3K1MA

Crystal structure of full-length benm, r156h mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
300
structure length
300
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
total genus 96
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA03
3QUFA 4ESFA 1H3DA 1S9TA 3OMBA 2GRVA 3SEYA 1MDQA 1FW0A 4TOZA 2DXRA 3USDA 3IWFA 1B9MA 1E2XA 4BDRA 2A68F 1XSVA 2YSRA 4GQOA 1ZTYA 4O3BA 1WKMA 4RYAA 4P9UA 2QBYB 2WC2A 3IKVA 4WXDA 4WWCA 4NF5B 3FVKA 1N7WA 2XGXA 3QYTA 2O7UA 5HPQA 2DPDA 4IO5A 1IITA 3FVOA 5LRSA 2O6AA 4UXNA 5I56A 4GF8A 4GCVA 3E9XA 4X48A 2FF4A 4OMYA 3SETA 5M2VA 1LNWA 1BOAA 4XKPA 2VP1A 2UYEA 3HHFA 2YX7A 3LAPA 1ZYRF 2Z99A 2FNCA 1YCJA 3RYRA 3HPIA 4EXKA 3C3WA 4DQ2A 2JTVA 5JHUA 4KCCA 4ISUA 3P7IA 3VV5A 2A6EF 5H8FB 4KHZE 5CVRA 4MEXF 1WODA 4YIIA 4IHTA 4F29A 1FSHA 1MDP1 1SW4A 2ALUA 3CG1A 4JBAA 4CO8A 5K5RA 2VHAA 2UVGA 4BDLA 3K9TA 1POTA 1NNFA 4YZZA 1J7KA 2Y7WA 4A5MA 2GAUA 3LWFA 1MQIA 4U0WA 3HCQA 4YMAA 5CBRA 1RNLA 2HKOA 5FD6A 3O2PE 4YAHX 2GXBA 2CYYA 1P1NA 1IAWA 1P4XA 1OVBA 1HKTA 2OD5A 1HSEA 1SYHA 2E1SA 3ONMA 2F6PA 4POWA 1PP8F 3DP8A 2GWRA 5DEQA 3E4RA 1NKXA 3TODA 1K79A 5DVJA 2DLLA 2F5FA 3ZMDA 4LLGF 3K1NA 2STWA 1Q1KA 1TQIA 2JSCA 4Q8RA 3TEPA 3P9KA 4L18B 4KIGA 5LHIA 4HV6A 2RCBA 2XVCA 1SAXA 3OO6A 4Q5TA 4EVIA 3NQOA 1II5A 2HS5A 3FV1A 4FHTA 4OMBA 2DQLA 2L01A 5E20A 5BPDA 3H6UA 3F8BA 5DT6A 2Z5UA 3L00A 3SEWA 4DCYA 1Y20A 2O84X 4U1ZA 1P6RA 2ZNUA 3I4PA 3GBBA 3RN8A 4HLXA 4IXAA 5B70A 3R61A 4KCDA 2DS9A 3ERED 2ACJA 2O7IA 4GXOA 1SDXA 2VBXA 1UHWA 5DD8A 2L4AA 4F3GA 4JWYA 1KGSA 1F1ZA 2Y7RA 4FEBA 3KOTA 2GFEA 4Z0IA 3IO6A 2Z33A 5D5VB 3ZMUA 1BC7C 1MPBA 2CFXA 3GUDA 2EFPA 3EHSA 2BYVE 4LZ5A 2DXYA 1SFEA 4KD5A 3HSEA 5I59A 2Z3YA 2V3QA 3JW4A 1QNTA 4PCQA 3PUVE 5ERIA 4NQWA 2V25A 1IN5A 1FY7A 1MQHA 5DCMB 1EH8A 4ETSA 2Y7IA 1XN7A 1KQ9A 5J1DA 2P1SA 2NOOA 1EZ9A 5F64A 3KP4A 1OYYA 5TPAA 2HAUA 1DP7P 2Q2AA 2GHAA 3I58A 3SZTA 2VBZA 3F8FA 4GL8A 3IL2A 4OFOA 5A5XA 3G3IA 1ZLKA 2V79A 2UXNA 1QW0A 4F2QA 1R00A 5K2YA 3J80K 3UN6A 3Q28A 1GTKA 3H06B 3TOAA 3M3KA 4P5OA 2DSFA 3IX1A 4N13A 4NF6A 1QKAA 1SQYA 2VOOA 1T6SA 1FQBA 2DWHA 3TELA 1AWCA 4RJZA 4BDQA 4GYGA 2FOKA 3FXUA 2A5TA 2HAVA 4ENNA 3WODF 3FJMA 1NHAA 4UVCA 2UXXA 3TO9A 3RJPA 3GEZA 4TLLB 1U8RA 4QF9A 3E3VA 4RK9A 2E1CA 4YFNF 1XVYA 5D8KB 4RGXA 2Y84A 1R58A 3VEPA 4IRIA 3CR9A 5AONA 4IGTA 4G8MA 2M45A 2O68A 2PLYA 4TLMB 5LHGA 2W84A 3ILUB 1OPCA 3HHHA 1A7LA 3WGIA 4P0IA 5CM6A 1FQAA 1YQAA 4WF2A 2RQPA 5HDKA 4LQ2A 5FHMA 4LG0A 1MPDA 5D5XB 4CXFA 3LSWA 1FTJA 5KCJB 4PFYA 2WWYA 1YTVA 4G6DA 4KYWA 3OOPA 3F6OA 1PBQA 4M1VA 3S9EA 1M5FA 2XXVA 3QOPA 1URGA 2XD2A 1KU3A 4ECFA 4I2OA 1MY1A 4M9XA 4FT8A 1VR5A 2OAZA 4IVNA 1SD3A 3TGNA 3V5AA 2OCUA 1R5GA 5A2QK 2HDCA 1YS6A 1MPCA 2XUBA 2EWNA 1ZLQA 3FMRA 4H5FA 2EFOA 2QUFA 1FTLA 1ZN2A 3GVAA 5BUUA 2AL4A 3M8UA 2B65A 4PFTA 3TCFA 1BLFA 1OLCA 3MVZA 1H76A 5L9SA 2IT0A 3ROUA 1FLIA 3IB0A 4L9VA 2HGCA 4H8IA 3E6MA 3G3FA 4HF2A 5DDGA 1IQ7A 3K2ZA 4KR5A 3ZMTA 5BWJA 2DI3A 4HTGA 1URSA 4C1TA 1G3SA 3KP7A 1I27A 3D0SA 4G77A 2OBPA 4HCWA 3RTRA 2IA2A 3FXRA 3ZMZA 4G8HA 1TT1A 2O69A 1TNSA 1Z6TA 2IP2A 2HZKA 1UIUA 3FV2A 2LDUA 3PQKA 1POY1 1H45A 4MLVA 4EUOA 1LJ9A 2GIVA 2PG4A 1LAGE 1MY4A 3K69A 1NFTA 5CJ9A 1LAHE 3T9HB 1KU2A 2HR3A 4WXJA 1EV7A 2PEXA 1B3LA 1ZKBA 1MXYA 3GBAA 3WTXC 4XKRA 4U0VA 2D3IA 4IRHA 3OEMA 2O6GE 3PU5A 3E6DA 3HSFA 3WE3A 5I2KA 2XHDA 4YIFA 2R6GE 2CO5A 3RKXA 2WV0A 3KG2A 2V93A 3H6WA 4U22A 3MZBA 5AA3A 2MH2A 3CSGA 1LDKB 4EF2A 3FUZA 1OMPA 5KCJA 4JSOA 2HCAA 3QPHA 1P4WA 2NYXA 2ZCWA 3F3XA 2D5WA 2F5DA 1G3YA 2XV4S 3MZYA 3IJOB 1OLAA 2HZTA 2Q88A 4UHTA 3TCHA 2CGPA 1RUOA 2ZKZA 3CUQA 2BJJX 2QMWA 3PV0E 2CSOA 3T93B 2FXAA 2I3WA 4G9YA 2HFBA 3U9GA 1JQFA 5K5OA 5HM4B 2VT2A 5BQTA 2QQ9A 2YU3A 1MXZA 3U8QA 5FTIA 1FCKA 2R7DA 2QQAA 2QS2A 2UVJA 5FD5A 3B02A 4UV8A 5TU0A 2Y7KA 3BJAA 4DXCA 1Q35A 3VFZA 4LLLA 3Q29A 3RQTA 2XX8A 2KRFA 3ML6A 4YICA 4OOIA 4ZDMA 4NHJA 2Y7PA 2P0SA 1P99A 3T22A 1JW4A 2V1UA 4NEDA 1XCVA 4G7OF 1DUXC 3FJ7A 3K1PA 2A07F 2I3VA 2HFHA 2JPCA 1PDAA 3NRVA 2EA4A 1MQJA 5ILSA 3KBRA 2PI0A 2D21A 3H03A 2ABHA 2OZ6A 2CQKA 1IN4A 4OU0A 3JAMZ 3DQVC 1R9LA 1OYIA 4ESWA 3BFUA 1Y4CA 4OERA 3MAMA 2QLZA 2F5EA 1HW1A 4A12A 4L5IA 2RC8A 4L9TA 3IB1A 2XASA 2DOJA 1D3KA 3C31A 1PBPA 3K1MA 4DXUA 1PB8A 2LF8A 2LKPA 1O3RA 2K4BA 3DF8A 1FQEA 4GYIA 3VLWA 4BAYA 5JTYA 3GFJA 3U72A 1A54A 4BYYA 1GHCA 1UTBB 1H9GA 1V3FA 3VXBA 1O3TA 4FJPA 4NTLA 3UK4A 5F1QA 2ESHA 4BDOA 3I64A 1Z05A 3C32A 3U1DA 2DAOA 4FORA 4WCGA 3KJTA 1I69A 2JPBA 2HEUA 2I0CA 4LK1F 1BIBA 4L0YB 1FOKA 5CMKA 4LONB 3TAJA 1AH5A 2Z9OA 4RB1A 1D3YA 1YW7A 1BI1A 4HF0A 4F7ZA 4LUBA 1N0TA 4LA9A 4ZS9A 3SESA 1ODDA 2A3SA 4FEDA 4N07A 5I56B 4LJZF 1Z7UA 1QBJA 1DTZA 5TRDA 4PP0A 2M5WA 3CVGA 5CVIA 1JEVA 4EV0A 3ECRA 2XAQA 3ZQ7A 3MBPA 4G2ZA 4ESXA 3EF7A 1YO5C 2DFIA 5BPIA 5CLSA 4HLYA 2YLNA 3H6TA 3QK6A 1BP5A 4RNSA 1FQCA 5IKBA 2NXOA 3QU6A 2AS5F 1US4A 3FM5A 4LATA 2L4MA 4HA8A 3TTMA 2UYFA 1B1XA 1YTYA 2ZXJA 4HOBA 5H8HB 1LEBA 2DT5A 3LA3A 4HAMA 3TKYA 3ZN0A 5DYMA 1WSUA 5DEXB 3U94A 4BDNA 4MF3A 2VBWA 4OENA 1ZRDA 1N3XA 4L5JA 3LSFB 5IAIA 4H67A 3EQLF 