3PPQA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
TIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 100
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ppqA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3ppqA02
2RC8A 3IL1B 4HW8A 5J1DA 3MPKA 3TCHA 3VVEA 1MY2A 4KHZE 3TFLA 1IUDA 1S9TA 2I4BA 2XXVA 4PFWA 3RTWB 3VLUA 3K6XA 3KJ7A 3G3FA 4XTCQ 3TTRA 2I49A 4QSEA 2RCAA 3H6WA 4IY5A 1IIWA 1RYXA 4OTEA 4I62A 5TPAB 5EYFA 4JB7A 2QMWA 2BJJX 2NWJA 4G77A 2QS3A 5KDTB 4IY6A 3WAEA 3B6QA 1LAFE 3VXBA 1USYH 3QAXA 1I69A 1R1NA 2O68A 5TP9B 3FXRA 1SW5A 3R26A 5DTBA 4F3GA 3MVWA 4ONYA 2DE2A 3KG2A 4FECA 1VFDA 3IOVA 4WEPA 1DMBA 4EXKA 3HCQA 2OK2A 4DCYA 3IORA 1GV8A 5HBCA 2D5WA 4FEDA 3EPEA 2PYYA 4UACA 4I9DA 4ELRA 5ISUA 3W15C 2VD2A 1JVYA 4BDMA 1JETA 2V3QA 3LSXA 4OFLA 3SETA 1BIYA 1NNPA 3O2AA 1LAXA 3L6GA 5EHSA 1UTHB 1Y3QA 3QK6A 3MW0A 3M8UA 2I0BA 1VR5A 2XD3A 5JK4A 1I6BA 1I6QA 2X7QA 3CG3A 4C1TA 2UXAA 1SI0A 3KN7A 1HSEA 4HTGA 2I58A 4MH5A 4ZECA 3QSLA 2A5TA 3VFJA 3FVKA 3MVXA 4ELOA 3MP8A 2VOZA 1IZ1A 4MF3A 3CSGA 2X7PA 1FTKA 4ECFA 3SEUA 5AA1A 4M1VA 2DE3A 5DEXA 1FQFA 4DXUA 4JWYA 4YICA 2F6PA 1B3EA 4ZEDA 1A7LA 1N3WA 4GLIA 3F11A 4U23A 1ZMGA 3U92A 3ONMA 3LBSA 2VGQA 4MFIA 3H3GA 2O84X 1Z7NE 2ANJA 1MQJA 3KFMA 2I6EA 1US5A 4G68B 1JW4A 2OWTA 4DE8A 4BDNA 3G3JA 1Q1KA 1KWHA 5AA4A 3GBBA 1PBQA 3MVZA 4R9GA 5DVJA 1SDXA 5AA2B 3ODBA 3KJTA 3HPIA 2GFEA 3DP4A 3MZBA 2AIXA 2VHAA 4U21A 5I59A 3SEXA 4DXBA 3U94A 2HEUA 4G8HA 1MXYA 1FQAA 1B40A 5ELVA 5JTYB 2HCAA 5DYHA 3S9EA 3S9LC 5H8SA 1DPPA 4ZEFA 4GL0A 4XKPA 3SDFA 2OBGA 1MPDA 1QUIA 3K6UA 4YB6A 3O66A 3HV1A 2X26A 4H0WA 5L8DA 5BWJA 2ZNSA 2ONKE 2UVGA 3MBPA 1USYE 4TLMB 1N3XA 3VVFA 2DWJA 3O6HA 3TYHA 4ISUA 1MQIA 1A55A 2V93A 1B3HA 4OYVA 4OHNA 4BDQA 2RF1A 2VD3A 3MZ9A 1UTBB 5CRYA 4EF2A 1LCFA 2DS9A 3E9XA 3RPWA 3SESA 3BFTA 1J1NA 2UVIA 3UGWA 4F18A 5FTIA 1EZPA 1H43A 4PFUA 3TQWA 1FQDA 5H8FB 1JW5A 5H8QA 3W9WA 3HN0A 1MPBA 1FTLA 5CBSA 1NNFA 3TKDA 3GBAA 5A5XB 1QJMA 3PD8A 4WKMA 1A99A 4H5FA 2E1SA 4NF5A 2XX9A 1B46A 1P1QA 3MQ9A 1II5A 4XIGQ 1NKXA 2QPQA 5H8NA 4G4PA 1OQHA 4R6YA 1ZIUA 1LSTA 4ZEBA 1FTJA 3MZ1A 3TMGA 3FV1A 2CMOA 3C9HA 3R7XA 4Q8RA 3K1NA 5BUUA 1I6AA 5I56B 4JWOA 1OQGA 3FVGA 3S4UA 3A3UA 5I2KA 2THIA 3CIJA 3CSBA 3GLBA 3OD7A 2O6AA 1PB9A 1M5DA 2O1LA 3CR9A 4NF6B 3LC8A 2I4CA 2F7CA 2Q8JA 5HM4B 3CFZA 5CI5A 3C4MA 2Q2AA 3QUFA 2H4IA 3CVGA 3K6VA 1ZLQA 3IOUA 3G7WA 2F78A 1MDP1 2QSXA 5ICTA 4IO3A 1NH8A 3SERA 1OIBA 3OEMA 3ECRA 3H7MA 1FW0A 2DWAA 1EZ9A 1O63A 3JYRA 2IEEA 3UK4A 3IO4A 4YMAA 4OEUA 3SKPA 1AH5A 2I0CA 4EXLA 4JSDA 2VP1A 5I58B 1DTZA 4GXSB 1LCTA 4WXJA 4LP2B 2UVHA 2UYFA 1B3FA 4N13A 3ILTB 2PMSA 1BP5A 3V89B 4YMBA 5CMMA 3H06B 2O7IA 4ELQA 1ATGA 3IJOB 4RJZA 4IO4A 4QFKA 4JBZA 1N76A 5KCJA 1T0KA 3KGCA 2XXPA 3FVOA 2F34A 5L9SA 2CZLA 1B7HA 1M5FA 4KI0E 2OCUA 3FV2A 3VLVA 4RK9A 2F6GA 1YCJA 1NNKA 3Q27A 4KPTA 4KFQA 3HSTA 3O9PA 4Q0CA 3TTLA 4NF4A 3LR1A 4F1YA 3RN8A 3T22A 4IO5A 3H6TA 4EDPA 2DVZA 2R71A 1SBPA 4XKQA 1B51A 1Z7ME 1JQFA 3E3KA 3FJGA 3TODA 2Z8EA 1R6ZA 2XXXA 4GRKA 5I57A 3H4ZA 3EF7A 2XXWA 2LAOA 4THIA 4OERA 3DP6A 1AL3A 1S7YA 2Y7KA 4TOZA 3K1PA 3PV0E 3IOWA 1B52A 1JEVA 3TAJA 5FHMA 3IOTA 1FTOA 1ZTYA 1FQBA 3RY3A 2O1MA 3N94A 1AMFA 4GWOA 4DLDA 1LAHE 1Y3PA 4OQOA 1XHYA 4U1OA 3Q28A 2DE4A 2PX1A 4NWDA 1ZJLA 2QL3A 1XVXA 4YKKA 4RPNA 3H03A 3O29A 4DDDA 1WDNA 3OO8A 4XKNA 5H8HA 4C1UA 1P1NA 1SQYA 2XHDA 4JSOA 3H6VA 2HAVA 3N5LA 1O7TA 1ZU0A 2HXWA 2H9BA 3OO7A 4F3BA 4HS7A 4KYDA 4ELPA 2RINA 4R2FA 1MH4A 3G3GA 1MRPA 5ICQA 4RA1A 3IAZA 1WVJA 3BBRA 2A5TB 3T9VA 1D4NA 3MPLA 3FXQA 3K2DA 4LZ5A 3UP9A 4KD5A 3O97A 1MH3A 2OJTA 1YTVA 4LQ2A 3QYTA 5DEXB 1PEBA 1UIVA 2ZYMA 3RUMA 4GIZA 2H25A 3PUZE 2DOJA 2NVUB 4ESXA 2B3BA 5L9MA 1MM6A 1B3LA 1UQWA 3MJNA 4RY1A 2XX8A 1M5CA 1IXHA 1P1UA 5CMKA 2QJEA 2AYSA 2RC7A 2AL4A 5DVFA 2Z8DA 1UTHA 3AXFA 3S2VA 1MQDA 3OELA 3KN8A 3B6WA 4RPOA 4NE4A 2GHBA 3PUWE 3I6VA 4U4XA 3TZAA 5AA4B 3PU5A 2ZYOA 4H1XA 3KEIA 3FD3A 2M8CA 1OVTA 2I3WA 4L17A 3MVYA 1MXXA 1QUJA 2ALUA 4F31B 4KCDA 3C34A 3OSQA 4G8MA 1D9VA 4Z0IA 1VFEA 1ZBMA 3C36A 4P0IA 4G68C 3CI8A 3S9NC 2HZLA 2REGA 2XXQA 1F9BA 4JXIA 4R6KA 3OMBA 4Q5TA 3V5AA 3TDJA 5F1QA 3S9MC 3RLFE 2Q89A 1QW0A 2E0SA 5HPQA 1QVSA 4OMBA 3MP6A 4NEDA 1MXZA 2DWHA 1B32A 1GTKA 1PB7A 1FCKA 2F8DA 1DSNA 3IJXB 1Y20A 4P0GA 1IITA 3OEKA 1QUKA 3EHSA 2I48A 1IQ7A 3H6UA 2RKMA 3CFLA 5CM6A 2Q88A 1B5JA 2A5SA 3TTMA 2ZNUA 3D4GA 1FTMA 1H3DA 1WODA 1TFAA 4YB5A 2PT2A 1JW1A 4PFYA 2F36A 4ZDMA 3KOTA 2O7UA 4H6DA 4F19A 3T9HB 1MG1A 4HCWA 2DP8A 4GL8A 2ONRA 2P1SA 2QS4A 2Y84A 1RYOA 2D3IA 1XOCA 5CMBA 4DZ1A 4KYEA 1N7WA 1MPCA 3MC2A 4YKIA 3L6HA 1LGBC 1XT8A 2ZYNA 4AB5A 5L9OA 2ZYKA 1PDAA 1A54A 3G3IA 4NF5B 3T66A 3M3FA 3EQ1A 1Y9UA 4GOTA 1NNTA 5H8NB 2GHAA 3MWBA 1MXVA 5EHMA 4GD5A 2F7BA 3IK6B 3LSWA 4PQJA 3TQLA 4TQUQ 3HHGA 2R6GE 3FASA 3HO7A 4LUBA 1FQCA 4IB2A 2Q9TA 1URSA 4F2OA 1D3KA 1B1XA 3JZJA 1B58A 3M3KA 3T9UA 3UN6A 3UA8A 1MY0A 5I2KB 3M3LA 3PGFA 2YPNA 2F97A 2V25A 1DOTA 4R72A 1OVBA 1RKMA 4QFLA 2DSFA 4BDRA 2DQVA 4NF8A 3TUSA 2QS2A 3K1MA 1MXUA 1SVXB 3LSFB 4RYAA 4Z7EA 3O28A 3FJ7A 2HZKA 3VE1B 1NL5A 2B3FA 1PC3A 1OMPA 2Q2CA 1LFGA 4F2QA 2GRVA 3IO6A 1IXGA 1QKAA 1MY3A 2XXUA 4DXCA 3VVDA 3K0VA 4FATA 2PVUA 1N04A 4XXUA 2ESNA 2OWSA 4N07A 4AQ4A 2NOOA 3N6TA 3C31A 1IXCA 4YKPA 1LBBA 1LFIA 4FE8A 4ND9A 3PUVE 3W9VA 4DCXA 3JV9A 4R75A 3PMVA 1S50A 3THIA 4M4GA 2YLNA 5FHNA 4BLAA 1FQEA 4ZE9A 2YJPA 1TFDA 1N7XA 3WAFA 3OXNA 1US4A 3SEYA 4LVQA 4JWXA 4KCCA 4OENA 1M5EA 2NUVA 5KCJB 4KYSA 4OXVA 2ZNTA 4H8IA 4QFOA 1JEUA 3VXCA 4LATA 1VSOA 4I1DA 4TLLB 1JNFA 1B2HA 4PETA 3IB2A 5LOMA 3O6GA 4QSDA 5KZTA 2XXHA 3A09A 1Y4CA 4ZEKA 4NF4B 4POWA 4U2RA 2FNCA 1CB6A 4GFRA 3TCFA 2F7AA 4EF1A 3B6TA 4GVOA 1MDQA 4X9TA 1ANFA 4OWDA 3KSXA 1POTA 3OO6A 1MY4A 1LLSA 3G3KA 3KN3A 5I57B 4R74A 2XXIA 1OLCA 2B65A 4RK2A 1P1WA 5I2NA 1DTGA 4IO6A 1OLAA 1A8EA 2H5YA 1ELJA 1Y3NA 2DXRA 3VLWA 2V3UA 3MAMA 5FHOA 2DWIA 3VV5A 5AA3A 4WEDA 4R9FA 3R6UA 2PT1A 4O3AA 1B1HA 2Z23A 1B9JA 1IEJA 1B3GA 3RT8A 4QFPA 5H8HB 2R9JA 4E0WA 1HSLA 4N6PA 1BLFA 4RXLA 4LQ5A 3RNNA 3QIMA 1LFHA 4NTLA 3LSLA 4H8JA 3FJMA 2RCBA 2QMXA 3MP1A 4YKJA 1NMUA 5CC2A 3I5OA 4F1UA 4IGRA 5TPAA 1SW1A 4H65A 4QHQA 1MS7A 2PBWA 2O51A 4F39A 4POXA 3CG1A 5KDTA 4P11A 2V3TA 3GXAA 2UVJA 1EZOA 3EHUA 5TP9A 1SI1A 4GXAA 4ZEIA 1P99A 1Q35A 3OSRA 1URGA 4QFNA 5ITOA 3Q25A 1EH3A 5K2YA 2FA7A 3RGYA 4F1VA 1NFTA 4O3CA 2ONSA 5ITPA 4PE5B 1H76A 1N0TA 3IB1A 3T9XB 1R9QA 3U72A 2Y7RA 4YAHX 3ZS6A 3RQTA 3Q29A 1B7UA 4F3PA 1GGGA 4KQPA 3A3CA 4C0RA 3V83A 3PMXA 3OO9A 2G29A 2D21A 2P2AA 5I84A 1ZKBA 2Y7IA 4ESWA 1LB8A 2XXRA 3PMWA 3G3HA 4BDOA 4FJPA 1Y1MA 4ZE8A 2WKYA 1TXFA 3IX1A 3EN3A 3PUYE 3TELA 4DIGA 2XD2A 4LZ8A 4JDFA 1MXWA 4ZS9A 4YB7A 2Z22A 3K01A 4NWCA 2RC9A 3P7IA 3RTFB 5CMCA 1N84A 3FATA 4Q30B 5FTHA 4FIMA 2QS1A 2IA4A 1R9LA 2XXYA 5JEIA 4OFOA 4PP0A 3BFUA 5I59B 2ZXTA 3EHTA 1XVYA 3PPPA 4R6HA 3DP8A 3T96B 1AIVA 1POY1 3E13X 4GQOA 1PB8A 3KOSA 4IGTA 1SW4A 1B4HA 1LB9A 4FAJA 3U1OA 4HCYA 3CRBA 4ZZEA 4LONB 5K2XA 2ABHA 3UIFA 1URDA 1A40A 4U4SA 4MLVA 3C33A 4NMYA 4QRZA 3PUXE 5CBRA 3FVNA 4YU0A 4G68A 2O69A 4G2ZA 4H67A 4EQ7A 1TT1A 1SYHA 3DM0A 5F7VA 1SW2A 2NXOA 4U22A 5DVIA 5B70A 1QKBA 1Y4TA 2KLFA 3ILUB 4UA8A 3K4UA 3C32A 5AA2A 2F35A 3KSJA 2OLBA 3T93B 1XS5A 1PBPA 3BKIB 1IXIA 2AL5A 1A8FA 2DYXA 3USDA 1O64A 1GVCA 4U1ZA 4OZ9A 3TTNA 1NH7A 5TU0A 1B5IA 4IO2A 1D9YA 3ZKKA 5H8QB 3PPOA 3K02A 1B05A 4FORA 4IO7A 1MY1A 5JTYA 4LZ7A 3TCGA 2P0SA 1B5HA 3E4RA 4GF8A 1SYIA 5DT6A 1MQGA 2REJA 3PPRA 4LA9A 4BDLA 4X1DA 3I3VA 1DPEA 3PPQA 3FIRA 1L5TA 1B0LA 3K6WA 3N6UA 4EUOA 3LUYA 3UORA 1B7ZA 2V84A 5AE4A 4PFTA 3MUQA 4R73A 2XXTA 2DVCA 4NF8B 4AB6A 4QF9A 1SD3A 4F3SA 4F29A 5IKBA 2F5XA 1BTJA 1LBCA 1LAGE 4X48A 3DELB 1UTBA 3OENA 1TWYA 1Y1ZA 3Q26A 3DLNA 4O3BA 3KZGA 1HSJA 2H99A 1UIUA 3QUJA 1VE4A 5H8FA 3SEWA 1B6HA 1MM7A 2FYIA 3FXUA 3KBRA 1H45A 4FEBA 5A5XA 1AOVA 2UYEA 3FZVA 5M2VA 4OFJA 4X1BA 3FUZA 3ZSFA 1EU8A 5B7DA 4MBPA 1JVXA 3HHFA 2HAUA 4G8NA 3V8XB 2ZMBA 3CFXA 3O6IA 2QRYA 3PD9A 4OETA 2HFBA 4K3FA 5I56A 2XX7A 2Y7WA 3FGSA 4OVJA 4EQ9A 3TTKA 2G93A 4E0XA 2H98A 2HQ0A 3IB0A 4NF6A 4MLQA 4R2BA 3SEVA 1BKAA 3TPAA 3TEPA 3D4CA 3U93A 3QXMA 4OEVA 4XKRA 2GH9A 2OZZA 3C35A 4OESA 1QULA 4I8CA 4QSCA 4YZZA 1GR2A 3B7DA 5AA2D 5IAIA 1MQHA 1YPNA 4ZZAA 2Z8FA 3VDFA 3ZKLA 1XC1A 1P1OA 1YAEA 1B0HA 1CE2A 2W7YA 2I3VA 4RNSA 1B4ZA 1H44A 3N26A 3GZGA 4F22A 2Y7PA 3OOAA 4KR5A 5I2NB 3K00A 3IR1A 4H5GA 2DXYA 5I58A 3RT6B 1M5BA 3U8QA 4EQBA 3PPNA
