4FEDA

Crystal structure of htt36q3h
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
401
structure length
401
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQQHQHQHQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Maltose-binding periplasmic protein,Huntingtin
publication title Beta conformation of polyglutamine track revealed by a crystal structure of Huntingtin N-terminal region with insertion of three histidine residues.
pubmed doi rcsb
source organism Escherichia coli
total genus 116
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fedA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fedA02
1UQWA 2A5TA 5AE4A 5A5XA 2RF1A 3S9MC 3ODBA 3EHTA 4PETA 2FNCA 5IAIA 5I58B 1ATGA 2OWTA 2V25A 1M5EA 2HCAA 1A40A 1B7ZA 4YB6A 4QFNA 1XOCA 2RKMA 5CC2A 1H76A 4YKJA 4G8HA 1MQHA 2RCBA 2HFBA 3KOTA 3I5OA 4G8NA 4OFOA 4MH5A 2A5SA 2Q2CA 5BWJA 3Q25A 1UTHB 2QS3A 2O51A 3C9HA 2P0SA 4R74A 1VSOA 2B3BA 3GXAA 3H6UA 3U8QA 3VV5A 5FHOA 2XX9A 4M4GA 1MXXA 3QSLA 2I0CA 2XXQA 4F22A 1A55A 2QL3A 2VGQA 1GVCA 5IKBA 3CIJA 3U72A 2ZNSA 1LFGA 3T96B 1URSA 3MVZA 3T93B 1N3XA 4EXLA 2F35A 3WAEA 1TFAA 4JSOA 3DELB 3O2AA 2D21A 1YAEA 4PFYA 3N6UA 4I8CA 4QSDA 3PMVA 4F3GA 1Y1ZA 2QSXA 2O68A 3IAZA 1SD3A 3FATA 3VLVA 1PDAA 4ZE9A 3FV2A 1EZOA 4Z7EA 3CSGA 4NF6A 2PT1A 3EF7A 4F2QA 3N26A 4IO5A 2AL4A 2F36A 1A8EA 5EHSA 2X26A 3FUZA 1IQ7A 4P11A 5JTYB 3MVYA 1UTBB 3PD8A 3OO8A 3N5LA 2ESNA 5H8NA 2VD2A 1SW1A 2H98A 4R6YA 5HBCA 4FEDA 4U23A 3TTLA 3T22A 2QPQA 3K6XA 3PPPA 4G77A 4OFJA 5CMMA 1BKAA 5H8HA 4JWXA 1O63A 3H06B 4RY1A 3MVWA 5L9OA 2AIXA 3LSWA 5FTIA 5B70A 4OYVA 2QS2A 2DSFA 4GVOA 1MPBA 2OWSA 5DTBA 4C0RA 4JXIA 3FIRA 3RUMA 1IZ1A 2A5TB 4NEDA 3UGWA 4OEVA 2Z8DA 4YZZA 1QKAA 1IXHA 4P0IA 3IB0A 3T66A 2PMSA 5L9MA 3O28A 2NWJA 1Y3PA 1OLCA 5CMCA 2ZXTA 2O7UA 3BFUA 4UACA 1FQCA 3OD7A 3FXQA 4ISUA 1I6AA 1JVXA 4F3BA 3K02A 2O84X 4N07A 3TTRA 1IEJA 4YB7A 3R26A 2DVCA 3KN8A 2XHDA 5DT6A 1DOTA 1A99A 4DXBA 3T9UA 1CE2A 1I6QA 1SW2A 4K3FA 2V3QA 3OELA 5CBSA 5FHNA 3M3FA 4G68A 2RC7A 2ZNUA 4OETA 3PUWE 2DWAA 4ZEIA 1XVXA 3A3UA 2E1SA 3UA8A 2DYXA 2AYSA 3UK4A 2XXYA 3FJMA 4HCYA 1MH4A 3F11A 2UXAA 3Q27A 3FGSA 1QULA 1O7TA 2UVGA 1JNFA 2QMWA 3WAFA 1UIVA 4JSDA 4GL0A 4NF6B 3DP8A 4H1XA 1Q1KA 1B7UA 2H9BA 3E4RA 5I2NA 4F3PA 1FTOA 5CMBA 4DIGA 3MZ1A 1P1UA 3U92A 3MPLA 3VXCA 2UYEA 2PVUA 2LAOA 4U22A 1MM7A 2DXRA 4RPOA 2Z23A 4X48A 1MDP1 3GBAA 1EZPA 4R2FA 1B05A 3KN7A 4TLMB 3K00A 3RLFE 3K1PA 1FQDA 2ABHA 2CMOA 2D3IA 2F7CA 4M1VA 3I3VA 1JETA 4ZEKA 1ZTYA 1B32A 3R7XA 3Q26A 2HAVA 1B0LA 4GQOA 1Y1MA 5B7DA 4KCDA 1TXFA 3RT8A 1HSEA 3TQLA 3S9NC 2AL5A 1B4ZA 1NL5A 3PMWA 4ELOA 4FIMA 4RK9A 3OO9A 1USYE 3RGYA 1LFIA 3KZGA 2Z22A 1B0HA 4DDDA 1IIWA 4R6KA 3TFLA 3ZS6A 2B3FA 4C1UA 4ZZEA 1A8FA 1YTVA 2H99A 1JW4A 3K6UA 4OTEA 2O6AA 5K2XA 1TWYA 4DCYA 1IXIA 3L6HA 2YJPA 4GXSB 2QRYA 3QAXA 2FYIA 3IJXB 5I59A 4GL8A 3RQTA 1B51A 3M3LA 4GIZA 2BJJX 5JTYA 1UTBA 1EZ9A 2Q89A 2R71A 2UYFA 3KFMA 3CFXA 1N7XA 3MBPA 5JEIA 2PX1A 2F6PA 2G29A 1SI0A 3Q29A 5AA4B 2OBGA 3DP4A 4PFTA 4QFOA 2I3VA 3MP8A 4IO4A 1B4HA 1LLSA 4R73A 1OIBA 3O29A 3MWBA 3A09A 5H8QB 3C31A 1MY2A 1SBPA 4YB5A 4G2ZA 3OO7A 1YPNA 5AA1A 2PBWA 1A54A 1JW5A 5DEXB 3PPNA 4R9FA 1SVXB 3PD9A 3TTKA 2QMXA 1FQEA 4OHNA 3A3CA 3PPOA 4EUOA 3SETA 2THIA 3T9HB 2HAUA 3IO6A 4H5FA 1S7YA 5JK4A 4HTGA 3HHFA 3TMGA 4THIA 5J1DA 2M8CA 4NF4A 5CM6A 3TDJA 3OMBA 4Q30B 1WDNA 2REGA 5I2NB 2Z8FA 1SI1A 1ELJA 2I4CA 3B6QA 4YKIA 5H8FA 1FTMA 2O69A 3FASA 4GD5A 4GXAA 3SKPA 3G3JA 5KCJA 1SW5A 2ALUA 4IO3A 4PP0A 5F7VA 1QUJA 4LVQA 2UVJA 3ZSFA 3TKDA 4F31B 1OMPA 1B46A 4F2OA 2XXIA 1GV8A 3FJ7A 4ND9A 3MVXA 4DXUA 1XS5A 3DLNA 2NUVA 1D4NA 2WKYA 4E0XA 4IO7A 3LUYA 3GZGA 1FW0A 2YPNA 3RN8A 1AL3A 3R6UA 3FVNA 3FVKA 4R75A 3C33A 4RXLA 3PUYE 3HN0A 3QXMA 1FCKA 3DM0A 1LAXA 3VVEA 3PMXA 4IY5A 1MQIA 4GWOA 4QHQA 3MUQA 5KDTB 1FTJA 4H0WA 2XX7A 4OZ9A 3O66A 4X1BA 3N94A 2QJEA 1ZMGA 4EQ7A 2VD3A 1BTJA 1QKBA 1SYHA 5LOMA 1II5A 5I59B 3G3KA 1P1WA 3OSQA 2HZLA 3W9VA 1LSTA 3O9PA 3JZJA 3KSXA 1Y3NA 3VXBA 4I1DA 1MY3A 3BFTA 2H25A 3QUJA 4QSCA 2I58A 4HCWA 1Y9UA 2R6GE 1GGGA 2P2AA 2REJA 1ZKBA 3P7IA 4PFWA 4EQBA 2XXVA 3MP6A 2XXXA 3N6TA 4FE8A 4LP2B 1S50A 5DVFA 4ZE8A 3IL1B 2Y7RA 1POTA 3K0VA 3IX1A 3MW0A 2DE2A 1LCTA 1WVJA 3CG1A 2I4BA 1N0TA 2OJTA 1SYIA 3K6VA 3T9VA 2OLBA 2DWJA 3KJ7A 3OXNA 3VVFA 4EF2A 1HSLA 4BDMA 2GRVA 1MXWA 4N13A 5F1QA 1R9LA 1B3LA 3K4UA 2XXWA 1POY1 1Y4TA 5TP9B 4BDLA 2D5WA 3H6TA 4NF4B 5L9SA 4R6HA 1Q35A 1F9BA 1H45A 3FXUA 4I62A 4WXJA 3IOTA 1MQJA 1AIVA 3OEMA 3OO6A 5DVIA 3VDFA 5H8FB 4BDNA 1LGBC 1B1HA 5KCJB 1M5BA 2XXHA 1FQFA 2Y7IA 5AA4A 2CZLA 2VP1A 2R9JA 5CMKA 4XKQA 2O1LA 3K1NA 3U94A 2ONKE 4ZEBA 4C1TA 4L17A 1T0KA 4EF1A 4ELPA 4QRZA 4KCCA 4IGTA 3FV1A 4POWA 1D9YA 3V8XB 4G68C 2V3UA 2I0BA 5AA2D 3QIMA 3E3KA 1J1NA 1OVTA 5H8QA 5TPAA 2F97A 3M3KA 1JEUA 4ELQA 2DWHA 3HCQA 2DE3A 2XXPA 3VVDA 2XD3A 1IUDA 1JW1A 3CSBA 4JWYA 1HSJA 4NF5A 4R9GA 2DP8A 4IGRA 4QSEA 3OOAA 1B9JA 3ILUB 5DEXA 3IR1A 4IB2A 2OK2A 4KPTA 5HPQA 5AA3A 4H65A 4QFKA 1B1XA 2Q88A 3IOWA 4FATA 4XIGQ 5EYFA 2Y7PA 4X9TA 1VE4A 3TELA 3RTWB 1US5A 3O6IA 3BKIB 1BP5A 1PC3A 1IITA 2IEEA 4LQ5A 2F78A 4UA8A 5ITOA 3V83A 4JB7A 1TT1A 2GHBA 1FQAA 2HEUA 2XXTA 3C34A 1B5JA 5ISUA 4WEDA 5EHMA 1FTLA 4ECFA 3EHSA 5I84A 1N76A 1DSNA 3B7DA 4Q5TA 1PB7A 4KYEA 4JBZA 2IA4A 4F29A 5AA2B 3SEUA 4F3SA 4H8IA 4NWCA 1M5CA 1UIUA 4AB6A 3EQ1A 1ZIUA 2H5YA 4NWDA 4U1OA 1EU8A 2V84A 4U4SA 1MM6A 3B6TA 4BDOA 3CR9A 3KJTA 1MXZA 4Q8RA 1B5IA 3LBSA 1NFTA 4HS7A 3FJGA 1M5DA 1LBBA 4BDQA 1PEBA 2V3TA 2ZYNA 1PB8A 5KDTA 4N6PA 1NKXA 4YKPA 3G7WA 1PB9A 1PBPA 4ZDMA 3K2DA 3IORA 4BDRA 3S2VA 1QJMA 2DS9A 4XKPA 2E0SA 4F19A 4EQ9A 1NNTA 3SEVA 1D3KA 4F39A 3G3HA 3GBBA 2DE4A 1Z7NE 3TCGA 3MZ9A 4XKNA 3TODA 1O64A 4ONYA 3O97A 3VLWA 4RJZA 4DLDA 4AQ4A 1P1NA 3RT6B 4RK2A 3V5AA 3KOSA 4IO2A 4FECA 2F7BA 1B58A 3UN6A 4LATA 2XX8A 5TPAB 3TZAA 4ESWA 3IJOB 4ZZAA 4Q0CA 4ZEFA 1OQGA 3MQ9A 3C32A 4OEUA 4NF5B 2V93A 4O3AA 3S9EA 1LFHA 1MDQA 3IOUA 4H5GA 2F8DA 1FTKA 1URDA 4OQOA 3BBRA 3Q28A 2B65A 1MH3A 4DZ1A 1QUKA 4G4PA 3G3FA 4I9DA 4LUBA 5TP9A 3KN3A 5CRYA 1JVYA 1N3WA 2FA7A 2ONSA 1MY1A 4OENA 2XXRA 3UP9A 2DXYA 4YICA 3K1MA 3H03A 3SEXA 1B40A 2ZYKA 5HM4B 3DP6A 4MF3A 5FHMA 2Y7KA 3AXFA 2DOJA 4GOTA 1B3GA 4H8JA 3CI8A 3RPWA 2NOOA 3CFLA 1Y4CA 4OFLA 1MXVA 5ITPA 1MXUA 4TOZA 2ZYOA 1XC1A 4Z0IA 4TQUQ 1MS7A 3H4ZA 4NF8B 2RCAA 1H3DA 3TPAA 4KQPA 1LAHE 1MQDA 4DE8A 1R9QA 4EDPA 2Q9TA 3FD3A 4KD5A 4OERA 1ZJLA 3UIFA 4LONB 3EPEA 2XD2A 1TFDA 4FEBA 2QS4A 3VFJA 4H6DA 4O3BA 3IB1A 1JQFA 3KEIA 3TTMA 1XT8A 3PU5A 4XXUA 1B3FA 1MY0A 3PPRA 4PFUA 1B6HA 1LCFA 1NH8A 3TQWA 1RYOA 4OESA 2GH9A 5I56B 4OVJA 4P0GA 2VOZA 3RY3A 3EN3A 1QW0A 2KLFA 2OZZA 3O6GA 4BLAA 1SDXA 3MAMA 1N04A 4F18A 5I2KB 1MPCA 4QF9A 3QK6A 1LB9A 4KYDA 4GFRA 1Y3QA 1S9TA 1WODA 3VLUA 1NH7A 4RA1A 1H44A 1DPEA 5K2YA 1JEVA 4KR5A 1QUIA 3MPKA 4XKRA 1B2HA 4JDFA 3TYHA 1NNFA 1OQHA 3MP1A 4LZ5A 4ESXA 5L8DA 4JWOA 3KSJA 4F1YA 3T9XB 1AMFA 4LA9A 5AA2A 4U4XA 3ZKLA 2Q8JA 3MC2A 2OCUA 3JYRA 2Z8EA 1GR2A 5DYHA 1ZLQA 2QS1A 1LAFE 4YMAA 1Z7ME 1B3HA 3SDFA 1BIYA 2HQ0A 3PGFA 1IXGA 1EH3A 4KHZE 5I57B 4KFQA 3S4UA 1M5FA 1KWHA 1DTZA 3PPQA 4MLVA 3IK6B 5KZTA 1P1QA 1US4A 4PE5B 1RKMA 3HSTA 4U1ZA 1B3EA 3PV0E 1B52A 5A5XB 2X7QA 3PUZE 3SEYA 1B5HA 1XHYA 3V89B 2W7YA 1P1OA 2F34A 4YAHX 4OWDA 4IY6A 4NMYA 5FTHA 4DXCA 1FQBA 5BUUA 3ILTB 3W9WA 1N7WA 1MG1A 1LBCA 3MZBA 3TUSA 1URGA 3JV9A 1GTKA 3UORA 2UVHA 4ELRA 1H43A 2PYYA 2I3WA 4U2RA 1R1NA 1RYXA 3O6HA 3SERA 4AB5A 5DVJA 4FORA 4F1VA 2HXWA 3QYTA 1OLAA 2GFEA 4RYAA 2NXOA 3SEWA 4KI0E 3CG3A 2O7IA 3MJNA 2ZYMA 3D4GA 4POXA 3B6WA 3USDA 4QFLA 3C4MA 2G93A 1AH5A 1MQGA 2X7PA 3PUXE 4DCXA 1MPDA 5CBRA 1SQYA 4H67A 3M8UA 1CB6A 3SESA 2RINA 2I48A 1MXYA 2Q2AA 2HZKA 2RC8A 3H6WA 1OVBA 5I58A 4O3CA 3OENA 2F6GA 4PQJA 1USYH 4YKKA 3D4CA 3G3GA 1MRPA 2ANJA 1DPPA 3TCHA 3ZKKA 5H8SA 1SW4A 2PT2A 4LZ7A 4OXVA 4U21A 4MBPA 2GHAA 3K01A 3RTFB 4IO6A 1NNPA 3LSXA 5ELVA 1ZU0A 1L5TA 1NNKA 5H8NB 3KBRA 3HV1A 1I6BA 3C36A 2DWIA 4NF8A 4EXKA 5ICQA 3U1OA 2RC9A 3TCFA 4ZECA 5CI5A 2I49A 1UTHA 3U93A 3LR1A 1R6ZA 3CRBA 3LSFB 4NE4A 4FJPA 5H8HB 2ONRA 2XXUA 2I6EA 1NMUA 3TAJA 3PUVE 3H7MA 3CVGA 4QFPA 3C35A 3TEPA 3THIA 2O1MA 1QVSA 4MFIA 1MY4A 4GLIA 4ZEDA 4LZ8A 4LQ2A 2VHAA 1AOVA 5I56A 3L6GA 3ECRA 3E13X 4NTLA 2P1SA 2H4IA 4GF8A 2ZNTA 3FZVA 3CFZA 3E9XA 2ZMBA 2NVUB 4OMBA 1N84A 3GLBA 5I2KA 3HHGA 1YCJA 3VE1B 1A7LA 3H3GA 5M2VA 4R2BA 3HO7A 4WKMA 3ONMA 2DQVA 4XTCQ 3FXRA 1LAGE 3HPIA 4RNSA 3H6VA 3FVOA 1B7HA 3RNNA 3I6VA 1I69A 3LC8A 2F7AA 4GRKA 3OEKA 1P99A 1Y20A 1VR5A 3K6WA 2Y84A 2DVZA 5TU0A 4HW8A 1VFDA 3KGCA 4ZS9A 5ICTA 4E0WA 4KYSA 2Y7WA 1ANFA 3G3IA 5I57A 1PBQA 1IXCA 4X1DA 1D9VA 1LB8A 4WEPA 4YMBA 1ZBMA 2F5XA 3IO4A 4YU0A 4G68B 3W15C 3QUFA 3LSLA 3FVGA 4MLQA 4FAJA 3EHUA 3S9LC 1BLFA 3IB2A 1DTGA 3TTNA 1VFEA 3KG2A 1DMBA 2YLNA 3OSRA 1XVYA 2UVIA 4G8MA 4R72A 4TLLB 4F1UA 3IOVA 4RPNA
