2UVGA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
403
structure length
401
Chain Sequence
VNLRMSWWGGNGRHEVTLKALEEFHKEHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGQVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWNGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVELGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
total genus 147
structure length 401
sequence length 403
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvgA02
4FE8A 5I58A 1ZLQA 3LR1A 2A5TA 4RXLA 1QVSA 3C32A 3K0VA 1LAGE 3CG1A 4GQOA 1FW0A 2NOOA 1LCFA 3IB2A 2AL5A 1QUIA 4C0RA 1L5TA 3UK4A 4F1UA 5CMMA 4FIMA 4EUOA 4ZZEA 2ZYOA 3T9UA 4G68C 1XHYA 4U1OA 5KCJB 5CC2A 2F35A 3CIJA 3FV1A 4H5FA 3IO4A 4G77A 4Z0IA 4KCDA 3VLVA 3LSFB 1MM7A 4OERA 2F5XA 3TTRA 2UVHA 4GVOA 5DYHA 3DM0A 3S9MC 1B7ZA 4U4XA 1XC1A 5HBCA 4M1VA 4NF8B 4ND9A 3PGFA 4HS7A 3PUWE 5FTIA 3K00A 1HSJA 3OEMA 4EQBA 5JTYB 3B6TA 3SEWA 4GL0A 3M8UA 4POWA 2RC9A 4LUBA 4O3BA 1SYIA 2O7UA 1FQDA 4QSDA 5I84A 1YTVA 5I57B 4OQOA 4R9FA 2UXAA 3HCQA 3FASA 4R74A 1D9VA 4MH5A 5JEIA 1IXGA 2ZNSA 3O66A 5AA3A 2Y7PA 2I48A 3N5LA 4ZDMA 2OLBA 3KN8A 2OZZA 3OENA 5DT6A 4H6DA 2ZYKA 3U94A 4RPOA 2OWTA 2IA4A 3HN0A 4I62A 4HW8A 3TZAA 1FTLA 5I58B 4F2QA 1ANFA 4P0IA 4GF8A 3KJTA 2PT2A 3T93B 1S7YA 3PPNA 2G29A 2HEUA 1S50A 1ZIUA 3HO7A 4G68B 2H25A 1D9YA 1OVBA 3V8XB 1MQJA 3UN6A 5BUUA 1Y3PA 1MY3A 1GV8A 4F22A 1NL5A 3PD8A 3L6HA 2HZKA 3H6UA 4M4GA 4ELQA 2NXOA 4ZEIA 3C33A 3ONMA 4DE8A 4F3BA 1POY1 2UVGA 5IKBA 4G2ZA 2XXHA 4RK2A 4XTCQ 5HM4B 3Q27A 3EPEA 5EYFA 4IO5A 5FHOA 5DVIA 2THIA 3M3FA 4I1DA 1AL3A 3KN3A 3TKDA 1SD3A 5FHNA 3MUQA 4KYDA 3SESA 3R7XA 1FCKA 3UGWA 4DXUA 2F6GA 2DOJA 3CSBA 1JEVA 2R6GE 3PPOA 1SYHA 2Z23A 3UORA 3ILUB 5AA2A 1MG1A 1PBQA 2Q89A 1JEUA 3TQLA 1EU8A 1Y3QA 1MDQA 3PUVE 1MPBA 1FQFA 5CBSA 4JWXA 3K1NA 3B6WA 2ESNA 1UTHB 4OFOA 3G3IA 1B1HA 1LBCA 4R72A 3UP9A 1BTJA 4R75A 2QMWA 4DIGA 2YLNA 2DXRA 2RCAA 4U1ZA 1NNKA 3T9HB 1R6ZA 3KSXA 3WAEA 2VHAA 4N07A 3H6WA 1SW1A 2O69A 1N0TA 2QPQA 1VR5A 3TDJA 2PX1A 4ESWA 3C36A 3E3KA 3QXMA 4IO6A 1N84A 3USDA 1OLCA 3TTLA 1IXHA 2ZNTA 5H8FA 3VLUA 4YMBA 2XXYA 1YAEA 2FNCA 3IOTA 2RC8A 1CB6A 1N7WA 2CZLA 3U92A 3O9PA 4LVQA 5ELVA 3CR9A 1MXZA 1NH8A 4R73A 5AA4B 3G3HA 4ZEKA 5TU0A 2LAOA 1ZMGA 1BP5A 3Q26A 1B1XA 3SERA 3KSJA 5I2NA 2DXYA 2O6AA 3RN8A 3W9WA 3IO6A 1M5DA 3T66A 3MAMA 1B4ZA 4PFTA 2HFBA 1US4A 1P1UA 3VXBA 2F6PA 1F9BA 1B5JA 4N13A 5JK4A 5AE4A 4ZE8A 1II5A 4KR5A 3I6VA 3RLFE 1TT1A 2B3BA 2I3VA 5B70A 3E13X 3C9HA 1Z7ME 4QFLA 2ZYNA 1B0HA 3FXRA 1WODA 1GVCA 3IL1B 4BDNA 3FXUA 1OIBA 4Z7EA 1N04A 2RKMA 3TCFA 4XKQA 4ELOA 1Y3NA 3RGYA 2PYYA 1QKBA 1Y9UA 4LQ2A 3KOTA 2ABHA 3KZGA 2XXQA 1JQFA 3TMGA 4ZZAA 2Q8JA 1RYOA 3VE1B 1YPNA 2F7AA 1B0LA 1MXXA 4RNSA 3QSLA 2O68A 3L6GA 3KG2A 2DE2A 1NNPA 4JB7A 4OEVA 2XXXA 1PBPA 2UYFA 4F3PA 1JVYA 3H4ZA 1DOTA 3GZGA 2ALUA 1MQGA 3A3CA 3OSQA 3LSWA 4FAJA 2ZXTA 1GTKA 2ONKE 1D3KA 4LATA 5DEXA 1EZ9A 1FQCA 5I2NB 3I5OA 4H65A 1MXYA 1HSEA 4H67A 1MDP1 1XT8A 1GR2A 2I58A 4N6PA 5L9SA 2KLFA 1POTA 2OJTA 4C1UA 1IEJA 4DDDA 1A99A 4NEDA 1LBBA 1LB8A 4H8IA 2YJPA 4HCWA 1AMFA 4R6HA 3CFZA 5H8QB 1B5IA 3FVKA 4MLQA 3PPQA 3O97A 4RK9A 4YKPA 3VVFA 2VGQA 3H03A 1D4NA 5H8HA 4JBZA 4ZS9A 4NMYA 1LLSA 3S9NC 1H76A 3VFJA 2E0SA 1QUKA 3OSRA 3K1MA 1ZJLA 4IB2A 2DVCA 5H8SA 4ZEDA 4TQUQ 1JVXA 2XXVA 4OYVA 1M5FA 1FTJA 1Y20A 2X26A 4U2RA 4OENA 5M2VA 1SBPA 3N26A 4F39A 4LP2B 3TPAA 4GD5A 5IAIA 2O1LA 3DELB 2I3WA 3LC8A 3RT8A 3IB0A 3MQ9A 4PE5B 3IJXB 4XKNA 4QHQA 3DP4A 1A55A 4H1XA 4NF6A 1Z7NE 2R71A 1FTKA 3O6GA 1QULA 3VV5A 5I59B 4NF4A 4DCXA 2DWHA 3OO7A 3IOVA 3TTNA 4LQ5A 3HSTA 3MP1A 3W9VA 4OVJA 5CRYA 4IO2A 1VSOA 3MPKA 2I0CA 4TOZA 2RINA 3PMVA 4JDFA 2GRVA 4RYAA 3KFMA 3WAFA 3HPIA 4H5GA 4LZ5A 4F3SA 4GLIA 3T9XB 2QMXA 1HSLA 3H3GA 3FIRA 2AYSA 2V3UA 3VLWA 2PMSA 2XXIA 1IXCA 1B51A 2AL4A 4KQPA 3FJMA 1B4HA 3D4CA 3RQTA 1NMUA 2XXRA 3SEXA 5FHMA 3RTFB 4KYSA 2A5TB 5L9OA 1EZOA 5KDTA 1UTBA 1B2HA 3GBAA 5BWJA 4EQ7A 4MLVA 2QSXA 4FECA 2PT1A 3TEPA 3TFLA 1LSTA 3MP6A 5HPQA 5K2YA 4NWDA 5L9MA 3A09A 1I6BA 1EH3A 3Q25A 1B9JA 1I6QA 3H06B 4F3GA 2OK2A 2PVUA 1XVXA 2VP1A 3PUYE 4AB5A 4E0WA 4KYEA 2RF1A 3FUZA 4R2FA 4KPTA 1AOVA 5A5XA 1WVJA 4OETA 2V3TA 5DVJA 1H44A 4JWYA 4FJPA 3BBRA 4IY6A 4EXLA 4G8HA 3M3LA 3MZ9A 5I2KA 3PUZE 1FQBA 3V89B 1SDXA 1UQWA 3Q29A 1PDAA 2XXPA 4IO4A 1B05A 4QSEA 1BKAA 3U8QA 2PBWA 2REJA 4NF5A 3LUYA 2O51A 1URSA 1N3XA 1B3GA 3V83A 1DPPA 3CG3A 1JW1A 1ATGA 3MZ1A 1MM6A 3N6UA 1SQYA 3IJOB 4OHNA 2RC7A 1M5CA 4U4SA 2QL3A 4PP0A 1YCJA 4LZ8A 3C34A 3K6WA 4F31B 4GOTA 3TELA 3MVYA 1Y4CA 4OFJA 1AH5A 3OO8A 2IEEA 2H4IA 3OELA 1DSNA 1OQGA 1H3DA 3PUXE 2OWSA 2QS4A 4QFOA 5DTBA 2DE3A 4FATA 3T96B 4IY5A 4TLMB 2HAVA 4RA1A 3KOSA 1B46A 4YZZA 1XS5A 3IOWA 3KGCA 4ECFA 4BDRA 2O7IA 5EHMA 1JETA 3FATA 3JZJA 2XXTA 3MWBA 3LSXA 4HCYA 3H6TA 3AXFA 4K3FA 5AA2D 5H8NA 4PFUA 1M5EA 2G93A 3K02A 1H45A 4FEDA 4BLAA 4ZEBA 2I4CA 1B3FA 2YPNA 3G7WA 5B7DA 5AA2B 4PFWA 1B3HA 3QK6A 3EHSA 2OBGA 1MPCA 3PV0E 1B3EA 2Z8FA 3IB1A 4WEDA 2I49A 1ZKBA 3K4UA 2BJJX 4P11A 1QUJA 1B7UA 1MXWA 3OD7A 3IOUA 3S9EA 3ODBA 2I4BA 4BDOA 1SW4A 2CMOA 3CFLA 3U1OA 3E9XA 1B52A 4G8MA 1R1NA 2P0SA 3ECRA 3Q28A 1O64A 1I69A 1P1QA 1IITA 4YB6A 5TPAA 2WKYA 4XKRA 1MY0A 3IORA 4X1DA 4F18A 4TLLB 5CI5A 5TP9A 3TYHA 2GH9A 1SW2A 3W15C 3K6UA 5CMCA 4O3AA 5DVFA 3VDFA 1OQHA 3QYTA 4LONB 3KJ7A 3QUFA 4G8NA 4R6KA 2QJEA 4KHZE 2AIXA 3EF7A 3HV1A 2ZMBA 3O2AA 1Q1KA 1MH3A 4YB5A 5CMKA 4X9TA 2NWJA 5ISUA 5H8FB 4YMAA 1Y1ZA 4ISUA 4Q8RA 3PD9A 3S9LC 4PETA 1LCTA 1IQ7A 3FVNA 3PU5A 1VFEA 3O6IA 4QSCA 4L17A 4ESXA 1N7XA 2Q88A 4GL8A 3CRBA 4YAHX 4R9GA 4F1YA 5KZTA 1LFIA 5EHSA 3C4MA 5F7VA 2DE4A 3H6VA 4GXSB 1VFDA 5KCJA 2VD3A 2Z22A 2RCBA 2M8CA 3IX1A 4OMBA 2HQ0A 4AB6A 4EF2A 4RJZA 1SVXB 1EZPA 4WKMA 4G4PA 4FEBA 3S4UA 3SEVA 2UYEA 4P0GA 2DWIA 1B32A 4NF8A 2DVZA 4QFKA 1QKAA 5JTYA 3C35A 1B58A 3A3UA 3VVDA 4EF1A 1TXFA 1A40A 2FA7A 3TTMA 3G3GA 3MVXA 3HHFA 3FVOA 1FQEA 4F1VA 2B3FA 5I57A 1A7LA 1JW5A 2XD2A 1MY2A 1A8FA 3QUJA 1FTMA 2Q2CA 1M5BA 2O84X 4PQJA 1DTGA 2V84A 4POXA 1PB9A 1LAXA 3BFUA 3IAZA 1BIYA 3ZKLA 1PEBA 2XX7A 2B65A 2D21A 4UACA 4YKIA 5LOMA 4Q0CA 1Y4TA 1A8EA 1XOCA 4MF3A 2I0BA 1B40A 1T0KA 1GGGA 4NWCA 2F7CA 3TUSA 3H7MA 1QW0A 4G68A 3OEKA 3UIFA 1MH4A 3ZS6A 5CMBA 2ONRA 2GHAA 5DEXB 3PMXA 4WXJA 4RPNA 5CM6A 2A5SA 1ZTYA 3OXNA 3TCHA 3EN3A 2DP8A 4OEUA 5CBRA 1TFDA 3CI8A 1NH7A 4JXIA 2HZLA 4JSOA 2Y7RA 3RUMA 2F36A 3U72A 1ZU0A 4IGTA 5ITPA 1OVTA 3MW0A 1URGA 3MP8A 4H8JA 2Z8DA 3R6UA 3TODA 4QFPA 1OLAA 1US5A 4I9DA 4LA9A 3RNNA 5H8HB 2X7QA 4ZE9A 4GRKA 3FGSA 3V5AA 2H9BA 2F97A 1JW4A 4GWOA 4DZ1A 4WEPA 2ANJA 3OO6A 1B7HA 1UTHA 2ONSA 2HXWA 4QF9A 3EQ1A 4JSDA 2Q2AA 4MBPA 3RTWB 1P99A 2P2AA 1NNFA 2HCAA 1O7TA 1USYE 3LSLA 3FJ7A 4IO3A 4X1BA 1MRPA 4GXAA 3N94A 4KFQA 4I8CA 2H5YA 4C1TA 2DQVA 3C31A 3G3FA 3MJNA 4EQ9A 4EXKA 2F8DA 2Q9TA 3B7DA 4BDMA 2H98A 1S9TA 3QIMA 3K1PA 1SW5A 3RT6B 3RY3A 3SDFA 4NF6B 4ZEFA 2NVUB 1Y1MA 4XIGQ 2R9JA 4F19A 4JWOA 1P1NA 1KWHA 5AA4A 4NF4B 1H43A 3O29A 2O1MA 3K2DA 4OESA 2ZYMA 3K01A 5I56A 2XD3A 3TTKA 3ZKKA 1IXIA 3BFTA 4YB7A 1ZBMA 3SKPA 4IGRA 1SI1A 1R9LA 1BLFA 3SETA 2XX9A 1PC3A 1WDNA 2DSFA 1PB7A 3M3KA 3MZBA 3CFXA 1LAHE 2ZNUA 3TAJA 2P1SA 4XXUA 1NFTA 3I3VA 3FVGA 3LBSA 4X48A 1LGBC 3JV9A 3T9VA 3EHTA 1FTOA 1FQAA 2VD2A 5KDTB 1UTBB 3FZVA 5F1QA 1MS7A 1DMBA 1MY1A 1DTZA 3MBPA 2F34A 1A54A 3B6QA 1NKXA 4QRZA 1SI0A 1VE4A 3MC2A 4OZ9A 3PPRA 5K2XA 1MPDA 1UIVA 1LFGA 4LZ7A 2HAUA 2DYXA 1TWYA 2F78A 5FTHA 1R9QA 4F29A 4Q5TA 3UA8A 4ELPA 4PFYA 4KD5A 4MFIA 4H0WA 3MVZA 3K6XA 3KN7A 5A5XB 4NTLA 4BDLA 2QS2A 4ELRA 3D4GA 2QS3A 3SEYA 3DLNA 4O3CA 1JNFA 1LAFE 2Z8EA 4ZECA 4KI0E 3THIA 1PB8A 2DWJA 5I2KB 2E1SA 2QS1A 4IO7A 4BDQA 1P1WA 1J1NA 1N76A 3IK6B 1AIVA 1I6AA 2REGA 4YU0A 5ICTA 3ILTB 5I56B 3KEIA 4E0XA 3E4RA 2V3QA 4FORA 4NF5B 3PMWA 3FXQA 3S2VA 1UIUA 3T22A 2F7BA 4GIZA 1B5HA 5L8DA 3U93A 4F2OA 3IR1A 4THIA 3GXAA 3N6TA 1URDA 1XVYA 3FD3A 1DPEA 5H8QA 1IUDA 3TQWA 4R2BA 2UVJA 4YKJA 3FV2A 3SEUA 3MVWA 4RY1A 1QJMA 4HTGA 2XHDA 3KBRA 3GBBA 2VOZA 3ZSFA 3K6VA 3JYRA 3PPPA 1MQIA 1MXVA 1MQDA 1MXUA 2H99A 1B6HA 2GFEA 2XXWA 2DWAA 1OMPA 4KCCA 4QFNA 2FYIA 4ONYA 1NNTA 2Y7WA 3R26A 2XX8A 2Y84A 1RYXA 4U23A 1MQHA 3O6HA 4OTEA 1B3LA 3OMBA 4DLDA 2UVIA 1MY4A 1LFHA 4NE4A 4YICA 5H8NB 4U22A 4OFLA 4OWDA 2V25A 3O28A 2V93A 1IZ1A 2NUVA 3TCGA 2Y7KA 4UA8A 1O63A 4R6YA 4AQ4A 2I6EA 3QAXA 3HHGA 2XXUA 4OXVA 4EDPA 3G3JA 5I59A 3OO9A 3VVEA 3VXCA 4DXCA 1IIWA 2D3IA 4U21A 3DP6A 1P1OA 3FJGA 1USYH 4YKKA 3P7IA 3CVGA 4Q30B 2GHBA 2OCUA 3EHUA 5J1DA 5ITOA 2X7PA 4DXBA 2D5WA 2DS9A 5TPAB 3BKIB 3GLBA 1N3WA 1LB9A 2W7YA 2QRYA 3MPLA 5TP9B 1TFAA 5ICQA 1CE2A 3RPWA 1RKMA 1ELJA 5AA1A 3G3KA 3CSGA 3OOAA 4GFRA 4DCYA 4XKPA 1Q35A 3DP8A 2Y7IA 3F11A