3TOBA 2DU9A 2ZYKA 3HN0A 3EN3A 4KN7X 4LLNA 3EQ1A 3O6HA 1LEAA 5I58A 1SMYF 2VOPA 4IO2A 3QAXA 3O6GA 3HOTA 5CMBA 2G7HA 4RB3C 2ZJ2A 1MH3A 4RY1A 1JXSA 1Z9CA 2DWJA 4CICA 1EH3A 2ZMEB 2THIA 3ZP5A 1BTJA 2VC1A 1RUNA 5HS8A 3GLBA 4OEVA 1I6XA 1Y4TA 4CYDA 1PC3A 4EM1A 3RDIA 3VDFA 5DD4A 1N76A 2EV6A 1FYLA 4RPOA 4R6KA 5DVFA 2PBIA 2XD3A 5ICQA 3B6QA 1LAXA 1B6AA 4U0YA 4AD9A 4ZEIA 4ENKA 2MD5A 5HS7A 4F3SA 4O3MA 1OMIA 1BI3A 2O1MA 2FMYA 3O9PA 4RGSA 2HQNA 5LRRA 2IJLA 5H20A 4GGGA 4ZYEA 3ZKLA 2H27A 1VE4A 2QENA 4WX9A 4UA8A 2GXGA 2ISYA 1RIOH 3S9LC 1B52A 2V9VA 4G6QA 2I49A 4HX4A 4G68A 3MCZA 2H25A 3HTUA 2LNBA 2DWAA 2HXWA 1FNNA 4N9IA 3N97A 2Z8EA 4F18A 2ZO4A 4ON0A 5HLHA 1O7LA 3CFLA 2EFNA 3A09A 2HWVA 4HF1A 2QS4A 1QULA 3WGGA 2H9BA 5L9OA 3N4MA 1MY3A 4U7BA 4LGWA 1ATGA 1WDNA 3ZSFA 3BPVA 3MVWA 5IT9K 1EH7A 3LSTA 5LOMA 2REGA 3D5LA 3F8NA 4XSXF 4WXHA 1SMTA 4P11A 4IO4A 4IRGA 1JVXA 1L5TA 1B9NA 4ZE8A 3UIFA 2VN2A 1F5TA 2ETHA 5L3GA 4IHSA 2QS3A 3LBSA 5EYFA 3RKYA 4RPNA 4I1DA 1GV8A 4WKMA 2PX1A 1YAEA 2DPUA 2O1LA 4KDPA 3TO7A 2R9JA 3J81K 2M8CA 2V3UA 3TTRA 5L9MA 3E5QA 3SQNA 4ENMA 3LUYA 3FD3A 1FTOA 4L9NA 3RPUA 3GWZA 4MHGA 1SBPA 4NF6B 3S2VA 5E8GA 5K5QA 1MGTA 1G3TA 2BGCA 4ENJA 1LCFA 5CVJA 3C9HA 2IPQX 3T8TA 4QFNA 1SYIA 3MW0A 4F3PA 1JETA 4U7DA 1B1BA 3VODA 2FU4A 5E1WA 4IO3A 1PUEE 1I5ZA 2H6CA 5CRYA 4H65A 3WAEA 1QVSA 3KGCA 3R6SA 2XXWA 3JTGA 5EEGA 2RN7A 3E6CC 3DP4A 1XT8A 5JTYB 4R72A 4YG2F 3FM3A 1OKRA 1LBCA 2AIXA 1JHHA 2Y75A 2UZKA 2A5YB 3QXMA 5HVQC 4K2EA 4BQAA 4QFLA 3VB2A 3BROA 4U4SA 1OR7A 3I0TA 4NMYA 5KDTB 3WU0A 5EHMA 4QLCU 1K78A 1P1WA 3KP2A 3F8CA 2O3FA 4ELPA 3RPQA 5TPAB 1MG1A 5CMMA 1JGSA 2B0LA 1TW3A 4B09A 3GF2A 1I6BA 1USSA 2NNNA 1TWYA 3IKTA 1N04A 4OQOA 3UP9A 3F6VA 2GHBA 1QZYA 4Y13A 1YFHA 3ZKKA 3K0LA 4GL0A 5I2NA 2VBYA 3J81Z 1KQ8A 3KEIA 5HDGA 2CMOA 4X1BA 4A6EA 1YIOA 3SEVA 1SVXB 2AYSA 3N6UA 1NH8A 3F22A 3N5LA 3UA8A 1J75A 1LFHA 2FE3A 1A8EA 1R22A 3C34A 3TTLA 4GOTA 1BN5A 5ICEA 1A55A 1Y3NA 2P2AA 3SZPA 1U5TC 2XHKA 4YFKF 3DEUA 4E0XA 1G3WA 3H3GA 2DE3A 1LSTA 4RA1A 4ZYDA 3IJXB 4M6XA 1TXFA 2OJTA 1MY2A 2BEOA 4TV7A 4M9SA 3RYPA 5FFXA 1RYXA 5H6RA 3MZHA 3FMSA 3JV9A 3ZMVA 1N84A 2QL3A 2PMUA 3CDHA 3JYRA 3KN8A 1O7TA 1ZREA 2KJBA 4HYEA 1ON2A 3M8FA 3KLNA 3V7CA 1NL5A 2B3FA 4AQ4A 4MTEA 4UUVA 3TUSA 3CO7C 3LA7A 1W7PA 1T39A 1USYH 1Y0UA 3H6VA 1MM6A 3K4UA 4LFUA 4OEUA 4FX4A 1MDMA 3J7AO 4EF1A 4YKJA 1O57A 3T1BA 3G73A 3GLXA 3Q25A 4PE5B 1IN6A 1R23A 4QFOA 3FVNA 1ZARA 2VT3A 3CLOA 2XX7A 3KZGA 4AB5A 2IW5A 2VD3A 5D4RA 4Z2YA 1B05A 2DQVA 3DKWA 4AWXB 5TP9B 4R79A 3OO9A 4XRFA 1OQGA 3KEOA 3PPNA 1MJAA 1S7YA 3EDPA 1BBYA 4S05A 2Z22A 1PEBA 4MH5A 2BE5F 3IL1B 5IT3A 3U2RA 5AA2B 3C7JA 1BKAA 3SHFA 3CUOA 1B58A 3O97A 5BOXA 3HUGA 1B7ZA 1DMBA 3BJOA 1B3HA 3G3KA 4XKQA 3U93A 3KN3A 1Z6RA 1MM7A 2COMA 4Q30B 4I09A 3MWBA 3DELB 1LVAA 1TQMA 1O63A 3FF5A 4O5VA 2FSWA 5DCFA 3T5XA 3TKDA 4S04A 4UNOA 3GFIA 3MJNA 1MZBA 3Q9VA 2M87A 3R60A 4XTCQ 3QSLA 4UVBA 4ASNA 2K4JA 3W6KB 1LLSA 3GFMA 2H94A 1JW1A 4YU0A 2VD2A 2Q2CA 4QHQA 2A69F 3N26A 4Q4ZF 3I53A 1B4ZA 2Q0OA 2MLGA 1I1SA 3F23A 3T66A 2FBKA 4F39A 1ZIUA 1S29A 4IO6A 1ZHFA 4QRZA 2XXYA 5DTBA 1B4AA 3BZ6A 4ELOA 1ZG1A 4I8CA 1Y9UA 3IB2A 2HKXA 2W24A 4K3FA 3E6BA 3LSLA 2FQ3A 4FE8A 4UV9A 3I5UA 2RKHA 3E5XA 1R1NA 2Q8JA 2XX9A 3FXQA 1P2FA 5ILVA 2I58A 4PETA 3OENA 4OXVA 1QUKA 1WVJA 1U3EM 2VONA 3TQNA 4PDKA 2UVHA 3TCGA 1D8KA 5DYHA 5CVVA 2C6YA 2F34A 4OESA 3PQJA 1XGOA 1N3WA 1D9VA 1B5HA 3IOWA 1Z91A 1BM9A 4BHPA 4GWOA 4UACA 1A04A 1MQGA 2RC9A 3DP7A 4FIMA 3PMXA 1D5VA 1TFDA 1O3SA 2W7YA 4EGYA 1P92A 5CMCA 2JT1A 1B7UA 1T98A 1ZBMA 2Q8KA 2E1NA 4RGRA 2V1DA 2G9WA 4ND9A 3KP5A 4PQJA 4FAJA 1GVJA 2HYGD 1B32A 2L54A 2P5LC 5FHOA 4OWDA 2ZNYA 4NF8B 5FLXK 1T38A 5FB2A 1BJAA 1NNPA 3MFKA 4IB2A 2Z8DA 2DBBA 1ELJA 2REJA 1B51A 3I59B 3ULQB 1LFIA 2HOEA 2DE4A 1F4KA 2FNAA 2LAOA 2RINA 2FNPA 5AA1A 4FX0A 3IR1A 2H09A 3V8JA 3L6GA 4KPTA 3D4CA 2PVUA 2PMHA 4YKPA 2X0LA 1U5TB 1IIWA 3R0AA 2ZYNA 1H43A 2XAHA 1TW2A 3VXCA 1YLFA 2TDXA 1H44A 4Y15A 1W7PB 4ZEDA 4G94A 4EXLA 2XXXA 4N6PA 3K01A 4YKIA 4ZE9A 4HS7A 3QRFF 1IXHA 3TO6A 4MNUA 1UTHB 4MTDA 4H6DA 2FEZA 5LEJA 1SFUA 3WG9A 3BPXA 3TDJA 1HKQA 2MH9A 3OOAA 3S4UA 3RUMA 3QP5A 1FBUA 1ANFA 3IAZA 1HBXG 4GXAA 3QP6A 3SXYA 2XXRA 1TNTA 1D4NA 4HW8A 5I2NB 2ZNTA 1SD5A 2PFBA 1B46A 1J0RA 1UIVA 3VFJA 1Y3QA 4G4PA 2EV5A 4HZFA 4EM0B 5AA2A 4P9FA 1S7OA 4DZ1A 2QYOA 4KA4A 3V8LA 1IXCA 1CF7B 2QZ8A 3MVXA 2A61A 3LR1A 1JE8A 4R73A 4HW0A 3R6UA 1PB9A 3OXNA 2RCAA 2ZMEA 3RIRA 1JEUA 1Y3PA 3B7DA 2XXIA 4A0ZA 2Y0MA 1G6NA 1YPNA 3UORA 1YG2A 1CE2A 1DPEA 3CUQC 2OZZA 3V83A 2MC3A 1S3JA 3O6BB 4I7HA 2H5YA 4JB7A 1U78A 2P5KA 2P8TA 2RNJA 1YYVA 4LK0F 4XBFA 2X26A 3I6VA 2XIGA 5E18F 2V6CA 3GYHX 3M3FA 2NVUB 2QBYA 1M5EA 5H8QA 4KNYA 3P9CA 2E7XA 3ECOA 3O3KA 2NAZA 2R71A 4FECA 2I0BA 3PPRA 3IHUA 1T0FA 5CVUA 4H0WA 2EB7A 5H8NB 2ZNZA 1S8NA 5F6FA 2F35A 4A0YA 3MUQA 1A40A 4UVAA 3HV1A 3ABTA 4DDDA 3PUZE 4KUMA 5LGNA 3O28A 2YPRA 4HQMA 3MPKA 4X1DA 4LZ8A 1DTGA 4G68C 1XDUA 3W15C 1MJ9A 2OBGA 2VC0A 1QUJA 1OQHA 2NWJA 3TTNA 1OYWA 1XVXA 5I59B 2DO7A 2V1XA 1UHMA 3IO4A 5I84A 1P1OA 5DUIA 2P6TA 