2UVGA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
403
structure length
401
Chain Sequence
VNLRMSWWGGNGRHEVTLKALEEFHKEHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGQVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWNGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVELGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Sugar binding protein
total genus 147
structure length 401
sequence length 403
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvgA02
4JB7A 5L9MA 5ISUA 3ZSFA 2R9JA 2AL5A 1MG1A 4NF6B 5KDTA 3S9NC 3IOVA 5I2KB 2UVIA 3MZ1A 1POTA 2RINA 2RF1A 2Z23A 4FECA 4LATA 4GXAA 3KFMA 3KSXA 3H3GA 2FNCA 3LSFB 1HSLA 4GF8A 2XXQA 4I8CA 4IO5A 3K02A 5I59A 3UGWA 2QPQA 4C1UA 2F6GA 1UTBA 2KLFA 2OJTA 1GGGA 1LSTA 3ZKKA 4NF5B 1P1UA 3M8UA 2I3WA 2XXTA 4F2QA 3EN3A 3QIMA 3RLFE 5H8HA 2DXRA 4LVQA 1NL5A 3GBAA 2QS3A 2O7UA 1A7LA 1B7UA 1PDAA 4OETA 2QS4A 5L8DA 4KYDA 4TQUQ 3TTNA 5TU0A 5FHMA 1M5DA 2I4CA 2DVZA 4GWOA 1NNPA 3PGFA 4H8JA 4YKPA 1B2HA 4GD5A 3EHTA 4Z0IA 3VLWA 4I62A 4F18A 2F7BA 1SQYA 4PQJA 1VFDA 3MP1A 3MZ9A 2I58A 5B70A 2YPNA 4AB5A 5F7VA 2I0BA 4EXLA 4N6PA 4O3BA 1OVTA 4FAJA 2ZNSA 2P2AA 2GRVA 3IL1B 4HCWA 3HPIA 3TYHA 2F35A 3TQLA 1P99A 4ZZAA 3M3LA 3ODBA 3U93A 1LB8A 4EQ7A 2NXOA 4BDMA 3PD9A 3K1MA 2HFBA 3H06B 1LFHA 3IB0A 5ITPA 4I1DA 1P1WA 4ELRA 2PT1A 5M2VA 4KCDA 4U23A 1ATGA 3SETA 2O7IA 4ZEBA 1PBPA 4QSEA 2A5SA 2VGQA 3FV2A 3S9MC 1H3DA 5AA2B 2F8DA 3VE1B 3IO4A 1CE2A 2ONSA 4X1BA 3MWBA 4H6DA 4OHNA 3ILUB 4KR5A 2DE3A 1MY4A 2Z8DA 4WEPA 4TLLB 5AA2D 4F22A 4TOZA 3RN8A 3Q28A 1BIYA 3PPPA 2X7PA 3T9XB 3KN8A 4YKIA 3MZBA 3H6WA 5I58A 2B3BA 2B3FA 3FJGA 2P1SA 4HCYA 4YU0A 3GZGA 1NMUA 2OZZA 1TT1A 1LGBC 1FTLA 1ZJLA 3IR1A 4BDRA 3TTRA 3KN3A 5I2NB 3VXBA 3SEUA 3OO7A 3ILTB 3FUZA 2V84A 2F97A 3PV0E 3MPLA 4RPNA 4AQ4A 1DPEA 3KN7A 5I2KA 1MQDA 1AL3A 3FVGA 3TFLA 5FTIA 4GL0A 3QK6A 5BUUA 4JSOA 3K6VA 2XXXA 3OXNA 3G3HA 1B7HA 2HEUA 3R7XA 4KD5A 1EZ9A 3U92A 3IJXB 1J1NA 3OSRA 4E0XA 1I69A 3O2AA 4YKJA 3HN0A 4OERA 1ELJA 2Q2CA 5AA4A 4GXSB 3USDA 3IOWA 1B1HA 4FJPA 2UVGA 4IY6A 1IXCA 2Z8FA 2FYIA 3E9XA 2XHDA 4R9FA 4NMYA 3IOUA 4LA9A 3DM0A 3U94A 4OESA 3MW0A 1JEUA 3FV1A 4R73A 2XD2A 3P7IA 3BFUA 4QF9A 3TEPA 2H25A 4IGTA 1MDQA 2B65A 2H99A 3TELA 5ICQA 4ELPA 1M5EA 2OCUA 1B0HA 2QMWA 4GOTA 3O28A 3PPOA 3LSLA 3V89B 4QFNA 1S50A 4WXJA 5ICTA 5I84A 4IO6A 4Q30B 3H6VA 1PEBA 1LBCA 1ZBMA 1Y9UA 1Q35A 1Y4TA 3VVEA 1DMBA 3DP6A 4JWOA 2ZMBA 1B46A 3ZKLA 3RNNA 2BJJX 1GV8A 1XS5A 4R6KA 1MQIA 2HQ0A 2AL4A 1LAFE 4Q8RA 3PU5A 4ELOA 3MVXA 1AOVA 1QKAA 2GH9A 4OTEA 1SW2A 1Y3NA 2QRYA 3OD7A 2O51A 4GRKA 3FVOA 4OFJA 1BP5A 3EF7A 2VHAA 4F3SA 4G4PA 1A8FA 3OEKA 1SW4A 2V25A 3KOSA 4LZ5A 1ZLQA 2Q89A 4FEDA 1R6ZA 3UIFA 4LZ7A 2Y7RA 5A5XA 1URGA 4H1XA 3LUYA 4OFOA 4F29A 3PD8A 4MF3A 3H7MA 3WAEA 1NNKA 3LR1A 2DWJA 2I48A 3MQ9A 3N6UA 1Q1KA 5CBRA 2D3IA 3RTFB 3O6IA 4KYEA 5H8FB 2F78A 3QAXA 5AA2A 1L5TA 5CC2A 3RUMA 1XVXA 2P0SA 1WODA 3PUWE 3G3IA 4RXLA 1JW1A 5H8QA 4BDLA 3FVKA 1USYE 4WKMA 3C31A 3Q25A 1A54A 2UXAA 3RTWB 1MY1A 4R75A 1IEJA 3K6WA 4ND9A 1QVSA 3RY3A 4L17A 2X7QA 2XXRA 5CMKA 4EQBA 2ZYNA 1VE4A 3IO6A 4LQ5A 1N7WA 2Q2AA 4G2ZA 1MM6A 4R2FA 1XHYA 2I4BA 2ESNA 4ZZEA 1JEVA 1SI0A 2O6AA 5I2NA 4O3CA 4JWYA 5J1DA 3MVWA 2OLBA 3CFXA 2DS9A 5ITOA 5L9SA 4F1UA 3OO9A 4RK2A 4GL8A 3I5OA 2YLNA 2CMOA 2HCAA 4XXUA 3ONMA 3HV1A 3FXUA 3AXFA 3G7WA 1OMPA 3BFTA 3G3GA 3VDFA 3A3CA 4IO4A 3S9LC 3O6HA 5CI5A 4DZ1A 5IAIA 3SEWA 1IXIA 5H8NB 3K1NA 3RT8A 3TDJA 3K2DA 2PYYA 3FGSA 2D21A 4EF2A 4GQOA 2UYEA 1OQHA 2ANJA 2UYFA 4EDPA 4ZEDA 1O64A 1GTKA 1Y1ZA 2H9BA 4M4GA 4NF8A 2XXHA 2ZNUA 1D9VA 3SDFA 3VFJA 5B7DA 1MRPA 1QKBA 2LAOA 5AA3A 1PB7A 5TPAB 4H5FA 1TXFA 3QSLA 2E0SA 4ELQA 4UA8A 1B4HA 1B3LA 3K01A 1RYOA 4POWA 4C1TA 4R9GA 4EXKA 4G8HA 5FHNA 1MDP1 3SEYA 2AYSA 3RQTA 1MXWA 3TUSA 5I56B 4YAHX 3KBRA 3C32A 5I57B 1MH3A 3QUJA 1OLAA 5TP9B 1MXVA 1H45A 1URSA 3THIA 2ALUA 5DVIA 3I3VA 1PC3A 1Y1MA 4R6HA 4XIGQ 1SD3A 3W9WA 3TTKA 4HS7A 3V8XB 3CVGA 4KQPA 3T96B 3CG1A 2UVJA 4QFKA 4RPOA 4QFPA 4C0RA 4F1VA 1VSOA 3KZGA 1N0TA 4EQ9A 1IIWA 3O66A 5DT6A 5KCJA 2VD3A 4F31B 1N3XA 2Y7KA 1LFGA 3OELA 3UORA 5DTBA 1OIBA 1H44A 2F6PA 4ECFA 3TPAA 4FIMA 5KZTA 2Y7IA 2DVCA 2H5YA 3PUXE 1JQFA 3CIJA 1WDNA 2QSXA 3HHGA 4U21A 4HW8A 2O69A 3RT6B 4BDQA 3UP9A 3UK4A 3M3FA 2M8CA 1D9YA 3EQ1A 4UACA 4JBZA 1OQGA 3CSBA 3W15C 3C9HA 5AA1A 4NF4B 1IZ1A 4R74A 1EH3A 3SERA 3MC2A 1IXGA 1HSJA 4DLDA 5JTYB 2O68A 5DEXA 4DCYA 2FA7A 4RNSA 2Q8JA 4ZDMA 1ANFA 1R9QA 4F19A 3MAMA 3K0VA 2YJPA 3TMGA 2I49A 1IXHA 3MJNA 4PFYA 2F7AA 1B3HA 4ESXA 2W7YA 2QMXA 4XTCQ 3H03A 2I0CA 3PMWA 4NF6A 1P1OA 3IB2A 3U1OA 2H98A 1GR2A 2QS2A 3LSWA 4OFLA 1R9LA 3Q27A 1US4A 1FQDA 4XKNA 4ZE9A 3HSTA 3PUZE 2O1LA 1IQ7A 3EHSA 1I6BA 3CG3A 2QJEA 3ZS6A 3A3UA 2G29A 3T93B 1FW0A 1N7XA 4YB5A 4RYAA 1ZMGA 1FTKA 3FZVA 4NF5A 4JXIA 1N3WA 3E4RA 4ZEFA 1JNFA 4U1ZA 1LAGE 4ZS9A 2NWJA 1SYIA 2RCBA 3W9VA 1AIVA 1XT8A 3JYRA 5H8HB 4MFIA 3CFLA 3RGYA 2HZKA 3WAFA 1S9TA 1USYH 2E1SA 2XX8A 4G68B 5TPAA 4FEBA 1B3EA 3QXMA 1JW4A 3KOTA 4DXCA 1MY0A 1DPPA 3N6TA 2DE4A 1DTGA 4JDFA 4XKQA 5BWJA 2RC9A 4GVOA 4OWDA 2HAUA 4OEUA 1MXUA 2ZYMA 3EPEA 1A8EA 4QFOA 4R6YA 1MPCA 1JW5A 1A55A 3S2VA 3SKPA 3T22A 3O97A 5DVFA 2F5XA 4G68C 4DXBA 5TP9A 1F9BA 4U2RA 3U8QA 2Q9TA 1MQJA 2DYXA 1MS7A 4G77A 1IUDA 4QFLA 2GFEA 4NEDA 1WVJA 3T9HB 1XOCA 2CZLA 4I9DA 3IOTA 4PFTA 3N5LA 4E0WA 3FXRA 2THIA 4X9TA 1NKXA 3CI8A 1QULA 4IO7A 4R2BA 3KSJA 1LAHE 3B6WA 4HTGA 1B9JA 4EF1A 4F39A 1B3GA 4GFRA 4IGRA 2X26A 4KHZE 4U4SA 2Q88A 2ONKE 4JSDA 2GHBA 3SEVA 1FQEA 1FTMA 4KCCA 3E3KA 3HO7A 4RY1A 1B51A 5JK4A 5CM6A 3VLVA 1FQAA 1XVYA 3UN6A 4IY5A 2G93A 1GVCA 1B7ZA 5HBCA 4QSDA 4OEVA 1MXYA 2AIXA 1I6AA 4AB6A 4LUBA 1NNFA 3U72A 1S7YA 2NOOA 3TZAA 2UVHA 4N07A 4GLIA 1B05A 1BLFA 1PBQA 4NF4A 4F1YA 1JETA 3TCHA 3MPKA 1FQBA 3N94A 2REJA 1EZOA 3PPQA 5I58B 1M5BA 2NUVA 2XXYA 4Z7EA 4MLQA 1DSNA 5HM4B 4BDNA 1FTJA 1MY2A 4U4XA 5CMMA 4LZ8A 1B5IA 4MBPA 4ZEIA 1OVBA 2PBWA 3H4ZA 3G3JA 3B6TA 4YMAA 4OXVA 3PPNA 1M5CA 3PUVE 4IO3A 2V93A 3QUFA 1P1NA 5CBSA 4Q5TA 1QUJA 3TKDA 3F11A 1N76A 1ZTYA 2NVUB 3OSQA 2PMSA 1BTJA 4THIA 4U22A 1QJMA 4RJZA 3PPRA 1O63A 4G8NA 2DQVA 1EU8A 1TFDA 3D4GA 2HAVA 4DE8A 1TWYA 3VLUA 2XD3A 2XX9A 3TCFA 1B40A 2RCAA 1DTZA 5HPQA 4QSCA 5AA4B 3SEXA 3UA8A 5CMBA 1A99A 3QYTA 4LQ2A 4MH5A 1EZPA 2OK2A 4Q0CA 2DXYA 3B7DA 1SW1A 3I6VA 1OLCA 3LBSA 4KI0E 3HCQA 3TTLA 2ZXTA 1Z7NE 2DWAA 1LB9A 3JZJA 1A40A 3R26A 1UTHB 3K1PA 3MVZA 2RC8A 3FXQA 4G68A 1JVYA 3VV5A 5IKBA 2PT2A 4IO2A 1MPDA 2VP1A 4QRZA 2XXUA 4ESWA 1P1QA 1PB9A 4H0WA 3KJTA 1LBBA 1Y3QA 3Q26A 3VXCA 4ONYA 2ZNTA 2O84X 3SESA 1NH8A 5JEIA 4YICA 1Y3PA 3MUQA 4DCXA 5EHSA 1H76A 5LOMA 3E13X 3MBPA 4N13A 4FORA 4ZEKA 1ZKBA 1B0LA 3IB1A 2DOJA 1LLSA 3BBRA 2XX7A 3DLNA 3G3FA 5CMCA 3CFZA 2OWTA 2PVUA 2A5TB 4H65A 1SW5A 3B6QA 4F3PA 4WEDA 3FIRA 1N04A 4F2OA 4OZ9A 3KGCA 3L6HA 4EUOA 4FE8A 4PP0A 3JV9A 3K6XA 4YKKA 3V5AA 3IX1A 4QHQA 1M5FA 1FTOA 1LCTA 2IEEA 3O29A 3CR9A 3OENA 5A5XB 3C4MA 2XXWA 4KYSA 1UQWA 2Z22A 3VVFA 2Y7PA 3CRBA 4POXA 2RC7A 5H8FA 1B5HA 3DP4A 1QUKA 2OWSA 3FJMA 3EHUA 3VVDA 3TAJA 2O1MA 3FJ7A 5F1QA 2XXPA 4K3FA 1FQCA 4KFQA 3MP6A 3OO8A 4OENA 2IA4A 4XKPA 3TCGA 3C36A 5H8QB 4ZECA 2ABHA 1B4ZA 3FATA 4R72A 5L9OA 1SYHA 1Y4CA 4NWCA 1AMFA 2VD2A 5EHMA 1YTVA 4YMBA 5FTHA 3GBBA 3IJOB 1B1XA 1B52A 1VR5A 3OOAA 3IK6B 2D5WA 4ISUA 4DIGA 3TTMA 4XKRA 1UIVA 3GXAA 3T66A 3L6GA 2F34A 3IAZA 2V3UA 3Q29A 1MY3A 3PMVA 4KPTA 2REGA 3G3KA 5KDTB 2DWIA 4NWDA 1KWHA 3OO6A 1N84A 3KJ7A 3HHFA 3FVNA 2XXIA 3BKIB 1SI1A 4PETA 1D4NA 1CB6A 1II5A 3D4CA 5H8NA 5EYFA 4H67A 1Y20A 2PX1A 4RA1A 5FHOA 5DVJA 4YB7A 4ZE8A 1B6HA 4IB2A 3OEMA 3PMXA 4MLVA 1AH5A 5I59B 3A09A 3N26A 1B32A 4OMBA 1O7TA 5DYHA 1UTBB 2DSFA 4JWXA 1RYXA 1NH7A 1SVXB 1MXXA 1US5A 2I3VA 5K2YA 3K6UA 1HSEA 4H8IA 1FCKA 1POY1 4NF8B 1XC1A 2DE2A 5ELVA 2RKMA 3ECRA 3T9VA 3TQWA 4BLAA 1UTHA 3R6UA 4G8MA 2HXWA 4TLMB 1YPNA 1UIUA 4BDOA 1IITA 2R6GE 4NTLA 4YB6A 1SDXA 5I56A 1MPBA 3O6GA 5I57A 1MQHA 1SBPA 1VFEA 1DOTA 4DDDA 1NFTA 4PE5B 1Z7ME 1I6QA 2VOZA 2Y84A 1LAXA 4PFUA 3KEIA 4X1DA 1NNTA 2V3TA 4PFWA 5AE4A 3MVYA 4M1VA 3DELB 2ZYKA 1BKAA 5H8SA 4FATA 2A5TA 2Z8EA 3RPWA 3LSXA 1RKMA 2DWHA 4GIZA 5KCJB 4U1OA 2V3QA 4LONB 2HZLA 3MP8A 4OYVA 2DP8A 3S4UA 2XXVA 4RK9A 3IORA 3C34A 1D3KA 1MXZA 3LC8A 1QW0A 1QUIA 1B3FA 3TODA 3DP8A 4P11A 1URDA 2OBGA 3K00A 5CRYA 2Y7WA 3T9UA 3H6TA 2ZYOA 4P0IA 3V83A 1B58A 4P0GA 1MH4A 4YZZA 1PB8A 3KG2A 3C35A 1ZIUA 3S9EA 2F7CA 3CSGA 4OVJA 2ONRA 1YAEA 2I6EA 4OQOA 3GLBA 5K2XA 4F3BA 3FD3A 1MM7A 2H4IA 1T0KA 3K4UA 4NE4A 1B5JA 2R71A 4H5GA 1TFAA 2GHAA 3M3KA 4X48A 3FASA 4DXUA 3O9PA 5JTYA 3H6UA 4LP2B 3C33A 1YCJA 1MQGA 1LFIA 1LCFA 1JVXA 2QL3A 5DEXB 4O3AA 1R1NA 1ZU0A 2QS1A 1FQFA 2WKYA 1H43A 4F3GA 2F36A 3PUYE 3OMBA