chains in the Genus database with same CATH superfamily
1SPIA 2PFYA 1UQWA 2A5TA 5AE4A 5A5XA 2RF1A 3S9MC 3ODBA 4PTKA 3EHTA 4PETA 2FNCA 5IAIA 5I58B 1RDYA 1ATGA 2OWTA 4MHFA 2V25A 1M5EA 2HCAA 4OVSA 1A40A 3RYDA 1B7ZA 4YB6A 4QFNA 4NGUA 1XOCA 2RKMA 5CC2A 4MIJA 1D9QA 1H76A 4YKJA 4G8HA 1FPEA 1NUZA 1MQHA 3SZPA 2RCBA 2HFBA 3KOTA 5IGAA 3I5OA 4G8NA 4OFOA 4MH5A 2A5SA 2Q2CA 4PE3A 5BWJA 3Q25A 1INPA 4OA4A 1IMDA 1UTHB 2QS3A 2O51A 3C9HA 2P0SA 4R74A 5FBPA 1VSOA 2B3BA 1LBZA 1NV3A 3H6UA 3GXAA 5FHOA 3U8QA 3VV5A 2XX9A 4M4GA 3T0JA 1MXXA 3QSLA 4NQ8A 2I0CA 4PGNA 2XXQA 4F22A 1A55A 2QL3A 4N17A 2VGQA 1GVCA 4PFRA 2CZKA 5IKBA 3CIJA 3U72A 2ZNSA 1LFGA 3T96B 1URSA 3MVZA 3T93B 1FPLA 1N3XA 4EXLA 2F35A 3WAEA 2XWIA 5ET5A 3HFUA 1TFAA 4JSOA 3DELB 3O2AA 1RDZA 1FJ9A 4GWWA 2D21A 1YAEA 4PFYA 3N6UA 4I8CA 4QSDA 3PMVA 4F3GA 1Y1ZA 2BJIA 2QSXA 2O68A 3IAZA 4N6DA 1SD3A 3FATA 4MJOA 3VLVA 1PDAA 4ZE9A 3FV2A 1EZOA 4Z7EA 3CSGA 4NF6A 2PT1A 5ET8A 3EF7A 3T1BA 4F2QA 3N26A 4IO5A 2AL4A 2F36A 1A8EA 5EHSA 2X26A 3FUZA 1IQ7A 4GX4A 4P11A 5JTYB 3MVYA 1UTBB 4I3YA 3PD8A 3OO8A 1FPDA 3N5LA 2ESNA 5H8NA 2VD2A 4PDHA 1SW1A 2H98A 4R6YA 5HBCA 4FEDA 4U23A 3TTLA 3T22A 2QPQA 3K6XA 3PPPA 4G77A 4OFJA 5CMMA 1BKAA 4N91A 3EKIA 1FBGA 2ZZWA 5H8HA 2QVVA 4JWXA 5T3JA 1O63A 1RDXA 3H06B 4RY1A 3MVWA 5L9OA 1VDWA 4NAPA 2AIXA 2B4LA 3LSWA 5FTIA 5B70A 4OYVA 2QS2A 2DSFA 4GVOA 1MPBA 2OWSA 5DTBA 4C0RA 3LUZA 4JXIA 3FIRA 3RUMA 1IZ1A 1KA0A 2A5TB 1IMBA 4NEDA 3UGWA 4OEVA 2Z8DA 4YZZA 1QKAA 2FIXA 1IXHA 4P0IA 4PBQA 3IB0A 3T66A 2PMSA 5L9MA 3O28A 2NWJA 3E79A 1Y3PA 1OLCA 1QGXA 5CMCA 2ZXTA 2O7UA 3BFUA 4UACA 4N4UA 5DW8A 2XWKA 1FQCA 3OD7A 4H46A 3FXQA 4P3LA 4ISUA 1I6AA 1JVXA 4F3BA 4HE0A 3K02A 3BIGA 2O84X 4N07A 3TTRA 2F3DA 1IEJA 4YB7A 4MCOA 3R26A 2DVCA 3KN8A 2XHDA 3CHGA 5DT6A 1DOTA 1A99A 4DXBA 3T9UA 1CE2A 1I6QA 1SW2A 5EYGA 4K3FA 2V3QA 3OELA 2XA5A 5CBSA 5FHNA 3M3FA 2MKZA 4HE2A 4G68A 2RC7A 3PTYA 2ZNUA 4OETA 3PUWE 2DWAA 4ZEIA 1NV6A 1XVXA 3A3UA 2E1SA 1BK4A 3UA8A 4MX6A 2DYXA 2AYSA 3UK4A 2XXYA 1NUXA 3FJMA 4HCYA 1MH4A 3F11A 1NUYA 2UXAA 4PCDA 3Q27A 3FGSA 1QULA 1O7TA 2UVGA 1JNFA 2QMWA 3WAFA 1UIVA 4JSDA 4GL0A 4NF6B 3DP8A 4H1XA 1Q1KA 1B7UA 2H9BA 3E4RA 5I2NA 4F3PA 1FTOA 5CMBA 4DIGA 3MZ1A 1P1UA 3U92A 4NHBA 3MPLA 3VXCA 4XFEA 2UYEA 3RPLA 2PVUA 2LAOA 1NV1A 4U22A 1MM7A 2DXRA 4IR8A 4RPOA 2Z23A 4X48A 1MDP1 3QMFA 3GBAA 1EZPA 5A5LA 4R2FA 1B05A 3KN7A 4TLMB 3K00A 3RLFE 3K1PA 1FQDA 2ABHA 2CMOA 2D3IA 2F7CA 3ISPA 4M1VA 3I3VA 1JETA 4ZEKA 1ZTYA 1B32A 3R7XA 3Q26A 2HAVA 1B0LA 4GQOA 1Y1MA 5B7DA 2WBBA 4KCDA 1TXFA 3RT8A 1HSEA 3TQLA 3S9NC 2AL5A 1B4ZA 1NL5A 3PMWA 4ELOA 4FIMA 4RK9A 3OO9A 1USYE 1KZ8A 3RGYA 1LFIA 3KZGA 2Z22A 1B0HA 4DDDA 1IIWA 4R6KA 3TFLA 3ZS6A 1EYIA 2B3FA 4ZZEA 4C1UA 1A8FA 1YTVA 3A29A 2H99A 1JW4A 1K9YA 3K6UA 4OTEA 2O6AA 5K2XA 1TWYA 1NV4A 4DCYA 1IXIA 3L6HA 2YJPA 4GXSB 2QRYA 3QAXA 2FYIA 3KBZA 3IJXB 5I59A 2XWVA 4GL8A 3RQTA 4PGPA 1B51A 3M3LA 4GIZA 2BJJX 5JTYA 1UTBA 1EZ9A 2Q89A 2R71A 2UYFA 3KFMA 3KC1A 3CFXA 1N7XA 3MBPA 5JEIA 2PX1A 2F6PA 2G29A 1SI0A 4OVPA 3Q29A 5AA4B 2OBGA 3DP4A 1NV7A 4PFTA 1LBVA 4QFOA 2I3VA 3MP8A 4IO4A 1B4HA 1LLSA 3B50A 2FVZA 4R73A 1OIBA 3O29A 3MWBA 3A09A 4MNIA 5H8QB 3C31A 1YZ0A 1MY2A 1SBPA 4YB5A 4G2ZA 3OO7A 4MNPA 1YPNA 5AA1A 2PBWA 1A54A 1JW5A 5DEXB 2Q74A 3PPNA 4R9FA 1SVXB 3PD9A 3TTKA 2QMXA 4HE1A 1FQEA 4OHNA 3A3CA 3PPOA 4EUOA 3SETA 2THIA 3T9HB 2HAUA 3IO6A 4H5FA 1S7YA 4GX3A 5JK4A 4HTGA 3HHFA 4THIA 3TMGA 5J1DA 2M8CA 4NF4A 5CM6A 3TDJA 3OMBA 4Q30B 5ET6A 1WDNA 1IMFA 2REGA 5I2NB 2Z8FA 1FJ6A 1SI1A 5ET7A 4NX1A 1ELJA 3LV0A 4O7IA 2I4CA 3B6QA 4YKIA 5H8FA 1FTMA 2O69A 3FASA 4GD5A 4GXAA 3RPLB 3SKPA 3G3JA 5KCJA 1SW5A 2ALUA 4IO3A 4PP0A 2FIEA 5F7VA 1QUJA 4LVQA 3MYUA 4X8RA 2UVJA 3ZSFA 3TKDA 4F31B 1OMPA 1B46A 2B4MA 4F2OA 4GBVA 2XXIA 1GV8A 3FJ7A 4ND9A 3MVXA 4DXUA 5EYHA 2WBDA 1XS5A 3DLNA 2NUVA 1D4NA 2WKYA 4PBHA 4E0XA 4IO7A 3LUYA 3GZGA 1FW0A 2YPNA 3RN8A 1AL3A 3R6UA 3FVNA 3FVKA 4R75A 3C33A 4RXLA 3PUYE 3HN0A 4NF0A 3QXMA 1FCKA 3DM0A 1LAXA 3VVEA 3PMXA 4IY5A 1MQIA 3KC0A 4GWOA 4QHQA 3MUQA 5KDTB 1FTJA 4H0WA 2XX7A 4OZ9A 3O66A 1NI9A 2FHYA 4X1BA 3N94A 2QJEA 1ZMGA 4EQ7A 2VD3A 1BTJA 4PDDA 1QKBA 2QVUA 1SYHA 5LOMA 1FPGA 1II5A 5I59B 3G3KA 1P1WA 5I3SA 3OSQA 2HZLA 1FBHA 3W9VA 1LSTA 3O9PA 3JZJA 2VPNA 3KSXA 1Y3NA 3VXBA 4I1DA 4AS5A 1MY3A 3BFTA 2H25A 3QUJA 4QSCA 2I58A 4HCWA 4DI4B 1Y9UA 2R6GE 1GGGA 2P2AA 2WX9A 2QVRA 2REJA 1ZKBA 3P7IA 4PFWA 3FXBA 4EQBA 2XXVA 3MP6A 2XXXA 2GQ1A 3N6TA 4FE8A 4LP2B 1S50A 5DVFA 4ZE8A 3IL1B 2Y7RA 1POTA 3K0VA 3IX1A 4P1EA 3MW0A 2DE2A 1LCTA 1WVJA 3CG1A 2OWZA 2I4BA 1N0TA 2OJTA 1SYIA 3K6VA 3T9VA 2OLBA 2OX3A 4H45A 2DWJA 3KJ7A 4OVRA 3OXNA 3VVFA 4EF2A 1HSLA 4BDMA 2GRVA 1MXWA 4N13A 5F1QA 1R9LA 1B3LA 3K4UA 2XXWA 4AS4A 1POY1 1Y4TA 5TP9B 4BDLA 2D5WA 3H6TA 4NF4B 4XEQA 5L9SA 4R6HA 1FPIA 1Q35A 1F9BA 1H45A 3FXUA 4I62A 4WXJA 3IOTA 1MQJA 5I5PA 1AIVA 3OEMA 3OO6A 2VPOA 5DVIA 3VDFA 5H8FB 4BDNA 1LGBC 1B1HA 5KCJB 2WYPA 1M5BA 2XXHA 1G0HA 1FQFA 2Y7IA 5AA4A 2CZLA 5EQ7A 2VP1A 2R9JA 5CMKA 4XKQA 2O1LA 3K1NA 3U94A 2ONKE 4ZEBA 2FBPA 4C1TA 4L17A 1T0KA 4EF1A 4ELPA 4QRZA 4KCCA 2QFLA 1YYZA 4IGTA 3FV1A 4POWA 1D9YA 3V8XB 3B8BA 4G68C 2V3UA 2CZHA 2I0BA 3ROJA 5AA2D 3QIMA 3E3KA 1J1NA 5F24A 1OVTA 5H8QA 5TPAA 2F97A 3M3KA 1JEUA 1XI6A 4ELQA 2DWHA 3HCQA 2DE3A 2XXPA 3VVDA 2XD3A 2KQZA 1IUDA 1JW1A 3CSBA 4JWYA 1HSJA 4NF5A 4R9GA 2DP8A 3E78A 4IGRA 4QSEA 3OOAA 1B9JA 3ILUB 5DEXA 3IR1A 4IB2A 2OK2A 2XWOA 4KPTA 5HPQA 5AA3A 4H65A 4QFKA 4PFIA 1B1XA 2Q88A 3IOWA 4FATA 4XIGQ 5EYFA 1G0IA 2Y7PA 2Y5LA 4X9TA 1VE4A 3TELA 4OANA 3RTWB 4MAGA 1US5A 3O6IA 3BKIB 5EQ8A 1BP5A 1PC3A 5IZ1A 1IITA 2IEEA 5J16A 4LQ5A 2F78A 4UA8A 5ITOA 3V83A 4JB7A 1TT1A 2GHBA 1FQAA 2HEUA 2XXTA 3C34A 1B5JA 5ISUA 4WEDA 5EHMA 1FTLA 4ECFA 3EHSA 5I84A 1N76A 1DSNA 3B7DA 4Q5TA 1PB7A 4KYEA 4JBZA 2IA4A 2KR0A 4O8MA 4F29A 5AA2B 3SEUA 4F3SA 1IMEA 4H8IA 3IFCA 1CNQA 4NWCA 1M5CA 1UIUA 4AB6A 3EQ1A 1ZIUA 2H5YA 4NWDA 1JP4A 4G61A 4HXVA 4U1OA 2CEXA 1EU8A 4PFBA 2V84A 4U4SA 1NUWA 5LDZA 1MM6A 3B6TA 4BDOA 3CR9A 3KJTA 1MXZA 4Q8RA 1B5IA 3LBSA 1NFTA 4HS7A 3FJGA 1M5DA 1LBBA 4BDQA 1PEBA 2V3TA 2PFZA 2ZYNA 1PB8A 5KDTA 4N6PA 1NKXA 4YKPA 2Y5KA 3G7WA 1PB9A 1PBPA 2HPGA 4ZDMA 3K2DA 3IORA 4BDRA 3S2VA 1QJMA 2DS9A 4XKPA 2E0SA 4F19A 4EQ9A 1NNTA 2HHMA 3SEVA 1D3KA 4F39A 3G3HA 3GBBA 2DE4A 1Z7NE 1FPFA 3TCGA 3MZ9A 4XKNA 4MEVA 3TODA 1O64A 1NV5A 4ONYA 1FRPA 3O97A 3VLWA 4RJZA 4N81A 4DLDA 4NG7A 4AQ4A 1P1NA 2CZIA 3RT6B 4RK2A 3V5AA 4O7MA 1EYKA 3KOSA 4IO2A 2ZZXA 4X04A 4FECA 2F7BA 1B58A 3UN6A 1K9ZA 1YXIA 4LATA 2XX8A 5TPAB 3TZAA 4ESWA 4I3EA 3IJOB 4ZZAA 4Q0CA 4ZEFA 1OQGA 2Q8MA 3MQ9A 3C32A 1DK4A 4I40A 4OEUA 4NF5B 2V93A 4O3AA 3S9EA 1LFHA 1MDQA 3IOUA 4H5GA 3MSTA 2F8DA 1FTKA 1URDA 4OQOA 3BBRA 3Q28A 2B65A 1MH3A 4DZ1A 1QUKA 4G4PA 3G3FA 4N8GA 4I9DA 4LUBA 2P3VA 5TP9A 3KN3A 5CRYA 1JVYA 1N3WA 2FA7A 2ONSA 1MY1A 4OENA 2XXRA 3UP9A 4OVTA 4PF6A 5IM2A 2DXYA 4YICA 3K1MA 3H03A 3SEXA 1B40A 2ZYKA 5HM4B 3DP6A 4MF3A 5FHMA 4UABA 2Y7KA 3AXFA 4FBPA 4GWUA 3IFAA 2DOJA 4GOTA 1B3GA 4H8JA 3CI8A 3RPWA 2NOOA 3CFLA 2WYKA 1Y4CA 4OFLA 1MXVA 4MMPA 5ITPA 1MXUA 4TOZA 2ZYOA 1XC1A 4Z0IA 4TQUQ 1MS7A 2HXRA 3H4ZA 4NF8B 2RCAA 1H3DA 3TPAA 4KQPA 1LAHE 1MQDA 4DE8A 1R9QA 4EDPA 2Q9TA 3FD3A 4PAIA 4KD5A 4OERA 1ZJLA 3UIFA 4LONB 3EPEA 2XD2A 1TFDA 4FEBA 2QS4A 3VFJA 4H6DA 4O3BA 3IB1A 1JQFA 3KEIA 4XF5A 3TTMA 1XT8A 2XXKA 3PU5A 1FBPA 1FPJA 1B3FA 1MY0A 4XXUA 3PPRA 4PFUA 1B6HA 4LN5A 1LCFA 1NH8A 3TQWA 1RYOA 4OESA 2GH9A 5I56B 4OVJA 4P0GA 2VOZA 4MNCA 3RY3A 3EN3A 1NV2A 1QW0A 2KLFA 2OZZA 3O6GA 2R8TA 5IZ3A 4P47A 1SDXA 4BLAA 3MAMA 5EQ9A 1N04A 4F18A 5I2KB 1MPCA 4QF9A 3QK6A 4PAFA 1LB9A 4KYDA 4GFRA 1Y3QA 1S9TA 1WODA 3VLUA 1NH7A 4RA1A 1H44A 4JVCA 1DPEA 3U65A 5K2YA 1JEVA 4KR5A 1QUIA 3MPKA 4XKRA 1B2HA 4JDFA 3TYHA 1NNFA 1OQHA 3MP1A 4LZ5A 4ESXA 5L8DA 4JWOA 3KSJA 4F1YA 3T9XB 1AMFA 4LA9A 5AA2A 4U4XA 3ZKLA 2Q8JA 3MC2A 2OCUA 3JYRA 2Z8EA 1GR2A 5DYHA 1ZLQA 2QS1A 1LAFE 4YMAA 1Z7ME 1B3HA 3SDFA 1BIYA 2HQ0A 3PGFA 