2XXWA

Crystal structure of the gluk2 (glur6) d776k lbd dimer in complex with glutamate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
250
structure length
250
Chain Sequence
RSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRKKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
total genus 78
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxwA02
4Q5TA 2QS4A 2ZXTA 4R6YA 5AA4B 1Y20A 4WEPA 3QYTA 3TAJA 1RYOA 2P0SA 3EN3A 3TPAA 4F19A 4PETA 4GOTA 5DEXB 3IORA 1IUDA 5I84A 1GGGA 1IXIA 5H8HA 5TP9B 4YMBA 3VVDA 5TPAB 3IB1A 2XX8A 3A3UA 2GFEA 2UVHA 2I48A 3DP8A 4F39A 3H06B 1R6ZA 1QKAA 3K1PA 5K2YA 4F3GA 4G77A 1VFDA 1M5FA 2Z8EA 5H8QA 3M3LA 4EDPA 3TCHA 4FECA 4QSCA 4ZDMA 3RNNA 1SQYA 2Y7PA 4ESWA 2A5TB 2GHBA 4H67A 4PFWA 3W9VA 3FVGA 2FA7A 2NUVA 5EHMA 5DVFA 4WEDA 4JWXA 2REJA 4JSOA 1FQAA 2O68A 3TKDA 1MXUA 1A8EA 4IO2A 3CSGA 2ONRA 1J1NA 5H8FB 4H5FA 1URSA 1PBPA 5B7DA 5ICTA 4N6PA 2QL3A 3Q25A 3HHFA 4G2ZA 2NXOA 3K6WA 3DP6A 3A3CA 3H6WA 2H25A 2H9BA 3TZAA 4NF5B 4X9TA 2PT1A 2I0CA 5CBRA 3BKIB 1BKAA 1UTBA 1QUJA 3TTMA 3G3JA 4DXCA 3TMGA 4IO5A 4ZECA 1MY3A 5ITOA 5AA2D 1XHYA 3B6QA 4JXIA 3PUWE 5AA3A 3BBRA 3O97A 5AA2B 3K4UA 3CFXA 3VLVA 3THIA 3RTFB 4G68B 2NWJA 2XXUA 3OSQA 2PVUA 3C32A 3O29A 5FTIA 4Q0CA 4I8CA 3O6HA 3GBAA 1BLFA 5ICQA 4NWDA 2G93A 2F5XA 3KGCA 5I57A 3ZSFA 5FHMA 4MF3A 1QULA 2HCAA 3M3KA 4UACA 4YKJA 4DXUA 5AA1A 4OEUA 3IJXB 1YCJA 1DTGA 3MZ9A 3TUSA 2XXTA 1M5CA 1FTLA 4LUBA 1JVYA 1GV8A 2XD2A 3MAMA 3OO7A 5HPQA 2F34A 1SI0A 1IXCA 2OZZA 1XVYA 2AYSA 4IY6A 3N94A 4XKQA 4RNSA 5HBCA 1Y4CA 4NTLA 3UORA 2DE2A 3RLFE 4GVOA 4KR5A 1JQFA 3Q29A 1MDP1 2ABHA 1VE4A 3G3IA 3ILTB 4OWDA 4F3PA 4F29A 2Z8DA 3MW0A 3KJ7A 5I2NB 3Q26A 4H6DA 2YJPA 3QUFA 1LSTA 1ELJA 3EF7A 2WKYA 3G7WA 3N26A 2OCUA 4GQOA 3FJMA 3PUVE 4POXA 3HHGA 2OJTA 4HS7A 1I6BA 2D5WA 1FTKA 1T0KA 3E9XA 3RT6B 5K2XA 2RC8A 3CG3A 4NMYA 3MVXA 5LOMA 1AMFA 4IO6A 3KZGA 3H6TA 1LLSA 1FQEA 3L6GA 1TFDA 4I9DA 1SBPA 1F9BA 1D4NA 1I6QA 3MZBA 2UXAA 4THIA 1PC3A 3PMVA 3QK6A 4R6HA 4IO4A 2PT2A 2A5SA 1GVCA 2DE3A 1PBQA 3O28A 2B3FA 4GFRA 4R9FA 1PB7A 3N6UA 2DYXA 3L6HA 4FATA 4R9GA 1HSJA 3TODA 1B32A 2QMWA 1MY1A 4OHNA 1B46A 1O63A 3TEPA 1MM6A 3U72A 5H8NB 1QJMA 1WDNA 3T22A 4PQJA 3N5LA 3B7DA 3IAZA 2D3IA 3C4MA 3IX1A 3CFLA 1FTMA 4F3SA 3Q27A 2DP8A 4LZ5A 5A5XB 5DYHA 2Z8FA 1TWYA 3MVYA 4EQ7A 3K01A 3JV9A 1N04A 3U94A 1IITA 4QFNA 5IKBA 1USYE 1OQHA 3VVEA 1O7TA 2IEEA 1S50A 5EYFA 4BDRA 2F7AA 2UVGA 3PD9A 2PMSA 3D4GA 1S7YA 4Z7EA 1OIBA 3S4UA 2NVUB 1B3LA 1Z7ME 4H1XA 3S9LC 1EZOA 1LAGE 3H03A 4O3BA 3ZS6A 3PPOA 3QUJA 4ELPA 1DPPA 1MQGA 3PU5A 4OYVA 3PPRA 4RY1A 4FAJA 2R6GE 4G8NA 3TQLA 3FZVA 4ESXA 1DPEA 3PGFA 3SERA 3SEYA 1ZJLA 3LC8A 3OELA 2V25A 1DSNA 4NF8A 1JEVA 1HSEA 4ECFA 1FTOA 1B52A 4G4PA 2AL4A 1N7XA 3RTWB 4DCXA 4IO3A 3K1NA 3DLNA 5I56B 3TQWA 2UVIA 1YPNA 3IO4A 2FNCA 2HAUA 3FJGA 4RYAA 1B5IA 3MP8A 4F2OA 2ANJA 1ZU0A 1LFHA 3I5OA 3AXFA 3KFMA 2DSFA 3MUQA 3KN3A 5I58B 3HCQA 3UGWA 2V84A 4C1TA 4XKNA 3IOTA 1FQCA 1IQ7A 2XXYA 3BFUA 4LZ8A 5EHSA 5KCJA 3C35A 3CVGA 3FVNA 3SDFA 3KEIA 3C36A 5DVJA 4R72A 1B3HA 1LAHE 4OZ9A 2Y84A 4PP0A 1MXZA 3RY3A 1MXYA 3OMBA 4YB6A 4O3AA 5JTYB 4WKMA 3FV2A 3V89B 4GXAA 1P1QA 3MQ9A 5CBSA 3RGYA 4FORA 3R7XA 3P7IA 1XS5A 1ZKBA 3UP9A 1Y1ZA 1KWHA 2RINA 3VDFA 1OQGA 4LVQA 5F1QA 3SESA 1URDA 1JEUA 2QMXA 2V3UA 1B51A 4H8IA 4TLMB 1OVBA 3CR9A 4LATA 5L9MA 2Q89A 1BP5A 1Y3PA 1A8FA 4IY5A 3MC2A 4IGTA 3SEWA 3KSXA 3E3KA 2DVCA 1LFGA 2XXRA 3PV0E 2G29A 4R73A 1S9TA 4F18A 2LAOA 2RC9A 3DM0A 1OLAA 5I2KB 3ZKKA 4F1UA 1LFIA 5F7VA 4GD5A 3HO7A 3KBRA 1VSOA 3CRBA 5KDTB 5CRYA 1B9JA 3LSLA 4FEBA 4TQUQ 2F7BA 1AOVA 3OO6A 1ZBMA 4M1VA 3HV1A 1I69A 1MQHA 4N13A 3TCFA 1OMPA 4XXUA 1FCKA 4GIZA 2Y7RA 4TLLB 3U8QA 3E13X 5CC2A 3ONMA 1VFEA 3IL1B 1JNFA 3TTLA 1MY4A 4RPNA 1WODA 2QRYA 3KOSA 3OEMA 3SKPA 5I59B 4PFTA 1SW2A 1ZTYA 1SW5A 2M8CA 3VXCA 1USYH 1WVJA 3EHUA 3PMWA 4XIGQ 1P1UA 4MH5A 4DE8A 2I3WA 3FD3A 4FIMA 4R74A 4NF4A 3TCGA 3VE1B 4GWOA 4QFLA 3S9MC 3CI8A 1B3EA 2Q2CA 4ELRA 2H99A 2E1SA 4QFOA 1JW5A 2RF1A 1GTKA 1SI1A 1Z7NE 2RCAA 3H6UA 4G68C 2XXVA 2ZMBA 1N84A 4FJPA 3KG2A 5JK4A 2ZYKA 2QS2A 2P2AA 3LBSA 5H8HB 3TELA 1US5A 5KZTA 1H3DA 4N07A 2AIXA 4NWCA 1R1NA 2O7UA 3VXBA 2ZNTA 4H0WA 4XTCQ 5H8QB 1TXFA 1RYXA 3LSXA 3TDJA 3O6IA 1PB8A 1SDXA 4ZEIA 4JDFA 1MQDA 4U4SA 4LP2B 2I4CA 2UYFA 4E0XA 2HQ0A 4ZEDA 2GHAA 4OTEA 1QVSA 4GRKA 2XXHA 2Z22A 4NEDA 1UQWA 2UVJA 2DS9A 1IIWA 3FIRA 2F36A 2I6EA 2ZYMA 3K0VA 3F11A 1CB6A 5CMCA 4F3BA 3PUXE 3SETA 1UTBB 1Y1MA 4PE5B 3H3GA 4GXSB 4KQPA 4QSDA 3EQ1A 4OFLA 4ND9A 3EPEA 4YICA 3UK4A 3O6GA 3FASA 5FTHA 1FTJA 4GL0A 3O2AA 3ZKLA 3O66A 1H45A 4JWOA 3MPKA 1B7UA 5TU0A 2O84X 1D9VA 1A7LA 2PX1A 2NOOA 4F31B 2XHDA 4EQ9A 5ITPA 3LUYA 5I57B 2OLBA 4F1YA 2X26A 3O9PA 1N7WA 1P1NA 1CE2A 3K1MA 3MVZA 2CMOA 4NF6A 3VFJA 3K02A 2F6PA 3G3KA 2V93A 4PFYA 4U23A 2HFBA 1AL3A 4OQOA 2V3TA 4LQ2A 1P1OA 4U21A 1I6AA 3EHTA 4EF1A 2VHAA 1LAFE 2UYEA 1UTHA 3SEXA 2REGA 2VP1A 3DP4A 2OWSA 2XXWA 3FGSA 1IXHA 4FEDA 1MXVA 4KYEA 2RCBA 1LCTA 4TOZA 3M3FA 1BIYA 3U1OA 3OO8A 1ZLQA 3I3VA 4YZZA 1EH3A 1TT1A 1SW1A 1B2HA 3HPIA 2O69A 3BFTA 3FUZA 3PUYE 2Z23A 5FHOA 2O6AA 3B6WA 1PDAA 2X7QA 3H4ZA 4FE8A 3K2DA 3RUMA 4RK9A 4YU0A 3MJNA 4BLAA 1OVTA 4OFOA 4E0WA 1QKBA 2HZKA 4IB2A 4M4GA 1NNFA 4RXLA 4Z0IA 1POY1 3PPQA 1MQJA 2YPNA 5AA4A 1LB9A 2QSXA 4OXVA 4U1ZA 1JW1A 1UIVA 3U92A 4P11A 3IB0A 5DEXA 3OOAA 2YLNA 2XX9A 1OLCA 4G8HA 5ISUA 1PB9A 3JZJA 5AE4A 3KN8A 5TP9A 3QSLA 3LSWA 4OFJA 5IAIA 5TPAA 1NNPA 1QW0A 2ZNUA 3VLUA 3S2VA 3MPLA 3FXUA 4QF9A 4GF8A 1Q35A 3UA8A 1R9QA 5DVIA 4BDLA 1UIUA 2H4IA 2P1SA 4F1VA 1B3FA 4BDQA 3RPWA 2DWJA 4H5GA 1EZ9A 2A5TA 1MM7A 3A09A 4H8JA 4MBPA 2ONSA 4LZ7A 4Q30B 2GH9A 3FXQA 4QFKA 3E4RA 1BTJA 2F97A 1EZPA 1H43A 4NF6B 4X1BA 1JW4A 2ZYOA 3FVKA 4WXJA 3KOTA 5BUUA 1AIVA 2XXQA 3PUZE 5H8FA 4LQ5A 3VLWA 3FVOA 1Y3QA 3RN8A 1XOCA 2VD3A 4DCYA 4K3FA 5CI5A 2DWHA 1UTHB 3QAXA 3G3FA 1HSLA 1FQBA 4OENA 4YKPA 4NF5A 3PPPA 4R2FA 1B1HA 3ODBA 3W15C 4ZEFA 4OEVA 4KYDA 5DTBA 4DZ1A 1JETA 3USDA 1H44A 1LBCA 5AA2A 4I1DA 2VGQA 3IOVA 2F7CA 3K6XA 1DOTA 4IO7A 1ZMGA 2HEUA 4G68A 1GR2A 1DMBA 2V3QA 3GXAA 4YB5A 1B5HA 1XVXA 4ZE8A 1D9YA 3T96B 1JVXA 3EHSA 1LAXA 1ATGA 1POTA 1B6HA 4YMAA 4C0RA 1US4A 4C1UA 4X48A 1MDQA 4KCCA 3T93B 3UN6A 1II5A 5JEIA 5BWJA 4NF8B 2QS3A 1N3XA 3W9WA 3T9VA 4L17A 3LR1A 1B1XA 4ONYA 1EU8A 3IO6A 4YB7A 4EXLA 2F78A 1B7HA 2Y7KA 2GRVA 1MPBA 4HCYA 5HM4B 1Y9UA 4LA9A 4BDMA 3N6TA 1MY2A 4U4XA 3T9HB 4LONB 1MXXA 3IOWA 1NKXA 3OSRA 5L9SA 3MP6A 3IOUA 3TTNA 4AB6A 1MY0A 1FQFA 2ESNA 4DXBA 2ZYNA 4XKPA 5KCJB 2ONKE 5I2NA 2I0BA 1B40A 4ISUA 3TTKA 1A54A 2DVZA 1B58A 1IEJA 1MPDA 2B3BA 1B0HA 4RPOA 4H65A 3V8XB 1VR5A 1LBBA 3H6VA 5CMBA 3MP1A 2H5YA 1MH3A 3CG1A 3ECRA 2Y7IA 1SVXB 1L5TA 3C9HA 4JB7A 1FQDA 1Q1KA 4POWA 4OMBA 3IB2A 2RKMA 1H76A 3LSFB 1SYHA 3T9XB 1YTVA 5H8SA 4QRZA 3FATA 1MRPA 1URGA 3MZ1A 4ZZEA 3JYRA 5L8DA 4OETA 2PBWA 3PMXA 4YAHX 2Q2AA 2X7PA 5H8NA 3K6UA 2ALUA 2DXYA 4RA1A 2XXXA 3GZGA 1D3KA 1MG1A 1XC1A 5A5XA 3MVWA 2F35A 2O51A 2THIA 5DT6A 1NH7A 2KLFA 1YAEA 2Y7WA 3IK6B 4PFUA 1A40A 1NL5A 2CZLA 4KI0E 4XKRA 2OBGA 1NMUA 1LB8A 4DDDA 5CMMA 2I4BA 2DWIA 3R6UA 3C33A 1MXWA 4U1OA 2PYYA 4ZE9A 2ZNSA 2AL5A 1XT8A 1Y4TA 1N0TA 4KPTA 3MWBA 3MBPA 4UA8A 2XXPA 4ZS9A 2IA4A 3TFLA 1NH8A 4EQBA 4EF2A 4AB5A 4F2QA 3HN0A 3WAFA 4IGRA 3H7MA 1IXGA 4NF4B 3QXMA 1LGBC 4U22A 4OESA 5L9OA 3V83A 2DOJA 3KN7A 1B4ZA 4KYSA 1B4HA 1DTZA 4ZZAA 5CMKA 3G3GA 3GLBA 2VD2A 1TFAA 1PEBA 2Q9TA 3S9NC 2BJJX 4KFQA 5FHNA 5I56A 1Y3NA 4JWYA 2DQVA 2O1MA 4GL8A 3V5AA 3K00A 1NNKA 3T9UA 3I6VA 3G3HA 3T66A 5I58A 1AH5A 3D4CA 3TTRA 4YKKA 3FV1A 1B0LA 1M5EA 3PPNA 1RKMA 3B6TA 1SYIA 3VV5A 4MFIA 2QS1A 1B5JA 4DLDA 2I3VA 3TYHA 3OENA 4F22A 4MLVA 4JSDA 3DELB 2Q8JA 3PD8A 2H98A 2HXWA 4R6KA 1P1WA 1M5BA 1QUIA 3RT8A 3OO9A 2DXRA 2F8DA 2XXIA 1ZIUA 4HTGA 4HW8A 2OWTA 4OERA 5JTYA 3OD7A 2W7YA 1NNTA 2XD3A 1MH4A 3WAEA 2O7IA 1NFTA 1FW0A 5M2VA 1B7ZA 3FXRA 4KHZE 4KCDA 4MLQA 2DE4A 4BDOA 5ELVA 2O1LA 5B70A 2B65A 4ELOA 4KD5A 4P0IA 3RQTA 4P0GA 3K6VA 4YKIA 3C31A 4JBZA 1ANFA 3GBBA 4RK2A 3VVFA 1A99A 2OK2A 1SW4A 4X1DA 4EXKA 3Q28A 2DWAA 4ZEKA 1QUKA 3CSBA 2QPQA 3IJOB 5I2KA 4RJZA 2VOZA 4U2RA 3CFZA 4I62A 3OEKA 5KDTA 2I58A 2F6GA 3OXNA 1P99A 2RC7A 2XX7A 1MS7A 3QIMA 4QHQA 2E0SA 3UIFA 4R2BA 4GLIA 1B05A 4ZEBA 3KJTA 3FJ7A 4EUOA 4OVJA 2I49A 4QSEA 4R75A 1O64A 3CIJA 5J1DA 4G8MA 1MPCA 1LCFA 1N3WA 2FYIA 2Q88A 4ELQA 3ILUB 3S9EA 3C34A 1SD3A 4O3CA 3M8UA 4BDNA 3KSJA 3SEVA 5I59A 4HCWA 3SEUA 3HSTA 1MQIA 1A55A 4NE4A 4AQ4A 1B3GA 1N76A 3IR1A 2HZLA 2QJEA 2D21A 2HAVA 4DIGA 4Q8RA 1IZ1A 3R26A 1R9LA 4QFPA 2R71A 1M5DA 3U93A 5CM6A 2R9JA
