2O84X

Crystal structure of k206e mutant of n-lobe human transferrin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two mutants that probe the role in iron release of the dilysine pair in the N-lobe of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Serotransferrin
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o84X01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o84X02
1B51A 4I9DA 1NKXA 4R6HA 1QUIA 4R9FA 4EUOA 4DDDA 3QK6A 4F3PA 4QF9A 3L6HA 1A55A 4ECFA 1B0HA 2W7YA 5DTBA 4NTLA 1PB8A 1FTLA 2VD3A 4M1VA 4OVJA 4R9GA 1B9JA 3E9XA 3HSTA 2VD2A 3FV2A 3HCQA 4FORA 5JTYB 1POTA 2ZNTA 5K2YA 1LB8A 4BDLA 2O68A 5HBCA 3O9PA 1Y3PA 4DCXA 3VDFA 3FGSA 1B6HA 4I62A 4YAHX 1ZTYA 4E0WA 1AOVA 1MQGA 5I59B 4EF2A 4RK9A 1JVXA 1IXIA 2PX1A 2GHAA 2NUVA 3EHUA 5CMBA 3MVZA 4JWOA 4ZEBA 3T9HB 4LA9A 3HN0A 1RYXA 3VE1B 1GV8A 2VGQA 4LATA 3MZ9A 2I0CA 4NEDA 4F3BA 4F1YA 4GOTA 1D4NA 5I58B 4NF5A 3DLNA 2G29A 2F7BA 3JZJA 3T66A 2AL5A 3MPKA 3S9EA 3UA8A 4NF8A 1EZ9A 3E13X 4G77A 2DE3A 3PUVE 4P0IA 4ELOA 4GXAA 2XXPA 5I56A 3G7WA 1XC1A 3RNNA 4C1TA 2Z8DA 1SI1A 3PUYE 5AE4A 4G8MA 3A3CA 1NNPA 3PV0E 5L9OA 1LFHA 2GH9A 1CE2A 2DVZA 4OTEA 5A5XB 4NF6B 1P1WA 1QKBA 2V93A 3LUYA 4P0GA 4R72A 4BDNA 1EZPA 2BJJX 4U22A 1O63A 1IIWA 1LSTA 4YB5A 1EH3A 1B52A 3C9HA 1MXYA 1MM6A 1NL5A 2HFBA 4MLVA 4DXBA 3UK4A 2I0BA 2O1MA 4FAJA 1KWHA 2HAUA 1LBCA 3V5AA 1B32A 1N3WA 4KCDA 3HHGA 1LAHE 2DVCA 3PD8A 4H8IA 4OWDA 5FHMA 3TTKA 4KHZE 1MQDA 3FXQA 1OLCA 3WAFA 4RYAA 4ZDMA 3QYTA 3FZVA 4GF8A 2XXXA 1MPBA 3K2DA 2F35A 3CFLA 4H8JA 5DVJA 1JQFA 4EQBA 3V83A 5F1QA 3CG3A 5KZTA 1VFEA 2X7QA 4Q0CA 3L6GA 4GQOA 2OCUA 4MH5A 2O7UA 3MJNA 4RPOA 1UTBB 1MXZA 2QJEA 3PUWE 1P1QA 2HXWA 3M8UA 5L8DA 1UIUA 1FQBA 1FQDA 3SEUA 1A8EA 2GRVA 2QS3A 3D4GA 2XXHA 4RK2A 2PT1A 2YJPA 1ELJA 2Q2CA 1QJMA 3FVNA 3PUXE 1IXGA 3H6WA 4EXLA 3MWBA 4F3GA 1M5EA 4KFQA 3LSXA 4PFUA 3N26A 4XKNA 1VFDA 2VOZA 4DZ1A 3IAZA 2Z22A 2Y7RA 1QKAA 3FIRA 3U94A 3U8QA 2LAOA 4L17A 4JB7A 4ZZEA 1R1NA 1QUKA 1GTKA 1JW5A 3C32A 2I58A 4KYSA 3VLVA 3HO7A 5CC2A 1CB6A 5I57A 1I6AA 2ZYMA 1A54A 3VXBA 1MDQA 4PE5B 1TXFA 4I8CA 3C35A 1MQIA 1WODA 4YMBA 3RQTA 2XD3A 3LR1A 4O3CA 4P11A 4UACA 4IGRA 3TKDA 2GHBA 4AB6A 4GXSB 3ZS6A 3OSQA 3TDJA 1IQ7A 1Q35A 4R6KA 3M3LA 3OEKA 3TMGA 1SYIA 3IR1A 2V3TA 2XXVA 4G4PA 3I5OA 4LZ7A 2PMSA 4POWA 1PBPA 3V8XB 2UYFA 4F3SA 4OFOA 2I49A 1B3FA 2GFEA 4JSOA 5HM4B 1A99A 3B6WA 4NF6A 1XOCA 2I48A 3G3IA 2H99A 1UTHA 5FHOA 1ATGA 2B65A 2P1SA 5DVFA 3KOTA 4GWOA 4IO4A 2ONKE 4H5GA 4KR5A 2X7PA 4X1DA 4C1UA 4TLMB 4DCYA 1MPCA 4ZE8A 5JK4A 4OYVA 1N0TA 3G3HA 3BFUA 5EYFA 3Q28A 4KI0E 1USYE 5H8NA 4DXUA 3USDA 3LBSA 3VVDA 3CIJA 2NVUB 2DOJA 3E3KA 1ZU0A 3MZ1A 5TPAA 5DT6A 3RTWB 3UGWA 4Q8RA 4IO3A 3SEWA 2HZLA 5CMKA 5CI5A 4H0WA 4UA8A 5TPAB 4BDQA 2FNCA 2QS1A 4YKIA 3HPIA 1QULA 3KGCA 1YPNA 2O51A 2QSXA 3FJ7A 4POXA 4HW8A 2F34A 2A5TB 2F78A 4YU0A 5M2VA 3PUZE 1B0LA 2DWJA 5I2NA 1B7ZA 2ZYOA 3SEYA 4FATA 1P99A 1S50A 2A5SA 1B5JA 2F5XA 4RJZA 5JEIA 3BBRA 4ND9A 5I2KB 3TPAA 3VXCA 3UN6A 1VSOA 2FA7A 3IORA 3RT6B 4IO2A 3OSRA 2Q8JA 3UIFA 3T22A 1YAEA 2YLNA 2ZNUA 1B7HA 3IB0A 4KPTA 1LAXA 1UIVA 2I6EA 1SDXA 2DWIA 1PB7A 2THIA 1FTMA 3EF7A 2DS9A 3PPPA 1MY3A 1XVXA 1NNTA 1RYOA 1TT1A 4GL8A 4OHNA 1ZMGA 1PB9A 3OELA 4YZZA 3TCFA 4F2OA 2V25A 3PMXA 4X48A 1H44A 1M5DA 2XX8A 4TLLB 4JBZA 4YKPA 3PMVA 3TTNA 1WVJA 3FASA 5CRYA 4F2QA 4OERA 3FXRA 3Q26A 1ZKBA 3TCHA 4WKMA 1SW1A 3GBBA 1D9VA 2G93A 3HV1A 1MXUA 5AA2D 3OO9A 1I69A 3FXUA 1LCTA 3VLWA 1URDA 1I6QA 3MP6A 4JXIA 5H8NB 4ELQA 2AYSA 2DQVA 5I59A 3PGFA 1FTJA 1ZBMA 2DWAA 5ITOA 1Y9UA 5TP9B 1SW2A 4LZ8A 1US4A 1YCJA 2Z23A 1JEVA 3ECRA 1DMBA 4ESXA 5KCJB 2AL4A 3TTRA 1O64A 4R2FA 2H9BA 1MH4A 4GL0A 1II5A 1VR5A 3C36A 3TZAA 1Y1ZA 4ZECA 2ANJA 1FQCA 4HCYA 4ELRA 4H1XA 3VVEA 1MRPA 4BLAA 3TAJA 1H76A 3H4ZA 4QSDA 3WAEA 3RUMA 5AA4B 5L9SA 4MF3A 2PVUA 4YKJA 1JEUA 2UVJA 2UVHA 3B7DA 3VLUA 2X26A 4OEVA 4Q5TA 2DYXA 3S2VA 3MVWA 1B5IA 3FJGA 1EZOA 1D9YA 1ZIUA 3KSXA 3MVXA 2D5WA 4GFRA 3FATA 4MLQA 3MW0A 5KDTA 5ITPA 1Y4TA 1M5FA 1N7XA 1HSJA 2QMWA 3O2AA 3SESA 2QS4A 3K6VA 4QFPA 3QAXA 4TOZA 4Z0IA 4BDRA 2RCBA 3SEVA 1DSNA 2XXRA 3OMBA 4NWDA 1R9QA 2QRYA 2F6GA 1TWYA 3H6UA 2HCAA 2OLBA 3B6QA 1OQHA 4BDOA 5AA2B 4U21A 5AA4A 3TELA 5I2KA 4ZEDA 5FHNA 1MPDA 3LSLA 5CMCA 5I2NB 1SBPA 3EHTA 2PT2A 3KEIA 4IY6A 4XKQA 3DP8A 1A8FA 1D3KA 1MH3A 1FCKA 3A3UA 3G3FA 3PPOA 4JWXA 1OMPA 2O69A 4O3AA 4OESA 3SERA 5TU0A 4H5FA 3Q29A 1ZLQA 3KJTA 4NF8B 4YB6A 1O7TA 4R75A 3W15C 3ONMA 4QHQA 3VVFA 1PDAA 2E0SA 4OMBA 1NMUA 2A5TA 3O29A 1MQHA 2NXOA 4X9TA 3OENA 3DP6A 4YMAA 4NF4B 2O7IA 2Q88A 4LP2B 2DSFA 5B7DA 3IX1A 1URGA 2QMXA 1B3EA 1NNFA 3IK6B 3IOWA 2UXAA 2YPNA 3FD3A 2F7CA 1OVTA 4BDMA 1SQYA 1F9BA 4MBPA 4M4GA 3MC2A 3CRBA 2DXRA 2XX9A 1B3LA 1Y20A 2QS2A 3Q27A 1Y4CA 5FTIA 4GVOA 3RLFE 4FJPA 4ZE9A 4U4SA 1ZJLA 1FQEA 3QSLA 4IB2A 4KCCA 4R74A 1JVYA 5KCJA 3K1MA 2XXIA 3T96B 5B70A 1MY0A 3R6UA 4LQ2A 2HEUA 3RPWA 4WXJA 3H7MA 4RXLA 5FTHA 3EN3A 3T93B 1MXVA 3T9UA 3KBRA 3KFMA 3QIMA 3MVYA 2R6GE 1N04A 4NE4A 4PETA 3IOVA 5ICQA 5DEXB 3SEXA 1DPEA 3K6UA 1LBBA 1SI0A 2Q89A 3H06B 3QXMA 3CSGA 5I56B 2F97A 5CM6A 3U1OA 1JNFA 5J1DA 1XT8A 3M3FA 3AXFA 3W9WA 4F1VA 1LB9A 2E1SA 2FYIA 1NH8A 4FECA 3S9LC 1RKMA 3MP8A 1IITA 3OO8A 3IOTA 1MXWA 1QUJA 3T9XB 2CZLA 2DE4A 1LGBC 1P1NA 2VHAA 3KG2A 1FTOA 2RF1A 1PBQA 1MY4A 4IO7A 2ALUA 4DE8A 5HPQA 4F31B 2F6PA 1Z7NE 2OJTA 3B6TA 3H3GA 1DTGA 1YTVA 2QPQA 3G3KA 3M3KA 3N6TA 4FIMA 5CMMA 4QFLA 4TQUQ 5K2XA 3PPQA 4O3BA 4N13A 3RY3A 3OEMA 1BTJA 3IJOB 1B58A 2HZKA 3EQ1A 3MP1A 3KN3A 2XXQA 2HAVA 2Y7WA 3K4UA 4QSCA 4QFNA 5L9MA 2XXTA 5IKBA 4OQOA 3CVGA 5H8QB 3I6VA 4RY1A 5AA1A 1N7WA 2F8DA 3K00A 2M8CA 1UQWA 3PD9A 3SETA 1UTBA 3TCGA 3CFZA 3QUJA 1MG1A 1LCFA 4WEDA 3KOSA 4GIZA 3MAMA 3SKPA 4OETA 1AH5A 5AA2A 3K1PA 1MQJA 1PEBA 1B1HA 1XS5A 5I58A 4EXKA 3CI8A 3UP9A 3W9VA 2B3BA 2PBWA 3KSJA 4ZZAA 3Q25A 3KN8A 2D3IA 4QFOA 3G3GA 3K1NA 1FW0A 3PMWA 1BP5A 3LSWA 2I4BA 1H3DA 2UYEA 3IB2A 2O1LA 4YB7A 2ONRA 1I6BA 5H8HA 3PPRA 4PFWA 5KDTB 3S9NC 5CBRA 2Y7KA 3EHSA 3F11A 2IA4A 1B2HA 1B46A 4RPNA 3DP4A 3U72A 1B4ZA 5BUUA 4R73A 1HSEA 3TQLA 4WEPA 5I57B 3TUSA 2XD2A 4F39A 1PC3A 2D21A 2XXWA 1IXCA 2ZMBA 2XXUA 3GBAA 4OXVA 4AB5A 4DXCA 3G3JA 4ESWA 3O6GA 3IL1B 1DPPA 3ZKLA 1QW0A 4XTCQ 3ODBA 2Y84A 1R6ZA 4JSDA 1OVBA 3FUZA 1B3HA 3RGYA 2RC9A 3RTFB 3PU5A 3N6UA 1POY1 1P1UA 1MY1A 2H5YA 3K02A 4MFIA 3IOUA 4PP0A 1A7LA 4THIA 1A40A 5ISUA 1AMFA 1BKAA 4DIGA 2O84X 1DTZA 2I3WA 3ILTB 2OK2A 3FV1A 4XKPA 1B1XA 3JYRA 2R9JA 2DE2A 4ZEKA 2Z8FA 3H6TA 1LLSA 4NF4A 5BWJA 1MDP1 1MXXA 1WDNA 4OENA 1NNKA 1OQGA 2AIXA 1BLFA 1JW4A 1SVXB 1Z7ME 2REJA 4NMYA 3ZSFA 3OXNA 4FE8A 4PFYA 1B5HA 2VP1A 5LOMA 3TODA 2F36A 1M5CA 2H25A 3GLBA 2V3QA 4HCWA 1SYHA 2ESNA 1MY2A 4OZ9A 4IY5A 4U23A 1S9TA 5JTYA 2H4IA 5TP9A 1XVYA 4AQ4A 1SD3A 1TFAA 1H45A 2Q9TA 3MUQA 4LUBA 1H43A 3GXAA 3C33A 4LZ5A 4NWCA 4HS7A 4QSEA 3A09A 4ZEIA 1XHYA 3TTMA 4HTGA 4EDPA 1OIBA 4F19A 2P0SA 1JW1A 1B40A 2Y7IA 4FEBA 4QFKA 1SW5A 4Z7EA 1MM7A 3CSBA 3FJMA 3OO7A 3H03A 5H8SA 2UVGA 5DYHA 4F1UA 1LFGA 3O28A 1FTKA 2NOOA 2PYYA 4RNSA 5AA3A 4U2RA 2RINA 4NF5B 1N76A 2ZYKA 4N6PA 1LFIA 2OBGA 3P7IA 4PFTA 4ZEFA 2NWJA 2XHDA 1B3GA 1URSA 3CR9A 4OFJA 4YICA 4G8HA 4RA1A 3S4UA 2DWHA 3OOAA 4H65A 3K0VA 3TFLA 1EU8A 4ELPA 3LSFB 2OWTA 3C34A 1DOTA 5EHMA 4EQ7A 2CMOA 1JETA 3GZGA 3SDFA 2ZYNA 2Y7PA 1J1NA 3KZGA 3D4CA 4X1BA 4F22A 5A5XA 1IUDA 3RT8A 1QVSA 2I3VA 3C4MA 5H8FB 3R7XA 3VFJA 5ELVA 1Y3NA 1N84A 3S9MC 1UTHB 2QL3A 3EPEA 3MPLA 4G68B 2Q2AA 4G68C 4R2BA 1USYH 2OZZA 5DEXA 5DVIA 1B7UA 3N5LA 4GRKA 4KQPA 3N94A 4OFLA 4ZS9A 1T0KA 1NFTA 3KN7A 2V3UA 1US5A 1OLAA 3O6IA 3PPNA 4EF1A 4G8NA 4JDFA 2KLFA 2P2AA 5IAIA 4F18A 4IO5A 3TYHA 3TTLA 4PQJA 4XXUA 2OWSA 3BFTA 2O6AA 3FVOA 4ISUA 2RC8A 4U4XA 2REGA 4H67A 5I84A 3MQ9A 2RCAA 1FQAA 3T9VA 3O6HA 5H8HB 3ZKKA 2RC7A 4N07A 1R9LA 3BKIB 5EHSA 1GGGA 1IZ1A 1SW4A 4KYDA 3ILUB 2ZXTA 2HQ0A 4R6YA 3U92A 4DLDA 1M5BA 3THIA 1HSLA 1S7YA 2XXYA 2ZNSA 1BIYA 1B4HA 3K01A 3DM0A 1LAFE 1Y1MA 4G68A 4I1DA 4LVQA 4Q30B 3O66A 3MZBA 4U1OA 5H8QA 1Q1KA 4E0XA 4JWYA 1AIVA 4G2ZA 1LAGE 3TQWA 1N3XA 2RKMA 4IGTA 2B3FA 2WKYA 3JV9A 3UORA 1P1OA 4XIGQ 1NH7A 4C0RA 5ICTA 3O97A 4QRZA 3H6VA 4LONB 1GR2A 1GVCA 2DXYA 4F29A 3HHFA 5H8FA 3OD7A 2DP8A 3DELB 2Z8EA 1MS7A 2ABHA 3IB1A 3IJXB 3LC8A 2F7AA 4FEDA 1TFDA 3V89B 4GD5A 5F7VA 1AL3A 4YKKA 3K6XA 2R71A 3E4RA 3R26A 3FVGA 2H98A 3C31A 2XX7A 3CG1A 3QUFA 4H6DA 4XKRA 3U93A 4OEUA 3K6WA 4K3FA 4GLIA 3VV5A 3IO6A 4ONYA 2ONSA 1Y3QA 1IEJA 3CFXA 4U1ZA 4EQ9A 3RN8A 3IO4A 1B05A 1VE4A 3I3VA 1L5TA 1ANFA 2IEEA 2I4CA 2UVIA 4KYEA 4IO6A 1FQFA 3TEPA 3KJ7A 4KD5A 2V84A 1IXHA 3MBPA 3OO6A 5CBSA 3FVKA 4LQ5A
