4FEDA

Crystal structure of htt36q3h
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
401
structure length
401
Chain Sequence
b'KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQQHQHQHQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein,Huntingtin
publication title Beta conformation of polyglutamine track revealed by a crystal structure of Huntingtin N-terminal region with insertion of three histidine residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 116
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fedA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fedA02
1PC3A 1SVXB 4EXKA 3VV5A 3MQ9A 3C33A 5H8QA 1XC1A 3FVOA 3PUWE 1FTJA 1QVSA 1QULA 4H8JA 4FORA 1LAFE 1UTBA 2REJA 3W15C 3HV1A 3MP8A 1UQWA 3C36A 3S9MC 1EU8A 1Y20A 1DTGA 2XXYA 4EDPA 5I2KB 1B32A 3PD9A 1JW4A 4LQ2A 1N84A 1R1NA 1IXCA 4EF2A 2R71A 4F39A 2B65A 3SEVA 2QJEA 4POXA 3JYRA 5IKBA 3PMWA 4RA1A 2NXOA 1XHYA 3K6UA 1N04A 2NWJA 1B4HA 1B3EA 2H25A 1PBPA 3DELB 2OWSA 2P1SA 1IIWA 4NF8A 4X1BA 4DLDA 2RC7A 2F36A 4ECFA 2XX9A 1B7HA 1SYIA 3PPPA 1NFTA 4OMBA 4JXIA 5ITPA 4DCXA 2O7UA 4KFQA 4G68B 1VFDA 1MQGA 4KQPA 4DXBA 4DCYA 1FTLA 5I2KA 1SW4A 4XIGQ 5CMMA 1P99A 3SESA 2HZKA 5LOMA 3FVGA 4YICA 2VOZA 1SW5A 4YU0A 4H0WA 4NTLA 2OZZA 3ZKLA 2H9BA 1S9TA 1I6QA 3KSXA 3MJNA 1QKAA 2DP8A 4Q0CA 3UK4A 4HCWA 2Y7RA 1BTJA 4R73A 3TDJA 1Q35A 4KYSA 2F7BA 3FVNA 4N6PA 3P7IA 3UN6A 3UIFA 3RT6B 3IO4A 3G3FA 4F3GA 4G68A 4RK9A 4ND9A 4YMBA 1NMUA 2O84X 1FTOA 3CG3A 5L9SA 3BFUA 4LZ7A 4F31B 2VD2A 2CMOA 3H7MA 2PMSA 4OETA 4TLLB 2A5TB 4OENA 2I4CA 1HSEA 1IEJA 5CBSA 4L17A 3S9NC 5ELVA 5CMCA 3T96B 3OXNA 4U4XA 5EHMA 1IITA 4Q5TA 5L9OA 2XXWA 4QFNA 2XXIA 3CVGA 3T93B 4RPOA 3OO8A 2I0BA 3IJOB 1IXIA 4R6HA 4P11A 4O3AA 3R7XA 4M4GA 1B40A 2F6GA 1DPEA 5H8NB 2ZNSA 3T9XB 1B51A 4EQ9A 1B3HA 1LFHA 1MXWA 4ESWA 2XXXA 3SETA 1GV8A 1AL3A 3CFLA 4R6KA 5FHNA 4KCCA 2OJTA 3G3GA 2A5TA 4JB7A 3EHUA 4R75A 1SBPA 1MY1A 4ZEDA 1MQJA 3BKIB 2F78A 1B3GA 3IB2A 1Y1ZA 1MQDA 4YZZA 5TU0A 3PPNA 3MZBA 1MPDA 2I49A 3CFZA 3G3IA 4QSDA 4R72A 4OFOA 3QK6A 5K2XA 2FA7A 2PVUA 3C9HA 5H8NA 1FQCA 1MPCA 1FQAA 1WODA 4U1OA 2LAOA 4MFIA 1QW0A 3EN3A 2RC9A 3PPQA 5I2NA 4HS7A 4NF4B 3HSTA 3O97A 3VVEA 1LFGA 4XKQA 2XX8A 3LC8A 3UGWA 1A54A 5CMBA 2F35A 1FQBA 2OLBA 4NWDA 1B0HA 1WVJA 5DVJA 4ZZEA 1Y3NA 3Q29A 3OOAA 3B6WA 3QYTA 2REGA 4JSOA 4H5FA 3PMXA 4ZS9A 2Z22A 2PT1A 3KEIA 2V3QA 4ZEKA 4F18A 4RYAA 1QJMA 4NWCA 3HO7A 3OSRA 3TEPA 3C32A 2FNCA 3H03A 5TP9B 1O64A 2QS3A 1F9BA 4PFUA 3QUFA 4ZEFA 4NF4A 2HQ0A 2XD3A 5KCJB 5JTYB 1D9YA 3VVDA 4EQ7A 4DZ1A 4OWDA 1MQHA 4I62A 4G68C 4OZ9A 5AE4A 4AB6A 3A09A 1P1OA 1Q1KA 3K1MA 4ELPA 1R6ZA 2UVGA 1YAEA 1JNFA 3CIJA 4XTCQ 5CRYA 4PFTA 1FTMA 3RTWB 2QS4A 4WEDA 3THIA 4X1DA 3MVYA 3PGFA 2UVIA 1MXYA 2ZXTA 4PE5B 3G7WA 1AIVA 2H5YA 1PB9A 2PT2A 1MH3A 5DT6A 1N3XA 1PB8A 3VLVA 3F11A 4R6YA 3IORA 1B7UA 4G8NA 4F2QA 1ELJA 2XXRA 5TP9A 5KCJA 4YKKA 2DXYA 5JTYA 4LUBA 1N7XA 2ABHA 4IO4A 2Z8DA 4Q8RA 4GXSB 1MY0A 1DTZA 4U21A 4LATA 4ZZAA 2VGQA 2ZYMA 3OSQA 1OLAA 3OENA 1MM6A 1ZTYA 2DQVA 3N5LA 4OESA 4FECA 2ZYOA 4Q30B 2DSFA 3MW0A 1J1NA 1H43A 4C0RA 1RYXA 2F97A 1MY2A 5M2VA 3U8QA 2ANJA 2P2AA 1D9VA 1EZ9A 2M8CA 1Y3PA 2XXPA 3K1PA 3ECRA 4HW8A 1YPNA 2HFBA 3MP6A 2Y84A 2H98A 4DXCA 1BIYA 2O6AA 4GFRA 3PUYE 2DE4A 4O3CA 2DS9A 5FTHA 4C1TA 3IOVA 1B1XA 1S50A 1N3WA 3T9VA 3U92A 3S4UA 3IAZA 4H65A 4EQBA 4UA8A 3T66A 5JEIA 3UORA 3N94A 1OQGA 3SKPA 3K6XA 3IOWA 5CM6A 1MY3A 1B1HA 4F3SA 4YMAA 1UIVA 2QSXA 2B3BA 4F3BA 1I6BA 2O68A 2V3UA 4IO6A 2OCUA 5CC2A 3RPWA 2QMWA 1MH4A 4P0IA 2PX1A 1IZ1A 2AL5A 4E0WA 3O29A 3VLUA 2Q2CA 3QXMA 3W9VA 1NNKA 5I84A 1EZOA 3JZJA 3FXUA 4THIA 5AA3A 4IGTA 2O7IA 1QUIA 2B3FA 5FHMA 3KJ7A 3OD7A 2G29A 3R6UA 1ZU0A 2RF1A 1US4A 3U94A 3JV9A 3DLNA 2QMXA 4LQ5A 2RKMA 1B5IA 2GRVA 4H1XA 3EF7A 4KI0E 4RNSA 3K02A 5B70A 3QSLA 1JQFA 1YCJA 4QFLA 2V84A 4LP2B 1SDXA 1Z7NE 4RJZA 3TZAA 2Q89A 3C31A 3MP1A 4U23A 3V5AA 3TKDA 2PBWA 5BUUA 1OQHA 1XS5A 4H8IA 3IB0A 2I48A 2AYSA 4N13A 3TQLA 2HXWA 1QUJA 3SDFA 1L5TA 4NF5B 4Z7EA 4BDLA 2DXRA 5I58B 2DWIA 3ZKKA 4ZE9A 3PD8A 2ZNTA 3TAJA 4FIMA 1POTA 1URGA 2Q2AA 2XD2A 3FGSA 3K0VA 4QF9A 2O51A 4WKMA 5FHOA 3KN3A 3QAXA 5K2YA 1AOVA 3IOUA 2I3WA 1LBCA 3VDFA 3FD3A 2YLNA 3M3FA 1AMFA 2P0SA 3EPEA 1LCTA 2RINA 3B6TA 3PUXE 2KLFA 5A5XB 1CB6A 2CZLA 1A99A 2OK2A 1PDAA 1XVYA 4GRKA 1LB9A 1JW1A 4FATA 3LSLA 2Z23A 4I1DA 3RTFB 1ANFA 4NF5A 4PFWA 3RLFE 1GGGA 4JBZA 1B9JA 4ESXA 1QUKA 2DVZA 1POY1 3DP6A 5I58A 4EF1A 3IR1A 3Q28A 1JVYA 3K00A 3TUSA 2GHAA 1MXZA 2YJPA 1KWHA 1T0KA 3CG1A 5AA4B 3D4CA 5I57A 1N7WA 2GHBA 3V8XB 4QHQA 1ZBMA 3IJXB 3HPIA 4K3FA 1MM7A 4OFJA 1URSA 5I59B 1Y4TA 3KG2A 5I2NB 5AA2D 3TTRA 3TQWA 1SYHA 1MQIA 5EHSA 3TCFA 3TTKA 3U1OA 1LSTA 2ONKE 3DM0A 1DMBA 1VE4A 5AA1A 5B7DA 3CRBA 1IXHA 5A5XA 4AB5A 1USYE 4OTEA 1LCFA 4QSEA 2V3TA 3TYHA 4GL0A 4H67A 1WDNA 5EYFA 3OEMA 3TMGA 3OO6A 1NKXA 3MAMA 4KPTA 1XT8A 3UP9A 4HTGA 2ZYNA 3IX1A 3FZVA 2DWHA 3LBSA 4GVOA 2I58A 2V93A 1P1NA 5F1QA 4C1UA 3ILTB 4BDQA 2ZYKA 2F7CA 3FASA 4DIGA 5CBRA 1MRPA 3G3JA 1SI0A 5AA4A 4BDOA 4BDMA 1OVTA 5DEXB 2X7QA 4YB7A 1Y9UA 5I59A 3G3KA 3FIRA 2RCAA 4KR5A 2AIXA 3HCQA 4G77A 4PP0A 1LAXA 2F5XA 3K1NA 1IUDA 4R74A 5DVFA 1ZLQA 2GFEA 4YB5A 3O9PA 3O6HA 1N76A 1MG1A 3TTMA 1B0LA 3TFLA 1LLSA 2XXUA 3MZ9A 1B3LA 4R2BA 1SW2A 1NL5A 1FW0A 2QPQA 1VFEA 4FEBA 5HM4B 3PPRA 3H6VA 4DXUA 3EHTA 3ZSFA 4YB6A 2NVUB 4F19A 4HCYA 4IO5A 4DDDA 2VHAA 1MY4A 2X7PA 4QFOA 4NEDA 3FJGA 1NNTA 4KCDA 3SEWA 2F7AA 1B52A 5DEXA 5ICTA 2HEUA 1CE2A 3SEXA 3LSWA 3FATA 3DP8A 4E0XA 5HPQA 2I6EA 1BP5A 1GVCA 2HCAA 1FQFA 1R9QA 4RY1A 3LSFB 1TFDA 5KZTA 3N26A 3D4GA 3H6UA 2D5WA 4X48A 1XOCA 4JSDA 1XVXA 3TCHA 4PFYA 3IK6B 3L6HA 3BBRA 4FEDA 3H3GA 4LZ8A 3I3VA 1M5BA 1A40A 3B7DA 1US5A 3GZGA 5H8SA 4Z0IA 1IXGA 1OVBA 4FJPA 3T22A 3PUZE 2DWJA 1Y1MA 3ODBA 4LVQA 3FXQA 4ELOA 2Q88A 1M5DA 4G8HA 5FTIA 1ZJLA 2HAUA 3K4UA 4OEVA 4U4SA 4GL8A 1B5HA 3CSGA 2DVCA 1AH5A 4IY5A 4GIZA 1MXVA 1JETA 3MUQA 4FE8A 3SEUA 2THIA 4QSCA 3K01A 3SERA 1OLCA 4JDFA 4U22A 1B7ZA 1LAGE 3RUMA 3U93A 3RNNA 3BFTA 4QRZA 2Q8JA 2XXQA 4R9FA 4KYEA 4BLAA 4QFPA 3KSJA 3OMBA 4KD5A 4MBPA 4OQOA 1PB7A 1VR5A 2DYXA 3E4RA 1HSLA 4XKPA 4OERA 2BJJX 2V25A 1GR2A 5HBCA 4G4PA 4MF3A 4EXLA 4F1YA 1UIUA 1P1UA 3RY3A 3WAFA 4LA9A 4AQ4A 2HAVA 2D3IA 3B6QA 4GWOA 4JWOA 5I56B 1B2HA 3HN0A 3OELA 1B46A 4RPNA 3RN8A 4JWXA 3U72A 1MS7A 1BLFA 1QKBA 5ISUA 3ONMA 1ZMGA 2DWAA 3PUVE 2HZLA 2OWTA 1D3KA 3IO6A 2DE2A 3FJMA 1SI1A 3C34A 3FUZA 3QUJA 4OFLA 3PU5A 3HHFA 3MVWA 3IL1B 1FQEA 3KGCA 1O7TA 1TT1A 3N6TA 4MLVA 3E3KA 1I69A 3VFJA 1TXFA 3PPOA 3QIMA 1B3FA 4I8CA 3KFMA 1LFIA 3FJ7A 3S9EA 2QRYA 4MH5A 3Q25A 4GXAA 1MDQA 2NOOA 1USYH 3C4MA 4NMYA 2I4BA 3Q26A 3PMVA 4FAJA 3IB1A 5I56A 1B05A 2H99A 1TWYA 5H8FB 3V83A 1OMPA 3TELA 4DE8A 5KDTB 1LGBC 3Q27A 2UYFA 1GTKA 1H45A 4F29A 4QFKA 3RQTA 4H6DA 1Z7ME 5DTBA 5L8DA 2VP1A 4M1VA 4F2OA 3TPAA 3MVZA 3ILUB 1MPBA 3S2VA 4F1UA 3AXFA 3DP4A 1B4ZA 1RKMA 1UTHB 3M8UA 4BDNA 3PV0E 2E1SA 2R9JA 1B5JA 5IAIA 4G8MA 2ZMBA 5I57B 1IQ7A 4ZDMA 5CMKA 4UACA 1SQYA 4N07A 1M5CA 2XHDA 3E13X 2Z8FA 4F3PA 1FQDA 3LUYA 4GF8A 2Z8EA 1LAHE 5H8FA 3A3CA 3CSBA 3TTNA 4IO3A 3FXRA 2GH9A 5KDTA 5AA2B 1PBQA 3O6GA 1DOTA 1II5A 3FV1A 2UYEA 4RXLA 4OXVA 1M5FA 5TPAB 4YKPA 1A7LA 3C35A 5DYHA 3GXAA 4GLIA 4F1VA 2O69A 3VE1B 3KJTA 1UTHA 2XX7A 4KHZE 4IY6A 3VXBA 4U1ZA 1B6HA 3K2DA 4MLQA 1ZIUA 5DVIA 4TOZA 2ESNA 3OO9A 3LSXA 2RCBA 3VVFA 1OIBA 4PETA 2UVJA 2UVHA 4JWYA 5BWJA 1B58A 3O66A 4TLMB 1Y4CA 2UXAA 4NF6B 3LR1A 3KBRA 4R9GA 1A8FA 1FCKA 1LBBA 2F34A 3L6GA 3MVXA 3FV2A 5AA2A 3USDA 1DPPA 2ALUA 3MBPA 2ONRA 1H76A 2PYYA 2VD3A 3ZS6A 1DSNA 3O28A 2E0SA 5TPAA 3MZ1A 1O63A 2D21A 2F8DA 3K6VA 4WXJA 3GBBA 2OBGA 4KYDA 5ICQA 3N6UA 3O6IA 4P0GA 1JEUA 3MC2A 2Q9TA 1D4NA 4G2ZA 2G93A 1NNFA 1JEVA 3EHSA 3KN8A 4R2FA 3EQ1A 1SD3A 4LONB 4BDRA 4YAHX 4PQJA 1YTVA 3OO7A 3M3LA 4NF6A 4GOTA 3CI8A 3GBAA 3MWBA 1NH8A 3HHGA 4YKJA 3CR9A 2XXHA 3A3UA 3SEYA 1P1QA 2DOJA 1EZPA 2R6GE 4POWA 2I0CA 2WKYA 2I3VA 2NUVA 2F6PA 4IGRA 2IA4A 2DE3A 3TTLA 3E9XA 3W9WA 3OEKA 2Y7KA 3V89B 2FYIA 3UA8A 2AL4A 3RGYA 1EH3A 3H06B 4U2RA 1RYOA 2A5SA 3GLBA 5J1DA 1BKAA 4ZE8A 2QS1A 2RC8A 2W7YA 1MDP1 3G3HA 2Y7PA 2O1MA 4IO2A 5CI5A 5H8HB 1NH7A 4LZ5A 4ZEBA 1S7YA 4GD5A 1Y3QA 2QL3A 1A55A 2QS2A 3KOTA 5L9MA 2ZNUA 3I6VA 4O3BA 1NNPA 3K6WA 5JK4A 3TODA 2X26A 1HSJA 4H5GA 4NE4A 4TQUQ 3I5OA 4WEPA 2Y7IA 1FTKA 4I9DA 4IB2A 2H4IA 3KZGA 3H6TA 1M5EA 3H4ZA 1P1WA 3R26A 3KOSA 2Y7WA 3VLWA 2XXVA 3M3KA 3H6WA 4ELQA 2IEEA 5F7VA 1LB8A 4XXUA 2XXTA 3WAEA 1H44A 1ZKBA 4XKRA 1JVXA 1MXXA 3CFXA 3T9HB 4OHNA 1JW5A 5H8QB 3FVKA 4ELRA 5H8HA 4OEUA 3MPLA 4ZEIA 2YPNA 4ZECA 3S9LC 1UTBB 1TFAA 1H3DA 4ONYA 4OYVA 5ITOA 1N0TA 4X9TA 2O1LA 3MPKA 4XKNA 4GQOA 1VSOA 1PEBA 1SW1A 2ONSA 4ISUA 1ATGA 1URDA 3TCGA 4EUOA 3O2AA 4F22A 3VXCA 3IOTA 1I6AA 1MXUA 1A8EA 4YKIA 4OVJA 4IO7A 4RK2A 4NF8B 3KN7A 3RT8A 3T9UA 1R9LA
