3PPQA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
TIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
total genus 100
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ppqA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3ppqA02
3FGSA 2Q89A 3BBRA 2OCUA 3WAFA 3FD3A 3QK6A 3D4CA 2UYFA 1TT1A 4BLAA 1II5A 2OLBA 4ESWA 4E0WA 5A5XA 1PC3A 4H67A 4KCDA 5F1QA 2Y7KA 3MVYA 2HFBA 4YB7A 4EQBA 1SW2A 4NF4A 2ZYNA 1DSNA 2ZYMA 3Q29A 2XXRA 2OK2A 2YPNA 4EXKA 3C34A 2DP8A 4G68A 1GVCA 3TUSA 5A5XB 1OVTA 3MVWA 1MPBA 3IB2A 1A8FA 2DE3A 3SEUA 3KZGA 1Y1MA 4LZ5A 2DWJA 3HSTA 2Z23A 3S2VA 1B05A 5I59A 1MS7A 3AXFA 1LAHE 2V3TA 4G8NA 1VR5A 4OEUA 1TFAA 1Y3PA 3I3VA 3K4UA 3T22A 3T9VA 2UVJA 3N6TA 3K2DA 3C33A 5FHNA 3VE1B 2QPQA 4IGRA 3TTNA 4ELOA 3MZ9A 3E3KA 2NXOA 4OFLA 2I4BA 4PFTA 2NOOA 3HN0A 1SW4A 4KHZE 5ICTA 2RKMA 4WXJA 3PPOA 5JTYA 3OSQA 4H0WA 1LFGA 2G93A 3FVGA 2UVHA 1J1NA 1VFDA 3LC8A 1US4A 4YICA 4U21A 4QFLA 2D3IA 1IIWA 4IO7A 4ELRA 1NKXA 2XD2A 4QFNA 1FQFA 5I56B 2QRYA 5HM4B 3QUFA 5JTYB 2H9BA 3MZ1A 3LSXA 2E0SA 4DCXA 3GLBA 2I3VA 2XXXA 4IO4A 4F39A 1ZKBA 3IOTA 2PMSA 3EHSA 3UA8A 4AB5A 1LAXA 3OEKA 4YMBA 1HSEA 2DE4A 2Y84A 5DTBA 5B70A 1M5CA 4E0XA 1B3HA 1N0TA 4NTLA 1B0HA 1B58A 3V89B 1GR2A 3O6GA 1UTHB 2F7AA 2QSXA 1FCKA 2QS2A 3Q25A 2DYXA 1OMPA 1JEUA 1H43A 1QW0A 4PFUA 4F3BA 1BTJA 1R9QA 1Y1ZA 4RA1A 4WEDA 2GRVA 1DMBA 5HBCA 2FNCA 3G3JA 4FAJA 2OJTA 1R9LA 4KYEA 1B3EA 5TP9B 4MLQA 2F78A 1ZLQA 3SEYA 4LZ7A 2V3QA 3KN3A 3LBSA 1OIBA 2UVIA 4IO6A 2H25A 3VVEA 1B4ZA 2O6AA 1LGBC 2HXWA 1NFTA 5DT6A 3CFLA 1I6BA 3CFXA 1XOCA 3IK6B 1MXWA 1B7UA 4R9GA 4I9DA 3O9PA 1P1OA 4U23A 4U2RA 1B9JA 4Q30B 1VE4A 5LOMA 4BDOA 2PT2A 2XXTA 2F36A 4YAHX 2Q9TA 3G3HA 4EQ7A 2Y7WA 4ZE9A 1SBPA 4OHNA 4H5GA 4P0GA 3CSBA 4HTGA 4F19A 5JEIA 4GOTA 4JSDA 3LSFB 1FTKA 1DTZA 3B6TA 3RNNA 5BUUA 3O28A 1UQWA 4I1DA 4LVQA 5CBRA 1NMUA 1DPEA 4ZZEA 2ZYOA 4ZDMA 1P1UA 3IB0A 1SI1A 1M5BA 1P99A 1R6ZA 5DVIA 4H8JA 1XHYA 2HZKA 4P11A 3KG2A 1B5JA 1SI0A 3JYRA 3UK4A 4C1TA 2X7QA 3QSLA 3CSGA 4IY6A 2O84X 2I4CA 5ISUA 4N13A 3K01A 1IUDA 3ZS6A 3A3CA 3MW0A 2Z8EA 3TTRA 3ZKKA 1S9TA 4KD5A 3MUQA 3PPPA 4XKPA 4FIMA 1O63A 1PB7A 3WAEA 3S9NC 3MVXA 4DXCA 3T9UA 1CB6A 1B6HA 1ZTYA 3KN8A 3SEXA 1OVBA 3C35A 4LATA 3RQTA 3T96B 5I2NA 4QHQA 4QSEA 5BWJA 1SDXA 4GXAA 4NF8A 3RPWA 3HCQA 3R6UA 1JW1A 3TTMA 4X1BA 1LFIA 4MLVA 3G3GA 2DWIA 4KR5A 3VV5A 3PUYE 3TKDA 2UVGA 3C32A 4P0IA 2QMWA 1XC1A 4F2QA 5I2NB 1F9BA 3OOAA 2Q8JA 1N7WA 2I49A 4OQOA 3VLVA 2GH9A 3EHUA 3QYTA 4NF5A 1XVYA 2QS3A 4I8CA 4X9TA 3VLWA 4GL0A 4KQPA 2DWHA 2LAOA 2A5TA 2F5XA 3FXUA 1WVJA 3G3FA 2DXRA 2XXPA 3IX1A 1TXFA 5FHOA 4MH5A 4R74A 5KDTB 3U93A 1QVSA 2D21A 4GL8A 2REJA 2QL3A 5J1DA 2RCAA 3VXBA 1NNKA 2O51A 2XXUA 4GF8A 1A7LA 4NF6A 2XXYA 3T9HB 5JK4A 1HSJA 2XX9A 4OZ9A 3RY3A 1D9YA 1S50A 3DP6A 3MC2A 3IJOB 2V3UA 3N94A 4ND9A 2QS4A 5H8NA 1MH4A 3W15C 4OTEA 4PE5B 5DVJA 3QXMA 4H65A 4MF3A 3B7DA 1SYIA 2Z8DA 4LQ5A 4NWDA 3H6TA 3UORA 2ONKE 4TLLB 2DE2A 1R1NA 1QJMA 1NL5A 4H1XA 4IO2A 5CMMA 2G29A 1PEBA 2I0CA 3LR1A 3H03A 5H8NB 4LONB 2O68A 5DEXA 1JVYA 1FQAA 4ISUA 2B3FA 3ILUB 4C1UA 5HPQA 2P1SA 1POTA 3PUWE 1UIVA 3TCGA 3EN3A 3TQLA 2VD2A 1BKAA 4JBZA 3PUVE 3OO7A 2DQVA 3P7IA 5M2VA 2HQ0A 4ZEDA 3IL1B 3GXAA 4X1DA 4Q8RA 3LSWA 1NNFA 2I58A 5DEXB 2YLNA 2GHBA 3E4RA 1P1NA 3MZBA 4HW8A 2Q2CA 1XT8A 2V25A 2ZXTA 4OVJA 1MY2A 3PUZE 3FJ7A 5FTIA 3O66A 1IXHA 3ECRA 3RT8A 1DTGA 1EU8A 4F22A 1JVXA 3FVKA 4PP0A 4U4SA 3R26A 2XXVA 1B4HA 4IY5A 5K2YA 4OMBA 2THIA 5L9SA 3IO4A 3O2AA 5I56A 5F7VA 2F35A 3UGWA 3VVDA 1LBCA 1Q35A 4O3AA 1MXVA 5AA1A 5AA2D 3FVOA 2Y7PA 1L5TA 3KSJA 4WKMA 1XS5A 4XTCQ 5KZTA 2P0SA 3MAMA 3V8XB 2QMXA 1JETA 4MBPA 1AMFA 1VSOA 3ZKLA 3RTFB 4POWA 4GFRA 1UTHA 4BDLA 2ANJA 4EXLA 3FV1A 1RYOA 3BFUA 3OSRA 1JNFA 2O1LA 3OENA 1QUIA 3H6VA 3K6UA 4GWOA 1MY4A 1A55A 1MY1A 3FJMA 1A40A 4ZEFA 5TP9A 4FE8A 2VD3A 2HAUA 2O7IA 3G3IA 1H45A 3UIFA 1FTLA 1MPCA 4OYVA 3TELA 1HSLA 4RNSA 2DSFA 3PMVA 4O3CA 1FTJA 4GQOA 3TFLA 3Q27A 1QUJA 1Z7ME 4F3SA 4GVOA 2PBWA 3U8QA 1N84A 1RKMA 4H8IA 3CVGA 3H4ZA 3SEVA 1Y4TA 5DYHA 3H06B 3G7WA 4M4GA 1YCJA 1URSA 2Z8FA 2XXWA 3PMXA 3HPIA 3IB1A 2DXYA 4KPTA 4ZEBA 1B40A 3HO7A 4UACA 4X48A 1IITA 4F31B 3CG1A 4KCCA 3K00A 4R72A 3EQ1A 4JXIA 4RK2A 4QFKA 1MQDA 1MH3A 4IGTA 4FATA 3MQ9A 3IORA 3K1NA 4HS7A 2AYSA 4OENA 2AL4A 3V5AA 4XKRA 4O3BA 1URGA 2RF1A 4JSOA 3K0VA 3S9LC 2I3WA 3OXNA 2F8DA 1O64A 3O29A 3VFJA 1S7YA 1EZPA 4ONYA 1PB9A 3CG3A 2HEUA 4H6DA 4BDNA 3CR9A 3A3UA 1ZIUA 2D5WA 3TEPA 2F7BA 2I6EA 1DPPA 1MXXA 2IA4A 3EPEA 4N6PA 2ONRA 2DWAA 1PDAA 4F1YA 3TCHA 3PMWA 2QJEA 4BDQA 4RXLA 2Y7IA 3ODBA 2OZZA 3HHFA 1M5FA 1I69A 3IOVA 3MWBA 4OFOA 2PT1A 4R9FA 2KLFA 1B1XA 2Q88A 3PPRA 4K3FA 4ZZAA 1B0LA 3TDJA 2HZLA 1NH7A 5EHSA 3E13X 2RC8A 2V84A 3M3LA 1UTBA 5L9OA 1Y20A 2NUVA 3K6XA 2R71A 2ESNA 1NNPA 3OD7A 3C31A 4R6HA 2XXQA 2X7PA 2VOZA 4YZZA 1EZOA 4Q5TA 5ITPA 3TPAA 3L6GA 3I5OA 1UTBB 2OWTA 5I84A 1CE2A 4LUBA 3W9WA 4PFWA 1MXZA 4MFIA 1LFHA 2GFEA 3KOSA 1D9VA 4DDDA 4ESXA 3IAZA 5CBSA 2I0BA 4RJZA 3C4MA 4N07A 3I6VA 2HAVA 4R2FA 2XHDA 3IO6A 2V93A 4THIA 3N6UA 2B3BA 4PETA 3N5LA 4QSCA 4F18A 1Y3NA 3U1OA 4OXVA 3H7MA 1MDP1 1B3FA 4DE8A 3OO8A 3A09A 3D4GA 5I57A 5KDTA 5AA4A 1B2HA 1UIUA 3TCFA 4QFOA 5H8SA 4YB6A 4U1ZA 4BDRA 5CM6A 1LBBA 4NMYA 1XVXA 3RGYA 1US5A 1B1HA 1WDNA 1Z7NE 3BFTA 3W9VA 3FJGA 3JV9A 1Y3QA 1FTMA 1OQGA 2NWJA 3RLFE 2P2AA 5I57B 1Q1KA 4QSDA 4EDPA 1ATGA 1MM7A 5AA4B 3K02A 1OLAA 5H8QA 1AH5A 1P1WA 4I62A 4ZEKA 3U72A 2XXIA 3O6HA 5IAIA 3DLNA 4GXSB 1B32A 4OESA 1N7XA 1N3WA 4XXUA 3QIMA 4DLDA 1OLCA 3KOTA 1QKBA 5B7DA 1IEJA 4YKIA 3S4UA 5I58B 1MQJA 3FXRA 5H8QB 5L8DA 2FYIA 3T9XB 4R73A 4L17A 4KFQA 3TTLA 2ZYKA 3O6IA 4OWDA 1M5EA 1NH8A 1LB8A 1BIYA 5TPAB 3JZJA 1JQFA 4HCYA 2H5YA 4DZ1A 3V83A 4ZEIA 3KN7A 3F11A 3VXCA 4R75A 5H8FA 1B7ZA 1MXYA 3VDFA 4ELQA 2ALUA 3KBRA 1LSTA 3KFMA 3FV2A 4ELPA 3FZVA 3GBBA 4NWCA 4JWOA 3SKPA 3PV0E 5CMBA 2IEEA 3B6QA 2AL5A 3OEMA 4XKQA 4IO3A 4DIGA 2OWSA 5H8FB 4EF1A 1JW5A 1QUKA 2PYYA 3IJXB 3TAJA 4GD5A 3K1PA 3T93B 3TZAA 4RPNA 4RYAA 3SERA 1A8EA 5CMCA 4Q0CA 4U22A 4JB7A 3C9HA 3N26A 1MQIA 5H8HA 2E1SA 1N04A 5FTHA 1SW1A 2QS1A 2DS9A 1Y4CA 4F1VA 1IXGA 3DELB 4G8HA 4H5FA 3IOUA 3VVFA 4YKPA 1EZ9A 3USDA 3QUJA 4NF4B 2REGA 1H76A 1BLFA 1YTVA 1ZBMA 1SVXB 1B7HA 2XX7A 5CRYA 4UA8A 4NE4A 1B52A 2RC9A 5H8HB 4G68B 1POY1 3KJTA 2H4IA 3LUYA 1MQHA 3EF7A 2PX1A 3ZSFA 1D4NA 3VLUA 3T66A 3OO9A 5I59B 2CZLA 4IB2A 1SW5A 2UYEA 4FJPA 4OETA 4QFPA 4DCYA 3U92A 4LZ8A 2W7YA 2XD3A 3BKIB 1FQEA 4KYDA 3Q26A 3GZGA 1QKAA 3B6WA 3HV1A 3O97A 4EF2A 1D3KA 4PQJA 1PB8A 3MJNA 1YPNA 1ANFA 2YJPA 3PGFA 1LAGE 4NEDA 5AE4A 3CI8A 3DP4A 2WKYA 1FQCA 4TLMB 2OBGA 1B5HA 2F6GA 2PVUA 4HCWA 2H99A 1BP5A 3PU5A 3KGCA 2ZNUA 5FHMA 3U94A 4F3PA 3H6WA 5ICQA 4FEDA 4QF9A 4C0RA 2VHAA 3H6UA 4DXUA 5IKBA 4F29A 2ONSA 2DOJA 1GV8A 4YKKA 1PBQA 3TTKA 4G68C 3CRBA 3EHTA 1PBPA 4YKJA 2VP1A 1H3DA 3IOWA 3M3KA 3UP9A 2O1MA 1SQYA 1TFDA 1P1QA 3K6WA 3MP6A 1T0KA 1MDQA 1OQHA 1B5IA 3OMBA 4FORA 3S9EA 4GRKA 4F3GA 3SEWA 1AOVA 1Y9UA 3OO6A 1MG1A 4R6KA 4XKNA 3C36A 3ILTB 4EUOA 2ZNTA 3TMGA 2M8CA 1N76A 4F2OA 5EHMA 2FA7A 1B51A 3DP8A 1TWYA 3KJ7A 3KSXA 1USYH 5AA3A 4POXA 3G3KA 4JDFA 1WODA 1RYXA 4LP2B 1I6AA 2CMOA 2GHAA 3RTWB 2RCBA 1A54A 1LB9A 4JWXA 3SDFA 1MPDA 5TU0A 2O69A 4DXBA 3MBPA 4OFJA 3FIRA 4OEVA 1IZ1A 4PFYA 5I2KA 2F6PA 1MY3A 5EYFA 4U1OA 1B3LA 4G8MA 1FTOA 3MPLA 3R7XA 4RY1A 2F97A 4QRZA 1GGGA 1KWHA 4ZECA 2B65A 4R6YA 1IQ7A 1LLSA 5I2KB 1LAFE 1IXCA 1AIVA 1URDA 4XIGQ 1O7TA 4OERA 1IXIA 3FXQA 3KEIA 4TQUQ 1GTKA 3E9XA 2I48A 2R6GE 2HCAA 3HHGA 4IO5A 4ZE8A 3S9MC 3PD8A 3FUZA 1VFEA 5K2XA 3MVZA 4M1VA 4YMAA 4G4PA 3RUMA 3K1MA 3FVNA 2BJJX 2F7CA 3TQWA 3FATA 4FEBA 3THIA 5CC2A 5ELVA 1MQGA 4U4XA 4RK9A 2ZNSA 1FQBA 4EQ9A 3TYHA 4BDMA 3MP8A 1SD3A 1EH3A 3GBAA 4ECFA 3M3FA 1JEVA 3PUXE 1B46A 2VGQA 3PPQA 4LA9A 2NVUB 1USYE 5CMKA 1MM6A 2DVZA 3RN8A 1YAEA 2X26A 3SESA 2O7UA 3TODA 2AIXA 2UXAA 1QULA 3K6VA 4NF8B 4G77A 1M5DA 3RT6B 2A5SA 5KCJA 1MRPA 4LQ2A 3QAXA 3L6HA 5AA2A 1MY0A 2Z22A 1N3XA 3DM0A 2F34A 3IR1A 3PD9A 2RC7A 4KI0E 4YB5A 4YU0A 1I6QA 4JWYA 5I58A 3CFZA 1JW4A 1H44A 5ITOA 1FW0A 4ZS9A 2Y7RA 5KCJB 4WEPA 4RPOA 1ELJA 5AA2B 1ZU0A 4NF5B 5TPAA 3Q28A 5L9MA 1DOTA 3ONMA 1ZMGA 3PPNA 1FQDA 2XXHA 4Z0IA 3LSLA 1NNTA 4G2ZA 3SETA 1B3GA 2A5TB 4TOZA 1LCFA 1AL3A 1LCTA 4Z7EA 4GLIA 3M8UA 1MXUA 3OELA 5DVFA 3FASA 4AB6A 2XX8A 3MPKA 3UN6A 2ABHA 4KYSA 2RINA 4R2BA 2H98A 3MP1A 2ZMBA 2DVCA 5CI5A 1A99A 3CIJA 4AQ4A 4FECA 4GIZA 4F1UA 1SYHA 2R9JA 2Q2AA 3H3GA 1ZJLA 4NF6B