4R2BA 4IPAA 3WAFA 2VODA 3LAJA 1ONVA 3WTSC 1E17A 2ZYOA 5ED4A 1LFGA 2JRTA 3PUYE 4F22A 1R1TA 4U21A 3WU1B 1NNKA 1J2XA 3MAJA 1B40A 5LHHA 4WEPA 2K7LA 1GXQA 4Y17A 2H4IA 4ZZAA 3MC2A 4NF8A 2B3BA 3V89B 1QJMA 5KZTA 1O7FA 2Y48A 5E8IA 3BP8A 3IC7A 3QAHA 3GZ6A 3PGFA 4H0EA 3HHGA 2BV6A 4HX7A 1P1QA 1FT9A 1QQIA 1XMAA 4XKNA 1KA8A 1AIVA 5ITOA 5JI6A 1XC1A 4OZ9A 4OIPF 2OA4A 2RKMA 1UFMA 2IA1A 3WTYC 3H7MA 1ZLJA 2GQQA 2LSOA 3ZPLA 3QUJA 4KYEA 1U5TA 3FWEA 2KLFA 2W25A 3DM0A 1DDNA 2D1HA 3HSTA 5IT9Z 3ISPA 4GD5A 1CB6A 3JTHA 1A8FA 3F8MA 5FLXZ 1ZU0A 2G29A 4M6YA 1R9QA 3PD9A 3ECHA 4Q48A 4H8JA 3K0VA 5K2XA 5CBSA 3CSBA 2ANJA 2PYYA 4WEDA 3KJ7A 2YR2A 1B3GA 3SKPA 3R26A 3I71A 3VOEA 3TQLA 1Z7NE 4G7ZF 4I02A 4Q0CA 3HSRA 3T8RA 3KFWX 2DE2A 2ZNSA 2CW0F 1I6QA 1K6OA 2HTJA 3F11A 3W9VA 3WTVC 2PN6A 3KCCA 3RT6B 1FQDA 2PBWA 1FBSA 4P96A 4MLQA 4GO1A 3CO6C 2F6GA 3TDZC 3CFXA 4NF4A 1S7AA 1B4HA 3KP3A 1MXXA 5BS6A 3MP6A 1HQCA 5H8HA 1LDJA 2R7FA 2GH9A 1LAFE 4JWXA 2F7BA 4ZZEA 2EFWA 3BKIB 4Q47A 1FBQA 5K1YA 1SD7A 5J6XA 2Q9TA 1R6ZA 3O66A 4JK1X 4CZZA 5ILUA 3U92A 2WKYA 4ZZDA 2IEEA 5A5XB 4HQEA 3EETA 2GA1A 2F5CA 2I4BA 2WTEA 3PD8A 3VVDA 5LGUA 4R6HA 3CTAA 4JBZA 4ZYHA 2RVCA 4AVPA 4YMBA 3MQ0A 3RNNA 3IRRA 4R9FA 1HXDA 1SW2A 1TTYA 3ELKA 1ULYA 1L3LA 1T2KA 4U4XA 3OO7A 5LGTA 4CGZA 4BNCA 1SD4A 3EPEA 1GR2A 3FJGA 4U23A 4ZEFA 1B2HA 5J8FA 1TFAA 4QSEA 3N6TA 1BI0A 2DWIA 1NMUA 4DXBA 3GFLA 4HDVA 4EQ7A 3AXFA 5CI5A 4YB7A 2O61A 4IY5A 2VE8A 1ZG5A 3V4GA 3SFZA 3BJ6A 3MWMA 4EGZA 4JXIA 2L02A 3RGYA 3T9XB 2VXZA 3IOTA 3BWGA 3T9UA 4MBPA 3G7WA 4GFRA 4GXSB 1FSEA 4G8XA 3IOVA 4EDPA 3TFLA 1JVYA 4NB5A 1IUDA 3VVFA 4LD5A 3B6WA 1HW2A 1P1UA 4L9JA 2DVCA 3Q9SA 4RB2C 2XKOA 4F31B 3PPQA 1ZG3A 3FZVA 5JEIA 2HZLA 3N94A 4LB5A 3E97A 1W7PD 3BBRA 4ZECA 3ZMSA 1EZPA 4R2FA 3FATA 3EHUA 4OIRF 4DE8A 5FTHA 1W4MA 4M72A 3K6UA 1QO0D 3WGHA 3HTSB 4IF4A 1HSLA 4U88A 2KIMA 1XD7A 4EQBA 2QWWA 2RC4A 5ELVA 2O03A 3HYIA 1M5BA 2O8XA 2J5PA 3O6IA 2RC7A 1RZ4A 3TTKA 2KIFA 2PT1A 3GXAA 3MEXA 2HEOA 3FHZA 4BHBA 4I0AA 1F9NA 5H8FA 2ADUA 3H3ZA 4PGGA 3CIJA 4U1OA 4NWCA 5HOOA 3E13X 5I2KB 4N9HA 2E7WA 1Q1HA 3F72A 1IZ1A 1IW7F 2OWSA 5FFZA 2P5VA 4M74A 2QM3A 4AIJA 3EUHA 2OQGA 3KZZA 3RKWA 3LFKA 2PMSA 3IRQA 2AXLA 4RAZA 1XDSA 4OMZA 1MXVA 2F2EA 3I3VA 4JWOA 1REPC 1XSXA 2EFQA 1IXRC 3COAC 5D6FA 3IORA 2KIUA 3OSQA 2H98A 1EU8A 3I5OA 3C1DA 5H8NA 4CHUA 2MA3A 3HO7A 1A99A 1GGGA 1GXPA 4R9GA 2QMXA 2RV8A 4RK2A 3PFIA 5KVRA 3CFZA 3C36A 3I59A 3QU3A 2NS0A 1FTMA 1MDMB 1B3EA 5JVTA 1LB8A 1ZGJA 4RXLA 3RI4A 2UXAA 2MBFA 4EJVA 2W57A 5AA4A 1B59A 2XAGA 4C0RA 4M73A 5L3FA 3L6HA 2YX4A 2DVZA 1IEJA 5TP9A 1MXWA 2CZLA 2IA4A 1UTBA 1KYWA 2FA7A 3QPTA 4BLAA 1B6HA 1K7AA 1FZPB 5KK1A 1V4RA 1O3QA 2F7CA 1EH6A 4I62A 3PMWA 4QSDA 2EA2A 2Z8FA 1OVTA 1XB4A 5HBCA 3GZ5A 4QFPA 4FATA 4R8HA 2XROA 2HQ0A 4OFLA 3KP6A 2X4HA 1P4AA 2LF7A 4OIOF 4YKKA 2F36A 4HV5A 1QUIA 4KT5C 3E5UA 4A2UA 4THIA 2F5XA 2OLBA 1B9JA 1KWHA 1BIAA 4F1VA 3JSOA 3L9FA 1XCBA 4DCXA 1SD6A 3DPLC 6PAXA 4QWQA 4EJTA 4OFJA 3O2AA 1IUYA 2M30A 2IVMA 3T9VA 1WQ2A 2D2WA 3R0JA 2E0SA 4A5NA 5L8DA 4MQ9F 2EV0A 3PUXE 5JK4A 2XXPA 4O3CA 3RPWA 5F7VA 3WE2A 1MJBA 2MLKA 3S9MC 2DK8A 3MP8A 4PGHA 2XRNA 4L0ZB 4QFKA 3SERA 3DV8A 2GZWA 2UWMA 1FQFA 2QVOA 3VLUA 2DW4A 2ELHA 1IXSB 2D45A 4OINF 4R75A 5L3DA 1FP2A 2QS1A 1AOYA 2VE9A 4OIQF 4H1XA 3GO5A 3M3LA 3M9AA 4HDUA 4G68B 1SW5A 3W9WA 2M1BA 4YB6A 3F21A 3WTZA 4PZJA 4GRKA 1R5HA 3P9IA 4ESJA 2RGVA 1IN7A 5E17F 5E1ZB 4KI0E 4Z7EA 3H3UA 4JSDA 2EJRA 3K6XA 3ILTB 1IXIA 4YFXF 5LBQA 3GX4X 3JZJA 5DUKA 4KFQA 2I4CA 3VLVA 1B5IA 4F19A 1SFXA 3P7NA 1FPQA 1LB9A 3DXJF 3LSXA 1CGPA 1J59A 5CC2A 3KLOA 5D5UB 4RB0A 2ONSA 3LA2A 1FYMA 1J5YA 1AL3A 1XOCA 4HBLA 1HSJA 1XGSA 3G3HA 1FP1D 2G7UA 5JFRA 4C1UA 3FGSA 2ZMBA 1UCRA 1VTNC 1PP7U 3GXOA 4EJUA 2OU2A 4PFUA 3PPPA 3KE2A 5EHSA 1USTA 3A3UA 5I58B 1ZAOA 3B6TA 2P7VB 2RDPA 1STZA 3C33A 5ITPA 3L2CA 1MH4A 1DOTA 4JDFA 2EK5A 1Z1DA 3MQ9A 1X3UA 1FX7A 4OETA 1U6GA 1R1UA 2FBIA 4HX8A 2OZUA 5DEXA 2QQBA 2CG4A 3V7RA 1LCTA 3DFGA 3T96B 1YW9A 3BY6A 3SEUA 4F2OA 3TYHA 1LBBA 4WXCA 3TMGA 4MGRA 1R36A 3S2WA 2NNYA 5FGMA 4EMSA 2ZXTA 1KQ0A 4F1YA 2P4WA 1URDA 4OTEA 2QPQA 4IY6A 1ON1A 3OO8A 4E0WA 4JQFA 1L0OC 2ZFWA 4ZEKA 3MPLA 1KYZA 1UTHA 4LZ7A 5L3CA 2DTRA 5HLIA 2Q89A 3R4KA 2XXQA 3DLNA 1B0LA 3D4GA 4EJWA 5A2QZ 4NF5A 1R7JA 1T0KA 2J5OA 2FMLA 1MD0A 3HIFA 3H92A 3L09A 3JAMK 2DP8A 2A6HF 5ICGA 5F1RA 4KICA 1W5SA 2F8DA 1ZMGA 4IO7A 1PB7A 1D8JA 4KMUX 4ESBA 1RYOA 1N7XA 3IK6B 5CYVA 3K2DA 1W5TA 3THIA 1MRPA 2ZBKA 3HOSA 1D9YA 1KU7A 1OIBA 5D5WB 3Q26A 3FVGA 2FBHA 1H0MA 5AIPA 3KN7A 2Q2EA 3E3KA 5J8CA 5FO5A 3CG3A 1ZRFA 3DPTA 3FASA 1WWXA 4E70A 2UVIA 3I54A 3GZGA 5AE4A 1KU9A 2NUVA 5EEHA 4ONYA 1BC8C 2KJCA 5AIQA 3JSPA 1K78B 1Y1ZA 4KYSA 4F1UA 3RTWB 4KFCA 3J80Z 2OQRA 2R3SA 4IJAA 1H9TA 4A0XA 3KSXA 1DPRA 2XXHA 3BOQA 1DSNA 4M4GA 2ONRA 2M8EA 4POXA 3SEXA 4ZYGA 3EHTA 4BHCA 3UGWA 1TLHB 1DPUA 2IRFG 4O3AA 4N0BA 1B3FA 5E1XA 2FYIA 1YW8A 1NNTA 2F78A 2ONKE 4NWDA 5BMZA 1MKMA 5H8QB 4EM2A 2PT2A 3TZAA 4M71A 1S50A 2X7QA 2QSXA 2ESNA 4B8XA 2H6BA 3SDFA 4LG0B 1FWZA 2BBYA 3LC8A 3TDUC 2XXUA 1ZGAA 2I6EA 3H4ZA 