3K1MA

Crystal structure of full-length benm, r156h mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
300
structure length
300
Chain Sequence
MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
publication title Structure of Full-length BenM
rcsb
source organism Acinetobacter sp.
total genus 96
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3k1mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3k1mA03
3V7SA 1N0TA 4LLNA 4H8JA 1B32A 2DI3A 4A0XA 2P4WA 5E8GA 3IC7A 5K5OA 2DWAA 1ZLQA 2HGCA 2NXOA 4OMBA 4A2UA 2LSOA 3PPPA 4G77A 3C32A 4KCCA 1MM7A 1JEVA 2BGCA 3CIJA 3ZMVA 3DP7A 3R7XA 4OTEA 4WKMA 4QFKA 2KLFA 1JETA 3CG3A 5HPQA 3QOPA 4WXHA 2ZNZA 1BI1A 2ZMEB 3MP6A 3ROUA 1ZBMA 4Q48A 3MZ1A 3BP8A 4P11A 3P9IA 1ZGJA 5I56A 3FWEA 1WKMA 4LZ5A 3KSXA 2HCAA 4EF1A 3C9HA 4I2OA 1LEAA 2EFPA 3GBAA 3SDFA 4KMFA 5HOOA 2EK5A 5IT9Z 2COMA 1EH8A 1KGSA 1EZPA 1MY2A 1UFMA 2D45A 1XC1A 2DT5A 3DM0A 2IA4A 5CMKA 4H5FA 3IOVA 2VODA 3TTLA 2XASA 2MH2A 1F1ZA 5L3DA 1SQYA 4F3PA 1J2XA 1MY0A 4FEDA 4MLQA 1H0MA 3Q27A 5A5XB 1TQMA 5IAIA 2F7BA 3T9UA 1BC8C 3KP4A 5CLSA 3K2DA 3EF7A 4HYEA 4R73A 1I6XA 3O6HA 4OZ9A 3KSJA 1KYZA 3KJ7A 2XXIA 5D6EA 4OWDA 1F4KA 2Z99A 3GZGA 3I53A 3L09A 3PPNA 3LSFB 2XKOA 2NOOA 4G8HA 2P5LC 4H6DA 4EF2A 2XAQA 4OVJA 2RGVA 5FD6A 2UVHA 2H94A 2HOEA 2YX4A 1HKSA 1B40A 5FLXZ 4AB6A 4HF1A 3IO6A 5CRYA 3QRFF 3HV1A 1PDAA 4IHSA 1P99A 3TKYA 3V8JA 1STZA 3WE3A 5TJJA 3RT8A 3TDUC 5D5WB 2RC4A 1URSA 1W5SA 4LGWA 3TEPA 4KPTA 1VR5A 2V9VA 2KRFA 3AXFA 1FTLA 1JQFA 2B3BA 2EFQA 4LMYA 1MH4A 4XKQA 1IXRC 2HQRA 2UXAA 2LKPA 2H6CA 4Y15A 5HM4B 4GL0A 3PPOA 4S04A 2V25A 4A6EA 1BIBA 5CMCA 1I1GA 4THIA 2ZNSA 1X3UA 5CMMA 2P6TA 5J8FA 5HDKA 4U0WA 4U0YA 2VE8A 4NTLA 3FV1A 4MHGA 2VBYA 4ESWA 3B7DA 5ICQA 4Z0IA 2PT2A 3QP6A 5LEJA 1I5ZA 4Q8RA 3PQJA 2P7VB 3HYIA 4UVBA 1EV7A 3T96B 1QO0D 3SEXA 1FTMA 4KYSA 3S4UA 3RNNA 3Q28A 4BDOA 1XB4A 1DPRA 4DNCA 3ZMSA 4NMYA 2DXRA 2QL3A 5FTIA 3GF2A 3FATA 3WAFA 3VFZA 1IXIA 1TT1A 2BBYA 4FT8A 4IO2A 3U94A 3M8FA 1HSEA 3U8QA 3C31A 2ANJA 3BJAA 2VT3A 2ZBKA 5CMBA 3FASA 4DZ1A 1MKMA 4QFOA 1XMKA 3K01A 2JSCA 3FX3A 1CF7A 1LAXA 2DE2A 4IO5A 1MPDA 4PQJA 5BQTA 3JTHA 4LQ5A 4XXUA 2XIGA 1B46A 3O6GA 1ZLJA 3VVFA 1ZU0A 4AIHA 1MXZA 2Q2AA 3O2AA 1IW7F 5H6RA 4GXOA 3I71A 5CVVA 1IN7A 2F7AA 4BQAA 3QAXA 2A3SA 3RKWA 1TBXA 3H3ZA 2EV5A 2GA1A 3IRRA 3MQ9A 3PMVA 3MZHA 4L9TA 1LDJA 1AMFA 3GYHX 1HKQA 3FVKA 3LQRA 2GAUA 5AA4A 5ILVA 1Y0UA 5JFRA 2EJRA 1OLAA 2E1NA 3CVGA 2ZYMA 5ISUA 1H9GA 1FLIA 4ASNA 3GBBA 5CM6A 1QZYA 3R61A 1FQCA 3FIRA 4PGHA 1P2FA 1UHWA 3I4PA 1AIVA 2ZO4A 4H5GA 3K1MA 1O63A 4GXSB 3C7JA 4XBFA 1G3WA 3LBSA 4YICA 1JGSA 4RGRA 1W7PD 2RINA 2Y7WA 2EFOA 4ZDMA 3I54A 4U23A 1O3QA 5ILUA 2NAZA 3M7GA 1O3SA 1AH5A 3UN6A 1US4A 2UXNA 3HTSB 2MH9A 2FA7A 4X1BA 2YR2A 3U92A 1DSNA 2HR3A 2YU3A 3GUDA 1M5DA 1VFEA 5I84A 3RYPA 1UTHA 2Y84A 3UP9A 1D8JA 1MQIA 1MDP1 2H98A 2BJJX 2RNJA 3SZTA 4L5IA 1N7WA 3TPAA 3QYTA 4N6PA 1YLFA 2P7CB 1R9LA 2JRTA 3RTRA 2NRAC 2HYGD 3MP8A 3S9LC 1IRGA 1Z7NE 4Q4ZF 5L3CA 3D4GA 3K00A 1GV8A 3JYRA 3R0AA 3RY3A 3GZ5A 2ISZA 2STTA 4EM2A 3T5XA 2OZUA 3V7CA 5K5QA 4YB7A 1B3EA 3KEIA 2E1CA 4F1YA 1KYWA 3CUQC 3KEOA 1UQWA 5DV5A 2A5TA 3LAJA 4GOTA 2DBBA 3KLOA 3HSEA 1MXVA 2W57A 4EQBA 2P5KA 1CB6A 1B51A 2OLBA 4GF8A 2NVUB 5DUIA 5BPIA 4HQMA 1CF7B 3IK6B 4UV8A 1VFDA 3PUZE 2NNNA 2MLGA 1A7LA 4XTCQ 1LSTA 2MLKA 1DPEA 4C1TA 2PN6A 4HV5A 4LATA 1W5TA 4DDDA 1T0FA 3VFJA 3K2ZA 5H8FA 1LDDA 2JTVA 2FNAA 1XSDA 3WTVC 3FVOA 3GEZA 4RY1A 1AOVA 4TOZA 1FW0A 2I3VA 1Z05A 4JBZA 2DVCA 3OENA 2OD5A 5ITPA 4MQ9F 3GLXA 4I7HA 2GHAA 1Z6TA 5AA4B 4H67A 2O84X 4CDGA 2L01A 4KNYA 1WVJA 1TXFA 1R6ZA 1O57A 1AL3A 1MQJA 4QHQA 4KCDA 2ESHA 3FMQA 1U78A 2XKPA 3TTRA 4ESXA 2ZXJA 1FSHA 3RT6B 3F8FA 1P4AA 4WCGA 2VC1A 1S3JA 1M5BA 1S6LA 4BAYA 2DYXA 4AQ4A 4PFTA 4U2RA 1FQBA 5D5VB 1LAGE 3MBPA 2UWMA 5I57A 1SDXA 3CFLA 4GGGA 1Z1DA 1ZMGA 2QQAA 3KFMA 1XDUA 3FJGA 2D1VA 2HTSA 1RKMA 2LAOA 2CO5A 5JVTA 1POTA 3TOBA 1JNFA 1GTKA 2E0SA 2Y7IA 1ZYRF 4Z2YA 4HX4A 3K69A 1OMIA 1FZPB 4HX8A 4I0BA 3VEPA 4QRZA 2L4AA 3TQWA 3S2VA 3HOSA 5E18F 2XX8A 1JW5A 1W7PA 3AAFA 2YLNA 3QSLA 1OVTA 3KZGA 1D5VA 1UTHB 3BZ6A 1MZBA 4ZYDA 2RQPA 2QPQA 2XX7A 4N0BA 3G7WA 2LF8A 4JSDA 4FHTA 5LLQA 2ZKZA 3WTYC 4KHZE 4ZE9A 2Y0MA 1IAWA 2HDCA 3IOUA 1Y1MA 2IRFG 3VB2A 3GO5A 4EMSA 2CWEA 3COAC 3GFMA 3ZKKA 1MRPA 3HRMA 2WV0A 3THIA 3PUXE 2V79A 2A6EF 3GZ6A 3E6BA 4IB2A 4WWCA 3MZYA 3FMSA 5DVIA 4LA9A 3D5LA 3EETA 3CR9A 4DE8A 2WTEA 5LGTA 1HW2A 4KUMA 2A5TB 4O3MA 3N94A 1GVCA 1YIOA 1ZRFA 4E70A 1JVXA 4GIZA 1OPCA 3MP1A 1ELJA 1N76A 2PG4A 3KZZA 4HLXA 2X26A 3MJNA 1YPNA 2VONA 3WU0A 3JAMK 3GWZA 5BS6A 2K7LA 3TDZC 5H8FB 1T98A 1Z7UA 5LHGA 1SW1A 4U21A 3B6TA 4IO7A 2IW5A 4R2BA 4G2ZA 5FB2A 3F22A 2EV6A 2OBPA 1LDKB 4BDLA 4YFKF 2Z22A 2DE3A 4JBAA 2V1UA 4EM1A 1IUDA 1T39A 3PMWA 4EJTA 2WC2A 3NEUA 4KT5C 3FXUA 3ULQB 2V3QA 4NWDA 1SI1A 5DT6A 1IXSB 1P6RA 1XSXA 1URDA 4DXCA 3E3VA 2QS4A 1V4RA 1H45A 1B9NA 4R79A 4ZECA 4X48A 3KG2A 3CO7C 2X7QA 5I57B 3BKIB 2VHAA 1QGPA 5TP9A 1NH8A 2HKOA 1LB2A 3F8CA 1B6HA 2CMOA 3TDJA 1DUXC 4L9VA 4YZZA 3O2PE 1H9TA 6PAXA 1ZIUA 3P7NA 4FATA 3W6JB 1OYIA 