chains in the Genus database with same CATH superfamily
5A5LA 3FGSA 2Q89A 2VT5A 3BBRA 2OCUA 3WAFA 3FD3A 3QK6A 4HXVA 3D4CA 2VPOA 2UYFA 1TT1A 4GWUA 4BLAA 1II5A 2OLBA 3T0JA 4ESWA 4E0WA 5A5XA 1PC3A 4H67A 4KCDA 5F1QA 2Y7KA 2B4LA 1NV3A 3MVYA 2HFBA 4YB7A 4EQBA 5FBPA 1SW2A 4NF4A 2ZYNA 1DSNA 2ZYMA 2QFLA 3Q29A 2XXRA 4PAFA 2OK2A 2YPNA 4EXKA 3C34A 2DP8A 4G68A 1GVCA 3TUSA 5A5XB 1OVTA 4HE2A 3MVWA 1MPBA 3IB2A 1A8FA 2DE3A 3SEUA 3KZGA 1FPJA 4PGNA 1Y1MA 4LZ5A 2DWJA 3HSTA 3IFAA 2Z23A 3S2VA 2KQZA 1B05A 5I59A 1MS7A 3AXFA 1LAHE 2XXKA 2V3TA 2WYPA 4G8NA 4P8BA 1VR5A 4OEUA 1TFAA 1Y3PA 3I3VA 3K4UA 3T22A 4N17A 2DDKA 4MNIA 3T9VA 3PTYA 2UVJA 3N6TA 3K2DA 3C33A 1FBDA 5FHNA 3VE1B 2PFYA 2QPQA 4IGRA 3TTNA 4ELOA 2QVVA 3MZ9A 5F24A 2QVRA 4IR8A 3E3KA 2NXOA 4OFLA 2I4BA 4PFTA 2NOOA 3HN0A 1SW4A 4KHZE 5ICTA 2RKMA 4WXJA 3EKIA 3PPOA 5JTYA 3OSQA 4H0WA 1LFGA 3B50A 2G93A 3FVGA 2UVHA 1J1NA 5DW8A 1VFDA 3LC8A 1US4A 4YICA 5ET8A 4U21A 4QFLA 2D3IA 1IIWA 4MMPA 4IO7A 4ELRA 1NKXA 2XD2A 4QFNA 1FQFA 5I56B 2QRYA 5HM4B 3QUFA 5JTYB 2H9BA 3MZ1A 3LSXA 4GX6A 2E0SA 1LBWA 4DCXA 2OWZA 3GLBA 4H45A 2I3VA 2XWOA 2XXXA 4IO4A 4F39A 1ZKBA 3IOTA 2PMSA 4PFBA 3EHSA 3UA8A 4AB5A 1LAXA 3OEKA 4YMBA 1HSEA 2ZZXA 2DE4A 2Y84A 5DTBA 4NN3A 5B70A 1M5CA 4E0XA 1B3HA 4PFRA 1N0TA 4NTLA 1B0HA 1B58A 3V89B 1GR2A 3O6GA 1UTHB 2F7AA 2QSXA 1FCKA 2QS2A 3Q25A 2DYXA 1OMPA 1JEUA 1H43A 1QW0A 4PFUA 4F3BA 1BTJA 1R9QA 4OVTA 1Y1ZA 4RA1A 5IM2A 4WEDA 2GRVA 2MKZA 1DMBA 4NQ8A 5HBCA 2FNCA 3G3JA 4FAJA 2OJTA 1R9LA 4KYEA 1B3EA 5TP9B 4MLQA 2F78A 1ZLQA 3SEYA 4LZ7A 2V3QA 3KN3A 3LBSA 1IMDA 1OIBA 2UVIA 4IO6A 2H25A 3VVEA 1B4ZA 2O6AA 1LGBC 2HXWA 1NFTA 5DT6A 3CFLA 1I6BA 3CFXA 1XOCA 4OA4A 3IK6B 1MXWA 1B7UA 4R9GA 4I9DA 3O9PA 1P1OA 4U23A 4U2RA 1B9JA 1FPFA 4Q30B 1VE4A 5LOMA 4HE0A 4BDOA 2V4CA 2PT2A 2XXTA 2XA5A 2F36A 4YAHX 2Q9TA 3G3HA 4EQ7A 2Y7WA 4ZE9A 1SBPA 4OHNA 4H5GA 4P0GA 3CSBA 2FBPA 1RDYA 4HTGA 1FPKA 4F19A 5JEIA 4GOTA 4JSDA 3LSFB 1FTKA 1DTZA 3B6TA 3RNNA 5BUUA 3O28A 1UQWA 2WYKA 4P9KA 2CZHA 4I1DA 4LVQA 5CBRA 1NMUA 1DPEA 4ZZEA 2ZYOA 4ZDMA 1P1UA 3IB0A 5EYHA 1SI1A 1M5BA 1P99A 1R6ZA 4P3LA 5DVIA 4NGUA 4H8JA 3GYYA 1XHYA 4GWYA 1FBGA 2HZKA 4P11A 3KG2A 1B5JA 1SI0A 3JYRA 3UK4A 2OX3A 4C1TA 2X7QA 3QSLA 3CSGA 4IY6A 2O84X 2I4CA 5ISUA 4N13A 3K01A 1LBYA 1IUDA 1DK4A 3ZS6A 3U65A 3A3CA 3MW0A 2Z8EA 3TTRA 3ZKKA 1S9TA 3BIGA 4KD5A 5EQ8A 3MUQA 3PPPA 4XKPA 4FIMA 1O63A 1PB7A 2HPGA 3WAEA 3S9NC 5EQ7A 3MVXA 4DXCA 3T9UA 1CB6A 1B6HA 1ZTYA 1K9YA 3KN8A 3SEXA 1OVBA 1RDXA 3C35A 4LATA 3RQTA 3T96B 5I2NA 4QHQA 4QSEA 5BWJA 1SDXA 4GXAA 4NF8A 3RPWA 3HCQA 3R6UA 1JW1A 3TTMA 4X1BA 3D1RA 1LFIA 4MLVA 3G3GA 2DWIA 4KR5A 3VV5A 4AS5A 3PUYE 3TKDA 2UVGA 3C32A 4P0IA 4OVSA 1FPGA 2QMWA 1XC1A 4F2QA 5I2NB 1F9BA 3OOAA 2Q8JA 1N7WA 2I49A 4OQOA 3VLVA 5T3JA 4XFEA 2GH9A 3EHUA 3QYTA 4NF5A 3CHGA 1XVYA 2QS3A 4I8CA 4P1LA 4X9TA 3VLWA 5J16A 4GL0A 4KQPA 2DWHA 3IFCA 2LAOA 2A5TA 2F5XA 3FXUA 1WVJA 3G3FA 2DXRA 2XXPA 3IX1A 1NV6A 1TXFA 1EYIA 5FHOA 4MH5A 4R74A 5KDTB 3U93A 1QVSA 2D21A 4GL8A 2REJA 2QL3A 5J1DA 2FIEA 2RCAA 1QGXA 1KA1A 3VXBA 1NNKA 2CEYA 2O51A 2XXUA 4GF8A 2WEFA 4PAIA 1A7LA 3MSTA 4NF6A 2XXYA 3T9HB 5JK4A 1HSJA 4X8RA 2XX9A 4OZ9A 1NV7A 3RY3A 1D9YA 1S50A 3DP6A 4MNPA 3MC2A 3IJOB 2V3UA 3N94A 4ND9A 2QS4A 5H8NA 4PDDA 1MH4A 3W15C 4OTEA 4PE5B 2QVUA 5DVJA 4N6KA 3QXMA 4H65A 4P56A 4MF3A 3B7DA 1SYIA 2Z8DA 4LQ5A 4NWDA 3H6TA 3UORA 2ONKE 4TLLB 2DE2A 1R1NA 3QMFA 1QJMA 1NL5A 4H1XA 4IO2A 5CMMA 2R8TA 2G29A 1PEBA 2I0CA 3LR1A 3H03A 1LBZA 5H8NB 4LONB 2O68A 5DEXA 1JVYA 4OVPA 3RPLA 1FQAA 4ISUA 2B3FA 3ILUB 4C1UA 4HE1A 5HPQA 2P1SA 1POTA 3PUWE 1UIVA 3TCGA 3EN3A 3TQLA 4GWZA 2VD2A 4AS4A 1BKAA 4JBZA 3PUVE 3OO7A 2Q74A 2DQVA 3P7IA 5M2VA 2HQ0A 4ZEDA 3IL1B 3GXAA 4X1DA 2P3NA 1G0IA 4Q8RA 3LSWA 2JJKA 1NNFA 2I58A 5DEXB 2YLNA 2GHBA 3RPLB 3E4RA 1P1NA 3MZBA 4HW8A 2Q2CA 1XT8A 2V25A 2ZXTA 4OVJA 1MY2A 3PUZE 2HHMA 3FJ7A 5FTIA 3O66A 4O7IA 1IXHA 3ECRA 3RT8A 1DTGA 1EU8A 3FXBA 4F22A 1JVXA 4DI4B 3FVKA 4PP0A 4U4SA 3R26A 2XXVA 4I40A 1B4HA 4PC9A 2KR0A 4IY5A 5K2YA 4OMBA 2THIA 5L9SA 3IO4A 3O2AA 5I56A 5F7VA 2F35A 3UGWA 3VVDA 1LBCA 1Q35A 4O3AA 4UABA 1XI6A 1MXVA 5AA1A 5AA2D 1NV2A 3FVOA 2Y7PA 1L5TA 3KSJA 4WKMA 1CNQA 1XS5A 4XTCQ 2Y5KA 5KZTA 2P0SA 2P3VA 4PBQA 3BIHA 3MAMA 4MJOA 3V8XB 2QMXA 4GWSA 1JETA 4PCDA 4H46A 4MBPA 1AMFA 1VSOA 3ZKLA 3RTFB 4POWA 4JVDA 4GFRA 1UTHA 4BDLA 2ANJA 4EXLA 3FV1A 1RYOA 3BFUA 4FBPA 4O94A 1D9QA 3OSRA 1JNFA 2O1LA 3OENA 1QUIA 1KZ8A 3H6VA 3K6UA 4GWOA 1MY4A 4N91A 1A55A 1MY1A 3FJMA 4LN5A 1A40A 4ZEFA 5TP9A 2B4MA 4FE8A 2VD3A 2HAUA 2O7IA 3G3IA 1H45A 3UIFA 1FTLA 1MPCA 4OYVA 3TELA 1HSLA 4RNSA 2DSFA 3PMVA 4O3CA 1FTJA 1NI9A 4GQOA 3TFLA 3Q27A 1QUJA 1Z7ME 4F3SA 4GVOA 2PBWA 1EYKA 1FBCA 3U8QA 1N84A 1RKMA 4H8IA 3CVGA 3H4ZA 3SEVA 1Y4TA 2F3BA 5DYHA 3H06B 2XWIA 3G7WA 4M4GA 1DCUA 2HXRA 1YCJA 1URSA 2Z8FA 2XXWA 3PMXA 3HPIA 3IB1A 2DXYA 4KPTA 4ZEBA 3MYUA 4NG7A 1B40A 3HO7A 4UACA 1LEVA 4X48A 1IITA 4F31B 3CG1A 4KCCA 3K00A 4R72A 3EQ1A 5I5PA 4JXIA 4RK2A 4QFKA 1MQDA 1MH3A 4IGTA 4FATA 3MQ9A 2WBBA 3IORA 4MIJA 3K1NA 4N4UA 4HS7A 2AYSA 4OENA 2Q8MA 2AL4A 3V5AA 4XKRA 4O3BA 1INPA 1URGA 2RF1A 4JSOA 3K0VA 4N8YA 3S9LC 5I3SA 2I3WA 3OXNA 2F8DA 1O64A 3O29A 4OVQA 3VFJA 1S7YA 1EZPA 4ONYA 1PB9A 3CG3A 2HEUA 4GBVA 4H6DA 4BDNA 3CR9A 3A3UA 1ZIUA 2D5WA 3TEPA 5LTCA 2F7BA 2I6EA 1DPPA 1MXXA 2IA4A 3EPEA 4N6PA 2ONRA 3E78A 2DWAA 1PDAA 4F1YA 3TCHA 3PMWA 2QJEA 4BDQA 2FIXA 4RXLA 2Y7IA 3ODBA 2OZZA 2ZZWA 3HHFA 1M5FA 1I69A 5IZ1A 3IOVA 3MWBA 4OFOA 1NV4A 2PT1A 4R9FA 2KLFA 1B1XA 2Q88A 2Y5LA 1FJ9A 5EQ9A 3PPRA 4K3FA 4ZZAA 1FPDA 2L5VA 1B0LA 3TDJA 2HZLA 1NH7A 5EHSA 3E13X 2RC8A 2V84A 4NX1A 3M3LA 1UTBA 5L9OA 1Y20A 2NUVA 3K6XA 2R71A 2ESNA 1NNPA 3OD7A 3C31A 4R6HA 4PE3A 2PFZA 1IMCA 2XXQA 2X7PA 2VOZA 4YZZA 1EZOA 4Q5TA 5ITPA 3TPAA 3L6GA 3I5OA 1UTBB 1K9ZA 2OWTA 1FPBA 4I3YA 5I84A 1CE2A 4LUBA 3W9WA 4PFWA 1MXZA 4MEVA 4MFIA 1LFHA 2GFEA 3KOSA 1D9VA 4DDDA 4ESXA 3IAZA 5CBSA 2I0BA 4RJZA 1FBHA 3C4MA 4NHBA 4N07A 3I6VA 2HAVA 4R2FA 2XHDA 3IO6A 2V93A 4THIA 3N6UA 2B3BA 4PETA 3N5LA 4QSCA 4GBWA 4F18A 4PTKA 1Y3NA 3U1OA 4OXVA 3H7MA 1MDP1 1B3FA 4DE8A 3OO8A 3A09A 3D4GA 5I57A 5KDTA 5AA4A 1B2HA 1UIUA 4GX3A 3TCFA 4QFOA 5H8SA 4YB6A 4N81A 4U1ZA 4BDRA 5CM6A 1LBBA 4NMYA 3LV0A 2F3DA 1XVXA 3RGYA 1US5A 1B1HA 1WDNA 1Z7NE 3BFTA 3W9VA 3FJGA 3JV9A 1Y3QA 1FTMA 4N8GA 1SPIA 1OQGA 2NWJA 3RLFE 2P2AA 5I57B 1Q1KA 4QSDA 4EDPA 1ATGA 1LBVA 1MM7A 5IZ3B 5AA4B 3K02A 1OLAA 5H8QA 1AH5A 1P1WA 4I62A 4ZEKA 3U72A 2XXIA 3O6HA 5IAIA 3DLNA 4GXSB 1B32A 4OESA 1N7XA 1N3WA 4XXUA 3QIMA 4DLDA 1OLCA 4MCOA 2WX9A 3KOTA 1QKBA 5B7DA 1IEJA 4YKIA 3S4UA 5I58B 1MQJA 3FXRA 5H8QB 5L8DA 2FYIA 3T9XB 4R73A 4L17A 4KFQA 3TTLA 2ZYKA 3O6IA 4OWDA 3ROJA 1M5EA 1NH8A 1LB8A 1BIYA 5LDZA 5TPAB 1YXIA 3JZJA 1JQFA 4HCYA 2H5YA 4DZ1A 3V83A 4ZEIA 5EQAA 3KN7A 3F11A 3VXCA 3ISPA 4R75A 5H8FA 1B7ZA 1MXYA 3VDFA 4ELQA 2ALUA 3KBRA 1LSTA 3KFMA 3FV2A 4ELPA 3FZVA 3GBBA 4NWCA 4JWOA 4MX6A 3SKPA 3PV0E 5CMBA 2IEEA 3B6QA 1FBEA 2AL5A 3OEMA 4XKQA 4IO3A 4X04A 4N6DA 4DIGA 2OWSA 5H8FB 4EF1A 1EYJA 1FPEA 1JW5A 1QUKA 2PYYA 3IJXB 3TAJA 4GD5A 3K1PA 3T93B 3TZAA 4RPNA 4MHFA 4RYAA 3SERA 1A8EA 5CMCA 4Q0CA 4U22A 1FJ6A 4JB7A 3C9HA 3N26A 1MQIA 5H8HA 2E1SA 1N04A 5FTHA 1SW1A 2QS1A 2DS9A 1Y4CA 1IMEA 4F1VA 1IXGA 3DELB 4G8HA 4H5FA 3IOUA 3VVFA 4YKPA 1EZ9A 3USDA 3QUJA 4NF4B 4PAKA 2REGA 1H76A 1BLFA 1YTVA 1ZBMA 1SVXB 1B7HA 2XX7A 5CRYA 4UA8A 4NE4A 1B52A 2RC9A 5H8HB 1FBPA 4G68B 3A29A 1POY1 4PDHA 3KJTA 2H4IA 3LUYA 1MQHA 3EF7A 2PX1A 3ZSFA 1D4NA 3VLUA 3T66A 3OO9A 5I59B 2CZLA 4IB2A 1JP4A 1SW5A 4KXPA 1NV1A 1BK4A 1NUXA 2UYEA 4FJPA 4OETA 4GWWA 4QFPA 2CZKA 4DCYA 1FPIA 3U92A 4LZ8A 4PGPA 2PCRA 2W7YA 2XD3A 3BKIB 1G0HA 1NUZA 1FQEA 4KYDA 1NUWA 3Q26A 4QXDA 4OVRA 3GZGA 1QKAA 3B6WA 4I3EA 3HV1A 3SZPA 4MAGA 3O97A 4EF2A 1D3KA 4PQJA 4PF8A 1PB8A 3MJNA 1YPNA 1ANFA 2YJPA 3PGFA 1LAGE 1FPLA 4NEDA 5AE4A 3CI8A 3DP4A 2WKYA 5ET5A 4PF6A 1FQCA 4TLMB 2OBGA 1B5HA 2F6GA 2PVUA 4HCWA 2H99A 1BP5A 3PU5A 3KGCA 1IMFA 5ET6A 2ZNUA 5FHMA 3U94A 4F3PA 3H6WA 5ICQA 4G61A 4FEDA 4QF9A 4P47A 5I7IA 5IGAA 4C0RA 2VHAA 3H6UA 5ET7A 4DXUA 5IKBA 4P1EA 4F29A 2ONSA 2DOJA 1GV8A 1IMBA 4YKKA 1NV0A 1PBQA 3TTKA 4G68C 3CRBA 3EHTA 1PBPA 4YKJA 4DI3D 2VP1A 2XWVA 3KC0A 5EYGA 1H3DA 3IOWA 3M3KA 3UP9A 1NV5A 3RYDA 2O1MA 1SQYA 