chains in the Genus database with same CATH superfamily
4JB7A 5L9MA 5ISUA 3ZSFA 2R9JA 2AL5A 1MG1A 4NF6B 5KDTA 3S9NC 3IOVA 5I2KB 2UVIA 3MZ1A 1POTA 2RINA 2RF1A 2Z23A 4FECA 4LATA 4DI3D 4GXAA 3KFMA 3KSXA 3H3GA 2FNCA 3LSFB 1HSLA 1RDZA 4GF8A 2XXQA 4I8CA 4IO5A 3K02A 5I59A 3UGWA 2QPQA 4C1UA 1RDYA 2F6GA 1UTBA 2KLFA 2OJTA 1GGGA 1LSTA 4PAFA 3ZKKA 4NF5B 4LN5A 1P1UA 3M8UA 2I3WA 2XXTA 4F2QA 3EN3A 3QIMA 3RLFE 5IZ1A 5H8HA 4I40A 2DXRA 4LVQA 3BIGA 1NL5A 3GBAA 2GQ1A 2QS3A 2O7UA 1A7LA 1FPLA 1B7UA 1PDAA 4OETA 2QS4A 5L8DA 1FPDA 4KYDA 4TQUQ 2KR0A 3TTNA 5TU0A 5FHMA 1M5DA 1FPJA 2I4CA 2DVZA 4GWOA 1NNPA 3PGFA 1LBYA 4H8JA 4YKPA 1B2HA 4GD5A 1EYKA 3EHTA 4Z0IA 3VLWA 4OA4A 4I62A 4F18A 2F7BA 1SQYA 1FPBA 4PQJA 5J16A 1VFDA 3MP1A 3MZ9A 2I58A 5B70A 2YPNA 4AB5A 2CEYA 5F7VA 2I0BA 4JVCA 4EXLA 4N6PA 2PFZA 4O3BA 3LV0A 1OVTA 5EYHA 2ZNSA 4FAJA 2P2AA 4KXPA 2GRVA 3IL1B 4HCWA 3HPIA 3TYHA 2F35A 3TQLA 1P99A 4MNIA 3M3LA 3ODBA 4ZZAA 3U93A 1LB8A 1FJ6A 2NXOA 4BDMA 3PD9A 4EQ7A 3K1MA 1IMDA 2HFBA 3H06B 1LFHA 3IB0A 5ITPA 4I1DA 1P1WA 4ELRA 4MNPA 2PT1A 5M2VA 4NX1A 4MAGA 4KCDA 4U23A 1ATGA 3SETA 2O7IA 4ZEBA 2FIEA 1PBPA 4HE0A 4QSEA 2A5SA 2VGQA 3FV2A 3S9MC 1H3DA 1XI6A 5AA2B 2F8DA 3VE1B 3IO4A 1CE2A 2ONSA 4X1BA 3MWBA 4H6DA 4OHNA 2WYKA 3ILUB 4KR5A 2DE3A 1MY4A 2Z8DA 3ROJA 4N8YA 4WEPA 2XA5A 4TLLB 5AA2D 4F22A 4TOZA 3RN8A 1AWBA 1G0HA 3Q28A 1BIYA 3PPPA 1EYIA 2X7PA 3KN8A 3T9XB 4YKIA 3MZBA 3H6WA 5I58A 2B3BA 3U65A 4O7IA 2B3FA 3FJGA 2P1SA 4HCYA 4YU0A 3GZGA 1NMUA 2OZZA 1TT1A 1LGBC 1FTLA 1ZJLA 4N91A 3IR1A 4BDRA 3TTRA 2F3DA 3KN3A 5I2NB 3VXBA 3SEUA 3OO7A 3ILTB 2QVUA 3FUZA 2V84A 2F97A 3PV0E 3MPLA 4RPNA 4AQ4A 1DPEA 3KBZA 2ZZWA 3KN7A 5I2KA 1MQDA 1AL3A 2PFYA 2OX3A 3FVGA 3TFLA 5FTIA 4GL0A 3QK6A 5BUUA 4JSOA 3K6VA 2XXXA 3OXNA 3G3HA 1B7HA 2HEUA 1FPIA 3R7XA 4KD5A 1EZ9A 3U92A 3IJXB 1J1NA 3OSRA 3O2AA 1I69A 4E0XA 4MHFA 2R8TA 4YKJA 3HN0A 1FBPA 4OERA 1ELJA 2Q2CA 5AA4A 4GXSB 3USDA 3IOWA 1B1HA 4FJPA 2UVGA 4IY6A 1IXCA 2Z8FA 2FYIA 3E9XA 2XHDA 4R9FA 2CEXA 4NMYA 3IOUA 4LA9A 3DM0A 4MX6A 3U94A 4OESA 3MW0A 1JEUA 5ET5A 3FV1A 4R73A 2XD2A 3P7IA 4H46A 3BFUA 4QF9A 3TEPA 2H25A 4IGTA 1MDQA 2B65A 2H99A 4G61A 3TELA 5ICQA 4ELPA 1M5EA 2OCUA 1B0HA 2QMWA 4GOTA 3O28A 3PPOA 3LSLA 3V89B 4QFNA 3NOHA 1KA0A 1S50A 2OWZA 4WXJA 5ICTA 5I84A 4IO6A 4Q30B 3H6VA 1PEBA 1NV2A 1LBCA 1ZBMA 1Y9UA 1Q35A 1Y4TA 5IGAA 1FBCA 3VVEA 1DMBA 3DP6A 4JWOA 2ZMBA 1B46A 3ZKLA 3RNNA 2BJJX 1GV8A 1XS5A 4R6KA 1MQIA 2HQ0A 2AL4A 1LAFE 3PU5A 4Q8RA 4ELOA 3MVXA 1AOVA 1SPIA 1KA1A 1QKAA 1FTAA 2GH9A 4OTEA 1SW2A 1Y3NA 2QRYA 5LDZA 3OD7A 2O51A 1DBZA 4GRKA 3FVOA 4OFJA 1BP5A 3EF7A 2VHAA 4O8MA 4F3SA 4G4PA 1FBEA 5T3JA 1A8FA 3OEKA 1SW4A 2V25A 3KOSA 4LZ5A 1ZLQA 1NV3A 2Q89A 4FEDA 1R6ZA 3UIFA 4LZ7A 2Y7RA 4P3LA 5A5XA 1URGA 4H1XA 3LUYA 4OFOA 4F29A 3PD8A 4MF3A 3H7MA 3WAEA 1NNKA 3LR1A 2DWJA 2I48A 3MQ9A 3N6UA 1Q1KA 5CBRA 2D3IA 3RTFB 3O6IA 4KYEA 5H8FB 2F78A 4N17A 3QAXA 5AA2A 1L5TA 3RPLB 5CC2A 1NUZA 3RUMA 1XVXA 2P0SA 1WODA 1JP4A 3PUWE 3G3IA 4RXLA 1JW1A 5H8QA 4BDLA 3FVKA 2VT5A 1USYE 4WKMA 3C31A 3Q25A 2DDKA 1A54A 2UXAA 3RTWB 2FVZA 1MY1A 4R75A 1IEJA 4HE2A 3K6WA 4GWUA 4ND9A 1QVSA 5DW8A 3RY3A 4L17A 2X7QA 2XXRA 5CMKA 4P9KA 4EQBA 1RDXA 2ZYNA 1VE4A 3IO6A 4LQ5A 4PCDA 1N7WA 2Q2AA 4G2ZA 1MM6A 4R2FA 2FIXA 3CHGA 4HXVA 1XHYA 2I4BA 2ESNA 4ZZEA 1JEVA 1SI0A 2O6AA 2QVVA 5I2NA 4O3CA 4JWYA 5J1DA 3MVWA 2WX9A 2OLBA 3CFXA 2DS9A 5ITOA 5L9SA 4F1UA 3OO9A 4RK2A 4GL8A 3I5OA 2YLNA 2CMOA 2HCAA 4XXUA 3ONMA 3HV1A 3FXUA 3AXFA 3G7WA 1OMPA 3BFTA 3G3GA 4PF8A 3VDFA 3A3CA 4IO4A 3S9LC 3O6HA 5CI5A 4DZ1A 5IAIA 3SEWA 1IXIA 5H8NB 3K1NA 3RT8A 3TDJA 3K2DA 5IZZA 2PYYA 3FGSA 2D21A 4EF2A 4GQOA 1NUXA 2UYEA 1OQHA 2ANJA 2UYFA 4EDPA 4ZEDA 2QFLA 4PC9A 2QVRA 1O64A 1GTKA 1Y1ZA 2H9BA 4M4GA 4NF8A 5I7IA 3E78A 2XXHA 2ZNUA 1D9VA 3SDFA 3VFJA 5B7DA 1MRPA 1QKBA 2LAOA 5AA3A 1PB7A 5TPAB 4H5FA 1TXFA 3QSLA 2E0SA 4ELQA 4UA8A 4N6DA 1B4HA 1B3LA 3HFUA 3K01A 1RYOA 4POWA 1NV5A 4C1TA 2F3BA 4R9GA 4I3EA 4EXKA 4G8HA 5FHNA 1MDP1 3SEYA 2AYSA 3RQTA 1MXWA 3TUSA 5I56B 4YAHX 1FBHA 3KBRA 3C32A 5I57B 1MH3A 3QUJA 1OLAA 5TP9B 1KZ8A 1MXVA 1H45A 1URSA 2ALUA 3THIA 5DVIA 3I3VA 1PC3A 1Y1MA 4MNCA 4R6HA 4XIGQ 1SD3A 3W9WA 5IZ3A 3TTKA 4HS7A 3V8XB 3CVGA 4KQPA 3T96B 3CG1A 4N8GA 2UVJA 4QFKA 4RPOA 4P47A 4QFPA 4C0RA 4F1VA 1VSOA 3KZGA 1N0TA 4MJOA 4EQ9A 1IIWA 3O66A 2XWOA 5DT6A 5KCJA 2VD3A 4F31B 1N3XA 2Y7KA 1CNQA 1LFGA 3OELA 4P8BA 3UORA 5DTBA 1OIBA 4OANA 4O94A 1H44A 2Q8MA 2F6PA 4HE1A 4PDDA 3IFAA 4ECFA 3TPAA 4FIMA 5KZTA 2Y7IA 2DVCA 2H5YA 3PUXE 4FBPA 1JQFA 2CZHA 3CIJA 1WDNA 2QSXA 2Y5KA 3HHGA 4U21A 4HW8A 2O69A 3RT6B 4BDQA 3UP9A 3UK4A 3M3FA 2M8CA 1D9YA 3B8BA 3EQ1A 4UACA 1YYZA 4JBZA 1OQGA 3CSBA 4OVSA 3W15C 4I3YA 3C9HA 5AA1A 4NF4B 1IZ1A 4OVPA 4R74A 1EH3A 3SERA 3MC2A 1IXGA 1HSJA 4DLDA 5JTYB 2O68A 1FSAA 4N6KA 5DEXA 4DCYA 2FA7A 4RNSA 2Q8JA 4ZDMA 3IFCA 1ANFA 1R9QA 1VDWA 4F19A 3MAMA 3K0VA 2YJPA 3TMGA 2I49A 1IXHA 3MJNA 4PFYA 2F7AA 1B3HA 4ESXA 5A5LA 2W7YA 4XFEA 4N4UA 4DI4B 2QMXA 4XEQA 4XTCQ 3H03A 2I0CA 3PMWA 4NF6A 1P1OA 3IB2A 3U1OA 2H98A 1QGXA 1GR2A 2QS2A 3LSWA 4OFLA 1R9LA 3Q27A 1US4A 1FQDA 4XKNA 4ZE9A 4PFBA 5LTCA 3HSTA 3PUZE 2O1LA 1IQ7A 3EHSA 1I6BA 4GWZA 2FHYA 3CG3A 2QJEA 3ZS6A 1LEVA 3A3UA 2G29A 3T93B 1K9ZA 1FW0A 1N7XA 4YB5A 4RYAA 2JJKA 2ZZVA 1ZMGA 1FTKA 3FZVA 4NF5A 3GYYA 4JXIA 1N3WA 3E4RA 4NHBA 4OVQA 4ZEFA 1JNFA 4U1ZA 1FBDA 1LAGE 4GX3A 4ZS9A 2NWJA 1SYIA 2RCBA 4N15A 3W9VA 1AIVA 1XT8A 3JYRA 5H8HB 4MFIA 3CFLA 1LBWA 3RGYA 2HZKA 3WAFA 1FJ9A 1S9TA 1USYH 2E1SA 2XX8A 1IMFA 4G68B 5TPAA 4FEBA 1B3EA 3QXMA 3KC0A 1JW4A 3KOTA 4DXCA 1MY0A 1DPPA 3N6TA 4NN3A 2DE4A 1DTGA 4PGNA 3FXBA 4JDFA 4XKQA 5BWJA 2RC9A 4GVOA 4OWDA 2HAUA 4OEUA 1MXUA 2ZYMA 3EPEA 1A8EA 4QFOA 4R6YA 1MPCA 1JW5A 1A55A 3E79A 3S2VA 3SKPA 3T22A 3O97A 5DVFA 2F5XA 4G68C 5EQ8A 4DXBA 5TP9A 1F9BA 1IMBA 4U2RA 3U8QA 2Q9TA 3D1RA 1MQJA 2DYXA 2P3NA 4PF6A 2WEFA 1MS7A 5I5PA 4G77A 2WBBA 1IUDA 4QFLA 2GFEA 4NEDA 1WVJA 3T9HB 1XOCA 2HHMA 2CZLA 4I9DA 3IOTA 4PFTA 3N5LA 4E0WA 3FXRA 2THIA 4X9TA 1NKXA 3CI8A 1QULA 4IO7A 2WBDA 4P1EA 4R2BA 1IMCA 3KSJA 5EQAA 4GBVA 1LAHE 2CZIA 1NI9A 3B6WA 4HTGA 1B9JA 4EF1A 4PFRA 4F39A 1B3GA 4GFRA 4IGRA 2X26A 5I3SA 4KHZE 4U4SA 2Q88A 2ONKE 4JSDA 2GHBA 3SEVA 2XXKA 1FQEA 1FTMA 4KCCA 3E3KA 3HO7A 4RY1A 1B51A 5JK4A 5CM6A 3VLVA 4GX6A 1FQAA 1XVYA 3UN6A 4IY5A 1BK4A 2G93A 1GVCA 1B7ZA 5HBCA 4QSDA 4OEVA 1MXYA 2AIXA 1I6AA 4AB6A 4LUBA 4GBWA 4MCOA 4JVDA 1NNFA 3U72A 1S7YA 1LBXA 2NOOA 3TZAA 3B50A 1NUYA 2UVHA 4N07A 4GLIA 1B05A 2HPGA 1BLFA 2Y5LA 3PTYA 1PBQA 4NF4A 4F1YA 1JETA 3TCHA 3MPKA 1FQBA 2B4MA 2XWIA 1IMAA 3N94A 4NQ8A 2REJA 1EZOA 3PPQA 5I58B 1M5BA 2NUVA 2XXYA 1NV1A 4Z7EA 4X8RA 4MLQA 1G0IA 1DSNA 5HM4B 4BDNA 4NF0A 1FTJA 1MY2A 4U4XA 5CMMA 4LZ8A 1B5IA 4MBPA 3ISPA 4MIJA 4ZEIA 1OVBA 2PBWA 3H4ZA 3G3JA 3B6TA 4YMAA 4OXVA 3PPNA 3KC1A 1M5CA 3PUVE 4IO3A 2V93A 3QUFA 1P1NA 5CBSA 4Q5TA 1QUJA 3TKDA 3F11A 1N76A 4GWSA 1ZTYA 2NVUB 3OSQA 2PMSA 1BTJA 4THIA 4U22A 3QMFA 1QJMA 4RJZA 3PPRA 1O63A 4G8NA 1FPKA 2DQVA 1EU8A 1TFDA 4QBAA 3D4GA 1YXIA 2HAVA 4DE8A 1TWYA 1FBGA 3VLUA 2XD3A 2XX9A 3RYDA 3TCFA 1B40A 2RCAA 1DTZA 5HPQA 4QSCA 5AA4B 3SEXA 3UA8A 5CMBA 1A99A 3QYTA 3MYUA 4LQ2A 4MH5A 1EZPA 2OK2A 4Q0CA 4PBHA 2DXYA 3B7DA 1SW1A 3I6VA 2Q74A 1OLCA 3LBSA 4KI0E 3HCQA 3TTLA 2ZXTA 1Z7NE 2DWAA 1LB9A 3JZJA 1A40A 3R26A 4H45A 1UTHB 3K1PA 3MVZA 2RC8A 1YZ0A 3FXQA 4G68A 1JVYA 3VV5A 5IKBA 2PT2A 4PBQA 4IO2A 1MPDA 2VP1A 4QRZA 2XXUA 4ESWA 1P1QA 1PB9A 4H0WA 3A29A 3KJTA 1LBBA 1Y3QA 3Q26A 3VXCA 4JVIA 4ONYA 2ZNTA 2O84X 3SESA 2MKZA 1NH8A 5JEIA 4YICA 1Y3PA 4XF5A 3MUQA 4DCXA 5EHSA 1H76A 5LOMA 3E13X 3MBPA 4N13A 3MSTA 4FORA 4ZEKA 1ZKBA 1B0LA 3IB1A 2DOJA 1LLSA 3BBRA 4QXDA 1LBVA 1DCUA 2XX7A 2P3VA 3DLNA 3G3FA 5CMCA 3CFZA 2OWTA 2PVUA 4NAPA 2A5TB 4P1LA 4H65A 1SW5A 3B6QA 4F3PA 4WEDA 3FIRA 1N04A 4F2OA 4OZ9A 3KGCA 3L6HA 4EUOA 4FE8A 2XWVA 3JV9A 4PP0A 3K6XA 2WYPA 4YKKA 3V5AA 3IX1A 4QHQA 1M5FA 1FTOA 4UABA 1LCTA 1DK4A 1K9YA 2IEEA 3O29A 3CR9A 3OENA 5A5XB 3C4MA 2XXWA 4KYSA 1UQWA 2Z22A 3VVFA 2Y7PA 3CRBA 4POXA 5ET6A 2RC7A 5H8FA 1B5HA 3DP4A 1QUKA 1LBZA 3RPLA 2OWSA 