2XXWA

Crystal structure of the gluk2 (glur6) d776k lbd dimer in complex with glutamate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
250
structure length
250
Chain Sequence
RSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRKKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational Flexibility of the Ligand-Binding Domain Dimer in Kainate Receptor Gating and Desensitization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 2
total genus 78
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2xxwA02
3MUQA 4GLIA 1MQHA 3H6TA 4Z0IA 5ISUA 3MZ9A 3AXFA 4UACA 1D3KA 1B3EA 4M1VA 4U4XA 3C32A 4RYAA 3PGFA 4KFQA 3S4UA 4C1TA 3FVOA 3G3JA 4YKJA 3VLWA 4QSEA 4P0GA 4H1XA 5ITPA 1OIBA 4TLLB 1PC3A 4BDOA 1MXXA 1WVJA 2I48A 4AB5A 2H5YA 2UXAA 4JBZA 2F5XA 5CMBA 3UK4A 1M5DA 5JEIA 1B32A 1IIWA 3OEMA 4I62A 4M4GA 4ISUA 5FTIA 4C0RA 3MPKA 3FGSA 3K02A 5L9MA 4EQBA 3KGCA 4NF4A 3JV9A 4F3PA 3KN3A 3TCGA 1B6HA 2YJPA 3M8UA 4NF5A 3QK6A 4ZEIA 4Q0CA 4YAHX 3LBSA 3BKIB 3SDFA 3Q28A 2XXPA 4OEUA 1MPCA 1FTMA 1ZBMA 4F3SA 4F31B 1VFDA 4R9GA 1A8EA 2WKYA 4H6DA 3KEIA 4POWA 3PU5A 1NNTA 2QS2A 2UYFA 3MQ9A 1DPEA 4PFTA 1J1NA 4HTGA 3Q29A 3PPRA 4G2ZA 4E0WA 2UVGA 3DM0A 4U23A 3T96B 3VE1B 3C31A 4K3FA 3U1OA 3UGWA 2ONKE 2ALUA 4KYEA 1H43A 4LZ8A 3MVYA 1B5JA 2Z23A 3V83A 1IZ1A 4BDLA 1MY3A 1QJMA 1OQHA 1OVTA 1SVXB 5I2NA 1NH7A 2DYXA 3DP8A 2V3QA 1NNPA 4ZEDA 1VFEA 1AL3A 4H5GA 3CG3A 2F35A 4FE8A 1TT1A 5AE4A 1KWHA 4I9DA 1Y1MA 2F7BA 2H9BA 3CSBA 4U22A 2P0SA 4HCYA 5I2NB 3B6QA 3GBAA 4NF8A 2ZYNA 3OMBA 3IB0A 5H8HA 2I49A 4FJPA 3CVGA 4GXSB 4ND9A 3TEPA 1OQGA 4G8HA 3O29A 4NWCA 1N3WA 3A3CA 2XX7A 4DE8A 2VD3A 4EXKA 4NE4A 1I6QA 4GFRA 3UN6A 1S7YA 1DMBA 3K00A 4I8CA 1R9QA 4YKKA 1EZOA 3RUMA 1IXGA 4Q5TA 5TPAA 3U94A 4F2OA 4LUBA 1R1NA 4JWOA 4KCDA 3T9HB 1NMUA 2I3VA 3RTWB 2XXTA 1OLAA 4G77A 3S2VA 3CIJA 1D4NA 4LONB 2Y7PA 2ESNA 5ITOA 2XXXA 4H8JA 4F18A 4EF1A 2E1SA 3N6UA 3H6VA 1A54A 1USYH 1MDQA 2XHDA 5DEXA 1JVXA 1HSJA 2DE3A 3RLFE 4H0WA 4F3GA 3PMWA 1T0KA 2I6EA 2Z8FA 1FW0A 2X7PA 1N84A 3H06B 2R6GE 3SETA 3TELA 1B2HA 4BLAA 1IEJA 3SEXA 1B0LA 1MPBA 2DVCA 3O2AA 4WEPA 1M5FA 3RGYA 5KCJA 3G3IA 5DVJA 1Z7NE 1F9BA 3N5LA 2B3FA 2QJEA 4DXCA 4EQ9A 3TZAA 5EYFA 2DXYA 2DWIA 3R26A 2W7YA 4IO6A 1R6ZA 3S9EA 3MW0A 3TODA 2DXRA 2HCAA 2P2AA 1LB8A 1EU8A 2OWTA 2YLNA 3K4UA 4GQOA 4GIZA 2REGA 3WAFA 3ZS6A 4FORA 4IO5A 3SKPA 4IB2A 3C35A 1AOVA 1FTKA 3PUZE 1MS7A 1B3LA 4IGRA 4PFYA 3TTMA 3P7IA 3T22A 2F6PA 5I2KB 3SEUA 1B3FA 2DP8A 5AA4B 5H8NB 2RINA 1BTJA 3FV1A 4ELPA 2PVUA 1QUJA 3IOVA 4R2FA 4R9FA 5I59B 3K6UA 1B1HA 5FHMA 3Q26A 3LSLA 1URGA 4RJZA 4XTCQ 3O6GA 2GFEA 1IITA 3PUWE 2F7AA 4U1OA 3RT6B 5IAIA 1M5CA 4C1UA 1UTBB 3BBRA 4MF3A 5CBSA 1YCJA 2UVIA 3D4CA 4IO7A 1DPPA 2HAVA 3C4MA 4IO3A 5CMCA 2HFBA 4RXLA 3RTFB 4DIGA 5IKBA 2Z22A 4H67A 3QUJA 3BFTA 1FQAA 3TAJA 1SI1A 2ANJA 3FXQA 1BIYA 2QSXA 5DVIA 3MBPA 3RNNA 3FATA 3FVKA 3ZKKA 3VXCA 4YB6A 2XXIA 1VSOA 5H8QA 3SEYA 4DXUA 3N26A 1UTHA 4R74A 1LFHA 2O7UA 5L8DA 2Q89A 2VHAA 3KG2A 3N94A 2R9JA 4BDRA 3FJMA 2BJJX 1VE4A 4OTEA 3IJXB 5I84A 2H25A 2XD2A 3HHGA 4OERA 4TQUQ 1XHYA 1ZTYA 2FA7A 3B6TA 3HPIA 1USYE 4DLDA 2HEUA 4OMBA 3IO4A 4GWOA 2HZKA 5AA1A 1ATGA 2B3BA 1HSLA 2ZNTA 3SEVA 3THIA 1WDNA 3TCHA 3K1MA 3OO8A 5AA2D 5JK4A 1DOTA 1N7WA 3ZSFA 3FASA 3UP9A 2H98A 3T9XB 4OETA 3GBBA 3MP8A 3U8QA 3Q27A 5H8NA 1IXCA 4NF6A 3MWBA 4YICA 1PEBA 1N7XA 1UQWA 4EUOA 1IXIA 3L6HA 2XXRA 1JW5A 4O3BA 2REJA 1ZMGA 3KZGA 4NWDA 4BDNA 4U2RA 2O1LA 4QRZA 1MXUA 3TKDA 1MXYA 2DSFA 4N6PA 4RNSA 1ZJLA 1TFDA 3OEKA 4DCXA 5ICQA 3TTLA 4LZ5A 3TUSA 3FXRA 5CI5A 2Y7RA 1S9TA 1YAEA 1QVSA 2OBGA 3IJOB 1O63A 1CB6A 1Y4TA 4Q30B 3TPAA 4Z7EA 4WKMA 2R71A 3MVXA 2DWJA 3H7MA 3M3KA 1LLSA 3OSRA 5I58B 3VFJA 3MPLA 1SBPA 4KYDA 3H6UA 4YU0A 1MY4A 2GH9A 3ILUB 3LSXA 3O6IA 1DTZA 2M8CA 4PFWA 1UIVA 1O64A 3FUZA 4F22A 2P1SA 3OELA 5K2XA 3TTRA 1B0HA 2Y7KA 4QFPA 3USDA 3TTNA 2AL5A 5EHMA 2PYYA 4YKPA 3ZKLA 4IO4A 4OWDA 1QKAA 1FTJA 2FYIA 3E9XA 1CE2A 3IX1A 3OO7A 2IEEA 5CC2A 3KJ7A 2QRYA 1FQFA 2H4IA 1PB8A 1OVBA 1SW2A 2X26A 3H03A 4JDFA 3GLBA 3TTKA 4ZEKA 1PBPA 1LAHE 2A5TB 5HPQA 4HCWA 4GXAA 4IO2A 1FCKA 3K0VA 1YPNA 4R73A 1MY0A 2F97A 1DSNA 1P1NA 1P1WA 2V93A 2ZYOA 1URDA 1N0TA 3E4RA 1FQCA 3EF7A 1NNFA 2IA4A 2Z8EA 3QUFA 4FEBA 4X1DA 3RY3A 3W15C 5HM4B 4H5FA 1AIVA 3H4ZA 4GF8A 4P0IA 4P11A 5KZTA 3G7WA 3EHSA 4HW8A 2I4CA 1ELJA 4XXUA 3RN8A 4ZEFA 2D5WA 1MQJA 1JEVA 1LFGA 3EN3A 3KBRA 3IK6B 1GV8A 1P99A 3MAMA 5B70A 5CMKA 5J1DA 4G68C 3B7DA 4F39A 4RPNA 4F1VA 5K2YA 3KOTA 4NEDA 3OD7A 5TU0A 1SQYA 1SYHA 3EHUA 3SESA 4EDPA 2Z8DA 3O66A 4LQ2A 4AB6A 3K1PA 5CMMA 1A7LA 4KYSA 3IORA 4RA1A 2O69A 5H8SA 4ESWA 3QXMA 2GHAA 2QS3A 3IOUA 4F2QA 2AL4A 2OZZA 3U93A 1MQIA 1MRPA 2THIA 1JW1A 2Y7IA 3IO6A 4FECA 4L17A 4OVJA 2RCBA 4QSCA 4IY5A 1H45A 2CMOA 4TOZA 2RC7A 1P1UA 4OFLA 3MVWA 2I58A 2V25A 1RYXA 1NL5A 1JVYA 1MXWA 3LUYA 1MY1A 2PT1A 3K01A 3TDJA 2O51A 3ONMA 5BWJA 2VGQA 3KSXA 3O6HA 1LAFE 2VD2A 4QFOA 4NF8B 1TXFA 1M5EA 3MZ1A 4R75A 2H99A 4QFLA 3TFLA 4E0XA 3CFXA 4RK9A 1Y3PA 1POTA 2O84X 4X48A 4OFJA 4XKRA 4IGTA 1HSEA 3PD8A 3DELB 2NUVA 3FD3A 4JSOA 3QSLA 4O3AA 4MFIA 4OYVA 3C9HA 4MLQA 3OOAA 3FV2A 4KPTA 5FTHA 4PETA 4ZDMA 1I6AA 1OLCA 3EQ1A 3N6TA 1XOCA 4G68A 4FAJA 5KDTB 3H6WA 4ZZAA 4BDMA 4RPOA 2CZLA 2FNCA 1MY2A 2RCAA 2AIXA 3ECRA 2NVUB 1JETA 1SDXA 3H3GA 3QIMA 1B5IA 1H76A 5DYHA 5FHNA 4ZZEA 1RYOA 4H65A 2XXUA 1B4ZA 2OK2A 2DQVA 5TP9A 3UIFA 2D21A 2Q88A 2V3TA 2Y7WA 1H3DA 4F29A 3CR9A 4G68B 3FZVA 2E0SA 2F7CA 2QMXA 1MM6A 3TQWA 4G8MA 3ODBA 4QFKA 3HV1A 3OXNA 4DXBA 4F19A 3CI8A 1GGGA 4U1ZA 3S9NC 1ANFA 4EQ7A 2DOJA 2F78A 2LAOA 3E13X 2ABHA 3GZGA 3V89B 3GXAA 3WAEA 4H8IA 4PP0A 1PBQA 1US5A 2VOZA 3R6UA 5H8HB 1GVCA 3OO9A 3U72A 4JSDA 1B4HA 3TCFA 3C34A 2G93A 3VVEA 3HO7A 1EH3A 4EXLA 1I69A 1WODA 3K6XA 1IQ7A 1EZ9A 2O7IA 1FQBA 3FVGA 3M3FA 4DDDA 3RPWA 3VLUA 2I3WA 3OENA 1BLFA 1S50A 3VXBA 4YKIA 3W9VA 4GOTA 3G3HA 5B7DA 3MZBA 5AA2A 4PQJA 4MLVA 4JXIA 1ZLQA 3JYRA 2XXVA 4OXVA 3K6WA 2QL3A 3PV0E 3RT8A 3TMGA 4ZE8A 2D3IA 3S9MC 4BDQA 1ZIUA 1SYIA 2QMWA 2DS9A 5L9OA 2UVJA 2RC9A 4OESA 1PB9A 3S9LC 2OLBA 3PMXA 3PPOA 5DT6A 2F8DA 3R7XA 4R72A 4NF4B 4GL0A 1BKAA 1UIUA 5F7VA 3CFZA 3FIRA 4KD5A 2HZLA 1LBBA 4U4SA 4RY1A 3T66A 3UORA 5CBRA 1B1XA 3B6WA 5DVFA 3O9PA 4NTLA 1RKMA 1GTKA 1NNKA 3IB1A 3IOTA 5TP9B 3V5AA 4XIGQ 1A55A 1ZU0A 1A8FA 3T9VA 2HXWA 1B05A 1MQDA 2OJTA 3VV5A 4ELQA 1IXHA 3KFMA 4ZE9A 5I2KA 4ZS9A 4LQ5A 3A3UA 3VLVA 1GR2A 1QUIA 3G3GA 1Z7ME 2PMSA 1B52A 2XXHA 2ZNUA 4QSDA 4LP2B 1A40A 1AMFA 3EPEA 4POXA 5CM6A 3EHTA 3KN8A 2QS1A 4G4PA 2UVHA 1N04A 3U92A 1Y4CA 4GD5A 1B7UA 2I0BA 4DCYA 2F36A 2O68A 1B3GA 1XS5A 2Q2CA 3A09A 2AYSA 3PUYE 4YB5A 5HBCA 1IUDA 3O97A 4GRKA 3MVZA 1SW1A 3PUVE 1NFTA 2RF1A 2XXWA 2XXYA 3RQTA 4Q8RA 5AA4A 1MQGA 1XVYA 4FATA 3L6GA 4LZ7A 1TWYA 1O7TA 4F1YA 5AA2B 4R6YA 4R2BA 3MJNA 3VDFA 3IB2A 3JZJA 3MP1A 2PT2A 2ZYMA 4KHZE 5DEXB 3T93B 4JWXA 4RK2A 3T9UA 1URSA 4JWYA 5I57A 1PB7A 5JTYB 1Y3QA 2OCUA 4ONYA 4PFUA 1SD3A 3DP6A 3FXUA 1SW5A 3PMVA 1N3XA 4ELRA 1VR5A 2HQ0A 3QAXA 1MM7A 2QS4A 3I5OA 1QW0A 3TQLA 2I0CA 4ZEBA 1JQFA 2KLFA 4YZZA 1DTGA 1QKBA 2NOOA 3G3KA 1YTVA 4QHQA 5I58A 1LBCA 3HCQA 4OFOA 3Q25A 3SERA 2Q9TA 5I56B 4ELOA 4X9TA 1NH8A 4N07A 4DZ1A 1Y9UA 4LVQA 3V8XB 4G8NA 4QF9A 2DWHA 5H8FA 1BP5A 4MH5A 3VVDA 4PE5B 5AA3A 2ZYKA 1QULA 2QPQA 1JNFA 1B7HA 3QYTA 3M3LA 4NF6B 1Q1KA 3CFLA 3I3VA 3K2DA 4WEDA 5JTYA 4NMYA 5L9SA 3BFUA 4OEVA 1LAXA 4OENA 4XKQA 1UTHB 2A5SA 4AQ4A 5ICTA 1A99A 1B58A 3PD9A 3IAZA 3PUXE 4X1BA 1SW4A 5KDTA 1H44A 4I1DA 5F1QA 1Y3NA 3PPPA 5A5XA 5BUUA 2B65A 4YMBA 1LB9A 1MPDA 3KN7A 1FQEA 4F1UA 4IY6A 2X7QA 4FIMA 5I59A 4F3BA 3LR1A 1R9LA 1TFAA 2RKMA 2XX8A 3ILTB 1MG1A 3IR1A 4QFNA 3SEWA 1FQDA 1PDAA 3HHFA 4GVOA 1B5HA 1LCFA 2GRVA 1UTBA 2O1MA 4OQOA 4MBPA 5ELVA 5TPAB 1MXZA 1P1OA 1B9JA 1XC1A 1LAGE 2V84A 2YPNA 3CSGA 1LFIA 5H8QB 1B40A 2HAUA 5A5XB 4FEDA 2PBWA 2Q8JA 1EZPA 2Q2AA 2Y84A 4R6KA 4YB7A 5M2VA 4ESXA 2NWJA 1MH3A 2I4BA 2O6AA 2PX1A 2VP1A 4LATA 5CRYA 5FHOA 1AH5A 4OZ9A 1MDP1 1Y1ZA 1B7ZA 3C33A 1LSTA 2UYEA 1NKXA 3DLNA 3HN0A 3LSFB 1P1QA 1D9VA 1MXVA 3K6VA 3OSQA 3PPNA 3DP4A 1LCTA 1I6BA 2F6GA 1B46A 3G3FA 3W9WA 3CRBA 4GL8A 5H8FB 4XKNA 2DVZA 2ZMBA 2RC8A 4NF5B 2XD3A 3MP6A 4U21A 3LSWA 3OO6A 2OWSA 1N76A 3IOWA 4N13A 1OMPA 4HS7A 2GHBA 1B3HA 4JB7A 3PPQA 1II5A 3FJ7A 2A5TA 3D4GA 4WXJA 3I6VA 4TLMB 2ZNSA 2ZXTA 3KJTA 4EF2A 4KR5A 1D9YA 1JEUA 4OHNA 2DWAA 4KCCA 4THIA 3CG1A 1Q35A 4LA9A 2V3UA 3E3KA 3HSTA 4R6HA 2NXOA 5LOMA 1M5BA 4KI0E 4YMAA 2G29A 1US4A 3UA8A 3FVNA 2XXQA 5EHSA 3MC2A 2DE2A 4KQPA 1FTLA 4UA8A 2ONRA 1POY1 3FJGA 5I56A 5KCJB 3O28A 3TYHA 3KOSA 1XT8A 1JW4A 4ECFA 2XX9A 1ZKBA 3C36A 1MH4A 3F11A 3K1NA 3LC8A 3VVFA 4O3CA 1B51A 1L5TA 2DE4A 3KSJA 4XKPA 3IL1B 1Y20A 2ONSA 1SI0A 1XVXA 5DTBA 4ZECA 5I57B 1LGBC 1QUKA 2F34A 1FTOA
