4FEDA

Crystal structure of htt36q3h
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
401
structure length
401
Chain Sequence
b'KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQQHQHQHQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein,Huntingtin
molecule tags Signaling protein
source organism Escherichia coli
publication title Beta conformation of polyglutamine track revealed by a crystal structure of Huntingtin N-terminal region with insertion of three histidine residues.
pubmed doi rcsb
total genus 116
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fedA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fedA02
4XKPA 1DOTA 1MY0A 1YAEA 3K4UA 3MPKA 5I2NB 3VLWA 4H67A 2HAVA 3OO8A 1EH3A 3MVZA 3TCFA 3MAMA 4F29A 1TFAA 1QULA 4YU0A 5H8QA 2DWAA 2QS2A 3N6UA 4MBPA 3VXBA 5HM4B 2D3IA 3ZKKA 1IQ7A 1SDXA 3IOVA 1EZ9A 3N5LA 2NUVA 4ZE9A 3S9NC 3TTRA 5CBRA 2ZYNA 1R9QA 1MH3A 3U94A 3E3KA 3KZGA 4R6KA 5I57A 5KDTA 3IB0A 2ABHA 3IR1A 1XOCA 1MM6A 2YJPA 3Q29A 2O1MA 1SI1A 1QW0A 3FGSA 1PB9A 2R9JA 5AA2B 1US5A 2QRYA 3RLFE 2F35A 2RC8A 1DSNA 3IX1A 4EXLA 3GBAA 1ANFA 3PUWE 4G4PA 1MPBA 2F36A 1NNFA 3JZJA 4G8NA 2A5SA 4NF8A 1Q1KA 2M8CA 2PT1A 3PUXE 4JDFA 4LATA 4XIGQ 2DE4A 4PE5B 1DPEA 4H0WA 4DZ1A 4DXBA 2HQ0A 5A5XB 3C36A 2LAOA 1NNPA 1VSOA 1B0LA 1FQAA 3R7XA 3OD7A 4F3SA 5IAIA 4F3GA 2CMOA 5B70A 4HTGA 3CI8A 2XXVA 4YB6A 5H8QB 1D3KA 4ZE8A 1SW4A 3H6VA 1MQHA 1MH4A 2H99A 4N6PA 4JBZA 4AQ4A 4N13A 1M5DA 4YB5A 4Z0IA 1B51A 3HPIA 5H8SA 1B3GA 4LONB 5I2KA 1JNFA 1VE4A 3EHUA 4DIGA 3I6VA 5H8NB 2F6GA 4OMBA 1FTJA 4R6YA 3K6UA 1ATGA 3RTFB 3SEUA 5ELVA 1B7ZA 3I5OA 2F97A 5TU0A 5KDTB 1JW5A 4EF1A 5TP9B 1USYH 2HXWA 1MM7A 2DWHA 3E9XA 4QSEA 5H8NA 3UA8A 2DE2A 4F3PA 3CG1A 4I8CA 2DWJA 4KD5A 5L9MA 4PFTA 3IAZA 1LAFE 3HCQA 4WEDA 4BLAA 2RKMA 3S9MC 3V5AA 2PT2A 2V93A 1DMBA 1P1UA 3E4RA 4IY5A 3S4UA 4YKIA 1JETA 1MQGA 3K00A 3MZBA 2DOJA 2P2AA 1H76A 2QJEA 2XXUA 1B1HA 4EQ9A 1URDA 2DS9A 2ZYMA 4IO5A 2V3QA 2PVUA 2Y7KA 4GRKA 1A55A 1TWYA 2V84A 2F34A 4JSDA 4NMYA 3FV2A 3IJOB 4OERA 4PFWA 4DE8A 4O3BA 4R9GA 3SEXA 1QUKA 2R6GE 4FE8A 3A3UA 4G68B 4RNSA 4ND9A 2DSFA 4U22A 5FHNA 5JTYB 1Y1MA 1M5BA 4QFPA 4X1BA 3VDFA 4XKQA 1TFDA 4N07A 1R9LA 3M3FA 4H8IA 4QFKA 3TCHA 1AH5A 3H6UA 2QL3A 1MQIA 3DP4A 4R6HA 3TTLA 5CMBA 4IGRA 1ZBMA 2Q2AA 2I4BA 2F5XA 3K1PA 1MY2A 2WKYA 1SYIA 1NFTA 1MQJA 1J1NA 2ONSA 4G8HA 1Q35A 4KHZE 4BDOA 3M3LA 3FZVA 1B5IA 3UIFA 2ONKE 4F1YA 1MY4A 2NXOA 4FECA 2Q9TA 1QJMA 3PMXA 5CMMA 1D9VA 1IXGA 2XX7A 3C33A 3T9XB 4YMBA 1S7YA 1SW1A 1VFDA 2B3FA 3HHGA 3T22A 3U72A 3UGWA 5AA4B 1WDNA 3FJGA 3M3KA 4O3CA 3V8XB 5IKBA 1HSLA 3T93B 3UN6A 2DVCA 2VD3A 4KQPA 3K6VA 4OHNA 4PETA 1IXCA 4KPTA 4RPOA 4G77A 1SI0A 3BFUA 3OEMA 4ZZAA 4THIA 3EHTA 1N3XA 1N7WA 2GFEA 2ZNSA 3O28A 4YKJA 3IL1B 2XXPA 3SERA 2OBGA 3C31A 4YMAA 3G3HA 4IB2A 1FCKA 2I3WA 1S9TA 3HO7A 4OFJA 4OEUA 4OFLA 4OFOA 5JTYA 3TMGA 3TUSA 1Y3PA 1MXXA 4FORA 1IEJA 2O7UA 3QXMA 1OQGA 3MPLA 1LAXA 2I0CA 3USDA 4ELOA 1B4ZA 3IO4A 3MVYA 3R26A 1T0KA 2F7BA 2XXIA 1ZU0A 3KEIA 3O2AA 1TXFA 1VR5A 1B6HA 2NOOA 3H6TA 3ILTB 2QS4A 1PB7A 3PUVE 4IO2A 4R2FA 4RY1A 5CMKA 1Y4CA 2DVZA 1ZMGA 2Y7RA 3IB2A 3T9VA 4XTCQ 2O1LA 1NH8A 1SW2A 4GL0A 4KYEA 3RPWA 1NMUA 3TZAA 1B52A 4RJZA 3PD8A 1FQDA 4R74A 5CBSA 5I57B 3ZS6A 3IJXB 5AA2D 4Q0CA 4H8JA 3OMBA 1A54A 3CVGA 3VVFA 1B05A 2B65A 1SQYA 4KI0E 4DCYA 5AA2A 2GRVA 2V3TA 3JV9A 3MUQA 1POY1 2FA7A 2IEEA 2XXQA 3PUYE 3T9UA 3O97A 1FTKA 3QIMA 1B58A 5JEIA 3PPNA 4NF8B 3I3VA 1JVXA 2RINA 1OIBA 2V25A 4POXA 4TOZA 2XXXA 4TLMB 1B5HA 4OXVA 4WXJA 1Y3QA 4XKNA 5EYFA 3KJ7A 1LCFA 4KYSA 4QHQA 1GGGA 5I2KB 4ECFA 1XVYA 3UK4A 4FATA 3PU5A 1B3HA 2Q88A 3IK6B 4KCDA 3TTKA 5LOMA 1SBPA 5EHSA 3D4CA 4QSCA 4BDQA 5HPQA 4OWDA 1IUDA 4RXLA 3BFTA 2X7PA 2F6PA 1B1XA 1B5JA 2F8DA 4H5FA 4FIMA 2E1SA 4P0IA 5I56B 3IB1A 3MC2A 3FXRA 4QRZA 1N04A 3N26A 4JB7A 2Q89A 4U21A 5K2XA 4U1OA 3OSRA 1EU8A 2O84X 4MLVA 4EQ7A 4F2QA 5I58B 5I59A 1JW1A 4FEBA 5CRYA 1MXVA 3Q28A 1LGBC 3LSWA 2PBWA 1B9JA 4F39A 1NL5A 3IOTA 4AB6A 2XXRA 3LSLA 5FHMA 3T9HB 1QVSA 1MDQA 2ESNA 3PUZE 4Q30B 3S9EA 5J1DA 3N94A 1B2HA 1ZLQA 4JWOA 3SKPA 3V83A 3FXUA 4R9FA 1DTZA 1B3LA 3K6WA 1TT1A 4GOTA 4YAHX 2A5TA 3C4MA 1GVCA 2KLFA 3MJNA 3MZ9A 1LFGA 3GXAA 2I48A 4LZ8A 2W7YA 2Y7IA 3E13X 4RA1A 4WEPA 3TQLA 3ZSFA 3RGYA 4Z7EA 4KR5A 1URGA 3KSXA 4GIZA 1BIYA 5FTHA 1XT8A 4PP0A 4I1DA 3K6XA 3KN8A 1MG1A 5DYHA 1DPPA 2G93A 3VXCA 1MXUA 4F3BA 4R72A 4ZEFA 1US4A 3DM0A 3MP8A 2OCUA 3O9PA 1MRPA 5AA1A 1JVYA 4C0RA 3TKDA 2I49A 4PQJA 2REGA 3MWBA 1YTVA 4O3AA 3SESA 1O7TA 4OENA 2HCAA 3TYHA 3RT8A 2I3VA 1II5A 2REJA 4EQBA 2RC9A 3IOWA 5I59B 1RYXA 2DE3A 3AXFA 3PMWA 5DEXB 5K2YA 4QFLA 4FJPA 3QK6A 3PPRA 4I62A 3TTMA 4EDPA 5AA4A 4NF4A 3LSFB 4R2BA 1AL3A 1Y1ZA 1NNTA 1SW5A 3A09A 2HAUA 3EN3A 5F1QA 2ALUA 1N76A 3U92A 3S9LC 3V89B 2XX9A 4QF9A 3TODA 1FQEA 3R6UA 4X1DA 3PPOA 3GBBA 2F78A 3S2VA 3CSBA 4MH5A 5CI5A 4P0GA 3KOTA 3W15C 3KG2A 4POWA 2VOZA 4K3FA 1DTGA 4NWDA 3DELB 3O66A 3EQ1A 4ELQA 3G7WA 2UVHA 3G3IA 4IO7A 3ZKLA 5KZTA 1I6AA 1R6ZA 2G29A 1R1NA 3KOSA 3VVEA 4R73A 2UVGA 4KFQA 1WVJA 4FEDA 4GVOA 1MQDA 1XVXA 1ZIUA 3HSTA 3IORA 3O6HA 4NF5B 1B3EA 1OVBA 1UTHA 4OETA 4DLDA 1UTBA 5BUUA 3ILUB 3EF7A 1PB8A 4YICA 5DVJA 4YKPA 2QS1A 3QUJA 2DYXA 3HHFA 2O51A 2OWSA 5DTBA 2DP8A 1LAHE 2O69A 1M5CA 2UVIA 4U4XA 4M1VA 3RY3A 2H25A 2OWTA 2RCAA 4EXKA 3LBSA 3DP6A 1YPNA 1LLSA 1IIWA 3A3CA 3DLNA 4IGTA 4NF4B 5DVFA 5DVIA 5DT6A 4ESXA 5ISUA 1AIVA 2Y7WA 2FYIA 2PX1A 3KGCA 3BKIB 4GD5A 3RN8A 3FVKA 1MPCA 1I69A 2E0SA 3FXQA 4ISUA 4HCYA 4G8MA 1FQFA 1FTLA 1LCTA 5H8FB 3K1MA 1F9BA 1WODA 4NF6A 4FAJA 1MDP1 1IXIA 4HCWA 3OO6A 1L5TA 4F19A 1QKAA 2ZXTA 4F2OA 3HN0A 1MY3A 3MVWA 4H65A 3TDJA 3TCGA 4L17A 2I4CA 1JEVA 2RCBA 2VP1A 3VE1B 2UYEA 4R75A 1OMPA 4DCXA 2NWJA 2YLNA 4GF8A 4LQ5A 3TTNA 2O7IA 4TLLB 3PPQA 2RC7A 3MQ9A 4LVQA 4I9DA 1CE2A 3CG3A 3ECRA 3KN7A 3LSXA 3PV0E 3LUYA 3MW0A 4QFOA 1B3FA 1P1WA 2AIXA 3CSGA 1B32A 4C1UA 1FQCA 3QYTA 5JK4A 3IOUA 1SD3A 3K01A 2H98A 3KFMA 4M4GA 4OVJA 3W9VA 1LB9A 1PEBA 1P1NA 2X26A 4U2RA 4GFRA 5KCJA 1XC1A 1PBQA 4DDDA 2HFBA 4HS7A 3OO7A 2ZYOA 1A7LA 1OLCA 4OTEA 5CMCA 2X7QA 3U93A 1MXZA 1H44A 1KWHA 1URSA 1BTJA 2QPQA 3ODBA 4XKRA 3IO6A 3GLBA 3RQTA 2GHAA 3EHSA 3N6TA 3TQWA 1BP5A 5HBCA 4F1UA 3QUFA 3B6TA 2ONRA 3RT6B 4OZ9A 1I6QA 2AYSA 2GHBA 3KN3A 2P0SA 2THIA 5TPAB 5FTIA 3G3JA 2QMWA 3C32A 3THIA 5BWJA 3RUMA 1A8EA 2O6AA 2A5TB 2Z22A 4IY6A 3K02A 4DXCA 4E0XA 4KCCA 3B7DA 4NEDA 3K0VA 3TFLA 1B40A 4ONYA 1LBBA 3DP8A 4ZDMA 2XXWA 4RK2A 1PDAA 2XD2A 3H03A 2PYYA 2VGQA 1FTOA 3LC8A 4ZZEA 3FV1A 4OEVA 4QFNA 3SEWA 5KCJB 1UIUA 3FATA 3TELA 1N0TA 1M5EA 1YCJA 2Y7PA 2UXAA 3VV5A 3TEPA 3PGFA 4TQUQ 1MS7A 1POTA 1BKAA 1ZKBA 3MVXA 1JQFA 3Q26A 4EUOA 4ZECA 1OLAA 1HSEA 4LZ7A 4E0WA 4YB7A 3OXNA 2PMSA 1IXHA 1RYOA 2XD3A 5TPAA 4ZEBA 3T66A 4F31B 4X9TA 1D9YA 3QSLA 2Z23A 1FW0A 2Z8EA 3VLVA 4F1VA 5L9OA 3ONMA 3M8UA 4Q5TA 4X48A 4ZEDA 4LA9A 4UACA 4H5GA 4JSOA 3G3KA 3H3GA 4G68A 1GTKA 3OEKA 3UP9A 1B4HA 2B3BA 4H1XA 1FTMA 3MBPA 4XXUA 1EZOA 2ZYKA 4ZEKA 4IO6A 1PBPA 4KYDA 1LB8A 1LSTA 1Y9UA 2IA4A 2QS3A 4ELPA 1AOVA 4F18A 1N84A 2OZZA 3RTWB 1EZPA 2BJJX 3O6IA 2CZLA 1S50A 4NWCA 3WAEA 3CFXA 3Q27A 3FUZA 3CRBA 3W9WA 4NF5A 4C1TA 4JXIA 4BDRA 5AA3A 3FVGA 2VHAA 2AL4A 4MLQA 5ICTA 1LFIA 1B7UA 1MXYA 3CR9A 4GQOA 3JYRA 1Z7NE 1PC3A 3SETA 3FD3A 2O68A 1OVTA 4GXSB 4NF6B 3G3GA 1ZJLA 2FNCA 3KJTA 1A40A 4PFUA 3OOAA 4PFYA 4UA8A 1HSJA 5H8HA 3SEVA 3PPPA 5ICQA 1H3DA 3D4GA 4GWOA 4MFIA 1VFEA 1GV8A 4RPNA 4ZS9A 2Z8DA 3OSQA 1QUJA 1QKBA 3FIRA 1SYHA 3F11A 3H06B 3G3FA 3L6GA 3CFLA 2OJTA 4G2ZA 4GXAA 4WKMA 5H8FA 1D4NA 3C35A 5I84A 5L9SA 2ZMBA 1IITA 1JEUA 1XS5A 3FJMA 4BDNA 3QAXA 4U1ZA 4BDMA 2AL5A 5A5XA 4RYAA 1H45A 2H5YA 2UVJA 1IZ1A 3FVNA 1LBCA 1A99A 4F22A 1B46A 2V3UA 5B7DA 3P7IA 5TP9A 3VLUA 1ZTYA 1XHYA 2I6EA 1P1QA 1MPDA 3CIJA 4U4SA 3H4ZA 5CM6A 4YKKA 2RF1A 3FJ7A 3WAFA 1LFHA 3Q25A 3B6WA 5DEXA 4IO3A 3CFZA 5FHOA 1USYE 4Q8RA 3VVDA 2UYFA 1NNKA 1UQWA 3OENA 5H8HB 3KBRA 4AB5A 4ELRA 3O6GA 4YZZA 3VFJA 5EHMA 3SEYA 2QMXA 2ZNUA 2Z8FA 3SDFA 1BLFA 2DXYA 4LP2B 4NE4A 4DXUA 4JWXA 1UIVA 4P11A 1MY1A 4NTLA 4GLIA 3MZ1A 2NVUB 1ELJA 3K1NA 1P99A 2ZNTA 1SVXB 3MP6A 2R71A 1QUIA 3L6HA 3GZGA 5ITPA 3HV1A 3MP1A 2YPNA 2ANJA 2H4IA 5L8DA 3UORA 5I2NA 2D5WA 2XXHA 4G68C 1LAGE 3U1OA 1O63A 4ESWA 1M5FA 3EPEA 3PD9A 4QSDA 1Z7ME 1N3WA 2I58A 3U8QA 3FASA 1A8FA 2OLBA 4MF3A 2P1SA 3OO9A 4OQOA 3PMVA 5M2VA 4RK9A 1NH7A 5F7VA 1UTHB 2F7AA 4ZEIA 5I56A 1UTBB 2I0BA 2HEUA 2HZKA 2XXYA 2Y84A 2DWIA 3K2DA 3O29A 4LQ2A 2GH9A 1B7HA 3T96B 3TAJA 3LR1A 4BDLA 5I58A 3KSJA 4HW8A 1I6BA 2VD2A 4IO4A 2Q2CA 1B0HA 4OYVA 4EF2A 3H7MA 1Y20A 3B6QA 1CB6A 2Q8JA 2DQVA 2F7CA 1FQBA 3H6WA 1H43A 2H9BA 3C9HA 4JWYA 4LUBA 2D21A 4LZ5A 1AMFA 3BBRA 3TPAA 1P1OA 1N7XA 1RKMA 4GL8A 1GR2A 2HZLA 1NKXA 1Y4TA 3OELA 5ITOA 2OK2A 2QSXA 5AE4A 4H6DA 1O64A 1OQHA 2DXRA 2XX8A 1MXWA 3C34A 1Y3NA 2XHDA 3RNNA 5CC2A 4OESA 4U23A 2XXTA 1JW4A 3FVOA