chains in the Genus database with same CATH superfamily
1PC3A 1SVXB 4EXKA 3VV5A 4MNIA 3MQ9A 3C33A 5H8QA 1XC1A 1FSAA 3FVOA 3PUWE 1FTJA 1QVSA 1QULA 4H8JA 4FORA 1LAFE 1IMAA 1YXIA 1UTBA 2REJA 3W15C 3HV1A 3MP8A 1UQWA 3C36A 3S9MC 4HE2A 1EU8A 1Y20A 1DTGA 2XXYA 4EDPA 4N4UA 5I2KB 1B32A 3PD9A 4UABA 1JW4A 4LQ2A 1N84A 1R1NA 1IXCA 3FXBA 4EF2A 2R71A 4F39A 2B65A 3SEVA 2QJEA 4POXA 3T0JA 3JYRA 5IKBA 1LBXA 3PMWA 4RA1A 2NXOA 1XHYA 1YZ0A 3K6UA 1N04A 2NWJA 1B4HA 1B3EA 2H25A 1PBPA 3DELB 2OWSA 5ET8A 2P1SA 1IIWA 4NF8A 4X1BA 4DLDA 2RC7A 2WBBA 2F36A 4ECFA 2XX9A 1B7HA 1SYIA 3PPPA 1NFTA 4OMBA 4JXIA 5ITPA 4PAFA 4DCXA 2O7UA 4KFQA 4G68B 1VFDA 1MQGA 2FIEA 4KQPA 1NV4A 4DXBA 4DCYA 1FTLA 5I2KA 1SW4A 4XIGQ 5CMMA 1P99A 3SESA 2HZKA 5LOMA 3FVGA 4YICA 2VOZA 5IZZA 1SW5A 4YU0A 1CNQA 4H0WA 4NTLA 2OZZA 3ZKLA 2H9BA 1S9TA 1I6QA 3KSXA 3MJNA 2P3NA 1QKAA 2DP8A 4Q0CA 3MSTA 3UK4A 4HCWA 2Y7RA 4NX1A 1BTJA 2FVZA 4R73A 1IMBA 3TDJA 1Q35A 4KYSA 2F7BA 3FVNA 4N6PA 3P7IA 3UN6A 3UIFA 1DK4A 3RT6B 4X04A 3IO4A 3G3FA 4F3GA 4G68A 4NN3A 4RK9A 4GWWA 4ND9A 4YMBA 1NMUA 2O84X 4P56A 1FTOA 2PFYA 3CG3A 5L9SA 3BFUA 4LZ7A 4F31B 2FHYA 2VD2A 2CMOA 3H7MA 2PMSA 4OETA 4TLLB 2A5TB 4OENA 2I4CA 4FBPA 1HSEA 1IEJA 5CBSA 4L17A 3S9NC 5ELVA 4OA4A 5CMCA 4PE3A 3T96B 3OXNA 4U4XA 5EHMA 1IITA 4Q5TA 5L9OA 2XXWA 4QFNA 2XXIA 3CVGA 3ROJA 3T93B 4RPOA 3OO8A 2QVUA 2HXRA 2I0BA 3E78A 3IJOB 1IXIA 3B8BA 4R6HA 4P11A 4O3AA 3R7XA 1SPIA 4OVSA 4M4GA 1B40A 1K9ZA 2F6GA 1DPEA 5H8NB 2GQ1A 2ZNSA 3T9XB 4N91A 1B51A 4EQ9A 1B3HA 2HPGA 1LFHA 4HXVA 1MXWA 4ESWA 2XXXA 3SETA 1GV8A 1K9YA 1AL3A 3CFLA 4R6KA 5FHNA 4KCCA 2OJTA 3G3GA 2A5TA 2FIXA 4JB7A 3EHUA 4R75A 1SBPA 1MY1A 4ZEDA 1MQJA 5I5PA 3BKIB 2F78A 1B3GA 5IGAA 4O7IA 2Y5LA 3IB2A 1Y1ZA 1MQDA 4YZZA 5TU0A 3PPNA 3MZBA 4PFIA 1FTAA 1MPDA 2I49A 3CFZA 4AS4A 4XFEA 3G3IA 1FBEA 1G0IA 4QSDA 4R72A 4OFOA 3QK6A 5K2XA 2FA7A 2PVUA 3C9HA 1FQCA 5H8NA 5LTCA 4GWXA 1MPCA 1FQAA 1WODA 4U1OA 2LAOA 4MFIA 1QW0A 3EN3A 2RC9A 3PPQA 5I2NA 5A5LA 4HS7A 4NF4B 3HSTA 3IFCA 3O97A 3VVEA 1LFGA 1D9QA 4XKQA 4MMPA 2XX8A 3LC8A 3UGWA 1A54A 1FJ6A 5CMBA 2F35A 1FQBA 3HFUA 2OLBA 4NWDA 1B0HA 1WVJA 2ZZXA 5DVJA 4ZZEA 1Y3NA 3Q29A 3OOAA 3B6WA 3QYTA 2REGA 4JSOA 4H5FA 3PMXA 4ZS9A 4P1LA 2P3VA 4GWUA 5LDZA 2Z22A 2PT1A 5FBPA 3KEIA 2V3QA 4ZEKA 4F18A 4RYAA 1QJMA 4NWCA 3HO7A 3OSRA 4PGPA 3TEPA 3C32A 2FNCA 3H03A 5TP9B 1O64A 2B4LA 2L5VA 2QS3A 1F9BA 4PFUA 1NUXA 3QUFA 5EYGA 4ZEFA 2ZZWA 4NF4A 2HQ0A 2XD3A 5KCJB 5JTYB 1D9YA 3VVDA 4EQ7A 4DZ1A 4OWDA 1MQHA 4I62A 4G68C 4OZ9A 5AE4A 4NF0A 4AB6A 3A09A 1P1OA 1Q1KA 3K1MA 3EKIA 4ELPA 1R6ZA 2UVGA 1YAEA 5EQ9A 1EYIA 4PDHA 1JNFA 3CIJA 4XTCQ 5CRYA 1FPIA 4H45A 4PFTA 1FTMA 3RTWB 5ET7A 2QS4A 4WEDA 3THIA 4X1DA 4P47A 4OVRA 3MVYA 4GWZA 3PGFA 2UVIA 1MXYA 2ZXTA 4PE5B 3G7WA 1AIVA 2H5YA 1PB9A 2PT2A 1MH3A 5DT6A 1N3XA 1PB8A 3VLVA 3F11A 4GX3A 4R6YA 3IORA 1B7UA 3BIGA 4G8NA 4F2QA 1ELJA 2XXRA 5TP9A 2HHMA 1NV7A 4XF5A 4N15A 5KCJA 4YKKA 2DXYA 5JTYA 4LUBA 1N7XA 3CHGA 2ABHA 4IO4A 2Z8DA 4Q8RA 4GXSB 1MY0A 1DTZA 4U21A 4LATA 4ZZAA 2VGQA 2ZYMA 2V4CA 3OSQA 1OLAA 3OENA 1MM6A 1ZTYA 2DQVA 3N5LA 4OESA 4FECA 2ZYOA 4Q30B 2DSFA 1LBYA 3MW0A 1FBGA 1J1NA 1H43A 4C0RA 1RYXA 2F97A 1MY2A 5M2VA 3U8QA 2ANJA 2P2AA 1D9VA 4O8MA 1EZ9A 2M8CA 1Y3PA 2XXPA 3K1PA 3ECRA 4HW8A 1YPNA 2HFBA 3MP6A 2Y84A 2H98A 4DXCA 1BIYA 2O6AA 4GFRA 2PCRA 3PUYE 2DE4A 4O3CA 2DS9A 5FTHA 4C1TA 3IOVA 1B1XA 1S50A 1N3WA 3T9VA 3U92A 2PFZA 3S4UA 3IAZA 4H65A 4EQBA 4UA8A 3T66A 5JEIA 3UORA 3N94A 1OQGA 3SKPA 3K6XA 3IOWA 5CM6A 1NV6A 1MY3A 1B1HA 4F3SA 4YMAA 1UIVA 2QSXA 2B3BA 5EQAA 4F3BA 1I6BA 2O68A 1KA0A 2V3UA 4HE1A 4IO6A 2OCUA 5CC2A 3RPWA 1DBZA 2QMWA 1MH4A 4P0IA 2PX1A 1IZ1A 2AL5A 4E0WA 3O29A 3VLUA 2Q2CA 3QXMA 3W9VA 1NNKA 5I84A 1EZOA 3JZJA 4N17A 3FXUA 4THIA 1AWBA 5AA3A 4IGTA 2O7IA 1QUIA 2B3FA 5FHMA 3KJ7A 3OD7A 2G29A 3R6UA 1LBWA 1ZU0A 2RF1A 1US4A 3U94A 3JV9A 3DLNA 2QMXA 4LQ5A 2RKMA 1B5IA 2GRVA 4H1XA 3EF7A 4KI0E 4RNSA 3K02A 5B70A 3QSLA 1JQFA 1NV0A 3FBPA 1YCJA 4QFLA 2V84A 4LP2B 1SDXA 4MX6A 1Z7NE 4RJZA 3TZAA 2Q89A 4PAIA 3C31A 3MP1A 4U23A 2XXKA 3V5AA 3TKDA 2PBWA 5BUUA 1OQHA 1XS5A 4H8IA 3IB0A 4AS5A 2I48A 2VT5A 2AYSA 4N13A 3TQLA 4NGUA 2HXWA 1QUJA 3SDFA 1EYKA 1L5TA 4NF5B 4Z7EA 5EYHA 4BDLA 4PAKA 1KZ8A 2DXRA 5I58B 2DWIA 3ZKKA 4ZE9A 3PD8A 2ZNTA 3TAJA 4FIMA 1POTA 1URGA 2Q2AA 2XD2A 3FGSA 2XWKA 3K0VA 4QF9A 2O51A 4WKMA 5FHOA 3KN3A 3KC1A 1LBZA 3QAXA 1FPBA 5K2YA 1AOVA 4JVCA 2ZZVA 3IOUA 2I3WA 1LBCA 3VDFA 3FD3A 2YLNA 3M3FA 1AMFA 2P0SA 3EPEA 1LCTA 1FBCA 2RINA 3B6TA 3PUXE 2B4MA 1FBFA 4QBAA 2KLFA 5A5XB 1CB6A 2CZLA 1A99A 2OK2A 1PDAA 1XVYA 4GRKA 1LB9A 1JW1A 4FATA 3LSLA 2Z23A 4I1DA 3RTFB 1ANFA 4GWSA 4NF5A 4PFWA 3RLFE 1GGGA 4JBZA 1XI6A 1B9JA 4ESXA 1QUKA 2DVZA 1POY1 3DP6A 5I58A 4EF1A 3IR1A 3Q28A 1JVYA 3K00A 3TUSA 2GHAA 1MXZA 2YJPA 1KWHA 1T0KA 4XEQA 3CG1A 3B50A 5AA4B 3D4CA 5I57A 1N7WA 2GHBA 4NAPA 3V8XB 1YYZA 2FBPA 4QHQA 1ZBMA 3IJXB 3HPIA 4K3FA 1MM7A 5ET6A 4OFJA 1URSA 4MNCA 5I59B 1Y4TA 3KG2A 1IMEA 5I2NB 4N81A 2R8TA 5AA2D 3TTRA 3TQWA 1SYHA 1MQIA 5EHSA 3TCFA 3TTKA 3U1OA 1LSTA 2ONKE 3DM0A 1DMBA 1VE4A 5AA1A 5B7DA 3CRBA 1IXHA 5A5XA 4AB5A 2CZIA 1USYE 4OTEA 1LCFA 4QSEA 1FPFA 2V3TA 3TYHA 4GL0A 4H67A 1WDNA 5EYFA 3OEMA 3TMGA 3OO6A 1NKXA 3MAMA 4KPTA 1XT8A 3UP9A 4HTGA 3MYUA 1RDYA 2ZYNA 3IX1A 3FZVA 4P9KA 2DWHA 4DI3D 3LBSA 4GVOA 2I58A 2V93A 1P1NA 5F1QA 4C1UA 3LUZA 3ILTB 4BDQA 2ZYKA 2F7CA 3FASA 4DIGA 5CBRA 1MRPA 3G3JA 1SI0A 5AA4A 4BDOA 4BDMA 4P3LA 1OVTA 4OVPA 5DEXB 3E79A 2X7QA 4YB7A 1Y9UA 5I59A 3G3KA 3FIRA 4GWYA 2RCAA 4KR5A 2AIXA 3HCQA 4G77A 4PP0A 1LAXA 2F5XA 3K1NA 1IUDA 4R74A 1BK4A 5DVFA 1ZLQA 2GFEA 4YB5A 3O9PA 3O6HA 4PFRA 1N76A 1MG1A 3TTMA 3QMFA 4NHBA 4GX6A 1B0LA 3TFLA 3A29A 1LLSA 2XXUA 3MZ9A 2WBDA 1B3LA 4R2BA 1SW2A 1NL5A 1FW0A 4MNPA 2QPQA 1VFEA 5I3SA 3KBZA 4FEBA 5HM4B 3PPRA 3H6VA 4DXUA 3EHTA 4PBQA 3ZSFA 4YB6A 1Q9DA 2NVUB 4F19A 4HCYA 4IO5A 1FJ9A 1NUWA 4DDDA 2VHAA 4H46A 4N6KA 1MY4A 2X7PA 4QFOA 4NEDA 2VPNA 3FJGA 3IFAA 1NNTA 2WYPA 4IR8A 4KCDA 3SEWA 2F7AA 1B52A 5DEXA 5ICTA 2HEUA 1CE2A 3SEXA 3LSWA 3FATA 3DP8A 4E0XA 5HPQA 2I6EA 2Q8MA 1EYJA 1FRPA 1BP5A 1GVCA 2HCAA 1FQFA 1LBVA 4OANA 1R9QA 4RY1A 3LSFB 1TFDA 5KZTA 4PBHA 1NUYA 3N26A 3D4GA 1IMCA 4PF8A 2XWIA 3H6UA 2D5WA 4X48A 1XOCA 4JSDA 1XVXA 3TCHA 4PFYA 1NUZA 2MKZA 4P8BA 3IK6B 3L6HA 2OX3A 5IZ1A 1FPLA 3BBRA 4FEDA 3H3GA 4I40A 4LZ8A 3I3VA 1M5BA 1A40A 3B7DA 1US5A 3GZGA 4QXDA 5I7IA 5H8SA 3RPLB 4Z0IA 1IXGA 1OVBA 4FJPA 3T22A 3PUZE 4KXPA 2DWJA 1Y1MA 3ODBA 4LVQA 3FXQA 4ELOA 4I3EA 2Q88A 1M5DA 2F3BA 4G8HA 5FTIA 5T3JA 1ZJLA 2HAUA 1RDZA 3K4UA 4OEVA 4U4SA 4GL8A 1B5HA 4OVQA 3CSGA 2DVCA 1AH5A 4IY5A 1FPDA 4GIZA 1MXVA 4O7MA 1JETA 4PCDA 3MUQA 4FE8A 3SEUA 2THIA 4PFBA 4QSCA 1FPKA 4GBWA 3K01A 3SERA 1OLCA 4JDFA 4U22A 1B7ZA 1LAGE 3RUMA 3U93A 3RNNA 3BFTA 5DW8A 4QRZA 2Q8JA 2XXQA 4R9FA 4KYEA 4BLAA 4QFPA 3KSJA 3ISPA 3OMBA 4KD5A 4MBPA 4OQOA 2JJKA 1PB7A 1VR5A 2DYXA 3E4RA 1HSLA 4XKPA 4MAGA 3RPLA 4OERA 2BJJX 4JVDA 2V25A 1GR2A 5HBCA 4PTKA 4G4PA 4MF3A 4EXLA 4F1YA 1UIUA 1P1UA 3RY3A 3WAFA 4LA9A 1KA1A 4AQ4A 2HAVA 2D3IA 3B6QA 4GWOA 4JWOA 5I56B 1B2HA 3HN0A 3OELA 1B46A 4RPNA 2WX9A 3RN8A 4JWXA 3U72A 1MS7A 1BLFA 1QKBA 1JP4A 3NOHA 5ISUA 3ONMA 1ZMGA 2DWAA 3PUVE 2HZLA 2OWTA 1D3KA 1NV5A 3IO6A 2DE2A 3FJMA 1SI1A 3C34A 3FUZA 3QUJA 4OFLA 1DCUA 3PU5A 3HHFA 4PGNA 3MVWA 3IL1B 1FQEA 3KGCA 1O7TA 2QFLA 1TT1A 3N6TA 4MLVA 3E3KA 1I69A 2Q74A 4GX4A 3VFJA 1TXFA 3PPOA 3QIMA 1B3FA 4I8CA 3KFMA 1LFIA 3FJ7A 3S9EA 2QRYA 3LV0A 4MH5A 3Q25A 4GXAA 4NG7A 2KR0A 1MDQA 2NOOA 1USYH 3C4MA 4NMYA 2I4BA 3Q26A 3PMVA 4FAJA 3IB1A 4LN5A 5I56A 4PF6A 1B05A 2H99A 2DDKA 1TWYA 5H8FB 4P1EA 1FBPA 3V83A 1OMPA 3TELA 4DE8A 2CEYA 4N8GA 5KDTB 1LGBC 3Q27A 2UYFA 1GTKA 1H45A 1NV3A 4F29A 4QFKA 1G0HA 3RQTA 4H6DA 2BJIA 1Z7ME 5DTBA 5L8DA 2VP1A 4M1VA 4F2OA 2CZHA 3MVZA 3TPAA 3ILUB 1MPBA 3S2VA 4F1UA 3AXFA 3DP4A 1B4ZA 1RKMA 1UTHB 3M8UA 4BDNA 3PV0E 2E1SA 2R9JA 1B5JA 5IAIA 4PC9A 4G8MA 2ZMBA 5I57B 1IQ7A 4ZDMA 5CMKA 4UACA 1SQYA 4N07A 1M5CA 2XHDA 3E13X 2QVRA 