3K1MA

Crystal structure of full-length benm, r156h mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
300
structure length
300
Chain Sequence
b'MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 96
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA03
2R6GE 3LA2A 4G94A 1R7JA 2FRHA 4MQ9F 4ZYDA 3SFZA 1XCBA 5FTHA 1BLFA 2O0YA 1USTA 4A5NA 1BI2A 4BAYA 5DEQA 4MNUA 3C32A 5BPDA 2QMXA 5H8SA 1B32A 3D0SA 1REPC 3HSTA 2M8EA 3TTLA 4F3PA 5F1QA 1KQ8A 3FXQA 5CVRA 5E1ZB 4ENKA 2EFOA 3ZN1A 4QFPA 2QBYA 2HEUA 1MQJA 4H1XA 3SZTA 1MQGA 2A69F 3ILTB 3FX3A 3QAXA 2DTRA 3UIFA 3QSLA 1B4HA 3O3KA 2M45A 5FGMA 1J5YA 4LZ7A 5KDTA 3VODA 2XD3A 4R6HA 2XXIA 3WTUC 1IRFA 5BWJA 1SW4A 3FF5A 2Z3YA 5DUKA 2HTJA 3TQNA 4RXLA 5D6FA 1P1NA 4BDMA 4JXIA 2ZYOA 3GZ5A 4C1TA 2EK5A 4I7HA 4QLCU 1JEUA 1SAXA 5HM4B 3R0AA 2G9WA 1XS5A 3M8UA 3TQWA 5DT6A 4ZEKA 4EXLA 4LZ8A 1PP7U 4BHBA 2VHAA 3G3FA 4YICA 1NL5A 4RK9A 4IGRA 3ECOA 1K6OA 5H6QA 3MWBA 2HZKA 4JK1X 1T0KA 2X0LA 1GHCA 1ZMGA 4Y17A 2P7VB 3CG3A 4F1YA 3EETA 2W24A 2I6EA 4OMYA 3F8NA 4BNCA 4EF2A 2IRFG 1FWZA 2V93A 4ISUA 1U2WA 1P1QA 4MTDA 4ZECA 3T9VA 4RGUA 1O3QA 1JGSA 4ZYHA 4EXKA 5I56B 3N6UA 2OD5A 2OJTA 1GTKA 3PUVE 3RDIA 5HVQC 5I2KB 4I9DA 3MQ9A 4Q30B 2I0CA 2PMSA 3FM5A 4R74A 1Q35A 1ONVA 4WK8F 1WKMA 3B7DA 1MXYA 1NHAA 3DV8A 5BMZA 2OA4A 1B7ZA 1WWXA 4P55A 5H8QB 1G4DA 4GCVA 1N7XA 1MD0A 1S29A 2NWJA 3ECHA 4F7ZA 1I6QA 2EFWA 4FECA 5A2QK 4EMSA 2OLBA 3MZ1A 2HFBA 3HHHA 1GVCA 3HRMA 1LDJA 3T5XA 4NF6B 4GRKA 3KEOA 2QPQA 2Q2AA 4BDQA 4QF9A 3CIJA 3HN0A 2VN2A 2R7DA 1LB8A 4XXUA 2XHDA 3SESA 3UA8A 3JTGA 4K3FA 2KJCA 4OINF 2CGPA 3EN3A 2EA4A 1MZBA 1NH8A 3M1EA 2GHAA 1HXDA 2Q0OA 1J9IA 5CMBA 4EM0B 3FVGA 3V7SA 3QU6A 4GXSB 2Z5UA 2DK5A 2HAUA 5I2NA 3W6JB 1YLFA 2MC3A 2FBIA 3DP6A 5HPQA 4U23A 3DKWA 1HSJA 2GH9A 3HSEA 1MH4A 1Y9UA 4QHQA 1P4WA 1KQ0A 3B02A 2I3VA 1NFTA 3RKXA 1F9BA 4IB2A 4LP2B 1SW5A 4WCGA 3LUYA 2RF1A 3O6GA 2XX8A 1IITA 1B3HA 4PCQA 2XXHA 4CXFA 3IL1B 3UN6A 5AIQA 2IA2A 5J6XA 1MQDA 1MY1A 2XRNA 4LG0A 2QBYB 5HBCA 2XXTA 1FNNA 2P6SA 3CDHA 3EHSA 3L09A 3VFZA 3RLFE 5DD8A 1MJAA 3EQ1A 2F5DA 5KDTB 2E1NA 1RIOH 1Y1ZA 3GYHX 5CBRA 4UVCA 2OZUA 1URDA 2FQ3A 3OO9A 5L8DA 1MG1A 3TCFA 3MUQA 2H09A 1MXZA 1QJMA 3T1BA 4Q4ZF 4L18B 3RTWB 1DPRA 3JV9A 1B1HA 2RKHA 2NNNA 1T0FA 4HAMA 5D4SA 1R9LA 1Z7ME 4OENA 1IIWA 1ZGAA 3GFMA 1UB9A 1TFDA 4OTEA 1KU7A 5CVJA 4OERA 5E18F 4DIGA 2AYSA 2YLNA 2CMOA 5H8HA 3LAPA 2L01A 2XXQA 5CMCA 4HQEA 3U94A 2RCAA 3QAHA 2QRYA 1GR2A 2W84A 4Y15A 3RT8A 4YG2F 2V1UA 1SDXA 1VFDA 2XROA 4GWOA 2FBHA 4DDDA 1IRGA 1ZH5A 3IOTA 3BBRA 4EVIA 2XXYA 3THIA 3F8CA 2CG4A 1F9NA 1YPNA 3VLWA 1WODA 1EU8A 3UGWA 3KJ7A 3VOEA 4THIA 3DELB 3NQOA 5ICCA 4NF5B 3TO6A 4B8XA 1I1SA 2QL3A 4A6DA 4Z0IA 3KP4A 3KFWX 2O61A 1L0OC 5KVRA 4R9GA 4KYEA 4M6XA 3TTRA 1S9TA 3TAJA 5LHHA 4GF8A 1ULYA 5L3CA 1BC7C 4UNOA 3FGSA 3PPPA 4YB5A 4YKIA 3ONMA 2STTA 2H27A 2QQ9A 4F22A 2FE3A 3PUWE 5ILVA 2OBPA 4XKPA 1GXQA 1FTMA 1Y3NA 3QUJA 2O8XA 3QU3A 1OVBA 4RAZA 1VE4A 2DO7A 5CJ9A 1MKMA 2FNAA 1YTYA 5F7VA 1FQBA 5DV5A 3HIFA 5DEXA 2O1LA 4IRGA 1FYKA 3ML6A 3OO6A 4G68C 4Y13A 1R1TA 1SI0A 4JWOA 3HOSA 4LFUA 4FHTA 1KYZA 1WRJA 5E1WA 1H43A 2I3WA 5I2NB 3GO5A 1A8FA 4A5MA 1Z05A 5EHSA 1EZPA 3KSJA 2OBGA 2FXAA 5L9MA 4MH5A 1QPMA 3KP7A 2PJPA 2PX1A 4OIOF 4LMYA 2F7BA 2L54A 2QLZA 1MY4A 3W15C 2YPRA 3I64A 1JETA 3HRTA 3QXMA 1A40A 5JVTA 3VLVA 5CVIA 2GIVA 1TT1A 3REOA 4PE5B 2DSFA 4QWQA 2HWVA 4A0ZA 2P1SA 1IN7A 3RI4A 2IPQX 4LJZF 3PD8A 4LG0B 1H76A 1B9NA 2O7UA 1A99A 1PB7A 5H8NA 1SW1A 4UXNA 1R1NA 4HDVA 1BI0A 1KYWA 4G68A 4LATA 1KA8A 2LSOA 4Q48A 4U0VA 3I53A 4O6JA 5LGTA 3LBSA 3IKTA 2Y84A 4LGWA 1MXXA 3M3KA 3RN8A 4DZ1A 1BN5A 3K9TA 3Q9VA 3I0TA 4X1BA 2HQRA 3VDFA 3F72A 2A6HF 2NXOA 2D1HA 3DFGA 2FF4A 3VB2A 1D3KA 1BM9A 1QGPA 1SFUA 4C0RA 2WWYA 1FQEA 3G3ZA 3HRUA 4IRHA 4OQOA 3T8TA 3GXAA 3P7NA 3Q9SA 3M9AA 4AB6A 3IR1A 4ENJA 1SMTA 3KEQA 4XKNA 2CQKA 4WXDA 5FFZA 1JE8A 4KD5A 1QULA 2VP1A 3GWZA 4KI0E 2LKPA 2DWJA 2HKXA 3EUHA 4DLDA 2XXWA 1OQGA 5AIPA 1KWHA 4F18A 3RPUA 2LNBA 2G7UA 4IO3A 2O68A 4FAJA 5L9SA 4BDOA 3HPIA 4N0BA 5AA2A 3LSFB 4LK1F 4G4PA 1BJAA 5D8KB 3L9FA 3B6WA 3KBRA 3RT6B 5K5QA 3HTSB 3GXOA 2UZKA 2DPUA 3FM3A 4PGGA 3E3VA 4CZZA 2VOZA 5CMKA 4JWXA 3MZHA 1II5A 1R22A 1ZG3A 2XAJA 4A2UA 1IAWA 2EFQA 1MJBA 2NRAC 4PFTA 2H98A 4RPNA 3JAMZ 5DCFA 4Q47A 1JVYA 2GXGA 4HLXA 2VE9A 1SYIA 1IXGA 4GYGA 3USDA 1QZYA 1UHMA 3GEZA 3B6TA 4OEUA 5E1XA 1ZARA 2M1BA 1B59A 2M30A 1B46A 3CO6C 2A68F 2BJJX 1P99A 1QBJA 3TTNA 4BQAA 4B09A 4HF0A 1J75A 5K2XA 3EDPA 4KCCA 2F8DA 2NUVA 2O7IA 2Q8JA 1FBQA 2RC8A 3V89B 3S2VA 4EUOA 1RKMA 4DNCA 3K6VA 1T6SA 3ABUA 5CLSA 1N76A 1URSA 1P6RA 1B0HA 1H9GA 1MY3A 4NF4A 2P6TA 1O3RA 4KMUX 2Q2CA 4FE8A 2V84A 5H8FA 5I58A 2PYYA 3WAEA 1RYOA 2NAZA 3WGGA 1IXRC 3ZMDA 5B70A 2IVMA 1HKTA 3PPNA 1O63A 4O3CA 4G68B 4U1OA 4EJTA 1TXFA 3PPQA 3K1NA 3O97A 3N26A 2K02A 4RY1A 3TELA 4NMYA 3ZKLA 4KIFA 4KIGA 4RGXA 3TDZC 1O3TA 3MQ0A 1MQHA 5JTYA 3S9EA 2ADUA 2MLGA 2RCBA 2YPNA 1ZIUA 3ZN0A 5ICEA 3R7XA 2ZMEA 1TW2A 2P8TA 5ISUA 3FVNA 2EV6A 3JTHA 5EEGA 5L3FA 5DCMA 4I0AA 2EV0A 4EF1A 2RC9A 2NVUB 3CSBA 4ZYGA 3JYRA 