3K1MA

Crystal structure of full-length benm, r156h mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
300
structure length
300
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 96
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA03
5D5XB 3I64A 2ZYOA 4TOZA 1POY1 4WXCA 2Z9OA 1LAFE 1IXHA 5ICQA 1QPMA 1XSDA 1ON2A 1KWHA 3KG2A 3BZ6A 3MC2A 3OEMA 3QSLA 4YAHX 5EYFA 3K00A 4X1DA 1RIOH 1EH7A 3SXYA 4LFUA 4G8HA 2XXHA 3PPOA 4POXA 4I0BA 3H3UA 2VT3A 2IA0A 3FZVA 3BJAA 3PMXA 2EA2A 1STZA 3DP7A 4UV9A 3PD9A 1M5DA 3IL1B 4WK8F 2KJBA 3RNNA 1MQHA 3F6VA 5B7DA 1Z7NE 5E18F 1KU2A 1I6AA 2UXNA 3GXOA 3Q29A 4O3AA 2F7BA 3M3KA 5I57A 4ZDMA 5I56A 4IVNA 5J6XA 4M6YA 4FATA 1W5SA 3TKYA 1VFDA 4R2FA 2HZTA 2P5KA 3CUQA 3TUSA 1FQAA 4ZECA 4L5JA 3DP4A 3L9FA 1FP2A 4LK0F 3O6IA 4QSDA 3B6QA 4EXKA 3H6VA 2WV0A 4YU0A 3MZ9A 1ONVA 1EH8A 2ZKZA 2VGQA 1ZGAA 4XKQA 2PBIA 1S3JA 1PB7A 2IRFG 3HPIA 4EXLA 3ISPA 1Z6RA 4A6EA 4N13A 2GHBA 1ZMGA 4Q47A 1Y0UA 1FQDA 4P0GA 3ZSFA 1IRFA 1B52A 4HYEA 4NF5B 4LQ2A 2I4CA 2O8XA 4L0ZB 5DCFA 3GZGA 2ISZA 2ESNA 3T1BA 2ONRA 2BEOA 2HZLA 4JBZA 2NUVA 3C31A 1U78A 1NNKA 1PDAA 3PUVE 1OR7A 2W24A 1GGGA 3IORA 1DPEA 2JPBA 4BAYA 2K86A 2CGPA 3OENA 1YQAA 1OQGA 4Q0CA 4AB5A 5IAIA 3DF8A 3DKWA 4U7DA 3F8BA 2O69A 5DVIA 1SFUA 3KLOA 5BUUA 3S9EA 4MTDA 5D5WB 1F1ZA 3PUZE 4H1XA 3DQVC 3TTNA 3H06B 3RGYA 3JAMK 3IB1A 2F36A 2OWSA 3ZMDA 2PI0A 3BKIB 1TFAA 2OLBA 1Z7UA 4RB1A 3KOSA 1DDNA 4Q5SF 3IOVA 2M1BA 1SDXA 4DIGA 5E8GA 2P1SA 4LATA 4ND9A 4ONYA 4M1VA 3VLWA 3VFJA 1Y3PA 1Q1KA 1MH4A 4IHTA 1UTBB 3LAJA 3HYIA 3C1DA 5F1RA 1OVBA 1P1OA 3TCHA 2EV0A 2VODA 3VOEA 1KYZA 3GFMA 3RKXA 1TW3A 2UXXA 4H8IA 1N76A 2Y7RA 3HCQA 2QPQA 2VE9A 1EZ9A 4L9JA 5IKBA 2GRVA 4I01A 5K2YA 4AVPA 1H9TA 3S2WA 3BFUA 3V83A 1WQ2A 1IITA 5FHNA 3K0VA 5TPAB 4RNSA 4HX8A 1FY7A 1N3XA 4DXCA 5FHMA 3I5UA 3P9IA 2FMYA 3UGWA 3BPVA 2F7AA 4DE8A 4G68B 1TT1A 1MY1A 4CICA 1MRPA 3CVGA 1Y3NA 4LP2B 4NQWA 4DNCA 5K5OA 4XKPA 5A5XB 3KP3A 3V7RA 5CBRA 5DV5A 1FLIA 1ODDA 1R5HA 2K02A 1B58A 3FV1A 4HBLA 3E13X 4KHZE 3BWGA 3C34A 4YKJA 1FX7A 4KYDA 1DTZA 2XAQA 4HDUA 4X48A 3ELKA 3SFZA 1W5TA 3M8UA 5I59A 4IO3A 1R7JA 2ACJA 2FNAA 3UP9A 1ZN2A 1LAXA 2RCAA 3IR1A 2Q2AA 2G93A 4GCVA 2Y7PA 1ZIUA 1XGSA 5I84A 3EDPA 4RB2C 3T96B 2PJPA 2ADUA 5H8HB 4ENJA 3FVOA 4R9GA 3GFIA 2M5WA 4OIPF 1T0KA 4L17A 1IXSB 4UVBA 5FFXA 1OKRA 2KKOA 2OCUA 1J1NA 3K01A 1IXIA 1TBXA 2HEOA 4HQEA 4NWDA 4Q30B 1B2HA 3K0LA 1VFEA 1EZOA 3T9UA 2HYFA 3T8TA 3M7GA 4AIKA 4KICA 2RNJA 2VBWA 3Q9SA 2VP1A 2V1UA 2DS9A 1QVSA 4KD5A 4ZEKA 3GLBA 1URGA 3E5QA 1UFMA 2QS2A 3UN6A 5JK4A 4M9XA 4G7ZF 4A5MA 3N26A 1FNNA 4NB5A 4I98B 1D8KA 4M74A 3R4KA 4LZ7A 4A5NA 3C9HA 2P7VB 3I4PA 2DPUA 1Q35A 3E3VA 1IN6A 1XHYA 4NF4B 2AIXA 3LBSA 1BI0A 4IY5A 4R72A 4ZYEA 1OLCA 3MVYA 3WTUC 3MP8A 3D4GA 1YO5C 4BDRA 3A09A 3E6DA 1EH3A 1GR2A 2XAJA 3J80K 2F78A 4MLVA 3QAXA 2QMXA 3FATA 5I58B 4OFJA 4BLAA 1QUKA 2R7DA 1B05A 3W9WA 1FTMA 4F2OA 5ERIA 2O61A 4MQ9F 2ABHA 1SMTA 2KIUA 4N9HA 4EQBA 4G7OF 4KYSA 3TCGA 1T6SA 1M5FA 4HLYA 4IO6A 4TLLB 1C0WA 4ZYHA 2O1MA 3RN8A 2W7YA 3U92A 1P1WA 1SMYF 3B6WA 1HKQA 3PV0E 2RCBA 3SETA 3TGNA 3H03A 4F3PA 1JHHA 1H43A 4R9FA 1W7PA 2Y75A 3PQJA 3I5OA 1Y1MA 1WI9A 2WC2A 2X7PA 4F39A 3C3WA 3PMWA 4LMYA 4CGZA 2WKYA 1MQJA 4QFPA 4ELPA 4R6HA 3CUQC 1MY0A 4P0IA 2UVHA 1P1QA 3CJNA 1G4DA 1FOKA 2H25A 3F8MA 1MS7A 5H8NB 4IHSA 2C6YA 3G3KA 2EFPA 2HKOA 1POTA 1S7AA 3N4MA 2RV8A 1YW7A 3U72A 2RC9A 3FJ7A 3N97A 2XASA 4PCQA 1PEBA 3HTSB 4XKNA 1LFGA 4NHJA 4HF2A 3RUMA 1BI3A 1XGNA 2R9JA 3SEVA 3E5UA 3QU3A 4ENMA 1HW5A 3M8FA 1KU7A 4YZZA 4E0WA 1XGMA 4U2RA 5CMKA 1M5BA 1MG1A 4BHBA 4ISUA 3O66A 4WXHA 4ELQA 1R00A 4ELRA 3PD8A 5CVIA 2O7UA 1PBPA 1IAWA 2AYSA 4LZ8A 4L9NA 1SD7A 4QSEA 3K2DA 1IEJA 5DTBA 2K27A 2KJCA 1TNTA 4OYVA 2IW5A 1BJAA 5L3FA 4YKKA 3T9VA 2UVGA 4UUVA 4H6DA 4XBFA 3O6BB 2I3VA 5KCJB 2BGCA 4EJVA 3EN3A 1PP8F 4QFOA 3ML6A 1O3QA 4DDDA 4JBAA 1IQ7A 3RT6B 3TTKA 2QBYB 2ETHA 4L0YB 5JI6A 4JWXA 5LGTA 1MQIA 1Y3QA 3UK4A 5HDGA 3EETA 1B40A 2MLKA 2Q9TA 1UTHA 3W9VA 1HBXG 1QUIA 4A0YA 4I62A 3LQQA 4EF2A 2Y48A 2EFWA 2QSXA 4X1BA 4CXFA 2NWJA 1S29A 3R6SA 1M5CA 2L4MA 4OMBA 4MFIA 2FBIA 1FBQA 5HBCA 3GWZA 3ABTA 4MEYF 4YICA 1TLHB 1GV8A 2DBBA 2W85A 3DM0A 2ONSA 4TV7A 3REOA 2KIMA 3I53A 3ROUA 1XS5A 2G29A 3QPTA 5AA2B 4JQFA 5HDNA 4ZE8A 2HWVA 4JSOA 3PMVA 3TKDA 3LSTA 2P4WA 3ZKLA 4MHGA 2Z99A 4KIBA 5FLXZ 2OZZA 4DXUA 2H27A 5H8QA 4LG0A 4GL0A 3LA2A 2G7HA 4QLCU 3CG3A 1LEBA 2GZWA 4RY1A 3GF2A 3C32A 1H3DA 4PFWA 3LR1A 3M9AA 5ICFA 4HV6A 4E70A 4B8XA 4OU0A 3HHHA 4AQ4A 4PGGA 1R22A 4NF8A 2A6EF 3L09A 1LB8A 3R26A 5AIPA 3K1MA 3IK6B 1AIVA 5CVJA 3RYPA 2H98A 3CR9A 4XTCQ 2REGA 4EJOA 4XXUA 3GYHX 4O3MA 1G3WA 1R9LA 4YB6A 3IRRA 5TP9A 2QYOA 4LUBA 1FP1D 2F5EA 1II5A 2P7CB 1FC3A 2E1SA 1REPC 1L3LA 4F7ZA 4F3GA 1F9BA 5AA1A 2JZYA 5I2KB 3TDUC 2OJTA 2DI3A 2O68A 2I58A 3WGIA 4IO5A 3BBRA 1B7UA 2MH2A 1MPBA 2XGXA 5HLHA 1W4MA 2O3FA 3N5LA 1DPUA 3WGGA 3FHZA 4HDVA 2V9VA 4Q4ZF 3H7MA 1KQ8A 5D5VB 3FF5A 4OETA 4L18B 2VC1A 3GUDA 2FBHA 1NH8A 1IRGA 3QPHA 4BHCA 1JVXA 5BWJA 5J8CA 3FXQA 4CDGA 2IJLA 2H09A 3SDFA 2XX9A 3C33A 2DXYA 2OA4A 2VOPA 