4FEDA

Crystal structure of htt36q3h
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
401
structure length
401
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQQHQHQHQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein,Huntingtin
publication title Beta conformation of polyglutamine track revealed by a crystal structure of Huntingtin N-terminal region with insertion of three histidine residues.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 116
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fedA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fedA02
4IY6A 2ZYMA 2V93A 1DTGA 1F9BA 1M5EA 1BIYA 1JQFA 3IL1B 1QUIA 5KCJB 4NEDA 1MG1A 3T9VA 3C9HA 2DOJA 1MH4A 2O1MA 1MPBA 1SQYA 2NUVA 1OIBA 2I4BA 4OQOA 3IR1A 3UN6A 3V89B 2O1LA 4ISUA 4ZE8A 4MH5A 1O63A 2A5SA 2PYYA 1LFHA 4QF9A 2VOZA 3VXCA 3S9MC 3RQTA 5DEXB 5H8HA 1Z7NE 3OELA 4JXIA 4O3CA 3SETA 4EXKA 3VE1B 3OENA 3MVYA 4THIA 2XXXA 3M8UA 5FHNA 1QULA 4RPOA 3JV9A 1XOCA 4P11A 1NH7A 3H6WA 3THIA 2PT1A 4KCDA 2Y7PA 1IXHA 3FVGA 4DLDA 1SI1A 1IXIA 2I0BA 2O51A 3RNNA 4BDRA 3OMBA 4GWOA 1USYH 5L8DA 5AA1A 2OJTA 3S9LC 4GD5A 2FA7A 2DWJA 5AA3A 1B3EA 5ICTA 4XKQA 1FQFA 3Q26A 2Q2CA 4GXAA 5H8NA 3EHUA 3CIJA 1B46A 1BLFA 1UIUA 2OCUA 2UYEA 1ZLQA 1P1UA 4KI0E 4GL0A 2OK2A 3KOTA 1DPPA 1DPEA 3G3KA 3OSRA 3DP8A 4R74A 3TUSA 3LSWA 5H8HB 3L6HA 3SDFA 4IO5A 1IXCA 2DP8A 2B3BA 1R1NA 3IAZA 4LQ5A 4LUBA 3T96B 3QIMA 4DDDA 1UIVA 3U93A 2XD2A 5LOMA 5CRYA 4ZEIA 2ZXTA 2PMSA 3N94A 4RY1A 1DOTA 1N0TA 1Y3PA 3E4RA 3GZGA 4IB2A 2F97A 1LFGA 3R7XA 4EXLA 3DLNA 3H06B 1LB9A 1AL3A 5CBSA 2ZNTA 4RA1A 4HW8A 3K2DA 3G3GA 1B51A 5H8NB 3T22A 4GL8A 4JSDA 1LAFE 4RXLA 3CG3A 3FVKA 4DXUA 4GRKA 5B7DA 2HCAA 1NMUA 3PUYE 5H8FA 2DVCA 1B3LA 3TTNA 5IKBA 3A09A 4FEDA 5CM6A 1H44A 4N13A 1ZMGA 3VV5A 4GVOA 1A7LA 1WDNA 1S7YA 3RT6B 4LONB 3EPEA 3ZS6A 2XXRA 1D9VA 1MXUA 1B3FA 4R75A 3C33A 1A8FA 4QSDA 1FQBA 2XD3A 1M5CA 1LAHE 3RLFE 1N7WA 1CE2A 4XTCQ 4OFLA 5CMMA 1WODA 3HPIA 3PV0E 4QHQA 2Y7WA 4H5GA 2XXPA 2QMWA 1A8EA 4ZECA 4I9DA 1MS7A 3CFXA 3U92A 2I3VA 2UVGA 1LB8A 1EZPA 2V25A 2V3TA 4KHZE 3MP6A 4O3AA 3FVNA 2I4CA 3ILTB 2NOOA 2Q88A 3TTMA 1ZKBA 1UTHA 4P0IA 3E13X 4OFJA 3KJTA 1B5JA 2RCBA 2XXVA 3JYRA 4G77A 4JWYA 1IZ1A 3PPNA 3FJMA 1OLCA 5H8SA 5H8FB 2RF1A 2B65A 2X26A 4NWDA 5I2NA 3H6TA 1A99A 2Z8EA 3EF7A 3S2VA 1POY1 4H65A 2QPQA 1MXWA 3TEPA 1OMPA 2IA4A 2QL3A 4FE8A 3MUQA 4OYVA 3MVZA 1GR2A 3OO8A 2F5XA 1YCJA 3MVXA 2HAUA 1USYE 3FV2A 2O6AA 5AA2A 4QFPA 3BKIB 3MPLA 2H5YA 1Q1KA 3TDJA 5EHMA 3QXMA 3DP4A 2KLFA 2ZNSA 1B32A 1HSEA 3MP1A 3OO9A 1MQIA 3OXNA 4C0RA 4PFYA 5CI5A 1NH8A 4G8MA 1BTJA 3O28A 4KPTA 1JW5A 5I56A 1UTHB 3O6GA 4P0GA 5KCJA 5CMCA 3TFLA 2I48A 4ESXA 2ABHA 1PB9A 3TTRA 3HV1A 5EYFA 4JWOA 4PFWA 2V84A 3IK6B 2RINA 2NXOA 1OVBA 4IO7A 2PVUA 3VLWA 4YMAA 1LLSA 4FIMA 4LQ2A 3O97A 3BBRA 5F7VA 1EZ9A 1QKAA 5I2NB 2DWAA 1EU8A 3OD7A 2I3WA 1MXXA 3CI8A 3HHGA 3HN0A 1MDP1 4U1ZA 1JVXA 4GQOA 2Z22A 4Z0IA 3TODA 2XX8A 5ITOA 4U4SA 3T66A 4BDMA 3T93B 2O68A 5AA2B 2DE3A 1JNFA 1FTMA 4F22A 1JEUA 3H3GA 4NF5B 4ELQA 3KN8A 4KCCA 4EF1A 1MXYA 1OLAA 4IO2A 3UORA 3ILUB 3FASA 4QFNA 1MY2A 1Y3QA 4ZEDA 1B7HA 4F31B 3O9PA 5BWJA 5BUUA 1S9TA 1R9QA 4G8NA 3LUYA 3H6UA 4EF2A 3E9XA 5I56B 3FVOA 1NNFA 2XXIA 1ZBMA 1H3DA 5ISUA 2F36A 2DXRA 1LCFA 2F7AA 1HSLA 3SKPA 2D3IA 3H6VA 2DQVA 3W9WA 2RC8A 3UA8A 3PMWA 5K2XA 4L17A 4RK9A 3GBAA 1ZIUA 4U1OA 5AA2D 2H98A 4EDPA 2G29A 1IUDA 3K6XA 4EQ9A 2Q2AA 4GOTA 1B6HA 3SERA 1SW1A 3KGCA 4R9GA 5I57B 2QRYA 4KFQA 3K1NA 1MQGA 3K01A 4X1BA 3V8XB 2UXAA 1B52A 4OFOA 5CC2A 1B40A 1B5IA 2XXUA 2YLNA 4KYSA 1JETA 1SW4A 3RT8A 1N04A 3ODBA 1B7UA 1II5A 3IJXB 1MQDA 4OZ9A 1JW4A 1QUKA 1FTKA 2REJA 5DVFA 4YB7A 4FEBA 2R9JA 1MPDA 3B6QA 1B1XA 5JEIA 3OSQA 4U23A 4H5FA 1ZU0A 4XKPA 5TU0A 3TCFA 3PUWE 3D4GA 3CG1A 4ZDMA 5B70A 1OQGA 4HCWA 3U72A 3VXBA 3K02A 4RYAA 4LP2B 1MM7A 3PMVA 1FQAA 1LCTA 3Q29A 3TMGA 1NKXA 5EHSA 1TFDA 4LZ5A 2F7BA 1P1OA 2F6PA 4AB6A 2Q8JA 4DCYA 3K1MA 4LVQA 3CFZA 3TPAA 3QUFA 2RC9A 2XXQA 3FXUA 3IO6A 3RGYA 1UTBA 1LBBA 3N6TA 4OESA 4Q5TA 3TQLA 3VVDA 4F1VA 3IORA 2X7QA 1P1QA 3RY3A 3SEWA 4ECFA 2O7IA 4QSCA 3TELA 3HHFA 5KZTA 5KDTA 5CMBA 1Q35A 2I6EA 3TAJA 2Z23A 2RC7A 2HZLA 4LA9A 1B3GA 1LAXA 1LBCA 3UGWA 1FTLA 1Y4CA 2DE2A 3G3JA 2F8DA 3N26A 4F19A 2H99A 1B7ZA 4C1TA 5ELVA 3TQWA 1J1NA 2IEEA 4WXJA 1MRPA 4F1YA 3PD9A 3S9EA 1MPCA 1IXGA 2HFBA 2V3QA 2R6GE 2AL4A 3H7MA 3PPRA 3IO4A 2OZZA 1LGBC 4OERA 4ZS9A 1Y20A 3R6UA 1B0LA 3C34A 2RKMA 4M4GA 3VLVA 4R72A 3O2AA 3P7IA 1MY0A 2Z8FA 3N6UA 3GBBA 2ZYOA 1UQWA 4H0WA 3G3FA 4OVJA 1RYXA 5HM4B 3E3KA 1YAEA 4JBZA 1XC1A 2VHAA 5HBCA 1MY4A 4FORA 1FQEA 1H43A 2NWJA 3ZSFA 2E0SA 1XVXA 4YAHX 3FATA 3S4UA 4XKRA 1UTBB 2D21A 1VFEA 3K1PA 4Q30B 3FJGA 3B7DA 1IITA 1B3HA 3O66A 3TCHA 1GTKA 3BFUA 4YMBA 3UIFA 5KDTB 4F29A 4F2QA 1TT1A 1JEVA 4ESWA 2ONRA 4PE5B 4G8HA 5ITPA 3DP6A 3JZJA 1B4HA 1MQJA 2GRVA 5J1DA 3D4CA 2F34A 1SBPA 3ECRA 4AB5A 1XHYA 1H45A 1NNPA 1Y1MA 4F2OA 1US4A 4JWXA 4FATA 4PFTA 3EHSA 2HEUA 4RJZA 2Q89A 4PP0A 4YB5A 5I84A 1VR5A 2YPNA 2ONKE 3L6GA 4YKJA 4TLMB 2DXYA 1QUJA 2Q9TA 3EQ1A 5F1QA 3UK4A 3FD3A 4ZEBA 5K2YA 4F1UA 4YB6A 1ZTYA 4R2FA 3USDA 4GFRA 3SEUA 3RTFB 3PU5A 4KD5A 3TYHA 2ANJA 5FTIA 4KYEA 3MZ1A 5FHOA 4F3PA 5DTBA 4MLVA 1YPNA 4FJPA 3T9HB 4MLQA 5TPAA 2V3UA 2VGQA 1PDAA 4PFUA 3AXFA 1BKAA 2RCAA 4X1DA 5L9MA 1NL5A 2ZYNA 3Q25A 4U22A 3IJOB 2QSXA 2NVUB 1PEBA 3FGSA 3CSGA 4G68A 4DXBA 2FNCA 4BLAA 1DSNA 3CFLA 3ONMA 3SEXA 1PBPA 1R9LA 1OVTA 3W15C 3C32A 1N76A 4JB7A 3QAXA 4R6YA 4NF5A 4YU0A 4XIGQ 5CMKA 1M5FA 2Y7RA 4E0WA 3B6TA 4DZ1A 1QW0A 4OENA 3LSLA 4IO6A 4FAJA 1PB8A 2OLBA 1LFIA 3KOSA 3KFMA 4I1DA 2F78A 3IOVA 3A3CA 3UP9A 4IO3A 3PUZE 3IOTA 4LZ7A 2AL5A 1QKBA 1URDA 2ESNA 4IO4A 3RUMA 1GV8A 4DIGA 1NNTA 4G68C 1Y1ZA 2F35A 1SW5A 3K4UA 2ZNUA 3IOUA 1P1NA 3U94A 3KJ7A 4TLLB 4F3GA 3I3VA 1ATGA 4QFOA 5I57A 5M2VA 4E0XA 1A40A 2O84X 3MAMA 5TPAB 3IB0A 4QRZA 1FQDA 3SEYA 2H4IA 2Z8DA 3MC2A 1I6AA 1B9JA 2P2AA 5I58B 1FW0A 1FTOA 1SD3A 4X48A 1BP5A 1Z7ME 1DMBA 1SI0A 5TP9A 5FHMA 4Q0CA 1Y3NA 2UVIA 3N5LA 4G68B 4R9FA 5L9OA 4I8CA 3HO7A 1SW2A 4OETA 4F3BA 1D9YA 3IB1A 3M3LA 3V83A 2XX7A 3QYTA 4UA8A 5I2KA 2HXWA 4QSEA 3KEIA 4KR5A 3C4MA 5DVJA 3A3UA 4DE8A 1B5HA 4JSOA 4UACA 2QS1A 4NTLA 3FZVA 1R6ZA 3IB2A 2G93A 1I6BA 1MY1A 3FJ7A 4OHNA 1MQHA 1NNKA 2F7CA 1PB7A 1B58A 3KZGA 4PQJA 3OEKA 2DVZA 2I0CA 4IGRA 4BDLA 5HPQA 2Y84A 5AA4A 4OXVA 3VDFA 3O29A 1NFTA 2CZLA 4GXSB 2GHBA 2QS4A 3MP8A 3CVGA 1ELJA 4TQUQ 1O7TA 2QMXA 5TP9B 3W9VA 1B0HA 4ELRA 4NE4A 2B3FA 1GGGA 5JTYA 1DTZA 3SESA 1M5DA 2DYXA 1N84A 3BFTA 3PD8A 2F6GA 5I2KB 4DCXA 2DWHA 4XKNA 1IEJA 1US5A 4HCYA 3MVWA 2XXYA 2DE4A 5AE4A 4YKPA 1MDQA 2O7UA 1HSJA 5IAIA 2W7YA 4R2BA 1B05A 2P0SA 3U8QA 4OTEA 4KYDA 1LAGE 3VFJA 4RPNA 4N6PA 1AMFA 1MXZA 2OWTA 1Y4TA 3OEMA 1SYHA 4U21A 2VD3A 2H9BA 4YICA 4NMYA 1QVSA 4U2RA 3KSXA 1GVCA 3PUXE 1SVXB 4NWCA 3FIRA 4F18A 3TTLA 3QK6A 3ZKLA 5AA4B 1D4NA 2OWSA 4YZZA 3VLUA 3CRBA 1S50A 1FQCA 2PX1A 4U4XA 4ZZAA 4OWDA 3K6UA 2VD2A 3MQ9A 2X7PA 1JW1A 1M5BA 2QJEA 2ZMBA 4OEUA 3R26A 2ALUA 5JTYB 3C31A 2D5WA 1EZOA 2Y7KA 2DS9A 1PC3A 3LR1A 4MBPA 1O64A 5DYHA 3CSBA 1N3WA 1FTJA 4BDNA 5H8QA 2QS3A 2XXHA 2HQ0A 5JK4A 3PPPA 1VE4A 1JVYA 4ZZEA 4PETA 4X9TA 3TKDA 5I59A 1ANFA 3PPQA 4HS7A 3IX1A 4NF6A 4RNSA 1A54A 2ZYKA 4LZ8A 1MXVA 1D3KA 1SYIA 4Z7EA 3Q27A 2I49A 4NF8A 4FECA 2QS2A 3I6VA 2REGA 1B2HA 2HZKA 1MY3A 3MW0A 4O3BA 3S9NC 3MJNA 2ONSA 5FTHA 4POXA 3KBRA 4WEPA 2FYIA 4XXUA 3G7WA 4LATA 3MZ9A 3EHTA 3K00A 2AYSA 3HCQA 2E1SA 4F39A 4BDQA 3RN8A 3FXRA 1FCKA 2PBWA 3C36A 4IY5A 5DVIA 1LSTA 2P1SA 1AOVA 1P1WA 1RKMA 2GFEA 1VFDA 3WAEA 1SDXA 2UVJA 5H8QB 3TTKA 1URSA 4YKIA 4ELPA 3FV1A 4H6DA 2AIXA 2A5TA 5I59B 3DELB 3EN3A 4QFLA 3VVFA 1P99A 3KN3A 2UYFA 4I62A 3MPKA 3MZBA 4NF6B 3I5OA 1YTVA 2H25A 1VSOA 3CR9A 4NF8B 2THIA 2R71A 4H67A 1T0KA 1POTA 3MBPA 4ZE9A 5CBRA 1CB6A 3HSTA 4F3SA 4M1VA 2OBGA 2O69A 1XVYA 4R6HA 4WEDA 3LC8A 4HTGA 4YKKA 5I58A 3O6IA 2GH9A 3H4ZA 3OOAA 3M3KA 3PUVE 3O6HA 1XT8A 1A55A 4ND9A 2XHDA 2Y7IA 3K0VA 5DT6A 3KN7A 2I58A 4H1XA 4ZEKA 3IOWA 3T9XB 4AQ4A 1I6QA 5A5XA 3B6WA 1XS5A 1TFAA 3LBSA 1L5TA 2DWIA 3QSLA 3DM0A 1ZJLA 3TCGA 1N7XA 3MWBA 1TWYA 3SEVA 3OO6A 2XX9A 1MH3A 4NF4A 3PMXA 3LSFB 4ONYA 3K6VA 3M3FA 1WVJA 4GF8A 3U1OA 3PPOA 1B1HA 1QJMA 2A5TB 4WKMA 2GHAA 3PGFA 1IIWA 4C1UA 4G4PA 2VP1A 4DXCA 1URGA 3TZAA 3KG2A 2BJJX 1TXFA 2CMOA 2PT2A 3K6WA 1H76A 5L9SA 1AIVA 2YJPA 3WAFA 1I69A 4Q8RA 4EQ7A 3OO7A 3FUZA 4ELOA 1RYOA 2XXWA 3LSXA 4MF3A 4OEVA 3KSJA 2M8CA 1B4ZA 4ZEFA 3VVEA 5DEXA 3G3IA 4KQPA 1KWHA 2DSFA 4JDFA 4MFIA 4H8JA 4K3FA 1AH5A 3H03A 3G3HA 4GIZA 3RPWA 1N3XA 1Y9UA 3GLBA 4GLIA 5A5XB 2LAOA 4EUOA 3C35A 2XXTA 4TOZA 1MM6A 1IQ7A 2WKYA 4R73A 3GXAA 4POWA 4BDOA 2UVHA 3ZKKA 2HAVA 3QUJA 4IGTA 4NF4B 4H8IA 3RTWB 4RK2A 3F11A 4OMBA 1EH3A 1PBQA 4N07A 4EQBA 3T9UA 3FXQA 4G2ZA 3Q28A 1OQHA 3V5AA 5ICQA 4QFKA 4R6KA