3FJMA 3EHUA 3VVDA 3TAJA 2O1MA 3FJ7A 5F1QA 3SZPA 2XXPA 4K3FA 4NG7A 1FQCA 1EYJA 4KFQA 3MP6A 3OO8A 4OENA 2IA4A 4XKPA 3TCGA 3C36A 5H8QB 4ZECA 4OVTA 2ABHA 1B4ZA 4PTKA 3FATA 4R72A 5L9OA 1SYHA 3BIHA 4PDHA 1Y4CA 4NWCA 1AMFA 2VD2A 3FBPA 5EHMA 1YTVA 5FTHA 4YMBA 3GBBA 3IJOB 1B1XA 1B52A 1VR5A 3OOAA 3IK6B 2D5WA 4ISUA 4PAKA 4DIGA 2VPNA 3TTMA 4XKRA 1UIVA 3GXAA 3T66A 3L6GA 2F34A 3IAZA 2V3UA 3Q29A 1MY3A 3PMVA 4GWXA 4KPTA 2REGA 4GX4A 2ZZXA 3G3KA 5ET8A 5KDTB 2PCRA 2DWIA 4NWDA 5IM2A 1KWHA 3OO6A 1N84A 3KJ7A 3HHFA 1NUWA 3FVNA 2XXIA 3BKIB 1SI1A 4PETA 1D4NA 1CB6A 2BJIA 1NV7A 1II5A 3D4CA 5H8NA 5EYFA 4H67A 1Y20A 2PX1A 4RA1A 5FHOA 5DVJA 4YB7A 4ZE8A 1B6HA 4IB2A 3OEMA 2B4LA 3PMXA 4MLVA 1AH5A 5I59B 3A09A 5EQ9A 4PAIA 4AS5A 3N26A 1B32A 4OMBA 4PGPA 1O7TA 3LUZA 5DYHA 2XWKA 1UTBB 1FPEA 2DSFA 4JWXA 1RYXA 1NH7A 1SVXB 1MXXA 1US5A 4NGUA 2I3VA 1NV6A 4PE3A 5K2YA 3K6UA 1HSEA 4H8IA 1IMEA 1FCKA 4GWWA 1POY1 4NF8B 1XC1A 1NV0A 2DE2A 5ELVA 5FBPA 2RKMA 4N81A 3ECRA 3T9VA 3TQWA 4BLAA 1UTHA 3R6UA 4G8MA 1D9QA 4AS4A 1INPA 2HXWA 4TLMB 4X04A 1YPNA 2L5VA 1UIUA 4BDOA 1IITA 4MMPA 2R6GE 4NTLA 4YB6A 1SDXA 2KQZA 5I56A 4IR8A 2HXRA 2V4CA 2VPOA 1MPBA 3O6GA 5I57A 1MQHA 1FPGA 1SBPA 1VFEA 5EQ7A 1DOTA 5ESYA 4DDDA 1NFTA 4PE5B 1Z7ME 1I6QA 2VOZA 2Y84A 1LAXA 4PFUA 3KEIA 4X1DA 1NNTA 2V3TA 4PFWA 5AE4A 3MVYA 4M1VA 3DELB 2ZYKA 5IZ3B 1BKAA 4O7MA 5H8SA 4FATA 2A5TA 3T0JA 2Z8EA 3RPWA 4GWYA 3LSXA 1RKMA 2DWHA 4GIZA 5KCJB 1FRPA 5F24A 4U1OA 2V3QA 4LONB 2HZLA 3MP8A 4OYVA 2DP8A 3S4UA 2XXVA 4RK9A 3IORA 3C34A 1D3KA 1MXZA 3LC8A 1QW0A 1QUIA 1B3FA 3TODA 1FBFA 3DP8A 4P11A 1URDA 2OBGA 3K00A 5CRYA 2Y7WA 3T9UA 4P56A 3H6TA 2ZYOA 4P0IA 3V83A 1B58A 4P0GA 1MH4A 4YZZA 1PB8A 5ET7A 3KG2A 3C35A 3EKIA 1ZIUA 3S9EA 2F7CA 3CSGA 4OVJA 2ONRA 5EYGA 2CZKA 1YAEA 2I6EA 4OQOA 3GLBA 5K2XA 4F3BA 3FD3A 1MM7A 2H4IA 4OVRA 1T0KA 3K4UA 4MEVA 4NE4A 1Q9DA 1B5JA 2R71A 4H5GA 3T1BA 1TFAA 2GHAA 3M3KA 4X48A 3FASA 4DXUA 3O9PA 5JTYA 3H6UA 2FBPA 4LP2B 1NV4A 3C33A 1YCJA 1MQGA 1LFIA 1LCFA 1JVXA 2QL3A 5DEXB 4O3AA 1R1NA 1ZU0A 2QS1A 4PFIA 1FQFA 1FPFA 2WKYA 1H43A 4F3GA 2F36A 3PUYE 3OMBA
chains in the Genus database with same CATH topology
4JB7A 5L9MA 5ISUA 3ZSFA 2R9JA 2AL5A 1MG1A 4NF6B 5KDTA 3S9NC 3IOVA 5I2KB 2UVIA 3MZ1A 1POTA 2RINA 2RF1A 2Z23A 4FECA 4LATA 4GXAA 3KFMA 3KSXA 3H3GA 2FNCA 3LSFB 1HSLA 4GF8A 2XXQA 4I8CA 4IO5A 3K02A 5I59A 3UGWA 2QPQA 4C1UA 2F6GA 1UTBA 2KLFA 2OJTA 1GGGA 1LSTA 3ZKKA 4NF5B 1P1UA 3M8UA 2I3WA 2XXTA 4F2QA 3EN3A 3QIMA 3RLFE 5H8HA 2DXRA 4LVQA 1NL5A 3GBAA 2QS3A 2O7UA 1A7LA 1B7UA 1PDAA 4OETA 2QS4A 5L8DA 4KYDA 4TQUQ 3TTNA 5TU0A 5FHMA 1M5DA 2I4CA 2DVZA 4GWOA 1NNPA 3PGFA 4H8JA 4YKPA 1B2HA 4GD5A 3EHTA 4Z0IA 3VLWA 4I62A 4F18A 2F7BA 1SQYA 4PQJA 1VFDA 3MP1A 3MZ9A 2I58A 5B70A 2YPNA 4AB5A 5F7VA 2I0BA 4EXLA 4N6PA 4O3BA 1OVTA 4FAJA 2ZNSA 2P2AA 2GRVA 3IL1B 4HCWA 3HPIA 3TYHA 2F35A 3TQLA 1P99A 4ZZAA 3M3LA 3ODBA 3U93A 1LB8A 4EQ7A 2NXOA 4BDMA 3PD9A 3K1MA 2HFBA 3H06B 1LFHA 3IB0A 5ITPA 4I1DA 1P1WA 4ELRA 2PT1A 5M2VA 4KCDA 4U23A 1ATGA 3SETA 2O7IA 4ZEBA 1PBPA 4QSEA 2A5SA 2VGQA 3FV2A 3S9MC 1H3DA 5AA2B 2F8DA 3VE1B 3IO4A 1CE2A 2ONSA 4X1BA 3MWBA 4H6DA 4OHNA 3ILUB 4KR5A 2DE3A 1MY4A 2Z8DA 4WEPA 4TLLB 5AA2D 4F22A 4TOZA 3RN8A 3Q28A 1BIYA 3PPPA 2X7PA 3T9XB 3KN8A 4YKIA 3MZBA 3H6WA 5I58A 2B3BA 2B3FA 3FJGA 2P1SA 4HCYA 4YU0A 3GZGA 1NMUA 2OZZA 1TT1A 1LGBC 1FTLA 1ZJLA 3IR1A 4BDRA 3TTRA 3KN3A 5I2NB 3VXBA 3SEUA 3OO7A 3ILTB 3FUZA 2V84A 2F97A 3PV0E 3MPLA 4RPNA 4AQ4A 1DPEA 3KN7A 5I2KA 1MQDA 1AL3A 3FVGA 3TFLA 5FTIA 4GL0A 3QK6A 5BUUA 4JSOA 3K6VA 2XXXA 3OXNA 3G3HA 1B7HA 2HEUA 3R7XA 4KD5A 1EZ9A 3U92A 3IJXB 1J1NA 3OSRA 4E0XA 1I69A 3O2AA 4YKJA 3HN0A 4OERA 1ELJA 2Q2CA 5AA4A 4GXSB 3USDA 3IOWA 1B1HA 4FJPA 2UVGA 4IY6A 1IXCA 2Z8FA 2FYIA 3E9XA 2XHDA 4R9FA 4NMYA 3IOUA 4LA9A 3DM0A 3U94A 4OESA 3MW0A 1JEUA 3FV1A 4R73A 2XD2A 3P7IA 3BFUA 4QF9A 3TEPA 2H25A 4IGTA 1MDQA 2B65A 2H99A 3TELA 5ICQA 4ELPA 1M5EA 2OCUA 1B0HA 2QMWA 4GOTA 3O28A 3PPOA 3LSLA 3V89B 4QFNA 1S50A 4WXJA 5ICTA 5I84A 4IO6A 4Q30B 3H6VA 1PEBA 1LBCA 1ZBMA 1Y9UA 1Q35A 1Y4TA 3VVEA 1DMBA 3DP6A 4JWOA 2ZMBA 1B46A 3ZKLA 3RNNA 2BJJX 1GV8A 1XS5A 4R6KA 1MQIA 2HQ0A 2AL4A 1LAFE 4Q8RA 3PU5A 4ELOA 3MVXA 1AOVA 1QKAA 2GH9A 4OTEA 1SW2A 1Y3NA 2QRYA 3OD7A 2O51A 4GRKA 3FVOA 4OFJA 1BP5A 3EF7A 2VHAA 4F3SA 4G4PA 1A8FA 3OEKA 1SW4A 2V25A 3KOSA 4LZ5A 1ZLQA 2Q89A 4FEDA 1R6ZA 3UIFA 4LZ7A 2Y7RA 5A5XA 1URGA 4H1XA 3LUYA 4OFOA 4F29A 3PD8A 4MF3A 3H7MA 3WAEA 1NNKA 3LR1A 2DWJA 2I48A 3MQ9A 3N6UA 1Q1KA 5CBRA 2D3IA 3RTFB 3O6IA 4KYEA 5H8FB 2F78A 3QAXA 5AA2A 1L5TA 5CC2A 3RUMA 1XVXA 2P0SA 1WODA 3PUWE 3G3IA 4RXLA 1JW1A 5H8QA 4BDLA 3FVKA 1USYE 4WKMA 3C31A 3Q25A 1A54A 2UXAA 3RTWB 1MY1A 4R75A 1IEJA 3K6WA 4ND9A 1QVSA 3RY3A 4L17A 2X7QA 2XXRA 5CMKA 4EQBA 2ZYNA 1VE4A 3IO6A 4LQ5A 1N7WA 2Q2AA 4G2ZA 1MM6A 4R2FA 1XHYA 2I4BA 2ESNA 4ZZEA 1JEVA 1SI0A 2O6AA 5I2NA 4O3CA 4JWYA 5J1DA 3MVWA 2OLBA 3CFXA 2DS9A 5ITOA 5L9SA 4F1UA 3OO9A 4RK2A 4GL8A 3I5OA 2YLNA 2CMOA 2HCAA 4XXUA 3ONMA 3HV1A 3FXUA 3AXFA 3G7WA 1OMPA 3BFTA 3G3GA 3VDFA 3A3CA 4IO4A 3S9LC 3O6HA 5CI5A 4DZ1A 5IAIA 3SEWA 1IXIA 5H8NB 3K1NA 3RT8A 3TDJA 3K2DA 2PYYA 3FGSA 2D21A 4EF2A 4GQOA 2UYEA 1OQHA 2ANJA 2UYFA 4EDPA 4ZEDA 1O64A 1GTKA 1Y1ZA 2H9BA 4M4GA 4NF8A 2XXHA 2ZNUA 1D9VA 3SDFA 3VFJA 5B7DA 1MRPA 1QKBA 2LAOA 5AA3A 1PB7A 5TPAB 4H5FA 1TXFA 3QSLA 2E0SA 4ELQA 4UA8A 1B4HA 1B3LA 3K01A 1RYOA 4POWA 4C1TA 4R9GA 4EXKA 4G8HA 5FHNA 1MDP1 3SEYA 2AYSA 3RQTA 1MXWA 3TUSA 5I56B 4YAHX 3KBRA 3C32A 5I57B 1MH3A 3QUJA 1OLAA 5TP9B 1MXVA 1H45A 1URSA 3THIA 2ALUA 5DVIA 3I3VA 1PC3A 1Y1MA 4R6HA 4XIGQ 1SD3A 3W9WA 3TTKA 4HS7A 3V8XB 3CVGA 4KQPA 3T96B 3CG1A 2UVJA 4QFKA 4RPOA 4QFPA 4C0RA 4F1VA 1VSOA 3KZGA 1N0TA 4EQ9A 1IIWA 3O66A 5DT6A 5KCJA 2VD3A 4F31B 1N3XA 2Y7KA 1LFGA 3OELA 3UORA 5DTBA 1OIBA 1H44A 2F6PA 4ECFA 3TPAA 4FIMA 5KZTA 2Y7IA 2DVCA 2H5YA 3PUXE 1JQFA 3CIJA 1WDNA 2QSXA 3HHGA 4U21A 4HW8A 2O69A 3RT6B 4BDQA 3UP9A 3UK4A 3M3FA 2M8CA 1D9YA 3EQ1A 4UACA 4JBZA 1OQGA 3CSBA 3W15C 3C9HA 5AA1A 4NF4B 1IZ1A 4R74A 1EH3A 3SERA 3MC2A 1IXGA 1HSJA 4DLDA 5JTYB 2O68A 5DEXA 4DCYA 2FA7A 4RNSA 2Q8JA 4ZDMA 1ANFA 1R9QA 4F19A 3MAMA 3K0VA 2YJPA 3TMGA 2I49A 1IXHA 3MJNA 4PFYA 2F7AA 1B3HA 4ESXA 2W7YA 2QMXA 4XTCQ 3H03A 2I0CA 3PMWA 4NF6A 1P1OA 3IB2A 3U1OA 2H98A 1GR2A 2QS2A 3LSWA 4OFLA 1R9LA 3Q27A 1US4A 1FQDA 4XKNA 4ZE9A 3HSTA 3PUZE 2O1LA 1IQ7A 3EHSA 1I6BA 3CG3A 2QJEA 3ZS6A 3A3UA 2G29A 3T93B 1FW0A 1N7XA 4YB5A 4RYAA 1ZMGA 1FTKA 3FZVA 4NF5A 4JXIA 1N3WA 3E4RA 4ZEFA 1JNFA 4U1ZA 1LAGE 4ZS9A 2NWJA 1SYIA 2RCBA 3W9VA 1AIVA 1XT8A 3JYRA 5H8HB 4MFIA 3CFLA 3RGYA 2HZKA 3WAFA 1S9TA 1USYH 2E1SA 2XX8A 4G68B 5TPAA 4FEBA 1B3EA 3QXMA 1JW4A 3KOTA 4DXCA 1MY0A 1DPPA 3N6TA 2DE4A 1DTGA 4JDFA 4XKQA 5BWJA 2RC9A 4GVOA 4OWDA 2HAUA 4OEUA 1MXUA 2ZYMA 3EPEA 1A8EA 4QFOA 4R6YA 1MPCA 1JW5A 1A55A 3S2VA 3SKPA 3T22A 3O97A 5DVFA 2F5XA 4G68C 4DXBA 5TP9A 1F9BA 4U2RA 3U8QA 2Q9TA 1MQJA 2DYXA 1MS7A 4G77A 1IUDA 4QFLA 2GFEA 4NEDA 1WVJA 3T9HB 1XOCA 2CZLA 4I9DA 3IOTA 4PFTA 3N5LA 4E0WA 3FXRA 2THIA 4X9TA 1NKXA 3CI8A 1QULA 4IO7A 4R2BA 3KSJA 1LAHE 3B6WA 4HTGA 1B9JA 4EF1A 4F39A 1B3GA 4GFRA 4IGRA 2X26A 4KHZE 4U4SA 2Q88A 2ONKE 4JSDA 2GHBA 3SEVA 1FQEA 1FTMA 4KCCA 3E3KA 3HO7A 4RY1A 1B51A 5JK4A 5CM6A 3VLVA 1FQAA 1XVYA 3UN6A 4IY5A 2G93A 1GVCA 1B7ZA 5HBCA 4QSDA 4OEVA 1MXYA 2AIXA 1I6AA 4AB6A 4LUBA 1NNFA 3U72A 1S7YA 2NOOA 3TZAA 2UVHA 4N07A 4GLIA 1B05A 1BLFA 1PBQA 4NF4A 4F1YA 1JETA 3TCHA 3MPKA 1FQBA 3N94A 2REJA 1EZOA 3PPQA 5I58B 1M5BA 2NUVA 2XXYA 4Z7EA 4MLQA 1DSNA 5HM4B 4BDNA 1FTJA 1MY2A 4U4XA 5CMMA 4LZ8A 1B5IA 4MBPA 4ZEIA 1OVBA 2PBWA 3H4ZA 3G3JA 3B6TA 4YMAA 4OXVA 3PPNA 1M5CA 3PUVE 4IO3A 2V93A 3QUFA 1P1NA 5CBSA 4Q5TA 1QUJA 3TKDA 3F11A 1N76A 1ZTYA 2NVUB 3OSQA 2PMSA 1BTJA 4THIA 4U22A 1QJMA 4RJZA 3PPRA 1O63A 4G8NA 2DQVA 1EU8A 1TFDA 3D4GA 2HAVA 4DE8A 1TWYA 3VLUA 2XD3A 2XX9A 3TCFA 1B40A 2RCAA 1DTZA 5HPQA 4QSCA 5AA4B 3SEXA 3UA8A 5CMBA 1A99A 3QYTA 4LQ2A 4MH5A 1EZPA 2OK2A 4Q0CA 2DXYA 3B7DA 1SW1A 3I6VA 1OLCA 3LBSA 4KI0E 3HCQA 3TTLA 2ZXTA 1Z7NE 2DWAA 1LB9A 3JZJA 1A40A 3R26A 1UTHB 3K1PA 3MVZA 2RC8A 3FXQA 4G68A 1JVYA 3VV5A 5IKBA 2PT2A 4IO2A 1MPDA 2VP1A 4QRZA 2XXUA 4ESWA 1P1QA 1PB9A 4H0WA 3KJTA 1LBBA 1Y3QA 3Q26A 3VXCA 4ONYA 2ZNTA 2O84X 3SESA 1NH8A 5JEIA 4YICA 1Y3PA 3MUQA 4DCXA 5EHSA 1H76A 5LOMA 3E13X 3MBPA 4N13A 4FORA 4ZEKA 1ZKBA 1B0LA 3IB1A 2DOJA 1LLSA 3BBRA 2XX7A 3DLNA 3G3FA 5CMCA 3CFZA 