3K1MA

Crystal structure of full-length benm, r156h mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
300
structure length
300
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 96
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA03
3LFKA 2OQGA 1Z7ME 2H09A 4KN4X 4L0ZB 3QK6A 2FBIA 5LGTA 2PJPA 2DSFA 4BDLA 1VR5A 2VD3A 2NXOA 3AAFA 3H6WA 3HCQA 3RPUA 1PB7A 1D3KA 4GXOA 1O3TA 2UVJA 3PD9A 1J75A 3WAEA 4L9VA 1J7KA 4WX9A 3T9XB 1YS6A 5D6FA 2Y7PA 2A6EF 3IO4A 4KCDA 3R60A 4NEDA 2DWHA 4XRFA 2G29A 1SQYA 2E1NA 3IKTA 3RN8A 1GXPA 3A3UA 1QZYA 4RGSA 3KOSA 3MZ1A 3TQWA 1P1NA 1G3WA 2P7VB 1BLFA 3HTSB 5L3DA 3IB0A 3KEQA 3MQ9A 4FORA 4ESJA 4IO4A 4I0BA 2EWNA 2VBWA 1B51A 2VBZA 5HBCA 1FBSA 3IX1A 3B73A 3BJ6A 4UVBA 1P1OA 3F11A 4YKPA 1I6AA 3OV8A 4G8MA 3LAJA 2PFBA 4G8NA 3SXYA 2WKYA 3N94A 4ZZDA 3E3VA 3ABTA 2F8DA 1IEJA 4KT5C 2VXZA 4UXNA 4E0XA 4LB6B 3C31A 2MBFA 4G7OF 2RN7A 1JGSA 1JQFA 3BZ6A 2R3SA 1TTYA 3HV1A 3IOVA 3S9EA 3FV1A 3H06B 5KCJB 1YFHA 3FATA 1GVJA 1YW7A 1ZMGA 5K5RA 2I6EA 3CI8A 2J5PA 2Z9OA 4C1UA 4Q4ZF 5CVRA 2LSOA 4LK1F 4M73A 1FYKA 5LBQA 3R6UA 3TKDA 1S6LA 4B09A 1LAGE 4IJAA 4R73A 1MDP1 4OEVA 2DXRA 4THIA 4AIKA 1HSLA 4JXIA 2I0BA 2O1LA 1PDAA 1XB4A 2JT1A 1J2XA 3KP5A 5LGNA 2HAUA 2QS1A 2ZXJA 2P7CB 1GXQA 2VGQA 3TTLA 1TW3A 3HRSA 2Z8EA 1UFMA 1USTA 1Y4CA 4AWXB 3S4UA 2FBKA 1R1NA 2GQQA 2EA4A 3ULQB 2W57A 1J0RA 4F3SA 1CE2A 3PUYE 3N26A 2AIXA 1IRGA 1NH7A 3KZZA 4CICA 3COAC 5K5OA 4WXHA 1Y1ZA 5LOMA 4UUVA 1IITA 2PMSA 3MVYA 3TGNA 4U1OA 5F1QA 2XX9A 1B5HA 3F72A 4A6EA 3CO6C 5AA2A 2X0LA 5B70A 4NF6A 3L6HA 5AONA 4GF8A 4N9IA 1PUEE 1LJ9A 1SW4A 4R6HA 4OXVA 3U8QA 2UYFA 3O97A 4CGZA 3R26A 3M3LA 1R7JA 1N76A 2EFOA 2D5WA 1XD7A 4IO2A 3G73A 3O29A 4MTDA 4DLDA 5I2NA 4Q47A 2B0LA 3F23A 2G7UA 3BROA 5I59A 3C32A 1U5TA 4IO3A 5LRSA 2XXUA 4Q30B 4DIGA 2PN6A 5KVRA 2LAOA 4OYVA 3LC8A 3GF2A 4U1ZA 3U94A 2STWA 3BOQA 1LCTA 2KJBA 4PFUA 3BP8A 1SAXA 4R6YA 2QVOA 4XLNF 2D21A 2O69A 3QXMA 5FO5A 4WXCA 2PBWA 4F7ZA 4XKPA 5H8SA 4EJTA 1N7XA 4IY6A 1LFHA 2ONSA 5CVJA 4GQOA 3G3IA 4EF2A 4K2EA 2P5KA 2GH9A 2XASA 5LEJA 4Y15A 1BC8C 4OENA 1OYWA 3VDFA 2R7DA 4HV5A 5F1RA 1T0KA 4HDVA 3CVGA 1XSVA 5AIPA 3T22A 4DXCA 4F31B 4PGGA 3RJPA 1OKRA 3EHSA 1OIBA 5DYMA 4EMSA 3T93B 1WVJA 3IRRA 5D4SA 5K2YA 4OESA 3GXOA 4HOBA 1B46A 3TCGA 4F18A 4MEYF 1MS7A 2NOOA 3TO6A 2DI3A 5CC2A 3TO7A 2UXXA 3N97A 1N3WA 2O3FA 4I01A 4I9DA 1R5GA 3SDFA 1A55A 2FU4A 1MY1A 2ALUA 4IHTA 2F5XA 2HWVA 4XKRA 1YQAA 3DV8A 1CGPA 4QWQA 1ELJA 4HX4A 1A40A 3PD8A 4UVAA 3L09A 2OA4A 1FQAA 5DVIA 2O0YA 5TP9B 3R4KA 2P0SA 2MH9A 3ERED 3EHUA 2GWRA 4H1XA 3BWGA 5D6EA 1M5EA 4KPTA 4XSZF 1FP1D 4L18B 4G7ZF 2OZZA 1B0LA 1URDA 2VC1A 2HZLA 1FY7A 2ETHA 1M5DA 4LLLA 2K4BA 3SEXA 1MXYA 4FT8A 1PB9A 1IF1A 3TYHA 4F2QA 2HEUA 1XCBA 3EYYA 5K5QA 3O6GA 4LVQA 3QU6A 4YFNF 2JRTA 1Y9UA 2NUVA 3C3WA 4R8HA 2MD5A 2FMYA 3IKVA 4OVJA 4ONYA 3TODA 2F5FA 3OOPA 1SD6A 4NTLA 4LQ2A 1B7UA 2BV6A 3VVEA 3RPQA 3TO9A 2XAHA 1FPQA 3JAMK 4XSXF 3FMQA 1XGNA 3KCCA 4OIOF 1AIVA 1DUXC 1ZG3A 5F64A 5L3BA 1S29A 4UHTA 4M6YA 3WTZA 1LVAA 2VT2A 3ZKLA 5CBSA 4HAMA 3TUSA 2M87A 2M5WA 3P7NA 3H7MA 2FNPA 5DUIA 2QQ9A 4BDQA 2GAUA 1X3UA 3SZTA 2I49A 2MC3A 2LF7A 4Z7EA 1QW0A 1VTNC 4EF1A 4GYGA 1HXDA 1Z1DA 2LNBA 2HZTA 4N13A 2HQRA 2QLZA 4GCVA 1MPBA 2MLKA 1MY3A 4M4GA 4PFYA 5I58B 1LBBA 1F4KA 2VT3A 1D5VA 1B4ZA 3PUZE 4ZDMA 3S9MC 2P5VA 1T98A 2BBYA 4BDNA 2PVUA 4FX4A 1I6QA 2Q88A 3FVKA 3EUHA 4PZJA 3RQTA 2IEEA 3KG2A 1QZZA 3ILUB 2VBXA 2FQ3A 2PYYA 4UA8A 3ILTB 2A5SA 4N6PA 5E17F 4H0EA 1I6BA 2EFQA 1B3EA 2YSRA 2AL4A 2M30A 4P9FA 1H3DA 1R58A 2P8TA 1JVXA 2IA2A 2W84A 4L9NA 4RGXA 2VE8A 3PPPA 2QQBA 3IJOB 2YX4A 1SW2A 4FATA 1FBUA 3RPWA 2VC0A 1POTA 1QUKA 1JEVA 4YKKA 1IN4A 1OLAA 1L5TA 4M71A 4P9UA 1B3LA 1ZU0A 4H0WA 3VODA 4F1YA 4GWOA 3M8FA 3SEYA 5TPAA 4F1UA 2ZJ2A 1ON2A 4CHUA 4LJZF 4LLGF 3F22A 3PUVE 4Q8RA 4HQMA 4P96A 4HF1A 2Z8FA 3L6GA 2O68A 1Z7NE 2QBYB 3TFLA 2H98A 4KNYA 3KOTA 5LEKA 3T1BA 2XAQA 1IXGA 4HDUA 3JV9A 1ZKBA 3P9CA 5BS6A 1UTHB 2G9WA 3R6SA 3ZMSA 2B3FA 5AIQA 4BH9A 1FNNA 3C33A 2BYVE 3V4GA 3VFJA 2ZNTA 2HQNA 2Z23A 1YW8A 4CYDA 3MZYA 5TP9A 1SD7A 3PQJA 4ZYEA 4JSOA 1MD0A 2RKMA 3RT8A 3LSXA 1SW1A 2VP1A 1VFDA 1Y3QA 2RQPA 3V8LA 1DOTA 3L9FA 2HZKA 2E1CA 3DP8A 1ZAOA 3ISPA 1FYLA 2XXPA 2HKXA 3I71A 4X48A 2QUFA 1U8RA 1ZRCA 1P1UA 3WTVC 1IXRC 2K7LA 3HRMA 1MDQA 4UV8A 1B4AA 2CW0F 1F9BA 1P4AA 4JBAA 1SYHA 1N7WA 3HO7A 2NNNA 2OQRA 3F3XA 5DCFA 5DEXB 4EGYA 4I2OA 3WGGA 5ICTA 1ZG1A 1DTZA 1OYYA 3ML6A 3LQRA 4O6JA 1U3EM 4GLIA 3K01A 3QYTA 1MGTA 4EXKA 2XXQA 1KYZA 1TNTA 2V79A 1MXWA 1T2KA 1Q1HA 4BAYA 2DOJA 4I1DA 4RNSA 2Q2CA 2RV8A 3IC7A 4I02A 4HW0A 1ZTYA 2EB7A 2Y75A 2L4AA 1REPC 5DEQA 3OO6A 2H6BA 1ONVA 2VD2A 2I3VA 3D4GA 1UHWA 5D5WB 1QUJA 2V9VA 1US4A 3N6UA 4YMAA 3KLNA 3GFMA 1R1UA 2YR2A 3CUOA 3K00A 2D2WA 4A0ZA 2P4WA 3G3ZA 2I4CA 5LRRA 3W6JB 2H99A 1BKAA 1O7LA 2DE4A 3KN3A 3KGCA 5H8QA 1U78A 3BBRA 4KMUX 2LDUA 3M3KA 2M8EA 2MH2A 5E1ZB 3CR9A 3UK4A 5IKBA 5I58A 3JZJA 3D0SA 6PAXA 2M45A 3RTRA 3KJ7A 4EJVA 2DP8A 4RYAA 2KKOA 3WTXC 4WEDA 3L7WA 2PMUA 1KQ8A 1XMKA 2VODA 4QFPA 2XKOA 2AYSA 5CLSA 2OZ6A 4BHBA 2XROA 