chains in the Genus database with same CATH superfamily
4IY6A 2ZYMA 2V93A 2WEFA 4PCDA 1DTGA 1F9BA 1M5EA 1BIYA 1JQFA 5FBPA 3IL1B 1QUIA 3E78A 5KCJB 4NEDA 1MG1A 1FTAA 3T9VA 4DI3D 3C9HA 2DOJA 1MH4A 2O1MA 1MPBA 1SQYA 2NUVA 1OIBA 2I4BA 4OQOA 3IR1A 3UN6A 3V89B 2O1LA 4ISUA 4ZE8A 4MH5A 3U65A 1O63A 2A5SA 2PYYA 1LFHA 4QF9A 2VOZA 3VXCA 3S9MC 3RQTA 1IMFA 5DEXB 5H8HA 1Z7NE 3OELA 4JXIA 4O3CA 3SETA 4JVDA 1CNQA 4EXKA 3VE1B 3OENA 3MVYA 4THIA 2XXXA 3M8UA 5FHNA 1QULA 4RPOA 3JV9A 1XOCA 4P11A 1NH7A 3H6WA 3THIA 1FPIA 1VDWA 4PAKA 2PT1A 4KCDA 1YZ0A 2Y7PA 1IXHA 3ISPA 3FVGA 4DLDA 1SI1A 3HFUA 4O7IA 1IXIA 2I0BA 2O51A 3RNNA 4BDRA 4OA4A 3OMBA 4GWOA 1USYH 5L8DA 5AA1A 2OJTA 3S9LC 4OANA 4GD5A 2FA7A 2DWJA 2HPGA 4OVSA 5AA3A 1B3EA 5ICTA 4XKQA 1FQFA 3Q26A 2Q2CA 4GXAA 5H8NA 3EHUA 3CIJA 1B46A 2OX3A 1BLFA 1UIUA 2OCUA 2UYEA 5EQ8A 1ZLQA 1P1UA 4KI0E 4GL0A 4X04A 2OK2A 3KOTA 1D9QA 1DPPA 3MSTA 1DPEA 3G3KA 3OSRA 3DP8A 4R74A 5IM2A 4DI4B 3TUSA 3LSWA 5H8HB 3L6HA 3SDFA 4IO5A 1IXCA 2DP8A 4AS4A 2B3BA 2L5VA 1R1NA 3IAZA 4LQ5A 4LUBA 3T96B 3QIMA 4DDDA 4PTKA 4PE3A 1UIVA 3U93A 2XD2A 5LOMA 5I7IA 2ZZXA 5CRYA 4ZEIA 2ZXTA 3B50A 4N17A 2PMSA 1KA0A 3N94A 4RY1A 1DOTA 1N0TA 1Y3PA 3E4RA 3GZGA 3QMFA 4IB2A 4NN3A 2F97A 1LFGA 3R7XA 1FPKA 4EXLA 3DLNA 3H06B 1LB9A 3D1RA 1AL3A 5CBSA 2ZNTA 4RA1A 4HW8A 1NUYA 3K2DA 3G3GA 1B51A 5H8NB 3T22A 4HE0A 4GL8A 4JSDA 1LAFE 4RXLA 4GX3A 3CG3A 3FVKA 4DXUA 4GRKA 4HE2A 5B7DA 1LBXA 2HCAA 1NMUA 3PUYE 5H8FA 4MNIA 2DVCA 1B3LA 3TTNA 5IKBA 3A09A 1LBYA 4FEDA 5CM6A 1H44A 4N13A 1ZMGA 3VV5A 1NV5A 4GVOA 1A7LA 1WDNA 1S7YA 3RT6B 4LONB 3EPEA 2FVZA 3ZS6A 2XXRA 1D9VA 1MXUA 1B3FA 4R75A 3C33A 1A8FA 4QSDA 1FQBA 5ET8A 2XD3A 1M5CA 1LAHE 3RLFE 3KBZA 1N7WA 1CE2A 4XTCQ 4OFLA 2KQZA 5CMMA 1WODA 3HPIA 3PV0E 4QHQA 2Y7WA 4H5GA 2XXPA 2QMWA 1XI6A 1A8EA 1DK4A 4ZECA 4I9DA 2Y5LA 1MS7A 3CFXA 3U92A 2QFLA 2I3VA 2UVGA 1LB8A 1EZPA 2V25A 2V3TA 4KHZE 3MP6A 4O3AA 3FVNA 2I4CA 3ILTB 2NOOA 2Q88A 3TTMA 2B4MA 1ZKBA 1UTHA 4P0IA 3E13X 4OFJA 3KJTA 1B5JA 2RCBA 2XXVA 1FPFA 3JYRA 2OWZA 4G77A 4JWYA 4PF6A 1IZ1A 3PPNA 4NGUA 4OVTA 3FJMA 5IZ3B 1OLCA 2VPOA 5H8SA 5H8FB 4P56A 1NV7A 2RF1A 2B65A 2X26A 4NWDA 5I2NA 3H6TA 1A99A 4X8RA 2Z8EA 3EF7A 3S2VA 1POY1 4H65A 2PFYA 2QPQA 1MXWA 3TEPA 1OMPA 2IA4A 2QL3A 4FE8A 3MUQA 4OYVA 5EQ9A 3MVZA 4GWWA 1GR2A 3OO8A 2HHMA 2F5XA 1YCJA 3MVXA 2HAUA 1USYE 3FV2A 2O6AA 5AA2A 4QFPA 2CEXA 3BKIB 4O94A 3MPLA 2H5YA 1Q1KA 3TDJA 5EHMA 3QXMA 3DP4A 2KLFA 2ZNSA 1B32A 1NUZA 1HSEA 3MP1A 4PDHA 3OO9A 1MQIA 3MYUA 3OXNA 4O8MA 1BK4A 4PFYA 4C0RA 5CI5A 1NH8A 4G8MA 4MCOA 1BTJA 3O28A 4KPTA 1JW5A 5I56A 1UTHB 3KC1A 4PGPA 3O6GA 1FBCA 4P0GA 4LN5A 4N8YA 5KCJA 5CMCA 3TFLA 2I48A 4ESXA 2ABHA 1PB9A 3TTRA 3HV1A 5EYFA 1K9ZA 2DDKA 4JWOA 4PFWA 2V84A 3IK6B 2RINA 1RDZA 3IFCA 2NXOA 1OVBA 4MAGA 4IO7A 2PVUA 3VLWA 4YMAA 1LLSA 4FIMA 4LQ2A 3O97A 3BBRA 1DCUA 3BIHA 5F7VA 4N6KA 1EZ9A 1QKAA 5I2NB 2DWAA 5LDZA 5ET7A 1EU8A 3OD7A 2I3WA 1MXXA 2CZIA 3CI8A 3HHGA 2FHYA 3HN0A 1MDP1 4U1ZA 1JVXA 4GQOA 2Z22A 4Z0IA 3TODA 2XX8A 5ITOA 4U4SA 3T66A 4BDMA 3LV0A 3T93B 2O68A 5AA2B 2DE3A 2B4LA 1JNFA 1FTMA 4F22A 1JEUA 1FPGA 3H3GA 4NF5B 4ELQA 3KN8A 4KCCA 4EF1A 1FBPA 1MXYA 1OLAA 1SPIA 4IO2A 1NUWA 3UORA 3ILUB 3FASA 4QFNA 4IR8A 1MY2A 1Y3QA 5EQAA 1B7HA 4ZEDA 4F31B 3O9PA 5BWJA 5BUUA 1S9TA 1R9QA 1FBGA 4G8NA 3T0JA 3LUYA 3H6UA 4EF2A 1DBZA 3E9XA 5I56B 3FVOA 1NNFA 2XXIA 1ZBMA 4OVQA 1H3DA 1AWBA 5ISUA 2F36A 2DXRA 1LCFA 2F7AA 1HSLA 3SKPA 2D3IA 3H6VA 2DQVA 3W9WA 2RC8A 3UA8A 3PMWA 5K2XA 4H46A 4UABA 4L17A 4RK9A 3GBAA 1ZIUA 4U1OA 5AA2D 2H98A 3FBPA 5EQ7A 4EDPA 4GX4A 2G29A 1IUDA 3K6XA 4EQ9A 2Q2AA 1IMCA 4GOTA 1B6HA 3SERA 1SW1A 3KGCA 4P8BA 4R9GA 5I57B 2QRYA 4KFQA 3K1NA 1MQGA 4G61A 3K01A 4X1BA 3V8XB 2UXAA 1B52A 4OFOA 5CC2A 1B40A 1B5IA 4GBWA 2XXUA 2YLNA 4KYSA 1JETA 2PCRA 1SW4A 3RT8A 4MNCA 1N04A 3ODBA 1B7UA 1II5A 3IJXB 4PAFA 2V4CA 1MQDA 4OZ9A 1JW4A 1QUKA 1FTKA 2REJA 5DVFA 4YB7A 4FEBA 4P9KA 2R9JA 1MPDA 3B6QA 1B1XA 5JEIA 3OSQA 4U23A 4H5FA 1ZU0A 4XKPA 4NAPA 5TU0A 3TCFA 3PUWE 3D4GA 3CG1A 2Q74A 4MEVA 4ZDMA 5B70A 1OQGA 4HCWA 3U72A 3VXBA 5EYGA 3K02A 4RYAA 4LP2B 1MM7A 3PMVA 1FQAA 1LCTA 3Q29A 3TMGA 1NKXA 5EHSA 1TFDA 4LZ5A 2F7BA 1P1OA 2F6PA 4GWZA 4AB6A 2Q8JA 4DCYA 2FIXA 3K1MA 3RYDA 4LVQA 3CFZA 3TPAA 3QUFA 2P3VA 2RC9A 2XXQA 3FXUA 3IO6A 3RGYA 2QVRA 1UTBA 1LBBA 3IFAA 3N6TA 4OESA 4Q5TA 3TQLA 3VVDA 4F1VA 1NI9A 3IORA 2X7QA 1P1QA 3RY3A 3SEWA 4ECFA 2O7IA 4QSCA 1NV0A 3TELA 3HHFA 5KZTA 5KDTA 5CMBA 1Q35A 2MKZA 2I6EA 3TAJA 2Z23A 2RC7A 2HZLA 4LA9A 1B3GA 1LAXA 1LBCA 3UGWA 1FTLA 1Y4CA 2DE2A 3G3JA 2F8DA 3N26A 4F19A 2H99A 1B7ZA 4C1TA 5ELVA 3TQWA 1J1NA 2IEEA 4WXJA 1MRPA 4F1YA 3PD9A 3S9EA 1MPCA 1IXGA 2HFBA 2V3QA 2R6GE 2AL4A 3H7MA 3PPRA 3IO4A 2OZZA 1LGBC 4OERA 4ZS9A 3ROJA 1Y20A 3R6UA 1B0LA 3C34A 2RKMA 4M4GA 4N6DA 3VLVA 4R72A 3O2AA 3P7IA 1MY0A 2Z8FA 3N6UA 3GBBA 2ZYOA 1UQWA 4H0WA 5IZ3A 3G3FA 4OVJA 1RYXA 5HM4B 3E3KA 1YAEA 4JBZA 1XC1A 2VHAA 2BJIA 5HBCA 1MY4A 4FORA 1FQEA 1H43A 2NWJA 3ZSFA 2E0SA 1XVXA 4HXVA 3FATA 4GX6A 4YAHX 3S4UA 4XKRA 2VPNA 1UTBB 2JJKA 2D21A 1VFEA 2GQ1A 3K1PA 4Q30B 1FBEA 3FJGA 1IMEA 3B7DA 1IITA 1B3HA 4GWYA 1RDXA 3O66A 2WYPA 3TCHA 1GTKA 1FJ6A 3BFUA 3B8BA 4YMBA 3UIFA 5KDTB 4F29A 4F2QA 1TT1A 1JEVA 4ESWA 2ONRA 4PE5B 4G8HA 5ITPA 5ET6A 3DP6A 3JZJA 1B4HA 1MQJA 2GRVA 5J1DA 3D4CA 2F34A 1SBPA 3ECRA 4AB5A 1XHYA 1H45A 1NNPA 1Y1MA 4P3LA 4PFIA 4F2OA 1US4A 4JWXA 4FATA 4PFTA 3EHSA 2HEUA 4RJZA 2Q89A 4QBAA 4PP0A 4YB5A 5I84A 1VR5A 2YPNA 2ONKE 4N8GA 3L6GA 1FBDA 4YKJA 4TLMB 2DXYA 1EYJA 1QUJA 2Q9TA 3EQ1A 5F1QA 5I3SA 3UK4A 3FD3A 4ZEBA 2CZHA 5K2YA 4F1UA 4YB6A 1ZTYA 4R2FA 3USDA 4GFRA 3NOHA 3SEUA 5LTCA 3RTFB 2F3BA 4NHBA 3PU5A 4KD5A 3TYHA 2ANJA 5FTIA 1FRPA 4KYEA 3MZ1A 5FHOA 4F3PA 5DTBA 4GBVA 4MLVA 1YPNA 4FJPA 4XFEA 3T9HB 4MLQA 5TPAA 2V3UA 2VGQA 1PDAA 4PFUA 3AXFA 1BKAA 2RCAA 4X1DA 5L9MA 1NL5A 2ZYNA 3Q25A 4U22A 3IJOB 2QSXA 2NVUB 4FBPA 1PEBA 4N15A 2QVVA 3FGSA 3CSGA 4G68A 4DXBA 2FNCA 4BLAA 1INPA 1DSNA 3CFLA 3ONMA 3SEXA 1FSAA 1PBPA 1R9LA 1OVTA 4PBQA 3W15C 3C32A 1N76A 4JB7A 4JVIA 2ZZVA 3QAXA 4R6YA 4NF5A 4YU0A 4XIGQ 5CMKA 1M5FA 2Y7RA 4E0WA 3B6TA 4DZ1A 1QW0A 4OENA 3LSLA 1Q9DA 4IO6A 4FAJA 1PB8A 2OLBA 1LFIA 3KOSA 3KFMA 1NUXA 2Q8MA 4I1DA 2F78A 3IOVA 3A3CA 3UP9A 4IO3A 3PUZE 4GWSA 3IOTA 4LZ7A 5IZ1A 2AL5A 4P47A 1QKBA 1URDA 2ESNA 4IO4A 3RUMA 1GV8A 2ZZWA 4DIGA 1NNTA 4G68C 4MMPA 1Y1ZA 2F35A 1SW5A 3K4UA 2ZNUA 3IOUA 1P1NA 3U94A 3KJ7A 4TLLB 4F3GA 3I3VA 1ATGA 4QFOA 5I57A 5M2VA 4E0XA 1A40A 2O84X 4P1LA 3MAMA 5TPAB 3IB0A 4QRZA 1FQDA 3SEYA 2H4IA 2Z8DA 3MC2A 1I6AA 1B9JA 2P2AA 5I58B 1FW0A 3PTYA 2WBDA 1FTOA 2PFZA 1SD3A 4X48A 1BP5A 1IMBA 1DMBA 1Z7ME 2HXRA 1SI0A 5TP9A 5FHMA 2WBBA 4Q0CA 4R9FA 1Y3NA 2UVIA 3N5LA 4G68B 1LEVA 5L9OA 4I8CA 3HO7A 1SW2A 4OETA 2CEYA 4F3BA 1D9YA 3IB1A 3M3LA 3V83A 2XX7A 3QYTA 4UA8A 5I2KA 2HXWA 4QSEA 3KEIA 4KR5A 3T1BA 5DW8A 3C4MA 5DVJA 5T3JA 3A3UA 1YXIA 4DE8A 1B5HA 4JSOA 4UACA 2QS1A 4NTLA 3FZVA 1R6ZA 3IB2A 2G93A 2WX9A 1I6BA 1MY1A 3FJ7A 5J16A 5IGAA 4OHNA 2FBPA 1MQHA 4PBHA 1NNKA 2P3NA 2F7CA 4I3YA 1PB7A 1B58A 3KZGA 4PQJA 3OEKA 1NV6A 2DVZA 2I0CA 4IGRA 3BIGA 4BDLA 1G0IA 1EYKA 5HPQA 2Y84A 4O7MA 5AA4A 2CZKA 4OXVA 3VDFA 3O29A 4N81A 1NFTA 2CZLA 4GXSB 2GHBA 4PGNA 2QS4A 3MP8A 1NV2A 3CVGA 1ELJA 4TQUQ 1FBHA 1O7TA 2QMXA 5TP9B 3W9VA 1B0HA 3GYYA 4ELRA 4NE4A 2R8TA 2VT5A 2B3FA 1GGGA 5JTYA 1DTZA 3SESA 4PFRA 1M5DA 2DYXA 2XWIA 1N84A 5IZZA 3BFTA 3PD8A 2F6GA 5I2KB 2WYKA 4DCXA 1LBVA 3CHGA 2DWHA 4XKNA 1IEJA 1US5A 4HCYA 3MVWA 2XXYA 4NG7A 2DE4A 5AE4A 1LBWA 4YKPA 1MDQA 2O7UA 1HSJA 5IAIA 2W7YA 4R2BA 1B05A 2P0SA 4P1EA 1FPEA 3U8QA 4OTEA 4KYDA 1LAGE 5ET5A 3VFJA 3RPLA 4RPNA 4N6PA 1AMFA 1MXZA 2OWTA 1Y4TA 3OEMA 1SYHA 4U21A 2VD3A 2H9BA 4YICA 4NMYA 1QVSA 4U2RA 3KSXA 1GVCA 3PUXE 1SVXB 4NWCA 3FIRA 4F18A 3TTLA 2KR0A 3QK6A 3ZKLA 5AA4B 1D4NA 2OWSA 4YZZA 3VLUA 3CRBA 1FJ9A 1S50A 1EYIA 1FQCA 3FXBA 2PX1A 4HE1A 4U4XA 4ZZAA 3E79A 4OWDA 3K6UA 2VD2A 3MQ9A 2X7PA 1JW1A 1M5BA 2QJEA 2ZMBA 4OEUA 3R26A 5EYHA 2ALUA 5JTYB 4NF0A 3C31A 2D5WA 1EZOA 