3OV8A 1B7UA 2OU2A 5F1RA 1SFXA 1Z6TA 4NHJA 4PFUA 1JHFA 2Y0MA 1ZREA 4Q5SF 4PDKA 2Y7WA 3G3HA 4MFIA 1YW8A 3MZYA 2G29A 1ZHFA 3PGFA 5D5VB 2UVJA 3FHZA 3G73A 4OFOA 1G3TA 2ESNA 2UVHA 1ELJA 3MW0A 3IWZA 1HBXG 5ICGA 1BKAA 3FMSA 2UYFA 4CO8A 2XD2A 1I6XA 5AA2B 4X1DA 4EGZA 3O6IA 4KHZE 3VXBA 4AVPA 2VODA 3O9PA 3KLNA 5BS6A 4ENMA 1UTBB 4IO2A 2PLYA 3JSOA 1B0LA 5HDKA 2FMYA 1MXUA 4IO6A 4F31B 1MPDA 4ESJA 2VONA 4MEYF 4KT5C 3WE3A 4R8HA 4U1ZA 4HX4A 3IB2A 3UP9A 2UYEA 3WTVC 4JWYA 4ESFA 2FNPA 4RGSA 1J1NA 2PBWA 1FQCA 3E5XA 4HTGA 2DLLA 5I59A 1R58A 3RPQA 1UCRA 3I59A 3HCQA 2O03A 3GFLA 2DS9A 4LONB 2DOJA 4P9FA 1YIOA 3F21A 1I6AA 4GXAA 3MBPA 5J8FA 2XXXA 2BV6A 3VLUA 4IJAA 2X7QA 4AIJA 1BI3A 1POTA 3V83A 2F7CA 2NNYA 4GGGA 4RS8A 3SEYA 3H6TA 5HLIA 1USSA 1ZJLA 5K1YA 1LBBA 3TGNA 5ITPA 1DPPA 4HBLA 1XGOA 4RNSA 4NF4B 2FA5A 3P7IA 3LQQA 3R6SA 2HYFA 3HOTA 1OVTA 3KSXA 3I71A 4LD5A 1H44A 1H45A 1QUJA 5D5XB 4OIQF 2L4AA 2F34A 5I58B 4LVQA 4OU0A 4G8HA 5ITOA 5CVVA 5HDGA 2HKOA 1R36A 3FXUA 3K00A 4ETSA 4XLNF 5CBSA 1NMUA 1V4RA 2VBWA 1QVSA 1OIBA 3IB0A 2V3QA 4XTCQ 3S2WA 5E8GA 1T98A 2DE4A 3DPLC 1MXWA 1JQFA 3TOAA 3FXRA 1AOVA 2WC2A 1PC3A 3TCHA 1FP2A 1HSTA 1O7FA 3IJXB 4G8NA 3K01A 5JTYB 4O5VA 2OAZA 1AWCA 2QVOA 2IA4A 1XGSA 4JB7A 2ZMEB 2I48A 1WVJA 3KETA 1P2FA 3C7JA 1B52A 4A0XA 5CYVA 2CZLA 1FBUA 2PFBA 2YSRA 4I0BA 2WV0A 4QFLA 1P1UA 1E17A 1B5IA 3JW4A 4ELPA 4EJOA 4Q0CA 1Q1HA 2P7CB 4I09A 3SEUA 2ZYKA 1B9MA 3CR9A 5LOMA 1B05A 2IJLA 1FQFA 4U0WA 2REGA 2Z33A 4ASNA 1FOKA 1LCFA 2DW4A 3IL2A 1VFEA 1USYH 5I57A 4KN4X 1JW5A 2Y7PA 4NF8A 2Z8FA 4R79A 3HTUA 1Y20A 3WU0A 1B3EA 3O2AA 2VBZA 2GA2A 3HRSA 3E6DA 4KFQA 2IP2A 1CB6A 3BP8A 1FBSA 1RUNA 1O7LA 3F6OA 3SETA 1H9TA 2COMA 1HKQA 5A5XA 4PZJA 3JAMK 1B6AA 3FMRA 4PFWA 3L6GA 3QYTA 4KUMA 4DE8A 4OWDA 1L5TA 1S7AA 2ZJ2A 3BJAA 2VOOA 3MEXA 1A8EA 5D4RA 5H6RA 4O3AA 4MTEA 5FD6A 1Y3PA 1YQAA 4HLYA 4MEXF 3H3GA 3ZS6A 5KCJA 3GFJA 1LFHA 2YJPA 5DVIA 5CI5A 3QK6A 4YAHX 1DPEA 2FSWA 1XVXA 5I59B 1UHWA 5E17F 1XT8A 4KYWA 3TTMA 3ABTA 3I59B 4ECFA 1SVXB 4OXVA 4OIPF 1C0WA 1YCJA 4LUBA 3MPLA 3J81Z 5FB2A 4I98B 3KGCA 1PBPA 1ZKBA 3ELKA 3LSTA 4U0YA 4I2OA 4LB6B 1DUXC 4HCWA 2OQGA 2XXPA 2DQLA 1K79A 3G3JA 5L3DA 4FEBA 3ZKKA 1Z91A 2KKOA 5ERIA 4UV9A 2VGQA 3CFXA 4H8JA 3BJOA 3H4ZA 3MP8A 5DD4A 1LFIA 4XKQA 1MDP1 1DPUA 5L3BA 2W57A 3KG2A 3P9CA 3F23A 2AL5A 2ABHA 4BDRA 3Q29A 1I1GA 2XKOA 5KK1A 4MBPA 4ESBA 3FVOA 2FYIA 5LRRA 4IXAA 1KU2A 1IN5A 1SD7A 2FMLA 3QRFF 3ZP5A 4NQWA 4G8MA 4P9UA 1MM7A 3PMWA 2RC7A 5DUIA 5ILUA 4MLVA 2F5EA 1QQIA 4ONYA 5JI6A 1LFGA 1M5BA 2DE2A 1CF7A 5EEHA 1FTKA 1Y0UA 2FU4A 2XAQA 4ZS9A 4EQ7A 4I01A 4H6DA 2OZZA 1N3XA 5J8CA 4KDPA 3ZMTA 3ULQB 1R6ZA 4R9FA 4DCYA 4YFNF 4E0WA 3CJNA 3RYRA 1W5TA 2VT2A 1Y4CA 2EB7A 1OYIA 3QPHA 4ELRA 3IK6B 4RA1A 2V79A 1BI1A 1LSTA 4IGTA 2GRVA 3IO6A 3O2PE 1YS6A 3P9KA 1MXVA 1NNKA 4P0GA 1IEJA 5I57B 3CUQC 1EH7A 4I1DA 3OMBA 4HX8A 2DAOA 2J5OA 4NF8B 1YS7A 2QUFA 2ZXTA 3E13X 4N13A 3KOTA 1Z6RA 4U7BA 1JEVA 1TQMA 1IN8A 2OZ6A 2DE3A 2BYVE 4IHSA 2FEZA 4G6QA 2ZYNA 3CTAA 1YW9A 1W5SA 1HW5A 1S7OA 5A5XB 3O29A 4LA9A 4P0IA 4PFYA 3WTTC 4OFLA 1P4AA 4ZEFA 4M1VA 1BIAA 4OMZA 4R6YA 2EV5A 3K1MA 2O69A 2H6BA 2HFHA 5AA1A 3C18A 4AIKA 2E1CA 2QJEA 5FHOA 2EA2A 2XAGA 4BXUA 5FTIA 5FFXA 1JW4A 3N5LA 3SEVA 4BDLA 4OMBA 4Z2YA 3VV5A 3CO7C 1IXIA 4FEDA 3FIRA 4TLMB 2F97A 4EJVA 4POXA 1QW0A 3E9XA 4KYDA 3CUQA 3BKIB 1O57A 1R00A 4G7ZF 1W4MA 3T96B 1ZTYA 4NB5A 1MDQA 2ACJA 3WU1B 4RB2C 1VTNC 2BE5F 2ALUA 4H8IA 2E1SA 4GL0A 2H94A 2H6CA 3DP8A 3W9WA 3ZQ7A 4DXUA 3HHFA 4OETA 1RUOA 4I8CA 4U4XA 4P5OA 1MJ9A 3FWEA 2QENA 4POWA 5ICTA 4U4SA 2ONKE 3LC8A 2JZYA 2L4MA 3HUGA 3TOBA 3PV0E 4R75A 3NRVA 2HAVA 4WXJA 1UIUA 4K2EA 3IOUA 2TDXA 2GAUA 1SD5A 4FATA 2GXBA 3RKYA 3KP5A 5TPAA 2VD3A 4LQ5A 4ZEIA 3LAJA 4LLLA 3TYHA 1SD4A 3D5LA 2MH2A 2VC1A 5DDGA 2GA1A 1AMFA 2AS5F 1IQ7A 2I49A 5ICQA 5AA4A 4O3MA 4H67A 4YU0A 1B40A 1HSLA 3GLXA 2QM3A 3LWFA 3V8KA 1DP7P 3TFLA 5BQTA 2WKYA 3IOWA 5ELVA 1FQDA 2F36A 5TU0A 2R3SA 1K78A 1B4AA 2D45A 4G77A 1B51A 1ZLQA 4M71A 1B3GA 4IO7A 1SBPA 1XVYA 3MC2A 4TOZA 1U5TC 2DI3A 4RPOA 4WX9A 2PI0A 4F3GA 4HX7A 5IKBA 5E20A 3IC7A 1SD6A 2KIMA 1OLCA 3QP5A 1LB9A 4I62A 1SD3A 3SEWA 4L0ZB 1O64A 4GD5A 1A04A 1I27A 5H8HB 3FJMA 2Z8EA 4F19A 2LDUA 2GHBA 1FYLA 3SERA 2XX7A 2YU3A 1B5HA 3WG9A 3K69A 3FATA 3CSGA 2DWHA 2ZYMA 4U2RA 1ANFA 3V4GA 2ZXJA 4YFKF 3OD7A 4XSXF 3C1DA 3RGYA 2DWIA 2YX7A 3T8RA 1U3EM 4R2BA 4ELQA 2K4BA 3CFZA 2REJA 3TKDA 1TWYA 3KP3A 3D4CA 2UVGA 1TNSA 3CRBA 2RDPA 3I4PA 3KOSA 1ZU0A 1LQ1A 5M2VA 3LFKA 4IF4A 1FCKA 4G9YA 4AIHA 2VC0A 5JHUA 3E5UA 1XGMA 4RJZA 4EJWA 1OQHA 4WEPA 2HDCA 4A6EA 1B3FA 4KR5A 1H0MA 4IVNA 2AL4A 4ON0A 4F29A 2A5TA 1T39A 4C1UA 2W7YA 3K02A 4BH9A 3N4MA 2MA3A 4H0EA 3EYIA 4LLGF 1NNPA 4GFRA 2YX4A 5DEXB 4KMFA 2DP8A 4H0WA 4WXCA 3J81K 2G7HA 5B7DA 2Y48A 3SQNA 1WSUA 2A5SA 3E4RA 5BOXA 1PBQA 4R72A 2D21A 1V3FA 2P0SA 1YYVA 3BDDA 1QNTA 1XMKA 1L3LA 4LK0F 3HYIA 3TO9A 1OYWA 3CUQB 3WAFA 1O3SA 1DDNA 1MRPA 3EQLF 1RI7A 1DTGA 5CM6A 5A2QZ 5LEJA 4X48A 3BFTA 1ZYRF 1YG2A 4G8XA 1F5TA 1G6NA 1XDUA 3PD9A 3OELA 3I58A 3GBBA 3RQTA 2IW5A 2JPBA 2HQ0A 4N6PA 