chains in the Genus database with same CATH superfamily
4FE8A 5I58A 1ZLQA 3LR1A 1FBCA 2A5TA 1XI6A 1QVSA 3C32A 4RXLA 4GWXA 3K0VA 1LAGE 3CG1A 4GQOA 1FW0A 2NOOA 1LCFA 4NN3A 4PBHA 3IB2A 2AL5A 1QUIA 4C0RA 1L5TA 3UK4A 1IMEA 4F1UA 5CMMA 4FIMA 4EUOA 4ZZEA 2ZYOA 3T9UA 5LTCA 4G68C 1XHYA 4U1OA 5KCJB 5CC2A 2F35A 5I3SA 3CIJA 3FV1A 4H5FA 3IO4A 3RPLA 4G77A 4Z0IA 4KCDA 3VLVA 4QBAA 3LSFB 1MM7A 2XWIA 4OERA 2F5XA 3TTRA 2UVHA 4GVOA 5DYHA 3DM0A 3S9MC 4NQ8A 5EYGA 1B7ZA 4U4XA 1XC1A 5HBCA 4M1VA 4NF8B 4ND9A 3KC1A 3PGFA 4HS7A 3PUWE 5FTIA 3K00A 1HSJA 3OEMA 4EQBA 1DK4A 5JTYB 3B6TA 3SEWA 4GL0A 3M8UA 4POWA 2RC9A 4LUBA 4O3BA 1SYIA 2O7UA 1FQDA 4QSDA 2P3VA 5I84A 1YTVA 5I57B 4OQOA 2XWKA 4PF6A 4R9FA 2UXAA 3HCQA 3FASA 4R74A 1D9VA 4MH5A 5JEIA 5ESYA 1IXGA 2ZNSA 3O66A 5AA3A 2Y7PA 2I48A 3N5LA 4ZDMA 2OLBA 3KN8A 2OZZA 3OENA 5DT6A 4H6DA 2ZYKA 3U94A 4RPOA 2OWTA 4PAFA 2IA4A 3HN0A 4P9KA 4I62A 4HW8A 3TZAA 1FTLA 5I58B 1NUWA 5EQ9A 1FPJA 4F2QA 1ANFA 4P0IA 4GF8A 3KJTA 2PT2A 3T93B 1S7YA 3PPNA 2G29A 2HEUA 3BIHA 1S50A 1ZIUA 3HO7A 1CNQA 2WBBA 4G68B 2H25A 3FXBA 1D9YA 1OVBA 3V8XB 1MQJA 3UN6A 5BUUA 2HXRA 1RDZA 1Y3PA 1MY3A 1EYJA 1GV8A 4F22A 1NL5A 3PD8A 3L6HA 2HZKA 3H6UA 4M4GA 4ELQA 2NXOA 4ZEIA 3C33A 3GYYA 3ONMA 4DE8A 4F3BA 4GX3A 1POY1 2UVGA 5IKBA 4G2ZA 4MIJA 2XXHA 4RK2A 4XTCQ 5HM4B 3Q27A 3EPEA 5EYFA 4PE3A 1K9YA 4IO5A 5FHOA 5DVIA 2THIA 3M3FA 4I1DA 1AL3A 3KN3A 3TKDA 1SD3A 5FHNA 4XFEA 3MUQA 1KA0A 4KYDA 3SESA 3R7XA 4OANA 1FCKA 3UGWA 4DXUA 2F6GA 2DOJA 3CSBA 1JEVA 2R6GE 3PPOA 1SYHA 4OVRA 2Z23A 3UORA 3ILUB 5AA2A 1MG1A 1PBQA 2Q89A 1JEUA 4LN5A 1EU8A 3TQLA 2CEXA 1Y3QA 1MDQA 3PUVE 1MPBA 1FQFA 2CZIA 4FBPA 5CBSA 4JWXA 3K1NA 2FHYA 3B6WA 2ESNA 1UTHB 4PCDA 4OFOA 3G3IA 1B1HA 1LBCA 4R72A 3UP9A 5T3JA 1BTJA 4R75A 2QMWA 4DIGA 4O8MA 2YLNA 2DXRA 2RCAA 4U1ZA 1YXIA 1NNKA 2Q8MA 3T9HB 1R6ZA 3KSXA 2WYPA 3WAEA 2VHAA 5IZZA 4N07A 3H6WA 1SW1A 2O69A 1N0TA 2QPQA 1VR5A 3TDJA 2PX1A 4ESWA 3C36A 3E3KA 3QXMA 4IO6A 1N84A 3USDA 1EYKA 5I7IA 1OLCA 1FRPA 2DDKA 3TTLA 1IXHA 2ZNTA 5H8FA 3VLUA 4YMBA 1NV0A 2XXYA 1YAEA 2FNCA 3IOTA 4O94A 2RC8A 1CB6A 1N7WA 2CZLA 3U92A 3O9PA 1FPBA 4LVQA 5ELVA 3CR9A 1MXZA 1NH8A 4R73A 5AA4B 3G3HA 4GWSA 4ZEKA 5TU0A 2LAOA 1ZMGA 1BP5A 3Q26A 1B1XA 3SERA 3KSJA 5I2NA 2DXYA 2O6AA 3RN8A 2QVRA 3W9WA 3IO6A 1M5DA 3T66A 3MAMA 1B4ZA 4PFTA 2HFBA 1US4A 1P1UA 3VXBA 2F6PA 1F9BA 1B5JA 4UABA 4N13A 4AS5A 5JK4A 4DI4B 5AE4A 4ZE8A 1II5A 4KR5A 4PDDA 3I6VA 3RLFE 1TT1A 2B3BA 2I3VA 4P8BA 5B70A 3E13X 1NV7A 1FSAA 3C9HA 1Z7ME 4QFLA 2ZYNA 1B0HA 3FXRA 4PFRA 4PF8A 1WODA 1GVCA 3IL1B 4BDNA 3FXUA 1OIBA 2WX9A 3EKIA 4AS4A 4Z7EA 1N04A 2RKMA 1KZ8A 3TCFA 1D9QA 4XKQA 4ELOA 4N81A 1Y3NA 3RGYA 2PYYA 1QKBA 1Y9UA 4LQ2A 3KOTA 2ABHA 3KZGA 2XXQA 3NOHA 1JQFA 3TMGA 3LUZA 4ZZAA 2Q8JA 1RYOA 3VE1B 1YPNA 2F7AA 1B0LA 1MXXA 4RNSA 3QSLA 1FJ9A 2O68A 3L6GA 4N15A 3KG2A 2DE2A 1NNPA 4JB7A 4GWYA 4OEVA 2XXXA 1PBPA 2UYFA 4F3PA 1JVYA 5IM2A 3H4ZA 1DOTA 3GZGA 2ALUA 1MQGA 3A3CA 3OSQA 3LSWA 4FAJA 2FVZA 2ZXTA 1GTKA 2ONKE 1D3KA 4LATA 5DEXA 1EZ9A 1FQCA 5I2NB 3I5OA 4H65A 1MXYA 1HSEA 1DCUA 4H67A 1MDP1 1K9ZA 1XT8A 1GR2A 1NUXA 2I58A 4N6PA 5L9SA 2KLFA 1POTA 2OJTA 4C1UA 1IEJA 4DDDA 1A99A 4NEDA 1LBBA 1LB8A 4HE0A 4H8IA 2YJPA 4HCWA 1AMFA 4R6HA 3CFZA 5H8QB 1B5IA 3FVKA 4JVIA 4MLQA 3PPQA 1NV5A 3O97A 4RK9A 4GX6A 4N6DA 1G0HA 3BIGA 3B8BA 4YKPA 3VVFA 2VGQA 3H03A 1D4NA 5H8HA 4JBZA 4ZS9A 4NMYA 1IMBA 3RYDA 4MCOA 4X8RA 1LLSA 3S9NC 1H76A 3VFJA 2E0SA 1QUKA 3OSRA 4PAKA 1FJ6A 3K1MA 1ZJLA 1LBWA 4IB2A 2DVCA 5H8SA 1FBHA 4ZEDA 3KBZA 1FBGA 4TQUQ 1JVXA 2XXVA 4OYVA 1M5FA 1FTJA 1Y20A 4P47A 4O7IA 1FPIA 1FBEA 3CHGA 2X26A 4U2RA 4OENA 5M2VA 1SBPA 3N26A 4F39A 4LP2B 3TPAA 4GD5A 5IAIA 2O1LA 3DELB 2I3WA 3LC8A 3RT8A 3IB0A 5J16A 3MQ9A 4PE5B 3IJXB 4XKNA 4QHQA 3DP4A 1A55A 4H1XA 4NF6A 1Z7NE 2R71A 4IR8A 1FTKA 4PDHA 4NAPA 4O7MA 3A29A 3O6GA 5DW8A 5EQ8A 1IMAA 1QULA 3VV5A 5I59B 2KQZA 4NF4A 3E78A 4DCXA 2DWHA 3OO7A 3IOVA 3TTNA 4LQ5A 3HSTA 3MP1A 2XXKA 3W9VA 4OVJA 5CRYA 4IO2A 1YYZA 1VSOA 3MPKA 2I0CA 4TOZA 2RINA 3PMVA 4JDFA 2GRVA 4RYAA 3KFMA 3WAFA 3HPIA 4H5GA 4LZ5A 4F3SA 4GLIA 3T9XB 2QMXA 1HSLA 3H3GA 3FIRA 2AYSA 1JP4A 2V3UA 3VLWA 2PMSA 2XXIA 4JVCA 1IXCA 1B51A 2AL4A 4KQPA 5IZ3A 3FJMA 1B4HA 3D4CA 2XWOA 3RQTA 1NMUA 2XXRA 5ET7A 3SEXA 5FHMA 3RTFB 4KYSA 2A5TB 5L9OA 1EZOA 5KDTA 1UTBA 1B2HA 3GBAA 3ROJA 5BWJA 4EQ7A 4MLVA 2QSXA 4FECA 2PT1A 3TEPA 3TFLA 1LSTA 3MP6A 5HPQA 3T0JA 5K2YA 4NWDA 5L9MA 3A09A 1I6BA 1EH3A 3Q25A 1B9JA 1I6QA 3H06B 4F3GA 2OK2A 2PVUA 1XVXA 2VP1A 1NV1A 3PUYE 4AB5A 4E0WA 4KYEA 2RF1A 3FUZA 4R2FA 4MJOA 4KPTA 1AOVA 3RPLB 5A5XA 1WVJA 4MEVA 4OETA 2V3TA 5DVJA 1H44A 4JWYA 4FJPA 3MYUA 3BBRA 1QGXA 4IY6A 4EXLA 4G8HA 3M3LA 3MZ9A 5I2KA 2XA5A 3PUZE 3FBPA 1FQBA 1DBZA 3V89B 4PFBA 1SDXA 1UQWA 3Q29A 1PDAA 2XXPA 2CZHA 1B05A 4IO4A 4PGPA 4QSEA 4MX6A 1BKAA 1YZ0A 3U8QA 2PBWA 2REJA 1NV3A 4NF5A 3LUYA 2O51A 1URSA 1N3XA 1B3GA 3V83A 1DPPA 3CG3A 2VT5A 1JW1A 1ATGA 3MZ1A 1MM6A 1FPDA 2FBPA 3N6UA 1SQYA 4N6KA 5EYHA 3IJOB 4OHNA 2RC7A 1M5CA 4U4SA 2QL3A 4PP0A 1YCJA 4LZ8A 3C34A 3K6WA 4F31B 2GQ1A 4GOTA 3TELA 2OX3A 3MVYA 1Y4CA 4OFJA 1AH5A 2WBDA 3OO8A 2IEEA 2H4IA 4KXPA 3OELA 1DSNA 1OQGA 1H3DA 1BK4A 3PUXE 2OWSA 4JVDA 2QS4A 4QFOA 5DTBA 2DE3A 4FATA 3T96B 4IY5A 2ZZXA 4TLMB 2HAVA 4RA1A 3KOSA 1B46A 3E79A 4YZZA 1XS5A 3IOWA 4NHBA 3KGCA 4ECFA 4BDRA 2O7IA 5EHMA 1JETA 3FATA 3JZJA 2XXTA 4PBQA 3MWBA 4MMPA 3LSXA 4HCYA 3H6TA 3AXFA 4K3FA 5AA2D 5H8NA 4PFUA 1M5EA 2G93A 3K02A 4I40A 1H45A 4FEDA 5A5LA 4BLAA 4ZEBA 4NF0A 2I4CA 1B3FA 2Q74A 2YPNA 3G7WA 1Q9DA 5AA2B 5B7DA 2CZKA 4PFWA 1B3HA 3QK6A 3EHSA 2OBGA 1MPCA 3PV0E 4OVQA 1B3EA 2Z8FA 3IB1A 4WEDA 2I49A 1ZKBA 3K4UA 2BJJX 4P11A 1AWBA 1QUJA 1B7UA 1MXWA 3OD7A 3IOUA 3S9EA 3ODBA 2I4BA 4BDOA 1SW4A 2CMOA 3CFLA 3U1OA 3E9XA 1B52A 4G8MA 1R1NA 3PTYA 2P0SA 3ECRA 3Q28A 2WYKA 1O64A 1I69A 1P1QA 1IITA 4YB6A 2JJKA 5IZ1A 5TPAA 2WKYA 4XKRA 1MY0A 3IORA 2HHMA 4X1DA 4F18A 2MKZA 4TLLB 5CI5A 5TP9A 3TYHA 2GH9A 1SW2A 3W15C 4PTKA 3K6UA 1FPKA 5CMCA 4O3AA 5DVFA 3VDFA 1OQHA 5EQAA 3QYTA 4LONB 3KJ7A 3QUFA 3T1BA 4G8NA 4R6KA 2QJEA 4KHZE 2AIXA 3EF7A 3HV1A 2ZMBA 3O2AA 1Q1KA 1MH3A 4YB5A 4GWZA 4DI3D 2ZZVA 5CMKA 4X9TA 2NWJA 5ISUA 5H8FB 4YMAA 1Y1ZA 4ISUA 3PD9A 1FPEA 4Q8RA 3S9LC 4PETA 1LCTA 1IQ7A 3FVNA 3PU5A 1VFEA 3O6IA 4QSCA 4L17A 4ESXA 1N7XA 2Q88A 4GL8A 3CRBA 4YAHX 4R9GA 4F1YA 5KZTA 1LFIA 5EHSA 2VPOA 3C4MA 5F7VA 2DE4A 3H6VA 4GXSB 1VFDA 1LBYA 5KCJA 2VD3A 2Z22A 2RCBA 2M8CA 3IX1A 4OMBA 2HQ0A 4AB6A 1FBFA 4EF2A 1VDWA 4RJZA 1SVXB 3IFAA 5FBPA 1EZPA 4WKMA 4G4PA 1FBDA 4FEBA 3S4UA 3SEVA 4GBWA 2UYEA 4P0GA 2DWIA 1B32A 1INPA 4NF8A 4NG7A 2DVZA 4QFKA 1QKAA 4I3EA 5JTYA 3C35A 1B58A 3A3UA 4P56A 3VVDA 1TXFA 4EF1A 1A40A 2FA7A 3TTMA 3G3GA 3MVXA 3HHFA 3FVOA 2PFYA 1FQEA 4F1VA 2B3FA 5I57A 1A7LA 3D1RA 4OA4A 1JW5A 2V4CA 2XD2A 1IMDA 1MY2A 1A8FA 3QUJA 1FTMA 2Q2CA 1M5BA 4XEQA 4N8GA 4HE1A 2O84X 2QVUA 4GX4A 4PQJA 1DTGA 4QXDA 2V84A 4POXA 4PGNA 5ET8A 1PB9A 1LAXA 4GBVA 3BFUA 3IAZA 2R8TA 1BIYA 3ZKLA 1PEBA 2XX7A 4H46A 2B65A 4OVTA 2D21A 4UACA 4YKIA 5LOMA 4Q0CA 1Y4TA 1LEVA 1A8EA 1XOCA 4MF3A 5LDZA 2I0BA 1B40A 5ET5A 1T0KA 1GGGA 4NWCA 2F7CA 3TUSA 3H7MA 1QW0A 4G68A 3OEKA 3UIFA 1MH4A 3ZS6A 5CMBA 2ONRA 2GHAA 5DEXB 5I5PA 2PFZA 3PMXA 4WXJA 4RPNA 1NV6A 5CM6A 2A5SA 1ZTYA 3OXNA 3TCHA 3EN3A 2DP8A 4OEUA 5CBRA 1TFDA 3CI8A 1NH7A 4JXIA 2HZLA 4JSOA 2Y7RA 1IMCA 4P1LA 3RUMA 4PC9A 2F36A 3U72A 1ZU0A 4IGTA 5ITPA 1OVTA 4G61A 3MW0A 1URGA 3MP8A 3HFUA 4H8JA 4HE2A 2Z8DA 3R6UA 1NI9A 3TODA 4QFPA 1OLAA 1US5A 4I9DA 3LV0A 4LA9A 4MNIA 3RNNA 2F3DA 5H8HB 2X7QA 4ZE9A 4GRKA 3FGSA 3V5AA 2KR0A 2H9BA 2F97A 1JW4A 4GWOA 4DZ1A 4MAGA 4WEPA 2ANJA 3OO6A 1B7HA 1UTHA 1FPLA 2ONSA 2HXWA 4GWWA 4QF9A 3EQ1A 3ISPA 4JSDA 2Q2AA 1SPIA 4MBPA 1LBXA 3RTWB 1P99A 2P2AA 1NNFA 2HCAA 1O7TA 1USYE 3LSLA 3FJ7A 4IO3A 4X1BA 1MRPA 4GXAA 3N94A 4KFQA 4NX1A 4I8CA 2H5YA 4C1TA 2DQVA 3C31A 3G3FA 2L5VA 3MJNA 4EQ9A 4EXKA 2F8DA 2Q9TA 3B7DA 4BDMA 2H98A 1S9TA 3QIMA 3K1PA 1SW5A 3RT6B 2HPGA 3RY3A 3SDFA 4NF6B 4ZEFA 2NVUB 4PFIA 1Y1MA 4XIGQ 2R9JA 4F19A 4JWOA 1P1NA 1KWHA 5AA4A 4NF4B 1H43A 1FBPA 3O29A 2O1MA 3K2DA 4OESA 2ZYMA 3K01A 