chains in the Genus database with same CATH superfamily
4Q5TA 1FPGA 2QS4A 2ZXTA 4R6YA 3T1BA 1IMFA 1Y20A 5AA4B 4N6KA 2FIEA 4WEPA 3QYTA 3TAJA 4PGPA 1RYOA 2P0SA 3EN3A 3TPAA 4F19A 4PETA 4GOTA 5DEXB 2HHMA 3IORA 1IUDA 5I84A 3B50A 1GGGA 1IXIA 5H8HA 1IMDA 1FPDA 2JJKA 5TP9B 4O94A 4YMBA 4UABA 5TPAB 3VVDA 3IB1A 2XX8A 3A3UA 2GFEA 2UVHA 2I48A 3DP8A 4F39A 3H06B 1R6ZA 1QKAA 3K1PA 5K2YA 4F3GA 4G77A 1VFDA 4P9KA 1M5FA 2Z8EA 5H8QA 1LBXA 3M3LA 4EDPA 3TCHA 4FECA 4QSCA 4OVTA 4ZDMA 3RNNA 1SQYA 2WYPA 5I3SA 2Y7PA 4ESWA 2A5TB 2GHBA 4H67A 4PFWA 4PGNA 3W9VA 2B4LA 3FVGA 2FA7A 1BK4A 2NUVA 5EHMA 5DVFA 4WEDA 4JWXA 2REJA 4JSOA 1FQAA 2O68A 3TKDA 1MXUA 1A8EA 4IO2A 3CSGA 2ONRA 1J1NA 5H8FB 1NV4A 4H5FA 1URSA 1PBPA 5B7DA 5ICTA 3PTYA 4N6PA 2QL3A 3Q25A 2CZIA 3HHFA 4G2ZA 2NXOA 3K6WA 3DP6A 3A3CA 4PDHA 3H6WA 2H25A 2H9BA 3TZAA 4NF5B 4X9TA 2PT1A 2I0CA 5FBPA 5CBRA 3BKIB 1BKAA 1NV5A 1UTBA 1QUJA 4GWZA 3TTMA 3G3JA 4PDDA 4DXCA 3TMGA 4IO5A 4ZECA 4PC9A 1MY3A 5ITOA 5AA2D 1XHYA 3B6QA 4JXIA 3PUWE 5AA3A 3BBRA 3O97A 2OX3A 5AA2B 5EQ7A 3K4UA 3CFXA 3VLVA 3THIA 3RTFB 4G68B 2NWJA 2XXUA 3OSQA 5ET8A 2PVUA 3C32A 1JP4A 3O29A 1Q9DA 5FTIA 4Q0CA 4I8CA 3O6HA 3GBAA 1BLFA 1AWBA 5ICQA 5EQAA 4PF8A 1LBWA 4NWDA 2G93A 2F5XA 3KGCA 5I57A 3ZSFA 3FXBA 4MF3A 5FHMA 1QULA 2HCAA 3M3KA 4UACA 4YKJA 4DXUA 5AA1A 4OEUA 3IJXB 1YCJA 1DTGA 3MZ9A 3TUSA 2XXTA 4GWYA 1FBGA 1M5CA 4MNIA 5IGAA 4N8GA 1FTLA 4LUBA 1JVYA 1GV8A 2XD2A 3MAMA 3OO7A 3HFUA 5HPQA 1NV1A 2F34A 1SI0A 1IXCA 2OZZA 3LV0A 1XVYA 2AYSA 4IY6A 3N94A 4XKQA 4RNSA 5HBCA 1Y4CA 4NTLA 3UORA 2DE2A 5ET7A 3RLFE 4GVOA 4KR5A 1JQFA 3Q29A 1MDP1 2ABHA 1VE4A 3G3IA 2Q8MA 4MAGA 3ILTB 2HPGA 4OWDA 4F3PA 2V4CA 4F29A 5LTCA 2XWOA 3KBZA 2Z8DA 3MW0A 3KJ7A 5I2NB 3Q26A 4FBPA 4H6DA 2YJPA 3QUFA 1LSTA 4GWSA 1ELJA 1LBVA 3EF7A 2WKYA 3G7WA 3N26A 1NUYA 2OCUA 4GQOA 3FJMA 3PUVE 4POXA 3HHGA 2OJTA 4HS7A 1EYKA 1I6BA 2D5WA 1FTKA 1T0KA 3E9XA 3RT6B 5K2XA 2RC8A 3CG3A 4NMYA 3E78A 4PBQA 3MVXA 5LOMA 1AMFA 4IO6A 3KZGA 5EYGA 3H6TA 1LLSA 1FQEA 3L6GA 1TFDA 4I9DA 1SBPA 1F9BA 1D4NA 1I6QA 4MHFA 3MZBA 2UXAA 4THIA 1PC3A 3PMVA 3QK6A 4R6HA 4IO4A 2PT2A 2A5SA 1GVCA 1G0IA 2DE3A 1PBQA 3O28A 4OVSA 2B3FA 4H46A 4GFRA 4R9FA 1PB7A 3B8BA 3N6UA 2DYXA 3L6HA 4FATA 4R9GA 1HSJA 3TODA 1B32A 2QMWA 3RPLA 1MY1A 4OHNA 1B46A 1O63A 3TEPA 3QMFA 1MM6A 3U72A 1DCUA 5H8NB 1QJMA 1WDNA 3T22A 4PQJA 5J16A 5ET6A 2B4MA 3N5LA 3B7DA 3IAZA 2D3IA 3C4MA 3IX1A 3CFLA 1FTMA 4F3SA 3Q27A 2DP8A 4LZ5A 5A5XB 5DYHA 2Z8FA 1TWYA 3MVYA 4EQ7A 3K01A 3JV9A 1N04A 3U94A 1IITA 4QFNA 5IKBA 1USYE 1OQHA 3VVEA 1O7TA 4PE3A 2IEEA 2QVUA 1S50A 5EYFA 4BDRA 2F7AA 2UVGA 3PD9A 4PAIA 4JVIA 2PMSA 5EYHA 3D4GA 1S7YA 4Z7EA 1OIBA 1LBZA 3S4UA 2NVUB 1B3LA 1Z7ME 4H1XA 3S9LC 1EZOA 1LAGE 3H03A 1NV3A 4NQ8A 4O3BA 3ZS6A 3PPOA 3QUJA 4ELPA 1DPPA 2L5VA 1MQGA 3PU5A 4OYVA 3PPRA 2KR0A 4RY1A 4FAJA 1FBFA 2R6GE 1IMBA 5ESYA 4G8NA 3TQLA 3E79A 3FZVA 4ESXA 4OANA 1DPEA 3PGFA 3SERA 3SEYA 1ZJLA 3LC8A 3OELA 2V25A 4I3EA 1DSNA 4NF8A 5IM2A 1JEVA 1FBEA 1HSEA 4ECFA 1FTOA 1B52A 4G4PA 2AL4A 1N7XA 3RTWB 4DCXA 4IO3A 3K1NA 3DLNA 5I56B 3TQWA 2UVIA 4GWWA 1YPNA 4P3LA 3IO4A 2FNCA 4P47A 1INPA 2HAUA 3FJGA 3T0JA 4NN3A 4RYAA 1B5IA 1VDWA 3MP8A 4F2OA 2ANJA 1ZU0A 1LFHA 3I5OA 3AXFA 3KFMA 2DSFA 3MUQA 1FBPA 3KN3A 5I58B 3HCQA 4PF6A 3UGWA 4QBAA 4N4UA 2V84A 3MYUA 1DBZA 4C1TA 4XKNA 3IOTA 1FQCA 1IQ7A 2XXYA 3BFUA 4LZ8A 5EHSA 5KCJA 3C35A 3CVGA 3FVNA 3SDFA 3KEIA 4MIJA 1KA1A 2WBDA 3C36A 5DVJA 4NGUA 4R72A 2MKZA 1B3HA 1LAHE 4OZ9A 2Y84A 4PP0A 1MXZA 3RY3A 1MXYA 3OMBA 4YB6A 4O3AA 5JTYB 4PFBA 4MCOA 4WKMA 3FV2A 3V89B 3CHGA 4GXAA 2BJIA 1P1QA 3MQ9A 5CBSA 3RGYA 4FORA 3R7XA 3P7IA 1XS5A 1FPBA 2WEFA 1ZKBA 3UP9A 1Y1ZA 1KWHA 2RINA 3VDFA 1OQGA 4LVQA 5F1QA 3SESA 1URDA 1JEUA 2QMXA 2V3UA 1B51A 4H8IA 4QXDA 4X8RA 4TLMB 1OVBA 3CR9A 4LATA 5L9MA 2Q89A 1BP5A 1Y3PA 1A8FA 4IY5A 3MC2A 4IGTA 3SEWA 3KSXA 3E3KA 2DVCA 4NG7A 1LFGA 2XXRA 3PV0E 2OWZA 2G29A 4R73A 1S9TA 4F18A 2LAOA 2RC9A 3DM0A 1OLAA 5I2KB 3ZKKA 4F1UA 1LFIA 5F7VA 4GD5A 3HO7A 3KBRA 1VSOA 3CRBA 5KDTB 5CRYA 1B9JA 1FPFA 3LSLA 4FEBA 4TQUQ 2F7BA 1AOVA 1FJ9A 3OO6A 1ZBMA 4M1VA 3HV1A 1I69A 1MQHA 4N13A 3TCFA 1OMPA 4XXUA 1FCKA 4GIZA 2Y7RA 4TLLB 3U8QA 3E13X 5CC2A 5IZ3B 3ONMA 1VFEA 3IL1B 1JNFA 3TTLA 1MY4A 4RPNA 1WODA 2QRYA 3D1RA 3KOSA 5F24A 3OEMA 3SKPA 5I59B 4PFTA 1SW2A 1ZTYA 1SW5A 2M8CA 3VXCA 1USYH 1WVJA 3EHUA 3PMWA 4PAFA 4XIGQ 1P1UA 5I5PA 4OVRA 4MH5A 4DE8A 2I3WA 3FD3A 4IR8A 4FIMA 4R74A 1NV0A 4NF4A 3TCGA 1FPIA 3VE1B 4GWOA 4QFLA 3S9MC 3A29A 3CI8A 1B3EA 2Q2CA 4ELRA 2H99A 2E1SA 3IFAA 4QFOA 1YYZA 1JW5A 2RF1A 2CZHA 1GTKA 1SI1A 1Z7NE 2RCAA 3H6UA 4G68C 2XXVA 2ZMBA 1N84A 4FJPA 1FSAA 3KG2A 5JK4A 2ZYKA 2QS2A 2P2AA 3LBSA 5H8HB 1NV7A 3TELA 1US5A 5KZTA 1H3DA 4N07A 2AIXA 4NWCA 1R1NA 2O7UA 3VXBA 2ZNTA 4H0WA 4XTCQ 5H8QB 1TXFA 1RYXA 3LSXA 3TDJA 3O6IA 1PB8A 1SDXA 4ZEIA 4JDFA 2QFLA 2FIXA 1MQDA 2WBBA 4N15A 4U4SA 1FPLA 4LP2B 2I4CA 2UYFA 4E0XA 4KXPA 2HQ0A 4ZEDA 2GHAA 4OTEA 1QVSA 4GRKA 2XXHA 2Z22A 4NEDA 1UQWA 2UVJA 2DS9A 1IIWA 4JVDA 3FIRA 2F36A 2I6EA 2ZYMA 3K0VA 3F11A 1CB6A 1FJ6A 4O7MA 1FBDA 5CMCA 4F3BA 3PUXE 3SETA 1UTBB 1Y1MA 4PE5B 3H3GA 4XEQA 2F3BA 4GXSB 4KQPA 5EQ9A 4QSDA 4N81A 4N17A 1LEVA 3EQ1A 4OFLA 2CZKA 4ND9A 3EPEA 4YICA 3UK4A 3O6GA 3FASA 5FTHA 1FTJA 4GL0A 3O2AA 3ZKLA 3O66A 1H45A 4JWOA 3MPKA 1B7UA 5TU0A 2O84X 1D9VA 1A7LA 3FBPA 4MNPA 2PX1A 2ZZVA 2NOOA 4GBVA 4F31B 2XHDA 4EQ9A 5ITPA 3LUYA 5I57B 1FTAA 2OLBA 1NI9A 4F1YA 2X26A 3O9PA 2DDKA 1N7WA 1P1NA 1CE2A 3K1MA 3MVZA 2CMOA 4NF6A 3VFJA 3K02A 2F6PA 3G3KA 2V93A 4PFYA 4U23A 2HFBA 1AL3A 4OQOA 3BIHA 3LUZA 2V3TA 4LQ2A 1P1OA 4U21A 4JVCA 4LN5A 1I6AA 1FPKA 3EHTA 4EF1A 2VHAA 1LAFE 2KQZA 1UTHA 2UYEA 3SEXA 2REGA 2VP1A 3DP4A 1YXIA 2OWSA 2XXWA 3FGSA 1IXHA 4FEDA 1MXVA 4KYEA 2RCBA 1LCTA 5DW8A 4TOZA 3M3FA 4GX4A 3IFCA 1BIYA 3U1OA 5I7IA 3OO8A 1ZLQA 3I3VA 4YZZA 2VPOA 1EH3A 1TT1A 2CEXA 1SW1A 1B2HA 3HPIA 2O69A 3BFTA 3FUZA 3KC0A 3PUYE 4P56A 2Z23A 1QGXA 5FHOA 2O6AA 3B6WA 1PDAA 2X7QA 3H4ZA 4FE8A 3K2DA 2F3DA 3RUMA 4RK9A 4XFEA 4YU0A 1XI6A 3MJNA 4BLAA 1OVTA 4OFOA 4E0WA 3ROJA 1QKBA 2HZKA 4IB2A 4NHBA 4M4GA 1NNFA 4AS4A 4RXLA 4Z0IA 1POY1 3PPQA 1MQJA 2YPNA 5AA4A 1LB9A 2QSXA 4OXVA 4N6DA 5EQ8A 4U1ZA 1JW1A 1UIVA 2XWKA 3U92A 4P11A 3IB0A 5DEXA 2R8TA 3OOAA 2YLNA 2XX9A 4MNCA 2FHYA 1OLCA 4G8HA 5ISUA 1PB9A 3JZJA 2CEYA 3KN8A 5AE4A 5TP9A 3QSLA 3LSWA 4OFJA 5IAIA 5TPAA 1NNPA 1QW0A 2ZNUA 3VLUA 3S2VA 3MPLA 3FXUA 4QF9A 4GF8A 1Q35A 4O8MA 3UA8A 1R9QA 5DVIA 4BDLA 1UIUA 2H4IA 2P1SA 4F1VA 1B3FA 4BDQA 3RPWA 2DWJA 4H5GA 1EZ9A 2VT5A 2A5TA 1MM7A 3A09A 4H8JA 4MBPA 2ONSA 4LZ7A 4PFRA 4Q30B 3RPLB 2GH9A 3FXQA 4QFKA 3E4RA 1BTJA 3KC1A 2F97A 1EZPA 1H43A 4NF6B 4X1BA 1JW4A 2ZYOA 3FVKA 4WXJA 3KOTA 5BUUA 1AIVA 2XXQA 3PUZE 4GX3A 4GWUA 5H8FA 4LQ5A 3VLWA 3FVOA 1Y3QA 3RN8A 1XOCA 2VD3A 4DCYA 4K3FA 5CI5A 2DWHA 1UTHB 1FPEA 3QAXA 1NUWA 3G3FA 4GWXA 1HSLA 4OVQA 1FQBA 4OENA 4YKPA 4NF5A 3PPPA 4R2FA 1B1HA 4N8YA 3ODBA 1RDYA 3W15C 4ZEFA 4OEVA 4KYDA 5DTBA 4DZ1A 1JETA 2WX9A 3USDA 1H44A 1LBCA 5AA2A 4I1DA 2VGQA 3IOVA 2F7CA 3K6XA 1DOTA 1SPIA 4IO7A 1ZMGA 2HEUA 4G68A 1GR2A 1DMBA 2V3QA 3GXAA 4NAPA 4MMPA 4YB5A 1B5HA 1XVXA 4ZE8A 1LBYA 1D9YA 3T96B 1JVXA 3EHSA 1LAXA 1ATGA 1POTA 1B6HA 4YMAA 4C0RA 1US4A 4C1UA 4X48A 4I3YA 4PTKA 1MDQA 4KCCA 3T93B 3BIGA 3U65A 3UN6A 1II5A 5JEIA 5BWJA 4NF8B 2QS3A 1N3XA 2PCRA 5T3JA 3W9WA 3T9VA 4L17A 1EYIA 3LR1A 1B1XA 4ONYA 1EU8A 1KA0A 2P3VA 3IO6A 4YB7A 4EXLA 2F78A 1B7HA 2Y7KA 1YZ0A 2GRVA 1MPBA 4HCYA 5HM4B 1Y9UA 4LA9A 4BDMA 4H45A 4P1LA 4XF5A 3N6TA 1MY2A 4U4XA 3T9HB 4LONB 1MXXA 3IOWA 1NKXA 3OSRA 5L9SA 3MP6A 2HXRA 3IOUA 2GQ1A 3TTNA 4AB6A 1MY0A 4OVPA 1FQFA 2ESNA 4DXBA 2ZYNA 4XKPA 5KCJB 2ONKE 5I2NA 2I0BA 1B40A 5IZ1A 4ISUA 3TTKA 4X04A 1A54A 2DVZA 1B58A 1IEJA 1MPDA 2B3BA 1IMCA 1B0HA 4RPOA 4H65A 3V8XB 1VR5A 1LBBA 3H6VA 3MSTA 5CMBA 3MP1A 2H5YA 1MH3A 4PAKA 3CG1A 3ECRA 2Y7IA 1SVXB 1L5TA 3C9HA 4JB7A 1FQDA 1Q1KA 4POWA 4OMBA 3IB2A 4HE0A 2RKMA 1H76A 3LSFB 1SYHA 3T9XB 3ISPA 1YTVA 1FPJA 1IMAA 5H8SA 4QRZA 2XXKA 4O7IA 3FATA 1MRPA 1URGA 3MZ1A 4ZZEA 3JYRA 5L8DA 4OETA 1D9QA 2PBWA 3PMXA 1G0HA 4YAHX 4N91A 2Q2AA 2X7PA 5H8NA 3K6UA 1K9YA 2ALUA 2DXYA 4RA1A 2XXXA 3GZGA 2XWVA 1D3KA 1MG1A 1XC1A 5A5XA 