3KLNA 2REJA 2JT1A 4KQPA 2YJPA 2ANJA 3VB2A 3S9LC 3AAFA 3DP8A 5J8FA 1BIYA 1SD3A 1HSLA 5JTYB 4ZZDA 2ZO4A 1Z7ME 4RGSA 4IO4A 3EYIA 1S6LA 2OBPA 2ZNZA 4WWCA 3OSRA 1R36A 3OMBA 2P2AA 5L8DA 3VLUA 4G68C 4YMAA 1SD6A 3TO9A 4YFXF 1MH3A 2FNCA 2CO5A 1B3EA 1J7KA 5JVTA 1P4WA 3WTVC 3TZAA 2D21A 3U9GA 1S9TA 4OENA 5IT9K 2MD5A 4BDOA 3TODA 4KFQA 2PX1A 4ENKA 1O7LA 2GH9A 5E1ZB 1MZBA 3IX1A 5FTIA 2DQLA 4Q48A 2EK5A 2F5DA 5CI5A 4HV5A 1OMPA 1A04A 3QP5A 3H6WA 3T9XB 2XRNA 3OELA 3WE2A 1FTOA 2PMHA 5CLSA 3KZYA 4EM0B 3M3FA 3HRMA 3C35A 2H94A 2NRAC 2IP2A 3KEQA 1AL3A 3TO6A 5FB2A 2CQKA 4HQMA 4K3FA 3RDIA 5HLIA 2PMSA 4ELOA 4HW8A 4B09A 3ZMTA 5ICEA 4H5FA 4I8CA 1WWXA 3GEZA 2PYYA 5D8LB 1DTGA 2KRFA 1K78B 5ICGA 2CG4A 2V6CA 4OXVA 5EHSA 4ZS9A 2XXIA 4M71A 2A68F 4OIOF 1XOCA 4KT5C 5DT6A 2XXQA 1QULA 3G3GA 5H8SA 1BKAA 4P96A 3MCZA 5LRRA 4BDMA 1ZH5A 4HX7A 4N0BA 3O28A 2HFBA 3K02A 3Q27A 1JHFA 2PLYA 1RYXA 5H6RA 5AE4A 1ZJLA 3M8EA 3M1EA 1GVJA 2OK2A 3MPLA 4N6PA 2K4JA 1JEUA 1KQ0A 2RGVA 3JTGA 4ZEIA 2L3DA 1PB8A 5DUIA 5CVRA 4CZZA 2EFQA 2HQ0A 2G9WA 2O03A 1B1XA 1B5IA 3G3ZA 1J75A 1JW1A 2HCAA 4HW0A 4H0EA 1N7WA 5L3CA 3FIRA 3F72A 4HZFA 3WODF 2STTA 3ABUA 2DLLA 1H9GA 4OFLA 2DE4A 3HV1A 3TAJA 4EQ9A 3ZMZA 3OO7A 1FQEA 3NEUA 1M5EA 2YX4A 1OYWA 4UNOA 3VXBA 3W6JB 1G3TA 5A2QK 5BPIA 3IOWA 3V8XB 2O6AA 5FHOA 4GGGA 1SD4A 3L7WA 4ZE9A 2ZMEA 4XLNF 4A12A 2GWRA 4QRZA 3A3UA 3KE2A 2LAOA 3MQ9A 1Z1DA 2XUBA 2IEEA 4HS7A 3MWMA 4BDQA 1ZLJA 1YS7A 1FBUA 3RPUA 1J5YA 1AWCA 2F6PA 3OO9A 4PFTA 2NVUB 1QO0D 3MPKA 2XIGA 2PVUA 1ZG5A 1HKTA 3N6UA 4ZZEA 3OO6A 2ZNUA 4IXAA 1YPNA 1P4XA 1QQIA 2X4HA 3DPLC 5FD5A 1R1UA 2HFHA 4IY6A 1HKSA 3O6GA 4NF6B 1MY3A 4FECA 5EEHA 2Z8FA 1KA8A 1MXZA 4BHPA 2QMWA 2XX7A 4GVOA 4AWXB 2FBKA 4G77A 3EYYA 1B0LA 1T2KA 4IGRA 2LF8A 1MGTA 1FSHA 3BJ6A 4YB7A 3WU1B 2XXTA 1S7YA 1B6AA 1LJ9A 2HS5A 5D4RA 3SZTA 1SAXA 4H65A 4G8MA 3U93A 3MZBA 5CMMA 3CUOA 3BJOA 1JNFA 2XXRA 4C1UA 3VODA 4MLQA 3U1OA 2LDUA 5FD6A 1D9VA 2FYIA 3KP4A 3MEXA 3E5XA 1P1UA 4U0VA 2EFNA 3P9KA 3E97A 3T0YA 1B9JA 3PGFA 4I9DA 2QENA 3MVWA 1UHMA 4M6XA 3Q28A 3RTWB 2V3UA 3FMSA 1NNTA 1EH6A 1B3GA 4PQJA 2A61A 2NYXA 3MZHA 1A7LA 2DW4A 1JETA 1B4HA 2XHKA 5LLQA 3V8KA 2OQRA 5IT3A 5LEKA 2VBYA 5L9SA 2H99A 2ZXTA 3ZMSA 5HPQA 2W57A 5HS8A 3F6OA 3K9TA 5KK1A 1B59A 2QS4A 3RTFB 3G3HA 1D5VA 2XX8A 5LGUA 4OERA 4NF5A 1BIAA 3RKWA 3GX4X 3I0TA 1ZRFA 3CTAA 1LNWA 1NNFA 3ZN0A 4Z0IA 1P4AA 1JVYA 2F2EA 4OFOA 4U88A 1D4NA 3TELA 3SKPA 4G6DA 2XXUA 4OESA 1RI7A 5TRDA 1XSXA 2RQPA 3MP1A 1LDKB 5L3DA 3VVFA 2PT2A 2RC4A 1R1VA 3F8FA 2ZNYA 4P9UA 3QAHA 1FTKA 5DUKA 2E7XA 3CSGA 5CVVA 3E3KA 1Q1HA 1FCKA 2O7IA 4HLXA 1BC7C 2DE2A 4PE5B 4R2BA 3QIMA 4OHNA 2DQRA 5KDTB 3ECRA 2QQAA 2R6GE 2DYXA 4M9SA 3HOSA 2DWHA 2H5YA 2NOOA 1J9IA 1XGOA 2YR2A 3HRSA 4G9YA 2YSRA 2QUFA 4RGUA 4LLLA 1JW5A 1UTBA 3J81Z 1I69A 5E17F 4KYWA 1AOVA 3GZ5A 2NAZA 4LGWA 4OMYA 5FTHA 2BV6A 2DVCA 3LAPA 2OBGA 3VXCA 4RAYA 3TDZC 3FGSA 3DV8A 1RKMA 3D0SA 3IB0A 3WTTC 1OVTA 3EQLF 4QFLA 4F1UA 3MAMA 1TNSA 3GZ6A 4ZYGA 4O5VA 4Y13A 5H20A 2M87A 1IN7A 2FRHA 1S8NA 3EPEA 3MZ1A 1FQBA 5BMZA 2LF7A 4ZYDA 4NWCA 4Q5TA 3LWFA 1FWZA 1A8EA 2UXAA 3FMRA 4ZEDA 1IIWA 3QOPA 1ZKBA 1H0MA 2RINA 2A5TB 4CYDA 3MQ0A 5TPAA 3J80Z 1U3EM 4U21A 3PUYE 1FYLA 1OQHA 4GF8A 2HGCA 4RGRA 2EFOA 4PP0A 1Z91A 3AXFA 4BQAA 1MJBA 3FVGA 3WU0A 1N3WA 2QWWA 1FTLA 3I6VA 2FU4A 4ESWA 4G68A 2W25A 3F8NA 3KCCA 4IRHA 1JW4A 2Z8DA 2BYVE 1B51A 2HAUA 2VD3A 1IW7F 1CGPA 4AIHA 2Q0OA 5A5XA 4FJPA 1T39A 4ESBA 1A8FA 2F8DA 2ZCWA 3SEUA 3O3KA 4G2ZA 3VV5A 4DZ1A 2TDXA 4F2QA 1MXVA 4G7HF 4D0PA 2XXXA 3EHTA 2VT2A 3HN0A 1G6NA 4I0AA 3C18A 2D2WA 1XVYA 4F19A 3WE3A 4IJAA 1SW1A 3KP2A 3IWFA 1DMBA 3CFLA 2IA2A 5LHGA 1MPCA 3VEPA 1D3KA 1ZU0A 1GHCA 3W6KB 3KJTA 1TW2A 5BOXA 3G73A 4GXOA 3FJGA 2DPDA 3KSJA 1O3TA 4UHTA 5LEJA 2EWNA 3R6UA 2CMOA 5H8HA 2Q8KA 2ELHA 1U5TB 4PDKA 1PC3A 2M8CA 4HCWA 2LKPA 2XXWA 1G3YA 1ZLKA 2PT1A 1MY2A 2F34A 4LB6B 4ZZLA 1HSJA 2P6SA 5CC2A 4U0YA 1ZTYA 2GAUA 3CRBA 2GA2A 1WSUA 5HDKA 1LBBA 1LLSA 4QFNA 3SERA 4EDPA 3H6TA 2A69F 3QXMA 4H8JA 1EZPA 1ATGA 3ILUB 2FOKA 1XB4A 3MAJA 2XV4S 3O2PE 4A0XA 3MVZA 4O6JA 4KDPA 2ZNTA 1Y9UA 5ICCA 2R7FA 3ZQ7A 3OSQA 2XD3A 3S2VA 1FT9A 1E2XA 4NF4A 2F97A 3UIFA 1IN4A 2D3IA 5AA4B 2XVCA 3D4CA 4R75A 5DCMB 2MC3A 3FX3A 3T8RA 3A3CA 2P0SA 1YG2A 2VD2A 2OWTA 1QNTA 4L5IA 4GIZA 5H8FB 5I58A 5BPDA 4H0WA 2HOEA 4EM1A 4FX4A 1B1BA 2A5SA 4PGHA 4E0XA 2ZJ2A 4H5GA 1XCVA 3ONMA 2F5XA 3EHUA 1MD0A 3JZJA 3RPWA 1GVCA 1GXPA 4EQ7A 1I6XA 5E20A 2RKHA 1I6BA 5KZTA 3JYRA 3MJNA 4LLGF 4JXIA 4NMYA 4JDFA 3WG9A 4U1OA 1YLFA 4XIGQ 3WAFA 3O9PA 4GFRA 2RVCA 4UV8A 1AH5A 2GXGA 3SEXA 3V7SA 3HRUA 4N07A 2HKXA 2VXZA 2GFEA 3TEPA 5LGNA 2NS0A 4KMFA 1FBSA 3CIJA 3WAEA 5H8NA 1HQCA 1IXGA 1FYMA 1W7PD 5TJJA 4GQOA 3K69A 4GXAA 4OMZA 3B02A 5I2NB 1ZG1A 3KZGA 3LQRA 4JK1X 4EJTA 1IXCA 3G3FA 2H4IA 4L9TA 4FE8A 4HAMA 4QFKA 1SW4A 3KOTA 4QHQA 1DUXC 1B4AA 3F23A 2Z5UA 2CYYA 5ILVA 3ECHA 3P7NA 4LZ5A 3ZMUA 4LK1F 3IKVA 3KFWX 3C4MA 3R0JA 3GFJA 3KEOA 2HQRA 2O0YA 1BTJA 1RYOA 2PN6A 2EB7A 2DT5A 3TO7A 5L3GA 1OPCA 4AB6A 1YYVA 6PAXA 4PZJA 4F3SA 5JR3A 3FUZA 4M73A 3KETA 1AOYA 2B65A 