2UVGA

Structure of a periplasmic oligogalacturonide binding protein from yersinia enterocolitica
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
403
structure length
401
Chain Sequence
VNLRMSWWGGNGRHEVTLKALEEFHKEHPNINVKAEYTGWDGHLSRLTTQIAGGTEPDVMQTNWNWLPIFSKDGTGFYNLFSVKEQLDLAQFDPKELQQTTVNGKLNGIPISVTARIFYFNDATWAKAGLEYPKTWDELLAAGQVFKEKLGDQYYPVVLEHQDTLALIRSYMTQKYNIPTIDEANKKFAYSPEQWVEFFTMYKTMVDNHVMPSTKYYASFGKSNMYEMKPWNGEWAGTYMWNSTITKYSDNLTKPAKLVLGPYPMLPGAKDAGLFFKPAQMLSIGKSTKHPQESAMLINFLLNSKEGVELGLERGVPLSATAVTQLRASGVIKDEDPSVAGLNMALELPHKMTTSPYFDDPQIVSLFGDAIQYIDYGQKTVQETAEYFNKQGDRILKRAMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Recognition of Saturated and 4,5-Unsaturated Hexuronate Sugars by a Periplasmic Binding Protein Involved in Pectin Catabolism.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Sugar binding protein
molecule keywords ABC TYPE PERIPLASMIC SUGAR-BINDING PROTEIN
total genus 147
structure length 401
sequence length 403
ec nomenclature
pdb deposition date 2007-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2uvgA02
3TYHA 1XC1A 3E9XA 2D5WA 2HQ0A 2I3VA 3G3HA 5L8DA 1Z7ME 1SW1A 1B9JA 4K3FA 4U22A 4DLDA 1GTKA 1S9TA 1JVYA 3QUFA 4GQOA 1OLCA 2P0SA 1B1XA 3OO6A 3DP8A 3C36A 4EQBA 2XXVA 5M2VA 2XXRA 1QJMA 3K02A 3S2VA 4ZEDA 2DP8A 2XX8A 1GR2A 2A5TA 4X1BA 1Y1ZA 3PUXE 1B58A 1LGBC 1N7XA 2PVUA 2ZYNA 2UVIA 3EN3A 2Z22A 2DYXA 5TP9B 5DTBA 1LFGA 3D4CA 4C1TA 1VSOA 1N3WA 3FJ7A 4KQPA 1OLAA 3LBSA 3PV0E 4FIMA 5H8SA 4ZE9A 3TTMA 5IKBA 3PU5A 3ILUB 4G4PA 4F3BA 3OELA 3PMWA 4U23A 5DVFA 4U1ZA 1P1WA 1N0TA 2HEUA 4RXLA 4ZEBA 1MQDA 4IO4A 1PB9A 3PPNA 3E13X 2Q2CA 1B51A 1LB9A 4L17A 2AIXA 3C34A 1IQ7A 3RT6B 4UACA 3TTRA 3MPKA 3WAEA 1JW1A 5CC2A 2PX1A 4KYEA 4IO2A 4N07A 3KN7A 3PD8A 4I9DA 2IA4A 2UYFA 1B7UA 1XS5A 2OWSA 2ZYKA 2DOJA 3Q25A 2XXIA 4IY5A 3VXCA 4KR5A 4FEDA 4ELRA 3S9MC 4FEBA 4LZ8A 3SEUA 1B1HA 3N5LA 2V3QA 2Z8EA 3GLBA 4GXAA 1UTBB 4ZS9A 4H5GA 3H4ZA 3C35A 3G3GA 3Q29A 3UA8A 5H8HA 3CI8A 1B7HA 4JBZA 2HFBA 3G3IA 3O66A 2VD3A 2H4IA 1MH4A 1SI1A 4ELPA 2RINA 2O6AA 2DWHA 2Y7WA 2QPQA 1XVYA 3DELB 2I4CA 2Z23A 3W9WA 1QVSA 3N94A 4PE5B 1IXCA 5I58A 2UVHA 1MQGA 2DXRA 2HZKA 3U8QA 4H1XA 4DXUA 3G3FA 1MQIA 4R2BA 4GLIA 4H8IA 5DVIA 1UTHA 4BDMA 1MY4A 2ABHA 3K6WA 3WAFA 1URDA 4OHNA 3MQ9A 4IO6A 3T96B 1IEJA 1NH7A 3FZVA 1VFDA 3M3FA 3ONMA 4GFRA 4ISUA 4Q30B 3M3KA 1T0KA 4Q5TA 2XXYA 3CFLA 4RY1A 4WEPA 4NF5B 4POXA 1GGGA 3TAJA 5ICTA 1MY3A 3GBBA 1DMBA 3C32A 3B7DA 5CI5A 5CMCA 4ESWA 3LSFB 4MF3A 3TTKA 2DXYA 3HN0A 1SYHA 4AQ4A 5CM6A 2LAOA 1UTBA 3GZGA 4FE8A 3K00A 4U1OA 4GOTA 5BUUA 3VXBA 3A09A 5L9OA 3L6GA 1N3XA 4MBPA 4MFIA 1F9BA 4YB7A 1BIYA 3DP6A 4JSDA 2ZYOA 1MDP1 4G68C 1NNKA 3T9UA 5JEIA 5I56A 4NWDA 2M8CA 3L6HA 3H3GA 2DE3A 2NUVA 1EZPA 4WEDA 3SKPA 1LBCA 2DSFA 5HBCA 2XD3A 5FHOA 4RJZA 5F7VA 4YMBA 3FJMA 1VFEA 3SEXA 5IAIA 4KHZE 2I4BA 1H76A 3H6VA 4JWYA 3R7XA 2QS4A 2O84X 3SEVA 4X9TA 1HSEA 4NE4A 3QXMA 1R1NA 1ZJLA 1Y1MA 3MPLA 1POTA 1OQHA 2PBWA 3K1PA 4PFTA 2GFEA 1BKAA 1O64A 3FATA 4YAHX 1NNTA 4F1YA 2I3WA 2ZNSA 2F5XA 1ANFA 3U93A 1PB8A 1LCTA 5I59A 2OWTA 3BBRA 3PUZE 4YZZA 1RYOA 4H5FA 2NVUB 4GRKA 4QFKA 3TFLA 3G3JA 3IO4A 2KLFA 2DWAA 2OLBA 5TPAA 2E1SA 3LSXA 3TPAA 1ELJA 5ICQA 1A8FA 1ZMGA 3FV1A 3Q28A 4GIZA 5KDTA 2D21A 4H65A 2B3BA 4PQJA 3V8XB 3VVFA 1SD3A 4ELQA 5A5XA 3K0VA 1WVJA 4OESA 2XXXA 1I69A 3B6TA 4QSDA 2QS3A 3FASA 1MXXA 3SEWA 3U92A 1D9YA 2Q9TA 2F97A 2UXAA 3TQWA 3UGWA 3V83A 3VV5A 1B46A 5EHMA 1B32A 3CG3A 1IXIA 1SVXB 5CMMA 4OETA 1LSTA 1SW4A 4O3CA 3SETA 4EF2A 1B7ZA 3CFZA 4ONYA 2F6GA 3LC8A 3PGFA 3TZAA 4NF6A 3LSWA 2RC8A 2RCAA 3O97A 2QMXA 4QSCA 2XXTA 4RPNA 4OFJA 2DVZA 4EXKA 1MXVA 1MXUA 3MVZA 1JQFA 3O29A 4QSEA 3Q27A 4E0XA 2FYIA 3N6TA 1MS7A 2DE2A 4FJPA 1FQAA 5BWJA 1FTMA 1LAXA 4LZ7A 3N6UA 3HSTA 4GF8A 3MUQA 1D9VA 5TPAB 1AL3A 2DS9A 4XTCQ 1O63A 4O3AA 2FNCA 2ONKE 1B05A 2QMWA 5AA4A 4IGRA 3CR9A 3MZBA 3O6HA 5AE4A 1QUIA 3M8UA 5ITPA 4OEUA 1MPCA 1OQGA 1QKAA 5FTIA 4ZEKA 4NF4B 3RPWA 4F2OA 3I5OA 3I3VA 2H99A 1LLSA 1NNFA 3D4GA 4QHQA 1FQFA 2RCBA 2UVGA 3PPPA 3RTWB 3ZKLA 3PMVA 5CBSA 3BFUA 1MH3A 1JEUA 2XXQA 1SBPA 1Y3PA 3QSLA 2BJJX 2Z8FA 4TQUQ 1LB8A 3FUZA 3UORA 1MY0A 3C9HA 3H03A 2DE4A 4Q0CA 1MY2A 4OZ9A 2R71A 2Y84A 1SDXA 1XVXA 4NTLA 4LONB 4UA8A 1Y3NA 3T22A 3VVDA 1TXFA 2NXOA 3N26A 4OFOA 4ZEIA 2I6EA 1R6ZA 3H6UA 2AL5A 1FW0A 3MWBA 3MW0A 4FATA 1AIVA 3OENA 1USYH 1QUKA 4PFWA 1N04A 2O68A 1MXYA 3QAXA 2XX9A 4LQ5A 1M5FA 2DWIA 3IOUA 3KSXA 4N6PA 4M4GA 4RK2A 5AA2B 1SI0A 3OSRA 3MP6A 4XKNA 1MDQA 4YMAA 3B6QA 4ESXA 4KD5A 5I2NB 4NWCA 3FGSA 4R73A 5K2YA 3UK4A 1UTHB 1YCJA 2GH9A 2QJEA 2ALUA 4U4SA 1RYXA 2VP1A 4IO7A 4C1UA 1DPPA 3A3UA 2CMOA 2A5SA 1MXWA 2XXHA 3GBAA 4F19A 3IOVA 5H8HB 3FXRA 1N7WA 3ODBA 1B52A 3OEMA 1MQHA 3H6TA 3TCGA 2F34A 1QULA 3HHGA 4DXCA 5AA3A 3KFMA 3EPEA 1LAFE 3SDFA 4HW8A 3MVYA 3T9VA 1MM7A 1XT8A 4IY6A 3V89B 1LCFA 4LZ5A 1N76A 3OEKA 4X48A 5H8QB 3TDJA 1A99A 1TFAA 5I2KA 1URGA 4LUBA 1DTGA 1PBPA 2O1LA 2REJA 3KGCA 1FCKA 4H0WA 1DSNA 3RY3A 3TEPA 4IO3A 4U4XA 2Y7IA 4F39A 3U72A 1LFHA 1O7TA 3FVGA 5DEXA 2RC7A 2CZLA 3A3CA 3U94A 4OENA 3UN6A 4NF5A 4OFLA 4DE8A 3VE1B 1JEVA 2F7BA 2ZXTA 3JYRA 2AL4A 2V3TA 3PMXA 4NF8B 3CG1A 4GL0A 4QFNA 3IR1A 4G8HA 3CSBA 1GV8A 1S7YA 2F36A 3PD9A 2YPNA 4FAJA 3VDFA 1MQJA 4XKRA 5EYFA 3TELA 4ZE8A 4P0IA 1B3GA 1UIUA 3U1OA 3PPQA 4NF4A 1LFIA 2R6GE 3O2AA 2ONSA 2R9JA 3FXUA 4OYVA 2ZYMA 1JNFA 4GVOA 4Z0IA 4I1DA 3QK6A 5DYHA 3KZGA 1TFDA 1BTJA 4KPTA 5H8NB 2V25A 3T9HB 5H8QA 4IGTA 3LR1A 3B6WA 2P2AA 1PEBA 2I49A 3CRBA 2ZMBA 4KCDA 4BLAA 3IOWA 4KFQA 4H8JA 3LUYA 2PT1A 4HCYA 4BDOA 1JETA 5FHNA 4ZECA 3K6VA 4XKQA 5AA4B 4JXIA 3IB0A 2NOOA 1Z7NE 2DWJA 2W7YA 1QKBA 3C33A 3EQ1A 1NNPA 3FJGA 4G77A 4U2RA 4LA9A 5CRYA 3KN8A 3JV9A 1NFTA 1QW0A 2XX7A 2QS2A 3K1MA 3KG2A 4ZDMA 1I6BA 3QUJA 3O28A 4ZZEA 2ONRA 5I57B 1VR5A 4KYDA 3E3KA 4RK9A 3RQTA 5I2NA 1FQBA 1H45A 1LAGE 2X7QA 2X26A 3JZJA 3O9PA 3OO7A 4LATA 2F7CA 3HV1A 4MLQA 3SEYA 5CMKA 3S9EA 3FVNA 4R9FA 3T9XB 1YPNA 3KEIA 1I6QA 1B3LA 2B3FA 2I0CA 1USYE 3F11A 1B5JA 2HAVA 4PETA 5K2XA 1OVTA 2ZNTA 4POWA 4NF6B 1MPBA 3TTLA 2I48A 3CSGA 4G8MA 1B0HA 3G7WA 5I84A 3FVOA 4R75A 5HM4B 4XKPA 5KZTA 1A55A 1B3FA 4YKIA 4F3GA 5CBRA 4GXSB 4EUOA 3K01A 4F3PA 5KDTB 1CE2A 1MG1A 5AA2A 2ZNUA 4PFYA 3PPOA 3FIRA 3FXQA 1FTKA 5L9MA 4R2FA 2XHDA 5JK4A 1B5HA 5A5XB 1N84A 1IIWA 1Y9UA 4DXBA 3P7IA 3RT8A 5AA2D 1POY1 4KCCA 4YB6A 2X7PA 3OOAA 4BDQA 4LP2B 2OCUA 1PB7A 4FECA 4M1VA 1P1QA 2VGQA 3HHFA 4F31B 3VLWA 4TOZA 2V3UA 3SERA 1MPDA 3MC2A 2UYEA 4HCWA 1BLFA 2F8DA 5KCJB 3S9NC 4P0GA 3DM0A 4WKMA 2F78A 3ECRA 4R6KA 4O3BA 2XD2A 4OQOA 4ZZAA 2Q8JA 1Y4TA 3UP9A 1A40A 3ZSFA 4QFPA 2A5TB 1Q1KA 3HO7A 4X1DA 2O51A 2VD2A 3TMGA 3BKIB 3QIMA 4IO5A 1P99A 1PC3A 4BDLA 1A7LA 1P1OA 1SQYA 2PMSA 1FQCA 2PYYA 3IX1A 3MJNA 1A54A 1ZIUA 1B40A 2FA7A 4QFOA 4DCXA 3V5AA 1NH8A 1WODA 2ESNA 2F35A 1R9LA 2HXWA 2H98A 3EF7A 4JDFA 3Q26A 4XIGQ 1ZBMA 1US5A 1IUDA 4KYSA 1SYIA 1FTJA 5ITOA 1P1NA 4NMYA 2ANJA 1LBBA 2Q88A 1EU8A 1KWHA 3DP4A 4GWOA 1H3DA 4QFLA 1OVBA 3TQLA 3S9LC 2Z8DA 3IJOB 1HSLA 1NMUA 2H5YA 4G2ZA 2HZLA 4QRZA 2F7AA 1VE4A 3E4RA 3OD7A 3PPRA 3KJ7A 2OK2A 4PP0A 4R6HA 1M5EA 4NF8A 2OJTA 3MBPA 1Y4CA 1ATGA 4OWDA 4RYAA 4F3SA 1JW5A 2GRVA 4YKKA 4OXVA 4TLLB 4E0WA 5LOMA 3RLFE 3IAZA 5B7DA 5ISUA 3CFXA 4DZ1A 2THIA 1P1UA 3R6UA 4Z7EA 3KJTA 1AOVA 1OIBA 1R9QA 1S50A 1RKMA 2O1MA 1MY1A 3DLNA 2PT2A 3OSQA 1H44A 4H67A 4WXJA 4R9GA 1B4HA 3W9VA 4C0RA 4KI0E 4F1UA 2G29A 3T66A 5TU0A 4F18A 1YTVA 4OERA 4ELOA 2E0SA 4DDDA 1Y20A 1OMPA 3KSJA 4YB5A 3SESA 3VLVA 1Q35A 5EHSA 4BDNA 2I0BA 3IL1B 5I59B 1AMFA 4QF9A 3C4MA 3R26A 3OMBA 1FTOA 3MVWA 2V84A 1FQEA 1ZKBA 4RNSA 3ZKKA 3PUVE 1SW2A 3CVGA 4AB6A 3MAMA 4JB7A 1B6HA 4OMBA 1UIVA 1D4NA 2RKMA 2GHBA 2VHAA 3FVKA 3MVXA 1AH5A 4I8CA 2XXUA 3PUWE 1YAEA 3BFTA 1SW5A 2RC9A 3TCHA 4DIGA 1HSJA 4NEDA 4TLMB 2I58A 2B65A 4LVQA 1IXGA 3K4UA 3LSLA 2Y7KA 4YICA 5ELVA 3OXNA 3RUMA 2UVJA 5JTYA 3CIJA 3IJXB 3K6UA 3G3KA 3S4UA 3I6VA 4DCYA 1FQDA 3RGYA 1DOTA 1WDNA 1Y3QA 2IEEA 2YLNA 4MLVA 1JW4A 1JVXA 3H6WA 4THIA 5DEXB 1US4A 4IB2A 5HPQA 3EHSA 3RTFB 2QL3A 3K6XA 1B0LA 1A8EA 1B3EA 2Q89A 3EHUA 4R72A 3RNNA 5B70A 2HAUA 3M3LA 2V93A 2F6PA 4EQ9A 1LAHE 2Y7RA 4GD5A 5FTHA 2G93A 4OTEA 3MZ9A 4FORA 1IITA 4JSOA 5CMBA 3FV2A 4F2QA 1UQWA 3VLUA 4YKJA 4EQ7A 4RPOA 3VVEA 4HS7A 5I56B 1URSA 1XOCA 3USDA 4R6YA 4EF1A 4EXLA 1TT1A 1B4ZA 1MRPA 3HPIA 4H6DA 4YU0A 2O69A 4HTGA 4I62A 1EZ9A 1M5DA 3KBRA 4G68A 5F1QA 1L5TA 1PBQA 2QRYA 4G8NA 3ZS6A 5DT6A 3QYTA 5FHMA 3K2DA 2XXPA 3FD3A 5AA1A 4F1VA 5H8FB 3HCQA 1EH3A 1PDAA 4OEVA 4JWXA 4BDRA 1ZU0A 3OO9A 3IB2A 3K1NA 3PUYE 4RA1A 4ZEFA 2NWJA 5L9SA 1II5A 5DVJA 5KCJA 4AB5A 3TCFA 3W15C 3MP1A 1ZTYA 3TKDA 3TUSA 2O7UA 2DQVA 1FTLA 2Y7PA 3O6IA 2WKYA 2DVCA 1H43A 1XHYA 4EDPA 2VOZA 3H06B 4F22A 3OO8A 1B2HA 2YJPA 1IXHA 2D3IA 3KOSA 3IB1A 1CB6A 4JWOA 4N13A 3VFJA 1ZLQA 3KN3A 5I57A 1M5CA 3UIFA 4ND9A 1NKXA 2REGA 2RF1A 2O7IA 1B3HA 1M5BA 3H7MA 5H8NA 5J1DA 1D3KA 2QS1A 2HCAA 3MP8A 4YKPA 3TTNA 4MH5A 1EZOA 3KOTA 3TODA 4Q8RA 3THIA 3IK6B 3GXAA 3O6GA 4U21A 1I6AA 5TP9A 1NL5A 3T93B 5I58B 1TWYA 2OZZA 2GHAA 4P11A 4R74A 1B5IA 1MM6A 2H25A 4G68B 2XXWA 3ILTB 2QSXA 5H8FA 3MZ1A 4GL8A 4LQ2A 4OVJA 4PFUA 5I2KB 2AYSA 2H9BA 1QUJA 3IOTA 3IORA 2P1SA 1MXZA 2OBGA 1J1NA 1BP5A 1DTZA 4F29A 3AXFA 3IO6A 4ECFA 3RN8A 3EHTA 1DPEA 2Q2AA 4XXUA 1IZ1A 3C31A 5JTYB 1GVCA
