;  2XWK A;  1NNF A;  3OO7 A;  3A3U A;  2ZNT A;  4H46 A;  4ZED A;  3D4C A;  1FTL A;  1Y1Z A;  4LZ7 A;  3FVO A;  4JDF A;  1P1W A;  1NH8 A;  3RUM A;  1B3L A;  1LBY A;  1OLA A;  3PPR A;  5H8Q A;  1UTB B;  2I58 A;  3FJ7 A;  2JJK A;  5EYH A;  2Z8F A;  3FXB A;  4LZ8 A;  2OX3 A;  3BIH A;  1FPK A;  3UK4 A;  1UQW A;  1FBG A;  5I7I A;  4N6P A;  3U72 A;  1A8F A;  5CBR A;  1QUL A;  1L5T A;  1Y4C A;  3IFC A;  4I40 A;  3QK6 A;  4OA4 A;  1Z7N E;  1LBW A;  2XXK A;  4P56 A;  5H8H B;  4OMB A;  3TTN A;  5ET7 A;  1K9Y A;  4IO5 A;  4IO6 A;  4PGP A;  3FXQ A;  4ESX A;  2H4I A;  1JEU A;  5CI5 A;  1IIW A;  4RK2 A;  2NVU B;  1B51 A;  4H0W A;  3TPA A;  1D9Y A;  2BJJ X;  4O7I A;  1Y1M A;  2O51 A;  2XA5 A;  3SER A;  4H8J A;  2RC7 A;  4DE8 A;  4ELR A;  1P1N A;  3IOR A;  1QGX A;  4U4S A;  3E3K A;  1SW2 A;  4PE3 A;  1IXG A;  1FTM A;  2FIE A;  3K6V A;  2G93 A;  2P0S A;  2AL5 A;  3ILT B;  3MJN A;  1JVY A;  3VDF A;  2QPQ A;  3T9H B;  4FBP A;  2QMX A;  3BFT A;  3JZJ A;  2F97 A;  1QUJ A;  3K6X A;  3MP8 A;  2NUV A;  2B3B A;  3W9V A;  2F7C A;  1IXI A;  2F6P A;  2CZK A;  3MUQ A;  5I58 A;  1XVX A;  1EZ9 A;  4F18 A;  4NG7 A;  1FJ6 A;  2FBP A;  2OWZ A;  2DXY A;  4KYS A;  1NV4 A;  2DWH A;  1FBD A;  5LTC A;  1OVT A;  1DMB A;  3TTM A;  1AOV A;  3O2A A;  1I6A A;  1N3W A;  2ONR A;  2Q9T A;  4EUO A;  3C9H A;  1URD A;  4U4X A;  1O64 A;  4ELP A;  3Q29 A;  1USY H;  3IB2 A;  5EHS A;  1A99 A;  2F5X A;  2O1L A;  1YZ0 A;  2FHY A;  3BFU A;  3USD A;  3EF7 A;  1RDZ A;  5FTI A;  4PAK A;  3S9E A;  1FQE A;  1NNP A;  1ZMG A;  4AQ4 A;  1SVX B;  1N04 A;  3MVZ A;  4ZEK A;  3PU5 A;  2QL3 A;  2WKY A;  2UVJ A;  3KOT A;  3PPN A;  1QW0 A;  4IO3 A;  2GRV A;  3TMG A;  1MXY A;  1MQJ A;  3LV0 A;  3N26 A;  2QMW A;  2ZYK A;  4HCW A;  4FJP A;  5AA2 B;  1TT1 A;  5F7V A;  3PD9 A;  4JWO A;  3T1B A;  1IMF A;  3K0V A;  3V5A A;  3FXU A;  4GBV A;  3U93 A;  4R2F A;  1MDP 1;  1VDW A;  2BJI A;  3IK6 B;  4MHF A;  2AL4 A;  3UP9 A;  1IME A;  3A09 A;  1EZO A;  1B7Z A;  4BDL A;  1B3F A;  3VV5 A;  1Z7M E;  3VE1 B;  2XXP A;  3HN0 A;  4WKM A;  5KDT B;  3OEN A;  5J1D A;  5DW8 A;  1FPF A;  3C32 A;  3O6I A;  3S4U A;  3HPI A;  3LSX A;  1YTV A;  4I3E A;  4RPO A;  4GWZ A;  2V4C A;  1B0L A;  2PVU A;  4N81 A;  2Q2A A;  3CSB A;  2V3U A;  2O6A A;  4AS5 A;  1CE2 A;  3VVF A;  4MNI A;  1SYI A;  3A29 A;  4KCD A;  1FW0 A;  1MY3 A;  4P1E A;  5JEI A;  2Y7P A;  4Q8R A;  2XXT A;  1SDX A;  4ELO A;  