chains in the Genus database with same CATH superfamily
3IFAA 2RC8A 3IL1B 4HW8A 5J1DA 3MPKA 3TCHA 3VVEA 5EYHA 1IMEA 1MY2A 4KHZE 3TFLA 1IUDA 1S9TA 2I4BA 2XXVA 4PFWA 1SPIA 3RTWB 1G0IA 3VLUA 3K6XA 3KJ7A 3G3FA 4NF0A 4XTCQ 3TTRA 2I49A 4O94A 4QSEA 2RCAA 3H6WA 4IY5A 1IIWA 1RYXA 4OTEA 4I62A 5TPAB 5EYFA 4JB7A 2QMWA 2BJJX 2VPOA 2NWJA 3MYUA 4G77A 2WX9A 2QS3A 5KDTB 4IY6A 5EQ9A 3WAEA 3B6QA 1LAFE 3VXBA 1USYH 3QAXA 1I69A 1R1NA 2O68A 5TP9B 3FXRA 4GX4A 1SW5A 3R26A 5DTBA 2KQZA 5T3JA 4F3GA 3MVWA 1FPLA 4ONYA 2DE2A 3KG2A 4FECA 1VFDA 3IOVA 3U65A 4WEPA 1DMBA 1NUYA 4EXKA 3HCQA 2OK2A 4DCYA 3IORA 2ZZWA 1GV8A 5HBCA 2D5WA 5ESYA 4FEDA 3EPEA 2PYYA 4UACA 1FPGA 4I9DA 4ELRA 5ISUA 3W15C 2VD2A 1JVYA 5EQ7A 1JETA 4BDMA 1KA1A 2V3QA 2FBPA 3LSXA 3PTYA 4OFLA 3SETA 5FBPA 1BIYA 1NNPA 5I3SA 3O2AA 1LAXA 4I3YA 3L6GA 5EHSA 1UTHB 1NV7A 1Y3QA 2B4MA 3QK6A 3MW0A 5IZZA 2FIEA 3M8UA 2I0BA 3B50A 1VR5A 4AS4A 2XD3A 5JK4A 1EYJA 1I6BA 1I6QA 2X7QA 3CG3A 4C1TA 2UXAA 1SI0A 3KN7A 1HSEA 4HTGA 4MNIA 2I58A 4MH5A 4ZECA 4OANA 5IZ3A 3QSLA 2Y5LA 2A5TA 3VFJA 3FVKA 3MVXA 4ELOA 2CEXA 3MP8A 2VOZA 1IZ1A 4MF3A 3CSGA 1KA0A 1EYIA 2X7PA 1FTKA 4ECFA 3SEUA 5AA1A 1IMCA 2DE3A 4M1VA 5DEXA 1FQFA 1XI6A 4DXUA 4JWYA 4YICA 2F6PA 1B3EA 4ZEDA 1A7LA 5ET7A 1VDWA 1N3WA 4GLIA 3F11A 1FBGA 4U23A 1ZMGA 3FXBA 3U92A 3ONMA 3LBSA 2VGQA 4MFIA 3H3GA 2O84X 1Z7NE 2ANJA 1MQJA 3KFMA 2I6EA 1US5A 4G68B 1JW4A 2OWTA 5DW8A 4DE8A 4BDNA 3G3JA 1Q1KA 1KWHA 5AA4A 3GBBA 1PBQA 3MVZA 4R9GA 5DVJA 1SDXA 5AA2B 3ODBA 3KJTA 3HPIA 2GFEA 3DP4A 2MKZA 4XF5A 3MZBA 2AIXA 2VHAA 2PFYA 4U21A 5I59A 3KBZA 1NUXA 3SEXA 4DXBA 3U94A 2HEUA 4G8HA 2GQ1A 1MXYA 1FQAA 1B40A 5ELVA 5JTYB 2HCAA 5DYHA 4P47A 3S9EA 1NV5A 3S9LC 5H8SA 1DPPA 4ZEFA 4NAPA 4GL0A 4XKPA 3SDFA 2OBGA 1MPDA 1QUIA 3K6UA 3HFUA 4YB6A 3O66A 4PDDA 3HV1A 2X26A 4H0WA 5L8DA 5BWJA 2ZNSA 2ONKE 2UVGA 3MBPA 1USYE 4TLMB 5J16A 1N3XA 3VVFA 2DWJA 2F3DA 3O6HA 4ISUA 2DDKA 3TYHA 1MQIA 1A55A 2V93A 1NV1A 1B3HA 2QVVA 3RPLA 4OYVA 4OHNA 4BDQA 2RF1A 2VD3A 3MZ9A 1UTBB 5CRYA 4EF2A 1LCFA 2DS9A 1NV4A 3E9XA 3RPWA 3SESA 3BFTA 1J1NA 2UVIA 3UGWA 4F18A 5FTIA 1EZPA 1H43A 4PFUA 3TQWA 1FQDA 5H8FB 1JW5A 5H8QA 3W9WA 3HN0A 1MPBA 1DBZA 1FTLA 5CBSA 1NNFA 3TKDA 3GBAA 5A5XB 4O7IA 1QJMA 3PD8A 4WKMA 1A99A 4H5FA 4OVTA 2E1SA 4NF5A 2XX9A 1B46A 1P1QA 3MQ9A 1II5A 4XIGQ 1NKXA 2QPQA 5H8NA 4G4PA 1OQHA 4R6YA 1ZIUA 1LSTA 4ZEBA 1FTJA 3MZ1A 3TMGA 3FV1A 1FBPA 2CMOA 3C9HA 3R7XA 4Q8RA 3K1NA 5BUUA 1I6AA 5I56B 4JWOA 1OQGA 1LBZA 3FVGA 3S4UA 1INPA 3A3UA 5I2KA 2THIA 3CIJA 3CSBA 3GLBA 3OD7A 2O6AA 1PB9A 1M5DA 2O1LA 3CR9A 5ET5A 4NF6B 3LC8A 2I4CA 2F7CA 2Q8JA 5HM4B 2FVZA 3CFZA 1DCUA 2CZIA 5CI5A 3C4MA 2Q2AA 3QUFA 2H4IA 3CVGA 3K6VA 4HE1A 1ZLQA 3IOUA 2JJKA 3G7WA 2F78A 1MDP1 2QSXA 5ICTA 4AS5A 4IO3A 4N91A 1NH8A 3SERA 1OIBA 1LBWA 3OEMA 3ECRA 3H7MA 5A5LA 1FW0A 2DWAA 1EZ9A 1O63A 3JYRA 1DK4A 2IEEA 3UK4A 3IO4A 4YMAA 4OEUA 3SKPA 1AH5A 2I0CA 4EXLA 4JSDA 2VP1A 4X04A 5I58B 1DTZA 4GXSB 1LCTA 4OVRA 4WXJA 4LP2B 2UVHA 2UYFA 1B3FA 1FPEA 4N13A 3ILTB 2PMSA 1BP5A 3V89B 4NQ8A 4YMBA 5CMMA 3H06B 2O7IA 3LV0A 4ELQA 1ATGA 3IJOB 4PCDA 4MX6A 4RJZA 1FJ6A 4IO4A 4QFKA 4JBZA 1N76A 2FIXA 5KCJA 1T0KA 3KGCA 2XXPA 2CEYA 3FVOA 2F34A 5L9SA 4PBHA 2CZLA 1FJ9A 1B7HA 1M5FA 4KI0E 2OCUA 3FV2A 3VLVA 1KZ8A 4RK9A 2F6GA 1YCJA 1FPBA 1NNKA 3Q27A 4KPTA 3LUZA 4KFQA 5IGAA 2HHMA 3HSTA 4H45A 3O9PA 4Q0CA 3TTLA 4NF4A 3LR1A 4F1YA 1FBHA 2BJIA 3RN8A 3T22A 4IO5A 3H6TA 4EDPA 2DVZA 2R71A 4PFBA 1SBPA 4XKQA 1B51A 4PDHA 1Z7ME 1JQFA 3E3KA 3FJGA 1LBXA 3TODA 2Z8EA 1R6ZA 2XWOA 2XXXA 4GRKA 5I57A 3H4ZA 3EF7A 2XXWA 2LAOA 4THIA 4OERA 3DP6A 1S7YA 1AL3A 2Y7KA 4TOZA 3K1PA 3PV0E 2XWVA 3IOWA 2HXRA 1B52A 1JEVA 3TAJA 5FHMA 3IOTA 1FTOA 1ZTYA 1FQBA 3RY3A 2O1MA 3N94A 1AMFA 4GWOA 4DLDA 1LAHE 1Y3PA 4OQOA 1XHYA 4U1OA 3Q28A 2DE4A 2PX1A 4NWDA 1ZJLA 4OA4A 2QL3A 1XVXA 4YKKA 4RPNA 3H03A 3O29A 4DDDA 1WDNA 3OO8A 4XKNA 5H8HA 4C1UA 1P1NA 5ET8A 1SQYA 2XHDA 4JSOA 3H6VA 2HAVA 3N5LA 1O7TA 1ZU0A 2HXWA 2H9BA 3OO7A 4PC9A 4F3BA 4HS7A 4KYDA 4ELPA 2RINA 4R2FA 1MH4A 3G3GA 1MRPA 5ICQA 4RA1A 3IAZA 1WVJA 3BBRA 3SZPA 5IZ3B 5IZ1A 2A5TB 1NV2A 3T9VA 1D4NA 3MPLA 3FXQA 3K2DA 4LZ5A 3UP9A 4KD5A 3O97A 1MH3A 2OJTA 1YTVA 4LQ2A 3QYTA 5DEXB 1PEBA 1UIVA 4N81A 4P9KA 2ZYMA 3RUMA 4GIZA 2H25A 3PUZE 2DOJA 2NVUB 4ESXA 2B3BA 5L9MA 1MM6A 1B3LA 1UQWA 3MJNA 4RY1A 2XX8A 1M5CA 1IXHA 1P1UA 5CMKA 2QJEA 4MHFA 2AYSA 2RC7A 2AL4A 5DVFA 2Z8DA 1UTHA 3AXFA 2FHYA 4P3LA 3S2VA 1MQDA 3OELA 3KN8A 3B6WA 4RPOA 4NE4A 2GHBA 1BK4A 4GWUA 3PUWE 3I6VA 4U4XA 3TZAA 5AA4B 3PU5A 2ZYOA 4H1XA 3KEIA 2XXKA 3FD3A 2M8CA 1OVTA 2I3WA 4L17A 3MVYA 1MXXA 1QUJA 2ALUA 4F31B 4KCDA 3C34A 3OSQA 4DI4B 4G8MA 1FPIA 1D9VA 3ISPA 1FSAA 4P1EA 1JP4A 4Z0IA 4PTKA 1VFEA 1ZBMA 3C36A 4P0IA 1YXIA 4G68C 3CI8A 3S9NC 4NN3A 2HZLA 2REGA 2XXQA 1F9BA 4JXIA 4R6KA 3OMBA 4Q5TA 1NV6A 3V5AA 3TDJA 5F1QA 3S9MC 3RLFE 2Q89A 1QW0A 4X8RA 2E0SA 5F24A 5HPQA 1QVSA 4OMBA 3MP6A 3BIGA 4NEDA 1MXZA 2DWHA 1B32A 1GTKA 1IMDA 2PCRA 1PB7A 1FCKA 4QBAA 2F8DA 1DSNA 3IJXB 1Y20A 4P0GA 1IITA 3OEKA 1QUKA 3EHSA 2I48A 1IQ7A 3H6UA 4N15A 2RKMA 4DI3D 4OVPA 3CFLA 5CM6A 2Q88A 1B5JA 2A5SA 1RDYA 3TTMA 2ZNUA 4PE3A 3D4GA 1FTMA 1H3DA 1WODA 1TFAA 1K9YA 4YB5A 2PT2A 4GWXA 1JW1A 4PFYA 2F36A 4ZDMA 3KOTA 2O7UA 4HXVA 4H6DA 4O8MA 4F19A 1NV0A 4PBQA 3T9HB 1MG1A 4HCWA 2DP8A 4GL8A 2ONRA 2P1SA 2QS4A 2Y84A 1RYOA 2D3IA 1XOCA 5CMBA 4DZ1A 4KYEA 1N7WA 1MPCA 3MC2A 4YKIA 3L6HA 1LGBC 2ZZXA 1XT8A 2ZYNA 4AB5A 5L9OA 2ZYKA 1PDAA 1A54A 3G3IA 4NF5B 3T66A 4GWSA 4I40A 3B8BA 3QMFA 3KC1A 4MMPA 1EYKA 3M3FA 3EQ1A 1Y9UA 4GOTA 1NNTA 5H8NB 3GYYA 2GHAA 3MWBA 1MXVA 5EHMA 4GD5A 2F7BA 3IK6B 3LSWA 4PQJA 3TQLA 1Q9DA 4TQUQ 3HHGA 2R6GE 4MNPA 3FASA 3HO7A 4LUBA 1FQCA 4IB2A 2Q9TA 1URSA 4F2OA 4GX3A 1D3KA 4GX6A 1B1XA 3JZJA 1B58A 3M3KA 3T9UA 3UN6A 3UA8A 1MY0A 5I2KB 3M3LA 3PGFA 3A29A 2YPNA 2F97A 2V25A 1DOTA 2CZKA 4R72A 1OVBA 1RKMA 2WEFA 4QFLA 2DSFA 4BDRA 2DQVA 4NF8A 1FBEA 3TUSA 2QS2A 3K1MA 1MXUA 1SVXB 4PGNA 3LSFB 2WYKA 4RYAA 5I5PA 4Z7EA 3O28A 3FJ7A 2HZKA 3VE1B 1NL5A 2B3FA 1PC3A 1OMPA 2Q2CA 1LFGA 4F2QA 2GRVA 3IO6A 4JVIA 1IXGA 1QKAA 4UABA 1MY3A 5LTCA 2VPNA 3CHGA 2XXUA 4DXCA 1IMFA 3VVDA 3K0VA 4FATA 2PVUA 1N04A 4XXUA 2ESNA 2OWSA 4N07A 2CZHA 4AQ4A 2NOOA 3N6TA 1IMBA 3C31A 1IXCA 4YKPA 1LBBA 1LFIA 4FE8A 4ND9A 3PUVE 1FBFA 4LN5A 3W9VA 4PAKA 4DCXA 3JV9A 4R75A 3PMVA 1S50A 3THIA 4M4GA 2YLNA 5FHNA 4BLAA 1FQEA 4FBPA 4ZE9A 2YJPA 1TFDA 1N7XA 3WAFA 3OXNA 1US4A 4NGUA 3SEYA 4LVQA 4JWXA 4KCCA 4OENA 1FPFA 1M5EA 2NUVA 5KCJB 4KYSA 4OXVA 2ZNTA 1FPKA 4N6KA 4H8IA 4QFOA 1JEUA 2QVUA 3VXCA 4LATA 1VSOA 3FBPA 4I1DA 4TLLB 1JNFA 1B2HA 4PETA 3IB2A 5LOMA 3O6GA 4QSDA 5KZTA 2XXHA 3A09A 4H46A 1Y4CA 4ZEKA 4PGPA 2Q74A 4NF4B 4POWA 4U2RA 2FNCA 1CB6A 4GFRA 3TCFA 2F7AA 4EF1A 3B6TA 4GVOA 1MDQA 4X9TA 1ANFA 2WBDA 4OWDA 3KSXA 1POTA 3OO6A 1MY4A 1LLSA 3G3KA 3KN3A 5I57B 4R74A 2XXIA 1OLCA 2B65A 4RK2A 4NHBA 1P1WA 5I2NA 1DTGA 4IO6A 1OLAA 4JVCA 4XFEA 1A8EA 2H5YA 1ELJA 1Y3NA 2DXRA 3VLWA 2V3UA 3MAMA 2L5VA 2R8TA 5FHOA 2DWIA 3VV5A 5AA3A 3IFCA 4WEDA 4R9FA 3R6UA 2PT1A 4O3AA 1B1HA 2Z23A 1B9JA 1IEJA 1B3GA 3RT8A 4QFPA 5H8HB 2R9JA 4E0WA 1HSLA 4N6PA 1BLFA 4OVQA 4RXLA 4LQ5A 3RNNA 3QIMA 1LFHA 4NTLA 3LSLA 4H8JA 3FJMA 2RCBA 2QMXA 3MP1A 4YKJA 2OX3A 4P8BA 4P1LA 1NMUA 5CC2A 3I5OA 4F1UA 4IGRA 1YZ0A 5TPAA 1SW1A 4H65A 4QHQA 3KC0A 1MS7A 2PBWA 2O51A 2QVRA 4F39A 4MEVA 4POXA 3CG1A 5KDTA 4P11A 2V3TA 3GXAA 2UVJA 1EZOA 2V4CA 3EHUA 5TP9A 1SI1A 4GXAA 4N4UA 4ZEIA 1P99A 4PF6A 1Q35A 3OSRA 1URGA 4QFNA 5ITOA 3Q25A 4MJOA 1EH3A 4N8YA 5K2YA 2FA7A 3RGYA 4F1VA 1NFTA 4O3CA 2ONSA 5ITPA 4PE5B 1H76A 1N0TA 3IB1A 3T9XB 2PFZA 1R9QA 3U72A 2Y7RA 4YAHX 3ZS6A 3RQTA 3Q29A 1B7UA 3T0JA 4F3PA 1GGGA 3ROJA 4KQPA 3A3CA 4C0RA 3V83A 3PMXA 3OO9A 2G29A 2D21A 2P2AA 5I84A 1ZKBA 4N8GA 4MAGA 2Y7IA 4ESWA 5I7IA 1FPDA 1LB8A 2F3BA 2XXRA 1IMAA 3PMWA 3G3HA 4PAIA 4BDOA 4FJPA 1Y1MA 4ZE8A 2WKYA 1TXFA 3IX1A 3EN3A 3PUYE 3TELA 4DIGA 2XD2A 4LZ8A 4JDFA 1MXWA 4OVSA 4ZS9A 4YB7A 4NX1A 2Z22A 4N17A 3K01A 4NWCA 2RC9A 3P7IA 4KXPA 3RTFB 5CMCA 1N84A 3FATA 4Q30B 5FTHA 4FIMA 2QS1A 2IA4A 1R9LA 2XXYA 5JEIA 4OFOA 4PP0A 3BFUA 5I59B 2ZXTA 3EHTA 4N6DA 1XVYA 3PPPA 4R6HA 3DP8A 3T96B 1AIVA 1POY1 3E13X 4GQOA 1FBCA 1PB8A 3KOSA 4IGTA 1SW4A 1B4HA 1LB9A 4FAJA 3U1OA 4HCYA 3CRBA 4ZZEA 4LONB 5K2XA 2ABHA 3UIFA 1URDA 