1TFDA 1P1QA 3K6WA 1KA0A 3MP6A 1FBFA 1T0KA 1MDQA 3T1BA 3HFUA 1OQHA 1B5IA 3OMBA 4FORA 3S9EA 2ZZVA 4GRKA 4F3GA 2FVZA 3SEWA 4OANA 1AOVA 1Y9UA 3OO6A 1YZ0A 1MG1A 4R6KA 4XKNA 3C36A 1FTAA 3ILTB 4EUOA 2ZNTA 4O8MA 3TMGA 2M8CA 1N76A 5IZZA 4F2OA 5EHMA 2FA7A 1B51A 4PBHA 3DP8A 1TWYA 3KJ7A 3KSXA 1USYH 3LUZA 5AA3A 3NOHA 4POXA 3G3KA 4QBAA 4NF0A 4JDFA 1WODA 1RYXA 4XF5A 4LP2B 1I6AA 1IMAA 2CMOA 2GHAA 3RTWB 2RCBA 1A54A 4MNCA 1LB9A 4JWXA 3B8BA 3SDFA 1MPDA 3KBZA 5TU0A 2O69A 4DXBA 3MBPA 4OFJA 3FIRA 4OEVA 1IZ1A 4PFYA 4XEQA 5I2KA 1FSAA 4JVCA 2F6PA 1MY3A 5EYFA 4U1OA 1B3LA 4G8MA 1FTOA 3MPLA 3R7XA 4RY1A 2F97A 4QRZA 1GGGA 1KWHA 4ZECA 2B65A 4R6YA 1IQ7A 1LLSA 5I2KB 1LAFE 1IXCA 1AIVA 1URDA 4XIGQ 1O7TA 4OERA 1IXIA 3FXQA 3KEIA 4TQUQ 1GTKA 3E9XA 2I48A 2R6GE 1DBZA 2HCAA 3HHGA 4IO5A 4ZE8A 3S9MC 3PD8A 2VPNA 3FUZA 1VFEA 5K2XA 3MVZA 4M1VA 4YMAA 1NUYA 2CEXA 4G4PA 3RUMA 3K1MA 3FVNA 2BJJX 2F7CA 3TQWA 3FATA 4FEBA 3THIA 5CC2A 5ELVA 1MQGA 4U4XA 4RK9A 2ZNSA 1FQBA 4EQ9A 3TYHA 4BDMA 3MP8A 1SD3A 1EH3A 3GBAA 3E79A 4ECFA 3M3FA 1JEVA 3PUXE 1B46A 1Q9DA 2VGQA 3PPQA 4LA9A 2NVUB 1USYE 5CMKA 1MM6A 2CZIA 2DVZA 3RN8A 1YAEA 2X26A 1AWBA 3SESA 2O7UA 3TODA 5IZ3A 1FRPA 2AIXA 2UXAA 1QULA 3K6VA 3KC1A 4NF8B 4G77A 1M5DA 2BJIA 3RT6B 2A5SA 5KCJA 1MRPA 4LQ2A 3QAXA 3L6HA 5AA2A 1MY0A 2Z22A 1N3XA 3DM0A 2F34A 3IR1A 3PD9A 2RC7A 4KI0E 4YB5A 4YU0A 1I6QA 4JWYA 5I58A 3CFZA 1JW4A 1H44A 5ITOA 1FW0A 4ZS9A 2Y7RA 5KCJB 4WEPA 4RPOA 1ELJA 5AA2B 1ZU0A 4NF5B 5TPAA 2GQ1A 3Q28A 5L9MA 4NAPA 1DOTA 3ONMA 1ZMGA 3PPNA 1FQDA 2XXHA 4Z0IA 3LSLA 1NNTA 4G2ZA 3SETA 1B3GA 2A5TB 4TOZA 1LCFA 1AL3A 1LCTA 2XWKA 4Z7EA 4GLIA 4GWXA 3M8UA 1MXUA 1VDWA 3FBPA 3OELA 5DVFA 3FASA 4AB6A 2XX8A 3MPKA 3UN6A 2ABHA 1LBXA 2FHYA 4KYSA 4N15A 2RINA 4GX4A 4JVIA 1YYZA 4R2BA 2H98A 3MP1A 2ZMBA 2WBDA 4PFIA 2DVCA 5CI5A 1A99A 3CIJA 4AQ4A 4O7MA 5ESYA 4FECA 4GIZA 4F1UA 1SYHA 2R9JA 2Q2AA 3H3GA 1RDZA 1ZJLA 4NF6B
chains in the Genus database with same CATH topology
3FGSA 2Q89A 3BBRA 2OCUA 3WAFA 3FD3A 3QK6A 3D4CA 2UYFA 1TT1A 4BLAA 1II5A 2OLBA 4ESWA 4E0WA 5A5XA 1PC3A 4H67A 4KCDA 5F1QA 2Y7KA 3MVYA 2HFBA 4YB7A 4EQBA 1SW2A 4NF4A 2ZYNA 1DSNA 2ZYMA 3Q29A 2XXRA 2OK2A 2YPNA 4EXKA 3C34A 2DP8A 4G68A 1GVCA 3TUSA 5A5XB 1OVTA 3MVWA 1MPBA 3IB2A 1A8FA 2DE3A 3SEUA 3KZGA 1Y1MA 4LZ5A 2DWJA 3HSTA 2Z23A 3S2VA 1B05A 5I59A 1MS7A 3AXFA 1LAHE 2V3TA 4G8NA 1VR5A 4OEUA 1TFAA 1Y3PA 3I3VA 3K4UA 3T22A 3T9VA 2UVJA 3N6TA 3K2DA 3C33A 5FHNA 3VE1B 2QPQA 4IGRA 3TTNA 4ELOA 3MZ9A 3E3KA 2NXOA 4OFLA 2I4BA 4PFTA 2NOOA 3HN0A 1SW4A 4KHZE 5ICTA 2RKMA 4WXJA 3PPOA 5JTYA 3OSQA 4H0WA 1LFGA 2G93A 3FVGA 2UVHA 1J1NA 1VFDA 3LC8A 1US4A 4YICA 4U21A 4QFLA 2D3IA 1IIWA 4IO7A 4ELRA 1NKXA 2XD2A 4QFNA 1FQFA 5I56B 2QRYA 5HM4B 3QUFA 5JTYB 2H9BA 3MZ1A 3LSXA 2E0SA 4DCXA 3GLBA 2I3VA 2XXXA 4IO4A 4F39A 1ZKBA 3IOTA 2PMSA 3EHSA 3UA8A 4AB5A 1LAXA 3OEKA 4YMBA 1HSEA 2DE4A 2Y84A 5DTBA 5B70A 1M5CA 4E0XA 1B3HA 1N0TA 4NTLA 1B0HA 1B58A 3V89B 1GR2A 3O6GA 1UTHB 2F7AA 2QSXA 1FCKA 2QS2A 3Q25A 2DYXA 1OMPA 1JEUA 1H43A 1QW0A 4PFUA 4F3BA 1BTJA 1R9QA 1Y1ZA 4RA1A 4WEDA 2GRVA 1DMBA 5HBCA 2FNCA 3G3JA 4FAJA 2OJTA 1R9LA 4KYEA 1B3EA 5TP9B 4MLQA 2F78A 1ZLQA 3SEYA 4LZ7A 2V3QA 3KN3A 3LBSA 1OIBA 2UVIA 4IO6A 2H25A 3VVEA 1B4ZA 2O6AA 1LGBC 2HXWA 1NFTA 5DT6A 3CFLA 1I6BA 3CFXA 1XOCA 3IK6B 1MXWA 1B7UA 4R9GA 4I9DA 3O9PA 1P1OA 4U23A 4U2RA 1B9JA 4Q30B 1VE4A 5LOMA 4BDOA 2PT2A 2XXTA 2F36A 4YAHX 2Q9TA 3G3HA 4EQ7A 2Y7WA 4ZE9A 1SBPA 4OHNA 4H5GA 4P0GA 3CSBA 4HTGA 4F19A 5JEIA 4GOTA 4JSDA 3LSFB 1FTKA 1DTZA 3B6TA 3RNNA 5BUUA 3O28A 1UQWA 4I1DA 4LVQA 5CBRA 1NMUA 1DPEA 4ZZEA 2ZYOA 4ZDMA 1P1UA 3IB0A 1SI1A 1M5BA 1P99A 1R6ZA 5DVIA 4H8JA 1XHYA 2HZKA 4P11A 3KG2A 1B5JA 1SI0A 3JYRA 3UK4A 4C1TA 2X7QA 3QSLA 3CSGA 4IY6A 2O84X 2I4CA 5ISUA 4N13A 3K01A 1IUDA 3ZS6A 3A3CA 3MW0A 2Z8EA 3TTRA 3ZKKA 1S9TA 4KD5A 3MUQA 3PPPA 4XKPA 4FIMA 1O63A 1PB7A 3WAEA 3S9NC 3MVXA 4DXCA 3T9UA 1CB6A 1B6HA 1ZTYA 3KN8A 3SEXA 1OVBA 3C35A 4LATA 3RQTA 3T96B 5I2NA 4QHQA 4QSEA 5BWJA 1SDXA 4GXAA 4NF8A 3RPWA 3HCQA 3R6UA 1JW1A 3TTMA 4X1BA 1LFIA 4MLVA 3G3GA 2DWIA 4KR5A 3VV5A 3PUYE 3TKDA 2UVGA 3C32A 4P0IA 2QMWA 1XC1A 4F2QA 5I2NB 1F9BA 3OOAA 2Q8JA 1N7WA 2I49A 4OQOA 3VLVA 2GH9A 3EHUA 3QYTA 4NF5A 1XVYA 2QS3A 4I8CA 4X9TA 3VLWA 4GL0A 4KQPA 2DWHA 2LAOA 2A5TA 2F5XA 3FXUA 1WVJA 3G3FA 2DXRA 2XXPA 3IX1A 1TXFA 5FHOA 4MH5A 4R74A 5KDTB 3U93A 1QVSA 2D21A 4GL8A 2REJA 2QL3A 5J1DA 2RCAA 3VXBA 1NNKA 2O51A 2XXUA 4GF8A 1A7LA 4NF6A 2XXYA 3T9HB 5JK4A 1HSJA 2XX9A 4OZ9A 3RY3A 1D9YA 1S50A 3DP6A 3MC2A 3IJOB 2V3UA 3N94A 4ND9A 2QS4A 5H8NA 1MH4A 3W15C 4OTEA 4PE5B 5DVJA 3QXMA 4H65A 4MF3A 3B7DA 1SYIA 2Z8DA 4LQ5A 4NWDA 3H6TA 3UORA 2ONKE 4TLLB 2DE2A 1R1NA 1QJMA 1NL5A 4H1XA 4IO2A 5CMMA 2G29A 1PEBA 2I0CA 3LR1A 3H03A 5H8NB 4LONB 2O68A 5DEXA 1JVYA 1FQAA 4ISUA 2B3FA 3ILUB 4C1UA 5HPQA 2P1SA 1POTA 3PUWE 1UIVA 3TCGA 3EN3A 3TQLA 2VD2A 1BKAA 4JBZA 3PUVE 3OO7A 2DQVA 3P7IA 5M2VA 2HQ0A 4ZEDA 3IL1B 3GXAA 4X1DA 4Q8RA 3LSWA 1NNFA 2I58A 5DEXB 2YLNA 2GHBA 3E4RA 1P1NA 3MZBA 4HW8A 2Q2CA 1XT8A 2V25A 2ZXTA 4OVJA 1MY2A 3PUZE 3FJ7A 5FTIA 3O66A 1IXHA 3ECRA 3RT8A 1DTGA 1EU8A 4F22A 1JVXA 3FVKA 4PP0A 4U4SA 3R26A 2XXVA 1B4HA 4IY5A 5K2YA 4OMBA 2THIA 5L9SA 3IO4A 3O2AA 5I56A 5F7VA 2F35A 3UGWA 3VVDA 1LBCA 1Q35A 4O3AA 1MXVA 5AA1A 5AA2D 3FVOA 2Y7PA 1L5TA 3KSJA 4WKMA 1XS5A 4XTCQ 5KZTA 2P0SA 3MAMA 3V8XB 2QMXA 1JETA 4MBPA 1AMFA 1VSOA 3ZKLA 3RTFB 4POWA 4GFRA 1UTHA 4BDLA 2ANJA 4EXLA 3FV1A 1RYOA 3BFUA 3OSRA 1JNFA 2O1LA 3OENA 1QUIA 3H6VA 3K6UA 4GWOA 1MY4A 1A55A 1MY1A 3FJMA 1A40A 4ZEFA 5TP9A 4FE8A 2VD3A 2HAUA 2O7IA 3G3IA 1H45A 3UIFA 1FTLA 1MPCA 4OYVA 3TELA 1HSLA 4RNSA 2DSFA 3PMVA 4O3CA 1FTJA 4GQOA 3TFLA 3Q27A 1QUJA 1Z7ME 4F3SA 4GVOA 2PBWA 3U8QA 1N84A 1RKMA 4H8IA 3CVGA 3H4ZA 3SEVA 1Y4TA 5DYHA 3H06B 3G7WA 4M4GA 1YCJA 1URSA 2Z8FA 2XXWA 3PMXA 3HPIA 3IB1A 2DXYA 4KPTA 4ZEBA 1B40A 3HO7A 4UACA 4X48A 1IITA 4F31B 3CG1A 4KCCA 3K00A 4R72A 3EQ1A 4JXIA 4RK2A 4QFKA 1MQDA 1MH3A 4IGTA 4FATA 3MQ9A 3IORA 3K1NA 4HS7A 2AYSA 4OENA 2AL4A 3V5AA 4XKRA 4O3BA 1URGA 2RF1A 4JSOA 3K0VA 3S9LC 2I3WA 3OXNA 2F8DA 1O64A 3O29A 3VFJA 1S7YA 1EZPA 4ONYA 1PB9A 3CG3A 2HEUA 4H6DA 4BDNA 3CR9A 3A3UA 1ZIUA 2D5WA 3TEPA 2F7BA 2I6EA 1DPPA 1MXXA 2IA4A 3EPEA 4N6PA 2ONRA 2DWAA 1PDAA 4F1YA 3TCHA 3PMWA 2QJEA 4BDQA 4RXLA 2Y7IA 3ODBA 2OZZA 3HHFA 1M5FA 1I69A 3IOVA 3MWBA 4OFOA 2PT1A 4R9FA 2KLFA 1B1XA 2Q88A 3PPRA 4K3FA 4ZZAA 1B0LA 3TDJA 2HZLA 1NH7A 5EHSA 3E13X 2RC8A 2V84A 3M3LA 1UTBA 5L9OA 1Y20A 2NUVA 3K6XA 2R71A 2ESNA 1NNPA 3OD7A 3C31A 4R6HA 2XXQA 2X7PA 2VOZA 4YZZA 1EZOA 4Q5TA 5ITPA 3TPAA 3L6GA 3I5OA 1UTBB 2OWTA 5I84A 1CE2A 4LUBA 3W9WA 4PFWA 1MXZA 4MFIA 1LFHA 2GFEA 3KOSA 1D9VA 4DDDA 4ESXA 3IAZA 5CBSA 2I0BA 4RJZA 3C4MA 4N07A 3I6VA 2HAVA 4R2FA 2XHDA 3IO6A 2V93A 4THIA 3N6UA 2B3BA 4PETA 3N5LA 4QSCA 4F18A 1Y3NA 3U1OA 4OXVA 3H7MA 1MDP1 1B3FA 4DE8A 3OO8A 3A09A 3D4GA 5I57A 5KDTA 5AA4A 1B2HA 1UIUA 3TCFA 4QFOA 5H8SA 4YB6A 4U1ZA 4BDRA 5CM6A 1LBBA 4NMYA 1XVXA 3RGYA 1US5A 1B1HA 1WDNA 1Z7NE 3BFTA 3W9VA 3FJGA 3JV9A 1Y3QA 1FTMA 1OQGA 2NWJA 3RLFE 2P2AA 5I57B 1Q1KA 4QSDA 4EDPA 1ATGA 1MM7A 5AA4B 3K02A 1OLAA 5H8QA 1AH5A 1P1WA 4I62A 4ZEKA 3U72A 2XXIA 3O6HA 5IAIA 3DLNA 4GXSB 1B32A 4OESA 1N7XA 1N3WA 4XXUA 3QIMA 4DLDA 1OLCA 3KOTA 1QKBA 5B7DA 1IEJA 4YKIA 3S4UA 5I58B 1MQJA 3FXRA 5H8QB 5L8DA 2FYIA 3T9XB 4R73A 4L17A 4KFQA 3TTLA 2ZYKA 3O6IA 4OWDA 1M5EA 1NH8A 1LB8A 1BIYA 5TPAB 3JZJA 1JQFA 4HCYA 2H5YA 4DZ1A 3V83A 4ZEIA 3KN7A 3F11A 3VXCA 4R75A 5H8FA 1B7ZA 1MXYA 3VDFA 4ELQA 2ALUA 3KBRA 1LSTA 3KFMA 3FV2A 4ELPA 3FZVA 3GBBA 4NWCA 4JWOA 3SKPA 3PV0E 5CMBA 2IEEA 3B6QA 2AL5A 3OEMA 4XKQA 4IO3A 4DIGA 2OWSA 5H8FB 4EF1A 1JW5A 1QUKA 2PYYA 3IJXB 3TAJA 4GD5A 3K1PA 3T93B 3TZAA 4RPNA 4RYAA 3SERA 1A8EA 5CMCA 4Q0CA 4U22A 4JB7A 3C9HA 3N26A 1MQIA 5H8HA 2E1SA 1N04A 5FTHA 1SW1A 2QS1A 2DS9A 1Y4CA 4F1VA 1IXGA 3DELB 4G8HA 4H5FA 3IOUA 3VVFA 4YKPA 1EZ9A 3USDA 3QUJA 4NF4B 2REGA 1H76A 1BLFA 1YTVA 1ZBMA 1SVXB 1B7HA 2XX7A 5CRYA 4UA8A 4NE4A 1B52A 2RC9A 5H8HB 4G68B 1POY1 3KJTA 2H4IA 3LUYA 1MQHA 3EF7A 2PX1A 3ZSFA 1D4NA 3VLUA 3T66A 3OO9A 5I59B 2CZLA 4IB2A 1SW5A 2UYEA 4FJPA 4OETA 4QFPA 4DCYA 3U92A 4LZ8A 2W7YA 2XD3A 3BKIB 1FQEA 4KYDA 3Q26A 3GZGA 1QKAA 3B6WA 3HV1A 3O97A 4EF2A 1D3KA 4PQJA 1PB8A 3MJNA 1YPNA 1ANFA 2YJPA 3PGFA 1LAGE 4NEDA 5AE4A 3CI8A 3DP4A 2WKYA 1FQCA 4TLMB 2OBGA 1B5HA 2F6GA 2PVUA 4HCWA 