chains in the Genus database with same CATH superfamily
1AWBA 4Z0IA 5I3SA 3G3JA 4H1XA 5ITPA 1OIBA 4P1LA 1PC3A 4TLLB 1MXXA 4BDOA 5CMBA 5JEIA 4I62A 4ISUA 3MPKA 3FGSA 4EQBA 4NF4A 5ET5A 2YJPA 3M8UA 1D9QA 3BKIB 3SDFA 3Q28A 1FTMA 2WKYA 4MMPA 3KEIA 1NNTA 2QS2A 3MQ9A 4U23A 3VE1B 3U1OA 4X04A 2FHYA 1H43A 2Z23A 1QJMA 4H5GA 1TT1A 4MNIA 2P0SA 1Q9DA 5I2NB 4GXSB 4NWCA 3O29A 4DE8A 4NQ8A 4EXKA 4NE4A 4GFRA 3UN6A 3K00A 1R9QA 4F2OA 1LBXA 4JWOA 1D4NA 3N6UA 3H6VA 3CHGA 1MDQA 2XHDA 2DE3A 1N84A 3SETA 1B2HA 4BLAA 1B0LA 1MPBA 2DVCA 1FPLA 1KA1A 3N5LA 2QJEA 3TZAA 4MEVA 2PCRA 3R26A 2QVVA 5DW8A 2P2AA 3FXBA 4GQOA 4GIZA 3ZS6A 4FORA 1FTKA 4IGRA 4PE3A 2F6PA 1B3FA 5H8NB 2RINA 5FHMA 1B1HA 2GQ1A 3Q26A 3O6GA 2P3NA 2GFEA 4C1UA 4MF3A 5CBSA 1YCJA 4IO7A 3D4CA 4IO3A 2B4LA 3RTFB 4H67A 5DVIA 3VXCA 4GX4A 3SEYA 3BIGA 2VHAA 3N94A 1VE4A 3HHGA 4OMBA 3IO4A 2B3BA 2ZNTA 3K1MA 4GWWA 3FASA 3T9XB 3U8QA 5H8NA 3KZGA 4NWDA 5EQAA 4LN5A 1MXUA 3TKDA 5ICQA 3RPLB 1ZJLA 2Y7RA 1FBFA 3IJOB 1O63A 1CB6A 5F24A 4KYDA 4YU0A 4PGNA 4PF8A 2GH9A 2M8CA 3OELA 1JP4A 2PYYA 4YKPA 3IX1A 3OO7A 2IEEA 3TTKA 1OVBA 1SW2A 1PBPA 1LAHE 5HPQA 4GXAA 4IO2A 1FCKA 3K0VA 2V93A 3E4RA 4X1DA 3H4ZA 3EHSA 2PFZA 1LFGA 2VPNA 4NF0A 4G68C 4F39A 1FPDA 1LBZA 3OD7A 3EHUA 2Z8DA 3O66A 4LQ2A 4AB6A 3K1PA 5CMMA 4I40A 1IMCA 3IOUA 3U93A 1MRPA 4FECA 4L17A 4IY5A 4TOZA 1P1UA 4OFLA 2I58A 1IMFA 1MXWA 1MY1A 2PT1A 2WBDA 3ONMA 2VGQA 4QFOA 3TFLA 4QFLA 4RK9A 1POTA 4X48A 4OFJA 4XKRA 4NAPA 4IGTA 3FD3A 4JSOA 3QSLA 3C9HA 4MLQA 4KPTA 4ZDMA 3N6TA 1OLCA 5I7IA 3H6WA 2NVUB 3ECRA 1JETA 3H3GA 3QIMA 3EKIA 4H65A 1B4ZA 4GWZA 1FPBA 2Q88A 2V3TA 3MYUA 4G68B 3FZVA 2E0SA 2F7CA 2QMXA 3TQWA 2L5VA 3HV1A 3OXNA 4F19A 4U1ZA 4EQ7A 3E13X 2F78A 2OWZA 4H8IA 1GVCA 5H8HB 1FBHA 4UABA 3HO7A 1IQ7A 4O7IA 1EZ9A 1BLFA 3PV0E 4BDQA 1SYIA 5L9OA 2UVJA 2RC9A 1PB9A 3PPOA 4NF4B 4GL0A 1BKAA 5CBRA 1LBBA 4RY1A 3IB1A 1ZU0A 4PCDA 1A8FA 2OJTA 3VV5A 4N81A 1IXHA 3KFMA 4LQ5A 1GR2A 3G3GA 1Z7ME 2PMSA 4POXA 4HE1A 2QS1A 3KN8A 1Y4CA 4GD5A 4DCYA 3PUYE 2WYKA 3RQTA 2RF1A 3E78A 1XVYA 4F1YA 3VDFA 3IB2A 3JZJA 3MP1A 1FPFA 2ZYMA 4RK2A 1URSA 5I57A 5JTYB 4N6DA 1Y3QA 3DP6A 1QW0A 4ZEBA 2KLFA 1DTGA 4QHQA 3SERA 5I56B 4ELOA 4DZ1A 4LVQA 5EYGA 5H8FA 3IFCA 3QYTA 3M3LA 5JTYA 3I3VA 4P3LA 5ICTA 1UTHB 4AQ4A 4JVIA 3PD9A 3PTYA 3PUXE 1INPA 5A5LA 4I1DA 1MPDA 4F1UA 2X7QA 3LR1A 3SEWA 1FQDA 3HHFA 1LEVA 4GVOA 1B5HA 2O1MA 4OQOA 1UTBA 2P3VA 4GX6A 5TPAB 5IM2A 2V84A 3CSGA 3LUZA 4YB7A 4X8RA 1MH3A 2O6AA 5CRYA 1AH5A 3C33A 1LSTA 3K6VA 4OVPA 1I6BA 5H8FB 3OO6A 2OWSA 1FJ6A 1N76A 4HS7A 4MHFA 5IGAA 4WXJA 2A5TA 3I6VA 2ZXTA 4EF2A 4KR5A 1JEUA 1Q35A 2KR0A 3E3KA 4KI0E 5KCJB 5KCJA 1FTLA 4UA8A 1POY1 1JW4A 4MX6A 4ECFA 3F11A 3VVFA 4PF6A 2HPGA 1L5TA 3IL1B 2HXRA 2F34A 1MQHA 1B3EA 4M1VA 3PGFA 3S4UA 4YKJA 3VLWA 4QSEA 3GYYA 4N8GA 4PAIA 2I48A 4N4UA 2UXAA 3UK4A 1B32A 1IIWA 3OEMA 5FTIA 3K02A 4F3PA 4YAHX 2XXPA 4PTKA 1ZBMA 1LBYA 4KXPA 1A8EA 3PU5A 4PFTA 4E0WA 4HTGA 3Q29A 3PPRA 4G2ZA 2UVGA 4K3FA 4MAGA 1B5JA 1IZ1A 4BDLA 2DYXA 1FBCA 2FVZA 1G0HA 1KWHA 2F7BA 4U22A 1YZ0A 4HCYA 3GBAA 3TEPA 1OQGA 1N3WA 2XX7A 2VD3A 2FBPA 1I6QA 3U94A 2CZKA 1R1NA 3T9HB 4GWXA 2XXTA 3S2VA 4G77A 3CIJA 5ITOA 2XXXA 4EF1A 1A54A 1USYH 1HSJA 3PMWA 2ZZWA 1T0KA 2Z8FA 2X7PA 5LTCA 4WEPA 2B4MA 1M5FA 3RGYA 3G3IA 5DVJA 4EQ9A 4DXCA 2DWIA 4IO6A 1YYZA 3S9EA 3MW0A 1LB8A 2OWTA 4HXVA 4IO5A 4H45A 3TTMA 2ZZXA 5I2KB 2PVUA 1QUJA 4XF5A 4H46A 5T3JA 4GWUA 3PUWE 1IMEA 5IAIA 4XEQA 1DPPA 4DIGA 5CMCA 3LV0A 2HFBA 4RXLA 5IKBA 2Z22A 3TAJA 1FQAA 3FATA 1FBDA 3BIHA 4YB6A 1DCUA 2XXIA 4DXUA 1UTHA 1LFHA 4BDRA 3FJMA 4OTEA 5EQ8A 4TQUQ 1XHYA 1LBVA 1RDZA 2HZKA 5AA1A 5JK4A 1N7WA 3Q27A 1IXCA 4NF6A 1PEBA 4JVDA 4EUOA 3ROJA 2REJA 4BDNA 1MXYA 4DCXA 3TTLA 3TUSA 3FXRA 1YAEA 2OBGA 1Y4TA 1YXIA 4Z7EA 2DWJA 1LLSA 3MPLA 3LSXA 3O6IA 1UIVA 2P1SA 5K2XA 1B0HA 4QFPA 3USDA 3TTNA 5EHMA 3ZKLA 3E9XA 1CE2A 1FQFA 2H4IA 3GLBA 4HCWA 1YPNA 3MVXA 1NNFA 2IA4A 4GF8A 3G7WA 2I4CA 4XXUA 3KBRA 3IK6B 3MAMA 5B70A 3B7DA 4F1VA 5K2YA 5TU0A 3SESA 5EYHA 4EDPA 4HE0A 1A7LA 1NV3A 1NV4A 3QXMA 2AL4A 2THIA 4G61A 2CMOA 2CEXA 3KC0A 2V25A 1RYXA 1JVYA 3LUYA 3K01A 5BWJA 3MZ1A 4E0XA 2H99A 4QBAA 4O3AA 4PFBA 4MFIA 5FTHA 3EQ1A 1XOCA 4P8BA 2PFYA 4ZZAA 4OVTA 2RCAA 1MY2A 1SDXA 1B5IA 5DYHA 2DQVA 2Q8MA 3CR9A 1MM6A 3ISPA 4DXBA 1GGGA 1ANFA 2ABHA 3GXAA 2CZHA 1US5A 2VOZA 3U72A 3OO9A 1B4HA 3VVEA 2O7IA 2XWIA 3RPWA 3VLUA 3W9VA 3G3HA 4PQJA 4MLVA 4JXIA 1ZLQA 3RT8A 1FJ9A 3S9LC 2F8DA 4R72A 5F7VA 3FIRA 4KD5A 3T66A 1CNQA 3B6WA 5DVFA 4PGPA 1RKMA 1GTKA 1B05A 1MQDA 2WYPA 5I2KA 4ZS9A 4FBPA 2ZNUA 1B52A 3EPEA 3EHTA 2UVHA 3A09A 4YB5A 1EYKA 3MVZA 2OX3A 4Q8RA 1MQGA 4FATA 3L6GA 3HFUA 4R2BA 3MJNA 2VPOA 1NV1A 4JWXA 3T9UA 2WEFA 4JWYA 1PB7A 2OCUA 4ONYA 3FXUA 1SW5A 3PMVA 1N3XA 2HQ0A 2QS4A 3I5OA 3G3KA 5I58A 1LBCA 4OFOA 4X9TA 1Y9UA 4QF9A 2DWHA 2QPQA 4NF6B 3CFLA 4WEDA 1DK4A 2A5SA 4XFEA 3IAZA 5A5XA 5F1QA 4YMBA 3KN7A 5I59A 4F3BA 2RKMA 3ILTB 1MG1A 4QFNA 5ELVA 1LCFA 1XC1A 5H8QB 1B40A 4FEDA 2Y84A 4R6KA 5FHOA 2PX1A 2UYEA 4OYVA 3LSFB 1P1QA 3PPNA 3DP4A 1LCTA 2F6GA 4NF5B 3MP6A 3LSWA 4I3YA 2GHBA 4HE2A 3FJ7A 4TLMB 2XXKA 3KJTA 3CG1A 2V3UA 4R6HA 2G29A 5EHSA 4N91A 5ET6A 3TYHA 3KOSA 4MIJA 1ZKBA 3K1NA 2DE4A 3KSJA 1Y20A 2HHMA 1NV5A 4O94A 1SI0A 1XVXA 5DTBA 5I57B 4GLIA 4NGUA 3MZ9A 3AXFA 4UACA 4RYAA 3FVOA 1M5DA 4C0RA 4PDDA 5L9MA 3KN3A 3QK6A 4Q0CA 3LBSA 4OEUA 1MPCA 4F31B 1VFDA 4R9GA 4H6DA 4POWA 3DM0A 1KZ8A 3C31A 3UGWA 2ALUA 4KYEA 3MVYA 3V83A 1OVTA 1NH7A 3DP8A 2V3QA 1NNPA 4ZEDA 1VFEA 2QVUA 1AL3A 3CG3A 4FE8A 5AE4A 1Y1MA 3CSBA 4NG7A 1EYIA 2CEYA 4NF8A 5H8HA 2I49A 4G8HA 3A3CA 1S7YA 3RUMA 1IXGA 1LBWA 5TPAA 4LUBA 4H8JA 2E1SA 5DEXA 4F3GA 3TELA 3H06B 1IEJA 3SEXA 3O2AA 2BJIA 4AS4A 1Z7NE 1F9BA 5EYFA 2DXYA 2DXRA 1EU8A 2REGA 3WAFA 1AOVA 4PFYA 4OVSA 4PFIA 2DP8A 1BTJA 4NN3A 4R9FA 2F7AA 3RT6B 3T22A 2HAVA 4PDHA 3BFTA 1SI1A 3FXQA 2QSXA 3MBPA 3FVKA 1VSOA 5H8QA 3NOHA 3N26A 5EQ7A 4R74A 2O7UA 1XI6A 4N17A 3KG2A 4N8YA 5L8DA 3T1BA 5I84A 2H25A 2XD2A 3B6TA 2FA7A 4DLDA 4GWOA 1ATGA 1HSLA 3SEVA 3TCHA 5AA2D 1NV2A 3ZSFA 3UP9A 3GBBA 3MP8A 5I5PA 4YICA 1IXIA 4O3BA 1FPEA 1ZMGA 4U2RA 2DSFA 1TFDA 1SPIA 1S9TA 1EYJA 3D1RA 4Q30B 4WKMA 5J16A 1SBPA 3H6UA 1MY4A 3ILUB 1DTZA 1O64A 2AL5A 4IO4A 1FTJA 2FYIA 5CC2A 3KJ7A 2QRYA 4JDFA 1PB8A 2X26A 3H03A 4ZEKA 2MKZA 4MCOA 1DSNA 1P1NA 1P1WA 4NF8B 1URDA 4FEBA 1FQCA 2Z8EA 3QUFA 3W15C 1AIVA 4H5FA 4P0IA 4HW8A 1ELJA 3RN8A 4ZEFA 1MQJA 2D5WA 5CMKA 4DI4B 4PFRA 1SQYA 1SYHA 4PBQA 3IORA 4RA1A 4ESWA 1NUWA 2QS3A 2Y7IA 1JW1A 4OVJA 2RCBA 1H45A 3MVWA 4MNCA 4DI3D 2O51A 3KSXA 4R75A 2V4CA 1HSEA 3PD8A 2NUVA 4IR8A 4PETA 4G68A 4BDMA 4RPOA 5EQ9A 2FNCA 1G0IA 1H76A 4ZZEA 1RYOA 5IZ1A 2XXUA 5TP9A 2D21A 2Y7WA 1H3DA 4OVRA 3ODBA 3S9NC 1RDYA 2DOJA 3GZGA 3WAEA 1PBQA 4JSDA 2G93A 1I69A 5FBPA 3FVGA 3M3FA 4DDDA 1S50A 3MZBA 2XXVA 4OXVA 3K6WA 2QL3A 4ZE8A 3E79A 4PAKA 2DS9A 3PMXA 1B1XA 5TP9B 3FBPA 3V5AA 1FRPA 2F3DA 3T9VA 4ZE9A 4AS5A 1NUZA 5CM6A 5KDTA 1K9YA 2XWKA 4G4PA 2F36A 2O68A 1B3GA 1FBEA 1XS5A 2Q2CA 2AYSA 3PUVE 4OVQA 1NFTA 2XXWA 4LZ7A 5AA2B 2PT2A 1SD3A 4ELRA 1DBZA 3TQLA 1MM7A 1QKBA 2NOOA 1YTVA 1IMAA 2Q9TA 1NH8A 4N07A 3B50A 3RPLA 3VVDA 1JNFA 1B7HA 1Q1KA 3K2DA 4NMYA 5L9SA 4XKQA 1A99A 4GBVA 4X1BA 1SW4A 1Y3NA 3PPPA 5BUUA 1FPJA 1LB9A 1FQEA 4GWYA 1TFAA 2XX8A 2GRVA 1P1OA 1LAGE 1LFIA 2HAUA 3KBZA 2PBWA 2Q8JA 1EZPA 4ESXA 2NWJA 1FBGA 2VP1A 4LATA 1Y1ZA 1B7ZA 5ET8A 3DLNA 3OSQA 1MXVA 1B46A 3G3FA 4GX3A 3CRBA 4GL8A 4XKNA 2DVZA 2XD3A 4U21A 3IOWA 4N13A 1OMPA 1B3HA 5DEXB 4JB7A 1II5A 3D4GA 1NV6A 2DWAA 4THIA 4KCCA 4LA9A 3HSTA 2NXOA 4YMAA 3UA8A 3FVNA 2XXQA 3MC2A 2DE2A 4O8MA 3IFAA 2ONRA 3O28A 4PBHA 2XX9A 1MH4A 4O3CA 2ONSA 2XWVA 1LGBC 1FTOA 3MUQA 3H6TA 5ISUA 1D3KA 2JJKA 4U4XA 3C32A 4KFQA 4C1TA 1FSAA 4OA4A 4P0GA 4AB5A 1WVJA 2H5YA 1FPIA 4JBZA 2F5XA 4PAFA 4M4GA 3KGCA 3JV9A 3TCGA 1B6HA 4NF5A 4ZEIA 4F3SA 2UYFA 4I3EA 1DPEA 1J1NA 3T96B 1FTAA 2ONKE 4O7MA 4LZ8A 1MY3A 1OQHA 1SVXB 5I2NA 2XA5A 2F35A 4I9DA 2H9BA 3B6QA 2ZYNA 3OMBA 3IB0A 4MNPA 4FJPA 3CVGA 4ND9A 1NUXA 5ESYA 1DMBA 4I8CA 4YKKA 1EZOA 4Q5TA 1K9ZA 