3MVWA 5IZZA 1NV2A 1EYJA 2F35A 2O51A 2THIA 5DT6A 4MJOA 2VPNA 1NH7A 2KLFA 1YAEA 4MEVA 2Y7WA 3IK6B 4PFUA 1A40A 1NL5A 4I40A 2CZLA 4KI0E 4XKRA 2OBGA 1NMUA 1LB8A 4DDDA 1FBHA 5CMMA 2I4BA 2DWIA 3R6UA 3C33A 4MX6A 1MXWA 4U1OA 4NX1A 2PYYA 4ZE9A 4P1EA 2ZNSA 3GYYA 3RYDA 2AL5A 1XT8A 1Y4TA 1N0TA 4KPTA 3MWBA 3MBPA 4UA8A 2XXPA 4ZS9A 2IA4A 3TFLA 1NH8A 4EQBA 4EF2A 4AB5A 4F2QA 3HN0A 3WAFA 4IGRA 3H7MA 1IXGA 4NF4B 3QXMA 1LGBC 4U22A 4OESA 5L9OA 5LDZA 2Y5LA 4HE2A 3V83A 2QVRA 2DOJA 3KN7A 1B4ZA 4KYSA 1B4HA 1DTZA 1K9ZA 4ZZAA 5CMKA 3G3GA 3GLBA 2VD2A 1TFAA 1PEBA 2Q9TA 3S9NC 2BJJX 4KFQA 5FHNA 5I56A 1Y3NA 4JWYA 2DQVA 2O1MA 4GL8A 3V5AA 3K00A 1NNKA 3T9UA 4GBWA 3I6VA 3G3HA 3T66A 5I58A 5A5LA 1AH5A 3D4CA 3TTRA 4YKKA 3FV1A 3NOHA 1B0LA 1M5EA 3PPNA 1RKMA 4DI4B 2XA5A 3B6TA 1SYIA 3VV5A 4MFIA 2QS1A 1B5JA 4P8BA 2P3NA 4DLDA 2I3VA 3TYHA 2ZZWA 3OENA 4F22A 4MLVA 4JSDA 1NV6A 3DELB 2Q8JA 3PD8A 2H98A 2HXWA 4R6KA 1P1WA 1M5BA 1QUIA 3RT8A 3OO9A 2DXRA 2F8DA 2PFYA 2XXIA 1ZIUA 4HTGA 4HW8A 2OWTA 4OERA 5JTYA 3OD7A 1FRPA 1NNTA 2W7YA 1NUXA 2XD3A 1MH4A 3WAEA 2O7IA 1NFTA 1FW0A 5M2VA 1B7ZA 5ET5A 3FXRA 4KHZE 4KCDA 4MLQA 2DE4A 1KZ8A 2QVVA 4BDOA 5ELVA 2O1LA 5B70A 2B65A 4ELOA 4KD5A 4P0IA 3RQTA 1IMEA 4P0GA 1FBCA 1RDXA 3K6VA 4YKIA 3C31A 4JBZA 1ANFA 3GBBA 2FBPA 4RK2A 3VVFA 2PFZA 1A99A 2OK2A 1SW4A 4X1DA 4EXKA 3Q28A 1NUZA 2DWAA 4ZEKA 1QUKA 3CSBA 2QPQA 3IJOB 5I2KA 4RJZA 2VOZA 2ZZXA 1CNQA 4GX6A 4U2RA 4G61A 3CFZA 4I62A 1RDZA 3OEKA 5KDTA 2I58A 2F6GA 3OXNA 1P99A 2RC7A 2XX7A 1MS7A 2XWIA 3QIMA 4QHQA 2E0SA 3UIFA 4R2BA 4GLIA 1B05A 4ZEBA 2Q74A 3KJTA 3FJ7A 4EUOA 4OVJA 2I49A 4QSEA 4R75A 4PBHA 1O64A 3CIJA 5J1DA 4G8MA 1MPCA 1LCFA 4PCDA 1N3WA 2FYIA 2Q88A 2WYKA 2Y5KA 4ELQA 3ILUB 3S9EA 3C34A 1SD3A 4O3CA 5IZ3A 3M8UA 4PFIA 1DK4A 4BDNA 3KSJA 3SEVA 2FVZA 5I59A 4AS5A 4HCWA 4OA4A 3SEUA 3HSTA 1MQIA 1A55A 4NE4A 4AQ4A 4NF0A 3EKIA 1B3GA 1N76A 3IR1A 2HZLA 2QJEA 2D21A 2HAVA 4DIGA 4Q8RA 1IZ1A 3R26A 4HE1A 1R9LA 4QFPA 2R71A 3SZPA 4DI3D 1M5DA 3U93A 4HXVA 5CM6A 2R9JA
chains in the Genus database with same CATH topology
4Q5TA 2QS4A 2ZXTA 4R6YA 5AA4B 1Y20A 4WEPA 3QYTA 3TAJA 1RYOA 2P0SA 3EN3A 3TPAA 4F19A 4PETA 4GOTA 5DEXB 3IORA 1IUDA 5I84A 1GGGA 1IXIA 5H8HA 5TP9B 4YMBA 3VVDA 5TPAB 3IB1A 2XX8A 3A3UA 2GFEA 2UVHA 2I48A 3DP8A 4F39A 3H06B 1R6ZA 1QKAA 3K1PA 5K2YA 4F3GA 4G77A 1VFDA 1M5FA 2Z8EA 5H8QA 3M3LA 4EDPA 3TCHA 4FECA 4QSCA 4ZDMA 3RNNA 1SQYA 2Y7PA 4ESWA 2A5TB 2GHBA 4H67A 4PFWA 3W9VA 3FVGA 2FA7A 2NUVA 5EHMA 5DVFA 4WEDA 4JWXA 2REJA 4JSOA 1FQAA 2O68A 3TKDA 1MXUA 1A8EA 4IO2A 3CSGA 2ONRA 1J1NA 5H8FB 4H5FA 1URSA 1PBPA 5B7DA 5ICTA 4N6PA 2QL3A 3Q25A 3HHFA 4G2ZA 2NXOA 3K6WA 3DP6A 3A3CA 3H6WA 2H25A 2H9BA 3TZAA 4NF5B 4X9TA 2PT1A 2I0CA 5CBRA 3BKIB 1BKAA 1UTBA 1QUJA 3TTMA 3G3JA 4DXCA 3TMGA 4IO5A 4ZECA 1MY3A 5ITOA 5AA2D 1XHYA 3B6QA 4JXIA 3PUWE 5AA3A 3BBRA 3O97A 5AA2B 3K4UA 3CFXA 3VLVA 3THIA 3RTFB 4G68B 2NWJA 2XXUA 3OSQA 2PVUA 3C32A 3O29A 5FTIA 4Q0CA 4I8CA 3O6HA 3GBAA 1BLFA 5ICQA 4NWDA 2G93A 2F5XA 3KGCA 5I57A 3ZSFA 5FHMA 4MF3A 1QULA 2HCAA 3M3KA 4UACA 4YKJA 4DXUA 5AA1A 4OEUA 3IJXB 1YCJA 1DTGA 3MZ9A 3TUSA 2XXTA 1M5CA 1FTLA 4LUBA 1JVYA 1GV8A 2XD2A 3MAMA 3OO7A 5HPQA 2F34A 1SI0A 1IXCA 2OZZA 1XVYA 2AYSA 4IY6A 3N94A 4XKQA 4RNSA 5HBCA 1Y4CA 4NTLA 3UORA 2DE2A 3RLFE 4GVOA 4KR5A 1JQFA 3Q29A 1MDP1 2ABHA 1VE4A 3G3IA 3ILTB 4OWDA 4F3PA 4F29A 2Z8DA 3MW0A 3KJ7A 5I2NB 3Q26A 4H6DA 2YJPA 3QUFA 1LSTA 1ELJA 3EF7A 2WKYA 3G7WA 3N26A 2OCUA 4GQOA 3FJMA 3PUVE 4POXA 3HHGA 2OJTA 4HS7A 1I6BA 2D5WA 1FTKA 1T0KA 3E9XA 3RT6B 5K2XA 2RC8A 3CG3A 4NMYA 3MVXA 5LOMA 1AMFA 4IO6A 3KZGA 3H6TA 1LLSA 1FQEA 3L6GA 1TFDA 4I9DA 1SBPA 1F9BA 1D4NA 1I6QA 3MZBA 2UXAA 4THIA 1PC3A 3PMVA 3QK6A 4R6HA 4IO4A 2PT2A 2A5SA 1GVCA 2DE3A 1PBQA 3O28A 2B3FA 4GFRA 4R9FA 1PB7A 3N6UA 2DYXA 3L6HA 4FATA 4R9GA 1HSJA 3TODA 1B32A 2QMWA 1MY1A 4OHNA 1B46A 1O63A 3TEPA 1MM6A 3U72A 5H8NB 1QJMA 1WDNA 3T22A 4PQJA 3N5LA 3B7DA 3IAZA 2D3IA 3C4MA 3IX1A 3CFLA 1FTMA 4F3SA 3Q27A 2DP8A 4LZ5A 5A5XB 5DYHA 2Z8FA 1TWYA 3MVYA 4EQ7A 3K01A 3JV9A 1N04A 3U94A 1IITA 4QFNA 5IKBA 1USYE 1OQHA 3VVEA 1O7TA 2IEEA 1S50A 5EYFA 4BDRA 2F7AA 2UVGA 3PD9A 2PMSA 3D4GA 1S7YA 4Z7EA 1OIBA 3S4UA 2NVUB 1B3LA 1Z7ME 4H1XA 3S9LC 1EZOA 1LAGE 3H03A 4O3BA 3ZS6A 3PPOA 3QUJA 4ELPA 1DPPA 1MQGA 3PU5A 4OYVA 3PPRA 4RY1A 4FAJA 2R6GE 4G8NA 3TQLA 3FZVA 4ESXA 1DPEA 3PGFA 3SERA 3SEYA 1ZJLA 3LC8A 3OELA 2V25A 1DSNA 4NF8A 1JEVA 1HSEA 4ECFA 1FTOA 1B52A 4G4PA 2AL4A 1N7XA 3RTWB 4DCXA 4IO3A 3K1NA 3DLNA 5I56B 3TQWA 2UVIA 1YPNA 3IO4A 2FNCA 2HAUA 3FJGA 4RYAA 1B5IA 3MP8A 4F2OA 2ANJA 1ZU0A 1LFHA 3I5OA 3AXFA 3KFMA 2DSFA 3MUQA 3KN3A 5I58B 3HCQA 3UGWA 2V84A 4C1TA 4XKNA 3IOTA 1FQCA 1IQ7A 2XXYA 3BFUA 4LZ8A 5EHSA 5KCJA 3C35A 3CVGA 3FVNA 3SDFA 3KEIA 3C36A 5DVJA 4R72A 1B3HA 1LAHE 4OZ9A 2Y84A 4PP0A 1MXZA 3RY3A 1MXYA 3OMBA 4YB6A 4O3AA 5JTYB 4WKMA 3FV2A 3V89B 4GXAA 1P1QA 3MQ9A 5CBSA 3RGYA 4FORA 3R7XA 3P7IA 1XS5A 1ZKBA 3UP9A 1Y1ZA 1KWHA 2RINA 3VDFA 1OQGA 4LVQA 5F1QA 3SESA 1URDA 1JEUA 2QMXA 2V3UA 1B51A 4H8IA 4TLMB 1OVBA 3CR9A 4LATA 5L9MA 2Q89A 1BP5A 1Y3PA 1A8FA 4IY5A 3MC2A 4IGTA 3SEWA 3KSXA 3E3KA 2DVCA 1LFGA 2XXRA 3PV0E 2G29A 4R73A 1S9TA 4F18A 2LAOA 2RC9A 3DM0A 1OLAA 5I2KB 3ZKKA 4F1UA 1LFIA 5F7VA 4GD5A 3HO7A 3KBRA 1VSOA 3CRBA 5KDTB 5CRYA 1B9JA 3LSLA 4FEBA 4TQUQ 2F7BA 1AOVA 3OO6A 1ZBMA 4M1VA 3HV1A 1I69A 1MQHA 4N13A 3TCFA 1OMPA 4XXUA 1FCKA 4GIZA 2Y7RA 4TLLB 3U8QA 3E13X 5CC2A 3ONMA 1VFEA 3IL1B 1JNFA 3TTLA 1MY4A 4RPNA 1WODA 2QRYA 3KOSA 3OEMA 3SKPA 5I59B 4PFTA 1SW2A 1ZTYA 1SW5A 2M8CA 3VXCA 1USYH 1WVJA 3EHUA 3PMWA 4XIGQ 1P1UA 4MH5A 4DE8A 2I3WA 3FD3A 4FIMA 4R74A 4NF4A 3TCGA 3VE1B 4GWOA 4QFLA 3S9MC 3CI8A 1B3EA 2Q2CA 4ELRA 2H99A 2E1SA 4QFOA 1JW5A 2RF1A 1GTKA 1SI1A 1Z7NE 2RCAA 3H6UA 4G68C 2XXVA 2ZMBA 1N84A 4FJPA 3KG2A 5JK4A 2ZYKA 2QS2A 2P2AA 3LBSA 5H8HB 3TELA 1US5A 5KZTA 1H3DA 4N07A 2AIXA 4NWCA 1R1NA 2O7UA 3VXBA 2ZNTA 4H0WA 4XTCQ 5H8QB 1TXFA 1RYXA 3LSXA 3TDJA 3O6IA 1PB8A 1SDXA 4ZEIA 4JDFA 1MQDA 4U4SA 4LP2B 2I4CA 2UYFA 4E0XA 2HQ0A 4ZEDA 2GHAA 4OTEA 1QVSA 4GRKA 2XXHA 2Z22A 4NEDA 1UQWA 2UVJA 2DS9A 1IIWA 3FIRA 2F36A 2I6EA 2ZYMA 3K0VA 3F11A 1CB6A 5CMCA 4F3BA 3PUXE 3SETA 1UTBB 1Y1MA 4PE5B 3H3GA 4GXSB 4KQPA 4QSDA 3EQ1A 4OFLA 4ND9A 3EPEA 4YICA 3UK4A 3O6GA 3FASA 5FTHA 1FTJA 4GL0A 3O2AA 3ZKLA 3O66A 1H45A 4JWOA 3MPKA 1B7UA 5TU0A 2O84X 1D9VA 1A7LA 2PX1A 2NOOA 4F31B 2XHDA 4EQ9A 5ITPA 3LUYA 5I57B 2OLBA 4F1YA 2X26A 3O9PA 1N7WA 1P1NA 1CE2A 3K1MA 3MVZA 2CMOA 4NF6A 3VFJA 3K02A 2F6PA 3G3KA 2V93A 4PFYA 4U23A 2HFBA 1AL3A 4OQOA 2V3TA 4LQ2A 1P1OA 4U21A 1I6AA 3EHTA 4EF1A 2VHAA 1LAFE 2UYEA 1UTHA 3SEXA 2REGA 2VP1A 3DP4A 2OWSA 2XXWA 3FGSA 1IXHA 4FEDA 1MXVA 4KYEA 2RCBA 1LCTA 4TOZA 3M3FA 1BIYA 3U1OA 3OO8A 1ZLQA 3I3VA 4YZZA 1EH3A 1TT1A 1SW1A 1B2HA 3HPIA 2O69A 3BFTA 3FUZA 3PUYE 2Z23A 5FHOA 2O6AA 3B6WA 1PDAA 2X7QA 3H4ZA 4FE8A 3K2DA 3RUMA 4RK9A 4YU0A 3MJNA 4BLAA 1OVTA 4OFOA 4E0WA 1QKBA 2HZKA 4IB2A 4M4GA 1NNFA 4RXLA 4Z0IA 1POY1 3PPQA 1MQJA 2YPNA 5AA4A 1LB9A 2QSXA 4OXVA 4U1ZA 1JW1A 1UIVA 3U92A 4P11A 3IB0A 5DEXA 3OOAA 2YLNA 2XX9A 1OLCA 4G8HA 5ISUA 1PB9A 3JZJA 5AE4A 3KN8A 5TP9A 3QSLA 3LSWA 4OFJA 5IAIA 5TPAA 1NNPA 1QW0A 2ZNUA 3VLUA 3S2VA 3MPLA 3FXUA 4QF9A 4GF8A 1Q35A 3UA8A 1R9QA 5DVIA 4BDLA 1UIUA 2H4IA 2P1SA 4F1VA 1B3FA 4BDQA 3RPWA 2DWJA 4H5GA 1EZ9A 2A5TA 1MM7A 3A09A 4H8JA 4MBPA 2ONSA 4LZ7A 4Q30B 2GH9A 3FXQA 4QFKA 3E4RA 1BTJA 2F97A 1EZPA 1H43A 4NF6B 4X1BA 1JW4A 2ZYOA 3FVKA 4WXJA 3KOTA 5BUUA 1AIVA 2XXQA 3PUZE 5H8FA 4LQ5A 3VLWA 3FVOA 1Y3QA 3RN8A 1XOCA 2VD3A 4DCYA 4K3FA 5CI5A 2DWHA 1UTHB 3QAXA 3G3FA 1HSLA 1FQBA 4OENA 4YKPA 4NF5A 3PPPA 4R2FA 1B1HA 3ODBA 3W15C 4ZEFA 4OEVA 4KYDA 5DTBA 4DZ1A 1JETA 3USDA 1H44A 1LBCA 5AA2A 4I1DA 2VGQA 3IOVA 2F7CA 3K6XA 1DOTA 4IO7A 1ZMGA 2HEUA 4G68A 1GR2A 1DMBA 2V3QA 3GXAA 4YB5A 1B5HA 1XVXA 4ZE8A 1D9YA 3T96B 1JVXA 3EHSA 1LAXA 1ATGA 1POTA 1B6HA 4YMAA 4C0RA 1US4A 4C1UA 4X48A 1MDQA 4KCCA 3T93B 3UN6A 1II5A 5JEIA 5BWJA 4NF8B 2QS3A 1N3XA 3W9WA 3T9VA 4L17A 3LR1A 1B1XA 4ONYA 1EU8A 3IO6A 4YB7A 4EXLA 2F78A 1B7HA 2Y7KA 2GRVA 1MPBA 4HCYA 5HM4B 1Y9UA 4LA9A 4BDMA 3N6TA 1MY2A 4U4XA 3T9HB 4LONB 1MXXA 3IOWA 1NKXA 3OSRA 5L9SA 3MP6A 3IOUA 3TTNA 4AB6A 1MY0A 1FQFA 2ESNA 4DXBA 2ZYNA 4XKPA 5KCJB 2ONKE 5I2NA 2I0BA 1B40A 4ISUA 3TTKA 1A54A 2DVZA 1B58A 1IEJA 1MPDA 2B3BA 1B0HA 4RPOA 4H65A 3V8XB 1VR5A 1LBBA 3H6VA 5CMBA 3MP1A 2H5YA 1MH3A 3CG1A 3ECRA 