3PPQA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
TIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 100
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ppqA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3ppqA02
5AA1A 3LBSA 4GXSB 1A40A 4DZ1A 4EF1A 2REJA 1TXFA 4F1VA 3RUMA 2Z8DA 4NF4A 4QFKA 4FAJA 3EHSA 4F22A 3IB2A 2LAOA 4NF5A 2GHBA 4NF8B 2F35A 4IY6A 4ELQA 4EQ7A 3ODBA 2QMXA 3FASA 5I84A 4OYVA 3CIJA 4X1BA 2I4BA 2DWHA 3L6HA 2O84X 1XT8A 4YB7A 4OEUA 5I59B 3EQ1A 1B3HA 1J1NA 4GQOA 2XXHA 1Y3PA 3PMXA 1HSLA 3PUWE 3FJMA 1H43A 1QUIA 3OSQA 2B3BA 3FD3A 5EYFA 3N6TA 1LAGE 4IO3A 2GFEA 4QSCA 2VOZA 5IAIA 4R2FA 5CM6A 3RY3A 4FEDA 3OMBA 2XXXA 2DQVA 1IXGA 5KCJA 3QAXA 1BP5A 1IZ1A 1N3XA 5JK4A 3WAEA 3K1NA 5ISUA 4OHNA 5ICQA 1EZ9A 1FQBA 3S9EA 3BFUA 1B51A 3QIMA 4XTCQ 1IIWA 2ALUA 1B7UA 3W15C 3RQTA 2ONRA 3FIRA 4R6KA 2I58A 2R6GE 2FA7A 2PT2A 3SEWA 4G68B 4RK2A 2I6EA 3FVKA 4QSEA 4Z7EA 4UA8A 3THIA 3M3LA 2D5WA 3U1OA 4GWOA 1XS5A 4P11A 3PPNA 1B3FA 3F11A 3MP1A 3TYHA 1P1QA 4U22A 4PFUA 2X7QA 5JTYA 5H8SA 1NNTA 5H8HB 2PVUA 3K1MA 2QJEA 2M8CA 3EF7A 1Y3NA 2DP8A 1YCJA 4BDRA 1MY1A 2GH9A 2G93A 3W9WA 4FJPA 1XVXA 2I49A 1VFEA 4N6PA 4DXCA 3U72A 4R73A 3G3FA 3FVOA 2NWJA 5M2VA 1N7XA 3LSXA 4H65A 3QSLA 3JV9A 2I4CA 3OO6A 2HAUA 1EH3A 3O9PA 4M4GA 1N84A 2W7YA 1PC3A 1MPBA 4IO7A 3JZJA 3O28A 1USYE 2Z8EA 2H9BA 1QUKA 1NFTA 3GZGA 3RTWB 4F39A 1DOTA 1SYIA 1YPNA 1QW0A 4XKQA 3CRBA 1JETA 5BWJA 1JEUA 3M3KA 2E1SA 2A5TB 3OD7A 3TODA 4C1TA 3RTFB 2DE2A 2GRVA 1Z7ME 3HHFA 2F34A 2O6AA 5EHSA 3HCQA 3PUYE 3IOTA 3QXMA 1BIYA 2A5SA 4OZ9A 3BBRA 3TCFA 1SI0A 1AL3A 1FTJA 3T22A 3VE1B 5AE4A 3DP6A 3UP9A 2QRYA 3G3JA 4RXLA 1LBBA 1EZPA 1MQIA 1B7ZA 3SETA 4OTEA 3K2DA 1N0TA 1IQ7A 1B9JA 3L6GA 3LSLA 2PYYA 4DIGA 1DTGA 2QSXA 5L9OA 3MPLA 1URSA 3KZGA 5K2XA 3SKPA 2F7CA 1MRPA 1MQHA 4G8MA 2O51A 1B0HA 3EN3A 1Y9UA 1P1UA 4KYEA 4F19A 3M3FA 3Q29A 3K6WA 2VHAA 3VVFA 3EHTA 3H3GA 3IO4A 3TAJA 2ZNUA 2DOJA 4EF2A 2UYFA 3KJ7A 1KWHA 4F2QA 1MG1A 4QF9A 1IEJA 4POWA 2NVUB 1B7HA 3FXQA 2XD3A 1USYH 2IA4A 3GLBA 1SQYA 2XXIA 1OLAA 2DYXA 2DWIA 4OFLA 5EHMA 2D21A 4IO5A 3C33A 1IXHA 2F7AA 1SW2A 4XXUA 3O29A 4OERA 2ABHA 4LQ5A 1MS7A 3OEMA 2H98A 4JWOA 1IITA 3UGWA 1DPPA 1ZBMA 4XKPA 5K2YA 1MH3A 4F3SA 3IK6B 2ZYOA 3K6XA 2E0SA 1AOVA 4BDOA 2XD2A 4IO6A 4ISUA 4PFWA 3VLVA 1SW1A 4YKKA 2VP1A 2XXQA 1DPEA 1MXYA 4R6YA 4FE8A 5LOMA 2ESNA 4NEDA 1R9QA 4C1UA 3HPIA 3FATA 3H7MA 4U4XA 5I2KB 1VFDA 3FXUA 3H6UA 3IOUA 1JW1A 4NWDA 1D9YA 3OENA 4X9TA 3I6VA 4JSOA 1A8EA 4EXKA 4FEBA 3CG1A 3MZ9A 2DE4A 3V89B 1NNKA 3TKDA 2UYEA 4R72A 1OVBA 3VDFA 3IB0A 1LSTA 2DXYA 3P7IA 3TDJA 3IL1B 5FHOA 4RY1A 1MXWA 1UIUA 3TPAA 1VSOA 3TZAA 1B3LA 3E4RA 4BLAA 2ZYMA 4O3CA 3FUZA 2XXVA 2DWJA 4GXAA 4TOZA 4F3GA 1POY1 3VVDA 4ZZAA 3ZS6A 3T9UA 4LZ8A 5ITOA 4GIZA 3PUZE 3ILUB 2XXYA 3VV5A 2O69A 4MBPA 4H8JA 1FTLA 1Y4TA 1UTHA 1ANFA 4NWCA 2DWAA 1HSJA 3U93A 3FGSA 4H6DA 3K01A 3R6UA 2AL5A 2RC8A 2CZLA 4QHQA 4Q0CA 1IUDA 1MXUA 1GGGA 2OK2A 4KCDA 5CMKA 1MDQA 3C35A 5L8DA 4ZEDA 2I48A 2Q8JA 3TTNA 3KOTA 4IGTA 2P1SA 3E9XA 2O1MA 4QFPA 4HCYA 4O3BA 4OETA 3ZKKA 1H45A 3SEUA 5AA4B 2HZKA 4DXBA 4Q8RA 1M5DA 3ONMA 4F3BA 4KCCA 2UVHA 3ZSFA 1POTA 3TFLA 1NH8A 1SW4A 3Q26A 2Y7KA 1GVCA 1XC1A 4G68C 1FTMA 2PBWA 3H06B 5DT6A 4JDFA 2QS2A 3G3KA 3HO7A 2XXPA 2ZXTA 4I1DA 2Z22A 5H8QA 3FXRA 4MF3A 5JEIA 4IO2A 4YKPA 2B3FA 2QPQA 2AYSA 3PUXE 1FQEA 1DMBA 3OO8A 4MLQA 1ZTYA 1Y3QA 3CG3A 4ZEBA 4OVJA 5H8NB 3MWBA 2PX1A 2I0BA 3GBAA 4NF8A 2RF1A 4IO4A 3O66A 4DCYA 2DVZA 4QSDA 5DYHA 2RC9A 1OVTA 3RPWA 1MH4A 3PU5A 1WODA 5HM4B 1NMUA 1GV8A 3B7DA 5I59A 3HN0A 4AQ4A 3KBRA 4UACA 4YMBA 3ZKLA 1I69A 1SBPA 3MUQA 4R2BA 4GRKA 4DDDA 1P1NA 3H6TA 3H03A 2XXRA 4PETA 4ZDMA 3O6IA 3S9NC 1B3EA 1B5IA 3EHUA 1LCFA 3MW0A 5I57B 2XHDA 1FTKA 3I5OA 1LGBC 1TT1A 1B46A 3MJNA 4U1OA 4Z0IA 4LONB 3ECRA 3IX1A 2FNCA 1YTVA 3OXNA 1M5CA 2WKYA 2XX9A 1BLFA 1B32A 2R9JA 3UN6A 3S9LC 4U21A 1BTJA 5BUUA 3FVNA 3D4CA 2GHAA 4F3PA 3TMGA 1M5EA 4EDPA 3KSXA 1SW5A 4G68A 1N04A 2DXRA 3LR1A 3FV2A 1ZLQA 3K1PA 3O2AA 2Z8FA 4H67A 4YKJA 1R1NA 3C9HA 2NXOA 1LAFE 3PGFA 4RPNA 3IJXB 3QK6A 3AXFA 4FIMA 4JWXA 2YLNA 2Z23A 5TPAB 4POXA 3LC8A 4NTLA 3BKIB 3IB1A 1MY3A 4OFOA 4WEPA 5I58B 2RINA 5FHNA 4I8CA 5H8HA 3CFZA 4DCXA 4PP0A 3H4ZA 4YZZA 4Q5TA 4FORA 3RLFE 3H6VA 3CSGA 5A5XB 4GL8A 3KG2A 3VLWA 1MPCA 2HAVA 2NOOA 3K6UA 1ZIUA 2RCBA 1SD3A 1B05A 2Q89A 4NF6B 1QJMA 4ELRA 2H25A 5DEXB 1XVYA 2OWSA 3W9VA 2QS1A 2I3VA 4H8IA 1H3DA 1LLSA 5IKBA 1L5TA 1LAHE 2CMOA 3MVYA 3K02A 4K3FA 5CC2A 4MFIA 5HPQA 1FQCA 2FYIA 3IOVA 4P0IA 1OMPA 4U1ZA 3RNNA 1LB8A 4ND9A 3VLUA 3U94A 1JNFA 2A5TA 3KJTA 3VVEA 3V83A 3OEKA 3OO9A 1A99A 1MDP1 3KN8A 3MZ1A 1M5BA 3S4UA 4R74A 1PEBA 2REGA 4OFJA 4RJZA 1NKXA 2Y7RA 4F1UA 4C0RA 2ZNTA 3DM0A 3MP6A 2YJPA 2AIXA 1VE4A 1Y1MA 3Q25A 1IXIA 5DVIA 4XKNA 1H76A 4NF6A 5DEXA 4JB7A 5CI5A 3QUJA 1YAEA 3HHGA 1Y4CA 4ZECA 2F6GA 4IGRA 1S7YA 3N6UA 4JXIA 4WXJA 1JEVA 4IY5A 4THIA 1N7WA 2HXWA 4RK9A 4WKMA 3DP4A 2UVJA 1TFDA 3VFJA 3LSWA 4KI0E 4DXUA 1PB9A 4KYSA 4RNSA 3MAMA 4EQBA 5KDTB 4RA1A 2P0SA 1MXVA 3T93B 2QMWA 3UK4A 5B70A 3O97A 3I3VA 3TCHA 1BKAA 3C36A 5TU0A 3TTRA 5J1DA 1SVXB 3N26A 1LFGA 3OO7A 2KLFA 3OSRA 1FQFA 3DLNA 1CB6A 2ZNSA 4LATA 2UXAA 1B5JA 3E13X 3FJ7A 4MLVA 4U2RA 1VR5A 4JWYA 3K00A 2OLBA 1QVSA 1DSNA 3IO6A 1AMFA 3RT6B 2ZYNA 1B2HA 1S9TA 4LQ2A 1MY0A 4ZS9A 4ZEFA 2B65A 5DVJA 3HSTA 5I56B 3QYTA 1MM7A 1URGA 3M8UA 3TQWA 4HTGA 3MVZA 1D9VA 4AB5A 5I2NB 1NNPA 4EUOA 2F8DA 4ELPA 4GD5A 3C32A 2RKMA 3LUYA 3KGCA 3IR1A 3TTKA 5CMBA 1CE2A 1ZMGA 2H4IA 4EXLA 3SEYA 2IEEA 2Y7IA 4NF5B 1FCKA 4P0GA 3A09A 3EPEA 5F1QA 5I2KA 1GR2A 4OQOA 1S50A 4FATA 4G8HA 4G2ZA 1Z7NE 3CR9A 1UIVA 3N94A 3G3GA 4BDLA 3Q28A 3VXBA 1AIVA 4R6HA 1JW4A 3RGYA 4O3AA 3PUVE 3FZVA 4I9DA 2F7BA 1XHYA 2V3TA 1LAXA 2Y7WA 5I2NA 1JQFA 4N13A 3G7WA 2HQ0A 3T66A 1Q1KA 5KCJB 1I6BA 1US5A 3KN3A 3K0VA 5CMCA 3TTLA 2ONKE 4LVQA 4YKIA 3OELA 1R6ZA 5TP9B 5ITPA 4OXVA 4X48A 4PQJA 1N3WA 4GL0A 5ICTA 3C34A 4TLMB 3V8XB 1II5A 2H99A 4ONYA 1OQGA 3V5AA 1MM6A 1FTOA 4WEDA 4ZEKA 4F1YA 1EZOA 3GBBA 3MZBA 3A3CA 1Y20A 1URDA 2I3WA 4LZ5A 2AL4A 1T0KA 3T9VA 1MXXA 1ELJA 3D4GA 5DVFA 3RN8A 4TQUQ 1XOCA 3TELA 1ATGA 1Y1ZA 3O6HA 1A8FA 3O6GA 1M5FA 2F5XA 4PE5B 3ILTB 5JTYB 2DE3A 4KD5A 2BJJX 3LSFB 3DP8A 4XKRA 1A55A 4GF8A 4H5GA 4TLLB 3JYRA 5AA4A 4OESA 3B6TA 4LA9A 2YPNA 2ONSA 1O63A 2D3IA 3PMVA 1US4A 2QS4A 2Y84A 3K6VA 5H8FB 5TP9A 3FV1A 2UVGA 4E0XA 4BDMA 2HEUA 3DELB 5AA2B 4YU0A 4QFOA 4NE4A 5L9SA 3PD9A 4KQPA 4YB6A 4KPTA 4ZE8A 2OJTA 3SDFA 1PDAA 4G4PA 4AB6A 3IAZA 3PPQA 1JVXA 3KEIA 2O68A 3UORA 1QKBA 4N07A 4LZ7A 1NL5A 3TEPA 3Q27A 1QKAA 4OENA 3SESA 1IXCA 2UVIA 4G77A 1P99A 3GXAA 3RT8A 5H8NA 1ZU0A 1RYOA 2NUVA 2OZZA 3T9HB 4H1XA 4GOTA 3MQ9A 3SEVA 3TQLA 1P1OA 4F18A 1PB7A 5H8FA 1B0LA 1UQWA 4YAHX 1B6HA 3MP8A 1LBCA 1QUJA 1B58A 3MVXA 5AA2A 3C31A 2XXWA 4ESXA 5HBCA 2VD2A 4KR5A 4HW8A 1MQJA 3VXCA 1ZJLA 1MY4A 5DTBA 1B5HA 1I6QA 1O7TA 1NH7A 4GFRA 4LP2B 3T9XB 3KFMA 1EU8A 4R75A 4BDQA 4QFLA 3CFLA 4LUBA 4G8NA 3SEXA 4KHZE 1P1WA 3PMWA 2Q88A 5I57A 1MXZA 2H5YA 2RCAA 3R26A 2F97A 1H44A 1RKMA 2OBGA 2X7PA 1LB9A 4JSDA 3MVWA 4H5FA 1WDNA 2P2AA 2O7IA 1GTKA 2PT1A 2X26A 2XXTA 5AA3A 4HS7A 3QUFA 1FW0A 3IOWA 4ECFA 2Q2AA 1B1HA 4XIGQ 3TTMA 3MPKA 1RYXA 3C4MA 2ANJA 1D3KA 3MC2A 4HCWA 5L9MA 3G3HA 1JVYA 3B6QA 3IORA 1B4ZA 4ESWA 1B40A 5TPAA 5CMMA 3SERA 4DE8A 4QRZA 1FQAA 5FTHA 5I58A 1R9LA 1NNFA 5CRYA 3B6WA 1PBQA 2ZMBA 5AA2D 1B3GA 1UTBB 2Q2CA 2VD3A 2THIA 1A7LA 5A5XA 4OEVA 3FVGA 2ZYKA 1QULA 3KN7A 1LFHA 1SDXA 4DLDA 2VGQA 1OIBA 2F36A 3PV0E 4Q30B 4ZEIA 3PPRA 4GLIA 5F7VA 1D4NA 4RYAA 4ZZEA 2OCUA 4PFYA 5FHMA 3A3UA 2HCAA 5KZTA 4E0WA 2HZLA 4F2OA 1A54A 4I62A 1B4HA 3MBPA 1DTZA 1SI1A 2G29A 1TFAA 3U92A 3WAFA 4ZE9A 1F9BA 1I6AA 3S9MC 4X1DA 2Q9TA 4U4SA 2F78A 3S2VA 3R7XA 1B52A 3UIFA 1UTBA 1O64A 1WVJA 4FECA 5CBSA 3TUSA 4YICA 2V25A 3PD8A 1LFIA 4EQ9A 4ELOA 2DSFA 5ELVA 2DS9A 1AH5A 2OWTA 1OQHA 5CBRA 1MY2A 4RPOA 1N76A 2HFBA 3PPPA 4YB5A 2R71A 3U8QA 1OLCA 2DVCA 1PB8A 4F29A 1FQDA 1ZKBA 4NMYA 2QL3A 3FJGA 2PMSA 1B1XA 2V3UA 1UTHB 2RC7A 2QS3A 4PFTA 2Y7PA 3T96B 3KOSA 3CVGA 4OMBA 3USDA 3KSJA 2XX7A 5KDTA 2V93A 2O7UA 4H0WA 1MQDA 4JBZA 4U23A 4GVOA 3IJOB 3K4UA 4NF4B 3CFXA 3CSBA 1LCTA 3OOAA 3E3KA 4KFQA 2V84A 4L17A 2F6PA 3PPOA 2I0CA 4F31B 3N5LA 2O1LA 4IB2A 1Q35A 4R9FA 1HSEA 5FTIA 3UA8A 1TWYA 2XXUA 4QFNA 3BFTA 1JW5A 5B7DA 2XX8A 4YMAA 3HV1A 4M1VA 5I56A 1MPDA 3H6WA 3TCGA 4OWDA 4BDNA 4R9GA 3G3IA 5H8QB 1PBPA 1MQGA 4MH5A 3CI8A 2V3QA 1SYHA 4KYDA