chains in the Genus database with same CATH superfamily
1DOTA 1YAEA 3MPKA 5I2NB 4F29A 1QULA 1EYKA 2QS2A 3VXBA 5HM4B 2OX3A 2D3IA 1EZ9A 2NUVA 5CBRA 2Y5KA 3U94A 5KDTA 2YJPA 4NN3A 5AA2B 2QRYA 2KR0A 4EXLA 4POXA 4G8NA 2F36A 1Q1KA 4XIGQ 1DPEA 4DXBA 1YXIA 2PFZA 3MSTA 3CI8A 2XXVA 1D3KA 4N13A 3HPIA 5H8SA 1B3GA 4DIGA 2F6GA 4OMBA 5ELVA 1B7ZA 3I5OA 1JW5A 2FIXA 1USYH 5H8NA 4OVTA 4KD5A 4PFTA 3IAZA 1LAFE 2CZHA 4WEDA 4BLAA 4UABA 3S9MC 2PT2A 3S4UA 1DMBA 2JJKA 3E4RA 4YKIA 3K00A 2P2AA 1H76A 2QJEA 4NG7A 1B1HA 1URDA 2Y7KA 4GRKA 2V84A 2HPGA 5A5LA 4JSDA 3FV2A 4PFWA 4O3BA 1QUKA 4FE8A 5FHNA 4ND9A 5JTYB 4XKQA 4OANA 4N07A 1R9LA 3M3FA 3T0JA 3H6UA 3TTLA 1ZBMA 2Q2AA 5L9SA 5CMMA 2XX7A 1SW1A 1FBCA 3T22A 3V8XB 3T93B 2VD3A 3OEMA 4ZZAA 4THIA 1N3XA 2GFEA 2OBGA 4OEUA 3TMGA 1NV6A 1MXXA 1IEJA 2I0CA 3IO4A 1LBWA 3KEIA 4GX3A 3O2AA 1FPBA 1VR5A 1B6HA 2NOOA 4R2FA 3PUVE 1ZMGA 1NH8A 4QXDA 4GL0A 1NMUA 4RJZA 1INPA 5AA2D 4Q0CA 1A54A 5J16A 4JVDA 1FJ9A 5AA2A 3CHGA 1POY1 2Q74A 3O97A 1B58A 5IZ3A 3I3VA 1JVXA 1OIBA 4F3SA 2XXXA 1B5HA 4XKNA 2GQ1A 4ECFA 1GGGA 5I2KB 1XVYA 4GWSA 3IK6B 5EHSA 1JP4A 3BFTA 2F6PA 1B5JA 4FIMA 4P0IA 4QRZA 1N04A 3N26A 2F3DA 2PFYA 4F2QA 4P9KA 1B9JA 1NL5A 3IOTA 4MX6A 2XXRA 3T9HB 5FHMA 5J1DA 3N94A 3FXUA 4R9FA 3K6WA 4GOTA 3MZ9A 5ET7A 2Y7IA 3RGYA 1XT8A 4PP0A 4I1DA 3K6XA 1DPPA 1MXUA 4JVCA 3TKDA 3MWBA 4O3AA 1II5A 2REJA 4MNPA 3IOWA 4QFLA 4EDPA 1SW5A 3U92A 3S9LC 4X1DA 1FBHA 3CSBA 1RDZA 1DTGA 4NWDA 2UVHA 3G3IA 4IO7A 2WYPA 1R1NA 4GVOA 1MQDA 1XVXA 1ZIUA 4NF5B 1OVBA 1UTHA 3ILUB 3EF7A 1PB8A 4YKPA 4MNIA 1FPLA 3HHFA 1LAHE 1M5CA 2P3VA 2ZZXA 2H25A 4IGTA 5DT6A 3KGCA 2QVRA 3RN8A 3BKIB 2E0SA 4ISUA 1LCTA 5H8FB 1F9BA 4FAJA 3OO6A 2VP1A 4DCXA 3TTNA 2RC7A 4LVQA 5IGAA 1CE2A 4MNCA 2AIXA 3CSGA 1FQCA 2XXKA 3W9VA 1SPIA 5KCJA 1XC1A 1PBQA 2HFBA 3U93A 2X7QA 1MXZA 2QPQA 1BTJA 3RQTA 2WBBA 3TQWA 4F1UA 2ONRA 1I6QA 4X8RA 3KN3A 4MIJA 2HXRA 2R8TA 3THIA 5BWJA 4DI3D 1LEVA 4E0XA 5I7IA 4KCCA 3B7DA 4P47A 3TFLA 2XWIA 3DP8A 4ZDMA 2XD2A 2PYYA 2FHYA 3SEWA 1LBVA 2UXAA 3VV5A 4TQUQ 1POTA 1ZKBA 1G0HA 4LZ7A 1DBZA 4YB7A 4GBVA 4F31B 1Q9DA 1D9YA 5L9OA 3VLVA 4X48A 4LA9A 4G68A 4N81A 2CEXA 1FTMA 4ZEKA 2IA4A 1AOVA 3O6IA 4MHFA 4BDRA 4GWUA 2AL4A 1B7UA 3NOHA 1FJ6A 1PC3A 3FD3A 4GXSB 4LN5A 1ZJLA 2FBPA 3D4GA 1GV8A 4RPNA 2Z8DA 3OSQA 4GWWA 2CZIA 4GXAA 2OJTA 1IITA 3FJMA 4U1ZA 3FVNA 2V3UA 5B7DA 4PGPA 5F24A 1XHYA 5CM6A 3CIJA 4YKKA 3FJ7A 1LFHA 3CFZA 2OWZA 3KC0A 3VVDA 4AB5A 5H8HB 3KBRA 4YZZA 5EHMA 3B8BA 1MY1A 5FBPA 2NVUB 3L6HA 3HV1A 3MP1A 2D5WA 4G68C 1NUXA 4QSDA 1Z7ME 4O7MA 3FASA 2OLBA 3OO9A 2F7AA 2XXYA 1YZ0A 2Q2CA 1B0HA 4OYVA 4LUBA 3ISPA 2D21A 1KA1A 1NKXA 1Y4TA 1G0IA 5EYGA 2XX8A 3C34A 4U23A 2XXTA 1QGXA 4XKPA 3K4UA 3VLWA 2HAVA 1EH3A 3MVZA 1TFAA 3A29A 5H8QA 4MBPA 3ZKKA 3N5LA 3TTRA 2ZYNA 1MH3A 4NAPA 2ABHA 2O1MA 3EKIA 3FGSA 3RLFE 1DSNA 3GBAA 3PUWE 3E78A 1MPBA 2WYKA 1NNFA 3JZJA 2A5SA 2M8CA 2PT1A 4LATA 2HQ0A 3C36A 2LAOA 1NNPA 3R7XA 1B0LA 1FQAA 3OD7A 4F3GA 5B70A 3H6VA 1MQHA 1FTAA 2H99A 4YB5A 2F3BA 1NV2A 5I2KA 3EHUA 3I6VA 1FTJA 5KDTB 4EF1A 4QSEA 4F3PA 3E9XA 4GWZA 1NUYA 2DWJA 3HCQA 1P1UA 1MQGA 1KZ8A 2DOJA 2XXUA 2ZYMA 2V3QA 1A55A 3IJOB 4R9GA 3SEXA 4G68B 3A3UA 1RDYA 4H8IA 5ESYA 2QL3A 3DP4A 4R6HA 4IGRA 2Y5LA 2F5XA 5H8NB 1J1NA 1Q35A 2ZZVA 1QJMA 3PMXA 1D9VA 2B3FA 3U72A 1WDNA 3UN6A 3K6VA 4PFRA 5DW8A 1IXCA 4G77A 3O28A 1K9ZA 3IL1B 5IZ1A 3G3HA 4MCOA 2I3WA 1S9TA 3HO7A 4OFJA 4NHBA 1Y3PA 4FORA 3MPLA 3USDA 4PF8A 1B4ZA 4X04A 1TXFA 4PDHA 5ET5A 2Y7RA 4XTCQ 3TZAA 3RPWA 3T1BA 5CBSA 4H8JA 3VVFA 2B65A 4KI0E 2GRVA 2V3TA 2FA7A 1XI6A 4NF8B 2V25A 1LCFA 4QHQA 4FATA 2ZZWA 3D4CA 4QSCA 1IUDA 4RXLA 2X7PA 2F8DA 2FVZA 4H5FA 5KZTA 3IB1A 5K2XA 1K9YA 3OSRA 5I59A 1LGBC 2PBWA 1KA0A 1QVSA 1MDQA 2ESNA 4Q30B 1B2HA 4JWOA 1LBZA 1B3LA 4OVRA 1FBGA 2KLFA 3MJNA 1LFGA 3GXAA 4RA1A 3E13X 4GIZA 5FTHA 4OVPA 4N6DA 2G93A 1US4A 3O9PA 3MYUA 2OCUA 1MRPA 1O7TA 4OENA 3TYHA 2I3VA 4EQBA 2QVVA 2RC9A 2DE3A 5DEXB 3PPRA 4I62A 3LSFB 1N76A 3V89B 1FQEA 3PPOA 4MH5A 4P0GA 3KOTA 3KG2A 4POWA 3O66A 3G7WA 3SZPA 1I6AA 3VVEA 4R73A 1GVCA 1WVJA 4OETA 3IORA 4DLDA 2XWOA 2O51A 5DTBA 4U4XA 3BIHA 1YPNA 3A3CA 1NV4A 4ESXA 4P56A 1FQFA 1WODA 1MDP1 1IXIA 1L5TA 3HN0A 1FPEA 4NQ8A 2RCBA 3VE1B 2UYEA 1OMPA 4LQ5A 1FBEA 2MKZA 4OQOA 3KN7A 3PV0E 3LUYA 3MW0A 4QFOA 1FSAA 1VDWA 4OVJA 4M4GA 3QMFA 5CMCA 4OTEA 1A7LA 1IMBA 3IO6A 4P1LA 3EHSA 1IMEA 1BP5A 3RT6B 2AYSA 5TPAB 2QMWA 3C32A 2A5TB 1B40A 1LBBA 1DK4A 3BIGA 5I5PA 3H03A 1NV3A 3TELA 1M5EA 1YCJA 3TEPA 4EUOA 1JQFA 3Q26A 1HSEA 4PTKA 2PMSA 3T66A 1FRPA 2Z23A 4F1VA 4ZEDA 4JSOA 3G3KA 4H1XA 4XXUA 3MBPA 1EZOA 2ZYKA 4KYDA 1Y9UA 4ELPA 1N84A 1EZPA 2CZLA 4NWCA 3CRBA 3FVGA 4MLQA 1LFIA 1MXYA 3CR9A 4GQOA 3SETA 1OVTA 4NF6B 1FBFA 4GBWA 4H46A 4ZS9A 1SYHA 3FBPA 1JEUA 1XS5A 4O8MA 4RYAA 2H5YA 2UVJA 4F22A 3P7IA 5TP9A 4HE0A 4PFBA 1MPDA 4N4UA 3H4ZA 4PBHA 1UQWA 1FBPA 3VFJA 3SEYA 2Z8FA 4LP2B 1UIVA 4NTLA 4GLIA 1ELJA 2ZNTA 3MP6A 1QUIA 5ITPA 2YPNA 5L8DA 5I2NA 2XXHA 3U1OA 1M5FA 4MF3A 5I56A 1UTHB 4N8YA 2VPNA 2I0BA 4LQ2A 2Y84A 3TAJA 1B7HA 4HW8A 1FPJA 4LZ5A 3BBRA 3TPAA 1P1OA 1N7XA 4GL8A 5ITOA 4H67A 3OO8A 3TCFA 3MAMA 4YU0A 2XWVA 3IOVA 3B50A 3KZGA 4R6KA 1XOCA 3Q29A 1SI1A 2R9JA 2BJIA 2F35A 1NV0A 1ANFA 4G4PA 4NF8A 4PC9A 3PUXE 2DE4A 4H0WA 5A5XB 1VSOA 2CMOA 4HTGA 4YB6A 4ZE8A 1MH4A 4N6PA 4AQ4A 4N15A 1M5DA 4Z0IA 1NUZA 4LONB 1VE4A 4PF6A 4R6YA 3K6UA 3RTFB 4G61A 5TU0A 4GWYA 5TP9B 2HXWA 1MM7A 2DE2A 3CG1A 4PE3A 2RKMA 4OVSA 3V5AA 4IY5A 1JETA 4P8BA 2PVUA 4OERA 4NMYA 2R6GE 4RNSA 2DSFA 1Y1MA 1M5BA 4QFPA 4HXVA 3VDFA 1TFDA 3TCHA 1AH5A 5ET8A 5CMBA 1MY2A 2WKYA 1SYIA 3D1RA 1MQJA 4G8HA 4BDOA 3M3LA 3FZVA 1MY4A 2NXOA 4FECA 1IXGA 3T9XB 4YMBA 4AS4A 4O3CA 1HSLA 2DVCA 4KQPA 4KPTA 4RPOA 1SI0A 3EHTA 3SERA 2ZNSA 4YKJA 4YMAA 1FCKA 4OFLA 5JTYA 4OFOA 3QXMA 2O7UA 4ELOA 1T0KA 4PAIA 3R26A 2XXIA 4IO2A 4RY1A 1PB7A 1NV5A 3IB2A 3T9VA 3KBZA 4PGNA 2O1LA 4KYEA 4DI4B 1B52A 1FQDA 5I57B 1B05A 4DCYA 1SQYA 3MUQA 3PUYE 2XXQA 1FTKA 4MAGA 4TOZA 4WXJA 4OXVA 5EYFA 1Y3QA 3KJ7A 4KYSA 3UK4A 3PU5A 5IZZA 5I56B 3MC2A 3KC1A 3FXRA 4U21A 1EYIA 1IMDA 2O84X 5CRYA 3FXBA 3Q28A 3LSWA 4AB6A 2WBDA 3S9EA 3V83A 4YAHX 2A5TA 1D9QA 2W7YA 3VXCA 4F3BA 4R72A 1JVYA 1IMAA 1YTVA 2HCAA 5I59B 3AXFA 3PMWA 5K2YA 1FPKA 4FJPA 3QK6A 5AA4A 4NF4A 4R2BA 1Y1ZA 5F1QA 2HAUA 2ALUA 2XX9A 3TODA 4PFIA 4GWXA 4I3YA 3S2VA 2F78A 4MMPA 1AWBA 5CI5A 3W15C 3IFAA 2VOZA 4K3FA 3DELB 4ELQA 3ZKLA 1CNQA 3KOSA 4KXPA 4R74A 2UVGA 4FEDA 3HSTA 2XA5A 1B3EA 1UTBA 4YICA 5DVJA 5EQ7A 2DYXA 2O69A 2UVIA 4M1VA 3LBSA 3DP6A 3DLNA 5DVIA 5DVFA 2Y7WA 2FYIA 2PX1A 4GD5A 1MPCA 1I69A 3FXQA 4HCYA 1FTLA 2HHMA 1QKAA 2ZXTA 4F2OA 3TDJA 3TCGA 2I4CA 2NWJA 4GF8A 2O7IA 5T3JA 3PPQA 4F1YA 3MQ9A 4I9DA 3CG3A 3ECRA 3LSXA 1B3FA 1P1WA 1B32A 4C1UA 5JK4A 3QYTA 1LB9A 1P1NA 2X26A 4GFRA 4HS7A 2ZYOA 1H44A 1KWHA 3ODBA 2FIEA 3N6TA 4O7IA 5HBCA 3QUFA 2P0SA 2THIA 3RUMA 4IY6A 4PBQA 4ONYA 1BK4A 4RK2A 1PDAA 2DDKA 4ZZEA 3FV1A 4OEVA 5KCJB 3FATA 3PGFA 1OLAA 4HE2A 3OXNA 1IXHA 5TPAA 4ZEBA 4XF5A 1FW0A 2Z8EA 3ONMA 3M8UA 4FBPA 1IMFA 1RDXA 1GTKA 3UP9A 2B3BA 4O94A 1PBPA 2QS3A 4F18A 2OZZA 2BJJX 3WAEA 3CFXA 3FUZA 4JXIA 5AA3A 2VHAA 3JYRA 3HFUA 3KJTA 4UA8A 1A40A 3SEVA 3OOAA 3PPPA 5ICQA 4GWOA 4MFIA 1QUJA 3L6GA 3F11A 3G3FA 4WKMA 5I84A 3C35A 2ZMBA 4BDNA 4BDMA 5A5XA 1IZ1A 1LBCA 5ET6A 1IMCA 2I6EA 4N6KA 4U4SA 1FPGA 4IR8A 3WAFA 5DEXA 4IO3A 5FHOA 3O6GA 2QMXA 2ZNUA 1NI9A 5LTCA 3K1NA 1P99A 3GZGA 4I3EA 2ANJA 3UORA 1LAGE 1N3WA 3U8QA 1A8FA 2P1SA 4RK9A 1NH7A 5F7VA 4ZEIA 2HZKA 2HEUA 3K2DA 5LOMA 2DWIA 5I58A 2GH9A 4AS5A 2VD2A 4IO4A 2V4CA 4EF2A 3H7MA 3B6QA 2F7CA 1FQBA 3H6WA 2H9BA 3C9HA 4QBAA 1GR2A 3OELA 2QSXA 1O64A 1OQHA 2DXRA 3LUZA 4OESA 4N91A 4GX4A 1MY0A 5EQAA 2WX9A 2DWAA 3N6UA 1IQ7A 1SDXA 1YYZA 4ZE9A 3S9NC 1R9QA 3E3KA 5I57A 3IB0A 3IR1A 1MM6A 1QW0A 1PB9A 1US5A 2RC8A 3IX1A 1LBXA 4JDFA 4PE5B 4DZ1A 5IAIA 4P1EA 4PAFA 5H8QB 1SW4A 4MJOA 2Q8MA 4JBZA 1B51A 1JNFA 4GX6A 3SEUA 1ATGA 4PDDA 2F97A 4NGUA 2QFLA 2DWHA 2P3NA 3UA8A 