chains in the Genus database with same CATH superfamily
2D5WA 5ET8A 2HQ0A 1Z7ME 4DLDA 1S9TA 3QUFA 1B1XA 2XXVA 4HE2A 1GR2A 2A5TA 4X1BA 2NWJA 4PFIA 3T1BA 1VSOA 3FJ7A 4PF8A 5I5PA 4F3BA 3ILUB 2JJKA 1EYKA 2HEUA 4FBPA 1MQDA 3E13X 2Q2CA 5ET6A 5EYGA 2UYFA 4KR5A 2XWIA 3SEUA 1B1HA 1FPLA 4ZS9A 4H5GA 3G3GA 3Q29A 1B7HA 3O66A 2VD3A 2DWHA 2Z23A 3W9WA 3U8QA 4DXUA 1NH7A 3CFLA 5ICTA 1GGGA 2V4CA 5ET7A 3GBBA 1DMBA 2Y5KA 3TTKA 2LAOA 3GZGA 5IZ3B 1FSAA 1F9BA 4YB7A 3DP6A 4JSDA 4GWUA 3L6HA 3H3GA 2DE3A 3SKPA 5HBCA 4KHZE 4JWYA 4PDHA 4NE4A 1ZJLA 1POTA 2PBWA 3K1PA 4HE1A 2F5XA 1ANFA 3U93A 2OWTA 4H5FA 3TFLA 1IMAA 4GIZA 2D21A 4H65A 4PQJA 3RPLA 4PGPA 3B6TA 3FASA 2QS3A 2UXAA 3V83A 5IZ1A 5EHMA 5CMMA 4O3CA 3PGFA 2XXTA 4RPNA 4OFJA 2XA5A 3KBZA 4QSEA 1KA1A 2DE2A 1D9VA 2DS9A 4XTCQ 3KC1A 3MZBA 3O6HA 1QUIA 3M8UA 1OQGA 5FTIA 4ZEKA 3RPWA 4F2OA 5EQ7A 2H99A 4QHQA 3PPPA 2RCBA 3BFUA 1SBPA 2BJJX 1LB8A 3UORA 2DE4A 3FBPA 4Q0CA 4OZ9A 2R71A 4PC9A 3T22A 2NXOA 4MCOA 4N81A 2HPGA 4PFWA 3QAXA 5K2YA 3E78A 4P47A 3ODBA 3H6TA 4NQ8A 1QULA 3KFMA 3EPEA 3T9VA 4IY6A 4X48A 1A99A 3TEPA 1FCKA 1DSNA 4XEQA 2XWOA 3E79A 2CZLA 4NF5A 3VE1B 2F7BA 3PMXA 3CSBA 3FXBA 4FAJA 1IMFA 4NF4A 2ONSA 2R9JA 4I40A 2VPOA 4Z0IA 5DYHA 5H8NB 2V25A 1XI6A 2ZMBA 3IOWA 4BDOA 1JETA 3K6VA 4XKQA 4N8YA 3IB0A 1Z7NE 1QKBA 3C33A 4NGUA 2XX7A 1I6BA 1FPDA 5I2NA 1FQBA 4PAIA 3SDFA 1LAGE 3FVNA 3T9XB 1EYIA 1B5JA 5K2XA 4POWA 4GWXA 3CSGA 4G8MA 1B0HA 3G7WA 3FVOA 4XKPA 5KZTA 4GXSB 4F3PA 1MG1A 2ZNUA 3PPOA 2XHDA 3P7IA 1FPKA 4OVQA 2VGQA 1MPDA 2UYEA 4HCWA 4WKMA 2F78A 4O3BA 1Q1KA 2O51A 3BKIB 3QIMA 4IO5A 1P99A 1P1OA 2PMSA 2PYYA 1FQCA 3IX1A 1K9ZA 1B40A 2HXWA 4KYSA 1FTJA 2Q88A 4N8GA 2FHYA 2HZLA 5DT6A 3E4RA 2OK2A 1M5EA 1Y4CA 4TLLB 3CFXA 1RKMA 3W9VA 4PGNA 4WXJA 5TU0A 1Y20A 1FPBA 3IL1B 1AMFA 4QF9A 3OMBA 4H46A 1FTOA 3TUSA 2RKMA 1D4NA 2XXUA 4DIGA 4NEDA 1IXGA 2Y7KA 5JTYA 3K6UA 3G3KA 3RGYA 1US4A 5HPQA 3RTFB 3BIGA 3BIHA 2Q89A 2CEYA 2Y7RA 4JSOA 3FV2A 4EQ7A 3USDA 4R6YA 1B4ZA 3CHGA 5IAIA 4G68A 3ZS6A 2XXPA 3FD3A 3HCQA 1EH3A 4PE3A 5L9SA 1NUYA 3PUYE 4ZEFA 3TCFA 3W15C 4MNCA 3QMFA 2VOZA 3H06B 1IXHA 2D3IA 4JWOA 3IB1A 4P8BA 4MMPA 3IK6B 3O6GA 4U21A 5TP9A 4P11A 3RPLB 2QSXA 3MZ1A 4LQ2A 2OWZA 3IOTA 2P1SA 4OANA 4ECFA 2CZIA 1DPEA 3C31A 1NV5A 1XC1A 3E9XA 5IZ3A 2I3VA 5L8DA 5LDZA 1SW1A 1JVYA 3OO6A 2DP8A 2XX8A 1Y1ZA 2ZYNA 2UVIA 1LFGA 4C1TA 1N3WA 3LBSA 5H8SA 4ZE9A 3PMWA 4ZEBA 3PPNA 3MSTA 1B51A 4XFEA 2PX1A 4KYEA 4IO2A 2IA4A 5FBPA 1XS5A 3Q25A 4ELRA 1FRPA 2V3QA 1NUXA 1IMDA 1MH4A 2RINA 2Y7WA 3DELB 3IFAA 4MAGA 4H1XA 3RYDA 1NV6A 1MQIA 4MIJA 1FJ9A 3ONMA 4GFRA 1T0KA 4Q5TA 2XXYA 4WEPA 3TAJA 4POXA 3B7DA 4AQ4A 2DXYA 1SYHA 4AS4A 4FE8A 3K00A 1DBZA 5L9OA 4MBPA 1N3XA 4GBWA 1BIYA 1MDP1 1NNKA 4WEDA 5F7VA 4YMBA 3FJMA 3SEXA 2QS4A 2O84X 1FBGA 1BK4A 3MPLA 4PFTA 2GFEA 1O64A 3FATA 1Q9DA 1PB8A 3BBRA 3PUZE 4QBAA 1RYOA 1AWBA 2DWAA 2OLBA 3FV1A 2F3BA 4ELQA 3K0VA 2XXXA 1NV4A 2QVVA 3UGWA 2WYKA 1IXIA 1SVXB 1SW4A 3SETA 4ONYA 2PCRA 3TZAA 4OA4A 3LSWA 2FBPA 5IGAA 1MXUA 3EKIA 4E0XA 4P1LA 1LAXA 3N6UA 2GQ1A 1SPIA 1AL3A 1O63A 4O3AA 2ONKE 4IGRA 5ESYA 3I3VA 3D4GA 1FQFA 1MH3A 4OVSA 1Y3PA 1MY2A 1XVXA 1Y3NA 3N26A 4FATA 1USYH 5EQAA 2XX9A 2DWIA 4RK2A 2VT5A 4YMAA 4KD5A 4DI3D 2GH9A 5DW8A 3A3UA 2CMOA 3GBAA 4F19A 3IOVA 5H8HB 1N7WA 1LBVA 1B52A 5T3JA 3TCGA 4HW8A 3MVYA 1MM7A 3OEKA 5H8QB 3TDJA 1DTGA 4IO3A 1O7TA 5DEXA 2RC7A 3MYUA 4OENA 3UN6A 4OFLA 4DE8A 4NF8B 3IR1A 4G8HA 1GV8A 1S7YA 3PD9A 3VDFA 4IR8A 4XKRA 3TELA 5IZZA 1B3GA 1UIUA 1LFIA 3O2AA 4NF0A 1IMCA 3T9HB 5H8QA 3LR1A 3B6WA 2P2AA 3CRBA 5FHNA 2NOOA 3EQ1A 2HHMA 5CRYA 3FJGA 3KN8A 3JV9A 5EQ9A 3LUZA 3K1MA 4ZDMA 3O28A 1VR5A 2DDKA 4KYDA 3E3KA 3RQTA 1RDZA 2X7QA 4LATA 3SEYA 3S9EA 2F7CA 3HV1A 4R9FA 1YPNA 3KEIA 2FIXA 1USYE 4PETA 1D9QA 1OVTA 2CZHA 5HM4B 4EUOA 5KDTB 1LBZA 5L9MA 3FIRA 4N91A 4GWYA 1N84A 1IIWA 4DXBA 5AA2D 1POY1 4KCCA 3KC0A 2OCUA 1PB7A 4LP2B 4M1VA 1P1QA 3VLWA 4TOZA 2V3UA 3SERA 4MNIA 3MC2A 5KCJB 3DM0A 4MJOA 4R6KA 1Y4TA 2FIEA 3HO7A 4X1DA 2VD2A 3TMGA 1PC3A 4BDLA 1A54A 4DCXA 5BUUA 4KPTA 1FPIA 2H98A 4NMYA 4EF1A 1EU8A 1KWHA 3TQLA 3S9LC 1OVBA 4GX3A 4G2ZA 1NMUA 3KJ7A 2OJTA 4YKKA 4E0WA 4OXVA 4DZ1A 2THIA 4Z7EA 1AOVA 1LBYA 2WBBA 1S50A 5IKBA 1MY1A 3DLNA 1B4HA 2G29A 4F18A 4OERA 4ELOA 4DDDA 1OMPA 3KSJA 1Q35A 5EHSA 2I0BA 3R26A 3MVWA 2V84A 1FQEA 3ZKKA 3PUVE 1SW2A 4AB6A 3MAMA 4OMBA 3MVXA 2GHBA 3FVKA 1AH5A 3PUWE 1YAEA 1SW5A 4JVDA 2P3NA 4TLMB 1FPFA 2B65A 4LVQA 3K4UA 5ELVA 3RUMA 3IJXB 2CEXA 1DOTA 4MLVA 4THIA 5DEXB 4IB2A 3EHSA 1A8EA 4R72A 2HAUA 2VPNA 4EQ9A 1RDYA 4FORA 1IITA 4F2QA 3VLUA 3VVEA 4HS7A 4EXLA 4H6DA 3HPIA 2R8TA 2O69A 5I58A 5F1QA 1EZ9A 3KBRA 3QYTA 4F1VA 5H8FB 1PDAA 1ZU0A 3K1NA 4AB5A 3PTYA 1ZTYA 1DK4A 2Y7PA 2DVCA 1H43A 4EDPA 3OO8A 1CB6A 3VFJA 3KN3A 2O7IA 1FBCA 5J1DA 3H7MA 3MP8A 3THIA 5I58B 1NL5A 2OZZA 4H45A 4R74A 3B50A 4G68B 2XXWA 4PFUA 1QUJA 4NAPA 3IORA 2OBGA 1J1NA 2QVUA 3LV0A 3ISPA 1DTZA 3AXFA 3VLVA 3MP1A 1IZ1A 1GVCA 3TYHA 3G3HA 1B9JA 1OLCA 4EQBA 3DP8A 4PFBA 5M2VA 3K02A 3S2VA 3PUXE 5TP9B 4I3EA 2Z22A 2DYXA 3D4CA 1OLAA 3PV0E 4FIMA 1NV0A 3PU5A 4U23A 4U1ZA 1P1WA 4IO4A 1PB9A 4L17A 1LB9A 3C34A 4UACA 3WAEA 4N07A 3PD8A 4I9DA 2WEFA 2ZYKA 1B7UA 3VXCA 2XXIA 3S9MC 4LZ8A 3GLBA 4GXAA 1UTBB 3C35A 4JBZA 3G3IA 2Q8MA 4ELPA 1SI1A 2QPQA 1XVYA 1QVSA 4HXVA 4PE5B 1IXCA 2UVHA 1MQGA 2DXRA 4R2BA 1UTHA 4BDMA 2ABHA 3K6WA 3WAFA 4IO6A 1IEJA 3FZVA 1VFDA 3M3FA 4ISUA 3M3KA 1G0HA 5LTCA 5CMCA 3C32A 5CI5A 3LSFB 4LN5A 1UTBA 4GOTA 3L6GA 4MFIA 2ZYOA 3T9UA 5I56A 4NWDA 1EZPA 1LBCA 2DSFA 2XD3A 5FHOA 4RJZA 4MNPA 3SEVA 4X9TA 1NUZA 3QXMA 1R1NA 4G61A 1OQHA 1FPGA 1FBHA 4N6KA 4YAHX 2BJIA 1LEVA 2ZNSA 4YZZA 5IM2A 4GRKA 4QFKA 3IO4A 3TPAA 2E1SA 5ICQA 1A8FA 5EQ8A 1SD3A 1WVJA 4OESA 1I69A 1EYJA 1IMEA 4X8RA 1FBEA 3U92A 4PBQA 1VDWA 2Q9TA 2F97A 3TQWA 3VV5A 1B32A 3CG3A 1KZ8A 1LSTA 3CFZA 3LC8A 4NF6A 3A29A 2RCAA 3O97A 2QMXA 4EXKA 1MXVA 4MX6A 1CNQA 3NOHA 3Q27A 2FYIA 3N6TA 1MS7A 4FJPA 1FQAA 5BWJA 4PAKA 4GF8A 4PF6A 1B05A 3CR9A 5ITPA 1QKAA 4NF4B 2B4LA 3I5OA 1LLSA 3RTWB 1NNFA 4MEVA 3ZKLA 3PMVA 3QSLA 4ESWA 4LONB 1TXFA 4ZEIA 2I6EA 1R6ZA 1FW0A 3OENA 2O68A 1MXYA 4PFRA 4P1EA 4M4GA 1SI0A 3OSRA 5J16A 3MP6A 1MDQA 5I2NB 4R73A 3UK4A 1UTHB 2QJEA 2ALUA 2VP1A 4IO7A 1DPPA 2A5SA 1MXWA 2XXHA 4AS5A 1YZ0A 1NV2A 1MQHA 3HHGA 2F3DA 1FBPA 1N76A 5I2KA 1URGA 3KGCA 3RY3A 4H0WA 2Y7IA 4F39A 3U72A 3FVGA 3A3CA 4PTKA 4KXPA 2ZXTA 3JYRA 2V3TA 3CG1A 2YPNA 1MQJA 4ZE8A 5I7IA 2R6GE 2ZYMA 1JNFA 3QK6A 3KZGA 1TFDA 1PEBA 4KCDA 4BLAA 4KFQA 4H8JA 3LUYA 2PT1A 4HCYA 4ZECA 5AA4B 4JXIA 2W7YA 3U1OA 4BDQA 4G77A 1NNPA 4GX4A 4LA9A 1NFTA 1QW0A 2L5VA 3KG2A 3QUJA 5I57B 4RK9A 3JZJA 2X26A 5CMKA 1B3LA 5EYHA 2P3VA 4NF6B 1MPBA 3TTLA 2I48A 5I84A 1A55A 1B3FA 4YKIA 4F3GA 5CBRA 3K01A 5AA2A 3FXQA 1FTKA 4R2FA 1B5HA 5A5XB 1Y9UA 3RT8A 4YB6A 3SZPA 2X7PA 4FECA 4HE0A 1BLFA 3S9NC 3ZSFA 1A40A 1NV1A 1ZIUA 4QFOA 3V5AA 1NH8A 4JDFA 1K9YA 3EF7A 4XIGQ 1SYIA 1P1NA 4GWOA 1H3DA 2Z8DA 1HSLA 2OX3A 3OD7A 4MHFA 4OWDA 4RYAA 4F3SA 2GRVA 5LOMA 5B7DA 5ISUA 4X04A 2PT2A 4H67A 1H44A 3U65A 4F1UA 4KI0E 2ZZWA 4YB5A 4BDNA 5I59B 4P56A 3C4MA 1ZKBA 4JB7A 1B6HA 1UIVA 2VHAA 1NI9A 4I8CA 4YICA 4P3LA 3S4UA 3I6VA 1INPA 1FQDA 2IEEA 1WDNA 2YLNA 1JW4A 4PDDA 1B0LA 1B3EA 5B70A 2V93A 2QVRA 4GD5A 3MZ9A 4YKJA 4RPOA 5I56B 4GWWA 4HTGA 1M5DA 4N15A 1PBQA 4G8NA 5FHMA 3K2DA 5AA1A 4JWXA 4BDRA 5AA4A 4RA1A 1II5A 5DVJA 2O7UA 1FTLA 3O6IA 4F22A 2YJPA 4N13A 3KOSA 5I57A 1M5CA 2ZZVA 3UIFA 2WX9A 1NKXA 1QGXA 2HCAA 3TTNA 4MH5A 3KOTA 3TODA 3T93B 1B5IA 1FBDA 2H25A 5H8FA 4OVJA 2AYSA 2H9BA 1MXZA 2PFYA 1FPJA 4NN3A 4F29A 2XD2A 4DCYA 4K3FA 4U22A 1GTKA 4GQOA 2P0SA 3C36A 2XXRA 