1IXGA 1EH3A 4KHZE 5I57B 4KFQA 5ESYA 3FBPA 3S4UA 2L5VA 2V4CA 1M5FA 1KWHA 1DTZA 3PPQA 4MLVA 3IK6B 5KZTA 4QBAA 1P1QA 1US4A 4PE5B 1RKMA 3HSTA 4U1ZA 1B3EA 3PV0E 1DBZA 1B52A 5A5XB 2X7QA 3PUZE 4JVDA 3SEYA 1B5HA 4GBWA 1XHYA 3V89B 2W7YA 1P1OA 2F34A 4YAHX 4GX6A 4OWDA 1LBXA 4IY6A 4NMYA 4N8YA 2WEFA 5FTHA 4DXCA 1FQBA 5BUUA 3ILTB 3W9WA 1EYJA 4OVQA 1N7WA 1MG1A 1LBCA 1IMAA 3MZBA 3TUSA 1URGA 3JV9A 1GTKA 3UORA 1AWBA 1LBYA 4GWZA 3GYYA 2UVHA 4GWSA 4ELRA 1H43A 2PYYA 4P9KA 2I3WA 4U2RA 1IMCA 1R1NA 1RYXA 3O6HA 3SERA 4AB5A 4GWYA 5DVJA 4FORA 4F1VA 2HXWA 3QYTA 1FPBA 1OLAA 2GFEA 4RYAA 2NXOA 3SEWA 4KI0E 3CG3A 4JVIA 2O7IA 3MJNA 2ZYMA 3D4GA 1FTAA 4POXA 3B6WA 3USDA 4QFLA 3C4MA 2G93A 4P1LA 1FPKA 1AH5A 1FBCA 1MQGA 2X7PA 3PUXE 4DCXA 1MPDA 5CBRA 1SQYA 4H67A 2P3NA 3M8UA 1CB6A 3SESA 4N15A 2RINA 1LBWA 4KXPA 5IZ3B 2I48A 1Q9DA 1MXYA 2Q2AA 1FBEA 2HZKA 2RC8A 3H6WA 1OVBA 5I58A 5IZZA 4O3CA 3OENA 2F6GA 4PQJA 1USYH 4YKKA 3D4CA 3G3GA 1MRPA 2ANJA 1DPPA 3TCHA 3ZKKA 5H8SA 1SW4A 2PT2A 4LZ7A 4OXVA 4U21A 4MBPA 2GHAA 3K01A 3RTFB 4IO6A 1NNPA 3LSXA 5ELVA 1ZU0A 1L5TA 1NNKA 4PC9A 5H8NB 3KBRA 3HV1A 1I6BA 3C36A 2DWIA 4NF8A 4EXKA 5ICQA 3U1OA 2RC9A 4PF8A 3TCFA 4NN3A 4ZECA 5CI5A 2I49A 1UTHA 3U93A 1KA1A 2CEYA 3LR1A 1R6ZA 3CRBA 3D1RA 3LSFB 4NE4A 2PCRA 4FJPA 5H8HB 2ONRA 2XXUA 4P8BA 2I6EA 3NOHA 1NMUA 3TAJA 3PUVE 2F3BA 3H7MA 3CVGA 4QFPA 3C35A 3TEPA 3THIA 2O1MA 2DDKA 1QVSA 4MFIA 1MY4A 4GLIA 4ZEDA 4LZ8A 4LQ2A 2VHAA 1AOVA 5I56A 3L6GA 4P56A 3ECRA 3E13X 4N6KA 1NV0A 4NTLA 2P1SA 2H4IA 4GF8A 2ZNTA 3FZVA 3CFZA 3E9XA 2ZMBA 2NVUB 4OMBA 4QXDA 1N84A 3GLBA 5I2KA 3HHGA 1DCUA 1YCJA 3VE1B 1A7LA 3H3GA 5LTCA 5M2VA 4R2BA 3HO7A 1LEVA 4WKMA 3ONMA 2DQVA 4DI3D 4XTCQ 3FXRA 5I7IA 2JJKA 1LAGE 3HPIA 1FBFA 4RNSA 5EQAA 2ZZVA 3H6VA 3FVOA 1B7HA 3RNNA 3I6VA 1I69A 3LC8A 2F7AA 4O94A 4GRKA 3OEKA 1P99A 3BIHA 1Y20A 1VR5A 3K6WA 2Y84A 2DVZA 5TU0A 4HW8A 1VFDA 3KGCA 4ZS9A 5ICTA 4E0WA 4KYSA 2Y7WA 1ANFA 3G3IA 5I57A 1PBQA 1IXCA 4X1DA 1FBDA 1D9VA 1LB8A 4WEPA 4YMBA 1ZBMA 2F5XA 3IO4A 4YU0A 4G68B 3W15C 3QUFA 3LSLA 4GWXA 3FVGA 4PAKA 4MLQA 4FAJA 3EHUA 3S9LC 1BLFA 1FSAA 3IB2A 1DTGA 3TTNA 1VFEA 3KG2A 1DMBA 2VT5A 2YLNA 3OSRA 1XVYA 2UVIA 4G8MA 4R72A 4TLLB 4F1UA 3IOVA 4RPNA
chains in the Genus database with same CATH topology
1UQWA 2A5TA 5AE4A 5A5XA 2RF1A 3S9MC 3ODBA 3EHTA 4PETA 2FNCA 5IAIA 5I58B 1ATGA 2OWTA 2V25A 1M5EA 2HCAA 1A40A 1B7ZA 4YB6A 4QFNA 1XOCA 2RKMA 5CC2A 1H76A 4YKJA 4G8HA 1MQHA 2RCBA 2HFBA 3KOTA 3I5OA 4G8NA 4OFOA 4MH5A 2A5SA 2Q2CA 5BWJA 3Q25A 1UTHB 2QS3A 2O51A 3C9HA 2P0SA 4R74A 1VSOA 2B3BA 3GXAA 3H6UA 3U8QA 3VV5A 5FHOA 2XX9A 4M4GA 1MXXA 3QSLA 2I0CA 2XXQA 4F22A 1A55A 2QL3A 2VGQA 1GVCA 5IKBA 3CIJA 3U72A 2ZNSA 1LFGA 3T96B 1URSA 3MVZA 3T93B 1N3XA 4EXLA 2F35A 3WAEA 1TFAA 4JSOA 3DELB 3O2AA 2D21A 1YAEA 4PFYA 3N6UA 4I8CA 4QSDA 3PMVA 4F3GA 1Y1ZA 2QSXA 2O68A 3IAZA 1SD3A 3FATA 3VLVA 1PDAA 4ZE9A 3FV2A 1EZOA 4Z7EA 3CSGA 4NF6A 2PT1A 3EF7A 4F2QA 3N26A 4IO5A 2AL4A 2F36A 1A8EA 5EHSA 2X26A 3FUZA 1IQ7A 4P11A 5JTYB 3MVYA 1UTBB 3PD8A 3OO8A 3N5LA 2ESNA 5H8NA 2VD2A 1SW1A 2H98A 4R6YA 5HBCA 4FEDA 4U23A 3TTLA 3T22A 2QPQA 3K6XA 3PPPA 4G77A 4OFJA 5CMMA 1BKAA 5H8HA 4JWXA 1O63A 3H06B 4RY1A 3MVWA 5L9OA 2AIXA 3LSWA 5FTIA 5B70A 4OYVA 2QS2A 2DSFA 4GVOA 1MPBA 2OWSA 5DTBA 4C0RA 4JXIA 3FIRA 3RUMA 1IZ1A 2A5TB 4NEDA 3UGWA 4OEVA 2Z8DA 4YZZA 1QKAA 1IXHA 4P0IA 3IB0A 3T66A 2PMSA 5L9MA 3O28A 2NWJA 1Y3PA 1OLCA 5CMCA 2ZXTA 2O7UA 3BFUA 4UACA 1FQCA 3OD7A 3FXQA 4ISUA 1I6AA 1JVXA 4F3BA 3K02A 2O84X 4N07A 3TTRA 1IEJA 4YB7A 3R26A 2DVCA 3KN8A 2XHDA 5DT6A 1DOTA 1A99A 4DXBA 3T9UA 1CE2A 1I6QA 1SW2A 4K3FA 2V3QA 3OELA 5CBSA 5FHNA 3M3FA 4G68A 2RC7A 2ZNUA 4OETA 3PUWE 2DWAA 4ZEIA 1XVXA 3A3UA 2E1SA 3UA8A 2DYXA 2AYSA 3UK4A 2XXYA 3FJMA 4HCYA 1MH4A 3F11A 2UXAA 3Q27A 3FGSA 1QULA 1O7TA 2UVGA 1JNFA 2QMWA 3WAFA 1UIVA 4JSDA 4GL0A 4NF6B 3DP8A 4H1XA 1Q1KA 1B7UA 2H9BA 3E4RA 5I2NA 4F3PA 1FTOA 5CMBA 4DIGA 3MZ1A 1P1UA 3U92A 3MPLA 3VXCA 2UYEA 2PVUA 2LAOA 4U22A 1MM7A 2DXRA 4RPOA 2Z23A 4X48A 1MDP1 3GBAA 1EZPA 4R2FA 1B05A 3KN7A 4TLMB 3K00A 3RLFE 3K1PA 1FQDA 2ABHA 2CMOA 2D3IA 2F7CA 4M1VA 3I3VA 1JETA 4ZEKA 1ZTYA 1B32A 3R7XA 3Q26A 2HAVA 1B0LA 4GQOA 1Y1MA 5B7DA 4KCDA 1TXFA 3RT8A 1HSEA 3TQLA 3S9NC 2AL5A 1B4ZA 1NL5A 3PMWA 4ELOA 4FIMA 4RK9A 3OO9A 1USYE 3RGYA 1LFIA 3KZGA 2Z22A 1B0HA 4DDDA 1IIWA 4R6KA 3TFLA 3ZS6A 2B3FA 4C1UA 4ZZEA 1A8FA 1YTVA 2H99A 1JW4A 3K6UA 4OTEA 2O6AA 5K2XA 1TWYA 4DCYA 1IXIA 3L6HA 2YJPA 4GXSB 2QRYA 3QAXA 2FYIA 3IJXB 5I59A 4GL8A 3RQTA 1B51A 3M3LA 4GIZA 2BJJX 5JTYA 1UTBA 1EZ9A 2Q89A 2R71A 2UYFA 3KFMA 3CFXA 1N7XA 3MBPA 5JEIA 2PX1A 2F6PA 2G29A 1SI0A 3Q29A 5AA4B 2OBGA 3DP4A 4PFTA 4QFOA 2I3VA 3MP8A 4IO4A 1B4HA 1LLSA 4R73A 1OIBA 3O29A 3MWBA 3A09A 5H8QB 3C31A 1MY2A 1SBPA 4YB5A 4G2ZA 3OO7A 1YPNA 5AA1A 2PBWA 1A54A 1JW5A 5DEXB 3PPNA 4R9FA 1SVXB 3PD9A 3TTKA 2QMXA 1FQEA 4OHNA 3A3CA 3PPOA 4EUOA 3SETA 2THIA 3T9HB 2HAUA 3IO6A 4H5FA 1S7YA 5JK4A 4HTGA 3HHFA 3TMGA 4THIA 5J1DA 2M8CA 4NF4A 5CM6A 3TDJA 3OMBA 4Q30B 1WDNA 2REGA 5I2NB 2Z8FA 1SI1A 1ELJA 2I4CA 3B6QA 4YKIA 5H8FA 1FTMA 2O69A 3FASA 4GD5A 4GXAA 3SKPA 3G3JA 5KCJA 1SW5A 2ALUA 4IO3A 4PP0A 5F7VA 1QUJA 4LVQA 2UVJA 3ZSFA 3TKDA 4F31B 1OMPA 1B46A 4F2OA 2XXIA 1GV8A 3FJ7A 4ND9A 3MVXA 4DXUA 1XS5A 3DLNA 2NUVA 1D4NA 2WKYA 4E0XA 4IO7A 3LUYA 3GZGA 1FW0A 2YPNA 3RN8A 1AL3A 3R6UA 3FVNA 3FVKA 4R75A 3C33A 4RXLA 3PUYE 3HN0A 3QXMA 1FCKA 3DM0A 1LAXA 3VVEA 3PMXA 4IY5A 1MQIA 4GWOA 4QHQA 3MUQA 5KDTB 1FTJA 4H0WA 2XX7A 4OZ9A 3O66A 4X1BA 3N94A 2QJEA 1ZMGA 4EQ7A 2VD3A 1BTJA 1QKBA 1SYHA 5LOMA 1II5A 5I59B 3G3KA 1P1WA 3OSQA 2HZLA 3W9VA 1LSTA 3O9PA 3JZJA 3KSXA 1Y3NA 3VXBA 4I1DA 1MY3A 3BFTA 2H25A 3QUJA 4QSCA 2I58A 4HCWA 1Y9UA 2R6GE 1GGGA 2P2AA 2REJA 1ZKBA 3P7IA 4PFWA 4EQBA 2XXVA 3MP6A 2XXXA 3N6TA 4FE8A 4LP2B 1S50A 5DVFA 4ZE8A 3IL1B 2Y7RA 1POTA 3K0VA 3IX1A 3MW0A 2DE2A 1LCTA 1WVJA 3CG1A 2I4BA 1N0TA 2OJTA 1SYIA 3K6VA 3T9VA 2OLBA 2DWJA 3KJ7A 3OXNA 3VVFA 4EF2A 1HSLA 4BDMA 2GRVA 1MXWA 4N13A 5F1QA 1R9LA 1B3LA 3K4UA 2XXWA 1POY1 1Y4TA 5TP9B 4BDLA 2D5WA 3H6TA 4NF4B 5L9SA 4R6HA 1Q35A 1F9BA 1H45A 3FXUA 4I62A 4WXJA 3IOTA 1MQJA 1AIVA 3OEMA 3OO6A 5DVIA 3VDFA 5H8FB 4BDNA 1LGBC 1B1HA 5KCJB 1M5BA 2XXHA 1FQFA 2Y7IA 5AA4A 2CZLA 2VP1A 2R9JA 5CMKA 4XKQA 2O1LA 3K1NA 3U94A 2ONKE 4ZEBA 4C1TA 4L17A 1T0KA 4EF1A 4ELPA 4QRZA 4KCCA 4IGTA 3FV1A 4POWA 1D9YA 3V8XB 4G68C 2V3UA 2I0BA 5AA2D 3QIMA 3E3KA 1J1NA 1OVTA 5H8QA 5TPAA 2F97A 3M3KA 1JEUA 4ELQA 2DWHA 3HCQA 2DE3A 2XXPA 3VVDA 2XD3A 1IUDA 1JW1A 3CSBA 4JWYA 1HSJA 4NF5A 4R9GA 2DP8A 4IGRA 4QSEA 3OOAA 1B9JA 3ILUB 5DEXA 3IR1A 4IB2A 2OK2A 4KPTA 5HPQA 5AA3A 4H65A 4QFKA 1B1XA 2Q88A 3IOWA 4FATA 4XIGQ 5EYFA 2Y7PA 4X9TA 1VE4A 3TELA 3RTWB 1US5A 3O6IA 3BKIB 1BP5A 1PC3A 1IITA 2IEEA 4LQ5A 2F78A 4UA8A 5ITOA 3V83A 4JB7A 1TT1A 2GHBA 1FQAA 2HEUA 2XXTA 3C34A 1B5JA 5ISUA 4WEDA 5EHMA 1FTLA 4ECFA 3EHSA 5I84A 1N76A 1DSNA 3B7DA 4Q5TA 1PB7A 4KYEA 4JBZA 2IA4A 4F29A 5AA2B 3SEUA 4F3SA 4H8IA 4NWCA 1M5CA 1UIUA 4AB6A 3EQ1A 1ZIUA 2H5YA 4NWDA 4U1OA 1EU8A 2V84A 4U4SA 1MM6A 3B6TA 4BDOA 3CR9A 3KJTA 1MXZA 4Q8RA 1B5IA 3LBSA 1NFTA 4HS7A 3FJGA 1M5DA 1LBBA 4BDQA 1PEBA 2V3TA 2ZYNA 1PB8A 5KDTA 4N6PA 1NKXA 4YKPA 3G7WA 1PB9A 1PBPA 4ZDMA 3K2DA 3IORA 4BDRA 3S2VA 1QJMA 2DS9A 4XKPA 2E0SA 4F19A 4EQ9A 1NNTA 3SEVA 1D3KA 4F39A 3G3HA 3GBBA 2DE4A 1Z7NE 3TCGA 3MZ9A 4XKNA 3TODA 1O64A 4ONYA 3O97A 3VLWA 4RJZA 4DLDA 4AQ4A 1P1NA 3RT6B 4RK2A 3V5AA 3KOSA 4IO2A 4FECA 2F7BA 1B58A 3UN6A 4LATA 2XX8A 5TPAB 3TZAA 4ESWA 3IJOB 4ZZAA 4Q0CA 4ZEFA 1OQGA 3MQ9A 3C32A 4OEUA 4NF5B 2V93A 4O3AA 3S9EA 1LFHA 1MDQA 3IOUA 4H5GA 2F8DA 1FTKA 1URDA 4OQOA 3BBRA 3Q28A 2B65A 1MH3A 4DZ1A 1QUKA 4G4PA 3G3FA 4I9DA 4LUBA 5TP9A 3KN3A 5CRYA 1JVYA 1N3WA 2FA7A 2ONSA 1MY1A 4OENA 2XXRA 3UP9A 2DXYA 4YICA 3K1MA 3H03A 3SEXA 1B40A 2ZYKA 5HM4B 3DP6A 4MF3A 5FHMA 2Y7KA 3AXFA 2DOJA 4GOTA 1B3GA 4H8JA 3CI8A 3RPWA 2NOOA 3CFLA 1Y4CA 4OFLA 1MXVA 5ITPA 1MXUA 4TOZA 2ZYOA 1XC1A 4Z0IA 4TQUQ 1MS7A 3H4ZA 4NF8B 2RCAA 1H3DA 3TPAA 4KQPA 1LAHE 1MQDA 4DE8A 1R9QA 4EDPA 2Q9TA 3FD3A 4KD5A 4OERA 1ZJLA 3UIFA 4LONB 3EPEA 2XD2A 1TFDA 4FEBA 2QS4A 3VFJA 4H6DA 4O3BA 3IB1A 1JQFA 3KEIA 3TTMA 1XT8A 3PU5A 4XXUA 1B3FA 1MY0A 3PPRA 4PFUA 1B6HA 1LCFA 1NH8A 3TQWA 1RYOA 4OESA 2GH9A 5I56B 4OVJA 4P0GA 2VOZA 3RY3A 3EN3A 1QW0A 2KLFA 2OZZA 3O6GA 4BLAA 1SDXA 3MAMA 1N04A 4F18A 5I2KB 1MPCA 4QF9A 3QK6A 1LB9A 4KYDA 4GFRA 1Y3QA 1S9TA 1WODA 3VLUA 1NH7A 4RA1A 