2OWTA 2PVUA 2A5TB 4H65A 1SW5A 3B6QA 4F3PA 4WEDA 3FIRA 1N04A 4F2OA 4OZ9A 3KGCA 3L6HA 4EUOA 4FE8A 4PP0A 3JV9A 3K6XA 4YKKA 3V5AA 3IX1A 4QHQA 1M5FA 1FTOA 1LCTA 2IEEA 3O29A 3CR9A 3OENA 5A5XB 3C4MA 2XXWA 4KYSA 1UQWA 2Z22A 3VVFA 2Y7PA 3CRBA 4POXA 2RC7A 5H8FA 1B5HA 3DP4A 1QUKA 2OWSA 3FJMA 3EHUA 3VVDA 3TAJA 2O1MA 3FJ7A 5F1QA 2XXPA 4K3FA 1FQCA 4KFQA 3MP6A 3OO8A 4OENA 2IA4A 4XKPA 3TCGA 3C36A 5H8QB 4ZECA 2ABHA 1B4ZA 3FATA 4R72A 5L9OA 1SYHA 1Y4CA 4NWCA 1AMFA 2VD2A 5EHMA 1YTVA 4YMBA 5FTHA 3GBBA 3IJOB 1B1XA 1B52A 1VR5A 3OOAA 3IK6B 2D5WA 4ISUA 4DIGA 3TTMA 4XKRA 1UIVA 3GXAA 3T66A 3L6GA 2F34A 3IAZA 2V3UA 3Q29A 1MY3A 3PMVA 4KPTA 2REGA 3G3KA 5KDTB 2DWIA 4NWDA 1KWHA 3OO6A 1N84A 3KJ7A 3HHFA 3FVNA 2XXIA 3BKIB 1SI1A 4PETA 1D4NA 1CB6A 1II5A 3D4CA 5H8NA 5EYFA 4H67A 1Y20A 2PX1A 4RA1A 5FHOA 5DVJA 4YB7A 4ZE8A 1B6HA 4IB2A 3OEMA 3PMXA 4MLVA 1AH5A 5I59B 3A09A 3N26A 1B32A 4OMBA 1O7TA 5DYHA 1UTBB 2DSFA 4JWXA 1RYXA 1NH7A 1SVXB 1MXXA 1US5A 2I3VA 5K2YA 3K6UA 1HSEA 4H8IA 1FCKA 1POY1 4NF8B 1XC1A 2DE2A 5ELVA 2RKMA 3ECRA 3T9VA 3TQWA 4BLAA 1UTHA 3R6UA 4G8MA 2HXWA 4TLMB 1YPNA 1UIUA 4BDOA 1IITA 2R6GE 4NTLA 4YB6A 1SDXA 5I56A 1MPBA 3O6GA 5I57A 1MQHA 1SBPA 1VFEA 1DOTA 4DDDA 1NFTA 4PE5B 1Z7ME 1I6QA 2VOZA 2Y84A 1LAXA 4PFUA 3KEIA 4X1DA 1NNTA 2V3TA 4PFWA 5AE4A 3MVYA 4M1VA 3DELB 2ZYKA 1BKAA 5H8SA 4FATA 2A5TA 2Z8EA 3RPWA 3LSXA 1RKMA 2DWHA 4GIZA 5KCJB 4U1OA 2V3QA 4LONB 2HZLA 3MP8A 4OYVA 2DP8A 3S4UA 2XXVA 4RK9A 3IORA 3C34A 1D3KA 1MXZA 3LC8A 1QW0A 1QUIA 1B3FA 3TODA 3DP8A 4P11A 1URDA 2OBGA 3K00A 5CRYA 2Y7WA 3T9UA 3H6TA 2ZYOA 4P0IA 3V83A 1B58A 4P0GA 1MH4A 4YZZA 1PB8A 3KG2A 3C35A 1ZIUA 3S9EA 2F7CA 3CSGA 4OVJA 2ONRA 1YAEA 2I6EA 4OQOA 3GLBA 5K2XA 4F3BA 3FD3A 1MM7A 2H4IA 1T0KA 3K4UA 4NE4A 1B5JA 2R71A 4H5GA 1TFAA 2GHAA 3M3KA 4X48A 3FASA 4DXUA 3O9PA 5JTYA 3H6UA 4LP2B 3C33A 1YCJA 1MQGA 1LFIA 1LCFA 1JVXA 2QL3A 5DEXB 4O3AA 1R1NA 1ZU0A 2QS1A 1FQFA 2WKYA 1H43A 4F3GA 2F36A 3PUYE 3OMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JB7 A;  5L9M A;  5ISU A;  3ZSF A;  2R9J A;  2AL5 A;  1MG1 A;  4NF6 B;  5KDT A;  3S9N C;  3IOV A;  5I2K B;  2UVI A;  3MZ1 A;  1POT A;  2RIN A;  2RF1 A;  2Z23 A;  4FEC A;  4LAT A;  4GXA A;  3KFM A;  3KSX A;  3H3G A;  2FNC A;  3LSF B;  1HSL A;  4GF8 A;  2XXQ A;  4I8C A;  4IO5 A;  3K02 A;  5I59 A;  3UGW A;  2QPQ A;  4C1U A;  2F6G A;  1UTB A;  2KLF A;  2OJT A;  1GGG A;  1LST A;  3ZKK A;  4NF5 B;  1P1U A;  3M8U A;  2I3W A;  2XXT A;  4F2Q A;  3EN3 A;  3QIM A;  3RLF E;  5H8H A;  2DXR A;  4LVQ A;  1NL5 A;  3GBA A;  2QS3 A;  2O7U A;  1A7L A;  1B7U A;  1PDA A;  4OET A;  2QS4 A;  5L8D A;  4KYD A;  4TQU Q;  3TTN A;  5TU0 A;  5FHM A;  1M5D A;  2I4C A;  2DVZ A;  4GWO A;  1NNP A;  3PGF A;  4H8J A;  4YKP A;  1B2H A;  4GD5 A;  3EHT A;  4Z0I A;  3VLW A;  4I62 A;  4F18 A;  2F7B A;  1SQY A;  4PQJ A;  1VFD A;  3MP1 A;  3MZ9 A;  2I58 A;  5B70 A;  2YPN A;  4AB5 A;  5F7V A;  2I0B A;  4EXL A;  4N6P A;  4O3B A;  1OVT A;  4FAJ A;  2ZNS A;  2P2A A;  2GRV A;  3IL1 B;  4HCW A;  3HPI A;  3TYH A;  2F35 A;  3TQL A;  1P99 A;  4ZZA A;  3M3L A;  3ODB A;  3U93 A;  1LB8 A;  4EQ7 A;  2NXO A;  4BDM A;  3PD9 A;  3K1M A;  2HFB A;  3H06 B;  1LFH A;  3IB0 A;  5ITP A;  4I1D A;  1P1W A;  4ELR A;  2PT1 A;  5M2V A;  4KCD A;  4U23 A;  1ATG A;  3SET A;  2O7I A;  4ZEB A;  1PBP A;  4QSE A;  2A5S A;  2VGQ A;  3FV2 A;  3S9M C;  1H3D A;  5AA2 B;  2F8D A;  3VE1 B;  3IO4 A;  1CE2 A;  2ONS A;  4X1B A;  3MWB A;  4H6D A;  4OHN A;  3ILU B;  4KR5 A;  2DE3 A;  1MY4 A;  2Z8D A;  4WEP A;  4TLL B;  5AA2 D;  4F22 A;  4TOZ A;  3RN8 A;  3Q28 A;  1BIY A;  3PPP A;  2X7P A;  3T9X B;  3KN8 A;  4YKI A;  3MZB A;  3H6W A;  5I58 A;  2B3B A;  2B3F A;  3FJG A;  2P1S A;  4HCY A;  4YU0 A;  3GZG A;  1NMU A;  2OZZ A;  1TT1 A;  1LGB C;  1FTL A;  1ZJL A;  3IR1 A;  4BDR A;  3TTR A;  3KN3 A;  5I2N B;  3VXB A;  3SEU A;  3OO7 A;  3ILT B;  3FUZ A;  2V84 A;  2F97 A;  3PV0 E;  3MPL A;  4RPN A;  4AQ4 A;  1DPE A;  3KN7 A;  5I2K A;  1MQD A;  1AL3 A;  3FVG A;  3TFL A;  5FTI A;  4GL0 A;  3QK6 A;  5BUU A;  4JSO A;  3K6V A;  2XXX A;  3OXN A;  3G3H A;  1B7H A;  2HEU A;  3R7X A;  4KD5 A;  1EZ9 A;  3U92 A;  3IJX B;  1J1N A;  3OSR A;  4E0X A;  1I69 A;  3O2A A;  4YKJ A;  3HN0 A;  4OER A;  1ELJ A;  2Q2C A;  5AA4 A;  4GXS B;  3USD A;  3IOW A;  1B1H A;  4FJP A;  2UVG A;  4IY6 A;  1IXC A;  2Z8F A;  2FYI A;  3E9X A;  2XHD A;  4R9F A;  4NMY A;  3IOU A;  4LA9 A;  3DM0 A;  3U94 A;  4OES A;  3MW0 A;  1JEU A;  3FV1 A;  4R73 A;  2XD2 A;  3P7I A;  3BFU A;  4QF9 A;  3TEP A;  2H25 A;  4IGT A;  1MDQ A;  2B65 A;  2H99 A;  3TEL A;  5ICQ A;  4ELP A;  1M5E A;  2OCU A;  1B0H A;  2QMW A;  4GOT A;  3O28 A;  3PPO A;  3LSL A;  3V89 B;  4QFN A;  1S50 A;  4WXJ A;  5ICT A;  5I84 A;  4IO6 A;  4Q30 B;  3H6V A;  1PEB A;  1LBC A;  1ZBM A;  1Y9U A;  1Q35 A;  1Y4T A;  3VVE A;  1DMB A;  3DP6 A;  4JWO A;  2ZMB A;  1B46 A;  3ZKL A;  3RNN A;  2BJJ X;  1GV8 A;  1XS5 A;  4R6K A;  1MQI A;  2HQ0 A;  2AL4 A;  1LAF E;  4Q8R A;  3PU5 A;  4ELO A;  3MVX A;  1AOV A;  1QKA A;  2GH9 A;  4OTE A;  1SW2 A;  1Y3N A;  2QRY A;  3OD7 A;  2O51 A;  4GRK A;  3FVO A;  4OFJ A;  1BP5 A;  3EF7 A;  2VHA A;  4F3S A;  4G4P A;  1A8F A;  3OEK A;  1SW4 A;  2V25 A;  3KOS A;  4LZ5 A;  1ZLQ A;  2Q89 A;  4FED A;  1R6Z A;  3UIF A;  4LZ7 A;  2Y7R A;  5A5X A;  1URG A;  4H1X A;  3LUY A;  4OFO A;  4F29 A;  3PD8 A;  4MF3 A;  3H7M A;  3WAE A;  1NNK A;  3LR1 A;  2DWJ A;  2I48 A;  3MQ9 A;  3N6U A;  1Q1K A;  5CBR A;  2D3I A;  3RTF B;  3O6I A;  4KYE A;  5H8F B;  2F78 A;  3QAX A;  5AA2 A;  1L5T A;  5CC2 A;  3RUM A;  1XVX A;  2P0S A;  1WOD A;  3PUW E;  3G3I A;  4RXL A;  1JW1 A;  5H8Q A;  4BDL A;  3FVK A;  1USY E;  4WKM A;  3C31 A;  3Q25 A;  1A54 A;  2UXA A;  3RTW B;  1MY1 A;  4R75 A;  1IEJ A;  3K6W A;  4ND9 A;  1QVS A;  3RY3 A;  4L17 A;  2X7Q A;  2XXR A;  5CMK A;  4EQB A;  2ZYN A;  1VE4 A;  3IO6 A;  4LQ5 A;  1N7W A;  2Q2A A;  4G2Z A;  1MM6 A;  4R2F A;  1XHY A;  2I4B A;  2ESN A;  4ZZE A;  1JEV A;  1SI0 A;  2O6A A;  5I2N A;  4O3C A;  4JWY A;  5J1D A;  3MVW A;  2OLB A;  3CFX A;  2DS9 A;  5ITO A;  5L9S A;  4F1U A;  3OO9 A;  4RK2 A;  4GL8 A;  3I5O A;  2YLN A;  2CMO A;  2HCA A;  4XXU A;  3ONM A;  3HV1 A;  3FXU A;  3AXF A;  3G7W A;  1OMP A;  3BFT A;  3G3G A;  3VDF A;  3A3C A;  4IO4 A;  3S9L C;  3O6H A;  5CI5 A;  4DZ1 A;  5IAI A;  3SEW A;  1IXI A;  5H8N B;  3K1N A;  3RT8 A;  3TDJ A;  3K2D A;  2PYY A;  3FGS A;  2D21 A;  4EF2 A;  4GQO A;  2UYE A;  1OQH A;  2ANJ A;  2UYF A;  4EDP A;  4ZED A;  1O64 A;  1GTK A;  1Y1Z A;  2H9B A;  4M4G A;  4NF8 A;  2XXH A;  2ZNU A;  1D9V A;  3SDF A;  3VFJ A;  5B7D A;  1MRP A;  1QKB A;  2LAO A;  5AA3 A;  1PB7 A;  5TPA B;  4H5F A;  1TXF A;  3QSL A;  2E0S A;  4ELQ A;  4UA8 A;  1B4H A;  1B3L A;  3K01 A;  1RYO A;  4POW A;  4C1T A;  4R9G A;  4EXK A;  4G8H A;  5FHN A;  1MDP 1;  3SEY A;  2AYS A;  3RQT A;  1MXW A;  3TUS A;  5I56 B;  4YAH X;  3KBR A;  3C32 A;  5I57 B;  1MH3 A;  3QUJ A;  1OLA A;  5TP9 B;  1MXV A;  1H45 A;  1URS A;  3THI A;  2ALU A;  5DVI A;  3I3V A;  1PC3 A;  1Y1M A;  4R6H A;  4XIG Q;  1SD3 A;  3W9W A;  3TTK A;  4HS7 A;  3V8X B;  3CVG A;  4KQP A;  3T96 B;  3CG1 A;  2UVJ A;  4QFK A;  4RPO A;  4QFP A;  4C0R A;  4F1V A;  1VSO A;  3KZG A;  1N0T A;  4EQ9 A;  1IIW A;  3O66 A;  5DT6 A;  5KCJ A;  2VD3 A;  4F31 B;  1N3X A;  2Y7K A;  1LFG A;  3OEL A;  3UOR A;  5DTB A;  1OIB A;  1H44 A;  2F6P A;  4ECF A;  3TPA A;  4FIM A;  5KZT A;  2Y7I A;  2DVC A;  2H5Y A;  3PUX E;  1JQF A;  3CIJ A;  1WDN A;  2QSX A;  3HHG A;  4U21 A;  4HW8 A;  2O69 A;  3RT6 B;  4BDQ A;  3UP9 A;  3UK4 A;  3M3F A;  2M8C A;  1D9Y A;  3EQ1 A;  4UAC A;  4JBZ A;  1OQG A;  3CSB A;  3W15 C;  3C9H A;  5AA1 A;  4NF4 B;  1IZ1 A;  4R74 A;  1EH3 A;  3SER A;  3MC2 A;  1IXG A;  1HSJ A;  4DLD A;  5JTY B;  2O68 A;  5DEX A;  4DCY A;  2FA7 A;  4RNS A;  2Q8J A;  4ZDM A;  1ANF A;  1R9Q A;  4F19 A;  3MAM A;  3K0V A;  2YJP A;  3TMG A;  2I49 A;  1IXH A;  3MJN A;  4PFY A;  2F7A A;  1B3H A;  4ESX A;  2W7Y A;  2QMX A;  4XTC Q;  3H03 A;  2I0C A;  3PMW A;  4NF6 A;  1P1O A;  3IB2 A;  3U1O A;  2H98 A;  1GR2 A;  2QS2 A;  3LSW A;  4OFL A;  1R9L A;  3Q27 A;  1US4 A;  1FQD A;  4XKN A;  4ZE9 A;  3HST A;  3PUZ E;  2O1L A;  1IQ7 A;  3EHS A;  1I6B A;  3CG3 A;  2QJE A;  3ZS6 A;  3A3U A;  2G29 A;  3T93 B;  1FW0 