1QJMA 4ZEDA 1B58A 1LGBC 1N7XA 2PVUA 3EN3A 5DTBA 4KQPA 1LBWA 4QXDA 3TTMA 4G4PA 3OELA 5DVFA 1N0TA 4RXLA 2MKZA 4OVRA 3TTRA 2AIXA 1IQ7A 2PFZA 3RT6B 3MPKA 1JW1A 4OVTA 5CC2A 1DCUA 3KN7A 4IY5A 2OWSA 2DOJA 4FEDA 4FEBA 3N5LA 2Z8EA 1FTAA 3H4ZA 3UA8A 1G0IA 5H8HA 3CI8A 2HFBA 2H4IA 4JVIA 2O6AA 3ROJA 2I4CA 1NV7A 3N94A 2HZKA 3G3FA 4GLIA 4H8IA 5DVIA 1MY4A 1URDA 4OHNA 3MQ9A 3T96B 4Q30B 2XXKA 4RY1A 4NF5B 1MY3A 4MF3A 3HN0A 5CM6A 4U1OA 3VXBA 3A09A 4G68C 5JEIA 2M8CA 2NUVA 4PCDA 1VFEA 1NV3A 2I4BA 4NX1A 1H76A 3H6VA 3R7XA 4UABA 3IFCA 1HSEA 3T0JA 1Y1MA 1BKAA 1NNTA 4F1YA 2I3WA 1LCTA 4O8MA 5I59A 2NVUB 1YXIA 3G3JA 2KLFA 4N17A 5TPAA 3LSXA 1ELJA 1ZMGA 3Q28A 5KDTA 3V8XB 2B3BA 3VVFA 5A5LA 5A5XA 4QSDA 4N4UA 1MXXA 3SEWA 1D9YA 1B46A 1RDXA 4OETA 4O7IA 4EF2A 1B7ZA 2F6GA 2WBDA 2RC8A 4QSCA 2DVZA 3MVZA 1JQFA 3O29A 3HFUA 1FTMA 4LZ7A 4GBVA 3HSTA 3MUQA 5TPAB 2FNCA 2QMWA 5AE4A 4OEUA 1MPCA 4NG7A 2UVGA 3B8BA 4GX6A 5CBSA 2FVZA 1JEUA 2XXQA 2Z8FA 4TQUQ 3FUZA 1MY0A 3C9HA 3H03A 2Y84A 4ESXA 1SDXA 4NTLA 4UA8A 3VVDA 2ZZXA 4OFOA 4OVPA 3H6UA 2AL5A 3MWBA 3MW0A 1AIVA 1QUKA 1N04A 4LQ5A 1M5FA 3IOUA 3KSXA 4N6PA 2KQZA 4XKNA 4N6DA 3B6QA 4NWCA 3FGSA 1YCJA 4U4SA 1RYXA 4C1UA 3GYYA 4P9KA 3FXRA 2Q74A 3OEMA 2F34A 4DXCA 2WYPA 1LAFE 1XT8A 3V89B 1LCFA 4LZ5A 1TFAA 4LUBA 1PBPA 2O1LA 2XWVA 2REJA 4U4XA 1LFHA 3U94A 4I3YA 1JEVA 4QFNA 5ET5A 2AL4A 4GL0A 2F36A 5I3SA 5EYFA 4P0IA 3PPQA 3FXUA 4OYVA 4GVOA 4I1DA 1BTJA 4IGTA 2I49A 4PAFA 2DWJA 4U2RA 4XF5A 2QS2A 4ZZEA 2ONRA 2B4MA 1H45A 3O9PA 4MLQA 3OO7A 1I6QA 2B3FA 2I0CA 3F11A 2HAVA 2ZNTA 4JVCA 4R75A 1FPEA 1YYZA 1CE2A 4PFYA 2HXRA 4O94A 3D1RA 5JK4A 2KR0A 3OOAA 3HHFA 4F31B 2F8DA 1JP4A 4P0GA 3ECRA 4ZZAA 4OQOA 2Q8JA 3UP9A 4QFPA 2A5TB 1A7LA 1SQYA 3MJNA 2FA7A 1WODA 2ESNA 2F35A 1R9LA 1IMBA 3Q26A 1US5A 1ZBMA 1IUDA 5ITOA 1LBBA 2ANJA 5AA2B 3DP4A 4QFLA 1KA0A 3IJOB 2H5YA 5F24A 4QRZA 2F7AA 1VE4A 3PPRA 4R6HA 4PP0A 4NF8A 3MBPA 1ATGA 1JW5A 3RLFE 3IAZA 1P1UA 3R6UA 3KJTA 1OIBA 1R9QA 2O1MA 3OSQA 4C0RA 4R9GA 3T66A 1YTVA 2E0SA 3SESA 1FJ6A 4RNSA 3CVGA 2QFLA 4DI4B 4PBHA 3BFTA 2RC9A 3TCHA 1HSJA 2I58A 3LSLA 2CZKA 3OXNA 2UVJA 3CIJA 1Y3QA 1JVXA 3H6WA 2QL3A 3K6XA 4O7MA 3EHUA 3RNNA 4GWZA 3M3LA 2F6PA 1LAHE 5FTHA 2G93A 4OTEA 5CMBA 1LBXA 1UQWA 2XWKA 1URSA 1XOCA 1TT1A 1MRPA 4YU0A 4I62A 1L5TA 2QRYA 4OEVA 3OO9A 3IB2A 5KCJA 3TKDA 2DQVA 2WKYA 1XHYA 1B2HA 1ZLQA 4ND9A 2REGA 2RF1A 1FBFA 1B3HA 1M5BA 5H8NA 1NUWA 1D3KA 2QS1A 1EZOA 4YKPA 4GWSA 4Q8RA 3GXAA 1I6AA 1TWYA 2GHAA 1MM6A 3ILTB 4NHBA 4GL8A 5I2KB 2Y5LA 1BP5A 3IO6A 3RN8A 3EHTA 2Q2AA 4XXUA 5AA3A 5JTYB
chains in the Genus database with same CATH topology
3TYHA 1XC1A 3E9XA 2D5WA 2HQ0A 2I3VA 3G3HA 5L8DA 1Z7ME 1SW1A 1B9JA 4K3FA 4U22A 4DLDA 1GTKA 1S9TA 1JVYA 3QUFA 4GQOA 1OLCA 2P0SA 1B1XA 3OO6A 3DP8A 3C36A 4EQBA 2XXVA 5M2VA 2XXRA 1QJMA 3K02A 3S2VA 4ZEDA 2DP8A 2XX8A 1GR2A 2A5TA 4X1BA 1Y1ZA 3PUXE 1B58A 1LGBC 1N7XA 2PVUA 2ZYNA 2UVIA 3EN3A 2Z22A 2DYXA 5TP9B 5DTBA 1LFGA 3D4CA 4C1TA 1VSOA 1N3WA 3FJ7A 4KQPA 1OLAA 3LBSA 3PV0E 4FIMA 5H8SA 4ZE9A 3TTMA 5IKBA 3PU5A 3ILUB 4G4PA 4F3BA 3OELA 3PMWA 4U23A 5DVFA 4U1ZA 1P1WA 1N0TA 2HEUA 4RXLA 4ZEBA 1MQDA 4IO4A 1PB9A 3PPNA 3E13X 2Q2CA 1B51A 1LB9A 4L17A 2AIXA 3C34A 1IQ7A 3RT6B 4UACA 3TTRA 3MPKA 3WAEA 1JW1A 5CC2A 2PX1A 4KYEA 4IO2A 4N07A 3KN7A 3PD8A 4I9DA 2IA4A 2UYFA 1B7UA 1XS5A 2OWSA 2ZYKA 2DOJA 3Q25A 2XXIA 4IY5A 3VXCA 4KR5A 4FEDA 4ELRA 3S9MC 4FEBA 4LZ8A 3SEUA 1B1HA 3N5LA 2V3QA 2Z8EA 3GLBA 4GXAA 1UTBB 4ZS9A 4H5GA 3H4ZA 3C35A 3G3GA 3Q29A 3UA8A 5H8HA 3CI8A 1B7HA 4JBZA 2HFBA 3G3IA 3O66A 2VD3A 2H4IA 1MH4A 1SI1A 4ELPA 2RINA 2O6AA 2DWHA 2Y7WA 2QPQA 1XVYA 3DELB 2I4CA 2Z23A 3W9WA 1QVSA 3N94A 4PE5B 1IXCA 5I58A 2UVHA 1MQGA 2DXRA 2HZKA 3U8QA 4H1XA 4DXUA 3G3FA 1MQIA 4R2BA 4GLIA 4H8IA 5DVIA 1UTHA 4BDMA 1MY4A 2ABHA 3K6WA 3WAFA 1URDA 4OHNA 3MQ9A 4IO6A 3T96B 1IEJA 1NH7A 3FZVA 1VFDA 3M3FA 3ONMA 4GFRA 4ISUA 4Q30B 3M3KA 1T0KA 4Q5TA 2XXYA 3CFLA 4RY1A 4WEPA 4NF5B 4POXA 1GGGA 3TAJA 5ICTA 1MY3A 3GBBA 1DMBA 3C32A 3B7DA 5CI5A 5CMCA 4ESWA 3LSFB 4MF3A 3TTKA 2DXYA 3HN0A 1SYHA 4AQ4A 5CM6A 2LAOA 1UTBA 3GZGA 4FE8A 3K00A 4U1OA 4GOTA 5BUUA 3VXBA 3A09A 5L9OA 3L6GA 1N3XA 4MBPA 4MFIA 1F9BA 4YB7A 1BIYA 3DP6A 4JSDA 2ZYOA 1MDP1 4G68C 1NNKA 3T9UA 5JEIA 5I56A 4NWDA 2M8CA 3L6HA 3H3GA 2DE3A 2NUVA 1EZPA 4WEDA 3SKPA 1LBCA 2DSFA 5HBCA 2XD3A 5FHOA 4RJZA 5F7VA 4YMBA 3FJMA 1VFEA 3SEXA 5IAIA 4KHZE 2I4BA 1H76A 3H6VA 4JWYA 3R7XA 2QS4A 2O84X 3SEVA 4X9TA 1HSEA 4NE4A 3QXMA 1R1NA 1ZJLA 1Y1MA 3MPLA 1POTA 1OQHA 2PBWA 3K1PA 4PFTA 2GFEA 1BKAA 1O64A 3FATA 4YAHX 1NNTA 4F1YA 2I3WA 2ZNSA 2F5XA 1ANFA 3U93A 1PB8A 1LCTA 5I59A 2OWTA 3BBRA 3PUZE 4YZZA 1RYOA 4H5FA 2NVUB 4GRKA 4QFKA 3TFLA 3G3JA 3IO4A 2KLFA 2DWAA 2OLBA 5TPAA 2E1SA 3LSXA 3TPAA 1ELJA 5ICQA 1A8FA 1ZMGA 3FV1A 3Q28A 4GIZA 5KDTA 2D21A 4H65A 2B3BA 4PQJA 3V8XB 3VVFA 1SD3A 4ELQA 5A5XA 3K0VA 1WVJA 4OESA 2XXXA 1I69A 3B6TA 4QSDA 2QS3A 3FASA 1MXXA 3SEWA 3U92A 1D9YA 2Q9TA 2F97A 2UXAA 3TQWA 3UGWA 3V83A 3VV5A 1B46A 5EHMA 1B32A 3CG3A 1IXIA 1SVXB 5CMMA 4OETA 1LSTA 1SW4A 4O3CA 3SETA 4EF2A 1B7ZA 3CFZA 4ONYA 2F6GA 3LC8A 3PGFA 3TZAA 4NF6A 3LSWA 2RC8A 2RCAA 3O97A 2QMXA 4QSCA 2XXTA 4RPNA 4OFJA 2DVZA 4EXKA 1MXVA 1MXUA 3MVZA 1JQFA 3O29A 4QSEA 3Q27A 4E0XA 2FYIA 3N6TA 1MS7A 2DE2A 4FJPA 1FQAA 5BWJA 1FTMA 1LAXA 4LZ7A 3N6UA 3HSTA 4GF8A 3MUQA 1D9VA 5TPAB 1AL3A 2DS9A 4XTCQ 1O63A 4O3AA 2FNCA 2ONKE 1B05A 2QMWA 5AA4A 4IGRA 3CR9A 3MZBA 3O6HA 5AE4A 1QUIA 3M8UA 5ITPA 4OEUA 1MPCA 1OQGA 1QKAA 5FTIA 4ZEKA 4NF4B 3RPWA 4F2OA 3I5OA 3I3VA 2H99A 1LLSA 1NNFA 3D4GA 4QHQA 1FQFA 2RCBA 2UVGA 3PPPA 3RTWB 3ZKLA 3PMVA 5CBSA 3BFUA 1MH3A 1JEUA 2XXQA 1SBPA 1Y3PA 3QSLA 2BJJX 2Z8FA 4TQUQ 1LB8A 3FUZA 3UORA 1MY0A 3C9HA 3H03A 2DE4A 4Q0CA 1MY2A 4OZ9A 2R71A 2Y84A 1SDXA 1XVXA 4NTLA 4LONB 4UA8A 1Y3NA 3T22A 3VVDA 1TXFA 2NXOA 3N26A 4OFOA 4ZEIA 2I6EA 1R6ZA 3H6UA 2AL5A 1FW0A 3MWBA 3MW0A 4FATA 1AIVA 3OENA 1USYH 1QUKA 4PFWA 1N04A 2O68A 1MXYA 3QAXA 2XX9A 4LQ5A 1M5FA 2DWIA 3IOUA 3KSXA 4N6PA 4M4GA 4RK2A 5AA2B 1SI0A 3OSRA 3MP6A 4XKNA 1MDQA 4YMAA 3B6QA 4ESXA 4KD5A 5I2NB 4NWCA 3FGSA 4R73A 5K2YA 3UK4A 1UTHB 1YCJA 2GH9A 2QJEA 2ALUA 4U4SA 1RYXA 2VP1A 4IO7A 4C1UA 1DPPA 3A3UA 2CMOA 2A5SA 1MXWA 2XXHA 3GBAA 4F19A 3IOVA 5H8HB 3FXRA 1N7WA 3ODBA 1B52A 3OEMA 1MQHA 3H6TA 3TCGA 2F34A 1QULA 3HHGA 4DXCA 5AA3A 3KFMA 3EPEA 1LAFE 3SDFA 4HW8A 3MVYA 3T9VA 1MM7A 1XT8A 4IY6A 3V89B 1LCFA 4LZ5A 1N76A 3OEKA 4X48A 5H8QB 3TDJA 1A99A 1TFAA 5I2KA 1URGA 4LUBA 1DTGA 1PBPA 2O1LA 2REJA 3KGCA 1FCKA 4H0WA 1DSNA 3RY3A 3TEPA 4IO3A 4U4XA 2Y7IA 4F39A 3U72A 1LFHA 1O7TA 3FVGA 5DEXA 2RC7A 2CZLA 3A3CA 3U94A 4OENA 3UN6A 4NF5A 4OFLA 4DE8A 3VE1B 1JEVA 2F7BA 2ZXTA 3JYRA 2AL4A 2V3TA 3PMXA 4NF8B 3CG1A 4GL0A 4QFNA 3IR1A 4G8HA 3CSBA 1GV8A 1S7YA 2F36A 3PD9A 2YPNA 4FAJA 3VDFA 1MQJA 4XKRA 5EYFA 3TELA 4ZE8A 4P0IA 1B3GA 1UIUA 3U1OA 3PPQA 4NF4A 1LFIA 2R6GE 3O2AA 2ONSA 2R9JA 3FXUA 4OYVA 2ZYMA 1JNFA 4GVOA 4Z0IA 4I1DA 3QK6A 5DYHA 3KZGA 1TFDA 1BTJA 4KPTA 5H8NB 2V25A 3T9HB 5H8QA 4IGTA 3LR1A 3B6WA 2P2AA 1PEBA 2I49A 3CRBA 2ZMBA 4KCDA 4BLAA 3IOWA 4KFQA 4H8JA 3LUYA 2PT1A 4HCYA 4BDOA 1JETA 5FHNA 4ZECA 3K6VA 4XKQA 5AA4B 4JXIA 3IB0A 2NOOA 1Z7NE 2DWJA 2W7YA 1QKBA 3C33A 3EQ1A 1NNPA 3FJGA 4G77A 4U2RA 4LA9A 5CRYA 3KN8A 3JV9A 1NFTA 1QW0A 2XX7A 2QS2A 3K1MA 3KG2A 4ZDMA 1I6BA 3QUJA 3O28A 4ZZEA 2ONRA 5I57B 1VR5A 4KYDA 3E3KA 4RK9A 3RQTA 5I2NA 1FQBA 1H45A 1LAGE 2X7QA 2X26A 3JZJA 3O9PA 3OO7A 4LATA 2F7CA 3HV1A 4MLQA 3SEYA 5CMKA 3S9EA 3FVNA 4R9FA 3T9XB 1YPNA 3KEIA 1I6QA 1B3LA 2B3FA 2I0CA 1USYE 3F11A 1B5JA 2HAVA 4PETA 5K2XA 1OVTA 2ZNTA 4POWA 4NF6B 1MPBA 3TTLA 2I48A 3CSGA 4G8MA 1B0HA 3G7WA 5I84A 3FVOA 4R75A 5HM4B 4XKPA 5KZTA 1A55A 1B3FA 4YKIA 4F3GA 5CBRA 4GXSB 4EUOA 3K01A 4F3PA 5KDTB 1CE2A 1MG1A 5AA2A 2ZNUA 4PFYA 3PPOA 3FIRA 3FXQA 1FTKA 5L9MA 4R2FA 2XHDA 5JK4A 1B5HA 5A5XB 1N84A 1IIWA 1Y9UA 4DXBA 3P7IA 3RT8A 5AA2D 1POY1 4KCCA 4YB6A 2X7PA 3OOAA 4BDQA 4LP2B 2OCUA 1PB7A 4FECA 4M1VA 1P1QA 2VGQA 3HHFA 4F31B 3VLWA 4TOZA 2V3UA 3SERA 1MPDA 3MC2A 2UYEA 4HCWA 1BLFA 2F8DA 5KCJB 3S9NC 4P0GA 3DM0A 4WKMA 2F78A 3ECRA 4R6KA 4O3BA 2XD2A 4OQOA 4ZZAA 2Q8JA 1Y4TA 3UP9A 1A40A 3ZSFA 4QFPA 2A5TB 1Q1KA 3HO7A 4X1DA 2O51A 2VD2A 3TMGA 3BKIB 3QIMA 4IO5A 1P99A 1PC3A 4BDLA 1A7LA 1P1OA 1SQYA 2PMSA 1FQCA 2PYYA 3IX1A 3MJNA 1A54A 1ZIUA 1B40A 2FA7A 4QFOA 4DCXA 3V5AA 1NH8A 1WODA 2ESNA 2F35A 1R9LA 2HXWA 2H98A 3EF7A 4JDFA 3Q26A 4XIGQ 1ZBMA 1US5A 1IUDA 4KYSA 1SYIA 1FTJA 5ITOA 1P1NA 4NMYA 2ANJA 1LBBA 2Q88A 