1WQ2A 2HDCA 1Y20A 4KICA 4ZEDA 1P1QA 5I2KB 4OWDA 1AOVA 1EH3A 2Z22A 3K2ZA 3ODBA 3FASA 2FA5A 5HVQC 2FRHA 3LSTA 3LSWA 3KLOA 4LATA 3TDJA 3IOWA 3KP3A 3N5LA 1IZ1A 2DU9A 4KIBA 1K78A 2ISYA 4BHPA 4PQJA 1UTBB 1PB8A 4NE4A 2Z33A 1S7AA 5FLXZ 1FTOA 4FE8A 3T9UA 1N04A 3KEIA 4DDDA 3KP4A 1HSTA 1QGPA 1DPEA 4H8IA 5E1WA 2YLNA 3IORA 2OK2A 3V83A 2QBYA 3F8FA 3VEPA 4ZZAA 1B2HA 3OO7A 3FXQA 2KJCA 2F35A 1UTHA 5AA1A 2XXWA 4GXSB 3SKPA 4RJZA 2HKOA 4P5OA 2XXVA 2Q8JA 5F6FA 4AIJA 1TXFA 4R6KA 3DXJF 1R22A 2FYIA 4QHQA 4EJWA 1B3HA 1FZPB 1MM7A 3S9NC 2O7UA 3MEXA 3WGIA 4RGRA 2HYFA 2A68F 1QNTA 4U21A 4WK8F 3EYIA 1NKXA 3LBSA 3FJMA 3IRQA 2ZXTA 1WWXA 4F22A 2PT2A 4AB5A 2W85A 2G93A 2H27A 2O61A 4L17A 1URSA 1NFTA 1TLHB 3C36A 3Q9SA 4XTCQ 1YW9A 5DEXA 2YU3A 3E5QA 3Q5FA 3MVXA 3TELA 3IB2A 4BDOA 4HCYA 3SEUA 3SHFA 1BI0A 2ZBKA 3GZ5A 4KUMA 4JDFA 4ESFA 3ECOA 4BXUA 4HLXA 1I69A 4U88A 1BIAA 5E8GA 1Y0UA 2DE3A 3LR1A 4KYEA 1JW1A 5A2QK 3MUQA 3IJXB 1TQMA 1BOAA 1KU3A 1MQDA 3NRVA 4ZE9A 4RPOA 4G4PA 3F8CA 1BJAA 3HIFA 2EV6A 1JHFA 1CF7B 2PT1A 4MQVA 3NQOA 1FX7A 1H76A 3MWMA 1B6AA 1MXVA 5HLHA 2OBGA 2UVHA 3PGFA 4G94A 2OWSA 4LUBA 3S2VA 5BMZA 5L3CA 4O3AA 3ZSFA 1KA8A 2F7AA 3M7GA 5LLQA 1QKAA 3E6MA 1H45A 3MZHA 2A5YB 1IN5A 4U4SA 5ICQA 3MPLA 2DQLA 3KZYA 3BFTA 4ENMA 1Y3PA 3RTFB 4H65A 3T5XA 3ONMA 4H8JA 4LZ5A 2ELHA 4LMYA 3OSQA 1Z05A 2DQRA 4RK9A 3VLUA 3OMBA 3S9LC 3TPAA 3CUQA 3OO8A 5ERIA 1WDNA 1KU7A 4HX8A 1NL5A 5CBRA 3WU0A 1MJBA 3MP1A 1YTVA 1OVTA 4QSEA 3PUXE 1XCVA 1UQWA 3DP4A 2QMXA 1OVBA 1O57A 5FHMA 3MP8A 5I2KA 2Y7KA 2QJEA 3BKIB 1TFAA 3FHZA 3CIJA 4ZYHA 3O6HA 3RUMA 4P11A 3M8UA 2ISZA 1B4HA 1URGA 4JSDA 2QS4A 4ELQA 1ULYA 2IA0A 1NHAA 4YFKF 3CJNA 2CMOA 3IB1A 4KFCA 5E20A 1CB6A 1SD4A 3QPTA 1T0FA 1M5CA 1Y3NA 4NF8B 3R7XA 3PMWA 3ZMZA 2Y0MA 4O3CA 4I7HA 1UTBA 2O7IA 3DP7A 2A6HF 1YIOA 2PX1A 5DVJA 2ACJA 4FEBA 4FAJA 1LB9A 5IT9K 4RB1A 1B58A 4MTEA 1JE8A 2NNYA 2XAFA 5E8IA 1ZIUA 2IVMA 1QO0D 1UB9A 2K27A 3FVGA 1P6RA 4LP2B 1FWZA 3KP2A 3OEKA 1OR7A 4F3PA 1K79A 1ZHFA 2H9BA 2OAZA 3FMSA 4PE5B 3ELKA 1S8NA 1U5TC 3Q25A 3IWFA 1MY4A 4LD5A 4M74A 1FLIA 1O7TA 1GHCA 3EDPA 2CO5A 1LAXA 4JBZA 2KRFA 4DXBA 5CRYA 2LF8A 3GFJA 2W25A 2KIMA 4TOZA 3VVFA 2PMHA 2W7YA 5DVFA 2XUBA 3GLBA 4G68B 1B05A 5D8KB 3IK6B 3F6OA 5F7VA 2WTEA 3GVAA 3IL2A 4GL0A 4LGWA 2F78A 5ICEA 1O3RA 3H6TA 4ESWA 2OD5A 1B0HA 2F36A 3P7IA 3KN8A 2QZ8A 4IHSA 1QULA 3MVZA 4G8XA 3UA8A 4IRGA 3HHHA 5HS7A 4C0RA 5HOOA 4I09A 1DPPA 1E17A 3QP6A 1NNFA 1QJMA 2D3IA 3RI4A 4Q48A 1I6XA 4NQWA 3QRFF 3FGSA 2YJPA 2I3WA 4A0XA 1RKMA 3HRTA 3PFIA 3CFLA 2OZUA 3J81K 4HX7A 2YX7A 2F6GA 3RTWB 2XHDA 3FWEA 3L00A 3KN7A 2K02A 3KP7A 3WGHA 1CF7A 4DQ2A 3BJOA 3V8JA 2X7PA 2QENA 2YPNA 2QS3A 1LEAA 1FCKA 1ZJLA 3KSJA 5H8HB 3TTKA 1HSJA 4KQPA 2VE9A 1R9QA 3H3UA 5BQTA 1W5SA 1GTKA 3E6DA 4G6DA 2DQVA 1DPRA 4LLNA 4FIMA 2ONKE 5DD8A 5LHIA 1LFGA 4L9TA 3E97A 1B5IA 2DYXA 2GHBA 3B6QA 1L3LA 1BC7C 5K1YA 3O2AA 4U23A 3VB2A 3K4UA 5I57B 4RB3C 1B32A 5CM6A 3IOTA 4QFLA 2COMA 4YIIA 4F19A 2ZYNA 1EZPA 5E1XA 2A5TB 4KFQA 3SERA 1Z6TA 1B3FA 5J1DA 4OINF 1MQHA 4X1DA 3MJNA 3ABUA 4TQUQ 2F5EA 1B9NA 3RYPA 4I98B 3MQ0A 3RDIA 4H6DA 3BPVA 1MQGA 1JNFA 1IRFA 4EVIA 4KA4A 4ESXA 4K3FA 4LG0B 3M8EA 5BWJA 5KCJA 4IGTA 3RGYA 1ZGAA 4NF8A 4HYEA 1DMBA 3UORA 4PDKA 1D8KA 3F21A 2ZYMA 1YLFA 5FFZA 2DWIA 3U72A 5AA3A 1IUYA 3MVWA 1XHYA 5HDNA 3DEUA 1TBXA 1M5FA 4CO8A 1R6ZA 1SFXA 3FJ7A 1HBXG 3F8NA 4NMYA 1H43A 5H8NB 4YMBA 2DW4A 1VSOA 2GA1A 2FBHA 1FTKA 2DVZA 2F6PA 1W7PB 4YB6A 5HLIA 2W24A 2I58A 5BOXA 4LZ7A 3LA7A 2UXAA 4IO6A 1O64A 1FQBA 3RYRA 3FZVA 1OQHA 3VVDA 3GZGA 3F6VA 3KE2A 1B3GA 3MP6A 3GYHX 1O3QA 1MQJA 2HTSA 5HS8A 1XOCA 1KQ0A 4TLLB 4F3BA 1QKBA 4G68A 1QBJA 5BPIA 1B59A 3FM5A 3FD3A 4RK2A 4LA9A 1G4DA 3THIA 3I4PA 4RXLA 3WODF 3EETA 1FQFA 3BFUA 3DM0A 3RKWA 2P5LC 5ITOA 4NWCA 2NRAC 3JSOA 3EN3A 1HW1A 3E6CC 3B02A 1EZ9A 2ONRA 1F5TA 4GRKA 4IGRA 1IW7F 1U6GA 4DZ1A 2JSCA 5D4RA 1RUNA 4L0YB 1A04A 1ZGJA 4PFWA 3RNNA 1MJAA 2CWEA 3C9HA 1J1NA 4N9HA 2BJJX 1XGMA 3K1NA 4U22A 4MEXF 1S3JA 2HEOA 2V84A 1N3XA 4Q5SF 3E3KA 3H3GA 4XKQA 5AE4A 1IXCA 1LQ1A 5ED4A 5HDKA 3O28A 4NF5B 2ZYOA 2H94A 3WTSC 5H8HA 3KP6A 1B7HA 1W5TA 2QWWA 3CLOA 3DKWA 4AIHA 2E1SA 1SMYF 2L4MA 3I64A 3LQQA 3T8TA 4ZECA 3U92A 1TT1A 2V93A 4U2RA 4KYSA 3G3JA 4WXJA 4FX0A 2DLLA 2CGPA 1KQ9A 3WTYC 1XSXA 1LDKB 2HCAA 3O66A 3IL1B 4EM2A 5L3FA 2V3QA 2ZYKA 4P0GA 2XXIA 1SFUA 3HHFA 2E0SA 4RA1A 4R75A 5CVIA 2A61A 3WE2A 4WF2A 1MM6A 3U1OA 5I57A 3QSLA 3WG9A 1BIYA 2A5TA 2I48A 2L01A 4OETA 2XD3A 1VFEA 4FECA 1II5A 1EH6A 2XXYA 2F5DA 2K4JA 1E2XA 1H9TA 3C18A 3KFWX 3H92A 2Y7RA 4LG0A 5KDTB 2EK5A 2HOEA 2Q89A 4H5FA 2DT5A 4HF2A 1Q1KA 4G2ZA 3V8KA 1MDMB 4WCGA 1NNKA 4E70A 3LSFB 4GGGA 2R7FA 1IIWA 3B7DA 3HN0A 2H25A 3I5UA 4X1BA 3QUJA 5A2QZ 1LGBC 4ISUA 3TAJA 4QRZA 3ZS6A 1USYE 2QMWA 2EA2A 4U7BA 4HTGA 1BBYA 5ICCA 1IN8A 1TW2A 1MPDA 1W7PA 5EEHA 3QAXA 1QPMA 4ESBA 1PP7U 2A07F 1SDXA 2XV4S 3GBBA 4BDMA 1A7LA 3WTWC 4U4XA 3FJGA 3DP6A 3SEVA 1A8EA 2A3SA 3HTUA 1MPCA 4OMYA 4EQ9A 1FTMA 4F39A 3PQKA 2NVUB 5L9OA 4R1HA 2FE3A 1O3SA 3ZMDA 1QUIA 2G7HA 4OMZA 1IN7A 1YO5C 4A12A 3N6TA 4YFXF 1I1GA 3HUGA 