4I8CA 5L9MA 2V93A 3MZBA 4EQ9A 2DS9A 4IO5A 1TWYA 2F34A 4DE8A 4U22A 4X1BA 4QFKA 1MQIA 2I4BA 3K1PA 1NFTA 2ONSA 4KHZE 1B5IA 3UIFA 2ONKE 2Q9TA 3C33A 3U65A 1S7YA 1VFDA 3HHGA 1FPDA 3UGWA 5AA4B 3FJGA 5IKBA 3M3KA 4OHNA 4PETA 3BFUA 1N7WA 3LV0A 2XXPA 3C31A 4IB2A 3TUSA 1OQGA 1LAXA 3MVYA 2F7BA 1ZU0A 3H6TA 3ILTB 2QS4A 4PCDA 1Y4CA 2DVZA 4OVQA 2B4LA 1SW2A 3PD8A 3ZS6A 3IJXB 3OMBA 3CVGA 3JV9A 2IEEA 3T9UA 3QIMA 5JEIA 3PPNA 4XFEA 4NX1A 2RINA 4TLMB 3T96B 5CMKA 1B3HA 2Q88A 2VPOA 4KCDA 3TTKA 1SBPA 4BDQA 5HPQA 4OWDA 1B1XA 2E1SA 4JB7A 2Q89A 5I58B 4U1OA 4MLVA 1EU8A 4EQ7A 1JW1A 4FEBA 1MXVA 4F39A 3LSLA 3PUZE 1ZLQA 3SKPA 1NUWA 1DTZA 1TT1A 3C4MA 2I48A 4N8GA 4LZ8A 3ZSFA 4WEPA 4Z7EA 3TQLA 4KR5A 1URGA 3KSXA 1BIYA 3KN8A 1MG1A 5DYHA 4ZEFA 3DM0A 3MP8A 5AA1A 4C0RA 2I49A 4PQJA 2REGA 3SESA 3RT8A 1RYXA 3TTMA 5EYHA 1AL3A 1NNTA 3A09A 3EN3A 4QF9A 3R6UA 4P3LA 1DCUA 3RPLA 3GBBA 3E79A 4OA4A 1FPFA 2PCRA 3EQ1A 1EYJA 1R6ZA 2G29A 4KFQA 3O6HA 5BUUA 4JVIA 1LBYA 2QS1A 3QUJA 2OWSA 3RY3A 2DP8A 2OWTA 2RCAA 4EXKA 1LLSA 1IIWA 4NF4B 5ISUA 1AIVA 3GYYA 3FVKA 4NF0A 4G8MA 3K1MA 4NF6A 4HCWA 4F19A 2VT5A 3PTYA 3MVWA 1MY3A 4H65A 3ROJA 4L17A 1JEVA 4R75A 2YLNA 1FBDA 5IZ3B 4TLLB 3IOUA 1SD3A 3K01A 2H98A 3KFMA 4U2RA 1PEBA 5EQ9A 4DDDA 3OO7A 1OLCA 4XKRA 1URSA 2KQZA 3GLBA 2GHAA 1FPIA 5IM2A 3B6TA 4OZ9A 2GHBA 5FTIA 3G3JA 1A8EA 2O6AA 2Z22A 4DXCA 3K02A 4NEDA 3K0VA 3IFCA 2XXWA 2VGQA 1FTOA 3LC8A 4QFNA 5I3SA 1UIUA 1N0TA 2Y7PA 1MS7A 1BKAA 3MVXA 4ZECA 4E0WA 4H45A 5LDZA 1RYOA 2XD3A 4XEQA 4X9TA 3QSLA 4Q5TA 4UACA 3RPLB 4H5GA 2B4MA 3H3GA 3OEKA 1B4HA 2CEYA 4IO6A 1LB8A 1LSTA 3RTWB 2XWKA 1S50A 3Q27A 3W9WA 4NF5A 4C1TA 5ICTA 1Z7NE 2O68A 3G3GA 2FNCA 5H8HA 4PFUA 4PFYA 1HSJA 1H3DA 1VFEA 3RYDA 3FIRA 4G2ZA 1QKBA 3H06B 4MEVA 5H8FA 3CFLA 1D4NA 5EQ8A 1NV7A 3QAXA 2WEFA 2AL5A 1H45A 1A99A 1B46A 3VLUA 1ZTYA 1P1QA 4PAKA 4HE1A 2L5VA 2RF1A 3Q25A 3B6WA 1USYE 4Q8RA 2UYFA 1NNKA 3OENA 4ELRA 3SDFA 1BLFA 2DXYA 4NE4A 2QVUA 4JWXA 4P11A 4DXUA 3MZ1A 1SVXB 2R71A 2H4IA 4ESWA 1O63A 3EPEA 3PD9A 2CZKA 2I58A 4I40A 3PMVA 5M2VA 1NV1A 1UTBB 3O29A 4BDLA 3LR1A 3KSJA 1I6BA 1Y20A 4N17A 2Q8JA 1CB6A 2DQVA 4JWYA 1H43A 5AE4A 1AMFA 1RKMA 2HZLA 2OK2A 4H6DA 1MXWA 3RNNA 1Y3NA 2XHDA 5CC2A 1JW4A 3FVOA
chains in the Genus database with same CATH topology
4XKPA 1DOTA 1MY0A 1YAEA 3K4UA 3MPKA 5I2NB 3VLWA 4H67A 2HAVA 3OO8A 1EH3A 3MVZA 3TCFA 3MAMA 4F29A 1TFAA 1QULA 4YU0A 5H8QA 2DWAA 2QS2A 3N6UA 4MBPA 3VXBA 5HM4B 2D3IA 3ZKKA 1IQ7A 1SDXA 3IOVA 1EZ9A 3N5LA 2NUVA 4ZE9A 3S9NC 3TTRA 5CBRA 2ZYNA 1R9QA 1MH3A 3U94A 3E3KA 3KZGA 4R6KA 5I57A 5KDTA 3IB0A 2ABHA 3IR1A 1XOCA 1MM6A 2YJPA 3Q29A 2O1MA 1SI1A 1QW0A 3FGSA 1PB9A 2R9JA 5AA2B 1US5A 2QRYA 3RLFE 2F35A 2RC8A 1DSNA 3IX1A 4EXLA 3GBAA 1ANFA 3PUWE 4G4PA 1MPBA 2F36A 1NNFA 3JZJA 4G8NA 2A5SA 4NF8A 1Q1KA 2M8CA 2PT1A 3PUXE 4JDFA 4LATA 4XIGQ 2DE4A 4PE5B 1DPEA 4H0WA 4DZ1A 4DXBA 2HQ0A 5A5XB 3C36A 2LAOA 1NNPA 1VSOA 1B0LA 1FQAA 3R7XA 3OD7A 4F3SA 5IAIA 4F3GA 2CMOA 5B70A 4HTGA 3CI8A 2XXVA 4YB6A 5H8QB 1D3KA 4ZE8A 1SW4A 3H6VA 1MQHA 1MH4A 2H99A 4N6PA 4JBZA 4AQ4A 4N13A 1M5DA 4YB5A 4Z0IA 1B51A 3HPIA 5H8SA 1B3GA 4LONB 5I2KA 1JNFA 1VE4A 3EHUA 4DIGA 3I6VA 5H8NB 2F6GA 4OMBA 1FTJA 4R6YA 3K6UA 1ATGA 3RTFB 3SEUA 5ELVA 1B7ZA 3I5OA 2F97A 5TU0A 5KDTB 1JW5A 4EF1A 5TP9B 1USYH 2HXWA 1MM7A 2DWHA 3E9XA 4QSEA 5H8NA 3UA8A 2DE2A 4F3PA 3CG1A 4I8CA 2DWJA 4KD5A 5L9MA 4PFTA 3IAZA 1LAFE 3HCQA 4WEDA 4BLAA 2RKMA 3S9MC 3V5AA 2PT2A 2V93A 1DMBA 1P1UA 3E4RA 4IY5A 3S4UA 4YKIA 1JETA 1MQGA 3K00A 3MZBA 2DOJA 2P2AA 1H76A 2QJEA 2XXUA 1B1HA 4EQ9A 1URDA 2DS9A 2ZYMA 4IO5A 2V3QA 2PVUA 2Y7KA 4GRKA 1A55A 1TWYA 2V84A 2F34A 4JSDA 4NMYA 3FV2A 3IJOB 4OERA 4PFWA 4DE8A 4O3BA 4R9GA 3SEXA 1QUKA 2R6GE 4FE8A 3A3UA 4G68B 4RNSA 4ND9A 2DSFA 4U22A 5FHNA 5JTYB 1Y1MA 1M5BA 4QFPA 4X1BA 3VDFA 4XKQA 1TFDA 4N07A 1R9LA 3M3FA 4H8IA 4QFKA 3TCHA 1AH5A 3H6UA 2QL3A 1MQIA 3DP4A 4R6HA 3TTLA 5CMBA 4IGRA 1ZBMA 2Q2AA 2I4BA 2F5XA 3K1PA 1MY2A 2WKYA 1SYIA 1NFTA 1MQJA 1J1NA 2ONSA 4G8HA 1Q35A 4KHZE 4BDOA 3M3LA 3FZVA 1B5IA 3UIFA 2ONKE 4F1YA 1MY4A 2NXOA 4FECA 2Q9TA 1QJMA 3PMXA 5CMMA 1D9VA 1IXGA 2XX7A 3C33A 3T9XB 4YMBA 1S7YA 1SW1A 1VFDA 2B3FA 3HHGA 3T22A 3U72A 3UGWA 5AA4B 1WDNA 3FJGA 3M3KA 4O3CA 3V8XB 5IKBA 1HSLA 3T93B 3UN6A 2DVCA 2VD3A 4KQPA 3K6VA 4OHNA 4PETA 1IXCA 4KPTA 4RPOA 4G77A 1SI0A 3BFUA 3OEMA 4ZZAA 4THIA 3EHTA 1N3XA 1N7WA 2GFEA 2ZNSA 3O28A 4YKJA 3IL1B 2XXPA 3SERA 2OBGA 3C31A 4YMAA 3G3HA 4IB2A 1FCKA 2I3WA 1S9TA 3HO7A 4OFJA 4OEUA 4OFLA 4OFOA 5JTYA 3TMGA 3TUSA 1Y3PA 1MXXA 4FORA 1IEJA 2O7UA 3QXMA 1OQGA 3MPLA 1LAXA 2I0CA 3USDA 4ELOA 1B4ZA 3IO4A 3MVYA 3R26A 1T0KA 2F7BA 2XXIA 1ZU0A 3KEIA 3O2AA 1TXFA 1VR5A 1B6HA 2NOOA 3H6TA 3ILTB 2QS4A 1PB7A 3PUVE 4IO2A 4R2FA 4RY1A 5CMKA 1Y4CA 2DVZA 1ZMGA 2Y7RA 3IB2A 3T9VA 4XTCQ 2O1LA 1NH8A 1SW2A 4GL0A 4KYEA 3RPWA 1NMUA 3TZAA 1B52A 4RJZA 3PD8A 1FQDA 4R74A 5CBSA 5I57B 3ZS6A 3IJXB 5AA2D 4Q0CA 4H8JA 3OMBA 1A54A 3CVGA 3VVFA 1B05A 2B65A 1SQYA 4KI0E 4DCYA 5AA2A 2GRVA 2V3TA 3JV9A 3MUQA 1POY1 2FA7A 2IEEA 2XXQA 3PUYE 3T9UA 3O97A 1FTKA 3QIMA 1B58A 5JEIA 3PPNA 4NF8B 3I3VA 1JVXA 2RINA 1OIBA 2V25A 4POXA 4TOZA 2XXXA 4TLMB 1B5HA 4OXVA 4WXJA 1Y3QA 4XKNA 5EYFA 3KJ7A 1LCFA 4KYSA 4QHQA 1GGGA 5I2KB 4ECFA 1XVYA 3UK4A 4FATA 3PU5A 1B3HA 2Q88A 3IK6B 4KCDA 3TTKA 5LOMA 1SBPA 5EHSA 3D4CA 4QSCA 4BDQA 5HPQA 4OWDA 1IUDA 4RXLA 3BFTA 2X7PA 2F6PA 1B1XA 1B5JA 2F8DA 4H5FA 4FIMA 2E1SA 4P0IA 5I56B 3IB1A 3MC2A 3FXRA 4QRZA 1N04A 3N26A 4JB7A 2Q89A 4U21A 5K2XA 4U1OA 3OSRA 1EU8A 2O84X 4MLVA 4EQ7A 4F2QA 5I58B 5I59A 1JW1A 4FEBA 5CRYA 1MXVA 3Q28A 1LGBC 3LSWA 2PBWA 1B9JA 4F39A 1NL5A 3IOTA 4AB6A 2XXRA 3LSLA 5FHMA 3T9HB 1QVSA 1MDQA 2ESNA 3PUZE 4Q30B 3S9EA 5J1DA 3N94A 1B2HA 1ZLQA 4JWOA 3SKPA 3V83A 3FXUA 4R9FA 1DTZA 1B3LA 3K6WA 1TT1A 4GOTA 4YAHX 2A5TA 3C4MA 1GVCA 2KLFA 3MJNA 3MZ9A 1LFGA 3GXAA 2I48A 4LZ8A 2W7YA 2Y7IA 3E13X 4RA1A 4WEPA 3TQLA 3ZSFA 3RGYA 4Z7EA 4KR5A 1URGA 3KSXA 4GIZA 1BIYA 5FTHA 1XT8A 4PP0A 4I1DA 3K6XA 3KN8A 1MG1A 5DYHA 1DPPA 2G93A 3VXCA 1MXUA 4F3BA 4R72A 4ZEFA 1US4A 3DM0A 3MP8A 2OCUA 3O9PA 1MRPA 5AA1A 1JVYA 4C0RA 3TKDA 2I49A 4PQJA 2REGA 3MWBA 1YTVA 4O3AA 3SESA 1O7TA 4OENA 2HCAA 3TYHA 3RT8A 2I3VA 1II5A 2REJA 4EQBA 2RC9A 3IOWA 5I59B 1RYXA 2DE3A 3AXFA 3PMWA 5DEXB 5K2YA 4QFLA 4FJPA 3QK6A 3PPRA 4I62A 3TTMA 4EDPA 5AA4A 4NF4A 3LSFB 4R2BA 1AL3A 1Y1ZA 1NNTA 1SW5A 3A09A 2HAUA 3EN3A 5F1QA 2ALUA 1N76A 3U92A 3S9LC 3V89B 2XX9A 4QF9A 3TODA 1FQEA 3R6UA 4X1DA 3PPOA 3GBBA 2F78A 3S2VA 3CSBA 4MH5A 5CI5A 4P0GA 3KOTA 3W15C 3KG2A 4POWA 2VOZA 4K3FA 1DTGA 4NWDA 3DELB 3O66A 3EQ1A 4ELQA 3G7WA 2UVHA 3G3IA 4IO7A 3ZKLA 5KZTA 1I6AA 1R6ZA 2G29A 1R1NA 3KOSA 3VVEA 4R73A 2UVGA 4KFQA 1WVJA 4FEDA 4GVOA 1MQDA 1XVXA 1ZIUA 3HSTA 3IORA 3O6HA 4NF5B 1B3EA 1OVBA 1UTHA 4OETA 4DLDA 1UTBA 5BUUA 3ILUB 3EF7A 1PB8A 4YICA 5DVJA 4YKPA 2QS1A 3QUJA 2DYXA 3HHFA 2O51A 2OWSA 5DTBA 2DP8A 1LAHE 2O69A 1M5CA 2UVIA 4U4XA 4M1VA 3RY3A 2H25A 2OWTA 2RCAA 4EXKA 3LBSA 3DP6A 1YPNA 1LLSA 1IIWA 3A3CA 3DLNA 4IGTA 4NF4B 5DVFA 5DVIA 5DT6A 4ESXA 5ISUA 1AIVA 2Y7WA 2FYIA 2PX1A 3KGCA 3BKIB 4GD5A 3RN8A 3FVKA 1MPCA 1I69A 2E0SA 3FXQA 4ISUA 4HCYA 4G8MA 1FQFA 1FTLA 1LCTA 5H8FB 3K1MA 1F9BA 1WODA 4NF6A 4FAJA 1MDP1 1IXIA 4HCWA 3OO6A 1L5TA 4F19A 1QKAA 2ZXTA 4F2OA 3HN0A 1MY3A 3MVWA 4H65A 3TDJA 3TCGA 4L17A 2I4CA 1JEVA 2RCBA 2VP1A 3VE1B 2UYEA 4R75A 1OMPA 4DCXA 2NWJA 2YLNA 4GF8A 4LQ5A 3TTNA 2O7IA 4TLLB 3PPQA 2RC7A 3MQ9A 4LVQA 4I9DA 1CE2A 3CG3A 3ECRA 3KN7A 3LSXA 3PV0E 3LUYA 3MW0A 4QFOA 1B3FA 1P1WA 2AIXA 3CSGA 1B32A 4C1UA 1FQCA 3QYTA 5JK4A 3IOUA 1SD3A 3K01A 2H98A 3KFMA 4M4GA 4OVJA 3W9VA 1LB9A 1PEBA 1P1NA 2X26A 4U2RA 4GFRA 5KCJA 1XC1A 1PBQA 4DDDA 2HFBA 4HS7A 3OO7A 2ZYOA 1A7LA 1OLCA 4OTEA 5CMCA 2X7QA 3U93A 1MXZA 1H44A 1KWHA 1URSA 1BTJA 2QPQA 3ODBA 4XKRA 3IO6A 3GLBA 3RQTA 2GHAA 3EHSA 3N6TA 3TQWA 1BP5A 5HBCA 4F1UA 3QUFA 3B6TA 2ONRA 3RT6B 4OZ9A 1I6QA 2AYSA 2GHBA 3KN3A 2P0SA 2THIA 5TPAB 5FTIA 3G3JA 2QMWA 3C32A 3THIA 5BWJA 3RUMA 1A8EA 2O6AA 2A5TB 2Z22A 4IY6A 3K02A 4DXCA 4E0XA 4KCCA 3B7DA 4NEDA 3K0VA 3TFLA 1B40A 4ONYA 1LBBA 3DP8A 4ZDMA 2XXWA 4RK2A 1PDAA 2XD2A 3H03A 2PYYA 2VGQA 1FTOA 3LC8A 4ZZEA 3FV1A 4OEVA 4QFNA 3SEWA 5KCJB 1UIUA 3FATA 3TELA 1N0TA 1M5EA 1YCJA 2Y7PA 2UXAA 3VV5A 3TEPA 3PGFA 4TQUQ 1MS7A 1POTA 1BKAA 1ZKBA 3MVXA 1JQFA 3Q26A 4EUOA 4ZECA 1OLAA 1HSEA 4LZ7A 4E0WA 4YB7A 3OXNA 2PMSA 1IXHA 1RYOA 2XD3A 5TPAA 4ZEBA 3T66A 4F31B 4X9TA 1D9YA 3QSLA 