chains in the Genus database with same CATH superfamily
5AA1A 3LBSA 4GXSB 4O94A 1A40A 4DZ1A 4EF1A 4I40A 2REJA 1TXFA 4F1VA 3RUMA 2Z8DA 4NF4A 4QFKA 4FAJA 3EHSA 4F22A 3IB2A 5EYGA 2LAOA 4NF5A 2GHBA 4NF8B 2F35A 4IY6A 4ELQA 4HE1A 4EQ7A 3ODBA 2QMXA 3FASA 5I84A 4OYVA 4XEQA 3CIJA 4X1BA 4LN5A 2I4BA 2DWHA 3L6HA 2BJIA 2O84X 1XT8A 4YB7A 4OEUA 5I59B 3EQ1A 1B3HA 1J1NA 4GQOA 2XXHA 2CEYA 1Y3PA 3PMXA 1HSLA 1FBEA 5DW8A 3PUWE 3FJMA 3MSTA 1H43A 1QUIA 3OSQA 2B3BA 3FD3A 1IMEA 5EYFA 3N6TA 3HFUA 1LAGE 4IO3A 2B4LA 4MNIA 2GFEA 4QSCA 2VOZA 5IAIA 4R2FA 5CM6A 3RY3A 4FEDA 3OMBA 5I7IA 2XXXA 2DQVA 1IXGA 3QMFA 5KCJA 3QAXA 4NHBA 1BP5A 1IZ1A 1N3XA 2WYPA 4N8GA 5JK4A 3WAEA 3K1NA 5ISUA 4OHNA 5ICQA 1EZ9A 1FQBA 3S9EA 3BFUA 1B51A 3QIMA 4XTCQ 1IIWA 1IMAA 2ALUA 1B7UA 3W15C 3RQTA 2ONRA 3FIRA 4R6KA 2I58A 2R6GE 2FA7A 2PT2A 3SEWA 1YXIA 4G68B 4GBVA 2XWIA 4RK2A 5EQ7A 2I6EA 3FVKA 4QSEA 4Z7EA 4UA8A 3THIA 3M3LA 2D5WA 3U1OA 1DK4A 4GWOA 1XS5A 4P11A 3PPNA 1B3FA 3F11A 3MP1A 4N4UA 3TYHA 1P1QA 4U22A 4PFUA 2X7QA 1D9QA 5JTYA 4OVRA 5H8SA 1NNTA 5H8HB 2PVUA 3K1MA 2QJEA 1INPA 2M8CA 3EF7A 1Y3NA 2DP8A 1YCJA 4NN3A 4BDRA 1MY1A 2GH9A 2G93A 3W9WA 4FJPA 1XVXA 2I49A 1VFEA 4N6PA 4DXCA 3U72A 4R73A 4NG7A 3G3FA 3FVOA 2NWJA 1EYKA 5M2VA 4P9KA 1N7XA 3LSXA 4JVDA 4H65A 3QSLA 3JV9A 2I4CA 3OO6A 2HAUA 1EH3A 4GWUA 2XXKA 3O9PA 4M4GA 1FPEA 5IZ3A 1N84A 2W7YA 1PC3A 2HHMA 1MPBA 4PC9A 4IO7A 3JZJA 3O28A 1USYE 2Z8EA 2H9BA 1QUKA 1NFTA 3GZGA 3RTWB 4F39A 1DOTA 1SYIA 1YPNA 1QW0A 4XKQA 3CRBA 1JETA 5BWJA 1JEUA 3M3KA 2E1SA 2A5TB 3OD7A 4PDDA 3U65A 3TODA 4C1TA 3RTFB 2DE2A 2GRVA 1Z7ME 3HHFA 2F34A 2O6AA 5EHSA 3HCQA 5FBPA 1XI6A 3PUYE 3IOTA 3QXMA 1BIYA 2A5SA 1NV6A 4OZ9A 3BBRA 4P8BA 3TCFA 1SI0A 4PAKA 1AL3A 1FTJA 3T22A 3VE1B 5AE4A 3DP6A 4N6KA 3UP9A 2QRYA 3G3JA 4RXLA 1LBBA 1FJ9A 1EZPA 2WEFA 1MQIA 1B7ZA 3SETA 4OTEA 3K2DA 1NV4A 1N0TA 4MNCA 1IQ7A 1FBHA 1B9JA 3L6GA 3LSLA 2PYYA 4DIGA 1LEVA 1DTGA 2QSXA 5L9OA 3MPLA 1URSA 3KZGA 5K2XA 5LTCA 4P47A 3SKPA 2F7CA 1MRPA 1MQHA 4G8MA 2O51A 1B0HA 3EN3A 1Y9UA 5I3SA 1P1UA 4KYEA 3A29A 4F19A 3M3FA 3Q29A 3K6WA 5ET7A 2VHAA 3VVFA 3EHTA 3H3GA 3IO4A 3TAJA 2ZNUA 3FXBA 2DOJA 4EF2A 2UYFA 3KJ7A 1KWHA 4F2QA 1MG1A 1DCUA 4QF9A 1IEJA 4GWWA 4POWA 2NVUB 1B7HA 4G61A 3FXQA 2XD3A 1USYH 2IA4A 1QGXA 3GLBA 1SQYA 2XXIA 1OLAA 2DYXA 2DWIA 4OFLA 5EHMA 2D21A 4OANA 4IO5A 3C33A 1IXHA 2F7AA 1SW2A 4XXUA 3O29A 4OERA 2ABHA 4LQ5A 1MS7A 3OEMA 2H98A 4JWOA 1IITA 3UGWA 1DPPA 2Q74A 3T0JA 1ZBMA 2QFLA 4XKPA 5K2YA 1MH3A 4F3SA 3IK6B 2ZYOA 3K6XA 2E0SA 1AOVA 4BDOA 2XD2A 4FBPA 4IO6A 4ISUA 1FBGA 4PFWA 3VLVA 1SW1A 4YKKA 1NV5A 2VP1A 2XXQA 1DPEA 4DI3D 1MXYA 4R6YA 4FE8A 5LOMA 2ESNA 4PAFA 4P1EA 4NEDA 1R9QA 4C1UA 3HPIA 3FATA 3H7MA 4U4XA 4PFIA 5I2KB 1VFDA 3FXUA 3H6UA 3IOUA 4N81A 1JW1A 4NWDA 1D9YA 3OENA 4X9TA 3BIGA 3I6VA 4JSOA 1A8EA 4EXKA 4FEBA 3CG1A 4NAPA 3MZ9A 2DE4A 3V89B 1NNKA 3TKDA 2UYEA 4R72A 1OVBA 3VDFA 3IB0A 1LSTA 2DXYA 3P7IA 2WBBA 3TDJA 3IL1B 5FHOA 3FBPA 4MHFA 4RY1A 4NGUA 1MXWA 1LBWA 1UIUA 3TPAA 1VSOA 3TZAA 1B3LA 3E4RA 4BLAA 2ZYMA 2WYKA 4O3CA 3FUZA 2F3BA 2DDKA 2XXVA 2DWJA 4GXAA 4TOZA 4F3GA 1POY1 3VVDA 4ZZAA 3ZS6A 3T9UA 4HE0A 4LZ8A 5ITOA 4GIZA 3PUZE 3ILUB 2XXYA 3VV5A 2O69A 4MBPA 4H8JA 1FTLA 1Y4TA 1UTHA 1ANFA 4NWCA 2DWAA 1HSJA 3U93A 3FGSA 4H6DA 3K01A 3R6UA 2AL5A 2RC8A 2CZLA 4QHQA 4Q0CA 1IUDA 1MXUA 4O7MA 1GGGA 2OK2A 4KCDA 5CMKA 1MDQA 3C35A 3IFCA 1NV3A 5L8DA 4ZEDA 2I48A 2QVRA 2Q8JA 4PFRA 3TTNA 3KOTA 4IGTA 1NUYA 2P1SA 3E9XA 4PDHA 2O1MA 4QFPA 4HCYA 4O3BA 4OETA 3ZKKA 1FPFA 1H45A 3SEUA 5AA4B 2HZKA 4DXBA 1M5DA 4Q8RA 3ONMA 4F3BA 4KCCA 2UVHA 3ZSFA 1KZ8A 1POTA 2OX3A 3TFLA 1NH8A 1SW4A 3Q26A 2Y7KA 1GVCA 1XC1A 2HXRA 4G68C 1FTMA 1IMFA 2PBWA 3H06B 5DT6A 4MCOA 2KR0A 3RPLB 4JDFA 2QS2A 3G3KA 3HO7A 2XXPA 2ZXTA 4I1DA 2Z22A 5H8QA 1JP4A 1FTAA 3FXRA 4MF3A 5JEIA 4IO2A 4YKPA 2B3FA 4N17A 2QPQA 3B50A 2AYSA 4GX3A 4MNPA 3PUXE 1FQEA 1DMBA 3OO8A 4MLQA 1ZTYA 1Y3QA 3CG3A 4ZEBA 4OVJA 5H8NB 3MWBA 2XWOA 2PX1A 4PBQA 2I0BA 3GBAA 4NF8A 2RF1A 4IO4A 1FJ6A 3O66A 4DCYA 2DVZA 4QSDA 5DYHA 2RC9A 1OVTA 3RPWA 4XF5A 1MH4A 3PU5A 1WODA 5HM4B 1NMUA 1GV8A 3B7DA 4QBAA 5I59A 3HN0A 4AQ4A 3KBRA 4UACA 4YMBA 3ZKLA 1I69A 1SBPA 3MUQA 4PTKA 4R2BA 5LDZA 4GRKA 4DDDA 1P1NA 3H6TA 3H03A 2XXRA 4PETA 4N6DA 4ZDMA 3O6IA 3S9NC 1B3EA 1B5IA 3EHUA 4PAIA 1LCFA 3MW0A 5I57B 2XHDA 1FTKA 1BK4A 3I5OA 2PFYA 1LGBC 1TT1A 1B46A 3MJNA 4U1OA 4Z0IA 4LONB 3ECRA 3IX1A 2FNCA 1YTVA 3OXNA 5F24A 1M5CA 2WKYA 2XX9A 1BLFA 1B32A 2R9JA 3UN6A 3S9LC 4U21A 1BTJA 5BUUA 3FVNA 3D4CA 2GHAA 4F3PA 2WX9A 5ET8A 3TMGA 4NF0A 1M5EA 4EDPA 1LBXA 3KSXA 1SW5A 4G68A 1N04A 2DXRA 3LR1A 3FV2A 4JVIA 1ZLQA 2XWVA 3O2AA 3K1PA 2Z8FA 4H67A 4YKJA 1R1NA 3C9HA 2NXOA 1LAFE 3PGFA 4PBHA 4RPNA 3IJXB 3QK6A 3AXFA 4FIMA 4JWXA 2YLNA 5J16A 2Z23A 5TPAB 1CNQA 4POXA 1VDWA 3LC8A 2VPNA 4NTLA 3BKIB 3IB1A 1MY3A 2PFZA 4OFOA 4WEPA 4I3YA 5I58B 2RINA 5FHNA 4I8CA 5H8HA 3CFZA 4DCXA 4PP0A 3H4ZA 3GYYA 4YZZA 4Q5TA 4FORA 3RLFE 3D1RA 3H6VA 1RDYA 3CSGA 5A5XB 4GL8A 3KG2A 3VLWA 1KA0A 1MPCA 2HAVA 2NOOA 3K6UA 1ZIUA 2RCBA 1SD3A 1B05A 2Q89A 4NF6B 1QJMA 4ELRA 2H25A 5DEXB 1XVYA 2OWSA 3W9VA 2QS1A 2I3VA 4H8IA 1H3DA 1LLSA 5IKBA 1L5TA 1LAHE 2CMOA 3MVYA 3K02A 4K3FA 3T1BA 5CC2A 4MFIA 3ROJA 5HPQA 1FQCA 2FYIA 3IOVA 4P0IA 1OMPA 4U1ZA 3RNNA 4O8MA 1LB8A 4ND9A 3VLUA 3U94A 3LV0A 1JNFA 2A5TA 3KJTA 3VVEA 3V83A 3OEKA 4PCDA 2L5VA 3OO9A 4OVTA 4GWYA 4GWZA 2F3DA 1A99A 1MDP1 3KN8A 3MZ1A 1M5BA 3S4UA 4R74A 1PEBA 2REGA 4OFJA 4RJZA 1NKXA 2FHYA 2Y7RA 4F1UA 4C0RA 2ZNTA 3DM0A 3MP6A 2YJPA 2AIXA 1NUZA 1LBZA 4MEVA 4MJOA 1VE4A 1Y1MA 3Q25A 1IXIA 5DVIA 4XKNA 4XFEA 5ESYA 1H76A 4OVSA 4NF6A 5DEXA 4JB7A 5CI5A 1LBYA 3QUJA 1YAEA 3HHGA 1Y4CA 4ZECA 2F6GA 1RDZA 4IGRA 2Y5LA 1S7YA 3N6UA 2Q8MA 4MIJA 4JXIA 4WXJA 1JEVA 4IY5A 4THIA 1IMCA 1N7WA 2HXWA 4RK9A 2B4MA 4WKMA 3DP4A 2UVJA 1TFDA 3VFJA 3LSWA 4KI0E 4DXUA 1PB9A 4KYSA 4RNSA 3MAMA 4EQBA 5KDTB 4RA1A 2P0SA 1MXVA 3T93B 4N15A 2QMWA 3UK4A 5B70A 3O97A 3I3VA 1BKAA 3C36A 3TCHA 5TU0A 1FBCA 3TTRA 2OWZA 3SZPA 2FBPA 5J1DA 1SVXB 3N26A 1LFGA 3OO7A 2KLFA 3OSRA 1FQFA 3DLNA 3B8BA 4PF6A 1CB6A 2ZNSA 4LATA 2UXAA 1B5JA 3E13X 3FJ7A 4MLVA 4H45A 1VR5A 4U2RA 4JWYA 3K00A 4JVCA 4UABA 2OLBA 1QVSA 1DSNA 3IO6A 1AMFA 1YZ0A 3RT6B 2ZYNA 1B2HA 1S9TA 1EYIA 3E79A 4LQ2A 4OVPA 1MY0A 4ZS9A 4ZEFA 2B65A 5DVJA 3HSTA 1LBVA 3QYTA 5I56B 1MM7A 1URGA 3M8UA 3TQWA 2Y5KA 4HTGA 2QVUA 3MVZA 3LUZA 1D9VA 4AB5A 5I2NB 1NNPA 4GX6A 4EUOA 3EKIA 2F8DA 2CEXA 4ELPA 2WBDA 4GD5A 1FPKA 3C32A 2RKMA 3LUYA 3KGCA 3IR1A 3TTKA 5CMBA 5IZZA 1CE2A 1ZMGA 2H4IA 4EXLA 2FIXA 3SEYA 2IEEA 2Y7IA 4NF5B 2ZZWA 1FCKA 4P0GA 2XWKA 3A09A 3EPEA 5F1QA 2HPGA 5I2KA 1GR2A 4OQOA 1S50A 4FATA 4G8HA 4G2ZA 1Z7NE 4P56A 3CR9A 1UIVA 2KQZA 3N94A 5IGAA 3G3GA 1FPIA 4BDLA 3Q28A 3VXBA 1AIVA 4R6HA 1NV1A 1JW4A 3RGYA 4O3AA 2FVZA 3PUVE 3FZVA 4I9DA 2F7BA 1XHYA 2V3TA 1LAXA 2Y7WA 5I2NA 1JQFA 4N13A 3G7WA 1K9ZA 2HQ0A 3T66A 1Q1KA 5KCJB 1I6BA 1US5A 3KN3A 3K0VA 2MKZA 5CMCA 3TTLA 2ONKE 2ZZVA 1FRPA 1FPJA 4LVQA 4YKIA 3OELA 1NI9A 4O7IA 1R6ZA 5TP9B 5ITPA 4OXVA 4X48A 4PQJA 1FBPA 1NV7A 1N3WA 1RDXA 4GL0A 5ICTA 3C34A 4TLMB 3V8XB 1II5A 2H99A 4ONYA 1OQGA 3V5AA 1MM6A 1IMBA 1FBFA 1FTOA 4WEDA 4ZEKA 4F1YA 1EZOA 3GBBA 3MZBA 3A3CA 1Y20A 1URDA 5IZ1A 2I3WA 3KC0A 4LZ5A 2AL4A 1T0KA 3T9VA 1MXXA 1ELJA 3D4GA 5DVFA 3RN8A 4TQUQ 1XOCA 3TELA 1ATGA 5ET5A 1Y1ZA 3O6HA 1A8FA 3O6GA 1M5FA 2F5XA 5T3JA 4PE5B 3ILTB 5JTYB 2DE3A 4KD5A 4X8RA 2BJJX 3LSFB 3DP8A 4XKRA 1A55A 4GF8A 4H5GA 4TLLB 3JYRA 5AA4A 4OESA 2VT5A 3B6TA 4LA9A 2YPNA 4GWSA 2ONSA 1O63A 2D3IA 3PMVA 1US4A 2QS4A 2Y84A 2ZZXA 3K6VA 1AWBA 5H8FB 1IMDA 5TP9A 3FV1A 2UVGA 4E0XA 4BDMA 2HEUA 3DELB 5AA2B 4YU0A 4QFOA 4NE4A 5L9SA 3PD9A 4KQPA 4YB6A 4MAGA 4KPTA 4ZE8A 3IFAA 1NUWA 2OJTA 3SDFA 3RPLA 1PDAA 4G4PA 1FPBA 5IZ3B 5ET6A 4AB6A 3IAZA 4PGPA 3PPQA 1JVXA 3KEIA 2FIEA 2O68A 3UORA 1QKBA 4N07A 4LZ7A 2JJKA 1NL5A 3TEPA 3Q27A 1QKAA 4OENA 3SESA 1IXCA 2UVIA 4G77A 2GQ1A 3CHGA 1P99A 1NUXA 3GXAA 3RT8A 5H8NA 1ZU0A 1G0IA 1RYOA 2P3NA 2NUVA 2OZZA 5EQ8A 3T9HB 4H1XA 4GOTA 3MQ9A 3SEVA 3TQLA 1P1OA 4PE3A 4F18A 1PB7A 1FSAA 5H8FA 1B0LA 1UQWA 4YAHX 5I5PA 3BIHA 1B6HA 1SPIA 3MP8A 1LBCA 1QUJA 1B58A 3MVXA 5AA2A 3C31A 2XXWA 4ESXA 5HBCA 2VD2A 4KR5A 4HW8A 1MQJA 3VXCA 1ZJLA 1MY4A 5DTBA 1B5HA 1I6QA 1O7TA 1NH7A 4GFRA 4LP2B 4AS4A 2R8TA 3T9XB 3KFMA 