2H99A 1BP5A 3PU5A 3KGCA 2ZNUA 5FHMA 3U94A 4F3PA 3H6WA 5ICQA 4FEDA 4QF9A 4C0RA 2VHAA 3H6UA 4DXUA 5IKBA 4F29A 2ONSA 2DOJA 1GV8A 4YKKA 1PBQA 3TTKA 4G68C 3CRBA 3EHTA 1PBPA 4YKJA 2VP1A 1H3DA 3IOWA 3M3KA 3UP9A 2O1MA 1SQYA 1TFDA 1P1QA 3K6WA 3MP6A 1T0KA 1MDQA 1OQHA 1B5IA 3OMBA 4FORA 3S9EA 4GRKA 4F3GA 3SEWA 1AOVA 1Y9UA 3OO6A 1MG1A 4R6KA 4XKNA 3C36A 3ILTB 4EUOA 2ZNTA 3TMGA 2M8CA 1N76A 4F2OA 5EHMA 2FA7A 1B51A 3DP8A 1TWYA 3KJ7A 3KSXA 1USYH 5AA3A 4POXA 3G3KA 4JDFA 1WODA 1RYXA 4LP2B 1I6AA 2CMOA 2GHAA 3RTWB 2RCBA 1A54A 1LB9A 4JWXA 3SDFA 1MPDA 5TU0A 2O69A 4DXBA 3MBPA 4OFJA 3FIRA 4OEVA 1IZ1A 4PFYA 5I2KA 2F6PA 1MY3A 5EYFA 4U1OA 1B3LA 4G8MA 1FTOA 3MPLA 3R7XA 4RY1A 2F97A 4QRZA 1GGGA 1KWHA 4ZECA 2B65A 4R6YA 1IQ7A 1LLSA 5I2KB 1LAFE 1IXCA 1AIVA 1URDA 4XIGQ 1O7TA 4OERA 1IXIA 3FXQA 3KEIA 4TQUQ 1GTKA 3E9XA 2I48A 2R6GE 2HCAA 3HHGA 4IO5A 4ZE8A 3S9MC 3PD8A 3FUZA 1VFEA 5K2XA 3MVZA 4M1VA 4YMAA 4G4PA 3RUMA 3K1MA 3FVNA 2BJJX 2F7CA 3TQWA 3FATA 4FEBA 3THIA 5CC2A 5ELVA 1MQGA 4U4XA 4RK9A 2ZNSA 1FQBA 4EQ9A 3TYHA 4BDMA 3MP8A 1SD3A 1EH3A 3GBAA 4ECFA 3M3FA 1JEVA 3PUXE 1B46A 2VGQA 3PPQA 4LA9A 2NVUB 1USYE 5CMKA 1MM6A 2DVZA 3RN8A 1YAEA 2X26A 3SESA 2O7UA 3TODA 2AIXA 2UXAA 1QULA 3K6VA 4NF8B 4G77A 1M5DA 3RT6B 2A5SA 5KCJA 1MRPA 4LQ2A 3QAXA 3L6HA 5AA2A 1MY0A 2Z22A 1N3XA 3DM0A 2F34A 3IR1A 3PD9A 2RC7A 4KI0E 4YB5A 4YU0A 1I6QA 4JWYA 5I58A 3CFZA 1JW4A 1H44A 5ITOA 1FW0A 4ZS9A 2Y7RA 5KCJB 4WEPA 4RPOA 1ELJA 5AA2B 1ZU0A 4NF5B 5TPAA 3Q28A 5L9MA 1DOTA 3ONMA 1ZMGA 3PPNA 1FQDA 2XXHA 4Z0IA 3LSLA 1NNTA 4G2ZA 3SETA 1B3GA 2A5TB 4TOZA 1LCFA 1AL3A 1LCTA 4Z7EA 4GLIA 3M8UA 1MXUA 3OELA 5DVFA 3FASA 4AB6A 2XX8A 3MPKA 3UN6A 2ABHA 4KYSA 2RINA 4R2BA 2H98A 3MP1A 2ZMBA 2DVCA 5CI5A 1A99A 3CIJA 4AQ4A 4FECA 4GIZA 4F1UA 1SYHA 2R9JA 2Q2AA 3H3GA 1ZJLA 4NF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGS A;  2Q89 A;  3BBR A;  2OCU A;  3WAF A;  3FD3 A;  3QK6 A;  3D4C A;  2UYF A;  1TT1 A;  4BLA A;  1II5 A;  2OLB A;  4ESW A;  4E0W A;  5A5X A;  1PC3 A;  4H67 A;  4KCD A;  5F1Q A;  2Y7K A;  3MVY A;  2HFB A;  4YB7 A;  4EQB A;  1SW2 A;  4NF4 A;  2ZYN A;  1DSN A;  2ZYM A;  3Q29 A;  2XXR A;  2OK2 A;  2YPN A;  4EXK A;  3C34 A;  2DP8 A;  4G68 A;  1GVC A;  3TUS A;  5A5X B;  1OVT A;  3MVW A;  1MPB A;  3IB2 A;  1A8F A;  2DE3 A;  3SEU A;  3KZG A;  1Y1M A;  4LZ5 A;  2DWJ A;  3HST A;  2Z23 A;  3S2V A;  1B05 A;  5I59 A;  1MS7 A;  3AXF A;  1LAH E;  2V3T A;  4G8N A;  1VR5 A;  4OEU A;  1TFA A;  1Y3P A;  3I3V A;  3K4U A;  3T22 A;  3T9V A;  2UVJ A;  3N6T A;  3K2D A;  3C33 A;  5FHN A;  3VE1 B;  2QPQ A;  4IGR A;  3TTN A;  4ELO A;  3MZ9 A;  3E3K A;  2NXO A;  4OFL A;  2I4B A;  4PFT A;  2NOO A;  3HN0 A;  1SW4 A;  4KHZ E;  5ICT A;  2RKM A;  4WXJ A;  3PPO A;  5JTY A;  3OSQ A;  4H0W A;  1LFG A;  2G93 A;  3FVG A;  2UVH A;  1J1N A;  1VFD A;  3LC8 A;  1US4 A;  4YIC A;  4U21 A;  4QFL A;  2D3I A;  1IIW A;  4IO7 A;  4ELR A;  1NKX A;  2XD2 A;  4QFN A;  1FQF A;  5I56 B;  2QRY A;  5HM4 B;  3QUF A;  5JTY B;  2H9B A;  3MZ1 A;  3LSX A;  2E0S A;  4DCX A;  3GLB A;  2I3V A;  2XXX A;  4IO4 A;  4F39 A;  1ZKB A;  3IOT A;  2PMS A;  3EHS A;  3UA8 A;  4AB5 A;  1LAX A;  3OEK A;  4YMB A;  1HSE A;  2DE4 A;  2Y84 A;  5DTB A;  5B70 A;  1M5C A;  4E0X A;  1B3H A;  1N0T A;  4NTL A;  1B0H A;  1B58 A;  3V89 B;  1GR2 A;  3O6G A;  1UTH B;  2F7A A;  2QSX A;  1FCK A;  2QS2 A;  3Q25 A;  2DYX A;  1OMP A;  1JEU A;  1H43 A;  1QW0 A;  4PFU A;  4F3B A;  1BTJ A;  1R9Q A;  1Y1Z A;  4RA1 A;  4WED A;  2GRV A;  1DMB A;  5HBC A;  2FNC A;  3G3J A;  4FAJ A;  2OJT A;  1R9L A;  4KYE A;  1B3E A;  5TP9 B;  4MLQ A;  2F78 A;  1ZLQ A;  3SEY A;  4LZ7 A;  2V3Q A;  3KN3 A;  3LBS A;  1OIB A;  2UVI A;  4IO6 A;  2H25 A;  3VVE A;  1B4Z A;  2O6A A;  1LGB C;  2HXW A;  1NFT A;  5DT6 A;  3CFL A;  1I6B A;  3CFX A;  1XOC A;  3IK6 B;  1MXW A;  1B7U A;  4R9G A;  4I9D A;  3O9P A;  1P1O A;  4U23 A;  4U2R A;  1B9J A;  4Q30 B;  1VE4 A;  5LOM A;  4BDO A;  2PT2 A;  2XXT A;  2F36 A;  4YAH X;  2Q9T A;  3G3H A;  4EQ7 A;  2Y7W A;  4ZE9 A;  1SBP A;  4OHN A;  4H5G A;  4P0G A;  3CSB A;  4HTG A;  4F19 A;  5JEI A;  4GOT A;  4JSD A;  3LSF B;  1FTK A;  1DTZ A;  3B6T A;  3RNN A;  5BUU A;  3O28 A;  1UQW A;  4I1D A;  4LVQ A;  5CBR A;  1NMU A;  1DPE A;  4ZZE A;  2ZYO A;  4ZDM A;  1P1U A;  3IB0 A;  1SI1 A;  1M5B A;  1P99 A;  1R6Z A;  5DVI A;  4H8J A;  1XHY A;  2HZK A;  4P11 A;  3KG2 A;  1B5J A;  1SI0 A;  3JYR A;  3UK4 A;  4C1T A;  2X7Q A;  3QSL A;  3CSG A;  4IY6 A;  2O84 X;  2I4C A;  5ISU A;  4N13 A;  3K01 A;  1IUD A;  3ZS6 A;  3A3C A;  3MW0 A;  2Z8E A;  3TTR A;  3ZKK A;  1S9T A;  4KD5 A;  3MUQ A;  3PPP A;  4XKP A;  4FIM A;  1O63 A;  1PB7 A;  3WAE A;  3S9N C;  3MVX A;  4DXC A;  3T9U A;  1CB6 A;  1B6H A;  1ZTY A;  3KN8 A;  3SEX A;  1OVB A;  3C35 A;  4LAT A;  3RQT A;  3T96 B;  5I2N A;  4QHQ A;  4QSE A;  5BWJ A;  1SDX A;  4GXA A;  4NF8 A;  3RPW A;  3HCQ A;  3R6U A;  1JW1 A;  3TTM A;  4X1B A;  1LFI A;  4MLV A;  3G3G A;  2DWI A;  4KR5 A;  3VV5 A;  3PUY E;  3TKD A;  2UVG A;  3C32 A;  4P0I A;  2QMW A;  1XC1 A;  4F2Q A;  5I2N B;  1F9B A;  3OOA A;  2Q8J A;  1N7W A;  2I49 A;  4OQO A;  3VLV A;  2GH9 A;  3EHU A;  3QYT A;  4NF5 A;  1XVY A;  2QS3 A;  4I8C A;  4X9T A;  3VLW A;  4GL0 A;  4KQP A;  2DWH A;  2LAO A;  2A5T A;  2F5X A;  3FXU A;  1WVJ A;  3G3F A;  2DXR A;  2XXP A;  3IX1 A;  1TXF A;  5FHO A;  4MH5 A;  4R74 A;  5KDT B;  3U93 A;  1QVS A;  2D21 A;  4GL8 A;  2REJ A;  2QL3 A;  5J1D A;  2RCA A;  3VXB A;  1NNK A;  2O51 A;  2XXU A;  4GF8 A;  1A7L A;  4NF6 A;  2XXY A;  3T9H B;  5JK4 A;  1HSJ A;  2XX9 A;  4OZ9 A;  3RY3 A;  1D9Y A;  1S50 A;  3DP6 A;  3MC2 A;  3IJO B;  2V3U A;  3N94 A;  4ND9 A;  2QS4 A;  5H8N A;  1MH4 A;  3W15 C;  4OTE A;  4PE5 B;  5DVJ A;  3QXM A;  4H65 A;  4MF3 A;  3B7D A;  1SYI A;  2Z8D A;  4LQ5 A;  4NWD A;  3H6T A;  3UOR A;  2ONK E;  4TLL B;  2DE2 A;  1R1N A;  1QJM A;  1NL5 A;  4H1X A;  4IO2 A;  5CMM A;  2G29 A;  1PEB A;  2I0C A;  3LR1 A;  3H03 A;  5H8N B;  4LON B;  2O68 A;  5DEX A;  1JVY A;  1FQA A;  4ISU A;  2B3F A;  3ILU B;  4C1U A;  5HPQ A;  2P1S A;  1POT A;  3PUW E;  1UIV A;  3TCG A;  3EN3 A;  3TQL A;  2VD2 A;  1BKA A;  4JBZ A;  3PUV E;  3OO7 A;  2DQV A;  3P7I A;  5M2V A;  2HQ0 A;  4ZED A;  3IL1 B;  3GXA A;  4X1D A;  4Q8R A;  3LSW A;  1NNF A;  2I58 A;  5DEX B;  2YLN A;  2GHB A;  3E4R A;  1P1N A;  3MZB A;  4HW8 A;  2Q2C A;  1XT8 A;  2V25 A;  2ZXT A;  4OVJ A;  1MY2 A;  3PUZ E;  3FJ7 A;  5FTI A;  3O66 A;  1IXH A;  3ECR A;  3RT8 A;  1DTG A;  1EU8 A;  4F22 A;  1JVX A;  3FVK A;  4PP0 A;  4U4S A;  3R26 A;  2XXV A;  1B4H A;  4IY5 A;  5K2Y A;  4OMB A;  2THI A;  5L9S A;  3IO4 A;  3O2A A;  5I56 A;  5F7V A;  2F35 A;  3UGW A;  3VVD A;  1LBC A;  1Q35 A;  4O3A A;  1MXV A;  5AA1 A;  5AA2 D;  3FVO A;  2Y7P A;  1L5T A;  3KSJ A;  4WKM A;  1XS5 A;  4XTC Q;  5KZT A;  2P0S A;  3MAM A;  3V8X B;  2QMX A;  1JET A;  4MBP A;  1AMF A;  1VSO A;  3ZKL A;  3RTF B;  4POW A;  4GFR A;  1UTH A;  4BDL A;  2ANJ A;  4EXL A;  3FV1 A;  1RYO A;  3BFU A;  3OSR A;  1JNF A;  2O1L A;  3OEN A;  1QUI A;  3H6V A;  3K6U A;  4GWO A;  1MY4 A;  1A55 A;  1MY1 A;  3FJM A;  1A40 A;  4ZEF A;  5TP9 A;  4FE8 A;  2VD3 A;  2HAU A;  2O7I A;  3G3I A;  1H45 A;  3UIF A;  1FTL A;  1MPC A;  4OYV A;  3TEL A;  1HSL A;  4RNS A;  2DSF A;  3PMV A;  4O3C A;  1FTJ A;  4GQO A;  3TFL A;  3Q27 A;  1QUJ A;  1Z7M E;  4F3S A;  4GVO A;  2PBW A;  3U8Q A;  1N84 A;  1RKM A;  4H8I A;  3CVG A;  3H4Z A;  3SEV A;  1Y4T A;  5DYH A;  3H06 B;  3G7W A;  4M4G A;  1YCJ A;  1URS A;  2Z8F A;  2XXW A;  3PMX A;  3HPI A;  3IB1 A;  2DXY A;  4KPT A;  4ZEB A;  1B40 A;  3HO7 A;  4UAC A;  4X48 A;  1IIT A;  4F31 B;  3CG1 A;  4KCC A;  3K00 A;  4R72 A;  3EQ1 A;  4JXI A;  4RK2 A;  4QFK A;  1MQD A;  1MH3 A;  4IGT A;  4FAT A;  3MQ9 A;  3IOR A;  3K1N A;  4HS7 A;  2AYS A;  4OEN A;  2AL4 A;  3V5A A;  4XKR A;  4O3B A;  1URG A;  2RF1 A;  4JSO A;  3K0V A;  3S9L C;  2I3W A;  3OXN A;  2F8D A;  1O64 A;  3O29 A;  3VFJ A;  1S7Y A;  1EZP A;  4ONY A;  1PB9 A;  3CG3 A;  2HEU A;  4H6D A;  4BDN A;  3CR9 A;  3A3U A;  1ZIU A;  2D5W A;  3TEP A;  2F7B A;  2I6E A;  1DPP A;  1MXX A;  2IA4 A;  3EPE A;  4N6P A;  2ONR A;  2DWA A;  1PDA A;  4F1Y A;  3TCH A;  3PMW A;  2QJE A;  4BDQ A;  4RXL A;  2Y7I A;  3ODB A;  2OZZ A;  3HHF A;  