3O2PE 5I84A 1RZ4A 4RS8A 5IAIA 4OU0A 4GOTA 3LUYA 1DDNA 3OOAA 4BHCA 3QP5A 3OD7A 4UNOA 1MRPA 2GFEA 4H5GA 4LZ8A 1SFEA 1XVXA 4ECFA 3LWFA 1G3SA 2P1SA 5D5VB 2F97A 2RF1A 3DELB 3MWBA 3FIRA 3TOBA 4S04A 1FSEA 3GUDA 3WTTC 5HPQA 1FQCA 4WWCA 2AS5F 3ZQ7A 2ESNA 4HV6A 4KIGA 2JPBA 4EQQA 3U93A 3K2DA 4KI0E 5D5XB 4YG2F 2BEOA 4NB5A 3ZN0A 3MZ9A 1HQCA 3T9VA 1RNLA 2P2AA 3C7JA 4JWYA 4A6DA 3O6BB 4YICA 3WAFA 4OIQF 5IT9Z 2GXBA 4NF5A 2FOKA 1RYOA 5L8DA 3V7RA 2QQAA 2FXAA 1I5ZA 4BYYA 1B6HA 1OQGA 2NAZA 2ZKZA 1N0TA 2V3UA 3CFZA 2FEZA 1WSUA 1YS7A 4HLYA 4QFKA 2EFPA 2X7QA 2HR3A 3ECRA 1WI9A 1QQIA 3MFKA 4MGRA 2F7BA 4EJUA 1PEBA 3OEMA 2REGA 1Z7UA 3K0LA 4LONB 4HBLA 3TDUC 2F34A 3W15C 4WXDA 3BDDA 2O51A 3D5LA 4GYIA 3RKYA 3W6KB 1FYMA 1N84A 3SESA 4G9YA 4DE8A 4WEPA 2ESHA 2RGVA 4S05A 3M1EA 1P1WA 5CYVA 1SMTA 3FUZA 3PMVA 4ON0A 3TTRA 1AWCA 5HDGA 3IHUA 2ANJA 1S7OA 4HCWA 2IW5A 1D3YA 3OENA 3GEZA 3I59B 2XX8A 1LLSA 2VOZA 5KDTA 5H6RA 4N07A 1EH8A 3JYRA 2ZFWA 1TWYA 4E0WA 1KU9A 2WC2A 1MDMA 5TU0A 1ON1A 2D1VA 4OIPF 2V25A 4ETSA 3P9IA 5FB2A 4JK1X 4DXUA 2ZNYA 3W9VA 2Q8KA 4I8CA 3TTNA 5E18F 3MBPA 4ZEBA 2XD2A 4OOIA 2CQKA 3F8BA 1HKQA 3K1MA 2AXLA 2HXWA 4OEUA 2QRYA 1TNSA 1JVYA 3VOEA 5AA2B 2PLYA 3GXAA 2HTJA 2IP2A 1ZARA 5JI6A 3A09A 3FVNA 1BIBA 3DLNA 5CMBA 1XMAA 1XT8A 2H4IA 4HF0A 4M6XA 1NH8A 4A5NA 1L0OC 2DWJA 4ENKA 1J59A 4ZEKA 2YPRA 3CUQC 3IAZA 4JQFA 4IRHA 3GZ6A 2NYXA 2CFXA 4Z2YA 4EV0A 1LEBA 2R6GE 4XLPF 5EHMA 4PFTA 1IXSB 2DBBA 3TEPA 1LNWA 2RCBA 3PMXA 1IAWA 1WRJA 2WV0A 3ROUA 3CG3A 2ZMEB 1AH5A 3K02A 1A8FA 1GGGA 1PC3A 1A99A 5H20A 3FXRA 4MHGA 2JZYA 3SEWA 5CJ9A 2RCAA 4B8XA 1PP8F 4R9FA 3CG1A 5HLGA 2GRVA 2R71A 4OIRF 1LSTA 1Y4TA 4KIFA 5J8FA 3MAMA 1PDNC 3I3VA 4D0PA 3EQLF 1HW2A 5ILUA 2IT0A 4QSDA 1NMUA 4QSCA 4YKJA 4Z0IA 3KJTA 1H44A 1AMFA 4OERA 4IY5A 1MH4A 4KHZE 3TCHA 3J80K 1FT9A 2FSWA 2XAJA 2FMLA 4EDPA 4A5MA 4RB0A 1ANFA 1D8JA 5JR3A 1DTGA 5FD6A 4KYDA 4F29A 4H67A 4OMBA 4MNUA 3ZMVA 2OCUA 3TQLA 5BUUA 1B7ZA 2X4HA 3KZGA 4IF4A 2PI0A 3KETA 4IXAA 3E4RA 3HOTA 4LFUA 1KU2A 3Q9VA 3HRUA 2QYOA 3IOUA 3PU5A 1LAHE 1LCFA 3H6UA 4PGHA 2UYEA 3R0JA 4FHTA 3HSTA 4M9XA 3JAMZ 3TZAA 3OXNA 2XVCA 3OELA 2XAGA 3GLXA 3TOAA 2Y7WA 5JFRA 4OFLA 4ELPA 2QS2A 5AA4B 1USYH 2CYYA 4ZYGA 1G6NA 1I27A 3DFGA 4IPAA 2XX7A 2IA1A 2VN2A 1IUDA 1UIVA 5CMCA 4ASNA 1JXSA 3I59A 1YAEA 2F2EA 4EQ7A 3PUWE 4P0IA 1Z9CA 1FSHA 2JTVA 1XC1A 1BI1A 3KFMA 3Q26A 3QU3A 2ZNSA 1LB8A 4JWOA 2ZNUA 3IWZA 2OWTA 4G77A 4HS7A 3EF7A 1EH7A 2EV5A 2B65A 2FNAA 2XHKA 4YB7A 1DSNA 1W7PD 4ND9A 4O3BA 3V89B 3ZMUA 2DAOA 2PQ8A 5FLXK 1VE4A 3C35A 2GXGA 3FF5A 4ZZEA 1F9NA 2DPDA 2ZCWA 2VONA 1JHHA 3M3FA 4Y17A 4ELOA 5FD5A 4EUOA 3O6IA 4RPNA 4ZYDA 4LK0F 4L9JA 3HPIA 2IJLA 1KYWA 2PBIA 1B40A 4M1VA 1HW5A 3FXUA 4Q5TA 3CDHA 2DTRA 3MAJA 1P99A 2DS9A 4RB2C 1T39A 4BNCA 5DT6A 2L3DA 4ZEIA 3SETA 4QFNA 5B7DA 2MLGA 3L2CA 2XXRA 1B9MA 1PBQA 5DUKA 4Q0CA 4U0WA 4ZEFA 5JEIA 3T0YA 5JTYB 3RT6B 5FTHA 1R5HA 2ZMEA 1R9LA 2E7WA 2V3TA 1NNTA 3E5UA 2XKPA 4AB6A 3JTGA 5CMKA 3MCZA 5K2XA 2A69F 2O03A 1A54A 3G3KA 1XVYA 2FNCA 4GXAA 5A5XB 4C1TA 3CO7C 2L02A 1UCRA 2Q2EA 1C0WA 1ZRFA 1R36A 5CVVA 3FM3A 3J7AO 3FVOA 1F1ZA 4OQOA 1XGSA 2TDXA 1W4MA 3HSEA 1XGOA 5CMMA 2H5YA 2QPQA 3ZMTA 2XXTA 4R9GA 3TCFA 3DPTA 3I53A 3WU1B 3GFLA 3RY3A 2DFIA 2PG4A 2RC8A 3IR1A 4FEDA 3E9XA 2DK8A 4A0YA 2M1BA 2IPQX 4MLQA 5ILVA 2VOOA 3TDZC 4R72A 4YAHX 1SVXB 4MH5A 5TPAB 3K6VA 1BN5A 4YKIA 1FTLA 3BJAA 2DVCA 2FF4A 1V3FA 4OFJA 1B9JA 1MZBA 3OO9A 4CDGA 4YB5A 1OLCA 3UGWA 4BLAA 2CZLA 5DCMB 1K7AA 1MJ9A 4KYWA 4M9SA 1XDSA 2H6CA 4G68C 5JK4A 4KMFA 4WKMA 3I6VA 2REJA 3SQNA 2Q0OA 1JETA 3MPKA 1BI3A 5I56B 5AA4A 3LA3A 5ELVA 2VHAA 2ABHA 1AL3A 1OYIA 4PP0A 3TMGA 3DF8A 2UXNA 1EV7A 1G3TA 3HSRA 4EM1A 2J5OA 1Z6RA 1TFDA 1SW5A 3H3ZA 5FGMA 1B1HA 2DXYA 4BDRA 3UP9A 4HW8A 2FA7A 1FTJA 3RKXA 4IO5A 1ZLQA 3ZPLA 1MY2A 3RIRA 1R23A 4JB7A 3V5AA 2P6TA 1MKMA 1DP7P 4I0AA 5CI5A 1QVSA 1TQIA 1RYXA 2OBPA 3E5XA 4ZH4F 3HSFA 3PPRA 1IN6A 3TKYA 3AXFA 3PPQA 1I1SA 4ZZLA 2LKPA 4GVOA 4O5VA 3C34A 1LBCA 2Z8DA 3K1PA 5ISUA 1O7FA 2KLFA 3T8RA 3V7SA 3D4CA 4IO7A 5ITPA 4F1VA 1XSDA 5FFXA 1B1XA 2XGXA 4OFOA 4QLCU 2V1DA 1LDDA 3E6BA 4OZ9A 1BI2A 1T6SA 3EQ1A 4IVNA 2MA3A 3K0VA 2OLBA 3U9GA 1JW5A 4UACA 3KBRA 4MFIA 2O6AA 2BGCA 3VFZA 3G3HA 3QIMA 2EV0A 3WE3A 3K6XA 2RKHA 2O8XA 3Q28A 5EHSA 5H8QB 3UIFA 4TV7A 2KIUA 3B6WA 4ENNA 5JTYA 1NNPA 2Y48A 2XRNA 3VXBA 1UIUA 3REOA 1R1TA 4X9TA 4MQ9F 3PPNA 1H9GA 1YPNA 3ZP5A 2GZWA 3PV0E 4NF4B 2Q9TA 4YZZA 5IT3A 2EFWA 2L54A 1STZA 2CSOA 5ICGA 2PEXA 1B1BA 1LFIA 2Z5UA 3HHGA 3OSRA 4I62A 1BTJA 5D8LB 1JEUA 5A5XA 2NS0A 4U0VA 2IA4A 3HYIA 1B5JA 4JWXA 4RGUA 1YCJA 2O6GE 1ZLJA 4EQBA 3PPOA 1US5A 4ZE8A 1O63A 2Z99A 3Q27A 1SYIA 1HSEA 1U2WA 1K78B 3N4MA 1RI7A 1ZREA 1ODDA 1EZOA 3LSLA 4EXLA 3F8MA 1OMIA 5JHUA 4RAZA 1PBPA 3JSPA 2GIVA 4Y13A 3ECHA 1FOKA 1P4XA 3B6TA 4O3MA 3G7WA 2QSXA 3MW0A 1MQIA 2JPCA 3A3CA 4UV9A 1B52A 2UVIA 2I4BA 1SI0A 3U1DA 2RVCA 2GHAA 5DCMA 3DPLC 1K6OA 1Z91A 4DCYA 3VE1B 3V8XB 1FQDA 4GO1A 4KD5A 4ZS9A 1JW4A 2Q2AA 2Y7IA 3T66A 3GO5A 5I56A 1ATGA 3W9WA 3FMRA 1P2FA 1OMPA 1R1VA 3EPEA 5LGUA 5H8NA 2BE5F 1J9IA 