2Z8FA 4GBVA 2KQZA 4F3PA 1FQDA 3LUYA 4GF8A 2Z8EA 1LAHE 5ET5A 5H8FA 3A3CA 3CSBA 3TTNA 4IO3A 3FXRA 2GH9A 5KDTA 5AA2B 1PBQA 3O6GA 1DOTA 1II5A 3FV1A 2UYEA 2F3DA 4RXLA 4OXVA 1M5FA 5IM2A 5TPAB 4YKPA 1A7LA 3C35A 5DYHA 3GXAA 4GLIA 4F1VA 2O69A 3VE1B 3KJTA 5J16A 1UTHA 2XX7A 4KHZE 4IY6A 2WYKA 3VXBA 4U1ZA 1B6HA 3K2DA 4MLQA 1ZIUA 5DVIA 4TOZA 2ESNA 1FPJA 2WEFA 3OO9A 3LSXA 2RCBA 3VVFA 1OIBA 4PETA 2CEXA 4JVIA 2UVJA 2UVHA 3RYDA 5EQ8A 4JWYA 4I3YA 5BWJA 1B58A 3O66A 4MJOA 5ESYA 4TLMB 1Y4CA 2UXAA 4NF6B 3LR1A 3KBRA 4R9GA 1A8FA 1FCKA 1LBBA 2F34A 3L6GA 3MVXA 3FV2A 5AA2A 3USDA 1FPEA 1DPPA 2XWVA 2ALUA 3MBPA 5EQ7A 2ONRA 1H76A 2PYYA 2VD3A 3ZS6A 1DSNA 3O28A 2E0SA 5TPAA 3MZ1A 1O63A 2D21A 2F8DA 4G61A 3K6VA 4WXJA 1LEVA 3GBBA 2OBGA 4KYDA 5ICQA 3N6UA 3SZPA 3O6IA 4P0GA 1JEUA 3MC2A 2Q9TA 1D4NA 4G2ZA 2G93A 1NNFA 1JEVA 3EHSA 3KN8A 4R2FA 5F24A 3EQ1A 1SD3A 4LONB 4BDRA 4YAHX 4PQJA 1YTVA 3OO7A 3M3LA 4NF6A 4GOTA 3CI8A 3GBAA 1VDWA 3MWBA 1NH8A 3HHGA 4YKJA 3CR9A 2XXHA 3A3UA 3SEYA 1P1QA 2DOJA 1EZPA 4N8YA 2R6GE 4POWA 2I0CA 4O94A 2WKYA 2I3VA 2NUVA 2F6PA 4IGRA 4NQ8A 3D1RA 2IA4A 2DE3A 3TTLA 3E9XA 1NI9A 3W9WA 3OEKA 2Y7KA 2Y5KA 3V89B 2FYIA 3UA8A 2AL4A 3RGYA 1EH3A 4U2RA 3H06B 1RYOA 2A5SA 3T1BA 3GLBA 1IMDA 5J1DA 1BKAA 4ZE8A 4MIJA 2QS1A 2RC8A 2W7YA 1MDP1 3G3HA 2CZKA 2Y7PA 2O1MA 4N6DA 4IO2A 5CI5A 5H8HB 1NH7A 3U65A 4LZ5A 3PTYA 4ZEBA 1S7YA 4GD5A 1Y3QA 2QL3A 1A55A 2QS2A 4PDDA 3KOTA 5L9MA 2ZNUA 3I6VA 4DI4B 1FPGA 4O3BA 1NNPA 2XWOA 3K6WA 4HE0A 5JK4A 3TODA 2X26A 1HSJA 4H5GA 4NE4A 4TQUQ 3I5OA 1FBDA 1INPA 4WEPA 1RDXA 2Y7IA 5IZ3B 1FTKA 4I9DA 4IB2A 2H4IA 3KZGA 3H6TA 2XA5A 1M5EA 3H4ZA 1P1WA 3R26A 3KOSA 2Y7WA 3VLWA 2XXVA 3M3KA 3H6WA 4ELQA 2IEEA 5F7VA 1LB8A 4XXUA 2XXTA 3WAEA 1H44A 1ZKBA 4XKRA 1JVXA 2VPOA 1MXXA 1FBHA 3CFXA 3T9HB 4OHNA 1JW5A 5H8QB 3FVKA 1IMFA 4ELRA 3KC0A 5H8HA 3RT8A 4OEUA 3MPLA 4ZEIA 2YPNA 4ZECA 3S9LC 1UTBB 4MCOA 1TFAA 1H3DA 1NV2A 4ONYA 4OYVA 5ITOA 1N0TA 4X9TA 2O1LA 3MPKA 4XKNA 3GYYA 4GQOA 1VSOA 1PEBA 1SW1A 2ONSA 5IZ3A 4ISUA 4MHFA 4X8RA 1ATGA 1URDA 3TCGA 4EUOA 3O2AA 4F22A 3VXCA 1QGXA 4MEVA 4OVTA 3IOTA 3BIHA 1I6AA 1MXUA 1A8EA 2OWZA 2QVVA 4YKIA 4OVJA 4IO7A 4RK2A 4NF8B 3KN7A 1NV1A 3T9UA 1R9LA
chains in the Genus database with same CATH topology
1PC3A 1SVXB 4EXKA 3VV5A 3MQ9A 3C33A 5H8QA 1XC1A 3FVOA 3PUWE 1FTJA 1QVSA 1QULA 4H8JA 4FORA 1LAFE 1UTBA 2REJA 3W15C 3HV1A 3MP8A 1UQWA 3C36A 3S9MC 1EU8A 1Y20A 1DTGA 2XXYA 4EDPA 5I2KB 1B32A 3PD9A 1JW4A 4LQ2A 1N84A 1R1NA 1IXCA 4EF2A 2R71A 4F39A 2B65A 3SEVA 2QJEA 4POXA 3JYRA 5IKBA 3PMWA 4RA1A 2NXOA 1XHYA 3K6UA 1N04A 2NWJA 1B4HA 1B3EA 2H25A 1PBPA 3DELB 2OWSA 2P1SA 1IIWA 4NF8A 4X1BA 4DLDA 2RC7A 2F36A 4ECFA 2XX9A 1B7HA 1SYIA 3PPPA 1NFTA 4OMBA 4JXIA 5ITPA 4DCXA 2O7UA 4KFQA 4G68B 1VFDA 1MQGA 4KQPA 4DXBA 4DCYA 1FTLA 5I2KA 1SW4A 4XIGQ 5CMMA 1P99A 3SESA 2HZKA 5LOMA 3FVGA 4YICA 2VOZA 1SW5A 4YU0A 4H0WA 4NTLA 2OZZA 3ZKLA 2H9BA 1S9TA 1I6QA 3KSXA 3MJNA 1QKAA 2DP8A 4Q0CA 3UK4A 4HCWA 2Y7RA 1BTJA 4R73A 3TDJA 1Q35A 4KYSA 2F7BA 3FVNA 4N6PA 3P7IA 3UN6A 3UIFA 3RT6B 3IO4A 3G3FA 4F3GA 4G68A 4RK9A 4ND9A 4YMBA 1NMUA 2O84X 1FTOA 3CG3A 5L9SA 3BFUA 4LZ7A 4F31B 2VD2A 2CMOA 3H7MA 2PMSA 4OETA 4TLLB 2A5TB 4OENA 2I4CA 1HSEA 1IEJA 5CBSA 4L17A 3S9NC 5ELVA 5CMCA 3T96B 3OXNA 4U4XA 5EHMA 1IITA 4Q5TA 5L9OA 2XXWA 4QFNA 2XXIA 3CVGA 3T93B 4RPOA 3OO8A 2I0BA 3IJOB 1IXIA 4R6HA 4P11A 4O3AA 3R7XA 4M4GA 1B40A 2F6GA 1DPEA 5H8NB 2ZNSA 3T9XB 1B51A 4EQ9A 1B3HA 1LFHA 1MXWA 4ESWA 2XXXA 3SETA 1GV8A 1AL3A 3CFLA 4R6KA 5FHNA 4KCCA 2OJTA 3G3GA 2A5TA 4JB7A 3EHUA 4R75A 1SBPA 1MY1A 4ZEDA 1MQJA 3BKIB 2F78A 1B3GA 3IB2A 1Y1ZA 1MQDA 4YZZA 5TU0A 3PPNA 3MZBA 1MPDA 2I49A 3CFZA 3G3IA 4QSDA 4R72A 4OFOA 3QK6A 5K2XA 2FA7A 2PVUA 3C9HA 5H8NA 1FQCA 1MPCA 1FQAA 1WODA 4U1OA 2LAOA 4MFIA 1QW0A 3EN3A 2RC9A 3PPQA 5I2NA 4HS7A 4NF4B 3HSTA 3O97A 3VVEA 1LFGA 4XKQA 2XX8A 3LC8A 3UGWA 1A54A 5CMBA 2F35A 1FQBA 2OLBA 4NWDA 1B0HA 1WVJA 5DVJA 4ZZEA 1Y3NA 3Q29A 3OOAA 3B6WA 3QYTA 2REGA 4JSOA 4H5FA 3PMXA 4ZS9A 2Z22A 2PT1A 3KEIA 2V3QA 4ZEKA 4F18A 4RYAA 1QJMA 4NWCA 3HO7A 3OSRA 3TEPA 3C32A 2FNCA 3H03A 5TP9B 1O64A 2QS3A 1F9BA 4PFUA 3QUFA 4ZEFA 4NF4A 2HQ0A 2XD3A 5KCJB 5JTYB 1D9YA 3VVDA 4EQ7A 4DZ1A 4OWDA 1MQHA 4I62A 4G68C 4OZ9A 5AE4A 4AB6A 3A09A 1P1OA 1Q1KA 3K1MA 4ELPA 1R6ZA 2UVGA 1YAEA 1JNFA 3CIJA 4XTCQ 5CRYA 4PFTA 1FTMA 3RTWB 2QS4A 4WEDA 3THIA 4X1DA 3MVYA 3PGFA 2UVIA 1MXYA 2ZXTA 4PE5B 3G7WA 1AIVA 2H5YA 1PB9A 2PT2A 1MH3A 5DT6A 1N3XA 1PB8A 3VLVA 3F11A 4R6YA 3IORA 1B7UA 4G8NA 4F2QA 1ELJA 2XXRA 5TP9A 5KCJA 4YKKA 2DXYA 5JTYA 4LUBA 1N7XA 2ABHA 4IO4A 2Z8DA 4Q8RA 4GXSB 1MY0A 1DTZA 4U21A 4LATA 4ZZAA 2VGQA 2ZYMA 3OSQA 1OLAA 3OENA 1MM6A 1ZTYA 2DQVA 3N5LA 4OESA 4FECA 2ZYOA 4Q30B 2DSFA 3MW0A 1J1NA 1H43A 4C0RA 1RYXA 2F97A 1MY2A 5M2VA 3U8QA 2ANJA 2P2AA 1D9VA 1EZ9A 2M8CA 1Y3PA 2XXPA 3K1PA 3ECRA 4HW8A 1YPNA 2HFBA 3MP6A 2Y84A 2H98A 4DXCA 1BIYA 2O6AA 4GFRA 3PUYE 2DE4A 4O3CA 2DS9A 5FTHA 4C1TA 3IOVA 1B1XA 1S50A 1N3WA 3T9VA 3U92A 3S4UA 3IAZA 4H65A 4EQBA 4UA8A 3T66A 5JEIA 3UORA 3N94A 1OQGA 3SKPA 3K6XA 3IOWA 5CM6A 1MY3A 1B1HA 4F3SA 4YMAA 1UIVA 2QSXA 2B3BA 4F3BA 1I6BA 2O68A 2V3UA 4IO6A 2OCUA 5CC2A 3RPWA 2QMWA 1MH4A 4P0IA 2PX1A 1IZ1A 2AL5A 4E0WA 3O29A 3VLUA 2Q2CA 3QXMA 3W9VA 1NNKA 5I84A 1EZOA 3JZJA 3FXUA 4THIA 5AA3A 4IGTA 2O7IA 1QUIA 2B3FA 5FHMA 3KJ7A 3OD7A 2G29A 3R6UA 1ZU0A 2RF1A 1US4A 3U94A 3JV9A 3DLNA 2QMXA 4LQ5A 2RKMA 1B5IA 2GRVA 4H1XA 3EF7A 4KI0E 4RNSA 3K02A 5B70A 3QSLA 1JQFA 1YCJA 4QFLA 2V84A 4LP2B 1SDXA 1Z7NE 4RJZA 3TZAA 2Q89A 3C31A 3MP1A 4U23A 3V5AA 3TKDA 2PBWA 5BUUA 1OQHA 1XS5A 4H8IA 3IB0A 2I48A 2AYSA 4N13A 3TQLA 2HXWA 1QUJA 3SDFA 1L5TA 4NF5B 4Z7EA 4BDLA 2DXRA 5I58B 2DWIA 3ZKKA 4ZE9A 3PD8A 2ZNTA 3TAJA 4FIMA 1POTA 1URGA 2Q2AA 2XD2A 3FGSA 3K0VA 4QF9A 2O51A 4WKMA 5FHOA 3KN3A 3QAXA 5K2YA 1AOVA 3IOUA 2I3WA 1LBCA 3VDFA 3FD3A 2YLNA 3M3FA 1AMFA 2P0SA 3EPEA 1LCTA 2RINA 3B6TA 3PUXE 2KLFA 5A5XB 1CB6A 2CZLA 1A99A 2OK2A 1PDAA 1XVYA 4GRKA 1LB9A 1JW1A 4FATA 3LSLA 2Z23A 4I1DA 3RTFB 1ANFA 4NF5A 4PFWA 3RLFE 1GGGA 4JBZA 1B9JA 4ESXA 1QUKA 2DVZA 1POY1 3DP6A 5I58A 4EF1A 3IR1A 3Q28A 1JVYA 3K00A 3TUSA 2GHAA 1MXZA 2YJPA 1KWHA 1T0KA 3CG1A 5AA4B 3D4CA 5I57A 1N7WA 2GHBA 3V8XB 4QHQA 1ZBMA 3IJXB 3HPIA 4K3FA 1MM7A 4OFJA 1URSA 5I59B 1Y4TA 3KG2A 5I2NB 5AA2D 3TTRA 3TQWA 1SYHA 1MQIA 5EHSA 3TCFA 3TTKA 3U1OA 1LSTA 2ONKE 3DM0A 1DMBA 1VE4A 5AA1A 5B7DA 3CRBA 1IXHA 5A5XA 4AB5A 1USYE 4OTEA 1LCFA 4QSEA 2V3TA 3TYHA 4GL0A 4H67A 1WDNA 5EYFA 3OEMA 3TMGA 3OO6A 1NKXA 3MAMA 4KPTA 1XT8A 3UP9A 4HTGA 2ZYNA 3IX1A 3FZVA 2DWHA 3LBSA 4GVOA 2I58A 2V93A 1P1NA 5F1QA 4C1UA 3ILTB 4BDQA 2ZYKA 2F7CA 3FASA 4DIGA 5CBRA 1MRPA 3G3JA 1SI0A 5AA4A 4BDOA 4BDMA 1OVTA 5DEXB 2X7QA 4YB7A 1Y9UA 5I59A 3G3KA 3FIRA 2RCAA 4KR5A 2AIXA 3HCQA 4G77A 4PP0A 1LAXA 2F5XA 3K1NA 1IUDA 4R74A 5DVFA 1ZLQA 2GFEA 4YB5A 3O9PA 3O6HA 1N76A 1MG1A 3TTMA 1B0LA 3TFLA 1LLSA 2XXUA 3MZ9A 1B3LA 4R2BA 1SW2A 1NL5A 1FW0A 2QPQA 1VFEA 4FEBA 5HM4B 3PPRA 3H6VA 4DXUA 3EHTA 3ZSFA 4YB6A 2NVUB 4F19A 4HCYA 4IO5A 4DDDA 2VHAA 1MY4A 2X7PA 4QFOA 4NEDA 3FJGA 1NNTA 4KCDA 3SEWA 2F7AA 1B52A 5DEXA 5ICTA 2HEUA 1CE2A 3SEXA 3LSWA 3FATA 3DP8A 4E0XA 5HPQA 2I6EA 1BP5A 1GVCA 2HCAA 1FQFA 1R9QA 4RY1A 3LSFB 1TFDA 5KZTA 3N26A 3D4GA 3H6UA 2D5WA 4X48A 1XOCA 4JSDA 1XVXA 3TCHA 4PFYA 3IK6B 3L6HA 3BBRA 4FEDA 3H3GA 4LZ8A 3I3VA 1M5BA 1A40A 3B7DA 1US5A 3GZGA 5H8SA 4Z0IA 1IXGA 1OVBA 4FJPA 3T22A 3PUZE 2DWJA 1Y1MA 3ODBA 4LVQA 3FXQA 4ELOA 2Q88A 1M5DA 4G8HA 5FTIA 1ZJLA 2HAUA 3K4UA 4OEVA 4U4SA 4GL8A 1B5HA 3CSGA 2DVCA 1AH5A 4IY5A 4GIZA 1MXVA 1JETA 3MUQA 4FE8A 3SEUA 2THIA 4QSCA 3K01A 3SERA 1OLCA 4JDFA 4U22A 1B7ZA 1LAGE 3RUMA 3U93A 3RNNA 3BFTA 4QRZA 2Q8JA 2XXQA 4R9FA 4KYEA 4BLAA 4QFPA 3KSJA 3OMBA 4KD5A 4MBPA 4OQOA 1PB7A 1VR5A 2DYXA 3E4RA 1HSLA 4XKPA 4OERA 2BJJX 2V25A 1GR2A 5HBCA 4G4PA 4MF3A 4EXLA 4F1YA 1UIUA 1P1UA 3RY3A 3WAFA 4LA9A 4AQ4A 2HAVA 2D3IA 3B6QA 4GWOA 4JWOA 5I56B 1B2HA 3HN0A 3OELA 1B46A 4RPNA 3RN8A 4JWXA 3U72A 1MS7A 1BLFA 1QKBA 5ISUA 3ONMA 1ZMGA 2DWAA 3PUVE 2HZLA 2OWTA 1D3KA 3IO6A 2DE2A 3FJMA 1SI1A 3C34A 3FUZA 3QUJA 4OFLA 3PU5A 3HHFA 3MVWA 3IL1B 1FQEA 3KGCA 1O7TA 1TT1A 3N6TA 4MLVA 3E3KA 1I69A 3VFJA 1TXFA 3PPOA 3QIMA 1B3FA 4I8CA 3KFMA 1LFIA 3FJ7A 3S9EA 2QRYA 4MH5A 3Q25A 4GXAA 1MDQA 2NOOA 1USYH 3C4MA 4NMYA 2I4BA 3Q26A 3PMVA 4FAJA 3IB1A 5I56A 1B05A 2H99A 1TWYA 5H8FB 3V83A 1OMPA 3TELA 4DE8A 5KDTB 1LGBC 3Q27A 2UYFA 1GTKA 1H45A 4F29A 