5I56A 2P3NA 2XD3A 3TTKA 1RDXA 3ZKKA 1IXIA 3BFTA 4YB7A 1ZBMA 3SKPA 4IGRA 4OVPA 1SI1A 1R9LA 1BLFA 3SETA 2XX9A 4NGUA 2B4MA 1PC3A 1WDNA 2DSFA 1PB7A 3M3KA 3MZBA 3CFXA 1LAHE 2ZNUA 3TAJA 2P1SA 4XXUA 1NFTA 3I3VA 5IZ3B 3FVGA 3LBSA 4X48A 1LGBC 3JV9A 3T9VA 3EHTA 1FTOA 2Y5KA 1FQAA 2VD2A 5KDTB 1IMFA 1UTBB 3FZVA 5F1QA 1MS7A 1DMBA 1MY1A 1DTZA 3MBPA 2F34A 1A54A 3B6QA 4N8YA 4X04A 1NKXA 4QRZA 1SI0A 1VE4A 3B50A 3MC2A 4OZ9A 3PPRA 5K2XA 1MPDA 1G0IA 1UIVA 1LFGA 4LZ7A 2HAUA 2DYXA 1TWYA 2F78A 5FTHA 1R9QA 4F29A 4Q5TA 3UA8A 4ELPA 4PFYA 4KD5A 4MFIA 5IGAA 3KC0A 5F24A 4H0WA 3MVZA 3K6XA 3KN7A 5ET6A 5A5XB 4NTLA 4BDLA 2QS2A 4ELRA 4XF5A 2Y5LA 3D4GA 2QS3A 1NV2A 4MNCA 3SEYA 3DLNA 4O3CA 1JNFA 1LAFE 2Z8EA 4ZECA 4KI0E 3THIA 1PB8A 2DWJA 5I2KB 2E1SA 2QS1A 4IO7A 4BDQA 1P1WA 1J1NA 1N76A 4OVSA 3IK6B 1AIVA 1I6AA 2REGA 2FIXA 4YU0A 4PAIA 5ICTA 3ILTB 5I56B 3KEIA 4E0XA 3E4RA 2V3QA 4FORA 2XWVA 4NF5B 3PMWA 2QVVA 3FXQA 3S2VA 1UIUA 3T22A 2F7BA 4GIZA 1B5HA 5L8DA 3U93A 4F2OA 3IR1A 4THIA 2QFLA 3GXAA 3N6TA 1URDA 1XVYA 3FD3A 1DPEA 5H8QA 1IUDA 3TQWA 4R2BA 2UVJA 4YKJA 3FV2A 3SEUA 3MVWA 4RY1A 1QJMA 4HTGA 4P1EA 2XHDA 1KA1A 4H45A 3KBRA 3GBBA 2VOZA 3ZSFA 2ZZWA 3K6VA 2CEYA 3JYRA 3PPPA 1MQIA 4I3YA 1MXVA 1MQDA 1MXUA 2H99A 1B6HA 2GFEA 2F3BA 2OWZA 2XXWA 2DWAA 2B4LA 1FPFA 4N4UA 1OMPA 4KCCA 4QFNA 2FYIA 4ONYA 1NNTA 4N91A 3SZPA 4MHFA 3IFCA 2Y7WA 3R26A 2XX8A 2Y84A 1RYXA 4U23A 1MQHA 3O6HA 4OTEA 1B3LA 3OMBA 4HXVA 4DLDA 4P3LA 1NUYA 3U65A 2UVIA 1MY4A 1LFHA 4NE4A 4MNPA 4YICA 5H8NB 1EYIA 1FTAA 4U22A 4OFLA 4OWDA 2V25A 3O28A 1NV4A 2V93A 1IZ1A 2NUVA 3TCGA 2Y7KA 5EQ7A 4UA8A 2VPNA 1O63A 4R6YA 4AQ4A 2I6EA 3QAXA 3HHGA 2XXUA 4GWUA 4OXVA 4EDPA 2WEFA 3G3JA 1LBZA 5I59A 3OO9A 3VVEA 3VXCA 4DXCA 1IIWA 2D3IA 1LBVA 4U21A 3DP6A 1P1OA 3FJGA 1USYH 4YKKA 3P7IA 3CVGA 4Q30B 2GHBA 3QMFA 2OCUA 3EHUA 5J1DA 5ITOA 3MSTA 2X7PA 4DXBA 1NUZA 2D5WA 2FIEA 1RDYA 2DS9A 5TPAB 3BKIB 3GLBA 1N3WA 1LB9A 2W7YA 2PCRA 2QRYA 3MPLA 5TP9B 1TFAA 5ICQA 2BJIA 1CE2A 4N17A 3RPWA 1FPGA 1RKMA 1ELJA 5AA1A 3G3KA 3CSGA 3OOAA 4GFRA 4DCYA 4XKPA 1Q35A 3DP8A 2Y7IA 3F11A
chains in the Genus database with same CATH topology
4FE8A 5I58A 1ZLQA 3LR1A 2A5TA 4RXLA 1QVSA 3C32A 3K0VA 1LAGE 3CG1A 4GQOA 1FW0A 2NOOA 1LCFA 3IB2A 2AL5A 1QUIA 4C0RA 1L5TA 3UK4A 4F1UA 5CMMA 4FIMA 4EUOA 4ZZEA 2ZYOA 3T9UA 4G68C 1XHYA 4U1OA 5KCJB 5CC2A 2F35A 3CIJA 3FV1A 4H5FA 3IO4A 4G77A 4Z0IA 4KCDA 3VLVA 3LSFB 1MM7A 4OERA 2F5XA 3TTRA 2UVHA 4GVOA 5DYHA 3DM0A 3S9MC 1B7ZA 4U4XA 1XC1A 5HBCA 4M1VA 4NF8B 4ND9A 3PGFA 4HS7A 3PUWE 5FTIA 3K00A 1HSJA 3OEMA 4EQBA 5JTYB 3B6TA 3SEWA 4GL0A 3M8UA 4POWA 2RC9A 4LUBA 4O3BA 1SYIA 2O7UA 1FQDA 4QSDA 5I84A 1YTVA 5I57B 4OQOA 4R9FA 2UXAA 3HCQA 3FASA 4R74A 1D9VA 4MH5A 5JEIA 1IXGA 2ZNSA 3O66A 5AA3A 2Y7PA 2I48A 3N5LA 4ZDMA 2OLBA 3KN8A 2OZZA 3OENA 5DT6A 4H6DA 2ZYKA 3U94A 4RPOA 2OWTA 2IA4A 3HN0A 4I62A 4HW8A 3TZAA 1FTLA 5I58B 4F2QA 1ANFA 4P0IA 4GF8A 3KJTA 2PT2A 3T93B 1S7YA 3PPNA 2G29A 2HEUA 1S50A 1ZIUA 3HO7A 4G68B 2H25A 1D9YA 1OVBA 3V8XB 1MQJA 3UN6A 5BUUA 1Y3PA 1MY3A 1GV8A 4F22A 1NL5A 3PD8A 3L6HA 2HZKA 3H6UA 4M4GA 4ELQA 2NXOA 4ZEIA 3C33A 3ONMA 4DE8A 4F3BA 1POY1 2UVGA 5IKBA 4G2ZA 2XXHA 4RK2A 4XTCQ 5HM4B 3Q27A 3EPEA 5EYFA 4IO5A 5FHOA 5DVIA 2THIA 3M3FA 4I1DA 1AL3A 3KN3A 3TKDA 1SD3A 5FHNA 3MUQA 4KYDA 3SESA 3R7XA 1FCKA 3UGWA 4DXUA 2F6GA 2DOJA 3CSBA 1JEVA 2R6GE 3PPOA 1SYHA 2Z23A 3UORA 3ILUB 5AA2A 1MG1A 1PBQA 2Q89A 1JEUA 3TQLA 1EU8A 1Y3QA 1MDQA 3PUVE 1MPBA 1FQFA 5CBSA 4JWXA 3K1NA 3B6WA 2ESNA 1UTHB 4OFOA 3G3IA 1B1HA 1LBCA 4R72A 3UP9A 1BTJA 4R75A 2QMWA 4DIGA 2YLNA 2DXRA 2RCAA 4U1ZA 1NNKA 3T9HB 1R6ZA 3KSXA 3WAEA 2VHAA 4N07A 3H6WA 1SW1A 2O69A 1N0TA 2QPQA 1VR5A 3TDJA 2PX1A 4ESWA 3C36A 3E3KA 3QXMA 4IO6A 1N84A 3USDA 1OLCA 3TTLA 1IXHA 2ZNTA 5H8FA 3VLUA 4YMBA 2XXYA 1YAEA 2FNCA 3IOTA 2RC8A 1CB6A 1N7WA 2CZLA 3U92A 3O9PA 4LVQA 5ELVA 3CR9A 1MXZA 1NH8A 4R73A 5AA4B 3G3HA 4ZEKA 5TU0A 2LAOA 1ZMGA 1BP5A 3Q26A 1B1XA 3SERA 3KSJA 5I2NA 2DXYA 2O6AA 3RN8A 3W9WA 3IO6A 1M5DA 3T66A 3MAMA 1B4ZA 4PFTA 2HFBA 1US4A 1P1UA 3VXBA 2F6PA 1F9BA 1B5JA 4N13A 5JK4A 5AE4A 4ZE8A 1II5A 4KR5A 3I6VA 3RLFE 1TT1A 2B3BA 2I3VA 5B70A 3E13X 3C9HA 1Z7ME 4QFLA 2ZYNA 1B0HA 3FXRA 1WODA 1GVCA 3IL1B 4BDNA 3FXUA 1OIBA 4Z7EA 1N04A 2RKMA 3TCFA 4XKQA 4ELOA 1Y3NA 3RGYA 2PYYA 1QKBA 1Y9UA 4LQ2A 3KOTA 2ABHA 3KZGA 2XXQA 1JQFA 3TMGA 4ZZAA 2Q8JA 1RYOA 3VE1B 1YPNA 2F7AA 1B0LA 1MXXA 4RNSA 3QSLA 2O68A 3L6GA 3KG2A 2DE2A 1NNPA 4JB7A 4OEVA 2XXXA 1PBPA 2UYFA 4F3PA 1JVYA 3H4ZA 1DOTA 3GZGA 2ALUA 1MQGA 3A3CA 3OSQA 3LSWA 4FAJA 2ZXTA 1GTKA 2ONKE 1D3KA 4LATA 5DEXA 1EZ9A 1FQCA 5I2NB 3I5OA 4H65A 1MXYA 1HSEA 4H67A 1MDP1 1XT8A 1GR2A 2I58A 4N6PA 5L9SA 2KLFA 1POTA 2OJTA 4C1UA 1IEJA 4DDDA 1A99A 4NEDA 1LBBA 1LB8A 4H8IA 2YJPA 4HCWA 1AMFA 4R6HA 3CFZA 5H8QB 1B5IA 3FVKA 4MLQA 3PPQA 3O97A 4RK9A 4YKPA 3VVFA 2VGQA 3H03A 1D4NA 5H8HA 4JBZA 4ZS9A 4NMYA 1LLSA 3S9NC 1H76A 3VFJA 2E0SA 1QUKA 3OSRA 3K1MA 1ZJLA 4IB2A 2DVCA 5H8SA 4ZEDA 4TQUQ 1JVXA 2XXVA 4OYVA 1M5FA 1FTJA 1Y20A 2X26A 4U2RA 4OENA 5M2VA 1SBPA 3N26A 4F39A 4LP2B 3TPAA 4GD5A 5IAIA 2O1LA 3DELB 2I3WA 3LC8A 3RT8A 3IB0A 3MQ9A 4PE5B 3IJXB 4XKNA 4QHQA 3DP4A 1A55A 4H1XA 4NF6A 1Z7NE 2R71A 1FTKA 3O6GA 1QULA 3VV5A 5I59B 4NF4A 4DCXA 2DWHA 3OO7A 3IOVA 3TTNA 4LQ5A 3HSTA 3MP1A 3W9VA 4OVJA 5CRYA 4IO2A 1VSOA 3MPKA 2I0CA 4TOZA 2RINA 3PMVA 4JDFA 2GRVA 4RYAA 3KFMA 3WAFA 3HPIA 4H5GA 4LZ5A 4F3SA 4GLIA 3T9XB 2QMXA 1HSLA 3H3GA 3FIRA 2AYSA 2V3UA 3VLWA 2PMSA 2XXIA 1IXCA 1B51A 2AL4A 4KQPA 3FJMA 1B4HA 3D4CA 3RQTA 1NMUA 2XXRA 3SEXA 5FHMA 3RTFB 4KYSA 2A5TB 5L9OA 1EZOA 5KDTA 1UTBA 1B2HA 3GBAA 5BWJA 4EQ7A 4MLVA 2QSXA 4FECA 2PT1A 3TEPA 3TFLA 1LSTA 3MP6A 5HPQA 5K2YA 4NWDA 5L9MA 3A09A 1I6BA 1EH3A 3Q25A 1B9JA 1I6QA 3H06B 4F3GA 2OK2A 2PVUA 1XVXA 2VP1A 3PUYE 4AB5A 4E0WA 4KYEA 2RF1A 3FUZA 4R2FA 4KPTA 1AOVA 5A5XA 1WVJA 4OETA 2V3TA 5DVJA 1H44A 4JWYA 4FJPA 3BBRA 4IY6A 4EXLA 4G8HA 3M3LA 3MZ9A 5I2KA 3PUZE 1FQBA 3V89B 1SDXA 1UQWA 3Q29A 1PDAA 2XXPA 4IO4A 1B05A 4QSEA 1BKAA 3U8QA 2PBWA 2REJA 4NF5A 3LUYA 2O51A 1URSA 1N3XA 1B3GA 3V83A 1DPPA 3CG3A 1JW1A 1ATGA 3MZ1A 1MM6A 3N6UA 1SQYA 3IJOB 4OHNA 2RC7A 1M5CA 4U4SA 2QL3A 4PP0A 1YCJA 4LZ8A 3C34A 3K6WA 4F31B 4GOTA 3TELA 3MVYA 1Y4CA 4OFJA 1AH5A 3OO8A 2IEEA 2H4IA 3OELA 1DSNA 1OQGA 1H3DA 3PUXE 2OWSA 2QS4A 4QFOA 5DTBA 2DE3A 4FATA 3T96B 4IY5A 4TLMB 2HAVA 4RA1A 3KOSA 1B46A 4YZZA 1XS5A 3IOWA 3KGCA 4ECFA 4BDRA 2O7IA 5EHMA 1JETA 3FATA 3JZJA 2XXTA 3MWBA 3LSXA 4HCYA 3H6TA 3AXFA 4K3FA 5AA2D 5H8NA 4PFUA 1M5EA 2G93A 3K02A 1H45A 4FEDA 4BLAA 4ZEBA 2I4CA 1B3FA 2YPNA 3G7WA 5B7DA 5AA2B 4PFWA 1B3HA 3QK6A 3EHSA 2OBGA 1MPCA 3PV0E 1B3EA 2Z8FA 3IB1A 4WEDA 2I49A 1ZKBA 3K4UA 2BJJX 4P11A 1QUJA 1B7UA 1MXWA 3OD7A 3IOUA 3S9EA 3ODBA 2I4BA 4BDOA 1SW4A 2CMOA 3CFLA 3U1OA 3E9XA 1B52A 4G8MA 1R1NA 2P0SA 3ECRA 3Q28A 1O64A 1I69A 1P1QA 1IITA 4YB6A 5TPAA 2WKYA 4XKRA 1MY0A 3IORA 4X1DA 4F18A 4TLLB 5CI5A 5TP9A 3TYHA 2GH9A 1SW2A 3W15C 3K6UA 5CMCA 4O3AA 5DVFA 3VDFA 1OQHA 3QYTA 4LONB 3KJ7A 3QUFA 4G8NA 4R6KA 2QJEA 4KHZE 2AIXA 3EF7A 3HV1A 2ZMBA 3O2AA 1Q1KA 1MH3A 4YB5A 5CMKA 4X9TA 2NWJA 5ISUA 5H8FB 4YMAA 1Y1ZA 4ISUA 4Q8RA 3PD9A 3S9LC 4PETA 1LCTA 1IQ7A 3FVNA 3PU5A 1VFEA 3O6IA 4QSCA 4L17A 4ESXA 1N7XA 2Q88A 4GL8A 3CRBA 4YAHX 4R9GA 4F1YA 5KZTA 1LFIA 5EHSA 3C4MA 5F7VA 2DE4A 3H6VA 4GXSB 1VFDA 5KCJA 2VD3A 2Z22A 2RCBA 2M8CA 3IX1A 4OMBA 2HQ0A 4AB6A 4EF2A 4RJZA 1SVXB 1EZPA 4WKMA 4G4PA 4FEBA 3S4UA 3SEVA 2UYEA 4P0GA 2DWIA 1B32A 4NF8A 2DVZA 4QFKA 1QKAA 5JTYA 3C35A 1B58A 3A3UA 3VVDA 4EF1A 1TXFA 1A40A 2FA7A 3TTMA 3G3GA 3MVXA 3HHFA 3FVOA 1FQEA 4F1VA 2B3FA 5I57A 1A7LA 1JW5A 2XD2A 1MY2A 1A8FA 3QUJA 1FTMA 2Q2CA 1M5BA 2O84X 4PQJA 1DTGA 2V84A 4POXA 1PB9A 1LAXA 3BFUA 3IAZA 1BIYA 3ZKLA 1PEBA 2XX7A 2B65A 2D21A 4UACA 4YKIA 5LOMA 4Q0CA 1Y4TA 1A8EA 1XOCA 4MF3A 2I0BA 1B40A 1T0KA 1GGGA 4NWCA 2F7CA 3TUSA 3H7MA 1QW0A 4G68A 3OEKA 3UIFA 1MH4A 3ZS6A 5CMBA 2ONRA 2GHAA 5DEXB 3PMXA 4WXJA 4RPNA 5CM6A 2A5SA 1ZTYA 3OXNA 3TCHA 3EN3A 2DP8A 4OEUA 5CBRA 1TFDA 3CI8A 1NH7A 4JXIA 2HZLA 4JSOA 2Y7RA 3RUMA 2F36A 3U72A 1ZU0A 4IGTA 5ITPA 1OVTA 3MW0A 1URGA 3MP8A 4H8JA 2Z8DA 3R6UA 3TODA 4QFPA 1OLAA 1US5A 4I9DA 4LA9A 3RNNA 5H8HB 2X7QA 4ZE9A 4GRKA 3FGSA 3V5AA 2H9BA 2F97A 1JW4A 4GWOA 4DZ1A 4WEPA 2ANJA 3OO6A 1B7HA 1UTHA 2ONSA 2HXWA 4QF9A 3EQ1A 4JSDA 2Q2AA 4MBPA 3RTWB 1P99A 2P2AA 1NNFA 2HCAA 1O7TA 1USYE 3LSLA 3FJ7A 4IO3A 4X1BA 1MRPA 4GXAA 