chains in the Genus database with same CATH superfamily
4I9DA 4R6HA 4R9FA 3L6HA 1DK4A 1FTLA 4R9GA 1LB8A 3O9PA 3FGSA 1AOVA 4EF2A 5L9OA 1IXIA 2PX1A 3VE1B 1RYXA 4F3BA 1GV8A 2VGQA 4LATA 3T66A 2F7BA 3UA8A 4P0IA 4ELOA 5I56A 3G7WA 1XC1A 3PUYE 4G8MA 2B4LA 1P1WA 5LDZA 1O63A 1IIWA 1EH3A 2I0BA 4FAJA 2HAUA 3V5AA 3TTKA 3FXQA 2PFZA 4ZDMA 1MPBA 4EQBA 5DVJA 4MH5A 2O7UA 1MXZA 2QJEA 5EQ7A 3FVNA 1IXGA 4EXLA 4P9KA 2Y7RA 4N8GA 4L17A 1R1NA 1GTKA 1MDQA 4MX6A 1WODA 3RQTA 2XD3A 4GXSB 3OSQA 3TMGA 1SYIA 3IR1A 5DW8A 3V8XB 2UYFA 2I49A 1A99A 4NF6A 1XOCA 1ATGA 2P1SA 3HFUA 4IO4A 4KR5A 2CZKA 4TLMB 3G3HA 4PDDA 3USDA 3MZ1A 5DT6A 3RTWB 4N81A 4MIJA 5CI5A 4BDQA 1QULA 4HW8A 2O51A 3FJ7A 4POXA 2FVZA 5M2VA 2ZYOA 3SEYA 1NI9A 3UN6A 2Q8JA 3ROJA 1B7HA 1LAXA 2DWIA 1PB7A 2DS9A 1NNTA 1RYOA 1TT1A 1QGXA 3TCFA 4X48A 1IMCA 4JBZA 1IMBA 3GBBA 4P47A 3FXUA 1URDA 1I6QA 4JXIA 5H8NB 4MNIA 3SZPA 4I3YA 1US4A 1YCJA 2Z23A 4ESXA 2H9BA 4GL0A 3TEPA 2OWZA 1FQCA 4H1XA 4O7IA 1MRPA 4BLAA 1KA0A 5L9SA 2PVUA 1JEUA 4PE3A 3B7DA 4Q5TA 1FBDA 2D5WA 4GFRA 3SESA 4QFPA 4TOZA 4NWDA 1R9QA 2F6GA 2HCAA 5AA4A 3ISPA 5FHNA 1MPDA 3LSLA 3T0JA 4IY6A 3DP8A 1A8FA 4OZ9A 3A3UA 4JWXA 3SERA 4H5FA 1O7TA 2CEXA 3W15C 1PDAA 4OMBA 2A5TA 1MQHA 2Q88A 5B7DA 1OVTA 2B4MA 1F9BA 2XX9A 1B3LA 4ZE9A 4U4SA 4KCCA 5KCJA 3T96B 5EQ9A 4LQ2A 4WXJA 3EN3A 3T9UA 3QIMA 4PAFA 3SEXA 1LBBA 3QXMA 2XWVA 2FIXA 1JNFA 5J1DA 3M3FA 4FECA 4DI3D 1MXWA 1QUJA 3T9XB 2DE4A 1LGBC 1P1NA 2VHAA 3KG2A 2RF1A 4DE8A 2ALUA 1Z7NE 3B6TA 1DTGA 2QPQA 3G3KA 1B58A 3K4UA 5L9MA 2XXTA 5IKBA 4OQOA 5H8QB 3I6VA 4P56A 3SETA 2F8DA 1DCUA 3CFZA 1LCFA 4GIZA 1B1HA 4GBVA 4NF0A 3KN8A 2I4BA 1H3DA 1NV4A 2UYEA 4YB7A 2O1LA 2WBDA 3PPRA 3S9NC 3F11A 2IA4A 4RPNA 3DP4A 4R73A 1HSEA 5IZ1A 2XXWA 2ZMBA 1IXCA 4ESWA 2XXUA 3O6GA 4XTCQ 2Y84A 1OVBA 2V4CA 1B3HA 3RTFB 3K02A 1P1UA 1A40A 4DIGA 1IMFA 2Z8FA 4NF4A 1SVXB 1Z7ME 4NMYA 3OXNA 4N15A 1FBCA 3TODA 2H25A 4HCWA 4PBQA 2H4IA 1H45A 2Q9TA 3E78A 3GXAA 3A09A 3LUZA 3TTMA 4F19A 4FEBA 5ESYA 1MM7A 3OO7A 3B8BA 3H03A 5H8SA 2UVGA 1LFGA 1EYKA 2RINA 4NF5B 4N6PA 1FPGA 4OVRA 4YICA 4H65A 1EU8A 1YZ0A 2CMOA 1JETA 3GZGA 4F22A 3C4MA 3R7XA 3VFJA 4R2BA 5DVIA 3N5LA 1NV3A 4OFLA 1T0KA 3KN7A 2V3UA 1OLAA 3PPNA 4EF1A 4GBWA 3TYHA 3TTLA 4XXUA 4U4XA 4H67A 5ET7A 1YYZA 3ILUB 4DLDA 4R6YA 1FPDA 1S7YA 2CZIA 1BIYA 4Q30B 4G68A 1K9ZA 4I1DA 1AIVA 4JWYA 2F3DA 3O97A 1GR2A 1MS7A 4OVQA 2F7AA 2H98A 3U93A 3CG1A 4OEUA 3IO6A 2L5VA 1Y3QA 1IEJA 4U1ZA 1B05A 1VE4A 2UVIA 2V84A 5CBSA 4Q8RA 1B51A 1NKXA 4MNCA 4EUOA 4DDDA 4QF9A 4ECFA 2W7YA 5DTBA 4NTLA 4M1VA 5HBCA 1FPJA 1ZTYA 1JVXA 3EHUA 4NEDA 4F1YA 5I58B 5EYHA 2P3NA 5A5LA 2G29A 3JZJA 2AL5A 2HXRA 3MPKA 3S9EA 2DE3A 3RNNA 2Z8DA 1LFHA 5A5XB 1QKBA 4BDNA 3LUYA 4N17A 1LSTA 2HFBA 4MLVA 5LTCA 4KCDA 4ELQA 5FHMA 4KHZE 4N6DA 4GF8A 3CFLA 5F1QA 1VFEA 4Q0CA 4GQOA 2OCUA 4RPOA 3MSTA 2QS3A 1ELJA 2Q2CA 1LBVA 3N26A 4XKNA 3IAZA 3U8QA 2LAOA 4JB7A 3VLVA 2QVVA 3C32A 2I58A 5CC2A 1I6AA 2ZYMA 1A54A 3VXBA 4YMBA 1MQIA 4LN5A 4O3CA 4IGRA 4AB6A 3ZS6A 1Q35A 2QFLA 4R6KA 3GYYA 3OEKA 1RDZA 4G4PA 1PBPA 5HM4B 4JSOA 3B6WA 2I48A 1Q9DA 3KOTA 2X7PA 4ZE8A 1N0TA 1NUZA 5EYFA 2NVUB 5TPAA 3SEWA 2HZLA 2QS1A 4YKIA 3HPIA 3KGCA 2A5TB 4YU0A 3PUZE 4AS5A 2Y5LA 1B5JA 4RJZA 5JEIA 3BBRA 5I2KB 2FA7A 4IO2A 3OSRA 2ZNUA 2KR0A 1SDXA 2THIA 3PPPA 2HHMA 3PTYA 3V83A 1ZMGA 5KZTA 4TLLB 3PMVA 3TTNA 1FPIA 5CRYA 4OERA 1ZKBA 3TCHA 1SW1A 2G93A 3HV1A 4PGPA 5EYGA 5ITOA 2DWAA 4LZ8A 1JEVA 1DMBA 4GX6A 1MH4A 1FJ9A 4ZECA 1Y1ZA 2ANJA 3BIGA 3H4ZA 4QSDA 4YKJA 2UVJA 2UVHA 1SPIA 3VLUA 2X26A 3FJGA 3KSXA 5KDTA 3FATA 4MLQA 1M5FA 1HSJA 3O2AA 4BDRA 3QAXA 2PFYA 2RCBA 1DSNA 1FRPA 3H6UA 3TELA 4UABA 4XKQA 3G3FA 4OESA 1OMPA 4NF8B 1ZLQA 4PTKA 4R75A 1FSAA 4QHQA 2E0SA 1LBWA 3OENA 3DP6A 2QMXA 3IK6B 2YPNA 2F7CA 4BDMA 4MBPA 3MC2A 1Y20A 1Y4CA 1FQEA 3K1MA 1NUYA 5B70A 1MY0A 2HEUA 3A29A 5FTHA 3T93B 2CEYA 2R6GE 1N04A 4NE4A 4PETA 5ICQA 1DPEA 1SI0A 5CM6A 1AWBA 4MNPA 3W9WA 4F1VA 3S9LC 1RKMA 1IITA 4IO7A 1NV7A 4F31B 3H3GA 1YTVA 5K2XA 4O3BA 4GWZA 3OEMA 3IJOB 2HZKA 3EQ1A 4AS4A 4QFNA 3CVGA 3K00A 3PD9A 3TCGA 1MG1A 3KOSA 4I3EA 5AA2A 3K1PA 5I58A 1XS5A 4EXKA 4N8YA 3UP9A 3W9VA 4ZZAA 4QFOA 3K1NA 3PMWA 1NV5A 5H8HA 4PFWA 5CBRA 2Y7KA 5BUUA 5I57B 4F39A 1YXIA 4DXCA 4HE1A 4XEQA 3FUZA 3RGYA 3PU5A 3N6UA 1MY1A 4MFIA 1NV2A 5ISUA 1FBEA 2XWOA 1BKAA 3ILTB 4XKPA 3JYRA 2DE2A 4ZEKA 1MDP1 1MXXA 4GWYA 2REJA 4XFEA 4PFYA 4FE8A 1B5HA 5LOMA 3GLBA 4MHFA 2FIEA 1JP4A 4U23A 1S9TA 4AQ4A 3CHGA 1TFAA 4LUBA 1H43A 3C33A 4LZ5A 1XHYA 4HTGA 1B40A 1K9YA 4GX3A 4Z7EA 3FJMA 4QBAA 1FBGA 4F1UA 2PYYA 1N76A 1LFIA 2QVUA 2XHDA 3S4UA 4RA1A 3TFLA 3C34A 5EHMA 3SDFA 2ZYNA 1J1NA 4N91A 4X1BA 5H8FB 1UTHB 2QL3A 1B7UA 4GRKA 4KQPA 4PFIA 4ZS9A 1US5A 4G8NA 4JDFA 2KLFA 5IAIA 2OWSA 4ISUA 2RC8A 3O6HA 2RC7A 4N07A 1R9LA 1IZ1A 1SW4A 3U92A 1HSLA 2XXYA 3RUMA 3DM0A 1Q1KA 1N3XA 3UORA 3JV9A 4C0RA 1P1OA 1NH7A 2ZZXA 4QRZA 1GVCA 4F29A 3HHFA 3OD7A 2DP8A 2Z8EA 3IB1A 5F7VA 1AL3A 3FVGA 3C31A 2XX7A 4H6DA 1LEVA 2ONSA 3IO4A 3I3VA 1ANFA 1FQFA 1IXHA 3MBPA 3FVKA 3EKIA 5ICTA 3QK6A 4F3PA 4X8RA 1A55A 1B0HA 3HSTA 2VD2A 3FV2A 4FORA 1POTA 2ZNTA 5K2YA 2O68A 1Y3PA 4DCXA 1B6HA 4I62A 4YAHX 4E0WA 3KC1A 5CMBA 4EDPA 4ZEBA 2GHAA 3MVZA 3MZ9A 2I0CA 4GOTA 4I40A 3DLNA 4NF8A 4G77A 4GXAA 2XXPA 1NNPA 3PV0E 3D1RA 4NF6B 4R72A 2BJJX 2FHYA 1B52A 3C9HA 4DXBA 3UK4A 1KWHA 1LBCA 5IM2A 3HHGA 1LAHE 3PD8A 4OWDA 1MQDA 3QYTA 2F35A 1JQFA 3CG3A 3MJNA 1UTBB 3PUWE 1FQBA 4GWUA 2KQZA 3SEUA 2GRVA 4RK2A 2PT1A 2YJPA 4PF6A 4KFQA 3LSXA 4DZ1A 1QKAA 3U94A 4ZZEA 4KYSA 1JW5A 3HO7A 5I57A 4PE5B 1TXFA 4I8CA 3LR1A 4P11A 4MMPA 2HPGA 3TDJA 2V3TA 3I5OA 1FPKA 1INPA 4P3LA 4F3SA 4OFOA 2GFEA 5IZ3A 1NUWA 2H99A 4PDHA 2B65A 4X1DA 2XWIA 5JK4A 4OYVA 3BFUA 4KI0E 5H8NA 4P1LA 3LBSA 3VVDA 4IO3A 5CMKA 2FNCA 2QSXA 3RYDA 2F34A 2F78A 5I2NA 4FATA 1P99A 3VXCA 3IORA 2YLNA 2I6EA 1UIVA 3EF7A 1FTMA 3IFCA 1MY3A 1XVXA 4F2OA 4OHNA 1G0HA 1PB9A 3OELA 2V25A 3PMXA 1H44A 1M5DA 4YKPA 2OX3A 1WVJA 4F2QA 3Q26A 1LBYA 4N4UA 4WKMA 1MXUA 1LCTA 3VLWA 3MP6A 2AYSA 2DQVA 5I59A 5TP9B 1ZBMA 3ECRA 1O64A 3VVEA 4PFBA 2JJKA 3S2VA 4OEVA 1B5IA 4FBPA 1EZOA 2QMWA 3K6VA 4Z0IA 2XXRA 3OMBA 2QRYA 4BDOA 4U21A 4G61A 1LBZA 4QXDA 4ZEDA 1IMAA 5CMCA 5I2NB 3EHTA 2PT2A 1D3KA 3PPOA 4PC9A 1IMEA 5TU0A 3KJTA 3ONMA 1NMUA 3O29A 2NXOA 2O7IA 4LP2B 1NNFA 1NV1A 3FD3A 1SQYA 3Q27A 3CRBA 2DXRA 3QSLA 2XXIA 3R6UA 3RPWA 5EQAA 4GWWA 3H7MA 4RXLA 3MVYA 3IOVA 5DEXB 3K6UA 3QMFA 5I56B 1XT8A 3AXFA 2E1SA 1NH8A 3OO8A 2CZLA 4NG7A 5HPQA 4GL8A 2OJTA 4TQUQ 4N13A 1BTJA 4QSCA 2XXQA 4MCOA 4PCDA 4RY1A 1N7WA 1UTBA 4OVSA 1AH5A 1MQJA 3CI8A 2B3BA 2PBWA 2D3IA 4KXPA 1FW0A 1I6BA 1B2HA 3U72A 1B4ZA 4P1EA 4WEPA 3TQLA 1FBPA 3GBAA 4OXVA 1XI6A 1DPPA 4JSDA 4JVCA 3BIHA 2RC9A 1POY1 2H5YA 4THIA 3IOUA 1A7LA 1CNQA 1AMFA 2PCRA 1DTZA 2I3WA 4NAPA 1B1XA 2R9JA 3KBZA 1WDNA 4OENA 4MAGA 2AIXA 3ZSFA 2VP1A 2F36A 2V3QA 1SYHA 2ESNA 5JTYA 5TP9A 1XVYA 1SD3A 4JVIA 2CZHA 4ZEIA 2Q74A 1OIBA 2P0SA 4QFKA 1SW5A 3CSBA 3B50A 1FTKA 2NOOA 4HXVA 4RNSA 4U2RA 4ZEFA 3P7IA 1B3GA 3CR9A 4OFJA 4PBHA 4G8HA 2DWHA 4X04A 3K0VA 3KZGA 5A5XA 5IGAA 1QVSA 5ELVA 1Y3NA 1N84A 3EPEA 2Q2AA 4G68C 1EYJA 1USYH 2OZZA 5DEXA 2F3BA 3N94A 4F18A 4IO5A 4PQJA 3BFTA 2WYPA 5I84A 2RCAA 5H8HB 3ZKKA 2WEFA 3BKIB 5EHSA 3THIA 2QVRA 2ZNSA 1B4HA 1LAFE 3FXBA 4LVQA 5H8QA 3MZBA 4G2ZA 