4QFKA 3RQTA 4H6DA 1Z7ME 5DTBA 5L8DA 2VP1A 4M1VA 4F2OA 3TPAA 3MVZA 3ILUB 1MPBA 3S2VA 4F1UA 3AXFA 3DP4A 1B4ZA 1RKMA 1UTHB 3M8UA 4BDNA 3PV0E 2E1SA 2R9JA 1B5JA 5IAIA 4G8MA 2ZMBA 5I57B 1IQ7A 4ZDMA 5CMKA 4UACA 1SQYA 4N07A 1M5CA 2XHDA 3E13X 2Z8FA 4F3PA 1FQDA 3LUYA 4GF8A 2Z8EA 1LAHE 5H8FA 3A3CA 3CSBA 3TTNA 4IO3A 3FXRA 2GH9A 5KDTA 5AA2B 1PBQA 3O6GA 1DOTA 1II5A 3FV1A 2UYEA 4RXLA 4OXVA 1M5FA 5TPAB 4YKPA 1A7LA 3C35A 5DYHA 3GXAA 4GLIA 4F1VA 2O69A 3VE1B 3KJTA 1UTHA 2XX7A 4KHZE 4IY6A 3VXBA 4U1ZA 1B6HA 3K2DA 4MLQA 1ZIUA 5DVIA 4TOZA 2ESNA 3OO9A 3LSXA 2RCBA 3VVFA 1OIBA 4PETA 2UVJA 2UVHA 4JWYA 5BWJA 1B58A 3O66A 4TLMB 1Y4CA 2UXAA 4NF6B 3LR1A 3KBRA 4R9GA 1A8FA 1FCKA 1LBBA 2F34A 3L6GA 3MVXA 3FV2A 5AA2A 3USDA 1DPPA 2ALUA 3MBPA 2ONRA 1H76A 2PYYA 2VD3A 3ZS6A 1DSNA 3O28A 2E0SA 5TPAA 3MZ1A 1O63A 2D21A 2F8DA 3K6VA 4WXJA 3GBBA 2OBGA 4KYDA 5ICQA 3N6UA 3O6IA 4P0GA 1JEUA 3MC2A 2Q9TA 1D4NA 4G2ZA 2G93A 1NNFA 1JEVA 3EHSA 3KN8A 4R2FA 3EQ1A 1SD3A 4LONB 4BDRA 4YAHX 4PQJA 1YTVA 3OO7A 3M3LA 4NF6A 4GOTA 3CI8A 3GBAA 3MWBA 1NH8A 3HHGA 4YKJA 3CR9A 2XXHA 3A3UA 3SEYA 1P1QA 2DOJA 1EZPA 2R6GE 4POWA 2I0CA 2WKYA 2I3VA 2NUVA 2F6PA 4IGRA 2IA4A 2DE3A 3TTLA 3E9XA 3W9WA 3OEKA 2Y7KA 3V89B 2FYIA 3UA8A 2AL4A 3RGYA 1EH3A 3H06B 4U2RA 1RYOA 2A5SA 3GLBA 5J1DA 1BKAA 4ZE8A 2QS1A 2RC8A 2W7YA 1MDP1 3G3HA 2Y7PA 2O1MA 4IO2A 5CI5A 5H8HB 1NH7A 4LZ5A 4ZEBA 1S7YA 4GD5A 1Y3QA 2QL3A 1A55A 2QS2A 3KOTA 5L9MA 2ZNUA 3I6VA 4O3BA 1NNPA 3K6WA 5JK4A 3TODA 2X26A 1HSJA 4H5GA 4NE4A 4TQUQ 3I5OA 4WEPA 2Y7IA 1FTKA 4I9DA 4IB2A 2H4IA 3KZGA 3H6TA 1M5EA 3H4ZA 1P1WA 3R26A 3KOSA 2Y7WA 3VLWA 2XXVA 3M3KA 3H6WA 4ELQA 2IEEA 5F7VA 1LB8A 4XXUA 2XXTA 3WAEA 1H44A 1ZKBA 4XKRA 1JVXA 1MXXA 3CFXA 3T9HB 4OHNA 1JW5A 5H8QB 3FVKA 4ELRA 5H8HA 4OEUA 3MPLA 4ZEIA 2YPNA 4ZECA 3S9LC 1UTBB 1TFAA 1H3DA 4ONYA 4OYVA 5ITOA 1N0TA 4X9TA 2O1LA 3MPKA 4XKNA 4GQOA 1VSOA 1PEBA 1SW1A 2ONSA 4ISUA 1ATGA 1URDA 3TCGA 4EUOA 3O2AA 4F22A 3VXCA 3IOTA 1I6AA 1MXUA 1A8EA 4YKIA 4OVJA 4IO7A 4RK2A 4NF8B 3KN7A 3RT8A 3T9UA 1R9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PC3 A;  1SVX B;  4EXK A;  3VV5 A;  3MQ9 A;  3C33 A;  5H8Q A;  1XC1 A;  3FVO A;  3PUW E;  1FTJ A;  1QVS A;  1QUL A;  4H8J A;  4FOR A;  1LAF E;  1UTB A;  2REJ A;  3W15 C;  3HV1 A;  3MP8 A;  1UQW A;  3C36 A;  3S9M C;  1EU8 A;  1Y20 A;  1DTG A;  2XXY A;  4EDP A;  5I2K B;  1B32 A;  3PD9 A;  1JW4 A;  4LQ2 A;  1N84 A;  1R1N A;  1IXC A;  4EF2 A;  2R71 A;  4F39 A;  2B65 A;  3SEV A;  2QJE A;  4POX A;  3JYR A;  5IKB A;  3PMW A;  4RA1 A;  2NXO A;  1XHY A;  3K6U A;  1N04 A;  2NWJ A;  1B4H A;  1B3E A;  2H25 A;  1PBP A;  3DEL B;  2OWS A;  2P1S A;  1IIW A;  4NF8 A;  4X1B A;  4DLD A;  2RC7 A;  2F36 A;  4ECF A;  2XX9 A;  1B7H A;  1SYI A;  3PPP A;  1NFT A;  4OMB A;  4JXI A;  5ITP A;  4DCX A;  2O7U A;  4KFQ A;  4G68 B;  1VFD A;  1MQG A;  4KQP A;  4DXB A;  4DCY A;  1FTL A;  5I2K A;  1SW4 A;  4XIG Q;  5CMM A;  1P99 A;  3SES A;  2HZK A;  5LOM A;  3FVG A;  4YIC A;  2VOZ A;  1SW5 A;  4YU0 A;  4H0W A;  4NTL A;  2OZZ A;  3ZKL A;  2H9B A;  1S9T A;  1I6Q A;  3KSX A;  3MJN A;  1QKA A;  2DP8 A;  4Q0C A;  3UK4 A;  4HCW A;  2Y7R A;  1BTJ A;  4R73 A;  3TDJ A;  1Q35 A;  4KYS A;  2F7B A;  3FVN A;  4N6P A;  3P7I A;  3UN6 A;  3UIF A;  3RT6 B;  3IO4 A;  3G3F A;  4F3G A;  4G68 A;  4RK9 A;  4ND9 A;  4YMB A;  1NMU A;  2O84 X;  1FTO A;  3CG3 A;  5L9S A;  3BFU A;  4LZ7 A;  4F31 B;  2VD2 A;  2CMO A;  3H7M A;  2PMS A;  4OET A;  4TLL B;  2A5T B;  4OEN A;  2I4C A;  1HSE A;  1IEJ A;  5CBS A;  4L17 A;  3S9N C;  5ELV A;  5CMC A;  3T96 B;  3OXN A;  4U4X A;  5EHM A;  1IIT A;  4Q5T A;  5L9O A;  2XXW A;  4QFN A;  2XXI A;  3CVG A;  3T93 B;  4RPO A;  3OO8 A;  2I0B A;  3IJO B;  1IXI A;  4R6H A;  4P11 A;  4O3A A;  3R7X A;  4M4G A;  1B40 A;  2F6G A;  1DPE A;  5H8N B;  2ZNS A;  3T9X B;  1B51 A;  4EQ9 A;  1B3H A;  1LFH A;  1MXW A;  4ESW A;  2XXX A;  3SET A;  1GV8 A;  1AL3 A;  3CFL A;  4R6K A;  5FHN A;  4KCC A;  2OJT A;  3G3G A;  2A5T A;  4JB7 A;  3EHU A;  4R75 A;  1SBP A;  1MY1 A;  4ZED A;  1MQJ A;  3BKI B;  2F78 A;  1B3G A;  3IB2 A;  1Y1Z A;  1MQD A;  4YZZ A;  5TU0 A;  3PPN A;  3MZB A;  1MPD A;  2I49 A;  3CFZ A;  3G3I A;  4QSD A;  4R72 A;  4OFO A;  3QK6 A;  5K2X A;  2FA7 A;  2PVU A;  3C9H A;  5H8N A;  1FQC A;  1MPC A;  1FQA A;  1WOD A;  4U1O A;  2LAO A;  4MFI A;  1QW0 A;  3EN3 A;  2RC9 A;  3PPQ A;  5I2N A;  4HS7 A;  4NF4 B;  3HST A;  3O97 A;  3VVE A;  1LFG A;  4XKQ A;  2XX8 A;  3LC8 A;  3UGW A;  1A54 A;  5CMB A;  2F35 A;  1FQB A;  2OLB A;  4NWD A;  1B0H A;  1WVJ A;  5DVJ A;  4ZZE A;  1Y3N A;  3Q29 A;  3OOA A;  3B6W A;  3QYT A;  2REG A;  4JSO A;  4H5F A;  3PMX A;  4ZS9 A;  2Z22 A;  2PT1 A;  3KEI A;  2V3Q A;  4ZEK A;  4F18 A;  4RYA A;  1QJM A;  4NWC A;  3HO7 A;  3OSR A;  3TEP A;  3C32 A;  2FNC A;  3H03 A;  5TP9 B;  1O64 A;  2QS3 A;  1F9B A;  4PFU A;  3QUF A;  4ZEF A;  4NF4 A;  2HQ0 A;  2XD3 A;  5KCJ B;  5JTY B;  1D9Y A;  3VVD A;  4EQ7 A;  4DZ1 A;  4OWD A;  1MQH A;  4I62 A;  4G68 C;  4OZ9 A;  5AE4 A;  4AB6 A;  3A09 A;  1P1O A;  1Q1K A;  3K1M A;  4ELP A;  1R6Z A;  2UVG A;  1YAE A;  1JNF A;  3CIJ A;  4XTC Q;  5CRY A;  4PFT A;  1FTM A;  3RTW B;  2QS4 A;  4WED A;  3THI A;  4X1D A;  3MVY A;  3PGF A;  2UVI A;  1MXY A;  2ZXT A;  4PE5 B;  3G7W A;  1AIV A;  2H5Y A;  1PB9 A;  2PT2 A;  1MH3 A;  5DT6 A;  1N3X A;  1PB8 A;  3VLV A;  3F11 A;  4R6Y A;  3IOR A;  1B7U A;  4G8N A;  4F2Q A;  1ELJ A;  2XXR A;  5TP9 A;  5KCJ A;  4YKK A;  2DXY A;  5JTY A;  4LUB A;  1N7X A;  2ABH A;  4IO4 A;  2Z8D A;  4Q8R A;  4GXS B;  1MY0 A;  1DTZ A;  4U21 A;  4LAT A;  4ZZA A;  2VGQ A;  2ZYM A;  3OSQ A;  1OLA A;  3OEN A;  1MM6 A;  1ZTY A;  2DQV A;  3N5L A;  4OES A;  4FEC A;  2ZYO A;  4Q30 B;  2DSF A;  3MW0 A;  1J1N A;  1H43 A;  4C0R A;  1RYX A;  2F97 A;  1MY2 A;  5M2V A;  3U8Q A;  2ANJ A;  2P2A A;  1D9V A;  1EZ9 A;  2M8C A;  1Y3P A;  2XXP A;  3K1P A;  3ECR A;  4HW8 A;  1YPN A;  2HFB A;  3MP6 A;  2Y84 A;  2H98 A;  4DXC A;  1BIY A;  2O6A A;  4GFR A;  3PUY E;  2DE4 A;  4O3C A;  2DS9 A;  5FTH A;  4C1T A;  3IOV A;  1B1X A;  1S50 A;  1N3W A;  3T9V A;  3U92 A;  3S4U A;  3IAZ A;  4H65 A;  4EQB A;  4UA8 A;  3T66 A;  5JEI A;  3UOR A;  3N94 A;  1OQG A;  3SKP A;  3K6X A;  3IOW A;  5CM6 A;  1MY3 A;  1B1H A;  4F3S A;  4YMA A;  1UIV A;  2QSX A;  2B3B A;  4F3B A;  1I6B A;  2O68 A;  2V3U A;  4IO6 A;  2OCU A;  5CC2 A;  3RPW A;  2QMW A;  1MH4 A;  4P0I A;  2PX1 A;  1IZ1 A;  2AL5 A;  4E0W A;  3O29 A;  3VLU A;  2Q2C A;  3QXM A;  3W9V A;  1NNK A;  5I84 A;  1EZO A;  3JZJ A;  3FXU A;  4THI A;  5AA3 A;  4IGT A;  2O7I A;  1QUI A;  2B3F A;  5FHM A;  3KJ7 A;  3OD7 A;  2G29 A;  3R6U A;  1ZU0 A;  2RF1 A;  1US4 A;  3U94 A;  3JV9 A;  3DLN A;  2QMX A;  4LQ5 A;  2RKM A;  1B5I A;  2GRV A;  4H1X A;  3EF7 A;  4KI0 E;  4RNS A;  3K02 A;  5B70 A;  3QSL A;  1JQF A;  1YCJ A;  4QFL A;  2V84 A;  4LP2 B;  1SDX A;  1Z7N E;  4RJZ A;  3TZA A;  2Q89 A;  3C31 A;  3MP1 A;  4U23 A;  3V5A A;  3TKD A;  2PBW A;  5BUU A;  1OQH A;  1XS5 A;  4H8I A;  3IB0 A;  2I48 A;  2AYS A;  4N13 A;  3TQL A;  2HXW A;  1QUJ A;  3SDF A;  1L5T A;  4NF5 B;  4Z7E A;  4BDL A;  2DXR A;  5I58 B;  2DWI A;  3ZKK A;  4ZE9 A;  3PD8 A;  2ZNT A;  3TAJ A;  4FIM A;  1POT A;  1URG A;  2Q2A A;  2XD2 A;  3FGS A;  3K0V A;  4QF9 A;  2O51 A;  4WKM A;  5FHO A;  3KN3 A;  3QAX A;  5K2Y A;  1AOV A;  3IOU A;  2I3W A;  1LBC A;  3VDF A;  3FD3 A;  2YLN A;  3M3F A;  1AMF A;  2P0S A;  3EPE A;  1LCT A;  2RIN A;  3B6T A;  3PUX E;  2KLF A;  5A5X B;  1CB6 A;  2CZL A;  1A99 A;  2OK2 A;  1PDA A;  1XVY A;  4GRK A;  1LB9 A;  1JW1 A;  4FAT A;  3LSL A;  2Z23 A;  4I1D A;  3RTF B;  1ANF A;  4NF5 A;  4PFW A;  3RLF E;  1GGG A;  4JBZ A;  1B9J A;  4ESX A;  1QUK A;  2DVZ A;  1POY 1;  3DP6 A;  5I58 A;  4EF1 A;  3IR1 A;  3Q28 A;  1JVY A;  3K00 A;  3TUS A;  2GHA A;  1MXZ A;  2YJP A;  1KWH A;  1T0K A;  3CG1 A;  5AA4 B;  3D4C A;  5I57 A;  1N7W A;  2GHB A;  3V8X B;  4QHQ A;  1ZBM A;  3IJX B;  3HPI A;  4K3F A;  1MM7 A;  4OFJ A;  1URS A;  5I59 B;  1Y4T A;  3KG2 A;  5I2N B;  5AA2 D;  3TTR A;  3TQW A;  1SYH A;  1MQI A;  5EHS A;  3TCF A;  3TTK A;  3U1O A;  1LST A;  2ONK E;  3DM0 A;  1DMB A;  1VE4 A;  5AA1 A;  5B7D A;  3CRB A;  1IXH A;  5A5X A;  4AB5 A;  1USY E;  4OTE A;  1LCF A;  4QSE A;  2V3T A;  3TYH A;  4GL0 A;  4H67 A;  1WDN A;  5EYF A;  