3FWEA 3EHSA 2CSOA 1US5A 3P7IA 2VC0A 5KCJA 2FA7A 2CZLA 3PU5A 2PBWA 2QBYA 1MPDA 3KP7A 1DPRA 4UA8A 4RK2A 4PFYA 1ZRDA 3B6TA 3H3GA 3KN3A 1S7OA 2I3WA 4P5OA 1A54A 4KR5A 4EVIA 1VSOA 2HTJA 1F5TA 1B46A 2Q8JA 3RT8A 2HYGD 1B7HA 3RI4A 4YG2F 4KA4A 3WGHA 4G8NA 1XCBA 3TYHA 4YKIA 3HRTA 3ZKKA 4ASNA 4I09A 1I6QA 3LA7A 2RC8A 4LQ5A 4BNCA 1Y1ZA 2F7CA 1UB9A 5AA2A 1N84A 4MNUA 1SFXA 1XDSA 4Z7EA 4PFUA 3R0AA 3BY6A 1MDQA 1LDDA 4PETA 5ITOA 3JTHA 1UHWA 1IN8A 1LB9A 1SVXB 2QQ9A 3F8CA 1KU9A 3F3XA 2Q2CA 3IOTA 4KN7X 3PPNA 4UACA 2YU3A 3KP6A 1WDNA 5LBQA 3F21A 5CMCA 3G3IA 4GYGA 3I54A 4DXBA 1FYKA 3GO5A 3FM3A 1QZYA 2W84A 2DK8A 2MA3A 3RTRA 4IF4A 3MFKA 2UZKA 5IT9Z 3LSXA 4OZ9A 5HM4B 3OOPA 1FZPB 1LSTA 4QSCA 2O6GE 1CF7B 2UVJA 3SESA 1WODA 4XRFA 1XMKA 3GLXA 3MBPA 4F22A 4WEPA 4G6QA 4RA1A 3WTSC 2JPCA 3DLNA 2IT0A 3CFXA 3K6VA 3HHGA 3RPQA 4MBPA 3RIRA 1SYIA 1MDMB 2VN2A 3I59B 1MDP1 3BPXA 4P55A 5ED4A 5I2KA 3SEWA 1WVJA 4ESJA 1G3SA 1BN5A 3IRQA 3HTUA 3BFTA 4GYIA 3FJMA 1ZAOA 2FF4A 2ZFWA 5L3EA 4BH9A 3OO8A 1EV7A 3PUWE 3B73A 1B5JA 4MTEA 1U2WA 4LJZF 4FHTA 2OQGA 4KCCA 1K79A 3PQKA 2X26A 2RDPA 4X9TA 1I1SA 2HR3A 2L02A 1FQFA 4KPTA 1X3UA 4HF0A 1NKXA 1A99A 3C36A 4YIIA 3G7WA 2Y0MA 3IOUA 3DPTA 1JE8A 5DEQA 1MXYA 1IXRC 3E9XA 3COAC 3K4UA 3J7AO 4TQUQ 1V4RA 4XKRA 2DWJA 4RB0A 3ZPLA 3R60A 4RJZA 4ZEBA 1ZRCA 4F29A 3HSRA 1WRJA 1TFDA 3THIA 2I6EA 1XSVA 4F31B 1LGBC 2ALUA 1SW2A 2E1NA 3TOBA 4P11A 5JTYA 2OD5A 1LEAA 5I57B 1H44A 5JHUA 2UYFA 4GRKA 5I56B 1SW5A 3L6HA 1I5ZA 2D5WA 4OTEA 4UVAA 3CUQB 5A2QZ 3FVKA 3ULQB 3KJ7A 4F1YA 1A40A 2F6GA 5L3BA 5K2XA 5DD4A 4QWQA 3QUJA 4HCYA 4FX0A 4JWYA 1B6HA 3MP6A 3T9HB 4K2EA 2IA1A 5AA3A 4C1TA 1NH7A 1OYYA 1Y4TA 1JEVA 3JV9A 1YCJA 2LSOA 4A6DA 3RQTA 3DELB 4EM2A 3CI8A 1MKMA 2MBFA 1KU3A 3BROA 1FTJA 4Q8RA 2RN7A 1OLAA 1RZ4A 2DOJA 1O3SA 1QGPA 3H3ZA 3HSTA 1F4KA 1UIUA 3LFKA 1IF1A 1P92A 3O6HA 1P1NA 2B3BA 3D5LA 2FXAA 4M4GA 1QBJA 3LSLA 1U5TC 2I0CA 3V5AA 4OWDA 1NNPA 4WCGA 4R6KA 1LAHE 1KGSA 1J0RA 2ZXJA 1I27A 3O29A 3HHFA 4OVJA 2A3SA 1YW8A 4GL8A 2E7WA 1ZBMA 1Z9CA 4JB7A 2HQNA 2P6TA 1K78A 4GXSB 3NQOA 2CW0F 4WX9A 2CWEA 1TWYA 1F9NA 1LAGE 5F7VA 1O63A 3ECOA 3G3JA 3OV8A 2Z3YA 1VE4A 3GBAA 3JAMZ 2XROA 3LUYA 3V89B 3IB2A 1QKAA 4ENNA 3V8LA 3C7JA 3RJPA 2ISYA 2B3FA 5HLGA 4WF2A 4YMBA 3R7XA 3QU6A 4KMUX 3KSXA 3IO4A 3OD7A 5E1WA 4EMSA 3WTYC 5K5RA 2V3TA 1HW1A 4F18A 1T0FA 1NFTA 3OOAA 5CMBA 1DP7P 1ZARA 2OZ6A 2V84A 1KQ9A 2DK5A 3GBBA 2HDCA 1N7XA 2Q88A 3U1DA 3KP5A 3MWBA 4OIQF 4OEVA 2F5CA 1VTNC 3ZN1A 3VVEA 1XVXA 1HSEA 2Q89A 1P6RA 2QS1A 2I0BA 3LSWA 4I2OA 1XN7A 1EU8A 2A5YB 4OEUA 2OAZA 1LVAA 1LFIA 4KNYA 2DQVA 2LNBA 4G4PA 5TU0A 2QL3A 2L54A 5B70A 4IO2A 4YFKF 1YTVA 3DP6A 3VLVA 5JFRA 4I02A 4RXLA 3IWZA 5D6EA 1JQFA 3SEYA 2VBZA 1USTA 1CB6A 1OMIA 1B3HA 4C0RA 2CFXA 4NF6A 1P2FA 2YPRA 1LCTA 2M45A 4IRIA 1B3FA 4XSZF 4LA9A 2FNPA 2X7QA 3KN7A 1MJAA 4HX4A 2EV6A 3DXJF 3GW2A 1R9QA 4R6YA 1PB9A 2DVZA 2K4BA 1YAEA 2XD2A 4L9VA 2Y7IA 5I59B 3Q5FA 4R79A 2FEZA 1B9NA 1MJ9A 4MF3A 3OEKA 2I48A 4U4XA 5L9OA 3U8QA 1YFHA 2THIA 4UXNA 2RC7A 1R1NA 1E17A 3K6UA 1ELJA 1H76A 5DVJA 2R3SA 1N0TA 3S9NC 1RUOA 2D1VA 5F1QA 1U6GA 2QRYA 4Z2YA 4G8XA 1Z6TA 2V93A 5L9MA 1B7ZA 3M3LA 1BBYA 2DXRA 4RS8A 2V3QA 1B0HA 3IHUA 1B4ZA 1IUDA 2Z8EA 3RLFE 4MEXF 1P99A 2MH9A 2HXWA 3ODBA 5E8IA 3QUFA 1FPQA 2DAOA 3HUGA 4KN4X 4NEDA 5M2VA 3QRFF 4EJWA 2MLGA 3TMGA 2JRTA 5DD8A 5HS7A 3KFMA 5J1DA 2Z22A 1MY4A 5HVQC 1DOTA 1USYE 3MVXA 1BC8C 2H9BA 3F22A 2DE3A 2KLFA 2HEUA 3PUXE 4I1DA 2XXVA 4OINF 3T93B 2QVOA 1HW2A 3PPRA 1BI2A 1YIOA 3KZZA 1R23A 3TDJA 3O97A 2ONKE 5ICTA 3MZYA 1LFHA 2UWMA 2Y84A 3T22A 2A6HF 1LCFA 4M9ZA 4O3BA 4RPNA 2J5PA 1T38A 3HIFA 3KN8A 4FEDA 5LOMA 3H92A 2VE8A 5KDTA 2IA4A 5HS9A 3CG1A 2ZBKA 2AL5A 3FV2A 1Y4CA 2I4BA 4DCYA 1ANFA 1HSTA 5D5UB 2QS3A 1FQCA 2AXLA 1DPPA 3PFIA 1MXUA 3QK6A 3EQ1A 2VBXA 3QYTA 2V1XA 4MH5A 1JXSA 4ZEFA 1ZREA 3TTMA 2O1LA 1W7PB 2H6BA 2AL4A 4G94A 3J81K 4LONB 2X0LA 3E6BA 3ZMVA 3CSBA 1URDA 2QLZA 1TTYA 1Z05A 3FXUA 3IC7A 2RF1A 4KYEA 3V8JA 1B1HA 3RY3A 3E6CC 1OIBA 4WEDA 1ULYA 3FM5A 3JW4A 2H6CA 1USYH 3CFZA 2Y7KA 3K6WA 3V4GA 3DFGA 1NHAA 5DEXB 2PQ8A 2QM3A 2UVIA 3IAZA 3USDA 1OYIA 4EGZA 5CYVA 4POWA 3ZS6A 2KIFA 3BP8A 2A5TA 3I58A 2NNYA 3U94A 2GA1A 3KEIA 3PPPA 3KBRA 3OXNA 1TQPA 1A55A 4IGTA 4R73A 3MW0A 4M72A 4ON0A 4BXUA 3S4UA 2BJJX 3TOAA 3V7CA 2XKPA 5D4SA 3T66A 2IVMA 4LB5A 3TQWA 3S9MC 5AIQA 2STWA 5ILSA 1QKBA 4IO7A 4FEBA 4ECFA 1N04A 3ILTB 1BIBA 3ERED 2J5OA 4DQ2A 2HAVA 3JSOA 2A07F 5KVRA 3VVDA 1PUEE 2GIVA 1HXDA 1DSNA 2NXOA 4LD5A 1QUJA 3EF7A 3FASA 1LQ1A 4YIFA 4BDLA 2RKMA 4U1ZA 1UTHB 4AIJA 2FA5A 4IRGA 1URSA 2Z33A 3W15C 1ZYRF 1D3YA 4HTGA 2D1HA 2VOZA 1B9MA 1US4A 1UQWA 4R74A 1R58A 3T5XA 5ITPA 1U8RA 3TCFA 3IL2A 2YLNA 3KGCA 2VOOA 5DDGA 5ILUA 1XMAA 1SYHA 1AMFA 2NNNA 1J2XA 5CM6A 4H67A 5DEXA 1LDJA 3BDDA 1T98A 4AD9A 2IPQX 1U5TA 4MQVA 4HF1A 5D8KB 3R61A 2XHDA 1RNLA 2D45A 3RKYA 2L01A 1YTYA 1GXQA 4S05A 4OQOA 3E4RA 5EHMA 1VR5A 3P9CA 2M30A 2AS5F 3VDFA 1NMUA 1USSA 5H8QB 4LG0B 1TXFA 2OU2A 2GHAA 2WWYA 4IPAA 2FE3A 3HSFA 2ZMBA 1RUNA 2PFBA 4JWOA 4WXDA 4RPOA 2L4AA 4YB5A 4Y17A 1WKMA 4NE4A 