1H44A 1DPEA 5K2YA 1JEVA 4KR5A 1QUIA 3MPKA 4XKRA 1B2HA 4JDFA 3TYHA 1NNFA 1OQHA 3MP1A 4LZ5A 4ESXA 5L8DA 4JWOA 3KSJA 4F1YA 3T9XB 1AMFA 4LA9A 5AA2A 4U4XA 3ZKLA 2Q8JA 3MC2A 2OCUA 3JYRA 2Z8EA 1GR2A 5DYHA 1ZLQA 2QS1A 1LAFE 4YMAA 1Z7ME 1B3HA 3SDFA 1BIYA 2HQ0A 3PGFA 1IXGA 1EH3A 4KHZE 5I57B 4KFQA 3S4UA 1M5FA 1KWHA 1DTZA 3PPQA 4MLVA 3IK6B 5KZTA 1P1QA 1US4A 4PE5B 1RKMA 3HSTA 4U1ZA 1B3EA 3PV0E 1B52A 5A5XB 2X7QA 3PUZE 3SEYA 1B5HA 1XHYA 3V89B 2W7YA 1P1OA 2F34A 4YAHX 4OWDA 4IY6A 4NMYA 5FTHA 4DXCA 1FQBA 5BUUA 3ILTB 3W9WA 1N7WA 1MG1A 1LBCA 3MZBA 3TUSA 1URGA 3JV9A 1GTKA 3UORA 2UVHA 4ELRA 1H43A 2PYYA 2I3WA 4U2RA 1R1NA 1RYXA 3O6HA 3SERA 4AB5A 5DVJA 4FORA 4F1VA 2HXWA 3QYTA 1OLAA 2GFEA 4RYAA 2NXOA 3SEWA 4KI0E 3CG3A 2O7IA 3MJNA 2ZYMA 3D4GA 4POXA 3B6WA 3USDA 4QFLA 3C4MA 2G93A 1AH5A 1MQGA 2X7PA 3PUXE 4DCXA 1MPDA 5CBRA 1SQYA 4H67A 3M8UA 1CB6A 3SESA 2RINA 2I48A 1MXYA 2Q2AA 2HZKA 2RC8A 3H6WA 1OVBA 5I58A 4O3CA 3OENA 2F6GA 4PQJA 1USYH 4YKKA 3D4CA 3G3GA 1MRPA 2ANJA 1DPPA 3TCHA 3ZKKA 5H8SA 1SW4A 2PT2A 4LZ7A 4OXVA 4U21A 4MBPA 2GHAA 3K01A 3RTFB 4IO6A 1NNPA 3LSXA 5ELVA 1ZU0A 1L5TA 1NNKA 5H8NB 3KBRA 3HV1A 1I6BA 3C36A 2DWIA 4NF8A 4EXKA 5ICQA 3U1OA 2RC9A 3TCFA 4ZECA 5CI5A 2I49A 1UTHA 3U93A 3LR1A 1R6ZA 3CRBA 3LSFB 4NE4A 4FJPA 5H8HB 2ONRA 2XXUA 2I6EA 1NMUA 3TAJA 3PUVE 3H7MA 3CVGA 4QFPA 3C35A 3TEPA 3THIA 2O1MA 1QVSA 4MFIA 1MY4A 4GLIA 4ZEDA 4LZ8A 4LQ2A 2VHAA 1AOVA 5I56A 3L6GA 3ECRA 3E13X 4NTLA 2P1SA 2H4IA 4GF8A 2ZNTA 3FZVA 3CFZA 3E9XA 2ZMBA 2NVUB 4OMBA 1N84A 3GLBA 5I2KA 3HHGA 1YCJA 3VE1B 1A7LA 3H3GA 5M2VA 4R2BA 3HO7A 4WKMA 3ONMA 2DQVA 4XTCQ 3FXRA 1LAGE 3HPIA 4RNSA 3H6VA 3FVOA 1B7HA 3RNNA 3I6VA 1I69A 3LC8A 2F7AA 4GRKA 3OEKA 1P99A 1Y20A 1VR5A 3K6WA 2Y84A 2DVZA 5TU0A 4HW8A 1VFDA 3KGCA 4ZS9A 5ICTA 4E0WA 4KYSA 2Y7WA 1ANFA 3G3IA 5I57A 1PBQA 1IXCA 4X1DA 1D9VA 1LB8A 4WEPA 4YMBA 1ZBMA 2F5XA 3IO4A 4YU0A 4G68B 3W15C 3QUFA 3LSLA 3FVGA 4MLQA 4FAJA 3EHUA 3S9LC 1BLFA 3IB2A 1DTGA 3TTNA 1VFEA 3KG2A 1DMBA 2YLNA 3OSRA 1XVYA 2UVIA 4G8MA 4R72A 4TLLB 4F1UA 3IOVA 4RPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UQW A;  2A5T A;  5AE4 A;  5A5X A;  2RF1 A;  3S9M C;  3ODB A;  3EHT A;  4PET A;  2FNC A;  5IAI A;  5I58 B;  1ATG A;  2OWT A;  2V25 A;  1M5E A;  2HCA A;  1A40 A;  1B7Z A;  4YB6 A;  4QFN A;  1XOC A;  2RKM A;  5CC2 A;  1H76 A;  4YKJ A;  4G8H A;  1MQH A;  2RCB A;  2HFB A;  3KOT A;  3I5O A;  4G8N A;  4OFO A;  4MH5 A;  2A5S A;  2Q2C A;  5BWJ A;  3Q25 A;  1UTH B;  2QS3 A;  2O51 A;  3C9H A;  2P0S A;  4R74 A;  1VSO A;  2B3B A;  3GXA A;  3H6U A;  3U8Q A;  3VV5 A;  5FHO A;  2XX9 A;  4M4G A;  1MXX A;  3QSL A;  2I0C A;  2XXQ A;  4F22 A;  1A55 A;  2QL3 A;  2VGQ A;  1GVC A;  5IKB A;  3CIJ A;  3U72 A;  2ZNS A;  1LFG A;  3T96 B;  1URS A;  3MVZ A;  3T93 B;  1N3X A;  4EXL A;  2F35 A;  3WAE A;  1TFA A;  4JSO A;  3DEL B;  3O2A A;  2D21 A;  1YAE A;  4PFY A;  3N6U A;  4I8C A;  4QSD A;  3PMV A;  4F3G A;  1Y1Z A;  2QSX A;  2O68 A;  3IAZ A;  1SD3 A;  3FAT A;  3VLV A;  1PDA A;  4ZE9 A;  3FV2 A;  1EZO A;  4Z7E A;  3CSG A;  4NF6 A;  2PT1 A;  3EF7 A;  4F2Q A;  3N26 A;  4IO5 A;  2AL4 A;  2F36 A;  1A8E A;  5EHS A;  2X26 A;  3FUZ A;  1IQ7 A;  4P11 A;  5JTY B;  3MVY A;  1UTB B;  3PD8 A;  3OO8 A;  3N5L A;  2ESN A;  5H8N A;  2VD2 A;  1SW1 A;  2H98 A;  4R6Y A;  5HBC A;  4FED A;  4U23 A;  3TTL A;  3T22 A;  2QPQ A;  3K6X A;  3PPP A;  4G77 A;  4OFJ A;  5CMM A;  1BKA A;  5H8H A;  4JWX A;  1O63 A;  3H06 B;  4RY1 A;  3MVW A;  5L9O A;  2AIX A;  3LSW A;  5FTI A;  5B70 A;  4OYV A;  2QS2 A;  2DSF A;  4GVO A;  1MPB A;  2OWS A;  5DTB A;  4C0R A;  4JXI A;  3FIR A;  3RUM A;  1IZ1 A;  2A5T B;  4NED A;  3UGW A;  4OEV A;  2Z8D A;  4YZZ A;  1QKA A;  1IXH A;  4P0I A;  3IB0 A;  3T66 A;  2PMS A;  5L9M A;  3O28 A;  2NWJ A;  1Y3P A;  1OLC A;  5CMC A;  2ZXT A;  2O7U A;  3BFU A;  4UAC A;  1FQC A;  3OD7 A;  3FXQ A;  4ISU A;  1I6A A;  1JVX A;  4F3B A;  3K02 A;  2O84 X;  4N07 A;  3TTR A;  1IEJ A;  4YB7 A;  3R26 A;  2DVC A;  3KN8 A;  2XHD A;  5DT6 A;  1DOT A;  1A99 A;  4DXB A;  3T9U A;  1CE2 A;  1I6Q A;  1SW2 A;  4K3F A;  2V3Q A;  3OEL A;  5CBS A;  5FHN A;  3M3F A;  4G68 A;  2RC7 A;  2ZNU A;  4OET A;  3PUW E;  2DWA A;  4ZEI A;  1XVX A;  3A3U A;  2E1S A;  3UA8 A;  2DYX A;  2AYS A;  3UK4 A;  2XXY A;  3FJM A;  4HCY A;  1MH4 A;  3F11 A;  2UXA A;  3Q27 A;  3FGS A;  1QUL A;  1O7T A;  2UVG A;  1JNF A;  2QMW A;  3WAF A;  1UIV A;  4JSD A;  4GL0 A;  4NF6 B;  3DP8 A;  4H1X A;  1Q1K A;  1B7U A;  2H9B A;  3E4R A;  5I2N A;  4F3P A;  1FTO A;  5CMB A;  4DIG A;  3MZ1 A;  1P1U A;  3U92 A;  3MPL A;  3VXC A;  2UYE A;  2PVU A;  2LAO A;  4U22 A;  1MM7 A;  2DXR A;  4RPO A;  2Z23 A;  4X48 A;  1MDP 1;  3GBA A;  1EZP A;  4R2F A;  1B05 A;  3KN7 A;  4TLM B;  3K00 A;  3RLF E;  3K1P A;  1FQD A;  2ABH A;  2CMO A;  2D3I A;  2F7C A;  4M1V A;  3I3V A;  1JET A;  4ZEK A;  1ZTY A;  1B32 A;  3R7X A;  3Q26 A;  2HAV A;  1B0L A;  4GQO A;  1Y1M A;  5B7D A;  4KCD A;  1TXF A;  3RT8 A;  1HSE A;  3TQL A;  3S9N C;  2AL5 A;  1B4Z A;  1NL5 A;  3PMW A;  4ELO A;  4FIM A;  4RK9 A;  3OO9 A;  1USY E;  3RGY A;  1LFI A;  3KZG A;  2Z22 A;  1B0H A;  4DDD A;  1IIW A;  4R6K A;  3TFL A;  3ZS6 A;  2B3F A;  4C1U A;  4ZZE A;  1A8F A;  1YTV A;  2H99 A;  1JW4 A;  3K6U A;  4OTE A;  2O6A A;  5K2X A;  1TWY A;  4DCY A;  1IXI A;  3L6H A;  2YJP A;  4GXS B;  2QRY A;  3QAX A;  2FYI A;  3IJX B;  5I59 A;  4GL8 A;  3RQT A;  1B51 A;  3M3L A;  4GIZ A;  2BJJ X;  5JTY A;  1UTB A;  1EZ9 A;  2Q89 A;  2R71 A;  2UYF A;  3KFM A;  3CFX A;  1N7X A;  3MBP A;  5JEI A;  2PX1 A;  2F6P A;  2G29 A;  1SI0 A;  3Q29 A;  5AA4 B;  2OBG A;  3DP4 A;  4PFT A;  4QFO A;  2I3V A;  3MP8 A;  4IO4 A;  1B4H A;  1LLS A;  4R73 A;  1OIB A;  3O29 A;  3MWB A;  3A09 A;  5H8Q B;  3C31 A;  1MY2 A;  1SBP A;  4YB5 A;  4G2Z A;  3OO7 A;  1YPN A;  5AA1 A;  2PBW A;  1A54 A;  1JW5 A;  5DEX B;  3PPN A;  4R9F A;  1SVX B;  3PD9 A;  3TTK A;  2QMX A;  1FQE A;  4OHN A;  3A3C A;  3PPO A;  4EUO A;  3SET A;  2THI A;  3T9H B;  2HAU A;  3IO6 A;  4H5F A;  1S7Y A;  5JK4 A;  4HTG A;  3HHF A;  3TMG A;  4THI A;  5J1D A;  2M8C A;  4NF4 A;  5CM6 A;  3TDJ A;  3OMB A;  4Q30 B;  1WDN A;  2REG A;  5I2N B;  2Z8F A;  1SI1 A;  1ELJ A;  2I4C A;  3B6Q A;  4YKI A;  5H8F A;  1FTM A;  2O69 A;  3FAS A;  4GD5 A;  4GXA A;  3SKP A;  3G3J A;  5KCJ A;  1SW5 A;  2ALU A;  4IO3 A;  4PP0 A;  5F7V A;  1QUJ A;  4LVQ A;  2UVJ A;  3ZSF A;  3TKD A;  4F31 B;  1OMP A;  1B46 A;  4F2O A;  2XXI A;  1GV8 A;  3FJ7 A;  4ND9 A;  3MVX A;  4DXU A;  1XS5 A;  3DLN A;  2NUV A;  1D4N A;  2WKY A;  4E0X A;  4IO7 A;  3LUY A;  3GZG A;  1FW0 A;  2YPN A;  3RN8 A;  1AL3 A;  3R6U A;  3FVN A;  3FVK A;  4R75 A;  3C33 A;  4RXL A;  3PUY E;  3HN0 A;  3QXM A;  1FCK A;  3DM0 A;  1LAX A;  3VVE A;  3PMX A;  4IY5 A;  1MQI A;  4GWO A;  4QHQ A;  3MUQ A;  5KDT B;  1FTJ A;  4H0W A;  2XX7 A;  4OZ9 A;  3O66 A;  4X1B A;  3N94 A;  2QJE A;  1ZMG A;  4EQ7 A;  2VD3 A;  1BTJ A;  1QKB A;  1SYH A;  5LOM A;  1II5 A;  5I59 B;  3G3K A;  1P1W A;  3OSQ A;  2HZL A;  3W9V A;  1LST A;  3O9P A;  3JZJ A;  3KSX A;  1Y3N A;  3VXB A;  4I1D A;  1MY3 A;  3BFT A;  2H25 A;  3QUJ A;  4QSC A;  2I58 A;  4HCW A;  1Y9U A;  2R6G E;  1GGG A;  2P2A A;  2REJ A;  1ZKB A;  3P7I A;  4PFW A;  4EQB A;  2XXV A;  3MP6 A;  2XXX A;  3N6T A;  4FE8 A;  4LP2 B;  1S50 A;  5DVF A;  4ZE8 A;  3IL1 B;  2Y7R A;  1POT A;  3K0V A;  3IX1 A;  3MW0 A;  2DE2 A;  1LCT A;  1WVJ A;  3CG1 A;  2I4B A;  1N0T A;  2OJT A;  1SYI A;  3K6V A;  3T9V A;  2OLB A;  2DWJ A;  3KJ7 A;  3OXN A;  3VVF A;  4EF2 A;  1HSL A;  4BDM A;  2GRV A;  1MXW A;  4N13 A;  5F1Q A;  1R9L A;  1B3L A;  3K4U A;  2XXW A;  1POY 1;  1Y4T A;  5TP9 B;  4BDL A;  2D5W A;  3H6T A;  4NF4 B;  5L9S A;  4R6H A;  1Q35 A;  1F9B A;  1H45 A;  3FXU A;  4I62 A;  4WXJ A;  3IOT A;  1MQJ A;  1AIV A;  3OEM A;  3OO6 A;  5DVI A;  3VDF A;  5H8F B;  4BDN A;  1LGB C;  1B1H A;  5KCJ B;  1M5B A;  2XXH A;  1FQF A;  2Y7I A;  5AA4 A;  2CZL A;  2VP1 A;  2R9J A;  5CMK A;  4XKQ A;  2O1L A;  3K1N A;  3U94 A;  2ONK E;  4ZEB A;  4C1T A;  4L17 A;  1T0K A;  4EF1 A;  4ELP A;  4QRZ A;  4KCC A;  4IGT A;  3FV1 A;  4POW A;  1D9Y A;  3V8X B;  4G68 C;  2V3U A;  2I0B A;  5AA2 D;  3QIM A;  3E3K A;  1J1N A;  1OVT A;  5H8Q A;  5TPA A;  2F97 A;  3M3K A;  1JEU A;  4ELQ A;  2DWH A;  3HCQ A;  2DE3 A;  2XXP A;  3VVD A;  