3OEM A;  3TMG A;  3OO6 A;  1NKX A;  3MAM A;  4KPT A;  1XT8 A;  3UP9 A;  4HTG A;  2ZYN A;  3IX1 A;  3FZV A;  2DWH A;  3LBS A;  4GVO A;  2I58 A;  2V93 A;  1P1N A;  5F1Q A;  4C1U A;  3ILT B;  4BDQ A;  2ZYK A;  2F7C A;  3FAS A;  4DIG A;  5CBR A;  1MRP A;  3G3J A;  1SI0 A;  5AA4 A;  4BDO A;  4BDM A;  1OVT A;  5DEX B;  2X7Q A;  4YB7 A;  1Y9U A;  5I59 A;  3G3K A;  3FIR A;  2RCA A;  4KR5 A;  2AIX A;  3HCQ A;  4G77 A;  4PP0 A;  1LAX A;  2F5X A;  3K1N A;  1IUD A;  4R74 A;  5DVF A;  1ZLQ A;  2GFE A;  4YB5 A;  3O9P A;  3O6H A;  1N76 A;  1MG1 A;  3TTM A;  1B0L A;  3TFL A;  1LLS A;  2XXU A;  3MZ9 A;  1B3L A;  4R2B A;  1SW2 A;  1NL5 A;  1FW0 A;  2QPQ A;  1VFE A;  4FEB A;  5HM4 B;  3PPR A;  3H6V A;  4DXU A;  3EHT A;  3ZSF A;  4YB6 A;  2NVU B;  4F19 A;  4HCY A;  4IO5 A;  4DDD A;  2VHA A;  1MY4 A;  2X7P A;  4QFO A;  4NED A;  3FJG A;  1NNT A;  4KCD A;  3SEW A;  2F7A A;  1B52 A;  5DEX A;  5ICT A;  2HEU A;  1CE2 A;  3SEX A;  3LSW A;  3FAT A;  3DP8 A;  4E0X A;  5HPQ A;  2I6E A;  1BP5 A;  1GVC A;  2HCA A;  1FQF A;  1R9Q A;  4RY1 A;  3LSF B;  1TFD A;  5KZT A;  3N26 A;  3D4G A;  3H6U A;  2D5W A;  4X48 A;  1XOC A;  4JSD A;  1XVX A;  3TCH A;  4PFY A;  3IK6 B;  3L6H A;  3BBR A;  4FED A;  3H3G A;  4LZ8 A;  3I3V A;  1M5B A;  1A40 A;  3B7D A;  1US5 A;  3GZG A;  5H8S A;  4Z0I A;  1IXG A;  1OVB A;  4FJP A;  3T22 A;  3PUZ E;  2DWJ A;  1Y1M A;  3ODB A;  4LVQ A;  3FXQ A;  4ELO A;  2Q88 A;  1M5D A;  4G8H A;  5FTI A;  1ZJL A;  2HAU A;  3K4U A;  4OEV A;  4U4S A;  4GL8 A;  1B5H A;  3CSG A;  2DVC A;  1AH5 A;  4IY5 A;  4GIZ A;  1MXV A;  1JET A;  3MUQ A;  4FE8 A;  3SEU A;  2THI A;  4QSC A;  3K01 A;  3SER A;  1OLC A;  4JDF A;  4U22 A;  1B7Z A;  1LAG E;  3RUM A;  3U93 A;  3RNN A;  3BFT A;  4QRZ A;  2Q8J A;  2XXQ A;  4R9F A;  4KYE A;  4BLA A;  4QFP A;  3KSJ A;  3OMB A;  4KD5 A;  4MBP A;  4OQO A;  1PB7 A;  1VR5 A;  2DYX A;  3E4R A;  1HSL A;  4XKP A;  4OER A;  2BJJ X;  2V25 A;  1GR2 A;  5HBC A;  4G4P A;  4MF3 A;  4EXL A;  4F1Y A;  1UIU A;  1P1U A;  3RY3 A;  3WAF A;  4LA9 A;  4AQ4 A;  2HAV A;  2D3I A;  3B6Q A;  4GWO A;  4JWO A;  5I56 B;  1B2H A;  3HN0 A;  3OEL A;  1B46 A;  4RPN A;  3RN8 A;  4JWX A;  3U72 A;  1MS7 A;  1BLF A;  1QKB A;  5ISU A;  3ONM A;  1ZMG A;  2DWA A;  3PUV E;  2HZL A;  2OWT A;  1D3K A;  3IO6 A;  2DE2 A;  3FJM A;  1SI1 A;  3C34 A;  3FUZ A;  3QUJ A;  4OFL A;  3PU5 A;  3HHF A;  3MVW A;  3IL1 B;  1FQE A;  3KGC A;  1O7T A;  1TT1 A;  3N6T A;  4MLV A;  3E3K A;  1I69 A;  3VFJ A;  1TXF A;  3PPO A;  3QIM A;  1B3F A;  4I8C A;  3KFM A;  1LFI A;  3FJ7 A;  3S9E A;  2QRY A;  4MH5 A;  3Q25 A;  4GXA A;  1MDQ A;  2NOO A;  1USY H;  3C4M A;  4NMY A;  2I4B A;  3Q26 A;  3PMV A;  4FAJ A;  3IB1 A;  5I56 A;  1B05 A;  2H99 A;  1TWY A;  5H8F B;  3V83 A;  1OMP A;  3TEL A;  4DE8 A;  5KDT B;  1LGB C;  3Q27 A;  2UYF A;  1GTK A;  1H45 A;  4F29 A;  4QFK A;  3RQT A;  4H6D A;  1Z7M E;  5DTB A;  5L8D A;  2VP1 A;  4M1V A;  4F2O A;  3TPA A;  3MVZ A;  3ILU B;  1MPB A;  3S2V A;  4F1U A;  3AXF A;  3DP4 A;  1B4Z A;  1RKM A;  1UTH B;  3M8U A;  4BDN A;  3PV0 E;  2E1S A;  2R9J A;  1B5J A;  5IAI A;  4G8M A;  2ZMB A;  5I57 B;  1IQ7 A;  4ZDM A;  5CMK A;  4UAC A;  1SQY A;  4N07 A;  1M5C A;  2XHD A;  3E13 X;  2Z8F A;  4F3P A;  1FQD A;  3LUY A;  4GF8 A;  2Z8E A;  1LAH E;  5H8F A;  3A3C A;  3CSB A;  3TTN A;  4IO3 A;  3FXR A;  2GH9 A;  5KDT A;  5AA2 B;  1PBQ A;  3O6G A;  1DOT A;  1II5 A;  3FV1 A;  2UYE A;  4RXL A;  4OXV A;  1M5F A;  5TPA B;  4YKP A;  1A7L A;  3C35 A;  5DYH A;  3GXA A;  4GLI A;  4F1V A;  2O69 A;  3VE1 B;  3KJT A;  1UTH A;  2XX7 A;  4KHZ E;  4IY6 A;  3VXB A;  4U1Z A;  1B6H A;  3K2D A;  4MLQ A;  1ZIU A;  5DVI A;  4TOZ A;  2ESN A;  3OO9 A;  3LSX A;  2RCB A;  3VVF A;  1OIB A;  4PET A;  2UVJ A;  2UVH A;  4JWY A;  5BWJ A;  1B58 A;  3O66 A;  4TLM B;  1Y4C A;  2UXA A;  4NF6 B;  3LR1 A;  3KBR A;  4R9G A;  1A8F A;  1FCK A;  1LBB A;  2F34 A;  3L6G A;  3MVX A;  3FV2 A;  5AA2 A;  3USD A;  1DPP A;  2ALU A;  3MBP A;  2ONR A;  1H76 A;  2PYY A;  2VD3 A;  3ZS6 A;  1DSN A;  3O28 A;  2E0S A;  5TPA A;  3MZ1 A;  1O63 A;  2D21 A;  2F8D A;  3K6V A;  4WXJ A;  3GBB A;  2OBG A;  4KYD A;  5ICQ A;  3N6U A;  3O6I A;  4P0G A;  1JEU A;  3MC2 A;  2Q9T A;  1D4N A;  4G2Z A;  2G93 A;  1NNF A;  1JEV A;  3EHS A;  3KN8 A;  4R2F A;  3EQ1 A;  1SD3 A;  4LON B;  4BDR A;  4YAH X;  4PQJ A;  1YTV A;  3OO7 A;  3M3L A;  4NF6 A;  4GOT A;  3CI8 A;  3GBA A;  3MWB A;  1NH8 A;  3HHG A;  4YKJ A;  3CR9 A;  2XXH A;  3A3U A;  3SEY A;  1P1Q A;  2DOJ A;  1EZP A;  2R6G E;  4POW A;  2I0C A;  2WKY A;  2I3V A;  2NUV A;  2F6P A;  4IGR A;  2IA4 A;  2DE3 A;  3TTL A;  3E9X A;  3W9W A;  3OEK A;  2Y7K A;  3V89 B;  2FYI A;  3UA8 A;  2AL4 A;  3RGY A;  1EH3 A;  3H06 B;  4U2R A;  1RYO A;  2A5S A;  3GLB A;  5J1D A;  1BKA A;  4ZE8 A;  2QS1 A;  2RC8 A;  2W7Y A;  1MDP 1;  3G3H A;  2Y7P A;  2O1M A;  4IO2 A;  5CI5 A;  5H8H B;  1NH7 A;  4LZ5 A;  4ZEB A;  1S7Y A;  4GD5 A;  1Y3Q A;  2QL3 A;  1A55 A;  2QS2 A;  3KOT A;  5L9M A;  2ZNU A;  3I6V A;  4O3B A;  1NNP A;  3K6W A;  5JK4 A;  3TOD A;  2X26 A;  1HSJ A;  4H5G A;  4NE4 A;  4TQU Q;  3I5O A;  4WEP A;  2Y7I A;  1FTK A;  4I9D A;  4IB2 A;  2H4I A;  3KZG A;  3H6T A;  1M5E A;  3H4Z A;  1P1W A;  3R26 A;  3KOS A;  2Y7W A;  3VLW A;  2XXV A;  3M3K A;  3H6W A;  4ELQ A;  2IEE A;  5F7V A;  1LB8 A;  4XXU A;  2XXT A;  3WAE A;  1H44 A;  1ZKB A;  4XKR A;  1JVX A;  1MXX A;  3CFX A;  3T9H B;  4OHN A;  1JW5 A;  5H8Q B;  3FVK A;  4ELR A;  5H8H A;  4OEU A;  3MPL A;  4ZEI A;  2YPN A;  4ZEC A;  3S9L C;  1UTB B;  1TFA A;  1H3D A;  4ONY A;  4OYV A;  5ITO A;  1N0T A;  4X9T A;  2O1L A;  3MPK A;  4XKN A;  4GQO A;  1VSO A;  1PEB A;  1SW1 A;  2ONS A;  4ISU A;  1ATG A;  1URD A;  3TCG A;  4EUO A;  3O2A A;  4F22 A;  3VXC A;  3IOT A;  1I6A A;  1MXU A;  1A8E A;  4YKI A;  4OVJ A;  4IO7 A;  4RK2 A;  4NF8 B;  3KN7 A;  3RT8 A;  3T9U A;  1R9L A; 
#chains in the Genus database with same CATH topology
 1PC3 A;  1SVX B;  4EXK A;  3VV5 A;  4MNI A;  3MQ9 A;  3C33 A;  5H8Q A;  1XC1 A;  1FSA A;  3FVO A;  3PUW E;  1FTJ A;  1QVS A;  1QUL A;  4H8J A;  4FOR A;  1LAF E;  1IMA A;  1YXI A;  1UTB A;  2REJ A;  3W15 C;  3HV1 A;  3MP8 A;  1UQW A;  3C36 A;  3S9M C;  4HE2 A;  1EU8 A;  1Y20 A;  1DTG A;  2XXY A;  4EDP A;  4N4U A;  5I2K B;  1B32 A;  3PD9 A;  4UAB A;  1JW4 A;  4LQ2 A;  1N84 A;  1R1N A;  1IXC A;  3FXB A;  4EF2 A;  2R71 A;  4F39 A;  2B65 A;  3SEV A;  2QJE A;  4POX A;  3T0J A;  3JYR A;  5IKB A;  1LBX A;  3PMW A;  4RA1 A;  2NXO A;  1XHY A;  1YZ0 A;  3K6U A;  1N04 A;  2NWJ A;  1B4H A;  1B3E A;  2H25 A;  1PBP A;  3DEL B;  2OWS A;  5ET8 A;  2P1S A;  1IIW A;  4NF8 A;  4X1B A;  4DLD A;  2RC7 A;  2WBB A;  2F36 A;  4ECF A;  2XX9 A;  1B7H A;  1SYI A;  3PPP A;  1NFT A;  4OMB A;  4JXI A;  5ITP A;  4PAF A;  4DCX A;  2O7U A;  4KFQ A;  4G68 B;  1VFD A;  1MQG A;  2FIE A;  4KQP A;  1NV4 A;  4DXB A;  4DCY A;  1FTL A;  5I2K A;  1SW4 A;  4XIG Q;  5CMM A;  1P99 A;  3SES A;  2HZK A;  5LOM A;  3FVG A;  4YIC A;  2VOZ A;  5IZZ A;  1SW5 A;  4YU0 A;  1CNQ A;  4H0W A;  4NTL A;  2OZZ A;  3ZKL A;  2H9B A;  1S9T A;  1I6Q A;  3KSX A;  3MJN A;  2P3N A;  1QKA A;  2DP8 A;  4Q0C A;  3MST A;  3UK4 A;  4HCW A;  2Y7R A;  4NX1 A;  1BTJ A;  2FVZ A;  4R73 A;  1IMB A;  3TDJ A;  1Q35 A;  4KYS A;  2F7B A;  3FVN A;  4N6P A;  3P7I A;  3UN6 A;  3UIF A;  1DK4 A;  3RT6 B;  4X04 A;  3IO4 A;  3G3F A;  4F3G A;  4G68 A;  4NN3 A;  4RK9 A;  4GWW A;  4ND9 A;  4YMB A;  1NMU A;  2O84 X;  4P56 A;  1FTO A;  2PFY A;  3CG3 A;  5L9S A;  3BFU A;  4LZ7 A;  4F31 B;  2FHY A;  2VD2 A;  2CMO A;  3H7M A;  2PMS A;  4OET A;  4TLL B;  2A5T B;  4OEN A;  2I4C A;  4FBP A;  1HSE A;  1IEJ A;  5CBS A;  4L17 A;  3S9N C;  5ELV A;  4OA4 A;  5CMC A;  4PE3 A;  3T96 B;  3OXN A;  4U4X A;  5EHM A;  1IIT A;  4Q5T A;  5L9O A;  2XXW A;  4QFN A;  2XXI A;  3CVG A;  3ROJ A;  3T93 B;  4RPO A;  3OO8 A;  2QVU A;  2HXR A;  2I0B A;  3E78 A;  3IJO B;  1IXI A;  3B8B A;  4R6H A;  4P11 A;  4O3A A;  3R7X A;  1SPI A;  4OVS A;  4M4G A;  1B40 A;  1K9Z A;  2F6G A;  1DPE A;  5H8N B;  2GQ1 A;  2ZNS A;  3T9X B;  4N91 A;  1B51 A;  4EQ9 A;  1B3H A;  2HPG A;  1LFH A;  4HXV A;  1MXW A;  4ESW A;  2XXX A;  3SET A;  1GV8 A;  1K9Y A;  1AL3 A;  3CFL A;  4R6K A;  5FHN A;  4KCC A;  2OJT A;  3G3G A;  2A5T A;  2FIX