3GBB A;  2V25 A;  1US5 A;  3H4Z A;  5ISU A;  3FD3 A;  4MLQ A;  4NED A;  1A7L A;  1PC3 A;  2ZZX A;  5DEX A;  1VR5 A;  4XXU A;  1QKA A;  4DI3 D;  4MAG A;  4N15 A;  4N6D A;  3CI8 A;  3G3G A;  2NXO A;  2CZH A;  2QS4 A;  1GVC A;  2UVI A;  4AB6 A;  3UN6 A;  4F2O A;  3CFL A;  4NGU A;  5KZT A;  1B4Z A;  1LLS A;  5DEX B;  4YB6 A;  1B2H A;  2VOZ A;  4GVO A;  5AA4 A;  5T3J A;  3RT8 A;  2ONS A;  4G68 C;  3TAJ A;  1HSJ A;  3G3I A;  3PGF A;  3OMB A;  3QYT A;  1DBZ A;  4L17 A;  4NF8 B;  4LQ2 A;  4F1U A;  1PBQ A;  1UTH A;  1IZ1 A;  1F9B A;  4TLM B;  3FV1 A;  1I69 A;  1XVY A;  3MZ9 A;  1A54 A;  2PX1 A;  2YJP A;  3QUF A;  1OQH A;  3KG2 A;  3B7D A;  4XKQ A;  3FVK A;  1MQG A;  4MX6 A;  2WBD A;  3CIJ A;  3OEM A;  3TOD A;  5KCJ B;  1JVX A;  1Y9U A;  5H8Q B;  3IOW A;  1PBP A;  1XS5 A;  2M8C A;  4KFQ A;  4ZEC A;  3U65 A;  3W9W A;  4THI A;  4PCD A;  3FUZ A;  1NUZ A;  2DYX A;  4KI0 E;  3FVG A;  2ZXT A;  3IL1 B;  1EYK A;  4NF6 A;  3RTW B;  4HXV A;  4HS7 A;  1FPB A;  4QFO A;  3O28 A;  3PMV A;  1LFH A;  1H44 A;  5TPA A;  1KA1 A;  2GQ1 A;  3TZA A;  1NUX A;  4XKP A;  1JW1 A;  5AA1 A;  2DE2 A;  1H3D A;  3TFL A;  4O8M A;  1B58 A;  1NV2 A;  2XXY A;  1AH5 A;  1DPE A;  4IO2 A;  1BTJ A;  2ZMB A;  4PFW A;  3G3H A;  1SD3 A;  2Y7R A;  3RN8 A;  3WAF A;  4H67 A;  2RKM A;  3N94 A;  4IB2 A;  4KD5 A;  3HV1 A;  1GTK A;  1JW5 A;  3KSJ A;  5I59 B;  1LB9 A;  4ZDM A;  3TYH A;  4BDN A;  2Z23 A;  2QVR A;  3EKI A;  4PBQ A;  3HST A;  1S7Y A;  3I6V A;  1N3X A;  4XTC Q;  3V89 B;  4RY1 A;  1QVS A;  3PUX E;  1NI9 A;  1FQC A;  4RXL A;  3ZKK A;  1SI1 A;  4R73 A;  1SW5 A;  1B3G A;  1NKX A;  3BBR A;  1NV1 A;  1MDQ A;  1BP5 A;  3IR1 A;  4RA1 A;  1B46 A;  3MZB A;  4R2B A;  2I49 A;  1R9Q A;  1LBX A;  1ZLQ A;  5I58 B;  4PFU A;  1NV3 A;  4E0W A;  1AIV A;  4IY6 A;  1FQF A;  3CHG A;  1Y3Q A;  4KPT A;  3TTR A;  1LCT A;  2QFL A;  4PBH A;  3FBP A;  1H43 A;  1OQG A;  3GYY A;  4U1O A;  4ZS9 A;  4ONY A;  3GLB A;  1B40 A;  2O84 X;  2WYK A;  4GX3 A;  4MIJ A;  4EF1 A;  2NOO A;  3S9M C;  1VFD A;  2I0C A;  4HE2 A;  2PMS A;  2XWO A;  3RTF B;  4XF5 A;  3LBS A;  1D4N A;  1GGG A;  2V3Q A;  3GZG A;  3VVD A;  4OQO A;  4O94 A;  5EQ7 A;  4PGN A;  3PTY A;  1MQH A;  3RY3 A;  2QSX A;  4NQ8 A;  1FBF A;  1MY2 A;  4FEC A;  3OO8 A;  4QFP A;  2X7P A;  3CG3 A;  1EZP A;  1LFI A;  2Y5K A;  3IOU A;  3SKP A;  3S9L C;  3IO6 A;  4MMP A;  1H45 A;  3ODB A;  4ND9 A;  4ISU A;  4KHZ E;  