2XD3 A;  1IUD A;  1JW1 A;  3CSB A;  4JWY A;  1HSJ A;  4NF5 A;  4R9G A;  2DP8 A;  4IGR A;  4QSE A;  3OOA A;  1B9J A;  3ILU B;  5DEX A;  3IR1 A;  4IB2 A;  2OK2 A;  4KPT A;  5HPQ A;  5AA3 A;  4H65 A;  4QFK A;  1B1X A;  2Q88 A;  3IOW A;  4FAT A;  4XIG Q;  5EYF A;  2Y7P A;  4X9T A;  1VE4 A;  3TEL A;  3RTW B;  1US5 A;  3O6I A;  3BKI B;  1BP5 A;  1PC3 A;  1IIT A;  2IEE A;  4LQ5 A;  2F78 A;  4UA8 A;  5ITO A;  3V83 A;  4JB7 A;  1TT1 A;  2GHB A;  1FQA A;  2HEU A;  2XXT A;  3C34 A;  1B5J A;  5ISU A;  4WED A;  5EHM A;  1FTL A;  4ECF A;  3EHS A;  5I84 A;  1N76 A;  1DSN A;  3B7D A;  4Q5T A;  1PB7 A;  4KYE A;  4JBZ A;  2IA4 A;  4F29 A;  5AA2 B;  3SEU A;  4F3S A;  4H8I A;  4NWC A;  1M5C A;  1UIU A;  4AB6 A;  3EQ1 A;  1ZIU A;  2H5Y A;  4NWD A;  4U1O A;  1EU8 A;  2V84 A;  4U4S A;  1MM6 A;  3B6T A;  4BDO A;  3CR9 A;  3KJT A;  1MXZ A;  4Q8R A;  1B5I A;  3LBS A;  1NFT A;  4HS7 A;  3FJG A;  1M5D A;  1LBB A;  4BDQ A;  1PEB A;  2V3T A;  2ZYN A;  1PB8 A;  5KDT A;  4N6P A;  1NKX A;  4YKP A;  3G7W A;  1PB9 A;  1PBP A;  4ZDM A;  3K2D A;  3IOR A;  4BDR A;  3S2V A;  1QJM A;  2DS9 A;  4XKP A;  2E0S A;  4F19 A;  4EQ9 A;  1NNT A;  3SEV A;  1D3K A;  4F39 A;  3G3H A;  3GBB A;  2DE4 A;  1Z7N E;  3TCG A;  3MZ9 A;  4XKN A;  3TOD A;  1O64 A;  4ONY A;  3O97 A;  3VLW A;  4RJZ A;  4DLD A;  4AQ4 A;  1P1N A;  3RT6 B;  4RK2 A;  3V5A A;  3KOS A;  4IO2 A;  4FEC A;  2F7B A;  1B58 A;  3UN6 A;  4LAT A;  2XX8 A;  5TPA B;  3TZA A;  4ESW A;  3IJO B;  4ZZA A;  4Q0C A;  4ZEF A;  1OQG A;  3MQ9 A;  3C32 A;  4OEU A;  4NF5 B;  2V93 A;  4O3A A;  3S9E A;  1LFH A;  1MDQ A;  3IOU A;  4H5G A;  2F8D A;  1FTK A;  1URD A;  4OQO A;  3BBR A;  3Q28 A;  2B65 A;  1MH3 A;  4DZ1 A;  1QUK A;  4G4P A;  3G3F A;  4I9D A;  4LUB A;  5TP9 A;  3KN3 A;  5CRY A;  1JVY A;  1N3W A;  2FA7 A;  2ONS A;  1MY1 A;  4OEN A;  2XXR A;  3UP9 A;  2DXY A;  4YIC A;  3K1M A;  3H03 A;  3SEX A;  1B40 A;  2ZYK A;  5HM4 B;  3DP6 A;  4MF3 A;  5FHM A;  2Y7K A;  3AXF A;  2DOJ A;  4GOT A;  1B3G A;  4H8J A;  3CI8 A;  3RPW A;  2NOO A;  3CFL A;  1Y4C A;  4OFL A;  1MXV A;  5ITP A;  1MXU A;  4TOZ A;  2ZYO A;  1XC1 A;  4Z0I A;  4TQU Q;  1MS7 A;  3H4Z A;  4NF8 B;  2RCA A;  1H3D A;  3TPA A;  4KQP A;  1LAH E;  1MQD A;  4DE8 A;  1R9Q A;  4EDP A;  2Q9T A;  3FD3 A;  4KD5 A;  4OER A;  1ZJL A;  3UIF A;  4LON B;  3EPE A;  2XD2 A;  1TFD A;  4FEB A;  2QS4 A;  3VFJ A;  4H6D A;  4O3B A;  3IB1 A;  1JQF A;  3KEI A;  3TTM A;  1XT8 A;  3PU5 A;  4XXU A;  1B3F A;  1MY0 A;  3PPR A;  4PFU A;  1B6H A;  1LCF A;  1NH8 A;  3TQW A;  1RYO A;  4OES A;  2GH9 A;  5I56 B;  4OVJ A;  4P0G A;  2VOZ A;  3RY3 A;  3EN3 A;  1QW0 A;  2KLF A;  2OZZ A;  3O6G A;  4BLA A;  1SDX A;  3MAM A;  1N04 A;  4F18 A;  5I2K B;  1MPC A;  4QF9 A;  3QK6 A;  1LB9 A;  4KYD A;  4GFR A;  1Y3Q A;  1S9T A;  1WOD A;  3VLU A;  1NH7 A;  4RA1 A;  1H44 A;  1DPE A;  5K2Y A;  1JEV A;  4KR5 A;  1QUI A;  3MPK A;  4XKR A;  1B2H A;  4JDF A;  3TYH A;  1NNF A;  1OQH A;  3MP1 A;  4LZ5 A;  4ESX A;  5L8D A;  4JWO A;  3KSJ A;  4F1Y A;  3T9X B;  1AMF A;  4LA9 A;  5AA2 A;  4U4X A;  3ZKL A;  2Q8J A;  3MC2 A;  2OCU A;  3JYR A;  2Z8E A;  1GR2 A;  5DYH A;  1ZLQ A;  2QS1 A;  1LAF E;  4YMA A;  1Z7M E;  1B3H A;  3SDF A;  1BIY A;  2HQ0 A;  3PGF A;  1IXG A;  1EH3 A;  4KHZ E;  5I57 B;  4KFQ A;  3S4U A;  1M5F A;  1KWH A;  1DTZ A;  3PPQ A;  4MLV A;  3IK6 B;  5KZT A;  1P1Q A;  1US4 A;  4PE5 B;  1RKM A;  3HST A;  4U1Z A;  1B3E A;  3PV0 E;  1B52 A;  5A5X B;  2X7Q A;  3PUZ E;  3SEY A;  1B5H A;  1XHY A;  3V89 B;  2W7Y A;  1P1O A;  2F34 A;  4YAH X;  4OWD A;  4IY6 A;  4NMY A;  5FTH A;  4DXC A;  1FQB A;  5BUU A;  3ILT B;  3W9W A;  1N7W A;  1MG1 A;  1LBC A;  3MZB A;  3TUS A;  1URG A;  3JV9 A;  1GTK A;  3UOR A;  2UVH A;  4ELR A;  1H43 A;  2PYY A;  2I3W A;  4U2R A;  1R1N A;  1RYX A;  3O6H A;  3SER A;  4AB5 A;  5DVJ A;  4FOR A;  4F1V A;  2HXW A;  3QYT A;  1OLA A;  2GFE A;  4RYA A;  2NXO A;  3SEW A;  4KI0 E;  3CG3 A;  2O7I A;  3MJN A;  2ZYM A;  3D4G A;  4POX A;  3B6W A;  3USD A;  4QFL A;  3C4M A;  2G93 A;  1AH5 A;  1MQG A;  2X7P A;  3PUX E;  4DCX A;  1MPD A;  5CBR A;  1SQY A;  4H67 A;  3M8U A;  1CB6 A;  3SES A;  2RIN A;  2I48 A;  1MXY A;  2Q2A A;  2HZK A;  2RC8 A;  3H6W A;  1OVB A;  5I58 A;  4O3C A;  3OEN A;  2F6G A;  4PQJ A;  1USY H;  4YKK A;  3D4C A;  3G3G A;  1MRP A;  2ANJ A;  1DPP A;  3TCH A;  3ZKK A;  5H8S A;  1SW4 A;  2PT2 A;  4LZ7 A;  4OXV A;  4U21 A;  4MBP A;  2GHA A;  3K01 A;  3RTF B;  4IO6 A;  1NNP A;  3LSX A;  5ELV A;  1ZU0 A;  1L5T A;  1NNK A;  5H8N B;  3KBR A;  3HV1 A;  1I6B A;  3C36 A;  2DWI A;  4NF8 A;  4EXK A;  5ICQ A;  3U1O A;  2RC9 A;  3TCF A;  4ZEC A;  5CI5 A;  2I49 A;  1UTH A;  3U93 A;  3LR1 A;  1R6Z A;  3CRB A;  3LSF B;  4NE4 A;  4FJP A;  5H8H B;  2ONR A;  2XXU A;  2I6E A;  1NMU A;  3TAJ A;  3PUV E;  3H7M A;  3CVG A;  4QFP A;  3C35 A;  3TEP A;  3THI A;  2O1M A;  1QVS A;  4MFI A;  1MY4 A;  4GLI A;  4ZED A;  4LZ8 A;  4LQ2 A;  2VHA A;  1AOV A;  5I56 A;  3L6G A;  3ECR A;  3E13 X;  4NTL A;  2P1S A;  2H4I A;  4GF8 A;  2ZNT A;  3FZV A;  3CFZ A;  3E9X A;  2ZMB A;  2NVU B;  4OMB A;  1N84 A;  3GLB A;  5I2K A;  3HHG A;  1YCJ A;  3VE1 B;  1A7L A;  3H3G A;  5M2V A;  4R2B A;  3HO7 A;  4WKM A;  3ONM A;  2DQV A;  4XTC Q;  3FXR A;  1LAG E;  3HPI A;  4RNS A;  3H6V A;  3FVO A;  1B7H A;  3RNN A;  3I6V A;  1I69 A;  3LC8 A;  2F7A A;  4GRK A;  3OEK A;  1P99 A;  1Y20 A;  1VR5 A;  3K6W A;  2Y84 A;  2DVZ A;  5TU0 A;  4HW8 A;  1VFD A;  3KGC A;  4ZS9 A;  5ICT A;  4E0W A;  4KYS A;  2Y7W A;  1ANF A;  3G3I A;  5I57 A;  1PBQ A;  1IXC A;  4X1D A;  1D9V A;  1LB8 A;  4WEP A;  4YMB A;  1ZBM A;  2F5X A;  3IO4 A;  4YU0 A;  4G68 B;  3W15 C;  3QUF A;  3LSL A;  3FVG A;  4MLQ A;  4FAJ A;  3EHU A;  3S9L C;  1BLF A;  3IB2 A;  1DTG A;  3TTN A;  1VFE A;  3KG2 A;  1DMB A;  2YLN A;  3OSR A;  1XVY A;  2UVI A;  4G8M A;  4R72 A;  4TLL B;  4F1U A;  3IOV A;  4RPN A; 
#chains in the Genus database with same CATH topology
 1SPI A;  2PFY A;  1UQW A;  2A5T A;  5AE4 A;  5A5X A;  2RF1 A;  3S9M C;  3ODB A;  4PTK A;  3EHT A;  4PET A;  2FNC A;  5IAI A;  5I58 B;  1RDY A;  1ATG A;  2OWT A;  4MHF A;  2V25 A;  1M5E A;  2HCA A;  4OVS A;  1A40 A;  3RYD A;  1B7Z A;  4YB6 A;  4QFN A;  4NGU A;  1XOC A;  2RKM A;  5CC2 A;  4MIJ A;  1D9Q A;  1H76 A;  4YKJ A;  4G8H A;  1FPE A;  1NUZ A;  1MQH A;  3SZP A;  2RCB A;  2HFB A;  3KOT A;  5IGA A;  3I5O A;  4G8N A;  4OFO A;  4MH5 A;  2A5S A;  2Q2C A;  4PE3 A;  5BWJ A;  3Q25 A;  1INP A;  4OA4 A;  1IMD A;  1UTH B;  2QS3 A;  2O51 A;  3C9H A;  2P0S A;  4R74 A;  5FBP A;  1VSO A;  2B3B A;  1LBZ A;  1NV3 A;  3H6U A;  3GXA A;  5FHO A;  3U8Q A;  3VV5 A;  2XX9 A;  4M4G A;  3T0J A;  1MXX A;  3QSL A;  4NQ8 A;  2I0C A;  4PGN A;  2XXQ A;  4F22 A;  1A55 A;  2QL3 A;  4N17 A;  2VGQ A;  1GVC A;  4PFR A;  2CZK A;  5IKB A;  3CIJ A;  3U72 A;  2ZNS A;  1LFG A;  3T96 B;  1URS A;  3MVZ A;  3T93 B;  1FPL A;  1N3X A;  4EXL A;  2F35 A;  3WAE A;  2XWI A;  5ET5 A;  3HFU A;  1TFA A;  4JSO A;  3DEL B;  3O2A A;  1RDZ A;  1FJ9 A;  4GWW A;  2D21 A;  1YAE A;  4PFY A;  3N6U A;  4I8C A;  4QSD A;  3PMV A;  4F3G A;  1Y1Z A;  2BJI A;  2QSX A;  2O68 A;  3IAZ A;  4N6D A;  1SD3 A;  3FAT A;  4MJO A;  3VLV A;  1PDA A;  4ZE9 A;  3FV2 A;  1EZO A;  4Z7E A;  3CSG A;  4NF6 A;  2PT1 A;  5ET8 A;  3EF7 A;  3T1B A;  4F2Q A;  3N26 A;  4IO5 A;  2AL4 A;  2F36 A;  1A8E A;  5EHS A;  2X26 A;  3FUZ A;  1IQ7 A;  4GX4 A;  4P11 A;  5JTY B;  3MVY A;  1UTB B;  4I3Y A;  3PD8 A;  3OO8 A;  1FPD A;  3N5L A;  2ESN A;  5H8N A;  2VD2 A;  4PDH A;  1SW1 A;  2H98 A;  4R6Y A;  5HBC A;  4FED A;  4U23 A;  3TTL A;  3T22 A;  2QPQ A;  3K6X A;  3PPP A;  4G77 A;  4OFJ A;  5CMM A;  1BKA A;  4N91 A;  3EKI A;  1FBG A;  2ZZW A;  5H8H A;  2QVV A;  4JWX A;  5T3J A;  1O63 A;  1RDX A;  3H06 B;  4RY1 A;  3MVW A;  5L9O A;  1VDW A;  4NAP A;  2AIX A;  2B4L A;  3LSW A;  5FTI A;  5B70 A;  4OYV A;  2QS2 A;  2DSF A;  4GVO A;  1MPB A;  2OWS A;  5DTB A;  4C0R A;  3LUZ A;  4JXI A;  3FIR A;  3RUM A;  1IZ1 A;  1KA0 A;  2A5T B;  1IMB A;  4NED A;  3UGW A;  4OEV A;  2Z8D A;  4YZZ A;  1QKA A;  2FIX A;  1IXH A;  4P0I A;  4PBQ A;  3IB0 A;  3T66 A;  2PMS A;  5L9M A;  3O28 A;  2NWJ A;  3E79 A;  1Y3P A;  1OLC A;  1QGX A;  5CMC A;  2ZXT A;  2O7U A;  3BFU A;  4UAC A;  4N4U A;  5DW8 A;  