2RCAA

Crystal structure of the nr3b ligand binding core complex with glycine at 1.58 angstrom resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
282
structure length
282
Chain Sequence
RPKLRVVTLVEHPFVFTRESDEDGQCPAGQLCLDPGTNDSARLDALFAALVNGSVPRTLRRCCYGYCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRGTELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRHSAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate [NMDA] receptor subunit 3B
publication title Molecular mechanism of ligand recognition by NR3 subtype glutamate receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 95
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2rcaA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2rcaA02
5FHNA 5AA2D 1UTBA 1H44A 3RUMA 4FEDA 2VGQA 3U72A 4HTGA 5HBCA 4GRKA 3ZSFA 4YZZA 3CI8A 1LAGE 2AL5A 2GFEA 3THIA 3TCGA 3LSFB 2YLNA 5H8NA 3H6UA 1FCKA 5I84A 4PFTA 4JB7A 4QFLA 1YCJA 4LZ5A 5BUUA 1AH5A 3PU5A 1TFDA 2B3BA 2QS3A 4G68A 3M8UA 4FE8A 2F7BA 3K6XA 5ICTA 1S50A 1ZLQA 3PV0E 4GD5A 3KN7A 3ILTB 2HFBA 4ZS9A 5ITPA 3U94A 3T66A 4LUBA 3G3GA 1LSTA 4Z0IA 5L8DA 1GR2A 1WODA 4N6PA 3IORA 2R71A 1JW1A 3I6VA 1S7YA 4KYEA 4KCCA 1SW4A 5I2NB 2UVIA 2XXPA 2RF1A 4H65A 3PMWA 2PX1A 4NF5A 4M4GA 3TZAA 2A5SA 1IXHA 1DPPA 1YTVA 4LP2B 4U2RA 3VLWA 3O29A 4MF3A 3KJTA 3OO9A 1B1HA 4TLMB 3T9VA 2ONKE 1Y3NA 2Y7PA 3RT6B 3OD7A 3HHFA 2NOOA 1MY1A 4G8NA 1POTA 1N3XA 3A3UA 2QSXA 5DVJA 1EZ9A 4QHQA 3Q25A 1A8EA 3LSWA 4PP0A 5EHSA 4IO4A 4ELQA 2UVJA 1OQGA 2XX8A 1B05A 2Q88A 3T9XB 5AA4A 4U4XA 3IK6B 5H8SA 4F3PA 4UA8A 3FVKA 4LVQA 2VD2A 1PC3A 3JYRA 2RC7A 4R6KA 5I56A 4I1DA 2B65A 3VLUA 3K6WA 4TLLB 3PPQA 1LB8A 3M3KA 2XD3A 1IZ1A 3MUQA 1N7WA 4LA9A 3CFLA 2W7YA 4XKRA 1NMUA 1B40A 2YPNA 2DVZA 4POWA 3USDA 2FYIA 3H03A 4F19A 5JEIA 4FAJA 4X1DA 3SESA 4DDDA 1WVJA 3PUZE 2V93A 5I2NA 3QUJA 3PUWE 1Y1ZA 3EQ1A 3OELA 4LONB 4H5GA 4XKNA 3OEKA 2Y84A 4NMYA 3T9UA 3LR1A 4MFIA 1SW1A 2Z8DA 3MW0A 3K1NA 1QVSA 2Z23A 4G8MA 1A40A 4G2ZA 2PBWA 2UVHA 1ATGA 3FVOA 2D3IA 5DEXB 1XT8A 1B3GA 1ELJA 3SKPA 5DYHA 3LUYA 1DTGA 5TPAB 1ZKBA 3O9PA 3N94A 5J1DA 4O3BA 4OZ9A 4GIZA 2RCBA 4F18A 3R26A 5ITOA 4YB6A 1B5HA 1VE4A 1QKAA 4PETA 1MQHA 2I4CA 4YMBA 3MPLA 4FEBA 4JDFA 1QULA 4F31B 3R6UA 5ELVA 2GHAA 1Z7ME 4OERA 3TKDA 3KSJA 1Y1MA 3I3VA 3FGSA 3HO7A 1Y9UA 2XXHA 5IAIA 3D4CA 2DXRA 3H3GA 3KFMA 3PMXA 1HSJA 1MQDA 4R6HA 2F36A 4YKPA 4ESXA 1R9QA 3I5OA 1LCFA 5FTIA 3ODBA 3MC2A 3TFLA 3U8QA 1URGA 4YB7A 4GWOA 3UA8A 2OWTA 4NWCA 3VVEA 1MPCA 3S9MC 4X9TA 2H5YA 2OLBA 4ELOA 1I6AA 5I57B 1USYE 1B32A 3FV1A 5BWJA 3FJ7A 5A5XB 4F1YA 4YKIA 2ZYMA 2PT1A 3HHGA 3FD3A 4OETA 3H06B 2I4BA 4F39A 4GFRA 4Q30B 4ZDMA 2I58A 4IB2A 4IO7A 3G3JA 1LAHE 3L6GA 1PB7A 3CR9A 4HS7A 5DEXA 1MQJA 2Q9TA 1IIWA 3T93B 5CMKA 4EF1A 2H9BA 5TPAA 1UTBB 4ZECA 1D9VA 5KCJA 3RY3A 4OXVA 1JNFA 2NXOA 1XS5A 1B7HA 2ZNTA 4HCYA 4FJPA 4DLDA 4H67A 4PQJA 1ZU0A 3VE1B 3UIFA 1B5JA 5KZTA 2O69A 2DWJA 5TP9A 4DZ1A 2RC8A 5ISUA 3CSBA 2P1SA 1UQWA 5I58A 2CZLA 3K6UA 3VDFA 3TDJA 4LZ8A 4ZEKA 1FTJA 1ZMGA 4P0IA 3A3CA 3TTLA 4R2FA 2DE3A 1P1WA 4OFOA 3MJNA 2ZNSA 4R2BA 2D21A 4X1BA 4EQBA 1SVXB 2DOJA 3EPEA 1A7LA 2HZLA 4NTLA 4OWDA 4GOTA 3MP8A 1AMFA 2I0CA 1FTOA 1OMPA 2UYFA 1A55A 3RQTA 2XXWA 3S9NC 4PFUA 2XHDA 4ZZEA 4RY1A 4LZ7A 5AA1A 2VHAA 2I3WA 1M5FA 4ECFA 2HCAA 3UORA 3PUYE 3ILUB 4QSEA 3MQ9A 3M3LA 4EF2A 1MXXA 1R1NA 4OENA 3TMGA 4DCXA 2X7QA 2E1SA 1Y4TA 4KD5A 4H8IA 2XXQA 3FVGA 4XIGQ 5F7VA 3AXFA 1IXGA 3ZS6A 1MXYA 5H8QA 2VOZA 2Z8FA 4JSDA 5I59B 3K02A 4H1XA 2I6EA 2REGA 1TFAA 1M5EA 5B70A 3QXMA 3K00A 5DT6A 4WXJA 3QSLA 2O6AA 4MLQA 4BDOA 2H99A 2I49A 5AA4B 1T0KA 3WAFA 3FJGA 4YICA 2OCUA 5I56B 5DVFA 3IOWA 3T22A 3MZ1A 1IQ7A 2P2AA 3RPWA 3CFZA 2HXWA 4EQ9A 4YKJA 4BLAA 3LC8A 1BIYA 1OVBA 3IO6A 3S2VA 4THIA 5TU0A 4I8CA 3KOTA 1MM6A 1MRPA 4OYVA 2QMXA 2I48A 3TELA 1HSLA 3MP6A 4ZEDA 2OZZA 4I9DA 4WEDA 4AB6A 3ZKKA 4H5FA 2O1MA 3DP4A 4ZE8A 4EQ7A 2X26A 3IOTA 1YAEA 1B3EA 2GHBA 3H7MA 4JWOA 1MXZA 1SDXA 1ZBMA 1N0TA 4G4PA 3GBAA 3V83A 1B7UA 3BKIB 3V89B 1FTLA 4XXUA 4LATA 1UIVA 3FXQA 1JQFA 3FZVA 5CBRA 2F6GA 3K1MA 1J1NA 4OFJA 2D5WA 4ZEBA 4LQ5A 4BDNA 4H8JA 1D9YA 4ZEFA 4F1VA 4U4SA 5CBSA 2O1LA 3TTRA 1P1UA 4QSDA 3TODA 3TQLA 3L6HA 4ZE9A 5I59A 4Q0CA 3D4GA 4ESWA 4GXSB 1Q35A 3IOVA 3KN3A 2H98A 4XKQA 4IY6A 2ZXTA 1B0LA 2CMOA 2Y7KA 5DVIA 2F6PA 3OEMA 1FQBA 3MVZA 1QUKA 4GVOA 4IO5A 2RC9A 5CM6A 4L17A 3QK6A 1ZTYA 2Z8EA 1GTKA 3TAJA 1MXUA 1LGBC 1B1XA 1R9LA 1POY1 4JWYA 3GLBA 1FTMA 1URDA 4DXUA 1Y4CA 3ECRA 3PUXE 4F29A 3U92A 3OO7A 5IKBA 1PDAA 4KR5A 3JV9A 5CRYA 2X7PA 2Y7IA 1B2HA 1XVYA 3S9LC 4XKPA 1PBQA 3OOAA 1MY3A 2PT2A 1L5TA 2QPQA 3VVDA 2I3VA 2QS2A 4C0RA 5KCJB 3F11A 3MVWA 2FNCA 1NH8A 4AB5A 3IR1A 1II5A 5FHOA 5TP9B 3IJOB 1BLFA 3HN0A 3O6GA 1XC1A 3VXCA 5I58B 3KOSA 3S4UA 2XX9A 3IL1B 4RA1A 4ELRA 3VXBA 2H25A 4ZZAA 4ZEIA 4OVJA 3Q29A 3H6WA 1FQEA 5F1QA 5LOMA 4FIMA 3OXNA 4QRZA 2NVUB 1MXVA 1FQFA 1QKBA 3LSXA 5HM4B 4H6DA 1N84A 2O7IA 2ALUA 4EDPA 1SW2A 2O7UA 3N26A 1F9BA 3TEPA 1GVCA 1H45A 3H4ZA 2Z22A 3TTMA 3SEYA 3G7WA 4KI0E 5I2KA 4KPTA 4F2QA 3P7IA 4RJZA 5AA3A 2HAUA 4QFPA 1SBPA 4H0WA 2Y7WA 4OMBA 3O6HA 4ND9A 1RYOA 2PVUA 1DPEA 1B3FA 3C9HA 1USYH 1DTZA 1P1NA 1GV8A 2G29A 2LAOA 3A09A 4OTEA 2ANJA 3N5LA 4BDLA 1UIUA 3Q28A 4E0XA 1NKXA 1B46A 1BTJA 4F3BA 2DXYA 3TUSA 3GBBA 3DP8A 3GXAA 3MVXA 4Z7EA 5H8QB 3MZ9A 3CVGA 4Q8RA 4YU0A 4IO3A 2F7AA 3ONMA 1LFGA 3UN6A 2QRYA 4G68C 1SYIA 5L9OA 4U23A 3K01A 2DQVA 4R73A 4RYAA 4NF8B 4G77A 4POXA 4RXLA 2HZKA 2XXXA 3GZGA 3QYTA 3OO6A 4OEVA 2QS4A 4KYSA 1DMBA 2OJTA 1QW0A 1DSNA 3MWBA 4RPNA 4PFWA 2DWIA 4R72A 4NF4A 4YAHX 2ZYKA 4BDRA 3TCHA 1QUIA 2PMSA 1MPBA 4GQOA 3PD9A 2DWAA 1Y20A 1TXFA 3RT8A 2IA4A 1Z7NE 3EHSA 3K4UA 4QFKA 3PPPA 3OSQA 1B6HA 3E4RA 4TOZA 1URSA 2Y7RA 3U1OA 5FHMA 4R6YA 4O3AA 3O28A 1XOCA 1OLCA 2DSFA 5AE4A 3K6VA 4K3FA 4N13A 2DP8A 3TTNA 3HCQA 4FECA 3SETA 1MY4A 3DELB 1Y3QA 1B58A 3G3FA 1SW5A 1PEBA 3N6UA 3TQWA 3LSLA 3LBSA 3CG1A 3OSRA 1GGGA 3PMVA 3DLNA 2XXUA 2V3UA 1JVXA 2F7CA 4P0GA 3KSXA 4NF6B 1BP5A 2ZNUA 1SD3A 4R75A 3MBPA 1LFIA 4EXKA 4DCYA 3CSGA 1N7XA 2XXVA 4MH5A 4NF8A 4DXCA 1ANFA 3VV5A 2KLFA 3W15C 4ONYA 1N3WA 2A5TA 3B7DA 4JSOA 1LFHA 4YB5A 4FORA 4WEPA 3KG2A 5CC2A 4JWXA 4QSCA 3IB1A 2REJA 1NFTA 2O68A 2THIA 4MLVA 5CMBA 3HV1A 1I6QA 2RKMA 2QJEA 4QF9A 1UTHA 1TT1A 4RPOA 2XXRA 5CMMA 4M1VA 3FIRA 2DE2A 1JETA 2V3QA 3IO4A 1B4ZA 2XD2A 3KJ7A 4GXAA 3IX1A 1FQDA 4EXLA 3G3HA 3C32A 1MG1A 3RN8A 1IXCA 1ZJLA 4UACA 1MH4A 1M5CA 3RTFB 5M2VA 2P0SA 4QFNA 3E13X 2OK2A 3C34A 3B6WA 4R9GA 1P1QA 3FVNA 2WKYA 1MDP1 3HPIA 5JK4A 2AYSA 3IB2A 1WDNA 2V25A 3C4MA 3VVFA 3IAZA 4IY5A 2F97A 3U93A 2O84X 4O3CA 1A8FA 3PUVE 4GL8A 4IGRA 4JXIA 3E9XA 5EYFA 3FUZA 3DM0A 2Q2AA 4C1TA 1B3HA 1VFEA 2GH9A 3W9VA 5H8FB 3T96B 4U1ZA 1Q1KA 3EHTA 2ONRA 4G8HA 4OQOA 3RNNA 1NL5A 4NF6A 3CIJA 3ZKLA 1A54A 3MP1A 1S9TA 2NWJA 4GL0A 3SDFA 4YKKA 5FTHA 5AA2B 3C35A 3IOUA 1D3KA 4KYDA 4R9FA 3TYHA 2FA7A 4WKMA 1VFDA 1QJMA 1LLSA 2ZYNA 4F3SA 2H4IA 2BJJX 2O51A 3KGCA 3MVYA 4DIGA 1LCTA 3SEVA 1EH3A 1MH3A 1CE2A 1LAFE 1CB6A 3O2AA 5K2YA 1D4NA 3FATA 2RCAA 2E0SA 4E0WA 3O66A 1SQYA 3CRBA 3K1PA 5I2KB 1N04A 3CG3A 2UXAA 3M3FA 3G3KA 1JEUA 3SERA 1US4A 3O6IA 3Q27A 3MZBA 1B4HA 3EF7A 4N07A 2UYEA 3N6TA 4F3GA 1DOTA 3OO8A 4HCWA 3OENA 3UK4A 1IUDA 3BBRA 1NNKA 3KBRA 4TQUQ 4IGTA 2ONSA 2QL3A 1LBBA 4RK9A 1B7ZA 1JW5A 1EU8A 4P11A 5K2XA 3IJXB 4BDQA 1PBPA 1O64A 2F5XA 2HAVA 3MAMA 3H6TA 3SEXA 5ICQA 5JTYB 1O7TA 5KDTB 4OHNA 3C36A 4C1UA 3MPKA 1NNFA 2I0BA 5B7DA 1MY2A 4U21A 3SEUA 3TCFA 1IEJA 1MQGA 1MPDA 5H8FA 4QFOA 2R9JA 3RTWB 5L9MA 4FATA 2XXIA 3EHUA 1FQAA 2B3FA 4I62A 3TTKA 4NF4B 2AL4A 4LQ2A 4IO2A 1H76A 3QUFA 4GLIA 5AA2A 3UP9A 1ZIUA 2R6GE 5HPQA 1LBCA 2M8CA 1B0HA 4GF8A 3FXUA 3IB0A 3PPNA 1VR5A 1QUJA 3FV2A 4OEUA 4KFQA 3E3KA 2UVGA 2G93A 3VLVA 1B5IA 1MDQA 1US5A 1SI0A 2DE4A 3FASA 1N76A 5L9SA 2DS9A 4ISUA 1PB8A 3V5AA 3Q26A 3BFUA 3C33A 2VP1A 1FTKA 5CI5A 1PB9A 4F2OA 2Q89A 1EZOA 2QMWA 1HSEA 1NH7A 2ESNA 2XXYA 3KN8A 3S9EA 2V84A 1AIVA 2Q2CA 3DP6A 4KQPA 1MXWA 1JEVA 3SEWA 4IO6A 4BDMA 2DVCA 3V8XB 4HW8A 2OWSA 4F22A 3BFTA 1VSOA 2QS1A 5H8HB 1M5BA 1IITA 4ELPA 1H3DA 3PPOA 1TWYA 1JVYA 1LB9A 2XXTA 4DE8A 1FW0A 5JTYA 5KDTA 4OESA 3B6TA 2ZMBA 3QIMA 2HQ0A 3PD8A 3FXRA 1NNTA 4DXBA 2OBGA 2RINA 2XX7A 4PFYA 1B52A 1JW4A 1P1OA 1XVXA 1R6ZA 3PPRA 2V3TA 4YMAA 1YPNA 2HEUA 2PYYA 5DTBA 2YJPA 2A5TB 3WAEA 4PE5B 3C31A 3HSTA 5CMCA 1OLAA 3KZGA 3EN3A 5H8NB 3UGWA 1SI1A 1O63A 4AQ4A 3H6VA 1FQCA 1AL3A 1UTHB 1OQHA 3CFXA 4NEDA 4G68B 4U1OA 4NWDA 1OIBA 1P99A 2GRVA 2VD3A 4KHZE 3T9HB 2DYXA 1NNPA 4X48A 4OFLA 3R7XA 1B3LA 2IEEA 4Q5TA 1MM7A 3QAXA 4XTCQ 1IXIA 2ZYOA 1EZPA 2F78A 1B51A 4KCDA 2F8DA 3FJMA 3TPAA 3RLFE 4JBZA 4NE4A 2F35A 3VFJA 1KWHA 2NUVA 3JZJA 3W9WA 1LAXA 1A99A 4RNSA 4NF5B 1MS7A 1B9JA 3K0VA 1RYXA 1M5DA 3OMBA 4U22A 3RGYA 1H43A 4EUOA 1Y3PA 4MBPA 1SYHA 5I57A 2ABHA 5A5XA 3KEIA 1AOVA 4F1UA 3O97A 1BKAA 3B6QA 5H8HA 1I69A 1OVTA 5EHMA 2AIXA 3PGFA 2Q8JA 1MY0A 3G3IA 4RK2A 1XHYA 3K2DA 1I6BA 2DWHA 1MQIA 4R74A 1RKMA 2F34A