2Y7KA 2DS9A 1PC3A 3LR1A 4MBPA 1O64A 5DYHA 3CSBA 4N4UA 1FPDA 4OVRA 4PAIA 1N3WA 1FTJA 1JP4A 4BDNA 5H8QA 2QS3A 2XXHA 1KA1A 2HQ0A 5JK4A 3PPPA 1VE4A 1JVYA 4ZZEA 4PETA 4X9TA 3TKDA 1FPLA 3RPLB 5I59A 5ESYA 1ANFA 3PPQA 4HS7A 4MHFA 3IX1A 1NV3A 4NF6A 4RNSA 1A54A 2ZYKA 4PF8A 4LZ8A 1MXVA 1D3KA 1SYIA 4Z7EA 1NV1A 3Q27A 2I49A 4NF8A 4FECA 2QS2A 4XF5A 3I6VA 2REGA 1B2HA 2HZKA 1MY3A 3MW0A 4MJOA 4O3BA 3S9NC 3MJNA 2ONSA 5FTHA 4POXA 3KBRA 4WEPA 1FBFA 2FYIA 4MX6A 4XXUA 3G7WA 4LATA 3MZ9A 3EHTA 3K00A 2AYSA 3HCQA 2E1SA 2XXKA 1FPJA 5A5LA 4F39A 4BDQA 3RN8A 3FXRA 1FCKA 2PBWA 3C36A 4IY5A 5DVIA 1LSTA 2P1SA 1AOVA 1P1WA 1RKMA 2GFEA 1VFDA 3WAEA 1SDXA 2UVJA 5H8QB 4QXDA 3TTKA 1URSA 4YKIA 4ELPA 3FV1A 4XEQA 4H6DA 2AIXA 2A5TA 5I59B 3DELB 3EN3A 4QFLA 3VVFA 1P99A 3KN3A 2UYFA 4I62A 3MPKA 3MZBA 4OVPA 4NF6B 3I5OA 1NV4A 2Y5KA 1YTVA 2H25A 1VSOA 5F24A 3CR9A 4NF8B 2THIA 2R71A 4H67A 1T0KA 1POTA 3MBPA 4ZE9A 5CBRA 1CB6A 3HSTA 4F3SA 3A29A 4M1VA 3EKIA 2OBGA 2O69A 1XVYA 4R6HA 4WEDA 1G0HA 1YYZA 3LC8A 1KZ8A 4HTGA 4YKKA 5I58A 1IMAA 3O6IA 2GH9A 3H4ZA 3OOAA 4NX1A 3M3KA 3PUVE 2XWVA 3O6HA 1XT8A 1A55A 4ND9A 2XHDA 2Y7IA 3K0VA 5DT6A 3KN7A 2I58A 4H1XA 4ZEKA 3IOWA 3T9XB 4AQ4A 1I6QA 5A5XA 3B6WA 1XS5A 1TFAA 4H45A 3LBSA 1L5TA 2DWIA 3QSLA 3DM0A 1ZJLA 3TCGA 1N7XA 4I3EA 3MWBA 1TWYA 3SEVA 3OO6A 2XX9A 1MH3A 2XA5A 4NF4A 3PMXA 3LSFB 4ONYA 1RDYA 3K6VA 3M3FA 4KXPA 1WVJA 4GF8A 3U1OA 3PPOA 4I40A 1B1HA 1FPBA 1QJMA 2A5TB 4WKMA 2GHAA 1IMDA 3PGFA 1IIWA 1K9YA 4C1UA 4G4PA 2VP1A 4DXCA 4MNPA 1URGA 3TZAA 2F3DA 4GWUA 3KG2A 2BJJX 1TXFA 2CMOA 2PT2A 3K6WA 1H76A 5L9SA 1AIVA 2YJPA 4MIJA 3WAFA 1I69A 4Q8RA 4EQ7A 3OO7A 4PDDA 4PFBA 3FUZA 4ELOA 1RYOA 2XXWA 3LSXA 2FIEA 4MF3A 3KC0A 4OEVA 3KSJA 2M8CA 1B4ZA 4ZEFA 3VVEA 5DEXA 3G3IA 4KQPA 1KWHA 2DSFA 4JVCA 3LUZA 4JDFA 4MFIA 4H8JA 4K3FA 1AH5A 3H03A 3G3HA 4GIZA 3RPWA 5I5PA 4GWXA 1N3XA 1QGXA 1Y9UA 3GLBA 4GLIA 5A5XB 2LAOA 4EUOA 3C35A 4PC9A 3SZPA 2XXTA 4TOZA 4AS5A 1MM6A 1IQ7A 2WKYA 4R73A 1LBZA 2XWKA 3GXAA 4NQ8A 4POWA 2QVUA 4BDOA 2UVHA 3ZKKA 2HAVA 3QUJA 4IGTA 4NF4B 4H8IA 3RTWB 4RK2A 3F11A 4OMBA 1EH3A 1PBQA 2XWOA 4N07A 4EQBA 3T9UA 3FXQA 4G2ZA 4N91A 3Q28A 1OQHA 3V5AA 5ICQA 4QFKA 4R6KA
chains in the Genus database with same CATH topology
4IY6A 2ZYMA 2V93A 1DTGA 1F9BA 1M5EA 1BIYA 1JQFA 3IL1B 1QUIA 5KCJB 4NEDA 1MG1A 3T9VA 3C9HA 2DOJA 1MH4A 2O1MA 1MPBA 1SQYA 2NUVA 1OIBA 2I4BA 4OQOA 3IR1A 3UN6A 3V89B 2O1LA 4ISUA 4ZE8A 4MH5A 1O63A 2A5SA 2PYYA 1LFHA 4QF9A 2VOZA 3VXCA 3S9MC 3RQTA 5DEXB 5H8HA 1Z7NE 3OELA 4JXIA 4O3CA 3SETA 4EXKA 3VE1B 3OENA 3MVYA 4THIA 2XXXA 3M8UA 5FHNA 1QULA 4RPOA 3JV9A 1XOCA 4P11A 1NH7A 3H6WA 3THIA 2PT1A 4KCDA 2Y7PA 1IXHA 3FVGA 4DLDA 1SI1A 1IXIA 2I0BA 2O51A 3RNNA 4BDRA 3OMBA 4GWOA 1USYH 5L8DA 5AA1A 2OJTA 3S9LC 4GD5A 2FA7A 2DWJA 5AA3A 1B3EA 5ICTA 4XKQA 1FQFA 3Q26A 2Q2CA 4GXAA 5H8NA 3EHUA 3CIJA 1B46A 1BLFA 1UIUA 2OCUA 2UYEA 1ZLQA 1P1UA 4KI0E 4GL0A 2OK2A 3KOTA 1DPPA 1DPEA 3G3KA 3OSRA 3DP8A 4R74A 3TUSA 3LSWA 5H8HB 3L6HA 3SDFA 4IO5A 1IXCA 2DP8A 2B3BA 1R1NA 3IAZA 4LQ5A 4LUBA 3T96B 3QIMA 4DDDA 1UIVA 3U93A 2XD2A 5LOMA 5CRYA 4ZEIA 2ZXTA 2PMSA 3N94A 4RY1A 1DOTA 1N0TA 1Y3PA 3E4RA 3GZGA 4IB2A 2F97A 1LFGA 3R7XA 4EXLA 3DLNA 3H06B 1LB9A 1AL3A 5CBSA 2ZNTA 4RA1A 4HW8A 3K2DA 3G3GA 1B51A 5H8NB 3T22A 4GL8A 4JSDA 1LAFE 4RXLA 3CG3A 3FVKA 4DXUA 4GRKA 5B7DA 2HCAA 1NMUA 3PUYE 5H8FA 2DVCA 1B3LA 3TTNA 5IKBA 3A09A 4FEDA 5CM6A 1H44A 4N13A 1ZMGA 3VV5A 4GVOA 1A7LA 1WDNA 1S7YA 3RT6B 4LONB 3EPEA 3ZS6A 2XXRA 1D9VA 1MXUA 1B3FA 4R75A 3C33A 1A8FA 4QSDA 1FQBA 2XD3A 1M5CA 1LAHE 3RLFE 1N7WA 1CE2A 4XTCQ 4OFLA 5CMMA 1WODA 3HPIA 3PV0E 4QHQA 2Y7WA 4H5GA 2XXPA 2QMWA 1A8EA 4ZECA 4I9DA 1MS7A 3CFXA 3U92A 2I3VA 2UVGA 1LB8A 1EZPA 2V25A 2V3TA 4KHZE 3MP6A 4O3AA 3FVNA 2I4CA 3ILTB 2NOOA 2Q88A 3TTMA 1ZKBA 1UTHA 4P0IA 3E13X 4OFJA 3KJTA 1B5JA 2RCBA 2XXVA 3JYRA 4G77A 4JWYA 1IZ1A 3PPNA 3FJMA 1OLCA 5H8SA 5H8FB 2RF1A 2B65A 2X26A 4NWDA 5I2NA 3H6TA 1A99A 2Z8EA 3EF7A 3S2VA 1POY1 4H65A 2QPQA 1MXWA 3TEPA 1OMPA 2IA4A 2QL3A 4FE8A 3MUQA 4OYVA 3MVZA 1GR2A 3OO8A 2F5XA 1YCJA 3MVXA 2HAUA 1USYE 3FV2A 2O6AA 5AA2A 4QFPA 3BKIB 3MPLA 2H5YA 1Q1KA 3TDJA 5EHMA 3QXMA 3DP4A 2KLFA 2ZNSA 1B32A 1HSEA 3MP1A 3OO9A 1MQIA 3OXNA 4C0RA 4PFYA 5CI5A 1NH8A 4G8MA 1BTJA 3O28A 4KPTA 1JW5A 5I56A 1UTHB 3O6GA 4P0GA 5KCJA 5CMCA 3TFLA 2I48A 4ESXA 2ABHA 1PB9A 3TTRA 3HV1A 5EYFA 4JWOA 4PFWA 2V84A 3IK6B 2RINA 2NXOA 1OVBA 4IO7A 2PVUA 3VLWA 4YMAA 1LLSA 4FIMA 4LQ2A 3O97A 3BBRA 5F7VA 1EZ9A 1QKAA 5I2NB 2DWAA 1EU8A 3OD7A 2I3WA 1MXXA 3CI8A 3HHGA 3HN0A 1MDP1 4U1ZA 1JVXA 4GQOA 2Z22A 4Z0IA 3TODA 2XX8A 5ITOA 4U4SA 3T66A 4BDMA 3T93B 2O68A 5AA2B 2DE3A 1JNFA 1FTMA 4F22A 1JEUA 3H3GA 4NF5B 4ELQA 3KN8A 4KCCA 4EF1A 1MXYA 1OLAA 4IO2A 3UORA 3ILUB 3FASA 4QFNA 1MY2A 1Y3QA 4ZEDA 1B7HA 4F31B 3O9PA 5BWJA 5BUUA 1S9TA 1R9QA 4G8NA 3LUYA 3H6UA 4EF2A 3E9XA 5I56B 3FVOA 1NNFA 2XXIA 1ZBMA 1H3DA 5ISUA 2F36A 2DXRA 1LCFA 2F7AA 1HSLA 3SKPA 2D3IA 3H6VA 2DQVA 3W9WA 2RC8A 3UA8A 3PMWA 5K2XA 4L17A 4RK9A 3GBAA 1ZIUA 4U1OA 5AA2D 2H98A 4EDPA 2G29A 1IUDA 3K6XA 4EQ9A 2Q2AA 4GOTA 1B6HA 3SERA 1SW1A 3KGCA 4R9GA 5I57B 2QRYA 4KFQA 3K1NA 1MQGA 3K01A 4X1BA 3V8XB 2UXAA 1B52A 4OFOA 5CC2A 1B40A 1B5IA 2XXUA 2YLNA 4KYSA 1JETA 1SW4A 3RT8A 1N04A 3ODBA 1B7UA 1II5A 3IJXB 1MQDA 4OZ9A 1JW4A 1QUKA 1FTKA 2REJA 5DVFA 4YB7A 4FEBA 2R9JA 1MPDA 3B6QA 1B1XA 5JEIA 3OSQA 4U23A 4H5FA 1ZU0A 4XKPA 5TU0A 3TCFA 3PUWE 3D4GA 3CG1A 4ZDMA 5B70A 1OQGA 4HCWA 3U72A 3VXBA 3K02A 4RYAA 4LP2B 1MM7A 3PMVA 1FQAA 1LCTA 3Q29A 3TMGA 1NKXA 5EHSA 1TFDA 4LZ5A 2F7BA 1P1OA 2F6PA 4AB6A 2Q8JA 4DCYA 3K1MA 4LVQA 3CFZA 3TPAA 3QUFA 2RC9A 2XXQA 3FXUA 3IO6A 3RGYA 1UTBA 1LBBA 3N6TA 4OESA 4Q5TA 3TQLA 3VVDA 4F1VA 3IORA 2X7QA 1P1QA 3RY3A 3SEWA 4ECFA 2O7IA 4QSCA 3TELA 3HHFA 5KZTA 5KDTA 5CMBA 1Q35A 2I6EA 3TAJA 2Z23A 2RC7A 2HZLA 4LA9A 1B3GA 1LAXA 1LBCA 3UGWA 1FTLA 1Y4CA 2DE2A 3G3JA 2F8DA 3N26A 4F19A 2H99A 1B7ZA 4C1TA 5ELVA 3TQWA 1J1NA 2IEEA 4WXJA 1MRPA 4F1YA 3PD9A 3S9EA 1MPCA 1IXGA 2HFBA 2V3QA 2R6GE 2AL4A 3H7MA 3PPRA 3IO4A 2OZZA 1LGBC 4OERA 4ZS9A 1Y20A 3R6UA 1B0LA 3C34A 2RKMA 4M4GA 3VLVA 4R72A 3O2AA 3P7IA 1MY0A 2Z8FA 3N6UA 3GBBA 2ZYOA 1UQWA 4H0WA 3G3FA 4OVJA 1RYXA 5HM4B 3E3KA 1YAEA 4JBZA 1XC1A 2VHAA 5HBCA 1MY4A 4FORA 1FQEA 1H43A 2NWJA 3ZSFA 2E0SA 1XVXA 4YAHX 3FATA 3S4UA 4XKRA 1UTBB 2D21A 1VFEA 3K1PA 4Q30B 3FJGA 3B7DA 1IITA 1B3HA 3O66A 3TCHA 1GTKA 3BFUA 4YMBA 3UIFA 5KDTB 4F29A 4F2QA 1TT1A 1JEVA 4ESWA 2ONRA 4PE5B 4G8HA 5ITPA 3DP6A 3JZJA 1B4HA 1MQJA 2GRVA 5J1DA 3D4CA 2F34A 1SBPA 3ECRA 4AB5A 1XHYA 1H45A 1NNPA 1Y1MA 4F2OA 1US4A 4JWXA 4FATA 4PFTA 3EHSA 2HEUA 4RJZA 2Q89A 4PP0A 4YB5A 5I84A 1VR5A 2YPNA 2ONKE 3L6GA 4YKJA 4TLMB 2DXYA 1QUJA 2Q9TA 3EQ1A 5F1QA 3UK4A 3FD3A 4ZEBA 5K2YA 4F1UA 4YB6A 1ZTYA 4R2FA 3USDA 4GFRA 3SEUA 3RTFB 3PU5A 4KD5A 3TYHA 2ANJA 5FTIA 4KYEA 3MZ1A 5FHOA 4F3PA 5DTBA 4MLVA 1YPNA 4FJPA 3T9HB 4MLQA 5TPAA 2V3UA 2VGQA 1PDAA 4PFUA 3AXFA 1BKAA 2RCAA 4X1DA 5L9MA 1NL5A 2ZYNA 3Q25A 4U22A 3IJOB 2QSXA 2NVUB 1PEBA 3FGSA 3CSGA 4G68A 4DXBA 2FNCA 4BLAA 1DSNA 3CFLA 3ONMA 3SEXA 1PBPA 1R9LA 1OVTA 3W15C 3C32A 1N76A 4JB7A 3QAXA 4R6YA 4NF5A 4YU0A 4XIGQ 5CMKA 1M5FA 2Y7RA 4E0WA 3B6TA 4DZ1A 1QW0A 4OENA 3LSLA 4IO6A 4FAJA 1PB8A 2OLBA 1LFIA 3KOSA 3KFMA 4I1DA 2F78A 3IOVA 3A3CA 3UP9A 4IO3A 3PUZE 3IOTA 4LZ7A 2AL5A 1QKBA 1URDA 2ESNA 4IO4A 3RUMA 1GV8A 4DIGA 1NNTA 4G68C 1Y1ZA 2F35A 1SW5A 3K4UA 2ZNUA 3IOUA 1P1NA 3U94A 3KJ7A 4TLLB 4F3GA 3I3VA 1ATGA 4QFOA 5I57A 5M2VA 4E0XA 1A40A 2O84X 3MAMA 5TPAB 3IB0A 4QRZA 1FQDA 3SEYA 2H4IA 2Z8DA 3MC2A 1I6AA 1B9JA 2P2AA 5I58B 1FW0A 1FTOA 1SD3A 4X48A 1BP5A 1Z7ME 1DMBA 1SI0A 5TP9A 5FHMA 4Q0CA 1Y3NA 2UVIA 3N5LA 4G68B 4R9FA 5L9OA 4I8CA 3HO7A 1SW2A 4OETA 4F3BA 1D9YA 3IB1A 3M3LA 3V83A 2XX7A 3QYTA 4UA8A 5I2KA 2HXWA 4QSEA 3KEIA 4KR5A 3C4MA 5DVJA 3A3UA 4DE8A 1B5HA 4JSOA 4UACA 2QS1A 4NTLA 3FZVA 1R6ZA 3IB2A 2G93A 1I6BA 1MY1A 3FJ7A 4OHNA 1MQHA 1NNKA 2F7CA 1PB7A 1B58A 3KZGA 4PQJA 3OEKA 2DVZA 2I0CA 4IGRA 4BDLA 5HPQA 2Y84A 5AA4A 4OXVA 3VDFA 3O29A 1NFTA 2CZLA 4GXSB 2GHBA 2QS4A 3MP8A 3CVGA 1ELJA 4TQUQ 1O7TA 2QMXA 5TP9B 3W9VA 1B0HA 4ELRA 4NE4A 2B3FA 1GGGA 5JTYA 1DTZA 3SESA 1M5DA 2DYXA 1N84A 3BFTA 3PD8A 2F6GA 5I2KB 4DCXA 2DWHA 4XKNA 1IEJA 1US5A 4HCYA 3MVWA 2XXYA 2DE4A 5AE4A 4YKPA 1MDQA 2O7UA 1HSJA 5IAIA 2W7YA 4R2BA 1B05A 2P0SA 3U8QA 4OTEA 4KYDA 1LAGE 3VFJA 4RPNA 4N6PA 1AMFA 1MXZA 2OWTA 1Y4TA 3OEMA 1SYHA 4U21A 2VD3A 2H9BA 