1A40A 4U4SA 3NOHA 5EYGA 4MLVA 3C33A 4NMYA 4QRZA 3PUXE 5CBRA 3FVNA 4NG7A 4YU0A 4G68A 2O69A 4G2ZA 2OWZA 4H67A 4PFIA 1TT1A 4EQ7A 1SYHA 1RDXA 2XA5A 3DM0A 2XWKA 5F7VA 1SW2A 2NXOA 4U22A 5DVIA 2HPGA 2QFLA 5B70A 1QKBA 1Y4TA 2KLFA 3ILUB 4UA8A 3K4UA 3C32A 5AA2A 2B4LA 1AWBA 2F35A 2Q8MA 3RPLB 1YYZA 3KSJA 2OLBA 3T93B 4PAFA 1XS5A 1PBPA 4GBVA 3BKIB 4HE2A 1IXIA 2AL5A 1A8FA 2DYXA 3USDA 1O64A 1GVCA 4U1ZA 4OZ9A 3TTNA 1NH7A 4HE0A 5TU0A 3MSTA 1B5IA 4IO2A 1D9YA 3ZKKA 5H8QB 3PPOA 3K02A 3BIHA 1B05A 4FORA 4IO7A 1MY1A 5JTYA 4LZ7A 2WYPA 2P0SA 3TCGA 1B5HA 5EQAA 1D9QA 3E4RA 4GF8A 1SYIA 5DT6A 1MQGA 2REJA 3PPRA 4LA9A 4BDLA 4GWYA 4X1DA 3I3VA 1DPEA 1LBVA 3PPQA 3FIRA 5EQ8A 1L5TA 1B0LA 3K6WA 3N6UA 4PFRA 4EUOA 3LUYA 1FTAA 3UORA 1B7ZA 2V84A 5AE4A 4PFTA 3MUQA 4R73A 2XXTA 2DVCA 4NF8B 4AB6A 4QF9A 1SD3A 4F3SA 4F29A 2KR0A 2XWIA 5IKBA 2F5XA 1BTJA 1LBCA 1LAGE 4X48A 3DELB 1UTBA 3OENA 1TWYA 3D1RA 1Y1ZA 3Q26A 3DLNA 4O3BA 3KZGA 1HSJA 2P3VA 3EKIA 2H99A 1UIUA 4GWWA 3QUJA 1VE4A 5H8FA 3SEWA 1B6HA 1MM7A 1LEVA 2FYIA 3FXUA 3KBRA 1K9ZA 1H45A 4QXDA 4FEBA 5A5XA 1AOVA 2UYEA 4O7MA 3FZVA 4MNCA 5M2VA 4OFJA 4X1BA 3FUZA 3ZSFA 1EU8A 5B7DA 1NI9A 4MBPA 1JVXA 3HHFA 1QGXA 2HAUA 4G8NA 4XEQA 3E79A 3V8XB 4JVDA 2ZMBA 1LBYA 4MIJA 3CFXA 3O6IA 2QRYA 3PD9A 4OETA 2HFBA 4K3FA 5I56A 5LDZA 2XX7A 2Y7WA 3FGSA 1NUWA 4OVJA 4EQ9A 4GWZA 3TTKA 1FPJA 2ZZVA 5IM2A 2G93A 1G0HA 4E0XA 4G61A 1RDZA 2H98A 1FRPA 1NV3A 2HQ0A 3IB0A 4NF6A 4MLQA 4R2BA 3SEVA 4I3EA 1BKAA 3TPAA 1NUZA 3TEPA 3D4CA 3QXMA 3U93A 4OEVA 4XKRA 2GH9A 3E78A 2OZZA 3C35A 4OESA 3RYDA 1QULA 4I8CA 2WBBA 2P3NA 4MCOA 4QSCA 4YZZA 5ET6A 1GR2A 3B7DA 5AA2D 5IAIA 1MQHA 1YPNA 4ZZAA 2Y5KA 2Z8FA 3VDFA 3T1BA 3ZKLA 4GBWA 1XC1A 1P1OA 1YAEA 1B0HA 1CE2A 2W7YA 2I3VA 4RNSA 1B4ZA 1H44A 4P56A 2VT5A 3N26A 3GZGA 4F22A 4IR8A 2Y7PA 3OOAA 4KR5A 5I2NB 3K00A 3IR1A 1CNQA 4PF8A 4H5GA 2DXYA 5I58A 3RT6B 1M5BA 3U8QA 1FBDA 4EQBA 3PPNA
chains in the Genus database with same CATH topology
2RC8A 3IL1B 4HW8A 5J1DA 3MPKA 3TCHA 3VVEA 1MY2A 4KHZE 3TFLA 1IUDA 1S9TA 2I4BA 2XXVA 4PFWA 3RTWB 3VLUA 3K6XA 3KJ7A 3G3FA 4XTCQ 3TTRA 2I49A 4QSEA 2RCAA 3H6WA 4IY5A 1IIWA 1RYXA 4OTEA 4I62A 5TPAB 5EYFA 4JB7A 2QMWA 2BJJX 2NWJA 4G77A 2QS3A 5KDTB 4IY6A 3WAEA 3B6QA 1LAFE 3VXBA 1USYH 3QAXA 1I69A 1R1NA 2O68A 5TP9B 3FXRA 1SW5A 3R26A 5DTBA 4F3GA 3MVWA 4ONYA 2DE2A 3KG2A 4FECA 1VFDA 3IOVA 4WEPA 1DMBA 4EXKA 3HCQA 2OK2A 4DCYA 3IORA 1GV8A 5HBCA 2D5WA 4FEDA 3EPEA 2PYYA 4UACA 4I9DA 4ELRA 5ISUA 3W15C 2VD2A 1JVYA 4BDMA 1JETA 2V3QA 3LSXA 4OFLA 3SETA 1BIYA 1NNPA 3O2AA 1LAXA 3L6GA 5EHSA 1UTHB 1Y3QA 3QK6A 3MW0A 3M8UA 2I0BA 1VR5A 2XD3A 5JK4A 1I6BA 1I6QA 2X7QA 3CG3A 4C1TA 2UXAA 1SI0A 3KN7A 1HSEA 4HTGA 2I58A 4MH5A 4ZECA 3QSLA 2A5TA 3VFJA 3FVKA 3MVXA 4ELOA 3MP8A 2VOZA 1IZ1A 4MF3A 3CSGA 2X7PA 1FTKA 4ECFA 3SEUA 5AA1A 4M1VA 2DE3A 5DEXA 1FQFA 4DXUA 4JWYA 4YICA 2F6PA 1B3EA 4ZEDA 1A7LA 1N3WA 4GLIA 3F11A 4U23A 1ZMGA 3U92A 3ONMA 3LBSA 2VGQA 4MFIA 3H3GA 2O84X 1Z7NE 2ANJA 1MQJA 3KFMA 2I6EA 1US5A 4G68B 1JW4A 2OWTA 4DE8A 4BDNA 3G3JA 1Q1KA 1KWHA 5AA4A 3GBBA 1PBQA 3MVZA 4R9GA 5DVJA 1SDXA 5AA2B 3ODBA 3KJTA 3HPIA 2GFEA 3DP4A 3MZBA 2AIXA 2VHAA 4U21A 5I59A 3SEXA 4DXBA 3U94A 2HEUA 4G8HA 1MXYA 1FQAA 1B40A 5ELVA 5JTYB 2HCAA 5DYHA 3S9EA 3S9LC 5H8SA 1DPPA 4ZEFA 4GL0A 4XKPA 3SDFA 2OBGA 1MPDA 1QUIA 3K6UA 4YB6A 3O66A 3HV1A 2X26A 4H0WA 5L8DA 5BWJA 2ZNSA 2ONKE 2UVGA 3MBPA 1USYE 4TLMB 1N3XA 3VVFA 2DWJA 3O6HA 3TYHA 4ISUA 1MQIA 1A55A 2V93A 1B3HA 4OYVA 4OHNA 4BDQA 2RF1A 2VD3A 3MZ9A 1UTBB 5CRYA 4EF2A 1LCFA 2DS9A 3E9XA 3RPWA 3SESA 3BFTA 1J1NA 2UVIA 3UGWA 4F18A 5FTIA 1EZPA 1H43A 4PFUA 3TQWA 1FQDA 5H8FB 1JW5A 5H8QA 3W9WA 3HN0A 1MPBA 1FTLA 5CBSA 1NNFA 3TKDA 3GBAA 5A5XB 1QJMA 3PD8A 4WKMA 1A99A 4H5FA 2E1SA 4NF5A 2XX9A 1B46A 1P1QA 3MQ9A 1II5A 4XIGQ 1NKXA 2QPQA 5H8NA 4G4PA 1OQHA 4R6YA 1ZIUA 1LSTA 4ZEBA 1FTJA 3MZ1A 3TMGA 3FV1A 2CMOA 3C9HA 3R7XA 4Q8RA 3K1NA 5BUUA 1I6AA 5I56B 4JWOA 1OQGA 3FVGA 3S4UA 3A3UA 5I2KA 2THIA 3CIJA 3CSBA 3GLBA 3OD7A 2O6AA 1PB9A 1M5DA 2O1LA 3CR9A 4NF6B 3LC8A 2I4CA 2F7CA 2Q8JA 5HM4B 3CFZA 5CI5A 3C4MA 2Q2AA 3QUFA 2H4IA 3CVGA 3K6VA 1ZLQA 3IOUA 3G7WA 2F78A 1MDP1 2QSXA 5ICTA 4IO3A 1NH8A 3SERA 1OIBA 3OEMA 3ECRA 3H7MA 1FW0A 2DWAA 1EZ9A 1O63A 3JYRA 2IEEA 3UK4A 3IO4A 4YMAA 4OEUA 3SKPA 1AH5A 2I0CA 4EXLA 4JSDA 2VP1A 5I58B 1DTZA 4GXSB 1LCTA 4WXJA 4LP2B 2UVHA 2UYFA 1B3FA 4N13A 3ILTB 2PMSA 1BP5A 3V89B 4YMBA 5CMMA 3H06B 2O7IA 4ELQA 1ATGA 3IJOB 4RJZA 4IO4A 4QFKA 4JBZA 1N76A 5KCJA 1T0KA 3KGCA 2XXPA 3FVOA 2F34A 5L9SA 2CZLA 1B7HA 1M5FA 4KI0E 2OCUA 3FV2A 3VLVA 4RK9A 2F6GA 1YCJA 1NNKA 3Q27A 4KPTA 4KFQA 3HSTA 3O9PA 4Q0CA 3TTLA 4NF4A 3LR1A 4F1YA 3RN8A 3T22A 4IO5A 3H6TA 4EDPA 2DVZA 2R71A 1SBPA 4XKQA 1B51A 1Z7ME 1JQFA 3E3KA 3FJGA 3TODA 2Z8EA 1R6ZA 2XXXA 4GRKA 5I57A 3H4ZA 3EF7A 2XXWA 2LAOA 4THIA 4OERA 3DP6A 1AL3A 1S7YA 2Y7KA 4TOZA 3K1PA 3PV0E 3IOWA 1B52A 1JEVA 3TAJA 5FHMA 3IOTA 1FTOA 1ZTYA 1FQBA 3RY3A 2O1MA 3N94A 1AMFA 4GWOA 4DLDA 1LAHE 1Y3PA 4OQOA 1XHYA 4U1OA 3Q28A 2DE4A 2PX1A 4NWDA 1ZJLA 2QL3A 1XVXA 4YKKA 4RPNA 3H03A 3O29A 4DDDA 1WDNA 3OO8A 4XKNA 5H8HA 4C1UA 1P1NA 1SQYA 2XHDA 4JSOA 3H6VA 2HAVA 3N5LA 1O7TA 1ZU0A 2HXWA 2H9BA 3OO7A 4F3BA 4HS7A 4KYDA 4ELPA 2RINA 4R2FA 1MH4A 3G3GA 1MRPA 5ICQA 4RA1A 3IAZA 1WVJA 3BBRA 2A5TB 3T9VA 1D4NA 3MPLA 3FXQA 3K2DA 4LZ5A 3UP9A 4KD5A 3O97A 1MH3A 2OJTA 1YTVA 4LQ2A 3QYTA 5DEXB 1PEBA 1UIVA 2ZYMA 3RUMA 4GIZA 2H25A 3PUZE 2DOJA 2NVUB 4ESXA 2B3BA 5L9MA 1MM6A 1B3LA 1UQWA 3MJNA 4RY1A 2XX8A 1M5CA 1IXHA 1P1UA 5CMKA 2QJEA 2AYSA 2RC7A 2AL4A 5DVFA 2Z8DA 1UTHA 3AXFA 3S2VA 1MQDA 3OELA 3KN8A 3B6WA 4RPOA 4NE4A 2GHBA 3PUWE 3I6VA 4U4XA 3TZAA 5AA4B 3PU5A 2ZYOA 4H1XA 3KEIA 3FD3A 2M8CA 1OVTA 2I3WA 4L17A 3MVYA 1MXXA 1QUJA 2ALUA 4F31B 4KCDA 3C34A 3OSQA 4G8MA 1D9VA 4Z0IA 1VFEA 1ZBMA 3C36A 4P0IA 4G68C 3CI8A 3S9NC 2HZLA 2REGA 2XXQA 1F9BA 4JXIA 4R6KA 3OMBA 4Q5TA 3V5AA 3TDJA 5F1QA 3S9MC 3RLFE 2Q89A 1QW0A 2E0SA 5HPQA 1QVSA 4OMBA 3MP6A 4NEDA 1MXZA 2DWHA 1B32A 1GTKA 1PB7A 1FCKA 2F8DA 1DSNA 3IJXB 1Y20A 4P0GA 1IITA 3OEKA 1QUKA 3EHSA 2I48A 1IQ7A 3H6UA 2RKMA 3CFLA 5CM6A 2Q88A 1B5JA 2A5SA 3TTMA 2ZNUA 3D4GA 1FTMA 1H3DA 1WODA 1TFAA 4YB5A 2PT2A 1JW1A 4PFYA 2F36A 4ZDMA 3KOTA 2O7UA 4H6DA 4F19A 3T9HB 1MG1A 4HCWA 2DP8A 4GL8A 2ONRA 2P1SA 2QS4A 2Y84A 1RYOA 2D3IA 1XOCA 5CMBA 4DZ1A 4KYEA 1N7WA 1MPCA 3MC2A 4YKIA 3L6HA 1LGBC 1XT8A 2ZYNA 4AB5A 5L9OA 2ZYKA 1PDAA 1A54A 3G3IA 4NF5B 3T66A 3M3FA 3EQ1A 1Y9UA 4GOTA 1NNTA 5H8NB 2GHAA 3MWBA 1MXVA 5EHMA 4GD5A 2F7BA 3IK6B 3LSWA 4PQJA 3TQLA 4TQUQ 3HHGA 2R6GE 3FASA 3HO7A 4LUBA 1FQCA 4IB2A 2Q9TA 1URSA 4F2OA 1D3KA 1B1XA 3JZJA 1B58A 3M3KA 3T9UA 3UN6A 3UA8A 1MY0A 5I2KB 3M3LA 3PGFA 2YPNA 2F97A 2V25A 1DOTA 4R72A 1OVBA 1RKMA 4QFLA 2DSFA 4BDRA 2DQVA 4NF8A 3TUSA 2QS2A 3K1MA 1MXUA 1SVXB 3LSFB 4RYAA 4Z7EA 3O28A 3FJ7A 2HZKA 3VE1B 1NL5A 2B3FA 1PC3A 1OMPA 2Q2CA 1LFGA 4F2QA 2GRVA 3IO6A 1IXGA 1QKAA 1MY3A 2XXUA 4DXCA 3VVDA 3K0VA 4FATA 2PVUA 1N04A 4XXUA 2ESNA 2OWSA 4N07A 4AQ4A 2NOOA 3N6TA 3C31A 1IXCA 4YKPA 1LBBA 1LFIA 4FE8A 4ND9A 3PUVE 3W9VA 4DCXA 3JV9A 4R75A 3PMVA 1S50A 3THIA 4M4GA 2YLNA 5FHNA 4BLAA 1FQEA 4ZE9A 2YJPA 1TFDA 1N7XA 3WAFA 3OXNA 1US4A 3SEYA 4LVQA 4JWXA 4KCCA 4OENA 1M5EA 2NUVA 5KCJB 4KYSA 4OXVA 2ZNTA 4H8IA 4QFOA 1JEUA 3VXCA 4LATA 1VSOA 4I1DA 4TLLB 1JNFA 1B2HA 4PETA 3IB2A 5LOMA 3O6GA 4QSDA 5KZTA 2XXHA 3A09A 1Y4CA 4ZEKA 4NF4B 4POWA 4U2RA 2FNCA 1CB6A 4GFRA 3TCFA 2F7AA 4EF1A 3B6TA 4GVOA 1MDQA 4X9TA 1ANFA 4OWDA 3KSXA 1POTA 3OO6A 1MY4A 1LLSA 3G3KA 3KN3A 5I57B 4R74A 2XXIA 1OLCA 2B65A 4RK2A 1P1WA 5I2NA 1DTGA 4IO6A 1OLAA 1A8EA 2H5YA 1ELJA 1Y3NA 2DXRA 3VLWA 2V3UA 3MAMA 5FHOA 2DWIA 3VV5A 5AA3A 4WEDA 4R9FA 3R6UA 2PT1A 4O3AA 1B1HA 2Z23A 1B9JA 1IEJA 1B3GA 3RT8A 4QFPA 5H8HB 2R9JA 4E0WA 1HSLA 4N6PA 1BLFA 4RXLA 4LQ5A 3RNNA 3QIMA 1LFHA 4NTLA 3LSLA 4H8JA 3FJMA 2RCBA 2QMXA 3MP1A 4YKJA 1NMUA 5CC2A 3I5OA 4F1UA 4IGRA 5TPAA 1SW1A 4H65A 4QHQA 1MS7A 2PBWA 2O51A 4F39A 4POXA 3CG1A 5KDTA 4P11A 2V3TA 3GXAA 2UVJA 1EZOA 3EHUA 5TP9A 1SI1A 4GXAA 4ZEIA 1P99A 1Q35A 3OSRA 1URGA 4QFNA 5ITOA 3Q25A 1EH3A 5K2YA 2FA7A 3RGYA 4F1VA 1NFTA 4O3CA 2ONSA 5ITPA 4PE5B 1H76A 1N0TA 3IB1A 3T9XB 1R9QA 3U72A 2Y7RA 4YAHX 3ZS6A 3RQTA 3Q29A 1B7UA 4F3PA 1GGGA 4KQPA 3A3CA 4C0RA 3V83A 3PMXA 3OO9A 2G29A 2D21A 2P2AA 5I84A 1ZKBA 2Y7IA 4ESWA 1LB8A 2XXRA 3PMWA 3G3HA 4BDOA 4FJPA 1Y1MA 4ZE8A 2WKYA 1TXFA 3IX1A 3EN3A 