3GXAA 4NF8B 1MXXA 3IKTA 3TPAA 5K5QA 5CRYA 2DO7A 5FFZA 3I71A 2FSWA 4WKMA 1Y20A 5LHHA 2F5FA 4R8HA 3VFZA 1MQDA 1PBQA 1QW0A 1YS6A 3K1PA 5TP9B 5AA4A 4U7BA 3FXRA 5DCMA 4WXJA 5DYHA 3TTRA 2P5VA 4ZH4F 2O84X 4THIA 5H6QA 4OOIA 1UCRA 2P8TA 2ESHA 5H8FA 2G7UA 1I1GA 2V1DA 1TQMA 3SQNA 3CO7C 4GD5A 3CO6C 1XDUA 4KIGA 2E0SA 4YFNF 1J59A 2DU9A 1BLFA 4N9IA 5FO5A 1B3LA 1SI1A 3MUQA 5LHIA 2ZYKA 1ZGJA 4JSDA 1MQGA 4TLMB 1O7FA 2XXPA 1TQIA 2HZKA 1D9YA 5HOOA 3VE1B 1PDNC 4GLIA 2QJEA 2M8EA 1ON1A 3K2ZA 5K1YA 1IN5A 3Q9VA 3F11A 4ETSA 1SI0A 3FD3A 4KIFA 1ZHFA 3LSFB 4FT8A 3IO6A 1O57A 2COMA 2VONA 4KCDA 5DVFA 1B5HA 3PPQA 2XKOA 3HO7A 3L6GA 2DFIA 1BM9A 2O51A 2GXBA 5LRSA 2DTRA 3NRVA 1MM6A 4LVQA 4U0WA 5CJ9A 2F35A 4LLNA 2UYEA 3FMQA 1JGSA 5FGMA 4RK9A 5CBSA 5I2NA 3CDHA 1ZLQA 3N94A 2XAGA 3H4ZA 3DEUA 4QF9A 4U4SA 4KFCA 2XAFA 5CVUA 1LB2A 4FAJA 3K1NA 1BP5A 2Z23A 1PP7U 4IB2A 4I7HA 4EQQA 4U23A 4P9FA 3WTXC 2WTEA 5AONA 2XXYA 4ESFA 4GO1A 3EUHA 1L5TA 5ISUA 3WTZA 3E6MA 3GFLA 2PMUA 3LA3A 2YX7A 5FLXK 4F3BA 1L0OC 1SFEA 1SBPA 2V25A 4U22A 4DLDA 4RGXA 3ZP5A 2Y7WA 4F1VA 4XLPF 4HOBA 2DP8A 1S50A 3TTLA 4KUMA 5F64A 1KYWA 1BI1A 1SD5A 2GQQA 3L00A 1IUYA 1B32A 4ESXA 3L2CA 1IZ1A 2R71A 2DSFA 1K7AA 4CHUA 4RYAA 3N6TA 2QQBA 4Y15A 3TQNA 1GTKA 1D8JA 4EUOA 1XT8A 2XAHA 5D6FA 2PG4A 3CLOA 3IJXB 2VHAA 2YPNA 3TFLA 1LBCA 2OZUA 1R6ZA 2PEXA 3U2RA 3SZPA 2E1CA 4XSXF 3UORA 2B0LA 1FW0A 5BQTA 1ZG3A 4YKPA 5BS6A 1O7TA 3FVNA 4DCXA 4S04A 4FORA 2BBYA 2JTVA 2HTSA 4RB3C 2P5LC 1K6OA 3O2AA 3B7DA 2JSCA 5DYMA 4OIRF 2QZ8A 2DWAA 1BOAA 1R1TA 1V3FA 4EGYA 2I49A 1H45A 2ZYNA 5AA2D 2BE5F 1CE2A 4BDNA 2ZYMA 4NTLA 4EV0A 1R5GA 2FQ3A 5F6FA 3I3VA 5ELVA 2EA4A 3UA8A 2Q2EA 3RYRA 1CF7A 4A2UA 1UIVA 4R1HA 2DWIA 3H6UA 1MXWA 1FSEA 1SQYA 4BYYA 1XD7A 4KI0E 5JEIA 3HSEA 3Q26A 3QP6A 4EJUA 1QJMA 4GWOA 4RAZA 2FMLA 4A0ZA 1MDMA 3WTWC 1O3RA 4ZZAA 3IJOB 3I59A 3K6XA 1MM7A 4UVCA 5E1XA 1O64A 3TQLA 4FIMA 4CO8A 4MGRA 5EEGA 1XC1A 4EF1A 3SHFA 2V79A 1QZZA 3BOQA 2ZMEB 2EV5A 2K7LA 2EJRA 3LC8A 1YW9A 3Q25A 1NL5A 4GOTA 4HA8A 3GVAA 4O3CA 3JSPA 2ZNSA 3HOTA
chains in the Genus database with same CATH superfamily
5D5XB 1MMSA 3I64A 2ZYOA 4TOZA 1POY1 4MNCA 4WXCA 2Z9OA 5IY5H 3IH3A 2ECBA 1LAFE 1IXHA 1LKXA 1QPMA 1XSDA 1ON2A 5ICQA 1KWHA 1R71A 2EZIA 3KG2A 3BZ6A 3MC2A 3OEMA 3QSLA 4R74A 4YAHX 3K00A 2B7EA 3MAMA 5EYFA 3V42A 4X1DA 2WAFA 1RIOH 2ID6A 1EH7A 3SXYA 1D1BA 4LFUA 3OYNA 3EKIA 4G8HA 2CV2A 2XXHA 3PPOA 5KHDA 4I0BA 4POXA 4GRIA 3H3UA 2VT3A 3PSFA 1IC8A 3OYJA 2IA0A 3FZVA 2XWOA 3BJAA 3PMXA 2EA2A 1STZA 3DP7A 4UV9A 3PD9A 1M5DA 3IL1B 4WK8F 2Q74A 2QSFX 2KJBA 3RNNA 1MQHA 3OYHA 3F6VA 2DOFA 1Z7NE 5E18F 1KU2A 5B7DA 1I6AA 2UXNA 2NVYJ 3VPRA 5LDZA 3AG3H 2QSGX 2MSYA 3GXOA 3Q29A 4O3AA 1YITI 2F7BA 3M3KA 5I57A 1P7IA 4ZDMA 5I56A 4IVNA 5J6XA 4M6YA 4FATA 1W5SA 5DM6F 3TKYA 3Q0VA 1TWAJ 1MNMC 2LLKA 1VFDA 4R2FA 2I8DA 2HZTA 1I3QJ 2P5KA 3CUQA 3TUSA 1FQAA 4ZECA 1ZGWA 4L5JA 2DFEA 3DP4A 3L9FA 1FP2A 1VQ5I 1VI0A 4LK0F 3O6IA 3B6QA 4QSDA 3H6VA 2WV0A 1OCOH 3CF2A 4EXKA 1ETOA 1CNQA 1K9ZA 4Y33A 1FPKA 2WYPA 4YU0A 3MZ9A 1ONVA 1EH8A 2ZKZA 2NS7A 3KYCB 3CD6I 2VGQA 1ZGAA 4J01A 4XKQA 5GPAA 1Z3XA 2O9LA 2PBIA 1S3JA 1PB7A 2IRFG 4F1UA 5F08A 3HPIA 4EXLA 3ISPA 3ABKH 1RDYA 1IMBA 1Z6RA 5LTCA 1Y8RB 4A6EA 2RREA 2Z2SB 5J3LA 4N13A 2GHBA 1ZMGA 4Q47A 1Y0UA 3C2HA 1FQDA 4P0GA 3ZSFA 3OS1A 4I76A 3IH2A 2MKZA 1IRFA 2LTPA 1YIJI 1N25A 1B52A 2ELKA 4A3LJ 4HYEA 4NF5B 4LQ2A 2I4CA 3LOCA 1RESA 2O8XA 4L0ZB 5DCFA 3GZGA 4OVPA 2ISZA 2ESNA 3T1BA 2ONRA 2BEOA 2HZLA 3JCUC 4JBZA 2NUVA 1X58A 1U78A 3CESA 1NNKA 1GVDA 1IV8A 1OR7A 1PDAA 2W24A 3C31A 1GGGA 3IORA 3PUVE 1DPEA 2CMPA 2JPBA 4BAYA 1LFUP 2JUCA 2K86A 2CGPA 3OYEA 4NBQA 3ZQGA 3OENA 1YQAA 3HOVJ 1OQGA 4Q0CA 4AB5A 5IAIA 3DF8A 3DKWA 4IX7A 2E2JJ 4U7DA 3F8BA 3PFYA 2O69A 1A5JA 5DVIA 2OV7A 1SFUA 1ZK8A 2KRHA 3KLOA 5BUUA 3TW6A 3S9EA 3S15J 4MTDA 1UELB 5D5WB 1SVLA 3M4OJ 5EDNA 2X51A 1FMVA 1F1ZA 4XORA 2L5VA 3PUZE 3MKWB 4H1XA 3DQVC 3TTNA 3H06B 3RGYA 3JAMK 1APLC 1QHGA 3IB1A 2HPMA 2F36A 3ZMDA 2PI0A 2OWSA 2XF5A 3BKIB 1TFAA 2OLBA 1Z7UA 3H5RA 2DOAA 4A3KJ 3NOHA 3SYTA 4RB1A 3CCYA 1ETWA 3KOSA 3BCBA 4CCJA 1DDNA 4Q5SF 3IOVA 2DMPA 2M1BA 3HKZA 1TWFJ 1SDXA 4DIGA 2ZXHA 5E8GA 2P1SA 4LATA 4ND9A 1WCMJ 3DKYA 4ONYA 4M1VA 3IUOA 3VLWA 3VFJA 2R92J 1Y3PA 2ID3A 4Y52J 3LMMA 1Q1KA 1MH4A 4IHTA 2ZFUA 4BEHB 2GLOA 1UTBB 3LAJA 3PTYA 4XRMA 3QYBA 3HYIA 3MN2A 3C1DA 5F1RA 5M3FJ 1SVMA 2P0WA 1OVBA 1P1OA 4PBHA 3TCHA 4NG7A 3BZKA 2FQ4A 1KZHA 2EV0A 3D5RC 2K3FA 3Q0WA 2CZKA 2LVSA 2VODA 3VOEA 1KYZA 3PIOF 1NV0A 1UZCA 3GFMA 3RKXA 1TW3A 2UXXA 1ENHA 4H8IA 1N76A 2Y7RA 3HCQA 3E7LA 2KR0A 3PNYA 2QPQA 2VE9A 2ZZXA 2HQ5A 3S17J 1EZ9A 4L9JA 5IKBA 2GRVA 4I01A 5K2YA 2CV1A 2F3DA 3I56I 4AVPA 3CCMI 1H9TA 3OWTA 3S2WA 3BFUA 4DZJA 1S72I 3V83A 2XC7A 1WQ2A 1IITA 5FHNA 3AL0C 3K0VA 5TPAB 3BG3A 4RNSA 4HX8A 1I39A 1LBZA 2N8GA 1FY7A 5IZ3B 1B8IA 1N3XA 4NC6A 5C4JJ 4DXCA 1INPA 4UUSB 4PF6A 5FHMA 3I5UA 3P9IA 3BG6A 1FIPA 2FMYA 4A3BJ 4P1EA 3UGWA 3BPVA 3OL4A 2F7AA 4MJOA 4DE8A 3I9V2 4G68B 3CCRI 4NC8A 1TT1A 1MY1A 4CICA 1MRPA 3CVGA 4HNVA 3M07A 1Y3NA 4LOCA 4OA4A 2AXTC 2Y0SA 4LP2B 