1LAGE 4PAIA 2RKMA 4IGTA 2B3FA 3H6VA 4PGNA 4PAKA 3DELB 2P3VA 2Y5KA 3IJXB 4FEDA 1TFDA 3V89B 4GD5A 4YKKA 3K6XA 3QUFA 4GLIA 3VV5A 4ONYA 3CFXA 4EQ9A 4PF8A 1L5TA 1KZ8A 2I4CA 4KYEA 5I3SA 4IO6A 3KJ7A 2XXKA 5J16A 4LQ5A 1QUIA 2ZZWA 1PB8A 2VD3A 4OVJA 1B9JA 3E9XA 3HCQA 5JTYB 4BDLA 3VDFA 1MQGA 5I59B 4RK9A 2NUVA 3T9HB 4JWOA 4LA9A 3HN0A 4O8MA 1D4NA 4NF5A 1EZ9A 5IZZA 3E13X 4P8BA 3PUVE 2ZZVA 4C1TA 1SI1A 5AE4A 3A3CA 2GH9A 1CE2A 2DVZA 4OTEA 3RPLA 2V93A 4P0GA 1EZPA 4U22A 4YB5A 4DI4B 1MXYA 1MM6A 1NL5A 4NN3A 2O1MA 1B32A 1N3WA 4H8IA 2DVCA 3WAFA 1OLCA 4RYAA 3FZVA 2XXXA 3K2DA 4H8JA 2X7QA 3L6GA 1P1QA 2HXWA 3M8UA 5L8DA 1UIUA 1FQDA 1A8EA 3D4GA 2XXHA 1EYIA 1QJMA 3PUXE 5ET8A 3H6WA 2FBPA 3MWBA 4F3GA 1M5EA 4PFUA 1VFDA 2VOZA 2VPNA 2Z22A 3FIRA 3FBPA 1QUKA 1CB6A 3C35A 4UACA 3TKDA 2GHBA 1IQ7A 3M3LA 4H46A 2XXVA 4OVTA 4LZ7A 2PMSA 4POWA 3IFAA 1B3FA 3RPLB 2XA5A 5IZ3B 3G3IA 1UTHA 5FHOA 5DVFA 3NOHA 4GWOA 2ONKE 4H5GA 4C1UA 4DCYA 1MPCA 1FTAA 3Q28A 1USYE 4DXUA 3CIJA 2DOJA 3E3KA 1ZU0A 3UGWA 5TPAB 4H0WA 4UA8A 1FPBA 1YPNA 1B0LA 4XF5A 2DWJA 1B7ZA 1S50A 2A5SA 2F5XA 4ND9A 2WYKA 3TPAA 1VSOA 3RT6B 1IMDA 3UIFA 3T22A 4JVDA 1YAEA 3U65A 3IB0A 4KPTA 4YZZA 2XX8A 3FASA 3FXRA 5AA2D 1D9VA 3OO9A 1I69A 1D9QA 1NV6A 1RDYA 3PGFA 1FTJA 1Y9UA 1SW2A 5KCJB 2AL4A 3TTRA 4R2FA 1II5A 1VR5A 3C36A 3TZAA 4HCYA 4ELRA 3TAJA 1H76A 3WAEA 5AA4B 3KC0A 4MF3A 5I5PA 1FPEA 2DYXA 3MVWA 1D9YA 1ZIUA 3MVXA 2GQ1A 3MW0A 5ITPA 1Y4TA 1N7XA 2WX9A 4NGUA 2QS4A 3SEVA 1TWYA 2OLBA 3B6QA 1OQHA 5AA2B 5I2KA 1SBPA 3KEIA 1MH3A 1FCKA 4O3AA 2O69A 4YB6A 3Q29A 1DBZA 3VVFA 4PFRA 4X9TA 4YMAA 4NF4B 2DSFA 4OA4A 3IX1A 4N6KA 4NX1A 1URGA 3IOWA 1B3EA 2UXAA 4M4GA 1VDWA 2QS2A 5FTIA 4GVOA 3RLFE 4FJPA 1ZJLA 4IB2A 4R74A 1JVYA 1LBXA 1MXVA 3KBRA 3KFMA 5I7IA 4OVPA 2Q89A 3H06B 5ET6A 3CSGA 2F97A 3U1OA 4O94A 1LB9A 2FYIA 3MP8A 3IOTA 1FTOA 3T1BA 1PBQA 1MY4A 4OANA 1FJ6A 2F6PA 4FIMA 3N6TA 5CMMA 3M3KA 4QFLA 3RY3A 3PPQA 1FBHA 2Q8MA 3MP1A 3KN3A 2HAVA 2Y7WA 2DDKA 5AA1A 2M8CA 1UQWA 4MEVA 3SKPA 3QUJA 4WEDA 3MAMA 4OETA 1PEBA 3KSJA 3Q25A 3G3GA 1BP5A 2XWKA 3LSWA 3IB2A 2ONRA 5KDTB 4H45A 3EHSA 1B46A 2XD2A 3LV0A 1PC3A 2D21A 3TUSA 4AB5A 3G3JA 3IL1B 3ZKLA 1QW0A 5FBPA 3ODBA 1R6ZA 4PP0A 2MKZA 2O84X 1NV0A 2OK2A 3FV1A 2WBBA 3H6TA 1LLSA 5BWJA 4HE0A 1FBFA 1NNKA 1OQGA 1BLFA 1JW4A 4IR8A 1M5CA 1MY2A 4IY5A 2VPOA 2VT5A 1BK4A 3MUQA 4QSEA 4NWCA 4HS7A 1G0IA 1JW1A 2Y7IA 5DYHA 1FPFA 3O28A 5AA3A 4NHBA 2NWJA 2ZYKA 4PFTA 2OBGA 1URSA 3E79A 3OOAA 4ELPA 3LSFB 2OWTA 4EQ7A 1DOTA 1RDXA 2Y7PA 3D4CA 1IUDA 3RT8A 2I3VA 5F24A 3S9MC 3MPLA 4G68B 5EQ8A 1NFTA 5T3JA 3O6IA 2BJIA 2R8TA 2P2AA 2O6AA 3FVOA 4NQ8A 2REGA 3MQ9A 1FQAA 4MJOA 3T9VA 1GGGA 4KYDA 2ZXTA 2HQ0A 1M5BA 3K01A 1Y1MA 4E0XA 3O66A 4U1OA 3TQWA 4GWXA 3MYUA 2WKYA 4XIGQ 4O7MA 4LONB 2DXYA 5H8FA 5ET5A 2ABHA 3LC8A 1FPLA 3R26A 2R71A 3E4RA 4XKRA 4HE2A 3K6WA 4K3FA 1KA1A 3RN8A 1NUXA 2IEEA 4GX4A 4KD5A 3OO6A 4GWSA
chains in the Genus database with same CATH topology
1B51A 4I9DA 1NKXA 4R6HA 1QUIA 4R9FA 4EUOA 4DDDA 3QK6A 4F3PA 4QF9A 3L6HA 1A55A 4ECFA 1B0HA 2W7YA 5DTBA 4NTLA 1PB8A 1FTLA 2VD3A 4M1VA 4OVJA 4R9GA 1B9JA 3E9XA 3HSTA 2VD2A 3FV2A 3HCQA 4FORA 5JTYB 1POTA 2ZNTA 5K2YA 1LB8A 4BDLA 2O68A 5HBCA 3O9PA 1Y3PA 4DCXA 3VDFA 3FGSA 1B6HA 4I62A 4YAHX 1ZTYA 4E0WA 1AOVA 1MQGA 5I59B 4EF2A 4RK9A 1JVXA 1IXIA 2PX1A 2GHAA 2NUVA 3EHUA 5CMBA 3MVZA 4JWOA 4ZEBA 3T9HB 4LA9A 3HN0A 1RYXA 3VE1B 1GV8A 2VGQA 4LATA 3MZ9A 2I0CA 4NEDA 4F3BA 4F1YA 4GOTA 1D4NA 5I58B 4NF5A 3DLNA 2G29A 2F7BA 3JZJA 3T66A 2AL5A 3MPKA 3S9EA 3UA8A 4NF8A 1EZ9A 3E13X 4G77A 2DE3A 3PUVE 4P0IA 4ELOA 4GXAA 2XXPA 5I56A 3G7WA 1XC1A 3RNNA 4C1TA 2Z8DA 1SI1A 3PUYE 5AE4A 4G8MA 3A3CA 1NNPA 3PV0E 5L9OA 1LFHA 2GH9A 1CE2A 2DVZA 4OTEA 5A5XB 4NF6B 1P1WA 1QKBA 2V93A 3LUYA 4P0GA 4R72A 4BDNA 1EZPA 2BJJX 4U22A 1O63A 1IIWA 1LSTA 4YB5A 1EH3A 1B52A 3C9HA 1MXYA 1MM6A 1NL5A 2HFBA 4MLVA 4DXBA 3UK4A 2I0BA 2O1MA 4FAJA 1KWHA 2HAUA 1LBCA 3V5AA 1B32A 1N3WA 4KCDA 3HHGA 1LAHE 2DVCA 3PD8A 4H8IA 4OWDA 5FHMA 3TTKA 4KHZE 1MQDA 3FXQA 1OLCA 3WAFA 4RYAA 4ZDMA 3QYTA 3FZVA 4GF8A 2XXXA 1MPBA 3K2DA 2F35A 3CFLA 4H8JA 5DVJA 1JQFA 4EQBA 3V83A 5F1QA 3CG3A 5KZTA 1VFEA 2X7QA 4Q0CA 3L6GA 4GQOA 2OCUA 4MH5A 2O7UA 3MJNA 4RPOA 1UTBB 1MXZA 2QJEA 3PUWE 1P1QA 2HXWA 3M8UA 5L8DA 1UIUA 1FQBA 1FQDA 3SEUA 1A8EA 2GRVA 2QS3A 3D4GA 2XXHA 4RK2A 2PT1A 2YJPA 1ELJA 2Q2CA 1QJMA 3FVNA 3PUXE 1IXGA 3H6WA 4EXLA 3MWBA 4F3GA 1M5EA 4KFQA 3LSXA 4PFUA 3N26A 4XKNA 1VFDA 2VOZA 4DZ1A 3IAZA 2Z22A 2Y7RA 1QKAA 3FIRA 3U94A 3U8QA 2LAOA 4L17A 4JB7A 4ZZEA 1R1NA 1QUKA 1GTKA 1JW5A 3C32A 2I58A 4KYSA 3VLVA 3HO7A 5CC2A 1CB6A 5I57A 1I6AA 2ZYMA 1A54A 3VXBA 1MDQA 4PE5B 1TXFA 4I8CA 3C35A 1MQIA 1WODA 4YMBA 3RQTA 2XD3A 3LR1A 4O3CA 4P11A 4UACA 4IGRA 3TKDA 2GHBA 4AB6A 4GXSB 3ZS6A 3OSQA 3TDJA 1IQ7A 1Q35A 4R6KA 3M3LA 3OEKA 3TMGA 1SYIA 3IR1A 2V3TA 2XXVA 4G4PA 3I5OA 4LZ7A 2PMSA 4POWA 1PBPA 3V8XB 2UYFA 4F3SA 4OFOA 2I49A 1B3FA 2GFEA 4JSOA 5HM4B 1A99A 3B6WA 4NF6A 1XOCA 2I48A 3G3IA 2H99A 1UTHA 5FHOA 1ATGA 2B65A 2P1SA 5DVFA 3KOTA 4GWOA 4IO4A 2ONKE 4H5GA 4KR5A 2X7PA 4X1DA 4C1UA 4TLMB 4DCYA 1MPCA 4ZE8A 5JK4A 4OYVA 1N0TA 3G3HA 3BFUA 5EYFA 3Q28A 4KI0E 1USYE 5H8NA 4DXUA 3USDA 3LBSA 3VVDA 3CIJA 2NVUB 2DOJA 3E3KA 1ZU0A 3MZ1A 5TPAA 5DT6A 3RTWB 3UGWA 4Q8RA 4IO3A 3SEWA 2HZLA 5CMKA 5CI5A 4H0WA 4UA8A 5TPAB 4BDQA 2FNCA 2QS1A 4YKIA 3HPIA 1QULA 3KGCA 1YPNA 2O51A 2QSXA 3FJ7A 4POXA 4HW8A 2F34A 2A5TB 2F78A 4YU0A 5M2VA 3PUZE 1B0LA 2DWJA 5I2NA 1B7ZA 2ZYOA 3SEYA 4FATA 1P99A 1S50A 2A5SA 1B5JA 2F5XA 4RJZA 5JEIA 3BBRA 4ND9A 5I2KB 3TPAA 3VXCA 3UN6A 1VSOA 2FA7A 3IORA 3RT6B 4IO2A 3OSRA 2Q8JA 3UIFA 3T22A 1YAEA 2YLNA 2ZNUA 1B7HA 3IB0A 4KPTA 1LAXA 1UIVA 2I6EA 1SDXA 2DWIA 1PB7A 2THIA 1FTMA 3EF7A 2DS9A 3PPPA 1MY3A 1XVXA 1NNTA 1RYOA 1TT1A 4GL8A 4OHNA 1ZMGA 1PB9A 3OELA 4YZZA 3TCFA 4F2OA 2V25A 3PMXA 4X48A 1H44A 1M5DA 2XX8A 4TLLB 4JBZA 4YKPA 3PMVA 3TTNA 1WVJA 3FASA 5CRYA 4F2QA 4OERA 3FXRA 3Q26A 1ZKBA 3TCHA 4WKMA 1SW1A 3GBBA 1D9VA 2G93A 3HV1A 1MXUA 5AA2D 3OO9A 1I69A 3FXUA 1LCTA 3VLWA 1URDA 1I6QA 3MP6A 4JXIA 5H8NB 4ELQA 2AYSA 2DQVA 5I59A 3PGFA 1FTJA 1ZBMA 2DWAA 5ITOA 1Y9UA 5TP9B 1SW2A 4LZ8A 1US4A 1YCJA 2Z23A 1JEVA 3ECRA 1DMBA 4ESXA 5KCJB 2AL4A 3TTRA 1O64A 4R2FA 2H9BA 1MH4A 4GL0A 1II5A 1VR5A 3C36A 3TZAA 1Y1ZA 4ZECA 2ANJA 1FQCA 4HCYA 4ELRA 4H1XA 3VVEA 1MRPA 4BLAA 3TAJA 1H76A 3H4ZA 4QSDA 3WAEA 3RUMA 5AA4B 5L9SA 4MF3A 2PVUA 4YKJA 1JEUA 2UVJA 2UVHA 3B7DA 3VLUA 2X26A 4OEVA 4Q5TA 2DYXA 3S2VA 3MVWA 1B5IA 3FJGA 1EZOA 1D9YA 1ZIUA 3KSXA 3MVXA 2D5WA 4GFRA 3FATA 4MLQA 3MW0A 5KDTA 5ITPA 1Y4TA 1M5FA 1N7XA 1HSJA 2QMWA 3O2AA 3SESA 2QS4A 3K6VA 4QFPA 3QAXA 4TOZA 4Z0IA 4BDRA 2RCBA 3SEVA 1DSNA 2XXRA 3OMBA 4NWDA 1R9QA 2QRYA 2F6GA 1TWYA 3H6UA 2HCAA 2OLBA 3B6QA 1OQHA 4BDOA 5AA2B 4U21A 5AA4A 3TELA 5I2KA 4ZEDA 5FHNA 1MPDA 3LSLA 5CMCA 5I2NB 1SBPA 3EHTA 2PT2A 3KEIA 4IY6A 4XKQA 3DP8A 1A8FA 1D3KA 1MH3A 1FCKA 3A3UA 3G3FA 3PPOA 4JWXA 1OMPA 2O69A 4O3AA 4OESA 3SERA 5TU0A 4H5FA 3Q29A 1ZLQA 3KJTA 4NF8B 4YB6A 1O7TA 4R75A 3W15C 3ONMA 4QHQA 3VVFA 1PDAA 2E0SA 4OMBA 1NMUA 2A5TA 3O29A 1MQHA 2NXOA 4X9TA 3OENA 3DP6A 4YMAA 4NF4B 2O7IA 2Q88A 4LP2B 2DSFA 5B7DA 3IX1A 1URGA 2QMXA 1B3EA 1NNFA 3IK6B 3IOWA 2UXAA 2YPNA 3FD3A 2F7CA 1OVTA 4BDMA 1SQYA 1F9BA 4MBPA 4M4GA 3MC2A 3CRBA 2DXRA 2XX9A 1B3LA 1Y20A 2QS2A 3Q27A 1Y4CA 5FTIA 4GVOA 3RLFE 4FJPA 4ZE9A 4U4SA 1ZJLA 1FQEA 3QSLA 4IB2A 4KCCA 4R74A 1JVYA 5KCJA 3K1MA 2XXIA 3T96B 5B70A 1MY0A 3R6UA 4LQ2A 2HEUA 3RPWA 4WXJA 3H7MA 4RXLA 5FTHA 3EN3A 3T93B 1MXVA 3T9UA 3KBRA 3KFMA 3QIMA 3MVYA 2R6GE 1N04A 4NE4A 4PETA 3IOVA 5ICQA 5DEXB 3SEXA 1DPEA 3K6UA 1LBBA 1SI0A 2Q89A 3H06B 3QXMA 3CSGA 5I56B 2F97A 5CM6A 3U1OA 1JNFA 5J1DA 1XT8A 3M3FA 3AXFA 3W9WA 4F1VA 1LB9A 2E1SA 2FYIA 1NH8A 4FECA 3S9LC 1RKMA 3MP8A 1IITA 3OO8A 3IOTA 1MXWA 1QUJA 3T9XB 2CZLA 2DE4A 1LGBC 1P1NA 2VHAA 3KG2A 1FTOA 2RF1A 1PBQA 1MY4A 4IO7A 2ALUA 4DE8A 5HPQA 4F31B 2F6PA 1Z7NE 2OJTA 3B6TA 3H3GA 1DTGA 1YTVA 2QPQA 3G3KA 