1EU8A 4R75A 4BDQA 4QFLA 3CFLA 4LUBA 4G8NA 3SEXA 4KHZE 1YYZA 1P1WA 3PMWA 2Q88A 5I57A 1MXZA 2H5YA 2RCAA 3R26A 2XA5A 5EQ9A 2F97A 1H44A 1RKMA 2OBGA 2X7PA 1LB9A 4JSDA 3MVWA 4H5FA 1WDNA 2P2AA 2O7IA 1GTKA 4NX1A 2PT1A 2X26A 2XXTA 5AA3A 4HE2A 4HS7A 3QUFA 1FW0A 3IOWA 4GWXA 3MYUA 4OVQA 4GX4A 2Q2AA 4AS5A 4ECFA 1B1HA 4XIGQ 4IR8A 3TTMA 3MPKA 1RYXA 3C4MA 2ANJA 5A5LA 1D3KA 2VPOA 3MC2A 4HCWA 5L9MA 3G3HA 4HXVA 3PTYA 1JVYA 3B6QA 3IORA 1B4ZA 4ESWA 4PGNA 1B40A 5TPAA 5CMMA 4KXPA 3SERA 4DE8A 4QRZA 1FQAA 3KC1A 4X04A 5FTHA 5I58A 1R9LA 1NNFA 5CRYA 3B6WA 1PBQA 2ZMBA 5AA2D 1B3GA 1UTBB 2Q2CA 1KA1A 2VD3A 2THIA 1A7LA 5A5XA 4PF8A 3E78A 3KBZA 4OEVA 5EQAA 3FVGA 2ZYKA 1QULA 3KN7A 1LFHA 1SDXA 4DLDA 2VGQA 1OIBA 2F36A 3NOHA 3PV0E 4Q30B 4ZEIA 3PPRA 2PCRA 4GLIA 5F7VA 4I3EA 1D4NA 4RYAA 4ZZEA 2OCUA 4MMPA 4PFYA 5FHMA 1FPDA 4N91A 3A3UA 2HCAA 5KZTA 4E0WA 4DI4B 2HZLA 2P3VA 4F2OA 1A54A 4I62A 1B4HA 3RYDA 3MBPA 1DTZA 2CZKA 1SI1A 2G29A 1TFAA 1FBDA 4MX6A 3U92A 3WAFA 4ZE9A 1F9BA 1I6AA 3S9MC 4X1DA 2Q9TA 4U4SA 2F78A 4P1LA 3S2VA 5IM2A 3R7XA 1B52A 3UIFA 1UTBA 1DBZA 1O64A 1WVJA 4FECA 5CBSA 3TUSA 4YICA 1FPLA 4QXDA 2V25A 3PD8A 1LFIA 5EYHA 4P3LA 4EQ9A 4ELOA 2DSFA 5ELVA 2DS9A 1AH5A 2OWTA 1OQHA 5CBRA 1MY2A 4RPOA 1N76A 2HFBA 3PPPA 4YB5A 2R71A 3U8QA 1OLCA 2DVCA 1PB8A 4F29A 1FQDA 1ZKBA 4NMYA 2QL3A 3FJGA 1G0HA 2PMSA 1B1XA 2V3UA 1UTHB 4NQ8A 2RC7A 1NV0A 2QS3A 4PFTA 2Y7PA 3T96B 3KOSA 3CVGA 4OMBA 3USDA 3KSJA 2XX7A 1EYJA 5KDTA 2V93A 2O7UA 4H0WA 1MQDA 4JBZA 4U23A 4GVOA 1NV2A 1FPGA 3IJOB 3K4UA 3CFXA 4NF4B 2CZIA 3CSBA 1LCTA 3OOAA 3E3KA 4KFQA 2V84A 4L17A 2F6PA 1K9YA 3PPOA 2I0CA 4F31B 3N5LA 2O1LA 4IB2A 3ISPA 4H46A 4GBWA 1Q35A 4R9FA 1HSEA 5FTIA 2QVVA 3UA8A 1TWYA 2XXUA 4QFNA 3BFTA 1JW5A 5B7DA 2XX8A 2CZHA 4YMAA 3HV1A 4M1VA 5I56A 1MPDA 3H6WA 3TCGA 4OWDA 4BDNA 4OA4A 4R9GA 3G3IA 5H8QB 1PBPA 2V4CA 4PFBA 1MQGA 4MH5A 1Q9DA 4N8YA 3CI8A 2V3QA 1SYHA 4KYDA
chains in the Genus database with same CATH topology
5AA1A 3LBSA 4GXSB 1A40A 4DZ1A 4EF1A 2REJA 1TXFA 4F1VA 3RUMA 2Z8DA 4NF4A 4QFKA 4FAJA 3EHSA 4F22A 3IB2A 2LAOA 4NF5A 2GHBA 4NF8B 2F35A 4IY6A 4ELQA 4EQ7A 3ODBA 2QMXA 3FASA 5I84A 4OYVA 3CIJA 4X1BA 2I4BA 2DWHA 3L6HA 2O84X 1XT8A 4YB7A 4OEUA 5I59B 3EQ1A 1B3HA 1J1NA 4GQOA 2XXHA 1Y3PA 3PMXA 1HSLA 3PUWE 3FJMA 1H43A 1QUIA 3OSQA 2B3BA 3FD3A 5EYFA 3N6TA 1LAGE 4IO3A 2GFEA 4QSCA 2VOZA 5IAIA 4R2FA 5CM6A 3RY3A 4FEDA 3OMBA 2XXXA 2DQVA 1IXGA 5KCJA 3QAXA 1BP5A 1IZ1A 1N3XA 5JK4A 3WAEA 3K1NA 5ISUA 4OHNA 5ICQA 1EZ9A 1FQBA 3S9EA 3BFUA 1B51A 3QIMA 4XTCQ 1IIWA 2ALUA 1B7UA 3W15C 3RQTA 2ONRA 3FIRA 4R6KA 2I58A 2R6GE 2FA7A 2PT2A 3SEWA 4G68B 4RK2A 2I6EA 3FVKA 4QSEA 4Z7EA 4UA8A 3THIA 3M3LA 2D5WA 3U1OA 4GWOA 1XS5A 4P11A 3PPNA 1B3FA 3F11A 3MP1A 3TYHA 1P1QA 4U22A 4PFUA 2X7QA 5JTYA 5H8SA 1NNTA 5H8HB 2PVUA 3K1MA 2QJEA 2M8CA 3EF7A 1Y3NA 2DP8A 1YCJA 4BDRA 1MY1A 2GH9A 2G93A 3W9WA 4FJPA 1XVXA 2I49A 1VFEA 4N6PA 4DXCA 3U72A 4R73A 3G3FA 3FVOA 2NWJA 5M2VA 1N7XA 3LSXA 4H65A 3QSLA 3JV9A 2I4CA 3OO6A 2HAUA 1EH3A 3O9PA 4M4GA 1N84A 2W7YA 1PC3A 1MPBA 4IO7A 3JZJA 3O28A 1USYE 2Z8EA 2H9BA 1QUKA 1NFTA 3GZGA 3RTWB 4F39A 1DOTA 1SYIA 1YPNA 1QW0A 4XKQA 3CRBA 1JETA 5BWJA 1JEUA 3M3KA 2E1SA 2A5TB 3OD7A 3TODA 4C1TA 3RTFB 2DE2A 2GRVA 1Z7ME 3HHFA 2F34A 2O6AA 5EHSA 3HCQA 3PUYE 3IOTA 3QXMA 1BIYA 2A5SA 4OZ9A 3BBRA 3TCFA 1SI0A 1AL3A 1FTJA 3T22A 3VE1B 5AE4A 3DP6A 3UP9A 2QRYA 3G3JA 4RXLA 1LBBA 1EZPA 1MQIA 1B7ZA 3SETA 4OTEA 3K2DA 1N0TA 1IQ7A 1B9JA 3L6GA 3LSLA 2PYYA 4DIGA 1DTGA 2QSXA 5L9OA 3MPLA 1URSA 3KZGA 5K2XA 3SKPA 2F7CA 1MRPA 1MQHA 4G8MA 2O51A 1B0HA 3EN3A 1Y9UA 1P1UA 4KYEA 4F19A 3M3FA 3Q29A 3K6WA 2VHAA 3VVFA 3EHTA 3H3GA 3IO4A 3TAJA 2ZNUA 2DOJA 4EF2A 2UYFA 3KJ7A 1KWHA 4F2QA 1MG1A 4QF9A 1IEJA 4POWA 2NVUB 1B7HA 3FXQA 2XD3A 1USYH 2IA4A 3GLBA 1SQYA 2XXIA 1OLAA 2DYXA 2DWIA 4OFLA 5EHMA 2D21A 4IO5A 3C33A 1IXHA 2F7AA 1SW2A 4XXUA 3O29A 4OERA 2ABHA 4LQ5A 1MS7A 3OEMA 2H98A 4JWOA 1IITA 3UGWA 1DPPA 1ZBMA 4XKPA 5K2YA 1MH3A 4F3SA 3IK6B 2ZYOA 3K6XA 2E0SA 1AOVA 4BDOA 2XD2A 4IO6A 4ISUA 4PFWA 3VLVA 1SW1A 4YKKA 2VP1A 2XXQA 1DPEA 1MXYA 4R6YA 4FE8A 5LOMA 2ESNA 4NEDA 1R9QA 4C1UA 3HPIA 3FATA 3H7MA 4U4XA 5I2KB 1VFDA 3FXUA 3H6UA 3IOUA 1JW1A 4NWDA 1D9YA 3OENA 4X9TA 3I6VA 4JSOA 1A8EA 4EXKA 4FEBA 3CG1A 3MZ9A 2DE4A 3V89B 1NNKA 3TKDA 2UYEA 4R72A 1OVBA 3VDFA 3IB0A 1LSTA 2DXYA 3P7IA 3TDJA 3IL1B 5FHOA 4RY1A 1MXWA 1UIUA 3TPAA 1VSOA 3TZAA 1B3LA 3E4RA 4BLAA 2ZYMA 4O3CA 3FUZA 2XXVA 2DWJA 4GXAA 4TOZA 4F3GA 1POY1 3VVDA 4ZZAA 3ZS6A 3T9UA 4LZ8A 5ITOA 4GIZA 3PUZE 3ILUB 2XXYA 3VV5A 2O69A 4MBPA 4H8JA 1FTLA 1Y4TA 1UTHA 1ANFA 4NWCA 2DWAA 1HSJA 3U93A 3FGSA 4H6DA 3K01A 3R6UA 2AL5A 2RC8A 2CZLA 4QHQA 4Q0CA 1IUDA 1MXUA 1GGGA 2OK2A 4KCDA 5CMKA 1MDQA 3C35A 5L8DA 4ZEDA 2I48A 2Q8JA 3TTNA 3KOTA 4IGTA 2P1SA 3E9XA 2O1MA 4QFPA 4HCYA 4O3BA 4OETA 3ZKKA 1H45A 3SEUA 5AA4B 2HZKA 4DXBA 4Q8RA 1M5DA 3ONMA 4F3BA 4KCCA 2UVHA 3ZSFA 1POTA 3TFLA 1NH8A 1SW4A 3Q26A 2Y7KA 1GVCA 1XC1A 4G68C 1FTMA 2PBWA 3H06B 5DT6A 4JDFA 2QS2A 3G3KA 3HO7A 2XXPA 2ZXTA 4I1DA 2Z22A 5H8QA 3FXRA 4MF3A 5JEIA 4IO2A 4YKPA 2B3FA 2QPQA 2AYSA 3PUXE 1FQEA 1DMBA 3OO8A 4MLQA 1ZTYA 1Y3QA 3CG3A 4ZEBA 4OVJA 5H8NB 3MWBA 2PX1A 2I0BA 3GBAA 4NF8A 2RF1A 4IO4A 3O66A 4DCYA 2DVZA 4QSDA 5DYHA 2RC9A 1OVTA 3RPWA 1MH4A 3PU5A 1WODA 5HM4B 1NMUA 1GV8A 3B7DA 5I59A 3HN0A 4AQ4A 3KBRA 4UACA 4YMBA 3ZKLA 1I69A 1SBPA 3MUQA 4R2BA 4GRKA 4DDDA 1P1NA 3H6TA 3H03A 2XXRA 4PETA 4ZDMA 3O6IA 3S9NC 1B3EA 1B5IA 3EHUA 1LCFA 3MW0A 5I57B 2XHDA 1FTKA 3I5OA 1LGBC 1TT1A 1B46A 3MJNA 4U1OA 4Z0IA 4LONB 3ECRA 3IX1A 2FNCA 1YTVA 3OXNA 1M5CA 2WKYA 2XX9A 1BLFA 1B32A 2R9JA 3UN6A 3S9LC 4U21A 1BTJA 5BUUA 3FVNA 3D4CA 2GHAA 4F3PA 3TMGA 1M5EA 4EDPA 3KSXA 1SW5A 4G68A 1N04A 2DXRA 3LR1A 3FV2A 1ZLQA 3K1PA 3O2AA 2Z8FA 4H67A 4YKJA 1R1NA 3C9HA 2NXOA 1LAFE 3PGFA 4RPNA 3IJXB 3QK6A 3AXFA 4FIMA 4JWXA 2YLNA 2Z23A 5TPAB 4POXA 3LC8A 4NTLA 3BKIB 3IB1A 1MY3A 4OFOA 4WEPA 5I58B 2RINA 5FHNA 4I8CA 5H8HA 3CFZA 4DCXA 4PP0A 3H4ZA 4YZZA 4Q5TA 4FORA 3RLFE 3H6VA 3CSGA 5A5XB 4GL8A 3KG2A 3VLWA 1MPCA 2HAVA 2NOOA 3K6UA 1ZIUA 2RCBA 1SD3A 1B05A 2Q89A 4NF6B 1QJMA 4ELRA 2H25A 5DEXB 1XVYA 2OWSA 3W9VA 2QS1A 2I3VA 4H8IA 1H3DA 1LLSA 5IKBA 1L5TA 1LAHE 2CMOA 3MVYA 3K02A 4K3FA 5CC2A 4MFIA 5HPQA 1FQCA 2FYIA 3IOVA 4P0IA 1OMPA 4U1ZA 3RNNA 1LB8A 4ND9A 3VLUA 3U94A 1JNFA 2A5TA 3KJTA 3VVEA 3V83A 3OEKA 3OO9A 1A99A 1MDP1 3KN8A 3MZ1A 1M5BA 3S4UA 4R74A 1PEBA 2REGA 4OFJA 4RJZA 1NKXA 2Y7RA 4F1UA 4C0RA 2ZNTA 3DM0A 3MP6A 2YJPA 2AIXA 1VE4A 1Y1MA 3Q25A 1IXIA 5DVIA 4XKNA 1H76A 4NF6A 5DEXA 4JB7A 5CI5A 3QUJA 1YAEA 3HHGA 1Y4CA 4ZECA 2F6GA 4IGRA 1S7YA 3N6UA 4JXIA 4WXJA 1JEVA 4IY5A 4THIA 1N7WA 2HXWA 4RK9A 4WKMA 3DP4A 2UVJA 1TFDA 3VFJA 3LSWA 4KI0E 4DXUA 1PB9A 4KYSA 4RNSA 3MAMA 4EQBA 5KDTB 4RA1A 2P0SA 1MXVA 3T93B 2QMWA 3UK4A 5B70A 3O97A 3I3VA 3TCHA 1BKAA 3C36A 5TU0A 3TTRA 5J1DA 1SVXB 3N26A 1LFGA 3OO7A 2KLFA 3OSRA 1FQFA 3DLNA 1CB6A 2ZNSA 4LATA 2UXAA 1B5JA 3E13X 3FJ7A 4MLVA 4U2RA 1VR5A 4JWYA 3K00A 2OLBA 1QVSA 1DSNA 3IO6A 1AMFA 3RT6B 2ZYNA 1B2HA 1S9TA 4LQ2A 1MY0A 4ZS9A 4ZEFA 2B65A 5DVJA 3HSTA 5I56B 3QYTA 1MM7A 1URGA 3M8UA 3TQWA 4HTGA 3MVZA 1D9VA 4AB5A 5I2NB 1NNPA 4EUOA 2F8DA 4ELPA 4GD5A 3C32A 2RKMA 3LUYA 3KGCA 3IR1A 3TTKA 5CMBA 1CE2A 1ZMGA 2H4IA 4EXLA 3SEYA 2IEEA 2Y7IA 4NF5B 1FCKA 4P0GA 3A09A 3EPEA 5F1QA 5I2KA 1GR2A 4OQOA 1S50A 4FATA 4G8HA 4G2ZA 1Z7NE 3CR9A 1UIVA 3N94A 3G3GA 4BDLA 3Q28A 3VXBA 1AIVA 4R6HA 1JW4A 3RGYA 4O3AA 3PUVE 3FZVA 4I9DA 2F7BA 1XHYA 2V3TA 1LAXA 2Y7WA 5I2NA 1JQFA 4N13A 3G7WA 2HQ0A 3T66A 1Q1KA 5KCJB 1I6BA 1US5A 3KN3A 3K0VA 5CMCA 3TTLA 2ONKE 4LVQA 4YKIA 3OELA 1R6ZA 5TP9B 5ITPA 4OXVA 4X48A 4PQJA 1N3WA 4GL0A 5ICTA 3C34A 4TLMB 3V8XB 1II5A 2H99A 4ONYA 1OQGA 3V5AA 1MM6A 1FTOA 4WEDA 4ZEKA 4F1YA 1EZOA 3GBBA 3MZBA 3A3CA 1Y20A 1URDA 2I3WA 4LZ5A 2AL4A 1T0KA 3T9VA 1MXXA 1ELJA 3D4GA 5DVFA 3RN8A 4TQUQ 1XOCA 3TELA 1ATGA 1Y1ZA 3O6HA 1A8FA 3O6GA 1M5FA 2F5XA 4PE5B 3ILTB 5JTYB 2DE3A 4KD5A 2BJJX 3LSFB 3DP8A 4XKRA 1A55A 4GF8A 4H5GA 4TLLB 3JYRA 5AA4A 4OESA 3B6TA 4LA9A 2YPNA 2ONSA 1O63A 2D3IA 3PMVA 1US4A 2QS4A 2Y84A 3K6VA 5H8FB 5TP9A 3FV1A 2UVGA 4E0XA 4BDMA 2HEUA 3DELB 5AA2B 4YU0A 4QFOA 4NE4A 5L9SA 3PD9A 4KQPA 4YB6A 4KPTA 4ZE8A 2OJTA 3SDFA 1PDAA 4G4PA 4AB6A 3IAZA 3PPQA 1JVXA 3KEIA 2O68A 3UORA 1QKBA 4N07A 4LZ7A 1NL5A 3TEPA 3Q27A 1QKAA 4OENA 3SESA 1IXCA 2UVIA 4G77A 1P99A 3GXAA 3RT8A 5H8NA 1ZU0A 