4NQWA 4DNCA 5K5OA 4XKPA 5A5XB 3KP3A 3V7RA 5CBRA 5DV5A 1FLIA 1ODDA 2CV0A 1R5HA 2K02A 1B58A 2XAUA 3FV1A 4HBLA 3E13X 4KHZE 3BWGA 3C34A 3JRGA 4YKJA 1FX7A 4KYDA 1DTZA 2XAQA 4HDUA 4X48A 2CFOA 3ELKA 1LBVA 3SFZA 1W5TA 5M5XJ 5EGOA 3M8UA 2EQRA 2BHYA 3I4NJ 1R7JA 2XB5A 2ACJA 4BDYA 2FNAA 2ZZVA 4IO3A 3UP9A 1ZN2A 1LAXA 3E79A 2V4CA 2RCAA 2WAEA 3IR1A 2Q2AA 2G93A 1RKTA 4GCVA 2YS9A 2Y7PA 1GUUA 4B44A 1U9OA 1ZIUA 1XGSA 5EF6A 5I84A 1BL0A 4XICA 3EDPA 1IDYA 3MMYB 4RB2C 2PJPA 1QVTA 2CUEA 3T96B 2ADUA 5H8HB 4ENJA 3FVOA 4R9GA 3GFIA 2M5WA 4PGNA 3BQZA 4OIPF 1T0KA 4L17A 1IXSB 4UVBA 5FFXA 2JA2A 1OKRA 2ZJQF 1ETXA 2KKOA 1J1NA 2OCUA 1DU0A 3K01A 2CZHA 1IXIA 1TBXA 4RMNA 3S3MA 2HEOA 4GDFA 4HQEA 2HPGA 1HC8A 4NWDA 2FOWA 5C44J 4BL0B 4Q30B 1B2HA 5IZ3A 2LFBA 3K0LA 1VFEA 1QHHD 2R7XA 1EZOA 3T9UA 4XOTA 2HYFA 3T8TA 2B4LA 3RCOA 3M7GA 4AIKA 2RNJA 4KICA 2HZDA 2VBWA 3Q9SA 2VP1A 2V1UA 2DS9A 2XF6A 4JP0A 1QVSA 4KD5A 4ZEKA 1XTAA 3GLBA 2M7AA 2WB1N 5J40A 3E5QA 1UFMA 2E35A 4A3JJ 1D5YA 1A6IA 4BJ5C 4M9XA 4G7ZF 2QS2A 3UN6A 5JK4A 4A5MA 2HXRA 1DGWY 3N26A 1FNNA 4NB5A 3H35A 4I98B 1D8KA 5IOYA 3J7YJ 1V5EA 1GT0C 1LE8B 4M74A 3R4KA 1BR4A 4P8BA 4LZ7A 5DW8A 2GBYA 4A5NA 3C9HA 2P7VB 3I4PA 1B72A 1OCCH 1VQ4I 2DPUA 1Q35A 3E3VA 1IN6A 4OANA 2ZJPF 1XHYA 2AIXA 3LBSA 4NF4B 1BI0A 4IY5A 3OYGA 4R72A 4ZYEA 1OLCA 3MVYA 3WTUC 1D1CA 3BR5A 3MP8A 3D4GA 5IYCJ 3A4CA 1YO5C 1YE9A 4BDRA 3A09A 1ZKGA 3E6DA 1EH3A 1GR2A 2XAJA 3J80K 2BXYA 2Y2ZA 2F78A 4MLVA 3QAXA 4IQ4A 2QMXA 3FATA 4OFJA 3LSPA 5I58B 1N75A 4BLAA 1QUKA 2R7DA 3AG2H 1B05A 1FTMA 1IUFA 2VKEA 3W9WA 5ERIA 3L2RA 4NQ8A 4F2OA 2O61A 4MQ9F 2ABHA 1SMTA 2R4GA 2KIUA 3M8JA 4N9HA 4EQBA 4G7OF 4KYSA 2CUJA 1VQMI 3TCGA 5EYHA 1T6SA 2JMWA 1M5FA 5ITPA 4HE0A 4HLYA 4IO6A 4TLLB 1C0WA 4ZYHA 5FKOA 2CH0A 3GTKJ 4GWZA 2O1MA 3RN8A 2W7YA 3U92A 2MG4A 1I6HJ 2X6WA 1IRZA 1SMYF 1P1WA 1HKQA 4FQGA 3B6WA 3PV0E 5GTIC 2RCBA 3SETA 3TGNA 3H03A 1UHSA 2VL8A 2W48A 4F3PA 1JHHA 3JRBA 1H43A 1XG1A 4R9FA 1W7PA 2Y75A 3PQJA 3I5OA 2KPMA 2I10A 1Y1MA 4BUPA 2JUGA 2WBDA 1WI9A 2WC2A 2IS6A 2X7PA 4F39A 3C3WA 3PMWA 4LMYA 4CGZA 3HOXJ 1MQJA 2WKYA 2BW3B 4ZDPA 3HDDA 4QFPA 4ELPA 2QKMB 4R6HA 2LR8A 4XK4A 1TZLA 3CUQC 1MY0A 4P0IA 2UVHA 4I3EA 2JRMA 1P1QA 1DGRM 3CJNA 1G4DA 1FOKA 2H25A 2OPTA 2GXAA 4UB6C 2IXSA 3F8MA 1MS7A 5H8NB 4IHSA 2C6YA 2ZC2A 3G3KA 2ZMEC 2EFPA 2HKOA 1LE8A 1POTA 1S7AA 3BTLA 3N4MA 3K4BA 4G6TB 2RV8A 1FOXA 5ET5A 1YW7A 3U72A 2RC9A 3K6WA 3FJ7A 3N97A 2XASA 4PCQA 1PEBA 3HTSB 4XKNA 1LFGA 4NHJA 2MC4A 4HF2A 3RUMA 1G0IA 1BI3A 1XGNA 2R9JA 3SEVA 3E5UA 5K7FA 3B50A 3ERMA 3QU3A 4ENMA 2HQAA 1HW5A 3M8FA 1KU7A 4YZZA 1XS9A 4E0WA 1XGMA 4U2RA 5CMKA 2LKSA 1M5BA 1MG1A 2AQEA 4BHBA 4ISUA 3LL7A 2BVLA 4PE3A 3O66A 1OFCX 4WXHA 1R00A 4ELQA 4ELRA 1FRPA 3PD8A 5CVIA 4NUBA 2O7UA 1PJRA 2JJ7A 2WX9A 2DDBA 2V9PA 1PBPA 3JRFA 4MX6A 1N77A 1IAWA 1G0HA 5F0CA 1WJ5A 2AYSA 4LZ8A 4L9NA 1SD7A 1YYZA 4QSEA 3K2DA 3OY9A 1IEJA 2K27A 5DTBA 2KJCA 3ZQFA 1TNTA 4OYVA 2IW5A 2XWIA 1BJAA 4JYKA 5L3FA 3JRHA 4YKKA 3T9VA 2UVGA 1UG2A 1SFOJ 4UUVA 4H6DA 4XBFA 3O6BB 2I3VA 4XEQA 4NDLA 3L2QA 5B1AH 5KCJB 2BGCA 1FPFA 4EJVA 3EN3A 1PP8F 2F4IA 3ML6A 1O3QA 4QFOA 4DDDA 4JBAA 1IQ7A 3RT6B 3TTKA 1DP3A 2QBYB 1EYJA 2V4JC 2ETHA 3K70D 4L0YB 4MIJA 5JI6A 4JWXA 5LGTA 1MQIA 4NGUA 4BJ6C 1Y3QA 3UK4A 5HDGA 3EETA 1B40A 2MLKA 2Q9TA 1UTHA 3W9VA 5FKKA 1HBXG 3BR6A 3PO2J 1QUIA 4A0YA 4I62A 3LQQA 2L9VA 4EF2A 2Y48A 1X3ZB 2EFWA 5IP7J 4CXFA 2QSXA 1V55H 4X1BA 2NWJA 1S29A 3R6SA 1M5CA 5K7ZA 4PGPA 2L4MA 5HNFA 3S14J 4OMBA 3G2BA 4MFIA 2FBIA 1FBQA 1NUYA 2HOSA 5EQ7A 5HBCA 3GWZA 2K9QA 3ABTA 4MEYF 4YICA 1TLHB 4II3A 1GV8A 2DBBA 2W85A 3DM0A 2KISA 2ONSA 4TV7A 3REOA 4BE0A 2KIMA 3KIOA 3I53A 3ROUA 1XS5A 3EUKL 4C30A 4E7SA 2G29A 1E3HA 3QPTA 5AA2B 3BG7A 5IYDJ 1O4XA 2PCRA 4JQFA 2HI3A 5HDNA 3BT9A 2HWVA 3PJRA 4JSOA 1MNDA 2R7UA 4PAKA 4ZE8A 4HNUA 3PMVA 2JVHA 5IM2A 1FBPA 3RZOJ 1ETQA 5C4XJ 1DBZA 4ZJZA 3TKDA 4BBRJ 3PUFA 3DLAA 4V2GA 3LSTA 2CEYA 5FBPA 2P4WA 3ZKLA 2Z99A 2DFHA 4KIBA 4MHGA 5FLXZ 3CMYA 2OZZA 4DXUA 2F4MB 2H27A 5JLXA 5H8QA 4LG0A 3X2QH 1VZ0A 4GL0A 5FJ8J 1F36A 3LA2A 2G7HA 2EPFA 4CYCB 4QLCU 4N15A 3CG3A 1LEBA 2GZWA 4H45A 4RY1A 3GF2A 2E2HJ 3FKIJ 3C32A 4RM3A 1H3DA 4PFWA 3LR1A 3M9AA 5ICFA 4HV6A 3U21A 3SEZA 4B4CA 4E70A 4B8XA 3HHHA 4OU0A 4XMYA 4PGGA 1R22A 4AQ4A 4NF8A 3LSGA 2A6EF 3L09A 2A6TA 1LB8A 3R26A 5AIPA 4XOPA 3K1MA 3IK6B 1AIVA 5CVJA 3RYPA 3I4MJ 2H98A 3CR9A 3K10A 1FJ9A 3PSIA 4XTCQ 2REGA 4EJOA 4XXUA 2V9KA 1LFBA 3GYHX 1G3WA 1IG7A 4O3MA 1R9LA 4YB6A 3IRRA 5J16A 5TP9A 2QYOA 4LUBA 4QBAA 2IGNA 1FP1D 4H4KC 1DQUA 2F5EA 1II5A 2P7CB 2A05A 1FC3A 2KLOA 2E1SA 4MNPA 1REPC 3PIPF 1L3LA 4NAPA 4JX4A 4F7ZA 4F3GA 1F9BA 5AA1A 1FMWA 2JZYA 5I2KB 2PFZA 3TDUC 2OJTA 1R5ID 1LUJB 2DI3A 2H1KA 5C3EJ 2O68A 2I58A 3HEFA 3WGIA 3TBIA 2HOTA 4IO5A 4PAIA 4QSHA 2XPUA 3K6GA 3BBRA 1B7UA 4RLQA 1VQ9I 2MH2A 1MPBA 1A6QA 5TISC 1FBEA 2WY7Q 3OYDA 2XGXA 5J1RA 3WU2C 5IZZA 5HLHA 1W4MA 4ZDOA 2O3FA 3N5LA 4D5CA 3D1RA 4PDDA 4CCOA 1DPUA 3WGGA 3FHZA 4HDVA 2V9VA 2FD5A 4Q4ZF 1KQ8A 5D5VB 3H7MA 1M1EB 2GOMA 1X3WB 3LSHA 4CCKA 5JHFA 3JREA 2VPRA 2R5YB 4GX4A 3FF5A 4N4OB 