4KCDA 1NMUA 2I3VA 3RTWB 4OANA 1OLAA 4LONB 2Y7PA 2ESNA 4F18A 1JVXA 3RLFE 4H0WA 2I6EA 1FW0A 3KC1A 2R6GE 1NUYA 2B3FA 2W7YA 1R6ZA 3TODA 2HCAA 2YLNA 3K4UA 4NX1A 3SKPA 4IB2A 3C35A 3PUZE 1MS7A 1B3LA 3P7IA 3SEUA 2R8TA 5AA4B 3FV1A 4ELPA 4R2FA 3IOVA 5I59B 3K6UA 3LSLA 1URGA 4RJZA 4XTCQ 3B8BA 1IITA 4U1OA 1M5CA 1UTBB 3BBRA 2UVIA 3C4MA 1KA0A 3QUJA 2ANJA 1BIYA 3RNNA 3ZKKA 2F3BA 2Q89A 2R9JA 2BJJX 3IJXB 4OERA 1ZTYA 3HPIA 1USYE 2HEUA 2Q74A 3THIA 1WDNA 3OO8A 1FBPA 1DOTA 2H98A 4OETA 3MWBA 2QFLA 1N7XA 1UQWA 3L6HA 2XXRA 1JW5A 2O1LA 4QRZA 5AA3A 5LOMA 4RNSA 4N6PA 3OEKA 4LZ5A 5CI5A 1QVSA 3TPAA 2R71A 3OSRA 1IMBA 3H7MA 3M3KA 5I58B 3VFJA 4PFWA 3FUZA 2QVRA 4F22A 3TTRA 1VDWA 2Y7KA 4OWDA 1QKAA 4PC9A 2A5TB 4R73A 1MY0A 2F97A 3RY3A 2ZYOA 1N0TA 3EF7A 5HM4B 4P11A 5KZTA 4NHBA 3SZPA 1JEVA 3EN3A 4GWSA 1GV8A 1P99A 5J1DA 4RPNA 3KOTA 1FPGA 4NEDA 5IZ3A 2WBBA 4KYSA 2O69A 5H8SA 2GHAA 4F2QA 2WX9A 2OZZA 4QXDA 1MQIA 3IO6A 4QSCA 2RC7A 1NL5A 3TDJA 3O6HA 1LAFE 2VD2A 1TXFA 1M5EA 3CFXA 1Y3PA 2FIXA 2O84X 2DDKA 3DELB 3OOAA 3FV2A 1I6AA 4FAJA 5KDTB 2CZLA 2AIXA 4P9KA 5FHNA 1NV0A 5ET7A 2OK2A 3UIFA 4F29A 2XWOA 4G8MA 4QFKA 4N15A 3CI8A 2LAOA 3V89B 1NI9A 4PP0A 3R6UA 3TCFA 3C34A 1EH3A 4EXLA 1WODA 3K6XA 2CZIA 1FQBA 2I3WA 3OENA 3VXBA 2KQZA 4YKIA 4GOTA 3T0JA 5B7DA 5AA2A 3JYRA 3TMGA 2D3IA 3S9MC 1ZIUA 2QMWA 1IMDA 4OESA 2OLBA 5DT6A 1BK4A 3R7XA 1UIUA 3CFZA 3UORA 4U4SA 2HZLA 3O9PA 2FIEA 3IOTA 1NNKA 4NTLA 4XIGQ 1A55A 2Y5LA 2HXWA 4P1EA 4ELQA 5LDZA 3A3UA 3VLVA 1QUIA 2XXHA 4QSDA 4LP2B 1A40A 1AMFA 3QMFA 1NV7A 1N04A 2VT5A 1B7UA 2I0BA 5HBCA 1IUDA 3O97A 4GRKA 1SW1A 2XXYA 2Y5KA 1TWYA 1O7TA 4R6YA 4KHZE 3T93B 5IZZA 4PFUA 1VR5A 3QAXA 2I0CA 1JQFA 4JVCA 4YZZA 3HCQA 3Q25A 3V8XB 4G8NA 1BP5A 4MH5A 4PE5B 4N6KA 1QGXA 2ZYKA 1QULA 3A29A 4P47A 3BFUA 4OEVA 1LAXA 4OENA 1B58A 1RDXA 1H44A 2B65A 4IY6A 4FIMA 1R9LA 3IR1A 1PDAA 4MBPA 1MXZA 1B9JA 2YPNA 5A5XB 2Q2AA 5M2VA 3MSTA 2I4BA 3U92A 4OZ9A 1MDP1 3RYDA 5AA4A 1NKXA 3HN0A 1D9VA 3W9WA 2ZMBA 2RC8A 5IZ3B 4GBWA 1FPKA 3PPQA 2ZNSA 1D9YA 4OHNA 2ZZVA 4MJOA 3U65A 1M5BA 1US4A 4KQPA 3FJGA 5I56A 1XT8A 3C36A 3LC8A 1B51A 4XKPA 4P56A 4ZECA 1QUKA
chains in the Genus database with same CATH topology
3MUQA 4GLIA 1MQHA 3H6TA 4Z0IA 5ISUA 3MZ9A 3AXFA 4UACA 1D3KA 1B3EA 4M1VA 4U4XA 3C32A 4RYAA 3PGFA 4KFQA 3S4UA 4C1TA 3FVOA 3G3JA 4YKJA 3VLWA 4QSEA 4P0GA 4H1XA 5ITPA 1OIBA 4TLLB 1PC3A 4BDOA 1MXXA 1WVJA 2I48A 4AB5A 2H5YA 2UXAA 4JBZA 2F5XA 5CMBA 3UK4A 1M5DA 5JEIA 1B32A 1IIWA 3OEMA 4I62A 4M4GA 4ISUA 5FTIA 4C0RA 3MPKA 3FGSA 3K02A 5L9MA 4EQBA 3KGCA 4NF4A 3JV9A 4F3PA 3KN3A 3TCGA 1B6HA 2YJPA 3M8UA 4NF5A 3QK6A 4ZEIA 4Q0CA 4YAHX 3LBSA 3BKIB 3SDFA 3Q28A 2XXPA 4OEUA 1MPCA 1FTMA 1ZBMA 4F3SA 4F31B 1VFDA 4R9GA 1A8EA 2WKYA 4H6DA 3KEIA 4POWA 3PU5A 1NNTA 2QS2A 2UYFA 3MQ9A 1DPEA 4PFTA 1J1NA 4HTGA 3Q29A 3PPRA 4G2ZA 4E0WA 2UVGA 3DM0A 4U23A 3T96B 3VE1B 3C31A 4K3FA 3U1OA 3UGWA 2ONKE 2ALUA 4KYEA 1H43A 4LZ8A 3MVYA 1B5JA 2Z23A 3V83A 1IZ1A 4BDLA 1MY3A 1QJMA 1OQHA 1OVTA 1SVXB 5I2NA 1NH7A 2DYXA 3DP8A 2V3QA 1NNPA 4ZEDA 1VFEA 1AL3A 4H5GA 3CG3A 2F35A 4FE8A 1TT1A 5AE4A 1KWHA 4I9DA 1Y1MA 2F7BA 2H9BA 3CSBA 4U22A 2P0SA 4HCYA 5I2NB 3B6QA 3GBAA 4NF8A 2ZYNA 3OMBA 3IB0A 5H8HA 2I49A 4FJPA 3CVGA 4GXSB 4ND9A 3TEPA 1OQGA 4G8HA 3O29A 4NWCA 1N3WA 3A3CA 2XX7A 4DE8A 2VD3A 4EXKA 4NE4A 1I6QA 4GFRA 3UN6A 1S7YA 1DMBA 3K00A 4I8CA 1R9QA 4YKKA 1EZOA 3RUMA 1IXGA 4Q5TA 5TPAA 3U94A 4F2OA 4LUBA 1R1NA 4JWOA 4KCDA 3T9HB 1NMUA 2I3VA 3RTWB 2XXTA 1OLAA 4G77A 3S2VA 3CIJA 1D4NA 4LONB 2Y7PA 2ESNA 5ITOA 2XXXA 4H8JA 4F18A 4EF1A 2E1SA 3N6UA 3H6VA 1A54A 1USYH 1MDQA 2XHDA 5DEXA 1JVXA 1HSJA 2DE3A 3RLFE 4H0WA 4F3GA 3PMWA 1T0KA 2I6EA 2Z8FA 1FW0A 2X7PA 1N84A 3H06B 2R6GE 3SETA 3TELA 1B2HA 4BLAA 1IEJA 3SEXA 1B0LA 1MPBA 2DVCA 3O2AA 4WEPA 1M5FA 3RGYA 5KCJA 3G3IA 5DVJA 1Z7NE 1F9BA 3N5LA 2B3FA 2QJEA 4DXCA 4EQ9A 3TZAA 5EYFA 2DXYA 2DWIA 3R26A 2W7YA 4IO6A 1R6ZA 3S9EA 3MW0A 3TODA 2DXRA 2HCAA 2P2AA 1LB8A 1EU8A 2OWTA 2YLNA 3K4UA 4GQOA 4GIZA 2REGA 3WAFA 3ZS6A 4FORA 4IO5A 3SKPA 4IB2A 3C35A 1AOVA 1FTKA 3PUZE 1MS7A 1B3LA 4IGRA 4PFYA 3TTMA 3P7IA 3T22A 2F6PA 5I2KB 3SEUA 1B3FA 2DP8A 5AA4B 5H8NB 2RINA 1BTJA 3FV1A 4ELPA 2PVUA 1QUJA 3IOVA 4R2FA 4R9FA 5I59B 3K6UA 1B1HA 5FHMA 3Q26A 3LSLA 1URGA 4RJZA 4XTCQ 3O6GA 2GFEA 1IITA 3PUWE 2F7AA 4U1OA 3RT6B 5IAIA 1M5CA 4C1UA 1UTBB 3BBRA 4MF3A 5CBSA 1YCJA 2UVIA 3D4CA 4IO7A 1DPPA 2HAVA 3C4MA 4IO3A 5CMCA 2HFBA 4RXLA 3RTFB 4DIGA 5IKBA 2Z22A 4H67A 3QUJA 3BFTA 1FQAA 3TAJA 1SI1A 2ANJA 3FXQA 1BIYA 2QSXA 5DVIA 3MBPA 3RNNA 3FATA 3FVKA 3ZKKA 3VXCA 4YB6A 2XXIA 1VSOA 5H8QA 3SEYA 4DXUA 3N26A 1UTHA 4R74A 1LFHA 2O7UA 5L8DA 2Q89A 2VHAA 3KG2A 3N94A 2R9JA 4BDRA 3FJMA 2BJJX 1VE4A 4OTEA 3IJXB 5I84A 2H25A 2XD2A 3HHGA 4OERA 4TQUQ 1XHYA 1ZTYA 2FA7A 3B6TA 3HPIA 1USYE 4DLDA 2HEUA 4OMBA 3IO4A 4GWOA 2HZKA 5AA1A 1ATGA 2B3BA 1HSLA 2ZNTA 3SEVA 3THIA 1WDNA 3TCHA 3K1MA 3OO8A 5AA2D 5JK4A 1DOTA 1N7WA 3ZSFA 3FASA 3UP9A 2H98A 3T9XB 4OETA 3GBBA 3MP8A 3U8QA 3Q27A 5H8NA 1IXCA 4NF6A 3MWBA 4YICA 1PEBA 1N7XA 1UQWA 4EUOA 1IXIA 3L6HA 2XXRA 1JW5A 4O3BA 2REJA 1ZMGA 3KZGA 4NWDA 4BDNA 4U2RA 2O1LA 4QRZA 1MXUA 3TKDA 1MXYA 2DSFA 4N6PA 4RNSA 1ZJLA 1TFDA 3OEKA 4DCXA 5ICQA 3TTLA 4LZ5A 3TUSA 3FXRA 5CI5A 2Y7RA 1S9TA 1YAEA 1QVSA 2OBGA 3IJOB 1O63A 1CB6A 1Y4TA 4Q30B 3TPAA 4Z7EA 4WKMA 2R71A 3MVXA 2DWJA 3H7MA 3M3KA 1LLSA 3OSRA 5I58B 3VFJA 3MPLA 1SBPA 4KYDA 3H6UA 4YU0A 1MY4A 2GH9A 3ILUB 3LSXA 3O6IA 1DTZA 2M8CA 4PFWA 1UIVA 1O64A 3FUZA 4F22A 2P1SA 3OELA 5K2XA 3TTRA 1B0HA 2Y7KA 4QFPA 3USDA 3TTNA 2AL5A 5EHMA 2PYYA 4YKPA 3ZKLA 4IO4A 4OWDA 1QKAA 1FTJA 2FYIA 3E9XA 1CE2A 3IX1A 3OO7A 2IEEA 5CC2A 3KJ7A 2QRYA 1FQFA 2H4IA 1PB8A 1OVBA 1SW2A 2X26A 3H03A 4JDFA 3GLBA 3TTKA 4ZEKA 1PBPA 1LAHE 2A5TB 5HPQA 4HCWA 4GXAA 4IO2A 1FCKA 3K0VA 1YPNA 4R73A 1MY0A 2F97A 1DSNA 1P1NA 1P1WA 2V93A 2ZYOA 1URDA 1N0TA 3E4RA 1FQCA 3EF7A 1NNFA 2IA4A 2Z8EA 3QUFA 4FEBA 4X1DA 3RY3A 3W15C 5HM4B 4H5FA 1AIVA 3H4ZA 4GF8A 4P0IA 4P11A 5KZTA 3G7WA 3EHSA 4HW8A 2I4CA 1ELJA 4XXUA 3RN8A 4ZEFA 2D5WA 1MQJA 1JEVA 1LFGA 3EN3A 3KBRA 3IK6B 1GV8A 1P99A 3MAMA 5B70A 5CMKA 5J1DA 4G68C 3B7DA 4F39A 4RPNA 4F1VA 5K2YA 3KOTA 4NEDA 3OD7A 5TU0A 1SQYA 1SYHA 3EHUA 3SESA 4EDPA 2Z8DA 3O66A 4LQ2A 4AB6A 3K1PA 5CMMA 1A7LA 4KYSA 3IORA 4RA1A 2O69A 5H8SA 4ESWA 3QXMA 2GHAA 2QS3A 3IOUA 4F2QA 2AL4A 2OZZA 3U93A 1MQIA 1MRPA 2THIA 1JW1A 2Y7IA 3IO6A 4FECA 4L17A 4OVJA 2RCBA 4QSCA 4IY5A 1H45A 2CMOA 4TOZA 2RC7A 1P1UA 4OFLA 3MVWA 2I58A 2V25A 1RYXA 1NL5A 1JVYA 1MXWA 3LUYA 1MY1A 2PT1A 3K01A 3TDJA 2O51A 3ONMA 5BWJA 2VGQA 3KSXA 3O6HA 1LAFE 2VD2A 4QFOA 4NF8B 1TXFA 1M5EA 3MZ1A 4R75A 2H99A 4QFLA 3TFLA 4E0XA 3CFXA 4RK9A 1Y3PA 1POTA 2O84X 4X48A 4OFJA 4XKRA 4IGTA 1HSEA 3PD8A 3DELB 2NUVA 3FD3A 4JSOA 3QSLA 4O3AA 4MFIA 4OYVA 3C9HA 4MLQA 3OOAA 3FV2A 4KPTA 5FTHA 4PETA 4ZDMA 1I6AA 1OLCA 3EQ1A 3N6TA 1XOCA 4G68A 4FAJA 5KDTB 3H6WA 4ZZAA 4BDMA 4RPOA 2CZLA 2FNCA 1MY2A 2RCAA 2AIXA 3ECRA 2NVUB 1JETA 1SDXA 3H3GA 3QIMA 1B5IA 1H76A 5DYHA 5FHNA 4ZZEA 1RYOA 4H65A 2XXUA 1B4ZA 2OK2A 2DQVA 5TP9A 3UIFA 2D21A 2Q88A 2V3TA 2Y7WA 1H3DA 4F29A 3CR9A 4G68B 3FZVA 2E0SA 2F7CA 2QMXA 1MM6A 3TQWA 4G8MA 3ODBA 4QFKA 3HV1A 3OXNA 4DXBA 4F19A 3CI8A 1GGGA 4U1ZA 3S9NC 1ANFA 4EQ7A 2DOJA 2F78A 2LAOA 3E13X 2ABHA 3GZGA 3V89B 3GXAA 3WAEA 4H8IA 4PP0A 1PBQA 1US5A 2VOZA 3R6UA 5H8HB 1GVCA 3OO9A 3U72A 4JSDA 1B4HA 3TCFA 3C34A 2G93A 3VVEA 3HO7A 1EH3A 4EXLA 1I69A 1WODA 3K6XA 1IQ7A 1EZ9A 2O7IA 1FQBA 3FVGA 3M3FA 4DDDA 3RPWA 3VLUA 2I3WA 3OENA 1BLFA 1S50A 3VXBA 4YKIA 3W9VA 4GOTA 3G3HA 5B7DA 3MZBA 5AA2A 4PQJA 4MLVA 4JXIA 1ZLQA 3JYRA 2XXVA 4OXVA 3K6WA 2QL3A 3PV0E 3RT8A 3TMGA 4ZE8A 2D3IA 3S9MC 4BDQA 1ZIUA 1SYIA 2QMWA 2DS9A 5L9OA 2UVJA 2RC9A 4OESA 1PB9A 3S9LC 2OLBA 3PMXA 3PPOA 5DT6A 2F8DA 3R7XA 4R72A 4NF4B 4GL0A 1BKAA 1UIUA 5F7VA 3CFZA 3FIRA 4KD5A 2HZLA 1LBBA 4U4SA 4RY1A 3T66A 3UORA 5CBRA 1B1XA 3B6WA 5DVFA 3O9PA 4NTLA 1RKMA 1GTKA 1NNKA 3IB1A 3IOTA 5TP9B 3V5AA 4XIGQ 1A55A 1ZU0A 1A8FA 3T9VA 2HXWA 1B05A 1MQDA 2OJTA 3VV5A 4ELQA 1IXHA 3KFMA 4ZE9A 5I2KA 4ZS9A 4LQ5A 3A3UA 3VLVA 1GR2A 1QUIA 3G3GA 1Z7ME 2PMSA 1B52A 2XXHA 2ZNUA 4QSDA 4LP2B 1A40A 1AMFA 3EPEA 4POXA 5CM6A 3EHTA 3KN8A 2QS1A 4G4PA 2UVHA 1N04A 3U92A 1Y4CA 4GD5A 1B7UA 2I0BA 4DCYA 2F36A 2O68A 1B3GA 1XS5A 2Q2CA 3A09A 2AYSA 3PUYE 4YB5A 5HBCA 1IUDA 3O97A 4GRKA 3MVZA 1SW1A 3PUVE 1NFTA 2RF1A 2XXWA 2XXYA 3RQTA 4Q8RA 5AA4A 1MQGA 1XVYA 4FATA 3L6GA 4LZ7A 