3ZN1A 4R2BA 1ZBMA 2O84X 1SD5A 1YG2A 1FQEA 3R0AA 4R2FA 1V4RA 5HM4B 1SD3A 2X26A 4CXFA 4R79A 1RUOA 1Q35A 1BP5A 4M9ZA 4PETA 3QUFA 4NHJA 5J6XA 3VLWA 2ZNZA 3O9PA 1GVCA 1USSA 3FX3A 4MF3A 3KEOA 3U2RA 3EHTA 4QFOA 5TRDA 5H8FB 2Z3YA 4IB2A 1LDJA 2UVGA 4G7HF 2KIFA 3LAPA 2V1XA 2EFNA 2C6YA 4GIZA 1BM9A 4R74A 2V6CA 4HZFA 1R00A 2QM3A 4XBFA 2F7CA 2RC4A 1D4NA 1OPCA 5AA2D 4POXA 2XXXA 3I58A 4QF9A 3J80Z 3H6VA 2RNJA 4LB5A 1M5BA 5L3EA 2HYGD 1WKMA 5LHHA 3C1DA 4POWA 2THIA 2DO7A 5FHNA 1J5YA 5D5UB 1IQ7A 1FP2A 5ILSA 2D1HA 4XXUA 1GR2A 3C4MA 2P6SA 4EM0B 1XS5A 2RC7A 4L5JA 1YTYA 1D9VA 1S7YA 1MH3A 1SBPA 2I0CA 2HFBA 3GW2A 3Q29A 3G3FA 3T9HB 4EJOA 4DCXA 1P4WA 3T96B 2NWJA 3I54A 2DK5A 3BY6A 2OU2A 3I0TA 3M9AA 1FW0A 4OTEA 5LHGA 4XKNA 2OJTA 3P9KA 1ZLKA 4NF4A 3CUQB 5HS9A 2ZO4A 1HKSA 4MBPA 3R61A 2RC9A 4G8HA 4M72A 1KGSA 2R9JA 3CSBA 3VLVA 3CTAA 2M8CA 3K6WA 1TQPA 4PCQA 2XXHA 2QL3A 2VBYA 1IXHA 4ENJA 2K86A 3O3KA 4IRIA 2ZMBA 3HOSA 3E13X 1D9YA 3IO6A 1H0MA 2HS5A 4DNCA 4P55A 3QAHA 1FBQA 3BPXA 4ELRA 2O1MA 4L5IA 1ZH5A 4RY1A 1KWHA 5EEGA 2UWMA 2STTA 4KCCA 3QPHA 5FTIA 3V7CA 1ZRDA 1FC3A 1MXZA 5DYHA 4HQEA 4TLMB 1ZYRF 2IRFG 3RLFE 4F3GA 4A2UA 2CG4A 3GX4X 4HA8A 3SFZA 2XIGA 1YYVA 1IXIA 4GL8A 5ICFA 2EJRA 2DPUA 5TJJA 3K69A 5BPDA 4KDPA 1GV8A 4F2OA 5L9MA 3QOPA 3JW4A 4LQ5A 5M2VA 5KK1A 3TQNA 5CVUA 2HQ0A 3K6UA 3UN6A 4YU0A 3VV5A 1UHMA 5L3GA 3DQVC 4KN7X 3I5OA 2VOPA 1MG1A 1MXXA 1P92A 1S50A 4KR5A 1RIOH 2WWYA 2DE2A 4AD9A 2AL5A 3GBAA 3LA2A 4U0YA 3J81Z 5FHOA 1S9TA 4BQAA 3JTHA 3KSXA 3VXCA 2DWAA 3NEUA 2D45A 5EYFA 5JVTA 1WODA 1ZG5A 3K9TA 3G3GA 1LB2A 2V1UA 1POY1 2ADUA 1XN7A 5H6QA 4NF6B 2F5CA 4UVCA 3MZBA 1SI1A 4AVPA 2GA2A 5L9SA 1AOYA 3TTMA 5H8FA 1ZN2A 2RDPA 3H4ZA 2B3BA 2Y84A 1Y1MA 4AQ4A 1MY0A 3SZPA 3USDA 2HAVA 5DDGA 3FV2A 3WTUC 5J8CA 2E7XA 2HGCA 4OHNA 3CRBA 4G6QA 4EGZA 3S2WA 5I2NB 5KZTA 1DPUA 4FJPA 3CFXA 2RINA 4XIGQ 5DD4A 1G3YA 1HKTA 2UZKA 5DTBA 3MC2A 5I59B 1LAFE 1U5TB 1T38A 4RAYA 3CSGA 3GFIA 4MLVA 4N0BA 1MXUA 1EU8A 1XDUA 3H03A 3ZKKA 4U7DA 4GD5A 4NWDA 5DV5A 4GFRA 4YIFA 4CZZA 2HFHA 3GWZA
chains in the Genus database with same CATH superfamily
2EIMH 3LFKA 2OQGA 1Z7ME 2H09A 4KN4X 4JVDA 4L0ZB 3QK6A 2JA2A 5M3MJ 2FBIA 5LGTA 2PJPA 3VDXA 3OS0A 1YYZA 1GV5A 1FMVA 4BACA 2DSFA 4BDLA 1VR5A 2VD3A 2A6TA 1B72A 4DZJA 2NXOA 2ZSIB 3LSIA 3AAFA 3H6WA 3HCQA 2E2HJ 1A36A 5C44J 3RPUA 1PB7A 1D3KA 4N6DA 2VJ5A 4C1TA 4GXOA 1O3TA 2UVJA 3J7YJ 3PD9A 1J75A 1WVRA 1SVLA 5ET8A 5M3FJ 4L9VA 3ZQLA 4QXDA 3WAEA 1J7KA 1K9YA 3FDYA 4WX9A 3T9XB 1YS6A 5D6FA 1U9NA 1S9HA 1Z21A 2A6EF 3HGGA 4MIMA 2Y7PA 3IO4A 3R60A 4KCDA 4NEDA 2DWHA 3FXLA 3G1OA 4XRFA 2G29A 1SQYA 2E1NA 3IKTA 3RN8A 1GXPA 3A3UA 1QZYA 4RGSA 3BR1A 4X0GA 5GPAA 3KOSA 3MZ1A 3TQWA 4B47A 1P1NA 2COBA 1G3WA 2P7VB 4A3EJ 3HTSB 1BLFA 5L3DA 3IB0A 3KEQA 2HVSA 1UG0A 2XPWA 3MQ9A 4ESJA 2QVUA 4FORA 4I0BA 2EWNA 2VBWA 1G2HA 1B51A 4IO4A 2VBZA 5HBCA 3MSTA 1FBSA 1BW5A 3IX1A 4CUGA 3B73A 4LIUA 1XS9A 3BJ6A 4UVBA 1P1OA 3F11A 1X1PA 2FIXA 4YKPA 2VI6A 1I6AA 3OV8A 4IHVA 3M4OJ 4G8MA 3ZQQA 3LAJA 2PFBA 3I4NJ 1GT0C 3SXYA 4G8NA 4P8BA 4QIWN 3FXKA 2WKYA 3N94A 4ZZDA 1D0ZA 3ABTA 3E3VA 4XKBA 2F8DA 1IEJA 4KT5C 2VXZA 2ZXWH 3EUAA 4UXNA 4LB6B 1IMCA 3C31A 2MBFA 4G7OF 4E0XA 2RN7A 2LVSA 2NS8A 3IH4A 1JGSA 1JQFA 3BZ6A 2R3SA 1TTYA 1XC5A 1IMBA 3HV1A 3IOVA 3S9EA 2MD0A 3FV1A 3H06B 5KCJB 4IL6C 1YFHA 2R7TA 3FATA 1GVJA 1YW7A 3BTIA 4CCNA 5K5RA 3JRCA 1AU7A 1ZMGA 2I6EA 3CI8A 2J5PA 4GX4A 3MYUA 4MFDA 2Z9OA 4C1UA 2VJJA 4Q4ZF 3CJRB 2LSOA 2R7QA 4LK1F 4LOCA 4M73A 5CVRA 5LBQA 1FYKA 4XN3A 3R6UA 2MC4A 1IGNA 5IP7J 1AKHB 1S6LA 2B9SA 4B09A 1FBCA 2ICWG 4IJAA 2KMUA 3BR6A 1LAGE 1MDP1 2DMNA 1RDXA 4R73A 2F6CA 3OYJA 2DXRA 3GYYA 4OEVA 4THIA 4AIKA 1HSLA 4JXIA 2I0BA 2O1LA 1VQ8I 1XB4A 1PDAA 2IS4A 2CUJA 2JT1A 1J2XA 1TZLA 3KP5A 5LGNA 2DA6A 3U1KA 2HAUA 2ZXJA 2QS1A 3HOXJ 2P7CB 1GXQA 3DCFA 2FVZA 2VGQA 2L7MP 4PFIA 3TTLA 1TW3A 1JJ8C 2DT7B 4P56A 2FQ4A 3HRSA 5EF6A 1UFMA 1USTA 2E19A 3LSRA 4AWXB 3CCRI 2CRGA 2FBKA 4J00A 1R1NA 2GQQA 2EA4A 3S4UA 3ULQB 3CCYA 2W57A 1J0RA 4F3SA 1CE2A 3PUYE 3N26A 1S7EA 3TW6A 4BE0A 1PUFB 1IRGA 3KX2A 2AIXA 2R4GA 3CCUI 1EKEA 3PNTA 1NH7A 3KZZA 5E3OA 1NV6A 1OCOH 4CICA 3COAC 3MD2A 3HXLA 5K5OA 4WXHA 1Y1ZA 5LOMA 4UUVA 1MSEC 1UMQA 1IITA 2PMSA 3MVYA 3TGNA 4PJMA 4U1OA 5F1QA 2XX9A 5DTDA 2L7ZA 1B5HA 2MKZA 3F72A 4A6EA 3CO6C 5AA2A 2X0LA 5B70A 1EYJA 4NF6A 3L6HA 5AONA 4NN3A 4GF8A 4N9IA 1PUEE 1LJ9A 1YE9A 1UELB 4G6TB 1SW4A 4R6HA 4OXVA 3I56I 3U8QA 2UYFA 3O97A 4XLAA 5JHFA 4CGZA 2XWOA 3M3LA 1R7JA 3R26A 1N76A 2EFOA 2D5WA 1XD7A 4IO2A 3G73A 5K7HA 3ZQFA 2GLOA 3O29A 4MTDA 4DLDA 5I2NA 1YOVB 4Q47A 3RQ4A 2B0LA 5IP9J 2QGUA 3F23A 2G7UA 2BY0A 3BROA 1FOWA 5F27A 5I59A 2DYSH 3C32A 1SVOA 1U5TA 3H9GA 4HE2A 4IO3A 5LRSA 2XXUA 4RAFA 4Q30B 4DIGA 2PN6A 4J01A 5KVRA 2LAOA 4OYVA 4XICA 3I4MJ 1E3PA 3LC8A 3GF2A 4U1ZA 2LC2A 4N4NB 3U94A 2STWA 3BOQA 1LCTA 1P7IA 2F5VA 3CZ6A 4JX6A 1MIJA 2KJBA 1CNQA 4PFUA 3BP8A 1Y8QB 1SAXA 4R6YA 5GP9A 2FUG2 2W00A 2QVOA 4XLNF 2D21A 2O69A 2QVRA 3QXMA 5FO5A 3PNVA 2DDAA 4WXCA 3IUOA 2PBWA 1FSAA 4F7ZA 4XKPA 4DGWB 5H8SA 4EJTA 2D3IA 1N7XA 4IY6A 1LFHA 