A;  1N7X A;  4YB5 A;  4RYA A;  1ZMG A;  1FTK A;  3FZV A;  4NF5 A;  4JXI A;  1N3W A;  3E4R A;  4ZEF A;  1JNF A;  4U1Z A;  1LAG E;  4ZS9 A;  2NWJ A;  1SYI A;  2RCB A;  3W9V A;  1AIV A;  1XT8 A;  3JYR A;  5H8H B;  4MFI A;  3CFL A;  3RGY A;  2HZK A;  3WAF A;  1S9T A;  1USY H;  2E1S A;  2XX8 A;  4G68 B;  5TPA A;  4FEB A;  1B3E A;  3QXM A;  1JW4 A;  3KOT A;  4DXC A;  1MY0 A;  1DPP A;  3N6T A;  2DE4 A;  1DTG A;  4JDF A;  4XKQ A;  5BWJ A;  2RC9 A;  4GVO A;  4OWD A;  2HAU A;  4OEU A;  1MXU A;  2ZYM A;  3EPE A;  1A8E A;  4QFO A;  4R6Y A;  1MPC A;  1JW5 A;  1A55 A;  3S2V A;  3SKP A;  3T22 A;  3O97 A;  5DVF A;  2F5X A;  4G68 C;  4DXB A;  5TP9 A;  1F9B A;  4U2R A;  3U8Q A;  2Q9T A;  1MQJ A;  2DYX A;  1MS7 A;  4G77 A;  1IUD A;  4QFL A;  2GFE A;  4NED A;  1WVJ A;  3T9H B;  1XOC A;  2CZL A;  4I9D A;  3IOT A;  4PFT A;  3N5L A;  4E0W A;  3FXR A;  2THI A;  4X9T A;  1NKX A;  3CI8 A;  1QUL A;  4IO7 A;  4R2B A;  3KSJ A;  1LAH E;  3B6W A;  4HTG A;  1B9J A;  4EF1 A;  4F39 A;  1B3G A;  4GFR A;  4IGR A;  2X26 A;  4KHZ E;  4U4S A;  2Q88 A;  2ONK E;  4JSD A;  2GHB A;  3SEV A;  1FQE A;  1FTM A;  4KCC A;  3E3K A;  3HO7 A;  4RY1 A;  1B51 A;  5JK4 A;  5CM6 A;  3VLV A;  1FQA A;  1XVY A;  3UN6 A;  4IY5 A;  2G93 A;  1GVC A;  1B7Z A;  5HBC A;  4QSD A;  4OEV A;  1MXY A;  2AIX A;  1I6A A;  4AB6 A;  4LUB A;  1NNF A;  3U72 A;  1S7Y A;  2NOO A;  3TZA A;  2UVH A;  4N07 A;  4GLI A;  1B05 A;  1BLF A;  1PBQ A;  4NF4 A;  4F1Y A;  1JET A;  3TCH A;  3MPK A;  1FQB A;  3N94 A;  2REJ A;  1EZO A;  3PPQ A;  5I58 B;  1M5B A;  2NUV A;  2XXY A;  4Z7E A;  4MLQ A;  1DSN A;  5HM4 B;  4BDN A;  1FTJ A;  1MY2 A;  4U4X A;  5CMM A;  4LZ8 A;  1B5I A;  4MBP A;  4ZEI A;  1OVB A;  2PBW A;  3H4Z A;  3G3J A;  3B6T A;  4YMA A;  4OXV A;  3PPN A;  1M5C A;  3PUV E;  4IO3 A;  2V93 A;  3QUF A;  1P1N A;  5CBS A;  4Q5T A;  1QUJ A;  3TKD A;  3F11 A;  1N76 A;  1ZTY A;  2NVU B;  3OSQ A;  2PMS A;  1BTJ A;  4THI A;  4U22 A;  1QJM A;  4RJZ A;  3PPR A;  1O63 A;  4G8N A;  2DQV A;  1EU8 A;  1TFD A;  3D4G A;  2HAV A;  4DE8 A;  1TWY A;  3VLU A;  2XD3 A;  2XX9 A;  3TCF A;  1B40 A;  2RCA A;  1DTZ A;  5HPQ A;  4QSC A;  5AA4 B;  3SEX A;  3UA8 A;  5CMB A;  1A99 A;  3QYT A;  4LQ2 A;  4MH5 A;  1EZP A;  2OK2 A;  4Q0C A;  2DXY A;  3B7D A;  1SW1 A;  3I6V A;  1OLC A;  3LBS A;  4KI0 E;  3HCQ A;  3TTL A;  2ZXT A;  1Z7N E;  2DWA A;  1LB9 A;  3JZJ A;  1A40 A;  3R26 A;  1UTH B;  3K1P A;  3MVZ A;  2RC8 A;  3FXQ A;  4G68 A;  1JVY A;  3VV5 A;  5IKB A;  2PT2 A;  4IO2 A;  1MPD A;  2VP1 A;  4QRZ A;  2XXU A;  4ESW A;  1P1Q A;  1PB9 A;  4H0W A;  3KJT A;  1LBB A;  1Y3Q A;  3Q26 A;  3VXC A;  4ONY A;  2ZNT A;  2O84 X;  3SES A;  1NH8 A;  5JEI A;  4YIC A;  1Y3P A;  3MUQ A;  4DCX A;  5EHS A;  1H76 A;  5LOM A;  3E13 X;  3MBP A;  4N13 A;  4FOR A;  4ZEK A;  1ZKB A;  1B0L A;  3IB1 A;  2DOJ A;  1LLS A;  3BBR A;  2XX7 A;  3DLN A;  3G3F A;  5CMC A;  3CFZ A;  2OWT A;  2PVU A;  2A5T B;  4H65 A;  1SW5 A;  3B6Q A;  4F3P A;  4WED A;  3FIR A;  1N04 A;  4F2O A;  4OZ9 A;  3KGC A;  3L6H A;  4EUO A;  4FE8 A;  4PP0 A;  3JV9 A;  3K6X A;  4YKK A;  3V5A A;  3IX1 A;  4QHQ A;  1M5F A;  1FTO A;  1LCT A;  2IEE A;  3O29 A;  3CR9 A;  3OEN A;  5A5X B;  3C4M A;  2XXW A;  4KYS A;  1UQW A;  2Z22 A;  3VVF A;  2Y7P A;  3CRB A;  4POX A;  2RC7 A;  5H8F A;  1B5H A;  3DP4 A;  1QUK A;  2OWS A;  3FJM A;  3EHU A;  3VVD A;  3TAJ A;  2O1M A;  3FJ7 A;  5F1Q A;  2XXP A;  4K3F A;  1FQC A;  4KFQ A;  3MP6 A;  3OO8 A;  4OEN A;  2IA4 A;  4XKP A;  3TCG A;  3C36 A;  5H8Q B;  4ZEC A;  2ABH A;  1B4Z A;  3FAT A;  4R72 A;  5L9O A;  1SYH A;  1Y4C A;  4NWC A;  1AMF A;  2VD2 A;  5EHM A;  1YTV A;  4YMB A;  5FTH A;  3GBB A;  3IJO B;  1B1X A;  1B52 A;  1VR5 A;  3OOA A;  3IK6 B;  2D5W A;  4ISU A;  4DIG A;  3TTM A;  4XKR A;  1UIV A;  3GXA A;  3T66 A;  3L6G A;  2F34 A;  3IAZ A;  2V3U A;  3Q29 A;  1MY3 A;  3PMV A;  4KPT A;  2REG A;  3G3K A;  5KDT B;  2DWI A;  4NWD A;  1KWH A;  3OO6 A;  1N84 A;  3KJ7 A;  3HHF A;  3FVN A;  2XXI A;  3BKI B;  1SI1 A;  4PET A;  1D4N A;  1CB6 A;  1II5 A;  3D4C A;  5H8N A;  5EYF A;  4H67 A;  1Y20 A;  2PX1 A;  4RA1 A;  5FHO A;  5DVJ A;  4YB7 A;  4ZE8 A;  1B6H A;  4IB2 A;  3OEM A;  3PMX A;  4MLV A;  1AH5 A;  5I59 B;  3A09 A;  3N26 A;  1B32 A;  4OMB A;  1O7T A;  5DYH A;  1UTB B;  2DSF A;  4JWX A;  1RYX A;  1NH7 A;  1SVX B;  1MXX A;  1US5 A;  2I3V A;  5K2Y A;  3K6U A;  1HSE A;  4H8I A;  1FCK A;  1POY 1;  4NF8 B;  1XC1 A;  2DE2 A;  5ELV A;  2RKM A;  3ECR A;  3T9V A;  3TQW A;  4BLA A;  1UTH A;  3R6U A;  4G8M A;  2HXW A;  4TLM B;  1YPN A;  1UIU A;  4BDO A;  1IIT A;  2R6G E;  4NTL A;  4YB6 A;  1SDX A;  5I56 A;  1MPB A;  3O6G A;  5I57 A;  1MQH A;  1SBP A;  1VFE A;  1DOT A;  4DDD A;  1NFT A;  4PE5 B;  1Z7M E;  1I6Q A;  2VOZ A;  2Y84 A;  1LAX A;  4PFU A;  3KEI A;  4X1D A;  1NNT A;  2V3T A;  4PFW A;  5AE4 A;  3MVY A;  4M1V A;  3DEL B;  2ZYK A;  1BKA A;  5H8S A;  4FAT A;  2A5T A;  2Z8E A;  3RPW A;  3LSX A;  1RKM A;  2DWH A;  4GIZ A;  5KCJ B;  4U1O A;  2V3Q A;  4LON B;  2HZL A;  3MP8 A;  4OYV A;  2DP8 A;  3S4U A;  2XXV A;  4RK9 A;  3IOR A;  3C34 A;  1D3K A;  1MXZ A;  3LC8 A;  1QW0 A;  1QUI A;  1B3F A;  3TOD A;  3DP8 A;  4P11 A;  1URD A;  2OBG A;  3K00 A;  5CRY A;  2Y7W A;  3T9U A;  3H6T A;  2ZYO A;  4P0I A;  3V83 A;  1B58 A;  4P0G A;  1MH4 A;  4YZZ A;  1PB8 A;  3KG2 A;  3C35 A;  1ZIU A;  3S9E A;  2F7C A;  3CSG A;  4OVJ A;  2ONR A;  1YAE A;  2I6E A;  4OQO A;  3GLB A;  5K2X A;  4F3B A;  3FD3 A;  1MM7 A;  2H4I A;  1T0K A;  3K4U A;  4NE4 A;  1B5J A;  2R71 A;  4H5G A;  1TFA A;  2GHA A;  3M3K A;  4X48 A;  3FAS A;  4DXU A;  3O9P A;  5JTY A;  3H6U A;  4LP2 B;  3C33 A;  1YCJ A;  1MQG A;  1LFI A;  1LCF A;  1JVX A;  2QL3 A;  5DEX B;  4O3A A;  1R1N A;  1ZU0 A;  2QS1 A;  1FQF A;  2WKY A;  1H43 A;  4F3G A;  2F36 A;  3PUY E;  3OMB A; 
#chains in the Genus database with same CATH topology
 4JB7 A;  5L9M A;  5ISU A;  3ZSF A;  2R9J A;  2AL5 A;  1MG1 A;  4NF6 B;  5KDT A;  3S9N C;  3IOV A;  5I2K B;  2UVI A;  3MZ1 A;  1POT A;  2RIN A;  2RF1 A;  2Z23 A;  4FEC A;  4LAT A;  4DI3 D;  4GXA A;  3KFM A;  3KSX A;  3H3G A;  2FNC A;  3LSF B;  1HSL A;  1RDZ A;  4GF8 A;  2XXQ A;  4I8C A;  4IO5 A;  3K02 A;  5I59 A;  3UGW A;  2QPQ A;  4C1U A;  1RDY A;  2F6G A;  1UTB A;  2KLF A;  2OJT A;  1GGG A;  1LST A;  4PAF A;  3ZKK A;  4NF5 B;  4LN5 A;  1P1U A;  3M8U A;  2I3W A;  2XXT A;  4F2Q A;  3EN3 A;  3QIM A;  3RLF E;  5IZ1 A;  5H8H A;  4I40 A;  2DXR A;  4LVQ A;  3BIG A;  1NL5 A;  3GBA A;  2GQ1 A;  2QS3 A;  2O7U A;  1A7L A;  1FPL A;  1B7U A;  1PDA A;  4OET A;  2QS4 A;  5L8D A;  1FPD A;  4KYD A;  4TQU Q;  2KR0 A;  3TTN A;  5TU0 A;  5FHM A;  1M5D A;  1FPJ A;  2I4C A;  2DVZ A;  4GWO A;  1NNP A;  3PGF A;  1LBY A;  4H8J A;  4YKP A;  1B2H A;  4GD5 A;  1EYK A;  3EHT A;  4Z0I A;  3VLW A;  4OA4 A;  4I62 A;  4F18 A;  2F7B A;  1SQY A;  1FPB A;  4PQJ A;  5J16 A;  1VFD A;  3MP1 A;  3MZ9 A;  2I58 A;  5B70 A;  2YPN A;  4AB5 A;  2CEY A;  5F7V A;  2I0B A;  4JVC A;  4EXL A;  4N6P A;  2PFZ A;  4O3B A;  3LV0 A;  1OVT A;  5EYH A;  2ZNS A;  4FAJ A;  2P2A A;  4KXP A;  2GRV A;  3IL1 B;  4HCW A;  3HPI A;  3TYH A;  2F35 A;  3TQL A;  1P99 A;  4MNI A;  3M3L A;  3ODB A;  4ZZA A;  3U93 A;  1LB8 A;  1FJ6 A;  2NXO A;  4BDM A;  3PD9 A;  4EQ7 A;  3K1M A;  1IMD A;  2HFB A;  3H06 B;  1LFH A;  3IB0 A;  5ITP A;  4I1D A;  1P1W A;  4ELR A;  4MNP A;  2PT1 A;  5M2V A;  4NX1 A;  4MAG A;  4KCD A;  4U23 A;  1ATG A;  3SET A;  2O7I A;  4ZEB A;  2FIE A;  1PBP A;  4HE0 A;  4QSE A;  2A5S A;  2VGQ A;  3FV2 A;  3S9M C;  1H3D A;  1XI6 A;  5AA2 B;  2F8D A;  3VE1 B;  3IO4 A;  1CE2 A;  2ONS A;  4X1B A;  3MWB A;  4H6D A;  4OHN A;  2WYK A;  3ILU B;  4KR5 A;  2DE3 A;  1MY4 A;  2Z8D A;  3ROJ A;  4N8Y A;  4WEP A;  2XA5 A;  4TLL B;  5AA2 D;  4F22 A;  4TOZ A;  3RN8 A;  1AWB A;  1G0H A;  3Q28 A;  1BIY A;  3PPP A;  1EYI A;  2X7P A;  3KN8 A;  3T9X B;  4YKI A;  3MZB A;  3H6W A;  5I58 A;  2B3B A;  3U65 A;  4O7I A;  2B3F A;  3FJG A;  2P1S A;  4HCY A;  4YU0 A;  3GZG A;  1NMU A;  2OZZ A;  1TT1 A;  1LGB C;  1FTL A;  1ZJL A;  4N91 A;  3IR1 A;  4BDR A;  3TTR A;  2F3D A;  3KN3 A;  5I2N B;  3VXB A;  3SEU A;  3OO7 A;  3ILT B;  2QVU A;  3FUZ A;  2V84 A;  2F97 A;  3PV0 E;  3MPL A;  4RPN A;  4AQ4 A;  1DPE A;  3KBZ A;  