2Z23A 1FW0A 2Z8EA 3VLVA 4F1VA 5L9OA 3ONMA 3M8UA 4Q5TA 4X48A 4ZEDA 4LA9A 4UACA 4H5GA 4JSOA 3G3KA 3H3GA 4G68A 1GTKA 3OEKA 3UP9A 1B4HA 2B3BA 4H1XA 1FTMA 3MBPA 4XXUA 1EZOA 2ZYKA 4ZEKA 4IO6A 1PBPA 4KYDA 1LB8A 1LSTA 1Y9UA 2IA4A 2QS3A 4ELPA 1AOVA 4F18A 1N84A 2OZZA 3RTWB 1EZPA 2BJJX 3O6IA 2CZLA 1S50A 4NWCA 3WAEA 3CFXA 3Q27A 3FUZA 3CRBA 3W9WA 4NF5A 4C1TA 4JXIA 4BDRA 5AA3A 3FVGA 2VHAA 2AL4A 4MLQA 5ICTA 1LFIA 1B7UA 1MXYA 3CR9A 4GQOA 3JYRA 1Z7NE 1PC3A 3SETA 3FD3A 2O68A 1OVTA 4GXSB 4NF6B 3G3GA 1ZJLA 2FNCA 3KJTA 1A40A 4PFUA 3OOAA 4PFYA 4UA8A 1HSJA 5H8HA 3SEVA 3PPPA 5ICQA 1H3DA 3D4GA 4GWOA 4MFIA 1VFEA 1GV8A 4RPNA 4ZS9A 2Z8DA 3OSQA 1QUJA 1QKBA 3FIRA 1SYHA 3F11A 3H06B 3G3FA 3L6GA 3CFLA 2OJTA 4G2ZA 4GXAA 4WKMA 5H8FA 1D4NA 3C35A 5I84A 5L9SA 2ZMBA 1IITA 1JEUA 1XS5A 3FJMA 4BDNA 3QAXA 4U1ZA 4BDMA 2AL5A 5A5XA 4RYAA 1H45A 2H5YA 2UVJA 1IZ1A 3FVNA 1LBCA 1A99A 4F22A 1B46A 2V3UA 5B7DA 3P7IA 5TP9A 3VLUA 1ZTYA 1XHYA 2I6EA 1P1QA 1MPDA 3CIJA 4U4SA 3H4ZA 5CM6A 4YKKA 2RF1A 3FJ7A 3WAFA 1LFHA 3Q25A 3B6WA 5DEXA 4IO3A 3CFZA 5FHOA 1USYE 4Q8RA 3VVDA 2UYFA 1NNKA 1UQWA 3OENA 5H8HB 3KBRA 4AB5A 4ELRA 3O6GA 4YZZA 3VFJA 5EHMA 3SEYA 2QMXA 2ZNUA 2Z8FA 3SDFA 1BLFA 2DXYA 4LP2B 4NE4A 4DXUA 4JWXA 1UIVA 4P11A 1MY1A 4NTLA 4GLIA 3MZ1A 2NVUB 1ELJA 3K1NA 1P99A 2ZNTA 1SVXB 3MP6A 2R71A 1QUIA 3L6HA 3GZGA 5ITPA 3HV1A 3MP1A 2YPNA 2ANJA 2H4IA 5L8DA 3UORA 5I2NA 2D5WA 2XXHA 4G68C 1LAGE 3U1OA 1O63A 4ESWA 1M5FA 3EPEA 3PD9A 4QSDA 1Z7ME 1N3WA 2I58A 3U8QA 3FASA 1A8FA 2OLBA 4MF3A 2P1SA 3OO9A 4OQOA 3PMVA 5M2VA 4RK9A 1NH7A 5F7VA 1UTHB 2F7AA 4ZEIA 5I56A 1UTBB 2I0BA 2HEUA 2HZKA 2XXYA 2Y84A 2DWIA 3K2DA 3O29A 4LQ2A 2GH9A 1B7HA 3T96B 3TAJA 3LR1A 4BDLA 5I58A 3KSJA 4HW8A 1I6BA 2VD2A 4IO4A 2Q2CA 1B0HA 4OYVA 4EF2A 3H7MA 1Y20A 3B6QA 1CB6A 2Q8JA 2DQVA 2F7CA 1FQBA 3H6WA 1H43A 2H9BA 3C9HA 4JWYA 4LUBA 2D21A 4LZ5A 1AMFA 3BBRA 3TPAA 1P1OA 1N7XA 1RKMA 4GL8A 1GR2A 2HZLA 1NKXA 1Y4TA 3OELA 5ITOA 2OK2A 2QSXA 5AE4A 4H6DA 1O64A 1OQHA 2DXRA 2XX8A 1MXWA 3C34A 1Y3NA 2XHDA 3RNNA 5CC2A 4OESA 4U23A 2XXTA 1JW4A 3FVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XKP A;  1DOT A;  1MY0 A;  1YAE A;  3K4U A;  3MPK A;  5I2N B;  3VLW A;  4H67 A;  2HAV A;  3OO8 A;  1EH3 A;  3MVZ A;  3TCF A;  3MAM A;  4F29 A;  1TFA A;  1QUL A;  4YU0 A;  5H8Q A;  2DWA A;  2QS2 A;  3N6U A;  4MBP A;  3VXB A;  5HM4 B;  2D3I A;  3ZKK A;  1IQ7 A;  1SDX A;  3IOV A;  1EZ9 A;  3N5L A;  2NUV A;  4ZE9 A;  3S9N C;  3TTR A;  5CBR A;  2ZYN A;  1R9Q A;  1MH3 A;  3U94 A;  3E3K A;  3KZG A;  4R6K A;  5I57 A;  5KDT A;  3IB0 A;  2ABH A;  3IR1 A;  1XOC A;  1MM6 A;  2YJP A;  3Q29 A;  2O1M A;  1SI1 A;  1QW0 A;  3FGS A;  1PB9 A;  2R9J A;  5AA2 B;  1US5 A;  2QRY A;  3RLF E;  2F35 A;  2RC8 A;  1DSN A;  3IX1 A;  4EXL A;  3GBA A;  1ANF A;  3PUW E;  4G4P A;  1MPB A;  2F36 A;  1NNF A;  3JZJ A;  4G8N A;  2A5S A;  4NF8 A;  1Q1K A;  2M8C A;  2PT1 A;  3PUX E;  4JDF A;  4LAT A;  4XIG Q;  2DE4 A;  4PE5 B;  1DPE A;  4H0W A;  4DZ1 A;  4DXB A;  2HQ0 A;  5A5X B;  3C36 A;  2LAO A;  1NNP A;  1VSO A;  1B0L A;  1FQA A;  3R7X A;  3OD7 A;  4F3S A;  5IAI A;  4F3G A;  2CMO A;  5B70 A;  4HTG A;  3CI8 A;  2XXV A;  4YB6 A;  5H8Q B;  1D3K A;  4ZE8 A;  1SW4 A;  3H6V A;  1MQH A;  1MH4 A;  2H99 A;  4N6P A;  4JBZ A;  4AQ4 A;  4N13 A;  1M5D A;  4YB5 A;  4Z0I A;  1B51 A;  3HPI A;  5H8S A;  1B3G A;  4LON B;  5I2K A;  1JNF A;  1VE4 A;  3EHU A;  4DIG A;  3I6V A;  5H8N B;  2F6G A;  4OMB A;  1FTJ A;  4R6Y A;  3K6U A;  1ATG A;  3RTF B;  3SEU A;  5ELV A;  1B7Z A;  3I5O A;  2F97 A;  5TU0 A;  5KDT B;  1JW5 A;  4EF1 A;  5TP9 B;  1USY H;  2HXW A;  1MM7 A;  2DWH A;  3E9X A;  4QSE A;  5H8N A;  3UA8 A;  2DE2 A;  4F3P A;  3CG1 A;  4I8C A;  2DWJ A;  4KD5 A;  5L9M A;  4PFT A;  3IAZ A;  1LAF E;  3HCQ A;  4WED A;  4BLA A;  2RKM A;  3S9M C;  3V5A A;  2PT2 A;  2V93 A;  1DMB A;  1P1U A;  3E4R A;  4IY5 A;  3S4U A;  4YKI A;  1JET A;  1MQG A;  3K00 A;  3MZB A;  2DOJ A;  2P2A A;  1H76 A;  2QJE A;  2XXU A;  1B1H A;  4EQ9 A;  1URD A;  2DS9 A;  2ZYM A;  4IO5 A;  2V3Q A;  2PVU A;  2Y7K A;  4GRK A;  1A55 A;  1TWY A;  2V84 A;  2F34 A;  4JSD A;  4NMY A;  3FV2 A;  3IJO B;  4OER A;  4PFW A;  4DE8 A;  4O3B A;  4R9G A;  3SEX A;  1QUK A;  2R6G E;  4FE8 A;  3A3U A;  4G68 B;  4RNS A;  4ND9 A;  2DSF A;  4U22 A;  5FHN A;  5JTY B;  1Y1M A;  1M5B A;  4QFP A;  4X1B A;  3VDF A;  4XKQ A;  1TFD A;  4N07 A;  1R9L A;  3M3F A;  4H8I A;  4QFK A;  3TCH A;  1AH5 A;  3H6U A;  2QL3 A;  1MQI A;  3DP4 A;  4R6H A;  3TTL A;  5CMB A;  4IGR A;  1ZBM A;  2Q2A A;  2I4B A;  2F5X A;  3K1P A;  1MY2 A;  2WKY A;  1SYI A;  1NFT A;  1MQJ A;  1J1N A;  2ONS A;  4G8H A;  1Q35 A;  4KHZ E;  4BDO A;  3M3L A;  3FZV A;  1B5I A;  3UIF A;  2ONK E;  4F1Y A;  1MY4 A;  2NXO A;  4FEC A;  2Q9T A;  1QJM A;  3PMX A;  5CMM A;  1D9V A;  1IXG A;  2XX7 A;  3C33 A;  3T9X B;  4YMB A;  1S7Y A;  1SW1 A;  1VFD A;  2B3F A;  3HHG A;  3T22 A;  3U72 A;  3UGW A;  5AA4 B;  1WDN A;  3FJG A;  3M3K A;  4O3C A;  3V8X B;  5IKB A;  1HSL A;  3T93 B;  3UN6 A;  2DVC A;  2VD3 A;  4KQP A;  3K6V A;  4OHN A;  4PET A;  1IXC A;  4KPT A;  4RPO A;  4G77 A;  1SI0 A;  3BFU A;  3OEM A;  4ZZA A;  4THI A;  3EHT A;  1N3X A;  1N7W A;  2GFE A;  2ZNS A;  3O28 A;  4YKJ A;  3IL1 B;  2XXP A;  3SER A;  2OBG A;  3C31 A;  4YMA A;  3G3H A;  4IB2 A;  1FCK A;  2I3W A;  1S9T A;  3HO7 A;  4OFJ A;  4OEU A;  4OFL A;  4OFO A;  5JTY A;  3TMG A;  3TUS A;  1Y3P A;  1MXX A;  4FOR A;  1IEJ A;  2O7U A;  3QXM A;  1OQG A;  3MPL A;  1LAX A;  2I0C A;  3USD A;  4ELO A;  1B4Z A;  3IO4 A;  3MVY A;  3R26 A;  1T0K A;  2F7B A;  2XXI A;  1ZU0 A;  3KEI A;  3O2A A;  1TXF A;  1VR5 A;  1B6H A;  2NOO A;  3H6T A;  3ILT B;  2QS4 A;  1PB7 A;  3PUV E;  4IO2 A;  4R2F A;  4RY1 A;  5CMK A;  1Y4C A;  2DVZ A;  1ZMG A;  2Y7R A;  3IB2 A;  3T9V A;  4XTC Q;  2O1L A;  1NH8 A;  1SW2 A;  4GL0 A;  4KYE A;  3RPW A;  1NMU A;  3TZA A;  1B52 A;  4RJZ A;  3PD8 A;  1FQD A;  4R74 A;  5CBS A;  5I57 B;  3ZS6 A;  3IJX B;  5AA2 D;  4Q0C A;  4H8J A;  3OMB A;  1A54 A;  3CVG A;  3VVF A;  1B05 A;  2B65 A;  1SQY A;  4KI0 E;  4DCY A;  5AA2 A;  2GRV A;  2V3T A;  3JV9 A;  3MUQ A;  1POY 1;  2FA7 A;  2IEE A;  2XXQ A;  3PUY E;  3T9U A;  3O97 A;  1FTK A;  3QIM A;  1B58 A;  5JEI A;  3PPN A;  4NF8 B;  3I3V A;  1JVX A;  2RIN A;  1OIB A;  2V25 A;  4POX A;  4TOZ A;  2XXX A;  4TLM B;  1B5H A;  4OXV A;  4WXJ A;  1Y3Q A;  4XKN A;  5EYF A;  3KJ7 A;  1LCF A;  4KYS A;  4QHQ A;  1GGG A;  5I2K B;  4ECF A;  1XVY A;  3UK4 A;  4FAT A;  3PU5 A;  1B3H A;  2Q88 A;  3IK6 B;  4KCD A;  3TTK A;  5LOM A;  1SBP A;  5EHS A;  3D4C A;  4QSC A;  4BDQ A;  5HPQ A;  4OWD A;  1IUD A;  4RXL A;  3BFT A;  2X7P A;  2F6P A;  1B1X A;  1B5J A;  2F8D A;  4H5F A;  4FIM A;  2E1S A;  4P0I A;  5I56 B;  3IB1 A;  3MC2 A;  3FXR A;  4QRZ A;  1N04 A;  3N26 A;  4JB7 A;  2Q89 A;  4U21 A;  5K2X A;  4U1O A;  3OSR A;  1EU8 A;  2O84 X;  4MLV A;  4EQ7 A;  4F2Q A;  5I58 B;  5I59 A;  1JW1 A;  4FEB A;  5CRY A;  1MXV A;  3Q28 A;  1LGB C;  3LSW A;  2PBW A;  1B9J A;  4F39 A;  1NL5 A;  3IOT A;  4AB6 A;  2XXR A;  3LSL A;  5FHM A;  3T9H B;  1QVS A;  1MDQ A;  2ESN A;  3PUZ E;  4Q30 B;  3S9E A;  5J1D A;  3N94 A;  1B2H A;  1ZLQ A;  4JWO A;  3SKP A;  3V83 A;  3FXU A;  4R9F A;  1DTZ A;  1B3L A;  3K6W A;  1TT1 A;  4GOT A;  4YAH X;  2A5T A;  3C4M A;  1GVC A;  2KLF A;  3MJN A;  3MZ9 A;  1LFG A;  3GXA A;  2I48 A;  4LZ8 A;  2W7Y A;  2Y7I A;  3E13 X;  4RA1 A;  4WEP A;  3TQL A;  3ZSF A;  3RGY A;  4Z7E A;  4KR5 A;  1URG A;  3KSX A;  4GIZ A;  1BIY A;  5FTH A;  1XT8 A;  4PP0 A;  4I1D A;  3K6X A;  3KN8 A;  1MG1 A;  5DYH A;  1DPP A;  2G93 A;  3VXC A;  1MXU A;  4F3B A;  4R72 A;  4ZEF A;  1US4 A;  3DM0 A;  3MP8 A;  2OCU A;  3O9P A;  1MRP A;  5AA1 A;  1JVY A;  4C0R A;  3TKD A;  2I49 A;  4PQJ A;  2REG A;  3MWB A;  1YTV A;  4O3A A;  3SES A;  1O7T A;  4OEN A;  2HCA A;  3TYH A;  3RT8 A;  2I3V A;  1II5 A;  2REJ A;  4EQB A;  2RC9 A;  3IOW A;  5I59 B;  1RYX A;  2DE3 A;  3AXF A;  3PMW A;  5DEX B;  5K2Y A;  4QFL A;  4FJP A;  3QK6 A;  3PPR A;  4I62 A;  3TTM A;  4EDP A;  5AA4 A;  4NF4 A;  3LSF B;  4R2B A;  1AL3 A;  1Y1Z A;  1NNT A;  1SW5 A;  3A09 A;  2HAU A;  3EN3 A;  5F1Q A;  2ALU A;  1N76 A;  3U92 A;  3S9L C;  3V89 B;  2XX9 A;  4QF9 A;  3TOD A;  1FQE A;  3R6U A;  4X1D A;  3PPO A;  3GBB A;  2F78 A;  3S2V A;  3CSB A;  4MH5 A;  