1RYOA 2NUVA 2OZZA 3T9HB 4H1XA 4GOTA 3MQ9A 3SEVA 3TQLA 1P1OA 4F18A 1PB7A 5H8FA 1B0LA 1UQWA 4YAHX 1B6HA 3MP8A 1LBCA 1QUJA 1B58A 3MVXA 5AA2A 3C31A 2XXWA 4ESXA 5HBCA 2VD2A 4KR5A 4HW8A 1MQJA 3VXCA 1ZJLA 1MY4A 5DTBA 1B5HA 1I6QA 1O7TA 1NH7A 4GFRA 4LP2B 3T9XB 3KFMA 1EU8A 4R75A 4BDQA 4QFLA 3CFLA 4LUBA 4G8NA 3SEXA 4KHZE 1P1WA 3PMWA 2Q88A 5I57A 1MXZA 2H5YA 2RCAA 3R26A 2F97A 1H44A 1RKMA 2OBGA 2X7PA 1LB9A 4JSDA 3MVWA 4H5FA 1WDNA 2P2AA 2O7IA 1GTKA 2PT1A 2X26A 2XXTA 5AA3A 4HS7A 3QUFA 1FW0A 3IOWA 4ECFA 2Q2AA 1B1HA 4XIGQ 3TTMA 3MPKA 1RYXA 3C4MA 2ANJA 1D3KA 3MC2A 4HCWA 5L9MA 3G3HA 1JVYA 3B6QA 3IORA 1B4ZA 4ESWA 1B40A 5TPAA 5CMMA 3SERA 4DE8A 4QRZA 1FQAA 5FTHA 5I58A 1R9LA 1NNFA 5CRYA 3B6WA 1PBQA 2ZMBA 5AA2D 1B3GA 1UTBB 2Q2CA 2VD3A 2THIA 1A7LA 5A5XA 4OEVA 3FVGA 2ZYKA 1QULA 3KN7A 1LFHA 1SDXA 4DLDA 2VGQA 1OIBA 2F36A 3PV0E 4Q30B 4ZEIA 3PPRA 4GLIA 5F7VA 1D4NA 4RYAA 4ZZEA 2OCUA 4PFYA 5FHMA 3A3UA 2HCAA 5KZTA 4E0WA 2HZLA 4F2OA 1A54A 4I62A 1B4HA 3MBPA 1DTZA 1SI1A 2G29A 1TFAA 3U92A 3WAFA 4ZE9A 1F9BA 1I6AA 3S9MC 4X1DA 2Q9TA 4U4SA 2F78A 3S2VA 3R7XA 1B52A 3UIFA 1UTBA 1O64A 1WVJA 4FECA 5CBSA 3TUSA 4YICA 2V25A 3PD8A 1LFIA 4EQ9A 4ELOA 2DSFA 5ELVA 2DS9A 1AH5A 2OWTA 1OQHA 5CBRA 1MY2A 4RPOA 1N76A 2HFBA 3PPPA 4YB5A 2R71A 3U8QA 1OLCA 2DVCA 1PB8A 4F29A 1FQDA 1ZKBA 4NMYA 2QL3A 3FJGA 2PMSA 1B1XA 2V3UA 1UTHB 2RC7A 2QS3A 4PFTA 2Y7PA 3T96B 3KOSA 3CVGA 4OMBA 3USDA 3KSJA 2XX7A 5KDTA 2V93A 2O7UA 4H0WA 1MQDA 4JBZA 4U23A 4GVOA 3IJOB 3K4UA 4NF4B 3CFXA 3CSBA 1LCTA 3OOAA 3E3KA 4KFQA 2V84A 4L17A 2F6PA 3PPOA 2I0CA 4F31B 3N5LA 2O1LA 4IB2A 1Q35A 4R9FA 1HSEA 5FTIA 3UA8A 1TWYA 2XXUA 4QFNA 3BFTA 1JW5A 5B7DA 2XX8A 4YMAA 3HV1A 4M1VA 5I56A 1MPDA 3H6WA 3TCGA 4OWDA 4BDNA 4R9GA 3G3IA 5H8QB 1PBPA 1MQGA 4MH5A 3CI8A 2V3QA 1SYHA 4KYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AA1 A;  3LBS A;  4GXS B;  1A40 A;  4DZ1 A;  4EF1 A;  2REJ A;  1TXF A;  4F1V A;  3RUM A;  2Z8D A;  4NF4 A;  4QFK A;  4FAJ A;  3EHS A;  4F22 A;  3IB2 A;  2LAO A;  4NF5 A;  2GHB A;  4NF8 B;  2F35 A;  4IY6 A;  4ELQ A;  4EQ7 A;  3ODB A;  2QMX A;  3FAS A;  5I84 A;  4OYV A;  3CIJ A;  4X1B A;  2I4B A;  2DWH A;  3L6H A;  2O84 X;  1XT8 A;  4YB7 A;  4OEU A;  5I59 B;  3EQ1 A;  1B3H A;  1J1N A;  4GQO A;  2XXH A;  1Y3P A;  3PMX A;  1HSL A;  3PUW E;  3FJM A;  1H43 A;  1QUI A;  3OSQ A;  2B3B A;  3FD3 A;  5EYF A;  3N6T A;  1LAG E;  4IO3 A;  2GFE A;  4QSC A;  2VOZ A;  5IAI A;  4R2F A;  5CM6 A;  3RY3 A;  4FED A;  3OMB A;  2XXX A;  2DQV A;  1IXG A;  5KCJ A;  3QAX A;  1BP5 A;  1IZ1 A;  1N3X A;  5JK4 A;  3WAE A;  3K1N A;  5ISU A;  4OHN A;  5ICQ A;  1EZ9 A;  1FQB A;  3S9E A;  3BFU A;  1B51 A;  3QIM A;  4XTC Q;  1IIW A;  2ALU A;  1B7U A;  3W15 C;  3RQT A;  2ONR A;  3FIR A;  4R6K A;  2I58 A;  2R6G E;  2FA7 A;  2PT2 A;  3SEW A;  4G68 B;  4RK2 A;  2I6E A;  3FVK A;  4QSE A;  4Z7E A;  4UA8 A;  3THI A;  3M3L A;  2D5W A;  3U1O A;  4GWO A;  1XS5 A;  4P11 A;  3PPN A;  1B3F A;  3F11 A;  3MP1 A;  3TYH A;  1P1Q A;  4U22 A;  4PFU A;  2X7Q A;  5JTY A;  5H8S A;  1NNT A;  5H8H B;  2PVU A;  3K1M A;  2QJE A;  2M8C A;  3EF7 A;  1Y3N A;  2DP8 A;  1YCJ A;  4BDR A;  1MY1 A;  2GH9 A;  2G93 A;  3W9W A;  4FJP A;  1XVX A;  2I49 A;  1VFE A;  4N6P A;  4DXC A;  3U72 A;  4R73 A;  3G3F A;  3FVO A;  2NWJ A;  5M2V A;  1N7X A;  3LSX A;  4H65 A;  3QSL A;  3JV9 A;  2I4C A;  3OO6 A;  2HAU A;  1EH3 A;  3O9P A;  4M4G A;  1N84 A;  2W7Y A;  1PC3 A;  1MPB A;  4IO7 A;  3JZJ A;  3O28 A;  1USY E;  2Z8E A;  2H9B A;  1QUK A;  1NFT A;  3GZG A;  3RTW B;  4F39 A;  1DOT A;  1SYI A;  1YPN A;  1QW0 A;  4XKQ A;  3CRB A;  1JET A;  5BWJ A;  1JEU A;  3M3K A;  2E1S A;  2A5T B;  3OD7 A;  3TOD A;  4C1T A;  3RTF B;  2DE2 A;  2GRV A;  1Z7M E;  3HHF A;  2F34 A;  2O6A A;  5EHS A;  3HCQ A;  3PUY E;  3IOT A;  3QXM A;  1BIY A;  2A5S A;  4OZ9 A;  3BBR A;  3TCF A;  1SI0 A;  1AL3 A;  1FTJ A;  3T22 A;  3VE1 B;  5AE4 A;  3DP6 A;  3UP9 A;  2QRY A;  3G3J A;  4RXL A;  1LBB A;  1EZP A;  1MQI A;  1B7Z A;  3SET A;  4OTE A;  3K2D A;  1N0T A;  1IQ7 A;  1B9J A;  3L6G A;  3LSL A;  2PYY A;  4DIG A;  1DTG A;  2QSX A;  5L9O A;  3MPL A;  1URS A;  3KZG A;  5K2X A;  3SKP A;  2F7C A;  1MRP A;  1MQH A;  4G8M A;  2O51 A;  1B0H A;  3EN3 A;  1Y9U A;  1P1U A;  4KYE A;  4F19 A;  3M3F A;  3Q29 A;  3K6W A;  2VHA A;  3VVF A;  3EHT A;  3H3G A;  3IO4 A;  3TAJ A;  2ZNU A;  2DOJ A;  4EF2 A;  2UYF A;  3KJ7 A;  1KWH A;  4F2Q A;  1MG1 A;  4QF9 A;  1IEJ A;  4POW A;  2NVU B;  1B7H A;  3FXQ A;  2XD3 A;  1USY H;  2IA4 A;  3GLB A;  1SQY A;  2XXI A;  1OLA A;  2DYX A;  2DWI A;  4OFL A;  5EHM A;  2D21 A;  4IO5 A;  3C33 A;  1IXH A;  2F7A A;  1SW2 A;  4XXU A;  3O29 A;  4OER A;  2ABH A;  4LQ5 A;  1MS7 A;  3OEM A;  2H98 A;  4JWO A;  1IIT A;  3UGW A;  1DPP A;  1ZBM A;  4XKP A;  5K2Y A;  1MH3 A;  4F3S A;  3IK6 B;  2ZYO A;  3K6X A;  2E0S A;  1AOV A;  4BDO A;  2XD2 A;  4IO6 A;  4ISU A;  4PFW A;  3VLV A;  1SW1 A;  4YKK A;  2VP1 A;  2XXQ A;  1DPE A;  1MXY A;  4R6Y A;  4FE8 A;  5LOM A;  2ESN A;  4NED A;  1R9Q A;  4C1U A;  3HPI A;  3FAT A;  3H7M A;  4U4X A;  5I2K B;  1VFD A;  3FXU A;  3H6U A;  3IOU A;  1JW1 A;  4NWD A;  1D9Y A;  3OEN A;  4X9T A;  3I6V A;  4JSO A;  1A8E A;  4EXK A;  4FEB A;  3CG1 A;  3MZ9 A;  2DE4 A;  3V89 B;  1NNK A;  3TKD A;  2UYE A;  4R72 A;  1OVB A;  3VDF A;  3IB0 A;  1LST A;  2DXY A;  3P7I A;  3TDJ A;  3IL1 B;  5FHO A;  4RY1 A;  1MXW A;  1UIU A;  3TPA A;  1VSO A;  3TZA A;  1B3L A;  3E4R A;  4BLA A;  2ZYM A;  4O3C A;  3FUZ A;  2XXV A;  2DWJ A;  4GXA A;  4TOZ A;  4F3G A;  1POY 1;  3VVD A;  4ZZA A;  3ZS6 A;  3T9U A;  4LZ8 A;  5ITO A;  4GIZ A;  3PUZ E;  3ILU B;  2XXY A;  3VV5 A;  2O69 A;  4MBP A;  4H8J A;  1FTL A;  1Y4T A;  1UTH A;  1ANF A;  4NWC A;  2DWA A;  1HSJ A;  3U93 A;  3FGS A;  4H6D A;  3K01 A;  3R6U A;  2AL5 A;  2RC8 A;  2CZL A;  4QHQ A;  4Q0C A;  1IUD A;  1MXU A;  1GGG A;  2OK2 A;  4KCD A;  5CMK A;  1MDQ A;  3C35 A;  5L8D A;  4ZED A;  2I48 A;  2Q8J A;  3TTN A;  3KOT A;  4IGT A;  2P1S A;  3E9X A;  2O1M A;  4QFP A;  4HCY A;  4O3B A;  4OET A;  3ZKK A;  1H45 A;  3SEU A;  5AA4 B;  2HZK A;  4DXB A;  4Q8R A;  1M5D A;  3ONM A;  4F3B A;  4KCC A;  2UVH A;  3ZSF A;  1POT A;  3TFL A;  1NH8 A;  1SW4 A;  3Q26 A;  2Y7K A;  1GVC A;  1XC1 A;  4G68 C;  1FTM A;  2PBW A;  3H06 B;  5DT6 A;  4JDF A;  2QS2 A;  3G3K A;  3HO7 A;  2XXP A;  2ZXT A;  4I1D A;  2Z22 A;  5H8Q A;  3FXR A;  4MF3 A;  5JEI A;  4IO2 A;  4YKP A;  2B3F A;  2QPQ A;  2AYS A;  3PUX E;  1FQE A;  1DMB A;  3OO8 A;  4MLQ A;  1ZTY A;  1Y3Q A;  3CG3 A;  4ZEB A;  4OVJ A;  5H8N B;  3MWB A;  2PX1 A;  2I0B A;  3GBA A;  4NF8 A;  2RF1 A;  4IO4 A;  3O66 A;  4DCY A;  2DVZ A;  4QSD A;  5DYH A;  2RC9 A;  1OVT A;  3RPW A;  1MH4 A;  3PU5 A;  1WOD A;  5HM4 B;  1NMU A;  1GV8 A;  3B7D A;  5I59 A;  3HN0 A;  4AQ4 A;  3KBR A;  4UAC A;  4YMB A;  3ZKL A;  1I69 A;  1SBP A;  3MUQ A;  4R2B A;  4GRK A;  4DDD A;  1P1N A;  3H6T A;  3H03 A;  2XXR A;  4PET A;  4ZDM A;  3O6I A;  3S9N C;  1B3E A;  1B5I A;  3EHU A;  1LCF A;  3MW0 A;  5I57 B;  2XHD A;  1FTK A;  3I5O A;  1LGB C;  1TT1 A;  1B46 A;  3MJN A;  4U1O A;  4Z0I A;  4LON B;  3ECR A;  3IX1 A;  2FNC A;  1YTV A;  3OXN A;  1M5C A;  2WKY A;  2XX9 A;  1BLF A;  1B32 A;  2R9J A;  3UN6 A;  3S9L C;  4U21 A;  1BTJ A;  5BUU A;  3FVN A;  3D4C A;  2GHA A;  4F3P A;  3TMG A;  1M5E A;  4EDP A;  3KSX A;  1SW5 A;  4G68 A;  1N04 A;  2DXR A;  3LR1 A;  3FV2 A;  1ZLQ A;  3K1P A;  3O2A A;  2Z8F A;  4H67 A;  4YKJ A;  1R1N A;  3C9H A;  2NXO A;  1LAF E;  3PGF A;  4RPN A;  3IJX B;  3QK6 A;  3AXF A;  4FIM A;  4JWX A;  2YLN A;  2Z23 A;  5TPA B;  4POX A;  3LC8 A;  4NTL A;  3BKI B;  3IB1 A;  1MY3 A;  4OFO A;  4WEP A;  5I58 B;  2RIN A;  5FHN A;  4I8C A;  5H8H A;  3CFZ A;  4DCX A;  4PP0 A;  3H4Z A;  4YZZ A;  4Q5T A;  4FOR A;  3RLF E;  3H6V A;  3CSG A;  5A5X B;  4GL8 A;  3KG2 A;  3VLW A;  1MPC A;  2HAV A;  2NOO A;  3K6U A;  1ZIU A;  2RCB A;  1SD3 A;  1B05 A;  2Q89 A;  4NF6 B;  1QJM A;  4ELR A;  2H25 A;  5DEX B;  1XVY A;  2OWS A;  3W9V A;  2QS1 A;  2I3V A;  4H8I A;  1H3D A;  1LLS A;  5IKB A;  1L5T A;  1LAH E;  2CMO A;  3MVY A;  3K02 A;  4K3F A;  5CC2 A;  4MFI A;  5HPQ A;  1FQC A;  2FYI A;  3IOV A;  4P0I A;  1OMP A;  4U1Z A;  3RNN A;  1LB8 A;  4ND9 A;  3VLU A;  3U94 A;  1JNF A;  2A5T