2Y7IA 1SVXB 1L5TA 3C9HA 4JB7A 1FQDA 1Q1KA 4POWA 4OMBA 3IB2A 2RKMA 1H76A 3LSFB 1SYHA 3T9XB 1YTVA 5H8SA 4QRZA 3FATA 1MRPA 1URGA 3MZ1A 4ZZEA 3JYRA 5L8DA 4OETA 2PBWA 3PMXA 4YAHX 2Q2AA 2X7PA 5H8NA 3K6UA 2ALUA 2DXYA 4RA1A 2XXXA 3GZGA 1D3KA 1MG1A 1XC1A 5A5XA 3MVWA 2F35A 2O51A 2THIA 5DT6A 1NH7A 2KLFA 1YAEA 2Y7WA 3IK6B 4PFUA 1A40A 1NL5A 2CZLA 4KI0E 4XKRA 2OBGA 1NMUA 1LB8A 4DDDA 5CMMA 2I4BA 2DWIA 3R6UA 3C33A 1MXWA 4U1OA 2PYYA 4ZE9A 2ZNSA 2AL5A 1XT8A 1Y4TA 1N0TA 4KPTA 3MWBA 3MBPA 4UA8A 2XXPA 4ZS9A 2IA4A 3TFLA 1NH8A 4EQBA 4EF2A 4AB5A 4F2QA 3HN0A 3WAFA 4IGRA 3H7MA 1IXGA 4NF4B 3QXMA 1LGBC 4U22A 4OESA 5L9OA 3V83A 2DOJA 3KN7A 1B4ZA 4KYSA 1B4HA 1DTZA 4ZZAA 5CMKA 3G3GA 3GLBA 2VD2A 1TFAA 1PEBA 2Q9TA 3S9NC 2BJJX 4KFQA 5FHNA 5I56A 1Y3NA 4JWYA 2DQVA 2O1MA 4GL8A 3V5AA 3K00A 1NNKA 3T9UA 3I6VA 3G3HA 3T66A 5I58A 1AH5A 3D4CA 3TTRA 4YKKA 3FV1A 1B0LA 1M5EA 3PPNA 1RKMA 3B6TA 1SYIA 3VV5A 4MFIA 2QS1A 1B5JA 4DLDA 2I3VA 3TYHA 3OENA 4F22A 4MLVA 4JSDA 3DELB 2Q8JA 3PD8A 2H98A 2HXWA 4R6KA 1P1WA 1M5BA 1QUIA 3RT8A 3OO9A 2DXRA 2F8DA 2XXIA 1ZIUA 4HTGA 4HW8A 2OWTA 4OERA 5JTYA 3OD7A 2W7YA 1NNTA 2XD3A 1MH4A 3WAEA 2O7IA 1NFTA 1FW0A 5M2VA 1B7ZA 3FXRA 4KHZE 4KCDA 4MLQA 2DE4A 4BDOA 5ELVA 2O1LA 5B70A 2B65A 4ELOA 4KD5A 4P0IA 3RQTA 4P0GA 3K6VA 4YKIA 3C31A 4JBZA 1ANFA 3GBBA 4RK2A 3VVFA 1A99A 2OK2A 1SW4A 4X1DA 4EXKA 3Q28A 2DWAA 4ZEKA 1QUKA 3CSBA 2QPQA 3IJOB 5I2KA 4RJZA 2VOZA 4U2RA 3CFZA 4I62A 3OEKA 5KDTA 2I58A 2F6GA 3OXNA 1P99A 2RC7A 2XX7A 1MS7A 3QIMA 4QHQA 2E0SA 3UIFA 4R2BA 4GLIA 1B05A 4ZEBA 3KJTA 3FJ7A 4EUOA 4OVJA 2I49A 4QSEA 4R75A 1O64A 3CIJA 5J1DA 4G8MA 1MPCA 1LCFA 1N3WA 2FYIA 2Q88A 4ELQA 3ILUB 3S9EA 3C34A 1SD3A 4O3CA 3M8UA 4BDNA 3KSJA 3SEVA 5I59A 4HCWA 3SEUA 3HSTA 1MQIA 1A55A 4NE4A 4AQ4A 1B3GA 1N76A 3IR1A 2HZLA 2QJEA 2D21A 2HAVA 4DIGA 4Q8RA 1IZ1A 3R26A 1R9LA 4QFPA 2R71A 1M5DA 3U93A 5CM6A 2R9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5T A;  2QS4 A;  2ZXT A;  4R6Y A;  5AA4 B;  1Y20 A;  4WEP A;  3QYT A;  3TAJ A;  1RYO A;  2P0S A;  3EN3 A;  3TPA A;  4F19 A;  4PET A;  4GOT A;  5DEX B;  3IOR A;  1IUD A;  5I84 A;  1GGG A;  1IXI A;  5H8H A;  5TP9 B;  4YMB A;  3VVD A;  5TPA B;  3IB1 A;  2XX8 A;  3A3U A;  2GFE A;  2UVH A;  2I48 A;  3DP8 A;  4F39 A;  3H06 B;  1R6Z A;  1QKA A;  3K1P A;  5K2Y A;  4F3G A;  4G77 A;  1VFD A;  1M5F A;  2Z8E A;  5H8Q A;  3M3L A;  4EDP A;  3TCH A;  4FEC A;  4QSC A;  4ZDM A;  3RNN A;  1SQY A;  2Y7P A;  4ESW A;  2A5T B;  2GHB A;  4H67 A;  4PFW A;  3W9V A;  3FVG A;  2FA7 A;  2NUV A;  5EHM A;  5DVF A;  4WED A;  4JWX A;  2REJ A;  4JSO A;  1FQA A;  2O68 A;  3TKD A;  1MXU A;  1A8E A;  4IO2 A;  3CSG A;  2ONR A;  1J1N A;  5H8F B;  4H5F A;  1URS A;  1PBP A;  5B7D A;  5ICT A;  4N6P A;  2QL3 A;  3Q25 A;  3HHF A;  4G2Z A;  2NXO A;  3K6W A;  3DP6 A;  3A3C A;  3H6W A;  2H25 A;  2H9B A;  3TZA A;  4NF5 B;  4X9T A;  2PT1 A;  2I0C A;  5CBR A;  3BKI B;  1BKA A;  1UTB A;  1QUJ A;  3TTM A;  3G3J A;  4DXC A;  3TMG A;  4IO5 A;  4ZEC A;  1MY3 A;  5ITO A;  5AA2 D;  1XHY A;  3B6Q A;  4JXI A;  3PUW E;  5AA3 A;  3BBR A;  3O97 A;  5AA2 B;  3K4U A;  3CFX A;  3VLV A;  3THI A;  3RTF B;  4G68 B;  2NWJ A;  2XXU A;  3OSQ A;  2PVU A;  3C32 A;  3O29 A;  5FTI A;  4Q0C A;  4I8C A;  3O6H A;  3GBA A;  1BLF A;  5ICQ A;  4NWD A;  2G93 A;  2F5X A;  3KGC A;  5I57 A;  3ZSF A;  5FHM A;  4MF3 A;  1QUL A;  2HCA A;  3M3K A;  4UAC A;  4YKJ A;  4DXU A;  5AA1 A;  4OEU A;  3IJX B;  1YCJ A;  1DTG A;  3MZ9 A;  3TUS A;  2XXT A;  1M5C A;  1FTL A;  4LUB A;  1JVY A;  1GV8 A;  2XD2 A;  3MAM A;  3OO7 A;  5HPQ A;  2F34 A;  1SI0 A;  1IXC A;  2OZZ A;  1XVY A;  2AYS A;  4IY6 A;  3N94 A;  4XKQ A;  4RNS A;  5HBC A;  1Y4C A;  4NTL A;  3UOR A;  2DE2 A;  3RLF E;  4GVO A;  4KR5 A;  1JQF A;  3Q29 A;  1MDP 1;  2ABH A;  1VE4 A;  3G3I A;  3ILT B;  4OWD A;  4F3P A;  4F29 A;  2Z8D A;  3MW0 A;  3KJ7 A;  5I2N B;  3Q26 A;  4H6D A;  2YJP A;  3QUF A;  1LST A;  1ELJ A;  3EF7 A;  2WKY A;  3G7W A;  3N26 A;  2OCU A;  4GQO A;  3FJM A;  3PUV E;  4POX A;  3HHG A;  2OJT A;  4HS7 A;  1I6B A;  2D5W A;  1FTK A;  1T0K A;  3E9X A;  3RT6 B;  5K2X A;  2RC8 A;  3CG3 A;  4NMY A;  3MVX A;  5LOM A;  1AMF A;  4IO6 A;  3KZG A;  3H6T A;  1LLS A;  1FQE A;  3L6G A;  1TFD A;  4I9D A;  1SBP A;  1F9B A;  1D4N A;  1I6Q A;  3MZB A;  2UXA A;  4THI A;  1PC3 A;  3PMV A;  3QK6 A;  4R6H A;  4IO4 A;  2PT2 A;  2A5S A;  1GVC A;  2DE3 A;  1PBQ A;  3O28 A;  2B3F A;  4GFR A;  4R9F A;  1PB7 A;  3N6U A;  2DYX A;  3L6H A;  4FAT A;  4R9G A;  1HSJ A;  3TOD A;  1B32 A;  2QMW A;  1MY1 A;  4OHN A;  1B46 A;  1O63 A;  3TEP A;  1MM6 A;  3U72 A;  5H8N B;  1QJM A;  1WDN A;  3T22 A;  4PQJ A;  3N5L A;  3B7D A;  3IAZ A;  2D3I A;  3C4M A;  3IX1 A;  3CFL A;  1FTM A;  4F3S A;  3Q27 A;  2DP8 A;  4LZ5 A;  5A5X B;  5DYH A;  2Z8F A;  1TWY A;  3MVY A;  4EQ7 A;  3K01 A;  3JV9 A;  1N04 A;  3U94 A;  1IIT A;  4QFN A;  5IKB A;  1USY E;  1OQH A;  3VVE A;  1O7T A;  2IEE A;  1S50 A;  5EYF A;  4BDR A;  2F7A A;  2UVG A;  3PD9 A;  2PMS A;  3D4G A;  1S7Y A;  4Z7E A;  1OIB A;  3S4U A;  2NVU B;  1B3L A;  1Z7M E;  4H1X A;  3S9L C;  1EZO A;  1LAG E;  3H03 A;  4O3B A;  3ZS6 A;  3PPO A;  3QUJ A;  4ELP A;  1DPP A;  1MQG A;  3PU5 A;  4OYV A;  3PPR A;  4RY1 A;  4FAJ A;  2R6G E;  4G8N A;  3TQL A;  3FZV A;  4ESX A;  1DPE A;  3PGF A;  3SER A;  3SEY A;  1ZJL A;  3LC8 A;  3OEL A;  2V25 A;  1DSN A;  4NF8 A;  1JEV A;  1HSE A;  4ECF A;  1FTO A;  1B52 A;  4G4P A;  2AL4 A;  1N7X A;  3RTW B;  4DCX A;  4IO3 A;  3K1N A;  3DLN A;  5I56 B;  3TQW A;  2UVI A;  1YPN A;  3IO4 A;  2FNC A;  2HAU A;  3FJG A;  4RYA A;  1B5I A;  3MP8 A;  4F2O A;  2ANJ A;  1ZU0 A;  1LFH A;  3I5O A;  3AXF A;  3KFM A;  2DSF A;  3MUQ A;  3KN3 A;  5I58 B;  3HCQ A;  3UGW A;  2V84 A;  4C1T A;  4XKN A;  3IOT A;  1FQC A;  1IQ7 A;  2XXY A;  3BFU A;  4LZ8 A;  5EHS A;  5KCJ A;  3C35 A;  3CVG A;  3FVN A;  3SDF A;  3KEI A;  3C36 A;  5DVJ A;  4R72 A;  1B3H A;  1LAH E;  4OZ9 A;  2Y84 A;  4PP0 A;  1MXZ A;  3RY3 A;  1MXY A;  3OMB A;  4YB6 A;  4O3A A;  5JTY B;  4WKM A;  3FV2 A;  3V89 B;  4GXA A;  1P1Q A;  3MQ9 A;  5CBS A;  3RGY A;  4FOR A;  3R7X A;  3P7I A;  1XS5 A;  1ZKB A;  3UP9 A;  1Y1Z A;  1KWH A;  2RIN A;  3VDF A;  1OQG A;  4LVQ A;  5F1Q A;  3SES A;  1URD A;  1JEU A;  2QMX A;  2V3U A;  1B51 A;  4H8I A;  4TLM B;  1OVB A;  3CR9 A;  4LAT A;  5L9M A;  2Q89 A;  1BP5 A;  1Y3P A;  1A8F A;  4IY5 A;  3MC2 A;  4IGT A;  3SEW A;  3KSX A;  3E3K A;  2DVC A;  1LFG A;  2XXR A;  3PV0 E;  2G29 A;  4R73 A;  1S9T A;  4F18 A;  2LAO A;  2RC9 A;  3DM0 A;  1OLA A;  5I2K B;  3ZKK A;  4F1U A;  1LFI A;  5F7V A;  4GD5 A;  3HO7 A;  3KBR A;  1VSO A;  3CRB A;  5KDT B;  5CRY A;  1B9J A;  3LSL A;  4FEB A;  4TQU Q;  2F7B A;  1AOV A;  3OO6 A;  1ZBM A;  4M1V A;  3HV1 A;  1I69 A;  1MQH A;  4N13 A;  3TCF A;  1OMP A;  4XXU A;  1FCK A;  4GIZ A;  2Y7R A;  4TLL B;  3U8Q A;  3E13 X;  5CC2 A;  3ONM A;  1VFE A;  3IL1 B;  1JNF A;  3TTL A;  1MY4 A;  4RPN A;  1WOD A;  2QRY A;  3KOS A;  3OEM A;  3SKP A;  5I59 B;  4PFT A;  1SW2 A;  1ZTY A;  1SW5 A;  2M8C A;  3VXC A;  1USY H;  1WVJ A;  3EHU A;  3PMW A;  4XIG Q;  1P1U A;  4MH5 A;  4DE8 A;  2I3W A;  3FD3 A;  4FIM A;  4R74 A;  4NF4 A;  3TCG A;  3VE1 B;  4GWO A;  4QFL A;  3S9M C;  3CI8 A;  1B3E A;  2Q2C A;  4ELR A;  2H99 A;  2E1S A;  4QFO A;  1JW5 A;  2RF1 A;  1GTK A;  1SI1 A;  1Z7N E;  2RCA A;  3H6U A;  4G68 C;  2XXV A;  2ZMB A;  1N84 A;  4FJP A;  3KG2 A;  5JK4 A;  2ZYK A;  2QS2 A;  2P2A A;  3LBS A;  5H8H B;  3TEL A;  1US5 A;  5KZT A;  1H3D A;  4N07 A;  2AIX A;  4NWC A;  1R1N A;  2O7U A;  3VXB A;  2ZNT A;  4H0W A;  4XTC Q;  5H8Q B;  1TXF A;  1RYX A;  3LSX A;  3TDJ A;  3O6I A;  1PB8 A;  1SDX A;  4ZEI A;  4JDF A;  1MQD A;  4U4S A;  4LP2 B;  2I4C A;  2UYF A;  4E0X A;  2HQ0 A;  4ZED A;  2GHA A;  4OTE A;  1QVS A;  4GRK A;  2XXH A;  2Z22 A;  4NED A;  1UQW A;  2UVJ A;  2DS9 A;  1IIW A;  3FIR A;  2F36 A;  2I6E A;  2ZYM A;  3K0V A;  3F11 A;  1CB6 A;  5CMC A;  4F3B A;  3PUX E;  3SET A;  1UTB B;  1Y1M A;  4PE5 B;  3H3G A;  4GXS B;  4KQP A;  4QSD A;  3EQ1 A;  4OFL A;  4ND9 A;  3EPE A;  4YIC A;  3UK4 A;  3O6G A;  3FAS A;  5FTH A;  1FTJ A;  4GL0 A;  3O2A A;  3ZKL A;  3O66 A;  1H45 A;  4JWO A;  3MPK A;  1B7U A;  5TU0 A;  2O84 X;  1D9V A;  1A7L A;  2PX1 A;  2NOO A;  4F31 B;  