1M5F A;  1I69 A;  3IOV A;  3MWB A;  4OFO A;  2PT1 A;  4R9F A;  2KLF A;  1B1X A;  2Q88 A;  3PPR A;  4K3F A;  4ZZA A;  1B0L A;  3TDJ A;  2HZL A;  1NH7 A;  5EHS A;  3E13 X;  2RC8 A;  2V84 A;  3M3L A;  1UTB A;  5L9O A;  1Y20 A;  2NUV A;  3K6X A;  2R71 A;  2ESN A;  1NNP A;  3OD7 A;  3C31 A;  4R6H A;  2XXQ A;  2X7P A;  2VOZ A;  4YZZ A;  1EZO A;  4Q5T A;  5ITP A;  3TPA A;  3L6G A;  3I5O A;  1UTB B;  2OWT A;  5I84 A;  1CE2 A;  4LUB A;  3W9W A;  4PFW A;  1MXZ A;  4MFI A;  1LFH A;  2GFE A;  3KOS A;  1D9V A;  4DDD A;  4ESX A;  3IAZ A;  5CBS A;  2I0B A;  4RJZ A;  3C4M A;  4N07 A;  3I6V A;  2HAV A;  4R2F A;  2XHD A;  3IO6 A;  2V93 A;  4THI A;  3N6U A;  2B3B A;  4PET A;  3N5L A;  4QSC A;  4F18 A;  1Y3N A;  3U1O A;  4OXV A;  3H7M A;  1MDP 1;  1B3F A;  4DE8 A;  3OO8 A;  3A09 A;  3D4G A;  5I57 A;  5KDT A;  5AA4 A;  1B2H A;  1UIU A;  3TCF A;  4QFO A;  5H8S A;  4YB6 A;  4U1Z A;  4BDR A;  5CM6 A;  1LBB A;  4NMY A;  1XVX A;  3RGY A;  1US5 A;  1B1H A;  1WDN A;  1Z7N E;  3BFT A;  3W9V A;  3FJG A;  3JV9 A;  1Y3Q A;  1FTM A;  1OQG A;  2NWJ A;  3RLF E;  2P2A A;  5I57 B;  1Q1K A;  4QSD A;  4EDP A;  1ATG A;  1MM7 A;  5AA4 B;  3K02 A;  1OLA A;  5H8Q A;  1AH5 A;  1P1W A;  4I62 A;  4ZEK A;  3U72 A;  2XXI A;  3O6H A;  5IAI A;  3DLN A;  4GXS B;  1B32 A;  4OES A;  1N7X A;  1N3W A;  4XXU A;  3QIM A;  4DLD A;  1OLC A;  3KOT A;  1QKB A;  5B7D A;  1IEJ A;  4YKI A;  3S4U A;  5I58 B;  1MQJ A;  3FXR A;  5H8Q B;  5L8D A;  2FYI A;  3T9X B;  4R73 A;  4L17 A;  4KFQ A;  3TTL A;  2ZYK A;  3O6I A;  4OWD A;  1M5E A;  1NH8 A;  1LB8 A;  1BIY A;  5TPA B;  3JZJ A;  1JQF A;  4HCY A;  2H5Y A;  4DZ1 A;  3V83 A;  4ZEI A;  3KN7 A;  3F11 A;  3VXC A;  4R75 A;  5H8F A;  1B7Z A;  1MXY A;  3VDF A;  4ELQ A;  2ALU A;  3KBR A;  1LST A;  3KFM A;  3FV2 A;  4ELP A;  3FZV A;  3GBB A;  4NWC A;  4JWO A;  3SKP A;  3PV0 E;  5CMB A;  2IEE A;  3B6Q A;  2AL5 A;  3OEM A;  4XKQ A;  4IO3 A;  4DIG A;  2OWS A;  5H8F B;  4EF1 A;  1JW5 A;  1QUK A;  2PYY A;  3IJX B;  3TAJ A;  4GD5 A;  3K1P A;  3T93 B;  3TZA A;  4RPN A;  4RYA A;  3SER A;  1A8E A;  5CMC A;  4Q0C A;  4U22 A;  4JB7 A;  3C9H A;  3N26 A;  1MQI A;  5H8H A;  2E1S A;  1N04 A;  5FTH A;  1SW1 A;  2QS1 A;  2DS9 A;  1Y4C A;  4F1V A;  1IXG A;  3DEL B;  4G8H A;  4H5F A;  3IOU A;  3VVF A;  4YKP A;  1EZ9 A;  3USD A;  3QUJ A;  4NF4 B;  2REG A;  1H76 A;  1BLF A;  1YTV A;  1ZBM A;  1SVX B;  1B7H A;  2XX7 A;  5CRY A;  4UA8 A;  4NE4 A;  1B52 A;  2RC9 A;  5H8H B;  4G68 B;  1POY 1;  3KJT A;  2H4I A;  3LUY A;  1MQH A;  3EF7 A;  2PX1 A;  3ZSF A;  1D4N A;  3VLU A;  3T66 A;  3OO9 A;  5I59 B;  2CZL A;  4IB2 A;  1SW5 A;  2UYE A;  4FJP A;  4OET A;  4QFP A;  4DCY A;  3U92 A;  4LZ8 A;  2W7Y A;  2XD3 A;  3BKI B;  1FQE A;  4KYD A;  3Q26 A;  3GZG A;  1QKA A;  3B6W A;  3HV1 A;  3O97 A;  4EF2 A;  1D3K A;  4PQJ A;  1PB8 A;  3MJN A;  1YPN A;  1ANF A;  2YJP A;  3PGF A;  1LAG E;  4NED A;  5AE4 A;  3CI8 A;  3DP4 A;  2WKY A;  1FQC A;  4TLM B;  2OBG A;  1B5H A;  2F6G A;  2PVU A;  4HCW A;  2H99 A;  1BP5 A;  3PU5 A;  3KGC A;  2ZNU A;  5FHM A;  3U94 A;  4F3P A;  3H6W A;  5ICQ A;  4FED A;  4QF9 A;  4C0R A;  2VHA A;  3H6U A;  4DXU A;  5IKB A;  4F29 A;  2ONS A;  2DOJ A;  1GV8 A;  4YKK A;  1PBQ A;  3TTK A;  4G68 C;  3CRB A;  3EHT A;  1PBP A;  4YKJ A;  2VP1 A;  1H3D A;  3IOW A;  3M3K A;  3UP9 A;  2O1M A;  1SQY A;  1TFD A;  1P1Q A;  3K6W A;  3MP6 A;  1T0K A;  1MDQ A;  1OQH A;  1B5I A;  3OMB A;  4FOR A;  3S9E A;  4GRK A;  4F3G A;  3SEW A;  1AOV A;  1Y9U A;  3OO6 A;  1MG1 A;  4R6K A;  4XKN A;  3C36 A;  3ILT B;  4EUO A;  2ZNT A;  3TMG A;  2M8C A;  1N76 A;  4F2O A;  5EHM A;  2FA7 A;  1B51 A;  3DP8 A;  1TWY A;  3KJ7 A;  3KSX A;  1USY H;  5AA3 A;  4POX A;  3G3K A;  4JDF A;  1WOD A;  1RYX A;  4LP2 B;  1I6A A;  2CMO A;  2GHA A;  3RTW B;  2RCB A;  1A54 A;  1LB9 A;  4JWX A;  3SDF A;  1MPD A;  5TU0 A;  2O69 A;  4DXB A;  3MBP A;  4OFJ A;  3FIR A;  4OEV A;  1IZ1 A;  4PFY A;  5I2K A;  2F6P A;  1MY3 A;  5EYF A;  4U1O A;  1B3L A;  4G8M A;  1FTO A;  3MPL A;  3R7X A;  4RY1 A;  2F97 A;  4QRZ A;  1GGG A;  1KWH A;  4ZEC A;  2B65 A;  4R6Y A;  1IQ7 A;  1LLS A;  5I2K B;  1LAF E;  1IXC A;  1AIV A;  1URD A;  4XIG Q;  1O7T A;  4OER A;  1IXI A;  3FXQ A;  3KEI A;  4TQU Q;  1GTK A;  3E9X A;  2I48 A;  2R6G E;  2HCA A;  3HHG A;  4IO5 A;  4ZE8 A;  3S9M C;  3PD8 A;  3FUZ A;  1VFE A;  5K2X A;  3MVZ A;  4M1V A;  4YMA A;  4G4P A;  3RUM A;  3K1M A;  3FVN A;  2BJJ X;  2F7C A;  3TQW A;  3FAT A;  4FEB A;  3THI A;  5CC2 A;  5ELV A;  1MQG A;  4U4X A;  4RK9 A;  2ZNS A;  1FQB A;  4EQ9 A;  3TYH A;  4BDM A;  3MP8 A;  1SD3 A;  1EH3 A;  3GBA A;  4ECF A;  3M3F A;  1JEV A;  3PUX E;  1B46 A;  2VGQ A;  3PPQ A;  4LA9 A;  2NVU B;  1USY E;  5CMK A;  1MM6 A;  2DVZ A;  3RN8 A;  1YAE A;  2X26 A;  3SES A;  2O7U A;  3TOD A;  2AIX A;  2UXA A;  1QUL A;  3K6V A;  4NF8 B;  4G77 A;  1M5D A;  3RT6 B;  2A5S A;  5KCJ A;  1MRP A;  4LQ2 A;  3QAX A;  3L6H A;  5AA2 A;  1MY0 A;  2Z22 A;  1N3X A;  3DM0 A;  2F34 A;  3IR1 A;  3PD9 A;  2RC7 A;  4KI0 E;  4YB5 A;  4YU0 A;  1I6Q A;  4JWY A;  5I58 A;  3CFZ A;  1JW4 A;  1H44 A;  5ITO A;  1FW0 A;  4ZS9 A;  2Y7R A;  5KCJ B;  4WEP A;  4RPO A;  1ELJ A;  5AA2 B;  1ZU0 A;  4NF5 B;  5TPA A;  3Q28 A;  5L9M A;  1DOT A;  3ONM A;  1ZMG A;  3PPN A;  1FQD A;  2XXH A;  4Z0I A;  3LSL A;  1NNT A;  4G2Z A;  3SET A;  1B3G A;  2A5T B;  4TOZ A;  1LCF A;  1AL3 A;  1LCT A;  4Z7E A;  4GLI A;  3M8U A;  1MXU A;  3OEL A;  5DVF A;  3FAS A;  4AB6 A;  2XX8 A;  3MPK A;  3UN6 A;  2ABH A;  4KYS A;  2RIN A;  4R2B A;  2H98 A;  3MP1 A;  2ZMB A;  2DVC A;  5CI5 A;  1A99 A;  3CIJ A;  4AQ4 A;  4FEC A;  4GIZ A;  4F1U A;  1SYH A;  2R9J A;  2Q2A A;  3H3G A;  1ZJL A;  4NF6 B; 
#chains in the Genus database with same CATH topology
 5A5L A;  3FGS A;  2Q89 A;  2VT5 A;  3BBR A;  2OCU A;  3WAF A;  3FD3 A;  3QK6 A;  4HXV A;  3D4C A;  2VPO A;  2UYF A;  1TT1 A;  4GWU A;  4BLA A;  1II5 A;  2OLB A;  3T0J A;  4ESW A;  4E0W A;  5A5X A;  1PC3 A;  4H67 A;  4KCD A;  5F1Q A;  2Y7K A;  2B4L A;  1NV3 A;  3MVY A;  2HFB A;  4YB7 A;  4EQB A;  5FBP A;  1SW2 A;  4NF4 A;  2ZYN A;  1DSN A;  2ZYM A;  2QFL A;  3Q29 A;  2XXR A;  4PAF A;  2OK2 A;  2YPN A;  4EXK A;  3C34 A;  2DP8 A;  4G68 A;  1GVC A;  3TUS A;  5A5X B;  1OVT A;  4HE2 A;  3MVW A;  1MPB A;  3IB2 A;  1A8F A;  2DE3 A;  3SEU A;  3KZG A;  1FPJ A;  4PGN A;  1Y1M A;  4LZ5 A;  2DWJ A;  3HST A;  3IFA A;  2Z23 A;  3S2V A;  2KQZ A;  1B05 A;  5I59 A;  1MS7 A;  3AXF A;  1LAH E;  2XXK A;  2V3T A;  2WYP A;  4G8N A;  4P8B A;  1VR5 A;  4OEU A;  1TFA A;  1Y3P A;  3I3V A;  3K4U A;  3T22 A;  4N17 A;  2DDK A;  4MNI A;  3T9V A;  3PTY A;  2UVJ A;  3N6T A;  3K2D A;  3C33 A;  1FBD A;  5FHN A;  3VE1 B;  2PFY A;  2QPQ A;  4IGR A;  3TTN A;  4ELO A;  2QVV A;  3MZ9 A;  5F24 A;  2QVR A;  4IR8 A;  3E3K A;  2NXO A;  4OFL A;  2I4B A;  4PFT A;  2NOO A;  3HN0 A;  1SW4 A;  4KHZ E;  5ICT A;  2RKM A;  4WXJ A;  3EKI A;  3PPO A;  5JTY A;  3OSQ A;  4H0W A;  1LFG A;  3B50 A;  2G93 A;  3FVG A;  2UVH A;  1J1N A;  5DW8 A;  1VFD A;  3LC8 A;  1US4 A;  4YIC A;  5ET8 A;  4U21 A;  4QFL A;  2D3I A;  1IIW A;  4MMP A;  4IO7 A;  4ELR A;  1NKX A;  2XD2 A;  4QFN A;  1FQF A;  5I56 B;  2QRY A;  5HM4 B;  3QUF A;  5JTY B;  2H9B A;  3MZ1 A;  3LSX A;  4GX6 A;  2E0S A;  1LBW A;  4DCX A;  2OWZ A;  3GLB A;  4H45 A;  2I3V A;  2XWO A;  2XXX A;  4IO4 A;  4F39 A;  1ZKB A;  3IOT A;  2PMS A;  4PFB A;  3EHS A;  3UA8 A;  4AB5 A;  1LAX A;  3OEK A;  4YMB A;  1HSE A;  2ZZX A;  2DE4 A;  2Y84 A;  5DTB A;  4NN3 A;  5B70 A;  1M5C A;  4E0X A;  1B3H A;  4PFR A;  1N0T A;  4NTL A;  1B0H A;  1B58 A;  3V89 B;  1GR2 A;  3O6G A;  1UTH B;  2F7A A;  2QSX A;  1FCK A;  2QS2 A;  3Q25 A;  2DYX A;  1OMP A;  1JEU A;  1H43 A;  1QW0 A;  4PFU A;  4F3B A;  1BTJ A;  1R9Q A;  4OVT A;  1Y1Z A;  4RA1 A;  5IM2 A;  4WED A;  2GRV A;  2MKZ A;  1DMB A;  4NQ8 A;  5HBC A;  2FNC A;  3G3J A;  4FAJ A;  2OJT A;  1R9L A;  4KYE A;  1B3E A;  5TP9 B;  4MLQ A;  2F78 A;  1ZLQ A;  3SEY A;  4LZ7 A;  2V3Q A;  3KN3 A;  3LBS A;  1IMD A;  1OIB A;  2UVI A;  4IO6 A;  2H25 A;  3VVE A;  1B4Z A;  2O6A A;  1LGB C;  2HXW A;  1NFT A;  5DT6 A;  3CFL A;  1I6B A;  3CFX A;  1XOC A;  4OA4 A;  3IK6 B;  1MXW A;  1B7U A;  4R9G A;  4I9D A;  3O9P A;  