1EU8A 1KWHA 3DP4A 4GWOA 1H3DA 4QFLA 1OVBA 3TQLA 3S9LC 2Z8DA 3IJOB 1HSLA 1NMUA 2H5YA 4G2ZA 2HZLA 4QRZA 2F7AA 1VE4A 3E4RA 3OD7A 3PPRA 3KJ7A 2OK2A 4PP0A 4R6HA 1M5EA 4NF8A 2OJTA 3MBPA 1Y4CA 1ATGA 4OWDA 4RYAA 4F3SA 1JW5A 2GRVA 4YKKA 4OXVA 4TLLB 4E0WA 5LOMA 3RLFE 3IAZA 5B7DA 5ISUA 3CFXA 4DZ1A 2THIA 1P1UA 3R6UA 4Z7EA 3KJTA 1AOVA 1OIBA 1R9QA 1S50A 1RKMA 2O1MA 1MY1A 3DLNA 2PT2A 3OSQA 1H44A 4H67A 4WXJA 4R9GA 1B4HA 3W9VA 4C0RA 4KI0E 4F1UA 2G29A 3T66A 5TU0A 4F18A 1YTVA 4OERA 4ELOA 2E0SA 4DDDA 1Y20A 1OMPA 3KSJA 4YB5A 3SESA 3VLVA 1Q35A 5EHSA 4BDNA 2I0BA 3IL1B 5I59B 1AMFA 4QF9A 3C4MA 3R26A 3OMBA 1FTOA 3MVWA 2V84A 1FQEA 1ZKBA 4RNSA 3ZKKA 3PUVE 1SW2A 3CVGA 4AB6A 3MAMA 4JB7A 1B6HA 4OMBA 1UIVA 1D4NA 2RKMA 2GHBA 2VHAA 3FVKA 3MVXA 1AH5A 4I8CA 2XXUA 3PUWE 1YAEA 3BFTA 1SW5A 2RC9A 3TCHA 4DIGA 1HSJA 4NEDA 4TLMB 2I58A 2B65A 4LVQA 1IXGA 3K4UA 3LSLA 2Y7KA 4YICA 5ELVA 3OXNA 3RUMA 2UVJA 5JTYA 3CIJA 3IJXB 3K6UA 3G3KA 3S4UA 3I6VA 4DCYA 1FQDA 3RGYA 1DOTA 1WDNA 1Y3QA 2IEEA 2YLNA 4MLVA 1JW4A 1JVXA 3H6WA 4THIA 5DEXB 1US4A 4IB2A 5HPQA 3EHSA 3RTFB 2QL3A 3K6XA 1B0LA 1A8EA 1B3EA 2Q89A 3EHUA 4R72A 3RNNA 5B70A 2HAUA 3M3LA 2V93A 2F6PA 4EQ9A 1LAHE 2Y7RA 4GD5A 5FTHA 2G93A 4OTEA 3MZ9A 4FORA 1IITA 4JSOA 5CMBA 3FV2A 4F2QA 1UQWA 3VLUA 4YKJA 4EQ7A 4RPOA 3VVEA 4HS7A 5I56B 1URSA 1XOCA 3USDA 4R6YA 4EF1A 4EXLA 1TT1A 1B4ZA 1MRPA 3HPIA 4H6DA 4YU0A 2O69A 4HTGA 4I62A 1EZ9A 1M5DA 3KBRA 4G68A 5F1QA 1L5TA 1PBQA 2QRYA 4G8NA 3ZS6A 5DT6A 3QYTA 5FHMA 3K2DA 2XXPA 3FD3A 5AA1A 4F1VA 5H8FB 3HCQA 1EH3A 1PDAA 4OEVA 4JWXA 4BDRA 1ZU0A 3OO9A 3IB2A 3K1NA 3PUYE 4RA1A 4ZEFA 2NWJA 5L9SA 1II5A 5DVJA 5KCJA 4AB5A 3TCFA 3W15C 3MP1A 1ZTYA 3TKDA 3TUSA 2O7UA 2DQVA 1FTLA 2Y7PA 3O6IA 2WKYA 2DVCA 1H43A 1XHYA 4EDPA 2VOZA 3H06B 4F22A 3OO8A 1B2HA 2YJPA 1IXHA 2D3IA 3KOSA 3IB1A 1CB6A 4JWOA 4N13A 3VFJA 1ZLQA 3KN3A 5I57A 1M5CA 3UIFA 4ND9A 1NKXA 2REGA 2RF1A 2O7IA 1B3HA 1M5BA 3H7MA 5H8NA 5J1DA 1D3KA 2QS1A 2HCAA 3MP8A 4YKPA 3TTNA 4MH5A 1EZOA 3KOTA 3TODA 4Q8RA 3THIA 3IK6B 3GXAA 3O6GA 4U21A 1I6AA 5TP9A 1NL5A 3T93B 5I58B 1TWYA 2OZZA 2GHAA 4P11A 4R74A 1B5IA 1MM6A 2H25A 4G68B 2XXWA 3ILTB 2QSXA 5H8FA 3MZ1A 4GL8A 4LQ2A 4OVJA 4PFUA 5I2KB 2AYSA 2H9BA 1QUJA 3IOTA 3IORA 2P1SA 1MXZA 2OBGA 1J1NA 1BP5A 1DTZA 4F29A 3AXFA 3IO6A 4ECFA 3RN8A 3EHTA 1DPEA 2Q2AA 4XXUA 1IZ1A 3C31A 5JTYB 1GVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TYH A;  1XC1 A;  3E9X A;  2D5W A;  2HQ0 A;  2I3V A;  3G3H A;  5L8D A;  1Z7M E;  1SW1 A;  1B9J A;  4K3F A;  4U22 A;  4DLD A;  1GTK A;  1S9T A;  1JVY A;  3QUF A;  4GQO A;  1OLC A;  2P0S A;  1B1X A;  3OO6 A;  3DP8 A;  3C36 A;  4EQB A;  2XXV A;  5M2V A;  2XXR A;  1QJM A;  3K02 A;  3S2V A;  4ZED A;  2DP8 A;  2XX8 A;  1GR2 A;  2A5T A;  4X1B A;  1Y1Z A;  3PUX E;  1B58 A;  1LGB C;  1N7X A;  2PVU A;  2ZYN A;  2UVI A;  3EN3 A;  2Z22 A;  2DYX A;  5TP9 B;  5DTB A;  1LFG A;  3D4C A;  4C1T A;  1VSO A;  1N3W A;  3FJ7 A;  4KQP A;  1OLA A;  3LBS A;  3PV0 E;  4FIM A;  5H8S A;  4ZE9 A;  3TTM A;  5IKB A;  3PU5 A;  3ILU B;  4G4P A;  4F3B A;  3OEL A;  3PMW A;  4U23 A;  5DVF A;  4U1Z A;  1P1W A;  1N0T A;  2HEU A;  4RXL A;  4ZEB A;  1MQD A;  4IO4 A;  1PB9 A;  3PPN A;  3E13 X;  2Q2C A;  1B51 A;  1LB9 A;  4L17 A;  2AIX A;  3C34 A;  1IQ7 A;  3RT6 B;  4UAC A;  3TTR A;  3MPK A;  3WAE A;  1JW1 A;  5CC2 A;  2PX1 A;  4KYE A;  4IO2 A;  4N07 A;  3KN7 A;  3PD8 A;  4I9D A;  2IA4 A;  2UYF A;  1B7U A;  1XS5 A;  2OWS A;  2ZYK A;  2DOJ A;  3Q25 A;  2XXI A;  4IY5 A;  3VXC A;  4KR5 A;  4FED A;  4ELR A;  3S9M C;  4FEB A;  4LZ8 A;  3SEU A;  1B1H A;  3N5L A;  2V3Q A;  2Z8E A;  3GLB A;  4GXA A;  1UTB B;  4ZS9 A;  4H5G A;  3H4Z A;  3C35 A;  3G3G A;  3Q29 A;  3UA8 A;  5H8H A;  3CI8 A;  1B7H A;  4JBZ A;  2HFB A;  3G3I A;  3O66 A;  2VD3 A;  2H4I A;  1MH4 A;  1SI1 A;  4ELP A;  2RIN A;  2O6A A;  2DWH A;  2Y7W A;  2QPQ A;  1XVY A;  3DEL B;  2I4C A;  2Z23 A;  3W9W A;  1QVS A;  3N94 A;  4PE5 B;  1IXC A;  5I58 A;  2UVH A;  1MQG A;  2DXR A;  2HZK A;  3U8Q A;  4H1X A;  4DXU A;  3G3F A;  1MQI A;  4R2B A;  4GLI A;  4H8I A;  5DVI A;  1UTH A;  4BDM A;  1MY4 A;  2ABH A;  3K6W A;  3WAF A;  1URD A;  4OHN A;  3MQ9 A;  4IO6 A;  3T96 B;  1IEJ A;  1NH7 A;  3FZV A;  1VFD A;  3M3F A;  3ONM A;  4GFR A;  4ISU A;  4Q30 B;  3M3K A;  1T0K A;  4Q5T A;  2XXY A;  3CFL A;  4RY1 A;  4WEP A;  4NF5 B;  4POX A;  1GGG A;  3TAJ A;  5ICT A;  1MY3 A;  3GBB A;  1DMB A;  3C32 A;  3B7D A;  5CI5 A;  5CMC A;  4ESW A;  3LSF B;  4MF3 A;  3TTK A;  2DXY A;  3HN0 A;  1SYH A;  4AQ4 A;  5CM6 A;  2LAO A;  1UTB A;  3GZG A;  4FE8 A;  3K00 A;  4U1O A;  4GOT A;  5BUU A;  3VXB A;  3A09 A;  5L9O A;  3L6G A;  1N3X A;  4MBP A;  4MFI A;  1F9B A;  4YB7 A;  1BIY A;  3DP6 A;  4JSD A;  2ZYO A;  1MDP 1;  4G68 C;  1NNK A;  3T9U A;  5JEI A;  5I56 A;  4NWD A;  2M8C A;  3L6H A;  3H3G A;  2DE3 A;  2NUV A;  1EZP A;  4WED A;  3SKP A;  1LBC A;  2DSF A;  5HBC A;  2XD3 A;  5FHO A;  4RJZ A;  5F7V A;  4YMB A;  3FJM A;  1VFE A;  3SEX A;  5IAI A;  4KHZ E;  2I4B A;  1H76 A;  3H6V A;  4JWY A;  3R7X A;  2QS4 A;  2O84 X;  3SEV A;  4X9T A;  1HSE A;  4NE4 A;  3QXM A;  1R1N A;  1ZJL A;  1Y1M A;  3MPL A;  1POT A;  1OQH A;  2PBW A;  3K1P A;  4PFT A;  2GFE A;  1BKA A;  1O64 A;  3FAT A;  4YAH X;  1NNT A;  4F1Y A;  2I3W A;  2ZNS A;  2F5X A;  1ANF A;  3U93 A;  1PB8 A;  1LCT A;  5I59 A;  2OWT A;  3BBR A;  3PUZ E;  4YZZ A;  1RYO A;  4H5F A;  2NVU B;  4GRK A;  4QFK A;  3TFL A;  3G3J A;  3IO4 A;  2KLF A;  2DWA A;  2OLB A;  5TPA A;  2E1S A;  3LSX A;  3TPA A;  1ELJ A;  5ICQ A;  1A8F A;  1ZMG A;  3FV1 A;  3Q28 A;  4GIZ A;  5KDT A;  2D21 A;  4H65 A;  2B3B A;  4PQJ A;  3V8X B;  3VVF A;  1SD3 A;  4ELQ A;  5A5X A;  3K0V A;  1WVJ A;  4OES A;  2XXX A;  1I69 A;  3B6T A;  4QSD A;  2QS3 A;  3FAS A;  1MXX A;  3SEW A;  3U92 A;  1D9Y A;  2Q9T A;  2F97 A;  2UXA A;  3TQW A;  3UGW A;  3V83 A;  3VV5 A;  1B46 A;  5EHM A;  1B32 A;  3CG3 A;  1IXI A;  1SVX B;  5CMM A;  4OET A;  1LST A;  1SW4 A;  4O3C A;  3SET A;  4EF2 A;  1B7Z A;  3CFZ A;  4ONY A;  2F6G A;  3LC8 A;  3PGF A;  3TZA A;  4NF6 A;  3LSW A;  2RC8 A;  2RCA A;  3O97 A;  2QMX A;  4QSC A;  2XXT A;  4RPN A;  4OFJ A;  2DVZ A;  4EXK A;  1MXV A;  1MXU A;  3MVZ A;  1JQF A;  3O29 A;  4QSE A;  3Q27 A;  4E0X A;  2FYI A;  3N6T A;  1MS7 A;  2DE2 A;  4FJP A;  1FQA A;  5BWJ A;  1FTM A;  1LAX A;  4LZ7 A;  3N6U A;  3HST A;  4GF8 A;  3MUQ A;  1D9V A;  5TPA B;  1AL3 A;  2DS9 A;  4XTC Q;  1O63 A;  4O3A A;  2FNC A;  2ONK E;  1B05 A;  2QMW A;  5AA4 A;  4IGR A;  3CR9 A;  3MZB A;  3O6H A;  5AE4 A;  1QUI A;  3M8U A;  5ITP A;  4OEU A;  1MPC A;  1OQG A;  1QKA A;  5FTI A;  4ZEK A;  4NF4 B;  3RPW A;  4F2O A;  3I5O A;  3I3V A;  2H99 A;  1LLS A;  1NNF A;  3D4G A;  4QHQ A;  1FQF A;  2RCB A;  2UVG A;  3PPP A;  3RTW B;  3ZKL A;  3PMV A;  5CBS A;  3BFU A;  1MH3 A;  1JEU A;  2XXQ A;  1SBP A;  1Y3P A;  3QSL A;  2BJJ X;  2Z8F A;  4TQU Q;  1LB8 A;  3FUZ A;  3UOR A;  1MY0 A;  3C9H A;  3H03 A;  2DE4 A;  4Q0C A;  1MY2 A;  4OZ9 A;  2R71 A;  2Y84 A;  1SDX A;  1XVX A;  4NTL A;  4LON B;  4UA8 A;  1Y3N A;  3T22 A;  3VVD A;  1TXF A;  2NXO A;  3N26 A;  4OFO A;  4ZEI A;  2I6E A;  1R6Z A;  3H6U A;  2AL5 A;  1FW0 A;  3MWB A;  3MW0 A;  4FAT A;  1AIV A;  3OEN A;  1USY H;  1QUK A;  4PFW A;  1N04 A;  2O68 A;  1MXY A;  3QAX A;  2XX9 A;  4LQ5 A;  1M5F A;  2DWI A;  3IOU A;  3KSX A;  4N6P A;  4M4G A;  4RK2 A;  5AA2 B;  1SI0 A;  3OSR A;  3MP6 A;  4XKN A;  1MDQ A;  4YMA A;  3B6Q A;  4ESX A;  4KD5 A;  5I2N B;  4NWC A;  3FGS A;  4R73 A;  5K2Y A;  3UK4 A;  1UTH B;  1YCJ A;  2GH9 A;  2QJE A;  2ALU A;  4U4S A;  1RYX A;  2VP1 A;  4IO7 A;  4C1U A;  1DPP A;  3A3U A;  2CMO A;  2A5S A;  1MXW A;  2XXH A;  3GBA A;  4F19 A;  3IOV A;  5H8H B;  3FXR A;  1N7W A;  3ODB A;  1B52 A;  3OEM A;  1MQH A;  3H6T A;  3TCG A;  2F34 A;  1QUL A;  3HHG A;  4DXC A;  5AA3 A;  3KFM A;  3EPE A;  1LAF E;  3SDF A;  4HW8 A;  3MVY A;  3T9V A;  1MM7 A;  1XT8 A;  4IY6 A;  3V89 B;  1LCF A;  4LZ5 A;  1N76 A;  3OEK A;  4X48 A;  5H8Q B;  3TDJ A;  1A99 A;  1TFA A;  5I2K A;  1URG A;  4LUB A;  1DTG A;  1PBP A;  2O1L A;  2REJ A;  3KGC A;  1FCK A;  4H0W A;  1DSN A;  3RY3 A;  3TEP A;  4IO3 A;  4U4X A;  2Y7I A;  4F39 A;  3U72 A;  1LFH A;  1O7T A;  3FVG A;  5DEX A;  2RC7 A;  2CZL A;  3A3C A;  3U94 A;  4OEN A;  3UN6 A;  4NF5 A;  4OFL A;  4DE8 A;  3VE1 B;  1JEV A;  2F7B A;  2ZXT A;  3JYR A;  2AL4 A;  2V3T