chains in the Genus database with same CATH superfamily
4KXPA 5FHNA 5AA2D 1NV2A 4PTKA 1UTBA 1H44A 3RUMA 4FEDA 2VGQA 4PAKA 3U72A 2XWOA 4HTGA 1LBZA 5HBCA 4GRKA 3ZSFA 4YZZA 3SZPA 3CI8A 1LAGE 2AL5A 2ZZWA 2GFEA 3THIA 3TCGA 1XI6A 3LSFB 1NUXA 2YLNA 5H8NA 3H6UA 1FCKA 5I84A 4PFTA 4JB7A 4QFLA 1YCJA 4LZ5A 5BUUA 1AH5A 3PU5A 1TFDA 2B3BA 2QS3A 4G68A 3M8UA 4FE8A 2JJKA 2F7BA 3K6XA 5I3SA 4NX1A 1NV4A 5ICTA 1S50A 1ZLQA 3PV0E 4GD5A 3KN7A 3ILTB 2HFBA 4ZS9A 5ITPA 1FRPA 3U94A 3T66A 2OWZA 4LUBA 3G3GA 1LSTA 3BIGA 4Z0IA 5L8DA 4PAFA 1GR2A 1WODA 4N6PA 3IORA 2R71A 5T3JA 1JW1A 3I6VA 1S7YA 4KYEA 4KCCA 1SW4A 5I2NB 1FPDA 2UVIA 2XXPA 2RF1A 4H65A 3PMWA 2PX1A 3GYYA 4NF5A 4MAGA 4M4GA 4NAPA 3TZAA 2A5SA 1IXHA 1DPPA 1YTVA 4LP2B 4U2RA 3VLWA 3LV0A 3O29A 4MF3A 1FPEA 4QXDA 3KJTA 3OO9A 2WX9A 1B1HA 4PFRA 4TLMB 3T9VA 2ONKE 1Y3NA 2Y7PA 3RT6B 3OD7A 3HHFA 2NOOA 1MY1A 3CHGA 4G8NA 1POTA 1N3XA 3A3UA 2QSXA 5DVJA 1EZ9A 5F24A 4QHQA 4MX6A 1NV1A 3Q25A 1A8EA 3LSWA 4PP0A 5EHSA 1NV7A 4IO4A 4ELQA 4I3EA 2UVJA 1OQGA 2XX8A 1B05A 2Q88A 3T9XB 5AA4A 4U4XA 3IK6B 4AS4A 5H8SA 4F3PA 4UA8A 3FVKA 4LVQA 2VD2A 1PC3A 3JYRA 2RC7A 4R6KA 5I56A 4I1DA 2B65A 5EYHA 3VLUA 2MKZA 3K6WA 4I40A 4TLLB 3PPQA 1LB8A 3M3KA 2XD3A 1IZ1A 4PFBA 3MUQA 1CNQA 1N7WA 4LA9A 3CFLA 2W7YA 4XKRA 1NMUA 1B40A 2FIEA 2YPNA 1QGXA 2DVZA 4N81A 2WYPA 2VT5A 4POWA 2PFZA 3USDA 2FYIA 1YXIA 3H03A 4F19A 5JEIA 4FAJA 4X1DA 3SESA 4DDDA 1WVJA 3PUZE 3PTYA 2V93A 5I2NA 2PCRA 3QUJA 3PUWE 4DI3D 1Y1ZA 4PGPA 3EQ1A 3OELA 4LONB 4H5GA 4XKNA 3OEKA 2Y84A 4NMYA 3T9UA 3LR1A 4MFIA 1SW1A 2Z8DA 3MW0A 3K1NA 1QVSA 2Z23A 4G8MA 1A40A 4G2ZA 2PBWA 3BIHA 2UVHA 1ATGA 3FVOA 2D3IA 5IZ3A 5DEXB 1XT8A 1B3GA 1ELJA 3SKPA 5DYHA 3LUYA 1DTGA 5TPAB 3T0JA 1ZKBA 3O9PA 2XWIA 3N94A 4XEQA 5J1DA 4O3BA 1RDZA 4OZ9A 2Y5KA 4GIZA 2RCBA 4F18A 3R26A 5ITOA 4YB6A 1B5HA 1VE4A 1QKAA 4PETA 1MQHA 2I4CA 4YMBA 3MPLA 4FEBA 4JDFA 1QULA 4F31B 3R6UA 5ELVA 2GHAA 1Z7ME 1FBHA 4OERA 1INPA 3TKDA 3KSJA 1Y1MA 4MNIA 3I3VA 3FGSA 2P3VA 3HO7A 5EQ9A 1Y9UA 2XXHA 5IAIA 4P56A 5IZZA 3IFAA 3D4CA 2DXRA 2VPNA 3H3GA 1IMEA 3KFMA 3PMXA 1HSJA 1MQDA 5I5PA 4R6HA 2F36A 4YKPA 4ESXA 4O7MA 1R9QA 2FHYA 3I5OA 1LCFA 5FTIA 3ODBA 3MC2A 4HE0A 3TFLA 3U8QA 1URGA 4YB7A 4GWOA 3UA8A 2OWTA 4NWCA 3VVEA 4XFEA 1MPCA 3S9MC 4X9TA 2H5YA 2OLBA 4ELOA 1I6AA 5I57B 1USYE 1B32A 3FV1A 5BWJA 3FJ7A 5A5XB 4F1YA 4YKIA 2ZYMA 2PT1A 3HHGA 3FD3A 4JVIA 4OETA 3H06B 2I4BA 4F39A 4GFRA 4Q30B 1G0HA 4ZDMA 3RPLB 3IFCA 2I58A 4IB2A 4IO7A 3G3JA 1LAHE 3L6GA 1PB7A 3CR9A 4HS7A 5DEXA 1MQJA 2Q9TA 1IIWA 3T93B 5CMKA 4EF1A 2H9BA 5TPAA 1UTBB 4ZECA 1D9VA 5KCJA 2GQ1A 3RY3A 4OXVA 1JNFA 2NXOA 1XS5A 1B7HA 2ZNTA 1EYIA 4HCYA 4FJPA 4DLDA 4H67A 3QMFA 5ET8A 4PQJA 1ZU0A 3VE1B 3UIFA 1B5JA 5KZTA 2O69A 2DWJA 5TP9A 4DZ1A 2RC8A 5ISUA 3CSBA 4PDDA 2P1SA 1UQWA 5I58A 2CZLA 3K6UA 3VDFA 3TDJA 4LZ8A 4ZEKA 1FTJA 1ZMGA 1FPGA 4P0IA 3A3CA 4NN3A 3TTLA 4R2FA 2DE3A 1P1WA 1D9QA 4OFOA 4MNPA 3MJNA 2ZNSA 4R2BA 2D21A 4X1BA 4PF6A 4EQBA 1SVXB 2DOJA 4OVQA 3EPEA 4PBQA 1A7LA 4P1LA 2HZLA 4NTLA 1FTAA 4OWDA 4GOTA 3MP8A 1AMFA 4G61A 2I0CA 1FTOA 1OMPA 2UYFA 1A55A 3RQTA 2XXWA 2DDKA 3S9NC 4PFUA 2XHDA 4ZZEA 4RY1A 4LZ7A 4OVSA 5AA1A 2VHAA 2I3WA 1M5FA 1AWBA 4ECFA 2HCAA 3UORA 3PUYE 2FIXA 3ILUB 4QSEA 3MQ9A 3M3LA 4EF2A 1MXXA 1R1NA 4OENA 3TMGA 4DCXA 4GWUA 2X7QA 3RPLA 2E1SA 5LDZA 1Y4TA 4KD5A 4H8IA 2XXQA 3FVGA 3FXBA 2QFLA 4XIGQ 5F7VA 4PC9A 3AXFA 1IXGA 3ZS6A 1MXYA 5H8QA 2VOZA 2Z8FA 4JSDA 5I59B 3K02A 1SPIA 4H1XA 2I6EA 2REGA 4DI4B 1TFAA 1M5EA 5B70A 3QXMA 3K00A 5DT6A 4WXJA 3QSLA 2O6AA 4MLQA 4BDOA 2H99A 2I49A 5AA4B 4I3YA 3T1BA 1T0KA 4PBHA 3WAFA 3FJGA 4YICA 2OCUA 5I56B 5DVFA 3IOWA 3T22A 3MZ1A 1IQ7A 2P2AA 3RPWA 3CFZA 2HXWA 4EQ9A 4YKJA 4BLAA 3LC8A 2CZIA 1BIYA 4H46A 1OVBA 3IO6A 3S2VA 4THIA 5TU0A 4I8CA 3KOTA 1MM6A 1MRPA 4GBWA 4OYVA 2QMXA 2I48A 3TELA 1HSLA 4H45A 3MP6A 2HXRA 2OZZA 4I9DA 4ZEDA 4WEDA 4AB6A 3ZKKA 4H5FA 3NOHA 2O1MA 3DP4A 4ZE8A 4EQ7A 2X26A 2WYKA 3IOTA 1YAEA 2ZZVA 1B3EA 2GHBA 3H7MA 4JWOA 1MXZA 1SDXA 2QVUA 1ZBMA 1N0TA 4P47A 4MMPA 1FPLA 4MEVA 3B8BA 4G4PA 3GBAA 3V83A 2ZZXA 1B7UA 3BKIB 3V89B 1FPKA 1FTLA 4XXUA 4LATA 5IZ3B 1UIVA 1K9YA 4N6DA 3FXQA 1LBVA 1JQFA 3FZVA 5CBRA 2F6GA 3K1MA 1J1NA 4OFJA 2D5WA 4OANA 3KC0A 3MYUA 4ZEBA 2KQZA 4LQ5A 4BDNA 4H8JA 2Y5LA 1D9YA 4ZEFA 4F1VA 4U4SA 5CBSA 2O1LA 3TTRA 1P1UA 1IMAA 4QSDA 3TODA 4HXVA 3TQLA 3L6HA 4ZE9A 5I59A 4Q0CA 3D4GA 4ESWA 4GXSB 1Q35A 3IOVA 3KN3A 4NG7A 2H98A 4FBPA 1LBXA 4UABA 4XKQA 4IY6A 2ZXTA 1B0LA 2B4MA 2CMOA 2Y7KA 5DVIA 2F6PA 3OEMA 1FQBA 3MVZA 1QUKA 4GVOA 4IO5A 2RC9A 4GWZA 5CM6A 4L17A 3QK6A 1ZTYA 1FBEA 4MHFA 2Z8EA 1GTKA 3TAJA 1MXUA 1LGBC 1B1XA 3KC1A 1R9LA 1POY1 4JWYA 3GLBA 3MSTA 1FTMA 1URDA 4DXUA 1Y4CA 3ECRA 3PUXE 1FBFA 4F29A 3U92A 3OO7A 5IKBA 1PDAA 4KR5A 3JV9A 4MCOA 5CRYA 2X7PA 1K9ZA 2Y7IA 1B2HA 2Q74A 1XVYA 4OVPA 3S9LC 2V4CA 4N6KA 4XKPA 1DK4A 1PBQA 3OOAA 1MY3A 2PT2A 1L5TA 2QPQA 3VVDA 2I3VA 3KBZA 2QS2A 4C0RA 5KCJB 3F11A 2XA5A 4PGNA 3MVWA 2FNCA 1NH8A 4AB5A 4OA4A 3IR1A 1NI9A 1NV5A 1II5A 5FHOA 5TP9B 4NF0A 1DCUA 3IJOB 1BLFA 3HN0A 3O6GA 1XC1A 4X8RA 3VXCA 5I58B 5LTCA 2FVZA 3KOSA 3S4UA 2XX9A 3IL1B 4RA1A 4GWSA 4ELRA 5I7IA 3VXBA 2H25A 4ZZAA 4ZEIA 4OVJA 3Q29A 3H6WA 1FQEA 5F1QA 5LOMA 4FIMA 3OXNA 4QRZA 2NVUB 1MXVA 1FQFA 1QKBA 3LSXA 2CEYA 5HM4B 4H6DA 3RYDA 1N84A 2O7IA 4PE3A 2ALUA 5A5LA 4EDPA 1SW2A 2O7UA 3N26A 1F9BA 3TEPA 1GVCA 1H45A 2VPOA 4NQ8A 3H4ZA 2Z22A 3TTMA 5ESYA 3SEYA 3G7WA 4GX3A 4KI0E 5I2KA 4KPTA 4F2QA 3P7IA 4RJZA 5AA3A 2HAUA 1Q9DA 4QFPA 1SBPA 4H0WA 2Y7WA 4OMBA 3O6HA 4ND9A 1RYOA 2PVUA 1DPEA 1B3FA 3C9HA 1USYH 2BJIA 1DTZA 1P1NA 1GV8A 2G29A 2LAOA 1FBCA 3A09A 4OTEA 3EKIA 2ANJA 3N5LA 1FJ9A 4BDLA 1UIUA 3Q28A 4E0XA 1NKXA 1B46A 1BTJA 1FJ6A 2PFYA 2CZKA 4F3BA 2B4LA 2DXYA 3TUSA 3GBBA 3DP8A 3GXAA 3MVXA 4Z7EA 5H8QB 3LUZA 3MZ9A 3CVGA 4Q8RA 4YU0A 4IO3A 5ET5A 1FPBA 2F7AA 3ONMA 4N17A 1LFGA 3UN6A 2QRYA 4G68C 1SYIA 5L9OA 4U23A 3K01A 2DQVA 4R73A 4RYAA 4N15A 4NF8B 4G77A 4POXA 4GWYA 4GWWA 4RXLA 2HZKA 2XXXA 4NHBA 3GZGA 3QYTA 1IMDA 1DBZA 3OO6A 4OEVA 2QS4A 4KYSA 1DMBA 2OJTA 1QW0A 1DSNA 1LBWA 3MWBA 4PFWA 4RPNA 2DWIA 5IM2A 4R72A 4NF4A 4YAHX 4OVTA 1IMCA 2ZYKA 4BDRA 3TCHA 1QUIA 2PMSA 1MPBA 4GQOA 3PD9A 2DWAA 1Y20A 1TXFA 3RT8A 2IA4A 1Z7NE 4PAIA 5EYGA 3EHSA 2WEFA 3K4UA 4QFKA 3PPPA 3OSQA 1B6HA 3E4RA 4TOZA 1URSA 2CEXA 2Y7RA 3U1OA 5FHMA 1FPFA 4R6YA 4O3AA 4JVDA 3O28A 4AS5A 1XOCA 1OLCA 2DSFA 4K3FA 3K6VA 5AE4A 4N13A 1FBDA 2DP8A 3TTNA 3HCQA 4FECA 3SETA 1MY4A 3DELB 1Y3QA 1B58A 1NUYA 3G3FA 1SW5A 1PEBA 5EQAA 3D1RA 2CZHA 3N6UA 3TQWA 3LSLA 3LBSA 3CG1A 3OSRA 1GGGA 3PMVA 3DLNA 5IZ1A 2XXUA 2V3UA 1JVXA 1KA0A 2F7CA 3KSXA 4P0GA 4NF6B 1BP5A 2ZNUA 1SD3A 4R75A 3MBPA 1LFIA 4EXKA 4DCYA 3CSGA 1N7XA 2XXVA 4MH5A 4MNCA 4NF8A 4DXCA 1ANFA 3VV5A 4GX4A 2KLFA 4QBAA 3W15C 4ONYA 1N3WA 2A5TA 3B7DA 4JSOA 1YZ0A 1LFHA 4YB5A 4FORA 4WEPA 3KG2A 5CC2A 4MJOA 4JWXA 4QSCA 3IB1A 2REJA 1NFTA 2O68A 2THIA 4MLVA 5CMBA 3HV1A 1I6QA 2RKMA 1EYKA 2QJEA 4HE2A 4QF9A 1UTHA 1TT1A 1KA1A 4RPOA 2XXRA 5CMMA 4M1VA 3FIRA 2DE2A 1JETA 2V3QA 3IO4A 1B4ZA 2XD2A 3KJ7A 4O7IA 4GXAA 3IX1A 1BK4A 1FQDA 4PFIA 4EXLA 3ISPA 5J16A 3G3HA 3C32A 1MG1A 3RN8A 1IXCA 1ZJLA 4UACA 1MH4A 1M5CA 3RTFB 5M2VA 2P0SA 4QFNA 3E13X 2OK2A 3C34A 3B6WA 4R9GA 1P1QA 3FVNA 2WKYA 1MDP1 3HPIA 5JK4A 2AYSA 3IB2A 3E78A 1WDNA 2V25A 3C4MA 3IAZA 5ET6A 3VVFA 4IY5A 2F97A 3U93A 2O84X 2WBBA 4O3CA 1A8FA 3PUVE 4GL8A 4IGRA 4JXIA 3E9XA 5EYFA 3FUZA 3DM0A 2Q2AA 4C1TA 1G0IA 1B3HA 1VFEA 2GH9A 3W9VA 5H8FB 4PCDA 3T96B 4U1ZA 1YYZA 1Q1KA 1RDXA 3EHTA 2ONRA 4G8HA 4OQOA 3RNNA 1NL5A 4NF6A 3CIJA 3ZKLA 4O8MA 1KZ8A 1A54A 3MP1A 1S9TA 2NWJA 4GL0A 3SDFA 4YKKA 5FTHA 5AA2B 3C35A 3IOUA 1D3KA 4KYDA 4R9FA 3TYHA 2HPGA 2FA7A 4WKMA 1VFDA 1QJMA 1LLSA 2ZYNA 4F3SA 2H4IA 1LEVA 2BJJX 2O51A 3KGCA 2WBDA 3MVYA 2OX3A 4DIGA 1LCTA 3SEVA 1EH3A 1MH3A 3HFUA 1CE2A 1LAFE 1CB6A 4P3LA 3O2AA 5K2YA 1D4NA 3FATA 2RCAA 2E0SA 4E0WA 3O66A 1SQYA 3CRBA 3K1PA 