3OSQ A;  3E78 A;  2FA7 A;  3SES A;  3K4U A;  3TEL A;  4U2R A;  4R72 A;  4JVI A;  3QMF A;  3OEK A;  3SEY A;  1PDA A;  4QSE A;  2ZYN A;  3C34 A;  3N5L A;  4OVR A;  3SEV A;  1JNF A;  4XKN A;  4GXA A;  2PT2 A;  3LSF B;  4NWC A;  4N8Y A;  2DOJ A;  2O68 A;  2XX7 A;  3KC0 A;  2ZNS A;  1A40 A;  4IY5 A;  4Q30 B;  1XI6 A;  2E0S A;  1HSE A;  3MYU A;  4PDH A;  3KN8 A;  1XHY A;  3T66 A;  1PB7 A;  4FAT A;  4NN3 A;  2H5Y A;  3WAE A;  1LST A;  4N8G A;  2HAV A;  1S9T A;  3M3K A;  2I4C A;  2V3T A;  4YKK A;  3VFJ A;  1FBH A;  4H5F A;  2HZL A;  3HHG A;  1B7U A;  1FBP A;  2WBB A;  5EYG A;  1B1X A;  4GWO A;  4F1V A;  2ZYO A;  1Q35 A;  1ZJL A;  2HHM A;  3Q28 A;  1SBP A;  3G3K A;  4TLL B;  5BWJ A;  4PE5 B;  3MVY A;  3H6W A;  4RJZ A;  4OVT A;  1PB9 A;  4LZ5 A;  5KDT A;  4QFL A;  3C31 A;  3Q25 A;  2O69 A;  4AB5 A;  2I4B A;  5A5L A;  1SYH A;  1NUW A;  2W7Y A;  4P47 A;  4OVP A;  3ONM A;  3SEW A;  4DCY A;  1MQI A;  2Y7I A;  3DP8 A;  1DOT A;  1RYX A;  1Y4T A;  3B6Q A;  1B32 A;  1Q1K A;  2A5S A;  4FIM A;  5K2Y A;  3RNN A;  5EYF A;  1MY0 A;  3OD7 A;  5CMM A;  5IKB A;  3EQ1 A;  2KQZ A;  3VLV A;  2DWI A;  2HXR A;  4FAJ A;  2WYP A;  4ELQ A;  1G0I A;  3KEI A;  2Y84 A;  3R6U A;  4P3L A;  3BKI B;  4LQ5 A;  4OES A;  4PF6 A;  2UYE A;  4PAF A;  1FBE A;  2R8T A;  2F35 A;  3L6G A;  4G8H A;  1IIT A;  3QAX A;  4GOT A;  3EN3 A;  3MQ9 A;  2Q8M A;  4R9G A;  2DWA A;  3QSL A;  2P1S A;  4OEN A;  3SEU A;  1M5B A;  1IMC A;  2QJE A;  1N0T A;  1GR2 A;  4PFR A;  2YPN A;  2VD3 A;  1SPI A;  4GRK A;  3DLN A;  2AIX A;  1R6Z A;  1BIY A;  5I57 B;  2CZL A;  3T9X B;  2F8D A;  3RYD A;  1B7H A;  1XT8 A;  3E13 X;  3JYR A;  3FIR A;  4JB7 A;  1POT A;  1YXI A;  4OER A;  4GLI A;  3IX1 A;  1B3H A;  4POW A;  2D5W A;  2D3I A;  1UIU A;  2X26 A;  5LDZ A;  2THI A;  3S2V A;  2VHA A;  4XFE A;  1N76 A;  1FPJ A;  1PB8 A;  5A5X B;  3L6H A;  4YU0 A;  5FHM A;  3JV9 A;  1MPD A;  3TCH A;  3K6U A;  4PFY A;  4O7M A;  1FRP A;  4XIG Q;  1MM7 A;  3TDJ A;  4K3F A;  4DI4 B;  1B5J A;  3VLU A;  1S50 A;  4P9K A;  2I6E A;  4GWX A;  1IMD A;  3RPL A;  3H3G A;  5H8N A;  3H7M A;  4JSO A;  1FPL A;  2F7A A;  2F6G A;  3TKD A;  4RK9 A;  4OAN A;  2QVV A;  4JVD A;  4EXL A;  4MLV A;  4BDQ A;  3U8Q A;  1I6Q A;  3ZS6 A;  5I56 B;  5CC2 A;  3DP6 A;  4QFK A;  5ET6 A;  4R9F A;  3ZKL A;  4G8N A;  4R6Y A;  4BDM A;  1N7W A;  4F19 A;  3MPK A;  4YKP A;  4QFN A;  4YKJ A;  3TQW A; 
#chains in the Genus database with same CATH homology
 5JK4 A;  4QSC A;  3FJG A;  4ZZE A;  1MXX A;  3PUZ E;  4JWY A;  3W9W A;  1NNT A;  4BDR A;  3H06 B;  3MPL A;  4THI A;  2PYY A;  4EQ9 A;  4F3S A;  3FUZ A;  3V83 A;  1ZIU A;  3O6G A;  2DYX A;  4KI0 E;  5JEI A;  5BUU A;  3FVG A;  2ZXT A;  1M5D A;  3IL1 B;  1O7T A;  1LAX A;  3M8U A;  4NF6 A;  3RTW B;  4HS7 A;  1UTH B;  4FE8 A;  4POX A;  2O7U A;  2UYF A;  4G8M A;  3F11 A;  4DXU A;  4QFO A;  2IEE A;  4ZEB A;  1FQD A;  3N6U A;  5CMC A;  3O28 A;  2YLN A;  3PMV A;  5H8F A;  4TQU Q;  4C1U A;  3OEL A;  4KYD A;  4O3C A;  5H8N B;  1H44 A;  1LFH A;  1TFA A;  5A5X A;  1B9J A;  4KCC A;  1FQA A;  4F3B A;  5F1Q A;  5TPA A;  3KGC A;  1H76 A;  2H98 A;  3PMW A;  3TZA A;  2ESN A;  1VSO A;  4HCY A;  4XKP A;  1NNK A;  1JW1 A;  3MW0 A;  5AA1 A;  2Q8J A;  3N6T A;  2XXI A;  2DE2 A;  1POY 1;  1H3D A;  2I3W A;  5DYH A;  3TFL A;  5ITO A;  1MPC A;  4DZ1 A;  4FED A;  4GQO A;  2Y7W A;  1LCF A;  4WEP A;  1DPP A;  2ALU A;  1A8E A;  3O6H A;  2R71 A;  2XXX A;  1TFD A;  3G3F A;  1Y3N A;  3KFM A;  4Z0I A;  4DLD A;  5L9S A;  1B58 A;  4H1X A;  2XXY A;  2UVG A;  4KR5 A;  3TTK A;  5B70 A;  3CG1 A;  1AH5 A;  1ANF A;  4N07 A;  2Q89 A;  1DPE A;  1UTB A;  4IO2 A;  4OFO A;  3U92 A;  1BTJ A;  1MXZ A;  2I0B A;  3K02 A;  4OEU A;  3K1M A;  4YKI A;  2ZMB A;  2IA4 A;  1LAG E;  5H8F B;  2QS1 A;  4PFW A;  3TEP A;  2REJ A;  3G3H A;  1SD3 A;  3KJT A;  2Y7R A;  2H9B A;  3RT6 B;  3R7X A;  3RN8 A;  3WAF A;  2LAO A;  4H67 A;  4Z7E A;  5IAI A;  2OWT A;  1NNF A;  2Y7K A;  3OO7 A;  2RKM A;  5CM6 A;  3A3U A;  3MP6 A;  1T0K A;  2ZNT A;  1B5H A;  4ZED A;  4JSD A;  3N94 A;  2F78 A;  4G4P A;  3D4C A;  4IB2 A;  4KD5 A;  4U22 A;  2ONK E;  3VXB A;  1FTL A;  1Y1Z A;  3HV1 A;  4LZ7 A;  1GTK A;  1JW5 A;  3FVO A;  3KSJ A;  1LB9 A;  1N7X A;  1NH8 A;  1P1W A;  4H65 A;  4JDF A;  1B3L A;  2DE4 A;  3FGS A;  1OLA A;  4R6H A;  4RYA A;  4ZDM A;  3H6T A;  3TYH A;  2Z23 A;  4BDN A;  4DXB A;  1LAH E;  2VGQ A;  3FVN A;  3PPR A;  3PV0 E;  4C0R A;  5H8Q A;  1UTB B;  2I58 A;  3H6V A;  3HST A;  1S7Y A;  2UVH A;  3FJ7 A;  4PFT A;  3QUJ A;  3I6V A;  1N3X A;  2A5T A;  1MXU A;  2RCB A;  4XTC Q;  3SEX A;  3T9U A;  4EQB A;  1UIV A;  3V89 B;  1MY4 A;  4X9T A;  5EHM A;  1AMF A;  1EU8 A;  3LSW A;  4RY1 A;  1OLC A;  1QVS A;  2OCU A;  2Z8F A;  3CSG A;  3PUX E;  1FQC A;  4HTG A;  5FHN A;  4LZ8 A;  4RXL A;  1DSN A;  1SI1 A;  4NWD A;  4R73 A;  3UK4 A;  1GV8 