1TWYA 1O7TA 4F1YA 5AA2B 4R6YA 4R2BA 3MJNA 3VDFA 3IB2A 3JZJA 3MP1A 2PT2A 2ZYMA 4KHZE 5DEXB 3T93B 4JWXA 4RK2A 3T9UA 1URSA 4JWYA 5I57A 1PB7A 5JTYB 1Y3QA 2OCUA 4ONYA 4PFUA 1SD3A 3DP6A 3FXUA 1SW5A 3PMVA 1N3XA 4ELRA 1VR5A 2HQ0A 3QAXA 1MM7A 2QS4A 3I5OA 1QW0A 3TQLA 2I0CA 4ZEBA 1JQFA 2KLFA 4YZZA 1DTGA 1QKBA 2NOOA 3G3KA 1YTVA 4QHQA 5I58A 1LBCA 3HCQA 4OFOA 3Q25A 3SERA 2Q9TA 5I56B 4ELOA 4X9TA 1NH8A 4N07A 4DZ1A 1Y9UA 4LVQA 3V8XB 4G8NA 4QF9A 2DWHA 5H8FA 1BP5A 4MH5A 3VVDA 4PE5B 5AA3A 2ZYKA 1QULA 2QPQA 1JNFA 1B7HA 3QYTA 3M3LA 4NF6B 1Q1KA 3CFLA 3I3VA 3K2DA 4WEDA 5JTYA 4NMYA 5L9SA 3BFUA 4OEVA 1LAXA 4OENA 4XKQA 1UTHB 2A5SA 4AQ4A 5ICTA 1A99A 1B58A 3PD9A 3IAZA 3PUXE 4X1BA 1SW4A 5KDTA 1H44A 4I1DA 5F1QA 1Y3NA 3PPPA 5A5XA 5BUUA 2B65A 4YMBA 1LB9A 1MPDA 3KN7A 1FQEA 4F1UA 4IY6A 2X7QA 4FIMA 5I59A 4F3BA 3LR1A 1R9LA 1TFAA 2RKMA 2XX8A 3ILTB 1MG1A 3IR1A 4QFNA 3SEWA 1FQDA 1PDAA 3HHFA 4GVOA 1B5HA 1LCFA 2GRVA 1UTBA 2O1MA 4OQOA 4MBPA 5ELVA 5TPAB 1MXZA 1P1OA 1B9JA 1XC1A 1LAGE 2V84A 2YPNA 3CSGA 1LFIA 5H8QB 1B40A 2HAUA 5A5XB 4FEDA 2PBWA 2Q8JA 1EZPA 2Q2AA 2Y84A 4R6KA 4YB7A 5M2VA 4ESXA 2NWJA 1MH3A 2I4BA 2O6AA 2PX1A 2VP1A 4LATA 5CRYA 5FHOA 1AH5A 4OZ9A 1MDP1 1Y1ZA 1B7ZA 3C33A 1LSTA 2UYEA 1NKXA 3DLNA 3HN0A 3LSFB 1P1QA 1D9VA 1MXVA 3K6VA 3OSQA 3PPNA 3DP4A 1LCTA 1I6BA 2F6GA 1B46A 3G3FA 3W9WA 3CRBA 4GL8A 5H8FB 4XKNA 2DVZA 2ZMBA 2RC8A 4NF5B 2XD3A 3MP6A 4U21A 3LSWA 3OO6A 2OWSA 1N76A 3IOWA 4N13A 1OMPA 4HS7A 2GHBA 1B3HA 4JB7A 3PPQA 1II5A 3FJ7A 2A5TA 3D4GA 4WXJA 3I6VA 4TLMB 2ZNSA 2ZXTA 3KJTA 4EF2A 4KR5A 1D9YA 1JEUA 4OHNA 2DWAA 4KCCA 4THIA 3CG1A 1Q35A 4LA9A 2V3UA 3E3KA 3HSTA 4R6HA 2NXOA 5LOMA 1M5BA 4KI0E 4YMAA 2G29A 1US4A 3UA8A 3FVNA 2XXQA 5EHSA 3MC2A 2DE2A 4KQPA 1FTLA 4UA8A 2ONRA 1POY1 3FJGA 5I56A 5KCJB 3O28A 3TYHA 3KOSA 1XT8A 1JW4A 4ECFA 2XX9A 1ZKBA 3C36A 1MH4A 3F11A 3K1NA 3LC8A 3VVFA 4O3CA 1B51A 1L5TA 2DE4A 3KSJA 4XKPA 3IL1B 1Y20A 2ONSA 1SI0A 1XVXA 5DTBA 4ZECA 5I57B 1LGBC 1QUKA 2F34A 1FTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MUQ A;  4GLI A;  1MQH A;  3H6T A;  4Z0I A;  5ISU A;  3MZ9 A;  3AXF A;  4UAC A;  1D3K A;  1B3E A;  4M1V A;  4U4X A;  3C32 A;  4RYA A;  3PGF A;  4KFQ A;  3S4U A;  4C1T A;  3FVO A;  3G3J A;  4YKJ A;  3VLW A;  4QSE A;  4P0G A;  4H1X A;  5ITP A;  1OIB A;  4TLL B;  1PC3 A;  4BDO A;  1MXX A;  1WVJ A;  2I48 A;  4AB5 A;  2H5Y A;  2UXA A;  4JBZ A;  2F5X A;  5CMB A;  3UK4 A;  1M5D A;  5JEI A;  1B32 A;  1IIW A;  3OEM A;  4I62 A;  4M4G A;  4ISU A;  5FTI A;  4C0R A;  3MPK A;  3FGS A;  3K02 A;  5L9M A;  4EQB A;  3KGC A;  4NF4 A;  3JV9 A;  4F3P A;  3KN3 A;  3TCG A;  1B6H A;  2YJP A;  3M8U A;  4NF5 A;  3QK6 A;  4ZEI A;  4Q0C A;  4YAH X;  3LBS A;  3BKI B;  3SDF A;  3Q28 A;  2XXP A;  4OEU A;  1MPC A;  1FTM A;  1ZBM A;  4F3S A;  4F31 B;  1VFD A;  4R9G A;  1A8E A;  2WKY A;  4H6D A;  3KEI A;  4POW A;  3PU5 A;  1NNT A;  2QS2 A;  2UYF A;  3MQ9 A;  1DPE A;  4PFT A;  1J1N A;  4HTG A;  3Q29 A;  3PPR A;  4G2Z A;  4E0W A;  2UVG A;  3DM0 A;  4U23 A;  3T96 B;  3VE1 B;  3C31 A;  4K3F A;  3U1O A;  3UGW A;  2ONK E;  2ALU A;  4KYE A;  1H43 A;  4LZ8 A;  3MVY A;  1B5J A;  2Z23 A;  3V83 A;  1IZ1 A;  4BDL A;  1MY3 A;  1QJM A;  1OQH A;  1OVT A;  1SVX B;  5I2N A;  1NH7 A;  2DYX A;  3DP8 A;  2V3Q A;  1NNP A;  4ZED A;  1VFE A;  1AL3 A;  4H5G A;  3CG3 A;  2F35 A;  4FE8 A;  1TT1 A;  5AE4 A;  1KWH A;  4I9D A;  1Y1M A;  2F7B A;  2H9B A;  3CSB A;  4U22 A;  2P0S A;  4HCY A;  5I2N B;  3B6Q A;  3GBA A;  4NF8 A;  2ZYN A;  3OMB A;  3IB0 A;  5H8H A;  2I49 A;  4FJP A;  3CVG A;  4GXS B;  4ND9 A;  3TEP A;  1OQG A;  4G8H A;  3O29 A;  4NWC A;  1N3W A;  3A3C A;  2XX7 A;  4DE8 A;  2VD3 A;  4EXK A;  4NE4 A;  1I6Q A;  4GFR A;  3UN6 A;  1S7Y A;  1DMB A;  3K00 A;  4I8C A;  1R9Q A;  4YKK A;  1EZO A;  3RUM A;  1IXG A;  4Q5T A;  5TPA A;  3U94 A;  4F2O A;  4LUB A;  1R1N A;  4JWO A;  4KCD A;  3T9H B;  1NMU A;  2I3V A;  3RTW B;  2XXT A;  1OLA A;  4G77 A;  3S2V A;  3CIJ A;  1D4N A;  4LON B;  2Y7P A;  2ESN A;  5ITO A;  2XXX A;  4H8J A;  4F18 A;  4EF1 A;  2E1S A;  3N6U A;  3H6V A;  1A54 A;  1USY H;  1MDQ A;  2XHD A;  5DEX A;  1JVX A;  1HSJ A;  2DE3 A;  3RLF E;  4H0W A;  4F3G A;  3PMW A;  1T0K A;  2I6E A;  2Z8F A;  1FW0 A;  2X7P A;  1N84 A;  3H06 B;  2R6G E;  3SET A;  3TEL A;  1B2H A;  4BLA A;  1IEJ A;  3SEX A;  1B0L A;  1MPB A;  2DVC A;  3O2A A;  4WEP A;  1M5F A;  3RGY A;  5KCJ A;  3G3I A;  5DVJ A;  1Z7N E;  1F9B A;  3N5L A;  2B3F A;  2QJE A;  4DXC A;  4EQ9 A;  3TZA A;  5EYF A;  2DXY A;  2DWI A;  3R26 A;  2W7Y A;  4IO6 A;  1R6Z A;  3S9E A;  3MW0 A;  3TOD A;  2DXR A;  2HCA A;  2P2A A;  1LB8 A;  1EU8 A;  2OWT A;  2YLN A;  3K4U A;  4GQO A;  4GIZ A;  2REG A;  3WAF A;  3ZS6 A;  4FOR A;  4IO5 A;  3SKP A;  4IB2 A;  3C35 A;  1AOV A;  1FTK A;  3PUZ E;  1MS7 A;  1B3L A;  4IGR A;  4PFY A;  3TTM A;  3P7I A;  3T22 A;  2F6P A;  5I2K B;  3SEU A;  1B3F A;  2DP8 A;  5AA4 B;  5H8N B;  2RIN A;  1BTJ A;  3FV1 A;  4ELP A;  2PVU A;  1QUJ A;  3IOV A;  4R2F A;  4R9F A;  5I59 B;  3K6U A;  1B1H A;  5FHM A;  3Q26 A;  3LSL A;  1URG A;  4RJZ A;  4XTC Q;  3O6G A;  2GFE A;  1IIT A;  3PUW E;  2F7A A;  4U1O A;  3RT6 B;  5IAI A;  1M5C A;  4C1U A;  1UTB B;  3BBR A;  4MF3 A;  5CBS A;  1YCJ A;  2UVI A;  3D4C A;  4IO7 A;  1DPP A;  2HAV A;  3C4M A;  4IO3 A;  5CMC A;  2HFB A;  4RXL A;  3RTF B;  4DIG A;  5IKB A;  2Z22 A;  4H67 A;  3QUJ A;  3BFT A;  1FQA A;  3TAJ A;  1SI1 A;  2ANJ A;  3FXQ A;  1BIY A;  2QSX A;  5DVI A;  3MBP A;  3RNN A;  3FAT A;  3FVK A;  3ZKK A;  3VXC A;  4YB6 A;  2XXI A;  1VSO A;  5H8Q A;  3SEY A;  4DXU A;  3N26 A;  1UTH A;  4R74 A;  1LFH A;  2O7U A;  5L8D A;  2Q89 A;  2VHA A;  3KG2 A;  3N94 A;  2R9J A;  4BDR A;  3FJM A;  2BJJ X;  1VE4 A;  4OTE A;  3IJX B;  5I84 A;  2H25 A;  2XD2 A;  3HHG A;  4OER A;  4TQU Q;  1XHY A;  1ZTY A;  2FA7 A;  3B6T A;  3HPI A;  1USY E;  4DLD A;  2HEU A;  4OMB A;  3IO4 A;  4GWO A;  2HZK A;  5AA1 A;  1ATG A;  2B3B A;  1HSL A;  2ZNT A;  3SEV A;  3THI A;  1WDN A;  3TCH A;  3K1M A;  3OO8 A;  5AA2 D;  5JK4 A;  1DOT A;  1N7W A;  3ZSF A;  3FAS A;  3UP9 A;  2H98 A;  3T9X B;  4OET A;  3GBB A;  3MP8 A;  3U8Q A;  3Q27 A;  5H8N A;  1IXC A;  4NF6 A;  3MWB A;  4YIC A;  1PEB A;  1N7X A;  1UQW A;  4EUO A;  1IXI A;  3L6H A;  2XXR A;  1JW5 A;  4O3B A;  2REJ A;  1ZMG A;  3KZG A;  4NWD A;  4BDN A;  4U2R A;  2O1L A;  4QRZ A;  1MXU A;  3TKD A;  1MXY A;  2DSF A;  4N6P A;  4RNS A;  1ZJL A;  1TFD A;  3OEK A;  4DCX A;  5ICQ A;  3TTL A;  4LZ5 A;  3TUS A;  3FXR A;  5CI5 A;  2Y7R A;  1S9T A;  1YAE A;  1QVS A;  2OBG A;  3IJO B;  1O63 A;  1CB6 A;  1Y4T A;  4Q30 B;  3TPA A;  4Z7E A;  4WKM A;  2R71 A;  3MVX A;  2DWJ A;  3H7M A;  3M3K A;  1LLS A;  3OSR A;  5I58 B;  3VFJ A;  3MPL A;  1SBP A;  4KYD A;  3H6U A;  4YU0 A;  1MY4 A;  2GH9 A;  3ILU B;  3LSX A;  3O6I A;  1DTZ A;  2M8C A;  4PFW A;  1UIV A;  1O64 A;  3FUZ A;  4F22 A;  2P1S A;  3OEL A;  5K2X A;  3TTR A;  1B0H A;  2Y7K A;  4QFP A;  3USD A;  3TTN A;  2AL5 A;  5EHM A;  2PYY A;  4YKP A;  3ZKL A;  4IO4 A;  4OWD A;  1QKA A;  1FTJ A;  2FYI A;  3E9X A;  1CE2 A;  3IX1 A;  3OO7 A;  2IEE A;  5CC2 A;  3KJ7 A;  2QRY A;  1FQF A;  2H4I A;  1PB8 A;  1OVB A;  1SW2 A;  2X26 A;  3H03 A;  4JDF A;  3GLB A;  3TTK A;  4ZEK A;  1PBP A;  1LAH E;  2A5T B;  5HPQ A;  4HCW A;  4GXA A;  4IO2 A;  1FCK A;  3K0V A;  1YPN A;  4R73 A;  1MY0 A;  2F97 A;  1DSN A;  1P1N A;  1P1W A;  2V93 A;  2ZYO A;  1URD A;  1N0T A;  3E4R A;  1FQC A;  3EF7 A;  1NNF A;  2IA4 A;  2Z8E A;  3QUF A;  4FEB A;  4X1D A;  3RY3 A;  3W15 C;  5HM4 B;  4H5F A;  1AIV A;  3H4Z A;  4GF8 A;  4P0I A;  4P11 A;  5KZT A;  3G7W A;  3EHS A;  4HW8 A;  2I4C A;  1ELJ A;  4XXU A;  3RN8 A;  4ZEF A;  2D5W A;  1MQJ A;  1JEV A;  1LFG A;  3EN3 A;  3KBR A;  3IK6 B;  1GV8 A;  1P99 A;  3MAM A;  5B70 A;  5CMK A;  5J1D A;  4G68 C;  3B7D A;  4F39 A;  4RPN A;  4F1V A;  5K2Y A;  3KOT A;  4NED A;  3OD7 A;  5TU0 A;  1SQY A;  1SYH A;  3EHU A;  3SES A;  4EDP A;  2Z8D A;  3O66 A;  4LQ2 A;  4AB6 A;  3K1P A;  5CMM A;  1A7L A;  4KYS A;  3IOR A;  4RA1 A;  2O69 A;  5H8S A;  4ESW A;  3QXM A;  2GHA A;  2QS3 A;  3IOU A;  4F2Q A;  2AL4 A;  2OZZ A;  3U93 A;  1MQI A;  1MRP A;  2THI A;  1JW1 A;  2Y7I A;  3IO6 A;  4FEC A;  4L17 A;  4OVJ A;  2RCB A;  4QSC A;  4IY5 A;  1H45 A;  2CMO A;  4TOZ A;  2RC7 A;  1P1U