5I2KB 1N04A 3CG3A 2XXKA 2UXAA 3M3FA 3G3KA 1JEUA 2P3NA 3SERA 1US4A 3O6IA 3Q27A 4GBVA 4P9KA 3MZBA 1B4HA 3EF7A 4N07A 2UYEA 3N6TA 1NV6A 4F3GA 1DOTA 3OO8A 4HCWA 3OENA 3UK4A 1IUDA 3BBRA 1NNKA 3KBRA 4TQUQ 4IGTA 2ONSA 2QL3A 1LBBA 4RK9A 1VDWA 1B7ZA 1JW5A 1EU8A 4P8BA 4P11A 5K2XA 3IJXB 1FBPA 1FPIA 4BDQA 1PBPA 5FBPA 1O64A 2F5XA 2HAVA 3MAMA 3H6TA 3SEXA 5ICQA 5JTYB 1O7TA 5KDTB 4OHNA 4N91A 3C36A 4C1UA 3MPKA 1NNFA 1IMBA 2I0BA 5B7DA 1MY2A 4U21A 3SEUA 3TCFA 1IEJA 1MQGA 4PF8A 1MPDA 1NUZA 5H8FA 4QFOA 2R8TA 2R9JA 3RTWB 5L9MA 4FATA 4JVCA 5EQ7A 2XXIA 3EHUA 1FQAA 2B3FA 4I62A 3TTKA 4NF4B 1FPJA 2AL4A 4LQ2A 4N8GA 4IO2A 1H76A 3QUFA 4GLIA 1NV0A 5AA2A 3UP9A 1ZIUA 2R6GE 5HPQA 1LBCA 2M8CA 1B0HA 4GF8A 3FXUA 3IB0A 3PPNA 1VR5A 1QUJA 3FV2A 4OEUA 4KFQA 3E3KA 2UVGA 2L5VA 2G93A 3VLVA 1B5IA 1MDQA 1US5A 1SI0A 2DE4A 3FASA 1N76A 5L9SA 2DS9A 4ISUA 1PB8A 2HHMA 5EQ8A 3V5AA 3ROJA 3Q26A 3FBPA 3BFUA 3C33A 2VP1A 3E79A 1EYJA 1FTKA 1NV3A 5CI5A 2XWKA 1PB9A 4N8YA 2FBPA 4F2OA 2Q89A 4GWXA 1EZOA 2QMWA 1HSEA 1NH7A 2ESNA 2XXYA 3KN8A 3S9EA 3U65A 2V84A 1AIVA 2Q2CA 4O94A 3DP6A 4IR8A 1FBGA 4KQPA 1MXWA 1JEVA 3SEWA 4IO6A 3B50A 4BDMA 2DVCA 3V8XB 4HW8A 2OWSA 4F22A 4NGUA 3BFTA 1VSOA 2QS1A 1LBYA 5H8HB 1M5BA 1IITA 4ELPA 1H3DA 3PPOA 1TWYA 1JVYA 1LB9A 2XXTA 4DE8A 1FW0A 5DW8A 5JTYA 5KDTA 1NUWA 4OESA 3B6TA 2ZMBA 3QIMA 2HQ0A 3PD8A 3FXRA 1NNTA 4DXBA 2OBGA 2RINA 2XWVA 2XX7A 4PFYA 1B52A 1JW4A 1P1OA 2Q8MA 1XVXA 1R6ZA 2F3BA 3PPRA 2V3TA 4YMAA 1YPNA 2HEUA 2PYYA 5DTBA 2YJPA 2A5TB 3WAEA 4PE5B 3C31A 3HSTA 4OVRA 5CMCA 1OLAA 3KZGA 3EN3A 5H8NB 3UGWA 1SI1A 1O63A 4AQ4A 3A29A 3H6VA 1FQCA 1IMFA 1AL3A 2F3DA 1UTHB 1OQHA 3CFXA 1FSAA 4NEDA 4G68B 4U1OA 4NWDA 1OIBA 1P99A 2GRVA 2VD3A 4KHZE 3T9HB 2DYXA 1NNPA 4X48A 4OFLA 3R7XA 1B3LA 2IEEA 4Q5TA 1MM7A 3QAXA 4XTCQ 4X04A 1IXIA 4N4UA 1RDYA 2ZYOA 1EZPA 4PDHA 2F78A 1B51A 4HE1A 4KCDA 1JP4A 2F8DA 3FJMA 4GX6A 3TPAA 3RLFE 4JBZA 4NE4A 2F35A 3VFJA 1KWHA 2QVVA 2NUVA 3JZJA 3W9WA 1LAXA 1A99A 4RNSA 4NF5B 1MS7A 1B9JA 3K0VA 1RYXA 1M5DA 3OMBA 4U22A 3RGYA 1H43A 4EUOA 1Y3PA 4MBPA 1SYHA 5I57A 4P1EA 2ABHA 2KR0A 5A5XA 4MIJA 3KEIA 1AOVA 4LN5A 4F1UA 3O97A 1BKAA 3B6QA 5H8HA 1I69A 2QVRA 1OVTA 5EHMA 2AIXA 3PGFA 2Q8JA 1MY0A 5ET7A 3G3IA 4RK2A 4XF5A 1XHYA 3K2DA 1I6BA 2DWHA 1MQIA 4R74A 5IGAA 1RKMA 2F34A
chains in the Genus database with same CATH topology
5FHNA 5AA2D 1UTBA 1H44A 3RUMA 4FEDA 2VGQA 3U72A 4HTGA 5HBCA 4GRKA 3ZSFA 4YZZA 3CI8A 1LAGE 2AL5A 2GFEA 3THIA 3TCGA 3LSFB 2YLNA 5H8NA 3H6UA 1FCKA 5I84A 4PFTA 4JB7A 4QFLA 1YCJA 4LZ5A 5BUUA 1AH5A 3PU5A 1TFDA 2B3BA 2QS3A 4G68A 3M8UA 4FE8A 2F7BA 3K6XA 5ICTA 1S50A 1ZLQA 3PV0E 4GD5A 3KN7A 3ILTB 2HFBA 4ZS9A 5ITPA 3U94A 3T66A 4LUBA 3G3GA 1LSTA 4Z0IA 5L8DA 1GR2A 1WODA 4N6PA 3IORA 2R71A 1JW1A 3I6VA 1S7YA 4KYEA 4KCCA 1SW4A 5I2NB 2UVIA 2XXPA 2RF1A 4H65A 3PMWA 2PX1A 4NF5A 4M4GA 3TZAA 2A5SA 1IXHA 1DPPA 1YTVA 4LP2B 4U2RA 3VLWA 3O29A 4MF3A 3KJTA 3OO9A 1B1HA 4TLMB 3T9VA 2ONKE 1Y3NA 2Y7PA 3RT6B 3OD7A 3HHFA 2NOOA 1MY1A 4G8NA 1POTA 1N3XA 3A3UA 2QSXA 5DVJA 1EZ9A 4QHQA 3Q25A 1A8EA 3LSWA 4PP0A 5EHSA 4IO4A 4ELQA 2UVJA 1OQGA 2XX8A 1B05A 2Q88A 3T9XB 5AA4A 4U4XA 3IK6B 5H8SA 4F3PA 4UA8A 3FVKA 4LVQA 2VD2A 1PC3A 3JYRA 2RC7A 4R6KA 5I56A 4I1DA 2B65A 3VLUA 3K6WA 4TLLB 3PPQA 1LB8A 3M3KA 2XD3A 1IZ1A 3MUQA 1N7WA 4LA9A 3CFLA 2W7YA 4XKRA 1NMUA 1B40A 2YPNA 2DVZA 4POWA 3USDA 2FYIA 3H03A 4F19A 5JEIA 4FAJA 4X1DA 3SESA 4DDDA 1WVJA 3PUZE 2V93A 5I2NA 3QUJA 3PUWE 1Y1ZA 3EQ1A 3OELA 4LONB 4H5GA 4XKNA 3OEKA 2Y84A 4NMYA 3T9UA 3LR1A 4MFIA 1SW1A 2Z8DA 3MW0A 3K1NA 1QVSA 2Z23A 4G8MA 1A40A 4G2ZA 2PBWA 2UVHA 1ATGA 3FVOA 2D3IA 5DEXB 1XT8A 1B3GA 1ELJA 3SKPA 5DYHA 3LUYA 1DTGA 5TPAB 1ZKBA 3O9PA 3N94A 5J1DA 4O3BA 4OZ9A 4GIZA 2RCBA 4F18A 3R26A 5ITOA 4YB6A 1B5HA 1VE4A 1QKAA 4PETA 1MQHA 2I4CA 4YMBA 3MPLA 4FEBA 4JDFA 1QULA 4F31B 3R6UA 5ELVA 2GHAA 1Z7ME 4OERA 3TKDA 3KSJA 1Y1MA 3I3VA 3FGSA 3HO7A 1Y9UA 2XXHA 5IAIA 3D4CA 2DXRA 3H3GA 3KFMA 3PMXA 1HSJA 1MQDA 4R6HA 2F36A 4YKPA 4ESXA 1R9QA 3I5OA 1LCFA 5FTIA 3ODBA 3MC2A 3TFLA 3U8QA 1URGA 4YB7A 4GWOA 3UA8A 2OWTA 4NWCA 3VVEA 1MPCA 3S9MC 4X9TA 2H5YA 2OLBA 4ELOA 1I6AA 5I57B 1USYE 1B32A 3FV1A 5BWJA 3FJ7A 5A5XB 4F1YA 4YKIA 2ZYMA 2PT1A 3HHGA 3FD3A 4OETA 3H06B 2I4BA 4F39A 4GFRA 4Q30B 4ZDMA 2I58A 4IB2A 4IO7A 3G3JA 1LAHE 3L6GA 1PB7A 3CR9A 4HS7A 5DEXA 1MQJA 2Q9TA 1IIWA 3T93B 5CMKA 4EF1A 2H9BA 5TPAA 1UTBB 4ZECA 1D9VA 5KCJA 3RY3A 4OXVA 1JNFA 2NXOA 1XS5A 1B7HA 2ZNTA 4HCYA 4FJPA 4DLDA 4H67A 4PQJA 1ZU0A 3VE1B 3UIFA 1B5JA 5KZTA 2O69A 2DWJA 5TP9A 4DZ1A 2RC8A 5ISUA 3CSBA 2P1SA 1UQWA 5I58A 2CZLA 3K6UA 3VDFA 3TDJA 4LZ8A 4ZEKA 1FTJA 1ZMGA 4P0IA 3A3CA 3TTLA 4R2FA 2DE3A 1P1WA 4OFOA 3MJNA 2ZNSA 4R2BA 2D21A 4X1BA 4EQBA 1SVXB 2DOJA 3EPEA 1A7LA 2HZLA 4NTLA 4OWDA 4GOTA 3MP8A 1AMFA 2I0CA 1FTOA 1OMPA 2UYFA 1A55A 3RQTA 2XXWA 3S9NC 4PFUA 2XHDA 4ZZEA 4RY1A 4LZ7A 5AA1A 2VHAA 2I3WA 1M5FA 4ECFA 2HCAA 3UORA 3PUYE 3ILUB 4QSEA 3MQ9A 3M3LA 4EF2A 1MXXA 1R1NA 4OENA 3TMGA 4DCXA 2X7QA 2E1SA 1Y4TA 4KD5A 4H8IA 2XXQA 3FVGA 4XIGQ 5F7VA 3AXFA 1IXGA 3ZS6A 1MXYA 5H8QA 2VOZA 2Z8FA 4JSDA 5I59B 3K02A 4H1XA 2I6EA 2REGA 1TFAA 1M5EA 5B70A 3QXMA 3K00A 5DT6A 4WXJA 3QSLA 2O6AA 4MLQA 4BDOA 2H99A 2I49A 5AA4B 1T0KA 3WAFA 3FJGA 4YICA 2OCUA 5I56B 5DVFA 3IOWA 3T22A 3MZ1A 1IQ7A 2P2AA 3RPWA 3CFZA 2HXWA 4EQ9A 4YKJA 4BLAA 3LC8A 1BIYA 1OVBA 3IO6A 3S2VA 4THIA 5TU0A 4I8CA 3KOTA 1MM6A 1MRPA 4OYVA 2QMXA 2I48A 3TELA 1HSLA 3MP6A 4ZEDA 2OZZA 4I9DA 4WEDA 4AB6A 3ZKKA 4H5FA 2O1MA 3DP4A 4ZE8A 4EQ7A 2X26A 3IOTA 1YAEA 1B3EA 2GHBA 3H7MA 4JWOA 1MXZA 1SDXA 1ZBMA 1N0TA 4G4PA 3GBAA 3V83A 1B7UA 3BKIB 3V89B 1FTLA 4XXUA 4LATA 1UIVA 3FXQA 1JQFA 3FZVA 5CBRA 2F6GA 3K1MA 1J1NA 4OFJA 2D5WA 4ZEBA 4LQ5A 4BDNA 4H8JA 1D9YA 4ZEFA 4F1VA 4U4SA 5CBSA 2O1LA 3TTRA 1P1UA 4QSDA 3TODA 3TQLA 3L6HA 4ZE9A 5I59A 4Q0CA 3D4GA 4ESWA 4GXSB 1Q35A 3IOVA 3KN3A 2H98A 4XKQA 4IY6A 2ZXTA 1B0LA 2CMOA 2Y7KA 5DVIA 2F6PA 3OEMA 1FQBA 3MVZA 1QUKA 4GVOA 4IO5A 2RC9A 5CM6A 4L17A 3QK6A 1ZTYA 2Z8EA 1GTKA 3TAJA 1MXUA 1LGBC 1B1XA 1R9LA 1POY1 4JWYA 3GLBA 1FTMA 1URDA 4DXUA 1Y4CA 3ECRA 3PUXE 4F29A 3U92A 3OO7A 5IKBA 1PDAA 4KR5A 3JV9A 5CRYA 2X7PA 2Y7IA 1B2HA 1XVYA 3S9LC 4XKPA 1PBQA 3OOAA 1MY3A 2PT2A 1L5TA 2QPQA 3VVDA 2I3VA 2QS2A 4C0RA 5KCJB 3F11A 3MVWA 2FNCA 1NH8A 4AB5A 3IR1A 1II5A 5FHOA 5TP9B 3IJOB 1BLFA 3HN0A 3O6GA 1XC1A 3VXCA 5I58B 3KOSA 3S4UA 2XX9A 3IL1B 4RA1A 4ELRA 3VXBA 2H25A 4ZZAA 4ZEIA 4OVJA 3Q29A 3H6WA 1FQEA 5F1QA 5LOMA 4FIMA 3OXNA 4QRZA 2NVUB 1MXVA 1FQFA 1QKBA 3LSXA 5HM4B 4H6DA 1N84A 2O7IA 2ALUA 4EDPA 1SW2A 2O7UA 3N26A 1F9BA 3TEPA 1GVCA 1H45A 3H4ZA 2Z22A 3TTMA 3SEYA 3G7WA 4KI0E 5I2KA 4KPTA 4F2QA 3P7IA 4RJZA 5AA3A 2HAUA 4QFPA 1SBPA 4H0WA 2Y7WA 4OMBA 3O6HA 4ND9A 1RYOA 2PVUA 1DPEA 1B3FA 3C9HA 1USYH 1DTZA 1P1NA 1GV8A 2G29A 2LAOA 3A09A 4OTEA 2ANJA 3N5LA 4BDLA 1UIUA 3Q28A 4E0XA 1NKXA 1B46A 1BTJA 4F3BA 2DXYA 3TUSA 3GBBA 3DP8A 3GXAA 3MVXA 4Z7EA 5H8QB 3MZ9A 3CVGA 4Q8RA 4YU0A 4IO3A 2F7AA 3ONMA 1LFGA 3UN6A 2QRYA 4G68C 1SYIA 5L9OA 4U23A 3K01A 2DQVA 4R73A 4RYAA 4NF8B 4G77A 4POXA 4RXLA 2HZKA 2XXXA 3GZGA 3QYTA 3OO6A 4OEVA 2QS4A 4KYSA 1DMBA 2OJTA 1QW0A 1DSNA 3MWBA 4RPNA 4PFWA 2DWIA 4R72A 4NF4A 4YAHX 2ZYKA 4BDRA 3TCHA 1QUIA 2PMSA 1MPBA 4GQOA 3PD9A 2DWAA 1Y20A 1TXFA 3RT8A 2IA4A 1Z7NE 3EHSA 3K4UA 4QFKA 3PPPA 3OSQA 1B6HA 3E4RA 4TOZA 1URSA 2Y7RA 3U1OA 5FHMA 4R6YA 4O3AA 3O28A 1XOCA 1OLCA 2DSFA 5AE4A 3K6VA 4K3FA 4N13A 2DP8A 3TTNA 3HCQA 4FECA 3SETA 1MY4A 3DELB 1Y3QA 1B58A 3G3FA 1SW5A 1PEBA 3N6UA 3TQWA 3LSLA 3LBSA 3CG1A 3OSRA 1GGGA 3PMVA 3DLNA 2XXUA 2V3UA 1JVXA 2F7CA 4P0GA 3KSXA 4NF6B 1BP5A 2ZNUA 1SD3A 4R75A 3MBPA 1LFIA 4EXKA 4DCYA 3CSGA 1N7XA 2XXVA 4MH5A 4NF8A 4DXCA 1ANFA 3VV5A 2KLFA 3W15C 4ONYA 1N3WA 2A5TA 3B7DA 4JSOA 1LFHA 4YB5A 4FORA 4WEPA 3KG2A 5CC2A 4JWXA 4QSCA 3IB1A 2REJA 1NFTA 2O68A 2THIA 4MLVA 5CMBA 3HV1A 1I6QA 2RKMA 2QJEA 4QF9A 1UTHA 1TT1A 4RPOA 2XXRA 5CMMA 4M1VA 3FIRA 2DE2A 1JETA 2V3QA 3IO4A 1B4ZA 2XD2A 3KJ7A 4GXAA 3IX1A 1FQDA 4EXLA 3G3HA 3C32A 1MG1A 3RN8A 1IXCA 1ZJLA 4UACA 1MH4A 1M5CA 3RTFB 5M2VA 2P0SA 4QFNA 3E13X 2OK2A 3C34A 3B6WA 4R9GA 1P1QA 3FVNA 2WKYA 1MDP1 3HPIA 5JK4A 2AYSA 3IB2A 1WDNA 2V25A 3C4MA 3VVFA 3IAZA 4IY5A 2F97A 3U93A 2O84X 4O3CA 1A8FA 3PUVE 4GL8A 4IGRA 4JXIA 3E9XA 5EYFA 3FUZA 3DM0A 2Q2AA 4C1TA 1B3HA 1VFEA 2GH9A 3W9VA 5H8FB 3T96B 4U1ZA 1Q1KA 3EHTA 2ONRA 4G8HA 4OQOA 3RNNA 1NL5A 4NF6A 3CIJA 3ZKLA 1A54A 3MP1A 1S9TA 2NWJA 4GL0A 3SDFA 4YKKA 5FTHA 