3K1MA

Crystal structure of full-length benm, r156h mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
300
structure length
300
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
total genus 96
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA03
1Z9CA 5FGMA 1J59A 1BI2A 1R6ZA 2V84A 1NKXA 3DP7A 2RCBA 1FBQA 1EH8A 4LZ5A 1W4MA 4HV5A 3EYYA 2DO7A 1MPDA 2XX9A 5DVFA 1MG1A 4Y13A 3DEUA 5LEJA 3FJ7A 1XSXA 1SFUA 1ZG1A 4F2OA 4DQ2A 1QUIA 2DT5A 3Q29A 4ELOA 3W6JB 2VHAA 1EV7A 1HSTA 4N6PA 1BLFA 1GVJA 2ZNYA 3IL2A 3L6HA 3WAFA 2M8EA 2BEOA 4YAHX 4ZZAA 1P1QA 4JBZA 5B70A 3IC7A 2Q8KA 2THIA 5EEHA 3H3UA 4G77A 3RLFE 3MUQA 4Z2YA 3N6UA 1ELJA 3E5UA 4LB6B 1SW1A 4F31B 2RC7A 3IAZA 3OO7A 4BQAA 4ESXA 3LSTA 1P1WA 3FXUA 3K00A 1R58A 3P9KA 2RF1A 3BDDA 1GXPA 4YIFA 1MXYA 1Y9UA 3M7GA 2VC0A 4L0ZB 3R7XA 5ILUA 4HDVA 1FC3A 2OK2A 1XS5A 1HW5A 3JSPA 2L4MA 4Q0CA 2OCUA 3RKYA 3S9EA 3VE1B 1ZRDA 4A0ZA 2W7YA 3PPPA 1B51A 1UB9A 3ZMDA 3RT6B 4UNOA 1UQWA 1V3FA 1MY2A 3K6UA 2YLNA 3KETA 4RYAA 4LONB 5F6FA 2ESNA 4KT5C 3JSOA 2QQAA 2IA2A 1X3UA 4XXUA 5CVIA 5BPIA 3W9VA 3LA7A 3LA3A 3O6HA 4RB3C 5DEXA 2G7HA 1NL5A 3ELKA 2XAGA 4AIKA 3B7DA 1N04A 2HFHA 1IXSB 1JEVA 1W5TA 3E9XA 2RKHA 5TRDA 5JK4A 3UN6A 4M74A 2QQBA 5DEXB 1YO5C 1U6GA 2OD5A 2NXOA 4E0XA 1BTJA 2L02A 4JSOA 1IEJA 4DLDA 3PPQA 4CZZA 1URDA 3K1MA 3IRQA 1FTOA 1M5BA 2D5WA 1TW3A 4MEXF 5CLSA 3TTNA 2Y7IA 2DOJA 3KEIA 1AOVA 4L5IA 4KUMA 1B1BA 1UFMA 1P99A 3LUYA 3WE3A 2QSXA 3EPEA 5H8FB 4L0YB 1R00A 4ASNA 5KDTB 3PU5A 2QLZA 2CZLA 4U22A 1NH7A 5D5UB 4PQJA 1UTHB 2VD3A 3O29A 1LFHA 1JXSA 2HKOA 1JETA 3QRFF 2PFBA 1IXIA 2GHBA 2YPNA 4M6XA 4EF1A 1LBCA 3MCZA 1VFEA 1B9MA 2L3DA 1DDNA 4HCWA 1HKQA 2H94A 2NYXA 4GRKA 2YX7A 3TODA 4UV8A 1SD3A 5LHIA 4IO3A 4ND9A 1KYZA 1R22A 2E7WA 5H8NA 2O51A 3CUQA 5A2QK 1WQ2A 4ESJA 4LG0A 2RQPA 4HLYA 2MH2A 3G3IA 1H45A 4ZEBA 2GQQA 1I5ZA 2FRHA 1Y4CA 2Q89A 1LFIA 2P6TA 4HX4A 3GBBA 3SZPA 2I58A 3UA8A 5TP9A 3RQTA 4F3GA 2K02A 1UIVA 2XXVA 2ANJA 2DPUA 3SEVA 2Q2AA 4THIA 4XKPA 2YU3A 2REGA 2HXWA 4YU0A 4BDLA 4U21A 2IA1A 2IPQX 1R1TA 4JQFA 2XX7A 1LVAA 5I58B 1XHYA 4UACA 4U0VA 5DUIA 1W7PA 1Q1KA 3IR1A 2FNAA 1I27A 4HX7A 2NUVA 3I54A 1UHMA 2RGVA 2PLYA 1PDNC 4KDPA 2YJPA 1H3DA 3ZS6A 3ILUB 5D6EA 5JTYB 2LF7A 4HQMA 4GD5A 1IN4A 2HZTA 1GTKA 1D8KA 3LWFA 3JAMZ 1MXXA 3HN0A 1J75A 1TQPA 3CG3A 3PQKA 1LAXA 2P6SA 4X48A 4YICA 1SD7A 2FNCA 4YZZA 4A0YA 4UVAA 3ZP5A 3J7AO 4A0XA 5K5OA 1T2KA 5JHUA 3SETA 3TPAA 2ZYNA 3IORA 4R79A 4YG2F 5A5XB 4EVIA 5H8FA 4R8HA 2HTJA 3IKVA 3TKDA 4XTCQ 3WTSC 4KIFA 3RIRA 1YFHA 2CQKA 1O3SA 3N4MA 2A61A 4G7OF 3BZ6A 4F1UA 1XGSA 3AAFA 1IXHA 1DMBA 4HF2A 2BJJX 2BBYA 4NF8B 1B3HA 4QHQA 4HOBA 4AD9A 4R9GA 1SD4A 4YKKA 2Z33A 4Q30B 2DQRA 5CVVA 3QU6A 3OENA 3GZGA 1Q35A 3AXFA 1JW4A 4OEVA 1U5TC 1B3FA 5FO5A 4WEDA 3HYIA 2OBPA 4HF1A 1DPRA 3TDUC 5L9OA 3R6SA 1DPUA 2G93A 2NNNA 2QENA 1TNSA 1MY4A 3EHSA 3NRVA 3WGIA 1K78B 3KGCA 1UTBB 2UXXA 2RC9A 1FSEA 3C31A 4A12A 1Y3NA 2E1SA 4M4GA 2LNBA 2DS9A 4RGSA 3RI4A 1B7UA 1QZZA 3RJPA 2IP2A 2Z8EA 3LR1A 2WC2A 1ZG5A 3KOSA 3IL1B 4ENNA 1F4KA 2CMOA 5DT6A 1TNTA 3RYRA 3M3LA 2XX8A 1OYYA 4UA8A 4S04A 4F29A 2R71A 4ENJA 1JHFA 1F5TA 4JBAA 3IRRA 4NB5A 3H03A 1HBXG 4E0WA 2PMHA 4GOTA 1AIVA 2P5LC 4G6DA 4G4PA 3SDFA 3E6CC 2JTVA 4HA8A 4BDOA 1B3LA 1P4AA 3KZYA 2K27A 1B2HA 2OA4A 1IZ1A 4P5OA 4NQWA 3R6UA 3RPWA 1D8JA 3DP6A 1J2XA 4ELPA 3G73A 1A55A 1K7AA 1F1ZA 2XASA 2K86A 2ZYOA 3HHGA 4GFRA 2DVZA 5CMCA 3RUMA 1MQJA 4ZECA 1PUEE 3VLUA 4MNUA 3MP1A 5E1XA 4KN4X 4EJOA 1ZTYA 2P2AA 2ZNSA 4PP0A 5IT3A 3BKIB 2E0SA 1TTYA 2Z8FA 4G7HF 2KKOA 2H25A 1GXQA 1D9YA 3S4UA 1TFDA 4QFOA 1FBSA 4UXNA 4OESA 4FE8A 1P4XA 3O6BB 2O8XA 3CTAA 1MXUA 1O7TA 3ISPA 2I4BA 1DTZA 1F9NA 3V8JA 4H0EA 3PGFA 4IO6A 3O28A 3TQLA 4G68C 1BN5A 3R4KA 4OOIA 3F22A 2QL3A 2ALUA 1T38A 4IO7A 2ESHA 3KN8A 1LNWA 4OIOF 1ODDA 4FX4A 1TFAA 2V93A 1BM9A 3SEUA 1ZLKA 4UVCA 4QLCU 2XKOA 1FYLA 4OERA 3IO6A 1NMUA 5AA2B 2PQ8A 1YW9A 3IJXB 1IXRC 2VONA 5FD5A 4ZZDA 1NNPA 4DXBA 3LFKA 2BE5F 1USTA 4U7DA 5CMMA 3IB2A 4FHTA 2E1CA 4MBPA 3ILTB 5FFZA 5ICTA 3Q9VA 3E4RA 1URGA 1XMAA 4LLNA 2OBGA 4G7ZF 3QUFA 4LLLA 4M72A 1SFEA 3K69A 4WXJA 2L01A 3ZMVA 4U23A 2PX1A 4H6DA 2UWMA 3BWGA 1JE8A 5DD4A 4U0YA 3H3GA 1ONVA 4U4XA 4Q47A 1I6AA 4DXCA 1HW1A 3MAJA 4KCDA 2ETHA 5KCJA 3CI8A 4JSDA 3KCCA 4OMBA 1FW0A 3JV9A 3IB0A 5L9MA 4OMYA 1DPEA 4RPNA 3DPLC 3CSBA 3GO5A 3R26A 1SBPA 4UHTA 4BHCA 1B58A 1YW7A 4LLGF 3TTKA 4MLQA 2KLFA 4ZYGA 1FP1D 3KEQA 3E5QA 4HV6A 5ICGA 3H6UA 4RAYA 4Q5SF 5I58A 4MGRA 5CJ9A 3T0YA 5IKBA 1DP7P 3H6VA 2P1SA 4YFXF 1YCJA 4XRFA 4XBFA 1IQ7A 2COMA 2X7PA 4L9VA 2JPBA 4FEDA 5JTYA 5E1WA 1MY1A 2DXYA 5K1YA 4GXSB 1ZU0A 1JNFA 3CG1A 1D3YA 1AH5A 4I2OA 1Z6TA 4HTGA 5TP9B 2P8TA 5DD8A 2XAFA 4R6YA 1S7AA 3WTTC 4HCYA 3EHUA 3KLNA 4A5MA 4OQOA 1RYOA 5K5RA 2XVCA 4A6DA 2DLLA 1YTVA 1PP8F 4DCYA 3DF8A 2HAVA 1STZA 2AL5A 4LJZF 2XHDA 1YLFA 2RVCA 4ZE9A 4WXDA 4NF4A 1G3SA 4O3AA 4I98B 5ITPA 4OINF 3ZMSA 5AA4A 4RAZA 2RNJA 4PFTA 3UGWA 3ZQ7A 2I48A 2F97A 3K6VA 3JZJA 4MHGA 2IA4A 1NNTA 1A04A 4GXAA 3I59A 2DQVA 3CRBA 3DLNA 3MZYA 4I0AA 2F34A 1USSA 2F7AA 4M9XA 3IK6B 1YYVA 4P9FA 1MQDA 