5CI5 A;  4P0G A;  3KOT A;  3W15 C;  3KG2 A;  4POW A;  2VOZ A;  4K3F A;  1DTG A;  4NWD A;  3DEL B;  3O66 A;  3EQ1 A;  4ELQ A;  3G7W A;  2UVH A;  3G3I A;  4IO7 A;  3ZKL A;  5KZT A;  1I6A A;  1R6Z A;  2G29 A;  1R1N A;  3KOS A;  3VVE A;  4R73 A;  2UVG A;  4KFQ A;  1WVJ A;  4FED A;  4GVO A;  1MQD A;  1XVX A;  1ZIU A;  3HST A;  3IOR A;  3O6H A;  4NF5 B;  1B3E A;  1OVB A;  1UTH A;  4OET A;  4DLD A;  1UTB A;  5BUU A;  3ILU B;  3EF7 A;  1PB8 A;  4YIC A;  5DVJ A;  4YKP A;  2QS1 A;  3QUJ A;  2DYX A;  3HHF A;  2O51 A;  2OWS A;  5DTB A;  2DP8 A;  1LAH E;  2O69 A;  1M5C A;  2UVI A;  4U4X A;  4M1V A;  3RY3 A;  2H25 A;  2OWT A;  2RCA A;  4EXK A;  3LBS A;  3DP6 A;  1YPN A;  1LLS A;  1IIW A;  3A3C A;  3DLN A;  4IGT A;  4NF4 B;  5DVF A;  5DVI A;  5DT6 A;  4ESX A;  5ISU A;  1AIV A;  2Y7W A;  2FYI A;  2PX1 A;  3KGC A;  3BKI B;  4GD5 A;  3RN8 A;  3FVK A;  1MPC A;  1I69 A;  2E0S A;  3FXQ A;  4ISU A;  4HCY A;  4G8M A;  1FQF A;  1FTL A;  1LCT A;  5H8F B;  3K1M A;  1F9B A;  1WOD A;  4NF6 A;  4FAJ A;  1MDP 1;  1IXI A;  4HCW A;  3OO6 A;  1L5T A;  4F19 A;  1QKA A;  2ZXT A;  4F2O A;  3HN0 A;  1MY3 A;  3MVW A;  4H65 A;  3TDJ A;  3TCG A;  4L17 A;  2I4C A;  1JEV A;  2RCB A;  2VP1 A;  3VE1 B;  2UYE A;  4R75 A;  1OMP A;  4DCX A;  2NWJ A;  2YLN A;  4GF8 A;  4LQ5 A;  3TTN A;  2O7I A;  4TLL B;  3PPQ A;  2RC7 A;  3MQ9 A;  4LVQ A;  4I9D A;  1CE2 A;  3CG3 A;  3ECR A;  3KN7 A;  3LSX A;  3PV0 E;  3LUY A;  3MW0 A;  4QFO A;  1B3F A;  1P1W A;  2AIX A;  3CSG A;  1B32 A;  4C1U A;  1FQC A;  3QYT A;  5JK4 A;  3IOU A;  1SD3 A;  3K01 A;  2H98 A;  3KFM A;  4M4G A;  4OVJ A;  3W9V A;  1LB9 A;  1PEB A;  1P1N A;  2X26 A;  4U2R A;  4GFR A;  5KCJ A;  1XC1 A;  1PBQ A;  4DDD A;  2HFB A;  4HS7 A;  3OO7 A;  2ZYO A;  1A7L A;  1OLC A;  4OTE A;  5CMC A;  2X7Q A;  3U93 A;  1MXZ A;  1H44 A;  1KWH A;  1URS A;  1BTJ A;  2QPQ A;  3ODB A;  4XKR A;  3IO6 A;  3GLB A;  3RQT A;  2GHA A;  3EHS A;  3N6T A;  3TQW A;  1BP5 A;  5HBC A;  4F1U A;  3QUF A;  3B6T A;  2ONR A;  3RT6 B;  4OZ9 A;  1I6Q A;  2AYS A;  2GHB A;  3KN3 A;  2P0S A;  2THI A;  5TPA B;  5FTI A;  3G3J A;  2QMW A;  3C32 A;  3THI A;  5BWJ A;  3RUM A;  1A8E A;  2O6A A;  2A5T B;  2Z22 A;  4IY6 A;  3K02 A;  4DXC A;  4E0X A;  4KCC A;  3B7D A;  4NED A;  3K0V A;  3TFL A;  1B40 A;  4ONY A;  1LBB A;  3DP8 A;  4ZDM A;  2XXW A;  4RK2 A;  1PDA A;  2XD2 A;  3H03 A;  2PYY A;  2VGQ A;  1FTO A;  3LC8 A;  4ZZE A;  3FV1 A;  4OEV A;  4QFN A;  3SEW A;  5KCJ B;  1UIU A;  3FAT A;  3TEL A;  1N0T A;  1M5E A;  1YCJ A;  2Y7P A;  2UXA A;  3VV5 A;  3TEP A;  3PGF A;  4TQU Q;  1MS7 A;  1POT A;  1BKA A;  1ZKB A;  3MVX A;  1JQF A;  3Q26 A;  4EUO A;  4ZEC A;  1OLA A;  1HSE A;  4LZ7 A;  4E0W A;  4YB7 A;  3OXN A;  2PMS A;  1IXH A;  1RYO A;  2XD3 A;  5TPA A;  4ZEB A;  3T66 A;  4F31 B;  4X9T A;  1D9Y A;  3QSL A;  2Z23 A;  1FW0 A;  2Z8E A;  3VLV A;  4F1V A;  5L9O A;  3ONM A;  3M8U A;  4Q5T A;  4X48 A;  4ZED A;  4LA9 A;  4UAC A;  4H5G A;  4JSO A;  3G3K A;  3H3G A;  4G68 A;  1GTK A;  3OEK A;  3UP9 A;  1B4H A;  2B3B A;  4H1X A;  1FTM A;  3MBP A;  4XXU A;  1EZO A;  2ZYK A;  4ZEK A;  4IO6 A;  1PBP A;  4KYD A;  1LB8 A;  1LST A;  1Y9U A;  2IA4 A;  2QS3 A;  4ELP A;  1AOV A;  4F18 A;  1N84 A;  2OZZ A;  3RTW B;  1EZP A;  2BJJ X;  3O6I A;  2CZL A;  1S50 A;  4NWC A;  3WAE A;  3CFX A;  3Q27 A;  3FUZ A;  3CRB A;  3W9W A;  4NF5 A;  4C1T A;  4JXI A;  4BDR A;  5AA3 A;  3FVG A;  2VHA A;  2AL4 A;  4MLQ A;  5ICT A;  1LFI A;  1B7U A;  1MXY A;  3CR9 A;  4GQO A;  3JYR A;  1Z7N E;  1PC3 A;  3SET A;  3FD3 A;  2O68 A;  1OVT A;  4GXS B;  4NF6 B;  3G3G A;  1ZJL A;  2FNC A;  3KJT A;  1A40 A;  4PFU A;  3OOA A;  4PFY A;  4UA8 A;  1HSJ A;  5H8H A;  3SEV A;  3PPP A;  5ICQ A;  1H3D A;  3D4G A;  4GWO A;  4MFI A;  1VFE A;  1GV8 A;  4RPN A;  4ZS9 A;  2Z8D A;  3OSQ A;  1QUJ A;  1QKB A;  3FIR A;  1SYH A;  3F11 A;  3H06 B;  3G3F A;  3L6G A;  3CFL A;  2OJT A;  4G2Z A;  4GXA A;  4WKM A;  5H8F A;  1D4N A;  3C35 A;  5I84 A;  5L9S A;  2ZMB A;  1IIT A;  1JEU A;  1XS5 A;  3FJM A;  4BDN A;  3QAX A;  4U1Z A;  4BDM A;  2AL5 A;  5A5X A;  4RYA A;  1H45 A;  2H5Y A;  2UVJ A;  1IZ1 A;  3FVN A;  1LBC A;  1A99 A;  4F22 A;  1B46 A;  2V3U A;  5B7D A;  3P7I A;  5TP9 A;  3VLU A;  1ZTY A;  1XHY A;  2I6E A;  1P1Q A;  1MPD A;  3CIJ A;  4U4S A;  3H4Z A;  5CM6 A;  4YKK A;  2RF1 A;  3FJ7 A;  3WAF A;  1LFH A;  3Q25 A;  3B6W A;  5DEX A;  4IO3 A;  3CFZ A;  5FHO A;  1USY E;  4Q8R A;  3VVD A;  2UYF A;  1NNK A;  1UQW A;  3OEN A;  5H8H B;  3KBR A;  4AB5 A;  4ELR A;  3O6G A;  4YZZ A;  3VFJ A;  5EHM A;  3SEY A;  2QMX A;  2ZNU A;  2Z8F A;  3SDF A;  1BLF A;  2DXY A;  4LP2 B;  4NE4 A;  4DXU A;  4JWX A;  1UIV A;  4P11 A;  1MY1 A;  4NTL A;  4GLI A;  3MZ1 A;  2NVU B;  1ELJ A;  3K1N A;  1P99 A;  2ZNT A;  1SVX B;  3MP6 A;  2R71 A;  1QUI A;  3L6H A;  3GZG A;  5ITP A;  3HV1 A;  3MP1 A;  2YPN A;  2ANJ A;  2H4I A;  5L8D A;  3UOR A;  5I2N A;  2D5W A;  2XXH A;  4G68 C;  1LAG E;  3U1O A;  1O63 A;  4ESW A;  1M5F A;  3EPE A;  3PD9 A;  4QSD A;  1Z7M E;  1N3W A;  2I58 A;  3U8Q A;  3FAS A;  1A8F A;  2OLB A;  4MF3 A;  2P1S A;  3OO9 A;  4OQO A;  3PMV A;  5M2V A;  4RK9 A;  1NH7 A;  5F7V A;  1UTH B;  2F7A A;  4ZEI A;  5I56 A;  1UTB B;  2I0B A;  2HEU A;  2HZK A;  2XXY A;  2Y84 A;  2DWI A;  3K2D A;  3O29 A;  4LQ2 A;  2GH9 A;  1B7H A;  3T96 B;  3TAJ A;  3LR1 A;  4BDL A;  5I58 A;  3KSJ A;  4HW8 A;  1I6B A;  2VD2 A;  4IO4 A;  2Q2C A;  1B0H A;  4OYV A;  4EF2 A;  3H7M A;  1Y20 A;  3B6Q A;  1CB6 A;  2Q8J A;  2DQV A;  2F7C A;  1FQB A;  3H6W A;  1H43 A;  2H9B A;  3C9H A;  4JWY A;  4LUB A;  2D21 A;  4LZ5 A;  1AMF A;  3BBR A;  3TPA A;  1P1O A;  1N7X A;  1RKM A;  4GL8 A;  1GR2 A;  2HZL A;  1NKX A;  1Y4T A;  3OEL A;  5ITO A;  2OK2 A;  2QSX A;  5AE4 A;  4H6D A;  1O64 A;  1OQH A;  2DXR A;  2XX8 A;  1MXW A;  3C34 A;  1Y3N A;  2XHD A;  3RNN A;  5CC2 A;  4OES A;  4U23 A;  2XXT A;  1JW4 A;  3FVO A; 
#chains in the Genus database with same CATH topology
 1DOT A;  1YAE A;  3MPK A;  5I2N B;  4F29 A;  1QUL A;  1EYK A;  2QS2 A;  3VXB A;  5HM4 B;  2OX3 A;  2D3I A;  1EZ9 A;  2NUV A;  5CBR A;  2Y5K A;  3U94 A;  5KDT A;  2YJP A;  4NN3 A;  5AA2 B;  2QRY A;  2KR0 A;  4EXL A;  4POX A;  4G8N A;  2F36 A;  1Q1K A;  4XIG Q;  1DPE A;  4DXB A;  1YXI A;  2PFZ A;  3MST A;  3CI8 A;  2XXV A;  1D3K A;  4N13 A;  3HPI A;  5H8S A;  1B3G A;  4DIG A;  2F6G A;  4OMB A;  5ELV A;  1B7Z A;  3I5O A;  1JW5 A;  2FIX A;  1USY H;  5H8N A;  4OVT A;  4KD5 A;  4PFT A;  3IAZ A;  1LAF E;  2CZH A;  4WED A;  4BLA A;  4UAB A;  3S9M C;  2PT2 A;  3S4U A;  1DMB A;  2JJK A;  3E4R A;  4YKI A;  3K00 A;  2P2A A;  1H76 A;  2QJE A;  4NG7 A;  1B1H A;  1URD A;  2Y7K A;  4GRK A;  2V84 A;  2HPG A;  5A5L A;  4JSD A;  3FV2 A;  4PFW A;  4O3B A;  1QUK A;  4FE8 A;  5FHN A;  4ND9 A;  5JTY B;  4XKQ A;  4OAN A;  4N07 A;  1R9L A;  3M3F A;  3T0J A;  3H6U A;  3TTL A;  1ZBM A;  2Q2A A;  5L9S A;  5CMM A;  2XX7 A;  1SW1 A;  1FBC A;  3T22 A;  3V8X B;  3T93 B;  2VD3 A;  3OEM A;  4ZZA A;  4THI A;  1N3X A;  2GFE A;  2OBG A;  4OEU A;  3TMG A;  1NV6 A;  1MXX A;  1IEJ A;  2I0C A;  3IO4 A;  1LBW A;  3KEI A;  4GX3 A;  3O2A A;  1FPB A;  1VR5 A;  1B6H A;  2NOO A;  4R2F A;  3PUV E;  1ZMG A;  1NH8 A;  4QXD A;  4GL0 A;  1NMU A;  4RJZ A;  1INP A;  5AA2 D;  4Q0C A;  1A54 A;  5J16 A;  4JVD A;  1FJ9 A;  5AA2 A;  3CHG A;  1POY 1;  2Q74 A;  3O97 A;  1B58 A;  5IZ3 A;  3I3V A;  1JVX A;  1OIB A;  4F3S A;  2XXX A;  1B5H A;  4XKN A;  2GQ1 A;  4ECF A;  1GGG A;  5I2K B;  1XVY A;  4GWS A;  3IK6 B;  5EHS A;  1JP4 A;  3BFT A;  2F6P A;  1B5J A;  4FIM A;  4P0I A;  4QRZ A;  1N04 A;  3N26 A;  2F3D A;  2PFY A;  4F2Q A;  4P9K A;  1B9J A;  1NL5 A;  3IOT A;  4MX6 A;  2XXR A;  3T9H B;  5FHM A;  5J1D A;  3N94 A;  3FXU A;  4R9F A;  3K6W A;  4GOT A;  3MZ9 A;  5ET7 A;  2Y7I A;  3RGY A;  1XT8 A;  4PP0 A;  4I1D A;  3K6X A;  1DPP A;  1MXU A;  4JVC A;  3TKD A;  3MWB A;  4O3A A;  1II5 A;  2REJ A;  4MNP A;  3IOW A;  4QFL A;  4EDP A;  1SW5 A;  3U92 A;  3S9L C;  4X1D A;  1FBH A;  3CSB A;  1RDZ A;  1DTG A;  4NWD A;  2UVH A;  3G3I A;  4IO7 A;  2WYP A;  1R1N A;  4GVO A;  1MQD A;  1XVX A;  1ZIU A;  4NF5 B;  1OVB A;  1UTH A;  3ILU B;  3EF7 A;  1PB8 A;  4YKP A;  4MNI A;  1FPL A;  3HHF A;  1LAH E;  1M5C A;  2P3V A;  2ZZX A;  2H25 A;  4IGT A;  5DT6 