2XHD A;  4EQ9 A;  5ITP A;  3LUY A;  5I57 B;  2OLB A;  4F1Y A;  2X26 A;  3O9P A;  1N7W A;  1P1N A;  1CE2 A;  3K1M A;  3MVZ A;  2CMO A;  4NF6 A;  3VFJ A;  3K02 A;  2F6P A;  3G3K A;  2V93 A;  4PFY A;  4U23 A;  2HFB A;  1AL3 A;  4OQO A;  2V3T A;  4LQ2 A;  1P1O A;  4U21 A;  1I6A A;  3EHT A;  4EF1 A;  2VHA A;  1LAF E;  2UYE A;  1UTH A;  3SEX A;  2REG A;  2VP1 A;  3DP4 A;  2OWS A;  2XXW A;  3FGS A;  1IXH A;  4FED A;  1MXV A;  4KYE A;  2RCB A;  1LCT A;  4TOZ A;  3M3F A;  1BIY A;  3U1O A;  3OO8 A;  1ZLQ A;  3I3V A;  4YZZ A;  1EH3 A;  1TT1 A;  1SW1 A;  1B2H A;  3HPI A;  2O69 A;  3BFT A;  3FUZ A;  3PUY E;  2Z23 A;  5FHO A;  2O6A A;  3B6W A;  1PDA A;  2X7Q A;  3H4Z A;  4FE8 A;  3K2D A;  3RUM A;  4RK9 A;  4YU0 A;  3MJN A;  4BLA A;  1OVT A;  4OFO A;  4E0W A;  1QKB A;  2HZK A;  4IB2 A;  4M4G A;  1NNF A;  4RXL A;  4Z0I A;  1POY 1;  3PPQ A;  1MQJ A;  2YPN A;  5AA4 A;  1LB9 A;  2QSX A;  4OXV A;  4U1Z A;  1JW1 A;  1UIV A;  3U92 A;  4P11 A;  3IB0 A;  5DEX A;  3OOA A;  2YLN A;  2XX9 A;  1OLC A;  4G8H A;  5ISU A;  1PB9 A;  3JZJ A;  5AE4 A;  3KN8 A;  5TP9 A;  3QSL A;  3LSW A;  4OFJ A;  5IAI A;  5TPA A;  1NNP A;  1QW0 A;  2ZNU A;  3VLU A;  3S2V A;  3MPL A;  3FXU A;  4QF9 A;  4GF8 A;  1Q35 A;  3UA8 A;  1R9Q A;  5DVI A;  4BDL A;  1UIU A;  2H4I A;  2P1S A;  4F1V A;  1B3F A;  4BDQ A;  3RPW A;  2DWJ A;  4H5G A;  1EZ9 A;  2A5T A;  1MM7 A;  3A09 A;  4H8J A;  4MBP A;  2ONS A;  4LZ7 A;  4Q30 B;  2GH9 A;  3FXQ A;  4QFK A;  3E4R A;  1BTJ A;  2F97 A;  1EZP A;  1H43 A;  4NF6 B;  4X1B A;  1JW4 A;  2ZYO A;  3FVK A;  4WXJ A;  3KOT A;  5BUU A;  1AIV A;  2XXQ A;  3PUZ E;  5H8F A;  4LQ5 A;  3VLW A;  3FVO A;  1Y3Q A;  3RN8 A;  1XOC A;  2VD3 A;  4DCY A;  4K3F A;  5CI5 A;  2DWH A;  1UTH B;  3QAX A;  3G3F A;  1HSL A;  1FQB A;  4OEN A;  4YKP A;  4NF5 A;  3PPP A;  4R2F A;  1B1H A;  3ODB A;  3W15 C;  4ZEF A;  4OEV A;  4KYD A;  5DTB A;  4DZ1 A;  1JET A;  3USD A;  1H44 A;  1LBC A;  5AA2 A;  4I1D A;  2VGQ A;  3IOV A;  2F7C A;  3K6X A;  1DOT A;  4IO7 A;  1ZMG A;  2HEU A;  4G68 A;  1GR2 A;  1DMB A;  2V3Q A;  3GXA A;  4YB5 A;  1B5H A;  1XVX A;  4ZE8 A;  1D9Y A;  3T96 B;  1JVX A;  3EHS A;  1LAX A;  1ATG A;  1POT A;  1B6H A;  4YMA A;  4C0R A;  1US4 A;  4C1U A;  4X48 A;  1MDQ A;  4KCC A;  3T93 B;  3UN6 A;  1II5 A;  5JEI A;  5BWJ A;  4NF8 B;  2QS3 A;  1N3X A;  3W9W A;  3T9V A;  4L17 A;  3LR1 A;  1B1X A;  4ONY A;  1EU8 A;  3IO6 A;  4YB7 A;  4EXL A;  2F78 A;  1B7H A;  2Y7K A;  2GRV A;  1MPB A;  4HCY A;  5HM4 B;  1Y9U A;  4LA9 A;  4BDM A;  3N6T A;  1MY2 A;  4U4X A;  3T9H B;  4LON B;  1MXX A;  3IOW A;  1NKX A;  3OSR A;  5L9S A;  3MP6 A;  3IOU A;  3TTN A;  4AB6 A;  1MY0 A;  1FQF A;  2ESN A;  4DXB A;  2ZYN A;  4XKP A;  5KCJ B;  2ONK E;  5I2N A;  2I0B A;  1B40 A;  4ISU A;  3TTK A;  1A54 A;  2DVZ A;  1B58 A;  1IEJ A;  1MPD A;  2B3B A;  1B0H A;  4RPO A;  4H65 A;  3V8X B;  1VR5 A;  1LBB A;  3H6V A;  5CMB A;  3MP1 A;  2H5Y A;  1MH3 A;  3CG1 A;  3ECR A;  2Y7I A;  1SVX B;  1L5T A;  3C9H A;  4JB7 A;  1FQD A;  1Q1K A;  4POW A;  4OMB A;  3IB2 A;  2RKM A;  1H76 A;  3LSF B;  1SYH A;  3T9X B;  1YTV A;  5H8S A;  4QRZ A;  3FAT A;  1MRP A;  1URG A;  3MZ1 A;  4ZZE A;  3JYR A;  5L8D A;  4OET A;  2PBW A;  3PMX A;  4YAH X;  2Q2A A;  2X7P A;  5H8N A;  3K6U A;  2ALU A;  2DXY A;  4RA1 A;  2XXX A;  3GZG A;  1D3K A;  1MG1 A;  1XC1 A;  5A5X A;  3MVW A;  2F35 A;  2O51 A;  2THI A;  5DT6 A;  1NH7 A;  2KLF A;  1YAE A;  2Y7W A;  3IK6 B;  4PFU A;  1A40 A;  1NL5 A;  2CZL A;  4KI0 E;  4XKR A;  2OBG A;  1NMU A;  1LB8 A;  4DDD A;  5CMM A;  2I4B A;  2DWI A;  3R6U A;  3C33 A;  1MXW A;  4U1O A;  2PYY A;  4ZE9 A;  2ZNS A;  2AL5 A;  1XT8 A;  1Y4T A;  1N0T A;  4KPT A;  3MWB A;  3MBP A;  4UA8 A;  2XXP A;  4ZS9 A;  2IA4 A;  3TFL A;  1NH8 A;  4EQB A;  4EF2 A;  4AB5 A;  4F2Q A;  3HN0 A;  3WAF A;  4IGR A;  3H7M A;  1IXG A;  4NF4 B;  3QXM A;  1LGB C;  4U22 A;  4OES A;  5L9O A;  3V83 A;  2DOJ A;  3KN7 A;  1B4Z A;  4KYS A;  1B4H A;  1DTZ A;  4ZZA A;  5CMK A;  3G3G A;  3GLB A;  2VD2 A;  1TFA A;  1PEB A;  2Q9T A;  3S9N C;  2BJJ X;  4KFQ A;  5FHN A;  5I56 A;  1Y3N A;  4JWY A;  2DQV A;  2O1M A;  4GL8 A;  3V5A A;  3K00 A;  1NNK A;  3T9U A;  3I6V A;  3G3H A;  3T66 A;  5I58 A;  1AH5 A;  3D4C A;  3TTR A;  4YKK A;  3FV1 A;  1B0L A;  1M5E A;  3PPN A;  1RKM A;  3B6T A;  1SYI A;  3VV5 A;  4MFI A;  2QS1 A;  1B5J A;  4DLD A;  2I3V A;  3TYH A;  3OEN A;  4F22 A;  4MLV A;  4JSD A;  3DEL B;  2Q8J A;  3PD8 A;  2H98 A;  2HXW A;  4R6K A;  1P1W A;  1M5B A;  1QUI A;  3RT8 A;  3OO9 A;  2DXR A;  2F8D A;  2XXI A;  1ZIU A;  4HTG A;  4HW8 A;  2OWT A;  4OER A;  5JTY A;  3OD7 A;  2W7Y A;  1NNT A;  2XD3 A;  1MH4 A;  3WAE A;  2O7I A;  1NFT A;  1FW0 A;  5M2V A;  1B7Z A;  3FXR A;  4KHZ E;  4KCD A;  4MLQ A;  2DE4 A;  4BDO A;  5ELV A;  2O1L A;  5B70 A;  2B65 A;  4ELO A;  4KD5 A;  4P0I A;  3RQT A;  4P0G A;  3K6V A;  4YKI A;  3C31 A;  4JBZ A;  1ANF A;  3GBB A;  4RK2 A;  3VVF A;  1A99 A;  2OK2 A;  1SW4 A;  4X1D A;  4EXK A;  3Q28 A;  2DWA A;  4ZEK A;  1QUK A;  3CSB A;  2QPQ A;  3IJO B;  5I2K A;  4RJZ A;  2VOZ A;  4U2R A;  3CFZ A;  4I62 A;  3OEK A;  5KDT A;  2I58 A;  2F6G A;  3OXN A;  1P99 A;  2RC7 A;  2XX7 A;  1MS7 A;  3QIM A;  4QHQ A;  2E0S A;  3UIF A;  4R2B A;  4GLI A;  1B05 A;  4ZEB A;  3KJT A;  3FJ7 A;  4EUO A;  4OVJ A;  2I49 A;  4QSE A;  4R75 A;  1O64 A;  3CIJ A;  5J1D A;  4G8M A;  1MPC A;  1LCF A;  1N3W A;  2FYI A;  2Q88 A;  4ELQ A;  3ILU B;  3S9E A;  3C34 A;  1SD3 A;  4O3C A;  3M8U A;  4BDN A;  3KSJ A;  3SEV A;  5I59 A;  4HCW A;  3SEU A;  3HST A;  1MQI A;  1A55 A;  4NE4 A;  4AQ4 A;  1B3G A;  1N76 A;  3IR1 A;  2HZL A;  2QJE A;  2D21 A;  2HAV A;  4DIG A;  4Q8R A;  1IZ1 A;  3R26 A;  1R9L A;  4QFP A;  2R71 A;  1M5D A;  3U93 A;  5CM6 A;  2R9J A; 
#chains in the Genus database with same CATH topology
 4Q5T A;  1FPG A;  2QS4 A;  2ZXT A;  4R6Y A;  3T1B A;  1IMF A;  1Y20 A;  5AA4 B;  4N6K A;  2FIE A;  4WEP A;  3QYT A;  3TAJ A;  4PGP A;  1RYO A;  2P0S A;  3EN3 A;  3TPA A;  4F19 A;  4PET A;  4GOT A;  5DEX B;  2HHM A;  3IOR A;  1IUD A;  5I84 A;  3B50 A;  1GGG A;  1IXI A;  5H8H A;  1IMD A;  1FPD A;  2JJK A;  5TP9 B;  4O94 A;  4YMB A;  4UAB A;  5TPA B;  3VVD A;  3IB1 A;  2XX8 A;  3A3U A;  2GFE A;  2UVH A;  2I48 A;  3DP8 A;  4F39 A;  3H06 B;  1R6Z A;  1QKA A;  3K1P A;  5K2Y A;  4F3G A;  4G77 A;  1VFD A;  4P9K A;  1M5F A;  2Z8E A;  5H8Q A;  1LBX A;  3M3L A;  4EDP A;  3TCH A;  4FEC A;  4QSC A;  4OVT A;  4ZDM A;  3RNN A;  1SQY A;  2WYP A;  5I3S A;  2Y7P A;  4ESW A;  2A5T B;  2GHB A;  4H67 A;  4PFW A;  4PGN A;  3W9V A;  2B4L A;  3FVG A;  2FA7 A;  1BK4 A;  2NUV A;  5EHM A;  5DVF A;  4WED A;  4JWX A;  2REJ A;  4JSO A;  1FQA A;  2O68 A;  3TKD A;  1MXU A;  1A8E A;  4IO2 A;  3CSG A;  2ONR A;  1J1N A;  5H8F B;  1NV4 A;  4H5F A;  1URS A;  1PBP A;  5B7D A;  5ICT A;  3PTY A;  4N6P A;  2QL3 A;  3Q25 A;  2CZI A;  3HHF A;  4G2Z A;  2NXO A;  3K6W A;  3DP6 A;  3A3C A;  4PDH A;  3H6W A;  2H25 A;  2H9B A;  3TZA A;  4NF5 B;  4X9T A;  2PT1 A;  2I0C A;  5FBP A;  5CBR A;  3BKI B;  1BKA A;  1NV5 A;  1UTB A;  1QUJ A;  4GWZ A;  3TTM A;  3G3J A;  4PDD A;  4DXC A;  3TMG A;  4IO5 A;  4ZEC A;  4PC9 A;  1MY3 A;  5ITO A;  5AA2 D;  1XHY A;  3B6Q A;  4JXI A;  3PUW E;  5AA3 A;  3BBR A;  3O97 A;  2OX3 A;  5AA2 B;  5EQ7 A;  3K4U A;  3CFX A;  3VLV A;  3THI A;  3RTF B;  4G68 B;  2NWJ A;  2XXU A;  3OSQ A;  5ET8 A;  2PVU A;  3C32 A;  1JP4 A;  3O29 A;  1Q9D A;  5FTI A;  4Q0C A;  4I8C A;  3O6H A;  3GBA A;  1BLF A;  1AWB A;  5ICQ A;  5EQA A;  4PF8 A;  1LBW A;  4NWD A;  2G93 A;  2F5X A;  3KGC A;  5I57 A;  3ZSF A;  3FXB A;  4MF3 A;  5FHM A;  1QUL A;  2HCA A;  3M3K A;  4UAC A;  4YKJ A;  4DXU A;  5AA1 A;  4OEU A;  3IJX B;  1YCJ A;  1DTG A;  3MZ9 A;  3TUS A;  2XXT A;  4GWY A;  1FBG A;  1M5C A;  4MNI A;  5IGA A;  4N8G A;  1FTL A;  4LUB A;  1JVY A;  1GV8 A;  2XD2 A;  3MAM A;  3OO7 A;  3HFU A;  5HPQ A;  1NV1 A;  2F34 A;  1SI0 A;  1IXC A;  2OZZ A;  3LV0 A;  1XVY A;  2AYS A;  4IY6 A;  3N94 A;  4XKQ A;  4RNS A;  5HBC A;  1Y4C A;  4NTL A;  3UOR A;  2DE2 A;  5ET7 A;  3RLF E;  4GVO A;  4KR5 A;  1JQF A;  3Q29 A;  1MDP 1;  2ABH A;  1VE4 A;  3G3I A;  2Q8M A;  4MAG A;  3ILT B;  2HPG A;  4OWD A;  4F3P A;  2V4C A;  4F29 A;  5LTC A;  2XWO A;  