3TELA 3TDZC 3TQNA 2C6YA 3J81K 1W7PD 5LGNA 1XT8A 1JVYA 3EHTA 2VBZA 4PFWA 1LAHE 4WF2A 4LQ2A 2O1LA 2STTA 4WKMA 1BI0A 1A54A 4MTEA 3GZ5A 1S7YA 1QPMA 2R7DA 3JW4A 5LHHA 4TQUQ 4Q48A 4LATA 1O57A 5HLIA 5M2VA 1IF1A 2ZYKA 2CO5A 5LRSA 4G8MA 5HPQA 3GW2A 1KU9A 2UVJA 1USYH 2DAOA 3ECHA 3MEXA 4I0BA 4QRZA 4G8XA 4EGYA 4H8IA 1EH6A 4ELQA 3EQ1A 2FQ3A 3N26A 4U2RA 2O7UA 3TCFA 2Z5UA 3GWZA 3GFLA 2Q8JA 5I84A 4L9TA 3UORA 2OQRA 2Y0MA 5D5WB 4HZFA 2XXIA 4OIQF 2V3UA 4RNSA 2V9VA 3C32A 3MJNA 1OLCA 3J80K 2ZNZA 3O3KA 2VBXA 4EXLA 5L3CA 2W85A 2GRVA 1A8FA 1OQGA 3FJMA 4ZS9A 3DKWA 1TLHB 4CO8A 1Y3PA 1EZOA 1J1NA 3FV1A 2A6HF 3HOTA 4U1ZA 2VGQA 4N07A 1BBYA 1FWZA 2DYXA 2WTEA 2VBWA 1R9QA 4H65A 3ZKLA 3HRUA 2FF4A 4WXCA 2V1UA 2J5OA 3FM3A 3QU3A 4KIBA 1KYWA 4DNCA 1R9LA 3TTLA 4I62A 4FX0A 4H5GA 2P5VA 2ONSA 2A6EF 4G8NA 3ZMZA 1QUJA 1A99A 3ABUA 1LB2A 4K2EA 3EF7A 3PUVE 1XGOA 3IOUA 1DUXC 1TT1A 4XIGQ 1Y1MA 1HSJA 2Z22A 4R6HA 2DXRA 3GUDA 4BAYA 4F1VA 1P6RA 4KYWA 4R9FA 2NWJA 2GFEA 4IY6A 4RJZA 4E70A 1KU3A 5DCFA 3K1PA 4G6QA 3WU0A 4AVPA 4OIRF 3E3KA 5AONA 1M5DA 1FX7A 2WKYA 2VBYA 3I3VA 1H43A 4F3BA 1LFGA 3HO7A 3RGYA 3V8XB 3I58A 5HLGA 1MDMB 4POWA 1PC3A 5DVJA 3CLOA 3FHZA 3M3KA 3VLVA 2V3QA 2EV5A 3T93B 1OQHA 1YAEA 2ZKZA 2Y48A 4TOZA 3OO8A 4RY1A 2XV4S 5I56B 2O0YA 5FHNA 1QGPA 3TTRA 3S9LC 1Z1DA 1K78A 2MA3A 1FY7A 4RB2C 5FHMA 3ECRA 1BIAA 1ZARA 3F3XA 1ZN2A 1QVSA 4OU0A 2PMSA 1FYKA 1YW8A 2HTSA 2QUFA 1SYIA 2XD3A 5AE4A 3T9VA 3BJAA 2IW5A 4UVBA 1LLSA 3VXCA 3VODA 2O69A 3QIMA 2DE4A 3FXRA 3FMSA 5HS7A 4L18B 3GFIA 3QYTA 4NF4B 5LLQA 3BP8A 4RA1A 1Y4TA 1OIBA 5AA3A 1T6SA 5ILVA 4KNYA 2RKMA 1MDP1 1G4DA 3FV2A 3IWZA 3H7MA 3MW0A 3PUYE 4GYGA 4EM2A 2EA4A 4PZJA 4PGGA 2L4AA 4ELRA 2W25A 2QM3A 3FVKA 3GFMA 5L3BA 1RIOH 2DE2A 2XXRA 3D0SA 1USYE 5L3GA 1KQ8A 1N0TA 3C33A 5D5VB 3MQ9A 5JR3A 5BOXA 2R3SA 3PPOA 3G7WA 3TAJA 1FQBA 1SVXB 4DIGA 4R73A 5LHGA 2K7LA 3EN3A 4YFNF 3IB1A 4OYVA 1HW2A 1XOCA 4RK2A 2QMXA 1XB4A 4IJAA 1XCVA 1GGGA 2OQGA 2MLKA 5FB2A 3I6VA 2B65A 2YR2A 3FASA 4NTLA 3T9HB 1XN7A 5LOMA 3RTWB 2M1BA 2XRNA 2DSFA 1OVBA 5FTHA 2Q0OA 1JEUA 2Z9OA 1H44A 3K0LA 5FFXA 4A2UA 3K2DA 4OMZA 1EZPA 3FWEA 3QPTA 1XSDA 4P9UA 1LAFE 3KN7A 2FE3A 3I0TA 2DK8A 2IA0A 1RI7A 1G6NA 3O9PA 2PBIA 2GA2A 4BDMA 3KFWX 1Z7UA 1FQFA 4ESBA 3H4ZA 1OVTA 4EJWA 3HIFA 4U88A 2UVGA 2ZJ2A 4FATA 3C1DA 1DOTA 5B7DA 3CR9A 3C7JA 5K2XA 5K5QA 3A09A 2OZUA 3E6DA 2NS0A 3I64A 3U72A 5H8QB 4QF9A 3CO7C 2I6EA 2M30A 1U3EM 2KJCA 2PEXA 3PFIA 1B0HA 1QW0A 5L8DA 4AB6A 5HVQC 1E2XA 1JW5A 4PCQA 3HCQA 3TCGA 4ECFA 5HLHA 2CG4A 2FYIA 2B3FA 3ZKKA 3TTMA 3SEWA 4GWOA 3FIRA 5CVJA 1TQMA 3KEOA 5CVRA 4XKNA 1SAXA 5DEQA 2CGPA 1E17A 3KZZA 3GBAA 3TFLA 4BYYA 3GXOA 2YPRA 5CI5A 4GIZA 3VV5A 4IO4A 4LVQA 5KZTA 4ZYHA 4X1BA 3OO9A 3RPUA 1N76A 2OZZA 3ZSFA 2XAQA 4ZEFA 3HHHA 1H9TA 4N0BA 2FBHA 1IRFA 4P55A 2DTRA 4R74A 5DYHA 1TW2A 3T9UA 3F6OA 4YFKF 5HDNA 3EDPA 1O3RA 2EFOA 4B09A 4IHTA 1JHHA 2DPDA 4CXFA 1WVJA 2P7CB 3H6WA 3KBRA 2JT1A 2GH9A 2I3WA 2P5KA 2Q88A 4ZE8A 4ZEIA 3H3ZA 3K02A 1LCFA 3MVWA 4B8XA 1VE4A 1L0OC 2GAUA 2HEUA 3F23A 1ZG3A 3WG9A 1FTKA 2I3VA 1IRGA 3R0JA 2O3FA 1U78A 3CVGA 2F5FA 2X0LA 3PUXE 3WE2A 2VT2A 3DFGA 1U5TA 4LA9A 5CRYA 2ELHA 3EYIA 2HQRA 1XGNA 2EB7A 4Q4ZF 4OVJA 2H5YA 2F7CA 2DVCA 1QQIA 4M1VA 3BPXA 2ZMBA 1I1GA 2QBYA 4RGXA 1SYHA 1H76A 2ZNUA 1MPCA 2R7FA 3QP5A 2ZFWA 3D5LA 4P0GA 5FD6A 1MH3A 5HS8A 1JVXA 5LGUA 4C1UA 1OKRA 1B5JA 2UYFA 3VB2A 2DK5A 3FX3A 1D5VA 2ISZA 3FZVA 2PYYA 5E17F 5K2YA 2IT0A 4AIJA 3H92A 1IXGA 4Z7EA 5BMZA 2HS5A 2VOPA 1RNLA 3V7SA 1J5YA 4UUVA 3M1EA 1S6LA 1O3QA 2HZLA 2FA5A 1XMKA 1LDJA 1LJ9A 2FSWA 2HWVA 1US4A 3FVGA 3LC8A 3NEUA 4F19A 4JB7A 1WODA 4MQ9F 1IN8A 1PP7U 2OLBA 3LQRA 2F5CA 5JI6A 2Q9TA 2M45A 3WGGA 3GFJA 1I6QA 1ZLJA 1BOAA 5DUKA 4HW8A 1LDDA 1U8RA 2DE3A 2PI0A 3KZGA 4NF8A 1Y0UA 1FTMA 2OJTA 2VOZA 1HKSA 1MZBA 5LGTA 3B73A 1YIOA 1A8EA 3G3GA 5H8HA 2OU2A 1KU2A 3HTSB 1B3EA 4DCXA 6PAXA 5J8FA 4HS7A 3I53A 3G3HA 4ENMA 1NNKA 2P7VB 3LSLA 3GVAA 1RZ4A 2MH9A 2F5XA 4OFLA 4BDNA 2V3TA 3KP3A 3BOQA 3J81Z 2HYFA 1EZ9A 4HQEA 4EQQA 3BFUA 4OFJA 3K6XA 1SFXA 3R61A 4GF8A 4HF0A 4OENA 5H6RA 3HSFA 1CF7B 1S3JA 4O3CA 4L5JA 2XAJA 4NHJA 2HYGD 2HQNA 1LDKB 4G2ZA 5A5XA 4ZEDA 3OMBA 1B05A 4G94A 4AB5A 3ZPLA 2A3SA 4LB5A 1K79A 3S9MC 2DWHA 3K9TA 3WTWC 2XXQA 3T1BA 4PFUA 3FVNA 5TU0A 4HX8A 4KICA 2F2EA 5F64A 5DVIA 4ETSA 3E97A 1Y1ZA 5D4RA 1QUKA 3DV8A 3FD3A 1LBBA 1Z7NE 2H99A 3F8FA 1HXDA 3U2RA 4RXLA 3EUHA 1IIWA 3IJOB 4L9JA 1MQHA 2G29A 1EU8A 4LD5A 3PV0E 4PETA 3EETA 3C4MA 4M9SA 1EH3A 4AIHA 4MF3A 3O6GA 2D1VA 3WTUC 5BS6A 4I1DA 1G3TA 1SMTA 2QS1A 4YKPA 1P1NA 5FLXK 1ON2A 3OOAA 4PGHA 4CICA 1I6XA 1FQDA 2F78A 3SQNA 3BROA 1RUOA 4F3PA 3T8RA 4LGWA 1RKMA 3REOA 3SERA 4H5FA 5I59B 1B9JA 1ZIUA 4H67A 1GHCA 5ISUA 1AL3A 2KIUA 3L2CA 5ICEA 1PDAA 5TPAA 2UVIA 1BC8C 3MBPA 3CUQC 3O97A 3P9CA 4GVOA 1KU7A 3OD7A 1F9BA 5E18F 3KLOA 1LGBC 2KIMA 3VEPA 3CUQB 3D4CA 4N9IA 3PMWA 3K2ZA 4IO2A 4AQ4A 5IT9Z 4LP2B 2EWNA 1UTHA 5F1RA 4M9ZA 2AXLA 2AS5F 1FPQA 3FMRA 4EM0B 3U8QA 1ZHFA 5HDKA 3BJ6A 2Z3YA 2VODA 1XSVA 3U94A 3I71A 2UVHA 1G3WA 2QVOA 4NMYA 4RB1A 3KP2A 3QSLA 3CUOA 3SEXA 1J9IA 