1R00A 3VVEA 1W7PB 1S7OA 3U1OA 1ODDA 4KDPA 1F5TA 3I58A 4M73A 2ZYNA 5L3FA 3EN3A 1RNLA 1MQGA 1B5HA 4GL8A 2GA2A 2B65A 1SW5A 1HXDA 3WU1B 1JXSA 3B6WA 2D2WA 3S9NC 4IO3A 4CICA 2AL4A 4KD5A 1IRFA 5CVIA 1HSTA 2XAJA 4DXUA 3UGWA 1MXXA 3KP3A 2V93A 4LFUA 1VTNC 1YS6A 2PQ8A 3PD9A 1G3YA 3KFWX 1EH6A 2G7UA 3CFZA 2EV0A 1W4MA 3IWZA 4YFNF 2P2AA 1ZARA 2K02A 2VBXA 2DLLA 4LJZF 5H8QA 4HX7A 3RN8A 1YAEA 2M8CA 4ISUA 3OO6A 2RC9A 2BEOA 2F7CA 2DU9A 3DP4A 4DIGA 5E17F 1L3LA 2Q88A 4IXAA 5K1YA 2NWJA 2FF4A 1HKTA 1FX7A 3VLUA 3TKDA 1DDNA 1MY4A 4F2OA 1B5IA 2CW0F 3QU6A 1J7KA 1ZHFA 3V8XB 3EYYA 1XS5A 4UHTA 3A3UA 1HW5A 3VE1B 2DK8A 4ESFA 1L0OC 1UIVA 3RJPA 3PMXA 3F21A 1LB8A 4MQVA 1JHFA 3BOQA 4YIFA 2I49A 1XCBA 3C1DA 1KU9A 1XN7A 1NFTA 3G73A 3V7RA 1A8EA 2HFBA 2RCAA 2OBGA 5LEKA 2O61A 1OVBA 1YTVA 2VD3A 4JWYA 4GFRA 3L00A 1Z7ME 4C0RA 2O8XA 4LG0A 2VBWA 2I48A 1D9YA 4HOBA 4GO1A 1B1BA 1PBQA 1A04A 1J0RA 4MH5A 2X0LA 4ENMA 4K2EA 2DXYA 4HF0A 5HVQC 3CJNA 4YKIA 4YMBA 3Q5FA 1USSA 3R4KA 1G4DA 1B4AA 2F5FA 3KETA 5F1RA 4OHNA 1O64A 2LDUA 3FXQA 4ZYGA 2RCBA 4ELQA 3KGCA 1FQEA 1PP8F 1MXYA 2XXPA 5TP9B 1BOAA 1YW7A 3FHZA 3CTAA 2RVCA 1FBQA 3O6IA 4ZYHA 3OELA 3LFKA 3T8TA 2R7FA 4P9FA 1U3EM 3H3GA 2UYFA 2DWJA 4G8NA 1Y3NA 4DXBA 5AIQA 1D9VA 4FECA 4F7ZA 3J80Z 3SKPA 3SQNA 1R1TA 5CVJA 2DK5A 2KIUA 3HSFA 3CLOA 2Q0OA 1B4ZA 2Q9TA 2VC0A 1FTJA 2H25A 3M9AA 3SEWA 2HZTA 4IHTA 4JQFA 1EH3A 3H6VA 5I58A 4GYGA 2K27A 2RN7A 3N5LA 3ZPLA 5CC2A 2A07F 4M9ZA 4GRKA 4JWXA 4P0GA 4D0PA 4U7DA 4OEVA 3MVXA 1UTBA 4QFLA 1E17A 3G3IA 1XVXA 4EJWA 3LA7A 3FXRA 2KIMA 4AVPA 4MFIA 3UK4A 4R74A 3D4CA 4IY6A 4HA8A 4BYYA 2F97A 1G3SA 2ONSA 3PUWE 3HCQA 1BTJA 3L6GA 5H8QB 1Q1HA 5DDGA 1FNNA 1R22A 2FU4A 4RS8A 4YU0A 1IXHA 4ETSA 4YKKA 1LCTA 3PUVE 1P92A 4OU0A 1B3FA 2F5DA 2ALUA 3GW2A 2PVUA 4L0YB 4KFCA 3SESA 4XSZF 4F29A 3MQ0A 1QW0A 1USYE 2RC7A 3K6UA 5JK4A 4G7ZF 4M72A 3IKVA 3PQKA 2CFXA 3VLVA 4CO8A 4BNCA 4O3CA 1Y20A 4IY5A 3V8LA 5D8LB 4FE8A 5DTBA 4OQOA 4HW8A 1ZTYA 1FPQA 3FJMA 1SI0A 2HEOA 4UVCA 4ZS9A 1O3RA 4ZH4F 4RNSA 4UUVA 2K86A 4HZFA 5E8IA 3V5AA 1J1NA 5JR3A 1FTKA 4I1DA 1RUOA 1QZZA 1TFAA 3JAMZ 4LG0B 2Q8KA 2PYYA 2OA4A 3DEUA 1K6OA 1PEBA 5F7VA 3FMRA 3CSGA 2ELHA 2IJLA 3VXBA 4LZ7A 4DQ2A 3TTKA 2XGXA 2W7YA 1ZG3A 5BMZA 3BFTA 3E6MA 1P1OA 2I4CA 1MY1A 4PGGA 1UCRA 3P9CA 2GXBA 2GRVA 3MVZA 4ZZEA 3QPHA 2YJPA 3T0YA 2FNPA 4KN4X 2DVZA 3WGGA 1SD3A 4WK8F 3W6KB 3LSWA 4R72A 2ISYA 4ENKA 1K78A 1RIOH 3A09A 3FF5A 3OD7A 3RTWB 5J8CA 5FO5A 1BKAA 2QMWA 3L6HA 1ZN2A 2K4BA 1T6SA 2O68A 2O7UA 5I58B 1YQAA 2XRNA 4MGRA 2VE9A 2THIA 3MZBA 3ML6A 4EXLA 5H8HB 3RGYA 1G3TA 4PDKA 1B9MA 5ICTA 2W24A 5CVRA 2I0CA 2DQLA 4NF4A 3HRSA 1UTBB 3HHHA 1B59A 1DP7P 1O3TA 2HS5A 1LB9A 1U2WA 4OMZA 2XXXA 3OOPA 3ZQ7A 1A54A 3RI4A 2Q2EA 2WKYA 1IUYA 1GHCA 2UVJA 2O0YA 2Y75A 1XSVA 4I01A 4EQ9A 1Z9CA 3FM5A 1AOYA 3A3CA 3W9VA 2E7XA 3F72A 1B0LA 4LD5A 5ICEA 4KYDA 4Q47A 3TELA 2BV6A 3U72A 2A5YB 4C1UA 2OJTA 4RB3C 2VP1A 1WWXA 3MC2A 4WEDA 4H65A 3HUGA 3F8NA 3U93A 5EHSA 4F3BA 2G9WA 3HSTA 1J75A 3ZSFA 3TTNA 2W85A 2OCUA 5E1WA 1SBPA 3E5UA 3U1DA 1LCFA 4EDPA 4MTEA 4G68A 4IO6A 3J81K 3MPLA 2CZLA 5M2VA 4M6XA 3GFJA 5HS7A 1SYIA 4L9JA 1NKXA 5AA2D 4O5VA 3IWFA 3ZMZA 2A6HF 1QBJA 2AL5A 3QU3A 3OO9A 3QPTA 4I0AA 3DLNA 2CQKA 3ERED 2PMUA 3Q25A 3BJOA 4JDFA 5A2QK 1TWYA 4MF3A 3N6TA 2O6GE 2AYSA 3B73A 4HQEA 3G3JA 5K2XA 4L9NA 3IRQA 3PUYE 2JT1A 3RPUA 5DEQA 5BPDA 2XAHA 1A8FA 4M71A 3FVNA 1NH7A 2Q89A 1ZJLA 3KP6A 2D1HA 4MTDA 1WQ2A 3GFIA 2QJEA 4ZEKA 4HDVA 1ZGAA 3O3KA 2UVGA 4ECFA 4RGXA 2GH9A 1K79A 2P6SA 3C35A 1TW3A 2FEZA 3ABUA 5E1ZB 3I0TA 3BWGA 3E6CC 1UIUA 2PEXA 1K78B 1F9NA 3B02A 4KMUX 5DD8A 2GQQA 5L8DA 3N97A 4G6DA 1QKAA 1OIBA 5EEHA 1LFHA 1SMTA 1HSJA 2DWIA 4F18A 2DPUA 3IB0A 4BHBA 3RIRA 2NUVA 2QQ9A 2V6CA 4P5OA 4KICA 2M5WA 1MJBA 5EEGA 4NF4B 1GXQA 4I02A 1RUNA 2IA0A 1UB9A 4EJUA 5HBCA 1LEBA 1PB8A 2QSXA 1SFXA 3BFUA 4BDRA 5LGUA 3K0VA 1GXPA 4LVQA 4PETA 1SD7A 5TRDA 4OIPF 2VN2A 4FX0A 2DFIA 3Q26A 4NEDA 2Q8JA 4B09A 2MD5A 1JW4A 3CFXA 2FRHA 2I0BA 3RQTA 1B7HA 1ON1A 1DMBA 1P1UA 4U88A 5KVRA 3KN3A 1B5JA 2QS3A 2VOPA 5BWJA 4P9UA 2DS9A 2DWHA 3K02A 3HN0A 2QZ8A 5I2NA 4IGTA 1BJAA 1BI3A 1UHMA 4O6JA 1YTYA 2MA3A 4G68B 4IF4A 3C33A 2FBIA 3CRBA 2AIXA 4H8IA 2A61A 4ELRA 4OIRF 4R1HA 4FJPA 2GHBA 3TAJA 5LOMA 2EB7A 2JPCA 2G93A 4BDQA 3K1PA 3ZMTA 1B1XA 1ZRDA 1OR7A 3O9PA 2KJCA 3ZN1A 4BXUA 5ICFA 1OMPA 2FXAA 5AA2A 3LA3A 3O29A 1U6GA 1SD6A 2W84A 1II5A 2REJA 2F2EA 2H09A 4ENJA 4H0WA 4F19A 4H1XA 3RKYA 3F3XA 3C34A 1XCVA 1O7FA 1JE8A 2NNYA 3SHFA 4P55A 5D8KB 3IJOB 2HZLA 1BC7C 3SEYA 5ED4A 3F11A 2XXTA 1V3FA 3IOWA 2V84A 3BPXA 3CI8A 4YB5A 3H6UA 3E6DA 1MM6A 4M74A 2QM3A 3DPTA 4YKJA 4YAHX 1CE2A 1FOKA 1BIYA 1H43A 3FZVA 4AIKA 2PJPA 4CYDA 1OQHA 2XHDA 5ELVA 5CJ9A 3ECRA 5LRSA 3BBRA 1GR2A 3CO6C 1Q1KA 1ZRCA 2DTRA 5HS8A 3VXCA 4YG2F 4KN7X 3EUHA 4ZEFA 3ILUB 5HLHA 1LJ9A 1HW1A 2FMLA 4ELPA 4IJAA 2KIFA 4PFYA 3T9VA 4I62A 2RDPA 1BIAA 3TOAA 3H4ZA 1BN5A 4G9YA 1SAXA 4CXFA 1A40A 4Y17A 3IX1A 5CBRA 2F5XA 4A12A 1O7LA 3DPLC 3H6WA 5CYVA 3GX4X 3WGHA 3PD8A 2BYVE 3SEVA 4ZZLA 2ETHA 1B2HA 2EFNA 3R60A 4PP0A 4Y13A 3F23A 3S2WA 1AWCA 1I27A 2FA5A 4LB6B 4FX4A 