3PUYE 3TELA 4DIGA 2XD2A 4LZ8A 4JDFA 1MXWA 4ZS9A 4YB7A 2Z22A 3K01A 4NWCA 2RC9A 3P7IA 3RTFB 5CMCA 1N84A 3FATA 4Q30B 5FTHA 4FIMA 2QS1A 2IA4A 1R9LA 2XXYA 5JEIA 4OFOA 4PP0A 3BFUA 5I59B 2ZXTA 3EHTA 1XVYA 3PPPA 4R6HA 3DP8A 3T96B 1AIVA 1POY1 3E13X 4GQOA 1PB8A 3KOSA 4IGTA 1SW4A 1B4HA 1LB9A 4FAJA 3U1OA 4HCYA 3CRBA 4ZZEA 4LONB 5K2XA 2ABHA 3UIFA 1URDA 1A40A 4U4SA 4MLVA 3C33A 4NMYA 4QRZA 3PUXE 5CBRA 3FVNA 4YU0A 4G68A 2O69A 4G2ZA 4H67A 4EQ7A 1TT1A 1SYHA 3DM0A 5F7VA 1SW2A 2NXOA 4U22A 5DVIA 5B70A 1QKBA 1Y4TA 2KLFA 3ILUB 4UA8A 3K4UA 3C32A 5AA2A 2F35A 3KSJA 2OLBA 3T93B 1XS5A 1PBPA 3BKIB 1IXIA 2AL5A 1A8FA 2DYXA 3USDA 1O64A 1GVCA 4U1ZA 4OZ9A 3TTNA 1NH7A 5TU0A 1B5IA 4IO2A 1D9YA 3ZKKA 5H8QB 3PPOA 3K02A 1B05A 4FORA 4IO7A 1MY1A 5JTYA 4LZ7A 3TCGA 2P0SA 1B5HA 3E4RA 4GF8A 1SYIA 5DT6A 1MQGA 2REJA 3PPRA 4LA9A 4BDLA 4X1DA 3I3VA 1DPEA 3PPQA 3FIRA 1L5TA 1B0LA 3K6WA 3N6UA 4EUOA 3LUYA 3UORA 1B7ZA 2V84A 5AE4A 4PFTA 3MUQA 4R73A 2XXTA 2DVCA 4NF8B 4AB6A 4QF9A 1SD3A 4F3SA 4F29A 5IKBA 2F5XA 1BTJA 1LBCA 1LAGE 4X48A 3DELB 1UTBA 3OENA 1TWYA 1Y1ZA 3Q26A 3DLNA 4O3BA 3KZGA 1HSJA 2H99A 1UIUA 3QUJA 1VE4A 5H8FA 3SEWA 1B6HA 1MM7A 2FYIA 3FXUA 3KBRA 1H45A 4FEBA 5A5XA 1AOVA 2UYEA 3FZVA 5M2VA 4OFJA 4X1BA 3FUZA 3ZSFA 1EU8A 5B7DA 4MBPA 1JVXA 3HHFA 2HAUA 4G8NA 3V8XB 2ZMBA 3CFXA 3O6IA 2QRYA 3PD9A 4OETA 2HFBA 4K3FA 5I56A 2XX7A 2Y7WA 3FGSA 4OVJA 4EQ9A 3TTKA 2G93A 4E0XA 2H98A 2HQ0A 3IB0A 4NF6A 4MLQA 4R2BA 3SEVA 1BKAA 3TPAA 3TEPA 3D4CA 3U93A 3QXMA 4OEVA 4XKRA 2GH9A 2OZZA 3C35A 4OESA 1QULA 4I8CA 4QSCA 4YZZA 1GR2A 3B7DA 5AA2D 5IAIA 1MQHA 1YPNA 4ZZAA 2Z8FA 3VDFA 3ZKLA 1XC1A 1P1OA 1YAEA 1B0HA 1CE2A 2W7YA 2I3VA 4RNSA 1B4ZA 1H44A 3N26A 3GZGA 4F22A 2Y7PA 3OOAA 4KR5A 5I2NB 3K00A 3IR1A 4H5GA 2DXYA 5I58A 3RT6B 1M5BA 3U8QA 4EQBA 3PPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RC8 A;  3IL1 B;  4HW8 A;  5J1D A;  3MPK A;  3TCH A;  3VVE A;  1MY2 A;  4KHZ E;  3TFL A;  1IUD A;  1S9T A;  2I4B A;  2XXV A;  4PFW A;  3RTW B;  3VLU A;  3K6X A;  3KJ7 A;  3G3F A;  4XTC Q;  3TTR A;  2I49 A;  4QSE A;  2RCA A;  3H6W A;  4IY5 A;  1IIW A;  1RYX A;  4OTE A;  4I62 A;  5TPA B;  5EYF A;  4JB7 A;  2QMW A;  2BJJ X;  2NWJ A;  4G77 A;  2QS3 A;  5KDT B;  4IY6 A;  3WAE A;  3B6Q A;  1LAF E;  3VXB A;  1USY H;  3QAX A;  1I69 A;  1R1N A;  2O68 A;  5TP9 B;  3FXR A;  1SW5 A;  3R26 A;  5DTB A;  4F3G A;  3MVW A;  4ONY A;  2DE2 A;  3KG2 A;  4FEC A;  1VFD A;  3IOV A;  4WEP A;  1DMB A;  4EXK A;  3HCQ A;  2OK2 A;  4DCY A;  3IOR A;  1GV8 A;  5HBC A;  2D5W A;  4FED A;  3EPE A;  2PYY A;  4UAC A;  4I9D A;  4ELR A;  5ISU A;  3W15 C;  2VD2 A;  1JVY A;  4BDM A;  1JET A;  2V3Q A;  3LSX A;  4OFL A;  3SET A;  1BIY A;  1NNP A;  3O2A A;  1LAX A;  3L6G A;  5EHS A;  1UTH B;  1Y3Q A;  3QK6 A;  3MW0 A;  3M8U A;  2I0B A;  1VR5 A;  2XD3 A;  5JK4 A;  1I6B A;  1I6Q A;  2X7Q A;  3CG3 A;  4C1T A;  2UXA A;  1SI0 A;  3KN7 A;  1HSE A;  4HTG A;  2I58 A;  4MH5 A;  4ZEC A;  3QSL A;  2A5T A;  3VFJ A;  3FVK A;  3MVX A;  4ELO A;  3MP8 A;  2VOZ A;  1IZ1 A;  4MF3 A;  3CSG A;  2X7P A;  1FTK A;  4ECF A;  3SEU A;  5AA1 A;  4M1V A;  2DE3 A;  5DEX A;  1FQF A;  4DXU A;  4JWY A;  4YIC A;  2F6P A;  1B3E A;  4ZED A;  1A7L A;  1N3W A;  4GLI A;  3F11 A;  4U23 A;  1ZMG A;  3U92 A;  3ONM A;  3LBS A;  2VGQ A;  4MFI A;  3H3G A;  2O84 X;  1Z7N E;  2ANJ A;  1MQJ A;  3KFM A;  2I6E A;  1US5 A;  4G68 B;  1JW4 A;  2OWT A;  4DE8 A;  4BDN A;  3G3J A;  1Q1K A;  1KWH A;  5AA4 A;  3GBB A;  1PBQ A;  3MVZ A;  4R9G A;  5DVJ A;  1SDX A;  5AA2 B;  3ODB A;  3KJT A;  3HPI A;  2GFE A;  3DP4 A;  3MZB A;  2AIX A;  2VHA A;  4U21 A;  5I59 A;  3SEX A;  4DXB A;  3U94 A;  2HEU A;  4G8H A;  1MXY A;  1FQA A;  1B40 A;  5ELV A;  5JTY B;  2HCA A;  5DYH A;  3S9E A;  3S9L C;  5H8S A;  1DPP A;  4ZEF A;  4GL0 A;  4XKP A;  3SDF A;  2OBG A;  1MPD A;  1QUI A;  3K6U A;  4YB6 A;  3O66 A;  3HV1 A;  2X26 A;  4H0W A;  5L8D A;  5BWJ A;  2ZNS A;  2ONK E;  2UVG A;  3MBP A;  1USY E;  4TLM B;  1N3X A;  3VVF A;  2DWJ A;  3O6H A;  3TYH A;  4ISU A;  1MQI A;  1A55 A;  2V93 A;  1B3H A;  4OYV A;  4OHN A;  4BDQ A;  2RF1 A;  2VD3 A;  3MZ9 A;  1UTB B;  5CRY A;  4EF2 A;  1LCF A;  2DS9 A;  3E9X A;  3RPW A;  3SES A;  3BFT A;  1J1N A;  2UVI A;  3UGW A;  4F18 A;  5FTI A;  1EZP A;  1H43 A;  4PFU A;  3TQW A;  1FQD A;  5H8F B;  1JW5 A;  5H8Q A;  3W9W A;  3HN0 A;  1MPB A;  1FTL A;  5CBS A;  1NNF A;  3TKD A;  3GBA A;  5A5X B;  1QJM A;  3PD8 A;  4WKM A;  1A99 A;  4H5F A;  2E1S A;  4NF5 A;  2XX9 A;  1B46 A;  1P1Q A;  3MQ9 A;  1II5 A;  4XIG Q;  1NKX A;  2QPQ A;  5H8N A;  4G4P A;  1OQH A;  4R6Y A;  1ZIU A;  1LST A;  4ZEB A;  1FTJ A;  3MZ1 A;  3TMG A;  3FV1 A;  2CMO A;  3C9H A;  3R7X A;  4Q8R A;  3K1N A;  5BUU A;  1I6A A;  5I56 B;  4JWO A;  1OQG A;  3FVG A;  3S4U A;  3A3U A;  5I2K A;  2THI A;  3CIJ A;  3CSB A;  3GLB A;  3OD7 A;  2O6A A;  1PB9 A;  1M5D A;  2O1L A;  3CR9 A;  4NF6 B;  3LC8 A;  2I4C A;  2F7C A;  2Q8J A;  5HM4 B;  3CFZ A;  5CI5 A;  3C4M A;  2Q2A A;  3QUF A;  2H4I A;  3CVG A;  3K6V A;  1ZLQ A;  3IOU A;  3G7W A;  2F78 A;  1MDP 1;  2QSX A;  5ICT A;  4IO3 A;  1NH8 A;  3SER A;  1OIB A;  3OEM A;  3ECR A;  3H7M A;  1FW0 A;  2DWA A;  1EZ9 A;  1O63 A;  3JYR A;  2IEE A;  3UK4 A;  3IO4 A;  4YMA A;  4OEU A;  3SKP A;  1AH5 A;  2I0C A;  4EXL A;  4JSD A;  2VP1 A;  5I58 B;  1DTZ A;  4GXS B;  1LCT A;  4WXJ A;  4LP2 B;  2UVH A;  2UYF A;  1B3F A;  4N13 A;  3ILT B;  2PMS A;  1BP5 A;  3V89 B;  4YMB A;  5CMM A;  3H06 B;  2O7I A;  4ELQ A;  1ATG A;  3IJO B;  4RJZ A;  4IO4 A;  4QFK A;  4JBZ A;  1N76 A;  5KCJ A;  1T0K A;  3KGC A;  2XXP A;  3FVO A;  2F34 A;  5L9S A;  2CZL A;  1B7H A;  1M5F A;  4KI0 E;  2OCU A;  3FV2 A;  3VLV A;  4RK9 A;  2F6G A;  1YCJ A;  1NNK A;  3Q27 A;  4KPT A;  4KFQ A;  3HST A;  3O9P A;  4Q0C A;  3TTL A;  4NF4 A;  3LR1 A;  4F1Y A;  3RN8 A;  3T22 A;  4IO5 A;  3H6T A;  4EDP A;  2DVZ A;  2R71 A;  1SBP A;  4XKQ A;  1B51 A;  1Z7M E;  1JQF A;  3E3K A;  3FJG A;  3TOD A;  2Z8E A;  1R6Z A;  2XXX A;  4GRK A;  5I57 A;  3H4Z A;  3EF7 A;  2XXW A;  2LAO A;  4THI A;  4OER A;  3DP6 A;  1AL3 A;  1S7Y A;  2Y7K A;  4TOZ A;  3K1P A;  3PV0 E;  3IOW A;  1B52 A;  1JEV A;  3TAJ A;  5FHM A;  3IOT A;  1FTO A;  1ZTY A;  1FQB A;  3RY3 A;  2O1M A;  3N94 A;  1AMF A;  4GWO A;  4DLD A;  1LAH E;  1Y3P A;  4OQO A;  1XHY A;  4U1O A;  3Q28 A;  2DE4 A;  2PX1 A;  4NWD A;  1ZJL A;  2QL3 A;  1XVX A;  4YKK A;  4RPN A;  3H03 A;  3O29 A;  4DDD A;  1WDN A;  3OO8 A;  4XKN A;  5H8H A;  4C1U A;  1P1N A;  1SQY A;  2XHD A;  4JSO A;  3H6V A;  2HAV A;  3N5L A;  1O7T A;  1ZU0 A;  2HXW A;  2H9B A;  3OO7 A;  4F3B A;  4HS7 A;  4KYD A;  4ELP A;  2RIN A;  4R2F A;  1MH4 A;  3G3G A;  1MRP A;  5ICQ A;  4RA1 A;  3IAZ A;  1WVJ A;  3BBR A;  2A5T B;  3T9V A;  1D4N A;  3MPL A;  3FXQ A;  3K2D A;  4LZ5 A;  3UP9 A;  4KD5 A;  3O97 A;  1MH3 A;  2OJT A;  1YTV A;  4LQ2 A;  3QYT A;  5DEX B;  1PEB A;  1UIV A;  2ZYM A;  3RUM A;  4GIZ A;  2H25 A;  3PUZ E;  2DOJ A;  2NVU B;  4ESX A;  2B3B A;  5L9M A;  1MM6 A;  1B3L A;  1UQW A;  3MJN A;  4RY1 A;  2XX8 A;  1M5C A;  1IXH A;  1P1U A;  5CMK A;  2QJE A;  2AYS A;  2RC7 A;  2AL4 A;  5DVF A;  2Z8D A;  1UTH A;  3AXF A;  3S2V A;  1MQD A;  3OEL A;  3KN8 A;  3B6W A;  4RPO A;  4NE4 A;  2GHB A;  3PUW E;  3I6V A;  4U4X A;  3TZA A;  5AA4 B;  3PU5 A;  2ZYO A;  4H1X A;  3KEI A;  3FD3 A;  2M8C A;  1OVT A;  2I3W A;  4L17 A;  3MVY A;  1MXX A;  1QUJ A;  2ALU A;  4F31 B;  4KCD A;  3C34 A;  3OSQ A;  4G8M A;  1D9V A;  4Z0I A;  1VFE A;  1ZBM A;  3C36 A;  4P0I A;  4G68 C;  3CI8 A;  3S9N C;  2HZL A;  2REG A;  2XXQ A;  1F9B A;  4JXI A;  4R6K A;  3OMB A;  4Q5T A;  3V5A A;  3TDJ A;  5F1Q A;  3S9M C;  3RLF E;  2Q89 A;  1QW0 A;  2E0S A;  5HPQ A;  1QVS A;  4OMB A;  3MP6 A;  4NED A;  1MXZ A;  2DWH A;  1B32 A;  1GTK A;  1PB7 A;  1FCK A;  2F8D A;  1DSN A;  3IJX B;  1Y20 A;  4P0G A;  1IIT A;  3OEK A;  1QUK A;  3EHS A;  2I48 A;  1IQ7 A;  3H6U A;  2RKM A;  3CFL A;  5CM6 A;  2Q88 A;  1B5J A;  2A5S A;  3TTM A;  2ZNU A;  3D4G A;  1FTM A;  1H3D A;  1WOD A;  1TFA A;  4YB5 A;  2PT2 A;  1JW1 A;  4PFY A;  2F36 A;  4ZDM A;  3KOT A;  2O7U A;  4H6D A;  4F19 A;  3T9H B;  1MG1 A;  4HCW A;  2DP8 A;  4GL8 A;  2ONR A;  2P1S A;  2QS4 A;  2Y84 A;  1RYO A;  2D3I A;  1XOC A;  5CMB A;  4DZ1 A;  4KYE