2ZMEB 2Y7RA 4P96A 4EF2A 2V79A 2W24A 3RTFB 4G68A 3Q25A 5D8LB 2XXYA 3P7IA 5HBCA 2UXNA 2FEZA 3SHFA 2F36A 3F6VA 4BDQA 1MH4A 1B6HA 3CFXA 1S9TA 1P2FA 3DQVC 1O64A 1R5HA 2FMLA 3KP6A 2VOOA 3FVOA 1TWYA 3IHUA 4EXKA 4R1HA 3ZN0A 4QWQA 4GCVA 1OMIA 2H6BA 3CSGA 2JZYA 1P1UA 1FOKA 3TKYA 4G8HA 4FIMA 4U1OA 1O3TA 2GWRA 3E13X 3TCHA 4XSXF 4AWXB 4KHZE 1P4WA 4YB6A 4R2BA 1B9NA 3M9AA 1KA8A 3HSTA 1B4ZA 1VFDA 4QFLA 1OYIA 3F8CA 4BXUA 2JSCA 5EHMA 3KP7A 1R1NA 5LRRA 2L54A 3S2VA 2GHAA 5CC2A 2ZBKA 1B5HA 3TMGA 1M5FA 4KD5A 3I59B 5LBQA 2JRTA 4RK9A 1YPNA 3N5LA 4JWOA 3LQQA 2H6CA 3GEZA 3IX1A 1FQCA 2EK5A 1URSA 5AA2D 3PPNA 3N97A 1SW5A 2I0CA 1PB8A 3I5OA 4NF5A 3RN8A 5F1QA 5TPAB 4YMAA 3T8TA 2F6PA 2O6AA 4XKQA 1T0FA 4O5VA 1IUYA 2ZNTA 3JYRA 2OZ6A 2M5WA 1PBPA 3K01A 4ONYA 5E1ZB 3HV1A 2X4HA 2HEOA 2A69F 3V7RA 4U7BA 1BI1A 4OXVA 5CMBA 3G3JA 1IITA 1O63A 3GLXA 4TV7A 1DTGA 4IHSA 1IUDA 2D2WA 2EV6A 3KE2A 1ANFA 1QO0D 3V5AA 4F18A 3E6MA 4IY5A 4D0PA 3LSWA 4X9TA 5A2QZ 2B3BA 3KSJA 2YX4A 3RPQA 3K1NA 1HSEA 4NF5B 2MD5A 5ERIA 3RTRA 4F22A 2MLGA 2Z99A 2F5DA 4EQBA 2D45A 4ZH4F 3ERED 4EQ9A 3ML6A 2IVMA 2Q2EA 1B32A 3TO7A 3HHFA 1R23A 2OAZA 3GX4X 3FM5A 4EM1A 4FJPA 4JXIA 4WXHA 4CGZA 1FQEA 1JW1A 5JVTA 1G3YA 4EMSA 4EJTA 5JEIA 5CM6A 1XCBA 3MWMA 5FTIA 3KJ7A 3PQJA 3M3FA 3SZTA 1XDUA 3B02A 4F1YA 3LAJA 2NNYA 1I69A 3C9HA 3IOVA 1GV8A 5CYVA 4F3SA 5D8KB 2VT3A 3DP4A 3BY6A 3ZMTA 3EQLF 2DWAA 2O7IA 3LSFB 1FNNA 3KP5A 3VOEA 1B6AA 4QSCA 1ON1A 1MJAA 2DW4A 1B4HA 4ESWA 2HAUA 4C0RA 3G3FA 5J6XA 4MFIA 2CFXA 5KVRA 3P7NA 1Z91A 2VN2A 4LFUA 4DXUA 3F8MA 4KYDA 4O3BA 2WWYA 3M8UA 2DU9A 5BPDA 2IJLA 1VR5A 3CFZA 3TDJA 3HSEA 4KMFA 3C18A 1W5SA 3P9IA 4ISUA 2A68F 4I01A 4LK1F 1OLAA 1B0LA 5J1DA 1QNTA 1ZJLA 5D6FA 2FU4A 2XGXA 3PUZE 3TQWA 3TOBA 5CBRA 3HUGA 1O7LA 1LEBA 4MTDA 1J0RA 2DBBA 2HOEA 1L3LA 3ULQB 4PE5B 1B7HA 4KPTA 1FZPB 3S9NC 3GZ6A 1MRPA 1B3GA 2OWTA 3R60A 4X1DA 1H0MA 3VVFA 1W7PB 3CDHA 4EDPA 1U2WA 4MH5A 4I8CA 2B0LA 2M87A 2QMWA 2EFNA 2LF8A 3OEKA 5DYMA 3TGNA 1ZRFA 1SMYF 4I02A 1II5A 1LCTA 2JPCA 3KP4A 2TDXA 2KRFA 2HQ0A 2ONRA 3D4GA 1SI1A 2E1NA 1QKAA 5I57A 4QFKA 1ZGAA 2EJRA 2XXTA 2ZXTA 1WRJA 3U1OA 2FA7A 3OSQA 1R36A 3DELB 4RPOA 4IGTA 4YB7A 3O6IA 5I2KA 2Q2CA 5ICFA 2W84A 1QBJA 1ATGA 1Z05A 2HR3A 3Q26A 1JGSA 2Y7PA 2Y7WA 1NHAA 1HQCA 2I49A 3Q5FA 2RC4A 1S7OA 1MM7A 1SD6A 3F21A 2Z8DA 1IXCA 3VDFA 3PD8A 4POXA 1B46A 2CW0F 1POY1 4QSEA 5BUUA 3H6TA 1B7ZA 1FQAA 2LDUA 2ZMEA 2P4WA 4IB2A 4H1XA 2QRYA 1KGSA 1SW4A 3VFJA 4IPAA 4Q5TA 1T98A 3UK4A 2YSRA 3B6TA 3T22A 4GLIA 2D3IA 2VE8A 2XD2A 4K3FA 5ELVA 4TLMB 4F7ZA 1O7FA 3ZN1A 2V1XA 3FF5A 3J80Z 5D5XB 1N7WA 4ON0A 3MWBA 2XUBA 3RNNA 2CYYA 4OIPF 2DP8A 5KDTA 3QP6A 2W57A 3WAEA 3GYHX 4S05A 4FAJA 1PEBA 3Q28A 1JQFA 3TZAA 3K6WA 3ONMA 2FBKA 1ZKBA 3WTYC 5L3EA 3MP8A 1CF7A 4IGRA 4F2QA 2O03A 1XVYA 4I09A 3T96B 3U92A 1FTLA 4ZZLA 2I0BA 2BGCA 2O6GE 4CYDA 1OR7A 3KOTA 4N9HA 4KFCA 1LB9A 1WKMA 4OZ9A 2RC8A 1UTBA 3ABTA 4IRGA 2VD2A 1UIUA 3DPTA 2UXAA 4HYEA 3BFTA 2KIFA 5J8CA 3VFZA 2J5PA 4L17A 5HM4B 1T0KA 2AIXA 1I6BA 2XKPA 2QS3A 2XXXA 3TO6A 2XXWA 4P11A 2QQ9A 3T5XA 3IWFA 1ZRCA 4WWCA 2R9JA 4WK8F 4BHPA 5LEKA 1BKAA 1MDMA 1H9GA 4JWXA 2RINA 3IOWA 5IAIA 3ZMUA 4YB5A 5JFRA 4LK0F 2P0SA 3CIJA 1UHWA 2ADUA 1PBQA 3MZ1A 3F8BA 3CJNA 5EEGA 1VSOA 3FGSA 4NF6A 1XVXA 2QS4A 3G3ZA 5CMKA 2G7UA 4JK1X 3FMQA 4DZ1A 3BJOA 3E6BA 2MBFA 4LMYA 4BNCA 3OO6A 3WTXC 3HOSA 3M8EA 1QULA 3MAMA 3MZ9A 3C34A 1BC7C 3MVYA 4WEPA 2DI3A 2NOOA 4JDFA 4PFYA 5TJJA 2H98A 1LAGE 2LSOA 5DDGA 1S29A 1FTJA 2ZXJA 4MEYF 3FUZA 1MXZA 3U1DA 2A5TA 1ZMGA 5BWJA 3HRMA 3RKXA 2EA2A 4OTEA 4M6YA 4NE4A 1PB9A 2Z23A 4HLXA 2GIVA 4ZDMA 1IW7F 4KA4A 2H27A 3RT8A 1GVCA 1LEAA 2F6GA 3TEPA 5EHSA 3WODF 2A5TB 4QSDA 1T39A 1BP5A 2ONKE 1MKMA 3L9FA 5H8HB 1NFTA 3C3WA 2IEEA 4L9NA 1OPCA 4BLAA 3VVDA 3KG2A 3TUSA 4LZ7A 5DCMB 4GO1A 3ODBA 4LQ5A 1K6OA 2IRFG 2CSOA 4OEUA 3COAC 2HKXA 2H9BA 4EJVA 3O2AA 3PD9A 4CDGA 1U5TB 4IVNA 2PT1A 4XLPF 1S50A 2PMUA 2LAOA 1AOYA 2XXPA 3KJTA 2K4JA 1SI0A 5AA2A 4Y15A 1MY0A 1KQ9A 3U9GA 5DV5A 2Y75A 4A5NA 1RYXA 4KMUX 1MXWA 3USDA 3MZHA 1B1HA 1FSHA 1MS7A 2RCAA 4Y17A 5HOOA 1REPC 4F39A 2GXBA 4GGGA 4RGRA 3M8FA 1DPPA 5H6QA 1B40A 3T66A 2RV8A 1FCKA 2PN6A 4XLNF 4YKIA 1OMPA 2K4BA 3BPVA 2DWJA 4FT8A 5F7VA 1D4NA 2ABHA 4NWDA 1UCRA 1C0WA 3KSXA 4H0WA 2VE9A 1ZREA 1SW2A 5ILSA 1IAWA 3VXBA 4P0IA 3JTGA 1MPBA 3SFZA 3GF2A 5ICCA 5AA1A 3K0VA 3RKWA 3V8LA 3MPKA 5DTBA 3F72A 3F11A 1US5A 4KN7X 2A5SA 1ZYRF 1BIYA 1BI3A 1QJMA 4ZYDA 3LA2A 1PB7A 2XROA 1MD0A 1L5TA 2PVUA 3DM0A 3QOPA 1OYWA 4HAMA 2O61A 1ZBMA 1YG2A 4RB0A 5IT9K 3MZBA 3UIFA 3OOPA 4U4SA 1P92A 3MVXA 1NNFA 1MDQA 4MLVA 3O2PE 2O1MA 2BYVE 2PJPA 3PMXA 3OSRA 2VXZA 2EV0A 3W9WA 1B59A 2FNPA 2DQLA 2HCAA 1B52A 3S2WA 4OETA 3FXQA 5I2NA 2PG4A 1FLIA 1ZH5A 4O3MA 2I4CA 1MJ9A 2FMYA 2G9WA 4EQ7A 3SESA 4BHBA 5L3FA 3QXMA 4Z0IA 5CBSA 4IF4A 3IKTA 3SKPA 1XD7A 2FBIA 1KWHA 4A6EA 3V89B 3WGHA 4KYEA 1FBUA 4YKJA 3SEYA 3V7CA 1Q1HA 1WWXA 2F8DA 2REJA 5EYFA 2XXUA 2DFIA 5FLXZ 4ZZEA 2H4IA 2XIGA 4NEDA 1ZLQA 2QPQA 3WTVC 2Y84A 5H8NB 3Q27A 1P1OA 3RY3A 4KR5A 3FATA 4ESFA 3B6WA 1BIBA 4GYIA 3IO4A 1ZGJA 4XKRA 2FXAA 