4YICA 4NMYA 1QVSA 4U2RA 3KSXA 1GVCA 3PUXE 1SVXB 4NWCA 3FIRA 4F18A 3TTLA 3QK6A 3ZKLA 5AA4B 1D4NA 2OWSA 4YZZA 3VLUA 3CRBA 1S50A 1FQCA 2PX1A 4U4XA 4ZZAA 4OWDA 3K6UA 2VD2A 3MQ9A 2X7PA 1JW1A 1M5BA 2QJEA 2ZMBA 4OEUA 3R26A 2ALUA 5JTYB 3C31A 2D5WA 1EZOA 2Y7KA 2DS9A 1PC3A 3LR1A 4MBPA 1O64A 5DYHA 3CSBA 1N3WA 1FTJA 4BDNA 5H8QA 2QS3A 2XXHA 2HQ0A 5JK4A 3PPPA 1VE4A 1JVYA 4ZZEA 4PETA 4X9TA 3TKDA 5I59A 1ANFA 3PPQA 4HS7A 3IX1A 4NF6A 4RNSA 1A54A 2ZYKA 4LZ8A 1MXVA 1D3KA 1SYIA 4Z7EA 3Q27A 2I49A 4NF8A 4FECA 2QS2A 3I6VA 2REGA 1B2HA 2HZKA 1MY3A 3MW0A 4O3BA 3S9NC 3MJNA 2ONSA 5FTHA 4POXA 3KBRA 4WEPA 2FYIA 4XXUA 3G7WA 4LATA 3MZ9A 3EHTA 3K00A 2AYSA 3HCQA 2E1SA 4F39A 4BDQA 3RN8A 3FXRA 1FCKA 2PBWA 3C36A 4IY5A 5DVIA 1LSTA 2P1SA 1AOVA 1P1WA 1RKMA 2GFEA 1VFDA 3WAEA 1SDXA 2UVJA 5H8QB 3TTKA 1URSA 4YKIA 4ELPA 3FV1A 4H6DA 2AIXA 2A5TA 5I59B 3DELB 3EN3A 4QFLA 3VVFA 1P99A 3KN3A 2UYFA 4I62A 3MPKA 3MZBA 4NF6B 3I5OA 1YTVA 2H25A 1VSOA 3CR9A 4NF8B 2THIA 2R71A 4H67A 1T0KA 1POTA 3MBPA 4ZE9A 5CBRA 1CB6A 3HSTA 4F3SA 4M1VA 2OBGA 2O69A 1XVYA 4R6HA 4WEDA 3LC8A 4HTGA 4YKKA 5I58A 3O6IA 2GH9A 3H4ZA 3OOAA 3M3KA 3PUVE 3O6HA 1XT8A 1A55A 4ND9A 2XHDA 2Y7IA 3K0VA 5DT6A 3KN7A 2I58A 4H1XA 4ZEKA 3IOWA 3T9XB 4AQ4A 1I6QA 5A5XA 3B6WA 1XS5A 1TFAA 3LBSA 1L5TA 2DWIA 3QSLA 3DM0A 1ZJLA 3TCGA 1N7XA 3MWBA 1TWYA 3SEVA 3OO6A 2XX9A 1MH3A 4NF4A 3PMXA 3LSFB 4ONYA 3K6VA 3M3FA 1WVJA 4GF8A 3U1OA 3PPOA 1B1HA 1QJMA 2A5TB 4WKMA 2GHAA 3PGFA 1IIWA 4C1UA 4G4PA 2VP1A 4DXCA 1URGA 3TZAA 3KG2A 2BJJX 1TXFA 2CMOA 2PT2A 3K6WA 1H76A 5L9SA 1AIVA 2YJPA 3WAFA 1I69A 4Q8RA 4EQ7A 3OO7A 3FUZA 4ELOA 1RYOA 2XXWA 3LSXA 4MF3A 4OEVA 3KSJA 2M8CA 1B4ZA 4ZEFA 3VVEA 5DEXA 3G3IA 4KQPA 1KWHA 2DSFA 4JDFA 4MFIA 4H8JA 4K3FA 1AH5A 3H03A 3G3HA 4GIZA 3RPWA 1N3XA 1Y9UA 3GLBA 4GLIA 5A5XB 2LAOA 4EUOA 3C35A 2XXTA 4TOZA 1MM6A 1IQ7A 2WKYA 4R73A 3GXAA 4POWA 4BDOA 2UVHA 3ZKKA 2HAVA 3QUJA 4IGTA 4NF4B 4H8IA 3RTWB 4RK2A 3F11A 4OMBA 1EH3A 1PBQA 4N07A 4EQBA 3T9UA 3FXQA 4G2ZA 3Q28A 1OQHA 3V5AA 5ICQA 4QFKA 4R6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IY6 A;  2ZYM A;  2V93 A;  1DTG A;  1F9B A;  1M5E A;  1BIY A;  1JQF A;  3IL1 B;  1QUI A;  5KCJ B;  4NED A;  1MG1 A;  3T9V A;  3C9H A;  2DOJ A;  1MH4 A;  2O1M A;  1MPB A;  1SQY A;  2NUV A;  1OIB A;  2I4B A;  4OQO A;  3IR1 A;  3UN6 A;  3V89 B;  2O1L A;  4ISU A;  4ZE8 A;  4MH5 A;  1O63 A;  2A5S A;  2PYY A;  1LFH A;  4QF9 A;  2VOZ A;  3VXC A;  3S9M C;  3RQT A;  5DEX B;  5H8H A;  1Z7N E;  3OEL A;  4JXI A;  4O3C A;  3SET A;  4EXK A;  3VE1 B;  3OEN A;  3MVY A;  4THI A;  2XXX A;  3M8U A;  5FHN A;  1QUL A;  4RPO A;  3JV9 A;  1XOC A;  4P11 A;  1NH7 A;  3H6W A;  3THI A;  2PT1 A;  4KCD A;  2Y7P A;  1IXH A;  3FVG A;  4DLD A;  1SI1 A;  1IXI A;  2I0B A;  2O51 A;  3RNN A;  4BDR A;  3OMB A;  4GWO A;  1USY H;  5L8D A;  5AA1 A;  2OJT A;  3S9L C;  4GD5 A;  2FA7 A;  2DWJ A;  5AA3 A;  1B3E A;  5ICT A;  4XKQ A;  1FQF A;  3Q26 A;  2Q2C A;  4GXA A;  5H8N A;  3EHU A;  3CIJ A;  1B46 A;  1BLF A;  1UIU A;  2OCU A;  2UYE A;  1ZLQ A;  1P1U A;  4KI0 E;  4GL0 A;  2OK2 A;  3KOT A;  1DPP A;  1DPE A;  3G3K A;  3OSR A;  3DP8 A;  4R74 A;  3TUS A;  3LSW A;  5H8H B;  3L6H A;  3SDF A;  4IO5 A;  1IXC A;  2DP8 A;  2B3B A;  1R1N A;  3IAZ A;  4LQ5 A;  4LUB A;  3T96 B;  3QIM A;  4DDD A;  1UIV A;  3U93 A;  2XD2 A;  5LOM A;  5CRY A;  4ZEI A;  2ZXT A;  2PMS A;  3N94 A;  4RY1 A;  1DOT A;  1N0T A;  1Y3P A;  3E4R A;  3GZG A;  4IB2 A;  2F97 A;  1LFG A;  3R7X A;  4EXL A;  3DLN A;  3H06 B;  1LB9 A;  1AL3 A;  5CBS A;  2ZNT A;  4RA1 A;  4HW8 A;  3K2D A;  3G3G A;  1B51 A;  5H8N B;  3T22 A;  4GL8 A;  4JSD A;  1LAF E;  4RXL A;  3CG3 A;  3FVK A;  4DXU A;  4GRK A;  5B7D A;  2HCA A;  1NMU A;  3PUY E;  5H8F A;  2DVC A;  1B3L A;  3TTN A;  5IKB A;  3A09 A;  4FED A;  5CM6 A;  1H44 A;  4N13 A;  1ZMG A;  3VV5 A;  4GVO A;  1A7L A;  1WDN A;  1S7Y A;  3RT6 B;  4LON B;  3EPE A;  3ZS6 A;  2XXR A;  1D9V A;  1MXU A;  1B3F A;  4R75 A;  3C33 A;  1A8F A;  4QSD A;  1FQB A;  2XD3 A;  1M5C A;  1LAH E;  3RLF E;  1N7W A;  1CE2 A;  4XTC Q;  4OFL A;  5CMM A;  1WOD A;  3HPI A;  3PV0 E;  4QHQ A;  2Y7W A;  4H5G A;  2XXP A;  2QMW A;  1A8E A;  4ZEC A;  4I9D A;  1MS7 A;  3CFX A;  3U92 A;  2I3V A;  2UVG A;  1LB8 A;  1EZP A;  2V25 A;  2V3T A;  4KHZ E;  3MP6 A;  4O3A A;  3FVN A;  2I4C A;  3ILT B;  2NOO A;  2Q88 A;  3TTM A;  1ZKB A;  1UTH A;  4P0I A;  3E13 X;  4OFJ A;  3KJT A;  1B5J A;  2RCB A;  2XXV A;  3JYR A;  4G77 A;  4JWY A;  1IZ1 A;  3PPN A;  3FJM A;  1OLC A;  5H8S A;  5H8F B;  2RF1 A;  2B65 A;  2X26 A;  4NWD A;  5I2N A;  3H6T A;  1A99 A;  2Z8E A;  3EF7 A;  3S2V A;  1POY 1;  4H65 A;  2QPQ A;  1MXW A;  3TEP A;  1OMP A;  2IA4 A;  2QL3 A;  4FE8 A;  3MUQ A;  4OYV A;  3MVZ A;  1GR2 A;  3OO8 A;  2F5X A;  1YCJ A;  3MVX A;  2HAU A;  1USY E;  3FV2 A;  2O6A A;  5AA2 A;  4QFP A;  3BKI B;  3MPL A;  2H5Y A;  1Q1K A;  3TDJ A;  5EHM A;  3QXM A;  3DP4 A;  2KLF A;  2ZNS A;  1B32 A;  1HSE A;  3MP1 A;  3OO9 A;  1MQI A;  3OXN A;  4C0R A;  4PFY A;  5CI5 A;  1NH8 A;  4G8M A;  1BTJ A;  3O28 A;  4KPT A;  1JW5 A;  5I56 A;  1UTH B;  3O6G A;  4P0G A;  5KCJ A;  5CMC A;  3TFL A;  2I48 A;  4ESX A;  2ABH A;  1PB9 A;  3TTR A;  3HV1 A;  5EYF A;  4JWO A;  4PFW A;  2V84 A;  3IK6 B;  2RIN A;  2NXO A;  1OVB A;  4IO7 A;  2PVU A;  3VLW A;  4YMA A;  1LLS A;  4FIM A;  4LQ2 A;  3O97 A;  3BBR A;  5F7V A;  1EZ9 A;  1QKA A;  5I2N B;  2DWA A;  1EU8 A;  3OD7 A;  2I3W A;  1MXX A;  3CI8 A;  3HHG A;  3HN0 A;  1MDP 1;  4U1Z A;  1JVX A;  4GQO A;  2Z22 A;  4Z0I A;  3TOD A;  2XX8 A;  5ITO A;  4U4S A;  3T66 A;  4BDM A;  3T93 B;  2O68 A;  5AA2 B;  2DE3 A;  1JNF A;  1FTM A;  4F22 A;  1JEU A;  3H3G A;  4NF5 B;  4ELQ A;  3KN8 A;  4KCC A;  4EF1 A;  1MXY A;  1OLA A;  4IO2 A;  3UOR A;  3ILU B;  3FAS A;  4QFN A;  1MY2 A;  1Y3Q A;  4ZED A;  1B7H A;  4F31 B;  3O9P A;  5BWJ A;  5BUU A;  1S9T A;  1R9Q A;  4G8N A;  3LUY A;  3H6U A;  4EF2 A;  3E9X A;  5I56 B;  3FVO A;  1NNF A;  2XXI A;  1ZBM A;  1H3D A;  5ISU A;  2F36 A;  2DXR A;  1LCF A;  2F7A A;  1HSL A;  3SKP A;  2D3I A;  3H6V A;  2DQV A;  3W9W A;  2RC8 A;  3UA8 A;  3PMW A;  5K2X A;  4L17 A;  4RK9 A;  3GBA A;  1ZIU A;  4U1O A;  5AA2 D;  2H98 A;  4EDP A;  2G29 A;  1IUD A;  3K6X A;  4EQ9 A;  2Q2A A;  4GOT A;  1B6H A;  3SER A;  1SW1 A;  3KGC A;  4R9G A;  5I57 B;  2QRY A;  4KFQ A;  3K1N A;  1MQG A;  3K01 A;  4X1B A;  3V8X B;  2UXA A;  1B52 A;  4OFO A;  5CC2 A;  1B40 A;  1B5I A;  2XXU A;  2YLN A;  4KYS A;  1JET A;  1SW4 A;  3RT8 A;  1N04 A;  3ODB A;  1B7U A;  1II5 A;  3IJX B;  1MQD A;  4OZ9 A;  1JW4 A;  1QUK A;  1FTK A;  2REJ A;  5DVF A;  4YB7 A;  4FEB A;  2R9J A;  1MPD A;  3B6Q A;  1B1X A;  5JEI A;  3OSQ A;  4U23 A;  4H5F A;  1ZU0 A;  4XKP A;  5TU0 A;  3TCF A;  3PUW E;  3D4G A;  3CG1 A;  4ZDM A;  5B70 A;  1OQG A;  4HCW A;  3U72 A;  3VXB A;  3K02 A;  4RYA A;  4LP2 B;  1MM7 A;  3PMV A;  1FQA A;  1LCT A;  3Q29 A;  3TMG A;  1NKX A;  5EHS A;  1TFD A;  4LZ5 A;  2F7B A;  1P1O A;  2F6P A;  4AB6 A;  2Q8J A;  4DCY A;  3K1M A;  4LVQ A;  3CFZ A;  3TPA A;  3QUF A;  2RC9 A;  2XXQ A;  3FXU A;  3IO6 A;  3RGY A;  1UTB A;  1LBB A;  3N6T A;  4OES A;  4Q5T A;  3TQL A;  3VVD A;  4F1V A;  3IOR A;  2X7Q A;  1P1Q A;  3RY3 A;  3SEW A;  4ECF A;  2O7I A;  4QSC A;  3TEL A;  3HHF A;  5KZT A;  5KDT A;  5CMB A;  1Q35 A;  2I6E A;  3TAJ A;  2Z23 A;  2RC7 A;  2HZL A;  4LA9 A;  1B3G A;  1LAX A;  1LBC A;  3UGW A;  1FTL A;  1Y4C A;  2DE2 A;  3G3J A;  2F8D A;  3N26 A;  4F19 A;  2H99 A;  1B7Z A;  4C1T A;  5ELV A;  3TQW A;  1J1N A;  2IEE A;  4WXJ A;  1MRP A;  4F1Y A;  3PD9 A;  3S9E A;  1MPC A;  1IXG A;  2HFB A;  2V3Q A;  2R6G E;  2AL4 A;  3H7M A;  3PPR A;  3IO4 A;  2OZZ A;  1LGB C;  4OER A;  4ZS9 A;  1Y20 A;  3R6U A;  1B0L A;  3C34 A;  2RKM A;  4M4G A;  3VLV A;  4R72 A;  3O2A A;  3P7I A;  1MY0 A;  2Z8F A;  3N6U A;  3GBB A;  2ZYO A;  1UQW A;  4H0W A;  3G3F A;  4OVJ A;  1RYX A;  5HM4 B;  3E3K A;  1YAE A;  4JBZ A;  1XC1 A;  2VHA A;  5HBC A;  1MY4 A;  4FOR A;  1FQE A;  1H43 A;  2NWJ A;  3ZSF A;  2E0S A;  1XVX A;  4YAH X;  3FAT A;  3S4U A;  4XKR A;  1UTB B;  2D21 A;  1VFE A;  3K1P A;  4Q30 B;  3FJG A;  3B7D A;  1IIT A;  1B3H A;  3O66 A;  3TCH A;  1GTK A;  3BFU A;  4YMB A;  3UIF A;  5KDT B;  4F29 A;  4F2Q A;  1TT1 A;  1JEV A;  4ESW A;  2ONR A;  4PE5 B;  4G8H A;  5ITP A;  