A;  1N7W A;  1MPC A;  3MC2 A;  4YKI A;  3L6H A;  1LGB C;  1XT8 A;  2ZYN A;  4AB5 A;  5L9O A;  2ZYK A;  1PDA A;  1A54 A;  3G3I A;  4NF5 B;  3T66 A;  3M3F A;  3EQ1 A;  1Y9U A;  4GOT A;  1NNT A;  5H8N B;  2GHA A;  3MWB A;  1MXV A;  5EHM A;  4GD5 A;  2F7B A;  3IK6 B;  3LSW A;  4PQJ A;  3TQL A;  4TQU Q;  3HHG A;  2R6G E;  3FAS A;  3HO7 A;  4LUB A;  1FQC A;  4IB2 A;  2Q9T A;  1URS A;  4F2O A;  1D3K A;  1B1X A;  3JZJ A;  1B58 A;  3M3K A;  3T9U A;  3UN6 A;  3UA8 A;  1MY0 A;  5I2K B;  3M3L A;  3PGF A;  2YPN A;  2F97 A;  2V25 A;  1DOT A;  4R72 A;  1OVB A;  1RKM A;  4QFL A;  2DSF A;  4BDR A;  2DQV A;  4NF8 A;  3TUS A;  2QS2 A;  3K1M A;  1MXU A;  1SVX B;  3LSF B;  4RYA A;  4Z7E A;  3O28 A;  3FJ7 A;  2HZK A;  3VE1 B;  1NL5 A;  2B3F A;  1PC3 A;  1OMP A;  2Q2C A;  1LFG A;  4F2Q A;  2GRV A;  3IO6 A;  1IXG A;  1QKA A;  1MY3 A;  2XXU A;  4DXC A;  3VVD A;  3K0V A;  4FAT A;  2PVU A;  1N04 A;  4XXU A;  2ESN A;  2OWS A;  4N07 A;  4AQ4 A;  2NOO A;  3N6T A;  3C31 A;  1IXC A;  4YKP A;  1LBB A;  1LFI A;  4FE8 A;  4ND9 A;  3PUV E;  3W9V A;  4DCX A;  3JV9 A;  4R75 A;  3PMV A;  1S50 A;  3THI A;  4M4G A;  2YLN A;  5FHN A;  4BLA A;  1FQE A;  4ZE9 A;  2YJP A;  1TFD A;  1N7X A;  3WAF A;  3OXN A;  1US4 A;  3SEY A;  4LVQ A;  4JWX A;  4KCC A;  4OEN A;  1M5E A;  2NUV A;  5KCJ B;  4KYS A;  4OXV A;  2ZNT A;  4H8I A;  4QFO A;  1JEU A;  3VXC A;  4LAT A;  1VSO A;  4I1D A;  4TLL B;  1JNF A;  1B2H A;  4PET A;  3IB2 A;  5LOM A;  3O6G A;  4QSD A;  5KZT A;  2XXH A;  3A09 A;  1Y4C A;  4ZEK A;  4NF4 B;  4POW A;  4U2R A;  2FNC A;  1CB6 A;  4GFR A;  3TCF A;  2F7A A;  4EF1 A;  3B6T A;  4GVO A;  1MDQ A;  4X9T A;  1ANF A;  4OWD A;  3KSX A;  1POT A;  3OO6 A;  1MY4 A;  1LLS A;  3G3K A;  3KN3 A;  5I57 B;  4R74 A;  2XXI A;  1OLC A;  2B65 A;  4RK2 A;  1P1W A;  5I2N A;  1DTG A;  4IO6 A;  1OLA A;  1A8E A;  2H5Y A;  1ELJ A;  1Y3N A;  2DXR A;  3VLW A;  2V3U A;  3MAM A;  5FHO A;  2DWI A;  3VV5 A;  5AA3 A;  4WED A;  4R9F A;  3R6U A;  2PT1 A;  4O3A A;  1B1H A;  2Z23 A;  1B9J A;  1IEJ A;  1B3G A;  3RT8 A;  4QFP A;  5H8H B;  2R9J A;  4E0W A;  1HSL A;  4N6P A;  1BLF A;  4RXL A;  4LQ5 A;  3RNN A;  3QIM A;  1LFH A;  4NTL A;  3LSL A;  4H8J A;  3FJM A;  2RCB A;  2QMX A;  3MP1 A;  4YKJ A;  1NMU A;  5CC2 A;  3I5O A;  4F1U A;  4IGR A;  5TPA A;  1SW1 A;  4H65 A;  4QHQ A;  1MS7 A;  2PBW A;  2O51 A;  4F39 A;  4POX A;  3CG1 A;  5KDT A;  4P11 A;  2V3T A;  3GXA A;  2UVJ A;  1EZO A;  3EHU A;  5TP9 A;  1SI1 A;  4GXA A;  4ZEI A;  1P99 A;  1Q35 A;  3OSR A;  1URG A;  4QFN A;  5ITO A;  3Q25 A;  1EH3 A;  5K2Y A;  2FA7 A;  3RGY A;  4F1V A;  1NFT A;  4O3C A;  2ONS A;  5ITP A;  4PE5 B;  1H76 A;  1N0T A;  3IB1 A;  3T9X B;  1R9Q A;  3U72 A;  2Y7R A;  4YAH X;  3ZS6 A;  3RQT A;  3Q29 A;  1B7U A;  4F3P A;  1GGG A;  4KQP A;  3A3C A;  4C0R A;  3V83 A;  3PMX A;  3OO9 A;  2G29 A;  2D21 A;  2P2A A;  5I84 A;  1ZKB A;  2Y7I A;  4ESW A;  1LB8 A;  2XXR A;  3PMW A;  3G3H A;  4BDO A;  4FJP A;  1Y1M A;  4ZE8 A;  2WKY A;  1TXF A;  3IX1 A;  3EN3 A;  3PUY E;  3TEL A;  4DIG A;  2XD2 A;  4LZ8 A;  4JDF A;  1MXW A;  4ZS9 A;  4YB7 A;  2Z22 A;  3K01 A;  4NWC A;  2RC9 A;  3P7I A;  3RTF B;  5CMC A;  1N84 A;  3FAT A;  4Q30 B;  5FTH A;  4FIM A;  2QS1 A;  2IA4 A;  1R9L A;  2XXY A;  5JEI A;  4OFO A;  4PP0 A;  3BFU A;  5I59 B;  2ZXT A;  3EHT A;  1XVY A;  3PPP A;  4R6H A;  3DP8 A;  3T96 B;  1AIV A;  1POY 1;  3E13 X;  4GQO A;  1PB8 A;  3KOS A;  4IGT A;  1SW4 A;  1B4H A;  1LB9 A;  4FAJ A;  3U1O A;  4HCY A;  3CRB A;  4ZZE A;  4LON B;  5K2X A;  2ABH A;  3UIF A;  1URD A;  1A40 A;  4U4S A;  4MLV A;  3C33 A;  4NMY A;  4QRZ A;  3PUX E;  5CBR A;  3FVN A;  4YU0 A;  4G68 A;  2O69 A;  4G2Z A;  4H67 A;  4EQ7 A;  1TT1 A;  1SYH A;  3DM0 A;  5F7V A;  1SW2 A;  2NXO A;  4U22 A;  5DVI A;  5B70 A;  1QKB A;  1Y4T A;  2KLF A;  3ILU B;  4UA8 A;  3K4U A;  3C32 A;  5AA2 A;  2F35 A;  3KSJ A;  2OLB A;  3T93 B;  1XS5 A;  1PBP A;  3BKI B;  1IXI A;  2AL5 A;  1A8F A;  2DYX A;  3USD A;  1O64 A;  1GVC A;  4U1Z A;  4OZ9 A;  3TTN A;  1NH7 A;  5TU0 A;  1B5I A;  4IO2 A;  1D9Y A;  3ZKK A;  5H8Q B;  3PPO A;  3K02 A;  1B05 A;  4FOR A;  4IO7 A;  1MY1 A;  5JTY A;  4LZ7 A;  3TCG A;  2P0S A;  1B5H A;  3E4R A;  4GF8 A;  1SYI A;  5DT6 A;  1MQG A;  2REJ A;  3PPR A;  4LA9 A;  4BDL A;  4X1D A;  3I3V A;  1DPE A;  3PPQ A;  3FIR A;  1L5T A;  1B0L A;  3K6W A;  3N6U A;  4EUO A;  3LUY A;  3UOR A;  1B7Z A;  2V84 A;  5AE4 A;  4PFT A;  3MUQ A;  4R73 A;  2XXT A;  2DVC A;  4NF8 B;  4AB6 A;  4QF9 A;  1SD3 A;  4F3S A;  4F29 A;  5IKB A;  2F5X A;  1BTJ A;  1LBC A;  1LAG E;  4X48 A;  3DEL B;  1UTB A;  3OEN A;  1TWY A;  1Y1Z A;  3Q26 A;  3DLN A;  4O3B A;  3KZG A;  1HSJ A;  2H99 A;  1UIU A;  3QUJ A;  1VE4 A;  5H8F A;  3SEW A;  1B6H A;  1MM7 A;  2FYI A;  3FXU A;  3KBR A;  1H45 A;  4FEB A;  5A5X A;  1AOV A;  2UYE A;  3FZV A;  5M2V A;  4OFJ A;  4X1B A;  3FUZ A;  3ZSF A;  1EU8 A;  5B7D A;  4MBP A;  1JVX A;  3HHF A;  2HAU A;  4G8N A;  3V8X B;  2ZMB A;  3CFX A;  3O6I A;  2QRY A;  3PD9 A;  4OET A;  2HFB A;  4K3F A;  5I56 A;  2XX7 A;  2Y7W A;  3FGS A;  4OVJ A;  4EQ9 A;  3TTK A;  2G93 A;  4E0X A;  2H98 A;  2HQ0 A;  3IB0 A;  4NF6 A;  4MLQ A;  4R2B A;  3SEV A;  1BKA A;  3TPA A;  3TEP A;  3D4C A;  3U93 A;  3QXM A;  4OEV A;  4XKR A;  2GH9 A;  2OZZ A;  3C35 A;  4OES A;  1QUL A;  4I8C A;  4QSC A;  4YZZ A;  1GR2 A;  3B7D A;  5AA2 D;  5IAI A;  1MQH A;  1YPN A;  4ZZA A;  2Z8F A;  3VDF A;  3ZKL A;  1XC1 A;  1P1O A;  1YAE A;  1B0H A;  1CE2 A;  2W7Y A;  2I3V A;  4RNS A;  1B4Z A;  1H44 A;  3N26 A;  3GZG A;  4F22 A;  2Y7P A;  3OOA A;  4KR5 A;  5I2N B;  3K00 A;  3IR1 A;  4H5G A;  2DXY A;  5I58 A;  3RT6 B;  1M5B A;  3U8Q A;  4EQB A;  3PPN A; 
#chains in the Genus database with same CATH topology
 3IFA A;  2RC8 A;  3IL1 B;  4HW8 A;  5J1D A;  3MPK A;  3TCH A;  3VVE A;  5EYH A;  1IME A;  1MY2 A;  4KHZ E;  3TFL A;  1IUD A;  1S9T A;  2I4B A;  2XXV A;  4PFW A;  1SPI A;  3RTW B;  1G0I A;  3VLU A;  3K6X A;  3KJ7 A;  3G3F A;  4NF0 A;  4XTC Q;  3TTR A;  2I49 A;  4O94 A;  4QSE A;  2RCA A;  3H6W A;  4IY5 A;  1IIW A;  1RYX A;  4OTE A;  4I62 A;  5TPA B;  5EYF A;  4JB7 A;  2QMW A;  2BJJ X;  2VPO A;  2NWJ A;  3MYU A;  4G77 A;  2WX9 A;  2QS3 A;  5KDT B;  4IY6 A;  5EQ9 A;  3WAE A;  3B6Q A;  1LAF E;  3VXB A;  1USY H;  3QAX A;  1I69 A;  1R1N A;  2O68 A;  5TP9 B;  3FXR A;  4GX4 A;  1SW5 A;  3R26 A;  5DTB A;  2KQZ A;  5T3J A;  4F3G A;  3MVW A;  1FPL A;  4ONY A;  2DE2 A;  3KG2 A;  4FEC A;  1VFD A;  3IOV A;  3U65 A;  4WEP A;  1DMB A;  1NUY A;  4EXK A;  3HCQ A;  2OK2 A;  4DCY A;  3IOR A;  2ZZW A;  1GV8 A;  5HBC A;  2D5W A;  5ESY A;  4FED A;  3EPE A;  2PYY A;  4UAC A;  1FPG A;  4I9D A;  4ELR A;  5ISU A;  3W15 C;  2VD2 A;  1JVY A;  5EQ7 A;  1JET A;  4BDM A;  1KA1 A;  2V3Q A;  2FBP A;  3LSX A;  3PTY A;  4OFL A;  3SET A;  5FBP A;  1BIY A;  1NNP A;  5I3S A;  3O2A A;  1LAX A;  4I3Y A;  3L6G A;  5EHS A;  1UTH B;  1NV7 A;  1Y3Q A;  2B4M A;  3QK6 A;  3MW0 A;  5IZZ A;  2FIE A;  3M8U A;  2I0B A;  3B50 A;  1VR5 A;  4AS4 A;  2XD3 A;  5JK4 A;  1EYJ A;  1I6B A;  1I6Q A;  2X7Q A;  3CG3 A;  4C1T A;  2UXA A;  1SI0 A;  3KN7 A;  1HSE A;  4HTG A;  4MNI A;  2I58 A;  4MH5 A;  4ZEC A;  4OAN A;  5IZ3 A;  3QSL A;  2Y5L A;  2A5T A;  3VFJ A;  3FVK A;  3MVX A;  4ELO A;  2CEX A;  3MP8 A;  2VOZ A;  1IZ1 A;  4MF3 A;  3CSG A;  1KA0 A;  1EYI A;  2X7P A;  1FTK A;  4ECF A;  3SEU A;  5AA1 A;  1IMC A;  2DE3 A;  4M1V A;  5DEX A;  1FQF A;  1XI6 A;  4DXU A;  4JWY A;  4YIC A;  2F6P A;  1B3E A;  4ZED A;  1A7L A;  5ET7 A;  1VDW A;  1N3W A;  4GLI A;  3F11 A;  1FBG A;  4U23 A;  1ZMG A;  3FXB A;  3U92 A;  3ONM A;  3LBS A;  2VGQ A;  4MFI A;  3H3G A;  2O84 X;  1Z7N E;  2ANJ A;  1MQJ A;  3KFM A;  2I6E A;  1US5 A;  4G68 B;  1JW4 A;  2OWT A;  5DW8 A;  4DE8 A;  4BDN A;  3G3J A;  1Q1K A;  1KWH A;  5AA4 A;  3GBB A;  1PBQ A;  3MVZ A;  4R9G A;  5DVJ A;  1SDX A;  5AA2 B;  3ODB A;  3KJT A;  3HPI A;  2GFE A;  3DP4 A;  2MKZ A;  4XF5 A;  3MZB A;  2AIX A;  2VHA A;  2PFY A;  4U21 A;  5I59 A;  3KBZ A;  1NUX A;  3SEX A;  4DXB A;  3U94 A;  2HEU A;  4G8H A;  2GQ1 A;  1MXY A;  1FQA A;  1B40 A;  5ELV A;  5JTY B;  2HCA A;  5DYH A;  4P47 A;  3S9E A;  1NV5 A;  3S9L C;  5H8S A;  1DPP A;  4ZEF A;  4NAP A;  4GL0 