4IRIA 5I2NB 2KJBA 3ZMUA 3TCHA 1B52A 1IXCA 2QQBA 1VSOA 3HTUA 4NHJA 1T2KA 2KKOA 4L5JA 3K4UA 2OZ6A 1XGSA 4NF6A 4H0EA 4U4SA 4HS7A 3V4GA 3LR1A 1YCJA 5KCJA 2IPQX 4XLPF 5ICCA 1MDQA 2ADUA 4XRFA 2JZYA 4U1ZA 2DQRA 5HLGA 1FBUA 5AIPA 3HRUA 3IR1A 4FIMA 1L5TA 4EGYA 1EH7A 3KP7A 2FMYA 4PCQA 2XAFA 5J6XA 3E4RA 2O3FA 5JTYA 5AA2B 1IN6A 2NS0A 1H3DA 5DYHA 3IL2A 1MPCA 2A69F 1KWHA 4L17A 4Q5TA 1SVXB 3WTUC 4ON0A 5HDNA 1OKRA 1FQDA 1IITA 1HSLA 3TCGA 3H92A 1B6AA 2QYOA 1QVSA 4UNOA 1P1NA 3TQNA 1XOCA 3TFLA 1NNTA 4RK2A 5A2QZ 4ND9A 3QK6A 3RUMA 3WTZA 1SD4A 4U7BA 1RYXA 3K6VA 3WODF 4ZZDA 1PBPA 2P5VA 3IKTA 1ZKBA 3EHUA 3MVWA 3IHUA 3P7IA 2DAOA 2HYFA 3DV8A 1MY3A 5AA3A 3USDA 5KZTA 1D4NA 4G8XA 3IL1B 2H27A 1BLFA 4FAJA 1WODA 4L0ZB 1OYYA 3DELB 2XXVA 2R9JA 3EYIA 3FM3A 5L9MA 2P0SA 2L4MA 4X1DA 2R3SA 5I59A 5AONA 5D6FA 2HAVA 4GCVA 2DSFA 3O66A 4TV7A 2H99A 3F6OA 3G3FA 1OLCA 3OO7A 3WTSC 1D3YA 3M1EA 2M30A 1KQ0A 3GXOA 1NNPA 2G7HA 1PB9A 3GVAA 4B8XA 4EJVA 4Q30B 2VOZA 3LA2A 1PDNC 2D21A 2O69A 2XXRA 1SFUA 2F5CA 2QLZA 1K7AA 1DOTA 5DCFA 4EM0B 1QPMA 2QBYA 2RV8A 2Y7RA 1M5FA 3JV9A 3J7AO 1ZAOA 3MZ9A 4EVIA 2F78A 3MCZA 4IGRA 1Y3PA 2Q2CA 4RPOA 1WI9A 4U0VA 4HV6A 1RYOA 2ZMBA 4NF6B 3T22A 5H6QA 1ZREA 4A6DA 3IO4A 1M5EA 1TQIA 3DXJF 4M9XA 1FYLA 1Z91A 2XHKA 5KCJB 3JSPA 4ZZAA 1B0HA 3REOA 3RKXA 5LHIA 2L3DA 1MQHA 5JI6A 1ANFA 2VGQA 3MVYA 4N9IA 1B05A 2ABHA 2BE5F 3FUZA 3DP6A 4AWXB 1IN4A 5ICGA 5JTYB 4LP2B 3L9FA 1NNKA 2O6AA 1YW8A 2PMHA 2XXHA 4P0IA 4R6KA 4ENNA 3JW4A 4RB0A 3I64A 2EFWA 3SERA 1S7YA 2X7PA 5FHMA 1MXWA 3C36A 3MUQA 2FBHA 4UXNA 3LWFA 4M9SA 3RYRA 5H20A 3G3KA 4MEXF 4KA4A 1Y1ZA 2M1BA 3N26A 4JXIA 4RGSA 5H8HA 2Z8DA 2V3UA 2HFHA 4KYWA 4KIFA 1FSEA 1TNTA 3DQVC 3GFLA 4JSOA 4R6HA 4N9HA 4G8MA 1YG2A 4DLDA 2ZYOA 3L7WA 5DD4A 3EHSA 3LC8A 1YW9A 1GGGA 2UVIA 4GLIA 1BM9A 4RK9A 3FVGA 3SXYA 3K9TA 4OFLA 5HS9A 2XXWA 1KQ8A 3TMGA 1QUKA 1WDNA 1RI7A 1IN5A 3E3KA 1B58A 5TPAA 2Z33A 4ZEIA 4R75A 4TLMB 3NRVA 3G3HA 4LLLA 1T38A 3UIFA 5FFXA 1R23A 4X9TA 3I5OA 4EUOA 5FFZA 3SEUA 5I59B 4UACA 4YFXF 2QUFA 3SZPA 4IO4A 4WEPA 4MEYF 1KQ9A 1IQ7A 4L18B 1HBXG 5E1XA 4HBLA 4KIGA 3M3KA 4FEBA 5F1QA 3G3GA 3JTGA 5J1DA 3OMBA 3CSBA 3TGNA 4ZEBA 3ECHA 4U1OA 3VODA 2RKMA 2F6PA 2J5PA 2IA1A 4KR5A 2QBYB 3E5XA 3KOTA 2Z9OA 4WXJA 4AD9A 4IVNA 1FQFA 2GIVA 2Y48A 5D4SA 4F1VA 4F3GA 2VD2A 5BUUA 4ZEDA 5D5UB 3R6SA 2Z23A 4OOIA 2H5YA 2HTJA 2XXQA 1D3KA 4RAZA 2XAGA 2XX9A 2IA2A 4YKPA 4WXCA 4GWOA 1A99A 2F36A 3I3VA 1TNSA 2FBKA 4RB2C 1SW4A 1Y4CA 3O97A 4S05A 5IKBA 3ABTA 1B7ZA 3RPWA 1POY1 5I2KA 4OIOF 4GVOA 2H9BA 3MWMA 4I8CA 4XSXF 1RZ4A 2RF1A 2FE3A 1FP2A 3BROA 4EXKA 5CI5A 4R9FA 5LHHA 2C6YA 1BI2A 4A5MA 2IP2A 4RAYA 1P1WA 2OZZA 3WG9A 4OESA 4DCYA 3T93B 3MWBA 2ZFWA 1SMYF 2AS5F 2UYEA 1ATGA 4I98B 5FHNA 3RTFB 2E7WA 2XVCA 2DO7A 3H3UA 4PFWA 3LSTA 3MEXA 3OOAA 3TUSA 1ON2A 2LF7A 1XD7A 4XLNF 1DTZA 3M8EA 1G6NA 3D0SA 4KIBA 4UV9A 3JSOA 2EA4A 3KZYA 1U8RA 1FP1D 4HCYA 3C18A 3CUOA 1LFIA 1CGPA 5D5XB 4NB5A 2QENA 2OWTA 5BOXA 5KDTA 2PX1A 3U9GA 1LBCA 2O51A 3N6UA 3LAPA 4OETA 2E1SA 1FBSA 4EGZA 4PZJA 4G68C 1B7UA 1IN8A 1SW2A 3WGIA 3M8UA 4R2FA 5CBSA 5I56B 3MW0A 3MAJA 1J9IA 2O1MA 5TPAB 1MS7A 4LZ8A 3TYHA 3E9XA 4BLAA 4N13A 3HHGA 4BH9A 3PU5A 5DVFA 1KU7A 3S9MC 1SD5A 4LB5A 3ISPA 4XKPA 1FT9A 3OEMA 5DCMA 1LNWA 4ESBA 1LLSA 3GXAA 2GXGA 4JB7A 1USTA 2I4BA 3O28A 4RB1A 5K5RA 1GVJA 3RPQA 2MBFA 3TTMA 2I58A 1MJAA 3V89B 3SETA 4HLYA 2Z8EA 4LUBA 1U5TC 2EWNA 1P4WA 4F22A 2OK2A 2MC3A 2HWVA 3KP2A 1OYWA 2P1SA 4EQ7A 2FQ3A 5B7DA 1EZOA 2CYYA 4TQUQ 4OXVA 2LNBA 4A0YA 4PFUA 3QP5A 1DPUA 4UA8A 4G7OF 2M8EA 4YMAA 4DCXA 5DYMA 4RJZA 1B4HA 4OINF 1OQGA 4GD5A 1JVYA 2X4HA 3QUJA 1S9TA 3I6VA 3P9KA 4KI0E 1N3XA 1U5TA 2R7DA 1R1VA 3OEKA 1MDMA 1LFGA 1XHYA 4BDNA 2AXLA 2HZKA 5I2KB 1FYKA 3QAHA 4NWCA 1QUIA 4ZYEA 4WX9A 1MD0A 5AA1A 1N84A 1LAFE 2L02A 3I5UA 1R9QA 2IEEA 1F9BA 1NMUA 4G7HF 1S50A 3RDIA 4TLLB 4Z7EA 4POXA 4IRHA 5IT3A 3HIFA 1S8NA 2OQGA 2Z5UA 1XGNA 2D3IA 5DVJA 3VV5A 1MXUA 2FOKA 1EZ9A 3IB1A 1MJ9A 3T66A 2PBWA 3NQOA 2ONKE 1BBYA 4HAMA 4OMYA 2QWWA 5F64A 5FHOA 3ELKA 3DFGA 1Y3QA 2W25A 2XXYA 3IJXB 4UVAA 1ZLKA 2DOJA 3U2RA 1JEUA 3HO7A 4ESJA 4HCWA 3W9WA 1NL5A 3ECOA 1N3WA 2F35A 5KDTB 4O3AA 1FC3A 3DP8A 5FGMA 1LBBA 4NF5A 3DF8A 1QJMA 4A5NA 1Y9UA 3ODBA 2ONRA 2FYIA 2PBIA 3ONMA 3LQQA 2F5EA 1BP5A 4OEUA 4XIGQ 4WXDA 1MQDA 4POWA 3KEQA 4Q0CA 4KFQA 3BPVA 2H6BA 3HSRA 4CGZA 4ZE8A 3ZS6A 4BHCA 3BDDA 5KK1A 4I09A 4I9DA 3C3WA 2WWYA 1PUEE 2HQNA 1I69A 4HTGA 3PV0E 1PB7A 1R1UA 3WAEA 2CGPA 5DCMB 1Y4TA 2QS2A 2IVMA 3CG1A 1R5GA 3M3FA 2VOOA 4GQOA 1E2XA 2DPDA 4K3FA 3KCCA 2A68F 3IOTA 4G94A 4RXLA 3OXNA 3QUFA 4IPAA 4OERA 5K2YA 1KU3A 4MLVA 4QFNA 4OENA 3V8KA 2O1LA 2ACJA 3QXMA 4WF2A 4F3SA 3G3ZA 2M87A 3CUQA 1IZ1A 1B1HA 2G29A 2XD2A 1N7XA 4YIIA 3T9XB 3FV2A 3VVDA 4LK1F 3HOTA 3OV8A 1B9JA 3Q29A 3EQLF 4YB6A 3EQ1A 3TZAA 2XUBA 1TTYA 5FD5A 4KYEA 2XXUA 1ZH5A 3IAZA 3EHTA 3K6WA 3W15C 4BHPA 2RC8A 4M6YA 3KN8A 3Q9SA 3J80K 2I3WA 1TW2A 1QNTA 3UORA 1ZG5A 1U5TB 3F6VA 1R58A 5D4RA 1MDMB 3ZKLA 3VLWA 1DTGA 5ILSA 5H8NA 5LRRA 2F6GA 1H44A 4LLGF 5LBQA 4RPNA 5L9OA 2V3TA 1QQIA 1M5CA 5L9SA 3V83A 3E13X 4NE4A 4A0ZA 1IEJA 