2ONSA 5CVJA 4GQOA 3G3IA 4EF2A 4K2EA 3CC4I 2P5KA 3GTPJ 1FEXA 2BZTA 4BS9A 3GTMJ 2VQLA 1EJ9A 1RKWA 2XPUA 2LRDA 2XASA 5LEJA 4Y15A 1BC8C 2GH9A 4OENA 1OYWA 3VDFA 2R7DA 4HV5A 5F1RA 3ASOH 4OA4A 4HDVA 1NUYA 1T0KA 3CVGA 1XSVA 5AIPA 4KISA 3T22A 4DXCA 4F31B 4PGGA 3RJPA 2R7RA 1IRZA 5CQEA 1OKRA 3EHSA 1OIBA 5DYMA 4EMSA 3T93B 5DM7F 1DBZA 3IRRA 1WVJA 2KFDA 1JJ6C 5D4SA 5K2YA 4OESA 4E6KG 3GXOA 1O4XA 2DMPA 4UUTA 2LBFB 4HOBA 1B46A 3TCGA 4N4OB 4MEYF 1MS7A 1KZ8A 2NOOA 4F18A 4A3BJ 3TO6A 2DI3A 2B63J 4O7IA 1VF9A 5CC2A 4BKXA 3TO7A 4AU7A 2L7KA 2UXXA 3N97A 1N3WA 2EQRA 3AKZA 2O3FA 4I01A 4I9DA 3TODA 1D1BA 1E3HA 1R5GA 3SDFA 3C2HA 1A55A 2FU4A 1MY1A 2ALUA 4IHTA 2F5XA 2HWVA 1QVUA 4XKRA 1YQAA 3DV8A 5F0HA 3L2UA 1FOXA 3QYBA 4QWQA 1CGPA 4MEVA 1ELJA 4A3DJ 4HX4A 1A40A 3PD8A 1LBVA 3LSHA 4UVAA 3L09A 2OA4A 2WAFA 2R0QC 2R7ZJ 2O0YA 2IEKA 4F55A 3R4KA 1W0TA 1FQAA 2P0SA 5DVIA 5TP9B 2MH9A 3ERED 4F92B 4XNFA 4DI3D 3BT9A 2WAQN 3EHUA 2GWRA 1Y1VJ 1FJLA 4H1XA 4N8GA 3BWGA 2ELKA 5D6EA 4D7MA 4P1EA 4C30A 1M5EA 4KPTA 3OOUA 1YX3A 1FP1D 4XSZF 4RBOA 4G7ZF 3FKIJ 4L18B 1AKHA 1VZ0A 1B0LA 2L9RA 2VC1A 1BR4A 1URDA 2HZLA 2OZZA 1FY7A 4I76A 3HOWJ 1F36A 3S1RJ 2ETHA 4AYBA 3IFCA 1M5DA 4LLLA 3ZOBA 2K4BA 5IYCJ 3LSKA 3SEXA 2K5CA 3U21A 2LREA 1FTAA 4IX7A 1MBKA 1MXYA 4FT8A 1PB9A 1IF1A 4M3DA 1HA8A 1J09A 2P3NA 3TYHA 4F2QA 2HEUA 1XCBA 3EYYA 5K5QA 3I3LA 3FBPA 3O6GA 3QU6A 4LVQA 4YFNF 2JRTA 3OR2C 3P5JA 3C3WA 1Y9UA 2NUVA 4R8HA 2MD5A 2FMYA 3IKVA 3PSFA 1NV0A 4OVJA 4ONYA 2F5FA 3OOPA 1SD6A 4NGUA 4OAYA 3VWBA 2BV6A 1B7UA 3RPQA 3TO9A 2XAHA 4LQ2A 4NTLA 3VVEA 1PUFA 1D5YA 1FPQA 4I40A 3JAMK 2HXIA 2MG4A 1R6RA 3OS2A 4A3LJ 4XSXF 2FOWA 1XGNA 3FMQA 4M3GA 3KCCA 3JRHA 4OIOF 1AIVA 2X6OA 2CQXA 2QCOA 1JTYA 5M5YJ 3IAS2 1BR1A 3ABLH 1DUXC 2R7SA 2LP0A 1ZG3A 5F64A 4M6VA 2QSGX 4NBQA 3MKWB 5L3BA 1H8AC 1S29A 4UHTA 4M6YA 3HUGB 5CKTA 3WTZA 1LVAA 2VT2A 3ZKLA 5CBSA 4HAMA 3TUSA 1SFOJ 2M87A 2M5WA 3P7NA 1IG7A 3H7MA 2ZFUA 2FNPA 2QQ9A 5DUIA 3T0JA 4BDQA 2GAUA 1X3UA 3SZTA 2FJ1A 2ZB9A 2I49A 2W48A 4D5CA 2MC3A 2LF7A 4Z7EA 1QW0A 1VTNC 4EF1A 4GYGA 1HXDA 1Z1DA 2LNBA 2HZTA 1HDDC 1W0UA 2Y0SN 2HQRA 2QLZA 4GCVA 2I8DA 4E7IA 2MLKA 4AM3A 1MPBA 2ZZXA 2H8RA 1MY3A 4M4GA 3G71I 4PFYA 5I58B 1Z7LA 1LBBA 1F4KA 2VT3A 3BZKA 3F0CA 1D5VA 1B4ZA 1ZELA 1FRPA 3PUZE 4ZDMA 3S9MC 2P5VA 1T98A 2BBYA 5FKLA 4BJ5C 2JMWA 4BDNA 2PVUA 4FX4A 3MKYB 1I6QA 2Q88A 1WI3A 3EUHA 4PZJA 5IOYA 3FVKA 3RQTA 2WV1A 3DU5A 2IEEA 3KG2A 1QZZA 2X1DA 3ILUB 2VBXA 1WZ2A 2FQ3A 1QZEA 2QQ8A 2PYYA 4UA8A 3ILTB 5ET6A 4XONA 2A5SA 4PE3A 5EQ8A 4N6PA 5E17F 4H0EA 1I6BA 2EFQA 1B3EA 2YSRA 2AL4A 1X4OA 2BW3B 2M30A 4P9FA 1H3DA 4N8YA 4CZZA 1R58A 2P8TA 2XB5A 4HSTA 1MMGA 1JVXA 2IA2A 2W84A 4L9NA 2K9LA 4GX6A 4RGXA 2VE8A 4GWSA 3PPPA 2QQBA 3IJOB 2YX4A 1NH3A 1SW2A 4FATA 1FBUA 4N13A 3RPWA 2VC0A 1POTA 1QUKA 1N75A 1JEVA 4YKKA 4FE7A 3QPSA 1P9QC 1VQ6I 1IN4A 1OLAA 1L5TA 1VQMI 2PMZN 4M71A 4E7HA 4P9UA 1B3LA 5TISC 1R5ID 1SEUA 1ZU0A 4H0WA 3FXMA 4C2TA 3VODA 4F1YA 1MMSA 3M8FA 5K7ZA 3JR9A 4GWOA 5J16A 3SEYA 2DMQA 5TPAA 4F1UA 2EZKA 2ZJ2A 1ON2A 2K3FA 4CHUA 2JSPA 4LJZF 4LLGF 3F22A 3PUVE 4Q8RA 1YJWI 4HQMA 4P96A 3S1QJ 4HF1A 2Z8FA 3TEDA 3L6GA 2E2JJ 2O68A 3QOEA 1OJLA 2X1EA 1Z7NE 2WBDA 4PC9A 2HQ5A 1N77A 3GCMA 2QBYB 3VSLA 3TFLA 2H98A 4KNYA 3KOTA 5LEKA 3T1BA 3CMYA 2XAQA 1IXGA 1ETQA 4HDUA 3JV9A 2XA5A 1YRNB 1ZKBA 2BHYA 3P9CA 4XRSA 5BS6A 1UTHB 2G9WA 3R6SA 3ZMSA 2B3FA 3W3CA 5AIQA 3ZRGA 1FNNA 1NG6A 2BYVE 4BH9A 3CMAI 3V4GA 3C33A 3VFJA 2ZNTA 2HQNA 2Z23A 1YW8A 4CYDA 3MZYA 5TP9A 1SD7A 3PQJA 4N4UA 4GWWA 4ZYEA 3CC7I 2A05A 1MD0A 4JSOA 2RKMA 3RT8A 3LSXA 4BE2A 1SW1A 2VP1A 1XMXA 1VFDA 1Y3QA 2XWVA 2RQPA 3V8LA 1FBPA 1FPBA 1DOTA 3L9FA 2HZKA 2E1CA 4FETA 1ZAOA 3DP8A 3ISPA 1R49A 1FYLA 2XXPA 1LUJB 1APLC 2Y31A 2HKXA 3I71A 3SDGA 2QUFA 4X48A 5IM2A 1U8RA 3TP0A 5IOZA 1ZRCA 1P1UA 1TT0A 5LDZA 3WTVC 4PTKA 1IXRC 2K7LA 2E1OA 3HRMA 4W1UA 3K4JA 4UV8A 1MDQA 1MNEA 1B4AA 4FCYA 4XORA 2E60A 1LFBA 2CW0F 1F9BA 2CQNA 1P4AA 4JBAA 5IP6A 1SYHA 4UUSB 1N7WA 3HO7A 1T33A 1BJZA 2NNNA 2OQRA 3F3XA 5DCFA 5DEXB 4EGYA 4I2OA 3WGGA 5ICTA 1ZG1A 1DTZA 1OYYA 3ML6A 1X19A 3LQRA 4O6JA 1U3EM 4GLIA 3K01A 3OY9A 1MGTA 3QYTA 4EXKA 2XXQA 4X8RA 4PAFA 2L0KA 2CW7A 1KYZA 1TNTA 2K9MA 2V79A 5GAGJ 2K9SA 1MXWA 1T2KA 1Q1HA 3OYLA 4BAYA 2DOJA 4I1DA 4RNSA 2Q2CA 2RV8A 3BG9A 2XSDC 4H45A 3IC7A 4P47A 4I02A 4HW0A 3MZ8A 4IHWA 3M3YJ 2K40A 1ZTYA 2EB7A 2Y75A 2HDDA 2L4AA 2NOGA 1REPC 5DEQA 3OO6A 3W6VA 2H6BA 1ONVA 2VD2A 1YI2I 2I3VA 3D4GA 1FTZA 1UHWA 5D5WB 5EJCA 1QUJA 2V9VA 1US4A 3N6UA 4YMAA 3KLNA 3OSGA 3GFMA 1R1UA 2YR2A 3CUOA 2EINH 3K00A 2PJRB 4XFEA 4DJAA 2D2WA 4W97A 4BEHB 3OWTA 5EQ9A 3K10A 2P4WA 4A0ZA 1OCTC 3G3ZA 2I4CA 5LRRA 3W6JB 2H99A 1BKAA 1O7LA 1XX5A 2OUMA 3FIWA 2WAQA 2DE4A 3KN3A 3KGCA 5H8QA 4XOPA 2E71A 2EH3A 3SFIA 1YJ9I 1U78A 3BBRA 1ETOA 4KMUX 2LDUA 3M3KA 2M8EA 2MH2A 5E1ZB 3PFYA 3GTJJ 3CR9A 4UABA 2IGNA 1Z3YA 3UK4A 5I58A 3JZJA 5IKBA 3VYRB 3D0SA 6PAXA 2M45A 3RTRA 3J7ZI 3KJ7A 4EJVA 4E7JA 1VQOI 3S2DJ 2KKOA 2DP8A 3WTXC 4RYAA 2KRHA 3H35A 3S16J 3ASNH 2NVYJ 4WEDA 1I6HJ 3L7WA 2PMUA 2MW8A 1KQ8A 2DOFA 2PX9A 1XMKA 1K61A 