3ROUA 4HDUA 3DP8A 3OEMA 4R72A 3QUJA 1Z7ME 4HBLA 2D21A 2M8CA 4IO5A 1D9VA 1MJBA 1MM6A 2XXHA 3V4GA 3UP9A 4IRHA 2HDCA 1MXVA 3OXNA 4DE8A 4ENKA 1SDXA 3JTHA 3TO9A 5KK1A 1IN5A 4EJUA 4MQVA 1R5GA 3LAPA 2EFQA 2D1HA 3R0AA 3I5UA 1CE2A 3PPRA 3HRSA 3WTZA 5I59A 1YQAA 3V83A 4ZEKA 2RDPA 4KFQA 2AYSA 3MP6A 5ICQA 3OELA 4LUBA 4RGUA 1R1UA 2NAZA 2CWEA 2H09A 1MGTA 2F35A 2QWWA 2QJEA 3MVZA 2HFBA 4OWDA 1SD5A 3I4PA 5L3DA 2BV6A 1FP2A 4BDRA 3KN3A 5BQTA 3QK6A 2EFWA 3RYPA 2NRAC 1A40A 3WU1B 3A3UA 3THIA 2ACJA 5E8GA 4KI0E 1LSTA 2ZYMA 3O66A 3MQ0A 2OWSA 4KIGA 1HKTA 1I1SA 1A7LA 3CO6C 2KJBA 1WSUA 2UYEA 4QFNA 3B6QA 1B4AA 2X26A 4WCGA 2AL4A 3E5XA 4OHNA 1NH8A 4QFPA 5AA4B 4BH9A 4UV9A 4M73A 3PMVA 2WV0A 1RUNA 4DDDA 4WX9A 4G68B 3QAXA 3MFKA 5E8IA 2GXGA 1Y3QA 2NVUB 1SQYA 3HSRA 3SXYA 1B5IA 4RS8A 3ECOA 1LQ1A 1M5CA 3HRTA 4GXOA 2X7QA 5AIQA 2V1DA 2VC1A 1S8NA 4I9DA 1CB6A 2QZ8A 4OFOA 1GR2A 4KYSA 2XAHA 5DCMA 5I56A 4KQPA 3DXJF 3C35A 2QBYB 2F7BA 4FEBA 5E20A 3LBSA 2STWA 1QZYA 4XSZF 1DSNA 1XGMA 3HPIA 1YS6A 4N13A 4G9YA 2F5EA 2PT2A 3W15C 1FYMA 3H06B 3TOAA 5I2KB 5AIPA 3GLBA 1ZAOA 2QS2A 4YMBA 4U0WA 3MPLA 3N94A 3RDIA 3JAMK 1TQIA 1M5EA 4EV0A 3K4UA 4GL8A 2A5YB 3LSXA 4H8JA 2ZO4A 1VTNC 2A07F 2LKPA 5H20A 4ZYEA 1N3XA 5ITOA 2ISYA 5I2NB 1AMFA 3W6KB 1R7JA 2HZKA 2PBWA 3CFLA 3L6GA 3A3CA 1CGPA 4JWYA 2MC3A 3FJGA 3VLWA 3C36A 2E7XA 1KQ0A 3V8KA 1TBXA 1R1VA 1HSLA 4LG0B 2HGCA 1V4RA 4LZ8A 1N84A 4EUOA 2FOKA 4NWCA 4KCCA 2RN7A 4I7HA 2QYOA 1WDNA 2V25A 4HW0A 2EFPA 2GA1A 1POTA 2XHKA 2R6GE 2DWIA 5ED4A 2V6CA 3OV8A 3PUWE 3U93A 5CVUA 3L09A 4IRIA 1D3KA 3NQOA 1B1XA 5FHOA 3Q9SA 3G3KA 5HS9A 1Z6RA 4FORA 3L00A 1YTYA 3BBRA 1ULYA 3E3VA 4C1TA 1MY3A 4R6KA 1XC1A 4R2FA 1IN6A 1BJAA 1XDSA 1MQIA 1QKBA 1J7KA 4R75A 2GZWA 1AWCA 3L7WA 5KCJB 1MQGA 3QPHA 3MC2A 2ZCWA 2Y7KA 4YIIA 1EH7A 5H8QA 4M71A 4NF6B 3QAHA 4CHUA 1FT9A 1IN7A 1N7XA 4EGZA 4TLLB 3F8NA 1LB8A 4GQOA 1WI9A 3VVEA 1N3WA 5L9SA 3HTUA 3IOTA 2O68A 2VP1A 4FECA 5H8SA 5D4SA 4IXAA 1YS7A 2UZKA 2O84X 3KFMA 4O6JA 3N6TA 4GL0A 1Y20A 3TYHA 4Q8RA 5I57B 5HDGA 3T9XB 3GXAA 1TXFA 4PDKA
chains in the Genus database with same CATH superfamily
1AWBA 2EZIA 2PFYA 1Z9CA 5FGMA 1J59A 1BI2A 1R6ZA 2V84A 1Z67A 1EJ9A 1U9NA 4XKCA 2LP0A 1NKXA 3DP7A 2RCBA 3D1RA 1FBQA 1G59A 1EH8A 4LZ5A 1W4MA 4HV5A 3EYYA 2DO7A 4HSRA 1MPDA 2XX9A 5DVFA 3MKYB 4Y13A 1Z21A 1MG1A 3DEUA 1YRNB 2Z16A 2ZB9A 5LEJA 3FJ7A 3HG9A 1XSXA 2WB1A 1SFUA 3QQAA 1ZG1A 4F2OA 4DQ2A 1QUIA 5K7HA 2DT5A 3Q29A 2OF7A 1FPFA 4AIDA 3W6JB 1FPBA 1EV7A 1HSTA 2VHAA 4ELOA 4N6PA 1BLFA 1GVJA 2ZNYA 3HGYA 1MBFA 5C3EJ 3IL2A 3L6HA 4PFRA 4CYCA 3WAFA 2M8EA 2BEOA 2L5QA 4YAHX 1P1QA 4JBZA 4ZZAA 1VQPI 5B70A 3IC7A 3HKZA 2Q8KA 3K70C 1QRYA 2CQXA 2THIA 4RLQA 3ZQFA 5EEHA 3H3UA 4G77A 1OQYA 3Q0VA 3RLFE 3MUQA 4Z2YA 3N6UA 1ELJA 3E5UA 4LB6B 1SW1A 4F31B 2RC7A 3IAZA 3FK6A 4BQAA 3OO7A 4ESXA 3LSTA 1P1WA 3FXUA 3K00A 3IFAA 1R58A 3P9KA 2RF1A 3BDDA 1GXPA 4BJTA 4YIFA 1MXYA 1Y9UA 1PJRA 2VUMJ 4OVQA 3M7GA 2VC0A 4L0ZB 3R7XA 5ILUA 3JRIA 1FC3A 3FBIB 4HDVA 4C2TA 1IO2A 1XS5A 2OK2A 4MNIA 4OVPA 1HW5A 3JSPA 2L4MA 4Q0CA 2OCUA 3RKYA 1NG6A 3S9EA 4AC0A 4CA0A 2B4MA 2HXRA 1UELB 3VE1B 1WZ2A 4PK4A 2XAUA 1VQMI 1ZRDA 4A0ZA 2W7YA 2QSGX 2WBMA 4JX5A 3CCMI 3PPPA 1B51A 1UB9A 3ZMDA 3RT6B 4UNOA 3S1QJ 2ID6A 1V3FA 1MY2A 1UQWA 3OYMA 3K6UA 4PF8A 2YLNA 2HPIA 3KETA 4RYAA 4LONB 5F6FA 2ESNA 4BXXJ 4KT5C 5B66C 1ZR2A 2IGMA 3JSOA 2KISA 1INPA 2QQAA 1LBVA 3QYEA 2IA2A 5B1BH 1X3UA 4XXUA 5CVIA 2DA3A 4ZTJA 2FBPA 5C4JJ 5BPIA 3W9VA 3LA7A 5HLTA 3LA3A 3O6HA 4RB3C 5DEXA 2G7HA 3DTKA 1VF9A 4B3AA 3ELKA 1K61A 2XAGA 1NL5A 4AIKA 3B7DA 1IUFA 5EYGA 3PFYA 3OIQA 1N04A 5EQ8A 1FBEA 2F3DA 2HFHA 2Y9ZA 1IXSB 4PJMA 2EINH 4P1LA 3ABMH 2DA6A 1JEVA 2KHMA 1W5TA 3E9XA 2P81A 2RKHA 4IQJA 5TRDA 2Y2ZA 3S2DJ 5JK4A 3UN6A 4M74A 1XTAA 3C2BA 2GM4A 2QQBA 5DEXB 1YO5C 1PUFA 1T8IA 1R4MB 1MSEC 2VPNA 3LSIA 1U6GA 2OD5A 2NXOA 4E0XA 1BTJA 2L02A 5FKNA 3UKGA 4JSOA 1IEJA 4DLDA 3PPQA 4CZZA 1YRNA 1URDA 1SEUA 2WBDA 1LFPA 3K1MA 3IRQA 1FTOA 1M5BA 2D5WA 1B72B 1TW3A 1KONA 4MEXF 4LOCA 5CLSA 4AYBA 3TTNA 2Y7IA 4O8MA 2DOJA 3KEIA 1AOVA 4L5IA 2JRMA 4KUMA 4C2MJ 3L2WA 1B1BA 4PJ0C 1UFMA 2QKLB 3VSKA 1EYIA 3WE3A 1P99A 2QSXA 3EPEA 3LUYA 5H8FB 4L0YB 1R00A 4ASNA 1HDPA 2HDDA 2NVQJ 5KDTB 3PU5A 2QLZA 2CZLA 3EPZA 4U22A 1NH7A 5JHFA 5D5UB 4PQJA 1UTHB 2DJIA 4FBPA 3TMOA 2VD3A 5B1AH 3O29A 1LFHA 4B48A 4A3DJ 1JXSA 2HKOA 1JETA 3QRFF 4I40A 2PFBA 1IXIA 1NH3A 2GHBA 1S7EA 2YPNA 4M6XA 3G6EI 5IYDJ 4EF1A 1LBCA 3MCZA 1VFEA 1B9MA 2IGKA 2L3DA 1DDNA 4BACA 4HCWA 1HKQA 2H94A 2NYXA 4XR6A 4GRKA 2YX7A 3ABKH 5IP7J 3TODA 4RAGA 2FX0A 4UV8A 1ZR4A 3M4OJ 1SD3A 5LHIA 4IO3A 4ND9A 5GP9A 1KYZA 1R22A 2E7WA 4Y52J 1ETXA 3CUQA 5A2QK 2O51A 4JVIA 5H8NA 1WQ2A 4LG0A 2RQPA 4ESJA 4HLYA 5M3FJ 5M3MJ 2MH2A 3G3IA 1DGWY 1H45A 3OOUA 4ZEBA 3HOUJ 2GQQA 3E78A 1I5ZA 2FRHA 2K40A 2X48A 3DCFA 4AU7A 2P6TA 4HX4A 1LFIA 1Y4CA 1AA7A 1MMAA 3GBBA 3SZPA 4J19A 2I58A 2XGDA 2LKXA 3UA8A 1MMSA 1AKHB 4H4KC 5TP9A 3RQTA 4F3GA 2K02A 1UIVA 2BJIA 2XXVA 2ANJA 2DPUA 3SEVA 2V6EA 2EZKA 1R6RA 2Q2AA 1WJFA 4THIA 4XKPA 5ESYA 5F24A 2YU3A 3IAS2 2REGA 2IBDA 2R5YB 2HXWA 