1Z6RA 1LAHE 3MPKA 4NF8A 2VBZA 3N4MA 1FTOA 2V1XA 3E5QA 3O6BB 1B3HA 1LQ1A 1J5YA 5IT9K 2F8DA 1VE4A 3I59A 2O7IA 4KQPA 1NHAA 2VT2A 3M3LA 2A5SA 2HAUA 1XVYA 3IORA 1S7AA 1YS7A 3VOEA 4M1VA 4QF9A 2EA2A 5L3BA 3H03A 3K6XA 4XKNA 4QFPA 1HQCA 1FQAA 3HPIA 3T8RA 3JZJA 1QULA 2YSRA 3UA8A 4OFJA 1I1SA 1B3GA 3ILTB 4NF5B 4GYIA 1P4XA 2DW4A 3EDPA 1REPC 2CSOA 4QSDA 4JWOA 1US5A 4IRGA 3RLFE 3KN7A 3WTXC 2ZXTA 3WTTC 1J59A 1XGOA 3BY6A 1FY7A 1Q35A 4F39A 5FLXK 5L3GA 3R26A 3WTWC 1C0WA 1N04A 1MG1A 4U4XA 4NQWA 1I6QA 4G6QA 2F34A 3HRTA 1MH3A 2PI0A 3L2CA 2Z8FA 2OAZA 2D5WA 5DUKA 1PC3A 1D8KA 4RA1A 3VDFA 4QSEA 3WE2A 2L54A 2Y7KA 4EQQA 3DKWA 3KP5A 3SFZA 2DE4A 2HXWA 3T1BA 3TQLA 4E0XA 1H76A 3KE2A 2ZCWA 3H06B 3KOSA 5ERIA 4MBPA 1ONVA 3CUQB 1TFDA 3MAMA 1P1QA 5HLIA 2ZJ2A 2QS1A 4OFOA 3C4MA 2K4JA 5FTHA 1TQPA 5DEXA 1MGTA 3TO6A 3TO9A 5CVUA 2Z3YA 4BDMA 2YPNA 2IT0A 2QVOA 1KU2A 1A55A 3R0JA 2PLYA 3CDHA 3J81Z 1ZG1A 2NYXA 3H6TA 2HEUA 2GWRA 4JK1X 3BJ6A 4R8HA 2M45A 2PT1A 3FD3A 3PPRA 1T0KA 1IIWA 4EJOA 3ZP5A 4RYAA 3K1NA 4U22A 1R36A 4HF2A 2XROA 5EHMA 2V1DA 3KLNA 2XV4S 2H4IA 5H8NB 2TDXA 3TO7A 1QUJA 2ESNA 5F6FA 4OIQF 3LSLA 3R6UA 1I6AA 1LVAA 2O03A 5JHUA 4FORA 3OSRA 2RKHA 2P8TA 2ZYKA 4NF8B 2VXZA 4EV0A 4AB5A 4F2QA 1TLHB 2GFEA 1DPPA 1KA8A 3I59B 2PMSA 2QRYA 3PGFA 1B3LA 4M4GA 1YYVA 3PPQA 1SYHA 3EPEA 1PP7U 4PE5B 2ZMEA 3LUYA 2DP8A 5H8SA 2UXXA 2HQ0A 4F1UA 3OO8A 4HDUA 4G4PA 5E20A 4RGUA 2ZNYA 4R6YA 3T9HB 3TCFA 1NNFA 3OSQA 2FNCA 1IXGA 3HHFA 2STWA 1IF1A 2DQVA 1QKBA 2ZNTA 1XMAA 1URGA 3FGSA 2R6GE 3QIMA 5EYFA 3MFKA 1R7JA 1XDSA 2PFBA 4QWQA 4LQ2A 3FJ7A 2J5OA 4HW0A 1FWZA 5B70A 5A5XA 3PFIA 5L3EA 3LSXA 4ELOA 2ZNUA 4P96A 3S9EA 2JPBA 4ONYA 1SFEA 4OYVA 2R71A 3GLBA 3B6QA 1YFHA 1USYH 1XT8A 1JHHA 4XKRA 5JEIA 4LK0F 4O3BA 2HKXA 5AE4A 1I6BA 1FCKA 4CHUA 2I6EA 3E97A 4LONB 2QMXA 1BI0A 1WRJA 2CG4A 3K0LA 2OQRA 4MNUA 1LGBC 3F8BA 2GZWA 1JW1A 2B3FA 2Y7PA 1ULYA 1FYMA 1MPBA 3F8MA 2REGA 1R1NA 4N07A 2OU2A 3Q9VA 4F31B 2XD3A 4AIJA 4QLCU 3ZMDA 5DEXB 4Q5SF 3TODA 1O7TA 2B0LA 2FSWA 1EU8A 4E0WA 1S29A 2YPRA 5ITOA 3KJTA 1XGMA 4R9GA 4CZZA 3KBRA 3IB2A 1WSUA 2UZKA 2OWSA 5TU0A 4GXAA 5LGNA 3H7MA 5HDGA 3ZN0A 4QSCA 1YO5C 1R5HA 2YX7A
chains in the Genus database with same CATH superfamily
3V7SA 2CQQA 3OS2A 4LLNA 1N0TA 4H8JA 1B32A 2XRLA 2DI3A 4A0XA 2P4WA 5E8GA 2O7OA 3IC7A 1ACIA 5K5OA 1YOVB 2DWAA 3HKZN 3TMOA 3OYFA 3BT9A 2HGCA 1ZLQA 2NXOA 4OMBA 2VKVA 4A2UA 2LSOA 2HHMA 3PPPA 4G77A 3C32A 4KCCA 1QHGA 1MM7A 4CZCA 2CUZA 4A3EJ 1ZR2A 1JEVA 2CZHA 1A36A 2BGCA 2LKSA 3CIJA 3ZMVA 3DP7A 2QFLA 3R7XA 3CESA 4OTEA 4WKMA 4QFKA 1I6HJ 1Z67A 1QGXA 2KLFA 1JETA 3CG3A 3PUZE 5HPQA 3QOPA 2M9HA 4WXHA 2ZNZA 3DKYA 1BI1A 2ZMEB 4MIMA 1IJWC 1NK3P 5IYCJ 3MP6A 2WV1A 3ROUA 4QTRA 4Q48A 3PIPF 3BP8A 1ZBMA 3P9IA 3MZ1A 1ZGJA 3CC4I 3FWEA 3CCEI 4BY1J 4P11A 3T0JA 1WKMA 4LZ5A 3OYMA 3KSXA 2HCAA 2HPGA 4H4KC 4EF1A 3C9HA 4KITB 4I2OA 2KMUA 1NUXA 1LEAA 2EFPA 4M3DA 3GBAA 1UELB 3SDFA 4OVQA 2IAIA 4KMFA 3NOHA 2X1CA 5HOOA 3ERMA 2EK5A 5IT9Z 1I50J 1EH8A 1KGSA 2COMA 1EZPA 4F93B 2K40A 1MY2A 1UFMA 2CQXA 2D45A 1YHQI 4ZDOA 1XC1A 1WZ2A 2DT5A 3DM0A 4A3MJ 1QHHD 2IA4A 5CMKA 3BIGA 4H5FA 3IOVA 2VODA 1IDZA 3TTLA 3J7ZI 4BBSJ 2HVSA 2XASA 2MH2A 1F1ZA 5L3DA 2GXAA 1SQYA 1J2XA 1MY0A 4FEDA 4MLQA 1H0MA 4F3PA 3Q27A 5A5XB 1TQMA 3TW6A 4IHVA 5IAIA 2F7BA 4CYCA 3T9UA 3MKLA 1BC8C 1DU6A 1MIJA 3KP4A 5CLSA 3K2DA 3FK6A 3EF7A 4HYEA 4HNTA 3CC2I 4R73A 1I6XA 3O6HA 2QVVA 2CU7A 4OZ9A 3BCAA 1VQMI 3KSJA 1KYZA 3KJ7A 2L7MP 2XXIA 2Y9YA 3P5JA 5D6EA 4OWDA 1F4KA 2Z99A 4B43A 3GZGA 3I53A 2VJJA 2R7TA 3L09A 3M07A 3PPNA 2L7ZA 3LSFB 1NV1A 2XKOA 2NOOA 4G8HA 2P5LC 4H6DA 4EF2A 1ZKGA 2XAQA 4OVJA 5IZ1A 2RGVA 5FD6A 2UVHA 2H94A 2HOEA 3OWTA 2YX4A 2LR8A 1K9ZA 1HKSA 4N15A 2GM4A 1B40A 3CMMA 5FLXZ 4AB6A 3CC7I 4HF1A 1X3ZB 3IO6A 5CRYA 3RPUD 3QRFF 3HV1A 2NVTJ 1X19A 1PDAA 4IHSA 1P99A 3TKYA 4X8RA 4XL9A 3V8JA 1STZA 5FRMA 3WE3A 2KDZA 3CF2A 5TJJA 3RT8A 3ABKH 3TDUC 3IAM2 5D5WB 3S1MJ 2RC4A 1URSA 1W5SA 3LSKA 3OIOA 4P47A 4LGWA 4BACA 3TEPA 1D0YA 3LSGA 1VR5A 2V9VA 2WAFA 2KRFA 4KPTA 3AXFA 1FTLA 5J40A 1JQFA 2B3BA 2EFQA 4LMYA 3HOYJ 2ZZVA 1FOXA 4GWYA 4UUSA 1MH4A 2VJ4A 1IXRC 2HQRA 3BQZA 2LKPA 1YJNI 2H6CA 4Y15A 2UXAA 4GL0A 3PPOA 4S04A 2V25A 4A6EA 5HM4B 1BIBA 5CMCA 1I1GA 4THIA 2ZNSA 4HRIA 1X3UA 2IGOA 2E36A 2P6TA 5CMMA 5J8FA 5HDKA 3LSWA 4U0WA 4U0YA 1IMFA 2VE8A 4I99C 4UB8C 3OSGA 3FV1A 4MHGA 1WI3A 2VBYA 4NTLA 4S0HB 4ANJA 4ESWA 3TP3A 2DJIA 3B7DA 5ICQA 4CCJA 2IS6A 3H36A 4Z0IA 2PT2A 3QP6A 4IQJA 5LEJA 1I5ZA 4Q8RA 3PQJA 2P7VB 3HYIA 2QA4I 1WJAA 4UVBA 1EV7A 1TWCJ 3T96B 4O7IA 1QO0D 3SEXA 1FTMA 4KYSA 3S4UA 3RNNA 3Q28A 4BDOA 1XB4A 2F3BA 1JT6A 3KYCB 1VQ6I 3S16J 1X2MA 1DPRA 4DNCA 3ZMSA 4NMYA 2DXRA 2QL3A 5FTIA 3WHBA 3GF2A 3OOUA 3FATA 3WAFA 4NN3A 5FKKA 3VFZA 5C4JJ 1T56A 1IXIA 1TT1A 3S3OA 2BBYA 4FT8A 4IO2A 3U94A 1OCZH 3M8FA 1HSEA 3U8QA 3C31A 2ANJA 3BJAA 2VT3A 2ZBKA 5CMBA 3FASA 4DZ1A 1MKMA 4QFOA 4P1LA 1XMKA 1V5GA 1K6YA 2JSCA 2KZVA 3BTIA 3K01A 2YS9A 3FX3A 1CF7A 2HYJA 3KIOA 5IP7J 1W0TA 2LRDA 1LAXA 1MPDA 2M0CA 2DE2A 4IO5A 4PQJA 2LY9A 5BQTA 3JTHA 1UAAA 3BC8A 4C2TA 1XX5A 4LQ5A 4XXUA 2XIGA 4EEFG 