2Q88A 2DVCA 3K0VA 4IY6A 3KP2A 1B3LA 2KLFA 3EHTA 5F64A 2DQRA 4RYAA 1B2HA 1PUEE 1YTVA 1IN4A 4Q5TA 5JFRA 3R4KA 3U1DA 2G93A 4KQPA 4HA8A 3KFMA 2Y7KA 5H8NB 4QSDA 2MLKA 3SEXA 3GBAA 5TPAB 2D1VA 3OO8A 2V1DA 5ICFA 3GW2A 3GLBA 1J7KA 3V8JA 4EQ9A 3I3VA 4H65A 1A7LA 3TUSA 2LAOA 2XXUA 1BP5A 3G3KA 3A3CA 2CW0F 3MAJA 4N9IA 5EYFA 4A12A 2O6GE 2IA1A 1I69A 1QKAA 3VXCA 1B7HA 3AAFA 3M7GA 4M6YA 4JBZA 4ND9A 3TCGA 5AA3A 1IUYA 1EZ9A 1K78B 1NNFA 2RVCA 2VXZA 5LGNA 4XLPF 5FLXZ 1J59A 3GZ6A 1FSHA 3CVGA 4KN7X 2HZTA 4BHPA 2A6EF 3BOQA 3LA3A 4IRIA 4OHNA 3EHUA 4F2QA 5AA2D 2JTVA 1Y4TA 1ON1A 1JW1A 3CUOA 2X26A 4CHUA 4U88A 4UVBA 5BPIA 4S05A 3TEPA 4M73A 3I5OA 4HZFA 4HQMA 2QS3A 3U92A 5LRSA 4JSOA 4GYIA 1TQPA 4H5FA 3DF8A 5D8LB 2KJBA 2LF8A 4CICA 2D5WA 1KQ9A 3KZZA 2HCAA 3MJNA 3A09A 4U22A 1HW1A 2F5CA 4R73A 3CFLA 4E70A 2ZNZA 2RN7A 4F39A 4YFXF 5IT9Z 4DCXA 4YIIA 3VE1B 3S4UA 4UHTA 2A07F 2V3UA 3SKPA 3IAZA 4F2OA 1OMIA 2B65A 4WF2A 5TRDA 4YB7A 3Q25A 2Q2EA 2QWWA 3RTRA 2V6CA 1GVJA 2DVZA 4EM2A 2DU9A 5JR3A 1MPBA 4JBAA 1XCVA 2CO5A 2KIFA 2ZMBA 2A5TB 2B0LA 1HKSA 2Z99A 3PFIA 3H6WA 2H99A 2PMHA 4Z7EA 4L9NA 3C35A 4YIFA 1ZRFA 1SQYA 4ESWA 3MCZA 5JEIA 3HHGA 1D9VA 4RK2A 3MWMA 2QYOA 4NF6A 4R2FA 3E5QA 2QQBA 3MVZA 4F3SA 1FYMA 2RQPA 5HS8A 3H3UA 1IXHA 3PPOA 2ZFWA 4PETA 4EJUA 3LA7A 4PGHA 1XGNA 4U7DA 4HS7A 4OZ9A 4YKKA 3ZSFA 1FY7A 2V25A 3MVYA 3L2CA 4DQ2A 3D4GA 4UUVA 2JRTA 2QQAA 3WODF 4XSZF 4HF1A 3IHUA 5ILSA 2XGXA 3QUFA 3K6XA 2XASA 2PG4A 1FX7A 3ZMUA 1T2KA 5TJJA 3FASA 3U8QA 4EDPA 1SYHA 4Q8RA 4ZZDA 4U21A 5LBQA 1DOTA 4YMAA 1U78A 2PT1A 3KN3A 2A61A 3ZMVA 1IN6A 1N0TA 3OSQA 4NTLA 2PN6A 2QS2A 5H8FB 5FD5A 2EJRA 3ILUB 3IJOB 1ZN2A 3IWFA 4R6KA 3HO7A 1KU9A 3N97A 5D5UB 5LGUA 1IUDA 5KZTA 4CDGA 5HDNA 1NH7A 4GO1A 4ZE8A 3RIRA 2RKMA 3M8EA 1EH6A 4MHGA 3OENA 2DK8A 5LHGA 2H4IA 1XSXA 1JHHA 4WWCA 4RAYA 2JT1A 3S9NC 5D6EA 1FT9A 3SHFA 1TFAA 4E0XA 2EWNA 3F3XA 4BLAA 3TDJA 2R9JA 2BEOA 2V3TA 5LHIA 3ROUA 2AXLA 3RNNA 1A55A 1D4NA 1P1OA 2UVIA 2A3SA 2Z9OA 3TODA 1ZG5A 5DCMB 3R60A 5HOOA 4M74A 2E7XA 4G6DA 1MDMA 2DPDA 1G3YA 4D0PA 3MP1A 3I5UA 1PEBA 1SFEA 1B1BA 2PBIA 4TLLB 5L9OA 4KPTA 4LZ5A 2OQRA 3MZBA 1ATGA 3PPRA 1LDDA 3PUZE 3PU5A 3KCCA 3Q26A 3M8FA 2NYXA 3UORA 3H06B 1QUIA 2R71A 2NS0A 1KU3A 3TQLA 4M9ZA 4JQFA 4AB5A 3H03A 4KYSA 4IY5A 2KIUA 4KCDA 2ONRA 4DXBA 1FLIA 2CYYA 2VBXA 3J7AO 3WTZA 2ISZA 2Q89A 5CC2A 2QSXA 3MFKA 4HCYA 5I84A 4FX0A 3R6UA 2ZBKA 1P92A 3BZ6A 5K2YA 1LVAA 4FX4A 3V7RA 1LB2A 3J80Z 3TZAA 1ON2A 3QOPA 4ELOA 1ZLKA 4NWCA 5CVUA 5IT3A 4NF5A 1XHYA 4PP0A 5HS9A 3IKVA 3LQRA 5EHMA 4DXCA 3RYPA 3FV2A 4HW0A 4CGZA 4NEDA 3ZMSA 2X7PA 3N94A 2STWA 1R1UA 3F8BA 1B58A 5FHNA 1E2XA 1ZLJA 2ZNYA 4UACA 4AD9A 1P4XA 2VT3A 4GOTA 3PQKA 1RNLA 2MD5A 1TTYA 4XRFA 5F6FA 2F5XA 2ETHA 3ZMZA 2FNCA 2PMUA 3S9LC 3C9HA 1DMBA 4JSDA 3V8XB 3BROA 3OOPA 3H7MA 1LEBA 1N04A 4WEDA 2FBKA 3MVXA 1UIVA 6PAXA 4IO4A 3Q28A 3GVAA 2D3IA 3WTWC 1LAHE 1QKBA 3CI8A 4QFKA 1HQCA 3N6TA 3OXNA 3ODBA 2D2WA 4ZZEA 1N3WA 3ECRA 5TP9A 2CSOA 2OWSA 1D8KA 1ZRDA 2UXAA 3MP6A 2HEOA 1M5DA 5FLXK 1DSNA 3RJPA 1WDNA 2XAFA 1USYE 2DT5A 2I58A 1OMPA 4MLQA 3NEUA 1NKXA 3UK4A 2P4WA 3PQJA 5H20A 2VE8A 1OYYA 1I6BA 1MY0A 1URGA 3EYYA 3B73A 3LSLA 3K2ZA 3RUMA 3S9MC 2FOKA 4RGRA 2ANJA 3KZYA 3W9VA 1ZG1A 2GZWA 2VBYA 3F11A 2JPCA 4QRZA 4ZEBA 2J5PA 3BWGA 4YZZA 3T9XB 3E6BA 4AWXB 4X9TA 4HV5A 3U1OA 1HSEA 3KE2A 4KFCA 1PDAA 1M5EA 1MDMB 5L3EA 2O84X 1R5HA 2VD2A 4ZE9A 3DQVC 3Q5FA 4GLIA 5IT9K 4M72A 1MPCA 4OESA 1LDKB 5ED4A 4OFJA 2ESHA 3H6VA 4YKJA 1LNWA 4KA4A 2E7WA 3EPEA 2K86A 1SW2A 2VOPA 3ZPLA 1YFHA 2BBYA 2RINA 2HZLA 3KJTA 3IB1A 3LSWA 5HLHA 1F1ZA 4O3BA 4L9JA 2XXRA 3VVFA 2W25A 4MF3A 1CGPA 2DWAA 3SXYA 1B6HA 2OWTA 4G2ZA 2HOEA 4NE4A 3WTXC 4GL8A 3ERED 1YO5C 4LLNA 1FPQA 4LB5A 1DTZA 1S50A 1Y3QA 1OKRA 2QZ8A 5JK4A 2Z8DA 3QPTA 4I02A 4LQ2A 2P5KA 2DXYA 3GFIA 3HV1A 1PB8A 4IHTA 1MM6A 2GWRA 1S8NA 4F1UA 1X3UA 2V1XA 2UXXA 2F7AA 4OOIA 3M3LA 1OLAA 3TDUC 4L17A 1F4KA 4N07A 3KZGA 5KCJB 2CFXA 1PDNC 2XV4S 3O28A 2DFIA 1S6LA 2ZKZA 2H9BA 1VR5A 1LLSA 5J1DA 1J0RA 1LJ9A 4F1VA 4S04A 3F8MA 3VEPA 4ENNA 1IW7F 4A0YA 1M5FA 1STZA 4GQOA 3L7WA 3C34A 2M5WA 2Q9TA 3IX1A 1Z9CA 3DP7A 5DTBA 4MQVA 3U2RA 2UXNA 3T66A 2L02A 4WXHA 1LBCA 2O51A 2F78A 2THIA 3I54A 3K2DA 1JXSA 5K5RA 1G3SA 3BPXA 5IAIA 2PVUA 3PMXA 3JZJA 4FORA 1XMAA 4OEVA 1YW7A 1JVXA 1FC3A 1S3JA 1FZPB 1N7WA 1K7AA 2XHKA 1US5A 4GIZA 3M3FA 4G7HF 4ESXA 5FHMA 2UWMA 3FV1A 4XBFA 2XX9A 1Y1MA 5DYHA 5FO5A 2ZO4A 3KN7A 3QP6A 1TBXA 1D5VA 3C3WA 4L5IA 3RPWA 4L9VA 1BOAA 3OSRA 2DYXA 2KRFA 2XUBA 3TMGA 1B4ZA 3GZGA 4P96A 5D5WB 5TP9B 2ZCWA 1A54A 4IPAA 3TKYA 4BYYA 2PEXA 3COAC 1LAFE 3V7CA 3W6KB 1VSOA 3F22A 3T93B 2ONSA 3WTYC 3E97A 5BUUA 1SMYF 1OR7A 4R1HA 4XIGQ 3DEUA 2HR3A 2HS5A 4OYVA 2Q8KA 3OOAA 2K27A 2M87A 2DBBA 2ELHA 1Q1KA 3GX4X 2Z23A 1XSVA 4BDNA 3K6WA 3A3UA 1BBYA 2AIXA 4QSEA 4FT8A 1CF7B 4CYDA 2HQNA 1R5GA 3O6HA 4IO5A 4TV7A 2Y7RA 3BY6A 1TW3A 1W7PA 2B3FA 5CRYA 2RGVA 2DXRA 1RYXA 2XIGA 3CG1A 3MVWA 3L00A 1IXSB 2A5YB 2F6GA 2X4HA 2Y7IA 3I6VA 2HTSA 1S7YA 1ZGJA 2P5LC 1M5CA 4JDFA 4UVAA 3R26A 1U6GA 5DVFA 1FTJA 2XKPA 2I4BA 3DLNA 3KN8A 1G3WA 