5AA2B 3C35A 3IOUA 1D3KA 4KYDA 4R9FA 3TYHA 2FA7A 4WKMA 1VFDA 1QJMA 1LLSA 2ZYNA 4F3SA 2H4IA 2BJJX 2O51A 3KGCA 3MVYA 4DIGA 1LCTA 3SEVA 1EH3A 1MH3A 1CE2A 1LAFE 1CB6A 3O2AA 5K2YA 1D4NA 3FATA 2RCAA 2E0SA 4E0WA 3O66A 1SQYA 3CRBA 3K1PA 5I2KB 1N04A 3CG3A 2UXAA 3M3FA 3G3KA 1JEUA 3SERA 1US4A 3O6IA 3Q27A 3MZBA 1B4HA 3EF7A 4N07A 2UYEA 3N6TA 4F3GA 1DOTA 3OO8A 4HCWA 3OENA 3UK4A 1IUDA 3BBRA 1NNKA 3KBRA 4TQUQ 4IGTA 2ONSA 2QL3A 1LBBA 4RK9A 1B7ZA 1JW5A 1EU8A 4P11A 5K2XA 3IJXB 4BDQA 1PBPA 1O64A 2F5XA 2HAVA 3MAMA 3H6TA 3SEXA 5ICQA 5JTYB 1O7TA 5KDTB 4OHNA 3C36A 4C1UA 3MPKA 1NNFA 2I0BA 5B7DA 1MY2A 4U21A 3SEUA 3TCFA 1IEJA 1MQGA 1MPDA 5H8FA 4QFOA 2R9JA 3RTWB 5L9MA 4FATA 2XXIA 3EHUA 1FQAA 2B3FA 4I62A 3TTKA 4NF4B 2AL4A 4LQ2A 4IO2A 1H76A 3QUFA 4GLIA 5AA2A 3UP9A 1ZIUA 2R6GE 5HPQA 1LBCA 2M8CA 1B0HA 4GF8A 3FXUA 3IB0A 3PPNA 1VR5A 1QUJA 3FV2A 4OEUA 4KFQA 3E3KA 2UVGA 2G93A 3VLVA 1B5IA 1MDQA 1US5A 1SI0A 2DE4A 3FASA 1N76A 5L9SA 2DS9A 4ISUA 1PB8A 3V5AA 3Q26A 3BFUA 3C33A 2VP1A 1FTKA 5CI5A 1PB9A 4F2OA 2Q89A 1EZOA 2QMWA 1HSEA 1NH7A 2ESNA 2XXYA 3KN8A 3S9EA 2V84A 1AIVA 2Q2CA 3DP6A 4KQPA 1MXWA 1JEVA 3SEWA 4IO6A 4BDMA 2DVCA 3V8XB 4HW8A 2OWSA 4F22A 3BFTA 1VSOA 2QS1A 5H8HB 1M5BA 1IITA 4ELPA 1H3DA 3PPOA 1TWYA 1JVYA 1LB9A 2XXTA 4DE8A 1FW0A 5JTYA 5KDTA 4OESA 3B6TA 2ZMBA 3QIMA 2HQ0A 3PD8A 3FXRA 1NNTA 4DXBA 2OBGA 2RINA 2XX7A 4PFYA 1B52A 1JW4A 1P1OA 1XVXA 1R6ZA 3PPRA 2V3TA 4YMAA 1YPNA 2HEUA 2PYYA 5DTBA 2YJPA 2A5TB 3WAEA 4PE5B 3C31A 3HSTA 5CMCA 1OLAA 3KZGA 3EN3A 5H8NB 3UGWA 1SI1A 1O63A 4AQ4A 3H6VA 1FQCA 1AL3A 1UTHB 1OQHA 3CFXA 4NEDA 4G68B 4U1OA 4NWDA 1OIBA 1P99A 2GRVA 2VD3A 4KHZE 3T9HB 2DYXA 1NNPA 4X48A 4OFLA 3R7XA 1B3LA 2IEEA 4Q5TA 1MM7A 3QAXA 4XTCQ 1IXIA 2ZYOA 1EZPA 2F78A 1B51A 4KCDA 2F8DA 3FJMA 3TPAA 3RLFE 4JBZA 4NE4A 2F35A 3VFJA 1KWHA 2NUVA 3JZJA 3W9WA 1LAXA 1A99A 4RNSA 4NF5B 1MS7A 1B9JA 3K0VA 1RYXA 1M5DA 3OMBA 4U22A 3RGYA 1H43A 4EUOA 1Y3PA 4MBPA 1SYHA 5I57A 2ABHA 5A5XA 3KEIA 1AOVA 4F1UA 3O97A 1BKAA 3B6QA 5H8HA 1I69A 1OVTA 5EHMA 2AIXA 3PGFA 2Q8JA 1MY0A 3G3IA 4RK2A 1XHYA 3K2DA 1I6BA 2DWHA 1MQIA 4R74A 1RKMA 2F34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FHN A;  5AA2 D;  1UTB A;  1H44 A;  3RUM A;  4FED A;  2VGQ A;  3U72 A;  4HTG A;  5HBC A;  4GRK A;  3ZSF A;  4YZZ A;  3CI8 A;  1LAG E;  2AL5 A;  2GFE A;  3THI A;  3TCG A;  3LSF B;  2YLN A;  5H8N A;  3H6U A;  1FCK A;  5I84 A;  4PFT A;  4JB7 A;  4QFL A;  1YCJ A;  4LZ5 A;  5BUU A;  1AH5 A;  3PU5 A;  1TFD A;  2B3B A;  2QS3 A;  4G68 A;  3M8U A;  4FE8 A;  2F7B A;  3K6X A;  5ICT A;  1S50 A;  1ZLQ A;  3PV0 E;  4GD5 A;  3KN7 A;  3ILT B;  2HFB A;  4ZS9 A;  5ITP A;  3U94 A;  3T66 A;  4LUB A;  3G3G A;  1LST A;  4Z0I A;  5L8D A;  1GR2 A;  1WOD A;  4N6P A;  3IOR A;  2R71 A;  1JW1 A;  3I6V A;  1S7Y A;  4KYE A;  4KCC A;  1SW4 A;  5I2N B;  2UVI A;  2XXP A;  2RF1 A;  4H65 A;  3PMW A;  2PX1 A;  4NF5 A;  4M4G A;  3TZA A;  2A5S A;  1IXH A;  1DPP A;  1YTV A;  4LP2 B;  4U2R A;  3VLW A;  3O29 A;  4MF3 A;  3KJT A;  3OO9 A;  1B1H A;  4TLM B;  3T9V A;  2ONK E;  1Y3N A;  2Y7P A;  3RT6 B;  3OD7 A;  3HHF A;  2NOO A;  1MY1 A;  4G8N A;  1POT A;  1N3X A;  3A3U A;  2QSX A;  5DVJ A;  1EZ9 A;  4QHQ A;  3Q25 A;  1A8E A;  3LSW A;  4PP0 A;  5EHS A;  4IO4 A;  4ELQ A;  2UVJ A;  1OQG A;  2XX8 A;  1B05 A;  2Q88 A;  3T9X B;  5AA4 A;  4U4X A;  3IK6 B;  5H8S A;  4F3P A;  4UA8 A;  3FVK A;  4LVQ A;  2VD2 A;  1PC3 A;  3JYR A;  2RC7 A;  4R6K A;  5I56 A;  4I1D A;  2B65 A;  3VLU A;  3K6W A;  4TLL B;  3PPQ A;  1LB8 A;  3M3K A;  2XD3 A;  1IZ1 A;  3MUQ A;  1N7W A;  4LA9 A;  3CFL A;  2W7Y A;  4XKR A;  1NMU A;  1B40 A;  2YPN A;  2DVZ A;  4POW A;  3USD A;  2FYI A;  3H03 A;  4F19 A;  5JEI A;  4FAJ A;  4X1D A;  3SES A;  4DDD A;  1WVJ A;  3PUZ E;  2V93 A;  5I2N A;  3QUJ A;  3PUW E;  1Y1Z A;  3EQ1 A;  3OEL A;  4LON B;  4H5G A;  4XKN A;  3OEK A;  2Y84 A;  4NMY A;  3T9U A;  3LR1 A;  4MFI A;  1SW1 A;  2Z8D A;  3MW0 A;  3K1N A;  1QVS A;  2Z23 A;  4G8M A;  1A40 A;  4G2Z A;  2PBW A;  2UVH A;  1ATG A;  3FVO A;  2D3I A;  5DEX B;  1XT8 A;  1B3G A;  1ELJ A;  3SKP A;  5DYH A;  3LUY A;  1DTG A;  5TPA B;  1ZKB A;  3O9P A;  3N94 A;  5J1D A;  4O3B A;  4OZ9 A;  4GIZ A;  2RCB A;  4F18 A;  3R26 A;  5ITO A;  4YB6 A;  1B5H A;  1VE4 A;  1QKA A;  4PET A;  1MQH A;  2I4C A;  4YMB A;  3MPL A;  4FEB A;  4JDF A;  1QUL A;  4F31 B;  3R6U A;  5ELV A;  2GHA A;  1Z7M E;  4OER A;  3TKD A;  3KSJ A;  1Y1M A;  3I3V A;  3FGS A;  3HO7 A;  1Y9U A;  2XXH A;  5IAI A;  3D4C A;  2DXR A;  3H3G A;  3KFM A;  3PMX A;  1HSJ A;  1MQD A;  4R6H A;  2F36 A;  4YKP A;  4ESX A;  1R9Q A;  3I5O A;  1LCF A;  5FTI A;  3ODB A;  3MC2 A;  3TFL A;  3U8Q A;  1URG A;  4YB7 A;  4GWO A;  3UA8 A;  2OWT A;  4NWC A;  3VVE A;  1MPC A;  3S9M C;  4X9T A;  2H5Y A;  2OLB A;  4ELO A;  1I6A A;  5I57 B;  1USY E;  1B32 A;  3FV1 A;  5BWJ A;  3FJ7 A;  5A5X B;  4F1Y A;  4YKI A;  2ZYM A;  2PT1 A;  3HHG A;  3FD3 A;  4OET A;  3H06 B;  2I4B A;  4F39 A;  4GFR A;  4Q30 B;  4ZDM A;  2I58 A;  4IB2 A;  4IO7 A;  3G3J A;  1LAH E;  3L6G A;  1PB7 A;  3CR9 A;  4HS7 A;  5DEX A;  1MQJ A;  2Q9T A;  1IIW A;  3T93 B;  5CMK A;  4EF1 A;  2H9B A;  5TPA A;  1UTB B;  4ZEC A;  1D9V A;  5KCJ A;  3RY3 A;  4OXV A;  1JNF A;  2NXO A;  1XS5 A;  1B7H A;  2ZNT A;  4HCY A;  4FJP A;  4DLD A;  4H67 A;  4PQJ A;  1ZU0 A;  3VE1 B;  3UIF A;  1B5J A;  5KZT A;  2O69 A;  2DWJ A;  5TP9 A;  4DZ1 A;  2RC8 A;  5ISU A;  3CSB A;  2P1S A;  1UQW A;  5I58 A;  2CZL A;  3K6U A;  3VDF A;  3TDJ A;  4LZ8 A;  4ZEK A;  1FTJ A;  1ZMG A;  4P0I A;  3A3C A;  3TTL A;  4R2F A;  2DE3 A;  1P1W A;  4OFO A;  3MJN A;  2ZNS A;  4R2B A;  2D21 A;  4X1B A;  4EQB A;  1SVX B;  2DOJ A;  3EPE A;  1A7L A;  2HZL A;  4NTL A;  4OWD A;  4GOT A;  3MP8 A;  1AMF A;  2I0C A;  1FTO A;  1OMP A;  2UYF A;  1A55 A;  3RQT A;  2XXW A;  3S9N C;  4PFU A;  2XHD A;  4ZZE A;  4RY1 A;  4LZ7 A;  5AA1 A;  2VHA A;  2I3W A;  1M5F A;  4ECF A;  2HCA A;  3UOR A;  3PUY E;  3ILU B;  4QSE A;  3MQ9 A;  3M3L A;  4EF2 A;  1MXX A;  1R1N A;  4OEN A;  3TMG A;  4DCX A;  2X7Q A;  2E1S A;  1Y4T A;  4KD5 A;  4H8I A;  2XXQ A;  3FVG A;  4XIG Q;  5F7V A;  3AXF A;  1IXG A;  3ZS6 A;  1MXY A;  5H8Q A;  2VOZ A;  2Z8F A;  4JSD A;  5I59 B;  3K02 A;  4H1X A;  2I6E A;  2REG A;  1TFA A;  1M5E A;  5B70 A;  3QXM A;  3K00 A;  5DT6 A;  4WXJ A;  3QSL A;  2O6A A;  4MLQ A;  4BDO A;  2H99 A;  2I49 A;  5AA4 B;  1T0K A;  3WAF A;  3FJG A;  4YIC A;  2OCU A;  5I56 B;  5DVF A;  3IOW A;  3T22 A;  3MZ1 A;  1IQ7 A;  2P2A A;  3RPW A;  3CFZ A;  2HXW A;  4EQ9 A;  4YKJ A;  4BLA A;  3LC8 A;  1BIY A;  1OVB A;  3IO6 A;  3S2V A;  4THI A;  5TU0 A;  4I8C A;  3KOT A;  1MM6 A;  1MRP A;  4OYV A;  2QMX A;  2I48 A;  3TEL A;  1HSL A;  3MP6 A;  4ZED A;  2OZZ A;  4I9D A;  4WED A;  4AB6 A;  3ZKK A;  4H5F A;  2O1M A;  3DP4 A;  4ZE8 A;  4EQ7 A;  2X26 A;  3IOT A;  1YAE A;  1B3E A;  2GHB A;  3H7M A;  4JWO A;  1MXZ A;  1SDX A;  1ZBM A;  1N0T A;  4G4P A;  3GBA A;  3V83 A;  1B7U A;  3BKI B;  3V89 B;  1FTL A;  4XXU A;  4LAT A;  1UIV A;  3FXQ A;  1JQF A;  3FZV A;  5CBR A;  2F6G A;  3K1M A;  1J1N A;  4OFJ A;  2D5W A;  4ZEB A;  4LQ5 A;  4BDN A;  4H8J A;  1D9Y A;  4ZEF A;  4F1V A;  4U4S A;  5CBS A;  2O1L A;  3TTR A;  1P1U A;  4QSD A;  3TOD A;  3TQL A;  3L6H A;  4ZE9 A;  5I59 A;  4Q0C A;  3D4G A;  4ESW A;  4GXS B;  1Q35 A;  3IOV A;  3KN3 A;  2H98 A;  4XKQ A;  4IY6 A;  2ZXT A;  1B0L A;  2CMO A;  2Y7K A;  5DVI A;  2F6P A;  3OEM A;  1FQB A;  3MVZ A;  1QUK A;  4GVO A;  4IO5 A;  2RC9 A;  5CM6 A;  4L17 A;  3QK6 A;  1ZTY A;  2Z8E A;  1GTK A;  3TAJ A;  1MXU A;  1LGB C;  1B1X A;  1R9L A;  1POY 1;  4JWY A;  3GLB A;  1FTM A;  1URD A;  4DXU A;  1Y4C A;  3ECR A;  3PUX E;  4F29 A;  3U92 A;  3OO7 A;  5IKB A;  1PDA A;  4KR5 A;  3JV9 A;  5CRY A;  2X7P A;  2Y7I A;  1B2H A;  1XVY A;  3S9L C;  4XKP A;  1PBQ A;  3OOA A;  1MY3 A;  2PT2 A;  1L5T A;  2QPQ A;  3VVD A;  2I3V A;  2QS2 A;  4C0R A;  5KCJ B;  3F11 A;  3MVW A;  2FNC A;  1NH8 A;  4AB5 A;  3IR1 A;  1II5 A;  5FHO A;  5TP9 B;  3IJO B;  1BLF A;  3HN0 A;  3O6G A;  1XC1 A;  3VXC A;  5I58 B;  3KOS A;  3S4U A;  2XX9 A;  3IL1 B;  4RA1 A;  4ELR A;  3VXB A;  2H25 A;  4ZZA A;  4ZEI A;  4OVJ A;  3Q29 A;  3H6W A;  1FQE A;  5F1Q A;  5LOM A;  4FIM A;  3OXN A;  4QRZ A;  2NVU B;  1MXV A;  1FQF A;  1QKB A;  3LSX A;  5HM4 B;  4H6D A;  1N84 A;  2O7I A;  2ALU