1B46A 3O6GA 4MNCA 1ZLJA 3VVFA 1ZU0A 4AIHA 1MXZA 2Q2AA 2GOMA 1IW7F 3O2AA 5H6RA 2JSPA 4GXOA 1VI0A 3I71A 1EYIA 5CVVA 2L5QA 1IN7A 4KT6A 4BS9A 5TISC 4CCLA 4CYCB 4BQAA 2A3SA 4IHXA 3RKWA 2F7AA 1TBXA 3H3ZA 3QAXA 1EYJA 2EV5A 2GA1A 3HXLA 3IRRA 3MQ9A 3PMVA 1W36D 3MZHA 3NWSA 4L9TA 1LDJA 1AMFA 3GYHX 1HKQA 5KAIC 2QSHX 4GX4A 1FOYA 5B5EC 3G1LA 3LQRA 2GAUA 1DP3A 1Y0NA 3FVKA 4QXDA 5AA4A 5ILVA 3LFUA 1XPXA 1Y0UA 5JFRA 1QZEA 1YJWI 1QVTA 2EJRA 1NV3A 1OLAA 2E1NA 4KI0E 3CVGA 1DGWY 2ZYMA 5ISUA 1Y39A 1B8IA 1H9GA 3K7AJ 5CKTA 4ASNA 1FLIA 4IHWA 4XLHA 4HXVA 3GBBA 5CM6A 1QZYA 3H1CA 3R61A 1FQCA 3FIRA 4PGHA 1P2FA 1UHWA 3I4PA 4MLOA 1AIVA 2ZO4A 3WG7H 3LNQA 4V2GA 4H5GA 3K1MA 2IEKA 1O63A 4GXSB 3C7JA 2E1OA 1IGNA 1VDWA 4XBFA 1G3WA 3LBSA 4YICA 1JGSA 4RGRA 1IDYA 1W7PD 2K5CA 2EQRA 2RINA 3SDGA 1VQ7I 2Y7WA 2EFOA 3PFYA 4ZDMA 5JLXA 3I54A 4U23A 1O3QA 4Z6YA 5ILUA 2NAZA 3M7GA 1IO2A 3CJTB 1O3SA 1AH5A 2DXIA 1US4A 3UN6A 2UXNA 3HTSB 1XG1A 2Y9ZA 2MH9A 1QA6A 1SFKA 2KT0A 2FA7A 3MD2A 4X1BA 4N17A 2YR2A 5K7HA 5FKLA 3U92A 1DSNA 4UUSB 2HR3A 2YU3A 1LKXA 1U9NA 3GUDA 1F43A 1M5DA 3H9GA 1G2HA 1VFEA 2B4LA 2VPNA 3RYPA 1UTHA 5I84A 2Y84A 1DQUA 2DTZA 1D8JA 1MQIA 3UP9A 2O5RA 1MDP1 2H98A 2BVLA 2BJJX 2RNJA 3SZTA 4E4HA 1JTXA 4L5IA 4XICA 1N7WA 1SANA 2DDKA 3E79A 3QYTA 3TPAA 2NVYJ 4HEA2 2GQ1A 1YLFA 2P7CB 4N6PA 4XEQA 5M3MJ 4GWWA 1R9LA 4HE2A 2JRTA 4OAYA 1ETWA 3ZCOA 3RTRA 2ID3A 2HYGD 2LK2A 1K4SA 2L9RA 2NRAC 1IRGA 1Z7NE 3MP8A 3S9LC 4Q4ZF 1BW6A 5L3CA 3D4GA 3K00A 1GV8A 3JYRA 3R0AA 3RY3A 3GZ5A 2ISZA 2STTA 4EM2A 4C1UA 3T5XA 3HC7A 4PDHA 4GX3A 2OZUA 3V7CA 5K5QA 1XS9A 5HODA 4YB7A 2Y30A 1B3EA 3KEIA 2TCTA 2E1CA 2O9LA 3A01A 4B3AA 1ZTRA 1KYWA 2YU9J 4AM3A 3CUQC 3PM1A 4F1YA 3KEOA 1UQWA 5DV5A 3IV5A 2A5TA 1D0ZA 3LAJA 3AG2H 2CUFA 4GOTA 2F48A 2DBBA 3KLOA 2JVHA 3HSEA 1MXVA 2W57A 1DCUA 3EPZA 2JN6A 4EQBA 2P5KA 5E3NA 1CB6A 4BUPA 1B51A 2CFOA 2NVUB 2OLBA 2XA5A 5DUIA 4GF8A 5BPIA 2WB1N 4HQMA 1CF7B 4UV8A 3DWLE 4PUSA 2NNNA 2VQCA 1VFDA 3IK6B 2MLGA 5EYRA 2LH9A 1A7LA 4XTCQ 4J00A 1LSTA 4PF6A 2HNHA 2NVQJ 2MLKA 1OLTA 1DPEA 4P9KA 2PN6A 4DYCA 4HV5A 4C1TA 4LATA 1WGXA 4D5CA 1W5TA 4QPOA 2RREA 3BTCA 4PJLA 4DDDA 1T0FA 3VFJA 3K2ZA 5H8FA 1LDDA 2JTVA 2FNAA 1XSDA 3WTVC 3JRIA 1RR8C 3FVOA 3GEZA 4RY1A 1VQ5I 3OYJA 3JREA 2V1NA 1FW0A 2I3VA 1Z05A 2OPTA 4JBZA 4TOZA 2Q8MA 4QIWN 2DVCA 3OENA 2OD5A 5ITPA 1PJRA 4MQ9F 3GLXA 4PJNA 4OVRA 4PGPA 4I7HA 4NDLA 4OA4A 2GHAA 1Z6TA 5AA4B 2ZXWH 4H67A 5JHFA 3LSRA 2O84X 1ORKA 2LYCA 4CDGA 2L01A 4KNYA 2M0MA 1WVJA 3HOVJ 1TXFA 5C44J 1UZCA 2E34A 1R6ZA 1O57A 1W5CC 1AL3A 1MQJA 4QHQA 3QYEA 4KCDA 3OMYA 2ESHA 1B8IB 3CCRI 3FMQA 1U78A 2XKPA 3VYRB 3S2HJ 3JCUC 3TTRA 4ESXA 2ZXJA 1FSHA 3RT6B 2LFBA 1P4AA 1Z0XA 2LOOA 2VC1A 3F8FA 4WCGA 1S3JA 2R7RA 2FHYA 1YI2I 1M5BA 1S6LA 4BAYA 2DYXA 4AQ4A 4PFTA 9ANTA 4U2RA 1FQBA 5D5VB 1WCMJ 1QRYA 2NOGA 3CCMI 1LAGE 2UWMA 3MBPA 1Q9DA 3RYDA 5EEAA 1SDXA 5I57A 1E0EA 3CFLA 1Q1VA 4GGGA 4A3FJ 1Z1DA 2VASA 4V2FA 1ZMGA 2QQAA 3KFMA 1XDUA 3FJGA 3U1KA 2D1VA 2HTSA 3AG1H 1RKMA 3GTOJ 2LAOA 2W48A 4QPQA 2CO5A 5JVTA 2CV0A 3TOBA 1JNFA 1GTKA 1POTA 2E0SA 2Y7IA 1ZYRF 4Z2YA 4HX4A 3K69A 1OMIA 4YELA 5GP9A 4D9JA 4HX8A 4I0BA 4B1RA 3VEPA 1FZPB 4QRZA 4DZJA 2DOEA 2L4AA 3TQWA 3S2VA 3HOSA 5E18F 3GTPJ 2XX8A 1JW5A 1W7PA 4FCYA 4OANA 4NG7A 3SYTA 3AAFA 2YLNA 3QSLA 3E78A 1OVTA 3KZGA 3SFIA 3BIHA 1D5VA 1UTHB 1E3HA 3WHCA 3BZ6A 1MZBA 4ZYDA 1R71A 3ASOH 2RQPA 2QPQA 2XX7A 3PL8A 4N0BA 2LF8A 3G7WA 4FHTA 3KEYA 2ZKZA 3DBLB 5LLQA 2ZC2A 3WTYC 4KHZE 4ZE9A 2ZJRF 2Y0MA 2JA7J 1IAWA 2HDCA 3CCLI 5F0CA 4II2A 3PUFA 4F91B 4E7KA 2IRFG 1Y1MA 3IOUA 2QVUA 3VB2A 3GO5A 4EMSA 2CWEA 3COAC 1W0UA 3GFMA 2ZXIA 3ZKKA 4E7SA 2H8RA 1MRPA 3HRMA 2WV0A 2FQ4A 3PUXE 3THIA 1YRNA 3KBZA 2IBDA 2V79A 5F04A 2A6EF 3GZ6A 3CJQB 3E6BA 4IB2A 4WWCA 3MZYA 1FEXA 3FMSA 4FE7A 4PJJA 5DVIA 4LA9A 3D5LA 3EETA 3A01B 5B3SH 3CR9A 4DE8A 2WTEA 4A3JJ 5LGTA 1S72I 1HW2A 4KUMA 3FXJA 1VFCA 2A5TB 4O3MA 2GBYA 3N94A 3A1YA 1Y1VJ 3D1NI 1GVCA 1YIOA 1G8XA 4PK4A 3I56I 1ZRFA 4E70A 1JVXA 1MBGA 1LUJB 4GIZA 1OPCA 4AS4A 3MP1A 2XPVA 1ELJA 2MKZA 1N76A 5EYHA 2PG4A 3KZZA 4HLXA 2R8TA 2X26A 4XLEA 1YPNA 2VONA 3MJNA 4MAGA 3WU0A 3OYAA 3JAMK 3GWZA 5BS6A 4II3A 2K7LA 2DA3A 2V26A 4OWRB 3HGYA 4BDYA 1YYZA 3TDZC 2B4MA 1SFOJ 2R7WA 1JUPA 3L2QA 5H8FB 1T98A 1Z7UA 4RBOA 2L9SA 5LHGA 2EIJH 1SW1A 3B6TA 4U21A 3DTEA 4MNPA 4IO7A 2IW5A 5E79C 1RDYA 2CS3A 5FB2A 4G2ZA 4R2BA 3F22A 4Y3OA 3RZOJ 2EV6A 2OBPA 1LDKB 1HCRA 4BDLA 3W3CA 4YFKF 2Z22A 2K85A 2MYSA 2DE3A 4JBAA 4XKCA 1JUSA 2V1UA 1X1PA 2K3PA 4EM1A 1LBZA 2OF7A 1IUDA 1T39A 3PMWA 4EJTA 3ZOBA 2XSDC 2WC2A 4AC0A 3NEUA 4KT5C 3FXUA 3ULQB 2GLOA 2V3QA 3RCOA 1SI1A 4NWDA 5DT6A 1IXSB 2ME0A 1P6RA 1XSXA 1YIJI 1FBCA 1NV5A 5GTIC 4A3KJ 1URDA 4DXCA 3E3VA 2XC7A 1UHSA 2QS4A 4LG3A 1V4RA 3BLYA 2ZMEC 1H45A 2WEFA 1B9NA 4R79A 2BHZA 2KIQA 4ZECA 4X48A 3KG2A 4MHFA 2QGUA 3DKXA 3CO7C 2X7QA 3BKIB 5I57B 2WYKA 2VHAA 3D1RA 3K4BA 1IUFA 1QGPA 5TP9A 1NH8A 2HKOA 5KCMA 2ID6A 5F0HA 1VQKI 1LB2A 1Z3XA 3F8CA 1B6HA 2CMOA 3TDJA 1DUXC 4L9VA 4A3IJ 4YZZA 3O2PE 1H9TA 1XC5A 6PAXA 2PFYA 2JJ7A 1ZIUA 3P7NA 4FATA 3W6JB 1OYIA 4D5FA 3BG7A 1ZK8A 5IYBJ 1R00A 