A;  4OFL A;  3MVW A;  2I58 A;  2V25 A;  1RYX A;  1NL5 A;  1JVY A;  1MXW A;  3LUY A;  1MY1 A;  2PT1 A;  3K01 A;  3TDJ A;  2O51 A;  3ONM A;  5BWJ A;  2VGQ A;  3KSX A;  3O6H A;  1LAF E;  2VD2 A;  4QFO A;  4NF8 B;  1TXF A;  1M5E A;  3MZ1 A;  4R75 A;  2H99 A;  4QFL A;  3TFL A;  4E0X A;  3CFX A;  4RK9 A;  1Y3P A;  1POT A;  2O84 X;  4X48 A;  4OFJ A;  4XKR A;  4IGT A;  1HSE A;  3PD8 A;  3DEL B;  2NUV A;  3FD3 A;  4JSO A;  3QSL A;  4O3A A;  4MFI A;  4OYV A;  3C9H A;  4MLQ A;  3OOA A;  3FV2 A;  4KPT A;  5FTH A;  4PET A;  4ZDM A;  1I6A A;  1OLC A;  3EQ1 A;  3N6T A;  1XOC A;  4G68 A;  4FAJ A;  5KDT B;  3H6W A;  4ZZA A;  4BDM A;  4RPO A;  2CZL A;  2FNC A;  1MY2 A;  2RCA A;  2AIX A;  3ECR A;  2NVU B;  1JET A;  1SDX A;  3H3G A;  3QIM A;  1B5I A;  1H76 A;  5DYH A;  5FHN A;  4ZZE A;  1RYO A;  4H65 A;  2XXU A;  1B4Z A;  2OK2 A;  2DQV A;  5TP9 A;  3UIF A;  2D21 A;  2Q88 A;  2V3T A;  2Y7W A;  1H3D A;  4F29 A;  3CR9 A;  4G68 B;  3FZV A;  2E0S A;  2F7C A;  2QMX A;  1MM6 A;  3TQW A;  4G8M A;  3ODB A;  4QFK A;  3HV1 A;  3OXN A;  4DXB A;  4F19 A;  3CI8 A;  1GGG A;  4U1Z A;  3S9N C;  1ANF A;  4EQ7 A;  2DOJ A;  2F78 A;  2LAO A;  3E13 X;  2ABH A;  3GZG A;  3V89 B;  3GXA A;  3WAE A;  4H8I A;  4PP0 A;  1PBQ A;  1US5 A;  2VOZ A;  3R6U A;  5H8H B;  1GVC A;  3OO9 A;  3U72 A;  4JSD A;  1B4H A;  3TCF A;  3C34 A;  2G93 A;  3VVE A;  3HO7 A;  1EH3 A;  4EXL A;  1I69 A;  1WOD A;  3K6X A;  1IQ7 A;  1EZ9 A;  2O7I A;  1FQB A;  3FVG A;  3M3F A;  4DDD A;  3RPW A;  3VLU A;  2I3W A;  3OEN A;  1BLF A;  1S50 A;  3VXB A;  4YKI A;  3W9V A;  4GOT A;  3G3H A;  5B7D A;  3MZB A;  5AA2 A;  4PQJ A;  4MLV A;  4JXI A;  1ZLQ A;  3JYR A;  2XXV A;  4OXV A;  3K6W A;  2QL3 A;  3PV0 E;  3RT8 A;  3TMG A;  4ZE8 A;  2D3I A;  3S9M C;  4BDQ A;  1ZIU A;  1SYI A;  2QMW A;  2DS9 A;  5L9O A;  2UVJ A;  2RC9 A;  4OES A;  1PB9 A;  3S9L C;  2OLB A;  3PMX A;  3PPO A;  5DT6 A;  2F8D A;  3R7X A;  4R72 A;  4NF4 B;  4GL0 A;  1BKA A;  1UIU A;  5F7V A;  3CFZ A;  3FIR A;  4KD5 A;  2HZL A;  1LBB A;  4U4S A;  4RY1 A;  3T66 A;  3UOR A;  5CBR A;  1B1X A;  3B6W A;  5DVF A;  3O9P A;  4NTL A;  1RKM A;  1GTK A;  1NNK A;  3IB1 A;  3IOT A;  5TP9 B;  3V5A A;  4XIG Q;  1A55 A;  1ZU0 A;  1A8F A;  3T9V A;  2HXW A;  1B05 A;  1MQD A;  2OJT A;  3VV5 A;  4ELQ A;  1IXH A;  3KFM A;  4ZE9 A;  5I2K A;  4ZS9 A;  4LQ5 A;  3A3U A;  3VLV A;  1GR2 A;  1QUI A;  3G3G A;  1Z7M E;  2PMS A;  1B52 A;  2XXH A;  2ZNU A;  4QSD A;  4LP2 B;  1A40 A;  1AMF A;  3EPE A;  4POX A;  5CM6 A;  3EHT A;  3KN8 A;  2QS1 A;  4G4P A;  2UVH A;  1N04 A;  3U92 A;  1Y4C A;  4GD5 A;  1B7U A;  2I0B A;  4DCY A;  2F36 A;  2O68 A;  1B3G A;  1XS5 A;  2Q2C A;  3A09 A;  2AYS A;  3PUY E;  4YB5 A;  5HBC A;  1IUD A;  3O97 A;  4GRK A;  3MVZ A;  1SW1 A;  3PUV E;  1NFT A;  2RF1 A;  2XXW A;  2XXY A;  3RQT A;  4Q8R A;  5AA4 A;  1MQG A;  1XVY A;  4FAT A;  3L6G A;  4LZ7 A;  1TWY A;  1O7T A;  4F1Y A;  5AA2 B;  4R6Y A;  4R2B A;  3MJN A;  3VDF A;  3IB2 A;  3JZJ A;  3MP1 A;  2PT2 A;  2ZYM A;  4KHZ E;  5DEX B;  3T93 B;  4JWX A;  4RK2 A;  3T9U A;  1URS A;  4JWY A;  5I57 A;  1PB7 A;  5JTY B;  1Y3Q A;  2OCU A;  4ONY A;  4PFU A;  1SD3 A;  3DP6 A;  3FXU A;  1SW5 A;  3PMV A;  1N3X A;  4ELR A;  1VR5 A;  2HQ0 A;  3QAX A;  1MM7 A;  2QS4 A;  3I5O A;  1QW0 A;  3TQL A;  2I0C A;  4ZEB A;  1JQF A;  2KLF A;  4YZZ A;  1DTG A;  1QKB A;  2NOO A;  3G3K A;  1YTV A;  4QHQ A;  5I58 A;  1LBC A;  3HCQ A;  4OFO A;  3Q25 A;  3SER A;  2Q9T A;  5I56 B;  4ELO A;  4X9T A;  1NH8 A;  4N07 A;  4DZ1 A;  1Y9U A;  4LVQ A;  3V8X B;  4G8N A;  4QF9 A;  2DWH A;  5H8F A;  1BP5 A;  4MH5 A;  3VVD A;  4PE5 B;  5AA3 A;  2ZYK A;  1QUL A;  2QPQ A;  1JNF A;  1B7H A;  3QYT A;  3M3L A;  4NF6 B;  1Q1K A;  3CFL A;  3I3V A;  3K2D A;  4WED A;  5JTY A;  4NMY A;  5L9S A;  3BFU A;  4OEV A;  1LAX A;  4OEN A;  4XKQ A;  1UTH B;  2A5S A;  4AQ4 A;  5ICT A;  1A99 A;  1B58 A;  3PD9 A;  3IAZ A;  3PUX E;  4X1B A;  1SW4 A;  5KDT A;  1H44 A;  4I1D A;  5F1Q A;  1Y3N A;  3PPP A;  5A5X A;  5BUU A;  2B65 A;  4YMB A;  1LB9 A;  1MPD A;  3KN7 A;  1FQE A;  4F1U A;  4IY6 A;  2X7Q A;  4FIM A;  5I59 A;  4F3B A;  3LR1 A;  1R9L A;  1TFA A;  2RKM A;  2XX8 A;  3ILT B;  1MG1 A;  3IR1 A;  4QFN A;  3SEW A;  1FQD A;  1PDA A;  3HHF A;  4GVO A;  1B5H A;  1LCF A;  2GRV A;  1UTB A;  2O1M A;  4OQO A;  4MBP A;  5ELV A;  5TPA B;  1MXZ A;  1P1O A;  1B9J A;  1XC1 A;  1LAG E;  2V84 A;  2YPN A;  3CSG A;  1LFI A;  5H8Q B;  1B40 A;  2HAU A;  5A5X B;  4FED A;  2PBW A;  2Q8J A;  1EZP A;  2Q2A A;  2Y84 A;  4R6K A;  4YB7 A;  5M2V A;  4ESX A;  2NWJ A;  1MH3 A;  2I4B A;  2O6A A;  2PX1 A;  2VP1 A;  4LAT A;  5CRY A;  5FHO A;  1AH5 A;  4OZ9 A;  1MDP 1;  1Y1Z A;  1B7Z A;  3C33 A;  1LST A;  2UYE A;  1NKX A;  3DLN A;  3HN0 A;  3LSF B;  1P1Q A;  1D9V A;  1MXV A;  3K6V A;  3OSQ A;  3PPN A;  3DP4 A;  1LCT A;  1I6B A;  2F6G A;  1B46 A;  3G3F A;  3W9W A;  3CRB A;  4GL8 A;  5H8F B;  4XKN A;  2DVZ A;  2ZMB A;  2RC8 A;  4NF5 B;  2XD3 A;  3MP6 A;  4U21 A;  3LSW A;  3OO6 A;  2OWS A;  1N76 A;  3IOW A;  4N13 A;  1OMP A;  4HS7 A;  2GHB A;  1B3H A;  4JB7 A;  3PPQ A;  1II5 A;  3FJ7 A;  2A5T A;  3D4G A;  4WXJ A;  3I6V A;  4TLM B;  2ZNS A;  2ZXT A;  3KJT A;  4EF2 A;  4KR5 A;  1D9Y A;  1JEU A;  4OHN A;  2DWA A;  4KCC A;  4THI A;  3CG1 A;  1Q35 A;  4LA9 A;  2V3U A;  3E3K A;  3HST A;  4R6H A;  2NXO A;  5LOM A;  1M5B A;  4KI0 E;  4YMA A;  2G29 A;  1US4 A;  3UA8 A;  3FVN A;  2XXQ A;  5EHS A;  3MC2 A;  2DE2 A;  4KQP A;  1FTL A;  4UA8 A;  2ONR A;  1POY 1;  3FJG A;  5I56 A;  5KCJ B;  3O28 A;  3TYH A;  3KOS A;  1XT8 A;  1JW4 A;  4ECF A;  2XX9 A;  1ZKB A;  3C36 A;  1MH4 A;  3F11 A;  3K1N A;  3LC8 A;  3VVF A;  4O3C A;  1B51 A;  1L5T A;  2DE4 A;  3KSJ A;  4XKP A;  3IL1 B;  1Y20 A;  2ONS A;  1SI0 A;  1XVX A;  5DTB A;  4ZEC A;  5I57 B;  1LGB C;  1QUK A;  2F34 A;  1FTO A; 
#chains in the Genus database with same CATH topology
 1AWB A;  4Z0I A;  5I3S A;  3G3J A;  4H1X A;  5ITP A;  1OIB A;  4P1L A;  1PC3 A;  4TLL B;  1MXX A;  4BDO A;  5CMB A;  5JEI A;  4I62 A;  4ISU A;  3MPK A;  3FGS A;  4EQB A;  4NF4 A;  5ET5 A;  2YJP A;  3M8U A;  1D9Q A;  3BKI B;  3SDF A;  3Q28 A;  1FTM A;  2WKY A;  4MMP A;  3KEI A;  1NNT A;  2QS2 A;  3MQ9 A;  4U23 A;  3VE1 B;  3U1O A;  4X04 A;  2FHY A;  1H43 A;  2Z23 A;  1QJM A;  4H5G A;  1TT1 A;  4MNI A;  2P0S A;  1Q9D A;  5I2N B;  4GXS B;  4NWC A;  3O29 A;  4DE8 A;  4NQ8 A;  4EXK A;  4NE4 A;  4GFR A;  3UN6 A;  3K00 A;  1R9Q A;  4F2O A;  1LBX A;  4JWO A;  1D4N A;  3N6U A;  3H6V A;  3CHG A;  1MDQ A;  2XHD A;  2DE3 A;  1N84 A;  3SET A;  1B2H A;  4BLA A;  1B0L A;  1MPB A;  2DVC A;  1FPL A;  1KA1 A;  3N5L A;  2QJE A;  3TZA A;  4MEV A;  2PCR A;  3R26 A;  2QVV A;  5DW8 A;  2P2A A;  3FXB A;  4GQO A;  4GIZ A;  3ZS6 A;  4FOR A;  1FTK A;  4IGR A;  4PE3 A;  2F6P A;  1B3F A;  5H8N B;  2RIN A;  5FHM A;  1B1H A;  2GQ1 A;  3Q26 A;  3O6G A;  2P3N A;  2GFE A;  4C1U A;  4MF3 A;  5CBS A;  1YCJ A;  4IO7 A;  3D4C A;  4IO3 A;  2B4L A;  3RTF B;  4H67 A;  5DVI A;  3VXC A;  4GX4 A;  3SEY A;  3BIG A;  2VHA A;  3N94 A;  1VE4 A;  3HHG A;  4OMB A;  3IO4 A;  2B3B A;  2ZNT A;  3K1M A;  4GWW A;  3FAS A;  3T9X B;  3U8Q A;  5H8N A;  3KZG A;  4NWD A;  5EQA A;  4LN5 A;  1MXU A;  3TKD A;  5ICQ A;  3RPL B;  1ZJL A;  2Y7R A;  1FBF A;  3IJO B;  1O63 A;  1CB6 A;  5F24 A;  4KYD A;  4YU0 A;  4PGN A;  4PF8 A;  2GH9 A;  2M8C A;  3OEL A;  1JP4 A;  2PYY A;  4YKP A;  3IX1 A;  3OO7 A;  2IEE A;  3TTK A;  1OVB A;  1SW2 A;  1PBP A;  1LAH E;  5HPQ A;  4GXA A;  4IO2 A;  1FCK A;  3K0V A;  2V93 A;  3E4R A;  4X1D A;  3H4Z A;  3EHS A;  2PFZ A;  1LFG A;  2VPN A;  4NF0 A;  4G68 C;  4F39 A;  1FPD A;  1LBZ A;  3OD7 A;  3EHU A;  2Z8D A;  3O66 A;  4LQ2 A;  4AB6 A;  3K1P A;  5CMM A;  4I40 A;  1IMC A;  3IOU A;  3U93 A;  1MRP A;  4FEC A;  4L17 A;  4IY5 A;  4TOZ A;  1P1U A;  4OFL A;  2I58 A;  1IMF A;  1MXW A;  1MY1 A;  2PT1 A;  2WBD A;  3ONM A;  2VGQ A;  4QFO A;  3TFL A;  4QFL A;  4RK9 A;  1POT A;  4X48 A;  4OFJ A;  4XKR A;  4NAP A;  4IGT A;  3FD3 A;  4JSO A;  3QSL A;  3C9H A;  4MLQ A;  4KPT A;  4ZDM A;  3N6T A;  1OLC A;  5I7I A;  3H6W A;  2NVU B;  3ECR A;  1JET A;  3H3G A;  3QIM A;  3EKI A;  4H65 A;  1B4Z A;  4GWZ A;  1FPB A;  2Q88 A;  2V3T A;  3MYU A;  4G68 B;  3FZV A;  2E0S A;  2F7C