3WTTC 4MFIA 2QJEA 1ZJLA 1YS7A 2K27A 1SI0A 3KETA 1Y1MA 4CDGA 4OYVA 1IRGA 3ODBA 3TQWA 3K6WA 3A3CA 2DYXA 1QPMA 3VE1B 1XGNA 3CUQB 3OV8A 5H8SA 2XXTA 3OEKA 5HDNA 1HW5A 1JW5A 1WRJA 1LB2A 4AIKA 5B7DA 4Q5SF 3REOA 2VGQA 2GA2A 3HRMA 1US5A 4ZH4F 3KOSA 4BXUA 3AAFA 3CRBA 2P6SA 3ZS6A 3FIRA 5KDTA 2JZYA 4LB6B 1IXGA 1C0WA 1QGPA 5DV5A 2NRAC 4LQ5A 4LP2B 1BIYA 1IF1A 2IA0A 1B7HA 5JR3A 1NH7A 3MP1A 2K86A 2KKOA 3C18A 2P7CB 2G93A 2H99A 3Q27A 4HCYA 5ICFA 3C4MA 3G3JA 3B73A 4O6JA 5AA4B 3KZYA 2ISZA 1GVCA 5D8LB 4GVOA 4KMFA 3C35A 1TBXA 4X9TA 5I57B 4TQUQ 4EQ9A 5DCMA 2XKPA 3HRTA 2V84A 4KQPA 2X7PA 3ABUA 1HSTA 2XAFA 2L3DA 3L7WA 1M5DA 3V8XB 1UB9A 4RGUA 5HS9A 4A6DA 3RT8A 2YJPA 1XMKA 3S9NC 3CI8A 3KEQA 1PDNC 5ISUA 4EJOA 3O29A 2D1VA 4ELRA 3FMQA 5L3EA 4OVJA 2HTSA 4P55A 1G4DA 3G3GA 4LVQA 5D4SA 1I1GA 2FRHA 1J1NA 1MS7A 4NF4B 1AMFA 1Z7ME 4XLNF 2O0YA 3DP6A 1LDDA 1MY0A 4ELQA 3IOUA 1F9BA 3KFMA 2VOZA 4BDMA 3PMVA 5FHNA 1MXUA 2F97A 3V8KA 3K02A 2HQRA 2YPNA 1FC3A 1S6LA 3BFTA 4G7HF 4DNCA 1SI1A 4I01A 4AIHA 3EYYA 4R74A 5DVIA 4QSCA 1R1VA 4KIFA 2O51A 4I0BA 2STTA 3HRSA 1B0HA 5HLGA 3VVEA 5LLQA 4XSZF 4I98B 3M1EA 4H5GA 4DLDA 2HYFA 3K00A 3RY3A 1FTKA 4DIGA 5ICCA 2XAJA 3OSRA 3TPAA 2PQ8A 3GW2A 1XSDA 5TJJA 4MEYF 4RAYA 2I48A 1J9IA 3K6VA 2W85A 4P0GA 1VFEA 3MVYA 3QIMA 2OWTA 1I6AA 4NE4A 4AB6A 3T0YA 3WTWC 4WK8F 1ZRCA 1XHYA 3BDDA 4I9DA 4KYDA 1DPPA 2QRYA 3MZ1A 4RS8A 1EZOA 1BI2A 4EQQA 2OK2A 2RF1A 2Z23A 1U2WA 4YB5A 3PUWE 1UQWA 4XLPF 4R6YA 2FA5A 3EYIA 3V7SA 4R1HA 4GIZA 4KIBA 1MQDA 3R7XA 4F3BA 1O64A 5I57A 1VSOA 1WI9A 3IWZA 4XXUA 1RKMA 4ZEBA 1XGMA 2A5TB 4PFWA 1HKSA 1USYE 3OELA 3ZN1A 3LQQA 2F7AA 3M8EA 4GLIA 1JHFA 1XS5A 1LQ1A 2DQRA 2CWEA 1TQPA 2ZYMA 3Q5FA 1JNFA 4KN4X 1IRFA 4U2RA 1RI7A 1VFDA 3MZ9A 1B1HA 1FYKA 4XIGQ 3U1OA 4BH9A 3OD7A 3PPOA 4G8NA 3KSJA 2V3TA 2K02A 4M9ZA 3CJNA 5LEKA 1IN8A 4OHNA 1AOVA 5L3BA 3LQRA 2AL5A 3NEUA 4ZZLA 3FX3A 1CF7A 2PJPA 1SW1A 3RLFE 3M7GA 3G3ZA 1QZZA 4D0PA 2A5SA 1B5JA 2DK5A 4IGRA 4LMYA 5ICTA 5D6EA 3RTFB 1ZH5A 1M5CA 5AA2D 3WTUC 1LGBC 4MQVA 4L17A 3W6JB 3HRUA 1QKBA 5H6QA
chains in the Genus database with same CATH superfamily
3QUFA 2L7FP 4ESFA 1H3DA 1S9TA 3OMBA 2GRVA 1UG2A 3SEYA 1MDQA 1FW0A 4YELA 2DXRA 4TOZA 3USDA 3IWFA 1B9MA 1LLSA 1E2XA 2JA7J 4BDRA 2A68F 1XSVA 2YSRA 4JP0A 4GQOA 1ZTYA 3S3NA 2JMWA 4NDLA 2HOTA 4O3BA 1WKMA 1R9TJ 4RYAA 3QYBA 4P9UA 2QBYB 2WC2A 4IHVA 3IKVA 3K4JA 2L9RA 4WXDA 4WWCA 3OSFA 4NF5B 4PC9A 4V19K 2WBMA 3FVKA 1N7WA 2XGXA 5I7IA 3QYTA 2KR0A 3TP0A 2O7UA 5HPQA 2DPDA 4IO5A 1IITA 3FVOA 5LRSA 4NHBA 2O6AA 5LTCA 4UXNA 4PJMA 5I56A 4GF8A 4GCVA 2X6OA 3E9XA 4X48A 2FF4A 4OMYA 1MMSA 3DU6A 3SETA 4N4UA 5M2VA 1LNWA 5E3NA 1BOAA 1K4TA 4XKPA 2VP1A 2F3BA 2UYEA 4O94A 3OR1C 3HHFA 2IXSA 2YX7A 3LAPA 4X6AJ 1ZYRF 4RA2A 2CEXA 2Z99A 5J1RA 4ZJZA 2FNCA 1YCJA 3RYRA 4CCLA 3HPIA 3C3WA 4EXKA 4DQ2A 2JTVA 5JHUA 4KCCA 1JTXA 3BR0A 5C44J 5IM2A 2JK3A 4ISUA 2JVGA 5EGOB 1UJ8A 3P7IA 3HC7A 1TWFJ 3VV5A 3HJEA 4BDZA 2A6EF 5H8FB 1R4NB 4KHZE 2B63J 4PGPA 4M3EA 1U9OA 5CVRA 4MEXF 1WODA 1V5EA 4YIIA 4IHTA 5I3SA 4F29A 1FSHA 1MDP1 1SW4A 2DDAA 2ALUA 2ME6A 3CG1A 4JBAA 4CO8A 5K5RA 5IGAA 1UHSA 1TWCJ 2UVGA 2B9SA 2VHAA 1ETXA 4BDLA 2VI6A 3K9TA 4A3LJ 1NNFA 1J7KA 1POTA 4YZZA 2Y7WA 4A5MA 3MKWB 2GAUA 1LBYA 3LWFA 1MQIA 4U0WA 3HCQA 4YMAA 1BA5A 5CBRA 1KZ8A 1RNLA 2HKOA 4HE0A 5FD6A 1IDYA 3GCMA 3O2PE 2GXBA 2CYYA 3NWSA 1P1NA 4YAHX 1WH5A 1IAWA 1P4XA 2DA4A 1HKTA 1OVBA 2OD5A 2W48A 1HSEA 2MD0A 2E2IJ 4J00A 3S1QJ 3FBPA 1SYHA 2E1SA 3IH4A 2F6PA 3ONMA 4POWA 1K83J 4RXLA 3VSLA 1PP8F 3DP8A 2GWRA 5DEQA 1XPXA 1FPBA 1NKXA 3E4RA 4DIQA 2JA8J 5FJ8J 3TODA 1K79A 4AM3A 5DVJA 2L0KA 2DLLA 1Y56A 3M1CA 2F5FA 3ZMDA 4LLGF 3K1NA 2STWA 4V2GA 1Q1KA 4PAFA 5HODA 3HOYJ 1TQIA 2JSCA 3TP3A 4Q8RA 3TEPA 3P9KA 4L18B 4BJ6C 3GZNB 4KIGA 5LHIA 2NS7A 4HV6A 2RCBA 2WBBA 2XVCA 1SAXA 3K6GA 3OO6A 4Q5TA 2X6YA 4EVIA 1YOVB 3NQOA 1II5A 1NV0A 2HS5A 4PF6A 3FV1A 2IGMA 4FHTA 1FBHA 4OMBA 5KNLA 2DQLA 2L01A 3OIOA 5E20A 4DOZA 3F8BA 5BPDA 2Z5UA 3L00A 1D9QA 1NUYA 3H6UA 3SEWA 1Y20A 4A3FJ 1D1AA 2O84X 4U1ZA 1P6RA 2ZNUA 3I4PA 2ID6A 3MZ8A 1B72A 2X1EA 5JLXA 3GBBA 3RN8A 4HLXA 4IXAA 2GQ1A 4M3FA 5B70A 3R61A 5C4XJ 4KCDA 5M3MJ 2DS9A 1PJRA 2EIMH 3U65A 3ERED 2ACJA 4CYCB 2O7IA 4GXOA 4L5EA 3JRBA 1JI8A 1SDXA 2VBXA 3DLAA 1HF0A 1UHWA 5DD8A 3ROJA 2DMUA 2L4AA 3RZOJ 2BHZA 3GLLA 2DA6A 4QPOA 1VQNI 4F3GA 4JWYA 4QXDA 1KGSA 1JKRC 2XF5A 4XRSG 1F1ZA 2Y7RA 2XGCA 4FEBA 1S9HA 3WHBA 4E7HA 2GFEA 3W2VA 3KOTA 4Z0IA 2M2EA 4PGNA 3IO6A 2ZXHA 2Z33A 5D5VB 4AU7A 3ZMUA 1BC7C 1MPBA 2CFXA 3GUDA 2EFPA 1I39A 3EHSA 2BYVE 5FBPA 2ZJQF 4LZ5A 2VKEA 2DXYA 1SFEA 3EUHC 4BL0B 3OSGA 3HSEA 4KD5A 2OTJI 1TP4A 2V6EA 4N81A 1NV2A 2KQZA 2Z3YA 3VWBA 5I59A 2V3QA 3JW4A 1QNTA 4PCQA 2OPTA 3PUVE 5ERIA 4NQWA 2V25A 1IN5A 1FY7A 2IGOA 2LKSA 5DCMB 1MQHA 1EH8A 4ETSA 2Y7IA 3HG9A 1XN7A 1KQ9A 5J1DA 1V5FA 2P1SA 2NOOA 1EZ9A 4IL6C 5F64A 3KP4A 2Y2ZA 3MMYB 4E7ZA 4CH7A 1OYYA 4DZPA 5TPAA 2HAUA 1DP7P 3DBHB 2Q2AA 2XGEA 2GHAA 3I58A 3SZTA 2VBZA 3F8FA 4GL8A 3IL2A 4OFOA 5A5XA 3G3IA 1ZLKA 2V79A 2UXNA 3OYLA 1QW0A 4F2QA 1R00A 4CSWA 5K2YA 3J80K 3H35A 3UN6A 3Q28A 