A;  4XKP A;  3SDF A;  2OBG A;  1MPD A;  1QUI A;  3K6U A;  3HFU A;  4YB6 A;  3O66 A;  4PDD A;  3HV1 A;  2X26 A;  4H0W A;  5L8D A;  5BWJ A;  2ZNS A;  2ONK E;  2UVG A;  3MBP A;  1USY E;  4TLM B;  5J16 A;  1N3X A;  3VVF A;  2DWJ A;  2F3D A;  3O6H A;  4ISU A;  2DDK A;  3TYH A;  1MQI A;  1A55 A;  2V93 A;  1NV1 A;  1B3H A;  2QVV A;  3RPL A;  4OYV A;  4OHN A;  4BDQ A;  2RF1 A;  2VD3 A;  3MZ9 A;  1UTB B;  5CRY A;  4EF2 A;  1LCF A;  2DS9 A;  1NV4 A;  3E9X A;  3RPW A;  3SES A;  3BFT A;  1J1N A;  2UVI A;  3UGW A;  4F18 A;  5FTI A;  1EZP A;  1H43 A;  4PFU A;  3TQW A;  1FQD A;  5H8F B;  1JW5 A;  5H8Q A;  3W9W A;  3HN0 A;  1MPB A;  1DBZ A;  1FTL A;  5CBS A;  1NNF A;  3TKD A;  3GBA A;  5A5X B;  4O7I A;  1QJM A;  3PD8 A;  4WKM A;  1A99 A;  4H5F A;  4OVT A;  2E1S A;  4NF5 A;  2XX9 A;  1B46 A;  1P1Q A;  3MQ9 A;  1II5 A;  4XIG Q;  1NKX A;  2QPQ A;  5H8N A;  4G4P A;  1OQH A;  4R6Y A;  1ZIU A;  1LST A;  4ZEB A;  1FTJ A;  3MZ1 A;  3TMG A;  3FV1 A;  1FBP A;  2CMO A;  3C9H A;  3R7X A;  4Q8R A;  3K1N A;  5BUU A;  1I6A A;  5I56 B;  4JWO A;  1OQG A;  1LBZ A;  3FVG A;  3S4U A;  1INP A;  3A3U A;  5I2K A;  2THI A;  3CIJ A;  3CSB A;  3GLB A;  3OD7 A;  2O6A A;  1PB9 A;  1M5D A;  2O1L A;  3CR9 A;  5ET5 A;  4NF6 B;  3LC8 A;  2I4C A;  2F7C A;  2Q8J A;  5HM4 B;  2FVZ A;  3CFZ A;  1DCU A;  2CZI A;  5CI5 A;  3C4M A;  2Q2A A;  3QUF A;  2H4I A;  3CVG A;  3K6V A;  4HE1 A;  1ZLQ A;  3IOU A;  2JJK A;  3G7W A;  2F78 A;  1MDP 1;  2QSX A;  5ICT A;  4AS5 A;  4IO3 A;  4N91 A;  1NH8 A;  3SER A;  1OIB A;  1LBW A;  3OEM A;  3ECR A;  3H7M A;  5A5L A;  1FW0 A;  2DWA A;  1EZ9 A;  1O63 A;  3JYR A;  1DK4 A;  2IEE A;  3UK4 A;  3IO4 A;  4YMA A;  4OEU A;  3SKP A;  1AH5 A;  2I0C A;  4EXL A;  4JSD A;  2VP1 A;  4X04 A;  5I58 B;  1DTZ A;  4GXS B;  1LCT A;  4OVR A;  4WXJ A;  4LP2 B;  2UVH A;  2UYF A;  1B3F A;  1FPE A;  4N13 A;  3ILT B;  2PMS A;  1BP5 A;  3V89 B;  4NQ8 A;  4YMB A;  5CMM A;  3H06 B;  2O7I A;  3LV0 A;  4ELQ A;  1ATG A;  3IJO B;  4PCD A;  4MX6 A;  4RJZ A;  1FJ6 A;  4IO4 A;  4QFK A;  4JBZ A;  1N76 A;  2FIX A;  5KCJ A;  1T0K A;  3KGC A;  2XXP A;  2CEY A;  3FVO A;  2F34 A;  5L9S A;  4PBH A;  2CZL A;  1FJ9 A;  1B7H A;  1M5F A;  4KI0 E;  2OCU A;  3FV2 A;  3VLV A;  1KZ8 A;  4RK9 A;  2F6G A;  1YCJ A;  1FPB A;  1NNK A;  3Q27 A;  4KPT A;  3LUZ A;  4KFQ A;  5IGA A;  2HHM A;  3HST A;  4H45 A;  3O9P A;  4Q0C A;  3TTL A;  4NF4 A;  3LR1 A;  4F1Y A;  1FBH A;  2BJI A;  3RN8 A;  3T22 A;  4IO5 A;  3H6T A;  4EDP A;  2DVZ A;  2R71 A;  4PFB A;  1SBP A;  4XKQ A;  1B51 A;  4PDH A;  1Z7M E;  1JQF A;  3E3K A;  3FJG A;  1LBX A;  3TOD A;  2Z8E A;  1R6Z A;  2XWO A;  2XXX A;  4GRK A;  5I57 A;  3H4Z A;  3EF7 A;  2XXW A;  2LAO A;  4THI A;  4OER A;  3DP6 A;  1S7Y A;  1AL3 A;  2Y7K A;  4TOZ A;  3K1P A;  3PV0 E;  2XWV A;  3IOW A;  2HXR A;  1B52 A;  1JEV A;  3TAJ A;  5FHM A;  3IOT A;  1FTO A;  1ZTY A;  1FQB A;  3RY3 A;  2O1M A;  3N94 A;  1AMF A;  4GWO A;  4DLD A;  1LAH E;  1Y3P A;  4OQO A;  1XHY A;  4U1O A;  3Q28 A;  2DE4 A;  2PX1 A;  4NWD A;  1ZJL A;  4OA4 A;  2QL3 A;  1XVX A;  4YKK A;  4RPN A;  3H03 A;  3O29 A;  4DDD A;  1WDN A;  3OO8 A;  4XKN A;  5H8H A;  4C1U A;  1P1N A;  5ET8 A;  1SQY A;  2XHD A;  4JSO A;  3H6V A;  2HAV A;  3N5L A;  1O7T A;  1ZU0 A;  2HXW A;  2H9B A;  3OO7 A;  4PC9 A;  4F3B A;  4HS7 A;  4KYD A;  4ELP A;  2RIN A;  4R2F A;  1MH4 A;  3G3G A;  1MRP A;  5ICQ A;  4RA1 A;  3IAZ A;  1WVJ A;  3BBR A;  3SZP A;  5IZ3 B;  5IZ1 A;  2A5T B;  1NV2 A;  3T9V A;  1D4N A;  3MPL A;  3FXQ A;  3K2D A;  4LZ5 A;  3UP9 A;  4KD5 A;  3O97 A;  1MH3 A;  2OJT A;  1YTV A;  4LQ2 A;  3QYT A;  5DEX B;  1PEB A;  1UIV A;  4N81 A;  4P9K A;  2ZYM A;  3RUM A;  4GIZ A;  2H25 A;  3PUZ E;  2DOJ A;  2NVU B;  4ESX A;  2B3B A;  5L9M A;  1MM6 A;  1B3L A;  1UQW A;  3MJN A;  4RY1 A;  2XX8 A;  1M5C A;  1IXH A;  1P1U A;  5CMK A;  2QJE A;  4MHF A;  2AYS A;  2RC7 A;  2AL4 A;  5DVF A;  2Z8D A;  1UTH A;  3AXF A;  2FHY A;  4P3L A;  3S2V A;  1MQD A;  3OEL A;  3KN8 A;  3B6W A;  4RPO A;  4NE4 A;  2GHB A;  1BK4 A;  4GWU A;  3PUW E;  3I6V A;  4U4X A;  3TZA A;  5AA4 B;  3PU5 A;  2ZYO A;  4H1X A;  3KEI A;  2XXK A;  3FD3 A;  2M8C A;  1OVT A;  2I3W A;  4L17 A;  3MVY A;  1MXX A;  1QUJ A;  2ALU A;  4F31 B;  4KCD A;  3C34 A;  3OSQ A;  4DI4 B;  4G8M A;  1FPI A;  1D9V A;  3ISP A;  1FSA A;  4P1E A;  1JP4 A;  4Z0I A;  4PTK A;  1VFE A;  1ZBM A;  3C36 A;  4P0I A;  1YXI A;  4G68 C;  3CI8 A;  3S9N C;  4NN3 A;  2HZL A;  2REG A;  2XXQ A;  1F9B A;  4JXI A;  4R6K A;  3OMB A;  4Q5T A;  1NV6 A;  3V5A A;  3TDJ A;  5F1Q A;  3S9M C;  3RLF E;  2Q89 A;  1QW0 A;  4X8R A;  2E0S A;  5F24 A;  5HPQ A;  1QVS A;  4OMB A;  3MP6 A;  3BIG A;  4NED A;  1MXZ A;  2DWH A;  1B32 A;  1GTK A;  1IMD A;  2PCR A;  1PB7 A;  1FCK A;  4QBA A;  2F8D A;  1DSN A;  3IJX B;  1Y20 A;  4P0G A;  1IIT A;  3OEK A;  1QUK A;  3EHS A;  2I48 A;  1IQ7 A;  3H6U A;  4N15 A;  2RKM A;  4DI3 D;  4OVP A;  3CFL A;  5CM6 A;  2Q88 A;  1B5J A;  2A5S A;  1RDY A;  3TTM A;  2ZNU A;  4PE3 A;  3D4G A;  1FTM A;  1H3D A;  1WOD A;  1TFA A;  1K9Y A;  4YB5 A;  2PT2 A;  4GWX A;  1JW1 A;  4PFY A;  2F36 A;  4ZDM A;  3KOT A;  2O7U A;  4HXV A;  4H6D A;  4O8M A;  4F19 A;  1NV0 A;  4PBQ A;  3T9H B;  1MG1 A;  4HCW A;  2DP8 A;  4GL8 A;  2ONR A;  2P1S A;  2QS4 A;  2Y84 A;  1RYO A;  2D3I A;  1XOC A;  5CMB A;  4DZ1 A;  4KYE A;  1N7W A;  1MPC A;  3MC2 A;  4YKI A;  3L6H A;  1LGB C;  2ZZX A;  1XT8 A;  2ZYN A;  4AB5 A;  5L9O A;  2ZYK A;  1PDA A;  1A54 A;  3G3I A;  4NF5 B;  3T66 A;  4GWS A;  4I40 A;  3B8B A;  3QMF A;  3KC1 A;  4MMP A;  1EYK A;  3M3F A;  3EQ1 A;  1Y9U A;  4GOT A;  1NNT A;  5H8N B;  3GYY A;  2GHA A;  3MWB A;  1MXV A;  5EHM A;  4GD5 A;  2F7B A;  3IK6 B;  3LSW A;  4PQJ A;  3TQL A;  1Q9D A;  4TQU Q;  3HHG A;  2R6G E;  4MNP A;  3FAS A;  3HO7 A;  4LUB A;  1FQC A;  4IB2 A;  2Q9T A;  1URS A;  4F2O A;  4GX3 A;  1D3K A;  4GX6 A;  1B1X A;  3JZJ A;  1B58 A;  3M3K A;  3T9U A;  3UN6 A;  3UA8 A;  1MY0 A;  5I2K B;  3M3L A;  3PGF A;  3A29 A;  2YPN A;  2F97 A;  2V25 A;  1DOT A;  2CZK A;  4R72 A;  1OVB A;  1RKM A;  2WEF A;  4QFL A;  2DSF A;  4BDR A;  2DQV A;  4NF8 A;  1FBE A;  3TUS A;  2QS2 A;  3K1M A;  1MXU A;  1SVX B;  4PGN A;  3LSF B;  2WYK A;  4RYA A;  5I5P A;  4Z7E A;  3O28 A;  3FJ7 A;  2HZK A;  3VE1 B;  1NL5 A;  2B3F A;  1PC3 A;  1OMP A;  2Q2C A;  1LFG A;  4F2Q A;  2GRV A;  3IO6 A;  4JVI A;  1IXG A;  1QKA A;  4UAB A;  1MY3 A;  5LTC A;  2VPN A;  3CHG A;  2XXU A;  4DXC A;  1IMF A;  3VVD A;  3K0V A;  4FAT A;  2PVU A;  1N04 A;  4XXU A;  2ESN A;  2OWS A;  4N07 A;  2CZH A;  4AQ4 A;  2NOO A;  3N6T A;  1IMB A;  3C31 A;  1IXC A;  4YKP A;  1LBB A;  1LFI A;  4FE8 A;  4ND9 A;  3PUV E;  1FBF A;  4LN5 A;  3W9V A;  4PAK A;  4DCX A;  3JV9 A;  4R75 A;  3PMV A;  1S50 A;  3THI A;  4M4G A;  2YLN A;  5FHN A;  4BLA A;  1FQE A;  4FBP A;  4ZE9 A;  2YJP A;  1TFD A;  1N7X A;  3WAF A;  3OXN A;  1US4 A;  4NGU A;  3SEY A;  4LVQ A;  4JWX A;  4KCC A;  4OEN A;  1FPF A;  1M5E A;  2NUV A;  5KCJ B;  4KYS A;  4OXV A;  2ZNT A;  1FPK A;  4N6K A;  4H8I A;  4QFO A;  1JEU A;  2QVU A;  3VXC A;  4LAT A;  1VSO A;  3FBP A;  4I1D A;  4TLL B;  1JNF A;  1B2H A;  4PET A;  3IB2 A;  5LOM A;  3O6G A;  4QSD A;  5KZT A;  2XXH A;  3A09 A;  4H46 A;  1Y4C A;  4ZEK A;  4PGP A;  2Q74 A;  4NF4 B;  4POW A;  4U2R A;  2FNC A;  1CB6 A;  4GFR A;  3TCF A;  2F7A A;  4EF1 A;  3B6T A;  4GVO A;  1MDQ A;  4X9T A;  1ANF A;  2WBD A;  4OWD A;  3KSX A;  1POT A;  3OO6 A;  1MY4 A;  1LLS A;  3G3K A;  3KN3 A;  5I57 B;  4R74 A;  2XXI A;  1OLC A;  2B65 A;  4RK2 A;  4NHB A;  1P1W A;  5I2N A;  1DTG A;  4IO6 A;  1OLA A;  4JVC A;  4XFE A;  1A8E A;  2H5Y A;  1ELJ A;  1Y3N A;  2DXR A;  3VLW A;  2V3U A;  3MAM A;  2L5V A;  2R8T A;  5FHO A;  2DWI A;  3VV5 A;  5AA3 A;  3IFC A;  4WED A;  4R9F A;  3R6U A;  2PT1 A;  4O3A A;  1B1H A;  2Z23 A;  1B9J A;  1IEJ A;  1B3G A;  3RT8 A;  4QFP A;  5H8H B;  2R9J A;  4E0W A;  1HSL A;  4N6P A;  1BLF A;  4OVQ A;  4RXL A;  4LQ5 A;  3RNN A;  3QIM A;  1LFH A;  4NTL A;  3LSL A;  4H8J A;  3FJM A;  2RCB A;  2QMX A;  3MP1 A;  4YKJ A;  2OX3 A;  4P8B A;  4P1L A;  1NMU A;  5CC2 A;  3I5O A;  4F1U A;  4IGR A;  1YZ0 A;  5TPA A;  1SW1 A;  4H65 A;  4QHQ A;  3KC0 A;  1MS7 A;  2PBW A;  2O51 