A;  3PMX A;  4NF8 B;  3CG1 A;  4GL0 A;  4QFN A;  3IR1 A;  4G8H A;  3CSB A;  1GV8 A;  1S7Y A;  2F36 A;  3PD9 A;  2YPN A;  4FAJ A;  3VDF A;  1MQJ A;  4XKR A;  5EYF A;  3TEL A;  4ZE8 A;  4P0I A;  1B3G A;  1UIU A;  3U1O A;  3PPQ A;  4NF4 A;  1LFI A;  2R6G E;  3O2A A;  2ONS A;  2R9J A;  3FXU A;  4OYV A;  2ZYM A;  1JNF A;  4GVO A;  4Z0I A;  4I1D A;  3QK6 A;  5DYH A;  3KZG A;  1TFD A;  1BTJ A;  4KPT A;  5H8N B;  2V25 A;  3T9H B;  5H8Q A;  4IGT A;  3LR1 A;  3B6W A;  2P2A A;  1PEB A;  2I49 A;  3CRB A;  2ZMB A;  4KCD A;  4BLA A;  3IOW A;  4KFQ A;  4H8J A;  3LUY A;  2PT1 A;  4HCY A;  4BDO A;  1JET A;  5FHN A;  4ZEC A;  3K6V A;  4XKQ A;  5AA4 B;  4JXI A;  3IB0 A;  2NOO A;  1Z7N E;  2DWJ A;  2W7Y A;  1QKB A;  3C33 A;  3EQ1 A;  1NNP A;  3FJG A;  4G77 A;  4U2R A;  4LA9 A;  5CRY A;  3KN8 A;  3JV9 A;  1NFT A;  1QW0 A;  2XX7 A;  2QS2 A;  3K1M A;  3KG2 A;  4ZDM A;  1I6B A;  3QUJ A;  3O28 A;  4ZZE A;  2ONR A;  5I57 B;  1VR5 A;  4KYD A;  3E3K A;  4RK9 A;  3RQT A;  5I2N A;  1FQB A;  1H45 A;  1LAG E;  2X7Q A;  2X26 A;  3JZJ A;  3O9P A;  3OO7 A;  4LAT A;  2F7C A;  3HV1 A;  4MLQ A;  3SEY A;  5CMK A;  3S9E A;  3FVN A;  4R9F A;  3T9X B;  1YPN A;  3KEI A;  1I6Q A;  1B3L A;  2B3F A;  2I0C A;  1USY E;  3F11 A;  1B5J A;  2HAV A;  4PET A;  5K2X A;  1OVT A;  2ZNT A;  4POW A;  4NF6 B;  1MPB A;  3TTL A;  2I48 A;  3CSG A;  4G8M A;  1B0H A;  3G7W A;  5I84 A;  3FVO A;  4R75 A;  5HM4 B;  4XKP A;  5KZT A;  1A55 A;  1B3F A;  4YKI A;  4F3G A;  5CBR A;  4GXS B;  4EUO A;  3K01 A;  4F3P A;  5KDT B;  1CE2 A;  1MG1 A;  5AA2 A;  2ZNU A;  4PFY A;  3PPO A;  3FIR A;  3FXQ A;  1FTK A;  5L9M A;  4R2F A;  2XHD A;  5JK4 A;  1B5H A;  5A5X B;  1N84 A;  1IIW A;  1Y9U A;  4DXB A;  3P7I A;  3RT8 A;  5AA2 D;  1POY 1;  4KCC A;  4YB6 A;  2X7P A;  3OOA A;  4BDQ A;  4LP2 B;  2OCU A;  1PB7 A;  4FEC A;  4M1V A;  1P1Q A;  2VGQ A;  3HHF A;  4F31 B;  3VLW A;  4TOZ A;  2V3U A;  3SER A;  1MPD A;  3MC2 A;  2UYE A;  4HCW A;  1BLF A;  2F8D A;  5KCJ B;  3S9N C;  4P0G A;  3DM0 A;  4WKM A;  2F78 A;  3ECR A;  4R6K A;  4O3B A;  2XD2 A;  4OQO A;  4ZZA A;  2Q8J A;  1Y4T A;  3UP9 A;  1A40 A;  3ZSF A;  4QFP A;  2A5T B;  1Q1K A;  3HO7 A;  4X1D A;  2O51 A;  2VD2 A;  3TMG A;  3BKI B;  3QIM A;  4IO5 A;  1P99 A;  1PC3 A;  4BDL A;  1A7L A;  1P1O A;  1SQY A;  2PMS A;  1FQC A;  2PYY A;  3IX1 A;  3MJN A;  1A54 A;  1ZIU A;  1B40 A;  2FA7 A;  4QFO A;  4DCX A;  3V5A A;  1NH8 A;  1WOD A;  2ESN A;  2F35 A;  1R9L A;  2HXW A;  2H98 A;  3EF7 A;  4JDF A;  3Q26 A;  4XIG Q;  1ZBM A;  1US5 A;  1IUD A;  4KYS A;  1SYI A;  1FTJ A;  5ITO A;  1P1N A;  4NMY A;  2ANJ A;  1LBB A;  2Q88 A;  1EU8 A;  1KWH A;  3DP4 A;  4GWO A;  1H3D A;  4QFL A;  1OVB A;  3TQL A;  3S9L C;  2Z8D A;  3IJO B;  1HSL A;  1NMU A;  2H5Y A;  4G2Z A;  2HZL A;  4QRZ A;  2F7A A;  1VE4 A;  3E4R A;  3OD7 A;  3PPR A;  3KJ7 A;  2OK2 A;  4PP0 A;  4R6H A;  1M5E A;  4NF8 A;  2OJT A;  3MBP A;  1Y4C A;  1ATG A;  4OWD A;  4RYA A;  4F3S A;  1JW5 A;  2GRV A;  4YKK A;  4OXV A;  4TLL B;  4E0W A;  5LOM A;  3RLF E;  3IAZ A;  5B7D A;  5ISU A;  3CFX A;  4DZ1 A;  2THI A;  1P1U A;  3R6U A;  4Z7E A;  3KJT A;  1AOV A;  1OIB A;  1R9Q A;  1S50 A;  1RKM A;  2O1M A;  1MY1 A;  3DLN A;  2PT2 A;  3OSQ A;  1H44 A;  4H67 A;  4WXJ A;  4R9G A;  1B4H A;  3W9V A;  4C0R A;  4KI0 E;  4F1U A;  2G29 A;  3T66 A;  5TU0 A;  4F18 A;  1YTV A;  4OER A;  4ELO A;  2E0S A;  4DDD A;  1Y20 A;  1OMP A;  3KSJ A;  4YB5 A;  3SES A;  3VLV A;  1Q35 A;  5EHS A;  4BDN A;  2I0B A;  3IL1 B;  5I59 B;  1AMF A;  4QF9 A;  3C4M A;  3R26 A;  3OMB A;  1FTO A;  3MVW A;  2V84 A;  1FQE A;  1ZKB A;  4RNS A;  3ZKK A;  3PUV E;  1SW2 A;  3CVG A;  4AB6 A;  3MAM A;  4JB7 A;  1B6H A;  4OMB A;  1UIV A;  1D4N A;  2RKM A;  2GHB A;  2VHA A;  3FVK A;  3MVX A;  1AH5 A;  4I8C A;  2XXU A;  3PUW E;  1YAE A;  3BFT A;  1SW5 A;  2RC9 A;  3TCH A;  4DIG A;  1HSJ A;  4NED A;  4TLM B;  2I58 A;  2B65 A;  4LVQ A;  1IXG A;  3K4U A;  3LSL A;  2Y7K A;  4YIC A;  5ELV A;  3OXN A;  3RUM A;  2UVJ A;  5JTY A;  3CIJ A;  3IJX B;  3K6U A;  3G3K A;  3S4U A;  3I6V A;  4DCY A;  1FQD A;  3RGY A;  1DOT A;  1WDN A;  1Y3Q A;  2IEE A;  2YLN A;  4MLV A;  1JW4 A;  1JVX A;  3H6W A;  4THI A;  5DEX B;  1US4 A;  4IB2 A;  5HPQ A;  3EHS A;  3RTF B;  2QL3 A;  3K6X A;  1B0L A;  1A8E A;  1B3E A;  2Q89 A;  3EHU A;  4R72 A;  3RNN A;  5B70 A;  2HAU A;  3M3L A;  2V93 A;  2F6P A;  4EQ9 A;  1LAH E;  2Y7R A;  4GD5 A;  5FTH A;  2G93 A;  4OTE A;  3MZ9 A;  4FOR A;  1IIT A;  4JSO A;  5CMB A;  3FV2 A;  4F2Q A;  1UQW A;  3VLU A;  4YKJ A;  4EQ7 A;  4RPO A;  3VVE A;  4HS7 A;  5I56 B;  1URS A;  1XOC A;  3USD A;  4R6Y A;  4EF1 A;  4EXL A;  1TT1 A;  1B4Z A;  1MRP A;  3HPI A;  4H6D A;  4YU0 A;  2O69 A;  4HTG A;  4I62 A;  1EZ9 A;  1M5D A;  3KBR A;  4G68 A;  5F1Q A;  1L5T A;  1PBQ A;  2QRY A;  4G8N A;  3ZS6 A;  5DT6 A;  3QYT A;  5FHM A;  3K2D A;  2XXP A;  3FD3 A;  5AA1 A;  4F1V A;  5H8F B;  3HCQ A;  1EH3 A;  1PDA A;  4OEV A;  4JWX A;  4BDR A;  1ZU0 A;  3OO9 A;  3IB2 A;  3K1N A;  3PUY E;  4RA1 A;  4ZEF A;  2NWJ A;  5L9S A;  1II5 A;  5DVJ A;  5KCJ A;  4AB5 A;  3TCF A;  3W15 C;  3MP1 A;  1ZTY A;  3TKD A;  3TUS A;  2O7U A;  2DQV A;  1FTL A;  2Y7P A;  3O6I A;  2WKY A;  2DVC A;  1H43 A;  1XHY A;  4EDP A;  2VOZ A;  3H06 B;  4F22 A;  3OO8 A;  1B2H A;  2YJP A;  1IXH A;  2D3I A;  3KOS A;  3IB1 A;  1CB6 A;  4JWO A;  4N13 A;  3VFJ A;  1ZLQ A;  3KN3 A;  5I57 A;  1M5C A;  3UIF A;  4ND9 A;  1NKX A;  2REG A;  2RF1 A;  2O7I A;  1B3H A;  1M5B A;  3H7M A;  5H8N A;  5J1D A;  1D3K A;  2QS1 A;  2HCA A;  3MP8 A;  4YKP A;  3TTN A;  4MH5 A;  1EZO A;  3KOT A;  3TOD A;  4Q8R A;  3THI A;  3IK6 B;  3GXA A;  3O6G A;  4U21 A;  1I6A A;  5TP9 A;  1NL5 A;  3T93 B;  5I58 B;  1TWY A;  2OZZ A;  2GHA A;  4P11 A;  4R74 A;  1B5I A;  1MM6 A;  2H25 A;  4G68 B;  2XXW A;  3ILT B;  2QSX A;  5H8F A;  3MZ1 A;  4GL8 A;  4LQ2 A;  4OVJ A;  4PFU A;  5I2K B;  2AYS A;  2H9B A;  1QUJ A;  3IOT A;  3IOR A;  2P1S A;  1MXZ A;  2OBG A;  1J1N A;  1BP5 A;  1DTZ A;  4F29 A;  3AXF A;  3IO6 A;  4ECF A;  3RN8 A;  3EHT A;  1DPE A;  2Q2A A;  4XXU A;  1IZ1 A;  3C31 A;  5JTY B;  1GVC A; 
#chains in the Genus database with same CATH topology
 2D5W A;  5ET8 A;  2HQ0 A;  1Z7M E;  4DLD A;  1S9T A;  3QUF A;  1B1X A;  2XXV A;  4HE2 A;  1GR2 A;  2A5T A;  4X1B A;  2NWJ A;  4PFI A;  3T1B A;  1VSO A;  3FJ7 A;  4PF8 A;  5I5P A;  4F3B A;  3ILU B;  2JJK A;  1EYK A;  2HEU A;  4FBP A;  1MQD A;  3E13 X;  2Q2C A;  5ET6 A;  5EYG A;  2UYF A;  4KR5 A;  2XWI A;  3SEU A;  1B1H A;  1FPL A;  4ZS9 A;  4H5G A;  3G3G A;  3Q29 A;  1B7H A;  3O66 A;  2VD3 A;  2DWH A;  2Z23 A;  3W9W A;  3U8Q A;  4DXU A;  1NH7 A;  3CFL A;  5ICT A;  1GGG A;  2V4C A;  5ET7 A;  3GBB A;  1DMB A;  2Y5K A;  3TTK A;  2LAO A;  3GZG A;  5IZ3 B;  1FSA A;  1F9B A;  4YB7 A;  3DP6 A;  4JSD A;  4GWU A;  3L6H A;  3H3G A;  2DE3 A;  3SKP A;  5HBC A;  4KHZ E;  4JWY A;  4PDH A;  4NE4 A;  1ZJL A;  1POT A;  2PBW A;  3K1P A;  4HE1 A;  2F5X A;  1ANF A;  3U93 A;  2OWT A;  4H5F A;  3TFL A;  1IMA A;  4GIZ A;  2D21 A;  4H65 A;  4PQJ A;  3RPL A;  4PGP A;  3B6T A;  3FAS A;  2QS3 A;  2UXA A;  3V83 A;  5IZ1 A;  5EHM A;  5CMM A;  4O3C A;  3PGF A;  2XXT A;  4RPN A;  4OFJ A;  2XA5 A;  3KBZ A;  4QSE A;  1KA1 A;  2DE2 A;  1D9V A;  2DS9 A;  4XTC Q;  3KC1 A;  3MZB A;  3O6H A;  1QUI A;  3M8U A;  1OQG A;  5FTI A;  4ZEK A;  3RPW A;  4F2O A;  5EQ7 A;  2H99 A;  4QHQ A;  3PPP A;  2RCB A;  3BFU A;  1SBP A;  2BJJ X;  1LB8 A;  3UOR A;  2DE4 A;  3FBP A;  4Q0C A;  4OZ9 A;  2R71 A;  4PC9 A;  3T22 A;  2NXO A;  4MCO A;  4N81 A;  2HPG A;  4PFW A;  3QAX A;  5K2Y A;  3E78 A;  4P47 A;  3ODB A;  3H6T A;  4NQ8 A;  1QUL A;  3KFM A;  3EPE A;  3T9V A;  4IY6 A;  4X48 A;  1A99 A;  3TEP A;  1FCK A;  1DSN A;  4XEQ A;  2XWO A;  3E79 A;  2CZL A;  4NF5 A;  3VE1 B;  2F7B A;  3PMX A;  3CSB A;  3FXB A;  4FAJ A;  1IMF A;  4NF4 A;  2ONS A;  2R9J A;  4I40 A;  2VPO A;  4Z0I A;  5DYH A;  5H8N B;  2V25 A;  1XI6 A;  2ZMB A;  3IOW A;  4BDO A;  1JET A;  3K6V A;  4XKQ A;  4N8Y A;  3IB0 A;  1Z7N E;  1QKB A;  3C33 A;  4NGU A;  2XX7 A;  1I6B A;  1FPD A;  5I2N A;  1FQB A;  4PAI A;  3SDF A;  1LAG E;  3FVN A;  3T9X B;  1EYI A;  1B5J A;  5K2X A;  4POW A;  4GWX A;  3CSG A;  4G8M A;  1B0H A;  3G7W A;  3FVO A;  4XKP A;  5KZT A;  4GXS B;  4F3P A;  1MG1 A;  2ZNU A;  3PPO A;  2XHD A;  3P7I A;  