A;  3KJT A;  3VVE A;  3V83 A;  3OEK A;  3OO9 A;  1A99 A;  1MDP 1;  3KN8 A;  3MZ1 A;  1M5B A;  3S4U A;  4R74 A;  1PEB A;  2REG A;  4OFJ A;  4RJZ A;  1NKX A;  2Y7R A;  4F1U A;  4C0R A;  2ZNT A;  3DM0 A;  3MP6 A;  2YJP A;  2AIX A;  1VE4 A;  1Y1M A;  3Q25 A;  1IXI A;  5DVI A;  4XKN A;  1H76 A;  4NF6 A;  5DEX A;  4JB7 A;  5CI5 A;  3QUJ A;  1YAE A;  3HHG A;  1Y4C A;  4ZEC A;  2F6G A;  4IGR A;  1S7Y A;  3N6U A;  4JXI A;  4WXJ A;  1JEV A;  4IY5 A;  4THI A;  1N7W A;  2HXW A;  4RK9 A;  4WKM A;  3DP4 A;  2UVJ A;  1TFD A;  3VFJ A;  3LSW A;  4KI0 E;  4DXU A;  1PB9 A;  4KYS A;  4RNS A;  3MAM A;  4EQB A;  5KDT B;  4RA1 A;  2P0S A;  1MXV A;  3T93 B;  2QMW A;  3UK4 A;  5B70 A;  3O97 A;  3I3V A;  3TCH A;  1BKA A;  3C36 A;  5TU0 A;  3TTR A;  5J1D A;  1SVX B;  3N26 A;  1LFG A;  3OO7 A;  2KLF A;  3OSR A;  1FQF A;  3DLN A;  1CB6 A;  2ZNS A;  4LAT A;  2UXA A;  1B5J A;  3E13 X;  3FJ7 A;  4MLV A;  4U2R A;  1VR5 A;  4JWY A;  3K00 A;  2OLB A;  1QVS A;  1DSN A;  3IO6 A;  1AMF A;  3RT6 B;  2ZYN A;  1B2H A;  1S9T A;  4LQ2 A;  1MY0 A;  4ZS9 A;  4ZEF A;  2B65 A;  5DVJ A;  3HST A;  5I56 B;  3QYT A;  1MM7 A;  1URG A;  3M8U A;  3TQW A;  4HTG A;  3MVZ A;  1D9V A;  4AB5 A;  5I2N B;  1NNP A;  4EUO A;  2F8D A;  4ELP A;  4GD5 A;  3C32 A;  2RKM A;  3LUY A;  3KGC A;  3IR1 A;  3TTK A;  5CMB A;  1CE2 A;  1ZMG A;  2H4I A;  4EXL A;  3SEY A;  2IEE A;  2Y7I A;  4NF5 B;  1FCK A;  4P0G A;  3A09 A;  3EPE A;  5F1Q A;  5I2K A;  1GR2 A;  4OQO A;  1S50 A;  4FAT A;  4G8H A;  4G2Z A;  1Z7N E;  3CR9 A;  1UIV A;  3N94 A;  3G3G A;  4BDL A;  3Q28 A;  3VXB A;  1AIV A;  4R6H A;  1JW4 A;  3RGY A;  4O3A A;  3PUV E;  3FZV A;  4I9D A;  2F7B A;  1XHY A;  2V3T A;  1LAX A;  2Y7W A;  5I2N A;  1JQF A;  4N13 A;  3G7W A;  2HQ0 A;  3T66 A;  1Q1K A;  5KCJ B;  1I6B A;  1US5 A;  3KN3 A;  3K0V A;  5CMC A;  3TTL A;  2ONK E;  4LVQ A;  4YKI A;  3OEL A;  1R6Z A;  5TP9 B;  5ITP A;  4OXV A;  4X48 A;  4PQJ A;  1N3W A;  4GL0 A;  5ICT A;  3C34 A;  4TLM B;  3V8X B;  1II5 A;  2H99 A;  4ONY A;  1OQG A;  3V5A A;  1MM6 A;  1FTO A;  4WED A;  4ZEK A;  4F1Y A;  1EZO A;  3GBB A;  3MZB A;  3A3C A;  1Y20 A;  1URD A;  2I3W A;  4LZ5 A;  2AL4 A;  1T0K A;  3T9V A;  1MXX A;  1ELJ A;  3D4G A;  5DVF A;  3RN8 A;  4TQU Q;  1XOC A;  3TEL A;  1ATG A;  1Y1Z A;  3O6H A;  1A8F A;  3O6G A;  1M5F A;  2F5X A;  4PE5 B;  3ILT B;  5JTY B;  2DE3 A;  4KD5 A;  2BJJ X;  3LSF B;  3DP8 A;  4XKR A;  1A55 A;  4GF8 A;  4H5G A;  4TLL B;  3JYR A;  5AA4 A;  4OES A;  3B6T A;  4LA9 A;  2YPN A;  2ONS A;  1O63 A;  2D3I A;  3PMV A;  1US4 A;  2QS4 A;  2Y84 A;  3K6V A;  5H8F B;  5TP9 A;  3FV1 A;  2UVG A;  4E0X A;  4BDM A;  2HEU A;  3DEL B;  5AA2 B;  4YU0 A;  4QFO A;  4NE4 A;  5L9S A;  3PD9 A;  4KQP A;  4YB6 A;  4KPT A;  4ZE8 A;  2OJT A;  3SDF A;  1PDA A;  4G4P A;  4AB6 A;  3IAZ A;  3PPQ A;  1JVX A;  3KEI A;  2O68 A;  3UOR A;  1QKB A;  4N07 A;  4LZ7 A;  1NL5 A;  3TEP A;  3Q27 A;  1QKA A;  4OEN A;  3SES A;  1IXC A;  2UVI A;  4G77 A;  1P99 A;  3GXA A;  3RT8 A;  5H8N A;  1ZU0 A;  1RYO A;  2NUV A;  2OZZ A;  3T9H B;  4H1X A;  4GOT A;  3MQ9 A;  3SEV A;  3TQL A;  1P1O A;  4F18 A;  1PB7 A;  5H8F A;  1B0L A;  1UQW A;  4YAH X;  1B6H A;  3MP8 A;  1LBC A;  1QUJ A;  1B58 A;  3MVX A;  5AA2 A;  3C31 A;  2XXW A;  4ESX A;  5HBC A;  2VD2 A;  4KR5 A;  4HW8 A;  1MQJ A;  3VXC A;  1ZJL A;  1MY4 A;  5DTB A;  1B5H A;  1I6Q A;  1O7T A;  1NH7 A;  4GFR A;  4LP2 B;  3T9X B;  3KFM A;  1EU8 A;  4R75 A;  4BDQ A;  4QFL A;  3CFL A;  4LUB A;  4G8N A;  3SEX A;  4KHZ E;  1P1W A;  3PMW A;  2Q88 A;  5I57 A;  1MXZ A;  2H5Y A;  2RCA A;  3R26 A;  2F97 A;  1H44 A;  1RKM A;  2OBG A;  2X7P A;  1LB9 A;  4JSD A;  3MVW A;  4H5F A;  1WDN A;  2P2A A;  2O7I A;  1GTK A;  2PT1 A;  2X26 A;  2XXT A;  5AA3 A;  4HS7 A;  3QUF A;  1FW0 A;  3IOW A;  4ECF A;  2Q2A A;  1B1H A;  4XIG Q;  3TTM A;  3MPK A;  1RYX A;  3C4M A;  2ANJ A;  1D3K A;  3MC2 A;  4HCW A;  5L9M A;  3G3H A;  1JVY A;  3B6Q A;  3IOR A;  1B4Z A;  4ESW A;  1B40 A;  5TPA A;  5CMM A;  3SER A;  4DE8 A;  4QRZ A;  1FQA A;  5FTH A;  5I58 A;  1R9L A;  1NNF A;  5CRY A;  3B6W A;  1PBQ A;  2ZMB A;  5AA2 D;  1B3G A;  1UTB B;  2Q2C A;  2VD3 A;  2THI A;  1A7L A;  5A5X A;  4OEV A;  3FVG A;  2ZYK A;  1QUL A;  3KN7 A;  1LFH A;  1SDX A;  4DLD A;  2VGQ A;  1OIB A;  2F36 A;  3PV0 E;  4Q30 B;  4ZEI A;  3PPR A;  4GLI A;  5F7V A;  1D4N A;  4RYA A;  4ZZE A;  2OCU A;  4PFY A;  5FHM A;  3A3U A;  2HCA A;  5KZT A;  4E0W A;  2HZL A;  4F2O A;  1A54 A;  4I62 A;  1B4H A;  3MBP A;  1DTZ A;  1SI1 A;  2G29 A;  1TFA A;  3U92 A;  3WAF A;  4ZE9 A;  1F9B A;  1I6A A;  3S9M C;  4X1D A;  2Q9T A;  4U4S A;  2F78 A;  3S2V A;  3R7X A;  1B52 A;  3UIF A;  1UTB A;  1O64 A;  1WVJ A;  4FEC A;  5CBS A;  3TUS A;  4YIC A;  2V25 A;  3PD8 A;  1LFI A;  4EQ9 A;  4ELO A;  2DSF A;  5ELV A;  2DS9 A;  1AH5 A;  2OWT A;  1OQH A;  5CBR A;  1MY2 A;  4RPO A;  1N76 A;  2HFB A;  3PPP A;  4YB5 A;  2R71 A;  3U8Q A;  1OLC A;  2DVC A;  1PB8 A;  4F29 A;  1FQD A;  1ZKB A;  4NMY A;  2QL3 A;  3FJG A;  2PMS A;  1B1X A;  2V3U A;  1UTH B;  2RC7 A;  2QS3 A;  4PFT A;  2Y7P A;  3T96 B;  3KOS A;  3CVG A;  4OMB A;  3USD A;  3KSJ A;  2XX7 A;  5KDT A;  2V93 A;  2O7U A;  4H0W A;  1MQD A;  4JBZ A;  4U23 A;  4GVO A;  3IJO B;  3K4U A;  4NF4 B;  3CFX A;  3CSB A;  1LCT A;  3OOA A;  3E3K A;  4KFQ A;  2V84 A;  4L17 A;  2F6P A;  3PPO A;  2I0C A;  4F31 B;  3N5L A;  2O1L A;  4IB2 A;  1Q35 A;  4R9F A;  1HSE A;  5FTI A;  3UA8 A;  1TWY A;  2XXU A;  4QFN A;  3BFT A;  1JW5 A;  5B7D A;  2XX8 A;  4YMA A;  3HV1 A;  4M1V A;  5I56 A;  1MPD A;  3H6W A;  3TCG A;  4OWD A;  4BDN A;  4R9G A;  3G3I A;  5H8Q B;  1PBP A;  1MQG A;  4MH5 A;  3CI8 A;  2V3Q A;  1SYH A;  4KYD A; 
#chains in the Genus database with same CATH topology
 5AA1 A;  3LBS A;  4GXS B;  4O94 A;  1A40 A;  4DZ1 A;  4EF1 A;  4I40 A;  2REJ A;  1TXF A;  4F1V A;  3RUM A;  2Z8D A;  4NF4 A;  4QFK A;  4FAJ A;  3EHS A;  4F22 A;  3IB2 A;  5EYG A;  2LAO A;  4NF5 A;  2GHB A;  4NF8 B;  2F35 A;  4IY6 A;  4ELQ A;  4HE1 A;  4EQ7 A;  3ODB A;  2QMX A;  3FAS A;  5I84 A;  4OYV A;  4XEQ A;  3CIJ A;  4X1B A;  4LN5 A;  2I4B A;  2DWH A;  3L6H A;  2BJI A;  2O84 X;  1XT8 A;  4YB7 A;  4OEU A;  5I59 B;  3EQ1 A;  1B3H A;  1J1N A;  4GQO A;  2XXH A;  2CEY A;  1Y3P A;  3PMX A;  1HSL A;  1FBE A;  5DW8 A;  3PUW E;  3FJM A;  3MST A;  1H43 A;  1QUI A;  3OSQ A;  2B3B A;  3FD3 A;  1IME A;  5EYF A;  3N6T A;  3HFU A;  1LAG E;  4IO3 A;  2B4L A;  4MNI A;  2GFE A;  4QSC A;  2VOZ A;  5IAI A;  4R2F A;  5CM6 A;  3RY3 A;  4FED A;  3OMB A;  5I7I A;  2XXX A;  2DQV A;  1IXG A;  3QMF A;  5KCJ A;  3QAX A;  4NHB A;  1BP5 A;  1IZ1 A;  1N3X A;  2WYP A;  4N8G A;  5JK4 A;  3WAE A;  3K1N A;  5ISU A;  4OHN A;  5ICQ A;  1EZ9 A;  1FQB A;  3S9E A;  3BFU A;  1B51 A;  3QIM A;  4XTC Q;  1IIW A;  1IMA A;  2ALU A;  1B7U A;  3W15 C;  3RQT A;  2ONR A;  3FIR A;  4R6K A;  2I58 A;  2R6G E;  2FA7 A;  2PT2 A;  3SEW A;  1YXI A;  4G68 B;  4GBV A;  2XWI A;  4RK2 A;  5EQ7 A;  2I6E A;  3FVK A;  4QSE A;  4Z7E A;  4UA8 A;  3THI A;  3M3L A;  2D5W A;  3U1O A;  1DK4 A;  4GWO A;  1XS5 A;  4P11 A;  3PPN A;  1B3F A;  3F11 A;  3MP1 A;  4N4U A;  3TYH A;  1P1Q A;  4U22 A;  4PFU A;  2X7Q A;  1D9Q A;  5JTY A;  4OVR A;  5H8S A;  1NNT A;  5H8H B;  2PVU A;  3K1M A;  2QJE A;  1INP A;  2M8C A;  3EF7 A;  1Y3N A;  2DP8 A;  1YCJ A;  4NN3 A;  4BDR A;  1MY1 A;  2GH9 A;  2G93 A;  3W9W A;  4FJP A;  1XVX A;  2I49 A;  1VFE A;  4N6P A;  4DXC A;  3U72 A;  4R73 A;  4NG7 A;  3G3F A;  3FVO A;  2NWJ A;  1EYK A;  5M2V A;  4P9K A;  1N7X A;  3LSX A;  4JVD A;  4H65 A;  3QSL A;  3JV9 A;  2I4C A;  3OO6 A;  2HAU A;  1EH3 A;  4GWU A;  2XXK A;  3O9P A;  4M4G A;  1FPE A;  5IZ3 A;  1N84 A;  2W7Y A;  1PC3 A;  2HHM A;  1MPB A;  4PC9 A;  4IO7 A;  3JZJ A;  3O28 A;  1USY E;  2Z8E A;  2H9B A;  1QUK A;  1NFT A;  3GZG A;  3RTW B;  4F39 A;  1DOT A;  1SYI A;  1YPN A;  1QW0 A;  4XKQ A;  3CRB A;  1JET A;  5BWJ A;  1JEU A;  3M3K A;  2E1S A;  2A5T B;  3OD7 A;  4PDD A;  3U65 A;  3TOD A;  4C1T A;  3RTF B;  2DE2 A;  2GRV A;  1Z7M E;  3HHF A;  2F34 A;  2O6A A;  5EHS A;  3HCQ A;  5FBP A;  1XI6 A;  3PUY E;  3IOT A;  3QXM A;  1BIY A;  2A5S A;  1NV6 A;  4OZ9 A;  3BBR A;  4P8B A;  3TCF A;  1SI0 A;  4PAK A;  1AL3 A;  1FTJ A;  3T22 A;  3VE1 B;  5AE4 A;  3DP6 A;  4N6K A;  3UP9 A;  2QRY A;  3G3J A;  4RXL A;  1LBB A;  1FJ9 A;  1EZP A;  2WEF A;  1MQI A;  1B7Z A;  3SET A;  4OTE A;  3K2D A;  1NV4 A;  1N0T A;  4MNC A;  1IQ7 A;  1FBH A;  1B9J A;  3L6G A;  3LSL A;  2PYY A;  4DIG A;  1LEV A;  1DTG A;  2QSX A;  5L9O A;  3MPL A;  1URS A;  3KZG A;  5K2X A;  5LTC A;  4P47 A;  3SKP A;  2F7C A;  1MRP A;  1MQH A;  4G8M A;  2O51 A;  1B0H A;  3EN3 A;  1Y9U A;  5I3S A;  1P1U A;  4KYE A;  3A29 A;  4F19 A;  3M3F A;  3Q29 A;  3K6W A;  5ET7 A;  2VHA A;  3VVF A;  3EHT A;  3H3G A;  3IO4 A;  3TAJ A;  2ZNU A;  3FXB A;  2DOJ A;  4EF2 A;  2UYF A;  3KJ7 A;  1KWH A;  4F2Q A;  1MG1 A;  1DCU A;  4QF9 A;  1IEJ A;  4GWW A;  4POW A;  2NVU B;  1B7H A;  4G61 A;  3FXQ A;  2XD3 A;  1USY H;  2IA4 A;  1QGX A;  3GLB A;  1SQY A;  2XXI A;  1OLA A;  2DYX A;  2DWI A;  4OFL A;  5EHM A;  2D21 A;  4OAN A;  4IO5 A;  3C33 A;  1IXH A;  2F7A A;  1SW2 A;  4XXU A;  3O29 A;  4OER A;  2ABH A;  4LQ5 A;  1MS7 A;  3OEM A;  2H98 A;  4JWO A;  1IIT A;  3UGW A;  1DPP A;  2Q74 A;  3T0J A;  1ZBM A;  2QFL A;  4XKP A;  5K2Y A;  1MH3 A;  4F3S A;  3IK6 B;  2ZYO A;  3K6X A;  2E0S A;  1AOV A;  4BDO A;  2XD2 A;  4FBP A;  4IO6 A;  4ISU A;  1FBG A;  4PFW A;  3VLV A;  1SW1 A;  4YKK A;  1NV5 A;  2VP1 A;  2XXQ A;  1DPE A;  4DI3 D;  1MXY A;  4R6Y A;  4FE8 A;  5LOM A;  2ESN A;  4PAF A;  4P1E A;  4NED A;  1R9Q A;  4C1U A;  3HPI A;  3FAT A;  3H7M A;  4U4X A;  4PFI A;  5I2K B;  1VFD A;  3FXU A;  3H6U A;  3IOU A;  4N81 A;  1JW1 A;  4NWD A;  1D9Y A;  3OEN A;  4X9T A;  3BIG A;  3I6V A;  4JSO A;  1A8E A;  4EXK A;  4FEB A;  3CG1 A;  4NAP A;  3MZ9 A;  2DE4 A;  3V89 B;  1NNK A;  3TKD A;  2UYE A;  4R72 A;  1OVB A;  3VDF A;  3IB0 A;  1LST A;  2DXY A;  3P7I A;  2WBB A;  3TDJ A;  3IL1 B;  5FHO A;  3FBP A;  4MHF A;  4RY1 A;  4NGU A;  1MXW A;  1LBW A;  1UIU A;  3TPA A;  1VSO A;  3TZA A;  1B3L A;  3E4R A;  4BLA A;  2ZYM A;  2WYK A;  4O3C A;  3FUZ A;  2F3B A;  2DDK A;  2XXV A;  2DWJ A;  4GXA A;  4TOZ A;  4F3G A;  1POY 1;  3VVD A;  4ZZA A;  3ZS6 A;  3T9U A;  4HE0 A;  4LZ8 A;  5ITO A;  4GIZ A;  3PUZ E;  3ILU B;  2XXY A;  3VV5 A;  2O69 A;  4MBP A;  4H8J A;  1FTL A;  1Y4T A;  1UTH A;  1ANF A;  4NWC A;  2DWA A;  1HSJ A;  3U93 A;  3FGS A;  4H6D A;  3K01 A;  3R6U A;  2AL5 A;  2RC8 A;  2CZL A;  4QHQ A;  4Q0C A;  1IUD A;  1MXU A;  4O7M A;  1GGG A;  2OK2 A;  4KCD A;  5CMK A;  1MDQ A;  3C35 A;  3IFC A;  1NV3 A;  5L8D A;  4ZED A;  2I48 A;  2QVR A;  2Q8J A;  4PFR A;  3TTN A;  3KOT A;  4IGT A;  1NUY A;  2P1S A;  3E9X A;  4PDH A;  2O1M A;  4QFP A;  4HCY A;  4O3B A;  4OET A;  3ZKK A;  1FPF A;  1H45 A;  3SEU A;  5AA4 B;  2HZK A;  4DXB A;  1M5D A;  4Q8R A;  3ONM A;  4F3B A;  4KCC A;  2UVH A;  3ZSF A;  1KZ8 A;  1POT A;  2OX3 A;  3TFL A;  1NH8 A;  1SW4 A;  3Q26 A;  2Y7K A;  1GVC A;  1XC1 A;  2HXR A;  4G68 C;  1FTM A;  1IMF A;  2PBW A;  3H06 B;  5DT6 A;  4MCO A;  2KR0 A;  3RPL B;  4JDF A;  2QS2 A;  3G3K A;  3HO7 A;  2XXP A;  2ZXT A;  4I1D A;  2Z22 A;  5H8Q A;  1JP4 A;  1FTA A;  3FXR A;  4MF3 A;  5JEI A;  4IO2 A;  4YKP A;  2B3F A;  4N17 A;  2QPQ A;  3B50 A;  2AYS A;  4GX3 A;  4MNP A;  3PUX E;  1FQE A;  1DMB A;  3OO8 A;  4MLQ A;  1ZTY A;  1Y3Q A;  3CG3 A;  4ZEB A;  4OVJ A;  5H8N B;  3MWB A;  2XWO A;  2PX1 A;  4PBQ A;  2I0B A;  3GBA A;  4NF8 A;  2RF1 A;  4IO4 A;  1FJ6 A;  3O66 A;  4DCY A;  2DVZ A;  4QSD A;  5DYH A;  2RC9 A;  1OVT A;  3RPW A;  4XF5 A;  1MH4 A;  3PU5 A;  1WOD A;  5HM4 B;  1NMU A;  1GV8 A;  3B7D A;  4QBA A;  5I59 A;  3HN0 A;  4AQ4 A;  3KBR A;  4UAC A;  4YMB A;  3ZKL A;  1I69 A;  1SBP A;  3MUQ A;  4PTK A;  4R2B A;  5LDZ A;  4GRK A;  4DDD A;  1P1N A;  3H6T A;  3H03 A;  2XXR A;  4PET A;  4N6D A;  4ZDM A;  3O6I A;  3S9N C;  1B3E A;  1B5I A;  3EHU A;  4PAI A;  1LCF A;  3MW0 A;  5I57 B;  2XHD A;  1FTK A;  1BK4 A;  3I5O A;  2PFY A;  1LGB C;  1TT1 A;  1B46 A;  3MJN A;  4U1O A;  4Z0I A;  4LON B;  3ECR A;  3IX1 A;  2FNC A;  1YTV A;  3OXN A;  5F24 A;  1M5C A;  2WKY A;  2XX9 A;  1BLF A;  1B32 A;  2R9J A;  3UN6 A;  3S9L C;  4U21 A;  1BTJ A;  5BUU A;  3FVN A;  3D4C A;  2GHA A;  4F3P A;  2WX9 A;  5ET8 A;  3TMG A;  4NF0 A;  1M5E A;  4EDP A;  1LBX A;  3KSX A;  1SW5 A;  4G68 A;  1N04 A;  2DXR A;  3LR1 A;  3FV2 A;  4JVI A;  1ZLQ A;  2XWV A;  3O2A A;  3K1P A;  2Z8F A;  4H67 A;  4YKJ A;  1R1N A;  3C9H A;  2NXO A;  1LAF E;  3PGF A;  4PBH A;  4RPN A;  3IJX B;  3QK6 A;  3AXF A;  4FIM A;  4JWX A;  2YLN A;  5J16 A;  2Z23 A;  5TPA B;  1CNQ A;  4POX A;  1VDW A;  3LC8 A;  2VPN A;  4NTL A;  3BKI B;  3IB1 A;  1MY3 A;  2PFZ A;  4OFO A;  4WEP A;  4I3Y A;  5I58 B;  2RIN A;  5FHN A;  4I8C A;  5H8H A;  3CFZ A;  4DCX A;  4PP0 A;  3H4Z A;  3GYY A;  4YZZ A;  4Q5T A;  4FOR A;  3RLF E;  3D1R A;  3H6V A;  1RDY A;  3CSG A;  5A5X B;  4GL8 A;  3KG2 A;  3VLW A;  1KA0 A;  1MPC A;  2HAV A;  2NOO A;  3K6U A;  1ZIU A;  2RCB A;  1SD3 A;  1B05 A;  2Q89 A;  4NF6 B;  1QJM A;  4ELR A;  2H25 A;  5DEX B;  1XVY A;  2OWS A;  3W9V A;  2QS1 A;  2I3V A;  4H8I A;  1H3D A;  1LLS A;  5IKB A;  1L5T A;  1LAH E;  2CMO A;  3MVY A;  3K02 A;  4K3F A;  3T1B A;  5CC2 A;  4MFI A;  3ROJ A;  5HPQ A;  1FQC A;  2FYI A;  3IOV A;  4P0I A;  1OMP A;  4U1Z A;  3RNN A;  4O8M A;  1LB8 A;  4ND9 A;  3VLU A;  3U94 A;  3LV0 A;  1JNF A;  2A5T A;  3KJT A;  3VVE A;  3V83 A;  3OEK A;  4PCD A;  2L5V A;  3OO9 A;  4OVT A;  4GWY A;  4GWZ A;  2F3D A;  1A99 A;  1MDP 1;  3KN8 A;  3MZ1 A;  1M5B A;  3S4U A;  4R74 A;  1PEB A;  2REG A;  4OFJ A;  4RJZ A;  1NKX A;  2FHY A;  2Y7R A;  4F1U A;  4C0R A;  2ZNT A;  3DM0 A;  3MP6 A;  2YJP A;  2AIX A;  1NUZ A;  1LBZ A;  4MEV A;  4MJO A;  1VE4 A;  1Y1M A;  3Q25 A;  1IXI A;  5DVI A;  4XKN A;  4XFE A;  5ESY A;  1H76 A;  4OVS A;  4NF6 A;  5DEX A;  4JB7 A;  5CI5 A;  1LBY A;  3QUJ A;  1YAE A;  3HHG A;  1Y4C A;  4ZEC A;  2F6G A;  1RDZ A;  4IGR A;  2Y5L A;  1S7Y A;  3N6U A;  2Q8M A;  4MIJ A;  4JXI A;  4WXJ A;  1JEV A;  4IY5 A;  4THI A;  1IMC A;  1N7W A;  2HXW A;  4RK9 A;  2B4M A;  4WKM A;  3DP4 A;  2UVJ A;  1TFD A;  3VFJ A;  3LSW A;  4KI0 E;  4DXU A;  1PB9 A;  4KYS A;  4RNS A;  3MAM A;  4EQB A;  5KDT B;  4RA1 A;  2P0S A;  1MXV A;  3T93 B;  4N15 A;  2QMW A;  3UK4 A;  5B70 A;  3O97 A;  3I3V A;  1BKA A;  3C36 A;  3TCH A;  5TU0 A;  1FBC A;  3TTR A;  2OWZ A;  3SZP A;  2FBP A;  5J1D A;  1SVX B;  3N26 A;  1LFG A;  3OO7 A;  2KLF A;  3OSR A;  1FQF A;  3DLN A;  3B8B A;  4PF6 A;  1CB6 A;  2ZNS A;  4LAT A;  2UXA A;  1B5J A;  3E13 X;  3FJ7 A;  4MLV A;  4H45 A;  1VR5 A;  4U2R A;  4JWY A;  3K00 A;  4JVC A;  4UAB A;  2OLB A;  1QVS A;  1DSN A;  3IO6 A;  1AMF A;  1YZ0 A;  3RT6 B;  2ZYN A;  1B2H A;  1S9T A;  1EYI A;  3E79 A;  4LQ2 A;  4OVP A;  1MY0 A;  4ZS9 A;  4ZEF A;  2B65 A;  5DVJ A;  3HST A;  1LBV A;  3QYT A;  5I56 B;  1MM7 A;  1URG A;  3M8U A;  3TQW A;  2Y5K A;  4HTG A;  2QVU A;  3MVZ A;  3LUZ A;  1D9V A;  4AB5 A;  5I2N B;  1NNP A;  4GX6 A;  4EUO A;  3EKI A;  2F8D A;  2CEX A;  4ELP A;  2WBD A;  4GD5 A;  1FPK A;  3C32 A;  2RKM A;  3LUY A;  3KGC A;  3IR1 A;  3TTK A;  5CMB A;  5IZZ A;  1CE2 A;  1ZMG A;  2H4I A;  4EXL A;  2FIX A;  3SEY A;  2IEE A;  2Y7I A;  4NF5 B;  2ZZW A;  1FCK A;  4P0G A;  2XWK A;  3A09 A;  3EPE A;  5F1Q A;  2HPG A;  5I2K A;  1GR2 A;  4OQO A;  1S50 A;  4FAT A;  4G8H A;  4G2Z A;  1Z7N E;  4P56 A;  3CR9 A;  1UIV A;  2KQZ A;  3N94 A;  5IGA A;  3G3G A;  1FPI A;  4BDL A;  3Q28 A;  3VXB A;  1AIV A;  4R6H A;  1NV1 A;  1JW4 A;  3RGY A;  4O3A A;  2FVZ A;  3PUV E;  3FZV A;  4I9D A;  2F7B A;  1XHY A;  2V3T A;  1LAX A;  2Y7W A;  5I2N A;  1JQF A;  4N13 A;  3G7W A;  1K9Z A;  2HQ0 A;  3T66 A;  1Q1K A;  5KCJ B;  1I6B A;  1US5 A;  3KN3 A;  3K0V A;  2MKZ A;  5CMC A;  3TTL A;  2ONK E;  2ZZV A;  1FRP A;  1FPJ A;  4LVQ A;  4YKI A;  3OEL A;  1NI9 A;  4O7I A;  1R6Z A;  5TP9 B;  5ITP A;  4OXV A;  4X48 A;  4PQJ A;  1FBP A;  1NV7 A;  1N3W A;  1RDX A;  4GL0 A;  5ICT A;  3C34 A;  4TLM B;  3V8X B;  1II5 A;  2H99 A;  4ONY A;  1OQG A;  3V5A A;  1MM6 A;  1IMB A;  1FBF A;  1FTO A;  4WED A;  4ZEK A;  4F1Y A;  1EZO A;  3GBB A;  3MZB A;  3A3C A;  1Y20 A;  1URD A;  5IZ1 A;  2I3W A;  3KC0 A;  4LZ5 A;  2AL4 A;  1T0K A;  3T9V A;  1MXX A;  1ELJ A;  3D4G A;  5DVF A;  3RN8 A;  4TQU Q;  1XOC A;  3TEL A;  1ATG A;  5ET5 A;  1Y1Z A;  3O6H