3VVEA 1W7PB 1S7OA 3U1OA 1ODDA 4KDPA 1F5TA 3I58A 4M73A 1A6IA 1OJLA 2ZYNA 5L3FA 2KR0A 3EN3A 1RNLA 1MQGA 1B5HA 4GL8A 2GA2A 2B65A 5F0FA 4AVZA 1SW5A 1HXDA 3WU1B 1JXSA 3B6WA 4PDDA 2D2WA 2HPMA 3S9NC 4IO3A 4CICA 2L0KA 2AL4A 3MYUA 4KD5A 2X6OA 3I55I 2F3DA 1IRFA 3ZXSA 5CVIA 1HSTA 2X48A 3CJRB 2XAJA 3BTLA 4XLCA 4DXUA 3UGWA 5J1UA 3KP3A 3K2AA 1MXXA 2V93A 2VKHA 4LFUA 2QVRA 1VTNC 1YS6A 3GCMA 2PQ8A 4BE1A 1NV4A 5EDNA 3PD9A 3MVPA 2MSYA 1G3YA 3KFWX 4EATA 1R5ID 1EH6A 2G7UA 3OYBA 1VQNI 3CFZA 2EV0A 1W4MA 3IWZA 4YFNF 2P2AA 3Q3SA 1ZARA 2K02A 2VBXA 2DLLA 4LJZF 4CUGA 1YRNB 4JVCA 4HX7A 5H8QA 3QQAA 1LBXA 4X0GA 5BNGA 3RN8A 4DJAA 3HOZJ 1YAEA 2M8CA 4ISUA 1T08B 2WADA 2BEOA 2RC9A 2N8GA 2F7CA 2DU9A 3DP4A 3OO6A 4DIGA 4BJ5C 5E17F 3HM5A 2F4OB 3S1RJ 1L3LA 2Q88A 4IXAA 3GLLA 2CW7A 5K1YA 2NWJA 4NF0A 2FF4A 1HKTA 3PNVA 1FX7A 3VLUA 3M4OJ 3TKDA 1NH3A 3OIQA 1DDNA 1X4OA 1MY4A 4NGUA 2RAEA 4F2OA 2VUMJ 4BGDA 1B5IA 2KISA 2CW0F 3QU6A 1J7KA 1ZHFA 2JWTA 3NARA 4U87A 5B66C 4GBWA 3V8XB 3EYYA 5I7IA 1XS5A 2NOJB 4UHTA 3A3UA 1HW5A 4XLFA 3VE1B 2DK8A 4ESFA 3OYDA 1D1CA 4A3GJ 1TT5B 2XWKA 1L0OC 3BR5A 3WU2C 1UIVA 3RJPA 4B47A 1X58A 3PMXA 2PJRA 4HSTA 2UUZA 2DMTA 3F21A 1AKHA 1LB8A 4MQVA 1VQPI 1JHFA 3BOQA 4YIFA 1FPJA 2V9KA 2I49A 3HB9A 5JVGF 1I39A 1XCBA 2Y0SA 3C1DA 1KU9A 3GMEA 1XN7A 1NFTA 3G73A 3V7RA 1A8EA 1MMNA 2HFBA 2OBGA 5LEKA 2O61A 2RCAA 1OVBA 2CEYA 1YTVA 4N6DA 1QVUA 2VD3A 1Z77A 2DMQA 1K4TA 4JWYA 4GFRA 3L00A 3ZQHA 1Z7ME 4C0RA 2O8XA 4LG0A 2VBWA 2I48A 1D9YA 5I3SA 4HOBA 4GO1A 1B1BA 2I5UA 1CNQA 1P7IA 1PBQA 1A04A 2CV2A 1J0RA 4MH5A 3D5SC 2V4JC 2X0LA 4K2EA 4ENMA 3I4NJ 1YX5A 4HF0A 4HSRA 3CJNA 5HVQC 3GTKJ 2DXYA 4YKIA 2DT7B 3Q5FA 1USSA 3R4KA 4YMBA 1G4DA 1B4AA 2F5FA 4D7NA 3KETA 1AU7A 2ZSHB 1MMGA 5F1RA 1FBHA 5IOYA 2LDUA 4KJZA 3I3LA 1O64A 4OHNA 3FXQA 4ZYGA 4ZTFA 2RCBA 4ELQA 2DA6A 1FQEA 3KGCA 4GBVA 2VJIA 1PP8F 1MXYA 2XXPA 5J1YA 5T3JA 3GZNB 2L9VA 2M7AA 5TP9B 2DFEA 1BOAA 1YW7A 3FHZA 4IZZA 3CTAA 2RVCA 5LTCA 1FBQA 3O6IA 1LPQA 2QKLB 4MNIA 4ZYHA 3OELA 2DOAA 3LFKA 3T8TA 2R7FA 4P9FA 1U3EM 3H3GA 2UYFA 2DWJA 2FVZA 4G8NA 1Y3NA 4DXBA 4XKQA 1NV7A 4FBPA 2DDBA 4IX7A 5AIQA 1D9VA 4FECA 4NBQA 2DA1A 2E71A 4F7ZA 3J80Z 3SKPA 3BCBA 4XIDA 1LE8A 3SQNA 2JVGA 1R1TA 3BG6A 2DK5A 2KIUA 3HSFA 3IUOA 3CLOA 2Q0OA 5CVJA 1B4ZA 1FJ9A 2FIXA 2Q9TA 3IFAA 4AYBA 5EQ8A 2VC0A 1FTJA 2H25A 3M9AA 3SEWA 2HZTA 2W4SA 3W6VA 3MZ8A 4IHTA 4N4UA 4JQFA 1EH3A 2V6EA 2PMZA 3H6VA 5I58A 3GTQJ 4GYGA 2K27A 2RN7A 3N5LA 3ZPLA 2HPIA 5KNLA 3JRFA 4M9ZA 2A07F 4GRKA 5CC2A 4CCKA 4JWXA 4P0GA 4D0PA 4U7DA 4OEVA 3MVXA 1RDXA 1UTBA 4B3XA 4QFLA 1E17A 3G3IA 1XVXA 4EJWA 3LA7A 3FXRA 4A93J 1FOWA 2JA2A 2KIMA 4AVPA 4MFIA 3UK4A 1FPBA 2E60A 2X85A 3D4CA 4IY6A 4R74A 4HA8A 4BYYA 4RDUA 2F97A 1G3SA 1X4PA 2ONSA 5FBPA 3PUWE 3HCQA 1BTJA 3L6GA 5H8QB 1Q1HA 4BKXA 3LSJA 5DDGA 2B9SA 1WH5A 1FNNA 1R22A 2FU4A 4RS8A 4YU0A 1IXHA 1T33A 3M3YJ 4ETSA 4YKKA 1LCTA 3PUVE 2XSJC 1IC8A 1P92A 4OU0A 1B3FA 5DW8A 2F5DA 1FJ6A 2ALUA 3GW2A 2PVUA 4L0YB 4KFCA 1A5JA 2V9PA 4BL0B 3SESA 2I8DA 4XSZF 1G0IA 4F29A 5EYGA 1OISA 3MQ0A 1QW0A 1USYE 2RC7A 3PSIA 3K6UA 5JK4A 3MN2A 4G7ZF 4M72A 3IKVA 1K9YA 3PQKA 2CFXA 3ZQLA 3JRHA 3VLVA 4CO8A 4BNCA 4AS5A 4O3CA 2F5VA 1Y20A 4IY5A 3V8LA 4PAFA 5IGAA 5D8LB 2PJRB 1I3QJ 5F08A 4FE8A 4LOCA 2MGQA 1AKHB 2CV1A 1ZR4A 2QSGX 4OQOA 1ZTYA 1FPQA 5DTBA 4HW8A 3FJMA 1SI0A 4M3EA 2HEOA 3GTMJ 2FIEA 1IRZA 4UVCA 4RLFA 4ZS9A 2XF6A 1O3RA 1JJ8C 4ZH4F 4C3IJ 3OYNA 4UUVA 4RNSA 2KL4A 3EUKL 2K86A 4HZFA 4XFEA 5E8IA 3V5AA 1J1NA 5JR3A 4M6VA 1FTKA 4I1DA 4YRVA 1X1CA 4DZPA 4M3BA 1RUOA 1QZZA 2Y31A 5EJCA 2A5WA 3JAMZ 2Q8KA 4LG0B 1TFAA 1FBEA 2PYYA 2OA4A 3DEUA 1K6OA 3K4JA 1KZ8A 3KX2A 3QODA 1PEBA 5F7VA 3FMRA 3CSGA 2ELHA 1RC9A 2IJLA 3VXBA 3K10A 4PF8A 4LZ7A 4DQ2A 3TTKA 1A31A 3FBIB 2XGXA 2W7YA 4B4CA 1ZG3A 3CP8A 3CMAI 1UG2A 5BMZA 3BFTA 3E6MA 4XORA 2R5YA 1ZGWA 1P1OA 4AU7A 2I4CA 1MBEA 4PCDA 5DTDA 1MY1A 4PGGA 1UCRA 3P9CA 2GXBA 1DTZA 2GRVA 3MVZA 5ESYA 4ZZEA 2E1MB 2EZHA 3QPHA 2YJPA 3T0YA 2FNPA 4KN4X 4BQOA 1FIPA 1N78A 2VQHA 3WGGA 1SD3A 2DVZA 4XR6A 4WK8F 2FJ1A 1BR4A 2CRGA 3ABMH 3W6KB 1MBHA 2ISYA 4ENKA 1RIOH 1K78A 3FF5A 3A09A 3BG5A 4Y7NJ 1LE8B 3OD7A 2BY1A 3RTWB 5J8CA 5FO5A 1BKAA 2QMWA 1R4MB 2DA7A 3L6HA 1ZN2A 2K4BA 4OVPA 4PTKA 1T6SA 2M4GA 3HKZA 3QYFA 1Z3YA 2BXYA 2HQAA 1TZLA 1ETVA 2O68A 2O7UA 5I58B 1YQAA 2XRNA 2M2EA 4MGRA 2VE9A 3LSIA 3ML6A 3VYSB 2THIA 2LY1A 4ZJZA 4EXLA 5H8HB 3RGYA 1G3TA 4PDKA 1B9MA 5ICTA 2W24A 5CVRA 1IMEA 2I0CA 2CQNA 2DQLA 4NF4A 2ELJA 4Y33A 3HRSA 1UTBB 3HHHA 1B59A 1DP7P 3QMFA 4I6ZA 1O3TA 2HS5A 1LB9A 1U2WA 4OMZA 4DI3D 2K9NA 5IZZA 2XXXA 3OOPA 5ET8A 4LN5A 1MW7A 3ZQ7A 1R9TJ 1AHDP 2L9NA 1A54A 2CJJA 3RI4A 4NC7A 2Q2EA 2WKYA 3DBHB 1IUYA 1GHCA 4G6TB 2UVJA 2O0YA 2Y75A 1XSVA 4I01A 1FPLA 4EQ9A 1Z9CA 1TWHJ 3FM5A 1AOYA 2OJED 5JLWA 3A3CA 2XGEA 2E7XA 3W9VA 3F72A 1B0LA 3D5RC 2XDVA 4LD5A 5ICEA 4Q47A 2ICWG 3OYGA 4KYDA 3TELA 2BV6A 2FBPA 5F1JA 3U72A 2A5YB 2ZSIB 2A05A 3ZRGA 4RB3C 2OJTA 2VP1A 1P9QC 4P1WA 4H45A 3FHNA 1WWXA 3VSKA 3MC2A 4WEDA 4H65A 3HUGA 3F8NA 4RM2A 5K7FA 3U93A 5EHSA 3A03A 4F3BA 2ZZXA 2G9WA 3HSTA 3FXLA 1J75A 2W7NA 3RQ4A 3GTGJ 