A;  2QMX A;  3TQW A;  2L5V A;  3HV1 A;  3OXN A;  4F19 A;  4U1Z A;  4EQ7 A;  3E13 X;  2F78 A;  2OWZ A;  4H8I A;  1GVC A;  5H8H B;  1FBH A;  4UAB A;  3HO7 A;  1IQ7 A;  4O7I A;  1EZ9 A;  1BLF A;  3PV0 E;  4BDQ A;  1SYI A;  5L9O A;  2UVJ A;  2RC9 A;  1PB9 A;  3PPO A;  4NF4 B;  4GL0 A;  1BKA A;  5CBR A;  1LBB A;  4RY1 A;  3IB1 A;  1ZU0 A;  4PCD A;  1A8F A;  2OJT A;  3VV5 A;  4N81 A;  1IXH A;  3KFM A;  4LQ5 A;  1GR2 A;  3G3G A;  1Z7M E;  2PMS A;  4POX A;  4HE1 A;  2QS1 A;  3KN8 A;  1Y4C A;  4GD5 A;  4DCY A;  3PUY E;  2WYK A;  3RQT A;  2RF1 A;  3E78 A;  1XVY A;  4F1Y A;  3VDF A;  3IB2 A;  3JZJ A;  3MP1 A;  1FPF A;  2ZYM A;  4RK2 A;  1URS A;  5I57 A;  5JTY B;  4N6D A;  1Y3Q A;  3DP6 A;  1QW0 A;  4ZEB A;  2KLF A;  1DTG A;  4QHQ A;  3SER A;  5I56 B;  4ELO A;  4DZ1 A;  4LVQ A;  5EYG A;  5H8F A;  3IFC A;  3QYT A;  3M3L A;  5JTY A;  3I3V A;  4P3L A;  5ICT A;  1UTH B;  4AQ4 A;  4JVI A;  3PD9 A;  3PTY A;  3PUX E;  1INP A;  5A5L A;  4I1D A;  1MPD A;  4F1U A;  2X7Q A;  3LR1 A;  3SEW A;  1FQD A;  3HHF A;  1LEV A;  4GVO A;  1B5H A;  2O1M A;  4OQO A;  1UTB A;  2P3V A;  4GX6 A;  5TPA B;  5IM2 A;  2V84 A;  3CSG A;  3LUZ A;  4YB7 A;  4X8R A;  1MH3 A;  2O6A A;  5CRY A;  1AH5 A;  3C33 A;  1LST A;  3K6V A;  4OVP A;  1I6B A;  5H8F B;  3OO6 A;  2OWS A;  1FJ6 A;  1N76 A;  4HS7 A;  4MHF A;  5IGA A;  4WXJ A;  2A5T A;  3I6V A;  2ZXT A;  4EF2 A;  4KR5 A;  1JEU A;  1Q35 A;  2KR0 A;  3E3K A;  4KI0 E;  5KCJ B;  5KCJ A;  1FTL A;  4UA8 A;  1POY 1;  1JW4 A;  4MX6 A;  4ECF A;  3F11 A;  3VVF A;  4PF6 A;  2HPG A;  1L5T A;  3IL1 B;  2HXR A;  2F34 A;  1MQH A;  1B3E A;  4M1V A;  3PGF A;  3S4U A;  4YKJ A;  3VLW A;  4QSE A;  3GYY A;  4N8G A;  4PAI A;  2I48 A;  4N4U A;  2UXA A;  3UK4 A;  1B32 A;  1IIW A;  3OEM A;  5FTI A;  3K02 A;  4F3P A;  4YAH X;  2XXP A;  4PTK A;  1ZBM A;  1LBY A;  4KXP A;  1A8E A;  3PU5 A;  4PFT A;  4E0W A;  4HTG A;  3Q29 A;  3PPR A;  4G2Z A;  2UVG A;  4K3F A;  4MAG A;  1B5J A;  1IZ1 A;  4BDL A;  2DYX A;  1FBC A;  2FVZ A;  1G0H A;  1KWH A;  2F7B A;  4U22 A;  1YZ0 A;  4HCY A;  3GBA A;  3TEP A;  1OQG A;  1N3W A;  2XX7 A;  2VD3 A;  2FBP A;  1I6Q A;  3U94 A;  2CZK A;  1R1N A;  3T9H B;  4GWX A;  2XXT A;  3S2V A;  4G77 A;  3CIJ A;  5ITO A;  2XXX A;  4EF1 A;  1A54 A;  1USY H;  1HSJ A;  3PMW A;  2ZZW A;  1T0K A;  2Z8F A;  2X7P A;  5LTC A;  4WEP A;  2B4M A;  1M5F A;  3RGY A;  3G3I A;  5DVJ A;  4EQ9 A;  4DXC A;  2DWI A;  4IO6 A;  1YYZ A;  3S9E A;  3MW0 A;  1LB8 A;  2OWT A;  4HXV A;  4IO5 A;  4H45 A;  3TTM A;  2ZZX A;  5I2K B;  2PVU A;  1QUJ A;  4XF5 A;  4H46 A;  5T3J A;  4GWU A;  3PUW E;  1IME A;  5IAI A;  4XEQ A;  1DPP A;  4DIG A;  5CMC A;  3LV0 A;  2HFB A;  4RXL A;  5IKB A;  2Z22 A;  3TAJ A;  1FQA A;  3FAT A;  1FBD A;  3BIH A;  4YB6 A;  1DCU A;  2XXI A;  4DXU A;  1UTH A;  1LFH A;  4BDR A;  3FJM A;  4OTE A;  5EQ8 A;  4TQU Q;  1XHY A;  1LBV A;  1RDZ A;  2HZK A;  5AA1 A;  5JK4 A;  1N7W A;  3Q27 A;  1IXC A;  4NF6 A;  1PEB A;  4JVD A;  4EUO A;  3ROJ A;  2REJ A;  4BDN A;  1MXY A;  4DCX A;  3TTL A;  3TUS A;  3FXR A;  1YAE A;  2OBG A;  1Y4T A;  1YXI A;  4Z7E A;  2DWJ A;  1LLS A;  3MPL A;  3LSX A;  3O6I A;  1UIV A;  2P1S A;  5K2X A;  1B0H A;  4QFP A;  3USD A;  3TTN A;  5EHM A;  3ZKL A;  3E9X A;  1CE2 A;  1FQF A;  2H4I A;  3GLB A;  4HCW A;  1YPN A;  3MVX A;  1NNF A;  2IA4 A;  4GF8 A;  3G7W A;  2I4C A;  4XXU A;  3KBR A;  3IK6 B;  3MAM A;  5B70 A;  3B7D A;  4F1V A;  5K2Y A;  5TU0 A;  3SES A;  5EYH A;  4EDP A;  4HE0 A;  1A7L A;  1NV3 A;  1NV4 A;  3QXM A;  2AL4 A;  2THI A;  4G61 A;  2CMO A;  2CEX A;  3KC0 A;  2V25 A;  1RYX A;  1JVY A;  3LUY A;  3K01 A;  5BWJ A;  3MZ1 A;  4E0X A;  2H99 A;  4QBA A;  4O3A A;  4PFB A;  4MFI A;  5FTH A;  3EQ1 A;  1XOC A;  4P8B A;  2PFY A;  4ZZA A;  4OVT A;  2RCA A;  1MY2 A;  1SDX A;  1B5I A;  5DYH A;  2DQV A;  2Q8M A;  3CR9 A;  1MM6 A;  3ISP A;  4DXB A;  1GGG A;  1ANF A;  2ABH A;  3GXA A;  2CZH A;  1US5 A;  2VOZ A;  3U72 A;  3OO9 A;  1B4H A;  3VVE A;  2O7I A;  2XWI A;  3RPW A;  3VLU A;  3W9V A;  3G3H A;  4PQJ A;  4MLV A;  4JXI A;  1ZLQ A;  3RT8 A;  1FJ9 A;  3S9L C;  2F8D A;  4R72 A;  5F7V A;  3FIR A;  4KD5 A;  3T66 A;  1CNQ A;  3B6W A;  5DVF A;  4PGP A;  1RKM A;  1GTK A;  1B05 A;  1MQD A;  2WYP A;  5I2K A;  4ZS9 A;  4FBP A;  2ZNU A;  1B52 A;  3EPE A;  3EHT A;  2UVH A;  3A09 A;  4YB5 A;  1EYK A;  3MVZ A;  2OX3 A;  4Q8R A;  1MQG A;  4FAT A;  3L6G A;  3HFU A;  4R2B A;  3MJN A;  2VPO A;  1NV1 A;  4JWX A;  3T9U A;  2WEF A;  4JWY A;  1PB7 A;  2OCU A;  4ONY A;  3FXU A;  1SW5 A;  3PMV A;  1N3X A;  2HQ0 A;  2QS4 A;  3I5O A;  3G3K A;  5I58 A;  1LBC A;  4OFO A;  4X9T A;  1Y9U A;  4QF9 A;  2DWH A;  2QPQ A;  4NF6 B;  3CFL A;  4WED A;  1DK4 A;  2A5S A;  4XFE A;  3IAZ A;  5A5X A;  5F1Q A;  4YMB A;  3KN7 A;  5I59 A;  4F3B A;  2RKM A;  3ILT B;  1MG1 A;  4QFN A;  5ELV A;  1LCF A;  1XC1 A;  5H8Q B;  1B40 A;  4FED A;  2Y84 A;  4R6K A;  5FHO A;  2PX1 A;  2UYE A;  4OYV A;  3LSF B;  1P1Q A;  3PPN A;  3DP4 A;  1LCT A;  2F6G A;  4NF5 B;  3MP6 A;  3LSW A;  4I3Y A;  2GHB A;  4HE2 A;  3FJ7 A;  4TLM B;  2XXK A;  3KJT A;  3CG1 A;  2V3U A;  4R6H A;  2G29 A;  5EHS A;  4N91 A;  5ET6 A;  3TYH A;  3KOS A;  4MIJ A;  1ZKB A;  3K1N A;  2DE4 A;  3KSJ A;  1Y20 A;  2HHM A;  1NV5 A;  4O94 A;  1SI0 A;  1XVX A;  5DTB A;  5I57 B;  4GLI A;  4NGU A;  3MZ9 A;  3AXF A;  4UAC A;  4RYA A;  3FVO A;  1M5D A;  4C0R A;  4PDD A;  5L9M A;  3KN3 A;  3QK6 A;  4Q0C A;  3LBS A;  4OEU A;  1MPC A;  4F31 B;  1VFD A;  4R9G A;  4H6D A;  4POW A;  3DM0 A;  1KZ8 A;  3C31 A;  3UGW A;  2ALU A;  4KYE A;  3MVY A;  3V83 A;  1OVT A;  1NH7 A;  3DP8 A;  2V3Q A;  1NNP A;  4ZED A;  1VFE A;  2QVU A;  1AL3 A;  3CG3 A;  4FE8 A;  5AE4 A;  1Y1M A;  3CSB A;  4NG7 A;  1EYI A;  2CEY A;  4NF8 A;  5H8H A;  2I49 A;  4G8H A;  3A3C A;  1S7Y A;  3RUM A;  1IXG A;  1LBW A;  5TPA A;  4LUB A;  4H8J A;  2E1S A;  5DEX A;  4F3G A;  3TEL A;  3H06 B;  1IEJ A;  3SEX A;  3O2A A;  2BJI A;  4AS4 A;  1Z7N E;  1F9B A;  5EYF A;  2DXY A;  2DXR A;  1EU8 A;  2REG A;  3WAF A;  1AOV A;  4PFY A;  4OVS A;  4PFI A;  2DP8 A;  1BTJ A;  4NN3 A;  4R9F A;  2F7A A;  3RT6 B;  3T22 A;  2HAV A;  4PDH A;  3BFT A;  1SI1 A;  3FXQ A;  2QSX A;  3MBP A;  3FVK A;  1VSO A;  5H8Q A;  3NOH A;  3N26 A;  5EQ7 A;  4R74 A;  2O7U A;  1XI6 A;  4N17 A;  3KG2 A;  4N8Y A;  5L8D A;  3T1B A;  5I84 A;  2H25 A;  2XD2 A;  3B6T A;  2FA7 A;  4DLD A;  4GWO A;  1ATG A;  1HSL A;  3SEV A;  3TCH A;  5AA2 D;  1NV2 A;  3ZSF A;  3UP9 A;  3GBB A;  3MP8 A;  5I5P A;  4YIC A;  1IXI A;  4O3B A;  1FPE A;  1ZMG A;  4U2R A;  2DSF A;  1TFD A;  1SPI A;  1S9T A;  1EYJ A;  3D1R A;  4Q30 B;  4WKM A;  5J16 A;  1SBP A;  3H6U A;  1MY4 A;  3ILU B;  1DTZ A;  1O64 A;  2AL5 A;  4IO4 A;  1FTJ A;  2FYI A;  5CC2 A;  3KJ7 A;  2QRY A;  4JDF A;  1PB8 A;  2X26 A;  3H03 A;  4ZEK A;  2MKZ A;  4MCO A;  1DSN A;  1P1N A;  1P1W A;  4NF8 B;  1URD A;  4FEB A;  1FQC A;  2Z8E A;  3QUF A;  3W15 C;  1AIV A;  4H5F A;  4P0I A;  4HW8 A;  1ELJ A;  3RN8 A;  4ZEF A;  1MQJ A;  2D5W A;  5CMK A;  4DI4 B;  4PFR A;  1SQY A;  1SYH A;  4PBQ A;  3IOR A;  4RA1 A;  4ESW A;  1NUW A;  2QS3 A;  2Y7I A;  1JW1 A;  4OVJ A;  2RCB A;  1H45 A;  3MVW A;  4MNC A;  4DI3 D;  2O51 A;  3KSX A;  4R75 A;  2V4C A;  1HSE A;  3PD8 A;  2NUV A;  4IR8 A;  4PET A;  4G68 A;  4BDM A;  4RPO A;  5EQ9 A;  2FNC A;  1G0I A;  1H76 A;  4ZZE A;  1RYO A;  5IZ1 A;  2XXU A;  5TP9 A;  2D21 A;  2Y7W A;  1H3D A;  4OVR A;  3ODB A;  3S9N C;  1RDY A;  2DOJ A;  3GZG A;  3WAE A;  1PBQ A;  4JSD A;  2G93 A;  1I69 A;  5FBP A;  3FVG A;  3M3F A;  4DDD A;  1S50 A;  3MZB A;  2XXV A;  4OXV A;  3K6W A;  2QL3 A;  4ZE8 A;  3E79 A;  4PAK A;  2DS9 A;  3PMX A;  1B1X A;  5TP9 B;  3FBP A;  3V5A A;  1FRP A;  2F3D A;  3T9V A;  4ZE9 A;  4AS5 A;  1NUZ A;  5CM6 A;  5KDT A;  1K9Y A;  2XWK A;  4G4P A;  2F36 A;  2O68 A;  1B3G A;  1FBE A;  1XS5 A;  2Q2C A;  2AYS A;  3PUV E;  4OVQ A;  1NFT A;  2XXW A;  4LZ7 A;  5AA2 B;  2PT2 A;  1SD3 A;  4ELR A;  1DBZ A;  3TQL A;  1MM7 A;  1QKB A;  2NOO A;  1YTV A;  1IMA A;  2Q9T A;  1NH8 A;  4N07 A;  3B50 A;  3RPL A;  3VVD A;  1JNF A;  1B7H A;  1Q1K A;  3K2D A;  4NMY A;  5L9S A;  4XKQ A;  1A99 A;  4GBV A;  4X1B A;  1SW4 A;  1Y3N A;  3PPP A;  5BUU A;  1FPJ A;  1LB9 A;  1FQE A;  4GWY A;  1TFA A;  2XX8 