3KBZ A;  2Z8D A;  3MW0 A;  3KJ7 A;  5I2N B;  3Q26 A;  4FBP A;  4H6D A;  2YJP A;  3QUF A;  1LST A;  4GWS A;  1ELJ A;  1LBV A;  3EF7 A;  2WKY A;  3G7W A;  3N26 A;  1NUY A;  2OCU A;  4GQO A;  3FJM A;  3PUV E;  4POX A;  3HHG A;  2OJT A;  4HS7 A;  1EYK A;  1I6B A;  2D5W A;  1FTK A;  1T0K A;  3E9X A;  3RT6 B;  5K2X A;  2RC8 A;  3CG3 A;  4NMY A;  3E78 A;  4PBQ A;  3MVX A;  5LOM A;  1AMF A;  4IO6 A;  3KZG A;  5EYG A;  3H6T A;  1LLS A;  1FQE A;  3L6G A;  1TFD A;  4I9D A;  1SBP A;  1F9B A;  1D4N A;  1I6Q A;  4MHF A;  3MZB A;  2UXA A;  4THI A;  1PC3 A;  3PMV A;  3QK6 A;  4R6H A;  4IO4 A;  2PT2 A;  2A5S A;  1GVC A;  1G0I A;  2DE3 A;  1PBQ A;  3O28 A;  4OVS A;  2B3F A;  4H46 A;  4GFR A;  4R9F A;  1PB7 A;  3B8B A;  3N6U A;  2DYX A;  3L6H A;  4FAT A;  4R9G A;  1HSJ A;  3TOD A;  1B32 A;  2QMW A;  3RPL A;  1MY1 A;  4OHN A;  1B46 A;  1O63 A;  3TEP A;  3QMF A;  1MM6 A;  3U72 A;  1DCU A;  5H8N B;  1QJM A;  1WDN A;  3T22 A;  4PQJ A;  5J16 A;  5ET6 A;  2B4M A;  3N5L A;  3B7D A;  3IAZ A;  2D3I A;  3C4M A;  3IX1 A;  3CFL A;  1FTM A;  4F3S A;  3Q27 A;  2DP8 A;  4LZ5 A;  5A5X B;  5DYH A;  2Z8F A;  1TWY A;  3MVY A;  4EQ7 A;  3K01 A;  3JV9 A;  1N04 A;  3U94 A;  1IIT A;  4QFN A;  5IKB A;  1USY E;  1OQH A;  3VVE A;  1O7T A;  4PE3 A;  2IEE A;  2QVU A;  1S50 A;  5EYF A;  4BDR A;  2F7A A;  2UVG A;  3PD9 A;  4PAI A;  4JVI A;  2PMS A;  5EYH A;  3D4G A;  1S7Y A;  4Z7E A;  1OIB A;  1LBZ A;  3S4U A;  2NVU B;  1B3L A;  1Z7M E;  4H1X A;  3S9L C;  1EZO A;  1LAG E;  3H03 A;  1NV3 A;  4NQ8 A;  4O3B A;  3ZS6 A;  3PPO A;  3QUJ A;  4ELP A;  1DPP A;  2L5V A;  1MQG A;  3PU5 A;  4OYV A;  3PPR A;  2KR0 A;  4RY1 A;  4FAJ A;  1FBF A;  2R6G E;  1IMB A;  5ESY A;  4G8N A;  3TQL A;  3E79 A;  3FZV A;  4ESX A;  4OAN A;  1DPE A;  3PGF A;  3SER A;  3SEY A;  1ZJL A;  3LC8 A;  3OEL A;  2V25 A;  4I3E A;  1DSN A;  4NF8 A;  5IM2 A;  1JEV A;  1FBE A;  1HSE A;  4ECF A;  1FTO A;  1B52 A;  4G4P A;  2AL4 A;  1N7X A;  3RTW B;  4DCX A;  4IO3 A;  3K1N A;  3DLN A;  5I56 B;  3TQW A;  2UVI A;  4GWW A;  1YPN A;  4P3L A;  3IO4 A;  2FNC A;  4P47 A;  1INP A;  2HAU A;  3FJG A;  3T0J A;  4NN3 A;  4RYA A;  1B5I A;  1VDW A;  3MP8 A;  4F2O A;  2ANJ A;  1ZU0 A;  1LFH A;  3I5O A;  3AXF A;  3KFM A;  2DSF A;  3MUQ A;  1FBP A;  3KN3 A;  5I58 B;  3HCQ A;  4PF6 A;  3UGW A;  4QBA A;  4N4U A;  2V84 A;  3MYU A;  1DBZ A;  4C1T A;  4XKN A;  3IOT A;  1FQC A;  1IQ7 A;  2XXY A;  3BFU A;  4LZ8 A;  5EHS A;  5KCJ A;  3C35 A;  3CVG A;  3FVN A;  3SDF A;  3KEI A;  4MIJ A;  1KA1 A;  2WBD A;  3C36 A;  5DVJ A;  4NGU A;  4R72 A;  2MKZ A;  1B3H A;  1LAH E;  4OZ9 A;  2Y84 A;  4PP0 A;  1MXZ A;  3RY3 A;  1MXY A;  3OMB A;  4YB6 A;  4O3A A;  5JTY B;  4PFB A;  4MCO A;  4WKM A;  3FV2 A;  3V89 B;  3CHG A;  4GXA A;  2BJI A;  1P1Q A;  3MQ9 A;  5CBS A;  3RGY A;  4FOR A;  3R7X A;  3P7I A;  1XS5 A;  1FPB A;  2WEF A;  1ZKB A;  3UP9 A;  1Y1Z A;  1KWH A;  2RIN A;  3VDF A;  1OQG A;  4LVQ A;  5F1Q A;  3SES A;  1URD A;  1JEU A;  2QMX A;  2V3U A;  1B51 A;  4H8I A;  4QXD A;  4X8R A;  4TLM B;  1OVB A;  3CR9 A;  4LAT A;  5L9M A;  2Q89 A;  1BP5 A;  1Y3P A;  1A8F A;  4IY5 A;  3MC2 A;  4IGT A;  3SEW A;  3KSX A;  3E3K A;  2DVC A;  4NG7 A;  1LFG A;  2XXR A;  3PV0 E;  2OWZ A;  2G29 A;  4R73 A;  1S9T A;  4F18 A;  2LAO A;  2RC9 A;  3DM0 A;  1OLA A;  5I2K B;  3ZKK A;  4F1U A;  1LFI A;  5F7V A;  4GD5 A;  3HO7 A;  3KBR A;  1VSO A;  3CRB A;  5KDT B;  5CRY A;  1B9J A;  1FPF A;  3LSL A;  4FEB A;  4TQU Q;  2F7B A;  1AOV A;  1FJ9 A;  3OO6 A;  1ZBM A;  4M1V A;  3HV1 A;  1I69 A;  1MQH A;  4N13 A;  3TCF A;  1OMP A;  4XXU A;  1FCK A;  4GIZ A;  2Y7R A;  4TLL B;  3U8Q A;  3E13 X;  5CC2 A;  5IZ3 B;  3ONM A;  1VFE A;  3IL1 B;  1JNF A;  3TTL A;  1MY4 A;  4RPN A;  1WOD A;  2QRY A;  3D1R A;  3KOS A;  5F24 A;  3OEM A;  3SKP A;  5I59 B;  4PFT A;  1SW2 A;  1ZTY A;  1SW5 A;  2M8C A;  3VXC A;  1USY H;  1WVJ A;  3EHU A;  3PMW A;  4PAF A;  4XIG Q;  1P1U A;  5I5P A;  4OVR A;  4MH5 A;  4DE8 A;  2I3W A;  3FD3 A;  4IR8 A;  4FIM A;  4R74 A;  1NV0 A;  4NF4 A;  3TCG A;  1FPI A;  3VE1 B;  4GWO A;  4QFL A;  3S9M C;  3A29 A;  3CI8 A;  1B3E A;  2Q2C A;  4ELR A;  2H99 A;  2E1S A;  3IFA A;  4QFO A;  1YYZ A;  1JW5 A;  2RF1 A;  2CZH A;  1GTK A;  1SI1 A;  1Z7N E;  2RCA A;  3H6U A;  4G68 C;  2XXV A;  2ZMB A;  1N84 A;  4FJP A;  1FSA A;  3KG2 A;  5JK4 A;  2ZYK A;  2QS2 A;  2P2A A;  3LBS A;  5H8H B;  1NV7 A;  3TEL A;  1US5 A;  5KZT A;  1H3D A;  4N07 A;  2AIX A;  4NWC A;  1R1N A;  2O7U A;  3VXB A;  2ZNT A;  4H0W A;  4XTC Q;  5H8Q B;  1TXF A;  1RYX A;  3LSX A;  3TDJ A;  3O6I A;  1PB8 A;  1SDX A;  4ZEI A;  4JDF A;  2QFL A;  2FIX A;  1MQD A;  2WBB A;  4N15 A;  4U4S A;  1FPL A;  4LP2 B;  2I4C A;  2UYF A;  4E0X A;  4KXP A;  2HQ0 A;  4ZED A;  2GHA A;  4OTE A;  1QVS A;  4GRK A;  2XXH A;  2Z22 A;  4NED A;  1UQW A;  2UVJ A;  2DS9 A;  1IIW A;  4JVD A;  3FIR A;  2F36 A;  2I6E A;  2ZYM A;  3K0V A;  3F11 A;  1CB6 A;  1FJ6 A;  4O7M A;  1FBD A;  5CMC A;  4F3B A;  3PUX E;  3SET A;  1UTB B;  1Y1M A;  4PE5 B;  3H3G A;  4XEQ A;  2F3B A;  4GXS B;  4KQP A;  5EQ9 A;  4QSD A;  4N81 A;  4N17 A;  1LEV A;  3EQ1 A;  4OFL A;  2CZK A;  4ND9 A;  3EPE A;  4YIC A;  3UK4 A;  3O6G A;  3FAS A;  5FTH A;  1FTJ A;  4GL0 A;  3O2A A;  3ZKL A;  3O66 A;  1H45 A;  4JWO A;  3MPK A;  1B7U A;  5TU0 A;  2O84 X;  1D9V A;  1A7L A;  3FBP A;  4MNP A;  2PX1 A;  2ZZV A;  2NOO A;  4GBV A;  4F31 B;  2XHD A;  4EQ9 A;  5ITP A;  3LUY A;  5I57 B;  1FTA A;  2OLB A;  1NI9 A;  4F1Y A;  2X26 A;  3O9P A;  2DDK A;  1N7W A;  1P1N A;  1CE2 A;  3K1M A;  3MVZ A;  2CMO A;  4NF6 A;  3VFJ A;  3K02 A;  2F6P A;  3G3K A;  2V93 A;  4PFY A;  4U23 A;  2HFB A;  1AL3 A;  4OQO A;  3BIH A;  3LUZ A;  2V3T A;  4LQ2 A;  1P1O A;  4U21 A;  4JVC A;  4LN5 A;  1I6A A;  1FPK A;  3EHT A;  4EF1 A;  2VHA A;  1LAF E;  2KQZ A;  1UTH A;  2UYE A;  3SEX A;  2REG A;  2VP1 A;  3DP4 A;  1YXI A;  2OWS A;  2XXW A;  3FGS A;  1IXH A;  4FED A;  1MXV A;  4KYE A;  2RCB A;  1LCT A;  5DW8 A;  4TOZ A;  3M3F A;  4GX4 A;  3IFC A;  1BIY A;  3U1O A;  5I7I A;  3OO8 A;  1ZLQ A;  3I3V A;  4YZZ A;  2VPO A;  1EH3 A;  1TT1 A;  2CEX A;  1SW1 A;  1B2H A;  3HPI A;  2O69 A;  3BFT A;  3FUZ A;  3KC0 A;  3PUY E;  4P56 A;  2Z23 A;  1QGX A;  5FHO A;  2O6A A;  3B6W A;  1PDA A;  2X7Q A;  3H4Z A;  4FE8 A;  3K2D A;  2F3D A;  3RUM A;  4RK9 A;  4XFE A;  4YU0 A;  1XI6 A;  3MJN A;  4BLA A;  1OVT A;  4OFO A;  4E0W A;  3ROJ A;  1QKB A;  2HZK A;  4IB2 A;  4NHB A;  4M4G A;  1NNF A;  4AS4 A;  4RXL A;  4Z0I A;  1POY 1;  3PPQ A;  1MQJ A;  2YPN A;  5AA4 A;  1LB9 A;  2QSX A;  4OXV A;  4N6D A;  5EQ8 A;  4U1Z A;  1JW1 A;  1UIV A;  2XWK A;  3U92 A;  4P11 A;  3IB0 A;  5DEX A;  2R8T A;  3OOA A;  2YLN A;  2XX9 A;  4MNC A;  2FHY A;  1OLC A;  4G8H A;  5ISU A;  1PB9 A;  3JZJ A;  2CEY A;  3KN8 A;  5AE4 A;  5TP9 A;  3QSL A;  3LSW A;  4OFJ A;  5IAI A;  5TPA A;  1NNP A;  1QW0 A;  2ZNU A;  3VLU A;  3S2V A;  3MPL A;  3FXU A;  4QF9 A;  4GF8 A;  1Q35 A;  4O8M A;  3UA8 A;  1R9Q A;  5DVI A;  4BDL A;  1UIU A;  2H4I A;  2P1S A;  4F1V A;  1B3F A;  4BDQ A;  3RPW A;  2DWJ A;  4H5G A;  1EZ9 A;  2VT5 A;  2A5T A;  1MM7 A;  3A09 A;  4H8J A;  4MBP A;  2ONS A;  4LZ7 A;  4PFR A;  4Q30 B;  3RPL B;  2GH9 A;  3FXQ A;  4QFK A;  3E4R A;  1BTJ A;  3KC1 A;  2F97 A;  1EZP A;  1H43 A;  4NF6 B;  4X1B A;  1JW4 A;  2ZYO A;  3FVK A;  4WXJ A;  3KOT A;  5BUU A;  1AIV A;  2XXQ A;  3PUZ E;  4GX3 A;  4GWU A;  5H8F A;  4LQ5 A;  3VLW A;  3FVO A;  1Y3Q A;  3RN8 A;  1XOC A;  2VD3 A;  4DCY A;  4K3F A;  5CI5 A;  2DWH A;  1UTH B;  1FPE A;  3QAX A;  1NUW A;  3G3F A;  4GWX A;  1HSL A;  4OVQ A;  1FQB A;  4OEN A;  4YKP A;  4NF5 A;  3PPP A;  4R2F A;  1B1H A;  4N8Y A;  3ODB A;  1RDY A;  3W15 C;  4ZEF A;  4OEV A;  4KYD A;  5DTB A;  4DZ1 A;  1JET A;  2WX9 A;  3USD A;  1H44 A;  1LBC A;  5AA2 A;  4I1D A;  2VGQ A;  3IOV A;  2F7C A;  3K6X A;  1DOT A;  1SPI A;  4IO7 A;  1ZMG A;  2HEU A;  4G68 A;  1GR2 A;  1DMB A;  2V3Q A;  3GXA A;  4NAP A;  4MMP A;  4YB5 A;  1B5H A;  1XVX A;  4ZE8 A;  1LBY A;  1D9Y A;  3T96 B;  1JVX A;  3EHS A;  1LAX A;  1ATG A;  1POT A;  1B6H A;  4YMA A;  4C0R A;  1US4 A;  4C1U A;  4X48 A;  4I3Y A;  4PTK A;  1MDQ A;  4KCC A;  3T93 B;  3BIG A;  3U65 A;  3UN6 A;  1II5 A;  5JEI A;  5BWJ A;  4NF8 B;  