1B9JA 2HGCA 2HXWA 3WE2A 1WI9A 2QMWA 1XOCA 1Z7NE 3L6HA 3U93A 3J80K 2OK2A 1KGSA 1LAXA 3T22A 3F8FA 2QS4A 2DQVA 3GUDA 1FTOA 4EM1A 1U5TA 3VVDA 1MH3A 3HSRA 1PB9A 3BFUA 1POY1 1BIBA 1JNFA 4BHCA 2P2AA 4ZH4F 5CMMA 1QZZA 5L3GA 1GV8A 4WKMA 2WTEA 3VVEA 3T0YA 2RV8A 1TLHB 4M9XA 4G7OF 1OPCA 2RC4A 1FQAA 3KLOA 4KIBA 3V5AA 1XC1A 2Y75A 3PUXE 1Z7UA 1UTBA 2K7LA 1EV7A 1XN7A 1FP1D 1CE2A 2ZNUA 3C33A 2C6YA 3R61A 1UTHA 4HDUA 1MGTA 1EZOA 3DP4A 4HOBA 1ODDA 4OVJA 4H5GA 2I0BA 2PQ8A 3DM0A 1AH5A 2PT2A 3C31A 3PUYE 3TPAA 1XSDA 4HF2A 2FA7A 1IF1A 1Z1DA 1MY2A 3HSFA 1B1XA 2IEEA 1AOYA 3KP6A 3IRQA 2ZNTA 2V9VA 1R9QA 2L3DA 1J2XA 3H6UA 4L5JA 1XB4A 2QS1A 4QFNA 4M9SA 1BTJA 1XD7A 1GXPA 3MZ9A 2NOOA 1YAEA 3G3GA 4QFOA 4EQQA 3K1PA 3JSPA 1FW0A 3TO7A 3E3KA 3T9HB 3H3ZA 3RTFB 4XKRA 1TNTA 1ZBMA 3V8LA 3FJ7A 3OEMA 1W7PD 5AE4A 2M8CA 4NWDA 4UV8A 3G3IA 1FSEA 5AA4B 4L0YB 4HYEA 3IOVA 4L9TA 1LCTA 2EFPA 2F2EA 5LEKA 3P9IA 1GGGA 3LR1A 1SI1A 2P5VA 1R23A 3O6BB 3AXFA 2K4JA 3RKWA 4N9HA 1O7TA 5AONA 3BPVA 3U9GA 2CWEA 3KEIA 4P11A 4UA8A 3TTKA 2EFNA 2YR2A 3K6UA 3IORA 4ZDMA 2ZNSA 1TQIA 3VFJA 2O1MA 2XAHA 3MAMA 4YKPA 2GQQA 3F6VA 4ZEDA 1LGBC 2JSCA 1W7PB 3K0LA 3R0JA 5LLQA 4RB3C 1D8JA 1BIYA 1P1WA 2F6PA 4ZYEA 2O3FA 3MPKA 3OEKA 3QIMA 4EV0A 4HV6A 5HLGA 4AQ4A 1IXCA 2MBFA 3DXJF 2XVCA 3SZPA 4ZZAA 3CLOA 1HW2A 4KNYA 1N84A 1LAGE 3LSXA 2RNJA 1IZ1A 1T38A 2IT0A 2H5YA 2I4CA 3ISPA 3RY3A 3FUZA 3PMVA 4EQBA 4KICA 1QO0D 1NNTA 3WGIA 2HYGD 4FIMA 1EH3A 3H92A 5K5OA 2O6AA 4YB6A 2IA0A 3O66A 1EH8A 3WGHA 3EF7A 2H25A 3Q27A 5I56A 2GFEA 3G7WA 1U5TB 5DVJA 3SDFA 4GVOA 4HW8A 5DYMA 4GXOA 2Z22A 5I2KA 1D9YA 4QSCA 2F5FA 4TQUQ 2E0SA 3C4MA 1QUKA 3K4UA 4YMBA 1ZAOA 4RB1A 4MGRA 1H3DA 1MS7A 1B5JA 3DPTA 4ZZLA 5H8QA 2W85A 2XXVA 2ISYA 3B6QA 1I5ZA 1RZ4A 4M4GA 2R7FA 5HS7A 3FMQA 1LEAA 2BGCA 1US4A 3IO4A 2LF7A 1FTLA 1D3YA 4RB0A 2OCUA 1UTHB 1AIVA 1MQIA 4FJPA 3GF2A 1XDSA 3WTSC 2B3BA 3C36A 3IRRA 1ZRCA 3BJ6A 5E8IA 1BC8C 3FVKA 1UFMA 3FJGA 2MH9A 3E6CC 4OIRF 1WQ2A 1UQWA 4F3BA 1PP8F 3U72A 3E6MA 3FZVA 3OO7A 2F35A 3T9UA 1AL3A 4EGYA 4PQJA 1R1VA 3FD3A 1U8RA
chains in the Genus database with same CATH superfamily
2R6GE 2BW3A 2HOSA 3LA2A 4G94A 1R7JA 3S2DJ 2FRHA 2K40A 4MQ9F 4ZYDA 2V9KA 2BHZA 3SFZA 1XCBA 1I50J 3DU5A 5FTHA 1BLFA 2O0YA 1USTA 4W97A 4A5NA 2X1CA 3SJMA 1BI2A 4BAYA 5DEQA 4MNUA 1UAAA 4UUSA 3K10A 3C32A 5BPDA 2QMXA 3CCSI 5H8SA 1B32A 3D0SA 1REPC 3HSTA 1QKAA 2M8EA 3DKYA 3TTLA 2L5VA 3CQZJ 4F3PA 5F1QA 1KQ8A 3FXQA 5CVRA 5E1ZB 4ENKA 2EFOA 3ZN1A 4QFPA 1X1AA 2JA5J 2QBYA 2HEUA 2IBDA 3CCQI 1MQJA 3SZTA 1JJ6C 4H1XA 1FIPA 1MQGA 2A69F 3OMYA 3ILTB 3FX3A 3QAXA 2DTRA 3UIFA 3QSLA 4V2FA 4PTKA 1B4HA 3O3KA 2M45A 4FE7A 5FGMA 2E36A 1J5YA 4LZ7A 4AS5A 5KDTA 2HZDA 2OJED 2KP6A 3VODA 2XD3A 4P1EA 4R6HA 2XXIA 2R0QC 3WTUC 1Y1WJ 1IRFA 3OWTA 5BWJA 1SW4A 3FF5A 2GOXB 2Z3YA 4FASD 2R7ZJ 5DUKA 2HTJA 3N05A 2PX9A 3TQNA 2KPMA 3I55I 3GTOJ 4IOCF 5D6FA 4RXLA 1P1NA 4BDMA 4JXIA 2ZYOA 4WEPA 1GUUA 4DZPA 3GZ5A 4PF8A 4C1TA 3A0BC 2EK5A 1MBFA 1VQ7I 3E1SA 4I7HA 2AXTC 4QLCU 1JEUA 1SAXA 2CZIA 5HM4B 3R0AA 2G9WA 1XS5A 3M8UA 3TQWA 5DT6A 4CZCA 4ZEKA 4EXLA 4LZ8A 2K5CA 4BHBA 1PP7U 2VHAA 3G3FA 4YICA 3KEYA 1NL5A 4RK9A 4IGRA 2H1LA 2ZJQF 3ECOA 1K6OA 3DTIA 5H6QA 3MWBA 2HZKA 4JK1X 1T0KA 2X0LA 2B9SA 1GHCA 4PCDA 1ZMGA 2TRTA 5M5XJ 2JMWA 4Y17A 2P7VB 3CG3A 4F1YA 3EETA 1PYVA 2W24A 2YS9A 2I6EA 1TWFJ 3F8NA 1SANA 1X4PA 4OMYA 1YXIA 1GLNA 2NOJB 4BNCA 4EF2A 3VLVA 2IRFG 3IUOA 3PIPF 4PJMA 1FWZA 2V93A 3BC8A 4RBOA 3OYEA 4ISUA 1U2WA 5IY5H 1P1QA 2X85A 4MTDA 4YELA 1TT1A 4HSRA 4RGUA 2XSDC 4PE5B 3T9VA 4ZECA 4BKXA 1O3QA 3HXLA 1JGSA 4KISA 1OCOH 1G0IA 4NBQA 1QGXA 4NHBA 4ZYHA 4EXKA 4FQGA 5I56B 3DU6A 1JKRC 3N6UA 2OD5A 2OJTA 1GTKA 3PUVE 3RDIA 3H5RA 5HVQC 3TCFA 5I2KB 4I9DA 3MQ9A 4Q30B 2V9PA 2I0CA 2PMSA 3FM5A 4R74A 1Q35A 1ONVA 4WK8F 1WKMA 3B7DA 3KX2A 1A31A 1MXYA 4HG2A 1NHAA 2ZXWH 3CMMA 3DV8A 4CCOA 5BMZA 2OA4A 4M3FA 1B7ZA 1WWXA 3GCMA 4P55A 5DS9A 5EF6A 5H8QB 1G4DA 4GCVA 1N7XA 1MD0A 1S29A 2NWJA 3ECHA 4F7ZA 1I6QA 1J09A 2EFWA 4FECA 5IOYA 5A2QK 3CESA 4EMSA 2OLBA 1XS9A 2HFBA 3MZ1A 3HHHA 1GVCA 3ABKH 3HRMA 1LDJA 2I8DA 3T5XA 3K0VA 3ONQA 4NF6B 1BW5A 4GRKA 3KEOA 2QPQA 2Q2AA 4BDQA 4QF9A 2OV7A 3CIJA 4P9KA 3HN0A 2VN2A 2R7DA 1LB8A 3GBGA 2XHDA 2JA7J 4XXUA 3JTGA 4K3FA 2AHQA 2KJCA 2CUEA 1UG0A 3SESA 4OINF 2CGPA 2PJRA 4DZJA 2EA4A 1FOXA 5DM6F 3EN3A 1MZBA 1NH8A 3TL4X 1HDDC 3M1EA 2GHAA 2FIXA 1HXDA 2Q0OA 1J9IA 1YZ0A 5CMBA 4EM0B 3FVGA 3V7SA 2VJIA 3QU6A 4GXSB 1WGXA 2Z5UA 3K4JA 2DK5A 2HAUA 1WFXA 2FBPA 5I2NA 3W6JB 1YLFA 2MC3A 2FBIA 3DP6A 5HPQA 3UKGA 4U23A 3DKWA 1HSJA 1QZEA 2GH9A 3HSEA 1MH4A 3WG7H 1Y9UA 1N77A 4QHQA 1P4WA 1KQ0A 5GTHC 2V4CA 2RREA 3B02A 3CCYA 2I3VA 1NFTA 3RKXA 1F9BA 3K4MA 5EZGA 3WU2C 4IB2A 4LP2B 1OQYA 4UUSB 2P0WA 1SW5A 4WCGA 3LUYA 3W3CA 2OCCH 2RF1A 2A05A 3O6GA 5KAIC 2ID3A 2XX8A 1IITA 3NOHA 1B3HA 4PCQA 2Q74A 2XXHA 4CXFA 3IL1B 3UN6A 3CF5F 4XKVA 2Y0SN 5AIQA 2IA2A 5J6XA 3M3YJ 1MQDA 1MY1A 2XRNA 4LG0A 2QBYB 4H46A 3TEDA 5HBCA 2XXTA 1FNNA 2P6SA 4JX4A 4YIRX 3BIHA 4FBPA 4PGNA 3CDHA 3EHSA 4GDFA 3BIGA 4JX6A 3L09A 3VFZA 3RLFE 5DD8A 1Y1VJ 1XMXA 5HODA 