A;  4EDP A;  1SW2 A;  2O7U A;  3N26 A;  1F9B A;  3TEP A;  1GVC A;  1H45 A;  3H4Z A;  2Z22 A;  3TTM A;  3SEY A;  3G7W A;  4KI0 E;  5I2K A;  4KPT A;  4F2Q A;  3P7I A;  4RJZ A;  5AA3 A;  2HAU A;  4QFP A;  1SBP A;  4H0W A;  2Y7W A;  4OMB A;  3O6H A;  4ND9 A;  1RYO A;  2PVU A;  1DPE A;  1B3F A;  3C9H A;  1USY H;  1DTZ A;  1P1N A;  1GV8 A;  2G29 A;  2LAO A;  3A09 A;  4OTE A;  2ANJ A;  3N5L A;  4BDL A;  1UIU A;  3Q28 A;  4E0X A;  1NKX A;  1B46 A;  1BTJ A;  4F3B A;  2DXY A;  3TUS A;  3GBB A;  3DP8 A;  3GXA A;  3MVX A;  4Z7E A;  5H8Q B;  3MZ9 A;  3CVG A;  4Q8R A;  4YU0 A;  4IO3 A;  2F7A A;  3ONM A;  1LFG A;  3UN6 A;  2QRY A;  4G68 C;  1SYI A;  5L9O A;  4U23 A;  3K01 A;  2DQV A;  4R73 A;  4RYA A;  4NF8 B;  4G77 A;  4POX A;  4RXL A;  2HZK A;  2XXX A;  3GZG A;  3QYT A;  3OO6 A;  4OEV A;  2QS4 A;  4KYS A;  1DMB A;  2OJT A;  1QW0 A;  1DSN A;  3MWB A;  4RPN A;  4PFW A;  2DWI A;  4R72 A;  4NF4 A;  4YAH X;  2ZYK A;  4BDR A;  3TCH A;  1QUI A;  2PMS A;  1MPB A;  4GQO A;  3PD9 A;  2DWA A;  1Y20 A;  1TXF A;  3RT8 A;  2IA4 A;  1Z7N E;  3EHS A;  3K4U A;  4QFK A;  3PPP A;  3OSQ A;  1B6H A;  3E4R A;  4TOZ A;  1URS A;  2Y7R A;  3U1O A;  5FHM A;  4R6Y A;  4O3A A;  3O28 A;  1XOC A;  1OLC A;  2DSF A;  5AE4 A;  3K6V A;  4K3F A;  4N13 A;  2DP8 A;  3TTN A;  3HCQ A;  4FEC A;  3SET A;  1MY4 A;  3DEL B;  1Y3Q A;  1B58 A;  3G3F A;  1SW5 A;  1PEB A;  3N6U A;  3TQW A;  3LSL A;  3LBS A;  3CG1 A;  3OSR A;  1GGG A;  3PMV A;  3DLN A;  2XXU A;  2V3U A;  1JVX A;  2F7C A;  4P0G A;  3KSX A;  4NF6 B;  1BP5 A;  2ZNU A;  1SD3 A;  4R75 A;  3MBP A;  1LFI A;  4EXK A;  4DCY A;  3CSG A;  1N7X A;  2XXV A;  4MH5 A;  4NF8 A;  4DXC A;  1ANF A;  3VV5 A;  2KLF A;  3W15 C;  4ONY A;  1N3W A;  2A5T A;  3B7D A;  4JSO A;  1LFH A;  4YB5 A;  4FOR A;  4WEP A;  3KG2 A;  5CC2 A;  4JWX A;  4QSC A;  3IB1 A;  2REJ A;  1NFT A;  2O68 A;  2THI A;  4MLV A;  5CMB A;  3HV1 A;  1I6Q A;  2RKM A;  2QJE A;  4QF9 A;  1UTH A;  1TT1 A;  4RPO A;  2XXR A;  5CMM A;  4M1V A;  3FIR A;  2DE2 A;  1JET A;  2V3Q A;  3IO4 A;  1B4Z A;  2XD2 A;  3KJ7 A;  4GXA A;  3IX1 A;  1FQD A;  4EXL A;  3G3H A;  3C32 A;  1MG1 A;  3RN8 A;  1IXC A;  1ZJL A;  4UAC A;  1MH4 A;  1M5C A;  3RTF B;  5M2V A;  2P0S A;  4QFN A;  3E13 X;  2OK2 A;  3C34 A;  3B6W A;  4R9G A;  1P1Q A;  3FVN A;  2WKY A;  1MDP 1;  3HPI A;  5JK4 A;  2AYS A;  3IB2 A;  1WDN A;  2V25 A;  3C4M A;  3VVF A;  3IAZ A;  4IY5 A;  2F97 A;  3U93 A;  2O84 X;  4O3C A;  1A8F A;  3PUV E;  4GL8 A;  4IGR A;  4JXI A;  3E9X A;  5EYF A;  3FUZ A;  3DM0 A;  2Q2A A;  4C1T A;  1B3H A;  1VFE A;  2GH9 A;  3W9V A;  5H8F B;  3T96 B;  4U1Z A;  1Q1K A;  3EHT A;  2ONR A;  4G8H A;  4OQO A;  3RNN A;  1NL5 A;  4NF6 A;  3CIJ A;  3ZKL A;  1A54 A;  3MP1 A;  1S9T A;  2NWJ A;  4GL0 A;  3SDF A;  4YKK A;  5FTH A;  5AA2 B;  3C35 A;  3IOU A;  1D3K A;  4KYD A;  4R9F A;  3TYH A;  2FA7 A;  4WKM A;  1VFD A;  1QJM A;  1LLS A;  2ZYN A;  4F3S A;  2H4I A;  2BJJ X;  2O51 A;  3KGC A;  3MVY A;  4DIG A;  1LCT A;  3SEV A;  1EH3 A;  1MH3 A;  1CE2 A;  1LAF E;  1CB6 A;  3O2A A;  5K2Y A;  1D4N A;  3FAT A;  2RCA A;  2E0S A;  4E0W A;  3O66 A;  1SQY A;  3CRB A;  3K1P A;  5I2K B;  1N04 A;  3CG3 A;  2UXA A;  3M3F A;  3G3K A;  1JEU A;  3SER A;  1US4 A;  3O6I A;  3Q27 A;  3MZB A;  1B4H A;  3EF7 A;  4N07 A;  2UYE A;  3N6T A;  4F3G A;  1DOT A;  3OO8 A;  4HCW A;  3OEN A;  3UK4 A;  1IUD A;  3BBR A;  1NNK A;  3KBR A;  4TQU Q;  4IGT A;  2ONS A;  2QL3 A;  1LBB A;  4RK9 A;  1B7Z A;  1JW5 A;  1EU8 A;  4P11 A;  5K2X A;  3IJX B;  4BDQ A;  1PBP A;  1O64 A;  2F5X A;  2HAV A;  3MAM A;  3H6T A;  3SEX A;  5ICQ A;  5JTY B;  1O7T A;  5KDT B;  4OHN A;  3C36 A;  4C1U A;  3MPK A;  1NNF A;  2I0B A;  5B7D A;  1MY2 A;  4U21 A;  3SEU A;  3TCF A;  1IEJ A;  1MQG A;  1MPD A;  5H8F A;  4QFO A;  2R9J A;  3RTW B;  5L9M A;  4FAT A;  2XXI A;  3EHU A;  1FQA A;  2B3F A;  4I62 A;  3TTK A;  4NF4 B;  2AL4 A;  4LQ2 A;  4IO2 A;  1H76 A;  3QUF A;  4GLI A;  5AA2 A;  3UP9 A;  1ZIU A;  2R6G E;  5HPQ A;  1LBC A;  2M8C A;  1B0H A;  4GF8 A;  3FXU A;  3IB0 A;  3PPN A;  1VR5 A;  1QUJ A;  3FV2 A;  4OEU A;  4KFQ A;  3E3K A;  2UVG A;  2G93 A;  3VLV A;  1B5I A;  1MDQ A;  1US5 A;  1SI0 A;  2DE4 A;  3FAS A;  1N76 A;  5L9S A;  2DS9 A;  4ISU A;  1PB8 A;  3V5A A;  3Q26 A;  3BFU A;  3C33 A;  2VP1 A;  1FTK A;  5CI5 A;  1PB9 A;  4F2O A;  2Q89 A;  1EZO A;  2QMW A;  1HSE A;  1NH7 A;  2ESN A;  2XXY A;  3KN8 A;  3S9E A;  2V84 A;  1AIV A;  2Q2C A;  3DP6 A;  4KQP A;  1MXW A;  1JEV A;  3SEW A;  4IO6 A;  4BDM A;  2DVC A;  3V8X B;  4HW8 A;  2OWS A;  4F22 A;  3BFT A;  1VSO A;  2QS1 A;  5H8H B;  1M5B A;  1IIT A;  4ELP A;  1H3D A;  3PPO A;  1TWY A;  1JVY A;  1LB9 A;  2XXT A;  4DE8 A;  1FW0 A;  5JTY A;  5KDT A;  4OES A;  3B6T A;  2ZMB A;  3QIM A;  2HQ0 A;  3PD8 A;  3FXR A;  1NNT A;  4DXB A;  2OBG A;  2RIN A;  2XX7 A;  4PFY A;  1B52 A;  1JW4 A;  1P1O A;  1XVX A;  1R6Z A;  3PPR A;  2V3T A;  4YMA A;  1YPN A;  2HEU A;  2PYY A;  5DTB A;  2YJP A;  2A5T B;  3WAE A;  4PE5 B;  3C31 A;  3HST A;  5CMC A;  1OLA A;  3KZG A;  3EN3 A;  5H8N B;  3UGW A;  1SI1 A;  1O63 A;  4AQ4 A;  3H6V A;  1FQC A;  1AL3 A;  1UTH B;  1OQH A;  3CFX A;  4NED A;  4G68 B;  4U1O A;  4NWD A;  1OIB A;  1P99 A;  2GRV A;  2VD3 A;  4KHZ E;  3T9H B;  2DYX A;  1NNP A;  4X48 A;  4OFL A;  3R7X A;  1B3L A;  2IEE A;  4Q5T A;  1MM7 A;  3QAX A;  4XTC Q;  1IXI A;  2ZYO A;  1EZP A;  2F78 A;  1B51 A;  4KCD A;  2F8D A;  3FJM A;  3TPA A;  3RLF E;  4JBZ A;  4NE4 A;  2F35 A;  3VFJ A;  1KWH A;  2NUV A;  3JZJ A;  3W9W A;  1LAX A;  1A99 A;  4RNS A;  4NF5 B;  1MS7 A;  1B9J A;  3K0V A;  1RYX A;  1M5D A;  3OMB A;  4U22 A;  3RGY A;  1H43 A;  4EUO A;  1Y3P A;  4MBP A;  1SYH A;  5I57 A;  2ABH A;  5A5X A;  3KEI A;  1AOV A;  4F1U A;  3O97 A;  1BKA A;  3B6Q A;  5H8H A;  1I69 A;  1OVT A;  5EHM A;  2AIX A;  3PGF A;  2Q8J A;  1MY0 A;  3G3I A;  4RK2 A;  1XHY A;  3K2D A;  1I6B A;  2DWH A;  1MQI A;  4R74 A;  1RKM A;  2F34 A; 
#chains in the Genus database with same CATH topology
 4KXP A;  5FHN A;  5AA2 D;  1NV2 A;  4PTK A;  1UTB A;  1H44 A;  3RUM A;  4FED A;  2VGQ A;  4PAK A;  3U72 A;  2XWO A;  4HTG A;  1LBZ A;  5HBC A;  4GRK A;  3ZSF A;  4YZZ A;  3SZP A;  3CI8 A;  1LAG E;  2AL5 A;  2ZZW A;  2GFE A;  3THI A;  3TCG A;  1XI6 A;  3LSF B;  1NUX A;  2YLN A;  5H8N A;  3H6U A;  1FCK A;  5I84 A;  4PFT A;  4JB7 A;  4QFL A;  1YCJ A;  4LZ5 A;  5BUU A;  1AH5 A;  3PU5 A;  1TFD A;  2B3B A;  2QS3 A;  4G68 A;  3M8U A;  4FE8 A;  2JJK A;  2F7B A;  3K6X A;  5I3S A;  4NX1 A;  1NV4 A;  5ICT A;  1S50 A;  1ZLQ A;  3PV0 E;  4GD5 A;  3KN7 A;  3ILT B;  2HFB A;  4ZS9 A;  5ITP A;  1FRP A;  3U94 A;  3T66 A;  2OWZ A;  4LUB A;  3G3G A;  1LST A;  3BIG A;  4Z0I A;  5L8D A;  4PAF A;  1GR2 A;  1WOD A;  4N6P A;  3IOR A;  2R71 A;  5T3J A;  1JW1 A;  3I6V A;  1S7Y A;  4KYE A;  4KCC A;  1SW4 A;  5I2N B;  1FPD A;  2UVI A;  2XXP A;  2RF1 A;  4H65 A;  3PMW A;  2PX1 A;  3GYY A;  4NF5 A;  4MAG A;  4M4G A;  4NAP A;  3TZA A;  2A5S A;  1IXH A;  1DPP A;  1YTV A;  4LP2 B;  4U2R A;  3VLW A;  3LV0 A;  3O29 A;  4MF3 A;  1FPE A;  4QXD A;  3KJT A;  3OO9 A;  2WX9 A;  1B1H A;  4PFR A;  4TLM B;  3T9V A;  2ONK E;  1Y3N A;  2Y7P A;  3RT6 B;  3OD7 A;  3HHF A;  2NOO A;  1MY1 A;  3CHG A;  4G8N A;  1POT A;  1N3X A;  3A3U A;  2QSX A;  5DVJ A;  1EZ9 A;  5F24 A;  4QHQ A;  4MX6 A;  1NV1 A;  3Q25 A;  1A8E A;  3LSW A;  4PP0 A;  5EHS A;  1NV7 A;  4IO4 A;  4ELQ A;  4I3E A;  2UVJ A;  1OQG A;  2XX8 A;  1B05 A;  2Q88 A;  3T9X B;  5AA4 A;  4U4X A;  3IK6 B;  4AS4 A;  5H8S A;  4F3P A;  4UA8 A;  3FVK A;  4LVQ A;  2VD2 A;  1PC3 A;  3JYR A;  2RC7 A;  4R6K A;  5I56 A;  4I1D A;  2B65 A;  5EYH A;  3VLU A;  2MKZ A;  3K6W A;  4I40 A;  4TLL B;  3PPQ A;  1LB8 A;  3M3K A;  2XD3 A;  1IZ1 A;  4PFB A;  3MUQ A;  1CNQ A;  1N7W A;  4LA9 A;  3CFL A;  2W7Y A;  4XKR A;  1NMU A;  1B40 A;  2FIE A;  2YPN A;  1QGX A;  2DVZ A;  4N81 A;  2WYP A;  2VT5 A;  4POW A;  2PFZ A;  3USD A;  2FYI A;  1YXI A;  3H03 A;  4F19 A;  5JEI A;  4FAJ A;  4X1D A;  3SES A;  4DDD A;  1WVJ A;  3PUZ E;  3PTY A;  2V93 A;  5I2N A;  2PCR A;  3QUJ A;  3PUW E;  4DI3 D;  1Y1Z A;  4PGP A;  3EQ1 A;  3OEL A;  4LON B;  4H5G A;  4XKN A;  3OEK A;  2Y84 A;  4NMY A;  3T9U A;  3LR1 A;  4MFI A;  1SW1 A;  2Z8D A;  3MW0 A;  3K1N A;  1QVS A;  2Z23 A;  4G8M A;  