1P1O A;  4U23 A;  4U2R A;  1B9J A;  1FPF A;  4Q30 B;  1VE4 A;  5LOM A;  4HE0 A;  4BDO A;  2V4C A;  2PT2 A;  2XXT A;  2XA5 A;  2F36 A;  4YAH X;  2Q9T A;  3G3H A;  4EQ7 A;  2Y7W A;  4ZE9 A;  1SBP A;  4OHN A;  4H5G A;  4P0G A;  3CSB A;  2FBP A;  1RDY A;  4HTG A;  1FPK A;  4F19 A;  5JEI A;  4GOT A;  4JSD A;  3LSF B;  1FTK A;  1DTZ A;  3B6T A;  3RNN A;  5BUU A;  3O28 A;  1UQW A;  2WYK A;  4P9K A;  2CZH A;  4I1D A;  4LVQ A;  5CBR A;  1NMU A;  1DPE A;  4ZZE A;  2ZYO A;  4ZDM A;  1P1U A;  3IB0 A;  5EYH A;  1SI1 A;  1M5B A;  1P99 A;  1R6Z A;  4P3L A;  5DVI A;  4NGU A;  4H8J A;  3GYY A;  1XHY A;  4GWY A;  1FBG A;  2HZK A;  4P11 A;  3KG2 A;  1B5J A;  1SI0 A;  3JYR A;  3UK4 A;  2OX3 A;  4C1T A;  2X7Q A;  3QSL A;  3CSG A;  4IY6 A;  2O84 X;  2I4C A;  5ISU A;  4N13 A;  3K01 A;  1LBY A;  1IUD A;  1DK4 A;  3ZS6 A;  3U65 A;  3A3C A;  3MW0 A;  2Z8E A;  3TTR A;  3ZKK A;  1S9T A;  3BIG A;  4KD5 A;  5EQ8 A;  3MUQ A;  3PPP A;  4XKP A;  4FIM A;  1O63 A;  1PB7 A;  2HPG A;  3WAE A;  3S9N C;  5EQ7 A;  3MVX A;  4DXC A;  3T9U A;  1CB6 A;  1B6H A;  1ZTY A;  1K9Y A;  3KN8 A;  3SEX A;  1OVB A;  1RDX A;  3C35 A;  4LAT A;  3RQT A;  3T96 B;  5I2N A;  4QHQ A;  4QSE A;  5BWJ A;  1SDX A;  4GXA A;  4NF8 A;  3RPW A;  3HCQ A;  3R6U A;  1JW1 A;  3TTM A;  4X1B A;  3D1R A;  1LFI A;  4MLV A;  3G3G A;  2DWI A;  4KR5 A;  3VV5 A;  4AS5 A;  3PUY E;  3TKD A;  2UVG A;  3C32 A;  4P0I A;  4OVS A;  1FPG A;  2QMW A;  1XC1 A;  4F2Q A;  5I2N B;  1F9B A;  3OOA A;  2Q8J A;  1N7W A;  2I49 A;  4OQO A;  3VLV A;  5T3J A;  4XFE A;  2GH9 A;  3EHU A;  3QYT A;  4NF5 A;  3CHG A;  1XVY A;  2QS3 A;  4I8C A;  4P1L A;  4X9T A;  3VLW A;  5J16 A;  4GL0 A;  4KQP A;  2DWH A;  3IFC A;  2LAO A;  2A5T A;  2F5X A;  3FXU A;  1WVJ A;  3G3F A;  2DXR A;  2XXP A;  3IX1 A;  1NV6 A;  1TXF A;  1EYI A;  5FHO A;  4MH5 A;  4R74 A;  5KDT B;  3U93 A;  1QVS A;  2D21 A;  4GL8 A;  2REJ A;  2QL3 A;  5J1D A;  2FIE A;  2RCA A;  1QGX A;  1KA1 A;  3VXB A;  1NNK A;  2CEY A;  2O51 A;  2XXU A;  4GF8 A;  2WEF A;  4PAI A;  1A7L A;  3MST A;  4NF6 A;  2XXY A;  3T9H B;  5JK4 A;  1HSJ A;  4X8R A;  2XX9 A;  4OZ9 A;  1NV7 A;  3RY3 A;  1D9Y A;  1S50 A;  3DP6 A;  4MNP A;  3MC2 A;  3IJO B;  2V3U A;  3N94 A;  4ND9 A;  2QS4 A;  5H8N A;  4PDD A;  1MH4 A;  3W15 C;  4OTE A;  4PE5 B;  2QVU A;  5DVJ A;  4N6K A;  3QXM A;  4H65 A;  4P56 A;  4MF3 A;  3B7D A;  1SYI A;  2Z8D A;  4LQ5 A;  4NWD A;  3H6T A;  3UOR A;  2ONK E;  4TLL B;  2DE2 A;  1R1N A;  3QMF A;  1QJM A;  1NL5 A;  4H1X A;  4IO2 A;  5CMM A;  2R8T A;  2G29 A;  1PEB A;  2I0C A;  3LR1 A;  3H03 A;  1LBZ A;  5H8N B;  4LON B;  2O68 A;  5DEX A;  1JVY A;  4OVP A;  3RPL A;  1FQA A;  4ISU A;  2B3F A;  3ILU B;  4C1U A;  4HE1 A;  5HPQ A;  2P1S A;  1POT A;  3PUW E;  1UIV A;  3TCG A;  3EN3 A;  3TQL A;  4GWZ A;  2VD2 A;  4AS4 A;  1BKA A;  4JBZ A;  3PUV E;  3OO7 A;  2Q74 A;  2DQV A;  3P7I A;  5M2V A;  2HQ0 A;  4ZED A;  3IL1 B;  3GXA A;  4X1D A;  2P3N A;  1G0I A;  4Q8R A;  3LSW A;  2JJK A;  1NNF A;  2I58 A;  5DEX B;  2YLN A;  2GHB A;  3RPL B;  3E4R A;  1P1N A;  3MZB A;  4HW8 A;  2Q2C A;  1XT8 A;  2V25 A;  2ZXT A;  4OVJ A;  1MY2 A;  3PUZ E;  2HHM A;  3FJ7 A;  5FTI A;  3O66 A;  4O7I A;  1IXH A;  3ECR A;  3RT8 A;  1DTG A;  1EU8 A;  3FXB A;  4F22 A;  1JVX A;  4DI4 B;  3FVK A;  4PP0 A;  4U4S A;  3R26 A;  2XXV A;  4I40 A;  1B4H A;  4PC9 A;  2KR0 A;  4IY5 A;  5K2Y A;  4OMB A;  2THI A;  5L9S A;  3IO4 A;  3O2A A;  5I56 A;  5F7V A;  2F35 A;  3UGW A;  3VVD A;  1LBC A;  1Q35 A;  4O3A A;  4UAB A;  1XI6 A;  1MXV A;  5AA1 A;  5AA2 D;  1NV2 A;  3FVO A;  2Y7P A;  1L5T A;  3KSJ A;  4WKM A;  1CNQ A;  1XS5 A;  4XTC Q;  2Y5K A;  5KZT A;  2P0S A;  2P3V A;  4PBQ A;  3BIH A;  3MAM A;  4MJO A;  3V8X B;  2QMX A;  4GWS A;  1JET A;  4PCD A;  4H46 A;  4MBP A;  1AMF A;  1VSO A;  3ZKL A;  3RTF B;  4POW A;  4JVD A;  4GFR A;  1UTH A;  4BDL A;  2ANJ A;  4EXL A;  3FV1 A;  1RYO A;  3BFU A;  4FBP A;  4O94 A;  1D9Q A;  3OSR A;  1JNF A;  2O1L A;  3OEN A;  1QUI A;  1KZ8 A;  3H6V A;  3K6U A;  4GWO A;  1MY4 A;  4N91 A;  1A55 A;  1MY1 A;  3FJM A;  4LN5 A;  1A40 A;  4ZEF A;  5TP9 A;  2B4M A;  4FE8 A;  2VD3 A;  2HAU A;  2O7I A;  3G3I A;  1H45 A;  3UIF A;  1FTL A;  1MPC A;  4OYV A;  3TEL A;  1HSL A;  4RNS A;  2DSF A;  3PMV A;  4O3C A;  1FTJ A;  1NI9 A;  4GQO A;  3TFL A;  3Q27 A;  1QUJ A;  1Z7M E;  4F3S A;  4GVO A;  2PBW A;  1EYK A;  1FBC A;  3U8Q A;  1N84 A;  1RKM A;  4H8I A;  3CVG A;  3H4Z A;  3SEV A;  1Y4T A;  2F3B A;  5DYH A;  3H06 B;  2XWI A;  3G7W A;  4M4G A;  1DCU A;  2HXR A;  1YCJ A;  1URS A;  2Z8F A;  2XXW A;  3PMX A;  3HPI A;  3IB1 A;  2DXY A;  4KPT A;  4ZEB A;  3MYU A;  4NG7 A;  1B40 A;  3HO7 A;  4UAC A;  1LEV A;  4X48 A;  1IIT A;  4F31 B;  3CG1 A;  4KCC A;  3K00 A;  4R72 A;  3EQ1 A;  5I5P A;  4JXI A;  4RK2 A;  4QFK A;  1MQD A;  1MH3 A;  4IGT A;  4FAT A;  3MQ9 A;  2WBB A;  3IOR A;  4MIJ A;  3K1N A;  4N4U A;  4HS7 A;  2AYS A;  4OEN A;  2Q8M A;  2AL4 A;  3V5A A;  4XKR A;  4O3B A;  1INP A;  1URG A;  2RF1 A;  4JSO A;  3K0V A;  4N8Y A;  3S9L C;  5I3S A;  2I3W A;  3OXN A;  2F8D A;  1O64 A;  3O29 A;  4OVQ A;  3VFJ A;  1S7Y A;  1EZP A;  4ONY A;  1PB9 A;  3CG3 A;  2HEU A;  4GBV A;  4H6D A;  4BDN A;  3CR9 A;  3A3U A;  1ZIU A;  2D5W A;  3TEP A;  5LTC A;  2F7B A;  2I6E A;  1DPP A;  1MXX A;  2IA4 A;  3EPE A;  4N6P A;  2ONR A;  3E78 A;  2DWA A;  1PDA A;  4F1Y A;  3TCH A;  3PMW A;  2QJE A;  4BDQ A;  2FIX A;  4RXL A;  2Y7I A;  3ODB A;  2OZZ A;  2ZZW A;  3HHF A;  1M5F A;  1I69 A;  5IZ1 A;  3IOV A;  3MWB A;  4OFO A;  1NV4 A;  2PT1 A;  4R9F A;  2KLF A;  1B1X A;  2Q88 A;  2Y5L A;  1FJ9 A;  5EQ9 A;  3PPR A;  4K3F A;  4ZZA A;  1FPD A;  2L5V A;  1B0L A;  3TDJ A;  2HZL A;  1NH7 A;  5EHS A;  3E13 X;  2RC8 A;  2V84 A;  4NX1 A;  3M3L A;  1UTB A;  5L9O A;  1Y20 A;  2NUV A;  3K6X A;  2R71 A;  2ESN A;  1NNP A;  3OD7 A;  3C31 A;  4R6H A;  4PE3 A;  2PFZ A;  1IMC A;  2XXQ A;  2X7P A;  2VOZ A;  4YZZ A;  1EZO A;  4Q5T A;  5ITP A;  3TPA A;  3L6G A;  3I5O A;  1UTB B;  1K9Z A;  2OWT A;  1FPB A;  4I3Y A;  5I84 A;  1CE2 A;  4LUB A;  3W9W A;  4PFW A;  1MXZ A;  4MEV A;  4MFI A;  1LFH A;  2GFE A;  3KOS A;  1D9V A;  4DDD A;  4ESX A;  3IAZ A;  5CBS A;  2I0B A;  4RJZ A;  1FBH A;  3C4M A;  4NHB A;  4N07 A;  3I6V A;  2HAV A;  4R2F A;  2XHD A;  3IO6 A;  2V93 A;  4THI A;  3N6U A;  2B3B A;  4PET A;  3N5L A;  4QSC A;  4GBW A;  4F18 A;  4PTK A;  1Y3N A;  3U1O A;  4OXV A;  3H7M A;  1MDP 1;  1B3F A;  4DE8 A;  3OO8 A;  3A09 A;  3D4G A;  5I57 A;  5KDT A;  5AA4 A;  1B2H A;  1UIU A;  4GX3 A;  3TCF A;  4QFO A;  5H8S A;  4YB6 A;  4N81 A;  4U1Z A;  4BDR A;  5CM6 A;  1LBB A;  4NMY A;  3LV0 A;  2F3D A;  1XVX A;  3RGY A;  1US5 A;  1B1H A;  1WDN A;  1Z7N E;  3BFT A;  3W9V A;  3FJG A;  3JV9 A;  1Y3Q A;  1FTM A;  4N8G A;  1SPI A;  1OQG A;  2NWJ A;  3RLF E;  2P2A A;  5I57 B;  1Q1K A;  4QSD A;  4EDP A;  1ATG A;  1LBV A;  1MM7 A;  5IZ3 B;  5AA4 B;  3K02 A;  1OLA A;  5H8Q A;  1AH5 A;  1P1W A;  4I62 A;  4ZEK A;  3U72 A;  2XXI A;  3O6H A;  5IAI A;  3DLN A;  4GXS B;  1B32 A;  4OES A;  1N7X A;  1N3W A;  4XXU A;  3QIM A;  4DLD A;  1OLC A;  4MCO A;  2WX9 A;  3KOT A;  1QKB A;  5B7D A;  1IEJ A;  4YKI A;  3S4U A;  5I58 B;  1MQJ A;  3FXR A;  5H8Q B;  5L8D A;  2FYI A;  3T9X B;  4R73 A;  4L17 A;  4KFQ A;  3TTL A;  2ZYK A;  3O6I A;  4OWD A;  3ROJ A;  1M5E A;  1NH8 A;  1LB8 A;  1BIY A;  5LDZ A;  5TPA B;  1YXI A;  3JZJ A;  1JQF A;  4HCY A;  2H5Y A;  4DZ1 A;  3V83 A;  4ZEI A;  5EQA A;  3KN7 A;  3F11 A;  3VXC A;  3ISP A;  4R75 A;  5H8F A;  1B7Z A;  1MXY A;  3VDF A;  4ELQ A;  2ALU A;  3KBR A;  1LST A;  3KFM A;  3FV2 A;  4ELP A;  3FZV A;  3GBB A;  4NWC A;  4JWO A;  4MX6 A;  3SKP A;  3PV0 E;  5CMB A;  2IEE A;  3B6Q A;  1FBE A;  2AL5 A;  3OEM A;  4XKQ A;  4IO3 A;  4X04 A;  4N6D A;  4DIG A;  2OWS A;  5H8F B;  4EF1 A;  1EYJ A;  1FPE A;  1JW5 A;  1QUK A;  2PYY A;  3IJX B;  3TAJ A;  4GD5 A;  3K1P A;  3T93 B;  3TZA A;  4RPN A;  4MHF A;  4RYA A;  3SER A;  1A8E A;  5CMC A;  4Q0C A;  4U22 A;  1FJ6 A;  4JB7 A;  3C9H A;  3N26 A;  1MQI A;  5H8H A;  2E1S A;  1N04 A;  5FTH A;  1SW1 A;  2QS1 A;  2DS9 A;  1Y4C A;  1IME A;  4F1V A;  1IXG A;  3DEL B;  4G8H A;  4H5F A;  3IOU A;  3VVF A;  4YKP A;  1EZ9 A;  3USD A;  3QUJ A;  