3GBGA 3TMOA 2R5ZA 2VC1A 3GUDA 1H89C 4L18B 2FBHA 1NH8A 1IRGA 3QPHA 3P5JA 4BHCA 2Q8MA 1JVXA 5BWJA 5J8CA 3FXQA 4CDGA 1D0YA 2IJLA 2H09A 3SDFA 2XX9A 3C33A 2DXYA 2OX3A 2OA4A 1D0ZA 5FROA 4HRIA 2VOPA 3KLNA 2REJA 4I3YA 1IMCA 2JT1A 3KBZA 4KQPA 4BQNA 2YJPA 1R6RA 4V19K 2ANJA 3VB2A 3S9LC 5I3SA 3AAFA 5F24A 2R93J 2V1NA 5J8FA 3DP8A 1BIYA 3ZRGA 1SD3A 1HSLA 5JTYB 4ZZDA 1KONA 2ZO4A 3ZGKA 4RGSA 1Z7ME 4IO4A 3EYIA 1S6LA 1EYKA 3FDYA 2OBPA 2ZNZA 4WWCA 3OSRA 1R36A 1A36A 2P2AA 5GPCA 3OMBA 5L8DA 5CPRB 4G68C 4GX6A 3U65A 1IJWC 2CS3A 3VLUA 1SD6A 3TO9A 2O8KA 4YFXF 4DYRA 1MH3A 2FNCA 2CO5A 1B3EA 2W00A 1A35A 1J7KA 5JVTA 3HL2A 1P4WA 4ZC3A 3WTVC 3BIHA 3BTIA 1LEVA 3TZAA 1LVKA 2D21A 3U9GA 5IP6A 1S9TA 2IEKA 4OENA 4XL9A 2VJ5A 5IT9K 1IV6A 1W36C 2MD5A 4BDOA 2BVMA 3TODA 4KFQA 1NK2P 4ENKA 2COBA 3ZQLA 1O7LA 1Y1WJ 2PX1A 1JGGA 2GH9A 3QYEA 1MZBA 5E1ZB 3IX1A 2VJJA 5FTIA 2DQLA 4DJAA 4Q48A 2EK5A 2F5DA 5CI5A 4HV5A 1OMPA 1A04A 3QP5A 4XKVA 3H6WA 1Q1VA 1JP4A 3T9XB 2XRNA 3OELA 3WE2A 1FTOA 1U0JA 2PMHA 5CLSA 1ETYA 3KZYA 4EM0B 2GQ1A 3HRMA 3M3FA 5H2FC 3QMFA 4LIUA 3C35A 2H94A 3S1MJ 2NRAC 2IP2A 3QYFA 3WHBA 3KEQA 1AL3A 3TO6A 3CF5F 5FB2A 2HYJA 1JT6A 2CQKA 2K3PA 1MMDA 4HQMA 3IFAA 3QODA 4K3FA 4D5FA 3RDIA 1QRYA 3RYDA 5HLIA 2PMSA 4ELOA 4HW8A 4B09A 3ZMTA 2HNHA 2K85A 5ICEA 4H5FA 2M7BA 4I8CA 1WWXA 3GEZA 2PYYA 5D8LB 1DTGA 4M3EA 2V6EA 2KRFA 1YI2I 1K78B 5ICGA 3G1MA 1X2MA 2CG4A 2V6CA 4OXVA 5EHSA 4ZS9A 2XXIA 4M71A 2A68F 4OIOF 1KZ8A 3RQIA 1XOCA 4KT5C 5DT6A 4PDHA 2XXQA 1QULA 3G3GA 4QIWN 1MBHA 1X1PA 1AKHB 5H8SA 1BKAA 4P96A 3MCZA 2P81A 5LRRA 1ZH5A 4BDMA 4HX7A 4N0BA 3O28A 2VXDA 2HFBA 1R9TJ 2XSDC 3K02A 3Q27A 1NV1A 1JHFA 2PLYA 1RYXA 5H6RA 5AE4A 2JA7J 1ZJLA 3M8EA 3M1EA 5M5WJ 1GVJA 2OK2A 3S16J 3MPLA 5EQ8A 3G1OA 2BZTA 4N6PA 2K4JA 2E5ZA 2KIQA 1KQ0A 4E7ZA 2VKVA 4C2TA 3OIOA 3IV5A 1JEUA 4AS4A 2RGVA 3JTGA 2LOOA 4ZEIA 2L3DA 1PB8A 4EEFG 4PFRA 3KEYA 5DUIA 5CVRA 1T56A 3BG9A 2DMQA 2EFQA 4KT6A 4CZZA 4Z6YA 5KNLA 2HQ0A 2G9WA 2O03A 1B1XA 4B48A 1B5IA 3G3ZA 4B43A 1J75A 2Y0SN 3VYSB 1JW1A 2HCAA 4HW0A 3LSJA 4H0EA 1N7WA 5L3CA 3FIRA 3F72A 4HZFA 3WODF 1YRNB 1AU7A 2STTA 3ABMH 1VQNI 2X6YA 3ABUA 3BR2A 2DLLA 1H9GA 2R7QA 2LBFB 3A2KA 4OFLA 2DE4A 3HV1A 1OCPA 2E60A 3TAJA 1T8IA 4EQ9A 3ZMZA 3OO7A 1FQEA 3NEUA 1Z7LA 2LKXA 1M5EA 2YX4A 1OYWA 5CQGA 4UNOA 3VXBA 3BR0A 3W6JB 5H8FA 4BGDA 4DIQA 1G3TA 5A2QK 5BPIA 3IOWA 3V8XB 3OSGA 2O6AA 3S8PA 4GGGA 5FHOA 1SD4A 3L7WA 4ZE9A 2ZMEA 4XLNF 2KDOA 4A12A 2A5WA 4M3BA 3PM1A 2GWRA 4QRZA 3A3UA 1VQ8I 5FRNA 3KE2A 2LAOA 2Z1DA 3MQ9A 1Z1DA 2XUBA 2IEEA 4HS7A 3MWMA 4BDQA 1ZLJA 4Y3OA 1YS7A 1FBUA 3RPUA 1J5YA 1AWCA 2F6PA 3OO9A 4PFTA 2NVUB 1QO0D 3MPKA 2XIGA 2PVUA 4GWWA 1ZG5A 1HKTA 5F04A 1FBHA 3N6UA 2WBMA 1FPIA 4ZZEA 3OO6A 4AUXA 2ZNUA 4IXAA 1YPNA 5IOZA 1WFXA 1P4XA 1QQIA 2X4HA 4NNJA 1TWHJ 4PBQA 3DPLC 4E6KG 5FD5A 4KITB 2YUSA 1R1UA 2HFHA 4IY6A 1HKSA 4W1UA 3RKQA 1ITYA 3O6GA 4NF6B 3B6CA 1MY3A 4FECA 5EEHA 2Z8FA 1KA8A 1MXZA 4BHPA 2QMWA 2XX7A 4GVOA 1JKOC 1ETVA 4AWXB 1NV5A 4DYCA 1BR1A 2FBKA 4PJ0C 4G77A 3EYYA 1B0LA 1X4OA 1T2KA 4IGRA 2LF8A 1J09A 1MGTA 1YX5A 2NVTJ 1FSHA 3BJ6A 4YB7A 3WU1B 1FBGA 2XXTA 3GMEA 3OIQA 1S7YA 1B6AA 1LJ9A 2HS5A 4HEA2 1EKEA 1Y0NA 3SZTA 5D4RA 1SAXA 3MZBA 4G8MA 4H65A 3DEWA 5CMMA 3CUOA 3BJOA 1JNFA 4PSWA 4BKXA 2LBFA 2XXRA 3VODA 4C1UA 3A0HC 3CLQA 4MLQA 3U1OA 2D5VA 2LDUA 5FD6A 5FRMA 1D9VA 5EZHA 3BTCA 2FYIA 3KP4A 2NOGA 3MEXA 3E5XA 2XPWA 1P1UA 4U0VA 1FBFA 2EFNA 3P9KA 3E97A 3T0YA 1B9JA 2FUG2 1NV6A 3I3LA 3PGFA 4I9DA 2QENA 2KQRA 3RQ4A 3MVWA 1UHMA 1QZEA 2M4GA 2H8WA 4M6XA 4YEJA 4AYBA 5M3MJ 3Q28A 4IHYA 3RTWB 4B3AA 2V3UA 2E36A 3FMSA 1X2NA 3HPGA 3ONQA 1JJ6C 1NNTA 1EH6A 4XF5A 1B3GA 3BCAA 2A61A 4PQJA 2NYXA 1FTTA 2XSJC 3MZHA 3W3CA 3HXLA 1A7LA 2DW4A 2R7VA 1JETA 1B4HA 1IRXA 2XHKA 5LLQA 3V8KA 2OQRA 3L1PA 2F3BA 5IT3A 5LEKA 2VBYA 2HHMA 5L9SA 2H99A 2ZXTA 3ZMSA 5HPQA 3PO3J 2W57A 3IFCA 1BW6A 1TT5B 5HS8A 3F6OA 3J7AY 3HUGB 3K9TA 5KK1A 1B59A 2QS4A 3ZCOA 4XLCA 5DTDA 2WAQA 3RTFB 3G3HA 2ZSHB 2LK2A 1D5VA 2XX8A 5LGUA 4OERA 1WGXA 1SANA 4NF5A 1BIAA 3RKWA 3GX4X 3ZQCA 3I0TA 1ZRFA 3CTAA 1LNWA 1KA1A 1NNFA 4MMPA 2ME6A 3ZN0A 2KZVA 4Z0IA 5T3JA 1P4AA 3SJMA 1WI3A 3CMEI 1JVYA 2F2EA 2VASA 2QFLA 4HXVA 4UY8I 1YJ9I 4U88A 4OFOA 3DTEA 1D4NA 3TELA 3SKPA 3K4JA 4G6DA 2XXUA 4OESA 1RI7A 2DT6A 5TRDA 1XSXA 4X1EA 2RQPA 3MP1A 1LDKB 2ZZWA 5L3DA 3VVFA 3NAUA 1S5LC 2PT2A 2RC4A 1R1VA 3OYCA 3F8FA 2XRLA 2ZNYA 1WZ2A 3H0DA 4P9UA 1OQYA 1TL8A 3QAHA 1FTKA 5DUKA 2E7XA 1LBWA 5I5PA 3CSGA 5CVVA 3E3KA 1Q1HA 1FCKA 2O7IA 4HLXA 4I40A 1BC7C 1VDWA 1T33A 2DN0A 4XN3A 2DE2A 4PE5B 1JUMA 4R2BA 3QIMA 4OHNA 2DQRA 4QPOA 5KDTB 3ECRA 2JK3A 2QQAA 2R6GE 2DYXA 2OJED 4M9SA 2XWKA 3HOSA 1BK4A 2HVQA 2HVSA 2DWHA 2H5YA 2NOOA 2LY1A 1J9IA 4UABA 2DDAA 1XGOA 3PL8A 2YR2A 3HRSA 3CJQB 3NWTA 4G9YA 2YSRA 1X1CA 2QUFA 1MMGA 4RGUA 4LLLA 4F52A 2VIXA 4BEHA 1JW5A 1UTBA 3FK6A 3J81Z 1I69A 1X1DA 2K40A 5E17F 4AU7A 4KYWA 1AOVA 3GZ5A 2NAZA 4LGWA 4OMYA 5FTHA 2BV6A 2DVCA 3LAPA 2OBGA 2HPIA 3VXCA 4RAYA 2M4KA 3TDZC 3FGSA 1PVEA 3DV8A 3D0SA 1RKMA 3IB0A 3Q0UA 2E71A 3WTTC 2CQQA 3EQLF 3QWLA 3TEDA 1OVTA 