3M3KA 3N6TA 4FIMA 5CMMA 4QFLA 4TQUQ 5K2XA 3PPQA 4O3BA 4N13A 3RY3A 3OEMA 1BTJA 3IJOB 1B58A 2HZKA 3EQ1A 3MP1A 3KN3A 2XXQA 2HAVA 2Y7WA 3K4UA 4QSCA 4QFNA 5L9MA 2XXTA 5IKBA 4OQOA 3CVGA 5H8QB 3I6VA 4RY1A 5AA1A 1N7WA 2F8DA 3K00A 2M8CA 1UQWA 3PD9A 3SETA 1UTBA 3TCGA 3CFZA 3QUJA 1MG1A 1LCFA 4WEDA 3KOSA 4GIZA 3MAMA 3SKPA 4OETA 1AH5A 5AA2A 3K1PA 1MQJA 1PEBA 1B1HA 1XS5A 5I58A 4EXKA 3CI8A 3UP9A 3W9VA 2B3BA 2PBWA 3KSJA 4ZZAA 3Q25A 3KN8A 2D3IA 4QFOA 3G3GA 3K1NA 1FW0A 3PMWA 1BP5A 3LSWA 2I4BA 1H3DA 2UYEA 3IB2A 2O1LA 4YB7A 2ONRA 1I6BA 5H8HA 3PPRA 4PFWA 5KDTB 3S9NC 5CBRA 2Y7KA 3EHSA 3F11A 2IA4A 1B2HA 1B46A 4RPNA 3DP4A 3U72A 1B4ZA 5BUUA 4R73A 1HSEA 3TQLA 4WEPA 5I57B 3TUSA 2XD2A 4F39A 1PC3A 2D21A 2XXWA 1IXCA 2ZMBA 2XXUA 3GBAA 4OXVA 4AB5A 4DXCA 3G3JA 4ESWA 3O6GA 3IL1B 1DPPA 3ZKLA 1QW0A 4XTCQ 3ODBA 2Y84A 1R6ZA 4JSDA 1OVBA 3FUZA 1B3HA 3RGYA 2RC9A 3RTFB 3PU5A 3N6UA 1POY1 1P1UA 1MY1A 2H5YA 3K02A 4MFIA 3IOUA 4PP0A 1A7LA 4THIA 1A40A 5ISUA 1AMFA 1BKAA 4DIGA 2O84X 1DTZA 2I3WA 3ILTB 2OK2A 3FV1A 4XKPA 1B1XA 3JYRA 2R9JA 2DE2A 4ZEKA 2Z8FA 3H6TA 1LLSA 4NF4A 5BWJA 1MDP1 1MXXA 1WDNA 4OENA 1NNKA 1OQGA 2AIXA 1BLFA 1JW4A 1SVXB 1Z7ME 2REJA 4NMYA 3ZSFA 3OXNA 4FE8A 4PFYA 1B5HA 2VP1A 5LOMA 3TODA 2F36A 1M5CA 2H25A 3GLBA 2V3QA 4HCWA 1SYHA 2ESNA 1MY2A 4OZ9A 4IY5A 4U23A 1S9TA 5JTYA 2H4IA 5TP9A 1XVYA 4AQ4A 1SD3A 1TFAA 1H45A 2Q9TA 3MUQA 4LUBA 1H43A 3GXAA 3C33A 4LZ5A 4NWCA 4HS7A 4QSEA 3A09A 4ZEIA 1XHYA 3TTMA 4HTGA 4EDPA 1OIBA 4F19A 2P0SA 1JW1A 1B40A 2Y7IA 4FEBA 4QFKA 1SW5A 4Z7EA 1MM7A 3CSBA 3FJMA 3OO7A 3H03A 5H8SA 2UVGA 5DYHA 4F1UA 1LFGA 3O28A 1FTKA 2NOOA 2PYYA 4RNSA 5AA3A 4U2RA 2RINA 4NF5B 1N76A 2ZYKA 4N6PA 1LFIA 2OBGA 3P7IA 4PFTA 4ZEFA 2NWJA 2XHDA 1B3GA 1URSA 3CR9A 4OFJA 4YICA 4G8HA 4RA1A 3S4UA 2DWHA 3OOAA 4H65A 3K0VA 3TFLA 1EU8A 4ELPA 3LSFB 2OWTA 3C34A 1DOTA 5EHMA 4EQ7A 2CMOA 1JETA 3GZGA 3SDFA 2ZYNA 2Y7PA 1J1NA 3KZGA 3D4CA 4X1BA 4F22A 5A5XA 1IUDA 3RT8A 1QVSA 2I3VA 3C4MA 5H8FB 3R7XA 3VFJA 5ELVA 1Y3NA 1N84A 3S9MC 1UTHB 2QL3A 3EPEA 3MPLA 4G68B 2Q2AA 4G68C 4R2BA 1USYH 2OZZA 5DEXA 5DVIA 1B7UA 3N5LA 4GRKA 4KQPA 3N94A 4OFLA 4ZS9A 1T0KA 1NFTA 3KN7A 2V3UA 1US5A 1OLAA 3O6IA 3PPNA 4EF1A 4G8NA 4JDFA 2KLFA 2P2AA 5IAIA 4F18A 4IO5A 3TYHA 3TTLA 4PQJA 4XXUA 2OWSA 3BFTA 2O6AA 3FVOA 4ISUA 2RC8A 4U4XA 2REGA 4H67A 5I84A 3MQ9A 2RCAA 1FQAA 3T9VA 3O6HA 5H8HB 3ZKKA 2RC7A 4N07A 1R9LA 3BKIB 5EHSA 1GGGA 1IZ1A 1SW4A 4KYDA 3ILUB 2ZXTA 2HQ0A 4R6YA 3U92A 4DLDA 1M5BA 3THIA 1HSLA 1S7YA 2XXYA 2ZNSA 1BIYA 1B4HA 3K01A 3DM0A 1LAFE 1Y1MA 4G68A 4I1DA 4LVQA 4Q30B 3O66A 3MZBA 4U1OA 5H8QA 1Q1KA 4E0XA 4JWYA 1AIVA 4G2ZA 1LAGE 3TQWA 1N3XA 2RKMA 4IGTA 2B3FA 2WKYA 3JV9A 3UORA 1P1OA 4XIGQ 1NH7A 4C0RA 5ICTA 3O97A 4QRZA 3H6VA 4LONB 1GR2A 1GVCA 2DXYA 4F29A 3HHFA 5H8FA 3OD7A 2DP8A 3DELB 2Z8EA 1MS7A 2ABHA 3IB1A 3IJXB 3LC8A 2F7AA 4FEDA 1TFDA 3V89B 4GD5A 5F7VA 1AL3A 4YKKA 3K6XA 2R71A 3E4RA 3R26A 3FVGA 2H98A 3C31A 2XX7A 3CG1A 3QUFA 4H6DA 4XKRA 3U93A 4OEUA 3K6WA 4K3FA 4GLIA 3VV5A 3IO6A 4ONYA 2ONSA 1Y3QA 1IEJA 3CFXA 4U1ZA 4EQ9A 3RN8A 3IO4A 1B05A 1VE4A 3I3VA 1L5TA 1ANFA 2IEEA 2I4CA 2UVIA 4KYEA 4IO6A 1FQFA 3TEPA 3KJ7A 4KD5A 2V84A 1IXHA 3MBPA 3OO6A 5CBSA 3FVKA 4LQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B51 A;  4I9D A;  1NKX A;  4R6H A;  1QUI A;  4R9F A;  4EUO A;  4DDD A;  3QK6 A;  4F3P A;  4QF9 A;  3L6H A;  1A55 A;  4ECF A;  1B0H A;  2W7Y A;  5DTB A;  4NTL A;  1PB8 A;  1FTL A;  2VD3 A;  4M1V A;  4OVJ A;  4R9G A;  1B9J A;  3E9X A;  3HST A;  2VD2 A;  3FV2 A;  3HCQ A;  4FOR A;  5JTY B;  1POT A;  2ZNT A;  5K2Y A;  1LB8 A;  4BDL A;  2O68 A;  5HBC A;  3O9P A;  1Y3P A;  4DCX A;  3VDF A;  3FGS A;  1B6H A;  4I62 A;  4YAH X;  1ZTY A;  4E0W A;  1AOV A;  1MQG A;  5I59 B;  4EF2 A;  4RK9 A;  1JVX A;  1IXI A;  2PX1 A;  2GHA A;  2NUV A;  3EHU A;  5CMB A;  3MVZ A;  4JWO A;  4ZEB A;  3T9H B;  4LA9 A;  3HN0 A;  1RYX A;  3VE1 B;  1GV8 A;  2VGQ A;  4LAT A;  3MZ9 A;  2I0C A;  4NED A;  4F3B A;  4F1Y A;  4GOT A;  1D4N A;  5I58 B;  4NF5 A;  3DLN A;  2G29 A;  2F7B A;  3JZJ A;  3T66 A;  2AL5 A;  3MPK A;  3S9E A;  3UA8 A;  4NF8 A;  1EZ9 A;  3E13 X;  4G77 A;  2DE3 A;  3PUV E;  4P0I A;  4ELO A;  4GXA A;  2XXP A;  5I56 A;  3G7W A;  1XC1 A;  3RNN A;  4C1T A;  2Z8D A;  1SI1 A;  3PUY E;  5AE4 A;  4G8M A;  3A3C A;  1NNP A;  3PV0 E;  5L9O A;  1LFH A;  2GH9 A;  1CE2 A;  2DVZ A;  4OTE A;  5A5X B;  4NF6 B;  1P1W A;  1QKB A;  2V93 A;  3LUY A;  4P0G A;  4R72 A;  4BDN A;  1EZP A;  2BJJ X;  4U22 A;  1O63 A;  1IIW A;  1LST A;  4YB5 A;  1EH3 A;  1B52 A;  3C9H A;  1MXY A;  1MM6 A;  1NL5 A;  2HFB A;  4MLV A;  4DXB A;  3UK4 A;  2I0B A;  2O1M A;  4FAJ A;  1KWH A;  2HAU A;  1LBC A;  3V5A A;  1B32 A;  1N3W A;  4KCD A;  3HHG A;  1LAH E;  2DVC A;  3PD8 A;  4H8I A;  4OWD A;  5FHM A;  3TTK A;  4KHZ E;  1MQD A;  3FXQ A;  1OLC A;  3WAF A;  4RYA A;  4ZDM A;  3QYT A;  3FZV A;  4GF8 A;  2XXX A;  1MPB A;  3K2D A;  2F35 A;  3CFL A;  4H8J A;  5DVJ A;  1JQF A;  4EQB A;  3V83 A;  5F1Q A;  3CG3 A;  5KZT A;  1VFE A;  2X7Q A;  4Q0C A;  3L6G A;  4GQO A;  2OCU A;  4MH5 A;  2O7U A;  3MJN A;  4RPO A;  1UTB B;  1MXZ A;  2QJE A;  3PUW E;  1P1Q A;  2HXW A;  3M8U A;  5L8D A;  1UIU A;  1FQB A;  1FQD A;  3SEU A;  1A8E A;  2GRV A;  2QS3 A;  3D4G A;  2XXH A;  4RK2 A;  2PT1 A;  2YJP A;  1ELJ A;  2Q2C A;  1QJM A;  3FVN A;  3PUX E;  1IXG A;  3H6W A;  4EXL A;  3MWB A;  4F3G A;  1M5E A;  4KFQ A;  3LSX A;  4PFU A;  3N26 A;  4XKN A;  1VFD A;  2VOZ A;  4DZ1 A;  3IAZ A;  2Z22 A;  2Y7R A;  1QKA A;  3FIR A;  3U94 A;  3U8Q A;  2LAO A;  4L17 A;  4JB7 A;  4ZZE A;  1R1N A;  1QUK A;  1GTK A;  1JW5 A;  3C32 A;  2I58 A;  4KYS A;  3VLV A;  3HO7 A;  5CC2 A;  1CB6 A;  5I57 A;  1I6A A;  2ZYM A;  1A54 A;  3VXB A;  1MDQ A;  4PE5 B;  1TXF A;  4I8C A;  3C35 A;  1MQI A;  1WOD A;  4YMB A;  3RQT A;  2XD3 A;  3LR1 A;  4O3C A;  4P11 A;  4UAC A;  4IGR A;  3TKD A;  2GHB A;  4AB6 A;  4GXS B;  3ZS6 A;  3OSQ A;  3TDJ A;  1IQ7 A;  1Q35 A;  4R6K A;  3M3L A;  3OEK A;  3TMG A;  1SYI A;  3IR1 A;  2V3T A;  2XXV A;  4G4P A;  3I5O A;  4LZ7 A;  2PMS A;  4POW A;  1PBP A;  3V8X B;  2UYF A;  4F3S A;  4OFO A;  2I49 A;  1B3F A;  2GFE A;  4JSO A;  5HM4 B;  1A99 A;  3B6W A;  4NF6 A;  1XOC A;  2I48 A;  3G3I A;  2H99 A;  1UTH A;  5FHO A;  1ATG A;  2B65 A;  2P1S A;  5DVF A;  3KOT A;  4GWO A;  4IO4 A;  2ONK E;  4H5G A;  4KR5 A;  2X7P A;  4X1D A;  4C1U A;  4TLM B;  4DCY A;  1MPC A;  4ZE8 A;  5JK4 A;  4OYV A;  1N0T A;  3G3H A;  3BFU A;  5EYF A;  3Q28 A;  4KI0 E;  1USY E;  5H8N A;  4DXU A;  3USD A;  3LBS A;  3VVD A;  3CIJ A;  2NVU B;  2DOJ A;  3E3K A;  1ZU0 A;  3MZ1 A;  5TPA A;  5DT6 A;  3RTW B;  3UGW A;  4Q8R A;  4IO3 A;  3SEW A;  2HZL A;  5CMK A;  5CI5 A;  4H0W A;  4UA8 A;  5TPA B;  4BDQ A;  2FNC A;  2QS1 A;  4YKI A;  3HPI A;  1QUL A;  3KGC A;  1YPN A;  2O51 A;  2QSX A;  3FJ7 A;  4POX A;  4HW8 A;  2F34 A;  2A5T B;  2F78 A;  4YU0 A;  5M2V A;  3PUZ E;  1B0L A;  2DWJ A;  5I2N A;  1B7Z A;  2ZYO A;  3SEY A;  4FAT A;  1P99 A;  1S50 A;  2A5S A;  1B5J A;  2F5X A;  4RJZ A;  5JEI A;  3BBR A;  4ND9 A;  5I2K B;  3TPA A;  3VXC A;  3UN6 A;  1VSO A;  2FA7 A;  3IOR A;  3RT6 B;  4IO2 A;  3OSR A;  2Q8J A;  3UIF A;  3T22 A;  1YAE A;  2YLN A;  2ZNU A;  1B7H A;  3IB0 A;  4KPT A;  1LAX A;  1UIV A;  2I6E A;  1SDX A;  2DWI A;  1PB7 A;  2THI A;  1FTM A;  3EF7 A;  2DS9 A;  3PPP A;  1MY3 A;  1XVX A;  1NNT A;  1RYO A;  1TT1 A;  4GL8 A;  4OHN A;  1ZMG A;  1PB9 A;  3OEL A;  4YZZ A;  3TCF A;  4F2O A;  2V25 A;  3PMX A;  4X48 A;  1H44 A;  1M5D A;  2XX8 A;  4TLL B;  4JBZ A;  4YKP A;  3PMV A;  3TTN A;  1WVJ A;  3FAS A;  5CRY A;  4F2Q A;  4OER A;  3FXR A;  3Q26 A;  1ZKB A;  3TCH A;  4WKM A;  1SW1 A;  3GBB A;  1D9V A;  2G93 A;  3HV1 A;  1MXU A;  5AA2 D;  3OO9 A;  1I69 A;  3FXU A;  1LCT A;  3VLW A;  1URD A;  1I6Q A;  3MP6 A;  4JXI A;  5H8N B;  4ELQ A;  2AYS A;  2DQV A;  5I59 A;  3PGF A;  