A;  4JB7 A;  3EHU A;  4R75 A;  1SBP A;  1MY1 A;  4ZED A;  1MQJ A;  5I5P A;  3BKI B;  2F78 A;  1B3G A;  5IGA A;  4O7I A;  2Y5L A;  3IB2 A;  1Y1Z A;  1MQD A;  4YZZ A;  5TU0 A;  3PPN A;  3MZB A;  4PFI A;  1FTA A;  1MPD A;  2I49 A;  3CFZ A;  4AS4 A;  4XFE A;  3G3I A;  1FBE A;  1G0I A;  4QSD A;  4R72 A;  4OFO A;  3QK6 A;  5K2X A;  2FA7 A;  2PVU A;  3C9H A;  1FQC A;  5H8N A;  5LTC A;  4GWX A;  1MPC A;  1FQA A;  1WOD A;  4U1O A;  2LAO A;  4MFI A;  1QW0 A;  3EN3 A;  2RC9 A;  3PPQ A;  5I2N A;  5A5L A;  4HS7 A;  4NF4 B;  3HST A;  3IFC A;  3O97 A;  3VVE A;  1LFG A;  1D9Q A;  4XKQ A;  4MMP A;  2XX8 A;  3LC8 A;  3UGW A;  1A54 A;  1FJ6 A;  5CMB A;  2F35 A;  1FQB A;  3HFU A;  2OLB A;  4NWD A;  1B0H A;  1WVJ A;  2ZZX A;  5DVJ A;  4ZZE A;  1Y3N A;  3Q29 A;  3OOA A;  3B6W A;  3QYT A;  2REG A;  4JSO A;  4H5F A;  3PMX A;  4ZS9 A;  4P1L A;  2P3V A;  4GWU A;  5LDZ A;  2Z22 A;  2PT1 A;  5FBP A;  3KEI A;  2V3Q A;  4ZEK A;  4F18 A;  4RYA A;  1QJM A;  4NWC A;  3HO7 A;  3OSR A;  4PGP A;  3TEP A;  3C32 A;  2FNC A;  3H03 A;  5TP9 B;  1O64 A;  2B4L A;  2L5V A;  2QS3 A;  1F9B A;  4PFU A;  1NUX A;  3QUF A;  5EYG A;  4ZEF A;  2ZZW A;  4NF4 A;  2HQ0 A;  2XD3 A;  5KCJ B;  5JTY B;  1D9Y A;  3VVD A;  4EQ7 A;  4DZ1 A;  4OWD A;  1MQH A;  4I62 A;  4G68 C;  4OZ9 A;  5AE4 A;  4NF0 A;  4AB6 A;  3A09 A;  1P1O A;  1Q1K A;  3K1M A;  3EKI A;  4ELP A;  1R6Z A;  2UVG A;  1YAE A;  5EQ9 A;  1EYI A;  4PDH A;  1JNF A;  3CIJ A;  4XTC Q;  5CRY A;  1FPI A;  4H45 A;  4PFT A;  1FTM A;  3RTW B;  5ET7 A;  2QS4 A;  4WED A;  3THI A;  4X1D A;  4P47 A;  4OVR A;  3MVY A;  4GWZ A;  3PGF A;  2UVI A;  1MXY A;  2ZXT A;  4PE5 B;  3G7W A;  1AIV A;  2H5Y A;  1PB9 A;  2PT2 A;  1MH3 A;  5DT6 A;  1N3X A;  1PB8 A;  3VLV A;  3F11 A;  4GX3 A;  4R6Y A;  3IOR A;  1B7U A;  3BIG A;  4G8N A;  4F2Q A;  1ELJ A;  2XXR A;  5TP9 A;  2HHM A;  1NV7 A;  4XF5 A;  4N15 A;  5KCJ A;  4YKK A;  2DXY A;  5JTY A;  4LUB A;  1N7X A;  3CHG A;  2ABH A;  4IO4 A;  2Z8D A;  4Q8R A;  4GXS B;  1MY0 A;  1DTZ A;  4U21 A;  4LAT A;  4ZZA A;  2VGQ A;  2ZYM A;  2V4C A;  3OSQ A;  1OLA A;  3OEN A;  1MM6 A;  1ZTY A;  2DQV A;  3N5L A;  4OES A;  4FEC A;  2ZYO A;  4Q30 B;  2DSF A;  1LBY A;  3MW0 A;  1FBG A;  1J1N A;  1H43 A;  4C0R A;  1RYX A;  2F97 A;  1MY2 A;  5M2V A;  3U8Q A;  2ANJ A;  2P2A A;  1D9V A;  4O8M A;  1EZ9 A;  2M8C A;  1Y3P A;  2XXP A;  3K1P A;  3ECR A;  4HW8 A;  1YPN A;  2HFB A;  3MP6 A;  2Y84 A;  2H98 A;  4DXC A;  1BIY A;  2O6A A;  4GFR A;  2PCR A;  3PUY E;  2DE4 A;  4O3C A;  2DS9 A;  5FTH A;  4C1T A;  3IOV A;  1B1X A;  1S50 A;  1N3W A;  3T9V A;  3U92 A;  2PFZ A;  3S4U A;  3IAZ A;  4H65 A;  4EQB A;  4UA8 A;  3T66 A;  5JEI A;  3UOR A;  3N94 A;  1OQG A;  3SKP A;  3K6X A;  3IOW A;  5CM6 A;  1NV6 A;  1MY3 A;  1B1H A;  4F3S A;  4YMA A;  1UIV A;  2QSX A;  2B3B A;  5EQA A;  4F3B A;  1I6B A;  2O68 A;  1KA0 A;  2V3U A;  4HE1 A;  4IO6 A;  2OCU A;  5CC2 A;  3RPW A;  1DBZ A;  2QMW A;  1MH4 A;  4P0I A;  2PX1 A;  1IZ1 A;  2AL5 A;  4E0W A;  3O29 A;  3VLU A;  2Q2C A;  3QXM A;  3W9V A;  1NNK A;  5I84 A;  1EZO A;  3JZJ A;  4N17 A;  3FXU A;  4THI A;  1AWB A;  5AA3 A;  4IGT A;  2O7I A;  1QUI A;  2B3F A;  5FHM A;  3KJ7 A;  3OD7 A;  2G29 A;  3R6U A;  1LBW A;  1ZU0 A;  2RF1 A;  1US4 A;  3U94 A;  3JV9 A;  3DLN A;  2QMX A;  4LQ5 A;  2RKM A;  1B5I A;  2GRV A;  4H1X A;  3EF7 A;  4KI0 E;  4RNS A;  3K02 A;  5B70 A;  3QSL A;  1JQF A;  1NV0 A;  3FBP A;  1YCJ A;  4QFL A;  2V84 A;  4LP2 B;  1SDX A;  4MX6 A;  1Z7N E;  4RJZ A;  3TZA A;  2Q89 A;  4PAI A;  3C31 A;  3MP1 A;  4U23 A;  2XXK A;  3V5A A;  3TKD A;  2PBW A;  5BUU A;  1OQH A;  1XS5 A;  4H8I A;  3IB0 A;  4AS5 A;  2I48 A;  2VT5 A;  2AYS A;  4N13 A;  3TQL A;  4NGU A;  2HXW A;  1QUJ A;  3SDF A;  1EYK A;  1L5T A;  4NF5 B;  4Z7E A;  5EYH A;  4BDL A;  4PAK A;  1KZ8 A;  2DXR A;  5I58 B;  2DWI A;  3ZKK A;  4ZE9 A;  3PD8 A;  2ZNT A;  3TAJ A;  4FIM A;  1POT A;  1URG A;  2Q2A A;  2XD2 A;  3FGS A;  2XWK A;  3K0V A;  4QF9 A;  2O51 A;  4WKM A;  5FHO A;  3KN3 A;  3KC1 A;  1LBZ A;  3QAX A;  1FPB A;  5K2Y A;  1AOV A;  4JVC A;  2ZZV A;  3IOU A;  2I3W A;  1LBC A;  3VDF A;  3FD3 A;  2YLN A;  3M3F A;  1AMF A;  2P0S A;  3EPE A;  1LCT A;  1FBC A;  2RIN A;  3B6T A;  3PUX E;  2B4M A;  1FBF A;  4QBA A;  2KLF A;  5A5X B;  1CB6 A;  2CZL A;  1A99 A;  2OK2 A;  1PDA A;  1XVY A;  4GRK A;  1LB9 A;  1JW1 A;  4FAT A;  3LSL A;  2Z23 A;  4I1D A;  3RTF B;  1ANF A;  4GWS A;  4NF5 A;  4PFW A;  3RLF E;  1GGG A;  4JBZ A;  1XI6 A;  1B9J A;  4ESX A;  1QUK A;  2DVZ A;  1POY 1;  3DP6 A;  5I58 A;  4EF1 A;  3IR1 A;  3Q28 A;  1JVY A;  3K00 A;  3TUS A;  2GHA A;  1MXZ A;  2YJP A;  1KWH A;  1T0K A;  4XEQ A;  3CG1 A;  3B50 A;  5AA4 B;  3D4C A;  5I57 A;  1N7W A;  2GHB A;  4NAP A;  3V8X B;  1YYZ A;  2FBP A;  4QHQ A;  1ZBM A;  3IJX B;  3HPI A;  4K3F A;  1MM7 A;  5ET6 A;  4OFJ A;  1URS A;  4MNC A;  5I59 B;  1Y4T A;  3KG2 A;  1IME A;  5I2N B;  4N81 A;  2R8T A;  5AA2 D;  3TTR A;  3TQW A;  1SYH A;  1MQI A;  5EHS A;  3TCF A;  3TTK A;  3U1O A;  1LST A;  2ONK E;  3DM0 A;  1DMB A;  1VE4 A;  5AA1 A;  5B7D A;  3CRB A;  1IXH A;  5A5X A;  4AB5 A;  2CZI A;  1USY E;  4OTE A;  1LCF A;  4QSE A;  1FPF A;  2V3T A;  3TYH A;  4GL0 A;  4H67 A;  1WDN A;  5EYF A;  3OEM A;  3TMG A;  3OO6 A;  1NKX A;  3MAM A;  4KPT A;  1XT8 A;  3UP9 A;  4HTG A;  3MYU A;  1RDY A;  2ZYN A;  3IX1 A;  3FZV A;  4P9K A;  2DWH A;  4DI3 D;  3LBS A;  4GVO A;  2I58 A;  2V93 A;  1P1N A;  5F1Q A;  4C1U A;  3LUZ A;  3ILT B;  4BDQ A;  2ZYK A;  2F7C A;  3FAS A;  4DIG A;  5CBR A;  1MRP A;  3G3J A;  1SI0 A;  5AA4 A;  4BDO A;  4BDM A;  4P3L A;  1OVT A;  4OVP A;  5DEX B;  3E79 A;  2X7Q A;  4YB7 A;  1Y9U A;  5I59 A;  3G3K A;  3FIR A;  4GWY A;  2RCA A;  4KR5 A;  2AIX A;  3HCQ A;  4G77 A;  4PP0 A;  1LAX A;  2F5X A;  3K1N A;  1IUD A;  4R74 A;  1BK4 A;  5DVF A;  1ZLQ A;  2GFE A;  4YB5 A;  3O9P A;  3O6H A;  4PFR A;  1N76 A;  1MG1 A;  3TTM A;  3QMF A;  4NHB A;  4GX6 A;  1B0L A;  3TFL A;  3A29 A;  1LLS A;  2XXU A;  3MZ9 A;  2WBD A;  1B3L A;  4R2B A;  1SW2 A;  1NL5 A;  1FW0 A;  4MNP A;  2QPQ A;  1VFE A;  5I3S A;  3KBZ A;  4FEB A;  5HM4 B;  3PPR A;  3H6V A;  4DXU A;  3EHT A;  4PBQ A;  3ZSF A;  4YB6 A;  1Q9D A;  2NVU B;  4F19 A;  4HCY A;  4IO5 A;  1FJ9 A;  1NUW A;  4DDD A;  2VHA A;  4H46 A;  4N6K A;  1MY4 A;  2X7P A;  4QFO A;  4NED A;  2VPN A;  3FJG A;  3IFA A;  1NNT A;  2WYP A;  4IR8 A;  4KCD A;  3SEW A;  2F7A A;  1B52 A;  5DEX A;  5ICT A;  2HEU A;  1CE2 A;  3SEX A;  3LSW A;  3FAT A;  3DP8 A;  4E0X A;  5HPQ A;  2I6E A;  2Q8M A;  1EYJ A;  1FRP A;  1BP5 A;  1GVC A;  2HCA A;  1FQF A;  1LBV A;  4OAN A;  1R9Q A;  4RY1 A;  3LSF B;  1TFD A;  5KZT A;  4PBH A;  1NUY A;  3N26 A;  3D4G A;  1IMC A;  4PF8 A;  2XWI A;  3H6U A;  2D5W A;  4X48 A;  1XOC A;  4JSD A;  1XVX A;  3TCH A;  4PFY A;  1NUZ A;  2MKZ A;  4P8B A;  3IK6 B;  3L6H A;  2OX3 A;  5IZ1 A;  1FPL A;  3BBR A;  4FED A;  3H3G A;  4I40 A;  4LZ8 A;  3I3V A;  1M5B A;  1A40 A;  3B7D A;  1US5 A;  3GZG A;  4QXD A;  5I7I A;  5H8S A;  3RPL B;  4Z0I A;  1IXG A;  1OVB A;  4FJP A;  3T22 A;  3PUZ E;  4KXP A;  2DWJ A;  1Y1M A;  3ODB A;  4LVQ A;  3FXQ A;  4ELO A;  4I3E A;  2Q88 A;  1M5D A;  2F3B A;  4G8H A;  5FTI A;  5T3J A;  1ZJL A;  2HAU A;  1RDZ A;  3K4U A;  4OEV A;  4U4S A;  4GL8 A;  1B5H A;  4OVQ A;  3CSG A;  2DVC A;  1AH5 A;  4IY5 A;  1FPD A;  4GIZ A;  1MXV A;  4O7M A;  1JET A;  4PCD A;  3MUQ A;  4FE8 A;  3SEU A;  2THI A;  4PFB A;  4QSC A;  1FPK A;  4GBW A;  3K01 A;  3SER A;  1OLC A;  4JDF A;  4U22 A;  1B7Z A;  1LAG E;  3RUM A;  3U93 A;  3RNN A;  3BFT A;  5DW8 A;  4QRZ A;  2Q8J A;  2XXQ A;  4R9F A;  4KYE A;  4BLA A;  4QFP A;  3KSJ A;  3ISP A;  3OMB A;  4KD5 A;  4MBP A;  4OQO A;  2JJK A;  1PB7 A;  1VR5 A;  2DYX A;  3E4R A;  1HSL A;  4XKP A;  4MAG A;  3RPL A;  4OER A;  2BJJ X;  4JVD A;  2V25 A;  1GR2 A;  5HBC A;  4PTK A;  4G4P A;  4MF3 A;  4EXL A;  4F1Y A;  1UIU A;  1P1U A;  3RY3 A;  3WAF A;  4LA9 A;  1KA1 A;  4AQ4 A;  2HAV A;  2D3I A;  3B6Q A;  4GWO A;  4JWO A;  5I56 B;  1B2H A;  3HN0 A;  3OEL A;  1B46 A;  4RPN A;  2WX9 A;  3RN8 A;  4JWX A;  3U72 A;  1MS7 A;  1BLF A;  1QKB A;  1JP4 A;  3NOH A;  5ISU A;  3ONM A;  1ZMG A;  2DWA A;  3PUV E;  2HZL A;  2OWT A;  1D3K A;  1NV5 A;  3IO6 A;  2DE2 A;  3FJM A;  1SI1 A;  3C34 