2QA4I 2VODA 1DK4A 3S1MJ 4QFPA 2XKOA 1X3WB 2W1OA 2L9SA 5CLSA 2BW3A 2OZ6A 2AYSA 4BHBA 2XROA 1WQ2A 3JREA 2HDCA 4KICA 4C3IJ 4X6AJ 1Y20A 4I3YA 4ZEDA 1P1QA 4MNPA 5I2KB 4OWDA 1AOVA 1EH3A 2Z22A 3K2ZA 1PJRA 1LBXA 3ODBA 1Y1WJ 4BDZA 3FASA 2FA5A 5HVQC 2FRHA 3LSTA 4NC7A 3LSWA 3KLOA 4LATA 3TDJA 3PUBA 3IOWA 2B7EA 4PDDA 2EZHA 2XF6A 1SAUA 3KP3A 3PIOF 3OYIA 3S1NJ 1IZ1A 2Z1DA 4XR6A 1DCUA 2DU9A 2W4SA 4KIBA 4B3XA 5GAEJ 1K78A 1WPKA 2ISYA 4BHPA 4PQJA 1UTBB 1PB8A 3GBGA 4NE4A 2Z33A 1S7AA 5FLXZ 3JRBA 2D5VA 1FTOA 4FE8A 1WJEA 3VYTB 3T9UA 1N04A 3KEIA 4XKCA 4DDDA 2GIZA 3JRIA 2QF7A 3KP4A 1HSTA 1ZQ3P 3UKGA 1QGPA 4BUPA 3MN2A 1DPEA 4H8IA 5FKMA 2L9NA 5E1WA 2YLNA 3IORA 2OK2A 5F24A 3V83A 2KDOA 4D9JA 2E5NA 1U8BA 2QBYA 3F8FA 3VEPA 4ZZAA 1B2HA 3OO7A 3FXQA 2RNGA 1VQLI 1YRNA 2WBBA 2KLOA 2KJCA 2CW8A 2F35A 1UTHA 3OMYA 1FBHA 5AA1A 1BOBA 2XXWA 4GXSB 3SKPA 4BXXJ 3DBHB 4RJZA 2HKOA 1TT5B 4P5OA 2XXVA 2Q8JA 5F6FA 4NC8A 4AIJA 1TC3C 1TXFA 4R6KA 3DXJF 3PM1A 3NARA 1R22A 2FYIA 4QHQA 4EJWA 1B3HA 1FZPB 3NAUA 1MM7A 1A6IA 2G0EA 3S9NC 2VPLA 2O7UA 3MEXA 5I3SA 2ELJA 3WGIA 2X1CA 4RGRA 2CUFA 1Q1VA 2WY8Q 4PCDA 1QA6A 4XLFA 2HYFA 2M7AA 4FISA 2A68F 1QNTA 2HHMA 4WK8F 3S3OA 3EYIA 2XSJC 5C4XJ 1NI9A 4HNUA 1NKXA 3FJMA 1N25A 3IRQA 1LE8B 2ZXTA 1WWXA 3LBSA 4P9KA 4F22A 2X9DA 4F93B 2DA2A 4E7KA 2PT2A 4AB5A 2DOAA 2W85A 5EYHA 4JX4A 5IYDJ 2G93A 2H27A 2O61A 4L17A 4GBVA 4I99C 1NFTA 1YX5A 1URSA 1TLHB 3C36A 3Q9SA 4UUSA 4XTCQ 1YW9A 5DEXA 1A35A 2CUZA 2YU3A 3E5QA 3AG2H 3Q5FA 3MVXA 3TELA 4B4CA 3IB2A 4AVZA 2NVTJ 1X2NA 4BDOA 4HCYA 3SEUA 3SHFA 1BI0A 4II3A 2ZBKA 1Z3XA 3FXBA 3GZ5A 4KUMA 4JDFA 2DODA 3C2BA 3ECOA 4ESFA 4BXUA 4PJJA 5LFAA 4NQWB 4HLXA 1I69A 1XI6A 4U88A 1BIAA 5E8GA 1Y0UA 3K4LA 2M34A 2DE3A 3LR1A 4KYEA 1OCPA 4V19K 1JW1A 1TWGJ 5A2QK 2BJIA 2XF7A 1OFCX 3MUQA 3IJXB 1TQMA 1BOAA 3K70D 3BG3A 1KU3A 1GLNA 3HKZN 3BTLA 1I39A 2PCRA 1MQDA 3NRVA 1W36D 4IQ4A 1FPKA 1VI0A 1P7JA 4ZE9A 4RPOA 4G4PA 3F8CA 1BJAA 3HIFA 2EV6A 1JHFA 3DLAA 4MFEA 2HOAA 1CF7B 2PT1A 4MQVA 3NQOA 2DFEA 1JKQC 1FX7A 1H76A 3MWMA 1B6AA 1MXVA 2PJRA 5HLHA 1U0JA 2OBGA 2UVHA 4BEHA 3PGFA 4G94A 2OWSA 1Y6IA 4LUBA 3S2VA 5BMZA 5L3CA 3QYFA 2JVHA 4O3AA 3ZSFA 1KA8A 2F7AA 3M7GA 5LLQA 1UAAA 1QKAA 3E6MA 5EGOB 1H45A 3MZHA 2A5YB 5EYGA 2CU7A 1UHSA 1IN5A 4U4SA 2VJ4A 3FK6A 5ICQA 3MPLA 2DQLA 3KZYA 2VKDA 4ENMA 3VYSB 2JVGA 1Y3PA 3BFTA 3RTFB 4H65A 3K4NA 3T5XA 2X6YA 3S15J 3ONMA 2ELHA 4LMYA 3OSQA 4H8JA 1Z05A 2DQRA 4LZ5A 4RK9A 3VLUA 4ANJA 3OMBA 3TPAA 3S9LC 3CUQA 3HB9A 3OO8A 5ERIA 1WDNA 1KU7A 4HX8A 4XIDA 1VQ5I 1G0HA 1NL5A 2DCEA 3WU0A 5CBRA 3LSGA 1MJBA 3MP1A 2XGEA 1YTVA 1OVTA 4QSEA 5EQAA 3PUXE 1XCVA 1UQWA 3DP4A 5H2FC 2QMXA 1OVBA 1O57A 5FHMA 3MP8A 5I2KA 2XDVA 2Y7KA 3BR3A 2QJEA 1MNDA 3BKIB 4OVSA 2PFZA 1TFAA 3FHZA 3CIJA 5ET5A 4ZYHA 3O6HA 3RUMA 4P11A 3M8UA 2ISZA 1B4HA 2KIQA 1URGA 3OSFA 3LMMA 2QS4A 3HFUA 4HE0A 4JSDA 1ULYA 3ROJA 4ELQA 2IA0A 1NHAA 4YFKF 3CJNA 2CMOA 2VT5A 2X48A 4KFCA 5E20A 3OYBA 1CB6A 3IB1A 1SD4A 3GTKJ 2JQ7A 3ZQCA 2K9NA 1HDPA 2LH9A 3QPTA 1T0FA 5KHDA 1K6YA 1M5CA 1Y3NA 4NF8B 3PMWA 3ZMZA 2Y0MA 4O3CA 3R7XA 4I7HA 1UTBA 2MYSA 2O7IA 3DP7A 2A6HF 1MBEA 1YIOA 1FJ9A 2PX1A 5DVJA 2ACJA 3IH2A 4FEBA 4FAJA 4H4KC 1LB9A 5IT9K 4RB1A 1B58A 4MTEA 1JE8A 2NNYA 2XAFA 5E8IA 2OX3A 4MMPA 1ZIUA 2JUGA 2IVMA 1QO0D 1UB9A 2BY3A 3W2WA 2K27A 4DI4B 2H1LA 3FVGA 1P6RA 4LP2B 3ZCOA 1FWZA 3KP2A 5LD2C 1OR7A 3OEKA 4F3PA 1K79A 1ZHFA 2H9BA 3TMOA 1RETA 2OAZA 3SJMA 3FMSA 1MW7A 4YELA 2CZHA 4PE5B 2QFLA 3ELKA 1S8NA 1U5TC 3ZR8X 2OF7A 3IWFA 1KA0A 4XKVA 1NV5A 3Q25A 4JP0A 1MY4A 4FE4A 4E7SA 4LD5A 1T56A 4ZJZA 3FK7A 1KONA 2ZMEC 4M74A 2BXYA 1FLIA 4UB8C 1V55H 1O7TA 1IDYA 1GHCA 2FIEA 3EDPA 3SEZA 2CO5A 2DA7A 1NK2P 1LAXA 4JBZA 4FQGA 2KRFA 4DXBA 5CRYA 2LF8A 3GFJA 3PO2J 2W25A 4RLQA 3TP3A 2P3VA 2KIMA 4TOZA 3VVFA 4Y4RA 2PMHA 2UV1A 2W7YA 3Q3SA 1D0YA 3D1RA 5DVFA 2XUBA 3GLBA 4KT6A 4G68B 1B05A 2LY1A 5D8KB 3OYGA 3IK6B 4N6KA 3F6OA 5F7VA 2WTEA 3GVAA 4Y52J 3IL2A 4GL0A 4LGWA 2F78A 2IBDA 2EIJH 2JK3A 1LFPA 5ICEA 1O3RA 2CZKA 3H6TA 1D0XA 2OD5A 4ESWA 2TCTA 1A31A 1B0HA 2F36A 4B3AA 3P7IA 2AXTC 3KN8A 3CCJI 2QZ8A 1NG7A 4IHSA 1QULA 5F0FA 3MVZA 2JJ7A 4G8XA 4PFBA 4QTRA 3UA8A 4F91B 3E78A 4IRGA 3HHHA 3A4CA 5HS7A 4C0RA 5HOOA 3G6EI 4I09A 1DPPA 1E17A 3QP6A 1NNFA 1QJMA 2KR0A 4CCOA 4Y3OA 5FKKA 3CCQI 1JP4A 1GVDA 2WB1N 1I6XA 4NQWA 4Q48A 3RI4A 3QRFF 1YXIA 3FGSA 2YJPA 4OANA 2MSYA 2I3WA 3BTCA 1JT6A 4A0XA 4A3IJ 1RKMA 1JUMA 3HRTA 3PFIA 5KNLA 1GUUA 3CFLA 5KAIC 2OZUA 1RDYA 3FBIB 3J81K 4HX7A 2Y5LA 2ECCA 2YX7A 2F6GA 3RTWB 2XHDA 1G0IA 3FWEA 1QPIA 3OR1C 1SVMA 5FRNA 1JTXA 3L00A 3TL4X 1H89C 3KN7A 1BK4A 2BY2A 2K02A 3KP7A 3WGHA 1CF7A 4DQ2A 1SFKA 3BJOA 2WADA 5J40A 4ABZA 2WAEA 3V8JA 2F3BA 2QENA 5K7FA 2HOSA 2X7PA 2YPNA 4MHFA 5JVGF 2QS3A 4MJOA 4XLCA 1LEAA 1T08B 1FCKA 1ZJLA 3KSJA 5JLXA 4BQOA 1HSJA 4KQPA 5H8HB 3TTKA 2VE9A 1R9QA 4P3LA 3H3UA 5BQTA 1W5SA 1GTKA 3E6DA 4G6DA 5EGOA 2DQVA 1DPRA 4LLNA 4FIMA 2ONKE 5DD8A 5LHIA 1KZHA 1LFGA 1ZR2A 4L9TA 3E97A 2BXZA 1B5IA 5J47A 2DYXA 3DU6A 4Y33A 4S0HB 3S14J 2DDKA 2GHBA 1IC8A 2O5RA 1L3LA 3B6QA 1BC7C 5K1YA 3ABKH 3O2AA 