1FPK A;  4OVQ A;  2VGQ A;  1MPD A;  2UYE A;  4HCW A;  4WKM A;  2F78 A;  4O3B A;  1Q1K A;  2O51 A;  3BKI B;  3QIM A;  4IO5 A;  1P99 A;  1P1O A;  2PMS A;  2PYY A;  1FQC A;  3IX1 A;  1K9Z A;  1B40 A;  2HXW A;  4KYS A;  1FTJ A;  2Q88 A;  4N8G A;  2FHY A;  2HZL A;  5DT6 A;  3E4R A;  2OK2 A;  1M5E A;  1Y4C A;  4TLL B;  3CFX A;  1RKM A;  3W9V A;  4PGN A;  4WXJ A;  5TU0 A;  1Y20 A;  1FPB A;  3IL1 B;  1AMF A;  4QF9 A;  3OMB A;  4H46 A;  1FTO A;  3TUS A;  2RKM A;  1D4N A;  2XXU A;  4DIG A;  4NED A;  1IXG A;  2Y7K A;  5JTY A;  3K6U A;  3G3K A;  3RGY A;  1US4 A;  5HPQ A;  3RTF B;  3BIG A;  3BIH A;  2Q89 A;  2CEY A;  2Y7R A;  4JSO A;  3FV2 A;  4EQ7 A;  3USD A;  4R6Y A;  1B4Z A;  3CHG A;  5IAI A;  4G68 A;  3ZS6 A;  2XXP A;  3FD3 A;  3HCQ A;  1EH3 A;  4PE3 A;  5L9S A;  1NUY A;  3PUY E;  4ZEF A;  3TCF A;  3W15 C;  4MNC A;  3QMF A;  2VOZ A;  3H06 B;  1IXH A;  2D3I A;  4JWO A;  3IB1 A;  4P8B A;  4MMP A;  3IK6 B;  3O6G A;  4U21 A;  5TP9 A;  4P11 A;  3RPL B;  2QSX A;  3MZ1 A;  4LQ2 A;  2OWZ A;  3IOT A;  2P1S A;  4OAN A;  4ECF A;  2CZI A;  1DPE A;  3C31 A;  1NV5 A;  1XC1 A;  3E9X A;  5IZ3 A;  2I3V A;  5L8D A;  5LDZ A;  1SW1 A;  1JVY A;  3OO6 A;  2DP8 A;  2XX8 A;  1Y1Z A;  2ZYN A;  2UVI A;  1LFG A;  4C1T A;  1N3W A;  3LBS A;  5H8S A;  4ZE9 A;  3PMW A;  4ZEB A;  3PPN A;  3MST A;  1B51 A;  4XFE A;  2PX1 A;  4KYE A;  4IO2 A;  2IA4 A;  5FBP A;  1XS5 A;  3Q25 A;  4ELR A;  1FRP A;  2V3Q A;  1NUX A;  1IMD A;  1MH4 A;  2RIN A;  2Y7W A;  3DEL B;  3IFA A;  4MAG A;  4H1X A;  3RYD A;  1NV6 A;  1MQI A;  4MIJ A;  1FJ9 A;  3ONM A;  4GFR A;  1T0K A;  4Q5T A;  2XXY A;  4WEP A;  3TAJ A;  4POX A;  3B7D A;  4AQ4 A;  2DXY A;  1SYH A;  4AS4 A;  4FE8 A;  3K00 A;  1DBZ A;  5L9O A;  4MBP A;  1N3X A;  4GBW A;  1BIY A;  1MDP 1;  1NNK A;  4WED A;  5F7V A;  4YMB A;  3FJM A;  3SEX A;  2QS4 A;  2O84 X;  1FBG A;  1BK4 A;  3MPL A;  4PFT A;  2GFE A;  1O64 A;  3FAT A;  1Q9D A;  1PB8 A;  3BBR A;  3PUZ E;  4QBA A;  1RYO A;  1AWB A;  2DWA A;  2OLB A;  3FV1 A;  2F3B A;  4ELQ A;  3K0V A;  2XXX A;  1NV4 A;  2QVV A;  3UGW A;  2WYK A;  1IXI A;  1SVX B;  1SW4 A;  3SET A;  4ONY A;  2PCR A;  3TZA A;  4OA4 A;  3LSW A;  2FBP A;  5IGA A;  1MXU A;  3EKI A;  4E0X A;  4P1L A;  1LAX A;  3N6U A;  2GQ1 A;  1SPI A;  1AL3 A;  1O63 A;  4O3A A;  2ONK E;  4IGR A;  5ESY A;  3I3V A;  3D4G A;  1FQF A;  1MH3 A;  4OVS A;  1Y3P A;  1MY2 A;  1XVX A;  1Y3N A;  3N26 A;  4FAT A;  1USY H;  5EQA A;  2XX9 A;  2DWI A;  4RK2 A;  2VT5 A;  4YMA A;  4KD5 A;  4DI3 D;  2GH9 A;  5DW8 A;  3A3U A;  2CMO A;  3GBA A;  4F19 A;  3IOV A;  5H8H B;  1N7W A;  1LBV A;  1B52 A;  5T3J A;  3TCG A;  4HW8 A;  3MVY A;  1MM7 A;  3OEK A;  5H8Q B;  3TDJ A;  1DTG A;  4IO3 A;  1O7T A;  5DEX A;  2RC7 A;  3MYU A;  4OEN A;  3UN6 A;  4OFL A;  4DE8 A;  4NF8 B;  3IR1 A;  4G8H A;  1GV8 A;  1S7Y A;  3PD9 A;  3VDF A;  4IR8 A;  4XKR A;  3TEL A;  5IZZ A;  1B3G A;  1UIU A;  1LFI A;  3O2A A;  4NF0 A;  1IMC A;  3T9H B;  5H8Q A;  3LR1 A;  3B6W A;  2P2A A;  3CRB A;  5FHN A;  2NOO A;  3EQ1 A;  2HHM A;  5CRY A;  3FJG A;  3KN8 A;  3JV9 A;  5EQ9 A;  3LUZ A;  3K1M A;  4ZDM A;  3O28 A;  1VR5 A;  2DDK A;  4KYD A;  3E3K A;  3RQT A;  1RDZ A;  2X7Q A;  4LAT A;  3SEY A;  3S9E A;  2F7C A;  3HV1 A;  4R9F A;  1YPN A;  3KEI A;  2FIX A;  1USY E;  4PET A;  1D9Q A;  1OVT A;  2CZH A;  5HM4 B;  4EUO A;  5KDT B;  1LBZ A;  5L9M A;  3FIR A;  4N91 A;  4GWY A;  1N84 A;  1IIW A;  4DXB A;  5AA2 D;  1POY 1;  4KCC A;  3KC0 A;  2OCU A;  1PB7 A;  4LP2 B;  4M1V A;  1P1Q A;  3VLW A;  4TOZ A;  2V3U A;  3SER A;  4MNI A;  3MC2 A;  5KCJ B;  3DM0 A;  4MJO A;  4R6K A;  1Y4T A;  2FIE A;  3HO7 A;  4X1D A;  2VD2 A;  3TMG A;  1PC3 A;  4BDL A;  1A54 A;  4DCX A;  5BUU A;  4KPT A;  1FPI A;  2H98 A;  4NMY A;  4EF1 A;  1EU8 A;  1KWH A;  3TQL A;  3S9L C;  1OVB A;  4GX3 A;  4G2Z A;  1NMU A;  3KJ7 A;  2OJT A;  4YKK A;  4E0W A;  4OXV A;  4DZ1 A;  2THI A;  4Z7E A;  1AOV A;  1LBY A;  2WBB A;  1S50 A;  5IKB A;  1MY1 A;  3DLN A;  1B4H A;  2G29 A;  4F18 A;  4OER A;  4ELO A;  4DDD A;  1OMP A;  3KSJ A;  1Q35 A;  5EHS A;  2I0B A;  3R26 A;  3MVW A;  2V84 A;  1FQE A;  3ZKK A;  3PUV E;  1SW2 A;  4AB6 A;  3MAM A;  4OMB A;  3MVX A;  2GHB A;  3FVK A;  1AH5 A;  3PUW E;  1YAE A;  1SW5 A;  4JVD A;  2P3N A;  4TLM B;  1FPF A;  2B65 A;  4LVQ A;  3K4U A;  5ELV A;  3RUM A;  3IJX B;  2CEX A;  1DOT A;  4MLV A;  4THI A;  5DEX B;  4IB2 A;  3EHS A;  1A8E A;  4R72 A;  2HAU A;  2VPN A;  4EQ9 A;  1RDY A;  4FOR A;  1IIT A;  4F2Q A;  3VLU A;  3VVE A;  4HS7 A;  4EXL A;  4H6D A;  3HPI A;  2R8T A;  2O69 A;  5I58 A;  5F1Q A;  1EZ9 A;  3KBR A;  3QYT A;  4F1V A;  5H8F B;  1PDA A;  1ZU0 A;  3K1N A;  4AB5 A;  3PTY A;  1ZTY A;  1DK4 A;  2Y7P A;  2DVC A;  1H43 A;  4EDP A;  3OO8 A;  1CB6 A;  3VFJ A;  3KN3 A;  2O7I A;  1FBC A;  5J1D A;  3H7M A;  3MP8 A;  3THI A;  5I58 B;  1NL5 A;  2OZZ A;  4H45 A;  4R74 A;  3B50 A;  4G68 B;  2XXW A;  4PFU A;  1QUJ A;  4NAP A;  3IOR A;  2OBG A;  1J1N A;  2QVU A;  3LV0 A;  3ISP A;  1DTZ A;  3AXF A;  3VLV A;  3MP1 A;  1IZ1 A;  1GVC A;  3TYH A;  3G3H A;  1B9J A;  1OLC A;  4EQB A;  3DP8 A;  4PFB A;  5M2V A;  3K02 A;  3S2V A;  3PUX E;  5TP9 B;  4I3E A;  2Z22 A;  2DYX A;  3D4C A;  1OLA A;  3PV0 E;  4FIM A;  1NV0 A;  3PU5 A;  4U23 A;  4U1Z A;  1P1W A;  4IO4 A;  1PB9 A;  4L17 A;  1LB9 A;  3C34 A;  4UAC A;  3WAE A;  4N07 A;  3PD8 A;  4I9D A;  2WEF A;  2ZYK A;  1B7U A;  3VXC A;  2XXI A;  3S9M C;  4LZ8 A;  3GLB A;  4GXA A;  1UTB B;  3C35 A;  4JBZ A;  3G3I A;  2Q8M A;  4ELP A;  1SI1 A;  2QPQ A;  1XVY A;  1QVS A;  4HXV A;  4PE5 B;  1IXC A;  2UVH A;  1MQG A;  2DXR A;  4R2B A;  1UTH A;  4BDM A;  2ABH A;  3K6W A;  3WAF A;  4IO6 A;  1IEJ A;  3FZV A;  1VFD A;  3M3F A;  4ISU A;  3M3K A;  1G0H A;  5LTC A;  5CMC A;  3C32 A;  5CI5 A;  3LSF B;  4LN5 A;  1UTB A;  4GOT A;  3L6G A;  4MFI A;  2ZYO A;  3T9U A;  5I56 A;  4NWD A;  1EZP A;  1LBC A;  2DSF A;  2XD3 A;  5FHO A;  4RJZ A;  4MNP A;  3SEV A;  4X9T A;  1NUZ A;  3QXM A;  1R1N A;  4G61 A;  1OQH A;  1FPG A;  1FBH A;  4N6K A;  4YAH X;  2BJI A;  1LEV A;  2ZNS A;  4YZZ A;  5IM2 A;  4GRK A;  4QFK A;  3IO4 A;  3TPA A;  2E1S A;  5ICQ A;  1A8F A;  5EQ8 A;  1SD3 A;  1WVJ A;  4OES A;  1I69 A;  1EYJ A;  1IME A;  4X8R A;  1FBE A;  3U92 A;  4PBQ A;  1VDW A;  2Q9T A;  2F97 A;  3TQW A;  3VV5 A;  1B32 A;  3CG3 A;  1KZ8 A;  1LST A;  3CFZ A;  3LC8 A;  4NF6 A;  3A29 A;  2RCA A;  3O97 A;  2QMX A;  4EXK A;  1MXV A;  4MX6 A;  1CNQ A;  3NOH A;  3Q27 A;  2FYI A;  3N6T A;  1MS7 A;  4FJP A;  1FQA A;  5BWJ A;  4PAK A;  4GF8 A;  4PF6 A;  1B05 A;  3CR9 A;  5ITP A;  1QKA A;  4NF4 B;  2B4L A;  3I5O A;  1LLS A;  3RTW B;  1NNF A;  4MEV A;  3ZKL A;  3PMV A;  3QSL A;  4ESW A;  4LON B;  1TXF A;  4ZEI A;  2I6E A;  1R6Z A;  1FW0 A;  3OEN A;  2O68 A;  1MXY A;  4PFR A;  4P1E A;  4M4G A;  1SI0 A;  3OSR A;  5J16 A;  3MP6 A;  1MDQ A;  5I2N B;  4R73 A;  3UK4 A;  1UTH B;  2QJE A;  2ALU A;  2VP1 A;  4IO7 A;  1DPP A;  2A5S A;  1MXW A;  2XXH A;  4AS5 A;  1YZ0 A;  1NV2 A;  1MQH A;  3HHG A;  2F3D A;  1FBP A;  1N76 A;  5I2K A;  1URG A;  3KGC A;  3RY3 A;  4H0W A;  2Y7I A;  4F39 A;  3U72 A;  3FVG A;  3A3C A;  4PTK A;  4KXP A;  2ZXT A;  3JYR A;  2V3T A;  3CG1 A;  2YPN A;  1MQJ A;  4ZE8 A;  5I7I A;  2R6G E;  2ZYM A;  1JNF A;  3QK6 A;  3KZG A;  1TFD A;  1PEB A;  4KCD A;  4BLA A;  4KFQ A;  4H8J A;  3LUY A;  2PT1 A;  4HCY A;  4ZEC A;  5AA4 B;  4JXI A;  2W7Y A;  3U1O A;  4BDQ A;  4G77 A;  1NNP A;  4GX4 A;  4LA9 A;  1NFT A;  1QW0 A;  2L5V A;  3KG2 A;  3QUJ A;  5I57 B;  4RK9 A;  3JZJ A;  2X26 A;  5CMK A;  1B3L A;  5EYH A;  2P3V A;  4NF6 B;  1MPB A;  3TTL A;  2I48 A;  5I84 A;  1A55 A;  1B3F A;  4YKI A;  4F3G A;  5CBR A;  3K01 A;  5AA2 A;  3FXQ A;  1FTK A;  4R2F A;  1B5H A;  5A5X B;  1Y9U A;  3RT8 A;  4YB6 A;  3SZP A;  2X7P A;  4FEC A;  4HE0 A;  1BLF A;  3S9N C;  3ZSF A;  1A40 A;  1NV1 A;  1ZIU A;  4QFO A;  3V5A A;  1NH8 A;  4JDF A;  1K9Y A;  3EF7 A;  4XIG Q;  1SYI A;  1P1N A;  4GWO A;  1H3D A;  2Z8D A;  1HSL A;  2OX3 A;  3OD7 A;  4MHF A;  4OWD A;  4RYA A;  4F3S A;  2GRV A;  5LOM A;  5B7D A;  5ISU A;  4X04 A;  2PT2 A;  4H67 A;  1H44 A;  3U65 A;  4F1U A;  4KI0 E;  2ZZW A;  4YB5 A;  4BDN A;  5I59 B;  4P56 A;  3C4M A;  1ZKB A;  4JB7 A;  1B6H A;  1UIV A;  2VHA A;  1NI9 A;  4I8C A;  4YIC A;  4P3L A;  3S4U A;  3I6V A;  1INP A;  1FQD A;  2IEE