3N94A 4KFQA 4I8CA 2H5YA 4C1TA 2DQVA 3C31A 3G3FA 3MJNA 4EQ9A 4EXKA 2F8DA 2Q9TA 3B7DA 4BDMA 2H98A 1S9TA 3QIMA 3K1PA 1SW5A 3RT6B 3RY3A 3SDFA 4NF6B 4ZEFA 2NVUB 1Y1MA 4XIGQ 2R9JA 4F19A 4JWOA 1P1NA 1KWHA 5AA4A 4NF4B 1H43A 3O29A 2O1MA 3K2DA 4OESA 2ZYMA 3K01A 5I56A 2XD3A 3TTKA 3ZKKA 1IXIA 3BFTA 4YB7A 1ZBMA 3SKPA 4IGRA 1SI1A 1R9LA 1BLFA 3SETA 2XX9A 1PC3A 1WDNA 2DSFA 1PB7A 3M3KA 3MZBA 3CFXA 1LAHE 2ZNUA 3TAJA 2P1SA 4XXUA 1NFTA 3I3VA 3FVGA 3LBSA 4X48A 1LGBC 3JV9A 3T9VA 3EHTA 1FTOA 1FQAA 2VD2A 5KDTB 1UTBB 3FZVA 5F1QA 1MS7A 1DMBA 1MY1A 1DTZA 3MBPA 2F34A 1A54A 3B6QA 1NKXA 4QRZA 1SI0A 1VE4A 3MC2A 4OZ9A 3PPRA 5K2XA 1MPDA 1UIVA 1LFGA 4LZ7A 2HAUA 2DYXA 1TWYA 2F78A 5FTHA 1R9QA 4F29A 4Q5TA 3UA8A 4ELPA 4PFYA 4KD5A 4MFIA 4H0WA 3MVZA 3K6XA 3KN7A 5A5XB 4NTLA 4BDLA 2QS2A 4ELRA 3D4GA 2QS3A 3SEYA 3DLNA 4O3CA 1JNFA 1LAFE 2Z8EA 4ZECA 4KI0E 3THIA 1PB8A 2DWJA 5I2KB 2E1SA 2QS1A 4IO7A 4BDQA 1P1WA 1J1NA 1N76A 3IK6B 1AIVA 1I6AA 2REGA 4YU0A 5ICTA 3ILTB 5I56B 3KEIA 4E0XA 3E4RA 2V3QA 4FORA 4NF5B 3PMWA 3FXQA 3S2VA 1UIUA 3T22A 2F7BA 4GIZA 1B5HA 5L8DA 3U93A 4F2OA 3IR1A 4THIA 3GXAA 3N6TA 1URDA 1XVYA 3FD3A 1DPEA 5H8QA 1IUDA 3TQWA 4R2BA 2UVJA 4YKJA 3FV2A 3SEUA 3MVWA 4RY1A 1QJMA 4HTGA 2XHDA 3KBRA 3GBBA 2VOZA 3ZSFA 3K6VA 3JYRA 3PPPA 1MQIA 1MXVA 1MQDA 1MXUA 2H99A 1B6HA 2GFEA 2XXWA 2DWAA 1OMPA 4KCCA 4QFNA 2FYIA 4ONYA 1NNTA 2Y7WA 3R26A 2XX8A 2Y84A 1RYXA 4U23A 1MQHA 3O6HA 4OTEA 1B3LA 3OMBA 4DLDA 2UVIA 1MY4A 1LFHA 4NE4A 4YICA 5H8NB 4U22A 4OFLA 4OWDA 2V25A 3O28A 2V93A 1IZ1A 2NUVA 3TCGA 2Y7KA 4UA8A 1O63A 4R6YA 4AQ4A 2I6EA 3QAXA 3HHGA 2XXUA 4OXVA 4EDPA 3G3JA 5I59A 3OO9A 3VVEA 3VXCA 4DXCA 1IIWA 2D3IA 4U21A 3DP6A 1P1OA 3FJGA 1USYH 4YKKA 3P7IA 3CVGA 4Q30B 2GHBA 2OCUA 3EHUA 5J1DA 5ITOA 2X7PA 4DXBA 2D5WA 2DS9A 5TPAB 3BKIB 3GLBA 1N3WA 1LB9A 2W7YA 2QRYA 3MPLA 5TP9B 1TFAA 5ICQA 1CE2A 3RPWA 1RKMA 1ELJA 5AA1A 3G3KA 3CSGA 3OOAA 4GFRA 4DCYA 4XKPA 1Q35A 3DP8A 2Y7IA 3F11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FE8 A;  5I58 A;  1ZLQ A;  3LR1 A;  2A5T A;  4RXL A;  1QVS A;  3C32 A;  3K0V A;  1LAG E;  3CG1 A;  4GQO A;  1FW0 A;  2NOO A;  1LCF A;  3IB2 A;  2AL5 A;  1QUI A;  4C0R A;  1L5T A;  3UK4 A;  4F1U A;  5CMM A;  4FIM A;  4EUO A;  4ZZE A;  2ZYO A;  3T9U A;  4G68 C;  1XHY A;  4U1O A;  5KCJ B;  5CC2 A;  2F35 A;  3CIJ A;  3FV1 A;  4H5F A;  3IO4 A;  4G77 A;  4Z0I A;  4KCD A;  3VLV A;  3LSF B;  1MM7 A;  4OER A;  2F5X A;  3TTR A;  2UVH A;  4GVO A;  5DYH A;  3DM0 A;  3S9M C;  1B7Z A;  4U4X A;  1XC1 A;  5HBC A;  4M1V A;  4NF8 B;  4ND9 A;  3PGF A;  4HS7 A;  3PUW E;  5FTI A;  3K00 A;  1HSJ A;  3OEM A;  4EQB A;  5JTY B;  3B6T A;  3SEW A;  4GL0 A;  3M8U A;  4POW A;  2RC9 A;  4LUB A;  4O3B A;  1SYI A;  2O7U A;  1FQD A;  4QSD A;  5I84 A;  1YTV A;  5I57 B;  4OQO A;  4R9F A;  2UXA A;  3HCQ A;  3FAS A;  4R74 A;  1D9V A;  4MH5 A;  5JEI A;  1IXG A;  2ZNS A;  3O66 A;  5AA3 A;  2Y7P A;  2I48 A;  3N5L A;  4ZDM A;  2OLB A;  3KN8 A;  2OZZ A;  3OEN A;  5DT6 A;  4H6D A;  2ZYK A;  3U94 A;  4RPO A;  2OWT A;  2IA4 A;  3HN0 A;  4I62 A;  4HW8 A;  3TZA A;  1FTL A;  5I58 B;  4F2Q A;  1ANF A;  4P0I A;  4GF8 A;  3KJT A;  2PT2 A;  3T93 B;  1S7Y A;  3PPN A;  2G29 A;  2HEU A;  1S50 A;  1ZIU A;  3HO7 A;  4G68 B;  2H25 A;  1D9Y A;  1OVB A;  3V8X B;  1MQJ A;  3UN6 A;  5BUU A;  1Y3P A;  1MY3 A;  1GV8 A;  4F22 A;  1NL5 A;  3PD8 A;  3L6H A;  2HZK A;  3H6U A;  4M4G A;  4ELQ A;  2NXO A;  4ZEI A;  3C33 A;  3ONM A;  4DE8 A;  4F3B A;  1POY 1;  2UVG A;  5IKB A;  4G2Z A;  2XXH A;  4RK2 A;  4XTC Q;  5HM4 B;  3Q27 A;  3EPE A;  5EYF A;  4IO5 A;  5FHO A;  5DVI A;  2THI A;  3M3F A;  4I1D A;  1AL3 A;  3KN3 A;  3TKD A;  1SD3 A;  5FHN A;  3MUQ A;  4KYD A;  3SES A;  3R7X A;  1FCK A;  3UGW A;  4DXU A;  2F6G A;  2DOJ A;  3CSB A;  1JEV A;  2R6G E;  3PPO A;  1SYH A;  2Z23 A;  3UOR A;  3ILU B;  5AA2 A;  1MG1 A;  1PBQ A;  2Q89 A;  1JEU A;  3TQL A;  1EU8 A;  1Y3Q A;  1MDQ A;  3PUV E;  1MPB A;  1FQF A;  5CBS A;  4JWX A;  3K1N A;  3B6W A;  2ESN A;  1UTH B;  4OFO A;  3G3I A;  1B1H A;  1LBC A;  4R72 A;  3UP9 A;  1BTJ A;  4R75 A;  2QMW A;  4DIG A;  2YLN A;  2DXR A;  2RCA A;  4U1Z A;  1NNK A;  3T9H B;  1R6Z A;  3KSX A;  3WAE A;  2VHA A;  4N07 A;  3H6W A;  1SW1 A;  2O69 A;  1N0T A;  2QPQ A;  1VR5 A;  3TDJ A;  2PX1 A;  4ESW A;  3C36 A;  3E3K A;  3QXM A;  4IO6 A;  1N84 A;  3USD A;  1OLC A;  3TTL A;  1IXH A;  2ZNT A;  5H8F A;  3VLU A;  4YMB A;  2XXY A;  1YAE A;  2FNC A;  3IOT A;  2RC8 A;  1CB6 A;  1N7W A;  2CZL A;  3U92 A;  3O9P A;  4LVQ A;  5ELV A;  3CR9 A;  1MXZ A;  1NH8 A;  4R73 A;  5AA4 B;  3G3H A;  4ZEK A;  5TU0 A;  2LAO A;  1ZMG A;  1BP5 A;  3Q26 A;  1B1X A;  3SER A;  3KSJ A;  5I2N A;  2DXY A;  2O6A A;  3RN8 A;  3W9W A;  3IO6 A;  1M5D A;  3T66 A;  3MAM A;  1B4Z A;  4PFT A;  2HFB A;  1US4 A;  1P1U A;  3VXB A;  2F6P A;  1F9B A;  1B5J A;  4N13 A;  5JK4 A;  5AE4 A;  4ZE8 A;  1II5 A;  4KR5 A;  3I6V A;  3RLF E;  1TT1 A;  2B3B A;  2I3V A;  5B70 A;  3E13 X;  3C9H A;  1Z7M E;  4QFL A;  2ZYN A;  1B0H A;  3FXR A;  1WOD A;  1GVC A;  3IL1 B;  4BDN A;  3FXU A;  1OIB A;  4Z7E A;  1N04 A;  2RKM A;  3TCF A;  4XKQ A;  4ELO A;  1Y3N A;  3RGY A;  2PYY A;  1QKB A;  1Y9U A;  4LQ2 A;  3KOT A;  2ABH A;  3KZG A;  2XXQ A;  1JQF A;  3TMG A;  4ZZA A;  2Q8J A;  1RYO A;  3VE1 B;  1YPN A;  2F7A A;  1B0L A;  1MXX A;  4RNS A;  3QSL A;  2O68 A;  3L6G A;  3KG2 A;  2DE2 A;  1NNP A;  4JB7 A;  4OEV A;  2XXX A;  1PBP A;  2UYF A;  4F3P A;  1JVY A;  3H4Z A;  1DOT A;  3GZG A;  2ALU A;  1MQG A;  3A3C A;  3OSQ A;  3LSW A;  4FAJ A;  2ZXT A;  1GTK A;  2ONK E;  1D3K A;  4LAT A;  5DEX A;  1EZ9 A;  1FQC A;  5I2N B;  3I5O A;  4H65 A;  1MXY A;  1HSE A;  4H67 A;  1MDP 1;  1XT8 A;  1GR2 A;  2I58 A;  4N6P A;  5L9S A;  2KLF A;  1POT A;  2OJT A;  4C1U A;  1IEJ A;  4DDD A;  1A99 A;  4NED A;  1LBB A;  1LB8 A;  4H8I A;  2YJP A;  4HCW A;  1AMF A;  4R6H A;  3CFZ A;  5H8Q B;  1B5I A;  3FVK A;  4MLQ A;  3PPQ A;  3O97 A;  4RK9 A;  4YKP A;  3VVF A;  2VGQ A;  3H03 A;  1D4N A;  5H8H A;  4JBZ A;  4ZS9 A;  4NMY A;  1LLS A;  3S9N C;  1H76 A;  3VFJ A;  2E0S A;  1QUK A;  3OSR A;  3K1M A;  1ZJL A;  4IB2 A;  2DVC A;  5H8S A;  4ZED A;  4TQU Q;  1JVX A;  2XXV A;  4OYV A;  1M5F A;  1FTJ A;  1Y20 A;  2X26 A;  4U2R A;  4OEN A;  5M2V A;  1SBP A;  3N26 A;  4F39 A;  4LP2 B;  3TPA A;  4GD5 A;  5IAI A;  2O1L A;  3DEL B;  2I3W A;  3LC8 A;  3RT8 A;  3IB0 A;  3MQ9 A;  4PE5 B;  3IJX B;  4XKN A;  4QHQ A;  3DP4 A;  1A55 A;  4H1X A;  4NF6 A;  1Z7N E;  2R71 A;  1FTK A;  3O6G A;  1QUL A;  3VV5 A;  5I59 B;  4NF4 A;  4DCX A;  2DWH A;  3OO7 A;  3IOV A;  3TTN A;  4LQ5 A;  3HST A;  3MP1 A;  3W9V A;  4OVJ A;  5CRY A;  4IO2 A;  1VSO A;  3MPK A;  2I0C A;  4TOZ A;  2RIN A;  3PMV A;  4JDF A;  2GRV A;  4RYA A;  3KFM A;  3WAF A;  3HPI A;  4H5G A;  4LZ5 A;  4F3S A;  4GLI A;  3T9X B;  2QMX A;  1HSL A;  3H3G A;  3FIR A;  2AYS A;  2V3U A;  3VLW A;  2PMS A;  2XXI A;  1IXC A;  1B51 A;  2AL4 A;  4KQP A;  3FJM A;  1B4H A;  3D4C A;  3RQT A;  1NMU A;  2XXR A;  3SEX A;  5FHM A;  3RTF B;  4KYS A;  2A5T B;  5L9O A;  1EZO A;  5KDT A;  1UTB A;  1B2H A;  3GBA A;  5BWJ A;  4EQ7 A;  4MLV A;  2QSX A;  4FEC A;  2PT1 A;  3TEP A;  3TFL A;  1LST A;  3MP6 A;  5HPQ A;  5K2Y A;  4NWD A;  5L9M A;  3A09 A;  1I6B A;  1EH3 A;  3Q25 A;  1B9J A;  1I6Q A;  3H06 B;  4F3G A;  2OK2 A;  2PVU A;  1XVX A;  2VP1 A;  3PUY E;  4AB5 A;  4E0W A;  4KYE A;  2RF1 A;  3FUZ A;  4R2F A;  4KPT A;  1AOV A;  5A5X A;  1WVJ A;  4OET A;  2V3T A;  5DVJ A;  1H44 A;  4JWY A;  4FJP A;  3BBR A;  4IY6 A;  4EXL A;  4G8H A;  3M3L A;  3MZ9 A;  5I2K A;  3PUZ E;  1FQB A;  3V89 B;  1SDX A;  1UQW A;  3Q29 A;  1PDA A;  2XXP A;  4IO4 A;  1B05 A;  4QSE A;  1BKA A;  3U8Q A;  2PBW A;  2REJ A;  4NF5 A;  3LUY A;  2O51 A;  1URS A;  1N3X A;  1B3G A;  3V83 A;  1DPP A;  3CG3 A;  1JW1 A;  1ATG A;  3MZ1 A;  1MM6 A;  3N6U A;  1SQY A;  3IJO B;  4OHN A;  2RC7 A;  1M5C A;  4U4S A;  2QL3 A;  4PP0 A;  1YCJ A;  4LZ8 A;  3C34 A;  3K6W A;  4F31 B;  4GOT A;  3TEL A;  3MVY A;  1Y4C A;  4OFJ A;  1AH5 A;  3OO8 A;  2IEE A;  2H4I A;  3OEL A;  1DSN A;  1OQG A;  1H3D A;  3PUX E;  2OWS A;  2QS4 A;  4QFO A;  5DTB A;  2DE3 A;  4FAT A;  3T96 B;  4IY5 A;  4TLM B;  2HAV A;  4RA1 A;  3KOS A;  1B46 A;  4YZZ A;  1XS5 A;  3IOW A;  3KGC A;  4ECF A;  4BDR A;  2O7I