2QS3 A;  1N3X A;  2PCR A;  5T3J A;  3W9W A;  3T9V A;  4L17 A;  1EYI A;  3LR1 A;  1B1X A;  4ONY A;  1EU8 A;  1KA0 A;  2P3V A;  3IO6 A;  4YB7 A;  4EXL A;  2F78 A;  1B7H A;  2Y7K A;  1YZ0 A;  2GRV A;  1MPB A;  4HCY A;  5HM4 B;  1Y9U A;  4LA9 A;  4BDM A;  4H45 A;  4P1L A;  4XF5 A;  3N6T A;  1MY2 A;  4U4X A;  3T9H B;  4LON B;  1MXX A;  3IOW A;  1NKX A;  3OSR A;  5L9S A;  3MP6 A;  2HXR A;  3IOU A;  2GQ1 A;  3TTN A;  4AB6 A;  1MY0 A;  4OVP A;  1FQF A;  2ESN A;  4DXB A;  2ZYN A;  4XKP A;  5KCJ B;  2ONK E;  5I2N A;  2I0B A;  1B40 A;  5IZ1 A;  4ISU A;  3TTK A;  4X04 A;  1A54 A;  2DVZ A;  1B58 A;  1IEJ A;  1MPD A;  2B3B A;  1IMC A;  1B0H A;  4RPO A;  4H65 A;  3V8X B;  1VR5 A;  1LBB A;  3H6V A;  3MST A;  5CMB A;  3MP1 A;  2H5Y A;  1MH3 A;  4PAK A;  3CG1 A;  3ECR A;  2Y7I A;  1SVX B;  1L5T A;  3C9H A;  4JB7 A;  1FQD A;  1Q1K A;  4POW A;  4OMB A;  3IB2 A;  4HE0 A;  2RKM A;  1H76 A;  3LSF B;  1SYH A;  3T9X B;  3ISP A;  1YTV A;  1FPJ A;  1IMA A;  5H8S A;  4QRZ A;  2XXK A;  4O7I A;  3FAT A;  1MRP A;  1URG A;  3MZ1 A;  4ZZE A;  3JYR A;  5L8D A;  4OET A;  1D9Q A;  2PBW A;  3PMX A;  1G0H A;  4YAH X;  4N91 A;  2Q2A A;  2X7P A;  5H8N A;  3K6U A;  1K9Y A;  2ALU A;  2DXY A;  4RA1 A;  2XXX A;  3GZG A;  2XWV A;  1D3K A;  1MG1 A;  1XC1 A;  5A5X A;  3MVW A;  5IZZ A;  1NV2 A;  1EYJ A;  2F35 A;  2O51 A;  2THI A;  5DT6 A;  4MJO A;  2VPN A;  1NH7 A;  2KLF A;  1YAE A;  4MEV A;  2Y7W A;  3IK6 B;  4PFU A;  1A40 A;  1NL5 A;  4I40 A;  2CZL A;  4KI0 E;  4XKR A;  2OBG A;  1NMU A;  1LB8 A;  4DDD A;  1FBH A;  5CMM A;  2I4B A;  2DWI A;  3R6U A;  3C33 A;  4MX6 A;  1MXW A;  4U1O A;  4NX1 A;  2PYY A;  4ZE9 A;  4P1E A;  2ZNS A;  3GYY A;  3RYD A;  2AL5 A;  1XT8 A;  1Y4T A;  1N0T A;  4KPT A;  3MWB A;  3MBP A;  4UA8 A;  2XXP A;  4ZS9 A;  2IA4 A;  3TFL A;  1NH8 A;  4EQB A;  4EF2 A;  4AB5 A;  4F2Q A;  3HN0 A;  3WAF A;  4IGR A;  3H7M A;  1IXG A;  4NF4 B;  3QXM A;  1LGB C;  4U22 A;  4OES A;  5L9O A;  5LDZ A;  2Y5L A;  4HE2 A;  3V83 A;  2QVR A;  2DOJ A;  3KN7 A;  1B4Z A;  4KYS A;  1B4H A;  1DTZ A;  1K9Z A;  4ZZA A;  5CMK A;  3G3G A;  3GLB A;  2VD2 A;  1TFA A;  1PEB A;  2Q9T A;  3S9N C;  2BJJ X;  4KFQ A;  5FHN A;  5I56 A;  1Y3N A;  4JWY A;  2DQV A;  2O1M A;  4GL8 A;  3V5A A;  3K00 A;  1NNK A;  3T9U A;  4GBW A;  3I6V A;  3G3H A;  3T66 A;  5I58 A;  5A5L A;  1AH5 A;  3D4C A;  3TTR A;  4YKK A;  3FV1 A;  3NOH A;  1B0L A;  1M5E A;  3PPN A;  1RKM A;  4DI4 B;  2XA5 A;  3B6T A;  1SYI A;  3VV5 A;  4MFI A;  2QS1 A;  1B5J A;  4P8B A;  2P3N A;  4DLD A;  2I3V A;  3TYH A;  2ZZW A;  3OEN A;  4F22 A;  4MLV A;  4JSD A;  1NV6 A;  3DEL B;  2Q8J A;  3PD8 A;  2H98 A;  2HXW A;  4R6K A;  1P1W A;  1M5B A;  1QUI A;  3RT8 A;  3OO9 A;  2DXR A;  2F8D A;  2PFY A;  2XXI A;  1ZIU A;  4HTG A;  4HW8 A;  2OWT A;  4OER A;  5JTY A;  3OD7 A;  1FRP A;  1NNT A;  2W7Y A;  1NUX A;  2XD3 A;  1MH4 A;  3WAE A;  2O7I A;  1NFT A;  1FW0 A;  5M2V A;  1B7Z A;  5ET5 A;  3FXR A;  4KHZ E;  4KCD A;  4MLQ A;  2DE4 A;  1KZ8 A;  2QVV A;  4BDO A;  5ELV A;  2O1L A;  5B70 A;  2B65 A;  4ELO A;  4KD5 A;  4P0I A;  3RQT A;  1IME A;  4P0G A;  1FBC A;  1RDX A;  3K6V A;  4YKI A;  3C31 A;  4JBZ A;  1ANF A;  3GBB A;  2FBP A;  4RK2 A;  3VVF A;  2PFZ A;  1A99 A;  2OK2 A;  1SW4 A;  4X1D A;  4EXK A;  3Q28 A;  1NUZ A;  2DWA A;  4ZEK A;  1QUK A;  3CSB A;  2QPQ A;  3IJO B;  5I2K A;  4RJZ A;  2VOZ A;  2ZZX A;  1CNQ A;  4GX6 A;  4U2R A;  4G61 A;  3CFZ A;  4I62 A;  1RDZ A;  3OEK A;  5KDT A;  2I58 A;  2F6G A;  3OXN A;  1P99 A;  2RC7 A;  2XX7 A;  1MS7 A;  2XWI A;  3QIM A;  4QHQ A;  2E0S A;  3UIF A;  4R2B A;  4GLI A;  1B05 A;  4ZEB A;  2Q74 A;  3KJT A;  3FJ7 A;  4EUO A;  4OVJ A;  2I49 A;  4QSE A;  4R75 A;  4PBH A;  1O64 A;  3CIJ A;  5J1D A;  4G8M A;  1MPC A;  1LCF A;  4PCD A;  1N3W A;  2FYI A;  2Q88 A;  2WYK A;  2Y5K A;  4ELQ A;  3ILU B;  3S9E A;  3C34 A;  1SD3 A;  4O3C A;  5IZ3 A;  3M8U A;  4PFI A;  1DK4 A;  4BDN A;  3KSJ A;  3SEV A;  2FVZ A;  5I59 A;  4AS5 A;  4HCW A;  4OA4 A;  3SEU A;  3HST A;  1MQI A;  1A55 A;  4NE4 A;  4AQ4 A;  4NF0 A;  3EKI A;  1B3G A;  1N76 A;  3IR1 A;  2HZL A;  2QJE A;  2D21 A;  2HAV A;  4DIG A;  4Q8R A;  1IZ1 A;  3R26 A;  4HE1 A;  1R9L A;  4QFP A;  2R71 A;  3SZP A;  4DI3 D;  1M5D A;  3U93 A;  4HXV A;  5CM6 A;  2R9J A; 
#chains in the Genus database with same CATH homology
 4Q5T A;  2QS4 A;  2ZXT A;  4R6Y A;  5AA4 B;  1Y20 A;  4WEP A;  3QYT A;  3TAJ A;  1RYO A;  2P0S A;  3EN3 A;  3TPA A;  4F19 A;  4PET A;  4GOT A;  5DEX B;  3IOR A;  1IUD A;  5I84 A;  1GGG A;  1IXI A;  5H8H A;  5TP9 B;  4YMB A;  3VVD A;  5TPA B;  3IB1 A;  2XX8 A;  3A3U A;  2GFE A;  2UVH A;  2I48 A;  3DP8 A;  4F39 A;  3H06 B;  1R6Z A;  1QKA A;  3K1P A;  5K2Y A;  4F3G A;  4G77 A;  1VFD A;  1M5F A;  2Z8E A;  5H8Q A;  3M3L A;  4EDP A;  3TCH A;  4FEC A;  4QSC A;  4ZDM A;  3RNN A;  1SQY A;  2Y7P A;  4ESW A;  2A5T B;  2GHB A;  4H67 A;  4PFW A;  3W9V A;  3FVG A;  2FA7 A;  2NUV A;  5EHM A;  5DVF A;  4WED A;  4JWX A;  2REJ A;  4JSO A;  1FQA A;  2O68 A;  3TKD A;  1MXU A;  1A8E A;  4IO2 A;  3CSG A;  2ONR A;  1J1N A;  5H8F B;  4H5F A;  1URS A;  1PBP A;  5B7D A;  5ICT A;  4N6P A;  2QL3 A;  3Q25 A;  3HHF A;  4G2Z A;  2NXO A;  3K6W A;  3DP6 A;  3A3C A;  3H6W A;  2H25 A;  2H9B A;  3TZA A;  4NF5 B;  4X9T A;  2PT1 A;  2I0C A;  5CBR A;  3BKI B;  1BKA A;  1UTB A;  1QUJ A;  3TTM A;  3G3J A;  4DXC A;  3TMG A;  4IO5 A;  4ZEC A;  1MY3 A;  5ITO A;  5AA2 D;  1XHY A;  3B6Q A;  4JXI A;  3PUW E;  5AA3 A;  3BBR A;  3O97 A;  5AA2 B;  3K4U A;  3CFX A;  3VLV A;  3THI A;  3RTF B;  4G68 B;  2NWJ A;  2XXU A;  3OSQ A;  2PVU A;  3C32 A;  3O29 A;  5FTI A;  4Q0C A;  4I8C A;  3O6H A;  3GBA A;  1BLF A;  5ICQ A;  4NWD A;  2G93 A;  2F5X A;  3KGC A;  5I57 A;  3ZSF A;  5FHM A;  4MF3 A;  1QUL A;  2HCA A;  3M3K A;  4UAC A;  4YKJ A;  4DXU A;  5AA1 A;  4OEU A;  3IJX B;  1YCJ A;  1DTG A;  3MZ9 A;  3TUS A;  2XXT A;  1M5C A;  1FTL A;  4LUB A;  1JVY A;  1GV8 A;  2XD2 A;  3MAM A;  3OO7 A;  5HPQ A;  2F34 A;  1SI0 A;  1IXC A;  2OZZ A;  1XVY A;  2AYS A;  4IY6 A;  3N94 A;  4XKQ A;  4RNS A;  5HBC A;  1Y4C A;  4NTL A;  3UOR A;  2DE2 A;  3RLF E;  4GVO A;  4KR5 A;  1JQF A;  3Q29 A;  1MDP 1;  2ABH A;  1VE4 A;  3G3I A;  3ILT B;  4OWD A;  4F3P A;  4F29 A;  2Z8D A;  3MW0 A;  3KJ7 A;  5I2N B;  3Q26 A;  4H6D A;  2YJP A;  3QUF A;  1LST A;  1ELJ A;  3EF7 A;  2WKY A;  3G7W A;  3N26 A;  2OCU A;  4GQO A;  3FJM A;  3PUV E;  4POX A;  3HHG A;  2OJT A;  4HS7 A;  1I6B A;  2D5W A;  1FTK A;  1T0K A;  3E9X A;  3RT6 B;  5K2X A;  2RC8 A;  3CG3 A;  4NMY A;  3MVX A;  5LOM A;  1AMF A;  4IO6 A;  3KZG A;  3H6T A;  1LLS A;  1FQE A;  3L6G A;  1TFD A;  4I9D A;  1SBP A;  1F9B A;  1D4N A;  1I6Q A;  3MZB A;  2UXA A;  4THI A;  1PC3 A;  3PMV A;  3QK6 A;  4R6H A;  4IO4 A;  2PT2 A;  2A5S A;  1GVC A;  2DE3 A;  1PBQ A;  3O28 A;  2B3F A;  4GFR A;  4R9F A;  1PB7 A;  3N6U A;  2DYX A;  3L6H A;  4FAT A;  4R9G A;  1HSJ A;  3TOD A;  1B32 A;  2QMW A;  1MY1 A;  4OHN A;  1B46 A;  1O63 A;  3TEP A;  1MM6 A;  3U72 A;  5H8N B;  1QJM A;  1WDN A;  3T22 A;  4PQJ A;  3N5L A;  3B7D A;  3IAZ A;  2D3I A;  3C4M A;  3IX1 A;  3CFL A;  1FTM A;  4F3S A;  3Q27 A;  2DP8 A;  4LZ5 A;  5A5X B;  5DYH A;  2Z8F A;  1TWY A;  3MVY A;  4EQ7 A;  3K01 A;  3JV9 A;  1N04 A;  3U94 A;  1IIT A;  4QFN A;  5IKB A;  1USY E;  1OQH A;  3VVE A;  1O7T A;  2IEE A;  1S50 A;  5EYF A;  4BDR A;  2F7A A;  2UVG A;  3PD9 A;  2PMS A;  3D4G A;  1S7Y A;  4Z7E A;  1OIB A;  3S4U A;  2NVU B;  1B3L A;  1Z7M E;  4H1X A;  3S9L C;  1EZO A;  1LAG E;  3H03 A;  4O3B A;  3ZS6 A;  3PPO A;  3QUJ A;  4ELP A;  1DPP A;  1MQG A;  3PU5 A;  4OYV A;  3PPR A;  4RY1 A;  4FAJ A;  2R6G E;  4G8N A;  3TQL A;  3FZV A;  4ESX A;  1DPE A;  3PGF A;  3SER A;  3SEY A;  1ZJL A;  3LC8 A;  3OEL A;  2V25 A;  1DSN A;  4NF8 A;  1JEV A;  1HSE A;  4ECF A;  1FTO A;  1B52 A;  4G4P A;  2AL4 A;  1N7X A;  3RTW B;  4DCX A;  4IO3 A;  3K1N A;  3DLN A;  5I56 B;  3TQW A;  2UVI A;  1YPN A;  3IO4 A;  2FNC A;  2HAU A;  3FJG A;  4RYA A;  1B5I A;  3MP8 A;  4F2O A;  2ANJ A;  1ZU0 A;  1LFH A;  3I5O A;  3AXF A;  3KFM A;  2DSF A;  3MUQ A;  3KN3 A;  5I58 B;  3HCQ A;  3UGW A;  2V84 A;  4C1T A;  4XKN A;  3IOT A;  1FQC A;  1IQ7 A;  2XXY A;  3BFU A;  4LZ8 A;  5EHS A;  5KCJ A;  3C35 