A;  2GRV A;  1P1O A;  1LAG E;  1LFI A;  2HAU A;  3KBZ A;  2PBW A;  2Q8J A;  1EZP A;  4ESX A;  2NWJ A;  1FBG A;  2VP1 A;  4LAT A;  1Y1Z A;  1B7Z A;  5ET8 A;  3DLN A;  3OSQ A;  1MXV A;  1B46 A;  3G3F A;  4GX3 A;  3CRB A;  4GL8 A;  4XKN A;  2DVZ A;  2XD3 A;  4U21 A;  3IOW A;  4N13 A;  1OMP A;  1B3H A;  5DEX B;  4JB7 A;  1II5 A;  3D4G A;  1NV6 A;  2DWA A;  4THI A;  4KCC A;  4LA9 A;  3HST A;  2NXO A;  4YMA A;  3UA8 A;  3FVN A;  2XXQ A;  3MC2 A;  2DE2 A;  4O8M A;  3IFA A;  2ONR A;  3O28 A;  4PBH A;  2XX9 A;  1MH4 A;  4O3C A;  2ONS A;  2XWV A;  1LGB C;  1FTO A;  3MUQ A;  3H6T A;  5ISU A;  1D3K A;  2JJK A;  4U4X A;  3C32 A;  4KFQ A;  4C1T A;  1FSA A;  4OA4 A;  4P0G A;  4AB5 A;  1WVJ A;  2H5Y A;  1FPI A;  4JBZ A;  2F5X A;  4PAF A;  4M4G A;  3KGC A;  3JV9 A;  3TCG A;  1B6H A;  4NF5 A;  4ZEI A;  4F3S A;  2UYF A;  4I3E A;  1DPE A;  1J1N A;  3T96 B;  1FTA A;  2ONK E;  4O7M A;  4LZ8 A;  1MY3 A;  1OQH A;  1SVX B;  5I2N A;  2XA5 A;  2F35 A;  4I9D A;  2H9B A;  3B6Q A;  2ZYN A;  3OMB A;  3IB0 A;  4MNP A;  4FJP A;  3CVG A;  4ND9 A;  1NUX A;  5ESY A;  1DMB A;  4I8C A;  4YKK A;  1EZO A;  4Q5T A;  1K9Z A;  4KCD A;  1NMU A;  2I3V A;  3RTW B;  4OAN A;  1OLA A;  4LON B;  2Y7P A;  2ESN A;  4F18 A;  1JVX A;  3RLF E;  4H0W A;  2I6E A;  1FW0 A;  3KC1 A;  2R6G E;  1NUY A;  2B3F A;  2W7Y A;  1R6Z A;  3TOD A;  2HCA A;  2YLN A;  3K4U A;  4NX1 A;  3SKP A;  4IB2 A;  3C35 A;  3PUZ E;  1MS7 A;  1B3L A;  3P7I A;  3SEU A;  2R8T A;  5AA4 B;  3FV1 A;  4ELP A;  4R2F A;  3IOV A;  5I59 B;  3K6U A;  3LSL A;  1URG A;  4RJZ A;  4XTC Q;  3B8B A;  1IIT A;  4U1O A;  1M5C A;  1UTB B;  3BBR A;  2UVI A;  3C4M A;  1KA0 A;  3QUJ A;  2ANJ A;  1BIY A;  3RNN A;  3ZKK A;  2F3B A;  2Q89 A;  2R9J A;  2BJJ X;  3IJX B;  4OER A;  1ZTY A;  3HPI A;  1USY E;  2HEU A;  2Q74 A;  3THI A;  1WDN A;  3OO8 A;  1FBP A;  1DOT A;  2H98 A;  4OET A;  3MWB A;  2QFL A;  1N7X A;  1UQW A;  3L6H A;  2XXR A;  1JW5 A;  2O1L A;  4QRZ A;  5AA3 A;  5LOM A;  4RNS A;  4N6P A;  3OEK A;  4LZ5 A;  5CI5 A;  1QVS A;  3TPA A;  2R71 A;  3OSR A;  1IMB A;  3H7M A;  3M3K A;  5I58 B;  3VFJ A;  4PFW A;  3FUZ A;  2QVR A;  4F22 A;  3TTR A;  1VDW A;  2Y7K A;  4OWD A;  1QKA A;  4PC9 A;  2A5T B;  4R73 A;  1MY0 A;  2F97 A;  3RY3 A;  2ZYO A;  1N0T A;  3EF7 A;  5HM4 B;  4P11 A;  5KZT A;  4NHB A;  3SZP A;  1JEV A;  3EN3 A;  4GWS A;  1GV8 A;  1P99 A;  5J1D A;  4RPN A;  3KOT A;  1FPG A;  4NED A;  5IZ3 A;  2WBB A;  4KYS A;  2O69 A;  5H8S A;  2GHA A;  4F2Q A;  2WX9 A;  2OZZ A;  4QXD A;  1MQI A;  3IO6 A;  4QSC A;  2RC7 A;  1NL5 A;  3TDJ A;  3O6H A;  1LAF E;  2VD2 A;  1TXF A;  1M5E A;  3CFX A;  1Y3P A;  2FIX A;  2O84 X;  2DDK A;  3DEL B;  3OOA A;  3FV2 A;  1I6A A;  4FAJ A;  5KDT B;  2CZL A;  2AIX A;  4P9K A;  5FHN A;  1NV0 A;  5ET7 A;  2OK2 A;  3UIF A;  4F29 A;  2XWO A;  4G8M A;  4QFK A;  4N15 A;  3CI8 A;  2LAO A;  3V89 B;  1NI9 A;  4PP0 A;  3R6U A;  3TCF A;  3C34 A;  1EH3 A;  4EXL A;  1WOD A;  3K6X A;  2CZI A;  1FQB A;  2I3W A;  3OEN A;  3VXB A;  2KQZ A;  4YKI A;  4GOT A;  3T0J A;  5B7D A;  5AA2 A;  3JYR A;  3TMG A;  2D3I A;  3S9M C;  1ZIU A;  2QMW A;  1IMD A;  4OES A;  2OLB A;  5DT6 A;  1BK4 A;  3R7X A;  1UIU A;  3CFZ A;  3UOR A;  4U4S A;  2HZL A;  3O9P A;  2FIE A;  3IOT A;  1NNK A;  4NTL A;  4XIG Q;  1A55 A;  2Y5L A;  2HXW A;  4P1E A;  4ELQ A;  5LDZ A;  3A3U A;  3VLV A;  1QUI A;  2XXH A;  4QSD A;  4LP2 B;  1A40 A;  1AMF A;  3QMF A;  1NV7 A;  1N04 A;  2VT5 A;  1B7U A;  2I0B A;  5HBC A;  1IUD A;  3O97 A;  4GRK A;  1SW1 A;  2XXY A;  2Y5K A;  1TWY A;  1O7T A;  4R6Y A;  4KHZ E;  3T93 B;  5IZZ A;  4PFU A;  1VR5 A;  3QAX A;  2I0C A;  1JQF A;  4JVC A;  4YZZ A;  3HCQ A;  3Q25 A;  3V8X B;  4G8N A;  1BP5 A;  4MH5 A;  4PE5 B;  4N6K A;  1QGX A;  2ZYK A;  1QUL A;  3A29 A;  4P47 A;  3BFU A;  4OEV A;  1LAX A;  4OEN A;  1B58 A;  1RDX A;  1H44 A;  2B65 A;  4IY6 A;  4FIM A;  1R9L A;  3IR1 A;  1PDA A;  4MBP A;  1MXZ A;  1B9J A;  2YPN A;  5A5X B;  2Q2A A;  5M2V A;  3MST A;  2I4B A;  3U92 A;  4OZ9 A;  1MDP 1;  3RYD A;  5AA4 A;  1NKX A;  3HN0 A;  1D9V A;  3W9W A;  2ZMB A;  2RC8 A;  5IZ3 B;  4GBW A;  1FPK A;  3PPQ A;  2ZNS A;  1D9Y A;  4OHN A;  2ZZV A;  4MJO A;  3U65 A;  1M5B A;  1US4 A;  4KQP A;  3FJG A;  5I56 A;  1XT8 A;  3C36 A;  3LC8 A;  1B51 A;  4XKP A;  4P56 A;  4ZEC A;  1QUK A; 
#chains in the Genus database with same CATH homology
 3MUQ A;  4GLI A;  1MQH A;  3H6T A;  4Z0I A;  5ISU A;  3MZ9 A;  3AXF A;  4UAC A;  1D3K A;  1B3E A;  4M1V A;  4U4X A;  3C32 A;  4RYA A;  3PGF A;  4KFQ A;  3S4U A;  4C1T A;  3FVO A;  3G3J A;  4YKJ A;  3VLW A;  4QSE A;  4P0G A;  4H1X A;  5ITP A;  1OIB A;  4TLL B;  1PC3 A;  4BDO A;  1MXX A;  1WVJ A;  2I48 A;  4AB5 A;  2H5Y A;  2UXA A;  4JBZ A;  2F5X A;  5CMB A;  3UK4 A;  1M5D A;  5JEI A;  1B32 A;  1IIW A;  3OEM A;  4I62 A;  4M4G A;  4ISU A;  5FTI A;  4C0R A;  3MPK A;  3FGS A;  3K02 A;  5L9M A;  4EQB A;  3KGC A;  4NF4 A;  3JV9 A;  4F3P A;  3KN3 A;  3TCG A;  1B6H A;  2YJP A;  3M8U A;  4NF5 A;  3QK6 A;  4ZEI A;  4Q0C A;  4YAH X;  3LBS A;  3BKI B;  3SDF A;  3Q28 A;  2XXP A;  4OEU A;  1MPC A;  1FTM A;  1ZBM A;  4F3S A;  4F31 B;  1VFD A;  4R9G A;  1A8E A;  2WKY A;  4H6D A;  3KEI A;  4POW A;  3PU5 A;  1NNT A;  2QS2 A;  2UYF A;  3MQ9 A;  1DPE A;  4PFT A;  1J1N A;  4HTG A;  3Q29 A;  3PPR A;  4G2Z A;  4E0W A;  2UVG A;  3DM0 A;  4U23 A;  3T96 B;  3VE1 B;  3C31 A;  4K3F A;  3U1O A;  3UGW A;  2ONK E;  2ALU A;  4KYE A;  1H43 A;  4LZ8 A;  3MVY A;  1B5J A;  2Z23 A;  3V83 A;  1IZ1 A;  4BDL A;  1MY3 A;  1QJM A;  1OQH A;  1OVT A;  1SVX B;  5I2N A;  1NH7 A;  2DYX A;  3DP8 A;  2V3Q A;  1NNP A;  4ZED A;  1VFE A;  1AL3 A;  4H5G A;  3CG3 A;  2F35 A;  4FE8 A;  1TT1 A;  5AE4 A;  1KWH A;  4I9D A;  1Y1M A;  2F7B A;  2H9B A;  3CSB A;  4U22 A;  2P0S A;  4HCY A;  5I2N B;  3B6Q A;  3GBA A;  4NF8 A;  2ZYN A;  3OMB A;  3IB0 A;  5H8H A;  2I49 A;  4FJP A;  3CVG A;  4GXS B;  4ND9 A;  3TEP A;  1OQG A;  4G8H A;  3O29 A;  4NWC A;  1N3W A;  3A3C A;  2XX7 A;  4DE8 A;  2VD3 A;  4EXK A;  4NE4 A;  1I6Q A;  4GFR A;  3UN6 A;  1S7Y A;  1DMB A;  3K00 A;  4I8C A;  1R9Q A;  4YKK A;  1EZO A;  3RUM A;  1IXG A;  4Q5T A;  5TPA A;  3U94 A;  4F2O A;  4LUB A;  1R1N A;  4JWO A;  4KCD A;  3T9H B;  1NMU A;  2I3V A;  3RTW B;  2XXT A;  1OLA A;  4G77 A;  3S2V A;  3CIJ A;  1D4N A;  4LON B;  2Y7P A;  2ESN A;  5ITO A;  2XXX A;  4H8J A;  4F18 A;  4EF1 A;  2E1S A;  3N6U A;  3H6V A;  1A54 A;  1USY H;  1MDQ A;  2XHD A;  5DEX A;  1JVX A;  1HSJ A;  2DE3 A;  3RLF E;  4H0W A;  4F3G A;  3PMW A;  1T0K A;  2I6E A;  2Z8F A;  1FW0 A;  2X7P A;  1N84 A;  3H06 B;  2R6G E;  3SET A;  3TEL A;  1B2H A;  4BLA A;  1IEJ A;  3SEX A;  1B0L A;  1MPB A;  2DVC A;  3O2A A;  4WEP A;  1M5F A;  3RGY A;  5KCJ A;  3G3I A;  5DVJ A;  1Z7N E;  1F9B A;  3N5L A;  2B3F A;  2QJE A;  4DXC A;  4EQ9 A;  3TZA A;  5EYF A;  2DXY A;  2DWI A;  3R26 A;  2W7Y A;  4IO6 A;  1R6Z A;  3S9E A;  3MW0 A;  3TOD A;  2DXR A;  2HCA A;  2P2A A;  1LB8 A;  1EU8 A;  2OWT A;  2YLN A;  3K4U A;  4GQO A;  4GIZ A;  2REG A;  3WAF A;  3ZS6 A;  4FOR A;  4IO5 A;  3SKP A;  4IB2 A;  3C35 A;  1AOV A;  1FTK A;  3PUZ E;  1MS7 A;  1B3L A;  4IGR A;  4PFY A;  3TTM A;  3P7I A;  3T22 A;  2F6P A;  5I2K B;  3SEU A;  1B3F A;  2DP8 A;  5AA4 B;  5H8N B;  2RIN A;  1BTJ A;  3FV1 A;  4ELP A;  2PVU A;  1QUJ A;  3IOV A;  4R2F A;  4R9F A;  5I59 B;  3K6U A;  1B1H A;  5FHM A;  3Q26 A;  3LSL A;  1URG A;  4RJZ A;  4XTC Q;  3O6G A;  2GFE A;  1IIT A;  3PUW E;  2F7A A;  4U1O A;  3RT6 B;  5IAI A;  1M5C A;  4C1U A;  1UTB B;  3BBR A;  4MF3 A;  5CBS A;  1YCJ A;  2UVI A;  3D4C A;  4IO7 A;  1DPP A;  2HAV A;  3C4M A;  4IO3 A;  5CMC A;  2HFB A;  4RXL A;  3RTF B;  4DIG A;  5IKB A;  2Z22 A;  4H67 A;  3QUJ A;  3BFT A;  1FQA A;  3TAJ A;  1SI1 A;  2ANJ A;  3FXQ A;  1BIY A;  2QSX A;  5DVI A;  3MBP A;  3RNN A;  3FAT A;  3FVK A;  3ZKK A;  3VXC A;  4YB6 A;  2XXI A;  1VSO A;  5H8Q A;  3SEY A;  4DXU A;  3N26 A;  1UTH A;  4R74 A;  1LFH A;  2O7U A;  5L8D A;  2Q89 A;  2VHA A;  3KG2 A;  3N94 A;  2R9J A;  4BDR A;  3FJM A;  2BJJ X;  1VE4 A;  4OTE A;  3IJX B;  5I84 A;  2H25 A;  2XD2 A;  3HHG A;  4OER A;  4TQU Q;  1XHY A;  1ZTY A;  2FA7 A;  3B6T A;  3HPI A;  1USY E;  4DLD A;  2HEU A;  4OMB A;  3IO4 A;  4GWO A;  2HZK A;  5AA1 A;  1ATG