1A40 A;  4G2Z A;  2PBW A;  3BIH A;  2UVH A;  1ATG A;  3FVO A;  2D3I A;  5IZ3 A;  5DEX B;  1XT8 A;  1B3G A;  1ELJ A;  3SKP A;  5DYH A;  3LUY A;  1DTG A;  5TPA B;  3T0J A;  1ZKB A;  3O9P A;  2XWI A;  3N94 A;  4XEQ A;  5J1D A;  4O3B A;  1RDZ A;  4OZ9 A;  2Y5K A;  4GIZ A;  2RCB A;  4F18 A;  3R26 A;  5ITO A;  4YB6 A;  1B5H A;  1VE4 A;  1QKA A;  4PET A;  1MQH A;  2I4C A;  4YMB A;  3MPL A;  4FEB A;  4JDF A;  1QUL A;  4F31 B;  3R6U A;  5ELV A;  2GHA A;  1Z7M E;  1FBH A;  4OER A;  1INP A;  3TKD A;  3KSJ A;  1Y1M A;  4MNI A;  3I3V A;  3FGS A;  2P3V A;  3HO7 A;  5EQ9 A;  1Y9U A;  2XXH A;  5IAI A;  4P56 A;  5IZZ A;  3IFA A;  3D4C A;  2DXR A;  2VPN A;  3H3G A;  1IME A;  3KFM A;  3PMX A;  1HSJ A;  1MQD A;  5I5P A;  4R6H A;  2F36 A;  4YKP A;  4ESX A;  4O7M A;  1R9Q A;  2FHY A;  3I5O A;  1LCF A;  5FTI A;  3ODB A;  3MC2 A;  4HE0 A;  3TFL A;  3U8Q A;  1URG A;  4YB7 A;  4GWO A;  3UA8 A;  2OWT A;  4NWC A;  3VVE A;  4XFE A;  1MPC A;  3S9M C;  4X9T A;  2H5Y A;  2OLB A;  4ELO A;  1I6A A;  5I57 B;  1USY E;  1B32 A;  3FV1 A;  5BWJ A;  3FJ7 A;  5A5X B;  4F1Y A;  4YKI A;  2ZYM A;  2PT1 A;  3HHG A;  3FD3 A;  4JVI A;  4OET A;  3H06 B;  2I4B A;  4F39 A;  4GFR A;  4Q30 B;  1G0H A;  4ZDM A;  3RPL B;  3IFC A;  2I58 A;  4IB2 A;  4IO7 A;  3G3J A;  1LAH E;  3L6G A;  1PB7 A;  3CR9 A;  4HS7 A;  5DEX A;  1MQJ A;  2Q9T A;  1IIW A;  3T93 B;  5CMK A;  4EF1 A;  2H9B A;  5TPA A;  1UTB B;  4ZEC A;  1D9V A;  5KCJ A;  2GQ1 A;  3RY3 A;  4OXV A;  1JNF A;  2NXO A;  1XS5 A;  1B7H A;  2ZNT A;  1EYI A;  4HCY A;  4FJP A;  4DLD A;  4H67 A;  3QMF A;  5ET8 A;  4PQJ A;  1ZU0 A;  3VE1 B;  3UIF A;  1B5J A;  5KZT A;  2O69 A;  2DWJ A;  5TP9 A;  4DZ1 A;  2RC8 A;  5ISU A;  3CSB A;  4PDD A;  2P1S A;  1UQW A;  5I58 A;  2CZL A;  3K6U A;  3VDF A;  3TDJ A;  4LZ8 A;  4ZEK A;  1FTJ A;  1ZMG A;  1FPG A;  4P0I A;  3A3C A;  4NN3 A;  3TTL A;  4R2F A;  2DE3 A;  1P1W A;  1D9Q A;  4OFO A;  4MNP A;  3MJN A;  2ZNS A;  4R2B A;  2D21 A;  4X1B A;  4PF6 A;  4EQB A;  1SVX B;  2DOJ A;  4OVQ A;  3EPE A;  4PBQ A;  1A7L A;  4P1L A;  2HZL A;  4NTL A;  1FTA A;  4OWD A;  4GOT A;  3MP8 A;  1AMF A;  4G61 A;  2I0C A;  1FTO A;  1OMP A;  2UYF A;  1A55 A;  3RQT A;  2XXW A;  2DDK A;  3S9N C;  4PFU A;  2XHD A;  4ZZE A;  4RY1 A;  4LZ7 A;  4OVS A;  5AA1 A;  2VHA A;  2I3W A;  1M5F A;  1AWB A;  4ECF A;  2HCA A;  3UOR A;  3PUY E;  2FIX A;  3ILU B;  4QSE A;  3MQ9 A;  3M3L A;  4EF2 A;  1MXX A;  1R1N A;  4OEN A;  3TMG A;  4DCX A;  4GWU A;  2X7Q A;  3RPL A;  2E1S A;  5LDZ A;  1Y4T A;  4KD5 A;  4H8I A;  2XXQ A;  3FVG A;  3FXB A;  2QFL A;  4XIG Q;  5F7V A;  4PC9 A;  3AXF A;  1IXG A;  3ZS6 A;  1MXY A;  5H8Q A;  2VOZ A;  2Z8F A;  4JSD A;  5I59 B;  3K02 A;  1SPI A;  4H1X A;  2I6E A;  2REG A;  4DI4 B;  1TFA A;  1M5E A;  5B70 A;  3QXM A;  3K00 A;  5DT6 A;  4WXJ A;  3QSL A;  2O6A A;  4MLQ A;  4BDO A;  2H99 A;  2I49 A;  5AA4 B;  4I3Y A;  3T1B A;  1T0K A;  4PBH A;  3WAF A;  3FJG A;  4YIC A;  2OCU A;  5I56 B;  5DVF A;  3IOW A;  3T22 A;  3MZ1 A;  1IQ7 A;  2P2A A;  3RPW A;  3CFZ A;  2HXW A;  4EQ9 A;  4YKJ A;  4BLA A;  3LC8 A;  2CZI A;  1BIY A;  4H46 A;  1OVB A;  3IO6 A;  3S2V A;  4THI A;  5TU0 A;  4I8C A;  3KOT A;  1MM6 A;  1MRP A;  4GBW A;  4OYV A;  2QMX A;  2I48 A;  3TEL A;  1HSL A;  4H45 A;  3MP6 A;  2HXR A;  2OZZ A;  4I9D A;  4ZED A;  4WED A;  4AB6 A;  3ZKK A;  4H5F A;  3NOH A;  2O1M A;  3DP4 A;  4ZE8 A;  4EQ7 A;  2X26 A;  2WYK A;  3IOT A;  1YAE A;  2ZZV A;  1B3E A;  2GHB A;  3H7M A;  4JWO A;  1MXZ A;  1SDX A;  2QVU A;  1ZBM A;  1N0T A;  4P47 A;  4MMP A;  1FPL A;  4MEV A;  3B8B A;  4G4P A;  3GBA A;  3V83 A;  2ZZX A;  1B7U A;  3BKI B;  3V89 B;  1FPK A;  1FTL A;  4XXU A;  4LAT A;  5IZ3 B;  1UIV A;  1K9Y A;  4N6D A;  3FXQ A;  1LBV A;  1JQF A;  3FZV A;  5CBR A;  2F6G A;  3K1M A;  1J1N A;  4OFJ A;  2D5W A;  4OAN A;  3KC0 A;  3MYU A;  4ZEB A;  2KQZ A;  4LQ5 A;  4BDN A;  4H8J A;  2Y5L A;  1D9Y A;  4ZEF A;  4F1V A;  4U4S A;  5CBS A;  2O1L A;  3TTR A;  1P1U A;  1IMA A;  4QSD A;  3TOD A;  4HXV A;  3TQL A;  3L6H A;  4ZE9 A;  5I59 A;  4Q0C A;  3D4G A;  4ESW A;  4GXS B;  1Q35 A;  3IOV A;  3KN3 A;  4NG7 A;  2H98 A;  4FBP A;  1LBX A;  4UAB A;  4XKQ A;  4IY6 A;  2ZXT A;  1B0L A;  2B4M A;  2CMO A;  2Y7K A;  5DVI A;  2F6P A;  3OEM A;  1FQB A;  3MVZ A;  1QUK A;  4GVO A;  4IO5 A;  2RC9 A;  4GWZ A;  5CM6 A;  4L17 A;  3QK6 A;  1ZTY A;  1FBE A;  4MHF A;  2Z8E A;  1GTK A;  3TAJ A;  1MXU A;  1LGB C;  1B1X A;  3KC1 A;  1R9L A;  1POY 1;  4JWY A;  3GLB A;  3MST A;  1FTM A;  1URD A;  4DXU A;  1Y4C A;  3ECR A;  3PUX E;  1FBF A;  4F29 A;  3U92 A;  3OO7 A;  5IKB A;  1PDA A;  4KR5 A;  3JV9 A;  4MCO A;  5CRY A;  2X7P A;  1K9Z A;  2Y7I A;  1B2H A;  2Q74 A;  1XVY A;  4OVP A;  3S9L C;  2V4C A;  4N6K A;  4XKP A;  1DK4 A;  1PBQ A;  3OOA A;  1MY3 A;  2PT2 A;  1L5T A;  2QPQ A;  3VVD A;  2I3V A;  3KBZ A;  2QS2 A;  4C0R A;  5KCJ B;  3F11 A;  2XA5 A;  4PGN A;  3MVW A;  2FNC A;  1NH8 A;  4AB5 A;  4OA4 A;  3IR1 A;  1NI9 A;  1NV5 A;  1II5 A;  5FHO A;  5TP9 B;  4NF0 A;  1DCU A;  3IJO B;  1BLF A;  3HN0 A;  3O6G A;  1XC1 A;  4X8R A;  3VXC A;  5I58 B;  5LTC A;  2FVZ A;  3KOS A;  3S4U A;  2XX9 A;  3IL1 B;  4RA1 A;  4GWS A;  4ELR A;  5I7I A;  3VXB A;  2H25 A;  4ZZA A;  4ZEI A;  4OVJ A;  3Q29 A;  3H6W A;  1FQE A;  5F1Q A;  5LOM A;  4FIM A;  3OXN A;  4QRZ A;  2NVU B;  1MXV A;  1FQF A;  1QKB A;  3LSX A;  2CEY A;  5HM4 B;  4H6D A;  3RYD A;  1N84 A;  2O7I A;  4PE3 A;  2ALU A;  5A5L A;  4EDP A;  1SW2 A;  2O7U A;  3N26 A;  1F9B A;  3TEP A;  1GVC A;  1H45 A;  2VPO A;  4NQ8 A;  3H4Z A;  2Z22 A;  3TTM A;  5ESY A;  3SEY A;  3G7W A;  4GX3 A;  4KI0 E;  5I2K A;  4KPT A;  4F2Q A;  3P7I A;  4RJZ A;  5AA3 A;  2HAU A;  1Q9D A;  4QFP A;  1SBP A;  4H0W A;  2Y7W A;  4OMB A;  3O6H A;  4ND9 A;  1RYO A;  2PVU A;  1DPE A;  1B3F A;  3C9H A;  1USY H;  2BJI A;  1DTZ A;  1P1N A;  1GV8 A;  2G29 A;  2LAO A;  1FBC A;  3A09 A;  4OTE A;  3EKI A;  2ANJ A;  3N5L A;  1FJ9 A;  4BDL A;  1UIU A;  3Q28 A;  4E0X A;  1NKX A;  1B46 A;  1BTJ A;  1FJ6 A;  2PFY A;  2CZK A;  4F3B A;  2B4L A;  2DXY A;  3TUS A;  3GBB A;  3DP8 A;  3GXA A;  3MVX A;  4Z7E A;  5H8Q B;  3LUZ A;  3MZ9 A;  3CVG A;  4Q8R A;  4YU0 A;  4IO3 A;  5ET5 A;  1FPB A;  2F7A A;  3ONM A;  4N17 A;  1LFG A;  3UN6 A;  2QRY A;  4G68 C;  1SYI A;  5L9O A;  4U23 A;  3K01 A;  2DQV A;  4R73 A;  4RYA A;  4N15 A;  4NF8 B;  4G77 A;  4POX A;  4GWY A;  4GWW A;  4RXL A;  2HZK A;  2XXX A;  4NHB A;  3GZG A;  3QYT A;  1IMD A;  1DBZ A;  3OO6 A;  4OEV A;  2QS4 A;  4KYS A;  1DMB A;  2OJT A;  1QW0 A;  1DSN A;  1LBW A;  3MWB A;  4PFW A;  4RPN A;  2DWI A;  5IM2 A;  4R72 A;  4NF4 A;  4YAH X;  4OVT A;  1IMC A;  2ZYK A;  4BDR A;  3TCH A;  1QUI A;  2PMS A;  1MPB A;  4GQO A;  3PD9 A;  2DWA A;  1Y20 A;  1TXF A;  3RT8 A;  2IA4 A;  1Z7N E;  4PAI A;  5EYG A;  3EHS A;  2WEF A;  3K4U A;  4QFK A;  3PPP A;  3OSQ A;  1B6H A;  3E4R A;  4TOZ A;  1URS A;  2CEX A;  2Y7R A;  3U1O A;  5FHM A;  1FPF A;  4R6Y A;  4O3A A;  4JVD A;  3O28 A;  4AS5 A;  1XOC A;  1OLC A;  2DSF A;  4K3F A;  3K6V A;  5AE4 A;  4N13 A;  1FBD A;  2DP8 A;  3TTN A;  3HCQ A;  4FEC A;  3SET A;  1MY4 A;  3DEL B;  1Y3Q A;  1B58 A;  1NUY A;  3G3F A;  1SW5 A;  1PEB A;  5EQA A;  3D1R A;  2CZH A;  3N6U A;  3TQW A;  3LSL A;  3LBS A;  3CG1 A;  3OSR A;  1GGG A;  3PMV A;  3DLN A;  5IZ1 A;  2XXU A;  2V3U A;  1JVX A;  1KA0 A;  2F7C A;  3KSX A;  4P0G A;  4NF6 B;  1BP5 A;  2ZNU A;  1SD3 A;  4R75 A;  3MBP A;  1LFI A;  4EXK A;  4DCY A;  3CSG A;  1N7X A;  2XXV A;  4MH5 A;  4MNC A;  4NF8 A;  4DXC A;  1ANF A;  3VV5 A;  4GX4 A;  2KLF A;  4QBA A;  3W15 C;  4ONY A;  1N3W A;  2A5T A;  3B7D A;  4JSO A;  1YZ0 A;  1LFH A;  4YB5 A;  4FOR A;  4WEP A;  3KG2 A;  5CC2 A;  4MJO A;  4JWX A;  4QSC A;  3IB1 A;  2REJ A;  1NFT A;  2O68 A;  2THI A;  4MLV A;  5CMB A;  3HV1 A;  1I6Q A;  2RKM A;  1EYK A;  2QJE A;  4HE2 A;  4QF9 A;  1UTH A;  1TT1 A;  1KA1 A;  4RPO A;  2XXR A;  5CMM A;  4M1V A;  3FIR A;  2DE2 A;  1JET A;  2V3Q A;  3IO4 A;  1B4Z A;  2XD2 A;  3KJ7 A;  4O7I A;  4GXA A;  3IX1 A;  1BK4 A;  1FQD A;  4PFI A;  4EXL A;  3ISP A;  5J16 A;  3G3H A;  3C32 A;  1MG1 A;  3RN8 A;  1IXC A;  1ZJL A;  4UAC A;  1MH4 A;  1M5C A;  3RTF B;  5M2V A;  2P0S A;  4QFN A;  3E13 X;  2OK2 A;  3C34 A;  3B6W A;  4R9G A;  1P1Q A;  3FVN A;  2WKY A;  