A;  5EHM A;  1JET A;  3FAT A;  3JZJ A;  2XXT A;  3MWB A;  3LSX A;  4HCY A;  3H6T A;  3AXF A;  4K3F A;  5AA2 D;  5H8N A;  4PFU A;  1M5E A;  2G93 A;  3K02 A;  1H45 A;  4FED A;  4BLA A;  4ZEB A;  2I4C A;  1B3F A;  2YPN A;  3G7W A;  5B7D A;  5AA2 B;  4PFW A;  1B3H A;  3QK6 A;  3EHS A;  2OBG A;  1MPC A;  3PV0 E;  1B3E A;  2Z8F A;  3IB1 A;  4WED A;  2I49 A;  1ZKB A;  3K4U A;  2BJJ X;  4P11 A;  1QUJ A;  1B7U A;  1MXW A;  3OD7 A;  3IOU A;  3S9E A;  3ODB A;  2I4B A;  4BDO A;  1SW4 A;  2CMO A;  3CFL A;  3U1O A;  3E9X A;  1B52 A;  4G8M A;  1R1N A;  2P0S A;  3ECR A;  3Q28 A;  1O64 A;  1I69 A;  1P1Q A;  1IIT A;  4YB6 A;  5TPA A;  2WKY A;  4XKR A;  1MY0 A;  3IOR A;  4X1D A;  4F18 A;  4TLL B;  5CI5 A;  5TP9 A;  3TYH A;  2GH9 A;  1SW2 A;  3W15 C;  3K6U A;  5CMC A;  4O3A A;  5DVF A;  3VDF A;  1OQH A;  3QYT A;  4LON B;  3KJ7 A;  3QUF A;  4G8N A;  4R6K A;  2QJE A;  4KHZ E;  2AIX A;  3EF7 A;  3HV1 A;  2ZMB A;  3O2A A;  1Q1K A;  1MH3 A;  4YB5 A;  5CMK A;  4X9T A;  2NWJ A;  5ISU A;  5H8F B;  4YMA A;  1Y1Z A;  4ISU A;  4Q8R A;  3PD9 A;  3S9L C;  4PET A;  1LCT A;  1IQ7 A;  3FVN A;  3PU5 A;  1VFE A;  3O6I A;  4QSC A;  4L17 A;  4ESX A;  1N7X A;  2Q88 A;  4GL8 A;  3CRB A;  4YAH X;  4R9G A;  4F1Y A;  5KZT A;  1LFI A;  5EHS A;  3C4M A;  5F7V A;  2DE4 A;  3H6V A;  4GXS B;  1VFD A;  5KCJ A;  2VD3 A;  2Z22 A;  2RCB A;  2M8C A;  3IX1 A;  4OMB A;  2HQ0 A;  4AB6 A;  4EF2 A;  4RJZ A;  1SVX B;  1EZP A;  4WKM A;  4G4P A;  4FEB A;  3S4U A;  3SEV A;  2UYE A;  4P0G A;  2DWI A;  1B32 A;  4NF8 A;  2DVZ A;  4QFK A;  1QKA A;  5JTY A;  3C35 A;  1B58 A;  3A3U A;  3VVD A;  4EF1 A;  1TXF A;  1A40 A;  2FA7 A;  3TTM A;  3G3G A;  3MVX A;  3HHF A;  3FVO A;  1FQE A;  4F1V A;  2B3F A;  5I57 A;  1A7L A;  1JW5 A;  2XD2 A;  1MY2 A;  1A8F A;  3QUJ A;  1FTM A;  2Q2C A;  1M5B A;  2O84 X;  4PQJ A;  1DTG A;  2V84 A;  4POX A;  1PB9 A;  1LAX A;  3BFU A;  3IAZ A;  1BIY A;  3ZKL A;  1PEB A;  2XX7 A;  2B65 A;  2D21 A;  4UAC A;  4YKI A;  5LOM A;  4Q0C A;  1Y4T A;  1A8E A;  1XOC A;  4MF3 A;  2I0B A;  1B40 A;  1T0K A;  1GGG A;  4NWC A;  2F7C A;  3TUS A;  3H7M A;  1QW0 A;  4G68 A;  3OEK A;  3UIF A;  1MH4 A;  3ZS6 A;  5CMB A;  2ONR A;  2GHA A;  5DEX B;  3PMX A;  4WXJ A;  4RPN A;  5CM6 A;  2A5S A;  1ZTY A;  3OXN A;  3TCH A;  3EN3 A;  2DP8 A;  4OEU A;  5CBR A;  1TFD A;  3CI8 A;  1NH7 A;  4JXI A;  2HZL A;  4JSO A;  2Y7R A;  3RUM A;  2F36 A;  3U72 A;  1ZU0 A;  4IGT A;  5ITP A;  1OVT A;  3MW0 A;  1URG A;  3MP8 A;  4H8J A;  2Z8D A;  3R6U A;  3TOD A;  4QFP A;  1OLA A;  1US5 A;  4I9D A;  4LA9 A;  3RNN A;  5H8H B;  2X7Q A;  4ZE9 A;  4GRK A;  3FGS A;  3V5A A;  2H9B A;  2F97 A;  1JW4 A;  4GWO A;  4DZ1 A;  4WEP A;  2ANJ A;  3OO6 A;  1B7H A;  1UTH A;  2ONS A;  2HXW A;  4QF9 A;  3EQ1 A;  4JSD A;  2Q2A A;  4MBP A;  3RTW B;  1P99 A;  2P2A A;  1NNF A;  2HCA A;  1O7T A;  1USY E;  3LSL A;  3FJ7 A;  4IO3 A;  4X1B A;  1MRP A;  4GXA A;  3N94 A;  4KFQ A;  4I8C A;  2H5Y A;  4C1T A;  2DQV A;  3C31 A;  3G3F A;  3MJN A;  4EQ9 A;  4EXK A;  2F8D A;  2Q9T A;  3B7D A;  4BDM A;  2H98 A;  1S9T A;  3QIM A;  3K1P A;  1SW5 A;  3RT6 B;  3RY3 A;  3SDF A;  4NF6 B;  4ZEF A;  2NVU B;  1Y1M A;  4XIG Q;  2R9J A;  4F19 A;  4JWO A;  1P1N A;  1KWH A;  5AA4 A;  4NF4 B;  1H43 A;  3O29 A;  2O1M A;  3K2D A;  4OES A;  2ZYM A;  3K01 A;  5I56 A;  2XD3 A;  3TTK A;  3ZKK A;  1IXI A;  3BFT A;  4YB7 A;  1ZBM A;  3SKP A;  4IGR A;  1SI1 A;  1R9L A;  1BLF A;  3SET A;  2XX9 A;  1PC3 A;  1WDN A;  2DSF A;  1PB7 A;  3M3K A;  3MZB A;  3CFX A;  1LAH E;  2ZNU A;  3TAJ A;  2P1S A;  4XXU A;  1NFT A;  3I3V A;  3FVG A;  3LBS A;  4X48 A;  1LGB C;  3JV9 A;  3T9V A;  3EHT A;  1FTO A;  1FQA A;  2VD2 A;  5KDT B;  1UTB B;  3FZV A;  5F1Q A;  1MS7 A;  1DMB A;  1MY1 A;  1DTZ A;  3MBP A;  2F34 A;  1A54 A;  3B6Q A;  1NKX A;  4QRZ A;  1SI0 A;  1VE4 A;  3MC2 A;  4OZ9 A;  3PPR A;  5K2X A;  1MPD A;  1UIV A;  1LFG A;  4LZ7 A;  2HAU A;  2DYX A;  1TWY A;  2F78 A;  5FTH A;  1R9Q A;  4F29 A;  4Q5T A;  3UA8 A;  4ELP A;  4PFY A;  4KD5 A;  4MFI A;  4H0W A;  3MVZ A;  3K6X A;  3KN7 A;  5A5X B;  4NTL A;  4BDL A;  2QS2 A;  4ELR A;  3D4G A;  2QS3 A;  3SEY A;  3DLN A;  4O3C A;  1JNF A;  1LAF E;  2Z8E A;  4ZEC A;  4KI0 E;  3THI A;  1PB8 A;  2DWJ A;  5I2K B;  2E1S A;  2QS1 A;  4IO7 A;  4BDQ A;  1P1W A;  1J1N A;  1N76 A;  3IK6 B;  1AIV A;  1I6A A;  2REG A;  4YU0 A;  5ICT A;  3ILT B;  5I56 B;  3KEI A;  4E0X A;  3E4R A;  2V3Q A;  4FOR A;  4NF5 B;  3PMW A;  3FXQ A;  3S2V A;  1UIU A;  3T22 A;  2F7B A;  4GIZ A;  1B5H A;  5L8D A;  3U93 A;  4F2O A;  3IR1 A;  4THI A;  3GXA A;  3N6T A;  1URD A;  1XVY A;  3FD3 A;  1DPE A;  5H8Q A;  1IUD A;  3TQW A;  4R2B A;  2UVJ A;  4YKJ A;  3FV2 A;  3SEU A;  3MVW A;  4RY1 A;  1QJM A;  4HTG A;  2XHD A;  3KBR A;  3GBB A;  2VOZ A;  3ZSF A;  3K6V A;  3JYR A;  3PPP A;  1MQI A;  1MXV A;  1MQD A;  1MXU A;  2H99 A;  1B6H A;  2GFE A;  2XXW A;  2DWA A;  1OMP A;  4KCC A;  4QFN A;  2FYI A;  4ONY A;  1NNT A;  2Y7W A;  3R26 A;  2XX8 A;  2Y84 A;  1RYX A;  4U23 A;  1MQH A;  3O6H A;  4OTE A;  1B3L A;  3OMB A;  4DLD A;  2UVI A;  1MY4 A;  1LFH A;  4NE4 A;  4YIC A;  5H8N B;  4U22 A;  4OFL A;  4OWD A;  2V25 A;  3O28 A;  2V93 A;  1IZ1 A;  2NUV A;  3TCG A;  2Y7K A;  4UA8 A;  1O63 A;  4R6Y A;  4AQ4 A;  2I6E A;  3QAX A;  3HHG A;  2XXU A;  4OXV A;  4EDP A;  3G3J A;  5I59 A;  3OO9 A;  3VVE A;  3VXC A;  4DXC A;  1IIW A;  2D3I A;  4U21 A;  3DP6 A;  1P1O A;  3FJG A;  1USY H;  4YKK A;  3P7I A;  3CVG A;  4Q30 B;  2GHB A;  2OCU A;  3EHU A;  5J1D A;  5ITO A;  2X7P A;  4DXB A;  2D5W A;  2DS9 A;  5TPA B;  3BKI B;  3GLB A;  1N3W A;  1LB9 A;  2W7Y A;  2QRY A;  3MPL A;  5TP9 B;  1TFA A;  5ICQ A;  1CE2 A;  3RPW A;  1RKM A;  1ELJ A;  5AA1 A;  3G3K A;  3CSG A;  3OOA A;  4GFR A;  4DCY A;  4XKP A;  1Q35 A;  3DP8 A;  2Y7I A;  3F11 A; 
#chains in the Genus database with same CATH topology
 4FE8 A;  5I58 A;  1ZLQ A;  3LR1 A;  1FBC A;  2A5T A;  1XI6 A;  1QVS A;  3C32 A;  4RXL A;  4GWX A;  3K0V A;  1LAG E;  3CG1 A;  4GQO A;  1FW0 A;  2NOO A;  1LCF A;  4NN3 A;  4PBH A;  3IB2 A;  2AL5 A;  1QUI A;  4C0R A;  1L5T A;  3UK4 A;  1IME A;  4F1U A;  5CMM A;  4FIM A;  4EUO A;  4ZZE A;  2ZYO A;  3T9U A;  5LTC A;  4G68 C;  1XHY A;  4U1O A;  5KCJ B;  5CC2 A;  2F35 A;  5I3S A;  3CIJ A;  3FV1 A;  4H5F A;  3IO4 A;  3RPL A;  4G77 A;  4Z0I A;  4KCD A;  3VLV A;  4QBA A;  3LSF B;  1MM7 A;  2XWI A;  4OER A;  2F5X A;  3TTR A;  2UVH A;  4GVO A;  5DYH A;  3DM0 A;  3S9M C;  4NQ8 A;  5EYG A;  1B7Z A;  4U4X A;  1XC1 A;  5HBC A;  4M1V A;  4NF8 B;  4ND9 A;  3KC1 A;  3PGF A;  4HS7 A;  3PUW E;  5FTI A;  3K00 A;  1HSJ A;  3OEM A;  4EQB A;  1DK4 A;  5JTY B;  3B6T A;  3SEW A;  4GL0 A;  3M8U A;  4POW A;  2RC9 A;  4LUB A;  4O3B A;  1SYI A;  2O7U A;  1FQD A;  4QSD A;  2P3V A;  5I84 A;  1YTV A;  5I57 B;  4OQO A;  2XWK A;  4PF6 A;  4R9F A;  2UXA A;  3HCQ A;  3FAS A;  4R74 A;  1D9V A;  4MH5 A;  5JEI A;  5ESY A;  1IXG A;  2ZNS A;  3O66 A;  5AA3 A;  2Y7P A;  2I48 A;  3N5L A;  4ZDM A;  2OLB A;  3KN8 A;  2OZZ A;  3OEN A;  5DT6 A;  4H6D A;  2ZYK A;  3U94 A;  4RPO A;  2OWT A;  4PAF A;  2IA4 A;  3HN0 A;  4P9K A;  4I62 A;  4HW8 A;  3TZA A;  1FTL A;  5I58 B;  1NUW A;  5EQ9 A;  1FPJ A;  4F2Q A;  1ANF A;  4P0I A;  4GF8 A;  3KJT A;  2PT2 A;  3T93 B;  1S7Y A;  3PPN A;  2G29 A;  2HEU A;  3BIH A;  1S50 A;  1ZIU A;  3HO7 A;  1CNQ A;  2WBB A;  4G68 B;  2H25 A;  3FXB A;  1D9Y A;  1OVB A;  3V8X B;  1MQJ A;  3UN6 A;  5BUU A;  2HXR A;  1RDZ A;  1Y3P A;  1MY3 A;  1EYJ A;  1GV8 A;  4F22 A;  1NL5 A;  3PD8 A;  3L6H A;  2HZK A;  3H6U A;  4M4G A;  4ELQ A;  2NXO A;  4ZEI A;  3C33 A;  3GYY A;  3ONM A;  4DE8 A;  4F3B A;  4GX3 A;  1POY 1;  2UVG A;  5IKB A;  4G2Z A;  4MIJ A;  2XXH A;  4RK2 A;  4XTC Q;  5HM4 B;  3Q27 A;  3EPE A;  5EYF A;  4PE3 A;  1K9Y A;  4IO5 A;  5FHO A;  5DVI A;  2THI A;  3M3F A;  4I1D A;  1AL3 A;  3KN3 A;  3TKD A;  1SD3 A;  5FHN A;  4XFE A;  3MUQ A;  1KA0 A;  4KYD A;  3SES A;  3R7X A;  4OAN A;  1FCK A;  3UGW A;  4DXU A;  2F6G A;  2DOJ A;  3CSB A;  1JEV A;  2R6G E;  3PPO A;  1SYH A;  4OVR A;  2Z23 A;  3UOR A;  3ILU B;  5AA2 A;  1MG1 A;  1PBQ A;  2Q89 A;  1JEU A;  4LN5 A;  1EU8 A;  3TQL A;  2CEX A;  1Y3Q A;  1MDQ A;  3PUV E;  1MPB A;  1FQF A;  2CZI A;  4FBP A;  5CBS A;  4JWX A;  