3ZSFA 3TTNA 2LBFA 2W85A 2OCUA 4JVIA 1GUUA 3K4MA 5E1WA 1SBPA 3E5UA 3U1DA 1LCFA 4EDPA 4MTEA 4G68A 4IO6A 3CDLA 3J81K 3MPLA 2CZLA 5M2VA 4M6XA 1EA3A 1P7JA 5FLMJ 4G61A 3GFJA 3K6GA 5HS7A 1SYIA 4L9JA 3JRBA 1ERDA 1NKXA 1O4XA 1HA8A 5AA2D 4O5VA 3IWFA 3ZMZA 2A6HF 1QBJA 2AL5A 3PSFA 5FRNA 3QU3A 3OO9A 3E1SA 4M3GA 3QPTA 4I0AA 4OVSA 3DLNA 2CQKA 3BR0A 1G59A 2LLKA 3ERED 1ETXA 1WJCA 2PMUA 1RDZA 4ZTJA 3Q25A 3BJOA 3NWTA 2X1DA 4JDFA 5A2QK 5LDZA 1TWYA 4MF3A 4N4OB 3N6TA 2O6GE 5EQ9A 2AYSA 3B73A 4HQEA 3UKGA 2LG4A 3HOUJ 3G3JA 5IZ3A 3PTYA 5K2XA 1D9QA 3JRCA 4GWSA 4L9NA 4RAGA 3IRQA 3PUYE 2JT1A 3LOCA 5DEQA 3RPUA 2KQZA 5FLVA 5BPDA 1HLVA 2IGNA 2XAHA 4JYKA 4XRSA 1FPIA 3DTKA 5FROA 1A8FA 4FISA 4M71A 3FVNA 1NH7A 2Q89A 1ZJLA 3KP6A 2E35A 2CZIA 2D1HA 4MTDA 1WQ2A 3GFIA 2QJEA 4ZEKA 4HDVA 1ZGAA 3O3KA 3OYKA 2R5YB 2KRHA 3U65A 3S1QJ 4NQ8A 2UVGA 4ECFA 4RGXA 2GH9A 2WY7Q 1WH7A 2P6SA 1K79A 1GV2A 3C35A 2VPOA 1TW3A 2KLOA 2FEZA 3ABUA 4LITA 3I0TA 5E1ZB 3BWGA 2WYPA 3E6CC 2X6YA 2PEXA 1K78B 4BXFA 1F9NA 3A0HC 1FPEA 1UIUA 3B02A 4KMUX 5EG0A 2W82A 5DD8A 4ABZA 2GQQA 2VPRA 5L8DA 3N97A 3IAS2 1SAUA 3AL0B 1MNDA 4G6DA 5J4YA 1TWFJ 1QKAA 1T0FC 1OIBA 5EEHA 1LFHA 1SMTA 1HSJA 2MABA 1LBVA 2DPUA 2DFHA 2DWIA 3IB0A 4F18A 3AG3H 1MBJA 4BHBA 3RIRA 3HDDA 3Q0WA 2NUVA 2QQ9A 4IOAF 2V6CA 4P5OA 5J47A 2L7KA 2HU9A 4KICA 2M5WA 1MJBA 5EEGA 3KPHA 5EF6A 1ETQA 2H1KA 1GXQA 4I02A 3H5NA 4NF4B 1RUNA 1NV0A 1JKQC 2IA0A 1UB9A 2HXOA 2E5ZA 3FXMA 4EJUA 1VF9A 3ZR8X 1VZ0A 3KZIC 5HBCA 1LEBA 1RKWA 1TT0A 1PB8A 2QSXA 1SFXA 3BFUA 1SVOA 4BDRA 5LGUA 1WVRA 1NK2P 2Q2EB 3K0VA 5EQ7A 2WAQN 2VI6A 1U9OA 4XMYA 1GXPA 1W36C 3OY9A 4LVQA 4PETA 1SD7A 5TRDA 4OIPF 1WJDA 1B72A 1AOVA 2HVRA 2QCOA 3PNYA 5M5YJ 2G0EA 2VN2A 4UY8I 4FX0A 2DFIA 2D5VA 3Q26A 4NEDA 2Q8JA 2FUG2 4B09A 2JA5J 2MD5A 1AWBA 1JW4A 3CFXA 4I3EA 2FRHA 3KYDB 1SC7A 2R92J 2I0BA 4BU2A 3RQTA 3W2WA 1B7HA 1ON1A 1DMBA 1P1UA 3HUGB 4U88A 5KVRA 1B5JA 2QS3A 3KN3A 2VOPA 5EQAA 5BWJA 4P9UA 2DS9A 2DWHA 4HE0A 3K02A 2LBFB 3HN0A 2QZ8A 5I2NA 4IGTA 1BJAA 1BI3A 1UHMA 4O6JA 4RLQA 1YTYA 2BHYA 2MA3A 4G68B 4IF4A 2K3FA 3C33A 2FBIA 3CHGA 2AIXA 2XB5A 3CRBA 4H8IA 2A61A 4N8GA 4ELRA 1MBKA 4CH7A 2VB6A 1GVDA 4R1HA 2WA0A 4OIRF 3TBIA 4FJPA 1FBFA 4XNFA 2MC4A 1MMSA 2ZJPF 4PSWA 3LL7A 2GHBA 2FX0A 1Y56A 2EB7A 2JPCA 1MSEC 1BR2A 4V19K 2G93A 4BDQA 2Y5LA 3K1PA 3ZMTA 1B1XA 3H9QA 1ZRDA 4ZDLA 1OR7A 2Z2SB 4JX5A 3O9PA 2KJCA 2R4GA 3V42A 3VDXA 5ICFA 3ZN1A 4BXUA 4IKFA 1OMPA 2FXAA 5AA2A 3LA3A 3O29A 3LMMA 5IZ3B 1U6GA 1SD6A 2EZLA 2W84A 4RA2A 1II5A 2REJA 2F2EA 2H09A 4YIRX 1WJ5A 4ENJA 2R7SA 1A35A 4H0WA 4F19A 4H1XA 3RKYA 4P3LA 3F3XA 2LMDA 3C34A 1XCVA 1O7FA 1JE8A 2NNYA 4DI4B 3A4CA 1LFBA 3SHFA 2HQ5A 4P55A 5D8KB 3IJOB 2WY8Q 2HZLA 1BC7C 2XWOA 3SEYA 5ED4A 3ABLH 2CEXA 2F4MB 3F11A 2XXTA 4C3JJ 1V3FA 2L2OA 3IOWA 1VQ8I 2R7UA 2V84A 3BPXA 3CI8A 4YB5A 2BY2A 1G0HA 3H6UA 5E3LA 2DA4A 2KHMA 4BBRJ 1I3AA 3E6DA 4IL6C 1MM6A 4HPQA 3NAUA 4M74A 2L5VA 1APLC 3CCUI 3AKZA 2QM3A 3DPTA 2YUSA 4QSHA 3RKQA 5EG0B 1CE2A 4YAHX 3S32A 4YKJA 3CD6I 4UABA 1FOKA 1BIYA 3H3VK 4NX1A 3DPUA 1H43A 3FZVA 4AIKA 2PJPA 4CYDA 1OQHA 2XHDA 5ELVA 2NS7A 4E7HA 3QWLA 5CJ9A 3MZBA 1FIAA 3ECRA 2FD5A 3FK7A 5LRSA 3BBRA 4GX6A 1GR2A 1IMBA 2E19A 3L2RA 3CO6C 1Q1KA 1ZRCA 2DTRA 5HS8A 3VXCA 4YG2F 4KN7X 5IP6A 5EZGA 3EUHA 2ZZWA 4ZEFA 1HC8A 3OYCA 3ILUB 1Y8RB 5HLHA 1Z7LA 1LJ9A 5GADJ 1HW1A 2FMLA 2BW3A 4ELPA 4IJAA 2KIFA 4PFYA 3T9VA 4I62A 5E3OA 3BR3A 3RSNA 2RDPA 1BIAA 3TOAA 3S14J 3H4ZA 1BN5A 4G9YA 1SAXA 4CXFA 1B72B 1A40A 4Y17A 3IX1A 3QPLA 4NAPA 5CBRA 2F5XA 4A12A 2B7EA 1O7LA 3DPLC 4PFPA 3H6WA 4NC8A 3OYLA 5CYVA 4X04A 5M3FJ 3GX4X 2WB1A 3WGHA 4CCMA 1N77A 3PD8A 2BYVE 3SEVA 4ZZLA 2ETHA 1B2HA 2EFNA 2CW8A 3HZJA 3R60A 2WAQA 2IS2A 4PP0A 4Y13A 3F23A 5IY5H 3S2WA 1AWCA 1I27A 2FA5A 4LB6B 4FX4A 2K9QA 4IRIA 2KJBA 5I2NB 3ZMUA 2OX3A 3TCHA 3VYTB 1IXCA 2QQBA 4UUTA 1B52A 1F36A 1VSOA 3HTUA 4NHJA 1T2KA 2KKOA 3DEEA 4L5JA 3K4UA 2OZ6A 1XGSA 3OL4A 2VIXA 4H0EA 4NF6A 4U4SA 4HS7A 1VQOI 3V4GA 3LR1A 2FOWA 4IOCF 1YCJA 5KCJA 2IPQX 4XLPF 5ICCA 1HOMA 1MDQA 2ADUA 4XRFA 2JZYA 4U1ZA 2DN0A 2CMPA 2DQRA 5HLGA 2R7XA 1R4NB 1FBUA 5AIPA 3HRUA 1A6QA 2BZTA 3IR1A 1YITI 2KZGA 4PJMA 2QKMB 4FIMA 2AO9A 1L5TA 3S8PA 1EH7A 4EGYA 3KP7A 4IQ4A 2FMYA 4PCQA 2XAFA 5J6XA 5LFAA 3E4RA 2H8WA 2O3FA 5JTYA 3SZGA 5AA2B 1ITYA 1IN6A 2NS0A 1H3DA 5DYHA 2QEXI 4XN3A 3IL2A 1MPCA 2A69F 3E0JB 1KWHA 1YE9A 4L17A 1SVXB 4Q5TA 5J16A 3WTUC 4ON0A 2M7BA 3K4NA 5HDNA 1QU3A 1AA7A 1OKRA 1FQDA 1NTCA 4A3DJ 1IITA 2F6CA 1JUMA 3U21A 3A02A 1HSLA 3TCGA 3H92A 1B6AA 2DA5A 1BR1A 2QYOA 1DBZA 1QVSA 4UNOA 1P1NA 2ELKA 1FSAA 3TQNA 4MFEA 1XOCA 3TFLA 1NNTA 4M3FA 4RK2A 5A2QZ 1N25A 4CA0A 4ND9A 2Y2ZA 1MSFC 3QK6A 3RUMA 3WTZA 1SD4A 4U7BA 1RYXA 4JX4A 3HL2A 3K6VA 1IMCA 3WODF 3L2UA 3H5RA 4ZZDA 3AFHA 1PBPA 3W2VA 2KPMA 2P5VA 4XQFA 4Y4RA 3IKTA 3CCQI 1RRJA 1ZKBA 3EHUA 3MVWA 4O7MA 3IHUA 2R7QA 2ECCA 1BJZA 3P7IA 2DAOA 3OL3A 2HYFA 5ET7A 2COBA 3DV8A 1MY3A 3USDA 5AA3A 5KZTA 4BXXJ 1BK4A 4G8XA 1D4NA 3B8BA 3IL1B 2H27A 3DU6A 1BLFA 4FAJA 1WODA 4L0ZB 1OYYA 3TP0A 2NXNB 3DELB 5E3MA 4IR8A 2XXVA 2R9JA 4A69C 3EYIA 3FM3A 5L9MA 2IGMA 2P0SA 