2XWK A;  1FQC A;  3OD7 A;  4H46 A;  3FXQ A;  4P3L A;  4ISU A;  1I6A A;  1JVX A;  4F3B A;  4HE0 A;  3K02 A;  3BIG A;  2O84 X;  4N07 A;  3TTR A;  2F3D A;  1IEJ A;  4YB7 A;  4MCO A;  3R26 A;  2DVC A;  3KN8 A;  2XHD A;  3CHG A;  5DT6 A;  1DOT A;  1A99 A;  4DXB A;  3T9U A;  1CE2 A;  1I6Q A;  1SW2 A;  5EYG A;  4K3F A;  2V3Q A;  3OEL A;  2XA5 A;  5CBS A;  5FHN A;  3M3F A;  2MKZ A;  4HE2 A;  4G68 A;  2RC7 A;  3PTY A;  2ZNU A;  4OET A;  3PUW E;  2DWA A;  4ZEI A;  1NV6 A;  1XVX A;  3A3U A;  2E1S A;  1BK4 A;  3UA8 A;  4MX6 A;  2DYX A;  2AYS A;  3UK4 A;  2XXY A;  1NUX A;  3FJM A;  4HCY A;  1MH4 A;  3F11 A;  1NUY A;  2UXA A;  4PCD A;  3Q27 A;  3FGS A;  1QUL A;  1O7T A;  2UVG A;  1JNF A;  2QMW A;  3WAF A;  1UIV A;  4JSD A;  4GL0 A;  4NF6 B;  3DP8 A;  4H1X A;  1Q1K A;  1B7U A;  2H9B A;  3E4R A;  5I2N A;  4F3P A;  1FTO A;  5CMB A;  4DIG A;  3MZ1 A;  1P1U A;  3U92 A;  4NHB A;  3MPL A;  3VXC A;  4XFE A;  2UYE A;  3RPL A;  2PVU A;  2LAO A;  1NV1 A;  4U22 A;  1MM7 A;  2DXR A;  4IR8 A;  4RPO A;  2Z23 A;  4X48 A;  1MDP 1;  3QMF A;  3GBA A;  1EZP A;  5A5L A;  4R2F A;  1B05 A;  3KN7 A;  4TLM B;  3K00 A;  3RLF E;  3K1P A;  1FQD A;  2ABH A;  2CMO A;  2D3I A;  2F7C A;  3ISP A;  4M1V A;  3I3V A;  1JET A;  4ZEK A;  1ZTY A;  1B32 A;  3R7X A;  3Q26 A;  2HAV A;  1B0L A;  4GQO A;  1Y1M A;  5B7D A;  2WBB A;  4KCD A;  1TXF A;  3RT8 A;  1HSE A;  3TQL A;  3S9N C;  2AL5 A;  1B4Z A;  1NL5 A;  3PMW A;  4ELO A;  4FIM A;  4RK9 A;  3OO9 A;  1USY E;  1KZ8 A;  3RGY A;  1LFI A;  3KZG A;  2Z22 A;  1B0H A;  4DDD A;  1IIW A;  4R6K A;  3TFL A;  3ZS6 A;  1EYI A;  2B3F A;  4ZZE A;  4C1U A;  1A8F A;  1YTV A;  3A29 A;  2H99 A;  1JW4 A;  1K9Y A;  3K6U A;  4OTE A;  2O6A A;  5K2X A;  1TWY A;  1NV4 A;  4DCY A;  1IXI A;  3L6H A;  2YJP A;  4GXS B;  2QRY A;  3QAX A;  2FYI A;  3KBZ A;  3IJX B;  5I59 A;  2XWV A;  4GL8 A;  3RQT A;  4PGP A;  1B51 A;  3M3L A;  4GIZ A;  2BJJ X;  5JTY A;  1UTB A;  1EZ9 A;  2Q89 A;  2R71 A;  2UYF A;  3KFM A;  3KC1 A;  3CFX A;  1N7X A;  3MBP A;  5JEI A;  2PX1 A;  2F6P A;  2G29 A;  1SI0 A;  4OVP A;  3Q29 A;  5AA4 B;  2OBG A;  3DP4 A;  1NV7 A;  4PFT A;  1LBV A;  4QFO A;  2I3V A;  3MP8 A;  4IO4 A;  1B4H A;  1LLS A;  3B50 A;  2FVZ A;  4R73 A;  1OIB A;  3O29 A;  3MWB A;  3A09 A;  4MNI A;  5H8Q B;  3C31 A;  1YZ0 A;  1MY2 A;  1SBP A;  4YB5 A;  4G2Z A;  3OO7 A;  4MNP A;  1YPN A;  5AA1 A;  2PBW A;  1A54 A;  1JW5 A;  5DEX B;  2Q74 A;  3PPN A;  4R9F A;  1SVX B;  3PD9 A;  3TTK A;  2QMX A;  4HE1 A;  1FQE A;  4OHN A;  3A3C A;  3PPO A;  4EUO A;  3SET A;  2THI A;  3T9H B;  2HAU A;  3IO6 A;  4H5F A;  1S7Y A;  4GX3 A;  5JK4 A;  4HTG A;  3HHF A;  4THI A;  3TMG A;  5J1D A;  2M8C A;  4NF4 A;  5CM6 A;  3TDJ A;  3OMB A;  4Q30 B;  5ET6 A;  1WDN A;  1IMF A;  2REG A;  5I2N B;  2Z8F A;  1FJ6 A;  1SI1 A;  5ET7 A;  4NX1 A;  1ELJ A;  3LV0 A;  4O7I A;  2I4C A;  3B6Q A;  4YKI A;  5H8F A;  1FTM A;  2O69 A;  3FAS A;  4GD5 A;  4GXA A;  3RPL B;  3SKP A;  3G3J A;  5KCJ A;  1SW5 A;  2ALU A;  4IO3 A;  4PP0 A;  2FIE A;  5F7V A;  1QUJ A;  4LVQ A;  3MYU A;  4X8R A;  2UVJ A;  3ZSF A;  3TKD A;  4F31 B;  1OMP A;  1B46 A;  2B4M A;  4F2O A;  4GBV A;  2XXI A;  1GV8 A;  3FJ7 A;  4ND9 A;  3MVX A;  4DXU A;  5EYH A;  2WBD A;  1XS5 A;  3DLN A;  2NUV A;  1D4N A;  2WKY A;  4PBH A;  4E0X A;  4IO7 A;  3LUY A;  3GZG A;  1FW0 A;  2YPN A;  3RN8 A;  1AL3 A;  3R6U A;  3FVN A;  3FVK A;  4R75 A;  3C33 A;  4RXL A;  3PUY E;  3HN0 A;  4NF0 A;  3QXM A;  1FCK A;  3DM0 A;  1LAX A;  3VVE A;  3PMX A;  4IY5 A;  1MQI A;  3KC0 A;  4GWO A;  4QHQ A;  3MUQ A;  5KDT B;  1FTJ A;  4H0W A;  2XX7 A;  4OZ9 A;  3O66 A;  1NI9 A;  2FHY A;  4X1B A;  3N94 A;  2QJE A;  1ZMG A;  4EQ7 A;  2VD3 A;  1BTJ A;  4PDD A;  1QKB A;  2QVU A;  1SYH A;  5LOM A;  1FPG A;  1II5 A;  5I59 B;  3G3K A;  1P1W A;  5I3S A;  3OSQ A;  2HZL A;  1FBH A;  3W9V A;  1LST A;  3O9P A;  3JZJ A;  2VPN A;  3KSX A;  1Y3N A;  3VXB A;  4I1D A;  4AS5 A;  1MY3 A;  3BFT A;  2H25 A;  3QUJ A;  4QSC A;  2I58 A;  4HCW A;  4DI4 B;  1Y9U A;  2R6G E;  1GGG A;  2P2A A;  2WX9 A;  2QVR A;  2REJ A;  1ZKB A;  3P7I A;  4PFW A;  3FXB A;  4EQB A;  2XXV A;  3MP6 A;  2XXX A;  2GQ1 A;  3N6T A;  4FE8 A;  4LP2 B;  1S50 A;  5DVF A;  4ZE8 A;  3IL1 B;  2Y7R A;  1POT A;  3K0V A;  3IX1 A;  4P1E A;  3MW0 A;  2DE2 A;  1LCT A;  1WVJ A;  3CG1 A;  2OWZ A;  2I4B A;  1N0T A;  2OJT A;  1SYI A;  3K6V A;  3T9V A;  2OLB A;  2OX3 A;  4H45 A;  2DWJ A;  3KJ7 A;  4OVR A;  3OXN A;  3VVF A;  4EF2 A;  1HSL A;  4BDM A;  2GRV A;  1MXW A;  4N13 A;  5F1Q A;  1R9L A;  1B3L A;  3K4U A;  2XXW A;  4AS4 A;  1POY 1;  1Y4T A;  5TP9 B;  4BDL A;  2D5W A;  3H6T A;  4NF4 B;  4XEQ A;  5L9S A;  4R6H A;  1FPI A;  1Q35 A;  1F9B A;  1H45 A;  3FXU A;  4I62 A;  4WXJ A;  3IOT A;  1MQJ A;  5I5P A;  1AIV A;  3OEM A;  3OO6 A;  2VPO A;  5DVI A;  3VDF A;  5H8F B;  4BDN A;  1LGB C;  1B1H A;  5KCJ B;  2WYP A;  1M5B A;  2XXH A;  1G0H A;  1FQF A;  2Y7I A;  5AA4 A;  2CZL A;  5EQ7 A;  2VP1 A;  2R9J A;  5CMK A;  4XKQ A;  2O1L A;  3K1N A;  3U94 A;  2ONK E;  4ZEB A;  2FBP A;  4C1T A;  4L17 A;  1T0K A;  4EF1 A;  4ELP A;  4QRZ A;  4KCC A;  2QFL A;  1YYZ A;  4IGT A;  3FV1 A;  4POW A;  1D9Y A;  3V8X B;  3B8B A;  4G68 C;  2V3U A;  2CZH A;  2I0B A;  3ROJ A;  5AA2 D;  3QIM A;  3E3K A;  1J1N A;  5F24 A;  1OVT A;  5H8Q A;  5TPA A;  2F97 A;  3M3K A;  1JEU A;  1XI6 A;  4ELQ A;  2DWH A;  3HCQ A;  2DE3 A;  2XXP A;  3VVD A;  2XD3 A;  2KQZ A;  1IUD A;  1JW1 A;  3CSB A;  4JWY A;  1HSJ A;  4NF5 A;  4R9G A;  2DP8 A;  3E78 A;  4IGR A;  4QSE A;  3OOA A;  1B9J A;  3ILU B;  5DEX A;  3IR1 A;  4IB2 A;  2OK2 A;  2XWO A;  4KPT A;  5HPQ A;  5AA3 A;  4H65 A;  4QFK A;  4PFI A;  1B1X A;  2Q88 A;  3IOW A;  4FAT A;  4XIG Q;  5EYF A;  1G0I A;  2Y7P A;  2Y5L A;  4X9T A;  1VE4 A;  3TEL A;  4OAN A;  3RTW B;  4MAG A;  1US5 A;  3O6I A;  3BKI B;  5EQ8 A;  1BP5 A;  1PC3 A;  5IZ1 A;  1IIT A;  2IEE A;  5J16 A;  4LQ5 A;  2F78 A;  4UA8 A;  5ITO A;  3V83 A;  4JB7 A;  1TT1 A;  2GHB A;  1FQA A;  2HEU A;  2XXT A;  3C34 A;  1B5J A;  5ISU A;  4WED A;  5EHM A;  1FTL A;  4ECF A;  3EHS A;  5I84 A;  1N76 A;  1DSN A;  3B7D A;  4Q5T A;  1PB7 A;  4KYE A;  4JBZ A;  2IA4 A;  2KR0 A;  4O8M A;  4F29 A;  5AA2 B;  3SEU A;  4F3S A;  1IME A;  4H8I A;  3IFC A;  1CNQ A;  4NWC A;  1M5C A;  1UIU A;  4AB6 A;  3EQ1 A;  1ZIU A;  2H5Y A;  4NWD A;  1JP4 A;  4G61 A;  4HXV A;  4U1O A;  2CEX A;  1EU8 A;  4PFB A;  2V84 A;  4U4S A;  1NUW A;  5LDZ A;  1MM6 A;  3B6T A;  4BDO A;  3CR9 A;  3KJT A;  1MXZ A;  4Q8R A;  1B5I A;  3LBS A;  1NFT A;  4HS7 A;  3FJG A;  1M5D A;  1LBB A;  4BDQ A;  1PEB A;  2V3T A;  2PFZ A;  2ZYN A;  1PB8 A;  5KDT A;  4N6P A;  1NKX A;  4YKP A;  2Y5K A;  3G7W A;  1PB9 A;  1PBP A;  2HPG A;  4ZDM A;  3K2D A;  3IOR A;  4BDR A;  3S2V A;  1QJM A;  2DS9 A;  4XKP A;  2E0S A;  4F19 A;  4EQ9 A;  1NNT A;  2HHM A;  3SEV A;  1D3K A;  4F39 A;  3G3H A;  3GBB A;  2DE4 A;  1Z7N E;  1FPF A;  3TCG A;  3MZ9 A;  4XKN A;  4MEV A;  3TOD A;  1O64 A;  1NV5 A;  4ONY A;  1FRP A;  3O97 A;  3VLW A;  4RJZ A;  4N81 A;  4DLD A;  4NG7 A;  4AQ4 A;  1P1N A;  2CZI A;  3RT6 B;  4RK2 A;  3V5A A;  4O7M A;  1EYK A;  3KOS A;  4IO2 A;  2ZZX A;  4X04 A;  4FEC A;  2F7B A;  1B58 A;  3UN6 A;  1K9Z A;  1YXI A;  4LAT A;  2XX8 A;  5TPA B;  3TZA A;  4ESW A;  4I3E A;  3IJO B;  4ZZA A;  4Q0C A;  4ZEF A;  1OQG A;  2Q8M A;  3MQ9 A;  3C32 A;  1DK4 A;  4I40 A;  4OEU A;  4NF5 B;  2V93 A;  4O3A A;  3S9E A;  1LFH A;  1MDQ A;  3IOU A;  4H5G A;  3MST A;  2F8D A;  1FTK A;  1URD A;  4OQO A;  3BBR A;  3Q28 A;  2B65 A;  1MH3 A;  4DZ1 A;  1QUK A;  4G4P A;  3G3F A;  4N8G A;  4I9D A;  4LUB A;  2P3V A;  5TP9 A;  3KN3 A;  5CRY A;  1JVY A;  1N3W A;  2FA7 A;  2ONS A;  1MY1 A;  4OEN A;  2XXR A;  3UP9 A;  4OVT A;  4PF6 A;  5IM2 A;  2DXY A;  4YIC A;  3K1M A;  3H03 A;  3SEX A;  1B40 A;  2ZYK A;  5HM4 B;  3DP6 A;  4MF3 A;  5FHM A;  4UAB A;  2Y7K A;  3AXF A;  4FBP A;  4GWU A;  3IFA A;  2DOJ A;  4GOT A;  1B3G A;  4H8J A;  3CI8 A;  3RPW A;  2NOO A;  3CFL A;  2WYK A;  1Y4C A;  4OFL A;  1MXV A;  4MMP A;  5ITP A;  1MXU A;  4TOZ A;  2ZYO A;  1XC1 A;  4Z0I A;  4TQU Q;  1MS7 A;  2HXR A;  3H4Z A;  4NF8 B;  2RCA A;  1H3D A;  3TPA A;  4KQP A;  1LAH E;  1MQD A;  4DE8 A;  1R9Q A;  4EDP A;  2Q9T A;  3FD3 A;  4PAI A;  4KD5 A;  4OER A;  1ZJL