1ZR4A 2EIMH 2R7QA 4GWYA 4IR8A 1MJAA 1YRNA 2CMPA 2F5DA 3EQ1A 5KDTB 2E1NA 5GPCA 3JRGA 1RIOH 1Y1ZA 3GYHX 5CBRA 4UVCA 2OZUA 1BK4A 5T3JA 1G8XA 1Q1VA 2DYRH 4LG3A 1URDA 1TWCJ 4P47A 2OC6A 2EINH 2QA4I 2FQ3A 4PC9A 3OO9A 5L8DA 3M4OJ 1MG1A 3AKZA 3BR0A 2ID6A 2H09A 3AG2H 2DMNA 1MXZA 1QJMA 3MUQA 3T1BA 4Q4ZF 4L18B 3RTWB 4X0GA 1DPRA 3EUAA 3RQIA 4DYCA 3JV9A 1B1HA 2RKHA 2NNNA 1T0FA 4HAMA 5D4SA 2R8TA 1R9LA 3G71I 1Z7ME 4OENA 1IIWA 3BR2A 1HLVA 2V26A 2QSGX 5B1BH 2JVGA 1ZGAA 3GFMA 2WEFA 3IH2A 4Z6YA 1FTTA 2EILH 1UB9A 4PSWA 1LUJB 1POGA 1TFDA 4OTEA 1TP4A 2ICWG 3HC7A 3OR2C 5CVJA 1KU7A 5E18F 2ECCA 2X1EA 1RR7A 5C4JJ 4OERA 4DIGA 4NUBA 2AYSA 1EKEA 5E3NA 1VQLI 2Z16A 2QKLB 1H8AC 2YLNA 2KZGA 2L0KA 2CMOA 5H8HA 3LAPA 3LSPA 3HOXJ 4IQJA 2L01A 2XXQA 1HOMA 3I4NJ 5CMCA 5EZHA 4HQEA 3U94A 2RCAA 3QAHA 2QRYA 1GR2A 2W84A 2XRLA 4Y15A 5EDNA 4YG2F 2V1UA 3HOWJ 1SDXA 2XROA 1VFDA 4GWOA 2FBHA 4DDDA 1VQMI 2IS2A 1IRGA 1ZH5A 2DDBA 3IOTA 3BBRA 4EVIA 2XXYA 3VXCA 5HNFA 1VI0A 3THIA 1S72I 3F8CA 4N4UA 2CG4A 1F9NA 1YPNA 5IP6A 4QTRA 3VLWA 4BJ5C 1WODA 1X3ZB 1EU8A 3UGWA 4HE0A 3KJ7A 1BJZA 3VOEA 4P56A 3B6AA 4THIA 3DELB 2LBFB 2DFFA 3NQOA 1TWGJ 5ICCA 4NF5B 3TO6A 3GLLA 4B8XA 4CCKA 3OSFA 1I1SA 2QL3A 4A6DA 4XEQA 3KP4A 4Z0IA 3KFWX 2O61A 1L0OC 5KVRA 4R9GA 5ESYA 4DI4B 4KYEA 1MW7A 4M6XA 1S9TA 3TTRA 3OYNA 3GTLJ 3TAJA 5LHHA 4GF8A 1ULYA 5L3CA 1BC7C 4UNOA 3FGSA 3PPPA 4YB5A 4YKIA 1NV1A 3ONMA 2STTA 2H27A 2QQ9A 4A3KJ 4F22A 2FE3A 3PUWE 5ILVA 2OBPA 4XKPA 4NC7A 1GXQA 1MMAA 1FTMA 1Y3NA 1GV2A 1TZLA 1DBZA 1AA7A 2O8XA 3OYMA 3QU3A 2HPGA 1OVBA 4RAZA 1VE4A 1IMCA 1W36D 3HG9A 2DO7A 5CJ9A 2VQGA 1MKMA 2FNAA 1YTYA 5F7VA 1FQBA 4NC8A 3HIFA 5DV5A 3L1PA 1ETQA 5DEXA 2O1LA 2QVUA 2VQHA 2PJRB 1LKXA 2EZHA 4IRGA 3ML6A 5IPAA 1FYKA 3OO6A 3OOUA 4G68C 2HYJA 4YEJA 4Y13A 2OUMA 1R1TA 1SI0A 5JHFA 2JUGA 1K6YA 4JWOA 5EYGA 3HOSA 4LFUA 4FHTA 1KYZA 1WRJA 1B8IA 5E1WA 3K6GA 5CQEA 4A3JJ 1IMAA 2IGOA 4ITVA 1H43A 1N25A 2E2IJ 2I3WA 3GO5A 1A8FA 4A5MA 1Z05A 5I2NB 5EHSA 1EZPA 3KSJA 2OBGA 2FXAA 2IGMA 5L9MA 4MH5A 1QPMA 3KP7A 4G6TB 2PJPA 2PX1A 4OIOF 1WZ2A 4HXVA 4XM3A 4LMYA 2F7BA 4C2TA 2L54A 2QLZA 1MY4A 3W15C 2YPRA 2R7RA 3I64A 1JETA 3HRTA 3QXMA 2NVYJ 1U9OA 3M07A 3O8HA 2HPIA 5CVIA 5B5EC 5JVTA 2GIVA 5K7HA 3REOA 1G2HA 1DCUA 2LRDA 2HWVA 1WJ5A 3CP8A 3MVPA 4QWQA 4A0ZA 1IN7A 3RI4A 1UELB 3W2VA 2IPQX 2P1SA 1RESA 3E78A 4LJZF 3FXLA 3PD8A 3HOVJ 4LG0B 1H76A 1B9NA 1E0EA 2O7UA 5J1RA 1A99A 1PB7A 5H8NA 3TBIA 4M3GA 1SW1A 4UXNA 3K4BA 1R1NA 4HDVA 4ZJZA 2WB1A 1BI0A 1KYWA 4G68A 4LATA 1KA8A 2LSOA 4Q48A 4U0VA 1R9TJ 1YRNB 1ZK8A 3EUHC 3I53A 2KRHA 5LDZA 3FK6A 4O6JA 3BQYA 5LGTA 3CDLA 3IKTA 3PNVA 1RR8C 3LBSA 2Y84A 4LGWA 1MXXA 4XNFA 3M3KA 3KPHA 3OIOA 3RN8A 4DZ1A 3BR3A 1BN5A 3K9TA 1K9ZA 3Q9VA 3G1LA 3I0TA 4DW6A 4X1BA 3GTPJ 2HQRA 2M9HA 3VDFA 3F72A 2A6HF 4ZTFA 2NXOA 2KL4A 2D1HA 3DFGA 4AYBN 2VKHA 2FF4A 3VB2A 5J47A 4BDZA 4D5FA 1DU0A 1D3KA 2JN6A 4O8MA 1BM9A 1QGPA 1SFUA 1X1PA 4C0RA 2WWYA 1FQEA 3G3ZA 3HRUA 4IRHA 4OQOA 3T8TA 3GXAA 3P7NA 3VSKA 4AIDA 1MNMC 1W0UA 3FXBA 3Q9SA 3M9AA 4AB6A 3IR1A 4BU2A 4ENJA 1SMTA 3KEQA 3OYBA 4XKNA 2CQKA 1RDYA 3S3NA 2E2JJ 4WXDA 2M7BA 5FFZA 1SVOA 4V2GA 2K9SA 1JE8A 4KD5A 1FEXA 1QULA 4FETA 2VP1A 9ANTA 3DBRB 3GWZA 3G2BA 4KI0E 1ETKA 2LKPA 2DWJA 2HKXA 4RM3A 5B66C 2JQ7A 3EUHA 1FBPA 3S1QJ 1EYJA 4DLDA 1P9QC 2XXWA 1OQGA 5AIPA 1KWHA 4F18A 3RPUA 2LNBA 1OCRH 2G7UA 2R92J 4IO3A 1XI6A 2XPVA 2ZXIA 2O68A 4FAJA 3PUBA 2IGKA 2XWOA 3D1NI 4BDOA 5L9SA 5C4XJ 1WJEA 3HOYJ 3HPIA 3MKLA 4N0BA 2E19A 5AA2A 3LSFB 4LK1F 2TCTA 4G4PA 1BJAA 5D8KB 3L9FA 3B6WA 2HVRA 1I6HJ 2FQ4A 3KBRA 3RT6B 4IHYA 4XORA 5K5QA 3HTSB 3LSRA 3CF2A 4RAFA 3BQZA 3GXOA 2UZKA 2DPUA 3FM3A 2F3BA 4BDYA 2ZJPF 1TWAJ 4PGGA 3E3VA 3K7AJ 4CZZA 2VOZA 5CMKA 4JWXA 2COBA 2KFDA 3MZHA 1II5A 1R22A 1E3PA 3O8GA 5FKOA 4JP0A 1ZG3A 2XAJA 3OYFA 4A2UA 3H9QA 2EFQA 1MJBA 3LFUA 1IAWA 3B6CA 3VSLA 2NRAC 1NV3A 2H98A 4PFBA 1IMEA 4PFTA 4RPNA 1YJ9I 3JAMZ 4BBRJ 2M0CA 5DCFA 3S15J 3QPLA 4Q47A 4GX6A 1JVYA 2GXGA 4HLXA 2VE9A 1SYIA 3M8JA 5K7FA 4FE4A 4GYGA 1IXGA 1QZYA 3USDA 1GVDA 1UHMA 3GEZA 2WV1A 3B6TA 5E3MA 3OL4A 1Z3YA 2KISA 5E1XA 5J3LA 4OEUA 1ZARA 2L2OA 3Q0UA 2M1BA 1B59A 4JVIA 2M30A 1B46A 2RQQA 3CO6C 1B8IB 2A68F 1V55H 2BJJX 1FBHA 1P99A 5GPAA 2CS3A 1QBJA 3TTNA 4BQAA 3BR5A 4B09A 4HF0A 1J75A 3S8PA 5K2XA 3KYLA 3A4CA 3EDPA 4FTHA 4KCCA 4CYCA 5TISC 2F8DA 5LD2C 2NUVA 1FBQA 2O7IA 2RC8A 2Q8JA 3S2VA 3BTIA 3V89B 4EUOA 1RKMA 4NGUA 4DNCA 3K6VA 1T6SA 1RPWA 2UUZA 2W1OA 2OF7A 3ABUA 5CLSA 5KCMA 1N76A 1URSA 1P6RA 1B0HA 1H9GA 1MY3A 2ZMEC 3LSIA 2K3FA 4NF4A 2P6TA 4QSHA 1O3RA 3S1NJ 1X1CA 4AC0A 4IHWA 4KMUX 2Q2CA 4FE8A 2L7ZA 2V84A 1HA8A 5H8FA 5I58A 2AQEA 3CCEI 2PYYA 3WAEA 4F91B 4DOZA 1T08B 4PJ0C 2NAZA 1LE8A 1RYOA 1VQKI 3WGGA 1IXRC 3ZMDA 5B70A 2IVMA 5ET5A 3LL7A 3MKZA 1HKTA 1O63A 3PPNA 1IUFA 4O3CA 4G68B 4N8GA 3ASNH 2D5VA 4U1OA 4EJTA 4E4HA 2EIKH 5M3FJ 3L2QA 1VFCA 1H88C 5A5XB 1ZR2A 1TXFA 3PPQA 2XXKA 3K1NA 1FTZA 3O97A 1JJ8C 2V4JC 3N26A 2HDWA 2K02A 2Y9YA 4RY1A 3TELA 4NMYA 2QGUA 3ZKLA 4KIFA 4KIGA 4RGXA 3TDZC 1O3TA 3MQ0A 1MQHA 2PCRA 5DM7F 5JTYA 3S9EA 2ADUA 2MLGA 4D7MA 