2JUGA 2L4MA 4X1DA 2ZB9A 2R3SA 5I59A 5AONA 1SVLA 5D6FA 2IXSA 2E2HJ 2WAEA 2DYRH 2HAVA 2Y69H 5FKMA 4GCVA 1MMDA 2DSFA 3O66A 4TV7A 2H99A 3F6OA 3DCFA 3L1PA 1SPIA 1OLCA 4CSWA 3G3FA 3OO7A 3WTSC 2BW3B 4I40A 2DYSH 1D3YA 3M1EA 4XLAA 2M30A 4C30A 1KQ0A 3GXOA 4GDFA 1NNPA 2O8KA 1Y8QB 2G7HA 1PB9A 3GVAA 4C2UA 2PFZA 3G2BA 4B8XA 4EJVA 1RR7A 4Q30B 2VOZA 4NUBA 1LVKA 1D1AA 3LA2A 5IPAA 1GT0C 1PDNC 1KA0A 2D21A 2O69A 2XXRA 1SFUA 2F5CA 2QLZA 1K7AA 5CQEA 1DOTA 5DCFA 1IRXA 3RQIA 4EM0B 4NHBA 5ET6A 1QPMA 2QBYA 2RV8A 4PBHA 2Y7RA 1M5FA 4N91A 3JV9A 3J7AO 4R72A 1ZAOA 3MZ9A 1XTAA 2DMUA 3H0GJ 2E1MC 4EVIA 2F78A 3MCZA 4IGRA 1Y3PA 1RPWA 2Q2CA 4RPOA 1WI9A 4U0VA 2AQFA 3KC0A 4HV6A 1ETOA 2RQQA 1TC3C 2VQGA 1RYOA 2ZMBA 1OQYA 1R49A 4NF6B 3T22A 1INPA 3PIOF 5H6QA 1ZREA 4DOZA 2JQ7A 2VPLA 4A6DA 3IO4A 1M5EA 1TQIA 3DXJF 4M9XA 1FYLA 1Z91A 2XHKA 5KCJB 2LC2A 4BEHA 4JOMA 2MD0A 3JSPA 3HFUA 1T95A 1FJLA 4ZZAA 2XGCA 3GTLJ 1B0HA 3REOA 3RKXA 1S9HA 4PGNA 2DMPA 2L3DA 5LHIA 1MQHA 5JI6A 1ANFA 2ZXHA 3MSTA 2JRMA 2OCEA 2VGQA 4N9IA 1B05A 2ABHA 2BE5F 1YXIA 3FUZA 4RAFA 3DP6A 3BZKA 3H35A 1JJ6C 1ZQ3P 3FXBA 2EIMH 1IN4A 4AWXB 5ICGA 3LV0A 5JTYB 4LP2B 3L9FA 2LP0A 4LIUA 4BY7J 4N4NB 1OCRH 1NNKA 2O6AA 1YW8A 2PMHA 1CQTA 1BL0A 2XXHA 4ENNA 2BVMA 3JW4A 4RB0A 4P0IA 3I64A 4R6KA 2EFWA 3SERA 3S3MA 1S7YA 2X7PA 3QYBA 3DTIA 1MXWA 5FHMA 2JMWA 3S93A 2FBHA 4UXNA 3C36A 3MUQA 3LWFA 4M9SA 1GDTA 2HOTA 3L2VA 3RYRA 5H20A 3G3KA 2NS8A 4MEXF 4D1QA 4KA4A 1Y1ZA 4BJTA 2M1BA 3N26A 4JXIA 2R93J 4RGSA 5H8HA 2Z8DA 2V3UA 1S7EA 2HFHA 4KYWA 4KIFA 2DJNA 1FSEA 1TNTA 3DBRB 3DQVC 3GFLA 1WHUA 1LBWA 3ROJA 4XN0A 4GWUA 4JSOA 4R6HA 4N9HA 4G8MA 1YG2A 4DLDA 2ZYOA 3L7WA 5DD4A 3EHSA 3LC8A 1YW9A 1PUFA 1GGGA 2UVIA 4GLIA 1BM9A 1OCOH 4RK9A 3FVGA 3SXYA 3K9TA 1XI6A 4OFLA 4MO7A 5HS9A 2XXWA 1KQ8A 3TMGA 1U8BA 1QUKA 1WDNA 1RI7A 1IN5A 1K61A 3E3KA 1B58A 5TPAA 2Z33A 4ZEIA 4R75A 4TLMB 3NRVA 3G3HA 4LLLA 1T38A 5EZHA 3UIFA 1IMAA 5FFXA 1R23A 4X9TA 3I5OA 4EUOA 2KFDA 4RM3A 5FFZA 3SEUA 5I59B 4UACA 4YFXF 2QUFA 3SZPA 3PO2J 4IO4A 4WEPA 4MEYF 1H8AC 4RMNA 4PE3A 1LFPA 1KQ9A 3DU5A 3BTJA 4L18B 1IQ7A 1T8IA 3MVYA 1HBXG 5E1XA 4HBLA 4KIGA 2X51A 1KZHA 1YZ0A 3M3KA 1GLNA 1TWGJ 4FEBA 5F1QA 3J7YJ 2DOFA 3HG9A 3G3GA 5J3LA 1HF0A 3JTGA 5J1DA 1WJBA 4A3LJ 5H2FC 3CSBA 3OMBA 3CCJI 3TGNA 3HEFA 4ZEBA 2IGKA 2X6XA 3ECHA 3VODA 3O8GA 4U1OA 2RKMA 2RNGA 2F6PA 1WJEA 2J5PA 3KC1A 3B50A 2IA1A 4KR5A 1EKEA 1D5YA 2QBYB 3E5XA 4DBRA 1EF4A 3KOTA 5EGOA 2Z9OA 4WXJA 1JP4A 4XKBA 2JJKA 4AD9A 2I10A 2WBMA 4IVNA 1FQFA 3VSLA 4JP0A 2GIVA 2Y48A 3Q0UA 5D4SA 4F1VA 4F3GA 2VD2A 5BUUA 4ZEDA 5M5WJ 2HDWA 5D5UB 3R6SA 3B6CA 2Z23A 3B6AA 2P0WA 4OOIA 3M8JA 4XKVA 5GAEJ 2HTJA 2H5YA 2XXQA 1D3KA 3G1MA 3F9KA 4RAZA 2XAGA 2XX9A 2IA2A 3AL0C 4YKPA 2W00A 4WXCA 3ZQFA 1A99A 2F36A 4GWOA 4BEHB 1V55H 3I3VA 1FPGA 4X1EA 1TNSA 2FBKA 3S1NJ 4RB2C 1SW4A 1Y4CA 3O97A 1HDPA 4S05A 5IKBA 3ABTA 1B7ZA 3RPWA 1POY1 5I2KA 4OIOF 5TGTA 3ZQIA 4GVOA 2H9BA 3MWMA 4I8CA 1POGA 2GIZA 4XSXF 5LOMA 3TL4X 1RZ4A 4MMPA 2RF1A 2FE3A 1FP2A 3BROA 4IO9F 4EXKA 2BY3A 5CI5A 4R9FA 5LHHA 3ZQCA 2C6YA 1BI2A 4A5MA 3A29A 2IP2A 4RAYA 2XAUA 1P1WA 2OZZA 3WG9A 4OESA 3RZDJ 2OTJI 2WBBA 4DCYA 3T93B 3MWBA 4F52A 3ASNH 2ZFWA 4C3HJ 1SMYF 2AS5F 2UYEA 1ATGA 4I98B 5FHNA 3CMYA 3RTFB 1V54H 2E7WA 2XVCA 2DO7A 3H3UA 4BJ6C 4E7LA 2DDAA 3LSTA 4GFBA 3MEXA 4PFWA 5DS9A 3OOAA 3E7LA 4CCOA 3TUSA 1ON2A 1GV5A 1XD7A 2LF7A 4NNJA 4XLNF 3M8EA 1G6NA 3D0SA 4KIBA 4UV9A 3JSOA 3AG4H 4NC6A 2EA4A 4MEVA 3KZYA 1U8RA 1FP1D 2Q1ZB 4HCYA 3C18A 3CUOA 1LFIA 1CGPA 3CF5F 1OCCH 4NB5A 5D5XB 3S3NA 2QENA 2OWTA 5BOXA 2KRCA 4N6KA 5GAHJ 2R7ZJ 3S15J 5KDTA 2HXIA 3K70D 2PX1A 4MCOA 2AHQA 2E5NA 3BQYA 3U9GA 1LBCA 2O51A 3N6UA 1PUFB 3LAPA 5FKOA 2L7FP 3HOWJ 2E1SA 3G1OA 4HE1A 1FBSA 2K9SA 4OETA 4EGZA 4PZJA 4G68C 1B7UA 1IN8A 1SW2A 3I9V2 1S5LC 3WGIA 3OYEA 4DYQA 3M8UA 5FKNA 4R2FA 5CBSA 5I56B 3M1CA 4ITVA 3MW0A 1BOBA 3MAJA 1J9IA 2O1MA 5TPAB 1MS7A 4BE2A 4LZ8A 3TYHA 3E9XA 4BLAA 4N13A 3HHGA 2HXRA 4BH9A 2B63J 2M3AA 3PU5A 5DVFA 1KU7A 3CQZJ 1SD5A 3S9MC 4LB5A 1R6RA 2OV7A 2VKEA 3ISPA 4GRIA 4XKPA 1N75A 3IP4B 3H5AA 1FT9A 1M1EB 3OEMA 5DCMA 1LNWA 4ESBA 4IEJA 5FJ8J 1LLSA 3GXAA 2NVXJ 4ZC3A 2GXGA 3S2DJ 4JB7A 1USTA 5GPAA 2I4BA 3O28A 4RB1A 5K5RA 4XONA 1GVJA 3RPQA 2MBFA 1NUYA 2V4CA 3MKZA 1FTZA 3TTMA 2I58A 1MJAA 2PX9A 3LSMA 3V89B 2XGDA 3SETA 1UJ8A 4HLYA 2Z8EA 4LUBA 4P56A 4C2MJ 1U5TC 2QSFX 2IS4A 2EWNA 1P4WA 3HGGA 4F22A 2OK2A 2MC3A 2HWVA 3KP2A 1OYWA 2P1SA 4EQ7A 5I5PA 2FQ3A 3FXOA 1RESA 5EGOB 5B7DA 1EZOA 4BDZA 2CYYA 2CUJA 3CCSI 3VYUB 5GPCA 4TQUQ 1E3OC 2OC6A 4PJ0C 5KAFC 4OXVA 2LNBA 4A0YA 3OIPA 4DGWB 2CZKA 3CP2A 4PFUA 3QP5A 1DPUA 3ONQA 4G7OF 2M8EA 1JI8A 4UA8A 5HLTA 4YMAA 4DCXA 5DYMA 4RJZA 1NV6A 4UB6C 1JTYA 1B4HA 4OINF 1OQGA 2Q74A 4GD5A 1JVYA 1MNMC 2X4HA 4F55A 1S9TA 3QUJA 3VWBA 2E2IJ 3I6VA 3MKYB 4P1EA 3P9KA 3BG9A 5F24A 4E7ZA 2Z1DA 3CCVI 1N3XA 1U5TA 2EINH 1R1VA 2R7DA 3QPSA 1FBPA 3OEKA 4B48A 4JVDA 1MDMA 5C3EJ 1LFGA 4FQGA 1XHYA 4BDNA 2AXLA 2HZKA 3PO3J 2KQRA 3QAHA 1FYKA 5I2KB 4NWCA 1QUIA 4ZYEA 4WX9A 1MD0A 5AA1A 1N84A 1LAFE 4E6KG 4F3QA 2L02A 3I5UA 1R9QA 2IEEA 3OSFA 2ZJQF 4G7HF 1F9BA