1FTJ A;  1ZBM A;  2DWA A;  5ITO A;  1Y9U A;  5TP9 B;  1SW2 A;  4LZ8 A;  1US4 A;  1YCJ A;  2Z23 A;  1JEV A;  3ECR A;  1DMB A;  4ESX A;  5KCJ B;  2AL4 A;  3TTR A;  1O64 A;  4R2F A;  2H9B A;  1MH4 A;  4GL0 A;  1II5 A;  1VR5 A;  3C36 A;  3TZA A;  1Y1Z A;  4ZEC A;  2ANJ A;  1FQC A;  4HCY A;  4ELR A;  4H1X A;  3VVE A;  1MRP A;  4BLA A;  3TAJ A;  1H76 A;  3H4Z A;  4QSD A;  3WAE A;  3RUM A;  5AA4 B;  5L9S A;  4MF3 A;  2PVU A;  4YKJ A;  1JEU A;  2UVJ A;  2UVH A;  3B7D A;  3VLU A;  2X26 A;  4OEV A;  4Q5T A;  2DYX A;  3S2V A;  3MVW A;  1B5I A;  3FJG A;  1EZO A;  1D9Y A;  1ZIU A;  3KSX A;  3MVX A;  2D5W A;  4GFR A;  3FAT A;  4MLQ A;  3MW0 A;  5KDT A;  5ITP A;  1Y4T A;  1M5F A;  1N7X A;  1HSJ A;  2QMW A;  3O2A A;  3SES A;  2QS4 A;  3K6V A;  4QFP A;  3QAX A;  4TOZ A;  4Z0I A;  4BDR A;  2RCB A;  3SEV A;  1DSN A;  2XXR A;  3OMB A;  4NWD A;  1R9Q A;  2QRY A;  2F6G A;  1TWY A;  3H6U A;  2HCA A;  2OLB A;  3B6Q A;  1OQH A;  4BDO A;  5AA2 B;  4U21 A;  5AA4 A;  3TEL A;  5I2K A;  4ZED A;  5FHN A;  1MPD A;  3LSL A;  5CMC A;  5I2N B;  1SBP A;  3EHT A;  2PT2 A;  3KEI A;  4IY6 A;  4XKQ A;  3DP8 A;  1A8F A;  1D3K A;  1MH3 A;  1FCK A;  3A3U A;  3G3F A;  3PPO A;  4JWX A;  1OMP A;  2O69 A;  4O3A A;  4OES A;  3SER A;  5TU0 A;  4H5F A;  3Q29 A;  1ZLQ A;  3KJT A;  4NF8 B;  4YB6 A;  1O7T A;  4R75 A;  3W15 C;  3ONM A;  4QHQ A;  3VVF A;  1PDA A;  2E0S A;  4OMB A;  1NMU A;  2A5T A;  3O29 A;  1MQH A;  2NXO A;  4X9T A;  3OEN A;  3DP6 A;  4YMA A;  4NF4 B;  2O7I A;  2Q88 A;  4LP2 B;  2DSF A;  5B7D A;  3IX1 A;  1URG A;  2QMX A;  1B3E A;  1NNF A;  3IK6 B;  3IOW A;  2UXA A;  2YPN A;  3FD3 A;  2F7C A;  1OVT A;  4BDM A;  1SQY A;  1F9B A;  4MBP A;  4M4G A;  3MC2 A;  3CRB A;  2DXR A;  2XX9 A;  1B3L A;  1Y20 A;  2QS2 A;  3Q27 A;  1Y4C A;  5FTI A;  4GVO A;  3RLF E;  4FJP A;  4ZE9 A;  4U4S A;  1ZJL A;  1FQE A;  3QSL A;  4IB2 A;  4KCC A;  4R74 A;  1JVY A;  5KCJ A;  3K1M A;  2XXI A;  3T96 B;  5B70 A;  1MY0 A;  3R6U A;  4LQ2 A;  2HEU A;  3RPW A;  4WXJ A;  3H7M A;  4RXL A;  5FTH A;  3EN3 A;  3T93 B;  1MXV A;  3T9U A;  3KBR A;  3KFM A;  3QIM A;  3MVY A;  2R6G E;  1N04 A;  4NE4 A;  4PET A;  3IOV A;  5ICQ A;  5DEX B;  3SEX A;  1DPE A;  3K6U A;  1LBB A;  1SI0 A;  2Q89 A;  3H06 B;  3QXM A;  3CSG A;  5I56 B;  2F97 A;  5CM6 A;  3U1O A;  1JNF A;  5J1D A;  1XT8 A;  3M3F A;  3AXF A;  3W9W A;  4F1V A;  1LB9 A;  2E1S A;  2FYI A;  1NH8 A;  4FEC A;  3S9L C;  1RKM A;  3MP8 A;  1IIT A;  3OO8 A;  3IOT A;  1MXW A;  1QUJ A;  3T9X B;  2CZL A;  2DE4 A;  1LGB C;  1P1N A;  2VHA A;  3KG2 A;  1FTO A;  2RF1 A;  1PBQ A;  1MY4 A;  4IO7 A;  2ALU A;  4DE8 A;  5HPQ A;  4F31 B;  2F6P A;  1Z7N E;  2OJT A;  3B6T A;  3H3G A;  1DTG A;  1YTV A;  2QPQ A;  3G3K A;  3M3K A;  3N6T A;  4FIM A;  5CMM A;  4QFL A;  4TQU Q;  5K2X A;  3PPQ A;  4O3B A;  4N13 A;  3RY3 A;  3OEM A;  1BTJ A;  3IJO B;  1B58 A;  2HZK A;  3EQ1 A;  3MP1 A;  3KN3 A;  2XXQ A;  2HAV A;  2Y7W A;  3K4U A;  4QSC A;  4QFN A;  5L9M A;  2XXT A;  5IKB A;  4OQO A;  3CVG A;  5H8Q B;  3I6V A;  4RY1 A;  5AA1 A;  1N7W A;  2F8D A;  3K00 A;  2M8C A;  1UQW A;  3PD9 A;  3SET A;  1UTB A;  3TCG A;  3CFZ A;  3QUJ A;  1MG1 A;  1LCF A;  4WED A;  3KOS A;  4GIZ A;  3MAM A;  3SKP A;  4OET A;  1AH5 A;  5AA2 A;  3K1P A;  1MQJ A;  1PEB A;  1B1H A;  1XS5 A;  5I58 A;  4EXK A;  3CI8 A;  3UP9 A;  3W9V A;  2B3B A;  2PBW A;  3KSJ A;  4ZZA A;  3Q25 A;  3KN8 A;  2D3I A;  4QFO A;  3G3G A;  3K1N A;  1FW0 A;  3PMW A;  1BP5 A;  3LSW A;  2I4B A;  1H3D A;  2UYE A;  3IB2 A;  2O1L A;  4YB7 A;  2ONR A;  1I6B A;  5H8H A;  3PPR A;  4PFW A;  5KDT B;  3S9N C;  5CBR A;  2Y7K A;  3EHS A;  3F11 A;  2IA4 A;  1B2H A;  1B46 A;  4RPN A;  3DP4 A;  3U72 A;  1B4Z A;  5BUU A;  4R73 A;  1HSE A;  3TQL A;  4WEP A;  5I57 B;  3TUS A;  2XD2 A;  4F39 A;  1PC3 A;  2D21 A;  2XXW A;  1IXC A;  2ZMB A;  2XXU A;  3GBA A;  4OXV A;  4AB5 A;  4DXC A;  3G3J A;  4ESW A;  3O6G A;  3IL1 B;  1DPP A;  3ZKL A;  1QW0 A;  4XTC Q;  3ODB A;  2Y84 A;  1R6Z A;  4JSD A;  1OVB A;  3FUZ A;  1B3H A;  3RGY A;  2RC9 A;  3RTF B;  3PU5 A;  3N6U A;  1POY 1;  1P1U A;  1MY1 A;  2H5Y A;  3K02 A;  4MFI A;  3IOU A;  4PP0 A;  1A7L A;  4THI A;  1A40 A;  5ISU A;  1AMF A;  1BKA A;  4DIG A;  2O84 X;  1DTZ A;  2I3W A;  3ILT B;  2OK2 A;  3FV1 A;  4XKP A;  1B1X A;  3JYR A;  2R9J A;  2DE2 A;  4ZEK A;  2Z8F A;  3H6T A;  1LLS A;  4NF4 A;  5BWJ A;  1MDP 1;  1MXX A;  1WDN A;  4OEN A;  1NNK A;  1OQG A;  2AIX A;  1BLF A;  1JW4 A;  1SVX B;  1Z7M E;  2REJ A;  4NMY A;  3ZSF A;  3OXN A;  4FE8 A;  4PFY A;  1B5H A;  2VP1 A;  5LOM A;  3TOD A;  2F36 A;  1M5C A;  2H25 A;  3GLB A;  2V3Q A;  4HCW A;  1SYH A;  2ESN A;  1MY2 A;  4OZ9 A;  4IY5 A;  4U23 A;  1S9T A;  5JTY A;  2H4I A;  5TP9 A;  1XVY A;  4AQ4 A;  1SD3 A;  1TFA A;  1H45 A;  2Q9T A;  3MUQ A;  4LUB A;  1H43 A;  3GXA A;  3C33 A;  4LZ5 A;  4NWC A;  4HS7 A;  4QSE A;  3A09 A;  4ZEI A;  1XHY A;  3TTM A;  4HTG A;  4EDP A;  1OIB A;  4F19 A;  2P0S A;  1JW1 A;  1B40 A;  2Y7I A;  4FEB A;  4QFK A;  1SW5 A;  4Z7E A;  1MM7 A;  3CSB A;  3FJM A;  3OO7 A;  3H03 A;  5H8S A;  2UVG A;  5DYH A;  4F1U A;  1LFG A;  3O28 A;  1FTK A;  2NOO A;  2PYY A;  4RNS A;  5AA3 A;  4U2R A;  2RIN A;  4NF5 B;  1N76 A;  2ZYK A;  4N6P A;  1LFI A;  2OBG A;  3P7I A;  4PFT A;  4ZEF A;  2NWJ A;  2XHD A;  1B3G A;  1URS A;  3CR9 A;  4OFJ A;  4YIC A;  4G8H A;  4RA1 A;  3S4U A;  2DWH A;  3OOA A;  4H65 A;  3K0V A;  3TFL A;  1EU8 A;  4ELP A;  3LSF B;  2OWT A;  3C34 A;  1DOT A;  5EHM A;  4EQ7 A;  2CMO A;  1JET A;  3GZG A;  3SDF A;  2ZYN A;  2Y7P A;  1J1N A;  3KZG A;  3D4C A;  4X1B A;  4F22 A;  5A5X A;  1IUD A;  3RT8 A;  1QVS A;  2I3V A;  3C4M A;  5H8F B;  3R7X A;  3VFJ A;  5ELV A;  1Y3N A;  1N84 A;  3S9M C;  1UTH B;  2QL3 A;  3EPE A;  3MPL A;  4G68 B;  2Q2A A;  4G68 C;  4R2B A;  1USY H;  2OZZ A;  5DEX A;  5DVI A;  1B7U A;  3N5L A;  4GRK A;  4KQP A;  3N94 A;  4OFL A;  4ZS9 A;  1T0K A;  1NFT A;  3KN7 A;  2V3U A;  1US5 A;  1OLA A;  3O6I A;  3PPN A;  4EF1 A;  4G8N A;  4JDF A;  2KLF A;  2P2A A;  5IAI A;  4F18 A;  4IO5 A;  3TYH A;  3TTL A;  4PQJ A;  4XXU A;  2OWS A;  3BFT A;  2O6A A;  3FVO A;  4ISU A;  2RC8 A;  4U4X A;  2REG A;  4H67 A;  5I84 A;  3MQ9 A;  2RCA A;  1FQA A;  3T9V A;  3O6H A;  5H8H B;  3ZKK A;  2RC7 A;  4N07 A;  1R9L A;  3BKI B;  5EHS A;  1GGG A;  1IZ1 A;  1SW4 A;  4KYD A;  3ILU B;  2ZXT A;  2HQ0 A;  4R6Y A;  3U92 A;  4DLD A;  1M5B A;  3THI A;  1HSL A;  1S7Y A;  2XXY A;  2ZNS A;  1BIY A;  1B4H A;  3K01 A;  3DM0 A;  1LAF E;  1Y1M A;  4G68 A;  4I1D A;  4LVQ A;  4Q30 B;  3O66 A;  3MZB A;  4U1O A;  5H8Q A;  1Q1K A;  4E0X A;  4JWY A;  1AIV A;  4G2Z A;  1LAG E;  3TQW A;  1N3X A;  2RKM A;  4IGT A;  2B3F A;  2WKY A;  3JV9 A;  3UOR A;  1P1O A;  4XIG Q;  1NH7 A;  4C0R A;  5ICT A;  3O97 A;  4QRZ A;  3H6V A;  4LON B;  1GR2 A;  1GVC A;  2DXY A;  4F29 A;  3HHF A;  5H8F A;  3OD7 A;  2DP8 A;  3DEL B;  2Z8E A;  1MS7 A;  2ABH A;  3IB1 A;  3IJX B;  3LC8 A;  2F7A A;  4FED A;  1TFD A;  3V89 B;  4GD5 A;  5F7V A;  1AL3 A;  4YKK A;  3K6X A;  2R71 A;  3E4R A;  3R26 A;  3FVG A;  2H98 A;  3C31 A;  2XX7 A;  3CG1 A;  3QUF A;  4H6D A;  4XKR A;  3U93 A;  4OEU A;  3K6W A;  4K3F A;  4GLI A;  3VV5 A;  3IO6 A;  4ONY A;  2ONS A;  1Y3Q A;  1IEJ A;  3CFX A;  4U1Z A;  4EQ9 A;  3RN8 A;  3IO4 A;  1B05 A;  1VE4 A;  3I3V A;  1L5T A;  1ANF A;  2IEE A;  2I4C A;  2UVI A;  4KYE A;  4IO6 A;  1FQF A;  3TEP A;  3KJ7 A;  4KD5 A;  2V84 A;  1IXH A;  3MBP A;  3OO6 A;  5CBS A;  3FVK A;  4LQ5 A; 
#chains in the Genus database with same CATH topology