1TNSA 1IMEA 3FXMA 3GZ6A 1RDZA 4ZYGA 3F9KA 4O5VA 3PNTA 5H20A 4Y13A 2M87A 4LIVA 4FBPA 2DODA 1IN7A 1G59A 3OIPA 2FRHA 1S8NA 2JA8J 3EPEA 3MZ1A 1FQBA 5BMZA 4C9YA 2LF7A 5EG0B 4ZYDA 4NWCA 1AHDP 4YMAA 4HNTA 1MBEA 1OLTA 2E1OA 4Y7NJ 3D1NI 3LWFA 1FWZA 1A8EA 4Q5TA 2UXAA 3FMRA 4ZEDA 1IIWA 3QOPA 1ZKBA 1H0MA 2RINA 1MMAA 2DA6A 4X6AJ 2B63J 2A5TB 3IP4B 4CYDA 4FE4A 2HU9A 3MQ0A 5TPAA 3J80Z 1U3EM 2WEFA 2HDWA 4U21A 1Z0XA 3A29A 3PUYE 2H1LA 1FYLA 1OQHA 4KXPA 4GF8A 2HGCA 4RBOA 4RGRA 2IS1A 2EFOA 2K9SA 1Y1VJ 1Z91A 4PP0A 1NH3A 3AXFA 4UUSA 2FIXA 4BQAA 1MJBA 2QF7A 3FVGA 2CU7A 3WU0A 4FETA 1N3WA 3OL3A 2JQ7A 2QWWA 5FLVA 1FTLA 3I6VA 4DBRA 2FU4A 4ESWA 4G68A 4KPTA 2W25A 3F8NA 3KCCA 4IRHA 1JW4A 1BOBA 2BYVE 2Z8DA 1B51A 4LN5A 2HAUA 2VD3A 4A69C 1IW7F 2F48A 4N4UA 1CGPA 4AIHA 2Q0OA 1VQPI 5A5XA 3LNQA 4IZZA 1T39A 4ESBA 3WHCA 4FJPA 1A8FA 2F8DA 2ZCWA 1MSEC 3SEUA 5E3LA 3O3KA 4G2ZA 3VV5A 4DZ1A 2TDXA 1YXIA 1MXVA 4F2QA 4G7HF 4D0PA 5EZGA 4ZTFA 2XXXA 4LITA 4FASD 3ASNH 3EHTA 2VPOA 2VT2A 3HN0A 1X19A 1G6NA 1U9NA 4I0AA 3BLYA 1MBFA 2HVRA 3HG9A 3C18A 2D2WA 3HGYA 1NUZA 1XVYA 3WE3A 4F19A 2JWTA 4IJAA 3KP2A 3IWFA 1SW1A 4C3HJ 1DMBA 4DYQA 3C2BA 3CFLA 2IA2A 3U1KA 5LHGA 1MPCA 3VEPA 1D3KA 1NG6A 1GHCA 3W6KB 1ZU0A 3KJTA 1TW2A 5BOXA 3G73A 1IMDA 2FHYA 2XF7A 4GXOA 3FJGA 2DPDA 3KSJA 1O3TA 4UHTA 3H9GA 4QXDA 5LEJA 2EWNA 1LPQA 2CMOA 3R6UA 1OISA 1RC9A 4OVTA 4FTHA 1TP4A 5H8HA 2ELHA 2Q8KA 1U5TB 4PDKA 5E3OA 1PC3A 2M8CA 4HCWA 5EEAA 1NV4A 2CEXA 2LKPA 2XXWA 1HCRA 1G3YA 2QSHX 1ZLKA 2PT1A 4KJZA 5KAFC 3RSNA 1W0TA 1MY2A 2F34A 4B1RA 4LB6B 2DMTA 4ZZLA 1HSJA 2P6SA 5CC2A 2F5VA 3VYTB 2GAUA 4U0YA 1ZTYA 3CRBA 2P3NA 3O8HA 4NF0A 2GA2A 3LSIA 3K2AA 3CCVI 5HDKA 1WSUA 1LBBA 1LLSA 4QFNA 1YJNI 3SERA 4EDPA 1E3PA 3HOUJ 3OS2A 3H6TA 2A69F 3QXMA 4H8JA 1EZPA 4E7JA 5TGTA 1ATGA 4IHVA 3ILUB 2FOKA 4BE1A 4C3JJ 1XB4A 3MAJA 2BY3A 2RAEA 1JTXA 2XV4S 3O2PE 3AG1H 4O6JA 4A0XA 3MVZA 4KDPA 4C2UA 1Y9UA 5ICCA 2ZNTA 1XPXA 2R7FA 3DCFA 4DGWB 3ZQ7A 1MIJA 1V54H 3S32A 3OSQA 1YHQI 4DI3D 2XD3A 3S2VA 1FT9A 3EUAA 2EH3A 1E2XA 2L2OA 3HM5A 1SEUA 4PJMA 4P47A 4NF4A 2F97A 2M2EA 2QQ8A 3UIFA 1IN4A 2D3IA 5AA4B 2XVCA 3D4CA 1HDPA 4MFEA 3HFUA 1QVUA 4R75A 2EIJH 5DCMB 2MC3A 3FX3A 3T8RA 1PUFB 3A3CA 3VSLA 3CHGA 2P0SA 1YG2A 2VD2A 2OWTA 1QNTA 4L5IA 1ACIA 4GIZA 1W36D 5H8FB 2IGKA 5I58A 5BPDA 3A02A 1X1AA 2VKHA 4H0WA 2HOEA 1TWCJ 3KX2A 1LFPA 5EJCA 4EM1A 2M8GX 1B1BA 4FX4A 1R49A 1JI8A 2A5SA 2PJRB 4N91A 1IGNA 4PGHA 4E0XA 1TT0A 2ZJ2A 4H5GA 1XCVA 3ONMA 4PAFA 3QPLA 2F5XA 3EHUA 1MD0A 1JKRC 3JZJA 3RPWA 1GVCA 1GXPA 4EQ7A 1I6XA 5E20A 2GOXB 1A31A 3CJRB 1SVOA 2RKHA 1HOMA 1D9QA 1I6BA 5KZTA 2HXIA 4BJTA 3JYRA 1F43A 1NTCA 3MJNA 4FISA 5B66C 3UKGA 2L7ZA 3SDBA 3CCSI 4LLGF 5JVGF 4JXIA 4NMYA 4JDFA 4E4HA 3WG9A 4U1OA 1YLFA 3CC4I 4XIGQ 3WAFA 3O9PA 4GFRA 2RVCA 2WYKA 4UV8A 3BQYA 2BW3A 5ET6A 1AH5A 2FBPA 3RPLB 2GXGA 3SEXA 4A3CJ 4OAZA 3V7SA 3HRUA 3MKZA 4N07A 2HKXA 2VXZA 1D0XA 3CC7I 5LGNA 2GFEA 2NS0A 4O94A 4KMFA 3TEPA 1FBSA 3HZJA 4L5EA 2CUZA 5EYRA 1RR8C 3CIJA 3WAEA 5J1UA 5H8NA 2QVRA 3TL4X 1HQCA 1JKPC 1FYMA 1IXGA 5ESYA 1W7PD 3FBPA 5TJJA 4J00A 4GQOA 3K69A 4GXAA 3H3VK 3HOYJ 4OMZA 3B02A 1FPJA 5I2NB 1ZG1A 3KZGA 3LQRA 4JK1X 4EJTA 1IXCA 1T08B 3G3FA 2H4IA 4L9TA 2LMDA 1V5FA 4FE8A 4HAMA 4BY1J 4QFKA 1SW4A 3MYUA 2W82A 3KOTA 4QHQA 1IO2A 1B4AA 1DUXC 2X9DA 3F23A 2Z5UA 2CYYA 5ILVA 2DJNA 3ECHA 3SFIA 3FIWA 3P7NA 4LZ5A 3CDIA 3ZMUA 4LK1F 3IKVA 2MGQA 3QQAA 2Y5KA 3KFWX 3DKXA 3C4MA 3R0JA 3GFJA 2PMZA 2O7OA 2HQRA 3KEOA 2O0YA 3DLLF 1BTJA 1RYOA 2PN6A 2EB7A 4RA2A 2EILH 4GFBA 2DT5A 3TO7A 5L3GA 1OPCA 4AB6A 1YYVA 3CCEI 4PZJA 6PAXA 4F3SA 5JR3A 3FUZA 4GWSA 4M73A 3KETA 2NVXJ 1AOYA 2B65A 4XFEA 3FWEA 3EHSA 4JVCA 2CSOA 3MZ8A 3VDXA 3S3NA 1FBCA 1US5A 4ABZA 2VC0A 3P7IA 5KCJA 2FA7A 2UV1A 2CZLA 3PU5A 1P7JA 2PBWA 2ZJRF 2QBYA 1MPDA 3KP7A 1DPRA 1TWGJ 4UA8A 4RK2A 4A3FJ 5B5EC 1ZRDA 5BNGA 4PFYA 3B6TA 2VT5A 3H3GA 4XONA 3KN3A 2QA4I 4PF8A 1S7OA 4PFIA 2VI6A 1QA6A 3KPHA 5FLMJ 2EZHA 2I3WA 4P5OA 4LG3A 3M1CA 3OYKA 3OYIA 4IKFA 4EVIA 1A54A 1VSOA 4KR5A 2HTJA 2NOJB 1F5TA 1JUSA 1B46A 2Q8JA 5EQ9A 3RT8A 2HYGD 1QU3A 1B7HA 3RI4A 4YG2F 4KA4A 3WGHA 2LY2A 4G8NA 4F93B 2L9SA 1XCBA 4M3FA 3TYHA 1N78A 4YKIA 3HRTA 5HODA 3ZKKA 4ASNA 2WADA 4I09A 1I6QA 2ME0A 3LA7A 3T0JA 4N4NB 2RC8A 4BNCA 1Y1ZA 4LQ5A 2F7CA 1UB9A 4N6KA 3NWSA 5AA2A 1FPDA 1N84A 4MNUA 1OCZH 1SFXA 1XDSA 3K4CA 4AIDA 2MD0A 3AG4H 3BY6A 3R0AA 1MDQA 4PFUA 4Z7EA 2NVQJ 1LDDA 4PETA 5ITOA 3JTHA 1UHWA 1IN8A 2DA2A 1LB9A 1SVXB 3CC2I 2QQ9A 3F8CA 2M0CA 1KU9A 3F3XA 2Q2CA 3IOTA 4KN7X 3PPNA 4UACA 2YU3A 3KP6A 1V5GA 1WDNA 5LBQA 3F21A 1W5CC 2MFZA 1H88C 5CMCA 3G3IA 4GYGA 3I54A 2F6CA 4DXBA 5GADJ 1JUPA 1FYKA 3GO5A 4P1WA 3FM3A 3G4SI 1QZYA 2W84A 2DK8A 2MA3A 3RTRA 4IF4A 4F91B 4CYCA 3MFKA 2UZKA 5IT9Z 3LSXA 4OZ9A 5HM4B 2KZGA 3OOPA 1ZTRA 1FZPB 1LSTA 4QSCA 5E3MA 5M5YJ 2G0EA 2KHMA 2O6GE 2Q2EB 4RAGA 1CF7B 2UVJA 4PTKA 2KFDA 1WODA 1ZQ3P 3SESA 5IYBJ 3G71I 4XRFA 1XMKA 1UMQA 3GLXA 1EA3A 3MBPA 4GWXA 4F22A 4WEPA 4G6QA 1Z21A 2RQQA 3K7AJ 1WVRA 1JJ8C 4RA1A 1BR2A 3WTSC 3OR2C 2JPCA 3DLNA 4PJJA 4D9JA 5DS9A 2IT0A 3CFXA 1MW7A 3HHGA 