4YU0A 4BDLA 3OYAA 1AU7A 2KRCA 3QYFA 4U21A 2IA1A 2IPQX 1R1TA 4ITVA 1XC5A 4JQFA 1JKPC 2XX7A 1LVAA 5I58B 1XHYA 4UACA 4NC8A 4O7IA 4U0VA 4A3EJ 3BQZA 5DUIA 1W7PA 2HVSA 1Q1KA 3IR1A 1I27A 2FNAA 4HX7A 1PYVA 2NUVA 3I54A 1A6QA 1UHMA 2RGVA 2PLYA 2G0EA 4J00A 1BK4A 1PDNC 1VQ9I 1V5EA 4KDPA 3OL4A 3PIOF 3S15J 1U9OA 1H3DA 2YJPA 2DODA 2VASA 3BTLA 3ILUB 5D6EA 3ZS6A 5JTYB 1Z7LA 2LF7A 4HQMA 2PJRA 4GD5A 1IN4A 2HZTA 4D5FA 2W7NA 1GTKA 1QGXA 1D8KA 2M7AA 3LWFA 4BUPA 3JAMZ 1MXXA 1MMGA 3HN0A 4LN5A 3LSKA 1J75A 1TQPA 3CG3A 3PQKA 1LAXA 3DWLE 2MSYA 2P6SA 3I3LA 4X48A 4YICA 1SD7A 3CDIA 2B63J 2FNCA 4YZZA 4A0YA 4MJOA 4UVAA 3ZP5A 3J7AO 4A0XA 5K5OA 4FQGA 2KDZA 1T2KA 5JHUA 1GV2A 3SETA 3HUGB 2ZYNA 4MNPA 3IORA 4R79A 3TPAA 2ECBA 4YG2F 5A5XB 4EVIA 1FPLA 5H8FA 4R8HA 3SEQA 2GLOA 3A01B 2HTJA 1YJ9I 4UY8I 3IKVA 1FJ6A 4N6KA 4XTCQ 3TKDA 3WTSC 4H45A 4KIFA 4KITB 4BY1J 1B72A 3DLLF 4JVCA 3RIRA 1YFHA 4PSWA 3HXLA 3K2AA 1H8AC 3LSHA 2CQKA 4B44A 1O3SA 3N4MA 2A61A 4G7OF 2F4OB 3BZ6A 4F1UA 1G8XA 1XGSA 3AAFA 1IXHA 3L2RA 2RQQA 4XOTA 4HF2A 1DMBA 1T56A 2BBYA 2BJJX 4NF8B 3RPLA 1B3HA 4QHQA 4NHBA 4HOBA 4AD9A 4R9GA 1SD4A 4YKKA 2Z33A 4Q30B 2DQRA 5CVVA 2OV7A 3QU6A 4HSTA 4BY7J 1ERDA 3GZGA 2QFLA 3OENA 1Q35A 1VI0A 3IH2A 3AXFA 1JW4A 4MAGA 2ZFUA 4OEVA 1FPKA 1U5TC 1K4TA 3JRGA 5FO5A 1X19A 1B3FA 4WEDA 3CCJI 1ZTRA 3HYIA 2MKZA 2OBPA 4HF1A 1DPRA 1SFOJ 4QIWN 4PFBA 3TDUC 4MFDA 3R6SA 5L9OA 4OAYA 1DPUA 2G93A 2NNNA 4N4UA 4XONA 2QENA 2HHMA 5F0CA 1TNSA 1MY4A 2R7UA 3EHSA 2OCCH 1WJEA 1MW7A 1FMVA 3NRVA 3WGIA 1K78B 4XKVA 3KGCA 1UTBB 2UXXA 2RC9A 4F55A 1FSEA 5TGTA 2VJ5A 3C31A 4P1EA 4A12A 2JSPA 2NXNB 1Y3NA 2JQ7A 3ONQA 2LBFB 3WHBA 1XPXA 2E1SA 3DPUA 4M4GA 2LNBA 4P1WA 2DS9A 4IOCF 3OSFA 4RGSA 1RESA 3RI4A 1B7UA 1QZZA 3RJPA 1AKHA 2IP2A 5KNLA 2XDVA 2Z8EA 2XF6A 5EQAA 5KAIC 3LR1A 2WC2A 4CCKA 1D5YA 4NQWB 4D7MA 1ZG5A 2RAEA 3KOSA 3IL1B 4ENNA 1F4KA 3PO2J 5DM7F 2CMOA 5DT6A 1TNTA 3RYRA 4HNVA 3M3LA 3FIWA 1OYYA 2XX8A 1FBPA 4UA8A 4S04A 4NGUA 4F29A 3OYJA 1EKEA 1A6IA 1JHFA 4ENJA 1F5TA 4JBAA 2R71A 5ET5A 3IRRA 4NB5A 3H03A 4PC9A 4ZDLA 1HBXG 2VPOA 4E0WA 2PMHA 4GOTA 1AIVA 5IZZA 5CQEA 2VQHA 3HBLA 2CQNA 2P5LC 1YHQI 4G6DA 4G4PA 2E34A 3SDFA 4UUSA 3ZQQA 3E6CC 3H9JA 4PAKA 2JTVA 1VQKI 4HA8A 2MGQA 1B3LA 4BDOA 1P4AA 2BHZA 2Q74A 3KZYA 2K27A 2KDOA 1B2HA 3OWTA 4PCDA 3ZQGA 2OA4A 1IZ1A 4P5OA 4NQWA 5C44J 1YI2I 3RZOJ 3R6UA 3RPWA 3FXBA 1D8JA 2VKVA 2JMWA 3DP6A 1OCCH 1J2XA 4ELPA 3G73A 2DN0A 3PL8A 1K7AA 1A55A 1TZLA 1F1ZA 2XASA 2K86A 2ZYOA 3HHGA 4GFRA 2DVZA 5CMCA 3RUMA 1MQJA 4ZECA 1PUEE 3VLUA 3GMEA 4MNUA 3E7LA 3TW6A 3MP1A 5E1XA 4KN4X 4EJOA 1ZTYA 2P2AA 2ZNSA 1X2MA 2X85A 5IT3A 2E0SA 1TTYA 2Z8FA 3BKIB 4PP0A 4G7HF 2KKOA 2H25A 4F91B 1GXQA 2QSFX 1D9YA 1TFDA 3AFHA 3S4UA 3SYTA 4QFOA 1YITI 1FBSA 1JUPA 2BY2A 4UXNA 4OESA 4FE8A 1P4XA 4CCMA 3S3OA 3O6BB 3RSNA 2O8XA 3ABLH 3CTAA 1MXUA 1O7TA 4E7HA 3ISPA 3ERMA 5IYCJ 2I4BA 1RPWA 1DTZA 1F9NA 3V8JA 4H0EA 3PGFA 5EG0A 4XFEA 3S1RJ 4DZJA 1SVOA 4IO6A 1AHDP 4C3IJ 2LREA 3O28A 4NQ8A 3U65A 1FPJA 4BQNA 3TQLA 4G68C 1BN5A 3R4KA 4OOIA 3F22A 2FQ4A 1IC8A 2QL3A 5I3SA 2LBFA 2ALUA 1T38A 1IGNA 4IO7A 2ESHA 3KN8A 1LNWA 3OS0A 3MKLA 4OIOF 1ODDA 4FX4A 1TFAA 2V93A 1BM9A 3SEUA 4UVCA 4QLCU 1ZLKA 2XKOA 1FYLA 2QVRA 4OERA 3IO6A 1NMUA 5AA2B 2PQ8A 3BG5A 3TZAA 1YW9A 2QGUA 3IJXB 1IXRC 2K3FA 2VONA 3A03A 5FD5A 4ZZDA 2XPUA 1NNPA 4D5CA 4DXBA 3LFKA 2BE5F 5GADJ 1USTA 4II3A 5F27A 4U7DA 3IB2A 4FHTA 2E1CA 5CMMA 5GTHC 3GYYA 2AL4A 3ILTB 4MBPA 1PVEA 5FFZA 5H2FC 3EUAA 3Q9VA 3CDLA 3E4RA 5ICTA 3OYIA 1URGA 1XMAA 4LLNA 2OBGA 4G7ZF 3QUFA 5EQ7A 4DYRA 1CQTA 4LLLA 3H5AA 4M72A 1X1CA 1SFEA 3K69A 4WXJA 2L01A 3ZMVA 4U23A 4BU2A 4ZJZA 1OR7C 2UWMA 3BWGA 3M07A 4I99C 5DD4A 4U0YA 1JE8A 2PX1A 3H3GA 1ONVA 4U4XA 4Q47A 1I6AA 4DXCA 2QQ8A 1HW1A 3CMYA 4M3EA 3MAJA 3CCQI 2ETHA 2X1EA 4KCDA 5KCJA 1ETOA 5B5EC 1Z0XA 2AXTC 1MNMC 2LR8A 3CI8A 4JSDA 3KCCA 4OMBA 1FW0A 1D9QA 2A6TA 3QPLA 3JV9A 3IB0A 5L9MA 5CKTA 4OMYA 1DPEA 4RPNA 3DPLC 3CSBA 3GO5A 3R26A 2K9SA 4PJJA 3AKZA 3HOVJ 1SBPA 2PMZA 4UHTA 2O7OA 4BHCA 1B58A 1YW7A 4LLGF 3TTKA 4MLQA 1W0UA 2KLFA 4ZYGA 1FP1D 3KEQA 1ETWA 3E5QA 4HV6A 5ICGA 4RAYA 2JA2A 1K6YA 1JTXA 3CC2I 4Q5SF 3H6UA 5I58A 4MGRA 1IRXA 3CCRI 3HC7A 1BA5A 4F52A 1GDTA 5CJ9A 3H9QA 3T0YA 3LOCA 5IKBA 1DP7P 3H6VA 4OA4A 3W2WA 2P1SA 4YFXF 1YCJA 3BR5A 3FISA 4XRFA 4XBFA 1IQ7A 2COMA 2X7PA 4L9VA 2JPBA 4DW6A 3BIGA 4L5EA 4FEDA 3BR2A 5JTYA 5E1WA 1MY1A 2DXYA 5K1YA 4GXSB 2DT6A 4V2GA 2MW8A 1JNFA 1ZU0A 1X58A 3CG1A 1D3YA 3K6GA 4II2A 1JKRC 1AH5A 5A5LA 2X6YA 3W2AA 2JA6J 3S8PA 4I2OA 4GX6A 1Z6TA 3G1MA 4HTGA 5TP9B 2P8TA 2FIXA 2AQEA 5DD8A 2R0QC 2XAFA 4HPQA 4R6YA 1S7AA 4MEVA 2LFBA 2MG4A 3WTTC 4HCYA 3EHUA 2FHYA 3KLNA 4A5MA 4OQOA 1RYOA 4OWRB 5K5RA 2XVCA 4LIVA 4A6DA 2DLLA 1IJWC 1YTVA 2BVLA 2V1NA 1PP8F 1DU0A 4DCYA 4IHVA 3DF8A 2HAVA 1STZA 5F04A 2AL5A 4LJZF 1X4PA 2XHDA 1ZELA 1YLFA 2RVCA 4XF5A 4ZE9A 4WXDA 4NF4A 1G3SA 4O3AA 4I98B 5ITPA 4OINF 5KAFC 2KP6A 3ZMSA 5AA4A 4RAZA 1G0IA 2GBYA 3G71I 2RNJA 4PFTA 3UGWA 3ZQ7A 2I48A 3U1KA 1IMFA 2F97A 4MHGA 3JZJA 3K6VA 2IA4A 3GCMA 4OANA 4P8BA 1QVUA 1NNTA 3OYCA 1A04A 2XWKA 