A;  1A8F A;  3O6G A;  1M5F A;  2F5X A;  5T3J A;  4PE5 B;  3ILT B;  5JTY B;  2DE3 A;  4KD5 A;  4X8R A;  2BJJ X;  3LSF B;  3DP8 A;  4XKR A;  1A55 A;  4GF8 A;  4H5G A;  4TLL B;  3JYR A;  5AA4 A;  4OES A;  2VT5 A;  3B6T A;  4LA9 A;  2YPN A;  4GWS A;  2ONS A;  1O63 A;  2D3I A;  3PMV A;  1US4 A;  2QS4 A;  2Y84 A;  2ZZX A;  3K6V A;  1AWB A;  5H8F B;  1IMD A;  5TP9 A;  3FV1 A;  2UVG A;  4E0X A;  4BDM A;  2HEU A;  3DEL B;  5AA2 B;  4YU0 A;  4QFO A;  4NE4 A;  5L9S A;  3PD9 A;  4KQP A;  4YB6 A;  4MAG A;  4KPT A;  4ZE8 A;  3IFA A;  1NUW A;  2OJT A;  3SDF A;  3RPL A;  1PDA A;  4G4P A;  1FPB A;  5IZ3 B;  5ET6 A;  4AB6 A;  3IAZ A;  4PGP A;  3PPQ A;  1JVX A;  3KEI A;  2FIE A;  2O68 A;  3UOR A;  1QKB A;  4N07 A;  4LZ7 A;  2JJK A;  1NL5 A;  3TEP A;  3Q27 A;  1QKA A;  4OEN A;  3SES A;  1IXC A;  2UVI A;  4G77 A;  2GQ1 A;  3CHG A;  1P99 A;  1NUX A;  3GXA A;  3RT8 A;  5H8N A;  1ZU0 A;  1G0I A;  1RYO A;  2P3N A;  2NUV A;  2OZZ A;  5EQ8 A;  3T9H B;  4H1X A;  4GOT A;  3MQ9 A;  3SEV A;  3TQL A;  1P1O A;  4PE3 A;  4F18 A;  1PB7 A;  1FSA A;  5H8F A;  1B0L A;  1UQW A;  4YAH X;  5I5P A;  3BIH A;  1B6H A;  1SPI A;  3MP8 A;  1LBC A;  1QUJ A;  1B58 A;  3MVX A;  5AA2 A;  3C31 A;  2XXW A;  4ESX A;  5HBC A;  2VD2 A;  4KR5 A;  4HW8 A;  1MQJ A;  3VXC A;  1ZJL A;  1MY4 A;  5DTB A;  1B5H A;  1I6Q A;  1O7T A;  1NH7 A;  4GFR A;  4LP2 B;  4AS4 A;  2R8T A;  3T9X B;  3KFM A;  1EU8 A;  4R75 A;  4BDQ A;  4QFL A;  3CFL A;  4LUB A;  4G8N A;  3SEX A;  4KHZ E;  1YYZ A;  1P1W A;  3PMW A;  2Q88 A;  5I57 A;  1MXZ A;  2H5Y A;  2RCA A;  3R26 A;  2XA5 A;  5EQ9 A;  2F97 A;  1H44 A;  1RKM A;  2OBG A;  2X7P A;  1LB9 A;  4JSD A;  3MVW A;  4H5F A;  1WDN A;  2P2A A;  2O7I A;  1GTK A;  4NX1 A;  2PT1 A;  2X26 A;  2XXT A;  5AA3 A;  4HE2 A;  4HS7 A;  3QUF A;  1FW0 A;  3IOW A;  4GWX A;  3MYU A;  4OVQ A;  4GX4 A;  2Q2A A;  4AS5 A;  4ECF A;  1B1H A;  4XIG Q;  4IR8 A;  3TTM A;  3MPK A;  1RYX A;  3C4M A;  2ANJ A;  5A5L A;  1D3K A;  2VPO A;  3MC2 A;  4HCW A;  5L9M A;  3G3H A;  4HXV A;  3PTY A;  1JVY A;  3B6Q A;  3IOR A;  1B4Z A;  4ESW A;  4PGN A;  1B40 A;  5TPA A;  5CMM A;  4KXP A;  3SER A;  4DE8 A;  4QRZ A;  1FQA A;  3KC1 A;  4X04 A;  5FTH A;  5I58 A;  1R9L A;  1NNF A;  5CRY A;  3B6W A;  1PBQ A;  2ZMB A;  5AA2 D;  1B3G A;  1UTB B;  2Q2C A;  1KA1 A;  2VD3 A;  2THI A;  1A7L A;  5A5X A;  4PF8 A;  3E78 A;  3KBZ A;  4OEV A;  5EQA A;  3FVG A;  2ZYK A;  1QUL A;  3KN7 A;  1LFH A;  1SDX A;  4DLD A;  2VGQ A;  1OIB A;  2F36 A;  3NOH A;  3PV0 E;  4Q30 B;  4ZEI A;  3PPR A;  2PCR A;  4GLI A;  5F7V A;  4I3E A;  1D4N A;  4RYA A;  4ZZE A;  2OCU A;  4MMP A;  4PFY A;  5FHM A;  1FPD A;  4N91 A;  3A3U A;  2HCA A;  5KZT A;  4E0W A;  4DI4 B;  2HZL A;  2P3V A;  4F2O A;  1A54 A;  4I62 A;  1B4H A;  3RYD A;  3MBP A;  1DTZ A;  2CZK A;  1SI1 A;  2G29 A;  1TFA A;  1FBD A;  4MX6 A;  3U92 A;  3WAF A;  4ZE9 A;  1F9B A;  1I6A A;  3S9M C;  4X1D A;  2Q9T A;  4U4S A;  2F78 A;  4P1L A;  3S2V A;  5IM2 A;  3R7X A;  1B52 A;  3UIF A;  1UTB A;  1DBZ A;  1O64 A;  1WVJ A;  4FEC A;  5CBS A;  3TUS A;  4YIC A;  1FPL A;  4QXD A;  2V25 A;  3PD8 A;  1LFI A;  5EYH A;  4P3L A;  4EQ9 A;  4ELO A;  2DSF A;  5ELV A;  2DS9 A;  1AH5 A;  2OWT A;  1OQH A;  5CBR A;  1MY2 A;  4RPO A;  1N76 A;  2HFB A;  3PPP A;  4YB5 A;  2R71 A;  3U8Q A;  1OLC A;  2DVC A;  1PB8 A;  4F29 A;  1FQD A;  1ZKB A;  4NMY A;  2QL3 A;  3FJG A;  1G0H A;  2PMS A;  1B1X A;  2V3U A;  1UTH B;  4NQ8 A;  2RC7 A;  1NV0 A;  2QS3 A;  4PFT A;  2Y7P A;  3T96 B;  3KOS A;  3CVG A;  4OMB A;  3USD A;  3KSJ A;  2XX7 A;  1EYJ A;  5KDT A;  2V93 A;  2O7U A;  4H0W A;  1MQD A;  4JBZ A;  4U23 A;  4GVO A;  1NV2 A;  1FPG A;  3IJO B;  3K4U A;  3CFX A;  4NF4 B;  2CZI A;  3CSB A;  1LCT A;  3OOA A;  3E3K A;  4KFQ A;  2V84 A;  4L17 A;  2F6P A;  1K9Y A;  3PPO A;  2I0C A;  4F31 B;  3N5L A;  2O1L A;  4IB2 A;  3ISP A;  4H46 A;  4GBW A;  1Q35 A;  4R9F A;  1HSE A;  5FTI A;  2QVV A;  3UA8 A;  1TWY A;  2XXU A;  4QFN A;  3BFT A;  1JW5 A;  5B7D A;  2XX8 A;  2CZH A;  4YMA A;  3HV1 A;  4M1V A;  5I56 A;  1MPD A;  3H6W A;  3TCG A;  4OWD A;  4BDN A;  4OA4 A;  4R9G A;  3G3I A;  5H8Q B;  1PBP A;  2V4C A;  4PFB A;  1MQG A;  4MH5 A;  1Q9D A;  4N8Y A;  3CI8 A;  2V3Q A;  1SYH A;  4KYD A; 
#chains in the Genus database with same CATH homology
 5AA1 A;  3LBS A;  4GXS B;  1A40 A;  4DZ1 A;  4EF1 A;  2REJ A;  1TXF A;  4F1V A;  3RUM A;  2Z8D A;  4NF4 A;  4QFK A;  4FAJ A;  3EHS A;  4F22 A;  3IB2 A;  2LAO A;  4NF5 A;  2GHB A;  4NF8 B;  2F35 A;  4IY6 A;  4ELQ A;  4EQ7 A;  3ODB A;  2QMX A;  3FAS A;  5I84 A;  4OYV A;  3CIJ A;  4X1B A;  2I4B A;  2DWH A;  3L6H A;  2O84 X;  1XT8 A;  4YB7 A;  4OEU A;  5I59 B;  3EQ1 A;  1B3H A;  1J1N A;  4GQO A;  2XXH A;  1Y3P A;  3PMX A;  1HSL A;  3PUW E;  3FJM A;  1H43 A;  1QUI A;  3OSQ A;  2B3B A;  3FD3 A;  5EYF A;  3N6T A;  1LAG E;  4IO3 A;  2GFE A;  4QSC A;  2VOZ A;  5IAI A;  4R2F A;  5CM6 A;  3RY3 A;  4FED A;  3OMB A;  2XXX A;  2DQV A;  1IXG A;  5KCJ A;  3QAX A;  1BP5 A;  1IZ1 A;  1N3X A;  5JK4 A;  3WAE A;  3K1N A;  5ISU A;  4OHN A;  5ICQ A;  1EZ9 A;  1FQB A;  3S9E A;  3BFU A;  1B51 A;  3QIM A;  4XTC Q;  1IIW A;  2ALU A;  1B7U A;  3W15 C;  3RQT A;  2ONR A;  3FIR A;  4R6K A;  2I58 A;  2R6G E;  2FA7 A;  2PT2 A;  3SEW A;  4G68 B;  4RK2 A;  2I6E A;  3FVK A;  4QSE A;  4Z7E A;  4UA8 A;  3THI A;  3M3L A;  2D5W A;  3U1O A;  4GWO A;  1XS5 A;  4P11 A;  3PPN A;  1B3F A;  3F11 A;  3MP1 A;  3TYH A;  1P1Q A;  4U22 A;  4PFU A;  2X7Q A;  5JTY A;  5H8S A;  1NNT A;  5H8H B;  2PVU A;  3K1M A;  2QJE A;  2M8C A;  3EF7 A;  1Y3N A;  2DP8 A;  1YCJ A;  4BDR A;  1MY1 A;  2GH9 A;  2G93 A;  3W9W A;  4FJP A;  1XVX A;  2I49 A;  1VFE A;  4N6P A;  4DXC A;  3U72 A;  4R73 A;  3G3F A;  3FVO A;  2NWJ A;  5M2V A;  1N7X A;  3LSX A;  4H65 A;  3QSL A;  3JV9 A;  2I4C A;  3OO6 A;  2HAU A;  1EH3 A;  3O9P A;  4M4G A;  1N84 A;  2W7Y A;  1PC3 A;  1MPB A;  4IO7 A;  3JZJ A;  3O28 A;  1USY E;  2Z8E A;  2H9B A;  1QUK A;  1NFT A;  3GZG A;  3RTW B;  4F39 A;  1DOT A;  1SYI A;  1YPN A;  1QW0 A;  4XKQ A;  3CRB A;  1JET A;  5BWJ A;  1JEU A;  3M3K A;  2E1S A;  2A5T B;  3OD7 A;  3TOD A;  4C1T A;  3RTF B;  2DE2 A;  2GRV A;  1Z7M E;  3HHF A;  2F34 A;  2O6A A;  5EHS A;  3HCQ A;  3PUY E;  3IOT A;  3QXM A;  1BIY A;  2A5S A;  4OZ9 A;  3BBR A;  3TCF A;  1SI0 A;  1AL3 A;  1FTJ A;  3T22 A;  3VE1 B;  5AE4 A;  3DP6 A;  3UP9 A;  2QRY A;  3G3J A;  4RXL A;  1LBB A;  1EZP A;  1MQI A;  1B7Z A;  3SET A;  4OTE A;  3K2D A;  1N0T A;  1IQ7 A;  1B9J A;  3L6G A;  3LSL A;  2PYY A;  4DIG A;  1DTG A;  2QSX A;  5L9O A;  3MPL A;  1URS A;  3KZG A;  5K2X A;  3SKP A;  2F7C A;  1MRP A;  1MQH A;  4G8M A;  2O51 A;  1B0H A;  3EN3 A;  1Y9U A;  1P1U A;  4KYE A;  4F19 A;  3M3F A;  3Q29 A;  3K6W A;  2VHA A;  3VVF A;  3EHT A;  3H3G A;  3IO4 A;  3TAJ A;  2ZNU A;  2DOJ A;  4EF2 A;  2UYF A;  3KJ7 A;  1KWH A;  4F2Q A;  1MG1 A;  4QF9 A;  1IEJ A;  4POW A;  2NVU B;  1B7H A;  3FXQ A;  2XD3 A;  1USY H;  2IA4 A;  3GLB A;  1SQY A;  2XXI A;  1OLA A;  2DYX A;  2DWI A;  4OFL A;  5EHM A;  2D21 A;  4IO5 A;  3C33 A;  1IXH A;  2F7A A;  1SW2 A;  4XXU A;  3O29 A;  4OER A;  2ABH A;  4LQ5 A;  1MS7 A;  3OEM A;  2H98 A;  4JWO A;  1IIT A;  3UGW A;  1DPP A;  1ZBM A;  4XKP A;  5K2Y A;  1MH3 A;  4F3S A;  3IK6 B;  2ZYO A;  3K6X A;  2E0S A;  1AOV A;  4BDO A;  2XD2 A;  4IO6 A;  4ISU A;  4PFW A;  3VLV A;  1SW1 A;  4YKK A;  2VP1 A;  2XXQ A;  1DPE A;  1MXY A;  4R6Y A;  4FE8 A;  5LOM A;  2ESN A;  4NED A;  1R9Q A;  4C1U A;  3HPI A;  3FAT A;  3H7M A;  4U4X A;  5I2K B;  1VFD A;  3FXU A;  3H6U A;  3IOU A;  1JW1 A;  4NWD A;  1D9Y A;  3OEN A;  4X9T A;  3I6V A;  4JSO A;  1A8E A;  4EXK A;  4FEB A;  3CG1 A;  3MZ9 A;  2DE4 A;  3V89 B;  1NNK A;  3TKD A;  2UYE A;  4R72 A;  1OVB A;  3VDF A;  3IB0 A;  1LST A;  2DXY A;  3P7I A;  3TDJ A;  3IL1 B;  5FHO A;  4RY1 A;  1MXW A;  1UIU A;  3TPA A;  1VSO A;  3TZA A;  1B3L A;  3E4R A;  4BLA A;  2ZYM A;  4O3C A;  3FUZ A;  2XXV A;  2DWJ A;  4GXA A;  4TOZ A;  4F3G A;  1POY 1;  3VVD A;  4ZZA A;  3ZS6 A;  3T9U A;  4LZ8 A;  5ITO A;  4GIZ A;  3PUZ E;  3ILU B;  2XXY A;  3VV5 A;  2O69 A;  4MBP A;  4H8J A;  1FTL A;  1Y4T A;  1UTH A;  1ANF A;  4NWC A;  2DWA A;  1HSJ A;  3U93 A;  3FGS A;  4H6D A;  3K01 