A;  1WDN A;  2YLN A;  1JW4 A;  4PDD A;  1B0L A;  1B3E A;  5B70 A;  2V93 A;  2QVR A;  4GD5 A;  3MZ9 A;  4YKJ A;  4RPO A;  5I56 B;  4GWW A;  4HTG A;  1M5D A;  4N15 A;  1PBQ A;  4G8N A;  5FHM A;  3K2D A;  5AA1 A;  4JWX A;  4BDR A;  5AA4 A;  4RA1 A;  1II5 A;  5DVJ A;  2O7U A;  1FTL A;  3O6I A;  4F22 A;  2YJP A;  4N13 A;  3KOS A;  5I57 A;  1M5C A;  2ZZV A;  3UIF A;  2WX9 A;  1NKX A;  1QGX A;  2HCA A;  3TTN A;  4MH5 A;  3KOT A;  3TOD A;  3T93 B;  1B5I A;  1FBD A;  2H25 A;  5H8F A;  4OVJ A;  2AYS A;  2H9B A;  1MXZ A;  2PFY A;  1FPJ A;  4NN3 A;  4F29 A;  2XD2 A;  4DCY A;  4K3F A;  4U22 A;  1GTK A;  4GQO A;  2P0S A;  3C36 A;  2XXR A;  1QJM A;  4ZED A;  1B58 A;  1LGB C;  1N7X A;  2PVU A;  3EN3 A;  5DTB A;  4KQP A;  1LBW A;  4QXD A;  3TTM A;  4G4P A;  3OEL A;  5DVF A;  1N0T A;  4RXL A;  2MKZ A;  4OVR A;  3TTR A;  2AIX A;  1IQ7 A;  2PFZ A;  3RT6 B;  3MPK A;  1JW1 A;  4OVT A;  5CC2 A;  1DCU A;  3KN7 A;  4IY5 A;  2OWS A;  2DOJ A;  4FED A;  4FEB A;  3N5L A;  2Z8E A;  1FTA A;  3H4Z A;  3UA8 A;  1G0I A;  5H8H A;  3CI8 A;  2HFB A;  2H4I A;  4JVI A;  2O6A A;  3ROJ A;  2I4C A;  1NV7 A;  3N94 A;  2HZK A;  3G3F A;  4GLI A;  4H8I A;  5DVI A;  1MY4 A;  1URD A;  4OHN A;  3MQ9 A;  3T96 B;  4Q30 B;  2XXK A;  4RY1 A;  4NF5 B;  1MY3 A;  4MF3 A;  3HN0 A;  5CM6 A;  4U1O A;  3VXB A;  3A09 A;  4G68 C;  5JEI A;  2M8C A;  2NUV A;  4PCD A;  1VFE A;  1NV3 A;  2I4B A;  4NX1 A;  1H76 A;  3H6V A;  3R7X A;  4UAB A;  3IFC A;  1HSE A;  3T0J A;  1Y1M A;  1BKA A;  1NNT A;  4F1Y A;  2I3W A;  1LCT A;  4O8M A;  5I59 A;  2NVU B;  1YXI A;  3G3J A;  2KLF A;  4N17 A;  5TPA A;  3LSX A;  1ELJ A;  1ZMG A;  3Q28 A;  5KDT A;  3V8X B;  2B3B A;  3VVF A;  5A5L A;  5A5X A;  4QSD A;  4N4U A;  1MXX A;  3SEW A;  1D9Y A;  1B46 A;  1RDX A;  4OET A;  4O7I A;  4EF2 A;  1B7Z A;  2F6G A;  2WBD A;  2RC8 A;  4QSC A;  2DVZ A;  3MVZ A;  1JQF A;  3O29 A;  3HFU A;  1FTM A;  4LZ7 A;  4GBV A;  3HST A;  3MUQ A;  5TPA B;  2FNC A;  2QMW A;  5AE4 A;  4OEU A;  1MPC A;  4NG7 A;  2UVG A;  3B8B A;  4GX6 A;  5CBS A;  2FVZ A;  1JEU A;  2XXQ A;  2Z8F A;  4TQU Q;  3FUZ A;  1MY0 A;  3C9H A;  3H03 A;  2Y84 A;  4ESX A;  1SDX A;  4NTL A;  4UA8 A;  3VVD A;  2ZZX A;  4OFO A;  4OVP A;  3H6U A;  2AL5 A;  3MWB A;  3MW0 A;  1AIV A;  1QUK A;  1N04 A;  4LQ5 A;  1M5F A;  3IOU A;  3KSX A;  4N6P A;  2KQZ A;  4XKN A;  4N6D A;  3B6Q A;  4NWC A;  3FGS A;  1YCJ A;  4U4S A;  1RYX A;  4C1U A;  3GYY A;  4P9K A;  3FXR A;  2Q74 A;  3OEM A;  2F34 A;  4DXC A;  2WYP A;  1LAF E;  1XT8 A;  3V89 B;  1LCF A;  4LZ5 A;  1TFA A;  4LUB A;  1PBP A;  2O1L A;  2XWV A;  2REJ A;  4U4X A;  1LFH A;  3U94 A;  4I3Y A;  1JEV A;  4QFN A;  5ET5 A;  2AL4 A;  4GL0 A;  2F36 A;  5I3S A;  5EYF A;  4P0I A;  3PPQ A;  3FXU A;  4OYV A;  4GVO A;  4I1D A;  1BTJ A;  4IGT A;  2I49 A;  4PAF A;  2DWJ A;  4U2R A;  4XF5 A;  2QS2 A;  4ZZE A;  2ONR A;  2B4M A;  1H45 A;  3O9P A;  4MLQ A;  3OO7 A;  1I6Q A;  2B3F A;  2I0C A;  3F11 A;  2HAV A;  2ZNT A;  4JVC A;  4R75 A;  1FPE A;  1YYZ A;  1CE2 A;  4PFY A;  2HXR A;  4O94 A;  3D1R A;  5JK4 A;  2KR0 A;  3OOA A;  3HHF A;  4F31 B;  2F8D A;  1JP4 A;  4P0G A;  3ECR A;  4ZZA A;  4OQO A;  2Q8J A;  3UP9 A;  4QFP A;  2A5T B;  1A7L A;  1SQY A;  3MJN A;  2FA7 A;  1WOD A;  2ESN A;  2F35 A;  1R9L A;  1IMB A;  3Q26 A;  1US5 A;  1ZBM A;  1IUD A;  5ITO A;  1LBB A;  2ANJ A;  5AA2 B;  3DP4 A;  4QFL A;  1KA0 A;  3IJO B;  2H5Y A;  5F24 A;  4QRZ A;  2F7A A;  1VE4 A;  3PPR A;  4R6H A;  4PP0 A;  4NF8 A;  3MBP A;  1ATG A;  1JW5 A;  3RLF E;  3IAZ A;  1P1U A;  3R6U A;  3KJT A;  1OIB A;  1R9Q A;  2O1M A;  3OSQ A;  4C0R A;  4R9G A;  3T66 A;  1YTV A;  2E0S A;  3SES A;  1FJ6 A;  4RNS A;  3CVG A;  2QFL A;  4DI4 B;  4PBH A;  3BFT A;  2RC9 A;  3TCH A;  1HSJ A;  2I58 A;  3LSL A;  2CZK A;  3OXN A;  2UVJ A;  3CIJ A;  1Y3Q A;  1JVX A;  3H6W A;  2QL3 A;  3K6X A;  4O7M A;  3EHU A;  3RNN A;  4GWZ A;  3M3L A;  2F6P A;  1LAH E;  5FTH A;  2G93 A;  4OTE A;  5CMB A;  1LBX A;  1UQW A;  2XWK A;  1URS A;  1XOC A;  1TT1 A;  1MRP A;  4YU0 A;  4I62 A;  1L5T A;  2QRY A;  4OEV A;  3OO9 A;  3IB2 A;  5KCJ A;  3TKD A;  2DQV A;  2WKY A;  1XHY A;  1B2H A;  1ZLQ A;  4ND9 A;  2REG A;  2RF1 A;  1FBF A;  1B3H A;  1M5B A;  5H8N A;  1NUW A;  1D3K A;  2QS1 A;  1EZO A;  4YKP A;  4GWS A;  4Q8R A;  3GXA A;  1I6A A;  1TWY A;  2GHA A;  1MM6 A;  3ILT B;  4NHB A;  4GL8 A;  5I2K B;  2Y5L A;  1BP5 A;  3IO6 A;  3RN8 A;  3EHT A;  2Q2A A;  4XXU A;  5AA3 A;  5JTY B; 
#chains in the Genus database with same CATH homology
 3TYH A;  1XC1 A;  3E9X A;  2D5W A;  2HQ0 A;  2I3V A;  3G3H A;  5L8D A;  1Z7M E;  1SW1 A;  1B9J A;  4K3F A;  4U22 A;  4DLD A;  1GTK A;  1S9T A;  1JVY A;  3QUF A;  4GQO A;  1OLC A;  2P0S A;  1B1X A;  3OO6 A;  3DP8 A;  3C36 A;  4EQB A;  2XXV A;  5M2V A;  2XXR A;  1QJM A;  3K02 A;  3S2V A;  4ZED A;  2DP8 A;  2XX8 A;  1GR2 A;  2A5T A;  4X1B A;  1Y1Z A;  3PUX E;  1B58 A;  1LGB C;  1N7X A;  2PVU A;  2ZYN A;  2UVI A;  3EN3 A;  2Z22 A;  2DYX A;  5TP9 B;  5DTB A;  1LFG A;  3D4C A;  4C1T A;  1VSO A;  1N3W A;  3FJ7 A;  4KQP A;  1OLA A;  3LBS A;  3PV0 E;  4FIM A;  5H8S A;  4ZE9 A;  3TTM A;  5IKB A;  3PU5 A;  3ILU B;  4G4P A;  4F3B A;  3OEL A;  3PMW A;  4U23 A;  5DVF A;  4U1Z A;  1P1W A;  1N0T A;  2HEU A;  4RXL A;  4ZEB A;  1MQD A;  4IO4 A;  1PB9 A;  3PPN A;  3E13 X;  2Q2C A;  1B51 A;  1LB9 A;  4L17 A;  2AIX A;  3C34 A;  1IQ7 A;  3RT6 B;  4UAC A;  3TTR A;  3MPK A;  3WAE A;  1JW1 A;  5CC2 A;  2PX1 A;  4KYE A;  4IO2 A;  4N07 A;  3KN7 A;  3PD8 A;  4I9D A;  2IA4 A;  2UYF A;  1B7U A;  1XS5 A;  2OWS A;  2ZYK A;  2DOJ A;  3Q25 A;  2XXI A;  4IY5 A;  3VXC A;  4KR5 A;  4FED A;  4ELR A;  3S9M C;  4FEB A;  4LZ8 A;  3SEU A;  1B1H A;  3N5L A;  2V3Q A;  2Z8E A;  3GLB A;  4GXA A;  1UTB B;  4ZS9 A;  4H5G A;  3H4Z A;  3C35 A;  3G3G A;  3Q29 A;  3UA8 A;  5H8H A;  3CI8 A;  1B7H A;  4JBZ A;  2HFB A;  3G3I A;  3O66 A;  2VD3 A;  2H4I A;  1MH4 A;  1SI1 A;  4ELP A;  2RIN A;  2O6A A;  2DWH A;  2Y7W A;  2QPQ A;  1XVY A;  3DEL B;  2I4C A;  2Z23 A;  3W9W A;  1QVS A;  3N94 A;  4PE5 B;  1IXC A;  5I58 A;  2UVH A;  1MQG A;  2DXR A;  2HZK A;  3U8Q A;  4H1X A;  4DXU A;  3G3F A;  1MQI A;  4R2B A;  4GLI A;  4H8I A;  5DVI A;  1UTH A;  4BDM A;  1MY4 A;  2ABH A;  3K6W A;  3WAF A;  1URD A;  4OHN A;  3MQ9 A;  4IO6 A;  3T96 B;  1IEJ A;  1NH7 A;  3FZV A;  1VFD A;  3M3F A;  3ONM A;  4GFR A;  4ISU A;  4Q30 B;  3M3K A;  1T0K A;  4Q5T A;  2XXY A;  3CFL A;  4RY1 A;  4WEP A;  4NF5 B;  4POX A;  1GGG A;  3TAJ A;  5ICT A;  1MY3 A;  3GBB A;  1DMB A;  3C32 A;  3B7D A;  5CI5 A;  5CMC A;  4ESW A;  3LSF B;  4MF3 A;  3TTK A;  2DXY A;  3HN0 A;  1SYH A;  4AQ4 A;  5CM6 A;  2LAO A;  1UTB A;  3GZG A;  4FE8 A;  3K00 A;  4U1O A;  4GOT A;  5BUU A;  3VXB A;  3A09 A;  5L9O A;  3L6G A;  1N3X A;  4MBP A;  4MFI A;  1F9B A;  4YB7 A;  1BIY A;  3DP6 A;  4JSD A;  2ZYO A;  1MDP 1;  4G68 C;  1NNK A;  3T9U A;  5JEI A;  5I56 A;  4NWD A;  2M8C A;  3L6H A;  3H3G A;  2DE3 A;  2NUV A;  1EZP A;  4WED A;  3SKP A;  1LBC A;  2DSF A;  5HBC A;  2XD3 A;  5FHO A;  4RJZ A;  5F7V A;  4YMB A;  3FJM A;  1VFE A;  3SEX A;  5IAI A;  4KHZ E;  2I4B A;  1H76 A;  3H6V A;  4JWY A;  3R7X A;  2QS4 A;  2O84 X;  3SEV A;  4X9T A;  1HSE A;  4NE4 A;  3QXM A;  1R1N A;  1ZJL A;  1Y1M A;  3MPL A;  1POT A;  1OQH A;  2PBW A;  3K1P A;  4PFT A;  2GFE A;  1BKA A;  1O64 A;  3FAT A;  4YAH X;  1NNT A;  4F1Y A;  2I3W A;  2ZNS A;  2F5X A;  1ANF A;  3U93 A;  1PB8 A;  1LCT A;  5I59 A;  2OWT A;  3BBR A;  3PUZ E;  4YZZ A;  1RYO A;  4H5F A;  2NVU B;  4GRK A;  4QFK A;  3TFL A;  3G3J A;  3IO4 A;  2KLF A;  2DWA A;  2OLB A;  5TPA A;  2E1S A;  3LSX A;  3TPA A;  1ELJ A;  5ICQ A;  1A8F A;  1ZMG A;  3FV1 A;  3Q28 A;  4GIZ A;  5KDT A;  2D21 A;  4H65 A;  2B3B A;  4PQJ A;  3V8X B;  3VVF A;  1SD3 A;  4ELQ A;  5A5X A;  3K0V A;  1WVJ A;  4OES A;  2XXX A;  1I69 A;  3B6T A;  4QSD A;  2QS3 A;  3FAS A;  1MXX A;  3SEW A;  3U92 A;  1D9Y A;  2Q9T A;  2F97 A;  2UXA A;  3TQW A;  3UGW A;  3V83 A;  3VV5 A;  1B46 A;  5EHM A;  1B32 A;  3CG3 A;  1IXI A;  1SVX B;  5CMM A;  4OET A;  1LST A;  1SW4 A;  4O3C A;  3SET A;  4EF2 A;  1B7Z A;  3CFZ A;  4ONY A;  2F6G A;  3LC8 A;  3PGF A;  3TZA A;  4NF6 A;  3LSW A;  2RC8 A;  2RCA A;  3O97 A;  2QMX A;  4QSC A;  2XXT A;  4RPN A;  4OFJ A;  2DVZ A;  4EXK A;  1MXV A;  1MXU A;  3MVZ A;  1JQF A;  3O29 A;  