3DP6 A;  3JZJ A;  1B4H A;  1MQJ A;  2GRV A;  5J1D A;  3D4C A;  2F34 A;  1SBP A;  3ECR A;  4AB5 A;  1XHY A;  1H45 A;  1NNP A;  1Y1M A;  4F2O A;  1US4 A;  4JWX A;  4FAT A;  4PFT A;  3EHS A;  2HEU A;  4RJZ A;  2Q89 A;  4PP0 A;  4YB5 A;  5I84 A;  1VR5 A;  2YPN A;  2ONK E;  3L6G A;  4YKJ A;  4TLM B;  2DXY A;  1QUJ A;  2Q9T A;  3EQ1 A;  5F1Q A;  3UK4 A;  3FD3 A;  4ZEB A;  5K2Y A;  4F1U A;  4YB6 A;  1ZTY A;  4R2F A;  3USD A;  4GFR A;  3SEU A;  3RTF B;  3PU5 A;  4KD5 A;  3TYH A;  2ANJ A;  5FTI A;  4KYE A;  3MZ1 A;  5FHO A;  4F3P A;  5DTB A;  4MLV A;  1YPN A;  4FJP A;  3T9H B;  4MLQ A;  5TPA A;  2V3U A;  2VGQ A;  1PDA A;  4PFU A;  3AXF A;  1BKA A;  2RCA A;  4X1D A;  5L9M A;  1NL5 A;  2ZYN A;  3Q25 A;  4U22 A;  3IJO B;  2QSX A;  2NVU B;  1PEB A;  3FGS A;  3CSG A;  4G68 A;  4DXB A;  2FNC A;  4BLA A;  1DSN A;  3CFL A;  3ONM A;  3SEX A;  1PBP A;  1R9L A;  1OVT A;  3W15 C;  3C32 A;  1N76 A;  4JB7 A;  3QAX A;  4R6Y A;  4NF5 A;  4YU0 A;  4XIG Q;  5CMK A;  1M5F A;  2Y7R A;  4E0W A;  3B6T A;  4DZ1 A;  1QW0 A;  4OEN A;  3LSL A;  4IO6 A;  4FAJ A;  1PB8 A;  2OLB A;  1LFI A;  3KOS A;  3KFM A;  4I1D A;  2F78 A;  3IOV A;  3A3C A;  3UP9 A;  4IO3 A;  3PUZ E;  3IOT A;  4LZ7 A;  2AL5 A;  1QKB A;  1URD A;  2ESN A;  4IO4 A;  3RUM A;  1GV8 A;  4DIG A;  1NNT A;  4G68 C;  1Y1Z A;  2F35 A;  1SW5 A;  3K4U A;  2ZNU A;  3IOU A;  1P1N A;  3U94 A;  3KJ7 A;  4TLL B;  4F3G A;  3I3V A;  1ATG A;  4QFO A;  5I57 A;  5M2V A;  4E0X A;  1A40 A;  2O84 X;  3MAM A;  5TPA B;  3IB0 A;  4QRZ A;  1FQD A;  3SEY A;  2H4I A;  2Z8D A;  3MC2 A;  1I6A A;  1B9J A;  2P2A A;  5I58 B;  1FW0 A;  1FTO A;  1SD3 A;  4X48 A;  1BP5 A;  1Z7M E;  1DMB A;  1SI0 A;  5TP9 A;  5FHM A;  4Q0C A;  1Y3N A;  2UVI A;  3N5L A;  4G68 B;  4R9F A;  5L9O A;  4I8C A;  3HO7 A;  1SW2 A;  4OET A;  4F3B A;  1D9Y A;  3IB1 A;  3M3L A;  3V83 A;  2XX7 A;  3QYT A;  4UA8 A;  5I2K A;  2HXW A;  4QSE A;  3KEI A;  4KR5 A;  3C4M A;  5DVJ A;  3A3U A;  4DE8 A;  1B5H A;  4JSO A;  4UAC A;  2QS1 A;  4NTL A;  3FZV A;  1R6Z A;  3IB2 A;  2G93 A;  1I6B A;  1MY1 A;  3FJ7 A;  4OHN A;  1MQH A;  1NNK A;  2F7C A;  1PB7 A;  1B58 A;  3KZG A;  4PQJ A;  3OEK A;  2DVZ A;  2I0C A;  4IGR A;  4BDL A;  5HPQ A;  2Y84 A;  5AA4 A;  4OXV A;  3VDF A;  3O29 A;  1NFT A;  2CZL A;  4GXS B;  2GHB A;  2QS4 A;  3MP8 A;  3CVG A;  1ELJ A;  4TQU Q;  1O7T A;  2QMX A;  5TP9 B;  3W9V A;  1B0H A;  4ELR A;  4NE4 A;  2B3F A;  1GGG A;  5JTY A;  1DTZ A;  3SES A;  1M5D A;  2DYX A;  1N84 A;  3BFT A;  3PD8 A;  2F6G A;  5I2K B;  4DCX A;  2DWH A;  4XKN A;  1IEJ A;  1US5 A;  4HCY A;  3MVW A;  2XXY A;  2DE4 A;  5AE4 A;  4YKP A;  1MDQ A;  2O7U A;  1HSJ A;  5IAI A;  2W7Y A;  4R2B A;  1B05 A;  2P0S A;  3U8Q A;  4OTE A;  4KYD A;  1LAG E;  3VFJ A;  4RPN A;  4N6P A;  1AMF A;  1MXZ A;  2OWT A;  1Y4T A;  3OEM A;  1SYH A;  4U21 A;  2VD3 A;  2H9B A;  4YIC A;  4NMY A;  1QVS A;  4U2R A;  3KSX A;  1GVC A;  3PUX E;  1SVX B;  4NWC A;  3FIR A;  4F18 A;  3TTL A;  3QK6 A;  3ZKL A;  5AA4 B;  1D4N A;  2OWS A;  4YZZ A;  3VLU A;  3CRB A;  1S50 A;  1FQC A;  2PX1 A;  4U4X A;  4ZZA A;  4OWD A;  3K6U A;  2VD2 A;  3MQ9 A;  2X7P A;  1JW1 A;  1M5B A;  2QJE A;  2ZMB A;  4OEU A;  3R26 A;  2ALU A;  5JTY B;  3C31 A;  2D5W A;  1EZO A;  2Y7K A;  2DS9 A;  1PC3 A;  3LR1 A;  4MBP A;  1O64 A;  5DYH A;  3CSB A;  1N3W A;  1FTJ A;  4BDN A;  5H8Q A;  2QS3 A;  2XXH A;  2HQ0 A;  5JK4 A;  3PPP A;  1VE4 A;  1JVY A;  4ZZE A;  4PET A;  4X9T A;  3TKD A;  5I59 A;  1ANF A;  3PPQ A;  4HS7 A;  3IX1 A;  4NF6 A;  4RNS A;  1A54 A;  2ZYK A;  4LZ8 A;  1MXV A;  1D3K A;  1SYI A;  4Z7E A;  3Q27 A;  2I49 A;  4NF8 A;  4FEC A;  2QS2 A;  3I6V A;  2REG A;  1B2H A;  2HZK A;  1MY3 A;  3MW0 A;  4O3B A;  3S9N C;  3MJN A;  2ONS A;  5FTH A;  4POX A;  3KBR A;  4WEP A;  2FYI A;  4XXU A;  3G7W A;  4LAT A;  3MZ9 A;  3EHT A;  3K00 A;  2AYS A;  3HCQ A;  2E1S A;  4F39 A;  4BDQ A;  3RN8 A;  3FXR A;  1FCK A;  2PBW A;  3C36 A;  4IY5 A;  5DVI A;  1LST A;  2P1S A;  1AOV A;  1P1W A;  1RKM A;  2GFE A;  1VFD A;  3WAE A;  1SDX A;  2UVJ A;  5H8Q B;  3TTK A;  1URS A;  4YKI A;  4ELP A;  3FV1 A;  4H6D A;  2AIX A;  2A5T A;  5I59 B;  3DEL B;  3EN3 A;  4QFL A;  3VVF A;  1P99 A;  3KN3 A;  2UYF A;  4I62 A;  3MPK A;  3MZB A;  4NF6 B;  3I5O A;  1YTV A;  2H25 A;  1VSO A;  3CR9 A;  4NF8 B;  2THI A;  2R71 A;  4H67 A;  1T0K A;  1POT A;  3MBP A;  4ZE9 A;  5CBR A;  1CB6 A;  3HST A;  4F3S A;  4M1V A;  2OBG A;  2O69 A;  1XVY A;  4R6H A;  4WED A;  3LC8 A;  4HTG A;  4YKK A;  5I58 A;  3O6I A;  2GH9 A;  3H4Z A;  3OOA A;  3M3K A;  3PUV E;  3O6H A;  1XT8 A;  1A55 A;  4ND9 A;  2XHD A;  2Y7I A;  3K0V A;  5DT6 A;  3KN7 A;  2I58 A;  4H1X A;  4ZEK A;  3IOW A;  3T9X B;  4AQ4 A;  1I6Q A;  5A5X A;  3B6W A;  1XS5 A;  1TFA A;  3LBS A;  1L5T A;  2DWI A;  3QSL A;  3DM0 A;  1ZJL A;  3TCG A;  1N7X A;  3MWB A;  1TWY A;  3SEV A;  3OO6 A;  2XX9 A;  1MH3 A;  4NF4 A;  3PMX A;  3LSF B;  4ONY A;  3K6V A;  3M3F A;  1WVJ A;  4GF8 A;  3U1O A;  3PPO A;  1B1H A;  1QJM A;  2A5T B;  4WKM A;  2GHA A;  3PGF A;  1IIW A;  4C1U A;  4G4P A;  2VP1 A;  4DXC A;  1URG A;  3TZA A;  3KG2 A;  2BJJ X;  1TXF A;  2CMO A;  2PT2 A;  3K6W A;  1H76 A;  5L9S A;  1AIV A;  2YJP A;  3WAF A;  1I69 A;  4Q8R A;  4EQ7 A;  3OO7 A;  3FUZ A;  4ELO A;  1RYO A;  2XXW A;  3LSX A;  4MF3 A;  4OEV A;  3KSJ A;  2M8C A;  1B4Z A;  4ZEF A;  3VVE A;  5DEX A;  3G3I A;  4KQP A;  1KWH A;  2DSF A;  4JDF A;  4MFI A;  4H8J A;  4K3F A;  1AH5 A;  3H03 A;  3G3H A;  4GIZ A;  3RPW A;  1N3X A;  1Y9U A;  3GLB A;  4GLI A;  5A5X B;  2LAO A;  4EUO A;  3C35 A;  2XXT A;  4TOZ A;  1MM6 A;  1IQ7 A;  2WKY A;  4R73 A;  3GXA A;  4POW A;  4BDO A;  2UVH A;  3ZKK A;  2HAV A;  3QUJ A;  4IGT A;  4NF4 B;  4H8I A;  3RTW B;  4RK2 A;  3F11 A;  4OMB A;  1EH3 A;  1PBQ A;  4N07 A;  4EQB A;  3T9U A;  3FXQ A;  4G2Z A;  3Q28 A;  1OQH A;  3V5A A;  5ICQ A;  4QFK A;  4R6K A; 
#chains in the Genus database with same CATH topology
 4IY6 A;  2ZYM A;  2V93 A;  2WEF A;  4PCD A;  1DTG A;  1F9B A;  1M5E A;  1BIY A;  1JQF A;  5FBP A;  3IL1 B;  1QUI A;  3E78 A;  5KCJ B;  4NED A;  1MG1 A;  1FTA A;  3T9V A;  4DI3 D;  3C9H A;  2DOJ A;  1MH4 A;  2O1M A;  1MPB A;  1SQY A;  2NUV A;  1OIB A;  2I4B A;  4OQO A;  3IR1 A;  3UN6 A;  3V89 B;  2O1L A;  4ISU A;  4ZE8 A;  4MH5 A;  3U65 A;  1O63 A;  2A5S A;  2PYY A;  1LFH A;  4QF9 A;  2VOZ A;  3VXC A;  3S9M C;  3RQT A;  1IMF A;  5DEX B;  5H8H A;  1Z7N E;  3OEL A;  4JXI A;  4O3C A;  3SET A;  4JVD A;  1CNQ A;  4EXK A;  3VE1 B;  3OEN A;  3MVY A;  4THI A;  2XXX A;  3M8U A;  5FHN A;  1QUL A;  4RPO A;  3JV9 A;  1XOC A;  4P11 A;  1NH7 A;  3H6W A;  3THI A;  1FPI A;  1VDW A;  4PAK A;  2PT1 A;  4KCD A;  1YZ0 A;  2Y7P A;  1IXH A;  3ISP A;  3FVG A;  4DLD A;  1SI1 A;  3HFU A;  4O7I A;  1IXI A;  2I0B A;  2O51 A;  3RNN A;  4BDR A;  4OA4 A;  3OMB A;  4GWO A;  1USY H;  5L8D A;  5AA1 A;  2OJT A;  3S9L C;  4OAN A;  4GD5 A;  2FA7 A;  2DWJ A;  2HPG A;  4OVS A;  5AA3 A;  1B3E A;  5ICT A;  4XKQ A;  1FQF A;  3Q26 A;  2Q2C A;  4GXA A;  5H8N A;  3EHU A;  3CIJ A;  1B46 A;  2OX3 A;  1BLF A;  1UIU A;  2OCU A;  2UYE A;  5EQ8 A;  1ZLQ A;  1P1U A;  4KI0 E;  4GL0 A;  4X04 A;  2OK2 A;  3KOT A;  1D9Q A;  1DPP A;  3MST A;  1DPE A;  3G3K A;  3OSR A;  3DP8 A;  4R74 A;  5IM2 A;  4DI4 B;  3TUS A;  3LSW A;  5H8H B;  3L6H A;  3SDF A;  4IO5 A;  1IXC A;  2DP8 A;  4AS4 A;  2B3B A;  2L5V A;  1R1N A;  3IAZ A;  4LQ5 A;  4LUB A;  3T96 B;  3QIM A;  4DDD A;  4PTK A;  4PE3 A;  1UIV A;  3U93 A;  2XD2 A;  5LOM A;  5I7I A;  2ZZX A;  5CRY A;  4ZEI A;  2ZXT A;  3B50 A;  4N17 A;  2PMS A;  1KA0 A;  3N94 A;  4RY1 A;  1DOT A;  1N0T A;  1Y3P A;  3E4R A;  3GZG A;  3QMF A;  4IB2 A;  4NN3 A;  2F97 A;  1LFG A;  3R7X A;  1FPK A;  4EXL A;  3DLN A;  3H06 B;  1LB9 A;  3D1R A;  1AL3 A;  5CBS A;  2ZNT A;  4RA1 A;  4HW8 A;  1NUY A;  3K2D A;  3G3G A;  1B51 A;  5H8N B;  3T22 A;  4HE0 A;  4GL8 A;  4JSD A;  1LAF E;  4RXL A;  4GX3 A;  3CG3 A;  3FVK A;  4DXU A;  4GRK A;  4HE2 A;  5B7D A;  1LBX A;  2HCA A;  1NMU A;  3PUY E;  5H8F A;  4MNI A;  2DVC A;  1B3L A;  3TTN A;  5IKB A;  3A09 A;  1LBY A;  4FED A;  5CM6 A;  1H44 A;  4N13 A;  1ZMG A;  3VV5 A;  1NV5 A;  4GVO A;  1A7L A;  1WDN A;  1S7Y A;  3RT6 B;  4LON B;  3EPE A;  2FVZ A;  3ZS6 A;  2XXR A;  1D9V A;  1MXU A;  1B3F A;  