A;  3UIF A;  4LON B;  3EPE A;  2XD2 A;  1TFD A;  4FEB A;  2QS4 A;  3VFJ A;  4H6D A;  4O3B A;  3IB1 A;  1JQF A;  3KEI A;  4XF5 A;  3TTM A;  1XT8 A;  2XXK A;  3PU5 A;  1FBP A;  1FPJ A;  1B3F A;  1MY0 A;  4XXU A;  3PPR A;  4PFU A;  1B6H A;  4LN5 A;  1LCF A;  1NH8 A;  3TQW A;  1RYO A;  4OES A;  2GH9 A;  5I56 B;  4OVJ A;  4P0G A;  2VOZ A;  4MNC A;  3RY3 A;  3EN3 A;  1NV2 A;  1QW0 A;  2KLF A;  2OZZ A;  3O6G A;  2R8T A;  5IZ3 A;  4P47 A;  1SDX A;  4BLA A;  3MAM A;  5EQ9 A;  1N04 A;  4F18 A;  5I2K B;  1MPC A;  4QF9 A;  3QK6 A;  4PAF A;  1LB9 A;  4KYD A;  4GFR A;  1Y3Q A;  1S9T A;  1WOD A;  3VLU A;  1NH7 A;  4RA1 A;  1H44 A;  4JVC A;  1DPE A;  3U65 A;  5K2Y A;  1JEV A;  4KR5 A;  1QUI A;  3MPK A;  4XKR A;  1B2H A;  4JDF A;  3TYH A;  1NNF A;  1OQH A;  3MP1 A;  4LZ5 A;  4ESX A;  5L8D A;  4JWO A;  3KSJ A;  4F1Y A;  3T9X B;  1AMF A;  4LA9 A;  5AA2 A;  4U4X A;  3ZKL A;  2Q8J A;  3MC2 A;  2OCU A;  3JYR A;  2Z8E A;  1GR2 A;  5DYH A;  1ZLQ A;  2QS1 A;  1LAF E;  4YMA A;  1Z7M E;  1B3H A;  3SDF A;  1BIY A;  2HQ0 A;  3PGF A;  1IXG A;  1EH3 A;  4KHZ E;  5I57 B;  4KFQ A;  5ESY A;  3FBP A;  3S4U A;  2L5V A;  2V4C A;  1M5F A;  1KWH A;  1DTZ A;  3PPQ A;  4MLV A;  3IK6 B;  5KZT A;  4QBA A;  1P1Q A;  1US4 A;  4PE5 B;  1RKM A;  3HST A;  4U1Z A;  1B3E A;  3PV0 E;  1DBZ A;  1B52 A;  5A5X B;  2X7Q A;  3PUZ E;  4JVD A;  3SEY A;  1B5H A;  4GBW A;  1XHY A;  3V89 B;  2W7Y A;  1P1O A;  2F34 A;  4YAH X;  4GX6 A;  4OWD A;  1LBX A;  4IY6 A;  4NMY A;  4N8Y A;  2WEF A;  5FTH A;  4DXC A;  1FQB A;  5BUU A;  3ILT B;  3W9W A;  1EYJ A;  4OVQ A;  1N7W A;  1MG1 A;  1LBC A;  1IMA A;  3MZB A;  3TUS A;  1URG A;  3JV9 A;  1GTK A;  3UOR A;  1AWB A;  1LBY A;  4GWZ A;  3GYY A;  2UVH A;  4GWS A;  4ELR A;  1H43 A;  2PYY A;  4P9K A;  2I3W A;  4U2R A;  1IMC A;  1R1N A;  1RYX A;  3O6H A;  3SER A;  4AB5 A;  4GWY A;  5DVJ A;  4FOR A;  4F1V A;  2HXW A;  3QYT A;  1FPB A;  1OLA A;  2GFE A;  4RYA A;  2NXO A;  3SEW A;  4KI0 E;  3CG3 A;  4JVI A;  2O7I A;  3MJN A;  2ZYM A;  3D4G A;  1FTA A;  4POX A;  3B6W A;  3USD A;  4QFL A;  3C4M A;  2G93 A;  4P1L A;  1FPK A;  1AH5 A;  1FBC A;  1MQG A;  2X7P A;  3PUX E;  4DCX A;  1MPD A;  5CBR A;  1SQY A;  4H67 A;  2P3N A;  3M8U A;  1CB6 A;  3SES A;  4N15 A;  2RIN A;  1LBW A;  4KXP A;  5IZ3 B;  2I48 A;  1Q9D A;  1MXY A;  2Q2A A;  1FBE A;  2HZK A;  2RC8 A;  3H6W A;  1OVB A;  5I58 A;  5IZZ A;  4O3C A;  3OEN A;  2F6G A;  4PQJ A;  1USY H;  4YKK A;  3D4C A;  3G3G A;  1MRP A;  2ANJ A;  1DPP A;  3TCH A;  3ZKK A;  5H8S A;  1SW4 A;  2PT2 A;  4LZ7 A;  4OXV A;  4U21 A;  4MBP A;  2GHA A;  3K01 A;  3RTF B;  4IO6 A;  1NNP A;  3LSX A;  5ELV A;  1ZU0 A;  1L5T A;  1NNK A;  4PC9 A;  5H8N B;  3KBR A;  3HV1 A;  1I6B A;  3C36 A;  2DWI A;  4NF8 A;  4EXK A;  5ICQ A;  3U1O A;  2RC9 A;  4PF8 A;  3TCF A;  4NN3 A;  4ZEC A;  5CI5 A;  2I49 A;  1UTH A;  3U93 A;  1KA1 A;  2CEY A;  3LR1 A;  1R6Z A;  3CRB A;  3D1R A;  3LSF B;  4NE4 A;  2PCR A;  4FJP A;  5H8H B;  2ONR A;  2XXU A;  4P8B A;  2I6E A;  3NOH A;  1NMU A;  3TAJ A;  3PUV E;  2F3B A;  3H7M A;  3CVG A;  4QFP A;  3C35 A;  3TEP A;  3THI A;  2O1M A;  2DDK A;  1QVS A;  4MFI A;  1MY4 A;  4GLI A;  4ZED A;  4LZ8 A;  4LQ2 A;  2VHA A;  1AOV A;  5I56 A;  3L6G A;  4P56 A;  3ECR A;  3E13 X;  4N6K A;  1NV0 A;  4NTL A;  2P1S A;  2H4I A;  4GF8 A;  2ZNT A;  3FZV A;  3CFZ A;  3E9X A;  2ZMB A;  2NVU B;  4OMB A;  4QXD A;  1N84 A;  3GLB A;  5I2K A;  3HHG A;  1DCU A;  1YCJ A;  3VE1 B;  1A7L A;  3H3G A;  5LTC A;  5M2V A;  4R2B A;  3HO7 A;  1LEV A;  4WKM A;  3ONM A;  2DQV A;  4DI3 D;  4XTC Q;  3FXR A;  5I7I A;  2JJK A;  1LAG E;  3HPI A;  1FBF A;  4RNS A;  5EQA A;  2ZZV A;  3H6V A;  3FVO A;  1B7H A;  3RNN A;  3I6V A;  1I69 A;  3LC8 A;  2F7A A;  4O94 A;  4GRK A;  3OEK A;  1P99 A;  3BIH A;  1Y20 A;  1VR5 A;  3K6W A;  2Y84 A;  2DVZ A;  5TU0 A;  4HW8 A;  1VFD A;  3KGC A;  4ZS9 A;  5ICT A;  4E0W A;  4KYS A;  2Y7W A;  1ANF A;  3G3I A;  5I57 A;  1PBQ A;  1IXC A;  4X1D A;  1FBD A;  1D9V A;  1LB8 A;  4WEP A;  4YMB A;  1ZBM A;  2F5X A;  3IO4 A;  4YU0 A;  4G68 B;  3W15 C;  3QUF A;  3LSL A;  4GWX A;  3FVG A;  4PAK A;  4MLQ A;  4FAJ A;  3EHU A;  3S9L C;  1BLF A;  1FSA A;  3IB2 A;  1DTG A;  3TTN A;  1VFE A;  3KG2 A;  1DMB A;  2VT5 A;  2YLN A;  3OSR A;  1XVY A;  2UVI A;  4G8M A;  4R72 A;  4TLL B;  4F1U A;  3IOV A;  4RPN A; 
#chains in the Genus database with same CATH homology
 1UQW A;  2A5T A;  5AE4 A;  5A5X A;  2RF1 A;  3S9M C;  3ODB A;  3EHT A;  4PET A;  2FNC A;  5IAI A;  5I58 B;  1ATG A;  2OWT A;  2V25 A;  1M5E A;  2HCA A;  1A40 A;  1B7Z A;  4YB6 A;  4QFN A;  1XOC A;  2RKM A;  5CC2 A;  1H76 A;  4YKJ A;  4G8H A;  1MQH A;  2RCB A;  2HFB A;  3KOT A;  3I5O A;  4G8N A;  4OFO A;  4MH5 A;  2A5S A;  2Q2C A;  5BWJ A;  3Q25 A;  1UTH B;  2QS3 A;  2O51 A;  3C9H A;  2P0S A;  4R74 A;  1VSO A;  2B3B A;  3GXA A;  3H6U A;  3U8Q A;  3VV5 A;  5FHO A;  2XX9 A;  4M4G A;  1MXX A;  3QSL A;  2I0C A;  2XXQ A;  4F22 A;  1A55 A;  2QL3 A;  2VGQ A;  1GVC A;  5IKB A;  3CIJ A;  3U72 A;  2ZNS A;  1LFG A;  3T96 B;  1URS A;  3MVZ A;  3T93 B;  1N3X A;  4EXL A;  2F35 A;  3WAE A;  1TFA A;  4JSO A;  3DEL B;  3O2A A;  2D21 A;  1YAE A;  4PFY A;  3N6U A;  4I8C A;  4QSD A;  3PMV A;  4F3G A;  1Y1Z A;  2QSX A;  2O68 A;  3IAZ A;  1SD3 A;  3FAT A;  3VLV A;  1PDA A;  4ZE9 A;  3FV2 A;  1EZO A;  4Z7E A;  3CSG A;  4NF6 A;  2PT1 A;  3EF7 A;  4F2Q A;  3N26 A;  4IO5 A;  2AL4 A;  2F36 A;  1A8E A;  5EHS A;  2X26 A;  3FUZ A;  1IQ7 A;  4P11 A;  5JTY B;  3MVY A;  1UTB B;  3PD8 A;  3OO8 A;  3N5L A;  2ESN A;  5H8N A;  2VD2 A;  1SW1 A;  2H98 A;  4R6Y A;  5HBC A;  4FED A;  4U23 A;  3TTL A;  3T22 A;  2QPQ A;  3K6X A;  3PPP A;  4G77 A;  4OFJ A;  5CMM A;  1BKA A;  5H8H A;  4JWX A;  1O63 A;  3H06 B;  4RY1 A;  3MVW A;  5L9O A;  2AIX A;  3LSW A;  5FTI A;  5B70 A;  4OYV A;  2QS2 A;  2DSF A;  4GVO A;  1MPB A;  2OWS A;  5DTB A;  4C0R A;  4JXI A;  3FIR A;  3RUM A;  1IZ1 A;  2A5T B;  4NED A;  3UGW A;  4OEV A;  2Z8D A;  4YZZ A;  1QKA A;  1IXH A;  4P0I A;  3IB0 A;  3T66 A;  2PMS A;  5L9M A;  3O28 A;  2NWJ A;  1Y3P A;  1OLC A;  5CMC A;  2ZXT A;  2O7U A;  3BFU A;  4UAC A;  1FQC A;  3OD7 A;  3FXQ A;  4ISU A;  1I6A A;  1JVX A;  4F3B A;  3K02 A;  2O84 X;  4N07 A;  3TTR A;  1IEJ A;  4YB7 A;  3R26 A;  2DVC A;  3KN8 A;  2XHD A;  5DT6 A;  1DOT A;  1A99 A;  4DXB A;  3T9U A;  1CE2 A;  1I6Q A;  1SW2 A;  4K3F A;  2V3Q A;  3OEL A;  5CBS A;  5FHN A;  3M3F A;  4G68 A;  2RC7 A;  2ZNU A;  4OET A;  3PUW E;  2DWA A;  4ZEI A;  1XVX A;  3A3U A;  2E1S A;  3UA8 A;  2DYX A;  2AYS A;  3UK4 A;  2XXY A;  3FJM A;  4HCY A;  1MH4 A;  3F11 A;  2UXA A;  3Q27 A;  3FGS A;  1QUL A;  1O7T A;  2UVG A;  1JNF A;  2QMW A;  3WAF A;  1UIV A;  4JSD A;  4GL0 A;  4NF6 B;  3DP8 A;  4H1X A;  1Q1K A;  1B7U A;  2H9B A;  3E4R A;  5I2N A;  4F3P A;  1FTO A;  5CMB A;  4DIG A;  3MZ1 A;  1P1U A;  3U92 A;  3MPL A;  3VXC A;  2UYE A;  2PVU A;  2LAO A;  4U22 A;  1MM7 A;  2DXR A;  4RPO A;  2Z23 A;  4X48 A;  1MDP 1;  3GBA A;  1EZP A;  4R2F A;  1B05 A;  3KN7 A;  4TLM B;  3K00 A;  3RLF E;  3K1P A;  1FQD A;  2ABH A;  2CMO A;  2D3I A;  2F7C A;  4M1V A;  3I3V A;  1JET A;  4ZEK A;  1ZTY A;  1B32 A;  3R7X A;  3Q26 A;  2HAV A;  1B0L A;  4GQO A;  1Y1M A;  5B7D A;  4KCD A;  1TXF A;  3RT8 A;  1HSE A;  3TQL A;  3S9N C;  2AL5 A;  1B4Z A;  1NL5 A;  3PMW A;  4ELO A;  4FIM A;  4RK9 A;  3OO9 A;  1USY E;  3RGY A;  1LFI A;  3KZG A;  2Z22 A;  1B0H A;  4DDD A;  1IIW A;  4R6K A;  3TFL A;  3ZS6 A;  2B3F A;  4C1U A;  4ZZE A;  1A8F A;  1YTV A;  2H99 A;  1JW4 A;  3K6U A;  4OTE A;  2O6A A;  5K2X A;  1TWY A;  4DCY A;  1IXI A;  3L6H A;  2YJP A;  4GXS B;  2QRY A;  3QAX A;  2FYI A;  3IJX B;  5I59 A;  4GL8 A;  3RQT A;  1B51 A;  3M3L A;  4GIZ A;  2BJJ X;  5JTY A;  1UTB A;  1EZ9 A;  2Q89 A;  2R71 A;  2UYF A;  3KFM A;  3CFX A;  1N7X A;  3MBP A;  5JEI A;  2PX1 A;  2F6P A;  2G29 A;  1SI0 A;  3Q29 A;  5AA4 B;  2OBG A;  3DP4 A;  4PFT A;  4QFO A;  2I3V A;  3MP8 A;  4IO4 A;  1B4H A;  1LLS A;  4R73 A;  1OIB A;  3O29 A;  3MWB A;  3A09 A;  5H8Q B;  3C31 A;  1MY2 A;  1SBP A;  4YB5 A;  4G2Z A;  3OO7 A;  1YPN A;  5AA1 A;  2PBW A;  1A54 A;  1JW5 A;  5DEX B;  3PPN A;  4R9F A;  1SVX B;  3PD9 A;  3TTK A;  2QMX A;  1FQE A;  4OHN A;  3A3C A;  3PPO A;  4EUO A;  3SET A;  2THI A;  