A;  3ZKK A;  1SW5 A;  1UQW A;  1B3G A;  1LFG A;  3UA8 A;  1NKX A;  3BBR A;  4OXV A;  1XC1 A;  1MDQ A;  3HHF A;  1BP5 A;  1D9V A;  3IR1 A;  2I3V A;  5FTH A;  4N6P A;  4RA1 A;  1B46 A;  3MZB A;  4EXK A;  4R2B A;  4LVQ A;  4YB5 A;  3Q27 A;  3U72 A;  1A8F A;  2I49 A;  5DVF A;  5AA2 A;  1R9Q A;  5CBR A;  1P1Q A;  1SQY A;  1QUL A;  1L5T A;  1Y4C A;  1ZLQ A;  5I58 B;  4X1D A;  4PFU A;  3QK6 A;  1Z7N E;  2NWJ A;  3G7W A;  5I84 A;  4E0W A;  1QKB A;  1AIV A;  1YPN A;  2PBW A;  1JET A;  1FQF A;  4IY6 A;  3IOT A;  3EHS A;  5H8H B;  3KN3 A;  4OMB A;  2V84 A;  1B3E A;  3UGW A;  1Y3Q A;  2H99 A;  5I59 B;  3TTN A;  4KPT A;  3TTR A;  4XKR A;  1VE4 A;  2Z8D A;  3V8X B;  1FCK A;  4IO5 A;  5TU0 A;  1LCT A;  3FAT A;  2ZNU A;  4IO6 A;  2F36 A;  3D4G A;  2V93 A;  1H43 A;  5AA2 D;  3CFX A;  3FXQ A;  4F1Y A;  1OQG A;  3O9P A;  1VFE A;  3IJX B;  3IAZ A;  3IB0 A;  2H4I A;  1JEU A;  4ONY A;  2GH9 A;  4QRZ A;  4P11 A;  1IIW A;  5CI5 A;  2RC8 A;  2VD2 A;  1B40 A;  2O84 X;  3GLB A;  4RK2 A;  3FZV A;  2NVU B;  1B5I A;  1B51 A;  4EF1 A;  4H0W A;  3TPA A;  1D9Y A;  2QRY A;  2REG A;  2X7Q A;  2BJJ X;  2DP8 A;  4PP0 A;  2NOO A;  1Y1M A;  2O51 A;  5CMK A;  1VFD A;  2I0C A;  3S9M C;  2PMS A;  3RTF B;  1Y3P A;  3MZ1 A;  1IXC A;  3SER A;  4H8J A;  5L8D A;  2XXV A;  2RC7 A;  1IQ7 A;  3M3F A;  1MQD A;  2XXH A;  4FEB A;  3LBS A;  1D4N A;  1GGG A;  2V3Q A;  1P1N A;  3GZG A;  4DE8 A;  4ELR A;  4OZ9 A;  3VVD A;  4I9D A;  4OQO A;  3IOR A;  4GL8 A;  2Q88 A;  4G68 A;  1SW1 A;  3KZG A;  3RY3 A;  1MQH A;  4MF3 A;  3CVG A;  2QSX A;  4U4S A;  3E3K A;  1B4H A;  1SW2 A;  1URS A;  3KOS A;  3DP4 A;  4GF8 A;  2FNC A;  4I1D A;  1IXG A;  1FTM A;  1MY2 A;  3GXA A;  1D3K A;  4FEC A;  4DDD A;  3OO8 A;  1MS7 A;  4QFP A;  3K6V A;  2X7P A;  3K1N A;  2G93 A;  2P0S A;  5KCJ A;  5DVJ A;  2OLB A;  2XHD A;  2AL5 A;  3CG3 A;  1LFI A;  2RCA A;  3ILT B;  3IOU A;  3MJN A;  3SKP A;  1US4 A;  2HQ0 A;  3IO6 A;  1JVY A;  3VDF A;  2QPQ A;  5ICT A;  3T9H B;  3S9L C;  1YAE A;  3OO9 A;  3PUY E;  4JXI A;  2OK2 A;  1H45 A;  2QMX A;  2DXR A;  3BFT A;  2F97 A;  3JZJ A;  3ODB A;  3OXN A;  4ISU A;  3OSQ A;  4KHZ E;  1FTO A;  1LGB C;  1QUJ A;  3OO6 A;  3M3L A;  2B65 A;  1XOC A;  2DVZ A;  2UXA A;  5I2K A;  4JBZ A;  1N84 A;  2FA7 A;  1IEJ A;  2F34 A;  2ABH A;  3K6X A;  3K4U A;  3SES A;  3TEL A;  1MY1 A;  3PD8 A;  3DEL B;  4G2Z A;  4OEV A;  2G29 A;  4R72 A;  4U2R A;  3MP8 A;  