 4I9D A;  4R6H A;  4R9F A;  3L6H A;  1DK4 A;  1FTL A;  4R9G A;  1LB8 A;  3O9P A;  3FGS A;  1AOV A;  4EF2 A;  5L9O A;  1IXI A;  2PX1 A;  3VE1 B;  1RYX A;  4F3B A;  1GV8 A;  2VGQ A;  4LAT A;  3T66 A;  2F7B A;  3UA8 A;  4P0I A;  4ELO A;  5I56 A;  3G7W A;  1XC1 A;  3PUY E;  4G8M A;  2B4L A;  1P1W A;  5LDZ A;  1O63 A;  1IIW A;  1EH3 A;  2I0B A;  4FAJ A;  2HAU A;  3V5A A;  3TTK A;  3FXQ A;  2PFZ A;  4ZDM A;  1MPB A;  4EQB A;  5DVJ A;  4MH5 A;  2O7U A;  1MXZ A;  2QJE A;  5EQ7 A;  3FVN A;  1IXG A;  4EXL A;  4P9K A;  2Y7R A;  4N8G A;  4L17 A;  1R1N A;  1GTK A;  1MDQ A;  4MX6 A;  1WOD A;  3RQT A;  2XD3 A;  4GXS B;  3OSQ A;  3TMG A;  1SYI A;  3IR1 A;  5DW8 A;  3V8X B;  2UYF A;  2I49 A;  1A99 A;  4NF6 A;  1XOC A;  1ATG A;  2P1S A;  3HFU A;  4IO4 A;  4KR5 A;  2CZK A;  4TLM B;  3G3H A;  4PDD A;  3USD A;  3MZ1 A;  5DT6 A;  3RTW B;  4N81 A;  4MIJ A;  5CI5 A;  4BDQ A;  1QUL A;  4HW8 A;  2O51 A;  3FJ7 A;  4POX A;  2FVZ A;  5M2V A;  2ZYO A;  3SEY A;  1NI9 A;  3UN6 A;  2Q8J A;  3ROJ A;  1B7H A;  1LAX A;  2DWI A;  1PB7 A;  2DS9 A;  1NNT A;  1RYO A;  1TT1 A;  1QGX A;  3TCF A;  4X48 A;  1IMC A;  4JBZ A;  1IMB A;  3GBB A;  4P47 A;  3FXU A;  1URD A;  1I6Q A;  4JXI A;  5H8N B;  4MNI A;  3SZP A;  4I3Y A;  1US4 A;  1YCJ A;  2Z23 A;  4ESX A;  2H9B A;  4GL0 A;  3TEP A;  2OWZ A;  1FQC A;  4H1X A;  4O7I A;  1MRP A;  4BLA A;  1KA0 A;  5L9S A;  2PVU A;  1JEU A;  4PE3 A;  3B7D A;  4Q5T A;  1FBD A;  2D5W A;  4GFR A;  3SES A;  4QFP A;  4TOZ A;  4NWD A;  1R9Q A;  2F6G A;  2HCA A;  5AA4 A;  3ISP A;  5FHN A;  1MPD A;  3LSL A;  3T0J A;  4IY6 A;  3DP8 A;  1A8F A;  4OZ9 A;  3A3U A;  4JWX A;  3SER A;  4H5F A;  1O7T A;  2CEX A;  3W15 C;  1PDA A;  4OMB A;  2A5T A;  1MQH A;  2Q88 A;  5B7D A;  1OVT A;  2B4M A;  1F9B A;  2XX9 A;  1B3L A;  4ZE9 A;  4U4S A;  4KCC A;  5KCJ A;  3T96 B;  5EQ9 A;  4LQ2 A;  4WXJ A;  3EN3 A;  3T9U A;  3QIM A;  4PAF A;  3SEX A;  1LBB A;  3QXM A;  2XWV A;  2FIX A;  1JNF A;  5J1D A;  3M3F A;  4FEC A;  4DI3 D;  1MXW A;  1QUJ A;  3T9X B;  2DE4 A;  1LGB C;  1P1N A;  2VHA A;  3KG2 A;  2RF1 A;  4DE8 A;  2ALU A;  1Z7N E;  3B6T A;  1DTG A;  2QPQ A;  3G3K A;  1B58 A;  3K4U A;  5L9M A;  2XXT A;  5IKB A;  4OQO A;  5H8Q B;  3I6V A;  4P56 A;  3SET A;  2F8D A;  1DCU A;  3CFZ A;  1LCF A;  4GIZ A;  1B1H A;  4GBV A;  4NF0 A;  3KN8 A;  2I4B A;  1H3D A;  1NV4 A;  2UYE A;  4YB7 A;  2O1L A;  2WBD A;  3PPR A;  3S9N C;  3F11 A;  2IA4 A;  4RPN A;  3DP4 A;  4R73 A;  1HSE A;  5IZ1 A;  2XXW A;  2ZMB A;  1IXC A;  4ESW A;  2XXU A;  3O6G A;  4XTC Q;  2Y84 A;  1OVB A;  2V4C A;  1B3H A;  3RTF B;  3K02 A;  1P1U A;  1A40 A;  4DIG A;  1IMF A;  2Z8F A;  4NF4 A;  1SVX B;  1Z7M E;  4NMY A;  3OXN A;  4N15 A;  1FBC A;  3TOD A;  2H25 A;  4HCW A;  4PBQ A;  2H4I A;  1H45 A;  2Q9T A;  3E78 A;  3GXA A;  3A09 A;  3LUZ A;  3TTM A;  4F19 A;  4FEB A;  5ESY A;  1MM7 A;  3OO7 A;  3B8B A;  3H03 A;  5H8S A;  2UVG A;  1LFG A;  1EYK A;  2RIN A;  4NF5 B;  4N6P A;  1FPG A;  4OVR A;  4YIC A;  4H65 A;  1EU8 A;  1YZ0 A;  2CMO A;  1JET A;  3GZG A;  4F22 A;  3C4M A;  3R7X A;  3VFJ A;  4R2B A;  5DVI A;  3N5L A;  1NV3 A;  4OFL A;  1T0K A;  3KN7 A;  2V3U A;  1OLA A;  3PPN A;  4EF1 A;  4GBW A;  3TYH A;  3TTL A;  4XXU A;  4U4X A;  4H67 A;  5ET7 A;  1YYZ A;  3ILU B;  4DLD A;  4R6Y A;  1FPD A;  1S7Y A;  2CZI A;  1BIY A;  4Q30 B;  4G68 A;  1K9Z A;  4I1D A;  1AIV A;  4JWY A;  2F3D A;  3O97 A;  1GR2 A;  1MS7 A;  4OVQ A;  2F7A A;  2H98 A;  3U93 A;  3CG1 A;  4OEU A;  3IO6 A;  2L5V A;  1Y3Q A;  1IEJ A;  4U1Z A;  1B05 A;  1VE4 A;  2UVI A;  2V84 A;  5CBS A;  4Q8R A;  1B51 A;  1NKX A;  4MNC A;  4EUO A;  4DDD A;  4QF9 A;  4ECF A;  2W7Y A;  5DTB A;  4NTL A;  4M1V A;  5HBC A;  1FPJ A;  1ZTY A;  1JVX A;  3EHU A;  4NED A;  4F1Y A;  5I58 B;  5EYH A;  2P3N A;  5A5L A;  2G29 A;  3JZJ A;  2AL5 A;  2HXR A;  3MPK A;  3S9E A;  2DE3 A;  3RNN A;  2Z8D A;  1LFH A;  5A5X B;  1QKB A;  4BDN A;  3LUY A;  4N17 A;  1LST A;  2HFB A;  4MLV A;  5LTC A;  4KCD A;  4ELQ A;  5FHM A;  4KHZ E;  4N6D A;  4GF8 A;  3CFL A;  5F1Q A;  1VFE A;  4Q0C A;  4GQO A;  2OCU A;  4RPO A;  3MST A;  2QS3 A;  1ELJ A;  2Q2C A;  1LBV A;  3N26 A;  4XKN A;  3IAZ A;  3U8Q A;  2LAO A;  4JB7 A;  3VLV A;  2QVV A;  3C32 A;  2I58 A;  5CC2 A;  1I6A A;  2ZYM A;  1A54 A;  3VXB A;  4YMB A;  1MQI A;  4LN5 A;  4O3C A;  4IGR A;  4AB6 A;  3ZS6 A;  1Q35 A;  2QFL A;  4R6K A;  3GYY A;  3OEK A;  1RDZ A;  4G4P A;  1PBP A;  5HM4 B;  4JSO A;  3B6W A;  2I48 A;  1Q9D A;  3KOT A;  2X7P A;  4ZE8 A;  1N0T A;  1NUZ A;  5EYF A;  2NVU B;  5TPA A;  3SEW A;  2HZL A;  2QS1 A;  4YKI A;  3HPI A;  3KGC A;  2A5T B;  4YU0 A;  3PUZ E;  4AS5 A;  2Y5L A;  1B5J A;  4RJZ A;  5JEI A;  3BBR A;  5I2K B;  2FA7 A;  4IO2 A;  3OSR A;  2ZNU A;  2KR0 A;  1SDX A;  2THI A;  3PPP A;  2HHM A;  3PTY A;  3V83 A;  1ZMG A;  5KZT A;  4TLL B;  3PMV A;  3TTN A;  1FPI A;  5CRY A;  4OER A;  1ZKB A;  3TCH A;  1SW1 A;  2G93 A;  3HV1 A;  4PGP A;  5EYG A;  5ITO A;  2DWA A;  4LZ8 A;  1JEV A;  1DMB A;  4GX6 A;  1MH4 A;  1FJ9 A;  4ZEC A;  1Y1Z A;  2ANJ A;  3BIG A;  3H4Z A;  4QSD A;  4YKJ A;  2UVJ A;  2UVH A;  1SPI A;  3VLU A;  2X26 A;  3FJG A;  3KSX A;  5KDT A;  3FAT A;  4MLQ A;  1M5F A;  1HSJ A;  3O2A A;  4BDR A;  3QAX A;  2PFY A;  2RCB A;  1DSN A;  1FRP A;  3H6U A;  3TEL A;  4UAB A;  4XKQ A;  3G3F A;  4OES A;  1OMP A;  4NF8 B;  1ZLQ A;  4PTK A;  4R75 A;  1FSA A;  4QHQ A;  2E0S A;  1LBW A;  3OEN A;  3DP6 A;  2QMX A;  3IK6 B;  2YPN A;  2F7C A;  4BDM A;  4MBP A;  3MC2 A;  1Y20 A;  1Y4C A;  1FQE A;  3K1M A;  1NUY A;  5B70 A;  1MY0 A;  2HEU A;  3A29 A;  5FTH A;  3T93 B;  2CEY A;  2R6G E;  1N04 A;  4NE4 A;  4PET A;  5ICQ A;  1DPE A;  1SI0 A;  5CM6 A;  1AWB A;  4MNP A;  3W9W A;  4F1V A;  3S9L C;  1RKM A;  1IIT A;  4IO7 A;  1NV7 A;  4F31 B;  3H3G A;  1YTV A;  5K2X A;  4O3B A;  4GWZ A;  3OEM A;  3IJO B;  2HZK A;  3EQ1 A;  4AS4 A;  4QFN A;  3CVG A;  3K00 A;  3PD9 A;  3TCG A;  1MG1 A;  3KOS A;  4I3E A;  5AA2 A;  3K1P A;  5I58 A;  1XS5 A;  4EXK A;  4N8Y A;  3UP9 A;  3W9V A;  4ZZA A;  4QFO A;  3K1N A;  3PMW A;  1NV5 A;  5H8H A;  4PFW A;  5CBR A;  2Y7K A;  5BUU A;  5I57 B;  4F39 A;  1YXI A;  4DXC A;  4HE1 A;  4XEQ A;  3FUZ A;  3RGY A;  3PU5 A;  3N6U A;  1MY1 A;  4MFI A;  1NV2 A;  5ISU A;  1FBE A;  2XWO A;  1BKA A;  3ILT B;  4XKP A;  3JYR A;  2DE2 A;  4ZEK A;  1MDP 1;  1MXX A;  4GWY A;  2REJ A;  4XFE A;  4PFY A;  4FE8 A;  1B5H A;  5LOM A;  3GLB A;  4MHF A;  2FIE A;  1JP4 A;  4U23 A;  1S9T A;  4AQ4 A;  3CHG A;  1TFA A;  4LUB A;  1H43 A;  3C33 A;  4LZ5 A;  1XHY A;  4HTG A;  1B40 A;  1K9Y A;  4GX3 A;  4Z7E A;  3FJM A;  4QBA A;  1FBG A;  4F1U A;  2PYY A;  1N76 A;  1LFI A;  2QVU A;  2XHD A;  3S4U A;  4RA1 A;  3TFL A;  3C34 A;  5EHM A;  3SDF A;  2ZYN A;  1J1N A;  4N91 A;  4X1B A;  5H8F B;  1UTH B;  2QL3 A;  1B7U A;  4GRK A;  4KQP A;  4PFI A;  4ZS9 A;  1US5 A;  4G8N A;  4JDF A;  2KLF A;  5IAI A;  2OWS A;  4ISU A;  2RC8 A;  3O6H A;  2RC7 A;  4N07 A;  1R9L A;  1IZ1 A;  1SW4 A;  3U92 A;  1HSL A;  2XXY A;  3RUM A;  3DM0 A;  1Q1K A;  1N3X A;  3UOR A;  3JV9 A;  4C0R A;  1P1O A;  1NH7 A;  2ZZX A;  4QRZ A;  1GVC A;  4F29 A;  3HHF A;  3OD7 A;  2DP8 A;  2Z8E A;  3IB1 A;  5F7V A;  1AL3 A;  3FVG A;  3C31 A;  2XX7 A;  4H6D A;  1LEV A;  2ONS A;  3IO4 A;  3I3V A;  1ANF A;  1FQF A;  1IXH A;  3MBP A;  3FVK A;  3EKI A;  5ICT A;  3QK6 A;  4F3P A;  4X8R A;  1A55 A;  1B0H A;  3HST A;  2VD2 A;  3FV2 A;  4FOR A;  1POT A;  2ZNT A;  5K2Y A;  2O68 A;  1Y3P A;  4DCX A;  1B6H A;  4I62 A;  4YAH X;  4E0W A;  3KC1 A;  5CMB A;  4EDP A;  4ZEB A;  2GHA A;  3MVZ A;  3MZ9 A;  2I0C A;  4GOT A;  4I40 A;  3DLN A;  4NF8 A;  4G77 A;  4GXA A;  2XXP A;  1NNP A;  3PV0 E;  3D1R A;  4NF6 B;  4R72 A;  2BJJ X;  2FHY A;  1B52 A;  3C9H A;  4DXB A;  3UK4 A;  1KWH A;  1LBC A;  5IM2 A;  3HHG A;  1LAH E;  3PD8 A;  4OWD A;  1MQD A;  3QYT A;  2F35 A;  1JQF A;  3CG3 A;  3MJN A;  1UTB B;  3PUW E;  1FQB A;  4GWU A;  2KQZ A;  3SEU A;  2GRV A;  4RK2 A;  2PT1 A;  2YJP A;  4PF6 A;  4KFQ A;  3LSX A;  4DZ1 A;  1QKA A;  3U94 A;  4ZZE A;  4KYS A;  1JW5 A;  3HO7 A;  5I57 A;  4PE5 B;  1TXF A;  