3RPQA 1XI6A 3RIRA 4BY7J 1SYIA 1MDMB 3K6VA 4MBPA 5JLWA 2VN2A 3I59B 1MDP1 2Y5LA 3BPXA 4P55A 5ED4A 5I2KA 3SEWA 1DK4A 4ESJA 1G3SA 1BN5A 1WVJA 3IRQA 3HTUA 1G8XA 3BFTA 1WJAA 4GYIA 1K4TA 2IBDA 3FJMA 3DU6A 1ZAOA 1FOWA 1XMXA 2FF4A 2ZFWA 5L3EA 4BH9A 3OO8A 1EV7A 3S2DJ 3PUWE 3B73A 3SDGA 1B5JA 2ZSIB 4LJZF 1U2WA 4MTEA 1BA5A 5CQEA 4FHTA 2B9SA 2R7TA 3H36A 4AYBN 2OQGA 3DBLB 4KCCA 1K79A 1NUWA 3PQKA 1EF4A 1FJ6A 2X26A 2RDPA 4X9TA 1I1SA 2DMNA 2HR3A 1FTZA 2R5YA 2Y9ZA 1I50J 3LSKA 3GTQJ 2L02A 1EJ9A 4M6VA 4MO7A 1X3UA 4HF0A 1FQFA 1A99A 1NKXA 4D1QA 3C36A 2X6OA 4YIIA 4PFOA 4PJLA 3GYYA 3G7WA 2Y0MA 2GM4A 3IOUA 4GWUA 3DPTA 1JE8A 5DEQA 2LP0A 1MXYA 1IXRC 3E9XA 4MAGA 1Y39A 3COAC 3K4UA 2K5CA 1OCTC 3J7AO 1V4RA 4JVDA 2KRCA 4TQUQ 4XKRA 5B3SH 2WAQN 2DWJA 4RB0A 3ZPLA 1WPKA 2VQGA 3R60A 4RJZA 5FKNA 3QPSA 1AWBA 1ZRCA 4ZEBA 4F29A 1Y6IA 3HSRA 3MKYB 1WRJA 4A3DJ 2E34A 1NV7A 1TFDA 1XSVA 2I6EA 3THIA 4F31B 2XA5A 1LGBC 2ALUA 5LFAA 1SW2A 4MFDA 5FKLA 2E1NA 3TOBA 4P11A 5JTYA 3K4LA 2OD5A 1LEAA 5E79C 5I57B 1H44A 5JHUA 2UYFA 4GRKA 5I56B 3ZQHA 1ERDA 2LD5A 1SW5A 5J4YA 3LSRA 4MIMA 1I5ZA 2D5WA 3L6HA 2Y9YA 4OTEA 4UVAA 2OF7A 3KC0A 4F3QA 3CUQB 5J4VA 3L2UA 5A2QZ 3FVKA 2BXZA 3ULQB 3KJ7A 1GV2A 4XRSG 1A40A 2F6GA 4F1YA 5L3BA 2UUZA 3F0CA 2XDVA 5K2XA 5DD4A 4B47A 4QWQA 3QUJA 5KCMA 4HCYA 3JRDA 4C3IJ 4FX0A 3GTOJ 4JWYA 1B6HA 4C2MJ 3MP6A 3T9HB 4K2EA 2IA1A 3A0BC 5AA3A 4C1TA 1NH7A 1NUXA 1OYYA 1S9HA 1JEVA 1Y4TA 3JV9A 1YCJA 2LSOA 4A6DA 3RQTA 3DELB 4EM2A 3CI8A 1MKMA 2MBFA 1KU3A 3BROA 4XLAA 1FTJA 4Q8RA 2KQZA 3CMMA 2RN7A 1OLAA 1RZ4A 3TP0A 1O3SA 2XB0X 1QGPA 2V26A 2R0QC 2DOJA 3H3ZA 3K4KA 3HSTA 1F4KA 2Z16A 1UIUA 4XKCA 1YOVB 3LFKA 1RETA 4XN0A 1IF1A 4BQQA 4UB8C 1P92A 1WHUA 3O6HA 2MABA 1P1NA 4UUTA 4OVQA 2RNGA 2B3BA 3D5LA 3LV0A 2R7OA 3OS0A 2FXAA 4M4GA 1MBJA 4ZYAA 1QBJA 1U5TC 1NV2A 3LSLA 2I0CA 3V5AA 4OWDA 1NNPA 2TCTA 4OETA 4WCGA 3EPZA 4R6KA 2Q1ZB 1KGSA 1LAHE 2X85A 1J0RA 4BBSJ 2EIMH 2ZXJA 1I27A 3O29A 3HHFA 3NARA 2A3SA 1YW8A 1FSAA 2L0KA 4GL8A 4OVJA 2E7WA 1YJWI 1OJLA 1ZBMA 1Z9CA 1QPIA 2HQNA 2P6TA 3FISA 1ZR4A 1K78A 4GXSB 4JB7A 4IL6C 4PCDA 3CZ6A 3NQOA 2W7NA 2CW0F 3OYAA 4WX9A 2CWEA 1TWYA 1F9NA 1LAGE 1FTAA 1MBKA 5F7VA 3IAS2 1VQOI 1O63A 3ECOA 3G3JA 3OV8A 2Z3YA 1VE4A 3GBAA 3JAMZ 2XROA 3LUYA 3V89B 3IB2A 1QKAA 5E3NA 2CW8A 4ENNA 1IDZA 1AKHA 4CZCA 3V8LA 3C7JA 3BTJA 3FHNA 3HJEA 3RJPA 2ISYA 2LH9A 5GAEJ 4BQOA 3RZDJ 4G61A 2E5NA 2B3FA 5HLGA 4GX3A 1HA8A 2VKDA 4WF2A 4YMBA 3R7XA 3CDLA 1FOYA 3QU6A 4A3GJ 4KMUX 2OTJI 3KSXA 3IO4A 3OD7A 3ZQQA 4W97A 5E1WA 4BU2A 4EMSA 4DBQA 3WTYC 5K5RA 4XIDA 2VJ4A 4JX5A 2V3TA 2DYSH 1HW1A 4F18A 1T0FA 1NFTA 2QCOA 3OOAA 3FKJA 5CMBA 1FEXA 1DP7P 5HLTA 1NV3A 1ZARA 3WG7H 1VQKI 4O8MA 2OZ6A 4HE2A 2KT0A 4A3MJ 1KQ9A 5GTHC 1YRNA 2DK5A 2V84A 3B8BA 2HDCA 3GBBA 2LC2A 1N7XA 2Q88A 3U1DA 5GAHJ 3KP5A 3ZOBA 3MWBA 4OIQF 1FBDA 4OEVA 2F5CA 4PJNA 1WJCA 2CQXA 2CJJA 1NG7A 3ZN1A 1VTNC 4KISA 3VVEA 1XVXA 3GZNB 1K9YA 1HSEA 2Q89A 1P6RA 3GTGJ 2QS1A 2I0BA 3LSWA 3TW7A 4I2OA 1UG0A 1FPBA 1XN7A 1EU8A 5EYGA 2A5YB 3L2WA 1MNEA 2OAZA 2P3VA 3OYMA 4OEUA 1LVAA 3CJTB 1WH5A 1VQ7I 1LFIA 4KNYA 2DQVA 2LNBA 2JJKA 4G4PA 3W2VA 5TU0A 2QL3A 2L54A 5B70A 4OVSA 4IO2A 1VQLI 4YFKF 2DOEA 1YTVA 3DP6A 5J1YA 1B8IB 5JFRA 3VLVA 4I02A 4RXLA 2DXIA 3IWZA 5D6EA 1JQFA 1MSFC 4N81A 2VBZA 9ANTA 5EQAA 3SEYA 3BIGA 2HOAA 3BR1A 3FXOA 1USTA 4BXFA 1CB6A 1OMIA 1B3HA 3SZGA 3H9QA 3VWBA 4C0RA 2CFXA 4NF6A 1P2FA 3H9JA 2YPRA 3ABLH 1H8AC 1LCTA 2M45A 4IRIA 1B3FA 2E1MB 4XR6A 4XSZF 3RPUD 4NQWB 3A03A 3ZXSA 2NS8A 4CA0A 4LA9A 2FNPA 2X7QA 3KN7A 2ZB9A 1MJAA 4HX4A 2EV6A 3DXJF 3OYBA 4GBWA 4YRVA 3GW2A 2W1OA 3GTMJ 3DWLE 1R9QA 2DDKA 4R6YA 5F0FA 3HOWJ 2ICWG 2FX0A 2K4BA 1PB9A 1YAEA 2DVZA 2KP6A 2XD2A 3S1RJ 4L9VA 5EGOB 1FJLA 5IPAA 2Y7IA 5I59B 2IGMA 3EUHC 3Q5FA 4R79A 2FEZA 3Q3SA 1B9NA 1MJ9A 3KZIC 1NK3P 4MF3A 3OEKA 2I48A 4O7MA 4U4XA 1WJDA 5L9OA 4RLFA 3U8QA 1YFHA 2THIA 2XGDA 4UXNA 1G2HA 2RC7A 4P9KA 4N6DA 4E7LA 1R1NA 1E17A 3K6UA 1ELJA 1H76A 5DVJA 2R3SA 3JRAA 1N0TA 3S9NC 5F27A 1RUOA 2D1VA 3FK7A 5F1QA 1BJZA 1U6GA 2QRYA 5F1JA 4NHBA 4Z2YA 4G8XA 1Z6TA 2QKLB 4I99C 1WJFA 2V93A 5L9MA 1IMAA 1MBGA 1YZ0A 1B7ZA 4FCYA 3BR3A 3M3LA 4MEVA 1D1AA 4PFPA 1BBYA 2DXRA 4RS8A 2V3QA 2EZLA 4RDUA 1B0HA 3IHUA 1B4ZA 1TC3C 1K83J 1IUDA 2Z8EA 3RLFE 4MEXF 1P99A 3DEEA 2MH9A 3JRIA 2HXWA 2DFFA 3ODBA 3BZCA 5E8IA 3QUFA 1FPQA 2DAOA 3HGGA 4IOCF 3HUGA 5I7IA 4KN4X 4NEDA 3UNGC 3BC8A 5M2VA 3U93A 5ET8A 3GTJJ 1RKWA 3ASOH 3QRFF 1X4PA 4EJWA 2VB6A 4BXXJ 2MLGA 3TMGA 2EBIA 2JRTA 4X8RA 2QGUA 5DD8A 5HS7A 3W2WA 2XGCA 3OOUA 3JR9A 4CCMA 3KFMA 5J1DA 4XLEA 3TP3A 2Z22A 1MY4A 4P56A 5HVQC 1DOTA 1USYE 3MVXA 1BC8C 3M3YJ 2HXOA 4AM3A 4XLHA 2H9BA 3F22A 1JKQC 2R7RA 4XQFA 2WBBA 2DE3A 2KLFA 4OAYA 3HPHA 1B72B 2HEUA 2H8RA 1DCUA 3PUXE 1K61A 5IP9J 4I1DA 2XXVA 4OINF 4DZPA 3T93B 2QVOA 1HW2A 1BW5A 3PPRA 4P1LA 1BI2A 1YIOA 2IS4A 2KMUA 3KZZA 1R23A 2QVVA 1WH7A 3TDJA 2NXNB 1VF9A 3O97A 2L9NA 2ONKE 5ICTA 3MZYA 1LFHA 2UWMA 2Y84A 1P9QC 4ITVA 1GV5A 2A6HF 1Z77A 2IS2A 3T22A 1LCFA 4DI4B 2M3AA 2XPVA 4M9ZA 4O3BA 4RPNA 2J5PA 1T38A 2JA6J 1RPWA 3HIFA 3KN8A 3H5NA 4FEDA