A;  2QVR A;  4F39 A;  4MEV A;  4POX A;  3CG1 A;  5KDT A;  4P11 A;  2V3T A;  3GXA A;  2UVJ A;  1EZO A;  2V4C A;  3EHU A;  5TP9 A;  1SI1 A;  4GXA A;  4N4U A;  4ZEI A;  1P99 A;  4PF6 A;  1Q35 A;  3OSR A;  1URG A;  4QFN A;  5ITO A;  3Q25 A;  4MJO A;  1EH3 A;  4N8Y A;  5K2Y A;  2FA7 A;  3RGY A;  4F1V A;  1NFT A;  4O3C A;  2ONS A;  5ITP A;  4PE5 B;  1H76 A;  1N0T A;  3IB1 A;  3T9X B;  2PFZ A;  1R9Q A;  3U72 A;  2Y7R A;  4YAH X;  3ZS6 A;  3RQT A;  3Q29 A;  1B7U A;  3T0J A;  4F3P A;  1GGG A;  3ROJ A;  4KQP A;  3A3C A;  4C0R A;  3V83 A;  3PMX A;  3OO9 A;  2G29 A;  2D21 A;  2P2A A;  5I84 A;  1ZKB A;  4N8G A;  4MAG A;  2Y7I A;  4ESW A;  5I7I A;  1FPD A;  1LB8 A;  2F3B A;  2XXR A;  1IMA A;  3PMW A;  3G3H A;  4PAI A;  4BDO A;  4FJP A;  1Y1M A;  4ZE8 A;  2WKY A;  1TXF A;  3IX1 A;  3EN3 A;  3PUY E;  3TEL A;  4DIG A;  2XD2 A;  4LZ8 A;  4JDF A;  1MXW A;  4OVS A;  4ZS9 A;  4YB7 A;  4NX1 A;  2Z22 A;  4N17 A;  3K01 A;  4NWC A;  2RC9 A;  3P7I A;  4KXP A;  3RTF B;  5CMC A;  1N84 A;  3FAT A;  4Q30 B;  5FTH A;  4FIM A;  2QS1 A;  2IA4 A;  1R9L A;  2XXY A;  5JEI A;  4OFO A;  4PP0 A;  3BFU A;  5I59 B;  2ZXT A;  3EHT A;  4N6D A;  1XVY A;  3PPP A;  4R6H A;  3DP8 A;  3T96 B;  1AIV A;  1POY 1;  3E13 X;  4GQO A;  1FBC A;  1PB8 A;  3KOS A;  4IGT A;  1SW4 A;  1B4H A;  1LB9 A;  4FAJ A;  3U1O A;  4HCY A;  3CRB A;  4ZZE A;  4LON B;  5K2X A;  2ABH A;  3UIF A;  1URD A;  1A40 A;  4U4S A;  3NOH A;  5EYG A;  4MLV A;  3C33 A;  4NMY A;  4QRZ A;  3PUX E;  5CBR A;  3FVN A;  4NG7 A;  4YU0 A;  4G68 A;  2O69 A;  4G2Z A;  2OWZ A;  4H67 A;  4PFI A;  1TT1 A;  4EQ7 A;  1SYH A;  1RDX A;  2XA5 A;  3DM0 A;  2XWK A;  5F7V A;  1SW2 A;  2NXO A;  4U22 A;  5DVI A;  2HPG A;  2QFL A;  5B70 A;  1QKB A;  1Y4T A;  2KLF A;  3ILU B;  4UA8 A;  3K4U A;  3C32 A;  5AA2 A;  2B4L A;  1AWB A;  2F35 A;  2Q8M A;  3RPL B;  1YYZ A;  3KSJ A;  2OLB A;  3T93 B;  4PAF A;  1XS5 A;  1PBP A;  4GBV A;  3BKI B;  4HE2 A;  1IXI A;  2AL5 A;  1A8F A;  2DYX A;  3USD A;  1O64 A;  1GVC A;  4U1Z A;  4OZ9 A;  3TTN A;  1NH7 A;  4HE0 A;  5TU0 A;  3MST A;  1B5I A;  4IO2 A;  1D9Y A;  3ZKK A;  5H8Q B;  3PPO A;  3K02 A;  3BIH A;  1B05 A;  4FOR A;  4IO7 A;  1MY1 A;  5JTY A;  4LZ7 A;  2WYP A;  2P0S A;  3TCG A;  1B5H A;  5EQA A;  1D9Q A;  3E4R A;  4GF8 A;  1SYI A;  5DT6 A;  1MQG A;  2REJ A;  3PPR A;  4LA9 A;  4BDL A;  4GWY A;  4X1D A;  3I3V A;  1DPE A;  1LBV A;  3PPQ A;  3FIR A;  5EQ8 A;  1L5T A;  1B0L A;  3K6W A;  3N6U A;  4PFR A;  4EUO A;  3LUY A;  1FTA A;  3UOR A;  1B7Z A;  2V84 A;  5AE4 A;  4PFT A;  3MUQ A;  4R73 A;  2XXT A;  2DVC A;  4NF8 B;  4AB6 A;  4QF9 A;  1SD3 A;  4F3S A;  4F29 A;  2KR0 A;  2XWI A;  5IKB A;  2F5X A;  1BTJ A;  1LBC A;  1LAG E;  4X48 A;  3DEL B;  1UTB A;  3OEN A;  1TWY A;  3D1R A;  1Y1Z A;  3Q26 A;  3DLN A;  4O3B A;  3KZG A;  1HSJ A;  2P3V A;  3EKI A;  2H99 A;  1UIU A;  4GWW A;  3QUJ A;  1VE4 A;  5H8F A;  3SEW A;  1B6H A;  1MM7 A;  1LEV A;  2FYI A;  3FXU A;  3KBR A;  1K9Z A;  1H45 A;  4QXD A;  4FEB A;  5A5X A;  1AOV A;  2UYE A;  4O7M A;  3FZV A;  4MNC A;  5M2V A;  4OFJ A;  4X1B A;  3FUZ A;  3ZSF A;  1EU8 A;  5B7D A;  1NI9 A;  4MBP A;  1JVX A;  3HHF A;  1QGX A;  2HAU A;  4G8N A;  4XEQ A;  3E79 A;  3V8X B;  4JVD A;  2ZMB A;  1LBY A;  4MIJ A;  3CFX A;  3O6I A;  2QRY A;  3PD9 A;  4OET A;  2HFB A;  4K3F A;  5I56 A;  5LDZ A;  2XX7 A;  2Y7W A;  3FGS A;  1NUW A;  4OVJ A;  4EQ9 A;  4GWZ A;  3TTK A;  1FPJ A;  2ZZV A;  5IM2 A;  2G93 A;  1G0H A;  4E0X A;  4G61 A;  1RDZ A;  2H98 A;  1FRP A;  1NV3 A;  2HQ0 A;  3IB0 A;  4NF6 A;  4MLQ A;  4R2B A;  3SEV A;  4I3E A;  1BKA A;  3TPA A;  1NUZ A;  3TEP A;  3D4C A;  3QXM A;  3U93 A;  4OEV A;  4XKR A;  2GH9 A;  3E78 A;  2OZZ A;  3C35 A;  4OES A;  3RYD A;  1QUL A;  4I8C A;  2WBB A;  2P3N A;  4MCO A;  4QSC A;  4YZZ A;  5ET6 A;  1GR2 A;  3B7D A;  5AA2 D;  5IAI A;  1MQH A;  1YPN A;  4ZZA A;  2Y5K A;  2Z8F A;  3VDF A;  3T1B A;  3ZKL A;  4GBW A;  1XC1 A;  1P1O A;  1YAE A;  1B0H A;  1CE2 A;  2W7Y A;  2I3V A;  4RNS A;  1B4Z A;  1H44 A;  4P56 A;  2VT5 A;  3N26 A;  3GZG A;  4F22 A;  4IR8 A;  2Y7P A;  3OOA A;  4KR5 A;  5I2N B;  3K00 A;  3IR1 A;  1CNQ A;  4PF8 A;  4H5G A;  2DXY A;  5I58 A;  3RT6 B;  1M5B A;  3U8Q A;  1FBD A;  4EQB A;  3PPN A; 
#chains in the Genus database with same CATH homology
 2RC8 A;  3IL1 B;  4HW8 A;  5J1D A;  3MPK A;  3TCH A;  3VVE A;  1MY2 A;  4KHZ E;  3TFL A;  1IUD A;  1S9T A;  2I4B A;  2XXV A;  4PFW A;  3RTW B;  3VLU A;  3K6X A;  3KJ7 A;  3G3F A;  4XTC Q;  3TTR A;  2I49 A;  4QSE A;  2RCA A;  3H6W A;  4IY5 A;  1IIW A;  1RYX A;  4OTE A;  4I62 A;  5TPA B;  5EYF A;  4JB7 A;  2QMW A;  2BJJ X;  2NWJ A;  4G77 A;  2QS3 A;  5KDT B;  4IY6 A;  3WAE A;  3B6Q A;  1LAF E;  3VXB A;  1USY H;  3QAX A;  1I69 A;  1R1N A;  2O68 A;  5TP9 B;  3FXR A;  1SW5 A;  3R26 A;  5DTB A;  4F3G A;  3MVW A;  4ONY A;  2DE2 A;  3KG2 A;  4FEC A;  1VFD A;  3IOV A;  4WEP A;  1DMB A;  4EXK A;  3HCQ A;  2OK2 A;  4DCY A;  3IOR A;  1GV8 A;  5HBC A;  2D5W A;  4FED A;  3EPE A;  2PYY A;  4UAC A;  4I9D A;  4ELR A;  5ISU A;  3W15 C;  2VD2 A;  1JVY A;  4BDM A;  1JET A;  2V3Q A;  3LSX A;  4OFL A;  3SET A;  1BIY A;  1NNP A;  3O2A A;  1LAX A;  3L6G A;  5EHS A;  1UTH B;  1Y3Q A;  3QK6 A;  3MW0 A;  3M8U A;  2I0B A;  1VR5 A;  2XD3 A;  5JK4 A;  1I6B A;  1I6Q A;  2X7Q A;  3CG3 A;  4C1T A;  2UXA A;  1SI0 A;  3KN7 A;  1HSE A;  4HTG A;  2I58 A;  4MH5 A;  4ZEC A;  3QSL A;  2A5T A;  3VFJ A;  3FVK A;  3MVX A;  4ELO A;  3MP8 A;  2VOZ A;  1IZ1 A;  4MF3 A;  3CSG A;  2X7P A;  1FTK A;  4ECF A;  3SEU A;  5AA1 A;  4M1V A;  2DE3 A;  5DEX A;  1FQF A;  4DXU A;  4JWY A;  4YIC A;  2F6P A;  1B3E A;  4ZED A;  1A7L A;  1N3W A;  4GLI A;  3F11 A;  4U23 A;  1ZMG A;  3U92 A;  3ONM A;  3LBS A;  2VGQ A;  4MFI A;  3H3G A;  2O84 X;  1Z7N E;  2ANJ A;  1MQJ A;  3KFM A;  2I6E A;  1US5 A;  4G68 B;  1JW4 A;  2OWT A;  4DE8 A;  4BDN A;  3G3J A;  1Q1K A;  1KWH A;  5AA4 A;  3GBB A;  1PBQ A;  3MVZ A;  4R9G A;  5DVJ A;  1SDX A;  5AA2 B;  3ODB A;  3KJT A;  3HPI A;  2GFE A;  3DP4 A;  3MZB A;  2AIX A;  2VHA A;  4U21 A;  5I59 A;  3SEX A;  4DXB A;  3U94 A;  2HEU A;  4G8H A;  1MXY A;  1FQA A;  1B40 A;  5ELV A;  5JTY B;  2HCA A;  5DYH A;  3S9E A;  3S9L C;  5H8S A;  1DPP A;  4ZEF A;  4GL0 A;  4XKP A;  3SDF A;  2OBG A;  1MPD A;  1QUI A;  3K6U A;  4YB6 A;  3O66 A;  3HV1 A;  2X26 A;  4H0W A;  5L8D A;  5BWJ A;  2ZNS A;  2ONK E;  2UVG A;  3MBP A;  1USY E;  4TLM B;  1N3X A;  3VVF A;  2DWJ A;  3O6H A;  3TYH A;  4ISU A;  1MQI A;  1A55 A;  2V93 A;  1B3H A;  4OYV A;  4OHN A;  4BDQ A;  2RF1 A;  2VD3 A;  3MZ9 A;  1UTB B;  5CRY A;  4EF2 A;  1LCF A;  2DS9 A;  3E9X A;  3RPW A;  3SES A;  3BFT A;  1J1N A;  2UVI A;  3UGW A;  4F18 A;  5FTI A;  1EZP A;  1H43 A;  4PFU A;  3TQW A;  1FQD A;  5H8F B;  1JW5 A;  5H8Q A;  3W9W A;  3HN0 A;  1MPB A;  1FTL A;  5CBS A;  1NNF A;  3TKD A;  3GBA A;  5A5X B;  1QJM A;  3PD8 A;  4WKM A;  1A99 A;  4H5F A;  2E1S A;  4NF5 A;  2XX9 A;  1B46 A;  1P1Q A;  3MQ9 A;  1II5 A;  4XIG Q;  1NKX A;  2QPQ A;  5H8N A;  4G4P A;  1OQH A;  4R6Y A;  1ZIU A;  1LST A;  4ZEB A;  1FTJ A;  3MZ1 A;  3TMG A;  3FV1 A;  2CMO A;  3C9H A;  3R7X A;  4Q8R A;  3K1N A;  5BUU A;  1I6A A;  5I56 B;  4JWO A;  1OQG A;  3FVG A;  3S4U A;  3A3U A;  5I2K A;  2THI A;  3CIJ A;  3CSB A;  3GLB A;  3OD7 A;  2O6A A;  1PB9 A;  1M5D A;  2O1L A;  3CR9 A;  4NF6 B;  3LC8 A;  2I4C A;  2F7C A;  2Q8J A;  5HM4 B;  3CFZ A;  5CI5 A;  3C4M A;  2Q2A A;  3QUF A;  2H4I A;  3CVG A;  3K6V A;  1ZLQ A;  3IOU A;  3G7W A;  2F78 A;  1MDP 1;  2QSX A;  5ICT A;  4IO3 A;  1NH8 A;  3SER A;  1OIB A;  3OEM A;  3ECR A;  3H7M A;  1FW0 A;  2DWA A;  1EZ9 A;  1O63 A;  3JYR A;  2IEE A;  3UK4 A;  3IO4 A;  4YMA A;  4OEU A;  3SKP A;  1AH5 A;  2I0C A;  4EXL A;  4JSD A;  2VP1 A;  5I58 B;  1DTZ A;  4GXS B;  1LCT A;  4WXJ A;  4LP2 B;  2UVH A;  2UYF A;  1B3F A;  4N13 A;  3ILT B;  2PMS A;  1BP5 A;  3V89 B;  4YMB A;  5CMM A;  3H06 B;  2O7I A;  4ELQ A;  1ATG A;  3IJO B;  4RJZ A;  4IO4 A;  4QFK A;  4JBZ A;  1N76 A;  5KCJ A;  1T0K A;  3KGC A;  2XXP A;  3FVO A;  2F34 A;  5L9S A;  2CZL A;  1B7H A;  1M5F A;  4KI0 E;  2OCU A;  3FV2 A;  3VLV A;  4RK9 A;  2F6G A;  1YCJ A;  1NNK A;  3Q27 A;  4KPT A;  4KFQ A;  3HST A;  3O9P A;  4Q0C