4I8C A;  3LR1 A;  4P11 A;  4MMP A;  2HPG A;  3TDJ A;  2V3T A;  3I5O A;  1FPK A;  1INP A;  4P3L A;  4F3S A;  4OFO A;  2GFE A;  5IZ3 A;  1NUW A;  2H99 A;  4PDH A;  2B65 A;  4X1D A;  2XWI A;  5JK4 A;  4OYV A;  3BFU A;  4KI0 E;  5H8N A;  4P1L A;  3LBS A;  3VVD A;  4IO3 A;  5CMK A;  2FNC A;  2QSX A;  3RYD A;  2F34 A;  2F78 A;  5I2N A;  4FAT A;  1P99 A;  3VXC A;  3IOR A;  2YLN A;  2I6E A;  1UIV A;  3EF7 A;  1FTM A;  3IFC A;  1MY3 A;  1XVX A;  4F2O A;  4OHN A;  1G0H A;  1PB9 A;  3OEL A;  2V25 A;  3PMX A;  1H44 A;  1M5D A;  4YKP A;  2OX3 A;  1WVJ A;  4F2Q A;  3Q26 A;  1LBY A;  4N4U A;  4WKM A;  1MXU A;  1LCT A;  3VLW A;  3MP6 A;  2AYS A;  2DQV A;  5I59 A;  5TP9 B;  1ZBM A;  3ECR A;  1O64 A;  3VVE A;  4PFB A;  2JJK A;  3S2V A;  4OEV A;  1B5I A;  4FBP A;  1EZO A;  2QMW A;  3K6V A;  4Z0I A;  2XXR A;  3OMB A;  2QRY A;  4BDO A;  4U21 A;  4G61 A;  1LBZ A;  4QXD A;  4ZED A;  1IMA A;  5CMC A;  5I2N B;  3EHT A;  2PT2 A;  1D3K A;  3PPO A;  4PC9 A;  1IME A;  5TU0 A;  3KJT A;  3ONM A;  1NMU A;  3O29 A;  2NXO A;  2O7I A;  4LP2 B;  1NNF A;  1NV1 A;  3FD3 A;  1SQY A;  3Q27 A;  3CRB A;  2DXR A;  3QSL A;  2XXI A;  3R6U A;  3RPW A;  5EQA A;  4GWW A;  3H7M A;  4RXL A;  3MVY A;  3IOV A;  5DEX B;  3K6U A;  3QMF A;  5I56 B;  1XT8 A;  3AXF A;  2E1S A;  1NH8 A;  3OO8 A;  2CZL A;  4NG7 A;  5HPQ A;  4GL8 A;  2OJT A;  4TQU Q;  4N13 A;  1BTJ A;  4QSC A;  2XXQ A;  4MCO A;  4PCD A;  4RY1 A;  1N7W A;  1UTB A;  4OVS A;  1AH5 A;  1MQJ A;  3CI8 A;  2B3B A;  2PBW A;  2D3I A;  4KXP A;  1FW0 A;  1I6B A;  1B2H A;  3U72 A;  1B4Z A;  4P1E A;  4WEP A;  3TQL A;  1FBP A;  3GBA A;  4OXV A;  1XI6 A;  1DPP A;  4JSD A;  4JVC A;  3BIH A;  2RC9 A;  1POY 1;  2H5Y A;  4THI A;  3IOU A;  1A7L A;  1CNQ A;  1AMF A;  2PCR A;  1DTZ A;  2I3W A;  4NAP A;  1B1X A;  2R9J A;  3KBZ A;  1WDN A;  4OEN A;  4MAG A;  2AIX A;  3ZSF A;  2VP1 A;  2F36 A;  2V3Q A;  1SYH A;  2ESN A;  5JTY A;  5TP9 A;  1XVY A;  1SD3 A;  4JVI A;  2CZH A;  4ZEI A;  2Q74 A;  1OIB A;  2P0S A;  4QFK A;  1SW5 A;  3CSB A;  3B50 A;  1FTK A;  2NOO A;  4HXV A;  4RNS A;  4U2R A;  4ZEF A;  3P7I A;  1B3G A;  3CR9 A;  4OFJ A;  4PBH A;  4G8H A;  2DWH A;  4X04 A;  3K0V A;  3KZG A;  5A5X A;  5IGA A;  1QVS A;  5ELV A;  1Y3N A;  1N84 A;  3EPE A;  2Q2A A;  4G68 C;  1EYJ A;  1USY H;  2OZZ A;  5DEX A;  2F3B A;  3N94 A;  4F18 A;  4IO5 A;  4PQJ A;  3BFT A;  2WYP A;  5I84 A;  2RCA A;  5H8H B;  3ZKK A;  2WEF A;  3BKI B;  5EHS A;  3THI A;  2QVR A;  2ZNS A;  1B4H A;  1LAF E;  3FXB A;  4LVQ A;  5H8Q A;  3MZB A;  4G2Z A;  1LAG E;  4PAI A;  2RKM A;  4IGT A;  2B3F A;  3H6V A;  4PGN A;  4PAK A;  3DEL B;  2P3V A;  2Y5K A;  3IJX B;  4FED A;  1TFD A;  3V89 B;  4GD5 A;  4YKK A;  3K6X A;  3QUF A;  4GLI A;  3VV5 A;  4ONY A;  3CFX A;  4EQ9 A;  4PF8 A;  1L5T A;  1KZ8 A;  2I4C A;  4KYE A;  5I3S A;  4IO6 A;  3KJ7 A;  2XXK A;  5J16 A;  4LQ5 A;  1QUI A;  2ZZW A;  1PB8 A;  2VD3 A;  4OVJ A;  1B9J A;  3E9X A;  3HCQ A;  5JTY B;  4BDL A;  3VDF A;  1MQG A;  5I59 B;  4RK9 A;  2NUV A;  3T9H B;  4JWO A;  4LA9 A;  3HN0 A;  4O8M A;  1D4N A;  4NF5 A;  1EZ9 A;  5IZZ A;  3E13 X;  4P8B A;  3PUV E;  2ZZV A;  4C1T A;  1SI1 A;  5AE4 A;  3A3C A;  2GH9 A;  1CE2 A;  2DVZ A;  4OTE A;  3RPL A;  2V93 A;  4P0G A;  1EZP A;  4U22 A;  4YB5 A;  4DI4 B;  1MXY A;  1MM6 A;  1NL5 A;  4NN3 A;  2O1M A;  1B32 A;  1N3W A;  4H8I A;  2DVC A;  3WAF A;  1OLC A;  4RYA A;  3FZV A;  2XXX A;  3K2D A;  4H8J A;  2X7Q A;  3L6G A;  1P1Q A;  2HXW A;  3M8U A;  5L8D A;  1UIU A;  1FQD A;  1A8E A;  3D4G A;  2XXH A;  1EYI A;  1QJM A;  3PUX E;  5ET8 A;  3H6W A;  2FBP A;  3MWB A;  4F3G A;  1M5E A;  4PFU A;  1VFD A;  2VOZ A;  2VPN A;  2Z22 A;  3FIR A;  3FBP A;  1QUK A;  1CB6 A;  3C35 A;  4UAC A;  3TKD A;  2GHB A;  1IQ7 A;  3M3L A;  4H46 A;  2XXV A;  4OVT A;  4LZ7 A;  2PMS A;  4POW A;  3IFA A;  1B3F A;  3RPL B;  2XA5 A;  5IZ3 B;  3G3I A;  1UTH A;  5FHO A;  5DVF A;  3NOH A;  4GWO A;  2ONK E;  4H5G A;  4C1U A;  4DCY A;  1MPC A;  1FTA A;  3Q28 A;  1USY E;  4DXU A;  3CIJ A;  2DOJ A;  3E3K A;  1ZU0 A;  3UGW A;  5TPA B;  4H0W A;  4UA8 A;  1FPB A;  1YPN A;  1B0L A;  4XF5 A;  2DWJ A;  1B7Z A;  1S50 A;  2A5S A;  2F5X A;  4ND9 A;  2WYK A;  3TPA A;  1VSO A;  3RT6 B;  1IMD A;  3UIF A;  3T22 A;  4JVD A;  1YAE A;  3U65 A;  3IB0 A;  4KPT A;  4YZZ A;  2XX8 A;  3FAS A;  3FXR A;  5AA2 D;  1D9V A;  3OO9 A;  1I69 A;  1D9Q A;  1NV6 A;  1RDY A;  3PGF A;  1FTJ A;  1Y9U A;  1SW2 A;  5KCJ B;  2AL4 A;  3TTR A;  4R2F A;  1II5 A;  1VR5 A;  3C36 A;  3TZA A;  4HCY A;  4ELR A;  3TAJ A;  1H76 A;  3WAE A;  5AA4 B;  3KC0 A;  4MF3 A;  5I5P A;  1FPE A;  2DYX A;  3MVW A;  1D9Y A;  1ZIU A;  3MVX A;  2GQ1 A;  3MW0 A;  5ITP A;  1Y4T A;  1N7X A;  2WX9 A;  4NGU A;  2QS4 A;  3SEV A;  1TWY A;  2OLB A;  3B6Q A;  1OQH A;  5AA2 B;  5I2K A;  1SBP A;  3KEI A;  1MH3 A;  1FCK A;  4O3A A;  2O69 A;  4YB6 A;  3Q29 A;  1DBZ A;  3VVF A;  4PFR A;  4X9T A;  4YMA A;  4NF4 B;  2DSF A;  4OA4 A;  3IX1 A;  4N6K A;  4NX1 A;  1URG A;  3IOW A;  1B3E A;  2UXA A;  4M4G A;  1VDW A;  2QS2 A;  5FTI A;  4GVO A;  3RLF E;  4FJP A;  1ZJL A;  4IB2 A;  4R74 A;  1JVY A;  1LBX A;  1MXV A;  3KBR A;  3KFM A;  5I7I A;  4OVP A;  2Q89 A;  3H06 B;  5ET6 A;  3CSG A;  2F97 A;  3U1O A;  4O94 A;  1LB9 A;  2FYI A;  3MP8 A;  3IOT A;  1FTO A;  3T1B A;  1PBQ A;  1MY4 A;  4OAN A;  1FJ6 A;  2F6P A;  4FIM A;  3N6T A;  5CMM A;  3M3K A;  4QFL A;  3RY3 A;  3PPQ A;  1FBH A;  2Q8M A;  3MP1 A;  3KN3 A;  2HAV A;  2Y7W A;  2DDK A;  5AA1 A;  2M8C A;  1UQW A;  4MEV A;  3SKP A;  3QUJ A;  4WED A;  3MAM A;  4OET A;  1PEB A;  3KSJ A;  3Q25 A;  3G3G A;  1BP5 A;  2XWK A;  3LSW A;  3IB2 A;  2ONR A;  5KDT B;  4H45 A;  3EHS A;  1B46 A;  2XD2 A;  3LV0 A;  1PC3 A;  2D21 A;  3TUS A;  4AB5 A;  3G3J A;  3IL1 B;  3ZKL A;  1QW0 A;  5FBP A;  3ODB A;  1R6Z A;  4PP0 A;  2MKZ A;  2O84 X;  1NV0 A;  2OK2 A;  3FV1 A;  2WBB A;  3H6T A;  1LLS A;  5BWJ A;  4HE0 A;  1FBF A;  1NNK A;  1OQG A;  1BLF A;  1JW4 A;  4IR8 A;  1M5C A;  1MY2 A;  4IY5 A;  2VPO A;  2VT5 A;  1BK4 A;  3MUQ A;  4QSE A;  4NWC A;  4HS7 A;  1G0I A;  1JW1 A;  2Y7I A;  5DYH A;  1FPF A;  3O28 A;  5AA3 A;  4NHB A;  2NWJ A;  2ZYK A;  4PFT A;  2OBG A;  1URS A;  3E79 A;  3OOA A;  4ELP A;  3LSF B;  2OWT A;  4EQ7 A;  1DOT A;  1RDX A;  2Y7P A;  3D4C A;  1IUD A;  3RT8 A;  2I3V A;  5F24 A;  3S9M C;  3MPL A;  4G68 B;  5EQ8 A;  1NFT A;  5T3J A;  3O6I A;  2BJI A;  2R8T A;  2P2A A;  2O6A A;  3FVO A;  4NQ8 A;  2REG A;  3MQ9 A;  1FQA A;  4MJO A;  3T9V A;  1GGG A;  4KYD A;  2ZXT A;  2HQ0 A;  1M5B A;  3K01 A;  1Y1M A;  4E0X A;  3O66 A;  4U1O A;  3TQW A;  4GWX A;  3MYU A;  2WKY A;  4XIG Q;  4O7M A;  4LON B;  2DXY A;  5H8F A;  5ET5 A;  2ABH A;  3LC8 A;  1FPL A;  3R26 A;  2R71 A;  3E4R A;  4XKR A;  4HE2 A;  3K6W A;  4K3F A;  1KA1 A;  3RN8 A;  1NUX A;  2IEE A;  4GX4 A;  4KD5 A;  3OO6 A;  4GWS A; 
#chains in the Genus database with same CATH homology