5DTB A;  3VVE A;  4PQJ A;  2NUV A;  2B3B A;  4JWX A;  3FJM A;  1MH3 A;  3W9V A;  3OEK A;  3SEY A;  2F7C A;  1IXI A;  2F6P A;  1PDA A;  4QSE A;  4KYE A;  2GHA A;  2GHB A;  3MUQ A;  2ZYN A;  3C34 A;  3N5L A;  1XVX A;  4F2Q A;  5I58 A;  3SEV A;  3MBP A;  1EZ9 A;  1JNF A;  3RGY A;  3UIF A;  1NL5 A;  4XKN A;  4F18 A;  1CB6 A;  5HM4 B;  3SDF A;  4UAC A;  5AA3 A;  2B3F A;  2DWJ A;  2DXY A;  1OVB A;  3HCQ A;  4KYS A;  2DWH A;  5H8H A;  4GXA A;  3TUS A;  1OVT A;  1DMB A;  2PT2 A;  3TTM A;  3C33 A;  3LSF B;  1AOV A;  3T22 A;  3O2A A;  1I6A A;  1MPB A;  4NWC A;  3ILU B;  5I2K B;  4BDO A;  1N3W A;  4I8C A;  2DOJ A;  2GFE A;  2ONR A;  2Q9T A;  3C9H A;  2O68 A;  4EUO A;  2XX7 A;  1URD A;  4U4X A;  1O64 A;  4ELP A;  1A55 A;  1ELJ A;  1A40 A;  2ZNS A;  4GD5 A;  4GL0 A;  4IY5 A;  4Q30 B;  5JTY B;  2XX8 A;  2E0S A;  1KWH A;  2OWS A;  1USY H;  2D21 A;  1HSE A;  3Q29 A;  3IB2 A;  4OYV A;  1A99 A;  4YAH X;  5EHS A;  5M2V A;  4EDP A;  4ESX A;  1OMP A;  4H6D A;  2F5X A;  3KN8 A;  4YKP A;  4IGT A;  2O1L A;  1XHY A;  3T66 A;  2XD3 A;  4R6K A;  4M4G A;  4DCX A;  1PB7 A;  4GXS B;  4ZEC A;  4FAT A;  2ANJ A;  3BFU A;  3USD A;  3VXC A;  2HXW A;  1MXW A;  3EF7 A;  2H5Y A;  3K1P A;  3WAE A;  1LST A;  5FTI A;  4LAT A;  4MBP A;  2QS2 A;  3S9E A;  1FQE A;  1NNP A;  2HFB A;  3PPP A;  2HAU A;  2RIN A;  3LR1 A;  4OFJ A;  1BKA A;  4O3B A;  1ZMG A;  5DVI A;  4NF8 A;  1JQF A;  1IXH A;  3P7I A;  4FOR A;  1M5F A;  4AQ4 A;  1SVX B;  2HAV A;  4E0X A;  1FTK A;  3EPE A;  3PUV E;  1N04 A;  3K00 A;  3S9N C;  4Q8R A;  3R26 A;  1S9T A;  3MVZ A;  4ZEK A;  1M5C A;  2Z8E A;  3PU5 A;  3M3K A;  2QL3 A;  3OSR A;  1QUK A;  1R1N A;  2I4C A;  2WKY A;  3ZSF A;  4DXC A;  5B7D A;  2UVJ A;  3QIM A;  1FTJ A;  1WDN A;  2Q2C A;  3KOT A;  1LAF E;  1EH3 A;  1M5E A;  1TXF A;  2V3T A;  1QW0 A;  3PPN A;  4IGR A;  4YKK A;  3VFJ A;  4H5F A;  2HZL A;  3HHG A;  5I2N A;  3VLW A;  1BLF A;  2GRV A;  4IO3 A;  1B7U A;  3TMG A;  2XXU A;  1ZU0 A;  1MXY A;  1MQJ A;  2DQV A;  1WVJ A;  4F3G A;  2OZZ A;  2DE3 A;  2QMW A;  3N26 A;  2ZYK A;  4F31 B;  3HO7 A;  1HSL A;  5ICQ A;  4HCW A;  4FJP A;  1P1O A;  3O97 A;  5AA2 B;  5K2X A;  1B1X A;  4GWO A;  4F1V A;  1TT1 A;  2ZYO A;  3LC8 A;  2DSF A;  1Q35 A;  1ZJL A;  4WXJ A;  3Q28 A;  1SBP A;  5F7V A;  3G3K A;  3PD9 A;  4TLL B;  3TQL A;  3MVW A;  3FAS A;  2FYI A;  5I56 A;  2OJT A;  4EF2 A;  5BWJ A;  4EQ7 A;  4PE5 B;  2E1S A;  