1GTKA 3H06B 2JJ7A 3TOAA 3M3KA 4P5OA 2DSFA 3IX1A 4N13A 4NF6A 1QKAA 4PBQA 3CJTB 3S1RJ 1SQYA 5IZ3A 2VOOA 1SPIA 2BXZA 1T6SA 1FQBA 2DWHA 1LKXA 1ZELA 2XGDA 1AWCA 3TELA 5J47A 4RJZA 4BDQA 4GYGA 2FOKA 3HM5A 3FXUA 4IOAF 2A5TA 2HAVA 4ENNA 2KZGA 4IHXA 3WODF 2WA0A 3FJMA 1NHAA 4UVCA 2UXXA 3TO9A 1XC5A 3RJPA 3GEZA 4C9YA 4TLLB 1U8RA 1GT0C 2OCCH 4QF9A 3E3VA 4W97A 5GP9A 4E4HA 4RK9A 4XIDA 2E1CA 4YFNF 4XQFA 1XVYA 5D8KB 5DW8A 4RGXA 2JA5J 2Y84A 1R58A 1I50J 3VEPA 4FASD 5AONA 4IRIA 3CR9A 4IGTA 4GWWA 5LFAA 1UMQA 2LOOA 2IS2A 2M45A 2O68A 4JX4A 3KPHA 2PLYA 4G8MA 4TLMB 5LHGA 2W84A 4F52A 3ILUB 3W3CA 4P9KA 3HKZA 2XF6A 1OPCA 3HHHA 1A7LA 3WGIA 4P0IA 5CM6A 1FQAA 1YQAA 4WF2A 2RQPA 5HDKA 4LQ2A 1FBPA 5LDZA 4RLFA 3SZGA 3TEDA 2D5VA 5FHMA 4LG0A 3IV5A 5D5XB 4CXFA 2O5RA 1MPDA 1R49A 3LSWA 1WJEA 1RKWA 1FTJA 5KCJB 3ZRGA 4PFYA 2WWYA 1YTVA 4G6DA 4KYWA 3GMEA 3OOPA 3F6OA 2VL8A 1PBQA 4M1VA 3S9EA 1M5FA 2XXVA 3QOPA 4U87A 1URGA 2P3NA 2XD2A 3CMEI 1KU3A 4IHYA 4ECFA 4I2OA 1RKTA 2R5YA 4M9XA 1MY1A 4FT8A 3FXBA 2A05A 1VR5A 3EUKL 1SANA 1N78A 2OAZA 1QGXA 2MABA 4IVNA 1SD3A 3TGNA 4QTRA 5IYCJ 1A5JA 3V5AA 3BCAA 1R5GA 1W0UA 2OCUA 3A02A 5A2QK 2HDCA 1YS6A 3SERA 1MPCA 2XUBA 2EWNA 2VJ4A 4LOCA 3FMRA 4M3GA 4LIUA 1ZLQA 4H5FA 2EFOA 2QUFA 2XSJC 1ZN2A 1FTLA 3GVAA 5ET7A 4DCYA 5BUUA 2AL4A 3M8UA 2B65A 1XX5A 4PFTA 3TCFA 1BLFA 1OLCA 3ZQIA 4BJTA 1H76A 3MVZA 5L9SA 2IT0A 3ROUA 1NUWA 1FLIA 3IB0A 4L9VA 3ZQFA 2HGCA 4H8IA 3E6MA 3G3FA 2L9VA 1ZK8A 4HF2A 5DDGA 4UUTA 3K70D 1IQ7A 3K2ZA 4KR5A 2ZFUA 2WB1N 3ZMTA 5BWJA 2DI3A 2DCEA 2XWKA 4HTGA 1URSA 3VYRB 3ASNH 3PFYA 4C1TA 1YRNB 1SVOA 1G3SA 3KP7A 1I27A 3D0SA 4G77A 2OBPA 2E2JJ 4HCWA 3RTRA 1QVUA 2IA2A 3FXRA 2X9DA 1MSEC 2IGKA 3ZMZA 4G8HA 1FOXA 1TT1A 2O69A 1TNSA 5CQGA 1Z6TA 1B8IB 4XLCA 1NI9A 3BG5A 4PCDA 4IEJA 2IP2A 3ZQCA 2HZKA 1UIUA 2R8TA 3FV2A 2LDUA 1NV4A 4RLQA 1Y1WJ 3PQKA 1POY1 1H45A 4MLVA 2Q8MA 1LJ9A 2GIVA 2R7OA 2PG4A 4S0HB 1LAGE 4O7MA 1MY4A 2EZKA 3K69A 1NFTA 5CJ9A 2ZJPF 1LAHE 1YJNI 3OYGA 1KU2A 2HR3A 3T9HB 4WXJA 1EV7A 2PEXA 1B3LA 1FPGA 1ZKBA 3VYSB 3FXOA 1MXYA 3GBAA 3WTXC 4XKRA 4U0VA 2D3IA 3M4OJ 1MNMC 3KIOA 4IRHA 3OEMA 2O6GE 3PU5A 5GTIC 3E6DA 2WY7Q 2WEFA 3HSFA 3WE3A 5I2KA 1T33A 2E1MC 3KEYA 2PJRB 2XHDA 4YIFA 1KONA 2R6GE 2CO5A 3RKXA 2WV0A 2N8GA 3OOUA 2V93A 3H6WA 3KG2A 4U22A 3MZBA 5AA3A 2MH2A 3CSGA 5KCMA 1LDKB 2I49A 3FUZA 1OMPA 3OYHA 4EF2A 5KCJA 4JSOA 1FJLA 2HCAA 3QPHA 1P4WA 2NYXA 3QPSA 3RYDA 2ZCWA 3F3XA 2F4MB 2D5WA 2CZKA 2F5DA 2UUZA 2VJIA 1G3YA 2XV4S 3MZYA 3IJOB 1OLAA 2HZTA 2ZXWH 4UHTA 2Q88A 3TCHA 3PSFA 2CGPA 2P81A 4JYKA 3V42A 1RUOA 2ZKZA 3CUQA 2BJJX 2QMWA 3PV0E 2CSOA 3T93B 2LC2A 2FD5A 2FXAA 3OL4A 2I3WA 4G9YA 5EG0A 4XR6A 3U9GA 2F4IA 2HFBA 1JQFA 3Q0UA 5K5OA 4BEHB 4CCNA 1VZ0A 1ITYA 2K3PA 5HM4B 1IUFA 3S2DJ 2VT2A 1T0FC 5BQTA 2QQ9A 2BXYA 2YU3A 1MXZA 3U8QA 5FTIA 1FCKA 2R7DA 4BACA 2DTZA 2QQAA 2QS2A 2UVJA 2LP0A 5FD5A 3B02A 3JREA 2ZJRF 4GBWA 4PAKA 4UV8A 5TU0A 2Y7KA 4GWUA 3BJAA 4XN0A 4DXCA 5LD2C 1Q35A 5IP9J 3VFZA 4LLLA 3Q29A 3RQTA 2XX8A 1X2NA 2KRFA 3ML6A 3E0JB 4OOIA 4YICA 1FPFA 4ZDMA 3I4NJ 4NHJA 2Y7PA 3BG7A 2P0SA 1P99A 3T22A 2XB5A 1JW4A 2V1UA 4NEDA 3PNYA 1XCVA 4G7OF 1VQ6I 1DUXC 3FJ7A 3K1PA 1TWGJ 2A07F 2I3VA 2VQHA 2HFHA 2JPCA 2V9PA 4MLOA 1PDAA 3NRVA 2EA4A 1MQJA 5ILSA 3KBRA 2PI0A 4II2A 3CC4I 2D21A 3H03A 4MX6A 2ABHA 2OZ6A 2JUCA 2CQKA 4KISA 1YJWI 1IN4A 4OU0A 3JAMZ 3IAM2 2BY3A 1S72I 3DQVC 1P9QC 3GTLJ 1FBFA 1R9LA 4R6YA 4E7LA 2WY8Q 1OYIA 4ESWA 3BFUA 1Y4CA 4OERA 3MAMA 2QLZA 2F5EA 2EILH 1HW1A 3CCUI 4A12A 2BY1A 4L5IA 3KYLA 2RC8A 4L9TA 3IB1A 2XASA 1UAAA 4XMYA 4DYQA 5JHFA 1D3KA 2DOJA 2QFLA 3C31A 1PBPA 3K1MA 3BCBA 3CC2I 1K6YA 1BW5A 3CD6I 1PB8A 4DXUA 2LF8A 2LKPA 4XLFA 1O3RA 2CV2A 4F92B 2CV0A 2F6CA 2K4BA 1FBEA 3DF8A 3L2QA 3DWLE 1FQEA 4GYIA 4C30A 3VLWA 5EQ9A 4BAYA 4QFKA 5JTYA 1XG1A 3GFJA 4D9JA 3U72A 2L2OA 2MFZA 2R5ZB 1A54A 4BYYA 1GHCA 1FBDA 2LBFA 3MSTA 5JVGF 1UTBB 1H9GA 1V3FA 3VXBA 1NV5A 1O3TA 4FJPA 4NTLA 3UK4A 5F1QA 2ESHA 4BDOA 1Y39A 3I64A 3J7YJ 1Z05A 1VQMI 3C32A 3B6AA 3U1DA 2DAOA 1D0XA 4FORA 4WCGA 3KJTA 3BTCA 1G0HA 1I69A 2JPBA 3HKZN 2DODA 2HEUA 2I0CA 2EPFA 4LK1F 2OTLI 2QSGX 1BIBA 4XLAA 4L0YB 1FOKA 3VDXA 3CJRB 2HVRA 1IRXA 5CMKA 4LONB 3TAJA 2KDOA 1AH5A 2Z9OA 4MHFA 3AG2H 4RB1A 4C3IJ 1D3YA 1YW7A 4PK4A 1IC8A 1BI1A 4HF0A 1OCPA 1X1PA 4F7ZA 2YU9J 4LUBA 1N0TA 4GRKA 5CKTA 3RQIA 1LPQA 4LA9A 4KXPA 4ZS9A 4I99C 4AC0A 3SESA 1ODDA 2A3SA 3QWLA 4FEDA 4N07A 5I56B 4FE7A 4JX6A 4LJZF 1H88C 4I6ZA 1Z7UA 1QBJA 1DTZA 5TRDA 4PP0A 2M5WA 3CVGA 5CVIA 3BR6A 1JEVA 4GX6A 4EV0A 3ECRA 1JKPC 3OMYA 2XAQA 3ZQ7A 3MBPA 4G2ZA 4AS4A 4ESXA 1DK4A 3EF7A 3VSKA 1YO5C 2DFIA 1K9YA 5BPIA 3B6CA 1IRZA 3H36A 5CLSA 5TISC 4HLYA 2YLNA 3H6TA 1NTCA 3QK6A 2G0EA 3AG4H 3J7ZI 1ENHA 1BP5A 4RNSA 2E5ZA 3BT9A 3O8GA 1FQCA 5IKBA 2NXOA 3PUFA 3QU6A 2AS5F 1US4A 3FM5A 3HDDA 3LSIA 4LATA 4CUGA 2L4MA 4HA8A 3TTMA 2UYFA 1B1XA 1YTYA 5K7ZA 2ZXJA 2IBDA 1INPA 3A1YA 4HOBA 5H8HB 4C3HJ 1LEBA 2V26A 2DT5A 4XICA 1LE8A 2CW7A 3LA3A 4HAMA 3TKYA 3ZN0A 5DYMA 4AVZA 4FTHA 1WSUA 2EZIA 5DEXB 3U94A 4BDNA 4XN3A 4MF3A 1FTAA 2VBWA 4XKCA 2MC4A 2VPNA 1POGA 1ZRDA 