2DFHA 2RCBA 4CCLA 1ZIUA 2YPNA 2HXIA 4X8RA 3ZN0A 5ICEA 3R7XA 1K9YA 2ZMEA 1TW2A 2FX0A 2P8TA 5ISUA 2X48A 3FVNA 4ELQA 2EV6A 3JTHA 5EEGA 5L3FA 5DCMA 4I0AA 4OVTA 2EV0A 4GRIA 4EF1A 2RC9A 5GAGJ 2NVUB 1RKTA 2R7UA 2R7VA 3CSBA 3A2KA 2DCEA 4ZYGA 4G12A 3TW7A 3JYRA 3OV8A 1B7UA 2OU2A 5F1RA 5JLWA 4P1LA 1SFXA 1Z6TA 4NHJA 4PFUA 2B7EA 4CCNA 1JHFA 2Y0MA 1ZREA 4Q5SF 4PDKA 2XC7A 2Y7WA 3G3HA 3HDDA 3LMMA 3OYDA 1YW8A 3MZYA 2G29A 4MFIA 1ZHFA 3PGFA 2E1OA 3DKXA 5D5VB 4I99C 1X19A 2UVJA 3FHZA 5HNHA 3LSMA 3G73A 4OFOA 1G3TA 4B3XA 1IJWC 4O94A 4B1RA 2ESNA 1KONA 1IC8A 2LR8A 2UVHA 5FRMA 3VYRB 1ELJA 4GX4A 3MW0A 3IWZA 1HBXG 2ZSHB 4N4NB 3FMSA 5ICGA 1BKAA 2UYFA 4CO8A 2XD2A 5TGTA 4LIVA 2PFYA 1I6XA 5AA2B 4X1DA 4EGZA 3O6IA 4KHZE 1QA6A 3VXBA 4AVPA 3LSGA 2VODA 3O9PA 3KLNA 5BS6A 1KZHA 4E7KA 4ENMA 1UTBB 4X04A 5I58B 1T8IA 1INPA 4D9JA 5IOZA 4IO2A 4ANJA 2PLYA 3JSOA 1B0LA 5HDKA 4XF5A 1A6QA 2FMYA 1MXUA 4A3CJ 1YI2I 2Y69H 1NUZA 4IO6A 4F31B 2XPUA 1MPDA 3K4CA 4ESJA 2VONA 4MEYF 3PSFA 4KT5C 3WE3A 2GM4A 4R8HA 4U1ZA 4E7SA 4HX4A 3IB2A 3UP9A 2UYEA 3WTVC 4JWYA 4ESFA 2FNPA 4IZZA 4RGSA 4RA2A 1J1NA 2PBWA 1WVRA 1MMDA 1FQCA 3E5XA 4HTGA 4C9YA 4MCOA 2DLLA 5I59A 1ITYA 1R58A 3RPQA 1UCRA 1TT5B 4P1WA 3I59A 3HCQA 2O03A 3GFLA 2DS9A 4LONB 4JYKA 3KIOA 4P9FA 2DOJA 1YIOA 2NS8A 3UA8A 3OY9A 3F21A 3S2HJ 1I6AA 4GXAA 3MBPA 5J8FA 2XXXA 2BV6A 4A69C 3VLUA 4IJAA 1LFBA 2QKMB 4AIJA 2X7QA 3CC2I 4E7ZA 1BI3A 1POTA 3V83A 2F7CA 2NNYA 3CC4I 5EYHA 3MSTA 4GGGA 4RS8A 4AVZA 3OYLA 3SEYA 3UR3C 1RKWA 3H6TA 5HLIA 1USSA 1ZJLA 2AO9A 1Z0XA 5K1YA 1K61A 2LD5A 1LBBA 3TGNA 3CMAI 2ZZWA 5ITPA 4NAPA 1DPPA 4HBLA 1LBXA 1XGOA 3DEWA 5ET6A 1MBGA 2W00A 1JKPC 4RNSA 4NF4B 2FA5A 2WBMA 3P7IA 3LQQA 3R6SA 2HYFA 3HOTA 3E0JB 2HOTA 2WYPA 1OVTA 4DYQA 3HJEA 2M2EA 3KSXA 3I71A 4LD5A 1H44A 1H45A 1QUJA 5D5XB 4OIQF 2DJNA 2L4AA 2F34A 4LVQA 2DN0A 4OU0A 2DMPA 4G8HA 4P3LA 5ITOA 2VI6A 1PJRA 2HOAA 2HKOA 5CVVA 5HDGA 1R36A 2W82A 3FXUA 1IO2A 2EIJH 4ETSA 3K00A 1XX5A 4XLNF 5CBSA 3DPUA 1NMUA 3OYHA 1V4RA 2VBWA 2R5ZA 1QVSA 1OIBA 5C3EJ 3FKIJ 3HBLA 4IEJA 3IB0A 2V3QA 4XTCQ 1ETOA 3S2WA 5E8GA 2Q1ZB 3HPGA 3PUFA 1T98A 2DE4A 3DPLC 3HB9A 4W1UA 1T56A 1JQFA 1MXWA 3TOAA 2DSFA 5ET8A 3FXRA 1AOVA 2WC2A 1PC3A 4NN3A 3TCHA 1FP2A 1HSTA 1O7FA 1U9NA 2Z1DA 1IG7A 3IJXB 3GTGJ 4G8NA 3NWSA 3FXJA 3K01A 5JTYB 4O5VA 3P5JA 2OAZA 2BHYA 3BLYA 2ELKA 1AWCA 2QVOA 2IA4A 2V6EA 1XGSA 2O7OA 4JB7A 2ZMEB 3WHBA 2I48A 1WVJA 3KETA 1P2FA 3C7JA 3CCRI 1B52A 4A0XA 5CYVA 1NV0A 2CZLA 3ZQCA 1FBUA 2PFBA 2YSRA 4I0BA 2WV0A 4DYRA 1P1UA 4XR6A 4QFLA 1E17A 1NG7A 2W4SA 1B5IA 3JW4A 2E71A 2HXOA 4A93J 4ELPA 2CV2A 4EJOA 2VJJA 2VASA 4BEHA 1FPIA 4NE4A 4I6ZA 4Q0CA 1Q1HA 2P7CB 2Y5KA 4I09A 3SEUA 2ZYKA 1B9MA 3CR9A 5LOMA 1YJWI 1B05A 2IJLA 3ASOH 1FQFA 2VKDA 4U0WA 1V54H 1QRYA 2REGA 2Z33A 4ASNA 1OCCH 3EPZA 1FOKA 1LCFA 2DW4A 3IL2A 1VFEA 1USYH 5I57A 4KN4X 1JW5A 2Y9ZA 2Y7PA 3A0HC 4NF8A 2Z8FA 4R79A 3HTUA 1Y20A 4RM2A 3WU0A 1B3EA 4PGPA 3O2AA 2VBZA 4DIQA 2GA2A 4UABA 1FOYA 2UV1A 3HRSA 3E6DA 4KFQA 2IP2A 1ETVA 1CB6A 3BP8A 1WJAA 1FBSA 4XKCA 5E3OA 1KZ8A 2WAFA 1RUNA 2DA7A 1O7LA 3F6OA 3SETA 1A36A 3IP4B 5FKMA 2COMA 1H9TA 1HKQA 4J01A 5A5XA 2E5NA 4PZJA 3JAMK 3ERMA 2R93J 4P8BA 1B6AA 3FMRA 4PFWA 3L6GA 3VDXA 1OJLA 3QYTA 1Z67A 4KUMA 4BACA 3U21A 1XG1A 3PM1A 4OWDA 1S7AA 1FBCA 1L5TA 4DE8A 2ZJ2A 3BJAA 2VOOA 1WPKA 2MABA 1GV5A 2DOFA 3MEXA 4RDUA 1A8EA 5D4RA 5H6RA 3CCUI 4M3DA 4O3AA 4MTEA 4HEA2 5FD6A 2M0MA 1Y3PA 4IX7A 4Y3OA 4IQ4A 1PUFA 1HCRA 1YQAA 3FXOA 1HC8A 4HLYA 4B48A 4MEXF 3H3GA 2M8GX 3ZS6A 3GFJA 5KCJA 2YJPA 3MN2A 5DVIA 5CI5A 1LFHA 3QK6A 1V5EA 1OCTC 4YAHX 1BA5A 1DPEA 3KYDB 2FSWA 1IDZA 4QBAA 1XVXA 5I59B 1UHWA 5E17F 1XT8A 4PJNA 3TP3A 3SEQA 3ABTA 4KYWA 3TTMA 3I59B 4ECFA 1ERDA 1SVXB 4OXVA 3ZQGA 5DVFA 1CNQA 5EG0A 1AHDP 2BW3B 2DXIA 1C0WA 4OIPF 1FPLA 3I9V2 4HRIA 1YCJA 4LUBA 3SDGA 3HFUA 1Z77A 4PSXA 3MPLA 5FB2A 3J81Z 1IRZA 1DU6A 4I98B 1IDYA 1PBPA 1ZKBA 3ELKA 3KGCA 3LSTA 3ZQHA 2O9LA 4U0YA 4G61A 4I2OA 4LB6B 1DUXC 4HCWA 2OQGA 2WADA 2XXPA 5KAFC 2DQLA 3MYUA 4IHVA 2KQRA 1NV2A 1K79A 3G3JA 5L3DA 1UJ8A 4LN5A 4FEBA 4A3GJ 3ZKKA 3CMYA 1Z91A 2KKOA 5ERIA 3HOZJ 4BGDA 1VQ4I 4UV9A 2VGQA 3CFXA 4H8JA 3BJOA 2CH0A 3H4ZA 3MP8A 2GIZA 5DD4A 1LFIA 4XKQA 1MDP1 3EKIA 1DPUA 5L3BA 1AU7A 1XC5A 2W57A 3KG2A 1Y56A 3P9CA 4OVSA 2DOAA 3F23A 4E7HA 2AL5A 4MHFA 2OWZA 2ABHA 4BDRA 3QYFA 3Q29A 1NG6A 1I1GA 2XKOA 5KK1A 4MBPA 4OANA 1H89C 4ESBA 2HQAA 3AG3H 4XQFA 4BE0A 3FVOA 2FYIA 2R5ZB 2H8RA 2IEKA 5LRRA 4A3IJ 4MAGA 4IXAA 1Z3XA 1KU2A 1IN5A 2JA6J 1SD7A 2FMLA 2PMZN 2XB0X 3QRFF 3ZP5A 1WHUA 2BY3A 2CEXA 3H0GJ 4NQWA 4C2UA 4G8MA 3RPLA 4P9UA 1TWHJ 1MM7A 2RC7A 3PMWA 5DUIA 5ILUA 4HE2A 4PF6A 4MNPA 4MLVA 2AQFA 2E1MC 2DMTA 2OCEA 1ZTRA 2F5EA 3BZCA 1QQIA 4ONYA 5JI6A 4JX5A 1LFGA 1M5BA 2DE2A 4XOTA 1ZELA 5F1JA 1CF7A 3D5RC 5EEHA 1E3OC 1FTKA 1Y0UA 2FU4A 2XAQA 4ZS9A 4EQ7A 2MG4A 4I01A 4H6DA 2OZZA 1N3XA 2VQLA 5J8CA 4XN3A 4KDPA 3ZMTA 3ULQB 4A3BJ 2LLKA 5F0CA 1R6ZA 4ZDOA 1UMQA 4R9FA 4DCYA 4YFNF 4E0WA 4C2MJ 3IFCA 3CJNA 2JUCA 2LY1A 3RYRA 5JLXA 2KLOA 4N17A 1W5TA 2CQXA 2VT2A 1Y4CA 2OTJI 2EB7A 1OYIA 4XLAA 4BEHB 3RCOA 3IV5A 