2ZZW A;  3KN7 A;  5I2K A;  1MQD A;  1AL3 A;  2PFY A;  2OX3 A;  3FVG A;  3TFL A;  5FTI A;  4GL0 A;  3QK6 A;  5BUU A;  4JSO A;  3K6V A;  2XXX A;  3OXN A;  3G3H A;  1B7H A;  2HEU A;  1FPI A;  3R7X A;  4KD5 A;  1EZ9 A;  3U92 A;  3IJX B;  1J1N A;  3OSR A;  3O2A A;  1I69 A;  4E0X A;  4MHF A;  2R8T A;  4YKJ A;  3HN0 A;  1FBP A;  4OER A;  1ELJ A;  2Q2C A;  5AA4 A;  4GXS B;  3USD A;  3IOW A;  1B1H A;  4FJP A;  2UVG A;  4IY6 A;  1IXC A;  2Z8F A;  2FYI A;  3E9X A;  2XHD A;  4R9F A;  2CEX A;  4NMY A;  3IOU A;  4LA9 A;  3DM0 A;  4MX6 A;  3U94 A;  4OES A;  3MW0 A;  1JEU A;  5ET5 A;  3FV1 A;  4R73 A;  2XD2 A;  3P7I A;  4H46 A;  3BFU A;  4QF9 A;  3TEP A;  2H25 A;  4IGT A;  1MDQ A;  2B65 A;  2H99 A;  4G61 A;  3TEL A;  5ICQ A;  4ELP A;  1M5E A;  2OCU A;  1B0H A;  2QMW A;  4GOT A;  3O28 A;  3PPO A;  3LSL A;  3V89 B;  4QFN A;  3NOH A;  1KA0 A;  1S50 A;  2OWZ A;  4WXJ A;  5ICT A;  5I84 A;  4IO6 A;  4Q30 B;  3H6V A;  1PEB A;  1NV2 A;  1LBC A;  1ZBM A;  1Y9U A;  1Q35 A;  1Y4T A;  5IGA A;  1FBC A;  3VVE A;  1DMB A;  3DP6 A;  4JWO A;  2ZMB A;  1B46 A;  3ZKL A;  3RNN A;  2BJJ X;  1GV8 A;  1XS5 A;  4R6K A;  1MQI A;  2HQ0 A;  2AL4 A;  1LAF E;  3PU5 A;  4Q8R A;  4ELO A;  3MVX A;  1AOV A;  1SPI A;  1KA1 A;  1QKA A;  1FTA A;  2GH9 A;  4OTE A;  1SW2 A;  1Y3N A;  2QRY A;  5LDZ A;  3OD7 A;  2O51 A;  1DBZ A;  4GRK A;  3FVO A;  4OFJ A;  1BP5 A;  3EF7 A;  2VHA A;  4O8M A;  4F3S A;  4G4P A;  1FBE A;  5T3J A;  1A8F A;  3OEK A;  1SW4 A;  2V25 A;  3KOS A;  4LZ5 A;  1ZLQ A;  1NV3 A;  2Q89 A;  4FED A;  1R6Z A;  3UIF A;  4LZ7 A;  2Y7R A;  4P3L A;  5A5X A;  1URG A;  4H1X A;  3LUY A;  4OFO A;  4F29 A;  3PD8 A;  4MF3 A;  3H7M A;  3WAE A;  1NNK A;  3LR1 A;  2DWJ A;  2I48 A;  3MQ9 A;  3N6U A;  1Q1K A;  5CBR A;  2D3I A;  3RTF B;  3O6I A;  4KYE A;  5H8F B;  2F78 A;  4N17 A;  3QAX A;  5AA2 A;  1L5T A;  3RPL B;  5CC2 A;  1NUZ A;  3RUM A;  1XVX A;  2P0S A;  1WOD A;  1JP4 A;  3PUW E;  3G3I A;  4RXL A;  1JW1 A;  5H8Q A;  4BDL A;  3FVK A;  2VT5 A;  1USY E;  4WKM A;  3C31 A;  3Q25 A;  2DDK A;  1A54 A;  2UXA A;  3RTW B;  2FVZ A;  1MY1 A;  4R75 A;  1IEJ A;  4HE2 A;  3K6W A;  4GWU A;  4ND9 A;  1QVS A;  5DW8 A;  3RY3 A;  4L17 A;  2X7Q A;  2XXR A;  5CMK A;  4P9K A;  4EQB A;  1RDX A;  2ZYN A;  1VE4 A;  3IO6 A;  4LQ5 A;  4PCD A;  1N7W A;  2Q2A A;  4G2Z A;  1MM6 A;  4R2F A;  2FIX A;  3CHG A;  4HXV A;  1XHY A;  2I4B A;  2ESN A;  4ZZE A;  1JEV A;  1SI0 A;  2O6A A;  2QVV A;  5I2N A;  4O3C A;  4JWY A;  5J1D A;  3MVW A;  2WX9 A;  2OLB A;  3CFX A;  2DS9 A;  5ITO A;  5L9S A;  4F1U A;  3OO9 A;  4RK2 A;  4GL8 A;  3I5O A;  2YLN A;  2CMO A;  2HCA A;  4XXU A;  3ONM A;  3HV1 A;  3FXU A;  3AXF A;  3G7W A;  1OMP A;  3BFT A;  3G3G A;  4PF8 A;  3VDF A;  3A3C A;  4IO4 A;  3S9L C;  3O6H A;  5CI5 A;  4DZ1 A;  5IAI A;  3SEW A;  1IXI A;  5H8N B;  3K1N A;  3RT8 A;  3TDJ A;  3K2D A;  5IZZ A;  2PYY A;  3FGS A;  2D21 A;  4EF2 A;  4GQO A;  1NUX A;  2UYE A;  1OQH A;  2ANJ A;  2UYF A;  4EDP A;  4ZED A;  2QFL A;  4PC9 A;  2QVR A;  1O64 A;  1GTK A;  1Y1Z A;  2H9B A;  4M4G A;  4NF8 A;  5I7I A;  3E78 A;  2XXH A;  2ZNU A;  1D9V A;  3SDF A;  3VFJ A;  5B7D A;  1MRP A;  1QKB A;  2LAO A;  5AA3 A;  1PB7 A;  5TPA B;  4H5F A;  1TXF A;  3QSL A;  2E0S A;  4ELQ A;  4UA8 A;  4N6D A;  1B4H A;  1B3L A;  3HFU A;  3K01 A;  1RYO A;  4POW A;  1NV5 A;  4C1T A;  2F3B A;  4R9G A;  4I3E A;  4EXK A;  4G8H A;  5FHN A;  1MDP 1;  3SEY A;  2AYS A;  3RQT A;  1MXW A;  3TUS A;  5I56 B;  4YAH X;  1FBH A;  3KBR A;  3C32 A;  5I57 B;  1MH3 A;  3QUJ A;  1OLA A;  5TP9 B;  1KZ8 A;  1MXV A;  1H45 A;  1URS A;  2ALU A;  3THI A;  5DVI A;  3I3V A;  1PC3 A;  1Y1M A;  4MNC A;  4R6H A;  4XIG Q;  1SD3 A;  3W9W A;  5IZ3 A;  3TTK A;  4HS7 A;  3V8X B;  3CVG A;  4KQP A;  3T96 B;  3CG1 A;  4N8G A;  2UVJ A;  4QFK A;  4RPO A;  4P47 A;  4QFP A;  4C0R A;  4F1V A;  1VSO A;  3KZG A;  1N0T A;  4MJO A;  4EQ9 A;  1IIW A;  3O66 A;  2XWO A;  5DT6 A;  5KCJ A;  2VD3 A;  4F31 B;  1N3X A;  2Y7K A;  1CNQ A;  1LFG A;  3OEL A;  4P8B A;  3UOR A;  5DTB A;  1OIB A;  4OAN A;  4O94 A;  1H44 A;  2Q8M A;  2F6P A;  4HE1 A;  4PDD A;  3IFA A;  4ECF A;  3TPA A;  4FIM A;  5KZT A;  2Y7I A;  2DVC A;  2H5Y A;  3PUX E;  4FBP A;  1JQF A;  2CZH A;  3CIJ A;  1WDN A;  2QSX A;  2Y5K A;  3HHG A;  4U21 A;  4HW8 A;  2O69 A;  3RT6 B;  4BDQ A;  3UP9 A;  3UK4 A;  3M3F A;  2M8C A;  1D9Y A;  3B8B A;  3EQ1 A;  4UAC A;  1YYZ A;  4JBZ A;  1OQG A;  3CSB A;  4OVS A;  3W15 C;  4I3Y A;  3C9H A;  5AA1 A;  4NF4 B;  1IZ1 A;  4OVP A;  4R74 A;  1EH3 A;  3SER A;  3MC2 A;  1IXG A;  1HSJ A;  4DLD A;  5JTY B;  2O68 A;  1FSA A;  4N6K A;  5DEX A;  4DCY A;  2FA7 A;  4RNS A;  2Q8J A;  4ZDM A;  3IFC A;  1ANF A;  1R9Q A;  1VDW A;  4F19 A;  3MAM A;  3K0V A;  2YJP A;  3TMG A;  2I49 A;  1IXH A;  3MJN A;  4PFY A;  2F7A A;  1B3H A;  4ESX A;  5A5L A;  2W7Y A;  4XFE A;  4N4U A;  4DI4 B;  2QMX A;  4XEQ A;  4XTC Q;  3H03 A;  2I0C A;  3PMW A;  4NF6 A;  1P1O A;  3IB2 A;  3U1O A;  2H98 A;  1QGX A;  1GR2 A;  2QS2 A;  3LSW A;  4OFL A;  1R9L A;  3Q27 A;  1US4 A;  1FQD A;  4XKN A;  4ZE9 A;  4PFB A;  5LTC A;  3HST A;  3PUZ E;  2O1L A;  1IQ7 A;  3EHS A;  1I6B A;  4GWZ A;  2FHY A;  3CG3 A;  2QJE A;  3ZS6 A;  1LEV A;  3A3U A;  2G29 A;  3T93 B;  1K9Z A;  1FW0 A;  1N7X A;  4YB5 A;  4RYA A;  2JJK A;  2ZZV A;  1ZMG A;  1FTK A;  3FZV A;  4NF5 A;  3GYY A;  4JXI A;  1N3W A;  3E4R A;  4NHB A;  4OVQ A;  4ZEF A;  1JNF A;  4U1Z A;  1FBD A;  1LAG E;  4GX3 A;  4ZS9 A;  2NWJ A;  1SYI A;  2RCB A;  4N15 A;  3W9V A;  1AIV A;  1XT8 A;  3JYR A;  5H8H B;  4MFI A;  3CFL A;  1LBW A;  3RGY A;  2HZK A;  3WAF A;  1FJ9 A;  1S9T A;  1USY H;  2E1S A;  2XX8 A;  1IMF A;  4G68 B;  5TPA A;  4FEB A;  1B3E A;  3QXM A;  3KC0 A;  1JW4 A;  3KOT A;  4DXC A;  1MY0 A;  1DPP A;  3N6T A;  4NN3 A;  2DE4 A;  1DTG A;  4PGN A;  3FXB A;  4JDF A;  4XKQ A;  5BWJ A;  2RC9 A;  4GVO A;  4OWD A;  2HAU A;  4OEU A;  1MXU A;  2ZYM A;  3EPE A;  1A8E A;  4QFO A;  4R6Y A;  1MPC A;  1JW5 A;  1A55 A;  3E79 A;  3S2V A;  3SKP A;  3T22 A;  3O97 A;  5DVF A;  2F5X A;  4G68 C;  5EQ8 A;  4DXB A;  5TP9 A;  1F9B A;  1IMB A;  4U2R A;  3U8Q A;  2Q9T A;  3D1R A;  1MQJ A;  2DYX A;  2P3N A;  4PF6 A;  2WEF A;  1MS7 A;  5I5P A;  4G77 A;  2WBB A;  1IUD A;  4QFL A;  2GFE A;  4NED A;  1WVJ A;  3T9H B;  1XOC A;  2HHM A;  2CZL A;  4I9D A;  3IOT A;  4PFT A;  3N5L A;  4E0W A;  3FXR A;  2THI A;  4X9T A;  1NKX A;  3CI8 A;  1QUL A;  4IO7 A;  2WBD A;  4P1E A;  4R2B A;  1IMC A;  3KSJ A;  5EQA A;  4GBV A;  1LAH E;  2CZI A;  1NI9 A;  3B6W A;  4HTG A;  1B9J A;  4EF1 A;  4PFR A;  4F39 A;  1B3G A;  4GFR A;  4IGR A;  2X26 A;  5I3S A;  4KHZ E;  4U4S A;  2Q88 A;  2ONK E;  4JSD A;  2GHB A;  3SEV A;  2XXK A;  1FQE A;  1FTM A;  4KCC A;  3E3K A;  3HO7 A;  4RY1 A;  1B51 A;  5JK4 A;  5CM6 A;  3VLV A;  4GX6 A;  1FQA A;  1XVY A;  3UN6 A;  4IY5 A;  1BK4 A;  2G93 A;  1GVC A;  1B7Z A;  5HBC A;  4QSD A;  4OEV A;  1MXY A;  2AIX A;  1I6A A;  4AB6 A;  4LUB A;  4GBW A;  4MCO A;  4JVD A;  1NNF A;  3U72 A;  1S7Y A;  1LBX A;  2NOO A;  3TZA A;  3B50 A;  1NUY A;  2UVH A;  4N07 A;  4GLI A;  1B05 A;  2HPG A;  1BLF A;  2Y5L A;  3PTY A;  1PBQ A;  4NF4 A;  4F1Y A;  1JET A;  3TCH A;  3MPK A;  1FQB A;  2B4M A;  2XWI A;  1IMA A;  3N94 A;  4NQ8 A;  2REJ A;  1EZO A;  3PPQ A;  5I58 B;  1M5B A;  2NUV A;  2XXY A;  1NV1 A;  4Z7E A;  4X8R A;  4MLQ A;  1G0I A;  1DSN A;  5HM4 B;  4BDN A;  4NF0 A;  1FTJ A;  1MY2 A;  4U4X A;  5CMM A;  4LZ8 A;  1B5I A;  4MBP A;  3ISP A;  4MIJ A;  4ZEI A;  1OVB A;  2PBW A;  3H4Z A;  3G3J A;  3B6T A;  4YMA A;  4OXV A;  3PPN A;  3KC1 A;  1M5C A;  3PUV E;  4IO3 A;  2V93 A;  3QUF A;  1P1N A;  5CBS A;  4Q5T A;  1QUJ A;  3TKD A;  3F11 A;  1N76 A;  4GWS A;  1ZTY A;  2NVU B;  3OSQ A;  2PMS A;  1BTJ A;  4THI A;  4U22 A;  3QMF A;  1QJM A;  4RJZ A;  3PPR A;  1O63 A;  4G8N A;  1FPK A;  2DQV A;  1EU8 A;  1TFD A;  4QBA A;  3D4G A;  1YXI A;  2HAV A;  4DE8 A;  1TWY A;  1FBG A;  3VLU A;  2XD3 A;  2XX9 A;  3RYD A;  3TCF A;  1B40 A;  2RCA A;  1DTZ A;  5HPQ A;  4QSC A;  5AA4 B;  3SEX A;  3UA8 A;  5CMB A;  1A99 A;  3QYT A;  3MYU A;  4LQ2 A;  4MH5 A;  1EZP A;  2OK2 A;  4Q0C A;  4PBH A;  2DXY A;  3B7D A;  1SW1 A;  3I6V A;  2Q74 A;  1OLC A;  3LBS A;  4KI0 E;  3HCQ A;  3TTL A;  2ZXT A;  1Z7N