A;  3R6U A;  2AL5 A;  2RC8 A;  2CZL A;  4QHQ A;  4Q0C A;  1IUD A;  1MXU A;  1GGG A;  2OK2 A;  4KCD A;  5CMK A;  1MDQ A;  3C35 A;  5L8D A;  4ZED A;  2I48 A;  2Q8J A;  3TTN A;  3KOT A;  4IGT A;  2P1S A;  3E9X A;  2O1M A;  4QFP A;  4HCY A;  4O3B A;  4OET A;  3ZKK A;  1H45 A;  3SEU A;  5AA4 B;  2HZK A;  4DXB A;  4Q8R A;  1M5D A;  3ONM A;  4F3B A;  4KCC A;  2UVH A;  3ZSF A;  1POT A;  3TFL A;  1NH8 A;  1SW4 A;  3Q26 A;  2Y7K A;  1GVC A;  1XC1 A;  4G68 C;  1FTM A;  2PBW A;  3H06 B;  5DT6 A;  4JDF A;  2QS2 A;  3G3K A;  3HO7 A;  2XXP A;  2ZXT A;  4I1D A;  2Z22 A;  5H8Q A;  3FXR A;  4MF3 A;  5JEI A;  4IO2 A;  4YKP A;  2B3F A;  2QPQ A;  2AYS A;  3PUX E;  1FQE A;  1DMB A;  3OO8 A;  4MLQ A;  1ZTY A;  1Y3Q A;  3CG3 A;  4ZEB A;  4OVJ A;  5H8N B;  3MWB A;  2PX1 A;  2I0B A;  3GBA A;  4NF8 A;  2RF1 A;  4IO4 A;  3O66 A;  4DCY A;  2DVZ A;  4QSD A;  5DYH A;  2RC9 A;  1OVT A;  3RPW A;  1MH4 A;  3PU5 A;  1WOD A;  5HM4 B;  1NMU A;  1GV8 A;  3B7D A;  5I59 A;  3HN0 A;  4AQ4 A;  3KBR A;  4UAC A;  4YMB A;  3ZKL A;  1I69 A;  1SBP A;  3MUQ A;  4R2B A;  4GRK A;  4DDD A;  1P1N A;  3H6T A;  3H03 A;  2XXR A;  4PET A;  4ZDM A;  3O6I A;  3S9N C;  1B3E A;  1B5I A;  3EHU A;  1LCF A;  3MW0 A;  5I57 B;  2XHD A;  1FTK A;  3I5O A;  1LGB C;  1TT1 A;  1B46 A;  3MJN A;  4U1O A;  4Z0I A;  4LON B;  3ECR A;  3IX1 A;  2FNC A;  1YTV A;  3OXN A;  1M5C A;  2WKY A;  2XX9 A;  1BLF A;  1B32 A;  2R9J A;  3UN6 A;  3S9L C;  4U21 A;  1BTJ A;  5BUU A;  3FVN A;  3D4C A;  2GHA A;  4F3P A;  3TMG A;  1M5E A;  4EDP A;  3KSX A;  1SW5 A;  4G68 A;  1N04 A;  2DXR A;  3LR1 A;  3FV2 A;  1ZLQ A;  3K1P A;  3O2A A;  2Z8F A;  4H67 A;  4YKJ A;  1R1N A;  3C9H A;  2NXO A;  1LAF E;  3PGF A;  4RPN A;  3IJX B;  3QK6 A;  3AXF A;  4FIM A;  4JWX A;  2YLN A;  2Z23 A;  5TPA B;  4POX A;  3LC8 A;  4NTL A;  3BKI B;  3IB1 A;  1MY3 A;  4OFO A;  4WEP A;  5I58 B;  2RIN A;  5FHN A;  4I8C A;  5H8H A;  3CFZ A;  4DCX A;  4PP0 A;  3H4Z A;  4YZZ A;  4Q5T A;  4FOR A;  3RLF E;  3H6V A;  3CSG A;  5A5X B;  4GL8 A;  3KG2 A;  3VLW A;  1MPC A;  2HAV A;  2NOO A;  3K6U A;  1ZIU A;  2RCB A;  1SD3 A;  1B05 A;  2Q89 A;  4NF6 B;  1QJM A;  4ELR A;  2H25 A;  5DEX B;  1XVY A;  2OWS A;  3W9V A;  2QS1 A;  2I3V A;  4H8I A;  1H3D A;  1LLS A;  5IKB A;  1L5T A;  1LAH E;  2CMO A;  3MVY A;  3K02 A;  4K3F A;  5CC2 A;  4MFI A;  5HPQ A;  1FQC A;  2FYI A;  3IOV A;  4P0I A;  1OMP A;  4U1Z A;  3RNN A;  1LB8 A;  4ND9 A;  3VLU A;  3U94 A;  1JNF A;  2A5T A;  3KJT A;  3VVE A;  3V83 A;  3OEK A;  3OO9 A;  1A99 A;  1MDP 1;  3KN8 A;  3MZ1 A;  1M5B A;  3S4U A;  4R74 A;  1PEB A;  2REG A;  4OFJ A;  4RJZ A;  1NKX A;  2Y7R A;  4F1U A;  4C0R A;  2ZNT A;  3DM0 A;  3MP6 A;  2YJP A;  2AIX A;  1VE4 A;  1Y1M A;  3Q25 A;  1IXI A;  5DVI A;  4XKN A;  1H76 A;  4NF6 A;  5DEX A;  4JB7 A;  5CI5 A;  3QUJ A;  1YAE A;  3HHG A;  1Y4C A;  4ZEC A;  2F6G A;  4IGR A;  1S7Y A;  3N6U A;  4JXI A;  4WXJ A;  1JEV A;  4IY5 A;  4THI A;  1N7W A;  2HXW A;  4RK9 A;  4WKM A;  3DP4 A;  2UVJ A;  1TFD A;  3VFJ A;  3LSW A;  4KI0 E;  4DXU A;  1PB9 A;  4KYS A;  4RNS A;  3MAM A;  4EQB A;  5KDT B;  4RA1 A;  2P0S A;  1MXV A;  3T93 B;  2QMW A;  3UK4 A;  5B70 A;  3O97 A;  3I3V A;  3TCH A;  1BKA A;  3C36 A;  5TU0 A;  3TTR A;  5J1D A;  1SVX B;  3N26 A;  1LFG A;  3OO7 A;  2KLF A;  3OSR A;  1FQF A;  3DLN A;  1CB6 A;  2ZNS A;  4LAT A;  2UXA A;  1B5J A;  3E13 X;  3FJ7 A;  4MLV A;  4U2R A;  1VR5 A;  4JWY A;  3K00 A;  2OLB A;  1QVS A;  1DSN A;  3IO6 A;  1AMF A;  3RT6 B;  2ZYN A;  1B2H A;  1S9T A;  4LQ2 A;  1MY0 A;  4ZS9 A;  4ZEF A;  2B65 A;  5DVJ A;  3HST A;  5I56 B;  3QYT A;  1MM7 A;  1URG A;  3M8U A;  3TQW A;  4HTG A;  3MVZ A;  1D9V A;  4AB5 A;  5I2N B;  1NNP A;  4EUO A;  2F8D A;  4ELP A;  4GD5 A;  3C32 A;  2RKM A;  3LUY A;  3KGC A;  3IR1 A;  3TTK A;  5CMB A;  1CE2 A;  1ZMG A;  2H4I A;  4EXL A;  3SEY A;  2IEE A;  2Y7I A;  4NF5 B;  1FCK A;  4P0G A;  3A09 A;  3EPE A;  5F1Q A;  5I2K A;  1GR2 A;  4OQO A;  1S50 A;  4FAT A;  4G8H A;  4G2Z A;  1Z7N E;  3CR9 A;  1UIV A;  3N94 A;  3G3G A;  4BDL A;  3Q28 A;  3VXB A;  1AIV A;  4R6H A;  1JW4 A;  3RGY A;  4O3A A;  3PUV E;  3FZV A;  4I9D A;  2F7B A;  1XHY A;  2V3T A;  1LAX A;  2Y7W A;  5I2N A;  1JQF A;  4N13 A;  3G7W A;  2HQ0 A;  3T66 A;  1Q1K A;  5KCJ B;  1I6B A;  1US5 A;  3KN3 A;  3K0V A;  5CMC A;  3TTL A;  2ONK E;  4LVQ A;  4YKI A;  3OEL A;  1R6Z A;  5TP9 B;  5ITP A;  4OXV A;  4X48 A;  4PQJ A;  1N3W A;  4GL0 A;  5ICT A;  3C34 A;  4TLM B;  3V8X B;  1II5 A;  2H99 A;  4ONY A;  1OQG A;  3V5A A;  1MM6 A;  1FTO A;  4WED A;  4ZEK A;  4F1Y A;  1EZO A;  3GBB A;  3MZB A;  3A3C A;  1Y20 A;  1URD A;  2I3W A;  4LZ5 A;  2AL4 A;  1T0K A;  3T9V A;  1MXX A;  1ELJ A;  3D4G A;  5DVF A;  3RN8 A;  4TQU Q;  1XOC A;  3TEL A;  1ATG A;  1Y1Z A;  3O6H A;  1A8F A;  3O6G A;  1M5F A;  2F5X A;  4PE5 B;  3ILT B;  5JTY B;  2DE3 A;  4KD5 A;  2BJJ X;  3LSF B;  3DP8 A;  4XKR A;  1A55 A;  4GF8 A;  4H5G A;  4TLL B;  3JYR A;  5AA4 A;  4OES A;  3B6T A;  4LA9 A;  2YPN A;  2ONS A;  1O63 A;  2D3I A;  3PMV A;  1US4 A;  2QS4 A;  2Y84 A;  3K6V A;  5H8F B;  5TP9 A;  3FV1 A;  2UVG A;  4E0X A;  4BDM A;  2HEU A;  3DEL B;  5AA2 B;  4YU0 A;  4QFO A;  4NE4 A;  5L9S A;  3PD9 A;  4KQP A;  4YB6 A;  4KPT A;  4ZE8 A;  2OJT A;  3SDF A;  1PDA A;  4G4P A;  4AB6 A;  3IAZ A;  3PPQ A;  1JVX A;  3KEI A;  2O68 A;  3UOR A;  1QKB A;  4N07 A;  4LZ7 A;  1NL5 A;  3TEP A;  3Q27 A;  1QKA A;  4OEN A;  3SES A;  1IXC A;  2UVI A;  4G77 A;  1P99 A;  3GXA A;  3RT8 A;  5H8N A;  1ZU0 A;  1RYO A;  2NUV A;  2OZZ A;  3T9H B;  4H1X A;  4GOT A;  3MQ9 A;  3SEV A;  3TQL A;  1P1O A;  4F18 A;  1PB7 A;  5H8F A;  1B0L A;  1UQW A;  4YAH X;  1B6H A;  3MP8 A;  1LBC A;  1QUJ A;  1B58 A;  3MVX A;  5AA2 A;  3C31 A;  2XXW A;  4ESX A;  5HBC A;  2VD2 A;  4KR5 A;  4HW8 A;  1MQJ A;  3VXC A;  1ZJL A;  1MY4 A;  5DTB A;  1B5H A;  1I6Q A;  1O7T A;  1NH7 A;  4GFR A;  4LP2 B;  3T9X B;  3KFM A;  1EU8 A;  4R75 A;  4BDQ A;  4QFL A;  3CFL A;  4LUB A;  4G8N A;  3SEX A;  4KHZ E;  1P1W A;  3PMW A;  2Q88 A;  5I57 A;  1MXZ A;  2H5Y A;  2RCA A;  3R26 A;  2F97 A;  1H44 A;  1RKM A;  2OBG A;  2X7P A;  1LB9 A;  4JSD A;  3MVW A;  4H5F A;  1WDN A;  2P2A A;  2O7I A;  1GTK A;  2PT1 A;  2X26 A;  2XXT A;  5AA3 A;  4HS7 A;  3QUF A;  1FW0 A;  3IOW A;  4ECF A;  2Q2A A;  1B1H A;  4XIG Q;  3TTM A;  3MPK A;  1RYX A;  3C4M A;  2ANJ A;  1D3K A;  3MC2 A;  4HCW A;  5L9M A;  3G3H A;  1JVY A;  3B6Q A;  3IOR A;  1B4Z A;  4ESW A;  1B40 A;  5TPA A;  5CMM A;  3SER A;  4DE8 A;  4QRZ A;  1FQA A;  5FTH A;  5I58 A;  1R9L A;  1NNF A;  5CRY A;  3B6W A;  1PBQ A;  2ZMB A;  5AA2 D;  1B3G A;  1UTB B;  2Q2C A;  2VD3 A;  2THI A;  1A7L A;  5A5X A;  4OEV A;  3FVG A;  2ZYK A;  1QUL A;  3KN7 A;  1LFH A;  1SDX A;  4DLD A;  2VGQ A;  1OIB A;  2F36 A;  3PV0 E;  4Q30 B;  4ZEI A;  3PPR A;  4GLI A;  5F7V A;  1D4N A;  4RYA A;  4ZZE A;  2OCU A;  4PFY A;  5FHM A;  3A3U A;  2HCA A;  5KZT A;  4E0W A;  2HZL A;  4F2O A;  1A54 A;  4I62 A;  1B4H A;  3MBP A;  1DTZ A;  1SI1 A;  2G29 A;  1TFA A;  3U92 A;  3WAF A;  4ZE9 A;  1F9B A;  1I6A A;  3S9M C;  4X1D A;  2Q9T A;  4U4S A;  2F78 A;  3S2V A;  3R7X A;  1B52 A;  3UIF A;  1UTB A;  1O64 A;  1WVJ A;  4FEC A;  5CBS A;  3TUS A;  4YIC A;  2V25 A;  3PD8 A;  1LFI A;  4EQ9 A;  4ELO A;  2DSF A;  5ELV A;  2DS9 A;  1AH5 A;  2OWT A;  1OQH A;  5CBR A;  1MY2 A;  4RPO A;  1N76 A;  2HFB A;  3PPP A;  4YB5 A;  2R71 A;  3U8Q A;  1OLC A;  2DVC A;  1PB8 A;  4F29 A;  1FQD A;  1ZKB A;  4NMY A;  2QL3 A;  3FJG A;  2PMS A;  1B1X A;  2V3U A;  1UTH B;  2RC7 A;  2QS3 A;  4PFT A;  2Y7P A;  3T96 B;  3KOS A;  3CVG A;  4OMB A;  3USD A;  3KSJ A;  2XX7 A;  5KDT A;  2V93 A;  2O7U A;  4H0W A;  1MQD A;  4JBZ A;  4U23 A;  4GVO A;  3IJO B;  3K4U A;  4NF4 B;  3CFX A;  3CSB A;  1LCT A;  3OOA A;  3E3K A;  4KFQ A;  2V84 A;  4L17 A;  2F6P A;  3PPO A;  2I0C A;  4F31 B;  3N5L A;  2O1L A;  4IB2 A;  1Q35 A;  4R9F A;  1HSE A;  5FTI A;  3UA8 A;  1TWY A;  2XXU A;  4QFN A;  3BFT A;  1JW5 A;  5B7D A;  2XX8 A;  4YMA A;  3HV1 A;  4M1V A;  5I56 A;  1MPD A;  3H6W A;  3TCG A;  4OWD A;  4BDN A;  4R9G A;  3G3I A;  5H8Q B;  1PBP A;  1MQG A;  4MH5 A;  3CI8 A;  2V3Q A;  1SYH A;  4KYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...