4U23A 3VB2A 2KHMA 3H9JA 2DA3A 3K4UA 4MCOA 5I57B 4RB3C 1B32A 5CM6A 3IOTA 4QFLA 2COMA 4YIIA 4GBWA 4GWXA 4F19A 2EIKH 1X1BA 3ZQIA 1BR2A 2DA4A 5E1XA 2A5TB 2ZYNA 2OTLI 2DFHA 4KFQA 3SERA 1Z6TA 1XG1A 5M5XJ 1AA7A 1B3FA 4EATA 5J1DA 4OINF 1MQHA 4X1DA 1TWHJ 4LITA 3MJNA 1YITI 2WEFA 3ABUA 4TQUQ 2F5EA 1B9NA 1WJFA 3RYPA 4I98B 3MQ0A 2V4CA 3RDIA 2Y9ZA 4H6DA 3BPVA 1MQGA 1JNFA 1IRFA 4EVIA 4KA4A 4ESXA 4K3FA 4LG0B 3M8EA 4PDHA 5BWJA 5M5WJ 5KCJA 4IGTA 3RGYA 1ZGAA 2CQ7A 4MLOA 1XTAA 4NF8A 4HYEA 4PAKA 1QGXA 3U65A 1DMBA 3UORA 4PDKA 1D8KA 3F21A 4GX3A 5TGTA 2ZYMA 1YLFA 5FFZA 2DWIA 2P0WA 4N91A 3U72A 5AA3A 3LSPA 1IUYA 3MVWA 1XHYA 5HDNA 3DEUA 1TBXA 1M5FA 4CO8A 2VQCA 1R6ZA 1SFXA 3FJ7A 3KYCB 3L2WA 1HBXG 3F8NA 4NMYA 2V7FA 1H43A 5H8NB 4YMBA 2DW4A 1OCRH 2AQFA 1VSOA 2GA1A 2XPVA 2FBHA 3K6GA 1FPEA 1FTKA 4MNCA 3QWLA 2VKHA 2DVZA 2F6PA 1W7PB 3S2HJ 4XF5A 4YB6A 5HLIA 2W24A 3FISA 3FXOA 3AL0B 2I58A 1X2MA 5BOXA 2XF5A 4DIQA 4LZ7A 3LA7A 2UXAA 4IO6A 1O64A 1FQBA 3RYRA 3FZVA 1OQHA 2E1MC 3BR5A 2IXSA 3VVDA 5E79C 2E34A 2IAIA 2VKEA 3K4BA 3GZGA 1DP3A 3F6VA 3KE2A 1B3GA 3MP6A 3H5AA 3GYHX 1O3QA 1BA5A 3EUHC 1MQJA 1X4PA 2HTSA 5HS8A 3BTJA 1XOCA 1KQ0A 2AO9A 2HZDA 2HPIA 4TLLB 4RM2A 1U9OA 2R7OA 3D5RC 4P1WA 4F3BA 1I50J 4A93J 1QKBA 1JKOC 1QBJA 5BPIA 4IQJA 4G68A 1B59A 3FM5A 4JYKA 3FD3A 4RK2A 4LA9A 1G4DA 2RAEA 3THIA 3I4PA 2KP6A 4PJNA 4RXLA 4IHXA 3WODF 3EETA 3DKXA 5C3EJ 1F43A 3RKWA 1FQFA 2GXAA 3BFUA 3DM0A 2P5LC 3CLQA 5ITOA 2N8GA 3W2VA 3HDDA 1GV2A 2JJKA 4NWCA 3HM5A 2NRAC 3JSOA 3EN3A 1HW1A 2LYCA 3E6CC 3B02A 1EZ9A 2ONRA 1F5TA 4GRKA 4IGRA 3KC0A 1IW7F 1RR7A 1U6GA 2B4LA 1ITYA 2JSCA 5D4RA 2FBPA 4DZ1A 1RUNA 4L0YB 2IGKA 4OVQA 1A04A 1IUFA 1ZGJA 3QYEA 3M8JA 2IS6A 4PFWA 3RNNA 1MJAA 2MFZA 2CWEA 3C9HA 3ZGKA 4E7LA 4C2MJ 2NVQJ 2R7UA 1J1NA 5FKOA 1MBFA 4D1QA 5ESYA 4N9HA 4ZC3A 1DQUA 1EA3A 2BJJX 1XGMA 3K1NA 1VQ9I 4MEXF 4HSRA 1S3JA 4U87A 2HEOA 1VQNI 3OYKA 2VL8A 3QPLA 4DZPA 2V84A 1N3XA 5CQGA 1QHHD 4Q5SF 3E3KA 3H3GA 4XKQA 5AE4A 3MVPA 1IXCA 1LQ1A 5ED4A 2CZIA 1G8XA 5HDKA 1FMWA 3G2BA 3O28A 4NF5B 4F3QA 2ZYOA 1WJCA 2HXOA 2H94A 5FROA 3WTSC 5H8HA 3KP6A 1B7HA 1W5TA 2QWWA 3CLOA 4PK4A 3DKWA 3GTLJ 4AIHA 3FKJA 5GTHC 2Y9YA 3EPZA 4BY7J 2E1SA 2V4JC 1SMYF 2L4MA 3I64A 3LQQA 3T8TA 3ZQGA 2NS7A 1TT1A 3U92A 2KDZA 4ZYAA 4ZECA 2V93A 4U2RA 2V26A 2R5YB 4KYSA 3G3JA 4KJZA 4FX0A 4WXJA 5B3SH 1LEVA 2DLLA 2CGPA 1KQ9A 3WTYC 2IS2A 1XSXA 1LDKB 2HCAA 3O66A 3IL1B 3CCMI 4EM2A 5L3FA 3FBNB 2CV2A 2V3QA 2ZYKA 4P0GA 3M1CA 4BJTA 4IO9F 2XXIA 1SFUA 3HHFA 2LBFA 2E0SA 4RA1A 2VB6A 4R75A 5CVIA 2A61A 3WE2A 4WF2A 2VQGA 1IMDA 4OAZA 1MM6A 2HPGA 3QSLA 3U1OA 4AS4A 3WG9A 1BIYA 2A5TA 2I48A 2L01A 3HPHA 1Z0XA 3LSJA 2XD3A 3GMEA 1VFEA 4FECA 4O94A 4OETA 1II5A 1EH6A 2FX0A 2XXYA 1K4SA 2F5DA 4RLFA 1WJDA 2WB1A 3A0HC 3H36A 2K4JA 1E2XA 2XWIA 4DYQA 3CCLI 3PNYA 1H9TA 2VASA 3C18A 3KFWX 3H92A 2Y7RA 3BZCA 4C9YA 3MMYB 3B50A 4LG0A 4GWZA 5KDTB 2EK5A 4D5FA 4E7ZA 2HOEA 2Q89A 4H5FA 2DT5A 1LPQA 1MBJA 4HF2A 3A2KA 1Q1KA 3HGYA 4BBRJ 3BG5A 4G2ZA 1R9TJ 2ZJRF 3V8KA 3OYEA 4WCGA 1MDMB 1NNKA 4E70A 2DJIA 4IHYA 3PO3J 4GGGA 2R7FA 2YUSA 1IIWA 3B7DA 2H25A 3HN0A 3LSFB 3I5UA 4X1BA 5KDTA 1RRJA 3QUJA 5A2QZ 1LGBC 1HOMA 4ISUA 3TAJA 5EG0B 2QEXI 4CCMA 3A0BC 4QRZA 2VPRA 2ZZVA 1USYE 2QMWA 3ZS6A 2EA2A 3BQZA 4U7BA 4HTGA 5JLWA 2WBMA 3BLYA 3ABMH 1BBYA 5J1UA 2OV7A 2KISA 5ICCA 3BR2A 3JRGA 1IN8A 1TW2A 1MPDA 4YEJA 1W7PA 5EEHA 1NV1A 3QAXA 1QPMA 4ESBA 1PP7U 2A07F 1SDXA 2XV4S 3GBBA 4BDMA 2DDBA 2ID3A 1A7LA 3WTWC 5IZZA 4U4XA 4CCKA 3FJGA 3DP6A 3SEVA 2R5ZB 3BCBA 1A8EA 2A3SA 3HTUA 1YJNI 2HNHA 3HEFA 1MPCA 1ETVA 4OMYA 3CCEI 4EQ9A 2HU9A 1FTMA 4F39A 3PQKA 2NVUB 2GM4A 5L9OA 4R1HA 2FE3A 1O3SA 3ZMDA 2CEYA 3QQAA 1EYIA 1QUIA 2G7HA 3K2AA 1IN7A 4OMZA 4A12A 1YO5C 3N6TA 4YFXF 1I1GA 2M3AA 3HUGA 3O2PE 2YU9J 3A01B 5I84A 1RZ4A 2ZC2A 4RS8A 5IAIA 4X04A 4OU0A 3RYDA 2Y69H 3LL7A 3JRAA 4GOTA 3LUYA 1WHUA 4IOCF 1DDNA 4X1EA 3OOAA 4BHCA 3QP5A 2F4IA 3OD7A 4UNOA 3RSNA 1MRPA 2GFEA 4H5GA 4LZ8A 1SFEA 1XVXA 2KZVA 4ECFA 3LWFA 1G3SA 3B6CA 5D5VB 2F97A 2P1SA 3HOUJ 2RF1A 3DELB 3TOBA 4S04A 1FSEA 3GUDA 3WTTC 1RKTA 2R92J 3FIRA 5HPQA 4AIDA 1FQCA 4WWCA 3OYDA 2IGMA 1TWCJ 2AS5F 1M1EB 3ZQ7A 2HDWA 2ESNA 1RC9A 4HV6A 1BL0A 4KIGA 2JPBA 4EQQA 3U93A 1RDZA 3K2DA 1MMNA 4KI0E 5D5XB 4KXPA 1I3QJ 4Z6YA 4YG2F 1DGRM 2BEOA 4NB5A 1FBDA 3MWBA 3ZN0A 3MZ9A 1HQCA 3T9VA 1RNLA 4CSWA 2P2AA 3C7JA 4JWYA 4A6DA 3O6BB 4YICA 2Z16A 4IR8A 3WAFA 2XAUA 4OIQF 2XGDA 3RPLB 1WJAA 5IT9Z 5FLVA 2GXBA 2AHQA 4NF5A 2FOKA 1RYOA 5L8DA 3V7RA 2QQAA 2FXAA 1I5ZA 4BYYA 1B6HA 1OQGA 2NAZA 2ZKZA 3DBRB 1N0TA 2V3UA 1NV4A 3CFZA 1JI8A 2XRLA 3HBLA 1IDZA 2FEZA 1WSUA 2TRTA 3X2QH 3RZDJ 1KA1A 1YS7A 3WHBA 2KQRA 4CYCB 3DBLB 2E36A 3KBZA 4HLYA 3HOZJ 4QFKA 2EFPA 2R5YA 2HR3A 2X7QA 3ECRA 1WI9A 4PGNA 1QQIA 3MFKA 3BQYA 4MGRA 3BR0A 2F7BA 4EJUA 2M0CA 1PEBA 2NOJB 4CZCA 3OEMA 2REGA 1I3AA 1Z7UA 3DTKA 3K0LA 1ZKGA 3LSMA 2K9QA 4HBLA 3TDUC 4WXDA 2A5WA 3BDDA 3PIPF 2F34A 4PGPA 2O51A 3W15C 3CF2A 2LTPA 4XK4A 3D5LA 4V2GA 4GYIA 3RKYA 3W6KB 3I9V2 1FYMA 1N84A 1MMAA 5HLTA 3SESA 1ETKA 4G9YA 2M2EA 4DE8A 4WEPA 3PSIA 2ESHA 2RGVA 4S05A 