4OENA 1N3XA 4L5JA 3LSFB 5IAIA 3H0DA 4H67A 3EQLF 3TOBA 1QRYA 4PDDA 2DU9A 2ZYKA 3HN0A 5J16A 1I3AA 1NG6A 4DYCA 3EN3A 3W2WA 4KN7X 4LLNA 2E5NA 1IG7A 3EQ1A 4MFDA 3O6HA 1LEAA 5I58A 1QHGA 1SMYF 3LSRA 1WJAA 2IAIA 1VQPI 2VOPA 1DP3A 3QAXA 2BW3A 4IO2A 2DN0A 2NVTJ 3O6GA 3HL2A 1X1DA 3HOTA 5CMBA 2G7HA 4RB3C 2ZJ2A 1PVEA 1MH3A 4N8GA 3ONQA 4RY1A 1JXSA 1Z9CA 2DDKA 4CICA 2DWJA 1EH3A 4F55A 2FUG2 2ZMEB 2THIA 3ZP5A 5C4JJ 2LMDA 3OR2C 1BTJA 2CEYA 2VC1A 1RUNA 2GLOA 1S5LC 2GIZA 4FCYA 2EINH 1JKQC 2GOMA 2HXIA 4IO9F 5HS8A 2WV1A 3GLBA 4OEVA 4RM3A 1I6XA 1Y4TA 3BQZA 4CYDA 1PC3A 4NN3A 1QU3A 4EM1A 4E7IA 3RDIA 3VDFA 5DD4A 4OVSA 1N76A 2EV6A 1FYLA 3IAZA 4O8MA 4R6KA 4RPOA 2PBIA 5DVFA 2XD3A 4H46A 5ICQA 3B6QA 1LAXA 1B6AA 4U0YA 1JTYA 2BHYA 4AD9A 1JUSA 5H2FC 4ENKA 3D1RA 4ZEIA 2MD5A 1OFCX 5HS7A 1VF9A 4F3SA 4O3MA 4H4KC 1H89C 1QA6A 1OMIA 1BI3A 5B3SH 2O1MA 2FMYA 3O9PA 3PNTA 4RGSA 2HQNA 5LRRA 2IJLA 1ETQA 3K4KA 5H20A 4GGGA 4ZYEA 3ZKLA 2TCTA 2ZSIB 5GTHC 2H27A 1VE4A 2R7UA 3ZQQA 5HNFA 1NG7A 2QENA 4WX9A 4UA8A 2GXGA 2ISYA 2LREA 1RIOH 3JRCA 2XA5A 3E78A 3S9LC 1F43A 5ESYA 1B52A 2OUMA 2V9VA 1ETKA 2DYRH 2VJJA 3MCZA 4G6QA 3HTUA 4HX4A 4ZTFA 2LNBA 2H25A 2X51A 2DWAA 2HXWA 1FNNA 4N9IA 3N97A 2Z8EA 3FKJA 4F18A 2O7OA 1RRJA 2HVSA 3EUAA 2FIXA 2AQEA 2ZO4A 1IDZA 4ON0A 5HLHA 1O7LA 5DM6F 4C3JJ 2EFNA 3CFLA 1A6IA 2VKDA 2HWVA 4HF1A 2QS4A 1BK4A 3A09A 1QULA 3WGGA 3CF2A 2H9BA 5L9OA 3N4MA 3IFCA 3CCRI 2B7EA 2RQQA 4BY1J 1MY3A 4U7BA 3BR3A 4LGWA 1ATGA 1WDNA 4MFEA 3ZSFA 3BPVA 3MVWA 5IT9K 1EH7A 3LSTA 5EG0B 2REGA 5LOMA 3D5LA 1DGWY 3F8NA 2WAQA 2M7BA 2M7AA 4XSXF 4WXHA 1SMTA 4P11A 5GAGJ 5KHDA 4IO4A 4IRGA 1JVXA 1L5TA 1B9NA 4ZE8A 3K4NA 2VN2A 1F5TA 2HU9A 3UIFA 2K3FA 2ETHA 3SDGA 5L3GA 4MO7A 4IHSA 2QS3A 1RC9A 5GPAA 4RBOA 3LBSA 3UNGC 3RKYA 2KLOA 4I1DA 4RPNA 5EYFA 4WKMA 3BC8A 2PX1A 1GV8A 1YAEA 2DPUA 2O1LA 2Z16A 4KDPA 1PUFA 3TO7A 2PFZA 2R9JA 3J81K 2M8CA 2V3UA 3TTRA 5L9MA 3E5QA 1FBCA 3SQNA 2ME0A 4ENMA 3LUYA 3FD3A 1FTOA 4L9NA 3RPUA 3GWZA 1MMAA 1WHUA 4MHGA 1SBPA 3CCEI 4NF6B 1Z7LA 4M6VA 5E8GA 5K5QA 2GOXB 3S2VA 1MGTA 2DA3A 4QPQA 1LFPA 1G3TA 3BQYA 4X0GA 1IMAA 2BGCA 3FK6A 2NOJB 4B3XA 4ENJA 2CMPA 1LCFA 3MKLA 3AFHA 4G12A 5CVJA 3C9HA 2KDZA 2IPQX 3T8TA 1IO2A 2CH0A 4PJNA 1SYIA 3MW0A 4QFNA 3DCFA 3QODA 2ECBA 4N6DA 4F3PA 1K61A 1I6HJ 1JETA 1MBGA 4U7DA 1B1BA 3VODA 2FU4A 3PIPF 3IAS2 2NXNB 5E1WA 1NUXA 3D1NI 2XWOA 4IO3A 5EYRA 2M4KA 1PUEE 1I5ZA 2H6CA 5CRYA 4H65A 4M3DA 3A4CA 2R7SA 3WAEA 4EEFG 5K7HA 5JLWA 3MYUA 1QVSA 3KGCA 3R6SA 1EJ9A 2VKVA 2XXWA 3JTGA 5EEGA 3CCQI 5EZGA 2XPWA 2RN7A 3CF5F 3E6CC 3DP4A 1XT8A 5JTYB 4R72A 4YG2F 3FM3A 1OKRA 1B72B 1ETOA 2XB0X 3CMAI 1LBCA 2W4SA 1ZR2A 1JHHA 3IH3A 2AIXA 3PUBA 3W2AA 2Y75A 3KYCB 2H8WA 3VYUB 2A5YB 2UZKA 3QXMA 2DFHA 5HVQC 4K2EA 4BQAA 1JKOC 2B4MA 1E0EA 3VB2A 2DMPA 3BROA 4QFLA 4U4SA 1OR7A 1X1CA 4NC6A 3I0TA 2F4OB 2K40A 3NAUA 4NMYA 2Y5LA 3WU0A 3SJMA 5EHMA 5KDTB 4QLCU 1K78A 3A2KA 4BE0A 4G6TB 2MW8A 3KP2A 1P1WA 3F8CA 2VUMJ 2O3FA 4ELPA 3RPQA 5TPAB 3BR2A 2ELKA 1MG1A 4DBQA 5CMMA 1JGSA 5EQ8A 2B0LA 1FJ6A 1TW3A 4B09A 3GF2A 1I6BA 1USSA 2NNNA 4Y33A 1TWYA 3IKTA 1N04A 4OQOA 3UP9A 1FTZA 3F6VA 3ZQHA 2HXOA 3OYMA 2GHBA 4FBPA 1MSFC 4RMNA 2VB6A 1QZYA 2QQ8A 3G2BA 4Y13A 2QA4I 1YFHA 3ZKKA 4PUSA 3K0LA 4GL0A 5I2NA 4A3DJ 2VBYA 3J81Z 1ZGWA 1KQ8A 3MD2A 3KEIA 5HDGA 2CMOA 3IFAA 4X1BA 3ABMH 4A6EA 1YIOA 3FXMA 2JJKA 2WX9A 1SVXB 2AYSA 3SEVA 3N6UA 1NH8A 3F22A 1FMVA 2AQFA 4IKFA 3N5LA 2UWMA 1J75A 3UA8A 1LFHA 2FE3A 4PBHA 1A8EA 4F91B 3FXJA 1R22A 1WJCA 2LKXA 2RREA 3C34A 3TTLA 4GOTA 1BN5A 5ICEA 1A55A 1Y3NA 2KT0A 2W82A 2P2AA 3SZPA 4MNIA 1U5TC 2XHKA 4MNCA 4A3GJ 4YFKF 3DEUA 2LD5A 2B4LA 2ELJA 4E0XA 1G3WA 1MNEA 1FBGA 2DE3A 2YS9A 3H3GA 1LSTA 4RA1A 3PO2J 1TT0A 2DT7B 2E34A 4ZYDA 3IJXB 4M6XA 4UY8I 1TXFA 1I3QJ 2QVUA 2OJTA 1MY2A 2BEOA 2QGUA 2H8RA 4TV7A 4M9SA 4P1WA 3RYPA 1SFKA 3F0CA 5FFXA 4BQOA 1RYXA 5F04A 5H6RA 3MZHA 1HDPA 2A6TA 2KHMA 4XL9A 1MIJA 4HE1A 3FMSA 1U8BA 3JV9A 4CCKA 4N6KA 3ZMVA 1N84A 2QL3A 2PMUA 2IGNA 3CDHA 3JYRA 1O7TA 1ZREA 4A93J 2KJBA 4HYEA 1ON2A 3M8FA 3KLNA 4BS9A 3V7CA 1NL5A 2FHYA 2B3FA 3W6VA 4AQ4A 4MTEA 4OA4A 4UUVA 1BW6A 4MIMA 2L7MP 3TUSA 3CO7C 3LA7A 1W7PA 5EDNA 1T39A 1USYH 1Y0UA 5M5YJ 1MM6A 3H6VA 4LFUA 3K4UA 4OEUA 4FX4A 1MDMA 3J7AO 4EF1A 4YKJA 2WB1A 1O57A 1D5YA 3T1BA 5IPAA 3G73A 3GLXA 3Q25A 5IZ3B 4PE5B 4BQNA 1IN6A 1R23A 2X6XA 4NC7A 1A35A 1ZARA 3FVNA 4MJOA 2NOGA 1OQYA 2VT3A 4QFOA 3BG6A 3CLOA 2XX7A 5EQ7A 3KZGA 4DI3D 4AB5A 2EZLA 2IW5A 2VD3A 5D4RA 4Z2YA 3BG3A 1B05A 2DQVA 2ZZXA 3NOHA 2Y0SN 3DKWA 4AWXB 5TP9B 1G59A 4R79A 3OO9A 4XRFA 1OQGA 3KEOA 1NV7A 3PPNA 1MJAA 4FQGA 1S7YA 1IMBA 1DBZA 3EDPA 5DTDA 1VFCA 1BBYA 4S05A 2Z22A 1PEBA 4MH5A 2BE5F 3IL1B 5IT3A 3U2RA 5AA2B 2E19A 3C7JA 3SHFA 1BKAA 1EYKA 3KC1A 2DMQA 3CUOA 1B58A 1YJ9I 4C2MJ 3ZGKA 3O97A 3S3OA 5BOXA 3T0JA 3HUGA 4II3A 4P1LA 1B7ZA 1RPWA 2WADA 3B8BA 1DMBA 4BEHA 1UELB 3OYIA 2WBDA 3BJOA 4BDYA 4HPQA 1B3HA 3G3KA 1W1WE 4XKQA 3U93A 3KN3A 1Z6RA 1MM7A 2COMA 3KYDB 4Q30B 4I09A 3MWBA 3DELB 4MEVA 1LVAA 1TQMA 1O63A 3FF5A 1RDZA 4PJJA 4O5VA 2R4GA 4GWZA 2FSWA 5DCFA 3T5XA 2CUJA 4PFBA 3TKDA 