4QSE A;  3Q27 A;  4E0X A;  2FYI A;  3N6T A;  1MS7 A;  2DE2 A;  4FJP A;  1FQA A;  5BWJ A;  1FTM A;  1LAX A;  4LZ7 A;  3N6U A;  3HST A;  4GF8 A;  3MUQ A;  1D9V A;  5TPA B;  1AL3 A;  2DS9 A;  4XTC Q;  1O63 A;  4O3A A;  2FNC A;  2ONK E;  1B05 A;  2QMW A;  5AA4 A;  4IGR A;  3CR9 A;  3MZB A;  3O6H A;  5AE4 A;  1QUI A;  3M8U A;  5ITP A;  4OEU A;  1MPC A;  1OQG A;  1QKA A;  5FTI A;  4ZEK A;  4NF4 B;  3RPW A;  4F2O A;  3I5O A;  3I3V A;  2H99 A;  1LLS A;  1NNF A;  3D4G A;  4QHQ A;  1FQF A;  2RCB A;  2UVG A;  3PPP A;  3RTW B;  3ZKL A;  3PMV A;  5CBS A;  3BFU A;  1MH3 A;  1JEU A;  2XXQ A;  1SBP A;  1Y3P A;  3QSL A;  2BJJ X;  2Z8F A;  4TQU Q;  1LB8 A;  3FUZ A;  3UOR A;  1MY0 A;  3C9H A;  3H03 A;  2DE4 A;  4Q0C A;  1MY2 A;  4OZ9 A;  2R71 A;  2Y84 A;  1SDX A;  1XVX A;  4NTL A;  4LON B;  4UA8 A;  1Y3N A;  3T22 A;  3VVD A;  1TXF A;  2NXO A;  3N26 A;  4OFO A;  4ZEI A;  2I6E A;  1R6Z A;  3H6U A;  2AL5 A;  1FW0 A;  3MWB A;  3MW0 A;  4FAT A;  1AIV A;  3OEN A;  1USY H;  1QUK A;  4PFW A;  1N04 A;  2O68 A;  1MXY A;  3QAX A;  2XX9 A;  4LQ5 A;  1M5F A;  2DWI A;  3IOU A;  3KSX A;  4N6P A;  4M4G A;  4RK2 A;  5AA2 B;  1SI0 A;  3OSR A;  3MP6 A;  4XKN A;  1MDQ A;  4YMA A;  3B6Q A;  4ESX A;  4KD5 A;  5I2N B;  4NWC A;  3FGS A;  4R73 A;  5K2Y A;  3UK4 A;  1UTH B;  1YCJ A;  2GH9 A;  2QJE A;  2ALU A;  4U4S A;  1RYX A;  2VP1 A;  4IO7 A;  4C1U A;  1DPP A;  3A3U A;  2CMO A;  2A5S A;  1MXW A;  2XXH A;  3GBA A;  4F19 A;  3IOV A;  5H8H B;  3FXR A;  1N7W A;  3ODB A;  1B52 A;  3OEM A;  1MQH A;  3H6T A;  3TCG A;  2F34 A;  1QUL A;  3HHG A;  4DXC A;  5AA3 A;  3KFM A;  3EPE A;  1LAF E;  3SDF A;  4HW8 A;  3MVY A;  3T9V A;  1MM7 A;  1XT8 A;  4IY6 A;  3V89 B;  1LCF A;  4LZ5 A;  1N76 A;  3OEK A;  4X48 A;  5H8Q B;  3TDJ A;  1A99 A;  1TFA A;  5I2K A;  1URG A;  4LUB A;  1DTG A;  1PBP A;  2O1L A;  2REJ A;  3KGC A;  1FCK A;  4H0W A;  1DSN A;  3RY3 A;  3TEP A;  4IO3 A;  4U4X A;  2Y7I A;  4F39 A;  3U72 A;  1LFH A;  1O7T A;  3FVG A;  5DEX A;  2RC7 A;  2CZL A;  3A3C A;  3U94 A;  4OEN A;  3UN6 A;  4NF5 A;  4OFL A;  4DE8 A;  3VE1 B;  1JEV A;  2F7B A;  2ZXT A;  3JYR A;  2AL4 A;  2V3T A;  3PMX A;  4NF8 B;  3CG1 A;  4GL0 A;  4QFN A;  3IR1 A;  4G8H A;  3CSB A;  1GV8 A;  1S7Y A;  2F36 A;  3PD9 A;  2YPN A;  4FAJ A;  3VDF A;  1MQJ A;  4XKR A;  5EYF A;  3TEL A;  4ZE8 A;  4P0I A;  1B3G A;  1UIU A;  3U1O A;  3PPQ A;  4NF4 A;  1LFI A;  2R6G E;  3O2A A;  2ONS A;  2R9J A;  3FXU A;  4OYV A;  2ZYM A;  1JNF A;  4GVO A;  4Z0I A;  4I1D A;  3QK6 A;  5DYH A;  3KZG A;  1TFD A;  1BTJ A;  4KPT A;  5H8N B;  2V25 A;  3T9H B;  5H8Q A;  4IGT A;  3LR1 A;  3B6W A;  2P2A A;  1PEB A;  2I49 A;  3CRB A;  2ZMB A;  4KCD A;  4BLA A;  3IOW A;  4KFQ A;  4H8J A;  3LUY A;  2PT1 A;  4HCY A;  4BDO A;  1JET A;  5FHN A;  4ZEC A;  3K6V A;  4XKQ A;  5AA4 B;  4JXI A;  3IB0 A;  2NOO A;  1Z7N E;  2DWJ A;  2W7Y A;  1QKB A;  3C33 A;  3EQ1 A;  1NNP A;  3FJG A;  4G77 A;  4U2R A;  4LA9 A;  5CRY A;  3KN8 A;  3JV9 A;  1NFT A;  1QW0 A;  2XX7 A;  2QS2 A;  3K1M A;  3KG2 A;  4ZDM A;  1I6B A;  3QUJ A;  3O28 A;  4ZZE A;  2ONR A;  5I57 B;  1VR5 A;  4KYD A;  3E3K A;  4RK9 A;  3RQT A;  5I2N A;  1FQB A;  1H45 A;  1LAG E;  2X7Q A;  2X26 A;  3JZJ A;  3O9P A;  3OO7 A;  4LAT A;  2F7C A;  3HV1 A;  4MLQ A;  3SEY A;  5CMK A;  3S9E A;  3FVN A;  4R9F A;  3T9X B;  1YPN A;  3KEI A;  1I6Q A;  1B3L A;  2B3F A;  2I0C A;  1USY E;  3F11 A;  1B5J A;  2HAV A;  4PET A;  5K2X A;  1OVT A;  2ZNT A;  4POW A;  4NF6 B;  1MPB A;  3TTL A;  2I48 A;  3CSG A;  4G8M A;  1B0H A;  3G7W A;  5I84 A;  3FVO A;  4R75 A;  5HM4 B;  4XKP A;  5KZT A;  1A55 A;  1B3F A;  4YKI A;  4F3G A;  5CBR A;  4GXS B;  4EUO A;  3K01 A;  4F3P A;  5KDT B;  1CE2 A;  1MG1 A;  5AA2 A;  2ZNU A;  4PFY A;  3PPO A;  3FIR A;  3FXQ A;  1FTK A;  5L9M A;  4R2F A;  2XHD A;  5JK4 A;  1B5H A;  5A5X B;  1N84 A;  1IIW A;  1Y9U A;  4DXB A;  3P7I A;  3RT8 A;  5AA2 D;  1POY 1;  4KCC A;  4YB6 A;  2X7P A;  3OOA A;  4BDQ A;  4LP2 B;  2OCU A;  1PB7 A;  4FEC A;  4M1V A;  1P1Q A;  2VGQ A;  3HHF A;  4F31 B;  3VLW A;  4TOZ A;  2V3U A;  3SER A;  1MPD A;  3MC2 A;  2UYE A;  4HCW A;  1BLF A;  2F8D A;  5KCJ B;  3S9N C;  4P0G A;  3DM0 A;  4WKM A;  2F78 A;  3ECR A;  4R6K A;  4O3B A;  2XD2 A;  4OQO A;  4ZZA A;  2Q8J A;  1Y4T A;  3UP9 A;  1A40 A;  3ZSF A;  4QFP A;  2A5T B;  1Q1K A;  3HO7 A;  4X1D A;  2O51 A;  2VD2 A;  3TMG A;  3BKI B;  3QIM A;  4IO5 A;  1P99 A;  1PC3 A;  4BDL A;  1A7L A;  1P1O A;  1SQY A;  2PMS A;  1FQC A;  2PYY A;  3IX1 A;  3MJN A;  1A54 A;  1ZIU A;  1B40 A;  2FA7 A;  4QFO A;  4DCX A;  3V5A A;  1NH8 A;  1WOD A;  2ESN A;  2F35 A;  1R9L A;  2HXW A;  2H98 A;  3EF7 A;  4JDF A;  3Q26 A;  4XIG Q;  1ZBM A;  1US5 A;  1IUD A;  4KYS A;  1SYI A;  1FTJ A;  5ITO A;  1P1N A;  4NMY A;  2ANJ A;  1LBB A;  2Q88 A;  1EU8 A;  1KWH A;  3DP4 A;  4GWO A;  1H3D A;  4QFL A;  1OVB A;  3TQL A;  3S9L C;  2Z8D A;  3IJO B;  1HSL A;  1NMU A;  2H5Y A;  4G2Z A;  2HZL A;  4QRZ A;  2F7A A;  1VE4 A;  3E4R A;  3OD7 A;  3PPR A;  3KJ7 A;  2OK2 A;  4PP0 A;  4R6H A;  1M5E A;  4NF8 A;  2OJT A;  3MBP A;  1Y4C A;  1ATG A;  4OWD A;  4RYA A;  4F3S A;  1JW5 A;  2GRV A;  4YKK A;  4OXV A;  4TLL B;  4E0W A;  5LOM A;  3RLF E;  3IAZ A;  5B7D A;  5ISU A;  3CFX A;  4DZ1 A;  2THI A;  1P1U A;  3R6U A;  4Z7E A;  3KJT A;  1AOV A;  1OIB A;  1R9Q A;  1S50 A;  1RKM A;  2O1M A;  1MY1 A;  3DLN A;  2PT2 A;  3OSQ A;  1H44 A;  4H67 A;  4WXJ A;  4R9G A;  1B4H A;  3W9V A;  4C0R A;  4KI0 E;  4F1U A;  2G29 A;  3T66 A;  5TU0 A;  4F18 A;  1YTV A;  4OER A;  4ELO A;  2E0S A;  4DDD A;  1Y20 A;  1OMP A;  3KSJ A;  4YB5 A;  3SES A;  3VLV A;  1Q35 A;  5EHS A;  4BDN A;  2I0B A;  3IL1 B;  5I59 B;  1AMF A;  4QF9 A;  3C4M A;  3R26 A;  3OMB A;  1FTO A;  3MVW A;  2V84 A;  1FQE A;  1ZKB A;  4RNS A;  3ZKK A;  3PUV E;  1SW2 A;  3CVG A;  4AB6 A;  3MAM A;  4JB7 A;  1B6H A;  4OMB A;  1UIV A;  1D4N A;  2RKM A;  2GHB A;  2VHA A;  3FVK A;  3MVX A;  1AH5 A;  4I8C A;  2XXU A;  3PUW E;  1YAE A;  3BFT A;  1SW5 A;  2RC9 A;  3TCH A;  4DIG A;  1HSJ A;  4NED A;  4TLM B;  2I58 A;  2B65 A;  4LVQ A;  1IXG A;  3K4U A;  3LSL A;  2Y7K A;  4YIC A;  5ELV A;  3OXN A;  3RUM A;  2UVJ A;  5JTY A;  3CIJ A;  3IJX B;  3K6U A;  3G3K A;  3S4U A;  3I6V A;  4DCY A;  1FQD A;  3RGY A;  1DOT A;  1WDN A;  1Y3Q A;  2IEE A;  2YLN A;  4MLV A;  1JW4 A;  1JVX A;  3H6W A;  4THI A;  5DEX B;  1US4 A;  4IB2 A;  5HPQ A;  3EHS A;  3RTF B;  2QL3 A;  3K6X A;  1B0L A;  1A8E A;  1B3E A;  2Q89 A;  3EHU A;  4R72 A;  3RNN A;  5B70 A;  2HAU A;  3M3L A;  2V93 A;  2F6P A;  4EQ9 A;  1LAH E;  2Y7R A;  4GD5 A;  5FTH A;  2G93 A;  4OTE A;  3MZ9 A;  4FOR A;  1IIT A;  4JSO A;  5CMB A;  3FV2 A;  4F2Q A;  1UQW A;  3VLU A;  4YKJ A;  4EQ7 A;  4RPO A;  3VVE A;  4HS7 A;  5I56 B;  1URS A;  1XOC A;  3USD A;  4R6Y A;  4EF1 A;  4EXL A;  1TT1 A;  1B4Z A;  1MRP A;  3HPI A;  4H6D A;  4YU0 A;  2O69 A;  4HTG A;  4I62 A;  1EZ9 A;  1M5D A;  3KBR A;  4G68 A;  5F1Q A;  1L5T A;  1PBQ A;  2QRY A;  4G8N A;  3ZS6 A;  5DT6 A;  3QYT A;  5FHM A;  3K2D A;  2XXP A;  3FD3 A;  5AA1 A;  4F1V A;  5H8F B;  3HCQ A;  1EH3 A;  1PDA A;  4OEV A;  4JWX A;  4BDR A;  1ZU0 A;  3OO9 A;  3IB2 A;  3K1N A;  3PUY E;  4RA1 A;  4ZEF A;  2NWJ A;  5L9S A;  1II5 A;  5DVJ A;  5KCJ A;  4AB5 A;  3TCF A;  3W15 C;  3MP1 A;  1ZTY A;  3TKD A;  3TUS A;  2O7U A;  2DQV A;  1FTL A;  2Y7P A;  3O6I A;  2WKY A;  2DVC A;  1H43 A;  1XHY A;  4EDP A;  2VOZ A;  3H06 B;  4F22 A;  3OO8 A;  1B2H A;  2YJP A;  1IXH A;  2D3I A;  3KOS A;  3IB1 A;  1CB6 A;  4JWO A;  4N13 A;  3VFJ A;  1ZLQ A;  3KN3 A;  5I57 A;  1M5C A;  3UIF A;  4ND9 A;  1NKX A;  2REG A;  2RF1 A;  2O7I A;  1B3H A;  1M5B A;  3H7M A;  5H8N A;  5J1D A;  1D3K A;  2QS1 A;  2HCA A;  3MP8 A;  4YKP A;  3TTN A;  4MH5 A;  1EZO A;  3KOT A;  3TOD A;  4Q8R A;  3THI A;  3IK6 B;  3GXA A;  3O6G A;  4U21 A;  1I6A A;  5TP9 A;  1NL5 A;  3T93 B;  5I58 B;  1TWY A;  2OZZ A;  2GHA A;  4P11 A;  4R74 A;  1B5I A;  1MM6 A;  2H25 A;  4G68 B;  2XXW A;  3ILT B;  2QSX A;  5H8F A;  3MZ1 A;  4GL8 A;  4LQ2 A;  4OVJ A;  4PFU A;  5I2K B;  2AYS A;  2H9B A;  1QUJ A;  3IOT A;  3IOR A;  2P1S A;  1MXZ A;  2OBG A;  1J1N A;  1BP5 A;  1DTZ A;  4F29 A;  3AXF A;  3IO6 A;  4ECF A;  3RN8 A;  3EHT A;  1DPE A;  2Q2A A;  4XXU A;  1IZ1 A;  3C31 A;  5JTY B;  1GVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...