3M1EA 1P1WA 4NQ8A 3CESA 5CYVA 1LBWA 1SMTA 1RR8C 3FUZA 3PMVA 2Y0SA 4ON0A 4DYRA 3TTRA 1AWCA 3EUKL 2OCCH 5HDGA 4L5EA 3IHUA 2UUZA 4BU2A 2CV0A 4A3CJ 2ANJA 1S7OA 4HCWA 2IW5A 1JKRC 5IYBJ 1D3YA 3OENA 4NAPA 3GEZA 3I59B 1HF0A 2XX8A 4BY1J 4B44A 1LLSA 3ERMA 5H6RA 2VOZA 1EH8A 2ZZWA 2ZFWA 4D7NA 3E79A 3JYRA 3F9KA 3H5NA 4N07A 4DBQA 3WHCA 2DN0A 1TWYA 4E0WA 2WY7Q 1KU9A 1VDWA 2WC2A 1MDMA 5TU0A 1ON1A 2D1VA 2ME6A 4OIPF 5GPCA 4DOZA 2V25A 1Y0NA 3DTEA 1D9QA 1PVEA 3KZIC 4JVIA 3DLLF 4ETSA 3P9IA 1IO2A 1YHQI 5EG0A 3BC8A 5FB2A 5FBPA 1VFCA 4JK1X 4ZDPA 4DXUA 2ZNYA 3W9VA 2Q8KA 4H46A 2I5UA 4I8CA 4PF6A 3TTNA 5FKNA 5E18F 2DTZA 2O9LA 3MBPA 4ZEBA 2XD2A 4OOIA 2CQKA 1D1CA 1HKQA 3F8BA 3O8HA 2QSFX 3K1MA 2AXLA 2HXWA 4OEUA 3OYCA 4BBSJ 2QRYA 1TNSA 1JVYA 4BGDA 2NXNB 3VOEA 2PMZA 5AA2B 2PLYA 4GWYA 4UY8I 3GXAA 2CMPA 2HTJA 2IP2A 3MKLA 2GQ1A 1ZARA 5JI6A 2M0MA 3A09A 2ZXIA 1B8IB 1BIBA 3DLNA 3FVNA 1XMAA 5CMBA 5LTCA 1X58A 1XT8A 4HF0A 2H4IA 1ZK8A 4M6XA 5KCMA 1NH8A 2OJED 2RQQA 4A5NA 4PF8A 1L0OC 2DWJA 4ENKA 5BNGA 1J59A 4LONB 4ZEKA 4I3EA 1RESA 2YPRA 3CUQC 4JQFA 3IAZA 2W82A 4FASD 4IRHA 2NYXA 3GZ6A 2CFXA 3M07A 4Z2YA 4EV0A 2JA6J 1LEBA 2R6GE 4XLPF 5EHMA 3EKIA 1W5CC 4YIRX 2EILH 4PFTA 1IXSB 4BE1A 2DBBA 2LY2A 3A01A 2F4MB 4NG7A 2ECBA 1MBGA 3TEPA 3UR3C 1H88C 1LNWA 5CPRB 1HLVA 1UG2A 1LBZA 3FHNA 3CJQB 4C2UA 5I7IA 2RCBA 3PMXA 1IAWA 1WRJA 2WV0A 3ROUA 2WX9A 3CG3A 5IZ1A 1EZPA 2ZMEB 1AH5A 3K02A 4NF0A 1A8FA 3TW7A 1GGGA 3DWLE 1PC3A 2OWZA 1A99A 5H20A 1QVTA 3FXRA 4MHGA 2JZYA 3SEWA 5CJ9A 2RCAA 4B8XA 1ZGWA 1PP8F 3OL3A 4R9FA 3CG1A 5HLGA 2CFOA 2GRVA 2R71A 1RPWA 3L2RA 1T0FC 4OIRF 1LSTA 2DT6A 1Y4TA 4KIFA 4FTHA 5J8FA 3MAMA 1PDNC 1FBGA 4C3JJ 4HNVA 3I3VA 2RREA 4D0PA 3EQLF 3Q0VA 4F52A 1R4NB 5ILUA 1HW2A 2IT0A 4QSDA 2Q2EB 1FBFA 3ZXSA 1NMUA 1JUPA 4AYBN 4XLEA 4QSCA 4YKJA 4Z0IA 3H1CA 3KJTA 1ETWA 3KPHA 1H44A 1AMFA 4OERA 4IY5A 1MH4A 1JGGA 1S72I 4KHZE 2DMUA 3TCHA 3J80K 1FT9A 2FSWA 2XAJA 2LKXA 2FMLA 5DS9A 3Q0UA 3RPLA 4QBAA 4EDPA 5ET7A 1OR7C 4A5MA 1JUSA 4RB0A 4DBRA 3HOYJ 1ANFA 1D8JA 4PFRA 5JR3A 2EPFA 1DTGA 5FD6A 2WYPA 4DYCA 4HPQA 4H67A 4KYDA 4F29A 4OMBA 3CP2A 4XL9A 5DW8A 5EDNA 4MNUA 3ZMVA 2OCUA 3TQLA 5B1AH 5BUUA 3K7AJ 3QODA 1B7ZA 2X4HA 3HZJA 3KZGA 4IF4A 2PI0A 3KETA 4IXAA 3E4RA 4CYCA 3HOTA 4LFUA 1KU2A 2Q1ZB 3OYNA 3Q9VA 3IV5A 3HRUA 4HNTA 2QYOA 3SZGA 5FJ8J 3IOUA 3PU5A 1LAHE 1LCFA 3H6UA 3JRFA 2R8TA 4PGHA 2LK2A 2UYEA 3R0JA 2OCEA 4FHTA 3BIGA 4M9XA 3JAMZ 3GTQJ 3HSTA 3TZAA 3OXNA 2XVCA 3OELA 2XAGA 3A03A 5F04A 3GLXA 5E3LA 3TOAA 3A29A 2Y7WA 5JFRA 4A3KJ 3G1MA 2MGQA 4OFLA 4ELPA 2QS2A 4CCJA 3DPUA 5AA4B 4B48A 1USYH 1SANA 2CYYA 4ZYGA 1G6NA 4NHBA 1I27A 2BOLA 3DFGA 4IPAA 2XX7A 1NV3A 3OIPA 5EEAA 1Z77A 2IA1A 2VN2A 1IUDA 3NOHA 1UIVA 1K83J 4PJLA 2QSHX 4XEQA 4ASNA 5CMCA 1JXSA 3I59A 4N15A 3CP8A 1YAEA 5B1BH 2F2EA 4EQ7A 3PUWE 2XB0X 4P0IA 2KPMA 3CMMA 1Z9CA 1FSHA 2JTVA 1XC1A 3L2VA 3D1NI 1BI1A 3KFMA 3Q26A 3H3VK 3H9QA 3QU3A 2ZNSA 5EZGA 1LB8A 4JWOA 2ZNUA 4HE1A 3IWZA 2OWTA 4G77A 1FPGA 1DGWY 4HS7A 1LE8A 3EF7A 1K4TA 1EH7A 5J1YA 2EV5A 4AUXA 2B65A 5T3JA 2FNAA 2XHKA 4YB7A 1DSNA 1W7PD 4ND9A 4O3BA 3V89B 1TWFJ 3ZMUA 2DAOA 2PQ8A 5F08A 2Y30A 4BL0B 5FLXK 4U22A 1VE4A 1R4MB 3C35A 2GXGA 3FF5A 1JKPC 4ZZEA 1F9NA 2DPDA 2ZCWA 2VONA 4LN5A 1JHHA 3B8BA 3M3FA 2ZSHB 5KAFC 4Y17A 4ELOA 5FD5A 1X1AA 1W1WE 4EUOA 3AG3H 1B8IA 3O6IA 4RPNA 3RCOA 4ZYDA 3HJEA 4L9JA 4LK0F 3HPIA 2IJLA 1KYWA 2PBIA 1B40A 5EZHA 4ZTFA 4M1VA 2JN6A 1HW5A 3FXUA 4GRIA 1WH7A 4MAGA 3CDHA 1A5JA 4Q5TA 2DTRA 3MAJA 1P99A 1WH5A 5IGAA 4KITB 2DS9A 4RB2C 5JEIA 1T39A 4BNCA 5DT6A 2DMTA 2L3DA 4ZEIA 2HVQA 3SETA 4QFNA 2VPNA 5B7DA 3PTYA 2GBYA 2MLGA 3J7AY 2CUEA 3L2CA 3TKDA 1IV6A 4J19A 2XXRA 1B9MA 1PBQA 5DUKA 4Q0CA 4U0WA 3DEWA 4EEFG 4ZEFA 3T0YA 4NC6A 1VQKI 5JTYB 2E35A 4Y7NJ 2R93J 2PFYA 3RT6B 5FTHA 1R5HA 5J1RA 2ZMEA 1R9LA 2E1MB 3BCAA 2Y5KA 2E7WA 2V3TA 1BW6A 2V6EA 1NNTA 3E5UA 3JRDA 3GTGJ 2XKPA 4AB6A 3JTGA 5A5LA 5CMKA 2Q74A 3MCZA 3IFAA 5K2XA 2KZGA 2A69F 2O03A 1A54A 3G3KA 1V5GA 1NUXA 1XVYA 2FNCA 1UZCA 5C4JJ 2HYJA 5HODA 3OYMA 2LG4A 4GXAA 5A5XB 5GTIC 4XMYA 3OYAA 3CO7C 1JT0A 2L02A 1UCRA 2Q2EA 5F0CA 4IKFA 1C0WA 4XLHA 1EF4A 1ZRFA 3O8GA 1R36A 5CVVA 3FM3A 3J7AO 3FVOA 1F1ZA 3E1SA 5E3NA 4OQOA 1XGSA 1X3ZB 4PAIA 4II2A 4PSXA 2TDXA 1W4MA 3HSEA 1XGOA 1ZR4A 5CMMA 2H5YA 2QPQA 2OC6A 3ZMTA 2XXTA 1WJ5A 4R9GA 1ENHA 3DPTA 3I53A 3TCFA 2K3PA 3WU1B 3GFLA 4AC0A 3RY3A 2DFIA 2PG4A 2RC8A 3IR1A 1WJBA 4MX6A 4FEDA 3E9XA 4A0YA 1NTCA 2M1BA 2IPQX 4XN0A 4MLQA 5ILVA 2VOOA 3TDZC 2GOXB 4R72A 4YAHX 1SVXB 1OCCH 4HEA2 4MH5A 5TPAB 3WG7H 2XWKA 4NNJA 1BN5A 1Z67A 2R7WA 3K6VA 4YKIA 1FTLA 4RAGA 2DYRH 2Z2SB 2FF4A 3BJAA 2DVCA 1V3FA 4OFJA 2EBIA 5DM6F 5F1JA 1E0EA 1MZBA 1B9JA 4CDGA 2JA5J 3OO9A 4A69C 3HKZA 4YB5A 4CCLA 1OLCA 5EYRA 3UGWA 4BLAA 1LVKA 2CZLA 2BHZA 2L2OA 2IGOA 5DCMB 3H0DA 1V5FA 1MJ9A 1K7AA 4KYWA 1WFXA 4M9SA 1XDSA 2H6CA 2M4GA 3N05A 4G68C 1MBHA 4OVRA 4KMFA 5JK4A 4WKMA 5J4YA 3I6VA 3K70C 4UB6C 5IY5H 4A3JJ 2B4MA 2REJA 3SQNA 1G59A 2Q0OA 1JETA 1LFUP 3MPKA 1BI3A 5I56B 1W36C 2V9PA 2K85A 1FBEA 5AA4A 3LA3A 5ELVA 3KYLA 3DKYA 4O7MA 2VHAA 2ABHA 4M3BA