E;  2DWA A;  1LB9 A;  3JZJ A;  1A40 A;  3R26 A;  4H45 A;  1UTH B;  3K1P A;  3MVZ A;  2RC8 A;  1YZ0 A;  3FXQ A;  4G68 A;  1JVY A;  3VV5 A;  5IKB A;  2PT2 A;  4PBQ A;  4IO2 A;  1MPD A;  2VP1 A;  4QRZ A;  2XXU A;  4ESW A;  1P1Q A;  1PB9 A;  4H0W A;  3A29 A;  3KJT A;  1LBB A;  1Y3Q A;  3Q26 A;  3VXC A;  4JVI A;  4ONY A;  2ZNT A;  2O84 X;  3SES A;  2MKZ A;  1NH8 A;  5JEI A;  4YIC A;  1Y3P A;  4XF5 A;  3MUQ A;  4DCX A;  5EHS A;  1H76 A;  5LOM A;  3E13 X;  3MBP A;  4N13 A;  3MST A;  4FOR A;  4ZEK A;  1ZKB A;  1B0L A;  3IB1 A;  2DOJ A;  1LLS A;  3BBR A;  4QXD A;  1LBV A;  1DCU A;  2XX7 A;  2P3V A;  3DLN A;  3G3F A;  5CMC A;  3CFZ A;  2OWT A;  2PVU A;  4NAP A;  2A5T B;  4P1L A;  4H65 A;  1SW5 A;  3B6Q A;  4F3P A;  4WED A;  3FIR A;  1N04 A;  4F2O A;  4OZ9 A;  3KGC A;  3L6H A;  4EUO A;  4FE8 A;  2XWV A;  3JV9 A;  4PP0 A;  3K6X A;  2WYP A;  4YKK A;  3V5A A;  3IX1 A;  4QHQ A;  1M5F A;  1FTO A;  4UAB A;  1LCT A;  1DK4 A;  1K9Y A;  2IEE A;  3O29 A;  3CR9 A;  3OEN A;  5A5X B;  3C4M A;  2XXW A;  4KYS A;  1UQW A;  2Z22 A;  3VVF A;  2Y7P A;  3CRB A;  4POX A;  5ET6 A;  2RC7 A;  5H8F A;  1B5H A;  3DP4 A;  1QUK A;  1LBZ A;  3RPL A;  2OWS A;  3FJM A;  3EHU A;  3VVD A;  3TAJ A;  2O1M A;  3FJ7 A;  5F1Q A;  3SZP A;  2XXP A;  4K3F A;  4NG7 A;  1FQC A;  1EYJ A;  4KFQ A;  3MP6 A;  3OO8 A;  4OEN A;  2IA4 A;  4XKP A;  3TCG A;  3C36 A;  5H8Q B;  4ZEC A;  4OVT A;  2ABH A;  1B4Z A;  4PTK A;  3FAT A;  4R72 A;  5L9O A;  1SYH A;  3BIH A;  4PDH A;  1Y4C A;  4NWC A;  1AMF A;  2VD2 A;  3FBP A;  5EHM A;  1YTV A;  5FTH A;  4YMB A;  3GBB A;  3IJO B;  1B1X A;  1B52 A;  1VR5 A;  3OOA A;  3IK6 B;  2D5W A;  4ISU A;  4PAK A;  4DIG A;  2VPN A;  3TTM A;  4XKR A;  1UIV A;  3GXA A;  3T66 A;  3L6G A;  2F34 A;  3IAZ A;  2V3U A;  3Q29 A;  1MY3 A;  3PMV A;  4GWX A;  4KPT A;  2REG A;  4GX4 A;  2ZZX A;  3G3K A;  5ET8 A;  5KDT B;  2PCR A;  2DWI A;  4NWD A;  5IM2 A;  1KWH A;  3OO6 A;  1N84 A;  3KJ7 A;  3HHF A;  1NUW A;  3FVN A;  2XXI A;  3BKI B;  1SI1 A;  4PET A;  1D4N A;  1CB6 A;  2BJI A;  1NV7 A;  1II5 A;  3D4C A;  5H8N A;  5EYF A;  4H67 A;  1Y20 A;  2PX1 A;  4RA1 A;  5FHO A;  5DVJ A;  4YB7 A;  4ZE8 A;  1B6H A;  4IB2 A;  3OEM A;  2B4L A;  3PMX A;  4MLV A;  1AH5 A;  5I59 B;  3A09 A;  5EQ9 A;  4PAI A;  4AS5 A;  3N26 A;  1B32 A;  4OMB A;  4PGP A;  1O7T A;  3LUZ A;  5DYH A;  2XWK A;  1UTB B;  1FPE A;  2DSF A;  4JWX A;  1RYX A;  1NH7 A;  1SVX B;  1MXX A;  1US5 A;  4NGU A;  2I3V A;  1NV6 A;  4PE3 A;  5K2Y A;  3K6U A;  1HSE A;  4H8I A;  1IME A;  1FCK A;  4GWW A;  1POY 1;  4NF8 B;  1XC1 A;  1NV0 A;  2DE2 A;  5ELV A;  5FBP A;  2RKM A;  4N81 A;  3ECR A;  3T9V A;  3TQW A;  4BLA A;  1UTH A;  3R6U A;  4G8M A;  1D9Q A;  4AS4 A;  1INP A;  2HXW A;  4TLM B;  4X04 A;  1YPN A;  2L5V A;  1UIU A;  4BDO A;  1IIT A;  4MMP A;  2R6G E;  4NTL A;  4YB6 A;  1SDX A;  2KQZ A;  5I56 A;  4IR8 A;  2HXR A;  2V4C A;  2VPO A;  1MPB A;  3O6G A;  5I57 A;  1MQH A;  1FPG A;  1SBP A;  1VFE A;  5EQ7 A;  1DOT A;  5ESY A;  4DDD A;  1NFT A;  4PE5 B;  1Z7M E;  1I6Q A;  2VOZ A;  2Y84 A;  1LAX A;  4PFU A;  3KEI A;  4X1D A;  1NNT A;  2V3T A;  4PFW A;  5AE4 A;  3MVY A;  4M1V A;  3DEL B;  2ZYK A;  5IZ3 B;  1BKA A;  4O7M A;  5H8S A;  4FAT A;  2A5T A;  3T0J A;  2Z8E A;  3RPW A;  4GWY A;  3LSX A;  1RKM A;  2DWH A;  4GIZ A;  5KCJ B;  1FRP A;  5F24 A;  4U1O A;  2V3Q A;  4LON B;  2HZL A;  3MP8 A;  4OYV A;  2DP8 A;  3S4U A;  2XXV A;  4RK9 A;  3IOR A;  3C34 A;  1D3K A;  1MXZ A;  3LC8 A;  1QW0 A;  1QUI A;  1B3F A;  3TOD A;  1FBF A;  3DP8 A;  4P11 A;  1URD A;  2OBG A;  3K00 A;  5CRY A;  2Y7W A;  3T9U A;  4P56 A;  3H6T A;  2ZYO A;  4P0I A;  3V83 A;  1B58 A;  4P0G A;  1MH4 A;  4YZZ A;  1PB8 A;  5ET7 A;  3KG2 A;  3C35 A;  3EKI A;  1ZIU A;  3S9E A;  2F7C A;  3CSG A;  4OVJ A;  2ONR A;  5EYG A;  2CZK A;  1YAE A;  2I6E A;  4OQO A;  3GLB A;  5K2X A;  4F3B A;  3FD3 A;  1MM7 A;  2H4I A;  4OVR A;  1T0K A;  3K4U A;  4MEV A;  4NE4 A;  1Q9D A;  1B5J A;  2R71 A;  4H5G A;  3T1B A;  1TFA A;  2GHA A;  3M3K A;  4X48 A;  3FAS A;  4DXU A;  3O9P A;  5JTY A;  3H6U A;  2FBP A;  4LP2 B;  1NV4 A;  3C33 A;  1YCJ A;  1MQG A;  1LFI A;  1LCF A;  1JVX A;  2QL3 A;  5DEX B;  4O3A A;  1R1N A;  1ZU0 A;  2QS1 A;  4PFI A;  1FQF A;  1FPF A;  2WKY A;  1H43 A;  4F3G A;  2F36 A;  3PUY E;  3OMB A; 
#chains in the Genus database with same CATH homology
 4JB7 A;  5L9M A;  5ISU A;  3ZSF A;  2R9J A;  2AL5 A;  1MG1 A;  4NF6 B;  5KDT A;  3S9N C;  3IOV A;  5I2K B;  2UVI A;  3MZ1 A;  1POT A;  2RIN A;  2RF1 A;  2Z23 A;  4FEC A;  4LAT A;  4GXA A;  3KFM A;  3KSX A;  3H3G A;  2FNC A;  3LSF B;  1HSL A;  4GF8 A;  2XXQ A;  4I8C A;  4IO5 A;  3K02 A;  5I59 A;  3UGW A;  2QPQ A;  4C1U A;  2F6G A;  1UTB A;  2KLF A;  2OJT A;  1GGG A;  1LST A;  3ZKK A;  4NF5 B;  1P1U A;  3M8U A;  2I3W A;  2XXT A;  4F2Q A;  3EN3 A;  3QIM A;  3RLF E;  5H8H A;  2DXR A;  4LVQ A;  1NL5 A;  3GBA A;  2QS3 A;  2O7U A;  1A7L A;  1B7U A;  1PDA A;  4OET A;  2QS4 A;  5L8D A;  4KYD A;  4TQU Q;  3TTN A;  5TU0 A;  5FHM A;  1M5D A;  2I4C A;  2DVZ A;  4GWO A;  1NNP A;  3PGF A;  4H8J A;  4YKP A;  1B2H A;  4GD5 A;  3EHT A;  4Z0I A;  3VLW A;  4I62 A;  4F18 A;  2F7B A;  1SQY A;  4PQJ A;  1VFD A;  3MP1 A;  3MZ9 A;  2I58 A;  5B70 A;  2YPN A;  4AB5 A;  5F7V A;  2I0B A;  4EXL A;  4N6P A;  4O3B A;  1OVT A;  4FAJ A;  2ZNS A;  2P2A A;  2GRV A;  3IL1 B;  4HCW A;  3HPI A;  3TYH A;  2F35 A;  3TQL A;  1P99 A;  4ZZA A;  3M3L A;  3ODB A;  3U93 A;  1LB8 A;  4EQ7 A;  2NXO A;  4BDM A;  3PD9 A;  3K1M A;  2HFB A;  3H06 B;  1LFH A;  3IB0 A;  5ITP A;  4I1D A;  1P1W A;  4ELR A;  2PT1 A;  5M2V A;  4KCD A;  4U23 A;  1ATG A;  3SET A;  2O7I A;  4ZEB A;  1PBP A;  4QSE A;  2A5S A;  2VGQ A;  3FV2 A;  3S9M C;  1H3D A;  5AA2 B;  2F8D A;  3VE1 B;  3IO4 A;  1CE2 A;  2ONS A;  4X1B A;  3MWB A;  4H6D A;  4OHN A;  3ILU B;  4KR5 A;  2DE3 A;  1MY4 A;  2Z8D A;  4WEP A;  4TLL B;  5AA2 D;  4F22 A;  4TOZ A;  3RN8 A;  3Q28 A;  1BIY A;  3PPP A;  2X7P A;  3T9X B;  3KN8 A;  4YKI A;  3MZB A;  3H6W A;  5I58 A;  2B3B A;  2B3F A;  3FJG A;  2P1S A;  4HCY A;  4YU0 A;  3GZG A;  1NMU A;  2OZZ A;  1TT1 A;  1LGB C;  1FTL A;  1ZJL A;  3IR1 A;  4BDR A;  3TTR A;  3KN3 A;  5I2N B;  3VXB A;  3SEU A;  3OO7 A;  3ILT B;  3FUZ A;  2V84 A;  2F97 A;  3PV0 E;  3MPL A;  4RPN A;  4AQ4 A;  1DPE A;  3KN7 A;  5I2K A;  1MQD A;  1AL3 A;  3FVG A;  3TFL A;  5FTI A;  4GL0 A;  3QK6 A;  5BUU A;  4JSO A;  3K6V A;  2XXX A;  3OXN A;  3G3H A;  1B7H A;  2HEU A;  3R7X A;  4KD5 A;  1EZ9 A;  3U92 A;  3IJX B;  1J1N A;  3OSR A;  4E0X A;  1I69 A;  3O2A A;  4YKJ A;  3HN0 A;  4OER A;  1ELJ A;  2Q2C A;  5AA4 A;  4GXS B;  3USD A;  3IOW A;  1B1H A;  4FJP A;  2UVG A;  4IY6 A;  1IXC A;  2Z8F A;  2FYI A;  3E9X A;  2XHD A;  4R9F A;  4NMY A;  3IOU A;  4LA9 A;  3DM0 A;  3U94 A;  4OES A;  3MW0 A;  1JEU A;  3FV1 A;  4R73 A;  2XD2 A;  3P7I A;  3BFU A;  4QF9 A;  3TEP A;  2H25 A;  4IGT A;  1MDQ A;  2B65 A;  2H99 A;  3TEL A;  5ICQ A;  4ELP A;  1M5E A;  2OCU A;  1B0H A;  2QMW A;  4GOT A;  3O28 A;  3PPO A;  3LSL A;  3V89 B;  4QFN A;  1S50 A;  4WXJ A;  5ICT A;  5I84 A;  4IO6 A;  4Q30 B;  3H6V A;  1PEB A;  1LBC A;  1ZBM A;  1Y9U A;  1Q35 A;  1Y4T A;  3VVE A;  1DMB A;  3DP6 A;  4JWO A;  2ZMB A;  1B46 A;  3ZKL A;  3RNN A;  2BJJ X;  1GV8 A;  1XS5 A;  4R6K A;  1MQI A;  2HQ0 A;  2AL4 A;  1LAF E;  4Q8R A;  3PU5 A;  4ELO A;  3MVX A;  1AOV A;  1QKA A;  2GH9 A;  4OTE A;  1SW2 A;  1Y3N A;  2QRY A;  3OD7 A;  2O51 A;  4GRK A;  3FVO A;  4OFJ A;  1BP5 A;  3EF7 A;  2VHA A;  4F3S A;  4G4P A;  1A8F A;  3OEK A;  1SW4 A;  2V25 A;  3KOS A;  4LZ5 A;  1ZLQ A;  2Q89 A;  4FED A;  1R6Z A;  3UIF A;  4LZ7 A;  2Y7R A;  5A5X A;  1URG A;  4H1X A;  3LUY A;  4OFO A;  4F29 A;  3PD8 A;  4MF3 A;  3H7M A;  3WAE A;  1NNK A;  3LR1 A;  2DWJ A;  2I48 A;  3MQ9 A;  3N6U A;  1Q1K A;  5CBR A;  2D3I A;  3RTF B;  3O6I A;  4KYE A;  5H8F B;  2F78 A;  3QAX A;  5AA2 A;  1L5T A;  5CC2 A;  3RUM A;  1XVX A;  2P0S A;  1WOD A;  3PUW E;  3G3I A;  4RXL A;  1JW1 A;  5H8Q A;  4BDL A;  3FVK A;  1USY E;  4WKM A;  3C31 A;  3Q25 A;  1A54 A;  2UXA A;  3RTW B;  1MY1 A;  4R75 A;  1IEJ A;  3K6W A;  4ND9 A;  1QVS A;  3RY3 A;  4L17 A;  2X7Q A;  2XXR A;  5CMK A;  4EQB A;  2ZYN A;  1VE4 A;  3IO6 A;  4LQ5 A;  1N7W A;  2Q2A A;  