4R75 A;  3C33 A;  1A8F A;  4QSD A;  1FQB A;  5ET8 A;  2XD3 A;  1M5C A;  1LAH E;  3RLF E;  3KBZ A;  1N7W A;  1CE2 A;  4XTC Q;  4OFL A;  2KQZ A;  5CMM A;  1WOD A;  3HPI A;  3PV0 E;  4QHQ A;  2Y7W A;  4H5G A;  2XXP A;  2QMW A;  1XI6 A;  1A8E A;  1DK4 A;  4ZEC A;  4I9D A;  2Y5L A;  1MS7 A;  3CFX A;  3U92 A;  2QFL A;  2I3V A;  2UVG A;  1LB8 A;  1EZP A;  2V25 A;  2V3T A;  4KHZ E;  3MP6 A;  4O3A A;  3FVN A;  2I4C A;  3ILT B;  2NOO A;  2Q88 A;  3TTM A;  2B4M A;  1ZKB A;  1UTH A;  4P0I A;  3E13 X;  4OFJ A;  3KJT A;  1B5J A;  2RCB A;  2XXV A;  1FPF A;  3JYR A;  2OWZ A;  4G77 A;  4JWY A;  4PF6 A;  1IZ1 A;  3PPN A;  4NGU A;  4OVT A;  3FJM A;  5IZ3 B;  1OLC A;  2VPO A;  5H8S A;  5H8F B;  4P56 A;  1NV7 A;  2RF1 A;  2B65 A;  2X26 A;  4NWD A;  5I2N A;  3H6T A;  1A99 A;  4X8R A;  2Z8E A;  3EF7 A;  3S2V A;  1POY 1;  4H65 A;  2PFY A;  2QPQ A;  1MXW A;  3TEP A;  1OMP A;  2IA4 A;  2QL3 A;  4FE8 A;  3MUQ A;  4OYV A;  5EQ9 A;  3MVZ A;  4GWW A;  1GR2 A;  3OO8 A;  2HHM A;  2F5X A;  1YCJ A;  3MVX A;  2HAU A;  1USY E;  3FV2 A;  2O6A A;  5AA2 A;  4QFP A;  2CEX A;  3BKI B;  4O94 A;  3MPL A;  2H5Y A;  1Q1K A;  3TDJ A;  5EHM A;  3QXM A;  3DP4 A;  2KLF A;  2ZNS A;  1B32 A;  1NUZ A;  1HSE A;  3MP1 A;  4PDH A;  3OO9 A;  1MQI A;  3MYU A;  3OXN A;  4O8M A;  1BK4 A;  4PFY A;  4C0R A;  5CI5 A;  1NH8 A;  4G8M A;  4MCO A;  1BTJ A;  3O28 A;  4KPT A;  1JW5 A;  5I56 A;  1UTH B;  3KC1 A;  4PGP A;  3O6G A;  1FBC A;  4P0G A;  4LN5 A;  4N8Y A;  5KCJ A;  5CMC A;  3TFL A;  2I48 A;  4ESX A;  2ABH A;  1PB9 A;  3TTR A;  3HV1 A;  5EYF A;  1K9Z A;  2DDK A;  4JWO A;  4PFW A;  2V84 A;  3IK6 B;  2RIN A;  1RDZ A;  3IFC A;  2NXO A;  1OVB A;  4MAG A;  4IO7 A;  2PVU A;  3VLW A;  4YMA A;  1LLS A;  4FIM A;  4LQ2 A;  3O97 A;  3BBR A;  1DCU A;  3BIH A;  5F7V A;  4N6K A;  1EZ9 A;  1QKA A;  5I2N B;  2DWA A;  5LDZ A;  5ET7 A;  1EU8 A;  3OD7 A;  2I3W A;  1MXX A;  2CZI A;  3CI8 A;  3HHG A;  2FHY A;  3HN0 A;  1MDP 1;  4U1Z A;  1JVX A;  4GQO A;  2Z22 A;  4Z0I A;  3TOD A;  2XX8 A;  5ITO A;  4U4S A;  3T66 A;  4BDM A;  3LV0 A;  3T93 B;  2O68 A;  5AA2 B;  2DE3 A;  2B4L A;  1JNF A;  1FTM A;  4F22 A;  1JEU A;  1FPG A;  3H3G A;  4NF5 B;  4ELQ A;  3KN8 A;  4KCC A;  4EF1 A;  1FBP A;  1MXY A;  1OLA A;  1SPI A;  4IO2 A;  1NUW A;  3UOR A;  3ILU B;  3FAS A;  4QFN A;  4IR8 A;  1MY2 A;  1Y3Q A;  5EQA A;  1B7H A;  4ZED A;  4F31 B;  3O9P A;  5BWJ A;  5BUU A;  1S9T A;  1R9Q A;  1FBG A;  4G8N A;  3T0J A;  3LUY A;  3H6U A;  4EF2 A;  1DBZ A;  3E9X A;  5I56 B;  3FVO A;  1NNF A;  2XXI A;  1ZBM A;  4OVQ A;  1H3D A;  1AWB A;  5ISU A;  2F36 A;  2DXR A;  1LCF A;  2F7A A;  1HSL A;  3SKP A;  2D3I A;  3H6V A;  2DQV A;  3W9W A;  2RC8 A;  3UA8 A;  3PMW A;  5K2X A;  4H46 A;  4UAB A;  4L17 A;  4RK9 A;  3GBA A;  1ZIU A;  4U1O A;  5AA2 D;  2H98 A;  3FBP A;  5EQ7 A;  4EDP A;  4GX4 A;  2G29 A;  1IUD A;  3K6X A;  4EQ9 A;  2Q2A A;  1IMC A;  4GOT A;  1B6H A;  3SER A;  1SW1 A;  3KGC A;  4P8B A;  4R9G A;  5I57 B;  2QRY A;  4KFQ A;  3K1N A;  1MQG A;  4G61 A;  3K01 A;  4X1B A;  3V8X B;  2UXA A;  1B52 A;  4OFO A;  5CC2 A;  1B40 A;  1B5I A;  4GBW A;  2XXU A;  2YLN A;  4KYS A;  1JET A;  2PCR A;  1SW4 A;  3RT8 A;  4MNC A;  1N04 A;  3ODB A;  1B7U A;  1II5 A;  3IJX B;  4PAF A;  2V4C A;  1MQD A;  4OZ9 A;  1JW4 A;  1QUK A;  1FTK A;  2REJ A;  5DVF A;  4YB7 A;  4FEB A;  4P9K A;  2R9J A;  1MPD A;  3B6Q A;  1B1X A;  5JEI A;  3OSQ A;  4U23 A;  4H5F A;  1ZU0 A;  4XKP A;  4NAP A;  5TU0 A;  3TCF A;  3PUW E;  3D4G A;  3CG1 A;  2Q74 A;  4MEV A;  4ZDM A;  5B70 A;  1OQG A;  4HCW A;  3U72 A;  3VXB A;  5EYG A;  3K02 A;  4RYA A;  4LP2 B;  1MM7 A;  3PMV A;  1FQA A;  1LCT A;  3Q29 A;  3TMG A;  1NKX A;  5EHS A;  1TFD A;  4LZ5 A;  2F7B A;  1P1O A;  2F6P A;  4GWZ A;  4AB6 A;  2Q8J A;  4DCY A;  2FIX A;  3K1M A;  3RYD A;  4LVQ A;  3CFZ A;  3TPA A;  3QUF A;  2P3V A;  2RC9 A;  2XXQ A;  3FXU A;  3IO6 A;  3RGY A;  2QVR A;  1UTB A;  1LBB A;  3IFA A;  3N6T A;  4OES A;  4Q5T A;  3TQL A;  3VVD A;  4F1V A;  1NI9 A;  3IOR A;  2X7Q A;  1P1Q A;  3RY3 A;  3SEW A;  4ECF A;  2O7I A;  4QSC A;  1NV0 A;  3TEL A;  3HHF A;  5KZT A;  5KDT A;  5CMB A;  1Q35 A;  2MKZ A;  2I6E A;  3TAJ A;  2Z23 A;  2RC7 A;  2HZL A;  4LA9 A;  1B3G A;  1LAX A;  1LBC A;  3UGW A;  1FTL A;  1Y4C A;  2DE2 A;  3G3J A;  2F8D A;  3N26 A;  4F19 A;  2H99 A;  1B7Z A;  4C1T A;  5ELV A;  3TQW A;  1J1N A;  2IEE A;  4WXJ A;  1MRP A;  4F1Y A;  3PD9 A;  3S9E A;  1MPC A;  1IXG A;  2HFB A;  2V3Q A;  2R6G E;  2AL4 A;  3H7M A;  3PPR A;  3IO4 A;  2OZZ A;  1LGB C;  4OER A;  4ZS9 A;  3ROJ A;  1Y20 A;  3R6U A;  1B0L A;  3C34 A;  2RKM A;  4M4G A;  4N6D A;  3VLV A;  4R72 A;  3O2A A;  3P7I A;  1MY0 A;  2Z8F A;  3N6U A;  3GBB A;  2ZYO A;  1UQW A;  4H0W A;  5IZ3 A;  3G3F A;  4OVJ A;  1RYX A;  5HM4 B;  3E3K A;  1YAE A;  4JBZ A;  1XC1 A;  2VHA A;  2BJI A;  5HBC A;  1MY4 A;  4FOR A;  1FQE A;  1H43 A;  2NWJ A;  3ZSF A;  2E0S A;  1XVX A;  4HXV A;  3FAT A;  4GX6 A;  4YAH X;  3S4U A;  4XKR A;  2VPN A;  1UTB B;  2JJK A;  2D21 A;  1VFE A;  2GQ1 A;  3K1P A;  4Q30 B;  1FBE A;  3FJG A;  1IME A;  3B7D A;  1IIT A;  1B3H A;  4GWY A;  1RDX A;  3O66 A;  2WYP A;  3TCH A;  1GTK A;  1FJ6 A;  3BFU A;  3B8B A;  4YMB A;  3UIF A;  5KDT B;  4F29 A;  4F2Q A;  1TT1 A;  1JEV A;  4ESW A;  2ONR A;  4PE5 B;  4G8H A;  5ITP A;  5ET6 A;  3DP6 A;  3JZJ A;  1B4H A;  1MQJ A;  2GRV A;  5J1D A;  3D4C A;  2F34 A;  1SBP A;  3ECR A;  4AB5 A;  1XHY A;  1H45 A;  1NNP A;  1Y1M A;  4P3L A;  4PFI A;  4F2O A;  1US4 A;  4JWX A;  4FAT A;  4PFT A;  3EHS A;  2HEU A;  4RJZ A;  2Q89 A;  4QBA A;  4PP0 A;  4YB5 A;  5I84 A;  1VR5 A;  2YPN A;  2ONK E;  4N8G A;  3L6G A;  1FBD A;  4YKJ A;  4TLM B;  2DXY A;  1EYJ A;  1QUJ A;  2Q9T A;  3EQ1 A;  5F1Q A;  5I3S A;  3UK4 A;  3FD3 A;  4ZEB A;  2CZH A;  5K2Y A;  4F1U A;  4YB6 A;  1ZTY A;  4R2F A;  3USD A;  4GFR A;  3NOH A;  3SEU A;  5LTC A;  3RTF B;  2F3B A;  4NHB A;  3PU5 A;  4KD5 A;  3TYH A;  2ANJ A;  5FTI A;  1FRP A;  4KYE A;  3MZ1 A;  5FHO A;  4F3P A;  5DTB A;  4GBV A;  4MLV A;  1YPN A;  4FJP A;  4XFE A;  3T9H B;  4MLQ A;  5TPA A;  2V3U A;  2VGQ A;  1PDA A;  4PFU A;  3AXF A;  1BKA A;  2RCA A;  4X1D A;  5L9M A;  1NL5 A;  2ZYN A;  3Q25 A;  4U22 A;  3IJO B;  2QSX A;  2NVU B;  4FBP A;  1PEB A;  4N15 A;  2QVV A;  3FGS A;  3CSG A;  4G68 A;  4DXB A;  2FNC A;  4BLA A;  1INP A;  1DSN A;  3CFL A;  3ONM A;  3SEX A;  1FSA A;  1PBP A;  1R9L A;  1OVT A;  4PBQ A;  3W15 C;  3C32 A;  1N76 A;  4JB7 A;  4JVI A;  2ZZV A;  3QAX A;  4R6Y A;  4NF5 A;  4YU0 A;  4XIG Q;  5CMK A;  1M5F A;  2Y7R A;  4E0W A;  3B6T A;  4DZ1 A;  1QW0 A;  4OEN A;  3LSL A;  1Q9D A;  4IO6 A;  4FAJ A;  1PB8 A;  2OLB A;  1LFI A;  3KOS A;  3KFM A;  1NUX A;  2Q8M A;  4I1D A;  2F78 A;  3IOV A;  3A3C A;  3UP9 A;  4IO3 A;  3PUZ E;  4GWS A;  3IOT A;  4LZ7 A;  5IZ1 A;  2AL5 A;  4P47 A;  1QKB A;  1URD A;  2ESN A;  4IO4 A;  3RUM A;  1GV8 A;  2ZZW A;  4DIG A;  1NNT A;  4G68 C;  4MMP A;  1Y1Z A;  2F35 A;  1SW5 A;  3K4U A;  2ZNU A;  3IOU A;  1P1N A;  3U94 A;  3KJ7 A;  4TLL B;  4F3G A;  3I3V A;  1ATG A;  4QFO A;  5I57 A;  5M2V A;  4E0X A;  1A40 A;  2O84 X;  4P1L A;  3MAM A;  5TPA B;  3IB0 A;  4QRZ A;  1FQD A;  3SEY A;  2H4I A;  2Z8D A;  3MC2 A;  1I6A A;  1B9J A;  2P2A A;  5I58 B;  1FW0 A;  3PTY A;  2WBD A;  1FTO A;  2PFZ A;  1SD3 A;  4X48 A;  1BP5 A;  1IMB A;  1DMB A;  1Z7M E;  2HXR A;  1SI0 A;  5TP9 A;  5FHM A;  2WBB A;  4Q0C A;  4R9F A;  1Y3N A;  2UVI A;  3N5L A;  4G68 B;  1LEV A;  5L9O A;  4I8C A;  3HO7 A;  1SW2 A;  4OET A;  2CEY A;  4F3B A;  1D9Y A;  3IB1 A;  3M3L A;  3V83 A;  2XX7 A;  3QYT A;  4UA8 A;  5I2K A;  2HXW A;  4QSE A;  3KEI A;  4KR5 A;  3T1B A;  5DW8 A;  3C4M A;  5DVJ A;  5T3J A;  3A3U A;  1YXI A;  4DE8 A;  1B5H A;  4JSO A;  4UAC A;  2QS1 A;  4NTL A;  3FZV A;  1R6Z A;  3IB2 A;  2G93 A;  2WX9 A;  1I6B A;  1MY1 A;  3FJ7 A;  5J16 A;  5IGA A;  4OHN A;  2FBP A;  1MQH A;  4PBH A;  1NNK A;  2P3N A;  2F7C A;  4I3Y A;  1PB7 A;  1B58 A;  3KZG A;  4PQJ A;  3OEK A;  1NV6 A;  2DVZ A;  2I0C A;  4IGR A;  3BIG A;  4BDL A;  1G0I A;  1EYK A;  5HPQ A;  2Y84 A;  4O7M A;  5AA4 A;  2CZK A;  4OXV A;  3VDF A;  3O29 A;  4N81 A;  1NFT A;  2CZL A;  4GXS B;  2GHB A;  4PGN A;  2QS4 A;  3MP8 A;  1NV2 A;  3CVG A;  1ELJ A;  4TQU Q;  1FBH A;  1O7T A;  