4NF4 B;  4PAK A;  2REG A;  1H76 A;  1BLF A;  1YTV A;  1ZBM A;  1SVX B;  1B7H A;  2XX7 A;  5CRY A;  4UA8 A;  4NE4 A;  1B52 A;  2RC9 A;  5H8H B;  1FBP A;  4G68 B;  3A29 A;  1POY 1;  4PDH A;  3KJT A;  2H4I A;  3LUY A;  1MQH A;  3EF7 A;  2PX1 A;  3ZSF A;  1D4N A;  3VLU A;  3T66 A;  3OO9 A;  5I59 B;  2CZL A;  4IB2 A;  1JP4 A;  1SW5 A;  4KXP A;  1NV1 A;  1BK4 A;  1NUX A;  2UYE A;  4FJP A;  4OET A;  4GWW A;  4QFP A;  2CZK A;  4DCY A;  1FPI A;  3U92 A;  4LZ8 A;  4PGP A;  2PCR A;  2W7Y A;  2XD3 A;  3BKI B;  1G0H A;  1NUZ A;  1FQE A;  4KYD A;  1NUW A;  3Q26 A;  4QXD A;  4OVR A;  3GZG A;  1QKA A;  3B6W A;  4I3E A;  3HV1 A;  3SZP A;  4MAG A;  3O97 A;  4EF2 A;  1D3K A;  4PQJ A;  4PF8 A;  1PB8 A;  3MJN A;  1YPN A;  1ANF A;  2YJP A;  3PGF A;  1LAG E;  1FPL A;  4NED A;  5AE4 A;  3CI8 A;  3DP4 A;  2WKY A;  5ET5 A;  4PF6 A;  1FQC A;  4TLM B;  2OBG A;  1B5H A;  2F6G A;  2PVU A;  4HCW A;  2H99 A;  1BP5 A;  3PU5 A;  3KGC A;  1IMF A;  5ET6 A;  2ZNU A;  5FHM A;  3U94 A;  4F3P A;  3H6W A;  5ICQ A;  4G61 A;  4FED A;  4QF9 A;  4P47 A;  5I7I A;  5IGA A;  4C0R A;  2VHA A;  3H6U A;  5ET7 A;  4DXU A;  5IKB A;  4P1E A;  4F29 A;  2ONS A;  2DOJ A;  1GV8 A;  1IMB A;  4YKK A;  1NV0 A;  1PBQ A;  3TTK A;  4G68 C;  3CRB A;  3EHT A;  1PBP A;  4YKJ A;  4DI3 D;  2VP1 A;  2XWV A;  3KC0 A;  5EYG A;  1H3D A;  3IOW A;  3M3K A;  3UP9 A;  1NV5 A;  3RYD A;  2O1M A;  1SQY A;  1TFD A;  1P1Q A;  3K6W A;  1KA0 A;  3MP6 A;  1FBF A;  1T0K A;  1MDQ A;  3T1B A;  3HFU A;  1OQH A;  1B5I A;  3OMB A;  4FOR A;  3S9E A;  2ZZV A;  4GRK A;  4F3G A;  2FVZ A;  3SEW A;  4OAN A;  1AOV A;  1Y9U A;  3OO6 A;  1YZ0 A;  1MG1 A;  4R6K A;  4XKN A;  3C36 A;  1FTA A;  3ILT B;  4EUO A;  2ZNT A;  4O8M A;  3TMG A;  2M8C A;  1N76 A;  5IZZ A;  4F2O A;  5EHM A;  2FA7 A;  1B51 A;  4PBH A;  3DP8 A;  1TWY A;  3KJ7 A;  3KSX A;  1USY H;  3LUZ A;  5AA3 A;  3NOH A;  4POX A;  3G3K A;  4QBA A;  4NF0 A;  4JDF A;  1WOD A;  1RYX A;  4XF5 A;  4LP2 B;  1I6A A;  1IMA A;  2CMO A;  2GHA A;  3RTW B;  2RCB A;  1A54 A;  4MNC A;  1LB9 A;  4JWX A;  3B8B A;  3SDF A;  1MPD A;  3KBZ A;  5TU0 A;  2O69 A;  4DXB A;  3MBP A;  4OFJ A;  3FIR A;  4OEV A;  1IZ1 A;  4PFY A;  4XEQ A;  5I2K A;  1FSA A;  4JVC A;  2F6P A;  1MY3 A;  5EYF A;  4U1O A;  1B3L A;  4G8M A;  1FTO A;  3MPL A;  3R7X A;  4RY1 A;  2F97 A;  4QRZ A;  1GGG A;  1KWH A;  4ZEC A;  2B65 A;  4R6Y A;  1IQ7 A;  1LLS A;  5I2K B;  1LAF E;  1IXC A;  1AIV A;  1URD A;  4XIG Q;  1O7T A;  4OER A;  1IXI A;  3FXQ A;  3KEI A;  4TQU Q;  1GTK A;  3E9X A;  2I48 A;  2R6G E;  1DBZ A;  2HCA A;  3HHG A;  4IO5 A;  4ZE8 A;  3S9M C;  3PD8 A;  2VPN A;  3FUZ A;  1VFE A;  5K2X A;  3MVZ A;  4M1V A;  4YMA A;  1NUY A;  2CEX A;  4G4P A;  3RUM A;  3K1M A;  3FVN A;  2BJJ X;  2F7C A;  3TQW A;  3FAT A;  4FEB A;  3THI A;  5CC2 A;  5ELV A;  1MQG A;  4U4X A;  4RK9 A;  2ZNS A;  1FQB A;  4EQ9 A;  3TYH A;  4BDM A;  3MP8 A;  1SD3 A;  1EH3 A;  3GBA A;  3E79 A;  4ECF A;  3M3F A;  1JEV A;  3PUX E;  1B46 A;  1Q9D A;  2VGQ A;  3PPQ A;  4LA9 A;  2NVU B;  1USY E;  5CMK A;  1MM6 A;  2CZI A;  2DVZ A;  3RN8 A;  1YAE A;  2X26 A;  1AWB A;  3SES A;  2O7U A;  3TOD A;  5IZ3 A;  1FRP A;  2AIX A;  2UXA A;  1QUL A;  3K6V A;  3KC1 A;  4NF8 B;  4G77 A;  1M5D A;  2BJI A;  3RT6 B;  2A5S A;  5KCJ A;  1MRP A;  4LQ2 A;  3QAX A;  3L6H A;  5AA2 A;  1MY0 A;  2Z22 A;  1N3X A;  3DM0 A;  2F34 A;  3IR1 A;  3PD9 A;  2RC7 A;  4KI0 E;  4YB5 A;  4YU0 A;  1I6Q A;  4JWY A;  5I58 A;  3CFZ A;  1JW4 A;  1H44 A;  5ITO A;  1FW0 A;  4ZS9 A;  2Y7R A;  5KCJ B;  4WEP A;  4RPO A;  1ELJ A;  5AA2 B;  1ZU0 A;  4NF5 B;  5TPA A;  2GQ1 A;  3Q28 A;  5L9M A;  4NAP A;  1DOT A;  3ONM A;  1ZMG A;  3PPN A;  1FQD A;  2XXH A;  4Z0I A;  3LSL A;  1NNT A;  4G2Z A;  3SET A;  1B3G A;  2A5T B;  4TOZ A;  1LCF A;  1AL3 A;  1LCT A;  2XWK A;  4Z7E A;  4GLI A;  4GWX A;  3M8U A;  1MXU A;  1VDW A;  3FBP A;  3OEL A;  5DVF A;  3FAS A;  4AB6 A;  2XX8 A;  3MPK A;  3UN6 A;  2ABH A;  1LBX A;  2FHY A;  4KYS A;  4N15 A;  2RIN A;  4GX4 A;  4JVI A;  1YYZ A;  4R2B A;  2H98 A;  3MP1 A;  2ZMB A;  2WBD A;  4PFI A;  2DVC A;  5CI5 A;  1A99 A;  3CIJ A;  4AQ4 A;  4O7M A;  5ESY A;  4FEC A;  4GIZ A;  4F1U A;  1SYH A;  2R9J A;  2Q2A A;  3H3G A;  1RDZ A;  1ZJL A;  4NF6 B; 
#chains in the Genus database with same CATH homology
 3FGS A;  2Q89 A;  3BBR A;  2OCU A;  3WAF A;  3FD3 A;  3QK6 A;  3D4C A;  2UYF A;  1TT1 A;  4BLA A;  1II5 A;  2OLB A;  4ESW A;  4E0W A;  5A5X A;  1PC3 A;  4H67 A;  4KCD A;  5F1Q A;  2Y7K A;  3MVY A;  2HFB A;  4YB7 A;  4EQB A;  1SW2 A;  4NF4 A;  2ZYN A;  1DSN A;  2ZYM A;  3Q29 A;  2XXR A;  2OK2 A;  2YPN A;  4EXK A;  3C34 A;  2DP8 A;  4G68 A;  1GVC A;  3TUS A;  5A5X B;  1OVT A;  3MVW A;  1MPB A;  3IB2 A;  1A8F A;  2DE3 A;  3SEU A;  3KZG A;  1Y1M A;  4LZ5 A;  2DWJ A;  3HST A;  2Z23 A;  3S2V A;  1B05 A;  5I59 A;  1MS7 A;  3AXF A;  1LAH E;  2V3T A;  4G8N A;  1VR5 A;  4OEU A;  1TFA A;  1Y3P A;  3I3V A;  3K4U A;  3T22 A;  3T9V A;  2UVJ A;  3N6T A;  3K2D A;  3C33 A;  5FHN A;  3VE1 B;  2QPQ A;  4IGR A;  3TTN A;  4ELO A;  3MZ9 A;  3E3K A;  2NXO A;  4OFL A;  2I4B A;  4PFT A;  2NOO A;  3HN0 A;  1SW4 A;  4KHZ E;  5ICT A;  2RKM A;  4WXJ A;  3PPO A;  5JTY A;  3OSQ A;  4H0W A;  1LFG A;  2G93 A;  3FVG A;  2UVH A;  1J1N A;  1VFD A;  3LC8 A;  1US4 A;  4YIC A;  4U21 A;  4QFL A;  2D3I A;  1IIW A;  4IO7 A;  4ELR A;  1NKX A;  2XD2 A;  4QFN A;  1FQF A;  5I56 B;  2QRY A;  5HM4 B;  3QUF A;  5JTY B;  2H9B A;  3MZ1 A;  3LSX A;  2E0S A;  4DCX A;  3GLB A;  2I3V A;  2XXX A;  4IO4 A;  4F39 A;  1ZKB A;  3IOT A;  2PMS A;  3EHS A;  3UA8 A;  4AB5 A;  1LAX A;  3OEK A;  4YMB A;  1HSE A;  2DE4 A;  2Y84 A;  5DTB A;  5B70 A;  1M5C A;  4E0X A;  1B3H A;  1N0T A;  4NTL A;  1B0H A;  1B58 A;  3V89 B;  1GR2 A;  3O6G A;  1UTH B;  2F7A A;  2QSX A;  1FCK A;  2QS2 A;  3Q25 A;  2DYX A;  1OMP A;  1JEU A;  1H43 A;  1QW0 A;  4PFU A;  4F3B A;  1BTJ A;  1R9Q A;  1Y1Z A;  4RA1 A;  4WED A;  2GRV A;  1DMB A;  5HBC A;  2FNC A;  3G3J A;  4FAJ A;  2OJT A;  1R9L A;  4KYE A;  1B3E A;  5TP9 B;  4MLQ A;  2F78 A;  1ZLQ A;  3SEY A;  4LZ7 A;  2V3Q A;  3KN3 A;  3LBS A;  1OIB A;  2UVI A;  4IO6 A;  2H25 A;  3VVE A;  1B4Z A;  2O6A A;  1LGB C;  2HXW A;  1NFT A;  5DT6 A;  3CFL A;  1I6B A;  3CFX A;  1XOC A;  3IK6 B;  1MXW A;  1B7U A;  4R9G A;  4I9D A;  3O9P A;  1P1O A;  4U23 A;  4U2R A;  1B9J A;  4Q30 B;  1VE4 A;  5LOM A;  4BDO A;  2PT2 A;  2XXT A;  2F36 A;  4YAH X;  2Q9T A;  3G3H A;  4EQ7 A;  2Y7W A;  4ZE9 A;  1SBP A;  4OHN A;  4H5G A;  4P0G A;  3CSB A;  4HTG A;  4F19 A;  5JEI A;  4GOT A;  4JSD A;  3LSF B;  1FTK A;  1DTZ A;  3B6T A;  3RNN A;  5BUU A;  3O28 A;  1UQW A;  4I1D A;  4LVQ A;  5CBR A;  1NMU A;  1DPE A;  4ZZE A;  2ZYO A;  4ZDM A;  1P1U A;  3IB0 A;  1SI1 A;  1M5B A;  1P99 A;  1R6Z A;  5DVI A;  4H8J A;  1XHY A;  2HZK A;  4P11 A;  3KG2 A;  1B5J A;  1SI0 A;  3JYR A;  3UK4 A;  4C1T A;  2X7Q A;  3QSL A;  3CSG A;  4IY6 A;  2O84 X;  2I4C A;  5ISU A;  4N13 A;  3K01 A;  1IUD A;  3ZS6 A;  3A3C A;  3MW0 A;  2Z8E A;  3TTR A;  3ZKK A;  1S9T A;  4KD5 A;  3MUQ A;  3PPP A;  4XKP A;  4FIM A;  1O63 A;  1PB7 A;  3WAE A;  3S9N C;  3MVX A;  4DXC A;  3T9U A;  1CB6 A;  1B6H A;  1ZTY A;  3KN8 A;  3SEX A;  1OVB A;  3C35 A;  4LAT A;  3RQT A;  3T96 B;  5I2N A;  4QHQ A;  4QSE A;  5BWJ A;  1SDX A;  4GXA A;  4NF8 A;  3RPW A;  3HCQ A;  3R6U A;  1JW1 A;  3TTM A;  4X1B A;  1LFI A;  4MLV A;  3G3G A;  2DWI A;  4KR5 A;  3VV5 A;  3PUY E;  3TKD A;  2UVG A;  3C32 A;  4P0I A;  2QMW A;  1XC1 A;  4F2Q A;  5I2N B;  1F9B A;  3OOA A;  2Q8J A;  1N7W A;  2I49 A;  4OQO A;  3VLV A;  2GH9 A;  3EHU A;  3QYT A;  4NF5 A;  1XVY A;  2QS3 A;  4I8C A;  4X9T A;  3VLW A;  4GL0 A;  4KQP A;  2DWH A;  2LAO A;  2A5T A;  2F5X A;  3FXU A;  1WVJ A;  3G3F A;  2DXR A;  2XXP A;  3IX1 A;  1TXF A;  5FHO A;  4MH5 A;  4R74 A;  5KDT B;  3U93 A;  1QVS A;  2D21 A;  4GL8 A;  2REJ A;  2QL3 A;  5J1D A;  2RCA A;  3VXB A;  1NNK A;  2O51 A;  2XXU A;  4GF8 A;  1A7L A;  4NF6 A;  2XXY A;  3T9H B;  5JK4 A;  1HSJ A;  2XX9 A;  4OZ9 A;  3RY3 A;  1D9Y A;  1S50 A;  3DP6 A;  3MC2 A;  3IJO B;  2V3U A;  3N94 A;  4ND9 A;  2QS4 A;  5H8N A;  1MH4 A;  3W15 C;  4OTE A;  4PE5 B;  5DVJ A;  3QXM A;  4H65 A;  4MF3 A;  3B7D A;  1SYI A;  2Z8D