A;  3KGC A;  2QVR A;  3RN8 A;  3BKI B;  2E0S A;  4ISU A;  1LCT A;  5H8F B;  1F9B A;  4FAJ A;  3OO6 A;  2VP1 A;  4DCX A;  3TTN A;  2RC7 A;  4LVQ A;  5IGA A;  1CE2 A;  4MNC A;  2AIX A;  3CSG A;  1FQC A;  2XXK A;  3W9V A;  1SPI A;  5KCJ A;  1XC1 A;  1PBQ A;  2HFB A;  3U93 A;  2X7Q A;  1MXZ A;  2QPQ A;  1BTJ A;  3RQT A;  2WBB A;  3TQW A;  4F1U A;  2ONR A;  1I6Q A;  4X8R A;  3KN3 A;  4MIJ A;  2HXR A;  2R8T A;  3THI A;  5BWJ A;  4DI3 D;  1LEV A;  4E0X A;  5I7I A;  4KCC A;  3B7D A;  4P47 A;  3TFL A;  2XWI A;  3DP8 A;  4ZDM A;  2XD2 A;  2PYY A;  2FHY A;  3SEW A;  1LBV A;  2UXA A;  3VV5 A;  4TQU Q;  1POT A;  1ZKB A;  1G0H A;  4LZ7 A;  1DBZ A;  4YB7 A;  4GBV A;  4F31 B;  1Q9D A;  1D9Y A;  5L9O A;  3VLV A;  4X48 A;  4LA9 A;  4G68 A;  4N81 A;  2CEX A;  1FTM A;  4ZEK A;  2IA4 A;  1AOV A;  3O6I A;  4MHF A;  4BDR A;  4GWU A;  2AL4 A;  1B7U A;  3NOH A;  1FJ6 A;  1PC3 A;  3FD3 A;  4GXS B;  4LN5 A;  1ZJL A;  2FBP A;  3D4G A;  1GV8 A;  4RPN A;  2Z8D A;  3OSQ A;  4GWW A;  2CZI A;  4GXA A;  2OJT A;  1IIT A;  3FJM A;  4U1Z A;  3FVN A;  2V3U A;  5B7D A;  4PGP A;  5F24 A;  1XHY A;  5CM6 A;  3CIJ A;  4YKK A;  3FJ7 A;  1LFH A;  3CFZ A;  2OWZ A;  3KC0 A;  3VVD A;  4AB5 A;  5H8H B;  3KBR A;  4YZZ A;  5EHM A;  3B8B A;  1MY1 A;  5FBP A;  2NVU B;  3L6H A;  3HV1 A;  3MP1 A;  2D5W A;  4G68 C;  1NUX A;  4QSD A;  1Z7M E;  4O7M A;  3FAS A;  2OLB A;  3OO9 A;  2F7A A;  2XXY A;  1YZ0 A;  2Q2C A;  1B0H A;  4OYV A;  4LUB A;  3ISP A;  2D21 A;  1KA1 A;  1NKX A;  1Y4T A;  1G0I A;  5EYG A;  2XX8 A;  3C34 A;  4U23 A;  2XXT A;  1QGX A;  4XKP A;  3K4U A;  3VLW A;  2HAV A;  1EH3 A;  3MVZ A;  1TFA A;  3A29 A;  5H8Q A;  4MBP A;  3ZKK A;  3N5L A;  3TTR A;  2ZYN A;  1MH3 A;  4NAP A;  2ABH A;  2O1M A;  3EKI A;  3FGS A;  3RLF E;  1DSN A;  3GBA A;  3PUW E;  3E78 A;  1MPB A;  2WYK A;  1NNF A;  3JZJ A;  2A5S A;  2M8C A;  2PT1 A;  4LAT A;  2HQ0 A;  3C36 A;  2LAO A;  1NNP A;  3R7X A;  1B0L A;  1FQA A;  3OD7 A;  4F3G A;  5B70 A;  3H6V A;  1MQH A;  1FTA A;  2H99 A;  4YB5 A;  2F3B A;  1NV2 A;  5I2K A;  3EHU A;  3I6V A;  1FTJ A;  5KDT B;  4EF1 A;  4QSE A;  4F3P A;  3E9X A;  4GWZ A;  1NUY A;  2DWJ A;  3HCQ A;  1P1U A;  1MQG A;  1KZ8 A;  2DOJ A;  2XXU A;  2ZYM A;  2V3Q A;  1A55 A;  3IJO B;  4R9G A;  3SEX A;  4G68 B;  3A3U A;  1RDY A;  4H8I A;  5ESY A;  2QL3 A;  3DP4 A;  4R6H A;  4IGR A;  2Y5L A;  2F5X A;  5H8N B;  1J1N A;  1Q35 A;  2ZZV A;  1QJM A;  3PMX A;  1D9V A;  2B3F A;  3U72 A;  1WDN A;  3UN6 A;  3K6V A;  4PFR A;  5DW8 A;  1IXC A;  4G77 A;  3O28 A;  1K9Z A;  3IL1 B;  5IZ1 A;  3G3H A;  4MCO A;  2I3W A;  1S9T A;  3HO7 A;  4OFJ A;  4NHB A;  1Y3P A;  4FOR A;  3MPL A;  3USD A;  4PF8 A;  1B4Z A;  4X04 A;  1TXF A;  4PDH A;  5ET5 A;  2Y7R A;  4XTC Q;  3TZA A;  3RPW A;  3T1B A;  5CBS A;  4H8J A;  3VVF A;  2B65 A;  4KI0 E;  2GRV A;  2V3T A;  2FA7 A;  1XI6 A;  4NF8 B;  2V25 A;  1LCF A;  4QHQ A;  4FAT A;  2ZZW A;  3D4C A;  4QSC A;  1IUD A;  4RXL A;  2X7P A;  2F8D A;  2FVZ A;  4H5F A;  5KZT A;  3IB1 A;  5K2X A;  1K9Y A;  3OSR A;  5I59 A;  1LGB C;  2PBW A;  1KA0 A;  1QVS A;  1MDQ A;  2ESN A;  4Q30 B;  1B2H A;  4JWO A;  1LBZ A;  1B3L A;  4OVR A;  1FBG A;  2KLF A;  3MJN A;  1LFG A;  3GXA A;  4RA1 A;  3E13 X;  4GIZ A;  5FTH A;  4OVP A;  4N6D A;  2G93 A;  1US4 A;  3O9P A;  3MYU A;  2OCU A;  1MRP A;  1O7T A;  4OEN A;  3TYH A;  2I3V A;  4EQB A;  2QVV A;  2RC9 A;  2DE3 A;  5DEX B;  3PPR A;  4I62 A;  3LSF B;  1N76 A;  3V89 B;  1FQE A;  3PPO A;  4MH5 A;  4P0G A;  3KOT A;  3KG2 A;  4POW A;  3O66 A;  3G7W A;  3SZP A;  1I6A A;  3VVE A;  4R73 A;  1GVC A;  1WVJ A;  4OET A;  3IOR A;  4DLD A;  2XWO A;  2O51 A;  5DTB A;  4U4X A;  3BIH A;  1YPN A;  3A3C A;  1NV4 A;  4ESX A;  4P56 A;  1FQF A;  1WOD A;  1MDP 1;  1IXI A;  1L5T A;  3HN0 A;  1FPE A;  4NQ8 A;  2RCB A;  3VE1 B;  2UYE A;  1OMP A;  4LQ5 A;  1FBE A;  2MKZ A;  4OQO A;  3KN7 A;  3PV0 E;  3LUY A;  3MW0 A;  4QFO A;  1FSA A;  1VDW A;  4OVJ A;  4M4G A;  3QMF A;  5CMC A;  4OTE A;  1A7L A;  1IMB A;  3IO6 A;  4P1L A;  3EHS A;  1IME A;  1BP5 A;  3RT6 B;  2AYS A;  5TPA B;  2QMW A;  3C32 A;  2A5T B;  1B40 A;  1LBB A;  1DK4 A;  3BIG A;  5I5P A;  3H03 A;  1NV3 A;  3TEL A;  1M5E A;  1YCJ A;  3TEP A;  4EUO A;  1JQF A;  3Q26 A;  1HSE A;  4PTK A;  2PMS A;  3T66 A;  1FRP A;  2Z23 A;  4F1V A;  4ZED A;  4JSO A;  3G3K A;  4H1X A;  4XXU A;  3MBP A;  1EZO A;  2ZYK A;  4KYD A;  1Y9U A;  4ELP A;  1N84 A;  1EZP A;  2CZL A;  4NWC A;  3CRB A;  3FVG A;  4MLQ A;  1LFI A;  1MXY A;  3CR9 A;  4GQO A;  3SET A;  1OVT A;  4NF6 B;  1FBF A;  4GBW A;  4H46 A;  4ZS9 A;  1SYH A;  3FBP A;  1JEU A;  1XS5 A;  4O8M A;  4RYA A;  2H5Y A;  2UVJ A;  4F22 A;  3P7I A;  5TP9 A;  4HE0 A;  4PFB A;  1MPD A;  4N4U A;  3H4Z A;  4PBH A;  1UQW A;  1FBP A;  3VFJ A;  3SEY A;  2Z8F A;  4LP2 B;  1UIV A;  4NTL A;  4GLI A;  1ELJ A;  2ZNT A;  3MP6 A;  1QUI A;  5ITP A;  2YPN A;  5L8D A;  5I2N A;  2XXH A;  3U1O A;  1M5F A;  4MF3 A;  5I56 A;  1UTH B;  4N8Y A;  2VPN A;  2I0B A;  4LQ2 A;  2Y84 A;  3TAJ A;  1B7H A;  4HW8 A;  1FPJ A;  4LZ5 A;  3BBR A;  3TPA A;  1P1O A;  1N7X A;  4GL8 A;  5ITO A;  4H67 A;  3OO8 A;  3TCF A;  3MAM A;  4YU0 A;  2XWV A;  3IOV A;  3B50 A;  3KZG A;  4R6K A;  1XOC A;  3Q29 A;  1SI1 A;  2R9J A;  2BJI A;  2F35 A;  1NV0 A;  1ANF A;  4G4P A;  4NF8 A;  4PC9 A;  3PUX E;  2DE4 A;  4H0W A;  5A5X B;  1VSO A;  2CMO A;  4HTG A;  4YB6 A;  4ZE8 A;  1MH4 A;  4N6P A;  4AQ4 A;  4N15 A;  1M5D A;  4Z0I A;  1NUZ A;  4LON B;  1VE4 A;  4PF6 A;  4R6Y A;  3K6U A;  3RTF B;  4G61 A;  5TU0 A;  4GWY A;  5TP9 B;  2HXW A;  1MM7 A;  2DE2 A;  3CG1 A;  4PE3 A;  2RKM A;  4OVS A;  3V5A A;  4IY5 A;  1JET A;  4P8B A;  2PVU A;  4OER A;  4NMY A;  2R6G E;  4RNS A;  2DSF A;  1Y1M A;  1M5B A;  4QFP A;  4HXV A;  3VDF A;  1TFD A;  3TCH A;  1AH5 A;  5ET8 A;  5CMB A;  1MY2 A;  2WKY A;  1SYI A;  3D1R A;  1MQJ A;  4G8H A;  4BDO A;  3M3L A;  3FZV A;  1MY4 A;  2NXO A;  4FEC A;  1IXG A;  3T9X B;  4YMB A;  4AS4 A;  4O3C A;  1HSL A;  2DVC A;  4KQP A;  4KPT A;  4RPO A;  1SI0 A;  3EHT A;  3SER A;  2ZNS A;  4YKJ A;  4YMA A;  1FCK A;  4OFL A;  5JTY A;  4OFO A;  3QXM A;  2O7U A;  4ELO A;  1T0K A;  4PAI A;  3R26 A;  2XXI A;  4IO2 A;  4RY1 A;  1PB7 A;  1NV5 A;  3IB2 A;  3T9V A;  3KBZ A;  4PGN A;  2O1L A;  4KYE A;  4DI4 B;  1B52 A;  1FQD A;  5I57 B;  1B05 A;  4DCY A;  1SQY A;  3MUQ A;  3PUY E;  2XXQ A;  1FTK A;  4MAG A;  4TOZ A;  4WXJ A;  4OXV A;  5EYF A;  1Y3Q A;  3KJ7 A;  4KYS A;  3UK4 A;  3PU5 A;  5IZZ A;  5I56 B;  3MC2 A;  3KC1 A;  3FXR A;  4U21 A;  1EYI A;  1IMD A;  2O84 X;  5CRY A;  3FXB A;  3Q28 A;  3LSW A;  4AB6 A;  2WBD A;  3S9E A;  3V83 A;  4YAH X;  2A5T A;  1D9Q A;  2W7Y A;  3VXC A;  4F3B A;  4R72 A;  1JVY A;  1IMA A;  1YTV A;  2HCA A;  5I59 B;  3AXF A;  3PMW A;  5K2Y A;  1FPK A;  4FJP A;  3QK6 A;  5AA4 A;  4NF4 A;  4R2B A;  1Y1Z A;  5F1Q A;  2HAU A;  2ALU A;  2XX9 A;  3TOD A;  4PFI A;  4GWX A;  4I3Y A;  3S2V A;  2F78 A;  4MMP A;  1AWB A;  5CI5 A;  3W15 C;  3IFA A;  2VOZ A;  4K3F A;  3DEL B;  4ELQ A;  3ZKL A;  1CNQ A;  3KOS A;  4KXP A;  4R74 A;  2UVG A;  4FED A;  3HST A;  2XA5 A;  1B3E A;  1UTB A;  4YIC A;  5DVJ A;  5EQ7 A;  2DYX A;  2O69 A;  2UVI A;  4M1V A;  3LBS A;  3DP6 A;  3DLN A;  5DVI A;  5DVF A;  2Y7W A;  2FYI A;  2PX1 A;  4GD5 A;  1MPC A;  1I69 A;  3FXQ A;  4HCY A;  1FTL A;  2HHM A;  1QKA A;  2ZXT A;  4F2O A;  3TDJ A;  3TCG A;  2I4C A;  2NWJ A;  4GF8 A;  2O7I A;  5T3J A;  3PPQ A;  4F1Y A;  3MQ9 A;  4I9D A;  3CG3 A;  3ECR A;  3LSX A;  1B3F A;  1P1W A;  1B32 A;  4C1U A;  5JK4 A;  3QYT A;  1LB9 A;  1P1N A;  2X26 A;  4GFR A;  4HS7 A;  2ZYO A;  1H44 A;  1KWH A;  3ODB A;  2FIE A;  3N6T A;  4O7I A;  5HBC A;  3QUF A;  2P0S A;  2THI A;  3RUM A;  4IY6 A;  4PBQ A;  4ONY A;  1BK4 A;  4RK2 A;  1PDA A;  2DDK A;  4ZZE A;  3FV1 A;  4OEV A;  5KCJ B;  3FAT A;  3PGF A;  1OLA A;  4HE2 A;  3OXN A;  1IXH A;  5TPA A;  4ZEB A;  4XF5 A;  1FW0 A;  2Z8E A;  3ONM A;  3M8U A;  4FBP A;  1IMF A;  1RDX A;  1GTK A;  3UP9 A;  2B3B A;  4O94 A;  1PBP A;  2QS3 A;  4F18 A;  2OZZ A;  2BJJ X;  3WAE A;  3CFX A;  3FUZ A;  4JXI A;  5AA3 A;  2VHA A;  3JYR A;  3HFU A;  3KJT A;  4UA8 A;  1A40 A;  3SEV A;  3OOA A;  3PPP A;  5ICQ A;  4GWO A;  4MFI A;  1QUJ A;  3L6G A;  3F11 A;  3G3F A;  4WKM A;  5I84 A;  3C35 A;  