3K1N A;  2FHY A;  3B6W A;  2ESN A;  1UTH B;  4PCD A;  4OFO A;  3G3I A;  1B1H A;  1LBC A;  4R72 A;  3UP9 A;  5T3J A;  1BTJ A;  4R75 A;  2QMW A;  4DIG A;  4O8M A;  2YLN A;  2DXR A;  2RCA A;  4U1Z A;  1YXI A;  1NNK A;  2Q8M A;  3T9H B;  1R6Z A;  3KSX A;  2WYP A;  3WAE A;  2VHA A;  5IZZ A;  4N07 A;  3H6W A;  1SW1 A;  2O69 A;  1N0T A;  2QPQ A;  1VR5 A;  3TDJ A;  2PX1 A;  4ESW A;  3C36 A;  3E3K A;  3QXM A;  4IO6 A;  1N84 A;  3USD A;  1EYK A;  5I7I A;  1OLC A;  1FRP A;  2DDK A;  3TTL A;  1IXH A;  2ZNT A;  5H8F A;  3VLU A;  4YMB A;  1NV0 A;  2XXY A;  1YAE A;  2FNC A;  3IOT A;  4O94 A;  2RC8 A;  1CB6 A;  1N7W A;  2CZL A;  3U92 A;  3O9P A;  1FPB A;  4LVQ A;  5ELV A;  3CR9 A;  1MXZ A;  1NH8 A;  4R73 A;  5AA4 B;  3G3H A;  4GWS A;  4ZEK A;  5TU0 A;  2LAO A;  1ZMG A;  1BP5 A;  3Q26 A;  1B1X A;  3SER A;  3KSJ A;  5I2N A;  2DXY A;  2O6A A;  3RN8 A;  2QVR A;  3W9W A;  3IO6 A;  1M5D A;  3T66 A;  3MAM A;  1B4Z A;  4PFT A;  2HFB A;  1US4 A;  1P1U A;  3VXB A;  2F6P A;  1F9B A;  1B5J A;  4UAB A;  4N13 A;  4AS5 A;  5JK4 A;  4DI4 B;  5AE4 A;  4ZE8 A;  1II5 A;  4KR5 A;  4PDD A;  3I6V A;  3RLF E;  1TT1 A;  2B3B A;  2I3V A;  4P8B A;  5B70 A;  3E13 X;  1NV7 A;  1FSA A;  3C9H A;  1Z7M E;  4QFL A;  2ZYN A;  1B0H A;  3FXR A;  4PFR A;  4PF8 A;  1WOD A;  1GVC A;  3IL1 B;  4BDN A;  3FXU A;  1OIB A;  2WX9 A;  3EKI A;  4AS4 A;  4Z7E A;  1N04 A;  2RKM A;  1KZ8 A;  3TCF A;  1D9Q A;  4XKQ A;  4ELO A;  4N81 A;  1Y3N A;  3RGY A;  2PYY A;  1QKB A;  1Y9U A;  4LQ2 A;  3KOT A;  2ABH A;  3KZG A;  2XXQ A;  3NOH A;  1JQF A;  3TMG A;  3LUZ A;  4ZZA A;  2Q8J A;  1RYO A;  3VE1 B;  1YPN A;  2F7A A;  1B0L A;  1MXX A;  4RNS A;  3QSL A;  1FJ9 A;  2O68 A;  3L6G A;  4N15 A;  3KG2 A;  2DE2 A;  1NNP A;  4JB7 A;  4GWY A;  4OEV A;  2XXX A;  1PBP A;  2UYF A;  4F3P A;  1JVY A;  5IM2 A;  3H4Z A;  1DOT A;  3GZG A;  2ALU A;  1MQG A;  3A3C A;  3OSQ A;  3LSW A;  4FAJ A;  2FVZ A;  2ZXT A;  1GTK A;  2ONK E;  1D3K A;  4LAT A;  5DEX A;  1EZ9 A;  1FQC A;  5I2N B;  3I5O A;  4H65 A;  1MXY A;  1HSE A;  1DCU A;  4H67 A;  1MDP 1;  1K9Z A;  1XT8 A;  1GR2 A;  1NUX A;  2I58 A;  4N6P A;  5L9S A;  2KLF A;  1POT A;  2OJT A;  4C1U A;  1IEJ A;  4DDD A;  1A99 A;  4NED A;  1LBB A;  1LB8 A;  4HE0 A;  4H8I A;  2YJP A;  4HCW A;  1AMF A;  4R6H A;  3CFZ A;  5H8Q B;  1B5I A;  3FVK A;  4JVI A;  4MLQ A;  3PPQ A;  1NV5 A;  3O97 A;  4RK9 A;  4GX6 A;  4N6D A;  1G0H A;  3BIG A;  3B8B A;  4YKP A;  3VVF A;  2VGQ A;  3H03 A;  1D4N A;  5H8H A;  4JBZ A;  4ZS9 A;  4NMY A;  1IMB A;  3RYD A;  4MCO A;  4X8R A;  1LLS A;  3S9N C;  1H76 A;  3VFJ A;  2E0S A;  1QUK A;  3OSR A;  4PAK A;  1FJ6 A;  3K1M A;  1ZJL A;  1LBW A;  4IB2 A;  2DVC A;  5H8S A;  1FBH A;  4ZED A;  3KBZ A;  1FBG A;  4TQU Q;  1JVX A;  2XXV A;  4OYV A;  1M5F A;  1FTJ A;  1Y20 A;  4P47 A;  4O7I A;  1FPI A;  1FBE A;  3CHG A;  2X26 A;  4U2R A;  4OEN A;  5M2V A;  1SBP A;  3N26 A;  4F39 A;  4LP2 B;  3TPA A;  4GD5 A;  5IAI A;  2O1L A;  3DEL B;  2I3W A;  3LC8 A;  3RT8 A;  3IB0 A;  5J16 A;  3MQ9 A;  4PE5 B;  3IJX B;  4XKN A;  4QHQ A;  3DP4 A;  1A55 A;  4H1X A;  4NF6 A;  1Z7N E;  2R71 A;  4IR8 A;  1FTK A;  4PDH A;  4NAP A;  4O7M A;  3A29 A;  3O6G A;  5DW8 A;  5EQ8 A;  1IMA A;  1QUL A;  3VV5 A;  5I59 B;  2KQZ A;  4NF4 A;  3E78 A;  4DCX A;  2DWH A;  3OO7 A;  3IOV A;  3TTN A;  4LQ5 A;  3HST A;  3MP1 A;  2XXK A;  3W9V A;  4OVJ A;  5CRY A;  4IO2 A;  1YYZ A;  1VSO A;  3MPK A;  2I0C A;  4TOZ A;  2RIN A;  3PMV A;  4JDF A;  2GRV A;  4RYA A;  3KFM A;  3WAF A;  3HPI A;  4H5G A;  4LZ5 A;  4F3S A;  4GLI A;  3T9X B;  2QMX A;  1HSL A;  3H3G A;  3FIR A;  2AYS A;  1JP4 A;  2V3U A;  3VLW A;  2PMS A;  2XXI A;  4JVC A;  1IXC A;  1B51 A;  2AL4 A;  4KQP A;  5IZ3 A;  3FJM A;  1B4H A;  3D4C A;  2XWO A;  3RQT A;  1NMU A;  2XXR A;  5ET7 A;  3SEX A;  5FHM A;  3RTF B;  4KYS A;  2A5T B;  5L9O A;  1EZO A;  5KDT A;  1UTB A;  1B2H A;  3GBA A;  3ROJ A;  5BWJ A;  4EQ7 A;  4MLV A;  2QSX A;  4FEC A;  2PT1 A;  3TEP A;  3TFL A;  1LST A;  3MP6 A;  5HPQ A;  3T0J A;  5K2Y A;  4NWD A;  5L9M A;  3A09 A;  1I6B A;  1EH3 A;  3Q25 A;  1B9J A;  1I6Q A;  3H06 B;  4F3G A;  2OK2 A;  2PVU A;  1XVX A;  2VP1 A;  1NV1 A;  3PUY E;  4AB5 A;  4E0W A;  4KYE A;  2RF1 A;  3FUZ A;  4R2F A;  4MJO A;  4KPT A;  1AOV A;  3RPL B;  5A5X A;  1WVJ A;  4MEV A;  4OET A;  2V3T A;  5DVJ A;  1H44 A;  4JWY A;  4FJP A;  3MYU A;  3BBR A;  1QGX A;  4IY6 A;  4EXL A;  4G8H A;  3M3L A;  3MZ9 A;  5I2K A;  2XA5 A;  3PUZ E;  3FBP A;  1FQB A;  1DBZ A;  3V89 B;  4PFB A;  1SDX A;  1UQW A;  3Q29 A;  1PDA A;  2XXP A;  2CZH A;  1B05 A;  4IO4 A;  4PGP A;  4QSE A;  4MX6 A;  1BKA A;  1YZ0 A;  3U8Q A;  2PBW A;  2REJ A;  1NV3 A;  4NF5 A;  3LUY A;  2O51 A;  1URS A;  1N3X A;  1B3G A;  3V83 A;  1DPP A;  3CG3 A;  2VT5 A;  1JW1 A;  1ATG A;  3MZ1 A;  1MM6 A;  1FPD A;  2FBP A;  3N6U A;  1SQY A;  4N6K A;  5EYH A;  3IJO B;  4OHN A;  2RC7 A;  1M5C A;  4U4S A;  2QL3 A;  4PP0 A;  1YCJ A;  4LZ8 A;  3C34 A;  3K6W A;  4F31 B;  2GQ1 A;  4GOT A;  3TEL A;  2OX3 A;  3MVY A;  1Y4C A;  4OFJ A;  1AH5 A;  2WBD A;  3OO8 A;  2IEE A;  2H4I A;  4KXP A;  3OEL A;  1DSN A;  1OQG A;  1H3D A;  1BK4 A;  3PUX E;  2OWS A;  4JVD A;  2QS4 A;  4QFO A;  5DTB A;  2DE3 A;  4FAT A;  3T96 B;  4IY5 A;  2ZZX A;  4TLM B;  2HAV A;  4RA1 A;  3KOS A;  1B46 A;  3E79 A;  4YZZ A;  1XS5 A;  3IOW A;  4NHB A;  3KGC A;  4ECF A;  4BDR A;  2O7I A;  5EHM A;  1JET A;  3FAT A;  3JZJ A;  2XXT A;  4PBQ A;  3MWB A;  4MMP A;  3LSX A;  4HCY A;  3H6T A;  3AXF A;  4K3F A;  5AA2 D;  5H8N A;  4PFU A;  1M5E A;  2G93 A;  3K02 A;  4I40 A;  1H45 A;  4FED A;  5A5L A;  4BLA A;  4ZEB A;  4NF0 A;  2I4C A;  1B3F A;  2Q74 A;  2YPN A;  3G7W A;  1Q9D A;  5AA2 B;  5B7D A;  2CZK A;  4PFW A;  1B3H A;  3QK6 A;  3EHS A;  2OBG A;  1MPC A;  3PV0 E;  4OVQ A;  1B3E A;  2Z8F A;  3IB1 A;  4WED A;  2I49 A;  1ZKB A;  3K4U A;  2BJJ X;  4P11 A;  1AWB A;  1QUJ A;  1B7U A;  1MXW A;  3OD7 A;  3IOU A;  3S9E A;  3ODB A;  2I4B A;  4BDO A;  1SW4 A;  2CMO A;  3CFL A;  3U1O A;  3E9X A;  1B52 A;  4G8M A;  1R1N A;  3PTY A;  2P0S A;  3ECR A;  3Q28 A;  2WYK A;  1O64 A;  1I69 A;  1P1Q A;  1IIT A;  4YB6 A;  2JJK A;  5IZ1 A;  5TPA A;  2WKY A;  4XKR A;  1MY0 A;  3IOR A;  2HHM A;  4X1D A;  4F18 A;  2MKZ A;  4TLL B;  5CI5 A;  5TP9 A;  3TYH A;  2GH9 A;  1SW2 A;  3W15 C;  4PTK A;  3K6U A;  1FPK A;  5CMC A;  4O3A A;  5DVF A;  3VDF A;  1OQH A;  5EQA A;  3QYT A;  4LON B;  3KJ7 A;  3QUF A;  3T1B A;  4G8N A;  4R6K A;  2QJE A;  4KHZ E;  2AIX A;  3EF7 A;  3HV1 A;  2ZMB A;  3O2A A;  1Q1K A;  1MH3 A;  4YB5 A;  4GWZ A;  4DI3 D;  2ZZV A;  5CMK A;  4X9T A;  2NWJ A;  5ISU A;  5H8F B;  4YMA A;  1Y1Z A;  4ISU A;  3PD9 A;  1FPE A;  4Q8R A;  3S9L C;  4PET A;  1LCT A;  1IQ7 A;  3FVN A;  3PU5 A;  1VFE A;  3O6I A;  4QSC A;  4L17 A;  4ESX A;  1N7X A;  2Q88 A;  4GL8 A;  3CRB A;  4YAH X;  4R9G A;  4F1Y A;  5KZT A;  1LFI A;  5EHS A;  2VPO A;  3C4M A;  5F7V A;  2DE4 A;  3H6V A;  4GXS B;  1VFD A;  1LBY A;  5KCJ A;  2VD3 A;  2Z22 A;  2RCB A;  2M8C A;  3IX1 A;  4OMB A;  2HQ0 A;  4AB6 A;  1FBF A;  4EF2 A;  1VDW A;  4RJZ A;  1SVX B;  3IFA A;  5FBP A;  1EZP A;  4WKM A;  4G4P A;  1FBD A;  4FEB A;  3S4U A;  3SEV A;  4GBW A;  2UYE A;  4P0G A;  2DWI A;  1B32 A;  1INP A;  4NF8 A;  4NG7 A;  2DVZ A;  4QFK A;  1QKA A;  4I3E A;  5JTY A;  3C35 A;  1B58 A;  3A3U A;  4P56 A;  3VVD A;  1TXF A;  4EF1 A;  1A40 A;  2FA7 A;  3TTM A;  3G3G A;  3MVX A;  3HHF A;  3FVO A;  2PFY A;  1FQE A;  4F1V A;  2B3F A;  5I57 A;  1A7L A;  3D1R A;  4OA4 A;  1JW5 A;  2V4C A;  2XD2 A;  1IMD A;  1MY2 A;  1A8F A;  3QUJ A;  1FTM A;  2Q2C A;  1M5B A;  4XEQ A;  4N8G A;  4HE1 A;  2O84 X;  2QVU A;  4GX4 A;  4PQJ A;  1DTG A;  4QXD A;  2V84 A;  4POX A;  4PGN A;  5ET8 A;  1PB9 A;  1LAX A;  4GBV A;  3BFU A;  3IAZ A;  2R8T A;  1BIY A;  3ZKL A;  1PEB A;  2XX7 A;  4H46 A;  2B65 A;  4OVT A;  2D21 A;  4UAC A;  4YKI A;  5LOM A;  4Q0C A;  1Y4T A;  1LEV A;  1A8E A;  1XOC A;  4MF3 A;  5LDZ A;  2I0B A;  1B40 A;  5ET5 A;  1T0K A;  1GGG A;  4NWC A;  2F7C A;  3TUS A;  3H7M A;  1QW0 A;  4G68 A;  3OEK A;  3UIF A;  1MH4 A;  3ZS6 A;  5CMB A;  2ONR A;  2GHA A;  5DEX B;  5I5P A;  2PFZ A;  3PMX A;  4WXJ A;  4RPN A;  1NV6 A;  5CM6 A;  2A5S A;  1ZTY A;  3OXN A;  3TCH A;  3EN3 A;  2DP8 A;  