1MDP 1;  3HPI A;  5JK4 A;  2AYS A;  3IB2 A;  3E78 A;  1WDN A;  2V25 A;  3C4M A;  3IAZ A;  5ET6 A;  3VVF A;  4IY5 A;  2F97 A;  3U93 A;  2O84 X;  2WBB A;  4O3C A;  1A8F A;  3PUV E;  4GL8 A;  4IGR A;  4JXI A;  3E9X A;  5EYF A;  3FUZ A;  3DM0 A;  2Q2A A;  4C1T A;  1G0I A;  1B3H A;  1VFE A;  2GH9 A;  3W9V A;  5H8F B;  4PCD A;  3T96 B;  4U1Z A;  1YYZ A;  1Q1K A;  1RDX A;  3EHT A;  2ONR A;  4G8H A;  4OQO A;  3RNN A;  1NL5 A;  4NF6 A;  3CIJ A;  3ZKL A;  4O8M A;  1KZ8 A;  1A54 A;  3MP1 A;  1S9T A;  2NWJ A;  4GL0 A;  3SDF A;  4YKK A;  5FTH A;  5AA2 B;  3C35 A;  3IOU A;  1D3K A;  4KYD A;  4R9F A;  3TYH A;  2HPG A;  2FA7 A;  4WKM A;  1VFD A;  1QJM A;  1LLS A;  2ZYN A;  4F3S A;  2H4I A;  1LEV A;  2BJJ X;  2O51 A;  3KGC A;  2WBD A;  3MVY A;  2OX3 A;  4DIG A;  1LCT A;  3SEV A;  1EH3 A;  1MH3 A;  3HFU A;  1CE2 A;  1LAF E;  1CB6 A;  4P3L A;  3O2A A;  5K2Y A;  1D4N A;  3FAT A;  2RCA A;  2E0S A;  4E0W A;  3O66 A;  1SQY A;  3CRB A;  3K1P A;  5I2K B;  1N04 A;  3CG3 A;  2XXK A;  2UXA A;  3M3F A;  3G3K A;  1JEU A;  2P3N A;  3SER A;  1US4 A;  3O6I A;  3Q27 A;  4GBV A;  4P9K A;  3MZB A;  1B4H A;  3EF7 A;  4N07 A;  2UYE A;  3N6T A;  1NV6 A;  4F3G A;  1DOT A;  3OO8 A;  4HCW A;  3OEN A;  3UK4 A;  1IUD A;  3BBR A;  1NNK A;  3KBR A;  4TQU Q;  4IGT A;  2ONS A;  2QL3 A;  1LBB A;  4RK9 A;  1VDW A;  1B7Z A;  1JW5 A;  1EU8 A;  4P8B A;  4P11 A;  5K2X A;  3IJX B;  1FBP A;  1FPI A;  4BDQ A;  1PBP A;  5FBP A;  1O64 A;  2F5X A;  2HAV A;  3MAM A;  3H6T A;  3SEX A;  5ICQ A;  5JTY B;  1O7T A;  5KDT B;  4OHN A;  4N91 A;  3C36 A;  4C1U A;  3MPK A;  1NNF A;  1IMB A;  2I0B A;  5B7D A;  1MY2 A;  4U21 A;  3SEU A;  3TCF A;  1IEJ A;  1MQG A;  4PF8 A;  1MPD A;  1NUZ A;  5H8F A;  4QFO A;  2R8T A;  2R9J A;  3RTW B;  5L9M A;  4FAT A;  4JVC A;  5EQ7 A;  2XXI A;  3EHU A;  1FQA A;  2B3F A;  4I62 A;  3TTK A;  4NF4 B;  1FPJ A;  2AL4 A;  4LQ2 A;  4N8G A;  4IO2 A;  1H76 A;  3QUF A;  4GLI A;  1NV0 A;  5AA2 A;  3UP9 A;  1ZIU A;  2R6G E;  5HPQ A;  1LBC A;  2M8C A;  1B0H A;  4GF8 A;  3FXU A;  3IB0 A;  3PPN A;  1VR5 A;  1QUJ A;  3FV2 A;  4OEU A;  4KFQ A;  3E3K A;  2UVG A;  2L5V A;  2G93 A;  3VLV A;  1B5I A;  1MDQ A;  1US5 A;  1SI0 A;  2DE4 A;  3FAS A;  1N76 A;  5L9S A;  2DS9 A;  4ISU A;  1PB8 A;  2HHM A;  5EQ8 A;  3V5A A;  3ROJ A;  3Q26 A;  3FBP A;  3BFU A;  3C33 A;  2VP1 A;  3E79 A;  1EYJ A;  1FTK A;  1NV3 A;  5CI5 A;  2XWK A;  1PB9 A;  4N8Y A;  2FBP A;  4F2O A;  2Q89 A;  4GWX A;  1EZO A;  2QMW A;  1HSE A;  1NH7 A;  2ESN A;  2XXY A;  3KN8 A;  3S9E A;  3U65 A;  2V84 A;  1AIV A;  2Q2C A;  4O94 A;  3DP6 A;  4IR8 A;  1FBG A;  4KQP A;  1MXW A;  1JEV A;  3SEW A;  4IO6 A;  3B50 A;  4BDM A;  2DVC A;  3V8X B;  4HW8 A;  2OWS A;  4F22 A;  4NGU A;  3BFT A;  1VSO A;  2QS1 A;  1LBY A;  5H8H B;  1M5B A;  1IIT A;  4ELP A;  1H3D A;  3PPO A;  1TWY A;  1JVY A;  1LB9 A;  2XXT A;  4DE8 A;  1FW0 A;  5DW8 A;  5JTY A;  5KDT A;  1NUW A;  4OES A;  3B6T A;  2ZMB A;  3QIM A;  2HQ0 A;  3PD8 A;  3FXR A;  1NNT A;  4DXB A;  2OBG A;  2RIN A;  2XWV A;  2XX7 A;  4PFY A;  1B52 A;  1JW4 A;  1P1O A;  2Q8M A;  1XVX A;  1R6Z A;  2F3B A;  3PPR A;  2V3T A;  4YMA A;  1YPN A;  2HEU A;  2PYY A;  5DTB A;  2YJP A;  2A5T B;  3WAE A;  4PE5 B;  3C31 A;  3HST A;  4OVR A;  5CMC A;  1OLA A;  3KZG A;  3EN3 A;  5H8N B;  3UGW A;  1SI1 A;  1O63 A;  4AQ4 A;  3A29 A;  3H6V A;  1FQC A;  1IMF A;  1AL3 A;  2F3D A;  1UTH B;  1OQH A;  3CFX A;  1FSA A;  4NED A;  4G68 B;  4U1O A;  4NWD A;  1OIB A;  1P99 A;  2GRV A;  2VD3 A;  4KHZ E;  3T9H B;  2DYX A;  1NNP A;  4X48 A;  4OFL A;  3R7X A;  1B3L A;  2IEE A;  4Q5T A;  1MM7 A;  3QAX A;  4XTC Q;  4X04 A;  1IXI A;  4N4U A;  1RDY A;  2ZYO A;  1EZP A;  4PDH A;  2F78 A;  1B51 A;  4HE1 A;  4KCD A;  1JP4 A;  2F8D A;  3FJM A;  4GX6 A;  3TPA A;  3RLF E;  4JBZ A;  4NE4 A;  2F35 A;  3VFJ A;  1KWH A;  2QVV A;  2NUV A;  3JZJ A;  3W9W A;  1LAX A;  1A99 A;  4RNS A;  4NF5 B;  1MS7 A;  1B9J A;  3K0V A;  1RYX A;  1M5D A;  3OMB A;  4U22 A;  3RGY A;  1H43 A;  4EUO A;  1Y3P A;  4MBP A;  1SYH A;  5I57 A;  4P1E A;  2ABH A;  2KR0 A;  5A5X A;  4MIJ A;  3KEI A;  1AOV A;  4LN5 A;  4F1U A;  3O97 A;  1BKA A;  3B6Q A;  5H8H A;  1I69 A;  2QVR A;  1OVT A;  5EHM A;  2AIX A;  3PGF A;  2Q8J A;  1MY0 A;  5ET7 A;  3G3I A;  4RK2 A;  4XF5 A;  1XHY A;  3K2D A;  1I6B A;  2DWH A;  1MQI A;  4R74 A;  5IGA A;  1RKM A;  2F34 A; 
#chains in the Genus database with same CATH homology
 5FHN A;  5AA2 D;  1UTB A;  1H44 A;  3RUM A;  4FED A;  2VGQ A;  3U72 A;  4HTG A;  5HBC A;  4GRK A;  3ZSF A;  4YZZ A;  3CI8 A;  1LAG E;  2AL5 A;  2GFE A;  3THI A;  3TCG A;  3LSF B;  2YLN A;  5H8N A;  3H6U A;  1FCK A;  5I84 A;  4PFT A;  4JB7 A;  4QFL A;  1YCJ A;  4LZ5 A;  5BUU A;  1AH5 A;  3PU5 A;  1TFD A;  2B3B A;  2QS3 A;  4G68 A;  3M8U A;  4FE8 A;  2F7B A;  3K6X A;  5ICT A;  1S50 A;  1ZLQ A;  3PV0 E;  4GD5 A;  3KN7 A;  3ILT B;  2HFB A;  4ZS9 A;  5ITP A;  3U94 A;  3T66 A;  4LUB A;  3G3G A;  1LST A;  4Z0I A;  5L8D A;  1GR2 A;  1WOD A;  4N6P A;  3IOR A;  2R71 A;  1JW1 A;  3I6V A;  1S7Y A;  4KYE A;  4KCC A;  1SW4 A;  5I2N B;  2UVI A;  2XXP A;  2RF1 A;  4H65 A;  3PMW A;  2PX1 A;  4NF5 A;  4M4G A;  3TZA A;  2A5S A;  1IXH A;  1DPP A;  1YTV A;  4LP2 B;  4U2R A;  3VLW A;  3O29 A;  4MF3 A;  3KJT A;  3OO9 A;  1B1H A;  4TLM B;  3T9V A;  2ONK E;  1Y3N A;  2Y7P A;  3RT6 B;  3OD7 A;  3HHF A;  2NOO A;  1MY1 A;  4G8N A;  1POT A;  1N3X A;  3A3U A;  2QSX A;  5DVJ A;  1EZ9 A;  4QHQ A;  3Q25 A;  1A8E A;  3LSW A;  4PP0 A;  5EHS A;  4IO4 A;  4ELQ A;  2UVJ A;  1OQG A;  2XX8 A;  1B05 A;  2Q88 A;  3T9X B;  5AA4 A;  4U4X A;  3IK6 B;  5H8S A;  4F3P A;  4UA8 A;  3FVK A;  4LVQ A;  2VD2 A;  1PC3 A;  3JYR A;  2RC7 A;  4R6K A;  5I56 A;  4I1D A;  2B65 A;  3VLU A;  3K6W A;  4TLL B;  3PPQ A;  1LB8 A;  3M3K A;  2XD3 A;  1IZ1 A;  3MUQ A;  1N7W A;  4LA9 A;  3CFL A;  2W7Y A;  4XKR A;  1NMU A;  1B40 A;  2YPN A;  2DVZ A;  4POW A;  3USD A;  2FYI A;  3H03 A;  4F19 A;  5JEI A;  4FAJ A;  4X1D A;  3SES A;  4DDD A;  1WVJ A;  3PUZ E;  2V93 A;  5I2N A;  3QUJ A;  3PUW E;  1Y1Z A;  3EQ1 A;  3OEL A;  4LON B;  4H5G A;  4XKN A;  3OEK A;  2Y84 A;  4NMY A;  3T9U A;  3LR1 A;  4MFI A;  1SW1 A;  2Z8D A;  3MW0 A;  3K1N A;  1QVS A;  2Z23 A;  4G8M A;  1A40 A;  4G2Z A;  2PBW A;  2UVH A;  1ATG A;  3FVO A;  2D3I A;  5DEX B;  1XT8 A;  1B3G A;  1ELJ A;  3SKP A;  5DYH A;  3LUY A;  1DTG A;  5TPA B;  1ZKB A;  3O9P A;  3N94 A;  5J1D A;  4O3B A;  4OZ9 A;  4GIZ A;  2RCB A;  4F18 A;  3R26 A;  5ITO A;  4YB6 A;  1B5H A;  1VE4 A;  1QKA A;  4PET A;  1MQH A;  2I4C A;  4YMB A;  3MPL A;  4FEB A;  4JDF A;  1QUL A;  4F31 B;  3R6U A;  5ELV A;  2GHA A;  1Z7M E;  4OER A;  3TKD A;  3KSJ A;  1Y1M A;  3I3V A;  3FGS A;  3HO7 A;  1Y9U A;  2XXH A;  5IAI A;  3D4C A;  2DXR A;  3H3G A;  3KFM A;  3PMX A;  1HSJ A;  1MQD A;  4R6H A;  2F36 A;  4YKP A;  4ESX A;  1R9Q A;  3I5O A;  1LCF A;  5FTI A;  3ODB A;  3MC2 A;  3TFL A;  3U8Q A;  1URG A;  4YB7 A;  4GWO A;  3UA8 A;  2OWT A;  4NWC A;  3VVE A;  1MPC A;  3S9M C;  4X9T A;  2H5Y A;  2OLB A;  4ELO A;  1I6A A;  5I57 B;  1USY E;  1B32 A;  3FV1 A;  5BWJ A;  3FJ7 A;  5A5X B;  4F1Y A;  4YKI A;  2ZYM A;  2PT1 A;  3HHG A;  3FD3 A;  4OET A;  3H06 B;  2I4B A;  4F39 A;  4GFR A;  4Q30 B;  4ZDM A;  2I58 A;  4IB2 A;  4IO7 A;  3G3J A;  1LAH E;  3L6G A;  1PB7 A;  3CR9 A;  4HS7 A;  5DEX A;  1MQJ A;  2Q9T A;  1IIW A;  3T93 B;  5CMK A;  4EF1 A;  2H9B A;  5TPA A;  1UTB B;  4ZEC A;  1D9V A;  5KCJ A;  3RY3 A;  4OXV A;  1JNF A;  2NXO A;  1XS5 A;  1B7H A;  2ZNT A;  4HCY A;  4FJP A;  4DLD A;  4H67 A;  4PQJ A;  1ZU0 A;  3VE1 B;  3UIF A;  1B5J A;  5KZT A;  2O69 A;  2DWJ A;  5TP9 A;  4DZ1 A;  2RC8 A;  5ISU A;  3CSB A;  2P1S A;  1UQW A;  5I58 A;  2CZL A;  3K6U A;  3VDF A;  3TDJ A;  4LZ8 A;  4ZEK A;  1FTJ A;  1ZMG A;  4P0I A;  3A3C A;  3TTL A;  4R2F A;  2DE3 A;  1P1W A;  4OFO A;  3MJN A;  2ZNS A;  4R2B A;  2D21 A;  4X1B A;  4EQB A;  1SVX B;  2DOJ A;  3EPE A;  1A7L A;  2HZL A;  4NTL A;  4OWD A;  4GOT A;  3MP8 A;  1AMF A;  2I0C A;  1FTO A;  1OMP A;  2UYF A;  1A55 A;  3RQT A;  2XXW A;  3S9N C;  4PFU A;  2XHD A;  4ZZE A;  4RY1 A;  4LZ7 A;  5AA1 A;  2VHA A;  2I3W A;  1M5F A;  4ECF A;  2HCA A;  3UOR A;  3PUY E;  3ILU B;  4QSE A;  3MQ9 A;  3M3L A;  4EF2 A;  1MXX A;  1R1N A;  4OEN A;  3TMG A;  4DCX A;  