5TP9 A;  4JWO A;  3MVY A;  4U23 A;  2XXW A;  3H6W A;  4YKJ A;  2R9J A;  4NF4 B;  4ESW A;  3K0V A;  1II5 A;  1AL3 A;  3MVX A;  4WED A;  3FXU A;  3I3V A;  3MWB A;  3U93 A;  3V5A A;  5LOM A;  3EHT A;  4R2F A;  3KSX A;  4QHQ A;  2AYS A;  4RJZ A;  1MDP 1;  5I57 A;  4IO7 A;  1PB9 A;  4RNS A;  4U1O A;  1EZP A;  4LZ5 A;  3OOA A;  5CRY A;  5DT6 A;  5KDT A;  3LUY A;  1LB8 A;  4NTL A;  2O7I A;  3O66 A;  3IK6 B;  4QFL A;  3T93 B;  3C36 A;  3RQT A;  5JTY A;  3G3J A;  1TWY A;  1MXV A;  2AL4 A;  3PMX A;  4ZZA A;  3C31 A;  3Q25 A;  3UP9 A;  2O69 A;  4AB5 A;  2I4B A;  4GFR A;  4NF6 B;  5HPQ A;  4UA8 A;  4NE4 A;  1SYH A;  2W7Y A;  3A09 A;  3IJO B;  1ZBM A;  3DM0 A;  3ONM A;  3SEW A;  4DCY A;  4LON B;  1MQI A;  4X1B A;  1WOD A;  4QSD A;  1EZO A;  3MP1 A;  1B7Z A;  2Y7I A;  3DP8 A;  4NF4 A;  3A3C A;  1DOT A;  1B3F A;  4R75 A;  1RYX A;  1URG A;  1LBB A;  1Y4T A;  1OIB A;  3B6Q A;  3FXR A;  4LP2 B;  1RYO A;  2F7B A;  4IO4 A;  3VV5 A;  1Z7M E;  1B32 A;  4MFI A;  3VE1 B;  2XXP A;  5HBC A;  1J1N A;  1Q1K A;  2A5S A;  4FIM A;  5K2Y A;  3C35 A;  3HN0 A;  2PT1 A;  4OTE A;  4WKM A;  5FHO A;  3RNN A;  3TCG A;  3OEN A;  3U94 A;  4DIG A;  1ZTY A;  4ZE8 A;  5J1D A;  4QF9 A;  5KDT B;  2CMO A;  3C32 A;  3O6I A;  4F29 A;  5EYF A;  1ATG A;  1O63 A;  3S4U A;  1MY0 A;  3OD7 A;  3HPI A;  3LSX A;  1YTV A;  3E4R A;  3IOV A;  3K6W A;  5CMM A;  4ND9 A;  4RPO A;  3QXM A;  5IKB A;  1P1U A;  4P0G A;  1B0L A;  2PVU A;  2Q2A A;  3CSB A;  3T96 B;  3EQ1 A;  2V3U A;  1B52 A;  2DWI A;  3CFZ A;  3RUM A;  2I48 A;  3THI A;  3VLV A;  2O6A A;  1CE2 A;  4FAJ A;  3VVF A;  4ELQ A;  4NF5 B;  3KEI A;  2Y84 A;  3R6U A;  3B6W A;  3BKI B;  4LQ5 A;  4OES A;  1NMU A;  4H5G A;  2UYE A;  1SYI A;  2Z22 A;  4KCD A;  4YIC A;  1NH7 A;  1FW0 A;  1MY3 A;  2F35 A;  2OBG A;  3H6U A;  1IIT A;  3L6G A;  2Y7P A;  3QAX A;  4G8H A;  4GOT A;  4RPN A;  1LBC A;  3RLF E;  3W15 C;  3EN3 A;  3MQ9 A;  2XXT A;  1SDX A;  3I5O A;  4M1V A;  1B0H A;  1B1H A;  3GBB A;  2V25 A;  4R9G A;  4ELO A;  1Y20 A;  2DWA A;  3QSL A;  3SET A;  2P1S A;  1US5 A;  4LA9 A;  3H4Z A;  1YCJ A;  4OEN A;  1MRP A;  3SEU A;  1QJM A;  5ISU A;  1SI0 A;  3FD3 A;  5I59 A;  1M5B A;  2KLF A;  5TP9 B;  1PEB A;  2QJE A;  4MLQ A;  1N0T A;  1GR2 A;  3PUW E;  4ZEI A;  5I2N B;  4NED A;  1B6H A;  2YPN A;  1A7L A;  2VD3 A;  1PC3 A;  3TTL A;  5DEX A;  1VR5 A;  3E9X A;  5ITP A;  2HEU A;  4GRK A;  3DLN A;  4H8I A;  4BLA