2ZMB A;  4BDN A;  4BDM A;  5A5X A;  1IZ1 A;  1LBC A;  5ET6 A;  1IMC A;  2I6E A;  4N6K A;  4U4S A;  1FPG A;  4IR8 A;  3WAF A;  5DEX A;  4IO3 A;  5FHO A;  3O6G A;  2QMX A;  2ZNU A;  1NI9 A;  5LTC A;  3K1N A;  1P99 A;  3GZG A;  4I3E A;  2ANJ A;  3UOR A;  1LAG E;  1N3W A;  3U8Q A;  1A8F A;  2P1S A;  4RK9 A;  1NH7 A;  5F7V A;  4ZEI A;  2HZK A;  2HEU A;  3K2D A;  5LOM A;  2DWI A;  5I58 A;  2GH9 A;  4AS5 A;  2VD2 A;  4IO4 A;  2V4C A;  4EF2 A;  3H7M A;  3B6Q A;  2F7C A;  1FQB A;  3H6W A;  2H9B A;  3C9H A;  4QBA A;  1GR2 A;  3OEL A;  2QSX A;  1O64 A;  1OQH A;  2DXR A;  3LUZ A;  4OES A;  4N91 A;  4GX4 A;  1MY0 A;  5EQA A;  2WX9 A;  2DWA A;  3N6U A;  1IQ7 A;  1SDX A;  1YYZ A;  4ZE9 A;  3S9N C;  1R9Q A;  3E3K A;  5I57 A;  3IB0 A;  3IR1 A;  1MM6 A;  1QW0 A;  1PB9 A;  1US5 A;  2RC8 A;  3IX1 A;  1LBX A;  4JDF A;  4PE5 B;  4DZ1 A;  5IAI A;  4P1E A;  4PAF A;  5H8Q B;  1SW4 A;  4MJO A;  2Q8M A;  4JBZ A;  1B51 A;  1JNF A;  4GX6 A;  3SEU A;  1ATG A;  4PDD A;  2F97 A;  4NGU A;  2QFL A;  2DWH A;  2P3N A;  3UA8 A;  4I8C A;  5L9M A;  2V93 A;  3MZB A;  4EQ9 A;  2DS9 A;  4IO5 A;  1TWY A;  2F34 A;  4DE8 A;  4U22 A;  4X1B A;  4QFK A;  1MQI A;  2I4B A;  3K1P A;  1NFT A;  2ONS A;  4KHZ E;  1B5I A;  3UIF A;  2ONK E;  2Q9T A;  3C33 A;  3U65 A;  1S7Y A;  1VFD A;  3HHG A;  1FPD A;  3UGW A;  5AA4 B;  3FJG A;  5IKB A;  3M3K A;  4OHN A;  4PET A;  3BFU A;  1N7W A;  3LV0 A;  2XXP A;  3C31 A;  4IB2 A;  3TUS A;  1OQG A;  1LAX A;  3MVY A;  2F7B A;  1ZU0 A;  3H6T A;  3ILT B;  2QS4 A;  4PCD A;  1Y4C A;  2DVZ A;  4OVQ A;  2B4L A;  1SW2 A;  3PD8 A;  3ZS6 A;  3IJX B;  3OMB A;  3CVG A;  3JV9 A;  2IEE A;  3T9U A;  3QIM A;  5JEI A;  3PPN A;  4XFE A;  4NX1 A;  2RIN A;  4TLM B;  3T96 B;  5CMK A;  1B3H A;  2Q88 A;  2VPO A;  4KCD A;  3TTK A;  1SBP A;  4BDQ A;  5HPQ A;  4OWD A;  1B1X A;  2E1S A;  4JB7 A;  2Q89 A;  5I58 B;  4U1O A;  4MLV A;  1EU8 A;  4EQ7 A;  1JW1 A;  4FEB A;  1MXV A;  4F39 A;  3LSL A;  3PUZ E;  1ZLQ A;  3SKP A;  1NUW A;  1DTZ A;  1TT1 A;  3C4M A;  2I48 A;  4N8G A;  4LZ8 A;  3ZSF A;  4WEP A;  4Z7E A;  3TQL A;  4KR5 A;  1URG A;  3KSX A;  1BIY A;  3KN8 A;  1MG1 A;  5DYH A;  4ZEF A;  3DM0 A;  3MP8 A;  5AA1 A;  4C0R A;  2I49 A;  4PQJ A;  2REG A;  3SES A;  3RT8 A;  1RYX A;  3TTM A;  5EYH A;  1AL3 A;  1NNT A;  3A09 A;  3EN3 A;  4QF9 A;  3R6U A;  4P3L A;  1DCU A;  3RPL A;  3GBB A;  3E79 A;  4OA4 A;  1FPF A;  2PCR A;  3EQ1 A;  1EYJ A;  1R6Z A;  2G29 A;  4KFQ A;  3O6H A;  5BUU A;  4JVI A;  1LBY A;  2QS1 A;  3QUJ A;  2OWS A;  3RY3 A;  2DP8 A;  2OWT A;  2RCA A;  4EXK A;  1LLS A;  1IIW A;  4NF4 B;  5ISU A;  1AIV A;  3GYY A;  3FVK A;  4NF0 A;  4G8M A;  3K1M A;  4NF6 A;  4HCW A;  4F19 A;  2VT5 A;  3PTY A;  3MVW A;  1MY3 A;  4H65 A;  3ROJ A;  4L17 A;  1JEV A;  4R75 A;  2YLN A;  1FBD A;  5IZ3 B;  4TLL B;  3IOU A;  1SD3 A;  3K01 A;  2H98 A;  3KFM A;  4U2R A;  1PEB A;  5EQ9 A;  4DDD A;  3OO7 A;  1OLC A;  4XKR A;  1URS A;  2KQZ A;  3GLB A;  2GHA A;  1FPI A;  5IM2 A;  3B6T A;  4OZ9 A;  2GHB A;  5FTI A;  3G3J A;  1A8E A;  2O6A A;  2Z22 A;  4DXC A;  3K02 A;  4NED A;  3K0V A;  3IFC A;  2XXW A;  2VGQ A;  1FTO A;  3LC8 A;  4QFN A;  5I3S A;  1UIU A;  1N0T A;  2Y7P A;  1MS7 A;  1BKA A;  3MVX A;  4ZEC A;  4E0W A;  4H45 A;  5LDZ A;  1RYO A;  2XD3 A;  4XEQ A;  4X9T A;  3QSL A;  4Q5T A;  4UAC A;  3RPL B;  4H5G A;  2B4M A;  3H3G A;  3OEK A;  1B4H A;  2CEY A;  4IO6 A;  1LB8 A;  1LST A;  3RTW B;  2XWK A;  1S50 A;  3Q27 A;  3W9W A;  4NF5 A;  4C1T A;  5ICT A;  1Z7N E;  2O68 A;  3G3G A;  2FNC A;  5H8H A;  4PFU A;  4PFY A;  1HSJ A;  1H3D A;  1VFE A;  3RYD A;  3FIR A;  4G2Z A;  1QKB A;  3H06 B;  4MEV A;  5H8F A;  3CFL A;  1D4N A;  5EQ8 A;  1NV7 A;  3QAX A;  2WEF A;  2AL5 A;  1H45 A;  1A99 A;  1B46 A;  3VLU A;  1ZTY A;  1P1Q A;  4PAK A;  4HE1 A;  2L5V A;  2RF1 A;  3Q25 A;  3B6W A;  1USY E;  4Q8R A;  2UYF A;  1NNK A;  3OEN A;  4ELR A;  3SDF A;  1BLF A;  2DXY A;  4NE4 A;  2QVU A;  4JWX A;  4P11 A;  4DXU A;  3MZ1 A;  1SVX B;  2R71 A;  2H4I A;  4ESW A;  1O63 A;  3EPE A;  3PD9 A;  2CZK A;  2I58 A;  4I40 A;  3PMV A;  5M2V A;  1NV1 A;  1UTB B;  3O29 A;  4BDL A;  3LR1 A;  3KSJ A;  1I6B A;  1Y20 A;  4N17 A;  2Q8J A;  1CB6 A;  2DQV A;  4JWY A;  1H43 A;  5AE4 A;  1AMF A;  1RKM A;  2HZL A;  2OK2 A;  4H6D A;  1MXW A;  3RNN A;  1Y3N A;  2XHD A;  5CC2 A;  1JW4 A;  3FVO A; 
#chains in the Genus database with same CATH homology
 4XKP A;  1DOT A;  1MY0 A;  1YAE A;  3K4U A;  3MPK A;  5I2N B;  3VLW A;  4H67 A;  2HAV A;  3OO8 A;  1EH3 A;  3MVZ A;  3TCF A;  3MAM A;  4F29 A;  1TFA A;  1QUL A;  4YU0 A;  5H8Q A;  2DWA A;  2QS2 A;  3N6U A;  4MBP A;  3VXB A;  5HM4 B;  2D3I A;  3ZKK A;  1IQ7 A;  1SDX A;  3IOV A;  1EZ9 A;  3N5L A;  2NUV A;  4ZE9 A;  3S9N C;  3TTR A;  5CBR A;  2ZYN A;  1R9Q A;  1MH3 A;  3U94 A;  3E3K A;  3KZG A;  4R6K A;  5I57 A;  5KDT A;  3IB0 A;  2ABH A;  3IR1 A;  1XOC A;  1MM6 A;  2YJP A;  3Q29 A;  2O1M A;  1SI1 A;  1QW0 A;  3FGS A;  1PB9 A;  2R9J A;  5AA2 B;  1US5 A;  2QRY A;  3RLF E;  2F35 A;  2RC8 A;  1DSN A;  3IX1 A;  4EXL A;  3GBA A;  1ANF A;  3PUW E;  4G4P A;  1MPB A;  2F36 A;  1NNF A;  3JZJ A;  4G8N A;  2A5S A;  4NF8 A;  1Q1K A;  2M8C A;  2PT1 A;  3PUX E;  4JDF A;  4LAT A;  4XIG Q;  2DE4 A;  4PE5 B;  1DPE A;  4H0W A;  4DZ1 A;  4DXB A;  2HQ0 A;  5A5X B;  3C36 A;  2LAO A;  1NNP A;  1VSO A;  1B0L A;  1FQA A;  3R7X A;  3OD7 A;  4F3S A;  5IAI A;  4F3G A;  2CMO A;  5B70 A;  4HTG A;  3CI8 A;  2XXV A;  4YB6 A;  5H8Q B;  1D3K A;  4ZE8 A;  1SW4 A;  3H6V A;  1MQH A;  1MH4 A;  2H99 A;  4N6P A;  4JBZ A;  4AQ4 A;  4N13 A;  1M5D A;  4YB5 A;  4Z0I A;  1B51 A;  3HPI A;  5H8S A;  1B3G A;  4LON B;  5I2K A;  1JNF A;  1VE4 A;  3EHU A;  4DIG A;  3I6V A;  5H8N B;  2F6G A;  4OMB A;  1FTJ A;  4R6Y A;  3K6U A;  1ATG A;  3RTF B;  3SEU A;  5ELV A;  1B7Z A;  3I5O A;  2F97 A;  5TU0 A;  5KDT B;  1JW5 A;  4EF1 A;  5TP9 B;  1USY H;  2HXW A;  1MM7 A;  2DWH A;  3E9X A;  4QSE A;  5H8N A;  3UA8 A;  2DE2 A;  4F3P A;  3CG1 A;  4I8C A;  2DWJ A;  4KD5 A;  5L9M A;  4PFT A;  3IAZ A;  1LAF E;  3HCQ A;  4WED A;  4BLA A;  2RKM A;  3S9M C;  3V5A A;  2PT2 A;  2V93 A;  1DMB A;  1P1U A;  3E4R A;  4IY5 A;  3S4U A;  4YKI A;  1JET A;  1MQG A;  3K00 A;  3MZB A;  2DOJ A;  2P2A A;  1H76 A;  2QJE A;  2XXU A;  1B1H A;  4EQ9 A;  1URD A;  2DS9 A;  2ZYM A;  4IO5 A;  2V3Q A;  2PVU A;  2Y7K A;  4GRK A;  1A55 A;  1TWY A;  2V84 A;  2F34 A;  4JSD A;  4NMY A;  3FV2 A;  3IJO B;  4OER A;  4PFW A;  4DE8 A;  4O3B A;  4R9G A;  3SEX A;  1QUK A;  2R6G E;  4FE8 A;  3A3U A;  4G68 B;  4RNS A;  4ND9 A;  2DSF A;  4U22 A;  5FHN A;  5JTY B;  1Y1M A;  1M5B A;  4QFP A;  4X1B A;  3VDF A;  4XKQ A;  1TFD A;  4N07 A;  1R9L A;  3M3F A;  4H8I A;  4QFK A;  3TCH A;  1AH5 A;  3H6U A;  2QL3 A;  1MQI A;  3DP4 A;  4R6H A;  3TTL A;  5CMB A;  4IGR A;  1ZBM A;  2Q2A A;  2I4B A;  2F5X A;  3K1P A;  1MY2 A;  2WKY A;  1SYI A;  1NFT A;  1MQJ A;  1J1N A;  2ONS A;  4G8H A;  1Q35 A;  4KHZ E;  4BDO A;  3M3L A;  3FZV A;  1B5I A;  3UIF A;  2ONK E;  4F1Y A;  1MY4 A;  2NXO A;  4FEC A;  2Q9T A;  1QJM A;  3PMX A;  5CMM A;  1D9V A;  1IXG A;  2XX7 A;  3C33 A;  3T9X B;  4YMB A;  1S7Y A;  1SW1 A;  1VFD A;  2B3F A;  3HHG A;  3T22 A;  3U72 A;  3UGW A;  5AA4 B;  1WDN A;  3FJG A;  3M3K A;  4O3C A;  3V8X B;  5IKB A;  1HSL A;  3T93 B;  3UN6 A;  2DVC A;  2VD3 A;  4KQP A;  3K6V A;  4OHN A;  4PET A;  1IXC A;  4KPT A;  4RPO A;  4G77 A;  1SI0 A;  3BFU A;  3OEM A;  4ZZA A;  4THI A;  3EHT A;  1N3X A;  1N7W A;  2GFE A;  2ZNS A;  3O28 A;  4YKJ A;  3IL1 B;  2XXP A;  3SER A;  2OBG A;  3C31 A;  4YMA A;  3G3H A;  4IB2 A;  1FCK A;  2I3W A;  1S9T A;  3HO7 A;  4OFJ A;  4OEU A;  4OFL A;  4OFO A;  5JTY A;  3TMG A;  3TUS A;  1Y3P A;  1MXX A;  4FOR A;  1IEJ A;  2O7U A;  3QXM A;  1OQG A;  3MPL A;  1LAX A;  2I0C A;  3USD A;  4ELO A;  1B4Z A;  3IO4 A;  3MVY A;  3R26 A;  1T0K A;  2F7B A;  2XXI A;  1ZU0 A;  3KEI A;  3O2A A;  1TXF A;  1VR5 A;  1B6H A;  2NOO A;  3H6T A;  3ILT B;  2QS4 A;  1PB7 A;  3PUV E;  4IO2 A;  4R2F A;  4RY1 A;  5CMK A;  1Y4C A;  2DVZ A;  1ZMG A;  2Y7R A;  3IB2 A;  3T9V A;  4XTC Q;  2O1L A;  1NH8 A;  1SW2 A;  4GL0 A;  4KYE A;  3RPW A;  1NMU A;  3TZA A;  1B52 A;  4RJZ A;  3PD8 A;  1FQD A;  4R74 A;  5CBS A;  5I57 B;  3ZS6 A;  3IJX B;  5AA2 D;  4Q0C A;  4H8J A;  