A;  3FUZ A;  3QUJ A;  4OFL A;  1DCU A;  3PU5 A;  3HHF A;  4PGN A;  3MVW A;  3IL1 B;  1FQE A;  3KGC A;  1O7T A;  2QFL A;  1TT1 A;  3N6T A;  4MLV A;  3E3K A;  1I69 A;  2Q74 A;  4GX4 A;  3VFJ A;  1TXF A;  3PPO A;  3QIM A;  1B3F A;  4I8C A;  3KFM A;  1LFI A;  3FJ7 A;  3S9E A;  2QRY A;  3LV0 A;  4MH5 A;  3Q25 A;  4GXA A;  4NG7 A;  2KR0 A;  1MDQ A;  2NOO A;  1USY H;  3C4M A;  4NMY A;  2I4B A;  3Q26 A;  3PMV A;  4FAJ A;  3IB1 A;  4LN5 A;  5I56 A;  4PF6 A;  1B05 A;  2H99 A;  2DDK A;  1TWY A;  5H8F B;  4P1E A;  1FBP A;  3V83 A;  1OMP A;  3TEL A;  4DE8 A;  2CEY A;  4N8G A;  5KDT B;  1LGB C;  3Q27 A;  2UYF A;  1GTK A;  1H45 A;  1NV3 A;  4F29 A;  4QFK A;  1G0H A;  3RQT A;  4H6D A;  2BJI A;  1Z7M E;  5DTB A;  5L8D A;  2VP1 A;  4M1V A;  4F2O A;  2CZH A;  3MVZ A;  3TPA A;  3ILU B;  1MPB A;  3S2V A;  4F1U A;  3AXF A;  3DP4 A;  1B4Z A;  1RKM A;  1UTH B;  3M8U A;  4BDN A;  3PV0 E;  2E1S A;  2R9J A;  1B5J A;  5IAI A;  4PC9 A;  4G8M A;  2ZMB A;  5I57 B;  1IQ7 A;  4ZDM A;  5CMK A;  4UAC A;  1SQY A;  4N07 A;  1M5C A;  2XHD A;  3E13 X;  2QVR A;  2Z8F A;  4GBV A;  2KQZ A;  4F3P A;  1FQD A;  3LUY A;  4GF8 A;  2Z8E A;  1LAH E;  5ET5 A;  5H8F A;  3A3C A;  3CSB A;  3TTN A;  4IO3 A;  3FXR A;  2GH9 A;  5KDT A;  5AA2 B;  1PBQ A;  3O6G A;  1DOT A;  1II5 A;  3FV1 A;  2UYE A;  2F3D A;  4RXL A;  4OXV A;  1M5F A;  5IM2 A;  5TPA B;  4YKP A;  1A7L A;  3C35 A;  5DYH A;  3GXA A;  4GLI A;  4F1V A;  2O69 A;  3VE1 B;  3KJT A;  5J16 A;  1UTH A;  2XX7 A;  4KHZ E;  4IY6 A;  2WYK A;  3VXB A;  4U1Z A;  1B6H A;  3K2D A;  4MLQ A;  1ZIU A;  5DVI A;  4TOZ A;  2ESN A;  1FPJ A;  2WEF A;  3OO9 A;  3LSX A;  2RCB A;  3VVF A;  1OIB A;  4PET A;  2CEX A;  4JVI A;  2UVJ A;  2UVH A;  3RYD A;  5EQ8 A;  4JWY A;  4I3Y A;  5BWJ A;  1B58 A;  3O66 A;  4MJO A;  5ESY A;  4TLM B;  1Y4C A;  2UXA A;  4NF6 B;  3LR1 A;  3KBR A;  4R9G A;  1A8F A;  1FCK A;  1LBB A;  2F34 A;  3L6G A;  3MVX A;  3FV2 A;  5AA2 A;  3USD A;  1FPE A;  1DPP A;  2XWV A;  2ALU A;  3MBP A;  5EQ7 A;  2ONR A;  1H76 A;  2PYY A;  2VD3 A;  3ZS6 A;  1DSN A;  3O28 A;  2E0S A;  5TPA A;  3MZ1 A;  1O63 A;  2D21 A;  2F8D A;  4G61 A;  3K6V A;  4WXJ A;  1LEV A;  3GBB A;  2OBG A;  4KYD A;  5ICQ A;  3N6U A;  3SZP A;  3O6I A;  4P0G A;  1JEU A;  3MC2 A;  2Q9T A;  1D4N A;  4G2Z A;  2G93 A;  1NNF A;  1JEV A;  3EHS A;  3KN8 A;  4R2F A;  5F24 A;  3EQ1 A;  1SD3 A;  4LON B;  4BDR A;  4YAH X;  4PQJ A;  1YTV A;  3OO7 A;  3M3L A;  4NF6 A;  4GOT A;  3CI8 A;  3GBA A;  1VDW A;  3MWB A;  1NH8 A;  3HHG A;  4YKJ A;  3CR9 A;  2XXH A;  3A3U A;  3SEY A;  1P1Q A;  2DOJ A;  1EZP A;  4N8Y A;  2R6G E;  4POW A;  2I0C A;  4O94 A;  2WKY A;  2I3V A;  2NUV A;  2F6P A;  4IGR A;  4NQ8 A;  3D1R A;  2IA4 A;  2DE3 A;  3TTL A;  3E9X A;  1NI9 A;  3W9W A;  3OEK A;  2Y7K A;  2Y5K A;  3V89 B;  2FYI A;  3UA8 A;  2AL4 A;  3RGY A;  1EH3 A;  4U2R A;  3H06 B;  1RYO A;  2A5S A;  3T1B A;  3GLB A;  1IMD A;  5J1D A;  1BKA A;  4ZE8 A;  4MIJ A;  2QS1 A;  2RC8 A;  2W7Y A;  1MDP 1;  3G3H A;  2CZK A;  2Y7P A;  2O1M A;  4N6D A;  4IO2 A;  5CI5 A;  5H8H B;  1NH7 A;  3U65 A;  4LZ5 A;  3PTY A;  4ZEB A;  1S7Y A;  4GD5 A;  1Y3Q A;  2QL3 A;  1A55 A;  2QS2 A;  4PDD A;  3KOT A;  5L9M A;  2ZNU A;  3I6V A;  4DI4 B;  1FPG A;  4O3B A;  1NNP A;  2XWO A;  3K6W A;  4HE0 A;  5JK4 A;  3TOD A;  2X26 A;  1HSJ A;  4H5G A;  4NE4 A;  4TQU Q;  3I5O A;  1FBD A;  1INP A;  4WEP A;  1RDX A;  2Y7I A;  5IZ3 B;  1FTK A;  4I9D A;  4IB2 A;  2H4I A;  3KZG A;  3H6T A;  2XA5 A;  1M5E A;  3H4Z A;  1P1W A;  3R26 A;  3KOS A;  2Y7W A;  3VLW A;  2XXV A;  3M3K A;  3H6W A;  4ELQ A;  2IEE A;  5F7V A;  1LB8 A;  4XXU A;  2XXT A;  3WAE A;  1H44 A;  1ZKB A;  4XKR A;  1JVX A;  2VPO A;  1MXX A;  1FBH A;  3CFX A;  3T9H B;  4OHN A;  1JW5 A;  5H8Q B;  3FVK A;  1IMF A;  4ELR A;  3KC0 A;  5H8H A;  3RT8 A;  4OEU A;  3MPL A;  4ZEI A;  2YPN A;  4ZEC A;  3S9L C;  1UTB B;  4MCO A;  1TFA A;  1H3D A;  1NV2 A;  4ONY A;  4OYV A;  5ITO A;  1N0T A;  4X9T A;  2O1L A;  3MPK A;  4XKN A;  3GYY A;  4GQO A;  1VSO A;  1PEB A;  1SW1 A;  2ONS A;  5IZ3 A;  4ISU A;  4MHF A;  4X8R A;  1ATG A;  1URD A;  3TCG A;  4EUO A;  3O2A A;  4F22 A;  3VXC A;  1QGX A;  4MEV A;  4OVT A;  3IOT A;  3BIH A;  1I6A A;  1MXU A;  1A8E A;  2OWZ A;  2QVV A;  4YKI A;  4OVJ A;  4IO7 A;  4RK2 A;  4NF8 B;  3KN7 A;  1NV1 A;  3T9U A;  1R9L A; 
#chains in the Genus database with same CATH homology
 1PC3 A;  1SVX B;  4EXK A;  3VV5 A;  3MQ9 A;  3C33 A;  5H8Q A;  1XC1 A;  3FVO A;  3PUW E;  1FTJ A;  1QVS A;  1QUL A;  4H8J A;  4FOR A;  1LAF E;  1UTB A;  2REJ A;  3W15 C;  3HV1 A;  3MP8 A;  1UQW A;  3C36 A;  3S9M C;  1EU8 A;  1Y20 A;  1DTG A;  2XXY A;  4EDP A;  5I2K B;  1B32 A;  3PD9 A;  1JW4 A;  4LQ2 A;  1N84 A;  1R1N A;  1IXC A;  4EF2 A;  2R71 A;  4F39 A;  2B65 A;  3SEV A;  2QJE A;  4POX A;  3JYR A;  5IKB A;  3PMW A;  4RA1 A;  2NXO A;  1XHY A;  3K6U A;  1N04 A;  2NWJ A;  1B4H A;  1B3E A;  2H25 A;  1PBP A;  3DEL B;  2OWS A;  2P1S A;  1IIW A;  4NF8 A;  4X1B A;  4DLD A;  2RC7 A;  2F36 A;  4ECF A;  2XX9 A;  1B7H A;  1SYI A;  3PPP A;  1NFT A;  4OMB A;  4JXI A;  5ITP A;  4DCX A;  2O7U A;  4KFQ A;  4G68 B;  1VFD A;  1MQG A;  4KQP A;  4DXB A;  4DCY A;  1FTL A;  5I2K A;  1SW4 A;  4XIG Q;  5CMM A;  1P99 A;  3SES A;  2HZK A;  5LOM A;  3FVG A;  4YIC A;  2VOZ A;  1SW5 A;  4YU0 A;  4H0W A;  4NTL A;  2OZZ A;  3ZKL A;  2H9B A;  1S9T A;  1I6Q A;  3KSX A;  3MJN A;  1QKA A;  2DP8 A;  4Q0C A;  3UK4 A;  4HCW A;  2Y7R A;  1BTJ A;  4R73 A;  3TDJ A;  1Q35 A;  4KYS A;  2F7B A;  3FVN A;  4N6P A;  3P7I A;  3UN6 A;  3UIF A;  3RT6 B;  3IO4 A;  3G3F A;  4F3G A;  4G68 A;  4RK9 A;  4ND9 A;  4YMB A;  1NMU A;  2O84 X;  1FTO A;  3CG3 A;  5L9S A;  3BFU A;  4LZ7 A;  4F31 B;  2VD2 A;  2CMO A;  3H7M A;  2PMS A;  4OET A;  4TLL B;  2A5T B;  4OEN A;  2I4C A;  1HSE A;  1IEJ A;  5CBS A;  4L17 A;  3S9N C;  5ELV A;  5CMC A;  3T96 B;  3OXN A;  4U4X A;  5EHM A;  1IIT A;  4Q5T A;  5L9O A;  2XXW A;  4QFN A;  2XXI A;  3CVG A;  3T93 B;  4RPO A;  3OO8 A;  2I0B A;  3IJO B;  1IXI A;  4R6H A;  4P11 A;  4O3A A;  3R7X A;  4M4G A;  1B40 A;  2F6G A;  1DPE A;  5H8N B;  2ZNS A;  3T9X B;  1B51 A;  4EQ9 A;  1B3H A;  1LFH A;  1MXW A;  4ESW A;  2XXX A;  3SET A;  1GV8 A;  1AL3 A;  3CFL A;  4R6K A;  5FHN A;  4KCC A;  2OJT A;  3G3G A;  2A5T A;  4JB7 A;  3EHU A;  4R75 A;  1SBP A;  1MY1 A;  4ZED A;  1MQJ A;  3BKI B;  2F78 A;  1B3G A;  3IB2 A;  1Y1Z A;  1MQD A;  4YZZ A;  5TU0 A;  3PPN A;  3MZB A;  1MPD A;  2I49 A;  3CFZ A;  3G3I A;  4QSD A;  4R72 A;  4OFO A;  3QK6 A;  5K2X A;  2FA7 A;  2PVU A;  3C9H A;  5H8N A;  1FQC A;  1MPC A;  1FQA A;  1WOD A;  4U1O A;  2LAO A;  4MFI A;  1QW0 A;  3EN3 A;  2RC9 A;  3PPQ A;  5I2N A;  4HS7 A;  4NF4 B;  3HST A;  3O97 A;  3VVE A;  1LFG A;  4XKQ A;  2XX8 A;  3LC8 A;  3UGW A;  1A54 A;  5CMB A;  2F35 A;  1FQB A;  2OLB A;  4NWD A;  1B0H A;  1WVJ A;  5DVJ A;  4ZZE A;  1Y3N A;  3Q29 A;  3OOA A;  3B6W A;  3QYT A;  2REG A;  4JSO A;  4H5F A;  3PMX A;  4ZS9 A;  2Z22 A;  2PT1 A;  3KEI A;  2V3Q A;  4ZEK A;  4F18 A;  4RYA A;  1QJM A;  4NWC A;  3HO7 A;  3OSR A;  3TEP A;  3C32 A;  2FNC A;  3H03 A;  5TP9 B;  1O64 A;  2QS3 A;  1F9B A;  4PFU A;  3QUF A;  4ZEF A;  4NF4 A;  2HQ0 A;  2XD3 A;  5KCJ B;  5JTY B;  1D9Y A;  3VVD A;  4EQ7 A;  4DZ1 A;  4OWD A;  1MQH A;  4I62 A;  4G68 C;  4OZ9 A;  5AE4 A;  4AB6 A;  3A09 A;  1P1O A;  1Q1K A;  3K1M A;  4ELP A;  1R6Z A;  2UVG A;  1YAE A;  1JNF A;  3CIJ A;  4XTC Q;  5CRY A;  4PFT A;  1FTM A;  3RTW B;  2QS4 A;  4WED A;  3THI A;  4X1D A;  3MVY A;  3PGF A;  2UVI A;  1MXY A;  2ZXT A;  4PE5 B;  3G7W A;  1AIV A;  2H5Y A;  1PB9 A;  2PT2 A;  1MH3 A;  5DT6 A;  1N3X A;  1PB8 A;  3VLV A;  3F11 A;  4R6Y A;  3IOR A;  1B7U A;  4G8N A;  4F2Q A;  1ELJ A;  2XXR A;  5TP9 A;  5KCJ A;  4YKK A;  2DXY A;  5JTY A;  4LUB A;  1N7X A;  2ABH A;  4IO4 A;  2Z8D A;  4Q8R A;  4GXS B;  1MY0 A;  1DTZ A;  4U21 A;  4LAT A;  4ZZA A;  2VGQ A;  2ZYM A;  3OSQ A;  1OLA A;  3OEN A;  1MM6 A;  1ZTY A;  2DQV A;  3N5L A;  4OES A;  4FEC A;  2ZYO A;  4Q30 B;  2DSF A;  3MW0 A;  1J1N A;  1H43 A;  4C0R A;  1RYX A;  2F97 A;  1MY2 A;  5M2V A;  3U8Q A;  2ANJ A;  2P2A A;  1D9V A;  1EZ9 A;  2M8C A;  1Y3P A;  2XXP A;  3K1P A;  3ECR A;  4HW8 A;  1YPN A;  2HFB A;  3MP6 A;  2Y84 A;  2H98 A;  4DXC A;  1BIY