1FPIA 4GXAA 3I59A 2DQVA 2F48A 3CRBA 3DLNA 5GAHJ 3MZYA 3NOHA 2CS3A 4I0AA 2F34A 1USSA 2F7AA 4M9XA 4GRIA 1S72I 1YYVA 3IK6B 4P9FA 1MQDA 3TELA 3TDZC 3TQNA 4MLOA 2C6YA 2HVQA 3J81K 1W7PD 5LGNA 2O5RA 1XT8A 3HB9A 3FBNB 2MD0A 3CC4I 1JVYA 3EHTA 2VBZA 3U21A 1ZK8A 2L9VA 4PFWA 4HRIA 1LAHE 4WF2A 5FKMA 4XMYA 2K9NA 4LQ2A 3HPGA 2O1LA 2STTA 4WKMA 1BI0A 1A54A 3HM5A 3GZ5A 4MTEA 1S7YA 1QPMA 4S0HB 2EIKH 5J1UA 2GXAA 2R7DA 3JW4A 4PJLA 5LHHA 4TQUQ 4Q48A 4LATA 4FE7A 3S2HJ 1T08B 1O57A 5HLIA 5M2VA 1IF1A 2ZYKA 2CO5A 5LRSA 4G8MA 4OVTA 5HPQA 3MMYB 3GW2A 1KU9A 2UVJA 2R7VA 1USYH 2DAOA 3ECHA 3MEXA 4I0BA 4QRZA 4G8XA 2CRGA 4EGYA 4H8IA 1EH6A 4ELQA 4IQ4A 2HI3A 2FQ3A 3EQ1A 3N26A 4U2RA 1GLNA 2O7UA 3TCFA 2Z5UA 3GWZA 3GFLA 4PUSA 2Q8JA 1FBFA 5I84A 4L9TA 3UORA 2OQRA 2Y0MA 5D5WB 4HZFA 4F92B 3Q0WA 2DXIA 3Q3SA 4P3LA 2H8WA 4ZC3A 2F5VA 2HYJA 4OIQF 2XXIA 1NV7A 2V3UA 4RNSA 1WJBA 2V9VA 3C32A 3QMFA 3GTGJ 3MJNA 1H88C 1OLCA 3J80K 2ZNZA 3O3KA 2VBXA 4EXLA 5L3CA 2W85A 2GRVA 3KYDB 1A8FA 5ET7A 1OQGA 2R8TA 3FJMA 4ZS9A 3DKWA 1TLHB 2ME0A 4FE4A 4CO8A 3M1CA 1Y3PA 1EZOA 1J1NA 2CZHA 3FV1A 2A6HF 3HJEA 3HOTA 4HE1A 4U1ZA 4E7SA 2VGQA 4N07A 1BBYA 1FWZA 3GBGA 2DA5A 2WTEA 2DYXA 2VBWA 3TEDA 4A3LJ 1R9QA 2QCOA 1IMEA 4H65A 3ZKLA 3HRUA 2FF4A 4WXCA 4H6DA 5F08A 3LSJA 2BHYA 2V1UA 2J5OA 2M4KA 3FM3A 3T0JA 2RNGA 3QU3A 4KIBA 4DI4B 1KYWA 4DNCA 1R9LA 3TTLA 2VT5A 4I62A 4FX0A 4H5GA 2FUG2 2P5VA 2ONSA 2A6EF 4G8NA 3T66A 1T0FC 2AHQA 2EQRA 3ZMZA 2NOJB 1A99A 1QUJA 4YIRX 3ABUA 2LY1A 3OSGA 4K2EA 1PUFB 1LB2A 3EF7A 3PUVE 3OYEA 2WADA 1XGOA 3IOUA 4UUTA 1DUXC 3RKQA 1JUMA 5FRMA 1MBEA 4PGPA 1TT1A 4XIGQ 1Y1MA 4A3MJ 1HSJA 2V26A 2F4MB 2Z22A 4R6HA 1LKXA 5IP9J 2DXRA 3GUDA 4BAYA 4XLFA 4F1VA 2WV1A 1P6RA 4KYWA 4R9FA 2NWJA 2GFEA 4IY6A 4RJZA 3KIOA 4E70A 1YJWI 1KU3A 5DCFA 3K1PA 4G6QA 3WU0A 4AVPA 4OIRF 3S1NJ 2KFDA 5AONA 1BW6A 5IY5H 1FX7A 1LBYA 1M5DA 2ZZWA 3E3KA 2WKYA 2VBYA 1V5FA 3I3VA 4BE2A 1H43A 4F3BA 1LFGA 3HO7A 3RGYA 3V8XB 3I58A 3VYUB 5HLGA 1QA6A 1MDMB 1VNDA 4POWA 1PC3A 5DVJA 4RM2A 3CLOA 3FHZA 4HNTA 3M3KA 2DCEA 3VLVA 2V3QA 2EV5A 3T93B 1OQHA 4ZDOA 1YAEA 2ZKZA 2Y48A 4TOZA 5IZ3B 2JUCA 2IGNA 5F1JA 3OO8A 3CCLI 4RY1A 2DFHA 2XV4S 5I56B 2O0YA 5FHNA 1QGPA 3TTRA 2DA1A 2JWTA 2DDKA 3S9LC 1Z1DA 4RM3A 2MA3A 1K78A 1FY7A 4RB2C 5FHMA 3ECRA 1BIAA 1ZARA 3F3XA 1ZN2A 1QVSA 2Y9YA 4OU0A 2PMSA 1FYKA 2A05A 1YW8A 2HTSA 2QUFA 1SYIA 2XD3A 2M0CA 2M9HA 5AE4A 3T9VA 3BJAA 2IW5A 4UVBA 1LLSA 2JVGA 3VODA 2O69A 3QIMA 3VXCA 2DE4A 3FXRA 1Y1VJ 4FETA 2LY9A 3FMSA 5HS7A 1HOMA 3FXLA 4L18B 3GFIA 3RQ4A 1DP3A 3QYTA 4NF4B 2XB5A 3BP8A 5LLQA 3S3MA 1E3OC 1Y4TA 1OIBA 4RA1A 1T6SA 2VQCA 3SZGA 1GVDA 1H89C 4PAFA 5AA3A 2L9RA 5ILVA 4KNYA 2RKMA 1MDP1 1JI8A 1G4DA 4BKXA 3IWZA 1TWGJ 3FV2A 4N15A 3H7MA 3MW0A 3PUYE 2E2IJ 4GYGA 4NBQA 4A3KJ 3JRCA 4EM2A 1JT6A 4GWSA 3B6AA 2EA4A 2ELJA 4PZJA 2LRDA 4PGGA 2L4AA 3U94A 1ZKGA 2NS7A 4ELRA 2CZKA 2W25A 1V54H 2QM3A 2L7FP 3FVKA 3GFMA 2VJIA 2FJ1A 5L3BA 4AUXA 1RIOH 3HEFA 2DE2A 2XC7A 1LFUP 1VQ4I 2XXRA 3D0SA 5FKLA 1USYE 2N8GA 1FMWA 5L3GA 3F0CA 1KQ8A 3CZ6A 1N0TA 4N4NB 3DBHB 1OLTA 4DOZA 2GIZA 5D5VB 3C33A 5JR3A 4ZYAA 3MSTA 3MQ9A 1B8IA 5LDZA 5BOXA 1RRJA 3IFCA 4A3BJ 9ANTA 2R3SA 3PPOA 1FBDA 4Y33A 3G7WA 2QF7A 3TAJA 1FQBA 1SVXB 4DIGA 1I39A 4R73A 5LHGA 2K7LA 1FBHA 2WYPA 4OVSA 2Q2EB 2Y30A 3EN3A 4CZCA 5J1YA 1SPIA 4MIMA 4YFNF 3IB1A 4OYVA 1HW2A 1XOCA 4RK2A 2QMXA 2Y0SA 1XB4A 4IJAA 4M6VA 1XCVA 2VJJA 3OYBA 1GGGA 2OQGA 2MLKA 5FB2A 3I6VA 2B65A 2YR2A 3FASA 1IMAA 3S32A 4NTLA 3T9HB 1XN7A 1IRZA 3H5NA 4Y7NJ 1FTZA 5LOMA 2V9PA 1LE8B 3A29A 3RTWB 2M1BA 2VQLA 2XRNA 2DSFA 1OVBA 5FTHA 3Q0UA 4D9JA 4XLCA 2Q0OA 1JEUA 2Z9OA 1H44A 3K0LA 1I50J 1SVLA 5FFXA 4A2UA 2ZZVA 3K2DA 4OMZA 4NN3A 2L5VA 1TT0A 1EZPA 2E2HJ 4IHWA 2BXYA 3FWEA 1A36A 3QPTA 1XSDA 4P9UA 2GOMA 1EF4A 2IXSA 1LAFE 1Z3XA 3PM1A 3K4BA 1WCMJ 2F6CA 3QODA 3KN7A 1T95A 2FE3A 3I0TA 2DK8A 4CCLA 3PTYA 2IA0A 1RI7A 1G6NA 3RZDJ 4PFOA 3S16J 3C2GA 3O9PA 2PBIA 5EDNA 2GA2A 4P47A 3G2BA 4BDMA 3K10A 3KFWX 1Z7UA 4XOPA 1FQFA 2PMZN 4ESBA 3I56I 3H4ZA 1OVTA 3DLAA 3HIFA 4U88A 2Y69H 2ZJ2A 4EJWA 2UVGA 4FATA 2LD5A 3C1DA 1DOTA 3TW7A 3CR9A 3C7JA 5K2XA 5B7DA 2YS9A 4KXPA 5K5QA 3A09A 2OZUA 3E6DA 2NS0A 3I64A 1ETYA 3U72A 5E3MA 5H8QB 1NG7A 3WU2C 1RDZA 4QF9A 3KC1A 3CO7C 2I6EA 2M30A 2R7QA 1U3EM 2KJCA 2M3AA 4XEQA 3TL4X 2PEXA 3PFIA 2IS4A 1B0HA 3CMEI 1QW0A 1WJCA 4DZPA 5M5YJ 3DBLB 1E2XA 1Z77A 5HVQC 4PCQA 1JW5A 3HCQA 5L8DA 3TCGA 5HLHA 4ECFA 2CG4A 3L2QA 4BDYA 1N75A 2B3FA 2FYIA 4A3CJ 3ZKKA 2PFZA 3NAUA 3TTMA 1MBHA 3SEWA 4A3FJ 1R4NB 4NNJA 4GWOA 3FIRA 5CVJA 1TQMA 3KEOA 5CVRA 5FRNA 1SAXA 4GBWA 4XKNA 3S1MJ 3JRHA 5DEQA 2CGPA 1E17A 3KZZA 4IZZA 3GBAA 3TFLA 4BYYA 3GXOA 2O9LA 2YPRA 1HDDC 5CI5A 4GIZA 3ZRGA 4IO4A 3VV5A 3GTQJ 4LVQA 5KZTA 3G1LA 3BG7A 4ZYHA 3CF5F 2Y5LA 3OO9A 4NG7A 4X1BA 4JX6A 3RPUA 1N76A 3A01A 2OZZA 3CLQA 3ZSFA 4E7ZA 3L2UA 2XAQA 4ZEFA 2DMUA 3HHHA 4N0BA 1H9TA 3QOEA 2FBHA 1IRFA 4P55A 1NUYA 2R7TA 1TP4A 5J16A 1Z3YA 2DTRA 4MIJA 4LITA 4R74A 4BGDA 3BR0A 1JTYA 1TW2A 2CMPA 1A5JA 5DYHA 3F6OA 4YFKF 3WG7H 5HDNA 3EDPA 4MHFA 1O3RA 2EFOA 5B3SH 4B09A 1JHHA 2DPDA 4IHTA 4CXFA 