3T9H B;  2HAU A;  3IO6 A;  4H5F A;  1S7Y A;  5JK4 A;  4HTG A;  3HHF A;  3TMG A;  4THI A;  5J1D A;  2M8C A;  4NF4 A;  5CM6 A;  3TDJ A;  3OMB A;  4Q30 B;  1WDN A;  2REG A;  5I2N B;  2Z8F A;  1SI1 A;  1ELJ A;  2I4C A;  3B6Q A;  4YKI A;  5H8F A;  1FTM A;  2O69 A;  3FAS A;  4GD5 A;  4GXA A;  3SKP A;  3G3J A;  5KCJ A;  1SW5 A;  2ALU A;  4IO3 A;  4PP0 A;  5F7V A;  1QUJ A;  4LVQ A;  2UVJ A;  3ZSF A;  3TKD A;  4F31 B;  1OMP A;  1B46 A;  4F2O A;  2XXI A;  1GV8 A;  3FJ7 A;  4ND9 A;  3MVX A;  4DXU A;  1XS5 A;  3DLN A;  2NUV A;  1D4N A;  2WKY A;  4E0X A;  4IO7 A;  3LUY A;  3GZG A;  1FW0 A;  2YPN A;  3RN8 A;  1AL3 A;  3R6U A;  3FVN A;  3FVK A;  4R75 A;  3C33 A;  4RXL A;  3PUY E;  3HN0 A;  3QXM A;  1FCK A;  3DM0 A;  1LAX A;  3VVE A;  3PMX A;  4IY5 A;  1MQI A;  4GWO A;  4QHQ A;  3MUQ A;  5KDT B;  1FTJ A;  4H0W A;  2XX7 A;  4OZ9 A;  3O66 A;  4X1B A;  3N94 A;  2QJE A;  1ZMG A;  4EQ7 A;  2VD3 A;  1BTJ A;  1QKB A;  1SYH A;  5LOM A;  1II5 A;  5I59 B;  3G3K A;  1P1W A;  3OSQ A;  2HZL A;  3W9V A;  1LST A;  3O9P A;  3JZJ A;  3KSX A;  1Y3N A;  3VXB A;  4I1D A;  1MY3 A;  3BFT A;  2H25 A;  3QUJ A;  4QSC A;  2I58 A;  4HCW A;  1Y9U A;  2R6G E;  1GGG A;  2P2A A;  2REJ A;  1ZKB A;  3P7I A;  4PFW A;  4EQB A;  2XXV A;  3MP6 A;  2XXX A;  3N6T A;  4FE8 A;  4LP2 B;  1S50 A;  5DVF A;  4ZE8 A;  3IL1 B;  2Y7R A;  1POT A;  3K0V A;  3IX1 A;  3MW0 A;  2DE2 A;  1LCT A;  1WVJ A;  3CG1 A;  2I4B A;  1N0T A;  2OJT A;  1SYI A;  3K6V A;  3T9V A;  2OLB A;  2DWJ A;  3KJ7 A;  3OXN A;  3VVF A;  4EF2 A;  1HSL A;  4BDM A;  2GRV A;  1MXW A;  4N13 A;  5F1Q A;  1R9L A;  1B3L A;  3K4U A;  2XXW A;  1POY 1;  1Y4T A;  5TP9 B;  4BDL A;  2D5W A;  3H6T A;  4NF4 B;  5L9S A;  4R6H A;  1Q35 A;  1F9B A;  1H45 A;  3FXU A;  4I62 A;  4WXJ A;  3IOT A;  1MQJ A;  1AIV A;  3OEM A;  3OO6 A;  5DVI A;  3VDF A;  5H8F B;  4BDN A;  1LGB C;  1B1H A;  5KCJ B;  1M5B A;  2XXH A;  1FQF A;  2Y7I A;  5AA4 A;  2CZL A;  2VP1 A;  2R9J A;  5CMK A;  4XKQ A;  2O1L A;  3K1N A;  3U94 A;  2ONK E;  4ZEB A;  4C1T A;  4L17 A;  1T0K A;  4EF1 A;  4ELP A;  4QRZ A;  4KCC A;  4IGT A;  3FV1 A;  4POW A;  1D9Y A;  3V8X B;  4G68 C;  2V3U A;  2I0B A;  5AA2 D;  3QIM A;  3E3K A;  1J1N A;  1OVT A;  5H8Q A;  5TPA A;  2F97 A;  3M3K A;  1JEU A;  4ELQ A;  2DWH A;  3HCQ A;  2DE3 A;  2XXP A;  3VVD A;  2XD3 A;  1IUD A;  1JW1 A;  3CSB A;  4JWY A;  1HSJ A;  4NF5 A;  4R9G A;  2DP8 A;  4IGR A;  4QSE A;  3OOA A;  1B9J A;  3ILU B;  5DEX A;  3IR1 A;  4IB2 A;  2OK2 A;  4KPT A;  5HPQ A;  5AA3 A;  4H65 A;  4QFK A;  1B1X A;  2Q88 A;  3IOW A;  4FAT A;  4XIG Q;  5EYF A;  2Y7P A;  4X9T A;  1VE4 A;  3TEL A;  3RTW B;  1US5 A;  3O6I A;  3BKI B;  1BP5 A;  1PC3 A;  1IIT A;  2IEE A;  4LQ5 A;  2F78 A;  4UA8 A;  5ITO A;  3V83 A;  4JB7 A;  1TT1 A;  2GHB A;  1FQA A;  2HEU A;  2XXT A;  3C34 A;  1B5J A;  5ISU A;  4WED A;  5EHM A;  1FTL A;  4ECF A;  3EHS A;  5I84 A;  1N76 A;  1DSN A;  3B7D A;  4Q5T A;  1PB7 A;  4KYE A;  4JBZ A;  2IA4 A;  4F29 A;  5AA2 B;  3SEU A;  4F3S A;  4H8I A;  4NWC A;  1M5C A;  1UIU A;  4AB6 A;  3EQ1 A;  1ZIU A;  2H5Y A;  4NWD A;  4U1O A;  1EU8 A;  2V84 A;  4U4S A;  1MM6 A;  3B6T A;  4BDO A;  3CR9 A;  3KJT A;  1MXZ A;  4Q8R A;  1B5I A;  3LBS A;  1NFT A;  4HS7 A;  3FJG A;  1M5D A;  1LBB A;  4BDQ A;  1PEB A;  2V3T A;  2ZYN A;  1PB8 A;  5KDT A;  4N6P A;  1NKX A;  4YKP A;  3G7W A;  1PB9 A;  1PBP A;  4ZDM A;  3K2D A;  3IOR A;  4BDR A;  3S2V A;  1QJM A;  2DS9 A;  4XKP A;  2E0S A;  4F19 A;  4EQ9 A;  1NNT A;  3SEV A;  1D3K A;  4F39 A;  3G3H A;  3GBB A;  2DE4 A;  1Z7N E;  3TCG A;  3MZ9 A;  4XKN A;  3TOD A;  1O64 A;  4ONY A;  3O97 A;  3VLW A;  4RJZ A;  4DLD A;  4AQ4 A;  1P1N A;  3RT6 B;  4RK2 A;  3V5A A;  3KOS A;  4IO2 A;  4FEC A;  2F7B A;  1B58 A;  3UN6 A;  4LAT A;  2XX8 A;  5TPA B;  3TZA A;  4ESW A;  3IJO B;  4ZZA A;  4Q0C A;  4ZEF A;  1OQG A;  3MQ9 A;  3C32 A;  4OEU A;  4NF5 B;  2V93 A;  4O3A A;  3S9E A;  1LFH A;  1MDQ A;  3IOU A;  4H5G A;  2F8D A;  1FTK A;  1URD A;  4OQO A;  3BBR A;  3Q28 A;  2B65 A;  1MH3 A;  4DZ1 A;  1QUK A;  4G4P A;  3G3F A;  4I9D A;  4LUB A;  5TP9 A;  3KN3 A;  5CRY A;  1JVY A;  1N3W A;  2FA7 A;  2ONS A;  1MY1 A;  4OEN A;  2XXR A;  3UP9 A;  2DXY A;  4YIC A;  3K1M A;  3H03 A;  3SEX A;  1B40 A;  2ZYK A;  5HM4 B;  3DP6 A;  4MF3 A;  5FHM A;  2Y7K A;  3AXF A;  2DOJ A;  4GOT A;  1B3G A;  4H8J A;  3CI8 A;  3RPW A;  2NOO A;  3CFL A;  1Y4C A;  4OFL A;  1MXV A;  5ITP A;  1MXU A;  4TOZ A;  2ZYO A;  1XC1 A;  4Z0I A;  4TQU Q;  1MS7 A;  3H4Z A;  4NF8 B;  2RCA A;  1H3D A;  3TPA A;  4KQP A;  1LAH E;  1MQD A;  4DE8 A;  1R9Q A;  4EDP A;  2Q9T A;  3FD3 A;  4KD5 A;  4OER A;  1ZJL A;  3UIF A;  4LON B;  3EPE A;  2XD2 A;  1TFD A;  4FEB A;  2QS4 A;  3VFJ A;  4H6D A;  4O3B A;  3IB1 A;  1JQF A;  3KEI A;  3TTM A;  1XT8 A;  3PU5 A;  4XXU A;  1B3F A;  1MY0 A;  3PPR A;  4PFU A;  1B6H A;  1LCF A;  1NH8 A;  3TQW A;  1RYO A;  4OES A;  2GH9 A;  5I56 B;  4OVJ A;  4P0G A;  2VOZ A;  3RY3 A;  3EN3 A;  1QW0 A;  2KLF A;  2OZZ A;  3O6G A;  4BLA A;  1SDX A;  3MAM A;  1N04 A;  4F18 A;  5I2K B;  1MPC A;  4QF9 A;  3QK6 A;  1LB9 A;  4KYD A;  4GFR A;  1Y3Q A;  1S9T A;  1WOD A;  3VLU A;  1NH7 A;  4RA1 A;  1H44 A;  1DPE A;  5K2Y A;  1JEV A;  4KR5 A;  1QUI A;  3MPK A;  4XKR A;  1B2H A;  4JDF A;  3TYH A;  1NNF A;  1OQH A;  3MP1 A;  4LZ5 A;  4ESX A;  5L8D A;  4JWO A;  3KSJ A;  4F1Y A;  3T9X B;  1AMF A;  4LA9 A;  5AA2 A;  4U4X A;  3ZKL A;  2Q8J A;  3MC2 A;  2OCU A;  3JYR A;  2Z8E A;  1GR2 A;  5DYH A;  1ZLQ A;  2QS1 A;  1LAF E;  4YMA A;  1Z7M E;  1B3H A;  3SDF A;  1BIY A;  2HQ0 A;  3PGF A;  1IXG A;  1EH3 A;  4KHZ E;  5I57 B;  4KFQ A;  3S4U A;  1M5F A;  1KWH A;  1DTZ A;  3PPQ A;  4MLV A;  3IK6 B;  5KZT A;  1P1Q A;  1US4 A;  4PE5 B;  1RKM A;  3HST A;  4U1Z A;  1B3E A;  3PV0 E;  1B52 A;  5A5X B;  2X7Q A;  3PUZ E;  3SEY A;  1B5H A;  1XHY A;  3V89 B;  2W7Y A;  1P1O A;  2F34 A;  4YAH X;  4OWD A;  4IY6 A;  4NMY A;  5FTH A;  4DXC A;  1FQB A;  5BUU A;  3ILT B;  3W9W A;  1N7W A;  1MG1 A;  1LBC A;  3MZB A;  3TUS A;  1URG A;  3JV9 A;  1GTK A;  3UOR A;  2UVH A;  4ELR A;  1H43 A;  2PYY A;  2I3W A;  4U2R A;  1R1N A;  1RYX A;  3O6H A;  3SER A;  4AB5 A;  5DVJ A;  4FOR A;  4F1V A;  2HXW A;  3QYT A;  1OLA A;  2GFE A;  4RYA A;  2NXO A;  3SEW A;  4KI0 E;  3CG3 A;  2O7I A;  3MJN A;  2ZYM A;  3D4G A;  4POX A;  3B6W A;  3USD A;  4QFL A;  3C4M A;  2G93 A;  1AH5 A;  1MQG A;  2X7P A;  3PUX E;  4DCX A;  1MPD A;  5CBR A;  1SQY A;  4H67 A;  3M8U A;  1CB6 A;  3SES A;  2RIN A;  2I48 A;  1MXY A;  2Q2A A;  2HZK A;  2RC8 A;  3H6W A;  1OVB A;  5I58 A;  4O3C A;  3OEN A;  2F6G A;  4PQJ A;  1USY H;  4YKK A;  3D4C A;  3G3G A;  1MRP A;  2ANJ A;  1DPP A;  3TCH A;  3ZKK A;  5H8S A;  1SW4 A;  2PT2 A;  4LZ7 A;  4OXV A;  4U21 A;  4MBP A;  2GHA A;  3K01 A;  3RTF B;  4IO6 A;  1NNP A;  3LSX A;  5ELV A;  1ZU0 A;  1L5T A;  1NNK A;  5H8N B;  3KBR A;  3HV1 A;  1I6B A;  3C36 A;  2DWI A;  4NF8 A;  4EXK A;  5ICQ A;  3U1O A;  2RC9 A;  3TCF A;  4ZEC A;  5CI5 A;  2I49 A;  1UTH A;  3U93 A;  3LR1 A;  1R6Z A;  3CRB A;  3LSF B;  4NE4 A;  4FJP A;  5H8H B;  2ONR A;  2XXU A;  2I6E A;  1NMU A;  3TAJ A;  3PUV E;  3H7M A;  3CVG A;  4QFP A;  3C35 A;  3TEP A;  3THI A;  2O1M A;  1QVS A;  4MFI A;  1MY4 A;  4GLI A;  4ZED A;  4LZ8 A;  4LQ2 A;  2VHA A;  1AOV A;  5I56 A;  3L6G A;  3ECR A;  3E13 X;  4NTL A;  2P1S A;  2H4I A;  4GF8 A;  2ZNT A;  3FZV A;  3CFZ A;  3E9X A;  2ZMB A;  2NVU B;  4OMB A;  1N84 A;  3GLB A;  5I2K A;  3HHG A;  1YCJ A;  3VE1 B;  1A7L A;  3H3G A;  5M2V A;  4R2B A;  3HO7 A;  4WKM A;  3ONM A;  2DQV A;  4XTC Q;  3FXR A;  1LAG E;  3HPI A;  4RNS A;  3H6V A;  3FVO A;  1B7H A;  3RNN A;  3I6V A;  1I69 A;  3LC8 A;  2F7A A;  4GRK A;  3OEK A;  1P99 A;  1Y20 A;  1VR5 A;  3K6W A;  2Y84 A;  2DVZ A;  5TU0 A;  4HW8 A;  1VFD A;  3KGC A;  4ZS9 A;  5ICT A;  4E0W A;  4KYS A;  2Y7W A;  1ANF A;  3G3I A;  5I57 A;  1PBQ A;  1IXC A;  4X1D A;  1D9V A;  1LB8 A;  4WEP A;  4YMB A;  1ZBM A;  2F5X A;  3IO4 A;  4YU0 A;  4G68 B;  3W15 C;  3QUF A;  3LSL A;  3FVG A;  4MLQ A;  4FAJ A;  3EHU A;  3S9L C;  1BLF A;  3IB2 A;  1DTG A;  3TTN A;  1VFE A;  3KG2 A;  1DMB A;  2YLN A;  3OSR A;  1XVY A;  2UVI A;  4G8M A;  4R72 A;  4TLL B;  4F1U A;  3IOV A;  4RPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...