4OEU A;  5CBR A;  1TFD A;  3CI8 A;  1NH7 A;  4JXI A;  2HZL A;  4JSO A;  2Y7R A;  1IMC A;  4P1L A;  3RUM A;  4PC9 A;  2F36 A;  3U72 A;  1ZU0 A;  4IGT A;  5ITP A;  1OVT A;  4G61 A;  3MW0 A;  1URG A;  3MP8 A;  3HFU A;  4H8J A;  4HE2 A;  2Z8D A;  3R6U A;  1NI9 A;  3TOD A;  4QFP A;  1OLA A;  1US5 A;  4I9D A;  3LV0 A;  4LA9 A;  4MNI A;  3RNN A;  2F3D A;  5H8H B;  2X7Q A;  4ZE9 A;  4GRK A;  3FGS A;  3V5A A;  2KR0 A;  2H9B A;  2F97 A;  1JW4 A;  4GWO A;  4DZ1 A;  4MAG A;  4WEP A;  2ANJ A;  3OO6 A;  1B7H A;  1UTH A;  1FPL A;  2ONS A;  2HXW A;  4GWW A;  4QF9 A;  3EQ1 A;  3ISP A;  4JSD A;  2Q2A A;  1SPI A;  4MBP A;  1LBX A;  3RTW B;  1P99 A;  2P2A A;  1NNF A;  2HCA A;  1O7T A;  1USY E;  3LSL A;  3FJ7 A;  4IO3 A;  4X1B A;  1MRP A;  4GXA A;  3N94 A;  4KFQ A;  4NX1 A;  4I8C A;  2H5Y A;  4C1T A;  2DQV A;  3C31 A;  3G3F A;  2L5V A;  3MJN A;  4EQ9 A;  4EXK A;  2F8D A;  2Q9T A;  3B7D A;  4BDM A;  2H98 A;  1S9T A;  3QIM A;  3K1P A;  1SW5 A;  3RT6 B;  2HPG A;  3RY3 A;  3SDF A;  4NF6 B;  4ZEF A;  2NVU B;  4PFI A;  1Y1M A;  4XIG Q;  2R9J A;  4F19 A;  4JWO A;  1P1N A;  1KWH A;  5AA4 A;  4NF4 B;  1H43 A;  1FBP A;  3O29 A;  2O1M A;  3K2D A;  4OES A;  2ZYM A;  3K01 A;  5I56 A;  2P3N A;  2XD3 A;  3TTK A;  1RDX A;  3ZKK A;  1IXI A;  3BFT A;  4YB7 A;  1ZBM A;  3SKP A;  4IGR A;  4OVP A;  1SI1 A;  1R9L A;  1BLF A;  3SET A;  2XX9 A;  4NGU A;  2B4M A;  1PC3 A;  1WDN A;  2DSF A;  1PB7 A;  3M3K A;  3MZB A;  3CFX A;  1LAH E;  2ZNU A;  3TAJ A;  2P1S A;  4XXU A;  1NFT A;  3I3V A;  5IZ3 B;  3FVG A;  3LBS A;  4X48 A;  1LGB C;  3JV9 A;  3T9V A;  3EHT A;  1FTO A;  2Y5K A;  1FQA A;  2VD2 A;  5KDT B;  1IMF A;  1UTB B;  3FZV A;  5F1Q A;  1MS7 A;  1DMB A;  1MY1 A;  1DTZ A;  3MBP A;  2F34 A;  1A54 A;  3B6Q A;  4N8Y A;  4X04 A;  1NKX A;  4QRZ A;  1SI0 A;  1VE4 A;  3B50 A;  3MC2 A;  4OZ9 A;  3PPR A;  5K2X A;  1MPD A;  1G0I A;  1UIV A;  1LFG A;  4LZ7 A;  2HAU A;  2DYX A;  1TWY A;  2F78 A;  5FTH A;  1R9Q A;  4F29 A;  4Q5T A;  3UA8 A;  4ELP A;  4PFY A;  4KD5 A;  4MFI A;  5IGA A;  3KC0 A;  5F24 A;  4H0W A;  3MVZ A;  3K6X A;  3KN7 A;  5ET6 A;  5A5X B;  4NTL A;  4BDL A;  2QS2 A;  4ELR A;  4XF5 A;  2Y5L A;  3D4G A;  2QS3 A;  1NV2 A;  4MNC A;  3SEY A;  3DLN A;  4O3C A;  1JNF A;  1LAF E;  2Z8E A;  4ZEC A;  4KI0 E;  3THI A;  1PB8 A;  2DWJ A;  5I2K B;  2E1S A;  2QS1 A;  4IO7 A;  4BDQ A;  1P1W A;  1J1N A;  1N76 A;  4OVS A;  3IK6 B;  1AIV A;  1I6A A;  2REG A;  2FIX A;  4YU0 A;  4PAI A;  5ICT A;  3ILT B;  5I56 B;  3KEI A;  4E0X A;  3E4R A;  2V3Q A;  4FOR A;  2XWV A;  4NF5 B;  3PMW A;  2QVV A;  3FXQ A;  3S2V A;  1UIU A;  3T22 A;  2F7B A;  4GIZ A;  1B5H A;  5L8D A;  3U93 A;  4F2O A;  3IR1 A;  4THI A;  2QFL A;  3GXA A;  3N6T A;  1URD A;  1XVY A;  3FD3 A;  1DPE A;  5H8Q A;  1IUD A;  3TQW A;  4R2B A;  2UVJ A;  4YKJ A;  3FV2 A;  3SEU A;  3MVW A;  4RY1 A;  1QJM A;  4HTG A;  4P1E A;  2XHD A;  1KA1 A;  4H45 A;  3KBR A;  3GBB A;  2VOZ A;  3ZSF A;  2ZZW A;  3K6V A;  2CEY A;  3JYR A;  3PPP A;  1MQI A;  4I3Y A;  1MXV A;  1MQD A;  1MXU A;  2H99 A;  1B6H A;  2GFE A;  2F3B A;  2OWZ A;  2XXW A;  2DWA A;  2B4L A;  1FPF A;  4N4U A;  1OMP A;  4KCC A;  4QFN A;  2FYI A;  4ONY A;  1NNT A;  4N91 A;  3SZP A;  4MHF A;  3IFC A;  2Y7W A;  3R26 A;  2XX8 A;  2Y84 A;  1RYX A;  4U23 A;  1MQH A;  3O6H A;  4OTE A;  1B3L A;  3OMB A;  4HXV A;  4DLD A;  4P3L A;  1NUY A;  3U65 A;  2UVI A;  1MY4 A;  1LFH A;  4NE4 A;  4MNP A;  4YIC A;  5H8N B;  1EYI A;  1FTA A;  4U22 A;  4OFL A;  4OWD A;  2V25 A;  3O28 A;  1NV4 A;  2V93 A;  1IZ1 A;  2NUV A;  3TCG A;  2Y7K A;  5EQ7 A;  4UA8 A;  2VPN A;  1O63 A;  4R6Y A;  4AQ4 A;  2I6E A;  3QAX A;  3HHG A;  2XXU A;  4GWU A;  4OXV A;  4EDP A;  2WEF A;  3G3J A;  1LBZ A;  5I59 A;  3OO9 A;  3VVE A;  3VXC A;  4DXC A;  1IIW A;  2D3I A;  1LBV A;  4U21 A;  3DP6 A;  1P1O A;  3FJG A;  1USY H;  4YKK A;  3P7I A;  3CVG A;  4Q30 B;  2GHB A;  3QMF A;  2OCU A;  3EHU A;  5J1D A;  5ITO A;  3MST A;  2X7P A;  4DXB A;  1NUZ A;  2D5W A;  2FIE A;  1RDY A;  2DS9 A;  5TPA B;  3BKI B;  3GLB A;  1N3W A;  1LB9 A;  2W7Y A;  2PCR A;  2QRY A;  3MPL A;  5TP9 B;  1TFA A;  5ICQ A;  2BJI A;  1CE2 A;  4N17 A;  3RPW A;  1FPG A;  1RKM A;  1ELJ A;  5AA1 A;  3G3K A;  3CSG A;  3OOA A;  4GFR A;  4DCY A;  4XKP A;  1Q35 A;  3DP8 A;  2Y7I A;  3F11 A; 
#chains in the Genus database with same CATH homology
 4FE8 A;  5I58 A;  1ZLQ A;  3LR1 A;  2A5T A;  4RXL A;  1QVS A;  3C32 A;  3K0V A;  1LAG E;  3CG1 A;  4GQO A;  1FW0 A;  2NOO A;  1LCF A;  3IB2 A;  2AL5 A;  1QUI A;  4C0R A;  1L5T A;  3UK4 A;  4F1U A;  5CMM A;  4FIM A;  4EUO A;  4ZZE A;  2ZYO A;  3T9U A;  4G68 C;  1XHY A;  4U1O A;  5KCJ B;  5CC2 A;  2F35 A;  3CIJ A;  3FV1 A;  4H5F A;  3IO4 A;  4G77 A;  4Z0I A;  4KCD A;  3VLV A;  3LSF B;  1MM7 A;  4OER A;  2F5X A;  3TTR A;  2UVH A;  4GVO A;  5DYH A;  3DM0 A;  3S9M C;  1B7Z A;  4U4X A;  1XC1 A;  5HBC A;  4M1V A;  4NF8 B;  4ND9 A;  3PGF A;  4HS7 A;  3PUW E;  5FTI A;  3K00 A;  1HSJ A;  3OEM A;  4EQB A;  5JTY B;  3B6T A;  3SEW A;  4GL0 A;  3M8U A;  4POW A;  2RC9 A;  4LUB A;  4O3B A;  1SYI A;  2O7U A;  1FQD A;  4QSD A;  5I84 A;  1YTV A;  5I57 B;  4OQO A;  4R9F A;  2UXA A;  3HCQ A;  3FAS A;  4R74 A;  1D9V A;  4MH5 A;  5JEI A;  1IXG A;  2ZNS A;  3O66 A;  5AA3 A;  2Y7P A;  2I48 A;  3N5L A;  4ZDM A;  2OLB A;  3KN8 A;  2OZZ A;  3OEN A;  5DT6 A;  4H6D A;  2ZYK A;  3U94 A;  4RPO A;  2OWT A;  2IA4 A;  3HN0 A;  4I62 A;  4HW8 A;  3TZA A;  1FTL A;  5I58 B;  4F2Q A;  1ANF A;  4P0I A;  4GF8 A;  3KJT A;  2PT2 A;  3T93 B;  1S7Y A;  3PPN A;  2G29 A;  2HEU A;  1S50 A;  1ZIU A;  3HO7 A;  4G68 B;  2H25 A;  1D9Y A;  1OVB A;  3V8X B;  1MQJ A;  3UN6 A;  5BUU A;  1Y3P A;  1MY3 A;  1GV8 A;  4F22 A;  1NL5 A;  3PD8 A;  3L6H A;  2HZK A;  3H6U A;  4M4G A;  4ELQ A;  2NXO A;  4ZEI A;  3C33 A;  3ONM A;  4DE8 A;  4F3B A;  1POY 1;  2UVG A;  5IKB A;  4G2Z A;  2XXH A;  4RK2 A;  4XTC Q;  5HM4 B;  3Q27 A;  3EPE A;  5EYF A;  4IO5 A;  5FHO A;  5DVI A;  2THI A;  3M3F A;  4I1D A;  1AL3 A;  3KN3 A;  3TKD A;  1SD3 A;  5FHN A;  3MUQ A;  4KYD A;  3SES A;  3R7X A;  1FCK A;  3UGW A;  4DXU A;  2F6G A;  2DOJ A;  3CSB A;  1JEV A;  2R6G E;  3PPO A;  1SYH A;  2Z23 A;  3UOR A;  3ILU B;  5AA2 A;  1MG1 A;  1PBQ A;  2Q89 A;  1JEU A;  3TQL A;  1EU8 A;  1Y3Q A;  1MDQ A;  3PUV E;  1MPB A;  1FQF A;  5CBS A;  4JWX A;  3K1N A;  3B6W A;  2ESN A;  1UTH B;  4OFO A;  3G3I A;  1B1H A;  1LBC A;  4R72 A;  3UP9 A;  1BTJ A;  4R75 A;  2QMW A;  4DIG A;  2YLN A;  2DXR A;  2RCA A;  4U1Z A;  1NNK A;  3T9H B;  1R6Z A;  3KSX A;  3WAE A;  2VHA A;  4N07 A;  3H6W A;  1SW1 A;  2O69 A;  1N0T A;  2QPQ A;  1VR5 A;  3TDJ A;  2PX1 A;  4ESW A;  3C36 A;  3E3K A;  3QXM A;  4IO6 A;  1N84 A;  3USD A;  1OLC A;  3TTL A;  1IXH A;  2ZNT A;  5H8F A;  3VLU A;  4YMB A;  2XXY A;  1YAE A;  2FNC A;  3IOT A;  2RC8 A;  1CB6 A;  1N7W A;  2CZL A;  3U92 A;  3O9P A;  4LVQ A;  5ELV A;  3CR9 A;  1MXZ A;  1NH8 A;  4R73 A;  5AA4 B;  3G3H A;  4ZEK A;  5TU0 A;  2LAO A;  1ZMG A;  1BP5 A;  3Q26 A;  1B1X A;  3SER A;  3KSJ A;  5I2N A;  2DXY A;  2O6A A;  3RN8 A;  3W9W A;  3IO6 A;  1M5D A;  3T66 A;  3MAM A;  1B4Z A;  4PFT A;  2HFB A;  1US4 A;  1P1U A;  3VXB A;  2F6P A;  1F9B A;  1B5J A;  4N13 A;  5JK4 A;  5AE4 A;  4ZE8 A;  1II5 A;  4KR5 A;  3I6V A;  3RLF E;  1TT1 A;  2B3B A;  2I3V A;  5B70 A;  3E13 X;  3C9H A;  1Z7M E;  4QFL A;  2ZYN A;  1B0H A;  3FXR A;  1WOD A;  1GVC A;  3IL1 B;  4BDN A;  3FXU A;  1OIB A;  4Z7E A;  1N04 A;  2RKM A;  3TCF A;  4XKQ A;  4ELO A;  1Y3N A;  3RGY A;  2PYY A;  1QKB A;  1Y9U A;  4LQ2 A;  3KOT A;  2ABH A;  3KZG A;  2XXQ A;  1JQF A;  3TMG A;  4ZZA A;  2Q8J A;  1RYO A;  3VE1 B;  1YPN A;  2F7A A;  1B0L A;  1MXX A;  4RNS A;  3QSL A;  2O68 A;  3L6G A;  3KG2 A;  2DE2 A;  1NNP A;  4JB7 A;  4OEV A;  2XXX A;  1PBP A;  2UYF A;  4F3P A;  1JVY A;  3H4Z A;  1DOT A;  3GZG A;  2ALU A;  1MQG A;  3A3C A;  3OSQ A;  3LSW A;  4FAJ A;  2ZXT A;  1GTK A;  2ONK E;  1D3K A;  4LAT A;  5DEX A;  1EZ9 A;  1FQC A;  5I2N B;  3I5O A;  4H65 A;  1MXY A;  1HSE A;  4H67 A;  1MDP 1;  1XT8 A;  1GR2 A;  2I58 A;  4N6P A;  5L9S A;  2KLF A;  1POT A;  2OJT A;  4C1U A;  1IEJ A;  4DDD A;  1A99 A;  4NED A;  1LBB A;  1LB8 A;  4H8I A;  2YJP A;  4HCW A;  1AMF A;  4R6H A;  3CFZ A;  5H8Q B;  1B5I