A;  2B3B A;  1HSL A;  2ZNT A;  3SEV A;  3THI A;  1WDN A;  3TCH A;  3K1M A;  3OO8 A;  5AA2 D;  5JK4 A;  1DOT A;  1N7W A;  3ZSF A;  3FAS A;  3UP9 A;  2H98 A;  3T9X B;  4OET A;  3GBB A;  3MP8 A;  3U8Q A;  3Q27 A;  5H8N A;  1IXC A;  4NF6 A;  3MWB A;  4YIC A;  1PEB A;  1N7X A;  1UQW A;  4EUO A;  1IXI A;  3L6H A;  2XXR A;  1JW5 A;  4O3B A;  2REJ A;  1ZMG A;  3KZG A;  4NWD A;  4BDN A;  4U2R A;  2O1L A;  4QRZ A;  1MXU A;  3TKD A;  1MXY A;  2DSF A;  4N6P A;  4RNS A;  1ZJL A;  1TFD A;  3OEK A;  4DCX A;  5ICQ A;  3TTL A;  4LZ5 A;  3TUS A;  3FXR A;  5CI5 A;  2Y7R A;  1S9T A;  1YAE A;  1QVS A;  2OBG A;  3IJO B;  1O63 A;  1CB6 A;  1Y4T A;  4Q30 B;  3TPA A;  4Z7E A;  4WKM A;  2R71 A;  3MVX A;  2DWJ A;  3H7M A;  3M3K A;  1LLS A;  3OSR A;  5I58 B;  3VFJ A;  3MPL A;  1SBP A;  4KYD A;  3H6U A;  4YU0 A;  1MY4 A;  2GH9 A;  3ILU B;  3LSX A;  3O6I A;  1DTZ A;  2M8C A;  4PFW A;  1UIV A;  1O64 A;  3FUZ A;  4F22 A;  2P1S A;  3OEL A;  5K2X A;  3TTR A;  1B0H A;  2Y7K A;  4QFP A;  3USD A;  3TTN A;  2AL5 A;  5EHM A;  2PYY A;  4YKP A;  3ZKL A;  4IO4 A;  4OWD A;  1QKA A;  1FTJ A;  2FYI A;  3E9X A;  1CE2 A;  3IX1 A;  3OO7 A;  2IEE A;  5CC2 A;  3KJ7 A;  2QRY A;  1FQF A;  2H4I A;  1PB8 A;  1OVB A;  1SW2 A;  2X26 A;  3H03 A;  4JDF A;  3GLB A;  3TTK A;  4ZEK A;  1PBP A;  1LAH E;  2A5T B;  5HPQ A;  4HCW A;  4GXA A;  4IO2 A;  1FCK A;  3K0V A;  1YPN A;  4R73 A;  1MY0 A;  2F97 A;  1DSN A;  1P1N A;  1P1W A;  2V93 A;  2ZYO A;  1URD A;  1N0T A;  3E4R A;  1FQC A;  3EF7 A;  1NNF A;  2IA4 A;  2Z8E A;  3QUF A;  4FEB A;  4X1D A;  3RY3 A;  3W15 C;  5HM4 B;  4H5F A;  1AIV A;  3H4Z A;  4GF8 A;  4P0I A;  4P11 A;  5KZT A;  3G7W A;  3EHS A;  4HW8 A;  2I4C A;  1ELJ A;  4XXU A;  3RN8 A;  4ZEF A;  2D5W A;  1MQJ A;  1JEV A;  1LFG A;  3EN3 A;  3KBR A;  3IK6 B;  1GV8 A;  1P99 A;  3MAM A;  5B70 A;  5CMK A;  5J1D A;  4G68 C;  3B7D A;  4F39 A;  4RPN A;  4F1V A;  5K2Y A;  3KOT A;  4NED A;  3OD7 A;  5TU0 A;  1SQY A;  1SYH A;  3EHU A;  3SES A;  4EDP A;  2Z8D A;  3O66 A;  4LQ2 A;  4AB6 A;  3K1P A;  5CMM A;  1A7L A;  4KYS A;  3IOR A;  4RA1 A;  2O69 A;  5H8S A;  4ESW A;  3QXM A;  2GHA A;  2QS3 A;  3IOU A;  4F2Q A;  2AL4 A;  2OZZ A;  3U93 A;  1MQI A;  1MRP A;  2THI A;  1JW1 A;  2Y7I A;  3IO6 A;  4FEC A;  4L17 A;  4OVJ A;  2RCB A;  4QSC A;  4IY5 A;  1H45 A;  2CMO A;  4TOZ A;  2RC7 A;  1P1U A;  4OFL A;  3MVW A;  2I58 A;  2V25 A;  1RYX A;  1NL5 A;  1JVY A;  1MXW A;  3LUY A;  1MY1 A;  2PT1 A;  3K01 A;  3TDJ A;  2O51 A;  3ONM A;  5BWJ A;  2VGQ A;  3KSX A;  3O6H A;  1LAF E;  2VD2 A;  4QFO A;  4NF8 B;  1TXF A;  1M5E A;  3MZ1 A;  4R75 A;  2H99 A;  4QFL A;  3TFL A;  4E0X A;  3CFX A;  4RK9 A;  1Y3P A;  1POT A;  2O84 X;  4X48 A;  4OFJ A;  4XKR A;  4IGT A;  1HSE A;  3PD8 A;  3DEL B;  2NUV A;  3FD3 A;  4JSO A;  3QSL A;  4O3A A;  4MFI A;  4OYV A;  3C9H A;  4MLQ A;  3OOA A;  3FV2 A;  4KPT A;  5FTH A;  4PET A;  4ZDM A;  1I6A A;  1OLC A;  3EQ1 A;  3N6T A;  1XOC A;  4G68 A;  4FAJ A;  5KDT B;  3H6W A;  4ZZA A;  4BDM A;  4RPO A;  2CZL A;  2FNC A;  1MY2 A;  2RCA A;  2AIX A;  3ECR A;  2NVU B;  1JET A;  1SDX A;  3H3G A;  3QIM A;  1B5I A;  1H76 A;  5DYH A;  5FHN A;  4ZZE A;  1RYO A;  4H65 A;  2XXU A;  1B4Z A;  2OK2 A;  2DQV A;  5TP9 A;  3UIF A;  2D21 A;  2Q88 A;  2V3T A;  2Y7W A;  1H3D A;  4F29 A;  3CR9 A;  4G68 B;  3FZV A;  2E0S A;  2F7C A;  2QMX A;  1MM6 A;  3TQW A;  4G8M A;  3ODB A;  4QFK A;  3HV1 A;  3OXN A;  4DXB A;  4F19 A;  3CI8 A;  1GGG A;  4U1Z A;  3S9N C;  1ANF A;  4EQ7 A;  2DOJ A;  2F78 A;  2LAO A;  3E13 X;  2ABH A;  3GZG A;  3V89 B;  3GXA A;  3WAE A;  4H8I A;  4PP0 A;  1PBQ A;  1US5 A;  2VOZ A;  3R6U A;  5H8H B;  1GVC A;  3OO9 A;  3U72 A;  4JSD A;  1B4H A;  3TCF A;  3C34 A;  2G93 A;  3VVE A;  3HO7 A;  1EH3 A;  4EXL A;  1I69 A;  1WOD A;  3K6X A;  1IQ7 A;  1EZ9 A;  2O7I A;  1FQB A;  3FVG A;  3M3F A;  4DDD A;  3RPW A;  3VLU A;  2I3W A;  3OEN A;  1BLF A;  1S50 A;  3VXB A;  4YKI A;  3W9V A;  4GOT A;  3G3H A;  5B7D A;  3MZB A;  5AA2 A;  4PQJ A;  4MLV A;  4JXI A;  1ZLQ A;  3JYR A;  2XXV A;  4OXV A;  3K6W A;  2QL3 A;  3PV0 E;  3RT8 A;  3TMG A;  4ZE8 A;  2D3I A;  3S9M C;  4BDQ A;  1ZIU A;  1SYI A;  2QMW A;  2DS9 A;  5L9O A;  2UVJ A;  2RC9 A;  4OES A;  1PB9 A;  3S9L C;  2OLB A;  3PMX A;  3PPO A;  5DT6 A;  2F8D A;  3R7X A;  4R72 A;  4NF4 B;  4GL0 A;  1BKA A;  1UIU A;  5F7V A;  3CFZ A;  3FIR A;  4KD5 A;  2HZL A;  1LBB A;  4U4S A;  4RY1 A;  3T66 A;  3UOR A;  5CBR A;  1B1X A;  3B6W A;  5DVF A;  3O9P A;  4NTL A;  1RKM A;  1GTK A;  1NNK A;  3IB1 A;  3IOT A;  5TP9 B;  3V5A A;  4XIG Q;  1A55 A;  1ZU0 A;  1A8F A;  3T9V A;  2HXW A;  1B05 A;  1MQD A;  2OJT A;  3VV5 A;  4ELQ A;  1IXH A;  3KFM A;  4ZE9 A;  5I2K A;  4ZS9 A;  4LQ5 A;  3A3U A;  3VLV A;  1GR2 A;  1QUI A;  3G3G A;  1Z7M E;  2PMS A;  1B52 A;  2XXH A;  2ZNU A;  4QSD A;  4LP2 B;  1A40 A;  1AMF A;  3EPE A;  4POX A;  5CM6 A;  3EHT A;  3KN8 A;  2QS1 A;  4G4P A;  2UVH A;  1N04 A;  3U92 A;  1Y4C A;  4GD5 A;  1B7U A;  2I0B A;  4DCY A;  2F36 A;  2O68 A;  1B3G A;  1XS5 A;  2Q2C A;  3A09 A;  2AYS A;  3PUY E;  4YB5 A;  5HBC A;  1IUD A;  3O97 A;  4GRK A;  3MVZ A;  1SW1 A;  3PUV E;  1NFT A;  2RF1 A;  2XXW A;  2XXY A;  3RQT A;  4Q8R A;  5AA4 A;  1MQG A;  1XVY A;  4FAT A;  3L6G A;  4LZ7 A;  1TWY A;  1O7T A;  4F1Y A;  5AA2 B;  4R6Y A;  4R2B A;  3MJN A;  3VDF A;  3IB2 A;  3JZJ A;  3MP1 A;  2PT2 A;  2ZYM A;  4KHZ E;  5DEX B;  3T93 B;  4JWX A;  4RK2 A;  3T9U A;  1URS A;  4JWY A;  5I57 A;  1PB7 A;  5JTY B;  1Y3Q A;  2OCU A;  4ONY A;  4PFU A;  1SD3 A;  3DP6 A;  3FXU A;  1SW5 A;  3PMV A;  1N3X A;  4ELR A;  1VR5 A;  2HQ0 A;  3QAX A;  1MM7 A;  2QS4 A;  3I5O A;  1QW0 A;  3TQL A;  2I0C A;  4ZEB A;  1JQF A;  2KLF A;  4YZZ A;  1DTG A;  1QKB A;  2NOO A;  3G3K A;  1YTV A;  4QHQ A;  5I58 A;  1LBC A;  3HCQ A;  4OFO A;  3Q25 A;  3SER A;  2Q9T A;  5I56 B;  4ELO A;  4X9T A;  1NH8 A;  4N07 A;  4DZ1 A;  1Y9U A;  4LVQ A;  3V8X B;  4G8N A;  4QF9 A;  2DWH A;  5H8F A;  1BP5 A;  4MH5 A;  3VVD A;  4PE5 B;  5AA3 A;  2ZYK A;  1QUL A;  2QPQ A;  1JNF A;  1B7H A;  3QYT A;  3M3L A;  4NF6 B;  1Q1K A;  3CFL A;  3I3V A;  3K2D A;  4WED A;  5JTY A;  4NMY A;  5L9S A;  3BFU A;  4OEV A;  1LAX A;  4OEN A;  4XKQ A;  1UTH B;  2A5S A;  4AQ4 A;  5ICT A;  1A99 A;  1B58 A;  3PD9 A;  3IAZ A;  3PUX E;  4X1B A;  1SW4 A;  5KDT A;  1H44 A;  4I1D A;  5F1Q A;  1Y3N A;  3PPP A;  5A5X A;  5BUU A;  2B65 A;  4YMB A;  1LB9 A;  1MPD A;  3KN7 A;  1FQE A;  4F1U A;  4IY6 A;  2X7Q A;  4FIM A;  5I59 A;  4F3B A;  3LR1 A;  1R9L A;  1TFA A;  2RKM A;  2XX8 A;  3ILT B;  1MG1 A;  3IR1 A;  4QFN A;  3SEW A;  1FQD A;  1PDA A;  3HHF A;  4GVO A;  1B5H A;  1LCF A;  2GRV A;  1UTB A;  2O1M A;  4OQO A;  4MBP A;  5ELV A;  5TPA B;  1MXZ A;  1P1O A;  1B9J A;  1XC1 A;  1LAG E;  2V84 A;  2YPN A;  3CSG A;  1LFI A;  5H8Q B;  1B40 A;  2HAU A;  5A5X B;  4FED A;  2PBW A;  2Q8J A;  1EZP A;  2Q2A A;  2Y84 A;  4R6K A;  4YB7 A;  5M2V A;  4ESX A;  2NWJ A;  1MH3 A;  2I4B A;  2O6A A;  2PX1 A;  2VP1 A;  4LAT A;  5CRY A;  5FHO A;  1AH5 A;  4OZ9 A;  1MDP 1;  1Y1Z A;  1B7Z A;  3C33 A;  1LST A;  2UYE A;  1NKX A;  3DLN A;  3HN0 A;  3LSF B;  1P1Q A;  1D9V A;  1MXV A;  3K6V A;  3OSQ A;  3PPN A;  3DP4 A;  1LCT A;  1I6B A;  2F6G A;  1B46 A;  3G3F A;  3W9W A;  3CRB A;  4GL8 A;  5H8F B;  4XKN A;  2DVZ A;  2ZMB A;  2RC8 A;  4NF5 B;  2XD3 A;  3MP6 A;  4U21 A;  3LSW A;  3OO6 A;  2OWS A;  1N76 A;  3IOW A;  4N13 A;  1OMP A;  4HS7 A;  2GHB A;  1B3H A;  4JB7 A;  3PPQ A;  1II5 A;  3FJ7 A;  2A5T A;  3D4G A;  4WXJ A;  3I6V A;  4TLM B;  2ZNS A;  2ZXT A;  3KJT A;  4EF2 A;  4KR5 A;  1D9Y A;  1JEU A;  4OHN A;  2DWA A;  4KCC A;  4THI A;  3CG1 A;  1Q35 A;  4LA9 A;  2V3U A;  3E3K A;  3HST A;  4R6H A;  2NXO A;  5LOM A;  1M5B A;  4KI0 E;  4YMA A;  2G29 A;  1US4 A;  3UA8 A;  3FVN A;  2XXQ A;  5EHS A;  3MC2 A;  2DE2 A;  4KQP A;  1FTL A;  4UA8 A;  2ONR A;  1POY 1;  3FJG A;  5I56 A;  5KCJ B;  3O28 A;  3TYH A;  3KOS A;  1XT8 A;  1JW4 A;  4ECF A;  2XX9 A;  1ZKB A;  3C36 A;  1MH4 A;  3F11 A;  3K1N A;  3LC8 A;  3VVF A;  4O3C A;  1B51 A;  1L5T A;  2DE4 A;  3KSJ A;  4XKP A;  3IL1 B;  1Y20 A;  2ONS A;  1SI0 A;  1XVX A;  5DTB A;  4ZEC A;  5I57 B;  1LGB C;  1QUK A;  2F34 A;  1FTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...