2QMX A;  5TP9 B;  3W9V A;  1B0H A;  3GYY A;  4ELR A;  4NE4 A;  2R8T A;  2VT5 A;  2B3F A;  1GGG A;  5JTY A;  1DTZ A;  3SES A;  4PFR A;  1M5D A;  2DYX A;  2XWI A;  1N84 A;  5IZZ A;  3BFT A;  3PD8 A;  2F6G A;  5I2K B;  2WYK A;  4DCX A;  1LBV A;  3CHG A;  2DWH A;  4XKN A;  1IEJ A;  1US5 A;  4HCY A;  3MVW A;  2XXY A;  4NG7 A;  2DE4 A;  5AE4 A;  1LBW A;  4YKP A;  1MDQ A;  2O7U A;  1HSJ A;  5IAI A;  2W7Y A;  4R2B A;  1B05 A;  2P0S A;  4P1E A;  1FPE A;  3U8Q A;  4OTE A;  4KYD A;  1LAG E;  5ET5 A;  3VFJ A;  3RPL A;  4RPN A;  4N6P A;  1AMF A;  1MXZ A;  2OWT A;  1Y4T A;  3OEM A;  1SYH A;  4U21 A;  2VD3 A;  2H9B A;  4YIC A;  4NMY A;  1QVS A;  4U2R A;  3KSX A;  1GVC A;  3PUX E;  1SVX B;  4NWC A;  3FIR A;  4F18 A;  3TTL A;  2KR0 A;  3QK6 A;  3ZKL A;  5AA4 B;  1D4N A;  2OWS A;  4YZZ A;  3VLU A;  3CRB A;  1FJ9 A;  1S50 A;  1EYI A;  1FQC A;  3FXB A;  2PX1 A;  4HE1 A;  4U4X A;  4ZZA A;  3E79 A;  4OWD A;  3K6U A;  2VD2 A;  3MQ9 A;  2X7P A;  1JW1 A;  1M5B A;  2QJE A;  2ZMB A;  4OEU A;  3R26 A;  5EYH A;  2ALU A;  5JTY B;  4NF0 A;  3C31 A;  2D5W A;  1EZO A;  2Y7K A;  2DS9 A;  1PC3 A;  3LR1 A;  4MBP A;  1O64 A;  5DYH A;  3CSB A;  4N4U A;  1FPD A;  4OVR A;  4PAI A;  1N3W A;  1FTJ A;  1JP4 A;  4BDN A;  5H8Q A;  2QS3 A;  2XXH A;  1KA1 A;  2HQ0 A;  5JK4 A;  3PPP A;  1VE4 A;  1JVY A;  4ZZE A;  4PET A;  4X9T A;  3TKD A;  1FPL A;  3RPL B;  5I59 A;  5ESY A;  1ANF A;  3PPQ A;  4HS7 A;  4MHF A;  3IX1 A;  1NV3 A;  4NF6 A;  4RNS A;  1A54 A;  2ZYK A;  4PF8 A;  4LZ8 A;  1MXV A;  1D3K A;  1SYI A;  4Z7E A;  1NV1 A;  3Q27 A;  2I49 A;  4NF8 A;  4FEC A;  2QS2 A;  4XF5 A;  3I6V A;  2REG A;  1B2H A;  2HZK A;  1MY3 A;  3MW0 A;  4MJO A;  4O3B A;  3S9N C;  3MJN A;  2ONS A;  5FTH A;  4POX A;  3KBR A;  4WEP A;  1FBF A;  2FYI A;  4MX6 A;  4XXU A;  3G7W A;  4LAT A;  3MZ9 A;  3EHT A;  3K00 A;  2AYS A;  3HCQ A;  2E1S A;  2XXK A;  1FPJ A;  5A5L A;  4F39 A;  4BDQ A;  3RN8 A;  3FXR A;  1FCK A;  2PBW A;  3C36 A;  4IY5 A;  5DVI A;  1LST A;  2P1S A;  1AOV A;  1P1W A;  1RKM A;  2GFE A;  1VFD A;  3WAE A;  1SDX A;  2UVJ A;  5H8Q B;  4QXD A;  3TTK A;  1URS A;  4YKI A;  4ELP A;  3FV1 A;  4XEQ A;  4H6D A;  2AIX A;  2A5T A;  5I59 B;  3DEL B;  3EN3 A;  4QFL A;  3VVF A;  1P99 A;  3KN3 A;  2UYF A;  4I62 A;  3MPK A;  3MZB A;  4OVP A;  4NF6 B;  3I5O A;  1NV4 A;  2Y5K A;  1YTV A;  2H25 A;  1VSO A;  5F24 A;  3CR9 A;  4NF8 B;  2THI A;  2R71 A;  4H67 A;  1T0K A;  1POT A;  3MBP A;  4ZE9 A;  5CBR A;  1CB6 A;  3HST A;  4F3S A;  3A29 A;  4M1V A;  3EKI A;  2OBG A;  2O69 A;  1XVY A;  4R6H A;  4WED A;  1G0H A;  1YYZ A;  3LC8 A;  1KZ8 A;  4HTG A;  4YKK A;  5I58 A;  1IMA A;  3O6I A;  2GH9 A;  3H4Z A;  3OOA A;  4NX1 A;  3M3K A;  3PUV E;  2XWV A;  3O6H A;  1XT8 A;  1A55 A;  4ND9 A;  2XHD A;  2Y7I A;  3K0V A;  5DT6 A;  3KN7 A;  2I58 A;  4H1X A;  4ZEK A;  3IOW A;  3T9X B;  4AQ4 A;  1I6Q A;  5A5X A;  3B6W A;  1XS5 A;  1TFA A;  4H45 A;  3LBS A;  1L5T A;  2DWI A;  3QSL A;  3DM0 A;  1ZJL A;  3TCG A;  1N7X A;  4I3E A;  3MWB A;  1TWY A;  3SEV A;  3OO6 A;  2XX9 A;  1MH3 A;  2XA5 A;  4NF4 A;  3PMX A;  3LSF B;  4ONY A;  1RDY A;  3K6V A;  3M3F A;  4KXP A;  1WVJ A;  4GF8 A;  3U1O A;  3PPO A;  4I40 A;  1B1H A;  1FPB A;  1QJM A;  2A5T B;  4WKM A;  2GHA A;  1IMD A;  3PGF A;  1IIW A;  1K9Y A;  4C1U A;  4G4P A;  2VP1 A;  4DXC A;  4MNP A;  1URG A;  3TZA A;  2F3D A;  4GWU A;  3KG2 A;  2BJJ X;  1TXF A;  2CMO A;  2PT2 A;  3K6W A;  1H76 A;  5L9S A;  1AIV A;  2YJP A;  4MIJ A;  3WAF A;  1I69 A;  4Q8R A;  4EQ7 A;  3OO7 A;  4PDD A;  4PFB A;  3FUZ A;  4ELO A;  1RYO A;  2XXW A;  3LSX A;  2FIE A;  4MF3 A;  3KC0 A;  4OEV A;  3KSJ A;  2M8C A;  1B4Z A;  4ZEF A;  3VVE A;  5DEX A;  3G3I A;  4KQP A;  1KWH A;  2DSF A;  4JVC A;  3LUZ A;  4JDF A;  4MFI A;  4H8J A;  4K3F A;  1AH5 A;  3H03 A;  3G3H A;  4GIZ A;  3RPW A;  5I5P A;  4GWX A;  1N3X A;  1QGX A;  1Y9U A;  3GLB A;  4GLI A;  5A5X B;  2LAO A;  4EUO A;  3C35 A;  4PC9 A;  3SZP A;  2XXT A;  4TOZ A;  4AS5 A;  1MM6 A;  1IQ7 A;  2WKY A;  4R73 A;  1LBZ A;  2XWK A;  3GXA A;  4NQ8 A;  4POW A;  2QVU A;  4BDO A;  2UVH A;  3ZKK A;  2HAV A;  3QUJ A;  4IGT A;  4NF4 B;  4H8I A;  3RTW B;  4RK2 A;  3F11 A;  4OMB A;  1EH3 A;  1PBQ A;  2XWO A;  4N07 A;  4EQB A;  3T9U A;  3FXQ A;  4G2Z A;  4N91 A;  3Q28 A;  1OQH A;  3V5A A;  5ICQ A;  4QFK A;  4R6K A; 
#chains in the Genus database with same CATH homology
 4IY6 A;  2ZYM A;  2V93 A;  1DTG A;  1F9B A;  1M5E A;  1BIY A;  1JQF A;  3IL1 B;  1QUI A;  5KCJ B;  4NED A;  1MG1 A;  3T9V A;  3C9H A;  2DOJ A;  1MH4 A;  2O1M A;  1MPB A;  1SQY A;  2NUV A;  1OIB A;  2I4B A;  4OQO A;  3IR1 A;  3UN6 A;  3V89 B;  2O1L A;  4ISU A;  4ZE8 A;  4MH5 A;  1O63 A;  2A5S A;  2PYY A;  1LFH A;  4QF9 A;  2VOZ A;  3VXC A;  3S9M C;  3RQT A;  5DEX B;  5H8H A;  1Z7N E;  3OEL A;  4JXI A;  4O3C A;  3SET A;  4EXK A;  3VE1 B;  3OEN A;  3MVY A;  4THI A;  2XXX A;  3M8U A;  5FHN A;  1QUL A;  4RPO A;  3JV9 A;  1XOC A;  4P11 A;  1NH7 A;  3H6W A;  3THI A;  2PT1 A;  4KCD A;  2Y7P A;  1IXH A;  3FVG A;  4DLD A;  1SI1 A;  1IXI A;  2I0B A;  2O51 A;  3RNN A;  4BDR A;  3OMB A;  4GWO A;  1USY H;  5L8D A;  5AA1 A;  2OJT A;  3S9L C;  4GD5 A;  2FA7 A;  2DWJ A;  5AA3 A;  1B3E A;  5ICT A;  4XKQ A;  1FQF A;  3Q26 A;  2Q2C A;  4GXA A;  5H8N A;  3EHU A;  3CIJ A;  1B46 A;  1BLF A;  1UIU A;  2OCU A;  2UYE A;  1ZLQ A;  1P1U A;  4KI0 E;  4GL0 A;  2OK2 A;  3KOT A;  1DPP A;  1DPE A;  3G3K A;  3OSR A;  3DP8 A;  4R74 A;  3TUS A;  3LSW A;  5H8H B;  3L6H A;  3SDF A;  4IO5 A;  1IXC A;  2DP8 A;  2B3B A;  1R1N A;  3IAZ A;  4LQ5 A;  4LUB A;  3T96 B;  3QIM A;  4DDD A;  1UIV A;  3U93 A;  2XD2 A;  5LOM A;  5CRY A;  4ZEI A;  2ZXT A;  2PMS A;  3N94 A;  4RY1 A;  1DOT A;  1N0T A;  1Y3P A;  3E4R A;  3GZG A;  4IB2 A;  2F97 A;  1LFG A;  3R7X A;  4EXL A;  3DLN A;  3H06 B;  1LB9 A;  1AL3 A;  5CBS A;  2ZNT A;  4RA1 A;  4HW8 A;  3K2D A;  3G3G A;  1B51 A;  5H8N B;  3T22 A;  4GL8 A;  4JSD A;  1LAF E;  4RXL A;  3CG3 A;  3FVK A;  4DXU A;  4GRK A;  5B7D A;  2HCA A;  1NMU A;  3PUY E;  5H8F A;  2DVC A;  1B3L A;  3TTN A;  5IKB A;  3A09 A;  4FED A;  5CM6 A;  1H44 A;  4N13 A;  1ZMG A;  3VV5 A;  4GVO A;  1A7L A;  1WDN A;  1S7Y A;  3RT6 B;  4LON B;  3EPE A;  3ZS6 A;  2XXR A;  1D9V A;  1MXU A;  1B3F A;  4R75 A;  3C33 A;  1A8F A;  4QSD A;  1FQB A;  2XD3 A;  1M5C A;  1LAH E;  3RLF E;  1N7W A;  1CE2 A;  4XTC Q;  4OFL A;  5CMM A;  1WOD A;  3HPI A;  3PV0 E;  4QHQ A;  2Y7W A;  4H5G A;  2XXP A;  2QMW A;  1A8E A;  4ZEC A;  4I9D A;  1MS7 A;  3CFX A;  3U92 A;  2I3V A;  2UVG A;  1LB8 A;  1EZP A;  2V25 A;  2V3T A;  4KHZ E;  3MP6 A;  4O3A A;  3FVN A;  2I4C A;  3ILT B;  2NOO A;  2Q88 A;  3TTM A;  1ZKB A;  1UTH A;  4P0I A;  3E13 X;  4OFJ A;  3KJT A;  1B5J A;  2RCB A;  2XXV A;  3JYR A;  4G77 A;  4JWY A;  1IZ1 A;  3PPN A;  3FJM A;  1OLC A;  5H8S A;  5H8F B;  2RF1 A;  2B65 A;  2X26 A;  4NWD A;  5I2N A;  3H6T A;  1A99 A;  2Z8E A;  3EF7 A;  3S2V A;  1POY 1;  4H65 A;  2QPQ A;  1MXW A;  3TEP A;  1OMP A;  2IA4 A;  2QL3 A;  4FE8 A;  3MUQ A;  4OYV A;  3MVZ A;  1GR2 A;  3OO8 A;  2F5X A;  1YCJ A;  3MVX A;  2HAU A;  1USY E;  3FV2 A;  2O6A A;  5AA2 A;  4QFP A;  3BKI B;  3MPL A;  2H5Y A;  1Q1K A;  3TDJ A;  5EHM A;  3QXM A;  3DP4 A;  2KLF A;  2ZNS A;  1B32 A;  1HSE A;  3MP1 A;  3OO9 A;  1MQI A;  3OXN A;  4C0R A;  4PFY A;  5CI5 A;  1NH8 A;  4G8M A;  1BTJ A;  3O28 A;  4KPT A;  1JW5 A;  5I56 A;  1UTH B;  3O6G A;  4P0G A;  5KCJ A;  5CMC A;  3TFL A;  2I48 A;  4ESX A;  2ABH A;  1PB9 A;  3TTR A;  3HV1 A;  5EYF A;  4JWO A;  4PFW A;  2V84 A;  3IK6 B;  2RIN A;  2NXO A;  1OVB A;  4IO7 A;  2PVU A;  3VLW A;  4YMA A;  1LLS A;  4FIM A;  4LQ2 A;  3O97 A;  3BBR A;  5F7V A;  1EZ9 A;  1QKA A;  5I2N B;  2DWA A;  1EU8 A;  3OD7 A;  2I3W A;  1MXX A;  3CI8 A;  3HHG A;  3HN0 A;  1MDP 1;  4U1Z A;  1JVX A;  4GQO A;  2Z22 A;  4Z0I A;  3TOD A;  2XX8 A;  5ITO A;  4U4S A;  3T66 A;  4BDM A;  3T93 B;  2O68 A;  5AA2 B;  2DE3 A;  1JNF A;  1FTM A;  4F22 A;  1JEU A;  3H3G A;  4NF5 B;  4ELQ A;  3KN8 A;  4KCC A;  4EF1 A;  1MXY A;  1OLA A;  4IO2 A;  3UOR A;  3ILU B;  3FAS A;  4QFN A;  1MY2 A;  1Y3Q A;  4ZED A;  1B7H A;  4F31 B;  3O9P A;  5BWJ A;  5BUU A;  1S9T A;  1R9Q A;  4G8N A;  3LUY A;  3H6U A;  4EF2 A;  3E9X A;  5I56 B;  3FVO A;  1NNF A;  2XXI