3QPHA 2VJ4A 3W2WA 4ELRA 5FRNA 3IK6B 1UG2A 4RA1A 2V79A 1SVLA 1BI1A 1LSTA 5FLVA 4IGTA 2GRVA 3IO6A 1Y8RB 3GZNB 1A5JA 3O2PE 1YS6A 3P9KA 1MXVA 3DCFA 1Y8QB 3QYEA 1IEJA 3CUQC 1NNKA 1EH7A 4I1DA 4P0GA 5I57B 3OMBA 4HX8A 1JT6A 2DAOA 2J5OA 1Y39A 2GQ1A 4NF8B 1YS7A 2QUFA 5I7IA 2R5YA 2ZXTA 2CUJA 2ZXHA 3E13X 4N13A 3KOTA 1Z6RA 4U7BA 4KXPA 3ZQQA 3RKQA 1JEVA 1TQMA 1IN8A 2OZ6A 2DE3A 1A6IA 2BYVE 1JTXA 4IHSA 2FEZA 1UHSA 1FPFA 2KHMA 4G6QA 3CTAA 1YW9A 1W5SA 1HW5A 1S7OA 2XSJC 4M3BA 2ZYNA 3O29A 4LA9A 4P0IA 4PBHA 4PFYA 3WTTC 4OFLA 1EA3A 1P4AA 1VQNI 4ZEFA 4E7JA 1YE9A 4M1VA 1BIAA 2KMUA 4OMZA 2K9QA 4R6YA 4CSWA 4C3JJ 2EV5A 2X1DA 3K1MA 3PIOF 2O69A 1I3AA 2H6BA 4II2A 4NC6A 2HFHA 3K70C 3H5AA 5AA1A 3ZR8X 3C18A 4AIKA 2E1CA 4UUTA 1LBWA 3EUKL 2QJEA 5FHOA 2EA2A 2XAGA 4DBRA 4BXUA 5FTIA 5FFXA 1JW4A 3N5LA 3SEVA 4BDLA 1PUFB 4OMBA 4Z2YA 4CCJA 1U8BA 3VV5A 1MSFC 3CO7C 1IXIA 4FEDA 3FIRA 4TLMB 4M6VA 2F97A 3S32A 4EJVA 4POXA 1QW0A 3E9XA 3KC0A 3OSGA 4KYDA 3CUQA 3BKIB 1O57A 1M1EB 1R00A 2M3AA 4G7ZF 1W4MA 3T96B 2XAUA 2F48A 5EG0B 2O5RA 1ZTYA 4ZYAA 4NB5A 3A29A 2YUSA 1MDQA 2ACJA 3WU1B 5E79C 4RB2C 1VTNC 2BE5F 2ALUA 3Q3SA 4H8IA 3GTQJ 2E1SA 1SPIA 2H94A 2H6CA 3DP8A 3WHCA 3ZQ7A 4GL0A 3W9WA 4DXUA 5M3MJ 5A5LA 1K83J 2DA5A 4J19A 1RUOA 2R7XA 3HHFA 4I8CA 4OETA 4U4XA 4P5OA 1JUPA 1MJ9A 2LMDA 3FWEA 2QENA 4BE1A 1X1DA 4POWA 3U65A 5ICTA 4GWUA 4U4SA 5FKKA 2A5WA 3AG1H 2ONKE 3LC8A 4I3EA 4BXFA 2JZYA 3BTJA 5JVGF 2L4MA 1ZKGA 3HUGA 4NNJA 3TOBA 3PV0E 3NRVA 2HAVA 2HPMA 4R75A 4WXJA 1UIUA 4K2EA 3IOUA 2TDXA 4OWRB 3LSKA 2GAUA 1SD5A 4FATA 2GXBA 3CP2A 3RKYA 3KP5A 5TPAA 2VD3A 4LQ5A 4ZEIA 3LAJA 4LLLA 3TYHA 1SD4A 3D5LA 2MH2A 4BY7J 2VC1A 5DDGA 2GA1A 4O7MA 1AMFA 2AS5F 3ZQLA 1IQ7A 1MBEA 1QHHD 2FIEA 2I49A 5ICQA 5AA4A 1B72A 3X2QH 4I76A 4O3MA 4MFDA 4H67A 4YU0A 1B40A 4BY1J 1HSLA 3H5NA 3QPSA 3GLXA 2L9VA 2QM3A 1U0JA 3LWFA 3V8KA 1BW6A 1DP7P 1VQ8I 3TFLA 5BQTA 2WKYA 3IOWA 4IHXA 5ELVA 1A35A 5J1UA 1FQDA 2F36A 5TU0A 2R3SA 2HVSA 1K78A 2HXRA 1B4AA 2D45A 3OR1C 1JKOC 4G77A 2XPWA 3BG3A 4NQWB 1B51A 4M71A 1ZLQA 1ENHA 1B3GA 4JOMA 3RPLB 4PJLA 5F04A 4B4CA 4IO7A 1SBPA 1XVYA 3MC2A 4TOZA 1U5TC 2DI3A 4RPOA 4WX9A 2CRGA 2PI0A 2KIQA 4HX7A 3HKZA 4F3GA 3OYCA 3F0CA 2Y5LA 3H35A 5E20A 1IGNA 3IC7A 1SD6A 4PFPA 2K9LA 2KIMA 1OLCA 2IAIA 3QP5A 3E7LA 4F93B 1LB9A 4I62A 5EQ8A 1SD3A 3SEWA 4XRSA 3KZIC 2R7TA 4L0ZB 1O64A 4GD5A 1A04A 1I27A 1FSAA 5H8HB 3FJMA 2Z8EA 4F19A 2LDUA 4X1EA 1FYLA 2GHBA 3SERA 2EPFA 5EGOA 2NVQJ 2XX7A 2YU3A 1QVTA 4JVCA 1B5HA 3WG9A 3K69A 3HZJA 3CSGA 2DWHA 2ZYMA 3FATA 4XKBA 3V4GA 1ANFA 4U2RA 3L2UA 2ZSIB 2ZXJA 4YFKF 3OD7A 4XSXF 3C1DA 4PE3A 1FPBA 3RGYA 2DWIA 2YX7A 1D0XA 2XGCA 3T8RA 1U3EM 4R2BA 3CLQA 2K4BA 2VPLA 2REJA 3CFZA 2XF6A 1K4TA 3D1RA 3TKDA 1TWYA 3KP3A 3D4CA 4BE2A 2UVGA 1TNSA 3CRBA 5J16A 2RDPA 4PAIA 3FBPA 2BVLA 3I4PA 4UY8I 3KOSA 1ZU0A 1LQ1A 2R5YB 5M2VA 3LFKA 4IF4A 1FCKA 4G9YA 5I5PA 3LSJA 4AIHA 2VC0A 5JHUA 3E5UA 1XGMA 4RJZA 4EJWA 5C44J 2NOGA 2KQZA 1OQHA 4YRVA 1R4NB 4A6EA 1MBHA 4XICA 2HDCA 3HOUJ 1B3FA 4KR5A 1H0MA 1S5LC 4D5CA 4IVNA 2AL4A 4ON0A 1FIAA 3OYJA 4F29A 5IGAA 3L2VA 4B44A 2A5TA 3JREA 1T39A 4C1UA 2W7YA 2VJ5A 3K02A 4BH9A 2YU9J 3N4MA 2MA3A 3OIPA 4H0EA 3EYIA 4LLGF 4XFEA 3SDBA 3K4NA 1NNPA 4GFRA 4I40A 1JUSA 2YX4A 5IM2A 2I5UA 4KITB 5DEXB 4KMFA 2DP8A 4H0WA 4WXCA 2L9RA 3FBNB 3J81K 2G7HA 5B7DA 2Y48A 3SQNA 1WSUA 2A5SA 3E4RA 5BOXA 1PBQA 4IOAF 2D21A 1V3FA 2P0SA 4R72A 1YYVA 3BDDA 5DW8A 1QNTA 1XMKA 4N8YA 1L3LA 4LK0F 4MLOA 2R7OA 3HYIA 1WJBA 3TO9A 1OYWA 3CUQB 1YHQI 3WAFA 1O3SA 3K2AA 4L5EA 1DDNA 1MRPA 4GWXA 1TT0A 3EQLF 1RI7A 3C2HA 1DTGA 1MNDA 3DBLB 5A2QZ 5CM6A 5B3SH 3H9GA 5LEJA 3BFTA 1ZYRF 4X48A 1YG2A 4G8XA 1F5TA 1G6NA 3JRIA 1XDUA 4ZDPA 3OELA 3I58A 3GBBA 3PD9A 1LFPA 2BXZA 2IW5A 3FBIB 2JPBA 2DT6A 2HQ0A 4N6PA 4PAKA 2Q88A 3NARA 3HPHA 4F55A 3JCUC 3KP2A 1B3LA 4ABZA 2DVCA 2KLFA 3EHTA 4XKWA 5F0FA 2DQRA 5F64A 4RYAA 1B2HA 1PUEE 1YTVA 2L5QA 1IN4A 4Q5TA 3RQTA 1NTCA 5JFRA 3FXMA 1D1AA 2MD0A 3R4KA 3U1DA 4N91A 2G93A 1LBVA 3HUGB 4KQPA 4D1QA 4HA8A 3KFMA 1WJCA 3H9JA 2BZTA 2Y7KA 5H8NB 4QSDA 2MLKA 2G0EA 4C3IJ 4G2ZA 3SEXA 3GBAA 5TPAB 2D1VA 2WB1N 2V1DA 5ICFA 3GW2A 3GLBA 3OO8A 3PO3J 4RLFA 3T0JA 1J7KA 3V8JA 5HLTA 4EQ9A 3I3VA 4H65A 1A7LA 3CD6I 5LFAA 3TUSA 3GTJJ 1B72B 3J7YJ 2LAOA 4ZC3A 1BP5A 2XXUA 3G3KA 3F9KA 2V7FA 3A3CA 2CW0F 2CUZA 3MAJA 4N9IA 5EYFA 4A12A 3PFYA 2IA1A 1V5FA 3H0DA 2O6GE 1PVEA 2DA2A 3AL0C 3SYTA 1I69A 4XMYA 1B7HA 1OCPA 3AAFA 3M7GA 2WY8Q 4M6YA 2QCOA 4A3FJ 4JBZA 4ND9A 3TCGA 3RPUD 5AA3A 1IUYA 1EZ9A 1K78B 5F27A 2HDDA 1NNFA 2RVCA 2CV1A 2VXZA 5LGNA 1DGRM 2EZIA 4XLPF 5FLXZ 1J59A 3GZ6A 1FSHA 3SEZA 3CVGA 1R5ID 2DYSH 4KN7X 1QPIA 2HZTA 4BHPA 3JR9A 2BXYA 2A6EF 3BOQA 3LA3A 4IRIA 4OHNA 2XGDA 2E5ZA 3PL8A 2WX9A 3EHUA 4JVDA 2JTVA 1Y4TA 4RMNA 1LFUP 1ON1A 4X6AJ 1JW1A 3G1OA 3CUOA 2MKZA 2X26A 4CHUA 4U88A 4UVBA 5BPIA 4S05A 1NUWA 1FBFA 4M73A 2QQ8A 3I5OA 3TEPA 4HZFA 1ORKA 1KA1A 4HQMA 2QS3A 3U92A 5LRSA 4JSOA 4GYIA 1TQPA 1E3HA 4H5FA 3DF8A 2ME0A 5D8LB 2CZKA 2KJBA 2LF8A 4CICA 5EGOB 2D5WA 1KQ9A 2LH9A 3KZZA 4M3EA 2HCAA 3A09A 4LIUA 2K9MA 3MJNA 4U22A 1HW1A 4F2QA 