4G2Z A;  1MM6 A;  4R2F A;  1XHY A;  2I4B A;  2ESN A;  4ZZE A;  1JEV A;  1SI0 A;  2O6A A;  5I2N A;  4O3C A;  4JWY A;  5J1D A;  3MVW A;  2OLB A;  3CFX A;  2DS9 A;  5ITO A;  5L9S A;  4F1U A;  3OO9 A;  4RK2 A;  4GL8 A;  3I5O A;  2YLN A;  2CMO A;  2HCA A;  4XXU A;  3ONM A;  3HV1 A;  3FXU A;  3AXF A;  3G7W A;  1OMP A;  3BFT A;  3G3G A;  3VDF A;  3A3C A;  4IO4 A;  3S9L C;  3O6H A;  5CI5 A;  4DZ1 A;  5IAI A;  3SEW A;  1IXI A;  5H8N B;  3K1N A;  3RT8 A;  3TDJ A;  3K2D A;  2PYY A;  3FGS A;  2D21 A;  4EF2 A;  4GQO A;  2UYE A;  1OQH A;  2ANJ A;  2UYF A;  4EDP A;  4ZED A;  1O64 A;  1GTK A;  1Y1Z A;  2H9B A;  4M4G A;  4NF8 A;  2XXH A;  2ZNU A;  1D9V A;  3SDF A;  3VFJ A;  5B7D A;  1MRP A;  1QKB A;  2LAO A;  5AA3 A;  1PB7 A;  5TPA B;  4H5F A;  1TXF A;  3QSL A;  2E0S A;  4ELQ A;  4UA8 A;  1B4H A;  1B3L A;  3K01 A;  1RYO A;  4POW A;  4C1T A;  4R9G A;  4EXK A;  4G8H A;  5FHN A;  1MDP 1;  3SEY A;  2AYS A;  3RQT A;  1MXW A;  3TUS A;  5I56 B;  4YAH X;  3KBR A;  3C32 A;  5I57 B;  1MH3 A;  3QUJ A;  1OLA A;  5TP9 B;  1MXV A;  1H45 A;  1URS A;  3THI A;  2ALU A;  5DVI A;  3I3V A;  1PC3 A;  1Y1M A;  4R6H A;  4XIG Q;  1SD3 A;  3W9W A;  3TTK A;  4HS7 A;  3V8X B;  3CVG A;  4KQP A;  3T96 B;  3CG1 A;  2UVJ A;  4QFK A;  4RPO A;  4QFP A;  4C0R A;  4F1V A;  1VSO A;  3KZG A;  1N0T A;  4EQ9 A;  1IIW A;  3O66 A;  5DT6 A;  5KCJ A;  2VD3 A;  4F31 B;  1N3X A;  2Y7K A;  1LFG A;  3OEL A;  3UOR A;  5DTB A;  1OIB A;  1H44 A;  2F6P A;  4ECF A;  3TPA A;  4FIM A;  5KZT A;  2Y7I A;  2DVC A;  2H5Y A;  3PUX E;  1JQF A;  3CIJ A;  1WDN A;  2QSX A;  3HHG A;  4U21 A;  4HW8 A;  2O69 A;  3RT6 B;  4BDQ A;  3UP9 A;  3UK4 A;  3M3F A;  2M8C A;  1D9Y A;  3EQ1 A;  4UAC A;  4JBZ A;  1OQG A;  3CSB A;  3W15 C;  3C9H A;  5AA1 A;  4NF4 B;  1IZ1 A;  4R74 A;  1EH3 A;  3SER A;  3MC2 A;  1IXG A;  1HSJ A;  4DLD A;  5JTY B;  2O68 A;  5DEX A;  4DCY A;  2FA7 A;  4RNS A;  2Q8J A;  4ZDM A;  1ANF A;  1R9Q A;  4F19 A;  3MAM A;  3K0V A;  2YJP A;  3TMG A;  2I49 A;  1IXH A;  3MJN A;  4PFY A;  2F7A A;  1B3H A;  4ESX A;  2W7Y A;  2QMX A;  4XTC Q;  3H03 A;  2I0C A;  3PMW A;  4NF6 A;  1P1O A;  3IB2 A;  3U1O A;  2H98 A;  1GR2 A;  2QS2 A;  3LSW A;  4OFL A;  1R9L A;  3Q27 A;  1US4 A;  1FQD A;  4XKN A;  4ZE9 A;  3HST A;  3PUZ E;  2O1L A;  1IQ7 A;  3EHS A;  1I6B A;  3CG3 A;  2QJE A;  3ZS6 A;  3A3U A;  2G29 A;  3T93 B;  1FW0 A;  1N7X A;  4YB5 A;  4RYA A;  1ZMG A;  1FTK A;  3FZV A;  4NF5 A;  4JXI A;  1N3W A;  3E4R A;  4ZEF A;  1JNF A;  4U1Z A;  1LAG E;  4ZS9 A;  2NWJ A;  1SYI A;  2RCB A;  3W9V A;  1AIV A;  1XT8 A;  3JYR A;  5H8H B;  4MFI A;  3CFL A;  3RGY A;  2HZK A;  3WAF A;  1S9T A;  1USY H;  2E1S A;  2XX8 A;  4G68 B;  5TPA A;  4FEB A;  1B3E A;  3QXM A;  1JW4 A;  3KOT A;  4DXC A;  1MY0 A;  1DPP A;  3N6T A;  2DE4 A;  1DTG A;  4JDF A;  4XKQ A;  5BWJ A;  2RC9 A;  4GVO A;  4OWD A;  2HAU A;  4OEU A;  1MXU A;  2ZYM A;  3EPE A;  1A8E A;  4QFO A;  4R6Y A;  1MPC A;  1JW5 A;  1A55 A;  3S2V A;  3SKP A;  3T22 A;  3O97 A;  5DVF A;  2F5X A;  4G68 C;  4DXB A;  5TP9 A;  1F9B A;  4U2R A;  3U8Q A;  2Q9T A;  1MQJ A;  2DYX A;  1MS7 A;  4G77 A;  1IUD A;  4QFL A;  2GFE A;  4NED A;  1WVJ A;  3T9H B;  1XOC A;  2CZL A;  4I9D A;  3IOT A;  4PFT A;  3N5L A;  4E0W A;  3FXR A;  2THI A;  4X9T A;  1NKX A;  3CI8 A;  1QUL A;  4IO7 A;  4R2B A;  3KSJ A;  1LAH E;  3B6W A;  4HTG A;  1B9J A;  4EF1 A;  4F39 A;  1B3G A;  4GFR A;  4IGR A;  2X26 A;  4KHZ E;  4U4S A;  2Q88 A;  2ONK E;  4JSD A;  2GHB A;  3SEV A;  1FQE A;  1FTM A;  4KCC A;  3E3K A;  3HO7 A;  4RY1 A;  1B51 A;  5JK4 A;  5CM6 A;  3VLV A;  1FQA A;  1XVY A;  3UN6 A;  4IY5 A;  2G93 A;  1GVC A;  1B7Z A;  5HBC A;  4QSD A;  4OEV A;  1MXY A;  2AIX A;  1I6A A;  4AB6 A;  4LUB A;  1NNF A;  3U72 A;  1S7Y A;  2NOO A;  3TZA A;  2UVH A;  4N07 A;  4GLI A;  1B05 A;  1BLF A;  1PBQ A;  4NF4 A;  4F1Y A;  1JET A;  3TCH A;  3MPK A;  1FQB A;  3N94 A;  2REJ A;  1EZO A;  3PPQ A;  5I58 B;  1M5B A;  2NUV A;  2XXY A;  4Z7E A;  4MLQ A;  1DSN A;  5HM4 B;  4BDN A;  1FTJ A;  1MY2 A;  4U4X A;  5CMM A;  4LZ8 A;  1B5I A;  4MBP A;  4ZEI A;  1OVB A;  2PBW A;  3H4Z A;  3G3J A;  3B6T A;  4YMA A;  4OXV A;  3PPN A;  1M5C A;  3PUV E;  4IO3 A;  2V93 A;  3QUF A;  1P1N A;  5CBS A;  4Q5T A;  1QUJ A;  3TKD A;  3F11 A;  1N76 A;  1ZTY A;  2NVU B;  3OSQ A;  2PMS A;  1BTJ A;  4THI A;  4U22 A;  1QJM A;  4RJZ A;  3PPR A;  1O63 A;  4G8N A;  2DQV A;  1EU8 A;  1TFD A;  3D4G A;  2HAV A;  4DE8 A;  1TWY A;  3VLU A;  2XD3 A;  2XX9 A;  3TCF A;  1B40 A;  2RCA A;  1DTZ A;  5HPQ A;  4QSC A;  5AA4 B;  3SEX A;  3UA8 A;  5CMB A;  1A99 A;  3QYT A;  4LQ2 A;  4MH5 A;  1EZP A;  2OK2 A;  4Q0C A;  2DXY A;  3B7D A;  1SW1 A;  3I6V A;  1OLC A;  3LBS A;  4KI0 E;  3HCQ A;  3TTL A;  2ZXT A;  1Z7N E;  2DWA A;  1LB9 A;  3JZJ A;  1A40 A;  3R26 A;  1UTH B;  3K1P A;  3MVZ A;  2RC8 A;  3FXQ A;  4G68 A;  1JVY A;  3VV5 A;  5IKB A;  2PT2 A;  4IO2 A;  1MPD A;  2VP1 A;  4QRZ A;  2XXU A;  4ESW A;  1P1Q A;  1PB9 A;  4H0W A;  3KJT A;  1LBB A;  1Y3Q A;  3Q26 A;  3VXC A;  4ONY A;  2ZNT A;  2O84 X;  3SES A;  1NH8 A;  5JEI A;  4YIC A;  1Y3P A;  3MUQ A;  4DCX A;  5EHS A;  1H76 A;  5LOM A;  3E13 X;  3MBP A;  4N13 A;  4FOR A;  4ZEK A;  1ZKB A;  1B0L A;  3IB1 A;  2DOJ A;  1LLS A;  3BBR A;  2XX7 A;  3DLN A;  3G3F A;  5CMC A;  3CFZ A;  2OWT A;  2PVU A;  2A5T B;  4H65 A;  1SW5 A;  3B6Q A;  4F3P A;  4WED A;  3FIR A;  1N04 A;  4F2O A;  4OZ9 A;  3KGC A;  3L6H A;  4EUO A;  4FE8 A;  4PP0 A;  3JV9 A;  3K6X A;  4YKK A;  3V5A A;  3IX1 A;  4QHQ A;  1M5F A;  1FTO A;  1LCT A;  2IEE A;  3O29 A;  3CR9 A;  3OEN A;  5A5X B;  3C4M A;  2XXW A;  4KYS A;  1UQW A;  2Z22 A;  3VVF A;  2Y7P A;  3CRB A;  4POX A;  2RC7 A;  5H8F A;  1B5H A;  3DP4 A;  1QUK A;  2OWS A;  3FJM A;  3EHU A;  3VVD A;  3TAJ A;  2O1M A;  3FJ7 A;  5F1Q A;  2XXP A;  4K3F A;  1FQC A;  4KFQ A;  3MP6 A;  3OO8 A;  4OEN A;  2IA4 A;  4XKP A;  3TCG A;  3C36 A;  5H8Q B;  4ZEC A;  2ABH A;  1B4Z A;  3FAT A;  4R72 A;  5L9O A;  1SYH A;  1Y4C A;  4NWC A;  1AMF A;  2VD2 A;  5EHM A;  1YTV A;  4YMB A;  5FTH A;  3GBB A;  3IJO B;  1B1X A;  1B52 A;  1VR5 A;  3OOA A;  3IK6 B;  2D5W A;  4ISU A;  4DIG A;  3TTM A;  4XKR A;  1UIV A;  3GXA A;  3T66 A;  3L6G A;  2F34 A;  3IAZ A;  2V3U A;  3Q29 A;  1MY3 A;  3PMV A;  4KPT A;  2REG A;  3G3K A;  5KDT B;  2DWI A;  4NWD A;  1KWH A;  3OO6 A;  1N84 A;  3KJ7 A;  3HHF A;  3FVN A;  2XXI A;  3BKI B;  1SI1 A;  4PET A;  1D4N A;  1CB6 A;  1II5 A;  3D4C A;  5H8N A;  5EYF A;  4H67 A;  1Y20 A;  2PX1 A;  4RA1 A;  5FHO A;  5DVJ A;  4YB7 A;  4ZE8 A;  1B6H A;  4IB2 A;  3OEM A;  3PMX A;  4MLV A;  1AH5 A;  5I59 B;  3A09 A;  3N26 A;  1B32 A;  4OMB A;  1O7T A;  5DYH A;  1UTB B;  2DSF A;  4JWX A;  1RYX A;  1NH7 A;  1SVX B;  1MXX A;  1US5 A;  2I3V A;  5K2Y A;  3K6U A;  1HSE A;  4H8I A;  1FCK A;  1POY 1;  4NF8 B;  1XC1 A;  2DE2 A;  5ELV A;  2RKM A;  3ECR A;  3T9V A;  3TQW A;  4BLA A;  1UTH A;  3R6U A;  4G8M A;  2HXW A;  4TLM B;  1YPN A;  1UIU A;  4BDO A;  1IIT A;  2R6G E;  4NTL A;  4YB6 A;  1SDX A;  5I56 A;  1MPB A;  3O6G A;  5I57 A;  1MQH A;  1SBP A;  1VFE A;  1DOT A;  4DDD A;  1NFT A;  4PE5 B;  1Z7M E;  1I6Q A;  2VOZ A;  2Y84 A;  1LAX A;  4PFU A;  3KEI A;  4X1D A;  1NNT A;  2V3T A;  4PFW A;  5AE4 A;  3MVY A;  4M1V A;  3DEL B;  2ZYK A;  1BKA A;  5H8S A;  4FAT A;  2A5T A;  2Z8E A;  3RPW A;  3LSX A;  1RKM A;  2DWH A;  4GIZ A;  5KCJ B;  4U1O A;  2V3Q A;  4LON B;  2HZL A;  3MP8 A;  4OYV A;  2DP8 A;  3S4U A;  2XXV A;  4RK9 A;  3IOR A;  3C34 A;  1D3K A;  1MXZ A;  3LC8 A;  1QW0 A;  1QUI A;  1B3F A;  3TOD A;  3DP8 A;  4P11 A;  1URD A;  2OBG A;  3K00 A;  5CRY A;  2Y7W A;  3T9U A;  3H6T A;  2ZYO A;  4P0I A;  3V83 A;  1B58 A;  4P0G A;  1MH4 A;  4YZZ A;  1PB8 A;  3KG2 A;  3C35 A;  1ZIU A;  3S9E A;  2F7C A;  3CSG A;  4OVJ A;  2ONR A;  1YAE A;  2I6E A;  4OQO A;  3GLB A;  5K2X A;  4F3B A;  3FD3 A;  1MM7 A;  2H4I A;  1T0K A;  3K4U A;  4NE4 A;  1B5J A;  2R71 A;  4H5G A;  1TFA A;  2GHA A;  3M3K A;  4X48 A;  3FAS A;  4DXU A;  3O9P A;  5JTY A;  3H6U A;  4LP2 B;  3C33 A;  1YCJ A;  1MQG A;  1LFI A;  1LCF A;  1JVX A;  2QL3 A;  5DEX B;  4O3A A;  1R1N A;  1ZU0 A;  2QS1 A;  1FQF A;  2WKY A;  1H43 A;  4F3G A;  2F36 A;  3PUY E;  3OMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...