3OMB A;  1A54 A;  3CVG A;  3VVF A;  1B05 A;  2B65 A;  1SQY A;  4KI0 E;  4DCY A;  5AA2 A;  2GRV A;  2V3T A;  3JV9 A;  3MUQ A;  1POY 1;  2FA7 A;  2IEE A;  2XXQ A;  3PUY E;  3T9U A;  3O97 A;  1FTK A;  3QIM A;  1B58 A;  5JEI A;  3PPN A;  4NF8 B;  3I3V A;  1JVX A;  2RIN A;  1OIB A;  2V25 A;  4POX A;  4TOZ A;  2XXX A;  4TLM B;  1B5H A;  4OXV A;  4WXJ A;  1Y3Q A;  4XKN A;  5EYF A;  3KJ7 A;  1LCF A;  4KYS A;  4QHQ A;  1GGG A;  5I2K B;  4ECF A;  1XVY A;  3UK4 A;  4FAT A;  3PU5 A;  1B3H A;  2Q88 A;  3IK6 B;  4KCD A;  3TTK A;  5LOM A;  1SBP A;  5EHS A;  3D4C A;  4QSC A;  4BDQ A;  5HPQ A;  4OWD A;  1IUD A;  4RXL A;  3BFT A;  2X7P A;  2F6P A;  1B1X A;  1B5J A;  2F8D A;  4H5F A;  4FIM A;  2E1S A;  4P0I A;  5I56 B;  3IB1 A;  3MC2 A;  3FXR A;  4QRZ A;  1N04 A;  3N26 A;  4JB7 A;  2Q89 A;  4U21 A;  5K2X A;  4U1O A;  3OSR A;  1EU8 A;  2O84 X;  4MLV A;  4EQ7 A;  4F2Q A;  5I58 B;  5I59 A;  1JW1 A;  4FEB A;  5CRY A;  1MXV A;  3Q28 A;  1LGB C;  3LSW A;  2PBW A;  1B9J A;  4F39 A;  1NL5 A;  3IOT A;  4AB6 A;  2XXR A;  3LSL A;  5FHM A;  3T9H B;  1QVS A;  1MDQ A;  2ESN A;  3PUZ E;  4Q30 B;  3S9E A;  5J1D A;  3N94 A;  1B2H A;  1ZLQ A;  4JWO A;  3SKP A;  3V83 A;  3FXU A;  4R9F A;  1DTZ A;  1B3L A;  3K6W A;  1TT1 A;  4GOT A;  4YAH X;  2A5T A;  3C4M A;  1GVC A;  2KLF A;  3MJN A;  3MZ9 A;  1LFG A;  3GXA A;  2I48 A;  4LZ8 A;  2W7Y A;  2Y7I A;  3E13 X;  4RA1 A;  4WEP A;  3TQL A;  3ZSF A;  3RGY A;  4Z7E A;  4KR5 A;  1URG A;  3KSX A;  4GIZ A;  1BIY A;  5FTH A;  1XT8 A;  4PP0 A;  4I1D A;  3K6X A;  3KN8 A;  1MG1 A;  5DYH A;  1DPP A;  2G93 A;  3VXC A;  1MXU A;  4F3B A;  4R72 A;  4ZEF A;  1US4 A;  3DM0 A;  3MP8 A;  2OCU A;  3O9P A;  1MRP A;  5AA1 A;  1JVY A;  4C0R A;  3TKD A;  2I49 A;  4PQJ A;  2REG A;  3MWB A;  1YTV A;  4O3A A;  3SES A;  1O7T A;  4OEN A;  2HCA A;  3TYH A;  3RT8 A;  2I3V A;  1II5 A;  2REJ A;  4EQB A;  2RC9 A;  3IOW A;  5I59 B;  1RYX A;  2DE3 A;  3AXF A;  3PMW A;  5DEX B;  5K2Y A;  4QFL A;  4FJP A;  3QK6 A;  3PPR A;  4I62 A;  3TTM A;  4EDP A;  5AA4 A;  4NF4 A;  3LSF B;  4R2B A;  1AL3 A;  1Y1Z A;  1NNT A;  1SW5 A;  3A09 A;  2HAU A;  3EN3 A;  5F1Q A;  2ALU A;  1N76 A;  3U92 A;  3S9L C;  3V89 B;  2XX9 A;  4QF9 A;  3TOD A;  1FQE A;  3R6U A;  4X1D A;  3PPO A;  3GBB A;  2F78 A;  3S2V A;  3CSB A;  4MH5 A;  5CI5 A;  4P0G A;  3KOT A;  3W15 C;  3KG2 A;  4POW A;  2VOZ A;  4K3F A;  1DTG A;  4NWD A;  3DEL B;  3O66 A;  3EQ1 A;  4ELQ A;  3G7W A;  2UVH A;  3G3I A;  4IO7 A;  3ZKL A;  5KZT A;  1I6A A;  1R6Z A;  2G29 A;  1R1N A;  3KOS A;  3VVE A;  4R73 A;  2UVG A;  4KFQ A;  1WVJ A;  4FED A;  4GVO A;  1MQD A;  1XVX A;  1ZIU A;  3HST A;  3IOR A;  3O6H A;  4NF5 B;  1B3E A;  1OVB A;  1UTH A;  4OET A;  4DLD A;  1UTB A;  5BUU A;  3ILU B;  3EF7 A;  1PB8 A;  4YIC A;  5DVJ A;  4YKP A;  2QS1 A;  3QUJ A;  2DYX A;  3HHF A;  2O51 A;  2OWS A;  5DTB A;  2DP8 A;  1LAH E;  2O69 A;  1M5C A;  2UVI A;  4U4X A;  4M1V A;  3RY3 A;  2H25 A;  2OWT A;  2RCA A;  4EXK A;  3LBS A;  3DP6 A;  1YPN A;  1LLS A;  1IIW A;  3A3C A;  3DLN A;  4IGT A;  4NF4 B;  5DVF A;  5DVI A;  5DT6 A;  4ESX A;  5ISU A;  1AIV A;  2Y7W A;  2FYI A;  2PX1 A;  3KGC A;  3BKI B;  4GD5 A;  3RN8 A;  3FVK A;  1MPC A;  1I69 A;  2E0S A;  3FXQ A;  4ISU A;  4HCY A;  4G8M A;  1FQF A;  1FTL A;  1LCT A;  5H8F B;  3K1M A;  1F9B A;  1WOD A;  4NF6 A;  4FAJ A;  1MDP 1;  1IXI A;  4HCW A;  3OO6 A;  1L5T A;  4F19 A;  1QKA A;  2ZXT A;  4F2O A;  3HN0 A;  1MY3 A;  3MVW A;  4H65 A;  3TDJ A;  3TCG A;  4L17 A;  2I4C A;  1JEV A;  2RCB A;  2VP1 A;  3VE1 B;  2UYE A;  4R75 A;  1OMP A;  4DCX A;  2NWJ A;  2YLN A;  4GF8 A;  4LQ5 A;  3TTN A;  2O7I A;  4TLL B;  3PPQ A;  2RC7 A;  3MQ9 A;  4LVQ A;  4I9D A;  1CE2 A;  3CG3 A;  3ECR A;  3KN7 A;  3LSX A;  3PV0 E;  3LUY A;  3MW0 A;  4QFO A;  1B3F A;  1P1W A;  2AIX A;  3CSG A;  1B32 A;  4C1U A;  1FQC A;  3QYT A;  5JK4 A;  3IOU A;  1SD3 A;  3K01 A;  2H98 A;  3KFM A;  4M4G A;  4OVJ A;  3W9V A;  1LB9 A;  1PEB A;  1P1N A;  2X26 A;  4U2R A;  4GFR A;  5KCJ A;  1XC1 A;  1PBQ A;  4DDD A;  2HFB A;  4HS7 A;  3OO7 A;  2ZYO A;  1A7L A;  1OLC A;  4OTE A;  5CMC A;  2X7Q A;  3U93 A;  1MXZ A;  1H44 A;  1KWH A;  1URS A;  1BTJ A;  2QPQ A;  3ODB A;  4XKR A;  3IO6 A;  3GLB A;  3RQT A;  2GHA A;  3EHS A;  3N6T A;  3TQW A;  1BP5 A;  5HBC A;  4F1U A;  3QUF A;  3B6T A;  2ONR A;  3RT6 B;  4OZ9 A;  1I6Q A;  2AYS A;  2GHB A;  3KN3 A;  2P0S A;  2THI A;  5TPA B;  5FTI A;  3G3J A;  2QMW A;  3C32 A;  3THI A;  5BWJ A;  3RUM A;  1A8E A;  2O6A A;  2A5T B;  2Z22 A;  4IY6 A;  3K02 A;  4DXC A;  4E0X A;  4KCC A;  3B7D A;  4NED A;  3K0V A;  3TFL A;  1B40 A;  4ONY A;  1LBB A;  3DP8 A;  4ZDM A;  2XXW A;  4RK2 A;  1PDA A;  2XD2 A;  3H03 A;  2PYY A;  2VGQ A;  1FTO A;  3LC8 A;  4ZZE A;  3FV1 A;  4OEV A;  4QFN A;  3SEW A;  5KCJ B;  1UIU A;  3FAT A;  3TEL A;  1N0T A;  1M5E A;  1YCJ A;  2Y7P A;  2UXA A;  3VV5 A;  3TEP A;  3PGF A;  4TQU Q;  1MS7 A;  1POT A;  1BKA A;  1ZKB A;  3MVX A;  1JQF A;  3Q26 A;  4EUO A;  4ZEC A;  1OLA A;  1HSE A;  4LZ7 A;  4E0W A;  4YB7 A;  3OXN A;  2PMS A;  1IXH A;  1RYO A;  2XD3 A;  5TPA A;  4ZEB A;  3T66 A;  4F31 B;  4X9T A;  1D9Y A;  3QSL A;  2Z23 A;  1FW0 A;  2Z8E A;  3VLV A;  4F1V A;  5L9O A;  3ONM A;  3M8U A;  4Q5T A;  4X48 A;  4ZED A;  4LA9 A;  4UAC A;  4H5G A;  4JSO A;  3G3K A;  3H3G A;  4G68 A;  1GTK A;  3OEK A;  3UP9 A;  1B4H A;  2B3B A;  4H1X A;  1FTM A;  3MBP A;  4XXU A;  1EZO A;  2ZYK A;  4ZEK A;  4IO6 A;  1PBP A;  4KYD A;  1LB8 A;  1LST A;  1Y9U A;  2IA4 A;  2QS3 A;  4ELP A;  1AOV A;  4F18 A;  1N84 A;  2OZZ A;  3RTW B;  1EZP A;  2BJJ X;  3O6I A;  2CZL A;  1S50 A;  4NWC A;  3WAE A;  3CFX A;  3Q27 A;  3FUZ A;  3CRB A;  3W9W A;  4NF5 A;  4C1T A;  4JXI A;  4BDR A;  5AA3 A;  3FVG A;  2VHA A;  2AL4 A;  4MLQ A;  5ICT A;  1LFI A;  1B7U A;  1MXY A;  3CR9 A;  4GQO A;  3JYR A;  1Z7N E;  1PC3 A;  3SET A;  3FD3 A;  2O68 A;  1OVT A;  4GXS B;  4NF6 B;  3G3G A;  1ZJL A;  2FNC A;  3KJT A;  1A40 A;  4PFU A;  3OOA A;  4PFY A;  4UA8 A;  1HSJ A;  5H8H A;  3SEV A;  3PPP A;  5ICQ A;  1H3D A;  3D4G A;  4GWO A;  4MFI A;  1VFE A;  1GV8 A;  4RPN A;  4ZS9 A;  2Z8D A;  3OSQ A;  1QUJ A;  1QKB A;  3FIR A;  1SYH A;  3F11 A;  3H06 B;  3G3F A;  3L6G A;  3CFL A;  2OJT A;  4G2Z A;  4GXA A;  4WKM A;  5H8F A;  1D4N A;  3C35 A;  5I84 A;  5L9S A;  2ZMB A;  1IIT A;  1JEU A;  1XS5 A;  3FJM A;  4BDN A;  3QAX A;  4U1Z A;  4BDM A;  2AL5 A;  5A5X A;  4RYA A;  1H45 A;  2H5Y A;  2UVJ A;  1IZ1 A;  3FVN A;  1LBC A;  1A99 A;  4F22 A;  1B46 A;  2V3U A;  5B7D A;  3P7I A;  5TP9 A;  3VLU A;  1ZTY A;  1XHY A;  2I6E A;  1P1Q A;  1MPD A;  3CIJ A;  4U4S A;  3H4Z A;  5CM6 A;  4YKK A;  2RF1 A;  3FJ7 A;  3WAF A;  1LFH A;  3Q25 A;  3B6W A;  5DEX A;  4IO3 A;  3CFZ A;  5FHO A;  1USY E;  4Q8R A;  3VVD A;  2UYF A;  1NNK A;  1UQW A;  3OEN A;  5H8H B;  3KBR A;  4AB5 A;  4ELR A;  3O6G A;  4YZZ A;  3VFJ A;  5EHM A;  3SEY A;  2QMX A;  2ZNU A;  2Z8F A;  3SDF A;  1BLF A;  2DXY A;  4LP2 B;  4NE4 A;  4DXU A;  4JWX A;  1UIV A;  4P11 A;  1MY1 A;  4NTL A;  4GLI A;  3MZ1 A;  2NVU B;  1ELJ A;  3K1N A;  1P99 A;  2ZNT A;  1SVX B;  3MP6 A;  2R71 A;  1QUI A;  3L6H A;  3GZG A;  5ITP A;  3HV1 A;  3MP1 A;  2YPN A;  2ANJ A;  2H4I A;  5L8D A;  3UOR A;  5I2N A;  2D5W A;  2XXH A;  4G68 C;  1LAG E;  3U1O A;  1O63 A;  4ESW A;  1M5F A;  3EPE A;  3PD9 A;  4QSD A;  1Z7M E;  1N3W A;  2I58 A;  3U8Q A;  3FAS A;  1A8F A;  2OLB A;  4MF3 A;  2P1S A;  3OO9 A;  4OQO A;  3PMV A;  5M2V A;  4RK9 A;  1NH7 A;  5F7V A;  1UTH B;  2F7A A;  4ZEI A;  5I56 A;  1UTB B;  2I0B A;  2HEU A;  2HZK A;  2XXY A;  2Y84 A;  2DWI A;  3K2D A;  3O29 A;  4LQ2 A;  2GH9 A;  1B7H A;  3T96 B;  3TAJ A;  3LR1 A;  4BDL A;  5I58 A;  3KSJ A;  4HW8 A;  1I6B A;  2VD2 A;  4IO4 A;  2Q2C A;  1B0H A;  4OYV A;  4EF2 A;  3H7M A;  1Y20 A;  3B6Q A;  1CB6 A;  2Q8J A;  2DQV A;  2F7C A;  1FQB A;  3H6W A;  1H43 A;  2H9B A;  3C9H A;  4JWY A;  4LUB A;  2D21 A;  4LZ5 A;  1AMF A;  3BBR A;  3TPA A;  1P1O A;  1N7X A;  1RKM A;  4GL8 A;  1GR2 A;  2HZL A;  1NKX A;  1Y4T A;  3OEL A;  5ITO A;  2OK2 A;  2QSX A;  5AE4 A;  4H6D A;  1O64 A;  1OQH A;  2DXR A;  2XX8 A;  1MXW A;  3C34 A;  1Y3N A;  2XHD A;  3RNN A;  5CC2 A;  4OES A;  4U23 A;  2XXT A;  1JW4 A;  3FVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...