A;  3FVK A;  4MLQ A;  3PPQ A;  3O97 A;  4RK9 A;  4YKP A;  3VVF A;  2VGQ A;  3H03 A;  1D4N A;  5H8H A;  4JBZ A;  4ZS9 A;  4NMY A;  1LLS A;  3S9N C;  1H76 A;  3VFJ A;  2E0S A;  1QUK A;  3OSR A;  3K1M A;  1ZJL A;  4IB2 A;  2DVC A;  5H8S A;  4ZED A;  4TQU Q;  1JVX A;  2XXV A;  4OYV A;  1M5F A;  1FTJ A;  1Y20 A;  2X26 A;  4U2R A;  4OEN A;  5M2V A;  1SBP A;  3N26 A;  4F39 A;  4LP2 B;  3TPA A;  4GD5 A;  5IAI A;  2O1L A;  3DEL B;  2I3W A;  3LC8 A;  3RT8 A;  3IB0 A;  3MQ9 A;  4PE5 B;  3IJX B;  4XKN A;  4QHQ A;  3DP4 A;  1A55 A;  4H1X A;  4NF6 A;  1Z7N E;  2R71 A;  1FTK A;  3O6G A;  1QUL A;  3VV5 A;  5I59 B;  4NF4 A;  4DCX A;  2DWH A;  3OO7 A;  3IOV A;  3TTN A;  4LQ5 A;  3HST A;  3MP1 A;  3W9V A;  4OVJ A;  5CRY A;  4IO2 A;  1VSO A;  3MPK A;  2I0C A;  4TOZ A;  2RIN A;  3PMV A;  4JDF A;  2GRV A;  4RYA A;  3KFM A;  3WAF A;  3HPI A;  4H5G A;  4LZ5 A;  4F3S A;  4GLI A;  3T9X B;  2QMX A;  1HSL A;  3H3G A;  3FIR A;  2AYS A;  2V3U A;  3VLW A;  2PMS A;  2XXI A;  1IXC A;  1B51 A;  2AL4 A;  4KQP A;  3FJM A;  1B4H A;  3D4C A;  3RQT A;  1NMU A;  2XXR A;  3SEX A;  5FHM A;  3RTF B;  4KYS A;  2A5T B;  5L9O A;  1EZO A;  5KDT A;  1UTB A;  1B2H A;  3GBA A;  5BWJ A;  4EQ7 A;  4MLV A;  2QSX A;  4FEC A;  2PT1 A;  3TEP A;  3TFL A;  1LST A;  3MP6 A;  5HPQ A;  5K2Y A;  4NWD A;  5L9M A;  3A09 A;  1I6B A;  1EH3 A;  3Q25 A;  1B9J A;  1I6Q A;  3H06 B;  4F3G A;  2OK2 A;  2PVU A;  1XVX A;  2VP1 A;  3PUY E;  4AB5 A;  4E0W A;  4KYE A;  2RF1 A;  3FUZ A;  4R2F A;  4KPT A;  1AOV A;  5A5X A;  1WVJ A;  4OET A;  2V3T A;  5DVJ A;  1H44 A;  4JWY A;  4FJP A;  3BBR A;  4IY6 A;  4EXL A;  4G8H A;  3M3L A;  3MZ9 A;  5I2K A;  3PUZ E;  1FQB A;  3V89 B;  1SDX A;  1UQW A;  3Q29 A;  1PDA A;  2XXP A;  4IO4 A;  1B05 A;  4QSE A;  1BKA A;  3U8Q A;  2PBW A;  2REJ A;  4NF5 A;  3LUY A;  2O51 A;  1URS A;  1N3X A;  1B3G A;  3V83 A;  1DPP A;  3CG3 A;  1JW1 A;  1ATG A;  3MZ1 A;  1MM6 A;  3N6U A;  1SQY A;  3IJO B;  4OHN A;  2RC7 A;  1M5C A;  4U4S A;  2QL3 A;  4PP0 A;  1YCJ A;  4LZ8 A;  3C34 A;  3K6W A;  4F31 B;  4GOT A;  3TEL A;  3MVY A;  1Y4C A;  4OFJ A;  1AH5 A;  3OO8 A;  2IEE A;  2H4I A;  3OEL A;  1DSN A;  1OQG A;  1H3D A;  3PUX E;  2OWS A;  2QS4 A;  4QFO A;  5DTB A;  2DE3 A;  4FAT A;  3T96 B;  4IY5 A;  4TLM B;  2HAV A;  4RA1 A;  3KOS A;  1B46 A;  4YZZ A;  1XS5 A;  3IOW A;  3KGC A;  4ECF A;  4BDR A;  2O7I A;  5EHM A;  1JET A;  3FAT A;  3JZJ A;  2XXT A;  3MWB A;  3LSX A;  4HCY A;  3H6T A;  3AXF A;  4K3F A;  5AA2 D;  5H8N A;  4PFU A;  1M5E A;  2G93 A;  3K02 A;  1H45 A;  4FED A;  4BLA A;  4ZEB A;  2I4C A;  1B3F A;  2YPN A;  3G7W A;  5B7D A;  5AA2 B;  4PFW A;  1B3H A;  3QK6 A;  3EHS A;  2OBG A;  1MPC A;  3PV0 E;  1B3E A;  2Z8F A;  3IB1 A;  4WED A;  2I49 A;  1ZKB A;  3K4U A;  2BJJ X;  4P11 A;  1QUJ A;  1B7U A;  1MXW A;  3OD7 A;  3IOU A;  3S9E A;  3ODB A;  2I4B A;  4BDO A;  1SW4 A;  2CMO A;  3CFL A;  3U1O A;  3E9X A;  1B52 A;  4G8M A;  1R1N A;  2P0S A;  3ECR A;  3Q28 A;  1O64 A;  1I69 A;  1P1Q A;  1IIT A;  4YB6 A;  5TPA A;  2WKY A;  4XKR A;  1MY0 A;  3IOR A;  4X1D A;  4F18 A;  4TLL B;  5CI5 A;  5TP9 A;  3TYH A;  2GH9 A;  1SW2 A;  3W15 C;  3K6U A;  5CMC A;  4O3A A;  5DVF A;  3VDF A;  1OQH A;  3QYT A;  4LON B;  3KJ7 A;  3QUF A;  4G8N A;  4R6K A;  2QJE A;  4KHZ E;  2AIX A;  3EF7 A;  3HV1 A;  2ZMB A;  3O2A A;  1Q1K A;  1MH3 A;  4YB5 A;  5CMK A;  4X9T A;  2NWJ A;  5ISU A;  5H8F B;  4YMA A;  1Y1Z A;  4ISU A;  4Q8R A;  3PD9 A;  3S9L C;  4PET A;  1LCT A;  1IQ7 A;  3FVN A;  3PU5 A;  1VFE A;  3O6I A;  4QSC A;  4L17 A;  4ESX A;  1N7X A;  2Q88 A;  4GL8 A;  3CRB A;  4YAH X;  4R9G A;  4F1Y A;  5KZT A;  1LFI A;  5EHS A;  3C4M A;  5F7V A;  2DE4 A;  3H6V A;  4GXS B;  1VFD A;  5KCJ A;  2VD3 A;  2Z22 A;  2RCB A;  2M8C A;  3IX1 A;  4OMB A;  2HQ0 A;  4AB6 A;  4EF2 A;  4RJZ A;  1SVX B;  1EZP A;  4WKM A;  4G4P A;  4FEB A;  3S4U A;  3SEV A;  2UYE A;  4P0G A;  2DWI A;  1B32 A;  4NF8 A;  2DVZ A;  4QFK A;  1QKA A;  5JTY A;  3C35 A;  1B58 A;  3A3U A;  3VVD A;  4EF1 A;  1TXF A;  1A40 A;  2FA7 A;  3TTM A;  3G3G A;  3MVX A;  3HHF A;  3FVO A;  1FQE A;  4F1V A;  2B3F A;  5I57 A;  1A7L A;  1JW5 A;  2XD2 A;  1MY2 A;  1A8F A;  3QUJ A;  1FTM A;  2Q2C A;  1M5B A;  2O84 X;  4PQJ A;  1DTG A;  2V84 A;  4POX A;  1PB9 A;  1LAX A;  3BFU A;  3IAZ A;  1BIY A;  3ZKL A;  1PEB A;  2XX7 A;  2B65 A;  2D21 A;  4UAC A;  4YKI A;  5LOM A;  4Q0C A;  1Y4T A;  1A8E A;  1XOC A;  4MF3 A;  2I0B A;  1B40 A;  1T0K A;  1GGG A;  4NWC A;  2F7C A;  3TUS A;  3H7M A;  1QW0 A;  4G68 A;  3OEK A;  3UIF A;  1MH4 A;  3ZS6 A;  5CMB A;  2ONR A;  2GHA A;  5DEX B;  3PMX A;  4WXJ A;  4RPN A;  5CM6 A;  2A5S A;  1ZTY A;  3OXN A;  3TCH A;  3EN3 A;  2DP8 A;  4OEU A;  5CBR A;  1TFD A;  3CI8 A;  1NH7 A;  4JXI A;  2HZL A;  4JSO A;  2Y7R A;  3RUM A;  2F36 A;  3U72 A;  1ZU0 A;  4IGT A;  5ITP A;  1OVT A;  3MW0 A;  1URG A;  3MP8 A;  4H8J A;  2Z8D A;  3R6U A;  3TOD A;  4QFP A;  1OLA A;  1US5 A;  4I9D A;  4LA9 A;  3RNN A;  5H8H B;  2X7Q A;  4ZE9 A;  4GRK A;  3FGS A;  3V5A A;  2H9B A;  2F97 A;  1JW4 A;  4GWO A;  4DZ1 A;  4WEP A;  2ANJ A;  3OO6 A;  1B7H A;  1UTH A;  2ONS A;  2HXW A;  4QF9 A;  3EQ1 A;  4JSD A;  2Q2A A;  4MBP A;  3RTW B;  1P99 A;  2P2A A;  1NNF A;  2HCA A;  1O7T A;  1USY E;  3LSL A;  3FJ7 A;  4IO3 A;  4X1B A;  1MRP A;  4GXA A;  3N94 A;  4KFQ A;  4I8C A;  2H5Y A;  4C1T A;  2DQV A;  3C31 A;  3G3F A;  3MJN A;  4EQ9 A;  4EXK A;  2F8D A;  2Q9T A;  3B7D A;  4BDM A;  2H98 A;  1S9T A;  3QIM A;  3K1P A;  1SW5 A;  3RT6 B;  3RY3 A;  3SDF A;  4NF6 B;  4ZEF A;  2NVU B;  1Y1M A;  4XIG Q;  2R9J A;  4F19 A;  4JWO A;  1P1N A;  1KWH A;  5AA4 A;  4NF4 B;  1H43 A;  3O29 A;  2O1M A;  3K2D A;  4OES A;  2ZYM A;  3K01 A;  5I56 A;  2XD3 A;  3TTK A;  3ZKK A;  1IXI A;  3BFT A;  4YB7 A;  1ZBM A;  3SKP A;  4IGR A;  1SI1 A;  1R9L A;  1BLF A;  3SET A;  2XX9 A;  1PC3 A;  1WDN A;  2DSF A;  1PB7 A;  3M3K A;  3MZB A;  3CFX A;  1LAH E;  2ZNU A;  3TAJ A;  2P1S A;  4XXU A;  1NFT A;  3I3V A;  3FVG A;  3LBS A;  4X48 A;  1LGB C;  3JV9 A;  3T9V A;  3EHT A;  1FTO A;  1FQA A;  2VD2 A;  5KDT B;  1UTB B;  3FZV A;  5F1Q A;  1MS7 A;  1DMB A;  1MY1 A;  1DTZ A;  3MBP A;  2F34 A;  1A54 A;  3B6Q A;  1NKX A;  4QRZ A;  1SI0 A;  1VE4 A;  3MC2 A;  4OZ9 A;  3PPR A;  5K2X A;  1MPD A;  1UIV A;  1LFG A;  4LZ7 A;  2HAU A;  2DYX A;  1TWY A;  2F78 A;  5FTH A;  1R9Q A;  4F29 A;  4Q5T A;  3UA8 A;  4ELP A;  4PFY A;  4KD5 A;  4MFI A;  4H0W A;  3MVZ A;  3K6X A;  3KN7 A;  5A5X B;  4NTL A;  4BDL A;  2QS2 A;  4ELR A;  3D4G A;  2QS3 A;  3SEY A;  3DLN A;  4O3C A;  1JNF A;  1LAF E;  2Z8E A;  4ZEC A;  4KI0 E;  3THI A;  1PB8 A;  2DWJ A;  5I2K B;  2E1S A;  2QS1 A;  4IO7 A;  4BDQ A;  1P1W A;  1J1N A;  1N76 A;  3IK6 B;  1AIV A;  1I6A A;  2REG A;  4YU0 A;  5ICT A;  3ILT B;  5I56 B;  3KEI A;  4E0X A;  3E4R A;  2V3Q A;  4FOR A;  4NF5 B;  3PMW A;  3FXQ A;  3S2V A;  1UIU A;  3T22 A;  2F7B A;  4GIZ A;  1B5H A;  5L8D A;  3U93 A;  4F2O A;  3IR1 A;  4THI A;  3GXA A;  3N6T A;  1URD A;  1XVY A;  3FD3 A;  1DPE A;  5H8Q A;  1IUD A;  3TQW A;  4R2B A;  2UVJ A;  4YKJ A;  3FV2 A;  3SEU A;  3MVW A;  4RY1 A;  1QJM A;  4HTG A;  2XHD A;  3KBR A;  3GBB A;  2VOZ A;  3ZSF A;  3K6V A;  3JYR A;  3PPP A;  1MQI A;  1MXV A;  1MQD A;  1MXU A;  2H99 A;  1B6H A;  2GFE A;  2XXW A;  2DWA A;  1OMP A;  4KCC A;  4QFN A;  2FYI A;  4ONY A;  1NNT A;  2Y7W A;  3R26 A;  2XX8 A;  2Y84 A;  1RYX A;  4U23 A;  1MQH A;  3O6H A;  4OTE A;  1B3L A;  3OMB A;  4DLD A;  2UVI A;  1MY4 A;  1LFH A;  4NE4 A;  4YIC A;  5H8N B;  4U22 A;  4OFL A;  4OWD A;  2V25 A;  3O28 A;  2V93 A;  1IZ1 A;  2NUV A;  3TCG A;  2Y7K A;  4UA8 A;  1O63 A;  4R6Y A;  4AQ4 A;  2I6E A;  3QAX A;  3HHG A;  2XXU A;  4OXV A;  4EDP A;  3G3J A;  5I59 A;  3OO9 A;  3VVE A;  3VXC A;  4DXC A;  1IIW A;  2D3I A;  4U21 A;  3DP6 A;  1P1O A;  3FJG A;  1USY H;  4YKK A;  3P7I A;  3CVG A;  4Q30 B;  2GHB A;  2OCU A;  3EHU A;  5J1D A;  5ITO A;  2X7P A;  4DXB A;  2D5W A;  2DS9 A;  5TPA B;  3BKI B;  3GLB A;  1N3W A;  1LB9 A;  2W7Y A;  2QRY A;  3MPL A;  5TP9 B;  1TFA A;  5ICQ A;  1CE2 A;  3RPW A;  1RKM A;  1ELJ A;  5AA1 A;  3G3K A;  3CSG A;  3OOA A;  4GFR A;  4DCY A;  4XKP A;  1Q35 A;  3DP8 A;  2Y7I A;  3F11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...