4GFBA 1FEXA 1WVJA 1RR8C 2P7CB 3H6WA 3KBRA 2JT1A 5BNGA 2GH9A 2I3WA 1R71A 4XICA 4NC7A 5C4XJ 3GZNB 2P5KA 2Q88A 2I5UA 4ZEIA 4E7IA 3H3ZA 4ZE8A 3K02A 1LCFA 3MVWA 4B8XA 5FLVA 1VE4A 1L0OC 2WA0A 2GAUA 4RLFA 2HEUA 1E3HA 1BJZA 3F23A 1ZG3A 1VQOI 3WG9A 3RQIA 1FTKA 2X1DA 2I3VA 3AG1H 1IRGA 2XGEA 2EH3A 3R0JA 2O3FA 4ZDPA 4PDHA 1U78A 3W15C 3CVGA 4GDFA 5IM2A 2CUJA 2F5FA 1WVRA 2X0LA 3PUXE 2B7EA 4BBRJ 3WE2A 2VT2A 3DFGA 1U5TA 1JJ6C 3LFUA 4XNFA 1NV3A 3CCUI 4LA9A 3UR3C 5CRYA 2ELHA 3JCUC 5EGOA 3EYIA 4PE3A 1F36A 2HQRA 1XGNA 2EB7A 4Q4ZF 3HFUA 4OVJA 1Y8RB 4BQQA 5EZGA 2E2JJ 3MYUA 2H5YA 2MFZA 2F7CA 2DVCA 1QQIA 4M1VA 3BPXA 1I6HJ 2ZMBA 1I1GA 3VPRA 2QBYA 4RGXA 1SYHA 4JP0A 1IV6A 1H76A 2ZNUA 4HG2A 3PSFA 3TBIA 1MPCA 2R7FA 2DDBA 3QP5A 1RDYA 2ZFWA 3D5LA 4P0GA 2R92J 1D0XA 1MH3A 5FD6A 5HS8A 1JVXA 3CJTB 5LGUA 2KQRA 4C1UA 2LH9A 4CCNA 1OKRA 2XRLA 1POGA 3D5SC 1B5JA 3VB2A 2UYFA 2DK5A 3FX3A 1D5VA 1ENHA 2ISZA 4PGNA 2F4IA 3FZVA 2PYYA 5E17F 5K2YA 2IT0A 4AIJA 3H92A 4A3JJ 1IXGA 4Z7EA 2DFEA 5E3NA 2HS5A 5BMZA 5IGAA 2VOPA 1RNLA 3V7SA 1J5YA 4UUVA 3BCBA 3M1EA 1S6LA 2WBBA 1O3QA 1D0YA 2QVUA 2HZLA 2MC4A 2FA5A 1XMKA 1S5LC 3N05A 1LDJA 1LJ9A 2FSWA 2HWVA 1US4A 5FJ8J 3FVGA 3GLLA 3CMMA 3LC8A 3NEUA 2I8DA 1LE8A 4F19A 2M4GA 4JB7A 1WHUA 4MQ9F 1IN8A 1PP7U 1WODA 2OLBA 2DA4A 4DYQA 3LQRA 2F5CA 3OYDA 5JI6A 4XM3A 2Q9TA 2QEXI 2M45A 3WGGA 3GFJA 1I6QA 1ZLJA 3M3YJ 1MBKA 2W4SA 3KPHA 2XF7A 4KJZA 1BOAA 5DUKA 4HW8A 1LDDA 1U8RA 4BDNA 2DE3A 2ZSIB 2PI0A 3KZGA 4NF8A 1Y0UA 1MSFC 1TWFJ 1FTMA 2OJTA 2VOZA 1HKSA 1MZBA 4DIQA 3B73A 1YIOA 5LGTA 3CCEI 1A8EA 3DTIA 3G3GA 2M2EA 2E1MB 5H8HA 2OU2A 1KU2A 3HTSB 1B3EA 5HNHA 2F3BA 4X6AJ 4DCXA 6PAXA 5J8FA 4HS7A 4NAPA 3I53A 4I76A 3G3HA 4ENMA 1S9HA 3CQZJ 1O4XA 3D5RC 2CEYA 1NNKA 4DBQA 3FXOA 2P7VB 4XL9A 4M3FA 4G61A 3LSLA 3GVAA 1RZ4A 2MH9A 1NV2A 2VJ4A 1UAAA 2F5XA 2V3TA 3KP3A 4A3GJ 4OFLA 3BOQA 3J81Z 2HYFA 2ZC2A 1EZ9A 4HQEA 4EQQA 2V4JC 5KHDA 3BFUA 4OFJA 2R5ZB 1SFXA 2CQ7A 3K6XA 1WH7A 1LBZA 3AG3H 3R61A 1E0EA 2ICWG 4GF8A 4HF0A 5FKKA 4OENA 5H6RA 3HSFA 4RAFA 1CF7B 3SDBA 1S3JA 4O3CA 4L5JA 1Y1WJ 2XAJA 3FDYA 1FBGA 3DEEA 2HYGD 4NHJA 3ZQHA 2HQNA 1LDKB 3HPIA 4G2ZA 5A5XA 5E3OA 3OMBA 4ZEDA 1B05A 4G94A 2VKHA 4AB5A 3ZPLA 2A3SA 4LB5A 3NWSA 3PUFA 4BE1A 4AVZA 4X04A 5FBPA 3MKWB 1K79A 1R5ID 4BS9A 4KISA 5JLWA 3IP4B 3S9MC 2WEFA 2DWHA 3K9TA 3WTWC 2XXQA 3T1BA 4PFUA 3ZQLA 3FVNA 1FRPA 2BY1A 4GWWA 5TU0A 3SJMA 4HX8A 4KICA 1FPEA 1X2NA 2F2EA 5F64A 2HPMA 5DVIA 3VYRB 4X8RA 5F7VA 4ETSA 2W48A 3E97A 1Y1ZA 5D4RA 1QUKA 3DV8A 3FD3A 1LBBA 1Z7NE 3H1CA 2H99A 1SFKA 1HXDA 3F8FA 3FXJA 3U2RA 4RXLA 3DKXA 3EUHA 1IIWA 3IJOB 4L9JA 2YUSA 1MQHA 3CP8A 2G29A 1EU8A 2CUZA 4LD5A 3PV0E 4PETA 2M0MA 3EETA 1IDZA 3C4MA 4M9SA 3OYFA 3CCSI 4AIHA 4XRMA 1EH3A 4MF3A 3O6GA 2D1VA 3WTUC 3HGGA 5BS6A 1NV6A 4I1DA 1G3TA 1SMTA 2QS1A 4YKPA 1P1NA 5FLXK 2K85A 1ON2A 4PBQA 3OOAA 1N77A 2DYRH 4PGHA 4CICA 1I6XA 2DT7B 1FQDA 1JJ8C 2F78A 3SQNA 1YX3A 3BROA 2KZVA 1LVKA 2H1LA 2M7BA 3OR2C 2ZJRF 3T8RA 4LGWA 1RUOA 3ONMA 1RKMA 4F3PA 4CSWA 3REOA 4CYCB 3SERA 4H5FA 4PBHA 5I59B 1B9JA 1ZIUA 4H67A 3G1OA 3OYLA 1GHCA 1AL3A 2KIUA 3L2CA 5J40A 5ISUA 1SC7A 5ICEA 1PDAA 2ME6A 5TPAA 3IAM2 3JRDA 1NUXA 2UVIA 2XSJC 1BC8C 1FIPA 3MBPA 3CUQC 2DDAA 3O97A 3PUBA 3P9CA 4GVOA 1KU7A 4UB8C 1NV5A 2DYSH 4CCOA 3OD7A 2CU7A 3S93A 1F9BA 4HE2A 2KLOA 5E18F 3BR1A 3KLOA 1K4SA 1LGBC 2P3NA 3LUZA 2KIMA 1GT0C 4X1EA 3BQYA 3OYGA 2ZJPF 3LMMA 3VEPA 3CUQB 3D4CA 4N9IA 4F3QA 3PMWA 4G6TB 3K2ZA 4IO2A 1ETKA 2CV0A 4AQ4A 5IT9Z 4LP2B 2EZHA 1NI9A 2EWNA 1UTHA 1WPKA 5F1RA 4M9ZA 3MVPA 4MX6A 2AXLA 2XPVA 4BJ5C 2KPMA 2AS5F 1FPQA 2VKEA 3FMRA 4EM0B 1ZHFA 3U8QA 5HDKA 1K83J 3I9V2 3BJ6A 2Z3YA 2VODA 2Q1ZB 1XSVA 3H5RA 3I71A 3CCVI 3NWTA 2UVHA 1G3WA 2QVOA 3LNQA 2WYKA 4NMYA 4RB1A 3KP2A 3QSLA 3CUOA 3SEXA 1W5CC 2CH0A 3BCAA 2ZMEB 2D5VA 1J9IA 1YXIA 4P96A 2Y7RA 4EF2A 2Z1DA 3K4CA 2V79A 2W24A 4Y3OA 2WAQA 3Q25A 4G68A 3RTFB 5D8LB 2XXYA 3P7IA 5HBCA 2UXNA 4IKFA 2FEZA 5F0FA 3SHFA 1FPDA 3F6VA 2F36A 4BDQA 1MH4A 1WI3A 3OYKA 2VPRA 1RR7A 1B6HA 3CFXA 1S9TA 1Q1VA 1P2FA 3DQVC 1O64A 2NVXJ 1R5HA 1WJ5A 2FMLA 3KP6A 1JKOC 2VOOA 3FVOA 1WJDA 1IG7A 1TWYA 3IHUA 3ZR8X 4EXKA 4R1HA 3ZN0A 1P7IA 4GCVA 1OMIA 2H6BA 4QWQA 4JYKA 3CSGA 2JZYA 5DM6F 1P1UA 1FOKA 3TKYA 1UG0A 3FHNA 4G8HA 4FIMA 1TWAJ 4U1OA 3PNVA 1O3TA 2GWRA 1NK3P 3E13X 3TCHA 4XSXF 4AWXB 4KHZE 1P4WA 4N6DA 4YB6A 4R2BA 1B9NA 1JP4A 3M9AA 1KA8A 3HSTA 1B4ZA 1VFDA 2XA5A 4QFLA 2ZJQF 1OYIA 3F8CA 4BXUA 2JSCA 5EHMA 3KP7A 1R1NA 5LRRA 4MNCA 2L54A 2VKDA 2DOFA 2HZDA 3S2VA 2GHAA 5CC2A 2Y5KA 2ZBKA 1B5HA 3TMGA 1M5FA 3ASNH 5IOZA 4KD5A 4UABA 1E3PA 3I59B 5LBQA 2JRTA 2LOOA 2R5YA 1YPNA 4RK9A 1BL0A 3N5LA 4JWOA 3HDDA 2MABA 3LQQA 2H6CA 2TCTA 3GEZA 3IX1A 3LV0A 3IUOA 1FQCA 1TL8A 1RKTA 2EK5A 1URSA 5LD2C 5AA2D 3P5JA 3PPNA 3N97A 1SW5A 3GTLJ 1PB8A 3FKIJ 2I0CA 3I5OA 4NF5A 2KL4A 5F1QA 5TPAB 3RN8A 4YMAA 4XRSG 3T8TA 2F6PA 2O6AA 4XKQA 1T0FA 4U87A 4O5VA 5J47A 1IUYA 3SDGA 2XXKA 3A0BC 2OZ6A 2ZNTA 3JYRA 3M8JA 2M5WA 1PBPA 1MIJA 3K01A 3JRFA 4ONYA 3I4MJ 5E1ZB 1OCZH 2OWZA 3HV1A 3VDXA 4M3GA 2X4HA 4XQFA 2A69F 3V7RA 4U7BA 1BI1A 2HEOA 