4S04A 1B8IA 4UNOA 3GFIA 3MJNA 1MZBA 3Q9VA 2M87A 2QF7A 2DA5A 2AXTC 3R60A 4XTCQ 3QSLA 2V4JC 4UVBA 4ASNA 2LY1A 2K4JA 3OYDA 3PL8A 3W6KB 3GTJJ 4QSHA 3GFMA 2H94A 5EZHA 2KFDA 5IP6A 1FPDA 1JW1A 4HRIA 4YU0A 2AHQA 2HHMA 2VD2A 2ZZWA 5DS9A 1IMCA 2A69F 2Q2CA 4QHQA 3N26A 4Q4ZF 3I53A 1B4ZA 2Q0OA 2MLGA 1I1SA 3F23A 3QYFA 2FBKA 3T66A 4F39A 1ZIUA 1S29A 1XTAA 3E1SA 5FKMA 4IO6A 4P47A 1ZHFA 4QRZA 2XXYA 5DTBA 1B4AA 3BZ6A 4ELOA 1ZG1A 3I56I 4I8CA 1Y9UA 3IB2A 2HKXA 2W24A 2L7ZA 4K3FA 2LRDA 3E6BA 3LSLA 2FQ3A 2VKHA 4FE8A 4UV9A 1Y0NA 2CUFA 2EZHA 3I5UA 2RKHA 3E5XA 4IOCF 1R1NA 2Q8JA 1JGGA 2XX9A 3FXKA 3FXQA 1P2FA 5ILVA 2I58A 4PETA 1YXIA 3OENA 5J1YA 5J4VA 1QUKA 4OXVA 1WVJA 2DA2A 4GWSA 1DGRM 1U3EM 2VONA 3TQNA 4PDKA 3AL0C 2UVHA 3TCGA 1D8KA 5DYHA 5CVVA 2C6YA 2F34A 4OESA 2BOLA 3AG1H 3ESWB 3PQJA 1XGOA 5F0CA 1N3WA 1D9VA 4UB8C 1B5HA 3UR3C 3IOWA 1Z91A 1BM9A 3DEEA 4BHPA 1HA8A 3JR9A 4GWOA 3LL7A 4UACA 1A04A 1YRNA 1MQGA 2RC9A 1VQ5I 2I8DA 3DP7A 4FIMA 3PMXA 1D5VA 1TFDA 1O3SA 2W7YA 1Y1VJ 4EGYA 1P92A 4XONA 5CMCA 2JT1A 1B7UA 1T98A 1ZBMA 2Q8KA 2E1NA 5ET8A 3CHGA 4RGRA 2V1DA 2G9WA 2M34A 4DYRA 4ND9A 3KP5A 4PQJA 4FAJA 1GVJA 2H1LA 2HYGD 1B32A 2L54A 2P5LC 2K9SA 5FHOA 1YE9A 2VPLA 3RPUD 4OWDA 2ZNYA 3MN2A 5FLXK 1T38A 4NF8B 5FB2A 3G6EI 4PFIA 1V5GA 1BJAA 1NNPA 3MFKA 1XI6A 1D0ZA 5GADJ 2Z8DA 4IB2A 2DBBA 5IY5H 3PM1A 4FE4A 1ELJA 1B51A 2REJA 3I59B 3ULQB 3D5RC 2HOEA 2FJ1A 1F4KA 2FNAA 1R5ID 2IS1A 1LFIA 2FNPA 2DE4A 2LAOA 2RINA 5AA1A 2GXAA 3JRHA 4FX0A 1VQ8I 3IR1A 2O9LA 4P3LA 2H09A 3PNVA 5F1JA 5HNHA 1V55H 3V8JA 3L6GA 4KPTA 3D4CA 2PVUA 2CQQA 2PMHA 1OISA 1SFOJ 4YKPA 5E3OA 2R0QC 2H1KA 2X0LA 1GLNA 1IJWC 1U5TB 1IIWA 3R0AA 2ZYNA 4Y52J 1H43A 3NWTA 2XAHA 1TW2A 4HXVA 3VXCA 1YLFA 2TDXA 4M3BA 1WZ2A 1H44A 4XRMA 2M9HA 4Y3OA 4KI0E 4Y15A 1W7PB 2HXRA 4ZEDA 4G94A 2QEXI 4EXLA 2XXXA 4N6PA 3K01A 4YKIA 3GTGJ 1CNQA 4JX5A 3FHNA 4ZE9A 4HS7A 1E3HA 3QRFF 1IXHA 4GX3A 3TO6A 1BR4A 4MNUA 4B47A 4MTDA 1UTHB 2EIJH 2VLAA 4H6DA 2FEZA 5LEJA 1SFUA 3WG9A 3BPXA 3TDJA 1HKQA 2MH9A 3OOAA 3S4UA 3RUMA 4P8BA 1Z0XA 2JWTA 3QP5A 4IX7A 1FBUA 1YHQI 3PIOF 1HBXG 1ANFA 2QSFX 2VQGA 4HNVA 3QP6A 1KA1A 3SXYA 2XXRA 3AG3H 1WJBA 1TNTA 1D4NA 4HW8A 5I2NB 2VXDA 2ZNTA 5J40A 1SVMA 1P7IA 1TL8A 2HZDA 2R7XA 5FKNA 4HE2A 1SD5A 2PFBA 1B46A 1X4PA 1J0RA 4G68A 1UIVA 3VFJA 1Y3QA 4G4PA 4OVRA 2EV5A 4HZFA 1Z77A 2Y30A 4B44A 3OYKA 1Y8RB 4EM0B 3FK7A 5AA2A 4P9FA 2FQ4A 1S7OA 4DZ1A 2QYOA 4B1RA 4KA4A 2F5VA 3V8LA 2JN6A 1IXCA 3HEFA 2QZ8A 1CF7B 2A61A 3MVXA 3M07A 3LR1A 1JE8A 4R73A 3JCUC 4HW0A 3R6UA 1PB9A 1AWBA 3OXNA 2CFOA 2ZMEA 2RCAA 2R5ZA 1WFXA 3LUZA 3H9GA 3RIRA 1JEUA 1Y3PA 3B7DA 1LBXA 2XXIA 4A0ZA 2Y0MA 1G6NA 1YPNA 3UORA 1YG2A 1CE2A 1DPEA 3CUQC 2OZZA 1W36D 1OLTA 3V83A 2MC3A 1W0TA 1S3JA 1Z21A 4CA0A 1QPIA 3O6BB 4I7HA 2UV1A 2H5YA 4IZZA 2DJNA 4JB7A 1U78A 2P5KA 2P8TA 1Z3YA 2RNJA 1YYVA 4O7IA 4DGWB 4LK0F 1X1BA 3D5SC 4XBFA 2X26A 3I6VA 2XIGA 5E18F 2VPRA 2V6CA 3PJRA 4D1QA 3GYHX 3M3FA 2NVUB 2PX9A 2QBYA 4GRIA 1M5EA 5H8QA 4KNYA 3P9CA 2E7XA 3ECOA 3O3KA 2Y5KA 2NAZA 2FBPA 2E60A 2Q74A 2R71A 2GBYA 2E1OA 4A69C 4FECA 2I0BA 3PPRA 3IHUA 5F08A 2V4CA 1T0FA 5CVUA 2K5CA 1X4OA 2HYJA 4H0WA 2EB7A 5H8NB 2ZNZA 1S8NA 1LVKA 5F6FA 2F35A 4A0YA 3MUQA 1A40A 3I9V2 5IZZA 4UVAA 3HV1A 4AIDA 3ABTA 4DDDA 1T56A 4KUMA 5LGNA 3O28A 3PUZE 2EBIA 1MBHA 2YPRA 4HQMA 4I76A 1JT6A 1MBFA 3MPKA 4LZ8A 4X1DA 1DTGA 4G68C 2M3AA 3OIPA 2Y9YA 1XDUA 3HOZJ 3W15C 1P7JA 2JVHA 1R6RA 1MJ9A 2M8GX 2R7TA 2VC0A 1QUJA 2OBGA 4EUOA 3TMOA 1MBKA 1OQHA 2OWZA 2NWJA 3TTNA 1OYWA 1XVXA 5I59B 2DO7A 2V1XA 1UHMA 1JJ6C 3IO4A 5I84A 2LH9A 1P1OA 5DUIA 2DXIA 2KZVA 4IR8A 3MKZA 2P6TA 4R2BA 1XMXA 4IPAA 3WAFA 2VODA 4B48A 3BZKA 3LAJA 1ONVA 3WTSC 1E17A 4OAZA 2ZYOA 5ED4A 2BVMA 1LFGA 2JRTA 3RPLB 3PUYE 5B1BH 4F22A 1R1TA 5A5LA 4V2FA 3S1NJ 4U21A 1AKHB 3ABKH 3WU1B 3CLQA 1NNKA 1J2XA 3MAJA 3OYBA 5GAEJ 1FRPA 1B40A 2CQ7A 5LHHA 4WEPA 1WH7A 2HOAA 2K7LA 3Q0VA 4KITB 3WHCA 4A3KJ 2HPMA 1GXQA 4Y17A 3OYAA 2K9QA 2H4IA 4ZZAA 3MC2A 4NF8A 2B3BA 3V89B 1QJMA 5KZTA 4I40A 1O7FA 2Y48A 5E8IA 3S15J 3BP8A 2HVQA 3IC7A 3QAHA 3GZ6A 3PGFA 1N75A 4H0EA 1ORKA 3L2RA 1OCRH 3HGYA 4PE3A 4Y7NJ 3HHGA 4AUXA 2BV6A 4HX7A 2JA6J 1P1QA 2V7FA 1FT9A 2I5UA 3CMMA 3CQZJ 1QQIA 1XMAA 3SEZA 1KA8A 3HBLA 4ANJA 4XKNA 1WJFA 5CQEA 5ITOA 1AIVA 5JI6A 2R7WA 1XC1A 4OZ9A 4OIPF 2OA4A 3CESA 2KP6A 3RQ4A 1UFMA 2IA1A 3WTYC 4PSWA 3OYJA 2RKMA 1ZLJA 2GQQA 2LSOA 3ZPLA 3H7MA 3QUJA 4GX4A 4KYEA 1U5TA 3FWEA 3I3LA 2W25A 2KLFA 3DM0A 3JRAA 1DDNA 2D1HA 4A3JJ 3HSTA 4YIRX 5IT9Z 3ISPA 4RAGA 4GD5A 2DOAA 3LOCA 1CB6A 3JTHA 1A8FA 4E6KG 2E36A 3F8MA 4PFOA 5FLXZ 1CQTA 1ZU0A 2G29A 4M6YA 1R9QA 3PD9A 3ECHA 4Q48A 4H8JA 2LR8A 3K0VA 1YIJI 3MKYB 5K2XA 5CBSA 2Q1ZB 3CSBA 2ANJA 2PYYA 4WEDA 3O8HA 3CDLA 2HNHA 3KJ7A 1X2MA 2YR2A 1B3GA 5M3FJ 1EKEA 5ET5A 3SKPA 3R26A 3I71A 3VOEA 3P5JA 1SVLA 3TQLA 1Z7NE 4G7ZF 4I02A 5F24A 4Q0CA 4IQ4A 3HSRA 3T8RA 4Z6YA 3KFWX 2XF7A 2DE2A 4N17A 2L9SA 1ZTRA 2CW0F 5M5WJ 1I6QA 1K6OA 2M4GA 2P3VA 2ZNSA 2LY9A 2HTJA 1R71A 1A6QA 2DMNA 3F11A 3W9VA 3WTVC 3JRIA 4FISA 3CC7I 2PN6A 3KCCA 4JVIA 3RT6B 4IQJA 3OIQA 1VQKI 1FQDA 4E7JA 2PBWA 