2X7Q A;  2E1S A;  1Y4T A;  4KD5 A;  4H8I A;  2XXQ A;  3FVG A;  4XIG Q;  5F7V A;  3AXF A;  1IXG A;  3ZS6 A;  1MXY A;  5H8Q A;  2VOZ A;  2Z8F A;  4JSD A;  5I59 B;  3K02 A;  4H1X A;  2I6E A;  2REG A;  1TFA A;  1M5E A;  5B70 A;  3QXM A;  3K00 A;  5DT6 A;  4WXJ A;  3QSL A;  2O6A A;  4MLQ A;  4BDO A;  2H99 A;  2I49 A;  5AA4 B;  1T0K A;  3WAF A;  3FJG A;  4YIC A;  2OCU A;  5I56 B;  5DVF A;  3IOW A;  3T22 A;  3MZ1 A;  1IQ7 A;  2P2A A;  3RPW A;  3CFZ A;  2HXW A;  4EQ9 A;  4YKJ A;  4BLA A;  3LC8 A;  1BIY A;  1OVB A;  3IO6 A;  3S2V A;  4THI A;  5TU0 A;  4I8C A;  3KOT A;  1MM6 A;  1MRP A;  4OYV A;  2QMX A;  2I48 A;  3TEL A;  1HSL A;  3MP6 A;  4ZED A;  2OZZ A;  4I9D A;  4WED A;  4AB6 A;  3ZKK A;  4H5F A;  2O1M A;  3DP4 A;  4ZE8 A;  4EQ7 A;  2X26 A;  3IOT A;  1YAE A;  1B3E A;  2GHB A;  3H7M A;  4JWO A;  1MXZ A;  1SDX A;  1ZBM A;  1N0T A;  4G4P A;  3GBA A;  3V83 A;  1B7U A;  3BKI B;  3V89 B;  1FTL A;  4XXU A;  4LAT A;  1UIV A;  3FXQ A;  1JQF A;  3FZV A;  5CBR A;  2F6G A;  3K1M A;  1J1N A;  4OFJ A;  2D5W A;  4ZEB A;  4LQ5 A;  4BDN A;  4H8J A;  1D9Y A;  4ZEF A;  4F1V A;  4U4S A;  5CBS A;  2O1L A;  3TTR A;  1P1U A;  4QSD A;  3TOD A;  3TQL A;  3L6H A;  4ZE9 A;  5I59 A;  4Q0C A;  3D4G A;  4ESW A;  4GXS B;  1Q35 A;  3IOV A;  3KN3 A;  2H98 A;  4XKQ A;  4IY6 A;  2ZXT A;  1B0L A;  2CMO A;  2Y7K A;  5DVI A;  2F6P A;  3OEM A;  1FQB A;  3MVZ A;  1QUK A;  4GVO A;  4IO5 A;  2RC9 A;  5CM6 A;  4L17 A;  3QK6 A;  1ZTY A;  2Z8E A;  1GTK A;  3TAJ A;  1MXU A;  1LGB C;  1B1X A;  1R9L A;  1POY 1;  4JWY A;  3GLB A;  1FTM A;  1URD A;  4DXU A;  1Y4C A;  3ECR A;  3PUX E;  4F29 A;  3U92 A;  3OO7 A;  5IKB A;  1PDA A;  4KR5 A;  3JV9 A;  5CRY A;  2X7P A;  2Y7I A;  1B2H A;  1XVY A;  3S9L C;  4XKP A;  1PBQ A;  3OOA A;  1MY3 A;  2PT2 A;  1L5T A;  2QPQ A;  3VVD A;  2I3V A;  2QS2 A;  4C0R A;  5KCJ B;  3F11 A;  3MVW A;  2FNC A;  1NH8 A;  4AB5 A;  3IR1 A;  1II5 A;  5FHO A;  5TP9 B;  3IJO B;  1BLF A;  3HN0 A;  3O6G A;  1XC1 A;  3VXC A;  5I58 B;  3KOS A;  3S4U A;  2XX9 A;  3IL1 B;  4RA1 A;  4ELR A;  3VXB A;  2H25 A;  4ZZA A;  4ZEI A;  4OVJ A;  3Q29 A;  3H6W A;  1FQE A;  5F1Q A;  5LOM A;  4FIM A;  3OXN A;  4QRZ A;  2NVU B;  1MXV A;  1FQF A;  1QKB A;  3LSX A;  5HM4 B;  4H6D A;  1N84 A;  2O7I A;  2ALU A;  4EDP A;  1SW2 A;  2O7U A;  3N26 A;  1F9B A;  3TEP A;  1GVC A;  1H45 A;  3H4Z A;  2Z22 A;  3TTM A;  3SEY A;  3G7W A;  4KI0 E;  5I2K A;  4KPT A;  4F2Q A;  3P7I A;  4RJZ A;  5AA3 A;  2HAU A;  4QFP A;  1SBP A;  4H0W A;  2Y7W A;  4OMB A;  3O6H A;  4ND9 A;  1RYO A;  2PVU A;  1DPE A;  1B3F A;  3C9H A;  1USY H;  1DTZ A;  1P1N A;  1GV8 A;  2G29 A;  2LAO A;  3A09 A;  4OTE A;  2ANJ A;  3N5L A;  4BDL A;  1UIU A;  3Q28 A;  4E0X A;  1NKX A;  1B46 A;  1BTJ A;  4F3B A;  2DXY A;  3TUS A;  3GBB A;  3DP8 A;  3GXA A;  3MVX A;  4Z7E A;  5H8Q B;  3MZ9 A;  3CVG A;  4Q8R A;  4YU0 A;  4IO3 A;  2F7A A;  3ONM A;  1LFG A;  3UN6 A;  2QRY A;  4G68 C;  1SYI A;  5L9O A;  4U23 A;  3K01 A;  2DQV A;  4R73 A;  4RYA A;  4NF8 B;  4G77 A;  4POX A;  4RXL A;  2HZK A;  2XXX A;  3GZG A;  3QYT A;  3OO6 A;  4OEV A;  2QS4 A;  4KYS A;  1DMB A;  2OJT A;  1QW0 A;  1DSN A;  3MWB A;  4RPN A;  4PFW A;  2DWI A;  4R72 A;  4NF4 A;  4YAH X;  2ZYK A;  4BDR A;  3TCH A;  1QUI A;  2PMS A;  1MPB A;  4GQO A;  3PD9 A;  2DWA A;  1Y20 A;  1TXF A;  3RT8 A;  2IA4 A;  1Z7N E;  3EHS A;  3K4U A;  4QFK A;  3PPP A;  3OSQ A;  1B6H A;  3E4R A;  4TOZ A;  1URS A;  2Y7R A;  3U1O A;  5FHM A;  4R6Y A;  4O3A A;  3O28 A;  1XOC A;  1OLC A;  2DSF A;  5AE4 A;  3K6V A;  4K3F A;  4N13 A;  2DP8 A;  3TTN A;  3HCQ A;  4FEC A;  3SET A;  1MY4 A;  3DEL B;  1Y3Q A;  1B58 A;  3G3F A;  1SW5 A;  1PEB A;  3N6U A;  3TQW A;  3LSL A;  3LBS A;  3CG1 A;  3OSR A;  1GGG A;  3PMV A;  3DLN A;  2XXU A;  2V3U A;  1JVX A;  2F7C A;  4P0G A;  3KSX A;  4NF6 B;  1BP5 A;  2ZNU A;  1SD3 A;  4R75 A;  3MBP A;  1LFI A;  4EXK A;  4DCY A;  3CSG A;  1N7X A;  2XXV A;  4MH5 A;  4NF8 A;  4DXC A;  1ANF A;  3VV5 A;  2KLF A;  3W15 C;  4ONY A;  1N3W A;  2A5T A;  3B7D A;  4JSO A;  1LFH A;  4YB5 A;  4FOR A;  4WEP A;  3KG2 A;  5CC2 A;  4JWX A;  4QSC A;  3IB1 A;  2REJ A;  1NFT A;  2O68 A;  2THI A;  4MLV A;  5CMB A;  3HV1 A;  1I6Q A;  2RKM A;  2QJE A;  4QF9 A;  1UTH A;  1TT1 A;  4RPO A;  2XXR A;  5CMM A;  4M1V A;  3FIR A;  2DE2 A;  1JET A;  2V3Q A;  3IO4 A;  1B4Z A;  2XD2 A;  3KJ7 A;  4GXA A;  3IX1 A;  1FQD A;  4EXL A;  3G3H A;  3C32 A;  1MG1 A;  3RN8 A;  1IXC A;  1ZJL A;  4UAC A;  1MH4 A;  1M5C A;  3RTF B;  5M2V A;  2P0S A;  4QFN A;  3E13 X;  2OK2 A;  3C34 A;  3B6W A;  4R9G A;  1P1Q A;  3FVN A;  2WKY A;  1MDP 1;  3HPI A;  5JK4 A;  2AYS A;  3IB2 A;  1WDN A;  2V25 A;  3C4M A;  3VVF A;  3IAZ A;  4IY5 A;  2F97 A;  3U93 A;  2O84 X;  4O3C A;  1A8F A;  3PUV E;  4GL8 A;  4IGR A;  4JXI A;  3E9X A;  5EYF A;  3FUZ A;  3DM0 A;  2Q2A A;  4C1T A;  1B3H A;  1VFE A;  2GH9 A;  3W9V A;  5H8F B;  3T96 B;  4U1Z A;  1Q1K A;  3EHT A;  2ONR A;  4G8H A;  4OQO A;  3RNN A;  1NL5 A;  4NF6 A;  3CIJ A;  3ZKL A;  1A54 A;  3MP1 A;  1S9T A;  2NWJ A;  4GL0 A;  3SDF A;  4YKK A;  5FTH A;  5AA2 B;  3C35 A;  3IOU A;  1D3K A;  4KYD A;  4R9F A;  3TYH A;  2FA7 A;  4WKM A;  1VFD A;  1QJM A;  1LLS A;  2ZYN A;  4F3S A;  2H4I A;  2BJJ X;  2O51 A;  3KGC A;  3MVY A;  4DIG A;  1LCT A;  3SEV A;  1EH3 A;  1MH3 A;  1CE2 A;  1LAF E;  1CB6 A;  3O2A A;  5K2Y A;  1D4N A;  3FAT A;  2RCA A;  2E0S A;  4E0W A;  3O66 A;  1SQY A;  3CRB A;  3K1P A;  5I2K B;  1N04 A;  3CG3 A;  2UXA A;  3M3F A;  3G3K A;  1JEU A;  3SER A;  1US4 A;  3O6I A;  3Q27 A;  3MZB A;  1B4H A;  3EF7 A;  4N07 A;  2UYE A;  3N6T A;  4F3G A;  1DOT A;  3OO8 A;  4HCW A;  3OEN A;  3UK4 A;  1IUD A;  3BBR A;  1NNK A;  3KBR A;  4TQU Q;  4IGT A;  2ONS A;  2QL3 A;  1LBB A;  4RK9 A;  1B7Z A;  1JW5 A;  1EU8 A;  4P11 A;  5K2X A;  3IJX B;  4BDQ A;  1PBP A;  1O64 A;  2F5X A;  2HAV A;  3MAM A;  3H6T A;  3SEX A;  5ICQ A;  5JTY B;  1O7T A;  5KDT B;  4OHN A;  3C36 A;  4C1U A;  3MPK A;  1NNF A;  2I0B A;  5B7D A;  1MY2 A;  4U21 A;  3SEU A;  3TCF A;  1IEJ A;  1MQG A;  1MPD A;  5H8F A;  4QFO A;  2R9J A;  3RTW B;  5L9M A;  4FAT A;  2XXI A;  3EHU A;  1FQA A;  2B3F A;  4I62 A;  3TTK A;  4NF4 B;  2AL4 A;  4LQ2 A;  4IO2 A;  1H76 A;  3QUF A;  4GLI A;  5AA2 A;  3UP9 A;  1ZIU A;  2R6G E;  5HPQ A;  1LBC A;  2M8C A;  1B0H A;  4GF8 A;  3FXU A;  3IB0 A;  3PPN A;  1VR5 A;  1QUJ A;  3FV2 A;  4OEU A;  4KFQ A;  3E3K A;  2UVG A;  2G93 A;  3VLV A;  1B5I A;  1MDQ A;  1US5 A;  1SI0 A;  2DE4 A;  3FAS A;  1N76 A;  5L9S A;  2DS9 A;  4ISU A;  1PB8 A;  3V5A A;  3Q26 A;  3BFU A;  3C33 A;  2VP1 A;  1FTK A;  5CI5 A;  1PB9 A;  4F2O A;  2Q89 A;  1EZO A;  2QMW A;  1HSE A;  1NH7 A;  2ESN A;  2XXY A;  3KN8 A;  3S9E A;  2V84 A;  1AIV A;  2Q2C A;  3DP6 A;  4KQP A;  1MXW A;  1JEV A;  3SEW A;  4IO6 A;  4BDM A;  2DVC A;  3V8X B;  4HW8 A;  2OWS A;  4F22 A;  3BFT A;  1VSO A;  2QS1 A;  5H8H B;  1M5B A;  1IIT A;  4ELP A;  1H3D A;  3PPO A;  1TWY A;  1JVY A;  1LB9 A;  2XXT A;  4DE8 A;  1FW0 A;  5JTY A;  5KDT A;  4OES A;  3B6T A;  2ZMB A;  3QIM A;  2HQ0 A;  3PD8 A;  3FXR A;  1NNT A;  4DXB A;  2OBG A;  2RIN A;  2XX7 A;  4PFY A;  1B52 A;  1JW4 A;  1P1O A;  1XVX A;  1R6Z A;  3PPR A;  2V3T A;  4YMA A;  1YPN A;  2HEU A;  2PYY A;  5DTB A;  2YJP A;  2A5T B;  3WAE A;  4PE5 B;  3C31 A;  3HST A;  5CMC A;  1OLA A;  3KZG A;  3EN3 A;  5H8N B;  3UGW A;  1SI1 A;  1O63 A;  4AQ4 A;  3H6V A;  1FQC A;  1AL3 A;  1UTH B;  1OQH A;  3CFX A;  4NED A;  4G68 B;  4U1O A;  4NWD A;  1OIB A;  1P99 A;  2GRV A;  2VD3 A;  4KHZ E;  3T9H B;  2DYX A;  1NNP A;  4X48 A;  4OFL A;  3R7X A;  1B3L A;  2IEE A;  4Q5T A;  1MM7 A;  3QAX A;  4XTC Q;  1IXI A;  2ZYO A;  1EZP A;  2F78 A;  1B51 A;  4KCD A;  2F8D A;  3FJM A;  3TPA A;  3RLF E;  4JBZ A;  4NE4 A;  2F35 A;  3VFJ A;  1KWH A;  2NUV A;  3JZJ A;  3W9W A;  1LAX A;  1A99 A;  4RNS A;  4NF5 B;  1MS7 A;  1B9J A;  3K0V A;  1RYX A;  1M5D A;  3OMB A;  4U22 A;  3RGY A;  1H43 A;  4EUO A;  1Y3P A;  4MBP A;  1SYH A;  5I57 A;  2ABH A;  5A5X A;  3KEI A;  1AOV A;  4F1U A;  3O97 A;  1BKA A;  3B6Q A;  5H8H A;  1I69 A;  1OVT A;  5EHM A;  2AIX A;  3PGF A;  2Q8J A;  1MY0 A;  3G3I A;  4RK2 A;  1XHY A;  3K2D A;  1I6B A;  2DWH A;  1MQI A;  4R74 A;  1RKM A;  2F34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...