2F5CA 4R73A 1X2NA 4XK4A 4GBWA 4ZDLA 3CFLA 3VYUB 4EEFG 4E70A 2ZNZA 2RN7A 5GP9A 2QF7A 1GV8A 4F39A 3H1CA 5H2FC 4YFXF 5IKBA 4IO9F 5IT9Z 4RAGA 4DCXA 4YIIA 3VE1B 3S4UA 4UHTA 1DP3A 3BG7A 1A40A 3JRFA 2VT5A 2A07F 2BY0A 3CHGA 2LFBA 2V3UA 3SKPA 3IAZA 4F2OA 1OMIA 2B65A 5J40A 4WF2A 5EYRA 5TRDA 3Q25A 3VYSB 4YB7A 2Q2EA 2QWWA 5M5YJ 1WH7A 2DA4A 3RTRA 2V6CA 1GVJA 2DVZA 3I4MJ 4EM2A 2DU9A 2VXDA 3K4KA 2E60A 3FISA 5JR3A 1MPBA 4JBAA 3TP0A 1XCVA 3C2BA 4XOPA 2CO5A 2KIFA 2GLOA 4H45A 1FPEA 2ZMBA 2A5TB 1W1WE 2B0LA 1HKSA 2Z99A 3PFIA 3H6WA 2H99A 3CMEI 2DDKA 2PMHA 4Z7EA 4L9NA 3OS1A 4N15A 3J7AY 3C35A 4YIFA 1ZRFA 4NF0A 5BNGA 2NVTJ 1SQYA 4ESWA 1SAUA 3MCZA 5JEIA 3JRCA 3HHGA 1D9VA 3KBZA 4RK2A 3MWMA 1Z7LA 2QYOA 2X6XA 2IS1A 4NF6A 4AUXA 4B3AA 4R2FA 3E5QA 5ET7A 2JK3A 2QQBA 1ZGWA 3MVZA 4F3SA 1FYMA 2RQPA 3RSNA 4HNVA 5HS8A 3H3UA 1IXHA 3PPOA 2ZFWA 4PETA 4EJUA 2Y31A 3LA7A 4PGHA 1XGNA 5J4VA 4U7DA 3RZOJ 4HS7A 4OZ9A 2L7KA 4YKKA 3ZSFA 2IS4A 1FY7A 2V25A 1NH3A 3MVYA 1IRXA 2WY7Q 4DQ2A 3L2CA 3D4GA 4UUVA 2I10A 2JRTA 2QQAA 2ME6A 4XSZF 3WODF 2FJ1A 4CYCB 4HF1A 4N81A 3IHUA 5ILSA 1F36A 2XGXA 3QUFA 3IAS2 3K6XA 2XASA 1G0HA 2PG4A 2DTZA 4MNIA 4B43A 1FX7A 3ZMUA 1T2KA 5TJJA 3FASA 3VYTB 3CCVI 1NV5A 3U8QA 2L9SA 4EDPA 1SYHA 4Q8RA 4ZZDA 2MC4A 1R71A 5LBQA 1DOTA 4U21A 1U78A 2PT1A 3KN3A 4YMAA 2A61A 3ZMVA 1IN6A 2XF5A 2DT7B 1N0TA 3OSQA 4NTLA 2PN6A 2BY1A 2NXNB 2Z2SB 3JRAA 2QS2A 2K85A 5H8FB 5FD5A 2EJRA 3GMEA 3ILUB 3IJOB 2OPTA 1ZN2A 1W5CC 3IWFA 4R6KA 1LE8B 3HO7A 3CCMI 3OYAA 1KU9A 3N97A 5D5UB 1S7EA 4PBQA 4BJ6C 5LGUA 1IUDA 5KZTA 4CDGA 5HDNA 1NH7A 4GO1A 1D1CA 3RIRA 4ZE8A 3FIWA 2RKMA 2VPRA 3M8EA 1EH6A 4MHGA 4PK4A 2VQCA 2DK8A 4H4KC 2Y0SA 5LHGA 3OENA 2FOWA 3QOEA 2H4IA 1XSXA 1JHHA 4WWCA 3CJQB 2JT1A 1X1BA 4RAYA 5D6EA 1FT9A 3S9NC 3SHFA 1X3WB 3PNTA 1TFAA 4E0XA 2X6WA 5E3LA 2EWNA 1FTAA 3F3XA 4BLAA 3TDJA 2R9JA 4AM3A 2BEOA 2V3TA 5LHIA 3ROUA 1K4SA 1S9HA 2LY9A 2AXLA 3RNNA 2IGNA 3HM5A 1JT0A 3L2WA 1YOVB 1A55A 1D4NA 3QODA 3AFHA 1P1OA 2UVIA 2A3SA 2Z9OA 2MYSA 5F08A 2R7SA 1ZG5A 3S1RJ 3TODA 4XL9A 5J4YA 5DCMB 3R60A 1NUYA 2ZZXA 5HOOA 1FJ6A 2LVSA 4M74A 2VLAA 2E7XA 4G6DA 2PMZA 1MDMA 2DPDA 1G3YA 1FRPA 3LUZA 4D0PA 3DBHB 1FMVA 3MP1A 3G1MA 4F3QA 3I5UA 1PEBA 1SFEA 1B1BA 2MSYA 2PBIA 1FJLA 4KPTA 4TLLB 4LZ5A 2OQRA 3MZBA 4MIJA 5L9OA 1ATGA 2Y2ZA 2JVHA 1LDDA 4BQNA 3PPRA 3PUZE 4O7IA 3PU5A 3KCCA 3Q26A 3M8FA 3FDYA 4RLQA 1HF0A 2B63J 2NYXA 3UORA 3H06B 5DTDA 3PJRA 1QUIA 2R71A 3A01A 3ZQIA 2NS0A 1KU3A 3G4SI 3TQLA 4C30A 1SC7A 4M9ZA 4JQFA 3BR1A 2LY2A 2VL8A 3Q0VA 1RDXA 4AB5A 2LC2A 3AL0B 3FXKA 1R49A 3H03A 2DODA 3HL2A 4KYSA 4IY5A 4XLHA 2KIUA 1NV6A 1IMFA 4KCDA 1YITI 2DA3A 1FLIA 2ONRA 4DXBA 2CYYA 3ABLH 2B4MA 4XIDA 2VBXA 3J7AO 3WTZA 2ISZA 2Q89A 5CC2A 3LV0A 4OVRA 2QSXA 3MFKA 3BT9A 4HCYA 5I84A 4FX0A 2R4GA 1VDWA 3R6UA 2ZBKA 2Q2EB 3J7ZI 2EZKA 1P92A 4XONA 3BZ6A 2F5VA 1LVAA 3V7RA 4FX4A 4OAYA 2QSFX 1LB2A 1QU3A 1LBZA 1NUXA 3J80Z 3I3LA 3TZAA 1ON2A 3QOPA 2LBFA 1ZLKA 4NWCA 4ELOA 5CVUA 5IT3A 4NF5A 1XHYA 4S0HB 5HS9A 3IKVA 3LQRA 4PP0A 5EHMA 4DXCA 2VPOA 2X51A 2P81A 3S1MJ 3RYPA 2WAQN 3FV2A 4HW0A 4CGZA 4NEDA 3ZMSA 2X7PA 3N94A 1XTAA 2STWA 1R1UA 1EYKA 3F8BA 1B58A 5FHNA 4PAFA 1E2XA 1ZLJA 2ZNYA 2CQQA 4UACA 4XRMA 4N6DA 5GTIC 1W0TA 4XN0A 1W36C 4AD9A 1P4XA 2VT3A 3AG4H 4E7IA 4GOTA 3PQKA 1FBDA 1RNLA 3FHNA 2MD5A 3GTKJ 1TTYA 4XRFA 5F6FA 2F5XA 2ETHA 4HPQA 1JGGA 3ZMZA 2FNCA 2KR0A 5IYDJ 2CW7A 2PMUA 2HHMA 1FPJA 3C9HA 3S9LC 2X6YA 1DMBA 4JSDA 3V8XB 3BROA 3OOPA 3H7MA 2DMUA 2DDAA 1UZCA 2K9NA 4QXDA 1LEBA 3IH4A 5GAHJ 3DWLE 1N04A 2XF7A 3CZ6A 4WEDA 2FBKA 3MVXA 2K3PA 2FD5A 5GADJ 2M34A 4MNCA 1UIVA 1X4OA 5EJCA 6PAXA 4IO4A 2FUG2 3Q28A 3GVAA 2D3IA 3WTWC 1WH5A 1LAHE 1QKBA 3CI8A 4QFKA 1FOWA 1HQCA 4QPQA 3N6TA 2XGEA 3ZQFA 4NQ8A 3OXNA 4XRSG 3CCLI 3ODBA 2D2WA 4F92B 1T0FC 4ZZEA 1JKQC 2A6TA 1N3WA 3ECRA 1X2MA 4NDLA 3BTLA 5TP9A 2CSOA 1WJFA 2OWSA 1D8KA 1ZRDA 3KYCB 2MFZA 2BOLA 2UXAA 3OIQA 4Y7NJ 3MP6A 1T33A 4Y33A 2HEOA 1M5DA 3C2GA 1APLC 4MX6A 2HVQA 4LITA 5FLXK 4PUSA 1DSNA 3RJPA 1WDNA 2DMQA 2XAFA 3BZKA 1USYE 1MBJA 4EATA 2DT5A 2I58A 1OMPA 2JA8J 4MLQA 3NEUA 4CH7A 1NKXA 3UK4A 2EBIA 1EJ9A 2P4WA 3PQJA 5H20A 2VE8A 1OYYA 2Y30A 4A3LJ 1I6BA 1MY0A 1URGA 1AKHA 3A02A 3EYYA 3B73A 3LSLA 3K2ZA 5IZ3A 3RUMA 3S9MC 2FOKA 4BS9A 4PFOA 4RGRA 1SFOJ 2ANJA 3KZYA 3MMYB 2OX3A 3CJTB 3W9VA 1ZG1A 2GZWA 2L9NA 2V1NA 2VBYA 1VF9A 2JPCA 3F11A 2E2HJ 4QRZA 2EZLA 4ZEBA 2VKEA 2X6OA 2J5PA 3BWGA 4YZZA 1I3QJ 3T9XB 3E6BA 4XLFA 3RYDA 4AWXB 4X9TA 4HV5A 3U1OA 1HSEA 3KE2A 4KFCA 1PDAA 1M5EA 1MDMB 2XWIA 5L3EA 3BTCA 1R5HA 4AYBA 2O84X 2VD2A 4ZE9A 3DQVC 3Q5FA 4GLIA 5IZZA 3VPRA 3LNQA 5IT9K 4M72A 1MPCA 4OESA 3OYKA 1LDKB 5ED4A 2ECBA 1FJ9A 4OFJA 2ESHA 3H6VA 1FBGA 4YKJA 2XWKA 3GYYA 1LNWA 4KA4A 2E7WA 3EPEA 1AWBA 2K86A 3MKWB 1SW2A 2VOPA 3ZPLA 1YFHA 2BBYA 3A01B 2LKXA 2RINA 5GAEJ 2HZLA 3KJTA 3IB1A 3LSWA 2CUFA 4AS4A 1BR1A 5HLHA 3B50A 1IV6A 4N6KA 3BG5A 2CJJA 2B4LA 1F1ZA 4O3BA 4L9JA 2XXRA 3VVFA 1VNDA 1GDTA 2W25A 3K4LA 4MF3A 2QFLA 1CGPA 2DWAA 3SXYA 1SVMA 1OISA 3LOCA 2HOEA 1B6HA 2OWTA 2BVMA 3WTXC 1NK3P 1Q9DA 4GL8A 1P7IA 3ERED 1YO5C 2WBBA