A;  1ZBM A;  1H3D A;  5ISU A;  2F36 A;  2DXR A;  1LCF A;  2F7A A;  1HSL A;  3SKP A;  2D3I A;  3H6V A;  2DQV A;  3W9W A;  2RC8 A;  3UA8 A;  3PMW A;  5K2X A;  4L17 A;  4RK9 A;  3GBA A;  1ZIU A;  4U1O A;  5AA2 D;  2H98 A;  4EDP A;  2G29 A;  1IUD A;  3K6X A;  4EQ9 A;  2Q2A A;  4GOT A;  1B6H A;  3SER A;  1SW1 A;  3KGC A;  4R9G A;  5I57 B;  2QRY A;  4KFQ A;  3K1N A;  1MQG A;  3K01 A;  4X1B A;  3V8X B;  2UXA A;  1B52 A;  4OFO A;  5CC2 A;  1B40 A;  1B5I A;  2XXU A;  2YLN A;  4KYS A;  1JET A;  1SW4 A;  3RT8 A;  1N04 A;  3ODB A;  1B7U A;  1II5 A;  3IJX B;  1MQD A;  4OZ9 A;  1JW4 A;  1QUK A;  1FTK A;  2REJ A;  5DVF A;  4YB7 A;  4FEB A;  2R9J A;  1MPD A;  3B6Q A;  1B1X A;  5JEI A;  3OSQ A;  4U23 A;  4H5F A;  1ZU0 A;  4XKP A;  5TU0 A;  3TCF A;  3PUW E;  3D4G A;  3CG1 A;  4ZDM A;  5B70 A;  1OQG A;  4HCW A;  3U72 A;  3VXB A;  3K02 A;  4RYA A;  4LP2 B;  1MM7 A;  3PMV A;  1FQA A;  1LCT A;  3Q29 A;  3TMG A;  1NKX A;  5EHS A;  1TFD A;  4LZ5 A;  2F7B A;  1P1O A;  2F6P A;  4AB6 A;  2Q8J A;  4DCY A;  3K1M A;  4LVQ A;  3CFZ A;  3TPA A;  3QUF A;  2RC9 A;  2XXQ A;  3FXU A;  3IO6 A;  3RGY A;  1UTB A;  1LBB A;  3N6T A;  4OES A;  4Q5T A;  3TQL A;  3VVD A;  4F1V A;  3IOR A;  2X7Q A;  1P1Q A;  3RY3 A;  3SEW A;  4ECF A;  2O7I A;  4QSC A;  3TEL A;  3HHF A;  5KZT A;  5KDT A;  5CMB A;  1Q35 A;  2I6E A;  3TAJ A;  2Z23 A;  2RC7 A;  2HZL A;  4LA9 A;  1B3G A;  1LAX A;  1LBC A;  3UGW A;  1FTL A;  1Y4C A;  2DE2 A;  3G3J A;  2F8D A;  3N26 A;  4F19 A;  2H99 A;  1B7Z A;  4C1T A;  5ELV A;  3TQW A;  1J1N A;  2IEE A;  4WXJ A;  1MRP A;  4F1Y A;  3PD9 A;  3S9E A;  1MPC A;  1IXG A;  2HFB A;  2V3Q A;  2R6G E;  2AL4 A;  3H7M A;  3PPR A;  3IO4 A;  2OZZ A;  1LGB C;  4OER A;  4ZS9 A;  1Y20 A;  3R6U A;  1B0L A;  3C34 A;  2RKM A;  4M4G A;  3VLV A;  4R72 A;  3O2A A;  3P7I A;  1MY0 A;  2Z8F A;  3N6U A;  3GBB A;  2ZYO A;  1UQW A;  4H0W A;  3G3F A;  4OVJ A;  1RYX A;  5HM4 B;  3E3K A;  1YAE A;  4JBZ A;  1XC1 A;  2VHA A;  5HBC A;  1MY4 A;  4FOR A;  1FQE A;  1H43 A;  2NWJ A;  3ZSF A;  2E0S A;  1XVX A;  4YAH X;  3FAT A;  3S4U A;  4XKR A;  1UTB B;  2D21 A;  1VFE A;  3K1P A;  4Q30 B;  3FJG A;  3B7D A;  1IIT A;  1B3H A;  3O66 A;  3TCH A;  1GTK A;  3BFU A;  4YMB A;  3UIF A;  5KDT B;  4F29 A;  4F2Q A;  1TT1 A;  1JEV A;  4ESW A;  2ONR A;  4PE5 B;  4G8H A;  5ITP A;  3DP6 A;  3JZJ A;  1B4H A;  1MQJ A;  2GRV A;  5J1D A;  3D4C A;  2F34 A;  1SBP A;  3ECR A;  4AB5 A;  1XHY A;  1H45 A;  1NNP A;  1Y1M A;  4F2O A;  1US4 A;  4JWX A;  4FAT A;  4PFT A;  3EHS A;  2HEU A;  4RJZ A;  2Q89 A;  4PP0 A;  4YB5 A;  5I84 A;  1VR5 A;  2YPN A;  2ONK E;  3L6G A;  4YKJ A;  4TLM B;  2DXY A;  1QUJ A;  2Q9T A;  3EQ1 A;  5F1Q A;  3UK4 A;  3FD3 A;  4ZEB A;  5K2Y A;  4F1U A;  4YB6 A;  1ZTY A;  4R2F A;  3USD A;  4GFR A;  3SEU A;  3RTF B;  3PU5 A;  4KD5 A;  3TYH A;  2ANJ A;  5FTI A;  4KYE A;  3MZ1 A;  5FHO A;  4F3P A;  5DTB A;  4MLV A;  1YPN A;  4FJP A;  3T9H B;  4MLQ A;  5TPA A;  2V3U A;  2VGQ A;  1PDA A;  4PFU A;  3AXF A;  1BKA A;  2RCA A;  4X1D A;  5L9M A;  1NL5 A;  2ZYN A;  3Q25 A;  4U22 A;  3IJO B;  2QSX A;  2NVU B;  1PEB A;  3FGS A;  3CSG A;  4G68 A;  4DXB A;  2FNC A;  4BLA A;  1DSN A;  3CFL A;  3ONM A;  3SEX A;  1PBP A;  1R9L A;  1OVT A;  3W15 C;  3C32 A;  1N76 A;  4JB7 A;  3QAX A;  4R6Y A;  4NF5 A;  4YU0 A;  4XIG Q;  5CMK A;  1M5F A;  2Y7R A;  4E0W A;  3B6T A;  4DZ1 A;  1QW0 A;  4OEN A;  3LSL A;  4IO6 A;  4FAJ A;  1PB8 A;  2OLB A;  1LFI A;  3KOS A;  3KFM A;  4I1D A;  2F78 A;  3IOV A;  3A3C A;  3UP9 A;  4IO3 A;  3PUZ E;  3IOT A;  4LZ7 A;  2AL5 A;  1QKB A;  1URD A;  2ESN A;  4IO4 A;  3RUM A;  1GV8 A;  4DIG A;  1NNT A;  4G68 C;  1Y1Z A;  2F35 A;  1SW5 A;  3K4U A;  2ZNU A;  3IOU A;  1P1N A;  3U94 A;  3KJ7 A;  4TLL B;  4F3G A;  3I3V A;  1ATG A;  4QFO A;  5I57 A;  5M2V A;  4E0X A;  1A40 A;  2O84 X;  3MAM A;  5TPA B;  3IB0 A;  4QRZ A;  1FQD A;  3SEY A;  2H4I A;  2Z8D A;  3MC2 A;  1I6A A;  1B9J A;  2P2A A;  5I58 B;  1FW0 A;  1FTO A;  1SD3 A;  4X48 A;  1BP5 A;  1Z7M E;  1DMB A;  1SI0 A;  5TP9 A;  5FHM A;  4Q0C A;  1Y3N A;  2UVI A;  3N5L A;  4G68 B;  4R9F A;  5L9O A;  4I8C A;  3HO7 A;  1SW2 A;  4OET A;  4F3B A;  1D9Y A;  3IB1 A;  3M3L A;  3V83 A;  2XX7 A;  3QYT A;  4UA8 A;  5I2K A;  2HXW A;  4QSE A;  3KEI A;  4KR5 A;  3C4M A;  5DVJ A;  3A3U A;  4DE8 A;  1B5H A;  4JSO A;  4UAC A;  2QS1 A;  4NTL A;  3FZV A;  1R6Z A;  3IB2 A;  2G93 A;  1I6B A;  1MY1 A;  3FJ7 A;  4OHN A;  1MQH A;  1NNK A;  2F7C A;  1PB7 A;  1B58 A;  3KZG A;  4PQJ A;  3OEK A;  2DVZ A;  2I0C A;  4IGR A;  4BDL A;  5HPQ A;  2Y84 A;  5AA4 A;  4OXV A;  3VDF A;  3O29 A;  1NFT A;  2CZL A;  4GXS B;  2GHB A;  2QS4 A;  3MP8 A;  3CVG A;  1ELJ A;  4TQU Q;  1O7T A;  2QMX A;  5TP9 B;  3W9V A;  1B0H A;  4ELR A;  4NE4 A;  2B3F A;  1GGG A;  5JTY A;  1DTZ A;  3SES A;  1M5D A;  2DYX A;  1N84 A;  3BFT A;  3PD8 A;  2F6G A;  5I2K B;  4DCX A;  2DWH A;  4XKN A;  1IEJ A;  1US5 A;  4HCY A;  3MVW A;  2XXY A;  2DE4 A;  5AE4 A;  4YKP A;  1MDQ A;  2O7U A;  1HSJ A;  5IAI A;  2W7Y A;  4R2B A;  1B05 A;  2P0S A;  3U8Q A;  4OTE A;  4KYD A;  1LAG E;  3VFJ A;  4RPN A;  4N6P A;  1AMF A;  1MXZ A;  2OWT A;  1Y4T A;  3OEM A;  1SYH A;  4U21 A;  2VD3 A;  2H9B A;  4YIC A;  4NMY A;  1QVS A;  4U2R A;  3KSX A;  1GVC A;  3PUX E;  1SVX B;  4NWC A;  3FIR A;  4F18 A;  3TTL A;  3QK6 A;  3ZKL A;  5AA4 B;  1D4N A;  2OWS A;  4YZZ A;  3VLU A;  3CRB A;  1S50 A;  1FQC A;  2PX1 A;  4U4X A;  4ZZA A;  4OWD A;  3K6U A;  2VD2 A;  3MQ9 A;  2X7P A;  1JW1 A;  1M5B A;  2QJE A;  2ZMB A;  4OEU A;  3R26 A;  2ALU A;  5JTY B;  3C31 A;  2D5W A;  1EZO A;  2Y7K A;  2DS9 A;  1PC3 A;  3LR1 A;  4MBP A;  1O64 A;  5DYH A;  3CSB A;  1N3W A;  1FTJ A;  4BDN A;  5H8Q A;  2QS3 A;  2XXH A;  2HQ0 A;  5JK4 A;  3PPP A;  1VE4 A;  1JVY A;  4ZZE A;  4PET A;  4X9T A;  3TKD A;  5I59 A;  1ANF A;  3PPQ A;  4HS7 A;  3IX1 A;  4NF6 A;  4RNS A;  1A54 A;  2ZYK A;  4LZ8 A;  1MXV A;  1D3K A;  1SYI A;  4Z7E A;  3Q27 A;  2I49 A;  4NF8 A;  4FEC A;  2QS2 A;  3I6V A;  2REG A;  1B2H A;  2HZK A;  1MY3 A;  3MW0 A;  4O3B A;  3S9N C;  3MJN A;  2ONS A;  5FTH A;  4POX A;  3KBR A;  4WEP A;  2FYI A;  4XXU A;  3G7W A;  4LAT A;  3MZ9 A;  3EHT A;  3K00 A;  2AYS A;  3HCQ A;  2E1S A;  4F39 A;  4BDQ A;  3RN8 A;  3FXR A;  1FCK A;  2PBW A;  3C36 A;  4IY5 A;  5DVI A;  1LST A;  2P1S A;  1AOV A;  1P1W A;  1RKM A;  2GFE A;  1VFD A;  3WAE A;  1SDX A;  2UVJ A;  5H8Q B;  3TTK A;  1URS A;  4YKI A;  4ELP A;  3FV1 A;  4H6D A;  2AIX A;  2A5T A;  5I59 B;  3DEL B;  3EN3 A;  4QFL A;  3VVF A;  1P99 A;  3KN3 A;  2UYF A;  4I62 A;  3MPK A;  3MZB A;  4NF6 B;  3I5O A;  1YTV A;  2H25 A;  1VSO A;  3CR9 A;  4NF8 B;  2THI A;  2R71 A;  4H67 A;  1T0K A;  1POT A;  3MBP A;  4ZE9 A;  5CBR A;  1CB6 A;  3HST A;  4F3S A;  4M1V A;  2OBG A;  2O69 A;  1XVY A;  4R6H A;  4WED A;  3LC8 A;  4HTG A;  4YKK A;  5I58 A;  3O6I A;  2GH9 A;  3H4Z A;  3OOA A;  3M3K A;  3PUV E;  3O6H A;  1XT8 A;  1A55 A;  4ND9 A;  2XHD A;  2Y7I A;  3K0V A;  5DT6 A;  3KN7 A;  2I58 A;  4H1X A;  4ZEK A;  3IOW A;  3T9X B;  4AQ4 A;  1I6Q A;  5A5X A;  3B6W A;  1XS5 A;  1TFA A;  3LBS A;  1L5T A;  2DWI A;  3QSL A;  3DM0 A;  1ZJL A;  3TCG A;  1N7X A;  3MWB A;  1TWY A;  3SEV A;  3OO6 A;  2XX9 A;  1MH3 A;  4NF4 A;  3PMX A;  3LSF B;  4ONY A;  3K6V A;  3M3F A;  1WVJ A;  4GF8 A;  3U1O A;  3PPO A;  1B1H A;  1QJM A;  2A5T B;  4WKM A;  2GHA A;  3PGF A;  1IIW A;  4C1U A;  4G4P A;  2VP1 A;  4DXC A;  1URG A;  3TZA A;  3KG2 A;  2BJJ X;  1TXF A;  2CMO A;  2PT2 A;  3K6W A;  1H76 A;  5L9S A;  1AIV A;  2YJP A;  3WAF A;  1I69 A;  4Q8R A;  4EQ7 A;  3OO7 A;  3FUZ A;  4ELO A;  1RYO A;  2XXW A;  3LSX A;  4MF3 A;  4OEV A;  3KSJ A;  2M8C A;  1B4Z A;  4ZEF A;  3VVE A;  5DEX A;  3G3I A;  4KQP A;  1KWH A;  2DSF A;  4JDF A;  4MFI A;  4H8J A;  4K3F A;  1AH5 A;  3H03 A;  3G3H A;  4GIZ A;  3RPW A;  1N3X A;  1Y9U A;  3GLB A;  4GLI A;  5A5X B;  2LAO A;  4EUO A;  3C35 A;  2XXT A;  4TOZ A;  1MM6 A;  1IQ7 A;  2WKY A;  4R73 A;  3GXA A;  4POW A;  4BDO A;  2UVH A;  3ZKK A;  2HAV A;  3QUJ A;  4IGT A;  4NF4 B;  4H8I A;  3RTW B;  4RK2 A;  3F11 A;  4OMB A;  1EH3 A;  1PBQ A;  4N07 A;  4EQB A;  3T9U A;  3FXQ A;  4G2Z A;  3Q28 A;  1OQH A;  3V5A A;  5ICQ A;  4QFK A;  4R6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...