A;  3TTL A;  4NF4 A;  3LR1 A;  4F1Y A;  3RN8 A;  3T22 A;  4IO5 A;  3H6T A;  4EDP A;  2DVZ A;  2R71 A;  1SBP A;  4XKQ A;  1B51 A;  1Z7M E;  1JQF A;  3E3K A;  3FJG A;  3TOD A;  2Z8E A;  1R6Z A;  2XXX A;  4GRK A;  5I57 A;  3H4Z A;  3EF7 A;  2XXW A;  2LAO A;  4THI A;  4OER A;  3DP6 A;  1AL3 A;  1S7Y A;  2Y7K A;  4TOZ A;  3K1P A;  3PV0 E;  3IOW A;  1B52 A;  1JEV A;  3TAJ A;  5FHM A;  3IOT A;  1FTO A;  1ZTY A;  1FQB A;  3RY3 A;  2O1M A;  3N94 A;  1AMF A;  4GWO A;  4DLD A;  1LAH E;  1Y3P A;  4OQO A;  1XHY A;  4U1O A;  3Q28 A;  2DE4 A;  2PX1 A;  4NWD A;  1ZJL A;  2QL3 A;  1XVX A;  4YKK A;  4RPN A;  3H03 A;  3O29 A;  4DDD A;  1WDN A;  3OO8 A;  4XKN A;  5H8H A;  4C1U A;  1P1N A;  1SQY A;  2XHD A;  4JSO A;  3H6V A;  2HAV A;  3N5L A;  1O7T A;  1ZU0 A;  2HXW A;  2H9B A;  3OO7 A;  4F3B A;  4HS7 A;  4KYD A;  4ELP A;  2RIN A;  4R2F A;  1MH4 A;  3G3G A;  1MRP A;  5ICQ A;  4RA1 A;  3IAZ A;  1WVJ A;  3BBR A;  2A5T B;  3T9V A;  1D4N A;  3MPL A;  3FXQ A;  3K2D A;  4LZ5 A;  3UP9 A;  4KD5 A;  3O97 A;  1MH3 A;  2OJT A;  1YTV A;  4LQ2 A;  3QYT A;  5DEX B;  1PEB A;  1UIV A;  2ZYM A;  3RUM A;  4GIZ A;  2H25 A;  3PUZ E;  2DOJ A;  2NVU B;  4ESX A;  2B3B A;  5L9M A;  1MM6 A;  1B3L A;  1UQW A;  3MJN A;  4RY1 A;  2XX8 A;  1M5C A;  1IXH A;  1P1U A;  5CMK A;  2QJE A;  2AYS A;  2RC7 A;  2AL4 A;  5DVF A;  2Z8D A;  1UTH A;  3AXF A;  3S2V A;  1MQD A;  3OEL A;  3KN8 A;  3B6W A;  4RPO A;  4NE4 A;  2GHB A;  3PUW E;  3I6V A;  4U4X A;  3TZA A;  5AA4 B;  3PU5 A;  2ZYO A;  4H1X A;  3KEI A;  3FD3 A;  2M8C A;  1OVT A;  2I3W A;  4L17 A;  3MVY A;  1MXX A;  1QUJ A;  2ALU A;  4F31 B;  4KCD A;  3C34 A;  3OSQ A;  4G8M A;  1D9V A;  4Z0I A;  1VFE A;  1ZBM A;  3C36 A;  4P0I A;  4G68 C;  3CI8 A;  3S9N C;  2HZL A;  2REG A;  2XXQ A;  1F9B A;  4JXI A;  4R6K A;  3OMB A;  4Q5T A;  3V5A A;  3TDJ A;  5F1Q A;  3S9M C;  3RLF E;  2Q89 A;  1QW0 A;  2E0S A;  5HPQ A;  1QVS A;  4OMB A;  3MP6 A;  4NED A;  1MXZ A;  2DWH A;  1B32 A;  1GTK A;  1PB7 A;  1FCK A;  2F8D A;  1DSN A;  3IJX B;  1Y20 A;  4P0G A;  1IIT A;  3OEK A;  1QUK A;  3EHS A;  2I48 A;  1IQ7 A;  3H6U A;  2RKM A;  3CFL A;  5CM6 A;  2Q88 A;  1B5J A;  2A5S A;  3TTM A;  2ZNU A;  3D4G A;  1FTM A;  1H3D A;  1WOD A;  1TFA A;  4YB5 A;  2PT2 A;  1JW1 A;  4PFY A;  2F36 A;  4ZDM A;  3KOT A;  2O7U A;  4H6D A;  4F19 A;  3T9H B;  1MG1 A;  4HCW A;  2DP8 A;  4GL8 A;  2ONR A;  2P1S A;  2QS4 A;  2Y84 A;  1RYO A;  2D3I A;  1XOC A;  5CMB A;  4DZ1 A;  4KYE A;  1N7W A;  1MPC A;  3MC2 A;  4YKI A;  3L6H A;  1LGB C;  1XT8 A;  2ZYN A;  4AB5 A;  5L9O A;  2ZYK A;  1PDA A;  1A54 A;  3G3I A;  4NF5 B;  3T66 A;  3M3F A;  3EQ1 A;  1Y9U A;  4GOT A;  1NNT A;  5H8N B;  2GHA A;  3MWB A;  1MXV A;  5EHM A;  4GD5 A;  2F7B A;  3IK6 B;  3LSW A;  4PQJ A;  3TQL A;  4TQU Q;  3HHG A;  2R6G E;  3FAS A;  3HO7 A;  4LUB A;  1FQC A;  4IB2 A;  2Q9T A;  1URS A;  4F2O A;  1D3K A;  1B1X A;  3JZJ A;  1B58 A;  3M3K A;  3T9U A;  3UN6 A;  3UA8 A;  1MY0 A;  5I2K B;  3M3L A;  3PGF A;  2YPN A;  2F97 A;  2V25 A;  1DOT A;  4R72 A;  1OVB A;  1RKM A;  4QFL A;  2DSF A;  4BDR A;  2DQV A;  4NF8 A;  3TUS A;  2QS2 A;  3K1M A;  1MXU A;  1SVX B;  3LSF B;  4RYA A;  4Z7E A;  3O28 A;  3FJ7 A;  2HZK A;  3VE1 B;  1NL5 A;  2B3F A;  1PC3 A;  1OMP A;  2Q2C A;  1LFG A;  4F2Q A;  2GRV A;  3IO6 A;  1IXG A;  1QKA A;  1MY3 A;  2XXU A;  4DXC A;  3VVD A;  3K0V A;  4FAT A;  2PVU A;  1N04 A;  4XXU A;  2ESN A;  2OWS A;  4N07 A;  4AQ4 A;  2NOO A;  3N6T A;  3C31 A;  1IXC A;  4YKP A;  1LBB A;  1LFI A;  4FE8 A;  4ND9 A;  3PUV E;  3W9V A;  4DCX A;  3JV9 A;  4R75 A;  3PMV A;  1S50 A;  3THI A;  4M4G A;  2YLN A;  5FHN A;  4BLA A;  1FQE A;  4ZE9 A;  2YJP A;  1TFD A;  1N7X A;  3WAF A;  3OXN A;  1US4 A;  3SEY A;  4LVQ A;  4JWX A;  4KCC A;  4OEN A;  1M5E A;  2NUV A;  5KCJ B;  4KYS A;  4OXV A;  2ZNT A;  4H8I A;  4QFO A;  1JEU A;  3VXC A;  4LAT A;  1VSO A;  4I1D A;  4TLL B;  1JNF A;  1B2H A;  4PET A;  3IB2 A;  5LOM A;  3O6G A;  4QSD A;  5KZT A;  2XXH A;  3A09 A;  1Y4C A;  4ZEK A;  4NF4 B;  4POW A;  4U2R A;  2FNC A;  1CB6 A;  4GFR A;  3TCF A;  2F7A A;  4EF1 A;  3B6T A;  4GVO A;  1MDQ A;  4X9T A;  1ANF A;  4OWD A;  3KSX A;  1POT A;  3OO6 A;  1MY4 A;  1LLS A;  3G3K A;  3KN3 A;  5I57 B;  4R74 A;  2XXI A;  1OLC A;  2B65 A;  4RK2 A;  1P1W A;  5I2N A;  1DTG A;  4IO6 A;  1OLA A;  1A8E A;  2H5Y A;  1ELJ A;  1Y3N A;  2DXR A;  3VLW A;  2V3U A;  3MAM A;  5FHO A;  2DWI A;  3VV5 A;  5AA3 A;  4WED A;  4R9F A;  3R6U A;  2PT1 A;  4O3A A;  1B1H A;  2Z23 A;  1B9J A;  1IEJ A;  1B3G A;  3RT8 A;  4QFP A;  5H8H B;  2R9J A;  4E0W A;  1HSL A;  4N6P A;  1BLF A;  4RXL A;  4LQ5 A;  3RNN A;  3QIM A;  1LFH A;  4NTL A;  3LSL A;  4H8J A;  3FJM A;  2RCB A;  2QMX A;  3MP1 A;  4YKJ A;  1NMU A;  5CC2 A;  3I5O A;  4F1U A;  4IGR A;  5TPA A;  1SW1 A;  4H65 A;  4QHQ A;  1MS7 A;  2PBW A;  2O51 A;  4F39 A;  4POX A;  3CG1 A;  5KDT A;  4P11 A;  2V3T A;  3GXA A;  2UVJ A;  1EZO A;  3EHU A;  5TP9 A;  1SI1 A;  4GXA A;  4ZEI A;  1P99 A;  1Q35 A;  3OSR A;  1URG A;  4QFN A;  5ITO A;  3Q25 A;  1EH3 A;  5K2Y A;  2FA7 A;  3RGY A;  4F1V A;  1NFT A;  4O3C A;  2ONS A;  5ITP A;  4PE5 B;  1H76 A;  1N0T A;  3IB1 A;  3T9X B;  1R9Q A;  3U72 A;  2Y7R A;  4YAH X;  3ZS6 A;  3RQT A;  3Q29 A;  1B7U A;  4F3P A;  1GGG A;  4KQP A;  3A3C A;  4C0R A;  3V83 A;  3PMX A;  3OO9 A;  2G29 A;  2D21 A;  2P2A A;  5I84 A;  1ZKB A;  2Y7I A;  4ESW A;  1LB8 A;  2XXR A;  3PMW A;  3G3H A;  4BDO A;  4FJP A;  1Y1M A;  4ZE8 A;  2WKY A;  1TXF A;  3IX1 A;  3EN3 A;  3PUY E;  3TEL A;  4DIG A;  2XD2 A;  4LZ8 A;  4JDF A;  1MXW A;  4ZS9 A;  4YB7 A;  2Z22 A;  3K01 A;  4NWC A;  2RC9 A;  3P7I A;  3RTF B;  5CMC A;  1N84 A;  3FAT A;  4Q30 B;  5FTH A;  4FIM A;  2QS1 A;  2IA4 A;  1R9L A;  2XXY A;  5JEI A;  4OFO A;  4PP0 A;  3BFU A;  5I59 B;  2ZXT A;  3EHT A;  1XVY A;  3PPP A;  4R6H A;  3DP8 A;  3T96 B;  1AIV A;  1POY 1;  3E13 X;  4GQO A;  1PB8 A;  3KOS A;  4IGT A;  1SW4 A;  1B4H A;  1LB9 A;  4FAJ A;  3U1O A;  4HCY A;  3CRB A;  4ZZE A;  4LON B;  5K2X A;  2ABH A;  3UIF A;  1URD A;  1A40 A;  4U4S A;  4MLV A;  3C33 A;  4NMY A;  4QRZ A;  3PUX E;  5CBR A;  3FVN A;  4YU0 A;  4G68 A;  2O69 A;  4G2Z A;  4H67 A;  4EQ7 A;  1TT1 A;  1SYH A;  3DM0 A;  5F7V A;  1SW2 A;  2NXO A;  4U22 A;  5DVI A;  5B70 A;  1QKB A;  1Y4T A;  2KLF A;  3ILU B;  4UA8 A;  3K4U A;  3C32 A;  5AA2 A;  2F35 A;  3KSJ A;  2OLB A;  3T93 B;  1XS5 A;  1PBP A;  3BKI B;  1IXI A;  2AL5 A;  1A8F A;  2DYX A;  3USD A;  1O64 A;  1GVC A;  4U1Z A;  4OZ9 A;  3TTN A;  1NH7 A;  5TU0 A;  1B5I A;  4IO2 A;  1D9Y A;  3ZKK A;  5H8Q B;  3PPO A;  3K02 A;  1B05 A;  4FOR A;  4IO7 A;  1MY1 A;  5JTY A;  4LZ7 A;  3TCG A;  2P0S A;  1B5H A;  3E4R A;  4GF8 A;  1SYI A;  5DT6 A;  1MQG A;  2REJ A;  3PPR A;  4LA9 A;  4BDL A;  4X1D A;  3I3V A;  1DPE A;  3PPQ A;  3FIR A;  1L5T A;  1B0L A;  3K6W A;  3N6U A;  4EUO A;  3LUY A;  3UOR A;  1B7Z A;  2V84 A;  5AE4 A;  4PFT A;  3MUQ A;  4R73 A;  2XXT A;  2DVC A;  4NF8 B;  4AB6 A;  4QF9 A;  1SD3 A;  4F3S A;  4F29 A;  5IKB A;  2F5X A;  1BTJ A;  1LBC A;  1LAG E;  4X48 A;  3DEL B;  1UTB A;  3OEN A;  1TWY A;  1Y1Z A;  3Q26 A;  3DLN A;  4O3B A;  3KZG A;  1HSJ A;  2H99 A;  1UIU A;  3QUJ A;  1VE4 A;  5H8F A;  3SEW A;  1B6H A;  1MM7 A;  2FYI A;  3FXU A;  3KBR A;  1H45 A;  4FEB A;  5A5X A;  1AOV A;  2UYE A;  3FZV A;  5M2V A;  4OFJ A;  4X1B A;  3FUZ A;  3ZSF A;  1EU8 A;  5B7D A;  4MBP A;  1JVX A;  3HHF A;  2HAU A;  4G8N A;  3V8X B;  2ZMB A;  3CFX A;  3O6I A;  2QRY A;  3PD9 A;  4OET A;  2HFB A;  4K3F A;  5I56 A;  2XX7 A;  2Y7W A;  3FGS A;  4OVJ A;  4EQ9 A;  3TTK A;  2G93 A;  4E0X A;  2H98 A;  2HQ0 A;  3IB0 A;  4NF6 A;  4MLQ A;  4R2B A;  3SEV A;  1BKA A;  3TPA A;  3TEP A;  3D4C A;  3U93 A;  3QXM A;  4OEV A;  4XKR A;  2GH9 A;  2OZZ A;  3C35 A;  4OES A;  1QUL A;  4I8C A;  4QSC A;  4YZZ A;  1GR2 A;  3B7D A;  5AA2 D;  5IAI A;  1MQH A;  1YPN A;  4ZZA A;  2Z8F A;  3VDF A;  3ZKL A;  1XC1 A;  1P1O A;  1YAE A;  1B0H A;  1CE2 A;  2W7Y A;  2I3V A;  4RNS A;  1B4Z A;  1H44 A;  3N26 A;  3GZG A;  4F22 A;  2Y7P A;  3OOA A;  4KR5 A;  5I2N B;  3K00 A;  3IR1 A;  4H5G A;  2DXY A;  5I58 A;  3RT6 B;  1M5B A;  3U8Q A;  4EQB A;  3PPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...