2NVTJ 3G3JA 4OXVA 4RMNA 1IITA 3GLXA 4TV7A 1O63A 1DTGA 3RCOA 4GWZA 4EATA 1RKWA 2M8GX 1A31A 4IHSA 1IUDA 3RYDA 2D2WA 2EV6A 3KE2A 1ANFA 2AQFA 1QO0D 3V5AA 1VQ8I 4F18A 3E6MA 4IY5A 4M3DA 4D0PA 3LSWA 2TRTA 3HOWJ 4X9TA 5A2QZ 2B3BA 3KSJA 2YX4A 1DK4A 3RPQA 3LSPA 3K1NA 1OJLA 4HE0A 1HSEA 4NF5B 1SVMA 3LSRA 2MD5A 5ERIA 3PSIA 2XWVA 2KIQA 3RTRA 5JVGF 4F22A 1XX5A 2MLGA 2Z99A 2HXIA 2F5DA 4EQBA 2D45A 3J7YJ 3ZCOA 4ZH4F 5I2KA 3ERED 4EQ9A 3K4JA 3ML6A 4YRVA 2IVMA 2Q2EA 1B32A 3TO7A 1K9ZA 3ESWB 2WY7Q 3IH4A 3HHFA 1R23A 2OAZA 3GX4X 3FM5A 4EM1A 4BL0B 1OCTC 2KQZA 4FJPA 4WXHA 4CGZA 1FQEA 4JXIA 4MMPA 1YOVB 1FOYA 1JW1A 5JVTA 1G3YA 1X1DA 4EMSA 3EKIA 4EJTA 2XWOA 5JEIA 5CM6A 1K9YA 2B4LA 5DS9A 1XCBA 3MWMA 5FTIA 3KJ7A 3PQJA 1VZ0A 3M3FA 3H36A 3SZTA 1XDUA 3B02A 4F1YA 3KYCB 3LAJA 2NNYA 1I69A 3C9HA 2X6OA 3IOVA 3HZJA 5CYVA 1GV8A 4F3SA 5D8KB 2VT3A 2M34A 3LSMA 3ZGKA 3BY6A 3ZMTA 3DP4A 3KC0A 4O7MA 3FXMA 1I3QJ 3EQLF 5HODA 2DWAA 1FNNA 2O7IA 3LSFB 3CJQB 1Y0NA 1ZGWA 1NTCA 4V2FA 2JA8J 1V55H 3B50A 3KP5A 3VOEA 1B6AA 2ZZXA 4QSCA 1ON1A 3PNYA 4YELA 1MJAA 4QXDA 2DW4A 5EQ9A 1B4HA 4B3XA 4ESWA 3KZIC 2WY8Q 3K70D 1HF0A 1KA1A 2HAUA 4C0RA 3G3FA 1B8IB 5J6XA 4MFIA 2CFXA 5KVRA 3P7NA 1Z91A 2VN2A 4LFUA 2DTZA 3A2KA 4DXUA 3E0JB 3F8MA 4KYDA 4O3BA 4W97A 2WWYA 4PFIA 3M8UA 1QHGA 2DMNA 3I4NJ 2DU9A 5BPDA 2IJLA 1VR5A 3CFZA 2XSDC 3TDJA 3HSEA 4BE0A 4KMFA 3K4MA 5IPAA 2KZGA 3C18A 1W5SA 3P9IA 2PJRB 1XMXA 4ISUA 1VQLI 2IGOA 1LBXA 3MKZA 3ZQCA 3UNGC 2A68F 4I01A 2IS1A 4LK1F 1BR1A 2K3PA 1B0LA 1OLAA 5J1DA 1QNTA 2HU9A 4NDLA 2XB0X 1ZJLA 5D6FA 2BXZA 1D1CA 1OCOH 3HOXJ 4CH7A 2UUZA 2LC2A 3HKZN 4NC6A 2FU4A 2XGXA 3PUZE 3TQWA 3TOBA 5CBRA 1RDXA 3HUGA 4KT6A 4UB6C 1O7LA 3J7AY 3L1PA 1LEBA 1J0RA 2DBBA 3H9GA 2ZSHB 4C3HJ 2HOEA 4MTDA 3CCYA 1L3LA 3ULQB 4PE5B 2R7WA 1B7HA 3ZXSA 4KPTA 1FZPB 3S9NC 4YEJA 3V42A 3GZ6A 1MRPA 1B3GA 1LPQA 2OWTA 2LVSA 2E19A 3R60A 3FK7A 4X1DA 1H0MA 4P56A 4DJAA 3VVFA 1W7PB 3CDHA 4EDPA 1VQ7I 1U2WA 4MH5A 4I8CA 2B0LA 2M87A 2QMWA 3GTMJ 2EFNA 2LF8A 3OEKA 5DYMA 3TGNA 4ANJA 1ZRFA 3B6CA 1SMYF 4I02A 1II5A 1LCTA 2JPCA 2OX3A 3KP4A 2TDXA 1DQUA 2YU9J 3G4SI 2KRFA 2HQ0A 2ONRA 3D4GA 1SI1A 2E1NA 2VI6A 1QKAA 2GQ1A 5I57A 4QFKA 5LTCA 1ZGAA 2EJRA 2NOGA 2XXTA 2ZXTA 1WRJA 3U1OA 2FA7A 3OSQA 1R36A 3VSLA 3DELB 4RPOA 2XPWA 4IGTA 4YB7A 3O6IA 2HXOA 3MN2A 2L7KA 5ICFA 2W84A 1QVTA 1QBJA 1YYZA 3CP2A 1ATGA 1Z05A 2HR3A 1TC3C 3Q26A 1JGSA 2Y7PA 2Y7WA 1NHAA 1HQCA 3DTEA 2I49A 2FVZA 3Q5FA 2RC4A 2L7MP 1S7OA 3DU6A 3X2QH 1G0HA 4XIDA 4V19K 1SD6A 3F21A 1MM7A 2Z8DA 3GTPJ 4P9KA 1IXCA 3QWLA 3VDFA 3PD8A 4POXA 1B46A 2CW0F 1POY1 3F9KA 4QSEA 5J3LA 4N4OB 3H6TA 5BUUA 1ZQ3P 1B7ZA 1FQAA 1X1AA 2LDUA 2ZMEA 4BQOA 2P4WA 3BTCA 1U0JA 3K4NA 4H1XA 4IB2A 4JX4A 2QRYA 1KGSA 1SW4A 3VFJA 3FKJA 4IPAA 1GV5A 1T98A 4Q5TA 3KYLA 2YSRA 3UK4A 3B6TA 3T22A 4GLIA 2D3IA 4GX4A 5CPRB 5I5PA 1TT5B 2VE8A 2XD2A 2I10A 4K3FA 3SEZA 5ELVA 4TLMB 2W1OA 4F7ZA 1O7FA 3ZN1A 2V1XA 3FF5A 3J80Z 2DA2A 5D5XB 1N7WA 1LFBA 4ON0A 2XUBA 3MWBA 2CYYA 3H0DA 4OIPF 5ET8A 3RNNA 4IO9F 2BY3A 2BW3A 3OL3A 2DP8A 3BR6A 3QP6A 5KDTA 4FCYA 2W57A 3WAEA 3GYHX 4S05A 2HOSA 1ACIA 4FAJA 3BTJA 1PEBA 1U8BA 3DU5A 3Q28A 4AYBN 4LIUA 2UV1A 1JQFA 3K6WA 2FBKA 1W1WE 2X6XA 4FTHA 3WTYC 5L3EA 2QA4I 1CF7A 5J4YA 1ZKBA 3MP8A 2JVHA 4IGRA 2O03A 1XVYA 4I09A 3T96B 3U92A 4F2QA 1FTLA 3MD2A 4ZZLA 2I0BA 3KEYA 2HVRA 2BGCA 2O6GE 4CYDA 1OR7A 3KOTA 4N9HA 3SFIA 1N78A 1WH5A 4KFCA 1MMNA 2CFOA 1LB9A 1WKMA 4OZ9A 2LG4A 2RC8A 1BR2A 1UTBA 3ABTA 4IRGA 1J09A 2VD2A 1UIUA 3K4LA 3DPTA 5FROA 2H1KA 2UXAA 4HYEA 3BFTA 2KIFA 5J8CA 2DFFA 3VFZA 2J5PA 3O8GA 4L17A 1XG1A 1FOXA 3TP3A 2AIXA 5HM4B 1T0KA 2NS8A 2CUFA 1G2HA 1I6BA 2XKPA 4B1RA 2QS3A 2XXXA 2EPFA 3TO6A 4X0GA 3OS1A 2QQ9A 2XXWA 4IOAF 3T5XA 4P11A 3IWFA 4D7NA 1ZRCA 4E6KG 2P0WA 4WWCA 2R9JA 4XLEA 4WK8F 4BHPA 5LEKA 1BKAA 2DMPA 4BEHA 1MDMA 1H9GA 3AG4H 2BY0A 4JWXA 2RINA 3IOWA 5IAIA 4LG3A 4PDDA 3ZMUA 1QU3A 3H3VK 5JFRA 4LK0F 5GTIC 4YB5A 2P0SA 3CIJA 5IZ3A 1UHWA 2ADUA 1PBQA 4N13A 5EG0B 1VQ5I 3MZ1A 1D1AA 3F8BA 3CESA 3CJNA 4QSHA 5EEGA 1VSOA 3FGSA 4NF6A 1XVXA 2QS4A 3G3ZA 4GWUA 5CMKA 2G7UA 4JK1X 2VQGA 3FMQA 5EZHA 4DZ1A 3BJOA 3E6BA 2MBFA 4LMYA 5T3JA 2EILH 2WAQN 4BNCA 3WTXC 3OO6A 3HOSA 3M8EA 1QULA 4MFEA 4QTRA 3MAMA 3C34A 3VYSB 1BC7C 3MVYA 3MZ9A 2JN6A 4WEPA 2DI3A 5IYBJ 2NOOA 4JDFA 4UUSB 2X9DA 4IX7A 2OTLI 4PFYA 5TJJA 2H98A 1LAGE 2LSOA 5DDGA 1S29A 1FTJA 2ZXJA 4O94A 4MEYF 3FUZA 2X51A 1MXZA 3BC8A 2MYSA 3U1DA 2A5TA 1ZMGA 5BWJA 2R4GA 3DEWA 2KT0A 3A0HC 3HRMA 4GX3A 4AS5A 3W3CA 2EA2A 3RKXA 4OTEA 1UZCA 4M6YA 4NE4A 1PB9A 2Z23A 1SAUA 4HLXA 2ECCA 4E4HA 2GIVA 4ZDMA 3OYNA 1IW7F 4OAZA 4KA4A 2H27A 3RT8A 1GVCA 1LEAA 2F6GA 3TEPA 2DJNA 3OIOA 5EHSA 3WODF 4N8YA 2VLAA 2A5TB 4QSDA 4XKWA 1T39A 3PO3J 1BP5A 1DCUA 3GTKJ 2ONKE 1MKMA 1VDWA 1OISA 1D1BA 2CUEA 3L9FA 3FXKA 1DGRM 4PJNA 4GBVA 4XK4A 5H8HB 1NFTA 3C3WA 1LEVA 2IEEA 4L9NA 1OPCA 4D1QA 2JK3A 4BLAA 3VVDA 2ID3A 3KG2A 4LZ7A 3TUSA 1MBGA 5DCMB 4GO1A 3ODBA 4LQ5A 4EEFG 1KA0A 2ZXWH 1K6OA 2IRFG 2CSOA 4OEUA 1IV8A 1W36D 2PCRA 3COAC 1YJNI 2HKXA 4NF0A 2H9BA 4EJVA 2E1OA 2LY2A 1X4OA 3JRBA 3O2AA 4DGWB