A;  1MG1 A;  4XXU A;  1QKA A;  4NF5 A;  2AIX A;  1R6Z A;  1BIY A;  5I57 B;  2CZL A;  3T9X B;  2F8D A;  4X48 A;  5AE4 A;  3PPO A;  3CI8 A;  1B7H A;  1XT8 A;  4GIZ A;  4OVJ A;  3E13 X;  3G3G A;  3TCF A;  2NXO A;  2R6G E;  3FV2 A;  3JYR A;  4P0I A;  3FIR A;  4JB7 A;  2QS4 A;  3EHU A;  1POT A;  4LUB A;  1GVC A;  3MC2 A;  4OER A;  4GLI A;  4OFL A;  4F22 A;  3AXF A;  1I6B A;  2VP1 A;  3IX1 A;  4OHN A;  1B3H A;  4POW A;  2UVI A;  2D5W A;  5ELV A;  3UN6 A;  4AB6 A;  4KQP A;  3IO4 A;  4F2O A;  3CFL A;  2D3I A;  1UIU A;  2X26 A;  4HW8 A;  5KZT A;  2THI A;  3S2V A;  3RPW A;  2VHA A;  4BDL A;  3IB1 A;  3PPQ A;  5L9O A;  4U1Z A;  1B4Z A;  2XXQ A;  1LLS A;  1B2H A;  1N76 A;  2VOZ A;  4GVO A;  3KJ7 A;  4PET A;  4YB6 A;  5DEX B;  5AA4 A;  1PB8 A;  3C4M A;  2RC9 A;  5A5X B;  5H8S A;  1B05 A;  2HZK A;  3L6H A;  2ONS A;  4YU0 A;  5FHM A;  3B6T A;  3RT8 A;  3JV9 A;  5AA4 B;  2XD2 A;  4G68 C;  1MPD A;  3TAJ A;  1HSJ A;  3G3I A;  3PGF A;  4TOZ A;  3OMB A;  3QYT A;  4ZS9 A;  4L17 A;  4NF8 B;  3K2D A;  3TCH A;  4YMB A;  4LQ2 A;  3K6U A;  4G77 A;  4PFY A;  2ZYM A;  4F1U A;  1SW4 A;  2RF1 A;  1PBQ A;  4XIG Q;  1MM7 A;  1USY E;  3LSL A;  3K01 A;  3TDJ A;  4K3F A;  1QUI A;  1B5J A;  1IZ1 A;  1UTH A;  3VLU A;  3KBR A;  1F9B A;  5L9M A;  3ECR A;  3MAM A;  4TLM B;  4ZE9 A;  1JW4 A;  3FV1 A;  4C1T A;  1I69 A;  1S50 A;  1XVY A;  2I6E A;  3MZ9 A;  4F39 A;  1IUD A;  1P99 A;  1FQB A;  3H3G A;  4N13 A;  1A54 A;  1NFT A;  2PX1 A;  2YJP A;  3QUF A;  3H7M A;  5H8N A;  2DS9 A;  4JSO A;  1OQH A;  2F7A A;  4NMY A;  2F6G A;  3KG2 A;  2QS3 A;  2XX9 A;  3CRB A;  5TPA B;  3H03 A;  2P2A A;  4RK9 A;  1RKM A;  4YZZ A;  3TKD A;  4YMA A;  3B7D A;  4YB7 A;  5CBS A;  4XKQ A;  3FVK A;  5CMB A;  4EXL A;  4G68 B;  4MLV A;  4BDQ A;  1DTZ A;  1MM6 A;  1DTG A;  3GBA A;  3U8Q A;  1I6Q A;  3UOR A;  4ECF A;  1MQG A;  4U21 A;  1ZKB A;  4Q0C A;  3ZS6 A;  5I56 B;  3KN7 A;  3T9V A;  3CIJ A;  4ZEF A;  1JEV A;  3OEM A;  2HCA A;  4F3P A;  3Q26 A;  4Q5T A;  3TOD A;  3CR9 A;  3DP6 A;  5CC2 A;  4MH5 A;  1R9L A;  1MH4 A;  3O29 A;  4QFK A;  2DVC A;  4R74 A;  4QFN A;  4R9F A;  1JVX A;  4OWD A;  5KCJ B;  2XXR A;  1Y9U A;  3ZKL A;  4OET A;  2O1M A;  4G8N A;  4O3A A;  5H8Q B;  4R6Y A;  3IOW A;  4BDM A;  1PBP A;  1N7W A;  1XS5 A;  2H25 A;  2M8C A;  2A5T B;  3MPK A;  4I62 A;  4KFQ A;  3U1O A;  4F19 A;  3TQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...