1FBSA 5BNGA 4P96A 3IH2A 4XF5A 4UUSA 1LFBA 2KRCA 2Y31A 2R7RA 4MLQA 4GO1A 3CO6C 2F6GA 3ABLH 3TDZC 3BIGA 3CFXA 3CCJI 3OYNA 4NF4A 1S7AA 4QIWN 2LTPA 2MKZA 1B4HA 3KP3A 1MXXA 4N4NB 5BS6A 1HQCA 1NV1A 3MP6A 1LDJA 5H8HA 2R7FA 2GH9A 1YX3A 5CPRB 1OJLA 3PO3J 1JT0A 1LAFE 5C3EJ 4JWXA 2F7BA 3LSGA 4ZZEA 2EFWA 3BKIB 4Q47A 1FBQA 4D5CA 5K1YA 3J7AY 2XXKA 1NK2P 2PCRA 1SD7A 2DA7A 5J6XA 3CCSI 4BGDA 2Q9TA 1R6ZA 4W1UA 3O66A 3OY9A 4JK1X 3UKGA 4CZZA 5ILUA 3U92A 2WKYA 4ZZDA 4NUBA 3JRFA 2IEEA 5B66C 2ZMEC 5A5XB 3HOXJ 4HQEA 3EETA 2GA1A 4LG3A 2F5CA 2I4BA 2JQ7A 2WTEA 3PD8A 3EKIA 1ETYA 3VVDA 1RESA 5LGUA 3LMMA 3CTAA 4R6HA 1Y8QB 4JBZA 4ZYHA 1DU6A 2RVCA 3K4MA 1ZR4A 4OAYA 2V1NA 4AVPA 4YMBA 1D1CA 3MQ0A 4XEQA 1WVRA 4DJAA 5IYDJ 3DPUA 3RNNA 4B3AA 3IRRA 4R9FA 1HXDA 4IHWA 1S7EA 1SW2A 1TTYA 3ELKA 1ETVA 1ULYA 1L3LA 3LSJA 1T2KA 4U4XA 3OO7A 5LGTA 4CGZA 4BNCA 1SD4A 3EPEA 2BZTA 4BXFA 1VQLI 1BR1A 3A0BC 2IS4A 4NNJA 5FROA 1GR2A 3FJGA 4U23A 3WG7H 4ZEFA 1B2HA 5J8FA 1HOMA 1TFAA 4QSEA 3N6TA 1BI0A 2DWIA 1NMUA 4DXBA 1QZEA 3GFLA 4HDVA 2HOSA 4FETA 4NBQA 4Z7EA 1T95A 4EQ7A 3AXFA 1MBEA 5CI5A 1PUFB 2O61A 4YB7A 4IY5A 4OWRB 2VE8A 1LBZA 1ZG5A 5FRMA 3V4GA 3SFZA 1EYJA 5EGOA 2DOEA 3BJ6A 3MWMA 4EGZA 4JXIA 2VT5A 4BE2A 4NX1A 2L02A 1D0YA 3S14J 2KISA 3FDYA 5EF6A 3RGYA 3T9XB 3DU5A 2NS8A 2VXZA 3BWGA 3IOTA 3T9UA 2Z1DA 3B50A 1GV5A 4MBPA 3ASOH 4GWXA 2COBA 3G7WA 4GFRA 1FSEA 4G8XA 3IOVA 4GXSB 4EDPA 4XNFA 1RR7A 1JJ8C 3PTYA 2VIXA 4HSTA 2VQLA 4MNPA 3TFLA 1JVYA 1RETA 4NB5A 4OVPA 4C2UA 3S16J 1IUDA 1Y6IA 3VVFA 4LD5A 2OX3A 1HW2A 3B6WA 1P1UA 3BIHA 4C2TA 2IEKA 3KX2A 5HLTA 4UUSB 4L9JA 4J01A 2DVCA 1FIAA 3Q9SA 5K7FA 1IMEA 3CJQB 4BBRJ 4OVQA 3S8PA 2XKOA 4RB2C 4F31B 3PPQA 1ZG3A 3FZVA 5EEAA 3SDBA 3ZXSA 1RDXA 2HZLA 5IZ1A 4HG2A 3N94A 5JEIA 4ZYAA 4LB5A 3E97A 4NF0A 1W7PD 4D7NA 1EYIA 3S32A 1OCTC 3ZMSA 3BBRA 4R2FA 4ZECA 1EZPA 4BJ5C 3EHUA 3FATA 5GAHJ 4OIRF 2LVSA 4P56A 2ZXIA 4PTKA 5FTHA 4DE8A 1W4MA 4M72A 3K6UA 1QO0D 3WGHA 3HTSB 4IF4A 1HSLA 4U88A 2KIMA 1XD7A 1OCZH 3HB9A 4EQBA 1HCRA 2QWWA 2RC4A 3CCLI 2O03A 1T08B 3HYIA 1FOYA 1M5BA 2O8XA 1Z3XA 2I10A 2J5PA 3O6IA 2RC7A 1RZ4A 3LFUA 1EA3A 4LITA 3TTKA 2KIFA 1LBWA 2LY2A 2PT1A 3GXAA 3MEXA 1FPEA 2XPVA 2DFEA 1WCMJ 2KMUA 4BHBA 3FHZA 2HEOA 4I0AA 1G0IA 4GWYA 2X1CA 1OR7C 1F9NA 5H8FA 2ADUA 3H3ZA 4PGGA 4XOPA 1IMFA 4GXAA 3CIJA 4U1OA 4NWCA 5HOOA 3E13X 4PAIA 5I2KB 5J4YA 4N9HA 1BR2A 2E7WA 1Q1HA 1LUJB 2CQNA 3A03A 3F72A 3OYCA 1HDDC 1IZ1A 1IW7F 2OWSA 2DA1A 3FBIB 2IS6A 1GVDA 2K9NA 2XPUA 5FFZA 2P5VA 3OYFA 4M74A 1VQOI 2DDBA 4AYBN 3BLYA 2QM3A 5B1AH 1BJZA 1YZ0A 1WJDA 4ZTJA 1Z67A 2CW8A 3Q3SA 3CCMI 4AIJA 3EUHA 2XC7A 2KQRA 2OQGA 3IUOA 3KZZA 3RKWA 3LFKA 2PMSA 3IRQA 4HNTA 2E1MB 2AXLA 2MGQA 4RAZA 1XDSA 1FPJA 4B4CA 4OMZA 2Q2EB 4PF8A 1MXVA 2ZC2A 2F2EA 3I3VA 4JWOA 4NAPA 1REPC 2Y0SA 1XSXA 1G8XA 2EFQA 1IXRC 3COAC 5D6FA 3IORA 2KIUA 3OSQA 2CUZA 2H98A 1EU8A 3I5OA 3C1DA 5H8NA 4CHUA 1PYVA 3K70C 2MA3A 3HXLA 3HO7A 1A99A 1K4SA 4AS5A 1GGGA 2PMZA 1GXPA 1GDTA 3HOWJ 2QMXA 4R9GA 1NV6A 1J09A 2RV8A 3WU2C 1GV2A 4MCOA 5FKOA 4RK2A 4RAFA 3PFIA 3A0HC 1ERDA 1X19A 5KVRA 3CFZA 3C36A 1KA0A 3I59A 4GBVA 3QU3A 2NS0A 1FTMA 5FKLA 2DFFA 1MDMB 1B3EA 3CMYA 5JVTA 4GFBA 1ZGJA 1QHHD 1LB8A 3RI4A 1AU7A 2UXAA 2MBFA 4EJVA 2W57A 4A3BJ 5AA4A 1B59A 4A3CJ 2BJIA 3G4SI 2XAGA 4C0RA 4M73A 5L3FA 3L6HA 2YX4A 1W36C 2DVZA 2CS3A 1AHDP 1IEJA 5TP9A 1MXWA 4XKVA 3VYTB 2LBFB 2CZLA 2IA4A 1UTBA 1KYWA 3BTLA 3H9JA 2X48A 2FA7A 2LLKA 3KBZA 3QPTA 5ELVA 4BLAA 4UB6C 4XKBA 1Q1VA 5I5PA 2NVYJ 1B6HA 1K7AA 1FZPB 5KK1A 1V4RA 1O3QA 2F7CA 3SFIA 1EH6A 5FRNA 1T8IA 4I62A 2TRTA 3PMWA 1WJ5A 3G1MA 5GPCA 3HUGB 2EA2A 2Z8FA 4OVTA 4QSDA 4B43A 2Y9ZA 1OVTA 1XB4A 5HBCA 3GZ5A 3QMFA 4QFPA 1IMDA 4FATA 4R8HA 2XROA 4QBAA 9ANTA 4ZC3A 1VNDA 3KP6A 2HQ0A 2X4HA 4OFLA 1YI2I 1P4AA 2LF7A 4OIOF 1TWHJ 3ZR8X 4E7SA 2F36A 5J3LA 4HV5A 4YKKA 2JA2A 1QUIA 4KT5C 2PFYA 3E5UA 1D1BA 4A2UA 1R4MB 2DJIA 4HSRA 4THIA 2F5XA 2KIQA 1ZQ3P 3BR1A 2OLBA 1B9JA 1KWHA 1APLC 3BG9A 1BIAA 4F1VA 3S93A 3JSOA 3L9FA 1XCBA 4DCXA 4JOMA 1WGXA 3LSMA 2ZSHB 1SD6A 3DPLC 6PAXA 2L9NA 4QWQA 4EJTA 4OFJA 2R7QA 1WPKA 3LNQA 3O2AA 2HQ5A 1IUYA 2M30A 2IVMA 3T9VA 1Q9DA 1WQ2A 2QVRA 2D2WA 3SYTA 5KAIC 4CZCA 3R0JA 2E0SA 4A5NA 1VQ7I 4MQ9F 5L8DA 2EV0A 3E7LA 3PUXE 5JK4A 3ZQGA 3OS2A 2XXPA 4O3CA 3RPWA 5F7VA 3WE2A 5KAFC 1MJBA 2NVQJ 2MLKA 1X3WB 2DK8A 3S9MC 3MP8A 2WAEA 3L1PA 4PGHA 2XRNA 1HLVA 4L0ZB 2XWIA 3DV8A 2GZWA 4XK4A 3M3YJ 2QVOA 2E71A 2DW4A 1LFUP 2ELHA 1IXSB 3PSIA 1FQFA 4G61A 2CUEA 4MIJA 2D45A 2DMTA 4OINF 4R75A 4N91A 5L3DA 1FP2A 2XDVA 1VDWA 2QS1A 1SC7A 1AOYA 2VE9A 2YUSA 4OIQF 2X1DA 3GO5A 4H1XA 1LE8B 3M3LA 3M9AA 2W00A 1UG0A 2X85A 4HDUA 4G68B 2RNGA 1SW5A 3W9WA 2M1BA 4YB6A 3F21A 4BU2A 4A3IJ 2HPGA 3A01A 3WTZA 4PZJA 2E35A 1R5HA 3P9IA 4ESJA 2RGVA 1IN7A 3JRDA 3H9QA 5E1ZB 5E17F 3H3UA 4JSDA 2EJRA 3OS1A 3K6XA 1BOBA 3HGGA 3ILTB 3QYEA 3KN8A 1IXIA 5B5EC 4YFXF 2K9LA 5LBQA 3KZIC 3GX4X 1A36A 2QSHX 5DUKA 3I4MJ 3JZJA 2I4CA 4KFQA 2O8KA 3VLVA 1B5IA 1YX5A 4F19A 1SFXA 3P7NA 1FPQA 1JUPA 1LB9A 1H8AC 1YYZA 3DXJF 3LSXA 2WAFA 1FMWA 1CGPA 1J59A 5CC2A 3KLOA 5D5UB 1E3OC