A;  4LQ5 A;  4NWD A;  3H6T A;  3UOR A;  2ONK E;  4TLL B;  2DE2 A;  1R1N A;  1QJM A;  1NL5 A;  4H1X A;  4IO2 A;  5CMM A;  2G29 A;  1PEB A;  2I0C A;  3LR1 A;  3H03 A;  5H8N B;  4LON B;  2O68 A;  5DEX A;  1JVY A;  1FQA A;  4ISU A;  2B3F A;  3ILU B;  4C1U A;  5HPQ A;  2P1S A;  1POT A;  3PUW E;  1UIV A;  3TCG A;  3EN3 A;  3TQL A;  2VD2 A;  1BKA A;  4JBZ A;  3PUV E;  3OO7 A;  2DQV A;  3P7I A;  5M2V A;  2HQ0 A;  4ZED A;  3IL1 B;  3GXA A;  4X1D A;  4Q8R A;  3LSW A;  1NNF A;  2I58 A;  5DEX B;  2YLN A;  2GHB A;  3E4R A;  1P1N A;  3MZB A;  4HW8 A;  2Q2C A;  1XT8 A;  2V25 A;  2ZXT A;  4OVJ A;  1MY2 A;  3PUZ E;  3FJ7 A;  5FTI A;  3O66 A;  1IXH A;  3ECR A;  3RT8 A;  1DTG A;  1EU8 A;  4F22 A;  1JVX A;  3FVK A;  4PP0 A;  4U4S A;  3R26 A;  2XXV A;  1B4H A;  4IY5 A;  5K2Y A;  4OMB A;  2THI A;  5L9S A;  3IO4 A;  3O2A A;  5I56 A;  5F7V A;  2F35 A;  3UGW A;  3VVD A;  1LBC A;  1Q35 A;  4O3A A;  1MXV A;  5AA1 A;  5AA2 D;  3FVO A;  2Y7P A;  1L5T A;  3KSJ A;  4WKM A;  1XS5 A;  4XTC Q;  5KZT A;  2P0S A;  3MAM A;  3V8X B;  2QMX A;  1JET A;  4MBP A;  1AMF A;  1VSO A;  3ZKL A;  3RTF B;  4POW A;  4GFR A;  1UTH A;  4BDL A;  2ANJ A;  4EXL A;  3FV1 A;  1RYO A;  3BFU A;  3OSR A;  1JNF A;  2O1L A;  3OEN A;  1QUI A;  3H6V A;  3K6U A;  4GWO A;  1MY4 A;  1A55 A;  1MY1 A;  3FJM A;  1A40 A;  4ZEF A;  5TP9 A;  4FE8 A;  2VD3 A;  2HAU A;  2O7I A;  3G3I A;  1H45 A;  3UIF A;  1FTL A;  1MPC A;  4OYV A;  3TEL A;  1HSL A;  4RNS A;  2DSF A;  3PMV A;  4O3C A;  1FTJ A;  4GQO A;  3TFL A;  3Q27 A;  1QUJ A;  1Z7M E;  4F3S A;  4GVO A;  2PBW A;  3U8Q A;  1N84 A;  1RKM A;  4H8I A;  3CVG A;  3H4Z A;  3SEV A;  1Y4T A;  5DYH A;  3H06 B;  3G7W A;  4M4G A;  1YCJ A;  1URS A;  2Z8F A;  2XXW A;  3PMX A;  3HPI A;  3IB1 A;  2DXY A;  4KPT A;  4ZEB A;  1B40 A;  3HO7 A;  4UAC A;  4X48 A;  1IIT A;  4F31 B;  3CG1 A;  4KCC A;  3K00 A;  4R72 A;  3EQ1 A;  4JXI A;  4RK2 A;  4QFK A;  1MQD A;  1MH3 A;  4IGT A;  4FAT A;  3MQ9 A;  3IOR A;  3K1N A;  4HS7 A;  2AYS A;  4OEN A;  2AL4 A;  3V5A A;  4XKR A;  4O3B A;  1URG A;  2RF1 A;  4JSO A;  3K0V A;  3S9L C;  2I3W A;  3OXN A;  2F8D A;  1O64 A;  3O29 A;  3VFJ A;  1S7Y A;  1EZP A;  4ONY A;  1PB9 A;  3CG3 A;  2HEU A;  4H6D A;  4BDN A;  3CR9 A;  3A3U A;  1ZIU A;  2D5W A;  3TEP A;  2F7B A;  2I6E A;  1DPP A;  1MXX A;  2IA4 A;  3EPE A;  4N6P A;  2ONR A;  2DWA A;  1PDA A;  4F1Y A;  3TCH A;  3PMW A;  2QJE A;  4BDQ A;  4RXL A;  2Y7I A;  3ODB A;  2OZZ A;  3HHF A;  1M5F A;  1I69 A;  3IOV A;  3MWB A;  4OFO A;  2PT1 A;  4R9F A;  2KLF A;  1B1X A;  2Q88 A;  3PPR A;  4K3F A;  4ZZA A;  1B0L A;  3TDJ A;  2HZL A;  1NH7 A;  5EHS A;  3E13 X;  2RC8 A;  2V84 A;  3M3L A;  1UTB A;  5L9O A;  1Y20 A;  2NUV A;  3K6X A;  2R71 A;  2ESN A;  1NNP A;  3OD7 A;  3C31 A;  4R6H A;  2XXQ A;  2X7P A;  2VOZ A;  4YZZ A;  1EZO A;  4Q5T A;  5ITP A;  3TPA A;  3L6G A;  3I5O A;  1UTB B;  2OWT A;  5I84 A;  1CE2 A;  4LUB A;  3W9W A;  4PFW A;  1MXZ A;  4MFI A;  1LFH A;  2GFE A;  3KOS A;  1D9V A;  4DDD A;  4ESX A;  3IAZ A;  5CBS A;  2I0B A;  4RJZ A;  3C4M A;  4N07 A;  3I6V A;  2HAV A;  4R2F A;  2XHD A;  3IO6 A;  2V93 A;  4THI A;  3N6U A;  2B3B A;  4PET A;  3N5L A;  4QSC A;  4F18 A;  1Y3N A;  3U1O A;  4OXV A;  3H7M A;  1MDP 1;  1B3F A;  4DE8 A;  3OO8 A;  3A09 A;  3D4G A;  5I57 A;  5KDT A;  5AA4 A;  1B2H A;  1UIU A;  3TCF A;  4QFO A;  5H8S A;  4YB6 A;  4U1Z A;  4BDR A;  5CM6 A;  1LBB A;  4NMY A;  1XVX A;  3RGY A;  1US5 A;  1B1H A;  1WDN A;  1Z7N E;  3BFT A;  3W9V A;  3FJG A;  3JV9 A;  1Y3Q A;  1FTM A;  1OQG A;  2NWJ A;  3RLF E;  2P2A A;  5I57 B;  1Q1K A;  4QSD A;  4EDP A;  1ATG A;  1MM7 A;  5AA4 B;  3K02 A;  1OLA A;  5H8Q A;  1AH5 A;  1P1W A;  4I62 A;  4ZEK A;  3U72 A;  2XXI A;  3O6H A;  5IAI A;  3DLN A;  4GXS B;  1B32 A;  4OES A;  1N7X A;  1N3W A;  4XXU A;  3QIM A;  4DLD A;  1OLC A;  3KOT A;  1QKB A;  5B7D A;  1IEJ A;  4YKI A;  3S4U A;  5I58 B;  1MQJ A;  3FXR A;  5H8Q B;  5L8D A;  2FYI A;  3T9X B;  4R73 A;  4L17 A;  4KFQ A;  3TTL A;  2ZYK A;  3O6I A;  4OWD A;  1M5E A;  1NH8 A;  1LB8 A;  1BIY A;  5TPA B;  3JZJ A;  1JQF A;  4HCY A;  2H5Y A;  4DZ1 A;  3V83 A;  4ZEI A;  3KN7 A;  3F11 A;  3VXC A;  4R75 A;  5H8F A;  1B7Z A;  1MXY A;  3VDF A;  4ELQ A;  2ALU A;  3KBR A;  1LST A;  3KFM A;  3FV2 A;  4ELP A;  3FZV A;  3GBB A;  4NWC A;  4JWO A;  3SKP A;  3PV0 E;  5CMB A;  2IEE A;  3B6Q A;  2AL5 A;  3OEM A;  4XKQ A;  4IO3 A;  4DIG A;  2OWS A;  5H8F B;  4EF1 A;  1JW5 A;  1QUK A;  2PYY A;  3IJX B;  3TAJ A;  4GD5 A;  3K1P A;  3T93 B;  3TZA A;  4RPN A;  4RYA A;  3SER A;  1A8E A;  5CMC A;  4Q0C A;  4U22 A;  4JB7 A;  3C9H A;  3N26 A;  1MQI A;  5H8H A;  2E1S A;  1N04 A;  5FTH A;  1SW1 A;  2QS1 A;  2DS9 A;  1Y4C A;  4F1V A;  1IXG A;  3DEL B;  4G8H A;  4H5F A;  3IOU A;  3VVF A;  4YKP A;  1EZ9 A;  3USD A;  3QUJ A;  4NF4 B;  2REG A;  1H76 A;  1BLF A;  1YTV A;  1ZBM A;  1SVX B;  1B7H A;  2XX7 A;  5CRY A;  4UA8 A;  4NE4 A;  1B52 A;  2RC9 A;  5H8H B;  4G68 B;  1POY 1;  3KJT A;  2H4I A;  3LUY A;  1MQH A;  3EF7 A;  2PX1 A;  3ZSF A;  1D4N A;  3VLU A;  3T66 A;  3OO9 A;  5I59 B;  2CZL A;  4IB2 A;  1SW5 A;  2UYE A;  4FJP A;  4OET A;  4QFP A;  4DCY A;  3U92 A;  4LZ8 A;  2W7Y A;  2XD3 A;  3BKI B;  1FQE A;  4KYD A;  3Q26 A;  3GZG A;  1QKA A;  3B6W A;  3HV1 A;  3O97 A;  4EF2 A;  1D3K A;  4PQJ A;  1PB8 A;  3MJN A;  1YPN A;  1ANF A;  2YJP A;  3PGF A;  1LAG E;  4NED A;  5AE4 A;  3CI8 A;  3DP4 A;  2WKY A;  1FQC A;  4TLM B;  2OBG A;  1B5H A;  2F6G A;  2PVU A;  4HCW A;  2H99 A;  1BP5 A;  3PU5 A;  3KGC A;  2ZNU A;  5FHM A;  3U94 A;  4F3P A;  3H6W A;  5ICQ A;  4FED A;  4QF9 A;  4C0R A;  2VHA A;  3H6U A;  4DXU A;  5IKB A;  4F29 A;  2ONS A;  2DOJ A;  1GV8 A;  4YKK A;  1PBQ A;  3TTK A;  4G68 C;  3CRB A;  3EHT A;  1PBP A;  4YKJ A;  2VP1 A;  1H3D A;  3IOW A;  3M3K A;  3UP9 A;  2O1M A;  1SQY A;  1TFD A;  1P1Q A;  3K6W A;  3MP6 A;  1T0K A;  1MDQ A;  1OQH A;  1B5I A;  3OMB A;  4FOR A;  3S9E A;  4GRK A;  4F3G A;  3SEW A;  1AOV A;  1Y9U A;  3OO6 A;  1MG1 A;  4R6K A;  4XKN A;  3C36 A;  3ILT B;  4EUO A;  2ZNT A;  3TMG A;  2M8C A;  1N76 A;  4F2O A;  5EHM A;  2FA7 A;  1B51 A;  3DP8 A;  1TWY A;  3KJ7 A;  3KSX A;  1USY H;  5AA3 A;  4POX A;  3G3K A;  4JDF A;  1WOD A;  1RYX A;  4LP2 B;  1I6A A;  2CMO A;  2GHA A;  3RTW B;  2RCB A;  1A54 A;  1LB9 A;  4JWX A;  3SDF A;  1MPD A;  5TU0 A;  2O69 A;  4DXB A;  3MBP A;  4OFJ A;  3FIR A;  4OEV A;  1IZ1 A;  4PFY A;  5I2K A;  2F6P A;  1MY3 A;  5EYF A;  4U1O A;  1B3L A;  4G8M A;  1FTO A;  3MPL A;  3R7X A;  4RY1 A;  2F97 A;  4QRZ A;  1GGG A;  1KWH A;  4ZEC A;  2B65 A;  4R6Y A;  1IQ7 A;  1LLS A;  5I2K B;  1LAF E;  1IXC A;  1AIV A;  1URD A;  4XIG Q;  1O7T A;  4OER A;  1IXI A;  3FXQ A;  3KEI A;  4TQU Q;  1GTK A;  3E9X A;  2I48 A;  2R6G E;  2HCA A;  3HHG A;  4IO5 A;  4ZE8 A;  3S9M C;  3PD8 A;  3FUZ A;  1VFE A;  5K2X A;  3MVZ A;  4M1V A;  4YMA A;  4G4P A;  3RUM A;  3K1M A;  3FVN A;  2BJJ X;  2F7C A;  3TQW A;  3FAT A;  4FEB A;  3THI A;  5CC2 A;  5ELV A;  1MQG A;  4U4X A;  4RK9 A;  2ZNS A;  1FQB A;  4EQ9 A;  3TYH A;  4BDM A;  3MP8 A;  1SD3 A;  1EH3 A;  3GBA A;  4ECF A;  3M3F A;  1JEV A;  3PUX E;  1B46 A;  2VGQ A;  3PPQ A;  4LA9 A;  2NVU B;  1USY E;  5CMK A;  1MM6 A;  2DVZ A;  3RN8 A;  1YAE A;  2X26 A;  3SES A;  2O7U A;  3TOD A;  2AIX A;  2UXA A;  1QUL A;  3K6V A;  4NF8 B;  4G77 A;  1M5D A;  3RT6 B;  2A5S A;  5KCJ A;  1MRP A;  4LQ2 A;  3QAX A;  3L6H A;  5AA2 A;  1MY0 A;  2Z22 A;  1N3X A;  3DM0 A;  2F34 A;  3IR1 A;  3PD9 A;  2RC7 A;  4KI0 E;  4YB5 A;  4YU0 A;  1I6Q A;  4JWY A;  5I58 A;  3CFZ A;  1JW4 A;  1H44 A;  5ITO A;  1FW0 A;  4ZS9 A;  2Y7R A;  5KCJ B;  4WEP A;  4RPO A;  1ELJ A;  5AA2 B;  1ZU0 A;  4NF5 B;  5TPA A;  3Q28 A;  5L9M A;  1DOT A;  3ONM A;  1ZMG A;  3PPN A;  1FQD A;  2XXH A;  4Z0I A;  3LSL A;  1NNT A;  4G2Z A;  3SET A;  1B3G A;  2A5T B;  4TOZ A;  1LCF A;  1AL3 A;  1LCT A;  4Z7E A;  4GLI A;  3M8U A;  1MXU A;  3OEL A;  5DVF A;  3FAS A;  4AB6 A;  2XX8 A;  3MPK A;  3UN6 A;  2ABH A;  4KYS A;  2RIN A;  4R2B A;  2H98 A;  3MP1 A;  2ZMB A;  2DVC A;  5CI5 A;  1A99 A;  3CIJ A;  4AQ4 A;  4FEC A;  4GIZ A;  4F1U A;  1SYH A;  2R9J A;  2Q2A A;  3H3G A;  1ZJL A;  4NF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...