A;  3CVG A;  3FVN A;  3SDF A;  3KEI A;  3C36 A;  5DVJ A;  4R72 A;  1B3H A;  1LAH E;  4OZ9 A;  2Y84 A;  4PP0 A;  1MXZ A;  3RY3 A;  1MXY A;  3OMB A;  4YB6 A;  4O3A A;  5JTY B;  4WKM A;  3FV2 A;  3V89 B;  4GXA A;  1P1Q A;  3MQ9 A;  5CBS A;  3RGY A;  4FOR A;  3R7X A;  3P7I A;  1XS5 A;  1ZKB A;  3UP9 A;  1Y1Z A;  1KWH A;  2RIN A;  3VDF A;  1OQG A;  4LVQ A;  5F1Q A;  3SES A;  1URD A;  1JEU A;  2QMX A;  2V3U A;  1B51 A;  4H8I A;  4TLM B;  1OVB A;  3CR9 A;  4LAT A;  5L9M A;  2Q89 A;  1BP5 A;  1Y3P A;  1A8F A;  4IY5 A;  3MC2 A;  4IGT A;  3SEW A;  3KSX A;  3E3K A;  2DVC A;  1LFG A;  2XXR A;  3PV0 E;  2G29 A;  4R73 A;  1S9T A;  4F18 A;  2LAO A;  2RC9 A;  3DM0 A;  1OLA A;  5I2K B;  3ZKK A;  4F1U A;  1LFI A;  5F7V A;  4GD5 A;  3HO7 A;  3KBR A;  1VSO A;  3CRB A;  5KDT B;  5CRY A;  1B9J A;  3LSL A;  4FEB A;  4TQU Q;  2F7B A;  1AOV A;  3OO6 A;  1ZBM A;  4M1V A;  3HV1 A;  1I69 A;  1MQH A;  4N13 A;  3TCF A;  1OMP A;  4XXU A;  1FCK A;  4GIZ A;  2Y7R A;  4TLL B;  3U8Q A;  3E13 X;  5CC2 A;  3ONM A;  1VFE A;  3IL1 B;  1JNF A;  3TTL A;  1MY4 A;  4RPN A;  1WOD A;  2QRY A;  3KOS A;  3OEM A;  3SKP A;  5I59 B;  4PFT A;  1SW2 A;  1ZTY A;  1SW5 A;  2M8C A;  3VXC A;  1USY H;  1WVJ A;  3EHU A;  3PMW A;  4XIG Q;  1P1U A;  4MH5 A;  4DE8 A;  2I3W A;  3FD3 A;  4FIM A;  4R74 A;  4NF4 A;  3TCG A;  3VE1 B;  4GWO A;  4QFL A;  3S9M C;  3CI8 A;  1B3E A;  2Q2C A;  4ELR A;  2H99 A;  2E1S A;  4QFO A;  1JW5 A;  2RF1 A;  1GTK A;  1SI1 A;  1Z7N E;  2RCA A;  3H6U A;  4G68 C;  2XXV A;  2ZMB A;  1N84 A;  4FJP A;  3KG2 A;  5JK4 A;  2ZYK A;  2QS2 A;  2P2A A;  3LBS A;  5H8H B;  3TEL A;  1US5 A;  5KZT A;  1H3D A;  4N07 A;  2AIX A;  4NWC A;  1R1N A;  2O7U A;  3VXB A;  2ZNT A;  4H0W A;  4XTC Q;  5H8Q B;  1TXF A;  1RYX A;  3LSX A;  3TDJ A;  3O6I A;  1PB8 A;  1SDX A;  4ZEI A;  4JDF A;  1MQD A;  4U4S A;  4LP2 B;  2I4C A;  2UYF A;  4E0X A;  2HQ0 A;  4ZED A;  2GHA A;  4OTE A;  1QVS A;  4GRK A;  2XXH A;  2Z22 A;  4NED A;  1UQW A;  2UVJ A;  2DS9 A;  1IIW A;  3FIR A;  2F36 A;  2I6E A;  2ZYM A;  3K0V A;  3F11 A;  1CB6 A;  5CMC A;  4F3B A;  3PUX E;  3SET A;  1UTB B;  1Y1M A;  4PE5 B;  3H3G A;  4GXS B;  4KQP A;  4QSD A;  3EQ1 A;  4OFL A;  4ND9 A;  3EPE A;  4YIC A;  3UK4 A;  3O6G A;  3FAS A;  5FTH A;  1FTJ A;  4GL0 A;  3O2A A;  3ZKL A;  3O66 A;  1H45 A;  4JWO A;  3MPK A;  1B7U A;  5TU0 A;  2O84 X;  1D9V A;  1A7L A;  2PX1 A;  2NOO A;  4F31 B;  2XHD A;  4EQ9 A;  5ITP A;  3LUY A;  5I57 B;  2OLB A;  4F1Y A;  2X26 A;  3O9P A;  1N7W A;  1P1N A;  1CE2 A;  3K1M A;  3MVZ A;  2CMO A;  4NF6 A;  3VFJ A;  3K02 A;  2F6P A;  3G3K A;  2V93 A;  4PFY A;  4U23 A;  2HFB A;  1AL3 A;  4OQO A;  2V3T A;  4LQ2 A;  1P1O A;  4U21 A;  1I6A A;  3EHT A;  4EF1 A;  2VHA A;  1LAF E;  2UYE A;  1UTH A;  3SEX A;  2REG A;  2VP1 A;  3DP4 A;  2OWS A;  2XXW A;  3FGS A;  1IXH A;  4FED A;  1MXV A;  4KYE A;  2RCB A;  1LCT A;  4TOZ A;  3M3F A;  1BIY A;  3U1O A;  3OO8 A;  1ZLQ A;  3I3V A;  4YZZ A;  1EH3 A;  1TT1 A;  1SW1 A;  1B2H A;  3HPI A;  2O69 A;  3BFT A;  3FUZ A;  3PUY E;  2Z23 A;  5FHO A;  2O6A A;  3B6W A;  1PDA A;  2X7Q A;  3H4Z A;  4FE8 A;  3K2D A;  3RUM A;  4RK9 A;  4YU0 A;  3MJN A;  4BLA A;  1OVT A;  4OFO A;  4E0W A;  1QKB A;  2HZK A;  4IB2 A;  4M4G A;  1NNF A;  4RXL A;  4Z0I A;  1POY 1;  3PPQ A;  1MQJ A;  2YPN A;  5AA4 A;  1LB9 A;  2QSX A;  4OXV A;  4U1Z A;  1JW1 A;  1UIV A;  3U92 A;  4P11 A;  3IB0 A;  5DEX A;  3OOA A;  2YLN A;  2XX9 A;  1OLC A;  4G8H A;  5ISU A;  1PB9 A;  3JZJ A;  5AE4 A;  3KN8 A;  5TP9 A;  3QSL A;  3LSW A;  4OFJ A;  5IAI A;  5TPA A;  1NNP A;  1QW0 A;  2ZNU A;  3VLU A;  3S2V A;  3MPL A;  3FXU A;  4QF9 A;  4GF8 A;  1Q35 A;  3UA8 A;  1R9Q A;  5DVI A;  4BDL A;  1UIU A;  2H4I A;  2P1S A;  4F1V A;  1B3F A;  4BDQ A;  3RPW A;  2DWJ A;  4H5G A;  1EZ9 A;  2A5T A;  1MM7 A;  3A09 A;  4H8J A;  4MBP A;  2ONS A;  4LZ7 A;  4Q30 B;  2GH9 A;  3FXQ A;  4QFK A;  3E4R A;  1BTJ A;  2F97 A;  1EZP A;  1H43 A;  4NF6 B;  4X1B A;  1JW4 A;  2ZYO A;  3FVK A;  4WXJ A;  3KOT A;  5BUU A;  1AIV A;  2XXQ A;  3PUZ E;  5H8F A;  4LQ5 A;  3VLW A;  3FVO A;  1Y3Q A;  3RN8 A;  1XOC A;  2VD3 A;  4DCY A;  4K3F A;  5CI5 A;  2DWH A;  1UTH B;  3QAX A;  3G3F A;  1HSL A;  1FQB A;  4OEN A;  4YKP A;  4NF5 A;  3PPP A;  4R2F A;  1B1H A;  3ODB A;  3W15 C;  4ZEF A;  4OEV A;  4KYD A;  5DTB A;  4DZ1 A;  1JET A;  3USD A;  1H44 A;  1LBC A;  5AA2 A;  4I1D A;  2VGQ A;  3IOV A;  2F7C A;  3K6X A;  1DOT A;  4IO7 A;  1ZMG A;  2HEU A;  4G68 A;  1GR2 A;  1DMB A;  2V3Q A;  3GXA A;  4YB5 A;  1B5H A;  1XVX A;  4ZE8 A;  1D9Y A;  3T96 B;  1JVX A;  3EHS A;  1LAX A;  1ATG A;  1POT A;  1B6H A;  4YMA A;  4C0R A;  1US4 A;  4C1U A;  4X48 A;  1MDQ A;  4KCC A;  3T93 B;  3UN6 A;  1II5 A;  5JEI A;  5BWJ A;  4NF8 B;  2QS3 A;  1N3X A;  3W9W A;  3T9V A;  4L17 A;  3LR1 A;  1B1X A;  4ONY A;  1EU8 A;  3IO6 A;  4YB7 A;  4EXL A;  2F78 A;  1B7H A;  2Y7K A;  2GRV A;  1MPB A;  4HCY A;  5HM4 B;  1Y9U A;  4LA9 A;  4BDM A;  3N6T A;  1MY2 A;  4U4X A;  3T9H B;  4LON B;  1MXX A;  3IOW A;  1NKX A;  3OSR A;  5L9S A;  3MP6 A;  3IOU A;  3TTN A;  4AB6 A;  1MY0 A;  1FQF A;  2ESN A;  4DXB A;  2ZYN A;  4XKP A;  5KCJ B;  2ONK E;  5I2N A;  2I0B A;  1B40 A;  4ISU A;  3TTK A;  1A54 A;  2DVZ A;  1B58 A;  1IEJ A;  1MPD A;  2B3B A;  1B0H A;  4RPO A;  4H65 A;  3V8X B;  1VR5 A;  1LBB A;  3H6V A;  5CMB A;  3MP1 A;  2H5Y A;  1MH3 A;  3CG1 A;  3ECR A;  2Y7I A;  1SVX B;  1L5T A;  3C9H A;  4JB7 A;  1FQD A;  1Q1K A;  4POW A;  4OMB A;  3IB2 A;  2RKM A;  1H76 A;  3LSF B;  1SYH A;  3T9X B;  1YTV A;  5H8S A;  4QRZ A;  3FAT A;  1MRP A;  1URG A;  3MZ1 A;  4ZZE A;  3JYR A;  5L8D A;  4OET A;  2PBW A;  3PMX A;  4YAH X;  2Q2A A;  2X7P A;  5H8N A;  3K6U A;  2ALU A;  2DXY A;  4RA1 A;  2XXX A;  3GZG A;  1D3K A;  1MG1 A;  1XC1 A;  5A5X A;  3MVW A;  2F35 A;  2O51 A;  2THI A;  5DT6 A;  1NH7 A;  2KLF A;  1YAE A;  2Y7W A;  3IK6 B;  4PFU A;  1A40 A;  1NL5 A;  2CZL A;  4KI0 E;  4XKR A;  2OBG A;  1NMU A;  1LB8 A;  4DDD A;  5CMM A;  2I4B A;  2DWI A;  3R6U A;  3C33 A;  1MXW A;  4U1O A;  2PYY A;  4ZE9 A;  2ZNS A;  2AL5 A;  1XT8 A;  1Y4T A;  1N0T A;  4KPT A;  3MWB A;  3MBP A;  4UA8 A;  2XXP A;  4ZS9 A;  2IA4 A;  3TFL A;  1NH8 A;  4EQB A;  4EF2 A;  4AB5 A;  4F2Q A;  3HN0 A;  3WAF A;  4IGR A;  3H7M A;  1IXG A;  4NF4 B;  3QXM A;  1LGB C;  4U22 A;  4OES A;  5L9O A;  3V83 A;  2DOJ A;  3KN7 A;  1B4Z A;  4KYS A;  1B4H A;  1DTZ A;  4ZZA A;  5CMK A;  3G3G A;  3GLB A;  2VD2 A;  1TFA A;  1PEB A;  2Q9T A;  3S9N C;  2BJJ X;  4KFQ A;  5FHN A;  5I56 A;  1Y3N A;  4JWY A;  2DQV A;  2O1M A;  4GL8 A;  3V5A A;  3K00 A;  1NNK A;  3T9U A;  3I6V A;  3G3H A;  3T66 A;  5I58 A;  1AH5 A;  3D4C A;  3TTR A;  4YKK A;  3FV1 A;  1B0L A;  1M5E A;  3PPN A;  1RKM A;  3B6T A;  1SYI A;  3VV5 A;  4MFI A;  2QS1 A;  1B5J A;  4DLD A;  2I3V A;  3TYH A;  3OEN A;  4F22 A;  4MLV A;  4JSD A;  3DEL B;  2Q8J A;  3PD8 A;  2H98 A;  2HXW A;  4R6K A;  1P1W A;  1M5B A;  1QUI A;  3RT8 A;  3OO9 A;  2DXR A;  2F8D A;  2XXI A;  1ZIU A;  4HTG A;  4HW8 A;  2OWT A;  4OER A;  5JTY A;  3OD7 A;  2W7Y A;  1NNT A;  2XD3 A;  1MH4 A;  3WAE A;  2O7I A;  1NFT A;  1FW0 A;  5M2V A;  1B7Z A;  3FXR A;  4KHZ E;  4KCD A;  4MLQ A;  2DE4 A;  4BDO A;  5ELV A;  2O1L A;  5B70 A;  2B65 A;  4ELO A;  4KD5 A;  4P0I A;  3RQT A;  4P0G A;  3K6V A;  4YKI A;  3C31 A;  4JBZ A;  1ANF A;  3GBB A;  4RK2 A;  3VVF A;  1A99 A;  2OK2 A;  1SW4 A;  4X1D A;  4EXK A;  3Q28 A;  2DWA A;  4ZEK A;  1QUK A;  3CSB A;  2QPQ A;  3IJO B;  5I2K A;  4RJZ A;  2VOZ A;  4U2R A;  3CFZ A;  4I62 A;  3OEK A;  5KDT A;  2I58 A;  2F6G A;  3OXN A;  1P99 A;  2RC7 A;  2XX7 A;  1MS7 A;  3QIM A;  4QHQ A;  2E0S A;  3UIF A;  4R2B A;  4GLI A;  1B05 A;  4ZEB A;  3KJT A;  3FJ7 A;  4EUO A;  4OVJ A;  2I49 A;  4QSE A;  4R75 A;  1O64 A;  3CIJ A;  5J1D A;  4G8M A;  1MPC A;  1LCF A;  1N3W A;  2FYI A;  2Q88 A;  4ELQ A;  3ILU B;  3S9E A;  3C34 A;  1SD3 A;  4O3C A;  3M8U A;  4BDN A;  3KSJ A;  3SEV A;  5I59 A;  4HCW A;  3SEU A;  3HST A;  1MQI A;  1A55 A;  4NE4 A;  4AQ4 A;  1B3G A;  1N76 A;  3IR1 A;  2HZL A;  2QJE A;  2D21 A;  2HAV A;  4DIG A;  4Q8R A;  1IZ1 A;  3R26 A;  1R9L A;  4QFP A;  2R71 A;  1M5D A;  3U93 A;  5CM6 A;  2R9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...