A;  2O6A A;  4GFR A;  3PUY E;  2DE4 A;  4O3C A;  2DS9 A;  5FTH A;  4C1T A;  3IOV A;  1B1X A;  1S50 A;  1N3W A;  3T9V A;  3U92 A;  3S4U A;  3IAZ A;  4H65 A;  4EQB A;  4UA8 A;  3T66 A;  5JEI A;  3UOR A;  3N94 A;  1OQG A;  3SKP A;  3K6X A;  3IOW A;  5CM6 A;  1MY3 A;  1B1H A;  4F3S A;  4YMA A;  1UIV A;  2QSX A;  2B3B A;  4F3B A;  1I6B A;  2O68 A;  2V3U A;  4IO6 A;  2OCU A;  5CC2 A;  3RPW A;  2QMW A;  1MH4 A;  4P0I A;  2PX1 A;  1IZ1 A;  2AL5 A;  4E0W A;  3O29 A;  3VLU A;  2Q2C A;  3QXM A;  3W9V A;  1NNK A;  5I84 A;  1EZO A;  3JZJ A;  3FXU A;  4THI A;  5AA3 A;  4IGT A;  2O7I A;  1QUI A;  2B3F A;  5FHM A;  3KJ7 A;  3OD7 A;  2G29 A;  3R6U A;  1ZU0 A;  2RF1 A;  1US4 A;  3U94 A;  3JV9 A;  3DLN A;  2QMX A;  4LQ5 A;  2RKM A;  1B5I A;  2GRV A;  4H1X A;  3EF7 A;  4KI0 E;  4RNS A;  3K02 A;  5B70 A;  3QSL A;  1JQF A;  1YCJ A;  4QFL A;  2V84 A;  4LP2 B;  1SDX A;  1Z7N E;  4RJZ A;  3TZA A;  2Q89 A;  3C31 A;  3MP1 A;  4U23 A;  3V5A A;  3TKD A;  2PBW A;  5BUU A;  1OQH A;  1XS5 A;  4H8I A;  3IB0 A;  2I48 A;  2AYS A;  4N13 A;  3TQL A;  2HXW A;  1QUJ A;  3SDF A;  1L5T A;  4NF5 B;  4Z7E A;  4BDL A;  2DXR A;  5I58 B;  2DWI A;  3ZKK A;  4ZE9 A;  3PD8 A;  2ZNT A;  3TAJ A;  4FIM A;  1POT A;  1URG A;  2Q2A A;  2XD2 A;  3FGS A;  3K0V A;  4QF9 A;  2O51 A;  4WKM A;  5FHO A;  3KN3 A;  3QAX A;  5K2Y A;  1AOV A;  3IOU A;  2I3W A;  1LBC A;  3VDF A;  3FD3 A;  2YLN A;  3M3F A;  1AMF A;  2P0S A;  3EPE A;  1LCT A;  2RIN A;  3B6T A;  3PUX E;  2KLF A;  5A5X B;  1CB6 A;  2CZL A;  1A99 A;  2OK2 A;  1PDA A;  1XVY A;  4GRK A;  1LB9 A;  1JW1 A;  4FAT A;  3LSL A;  2Z23 A;  4I1D A;  3RTF B;  1ANF A;  4NF5 A;  4PFW A;  3RLF E;  1GGG A;  4JBZ A;  1B9J A;  4ESX A;  1QUK A;  2DVZ A;  1POY 1;  3DP6 A;  5I58 A;  4EF1 A;  3IR1 A;  3Q28 A;  1JVY A;  3K00 A;  3TUS A;  2GHA A;  1MXZ A;  2YJP A;  1KWH A;  1T0K A;  3CG1 A;  5AA4 B;  3D4C A;  5I57 A;  1N7W A;  2GHB A;  3V8X B;  4QHQ A;  1ZBM A;  3IJX B;  3HPI A;  4K3F A;  1MM7 A;  4OFJ A;  1URS A;  5I59 B;  1Y4T A;  3KG2 A;  5I2N B;  5AA2 D;  3TTR A;  3TQW A;  1SYH A;  1MQI A;  5EHS A;  3TCF A;  3TTK A;  3U1O A;  1LST A;  2ONK E;  3DM0 A;  1DMB A;  1VE4 A;  5AA1 A;  5B7D A;  3CRB A;  1IXH A;  5A5X A;  4AB5 A;  1USY E;  4OTE A;  1LCF A;  4QSE A;  2V3T A;  3TYH A;  4GL0 A;  4H67 A;  1WDN A;  5EYF A;  3OEM A;  3TMG A;  3OO6 A;  1NKX A;  3MAM A;  4KPT A;  1XT8 A;  3UP9 A;  4HTG A;  2ZYN A;  3IX1 A;  3FZV A;  2DWH A;  3LBS A;  4GVO A;  2I58 A;  2V93 A;  1P1N A;  5F1Q A;  4C1U A;  3ILT B;  4BDQ A;  2ZYK A;  2F7C A;  3FAS A;  4DIG A;  5CBR A;  1MRP A;  3G3J A;  1SI0 A;  5AA4 A;  4BDO A;  4BDM A;  1OVT A;  5DEX B;  2X7Q A;  4YB7 A;  1Y9U A;  5I59 A;  3G3K A;  3FIR A;  2RCA A;  4KR5 A;  2AIX A;  3HCQ A;  4G77 A;  4PP0 A;  1LAX A;  2F5X A;  3K1N A;  1IUD A;  4R74 A;  5DVF A;  1ZLQ A;  2GFE A;  4YB5 A;  3O9P A;  3O6H A;  1N76 A;  1MG1 A;  3TTM A;  1B0L A;  3TFL A;  1LLS A;  2XXU A;  3MZ9 A;  1B3L A;  4R2B A;  1SW2 A;  1NL5 A;  1FW0 A;  2QPQ A;  1VFE A;  4FEB A;  5HM4 B;  3PPR A;  3H6V A;  4DXU A;  3EHT A;  3ZSF A;  4YB6 A;  2NVU B;  4F19 A;  4HCY A;  4IO5 A;  4DDD A;  2VHA A;  1MY4 A;  2X7P A;  4QFO A;  4NED A;  3FJG A;  1NNT A;  4KCD A;  3SEW A;  2F7A A;  1B52 A;  5DEX A;  5ICT A;  2HEU A;  1CE2 A;  3SEX A;  3LSW A;  3FAT A;  3DP8 A;  4E0X A;  5HPQ A;  2I6E A;  1BP5 A;  1GVC A;  2HCA A;  1FQF A;  1R9Q A;  4RY1 A;  3LSF B;  1TFD A;  5KZT A;  3N26 A;  3D4G A;  3H6U A;  2D5W A;  4X48 A;  1XOC A;  4JSD A;  1XVX A;  3TCH A;  4PFY A;  3IK6 B;  3L6H A;  3BBR A;  4FED A;  3H3G A;  4LZ8 A;  3I3V A;  1M5B A;  1A40 A;  3B7D A;  1US5 A;  3GZG A;  5H8S A;  4Z0I A;  1IXG A;  1OVB A;  4FJP A;  3T22 A;  3PUZ E;  2DWJ A;  1Y1M A;  3ODB A;  4LVQ A;  3FXQ A;  4ELO A;  2Q88 A;  1M5D A;  4G8H A;  5FTI A;  1ZJL A;  2HAU A;  3K4U A;  4OEV A;  4U4S A;  4GL8 A;  1B5H A;  3CSG A;  2DVC A;  1AH5 A;  4IY5 A;  4GIZ A;  1MXV A;  1JET A;  3MUQ A;  4FE8 A;  3SEU A;  2THI A;  4QSC A;  3K01 A;  3SER A;  1OLC A;  4JDF A;  4U22 A;  1B7Z A;  1LAG E;  3RUM A;  3U93 A;  3RNN A;  3BFT A;  4QRZ A;  2Q8J A;  2XXQ A;  4R9F A;  4KYE A;  4BLA A;  4QFP A;  3KSJ A;  3OMB A;  4KD5 A;  4MBP A;  4OQO A;  1PB7 A;  1VR5 A;  2DYX A;  3E4R A;  1HSL A;  4XKP A;  4OER A;  2BJJ X;  2V25 A;  1GR2 A;  5HBC A;  4G4P A;  4MF3 A;  4EXL A;  4F1Y A;  1UIU A;  1P1U A;  3RY3 A;  3WAF A;  4LA9 A;  4AQ4 A;  2HAV A;  2D3I A;  3B6Q A;  4GWO A;  4JWO A;  5I56 B;  1B2H A;  3HN0 A;  3OEL A;  1B46 A;  4RPN A;  3RN8 A;  4JWX A;  3U72 A;  1MS7 A;  1BLF A;  1QKB A;  5ISU A;  3ONM A;  1ZMG A;  2DWA A;  3PUV E;  2HZL A;  2OWT A;  1D3K A;  3IO6 A;  2DE2 A;  3FJM A;  1SI1 A;  3C34 A;  3FUZ A;  3QUJ A;  4OFL A;  3PU5 A;  3HHF A;  3MVW A;  3IL1 B;  1FQE A;  3KGC A;  1O7T A;  1TT1 A;  3N6T A;  4MLV A;  3E3K A;  1I69 A;  3VFJ A;  1TXF A;  3PPO A;  3QIM A;  1B3F A;  4I8C A;  3KFM A;  1LFI A;  3FJ7 A;  3S9E A;  2QRY A;  4MH5 A;  3Q25 A;  4GXA A;  1MDQ A;  2NOO A;  1USY H;  3C4M A;  4NMY A;  2I4B A;  3Q26 A;  3PMV A;  4FAJ A;  3IB1 A;  5I56 A;  1B05 A;  2H99 A;  1TWY A;  5H8F B;  3V83 A;  1OMP A;  3TEL A;  4DE8 A;  5KDT B;  1LGB C;  3Q27 A;  2UYF A;  1GTK A;  1H45 A;  4F29 A;  4QFK A;  3RQT A;  4H6D A;  1Z7M E;  5DTB A;  5L8D A;  2VP1 A;  4M1V A;  4F2O A;  3TPA A;  3MVZ A;  3ILU B;  1MPB A;  3S2V A;  4F1U A;  3AXF A;  3DP4 A;  1B4Z A;  1RKM A;  1UTH B;  3M8U A;  4BDN A;  3PV0 E;  2E1S A;  2R9J A;  1B5J A;  5IAI A;  4G8M A;  2ZMB A;  5I57 B;  1IQ7 A;  4ZDM A;  5CMK A;  4UAC A;  1SQY A;  4N07 A;  1M5C A;  2XHD A;  3E13 X;  2Z8F A;  4F3P A;  1FQD A;  3LUY A;  4GF8 A;  2Z8E A;  1LAH E;  5H8F A;  3A3C A;  3CSB A;  3TTN A;  4IO3 A;  3FXR A;  2GH9 A;  5KDT A;  5AA2 B;  1PBQ A;  3O6G A;  1DOT A;  1II5 A;  3FV1 A;  2UYE A;  4RXL A;  4OXV A;  1M5F A;  5TPA B;  4YKP A;  1A7L A;  3C35 A;  5DYH A;  3GXA A;  4GLI A;  4F1V A;  2O69 A;  3VE1 B;  3KJT A;  1UTH A;  2XX7 A;  4KHZ E;  4IY6 A;  3VXB A;  4U1Z A;  1B6H A;  3K2D A;  4MLQ A;  1ZIU A;  5DVI A;  4TOZ A;  2ESN A;  3OO9 A;  3LSX A;  2RCB A;  3VVF A;  1OIB A;  4PET A;  2UVJ A;  2UVH A;  4JWY A;  5BWJ A;  1B58 A;  3O66 A;  4TLM B;  1Y4C A;  2UXA A;  4NF6 B;  3LR1 A;  3KBR A;  4R9G A;  1A8F A;  1FCK A;  1LBB A;  2F34 A;  3L6G A;  3MVX A;  3FV2 A;  5AA2 A;  3USD A;  1DPP A;  2ALU A;  3MBP A;  2ONR A;  1H76 A;  2PYY A;  2VD3 A;  3ZS6 A;  1DSN A;  3O28 A;  2E0S A;  5TPA A;  3MZ1 A;  1O63 A;  2D21 A;  2F8D A;  3K6V A;  4WXJ A;  3GBB A;  2OBG A;  4KYD A;  5ICQ A;  3N6U A;  3O6I A;  4P0G A;  1JEU A;  3MC2 A;  2Q9T A;  1D4N A;  4G2Z A;  2G93 A;  1NNF A;  1JEV A;  3EHS A;  3KN8 A;  4R2F A;  3EQ1 A;  1SD3 A;  4LON B;  4BDR A;  4YAH X;  4PQJ A;  1YTV A;  3OO7 A;  3M3L A;  4NF6 A;  4GOT A;  3CI8 A;  3GBA A;  3MWB A;  1NH8 A;  3HHG A;  4YKJ A;  3CR9 A;  2XXH A;  3A3U A;  3SEY A;  1P1Q A;  2DOJ A;  1EZP A;  2R6G E;  4POW A;  2I0C A;  2WKY A;  2I3V A;  2NUV A;  2F6P A;  4IGR A;  2IA4 A;  2DE3 A;  3TTL A;  3E9X A;  3W9W A;  3OEK A;  2Y7K A;  3V89 B;  2FYI A;  3UA8 A;  2AL4 A;  3RGY A;  1EH3 A;  3H06 B;  4U2R A;  1RYO A;  2A5S A;  3GLB A;  5J1D A;  1BKA A;  4ZE8 A;  2QS1 A;  2RC8 A;  2W7Y A;  1MDP 1;  3G3H A;  2Y7P A;  2O1M A;  4IO2 A;  5CI5 A;  5H8H B;  1NH7 A;  4LZ5 A;  4ZEB A;  1S7Y A;  4GD5 A;  1Y3Q A;  2QL3 A;  1A55 A;  2QS2 A;  3KOT A;  5L9M A;  2ZNU A;  3I6V A;  4O3B A;  1NNP A;  3K6W A;  5JK4 A;  3TOD A;  2X26 A;  1HSJ A;  4H5G A;  4NE4 A;  4TQU Q;  3I5O A;  4WEP A;  2Y7I A;  1FTK A;  4I9D A;  4IB2 A;  2H4I A;  3KZG A;  3H6T A;  1M5E A;  3H4Z A;  1P1W A;  3R26 A;  3KOS A;  2Y7W A;  3VLW A;  2XXV A;  3M3K A;  3H6W A;  4ELQ A;  2IEE A;  5F7V A;  1LB8 A;  4XXU A;  2XXT A;  3WAE A;  1H44 A;  1ZKB A;  4XKR A;  1JVX A;  1MXX A;  3CFX A;  3T9H B;  4OHN A;  1JW5 A;  5H8Q B;  3FVK A;  4ELR A;  5H8H A;  4OEU A;  3MPL A;  4ZEI A;  2YPN A;  4ZEC A;  3S9L C;  1UTB B;  1TFA A;  1H3D A;  4ONY A;  4OYV A;  5ITO A;  1N0T A;  4X9T A;  2O1L A;  3MPK A;  4XKN A;  4GQO A;  1VSO A;  1PEB A;  1SW1 A;  2ONS A;  4ISU A;  1ATG A;  1URD A;  3TCG A;  4EUO A;  3O2A A;  4F22 A;  3VXC A;  3IOT A;  1I6A A;  1MXU A;  1A8E A;  4YKI A;  4OVJ A;  4IO7 A;  4RK2 A;  4NF8 B;  3KN7 A;  3RT8 A;  3T9U A;  1R9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...