 1B51 A;  4I9D A;  1NKX A;  4R6H A;  1QUI A;  4R9F A;  4EUO A;  4DDD A;  3QK6 A;  4F3P A;  4QF9 A;  3L6H A;  1A55 A;  4ECF A;  1B0H A;  2W7Y A;  5DTB A;  4NTL A;  1PB8 A;  1FTL A;  2VD3 A;  4M1V A;  4OVJ A;  4R9G A;  1B9J A;  3E9X A;  3HST A;  2VD2 A;  3FV2 A;  3HCQ A;  4FOR A;  5JTY B;  1POT A;  2ZNT A;  5K2Y A;  1LB8 A;  4BDL A;  2O68 A;  5HBC A;  3O9P A;  1Y3P A;  4DCX A;  3VDF A;  3FGS A;  1B6H A;  4I62 A;  4YAH X;  1ZTY A;  4E0W A;  1AOV A;  1MQG A;  5I59 B;  4EF2 A;  4RK9 A;  1JVX A;  1IXI A;  2PX1 A;  2GHA A;  2NUV A;  3EHU A;  5CMB A;  3MVZ A;  4JWO A;  4ZEB A;  3T9H B;  4LA9 A;  3HN0 A;  1RYX A;  3VE1 B;  1GV8 A;  2VGQ A;  4LAT A;  3MZ9 A;  2I0C A;  4NED A;  4F3B A;  4F1Y A;  4GOT A;  1D4N A;  5I58 B;  4NF5 A;  3DLN A;  2G29 A;  2F7B A;  3JZJ A;  3T66 A;  2AL5 A;  3MPK A;  3S9E A;  3UA8 A;  4NF8 A;  1EZ9 A;  3E13 X;  4G77 A;  2DE3 A;  3PUV E;  4P0I A;  4ELO A;  4GXA A;  2XXP A;  5I56 A;  3G7W A;  1XC1 A;  3RNN A;  4C1T A;  2Z8D A;  1SI1 A;  3PUY E;  5AE4 A;  4G8M A;  3A3C A;  1NNP A;  3PV0 E;  5L9O A;  1LFH A;  2GH9 A;  1CE2 A;  2DVZ A;  4OTE A;  5A5X B;  4NF6 B;  1P1W A;  1QKB A;  2V93 A;  3LUY A;  4P0G A;  4R72 A;  4BDN A;  1EZP A;  2BJJ X;  4U22 A;  1O63 A;  1IIW A;  1LST A;  4YB5 A;  1EH3 A;  1B52 A;  3C9H A;  1MXY A;  1MM6 A;  1NL5 A;  2HFB A;  4MLV A;  4DXB A;  3UK4 A;  2I0B A;  2O1M A;  4FAJ A;  1KWH A;  2HAU A;  1LBC A;  3V5A A;  1B32 A;  1N3W A;  4KCD A;  3HHG A;  1LAH E;  2DVC A;  3PD8 A;  4H8I A;  4OWD A;  5FHM A;  3TTK A;  4KHZ E;  1MQD A;  3FXQ A;  1OLC A;  3WAF A;  4RYA A;  4ZDM A;  3QYT A;  3FZV A;  4GF8 A;  2XXX A;  1MPB A;  3K2D A;  2F35 A;  3CFL A;  4H8J A;  5DVJ A;  1JQF A;  4EQB A;  3V83 A;  5F1Q A;  3CG3 A;  5KZT A;  1VFE A;  2X7Q A;  4Q0C A;  3L6G A;  4GQO A;  2OCU A;  4MH5 A;  2O7U A;  3MJN A;  4RPO A;  1UTB B;  1MXZ A;  2QJE A;  3PUW E;  1P1Q A;  2HXW A;  3M8U A;  5L8D A;  1UIU A;  1FQB A;  1FQD A;  3SEU A;  1A8E A;  2GRV A;  2QS3 A;  3D4G A;  2XXH A;  4RK2 A;  2PT1 A;  2YJP A;  1ELJ A;  2Q2C A;  1QJM A;  3FVN A;  3PUX E;  1IXG A;  3H6W A;  4EXL A;  3MWB A;  4F3G A;  1M5E A;  4KFQ A;  3LSX A;  4PFU A;  3N26 A;  4XKN A;  1VFD A;  2VOZ A;  4DZ1 A;  3IAZ A;  2Z22 A;  2Y7R A;  1QKA A;  3FIR A;  3U94 A;  3U8Q A;  2LAO A;  4L17 A;  4JB7 A;  4ZZE A;  1R1N A;  1QUK A;  1GTK A;  1JW5 A;  3C32 A;  2I58 A;  4KYS A;  3VLV A;  3HO7 A;  5CC2 A;  1CB6 A;  5I57 A;  1I6A A;  2ZYM A;  1A54 A;  3VXB A;  1MDQ A;  4PE5 B;  1TXF A;  4I8C A;  3C35 A;  1MQI A;  1WOD A;  4YMB A;  3RQT A;  2XD3 A;  3LR1 A;  4O3C A;  4P11 A;  4UAC A;  4IGR A;  3TKD A;  2GHB A;  4AB6 A;  4GXS B;  3ZS6 A;  3OSQ A;  3TDJ A;  1IQ7 A;  1Q35 A;  4R6K A;  3M3L A;  3OEK A;  3TMG A;  1SYI A;  3IR1 A;  2V3T A;  2XXV A;  4G4P A;  3I5O A;  4LZ7 A;  2PMS A;  4POW A;  1PBP A;  3V8X B;  2UYF A;  4F3S A;  4OFO A;  2I49 A;  1B3F A;  2GFE A;  4JSO A;  5HM4 B;  1A99 A;  3B6W A;  4NF6 A;  1XOC A;  2I48 A;  3G3I A;  2H99 A;  1UTH A;  5FHO A;  1ATG A;  2B65 A;  2P1S A;  5DVF A;  3KOT A;  4GWO A;  4IO4 A;  2ONK E;  4H5G A;  4KR5 A;  2X7P A;  4X1D A;  4C1U A;  4TLM B;  4DCY A;  1MPC A;  4ZE8 A;  5JK4 A;  4OYV A;  1N0T A;  3G3H A;  3BFU A;  5EYF A;  3Q28 A;  4KI0 E;  1USY E;  5H8N A;  4DXU A;  3USD A;  3LBS A;  3VVD A;  3CIJ A;  2NVU B;  2DOJ A;  3E3K A;  1ZU0 A;  3MZ1 A;  5TPA A;  5DT6 A;  3RTW B;  3UGW A;  4Q8R A;  4IO3 A;  3SEW A;  2HZL A;  5CMK A;  5CI5 A;  4H0W A;  4UA8 A;  5TPA B;  4BDQ A;  2FNC A;  2QS1 A;  4YKI A;  3HPI A;  1QUL A;  3KGC A;  1YPN A;  2O51 A;  2QSX A;  3FJ7 A;  4POX A;  4HW8 A;  2F34 A;  2A5T B;  2F78 A;  4YU0 A;  5M2V A;  3PUZ E;  1B0L A;  2DWJ A;  5I2N A;  1B7Z A;  2ZYO A;  3SEY A;  4FAT A;  1P99 A;  1S50 A;  2A5S A;  1B5J A;  2F5X A;  4RJZ A;  5JEI A;  3BBR A;  4ND9 A;  5I2K B;  3TPA A;  3VXC A;  3UN6 A;  1VSO A;  2FA7 A;  3IOR A;  3RT6 B;  4IO2 A;  3OSR A;  2Q8J A;  3UIF A;  3T22 A;  1YAE A;  2YLN A;  2ZNU A;  1B7H A;  3IB0 A;  4KPT A;  1LAX A;  1UIV A;  2I6E A;  1SDX A;  2DWI A;  1PB7 A;  2THI A;  1FTM A;  3EF7 A;  2DS9 A;  3PPP A;  1MY3 A;  1XVX A;  1NNT A;  1RYO A;  1TT1 A;  4GL8 A;  4OHN A;  1ZMG A;  1PB9 A;  3OEL A;  4YZZ A;  3TCF A;  4F2O A;  2V25 A;  3PMX A;  4X48 A;  1H44 A;  1M5D A;  2XX8 A;  4TLL B;  4JBZ A;  4YKP A;  3PMV A;  3TTN A;  1WVJ A;  3FAS A;  5CRY A;  4F2Q A;  4OER A;  3FXR A;  3Q26 A;  1ZKB A;  3TCH A;  4WKM A;  1SW1 A;  3GBB A;  1D9V A;  2G93 A;  3HV1 A;  1MXU A;  5AA2 D;  3OO9 A;  1I69 A;  3FXU A;  1LCT A;  3VLW A;  1URD A;  1I6Q A;  3MP6 A;  4JXI A;  5H8N B;  4ELQ A;  2AYS A;  2DQV A;  5I59 A;  3PGF A;  1FTJ A;  1ZBM A;  2DWA A;  5ITO A;  1Y9U A;  5TP9 B;  1SW2 A;  4LZ8 A;  1US4 A;  1YCJ A;  2Z23 A;  1JEV A;  3ECR A;  1DMB A;  4ESX A;  5KCJ B;  2AL4 A;  3TTR A;  1O64 A;  4R2F A;  2H9B A;  1MH4 A;  4GL0 A;  1II5 A;  1VR5 A;  3C36 A;  3TZA A;  1Y1Z A;  4ZEC A;  2ANJ A;  1FQC A;  4HCY A;  4ELR A;  4H1X A;  3VVE A;  1MRP A;  4BLA A;  3TAJ A;  1H76 A;  3H4Z A;  4QSD A;  3WAE A;  3RUM A;  5AA4 B;  5L9S A;  4MF3 A;  2PVU A;  4YKJ A;  1JEU A;  2UVJ A;  2UVH A;  3B7D A;  3VLU A;  2X26 A;  4OEV A;  4Q5T A;  2DYX A;  3S2V A;  3MVW A;  1B5I A;  3FJG A;  1EZO A;  1D9Y A;  1ZIU A;  3KSX A;  3MVX A;  2D5W A;  4GFR A;  3FAT A;  4MLQ A;  3MW0 A;  5KDT A;  5ITP A;  1Y4T A;  1M5F A;  1N7X A;  1HSJ A;  2QMW A;  3O2A A;  3SES A;  2QS4 A;  3K6V A;  4QFP A;  3QAX A;  4TOZ A;  4Z0I A;  4BDR A;  2RCB A;  3SEV A;  1DSN A;  2XXR A;  3OMB A;  4NWD A;  1R9Q A;  2QRY A;  2F6G A;  1TWY A;  3H6U A;  2HCA A;  2OLB A;  3B6Q A;  1OQH A;  4BDO A;  5AA2 B;  4U21 A;  5AA4 A;  3TEL A;  5I2K A;  4ZED A;  5FHN A;  1MPD A;  3LSL A;  5CMC A;  5I2N B;  1SBP A;  3EHT A;  2PT2 A;  3KEI A;  4IY6 A;  4XKQ A;  3DP8 A;  1A8F A;  1D3K A;  1MH3 A;  1FCK A;  3A3U A;  3G3F A;  3PPO A;  4JWX A;  1OMP A;  2O69 A;  4O3A A;  4OES A;  3SER A;  5TU0 A;  4H5F A;  3Q29 A;  1ZLQ A;  3KJT A;  4NF8 B;  4YB6 A;  1O7T A;  4R75 A;  3W15 C;  3ONM A;  4QHQ A;  3VVF A;  1PDA A;  2E0S A;  4OMB A;  1NMU A;  2A5T A;  3O29 A;  1MQH A;  2NXO A;  4X9T A;  3OEN A;  3DP6 A;  4YMA A;  4NF4 B;  2O7I A;  2Q88 A;  4LP2 B;  2DSF A;  5B7D A;  3IX1 A;  1URG A;  2QMX A;  1B3E A;  1NNF A;  3IK6 B;  3IOW A;  2UXA A;  2YPN A;  3FD3 A;  2F7C A;  1OVT A;  4BDM A;  1SQY A;  1F9B A;  4MBP A;  4M4G A;  3MC2 A;  3CRB A;  2DXR A;  2XX9 A;  1B3L A;  1Y20 A;  2QS2 A;  3Q27 A;  1Y4C A;  5FTI A;  4GVO A;  3RLF E;  4FJP A;  4ZE9 A;  4U4S A;  1ZJL A;  1FQE A;  3QSL A;  4IB2 A;  4KCC A;  4R74 A;  1JVY A;  5KCJ A;  3K1M A;  2XXI A;  3T96 B;  5B70 A;  1MY0 A;  3R6U A;  4LQ2 A;  2HEU A;  3RPW A;  4WXJ A;  3H7M A;  4RXL A;  5FTH A;  3EN3 A;  3T93 B;  1MXV A;  3T9U A;  3KBR A;  3KFM A;  3QIM A;  3MVY A;  2R6G E;  1N04 A;  4NE4 A;  4PET A;  3IOV A;  5ICQ A;  5DEX B;  3SEX A;  1DPE A;  3K6U A;  1LBB A;  1SI0 A;  2Q89 A;  3H06 B;  3QXM A;  3CSG A;  5I56 B;  2F97 A;  5CM6 A;  3U1O A;  1JNF A;  5J1D A;  1XT8 A;  3M3F A;  3AXF A;  3W9W A;  4F1V A;  1LB9 A;  2E1S A;  2FYI A;  1NH8 A;  4FEC A;  3S9L C;  1RKM A;  3MP8 A;  1IIT A;  3OO8 A;  3IOT A;  1MXW A;  1QUJ A;  3T9X B;  2CZL A;  2DE4 A;  1LGB C;  1P1N A;  2VHA A;  3KG2 A;  1FTO A;  2RF1 A;  1PBQ A;  1MY4 A;  4IO7 A;  2ALU A;  4DE8 A;  5HPQ A;  4F31 B;  2F6P A;  1Z7N E;  2OJT A;  3B6T A;  3H3G A;  1DTG A;  1YTV A;  2QPQ A;  3G3K A;  3M3K A;  3N6T A;  4FIM A;  5CMM A;  4QFL A;  4TQU Q;  5K2X A;  3PPQ A;  4O3B A;  4N13 A;  3RY3 A;  3OEM A;  1BTJ A;  3IJO B;  1B58 A;  2HZK A;  3EQ1 A;  3MP1 A;  3KN3 A;  2XXQ A;  2HAV A;  2Y7W A;  3K4U A;  4QSC A;  4QFN A;  5L9M A;  2XXT A;  5IKB A;  4OQO A;  3CVG A;  5H8Q B;  3I6V A;  4RY1 A;  5AA1 A;  1N7W A;  2F8D A;  3K00 A;  2M8C A;  1UQW A;  3PD9 A;  3SET A;  1UTB A;  3TCG A;  3CFZ A;  3QUJ A;  1MG1 A;  1LCF A;  4WED A;  3KOS A;  4GIZ A;  3MAM A;  3SKP A;  4OET A;  1AH5 A;  5AA2 A;  3K1P A;  1MQJ A;  1PEB A;  1B1H A;  1XS5 A;  5I58 A;  4EXK A;  3CI8 A;  3UP9 A;  3W9V A;  2B3B A;  2PBW A;  3KSJ A;  4ZZA A;  3Q25 A;  3KN8 A;  2D3I A;  4QFO A;  3G3G A;  3K1N A;  1FW0 A;  3PMW A;  1BP5 A;  3LSW A;  2I4B A;  1H3D A;  2UYE A;  3IB2 A;  2O1L A;  4YB7 A;  2ONR A;  1I6B A;  5H8H A;  3PPR A;  4PFW A;  5KDT B;  3S9N C;  5CBR A;  2Y7K A;  3EHS A;  3F11 A;  2IA4 A;  1B2H A;  1B46 A;  4RPN A;  3DP4 A;  3U72 A;  1B4Z A;  5BUU A;  4R73 A;  1HSE A;  3TQL A;  4WEP A;  5I57 B;  3TUS A;  2XD2 A;  4F39 A;  1PC3 A;  2D21 A;  2XXW A;  1IXC A;  2ZMB A;  2XXU A;  3GBA A;  4OXV A;  4AB5 A;  4DXC A;  3G3J A;  4ESW A;  3O6G A;  3IL1 B;  1DPP A;  3ZKL A;  1QW0 A;  4XTC Q;  3ODB A;  2Y84 A;  1R6Z A;  4JSD A;  1OVB A;  3FUZ A;  1B3H A;  3RGY A;  2RC9 A;  3RTF B;  3PU5 A;  3N6U A;  1POY 1;  1P1U A;  1MY1 A;  2H5Y A;  3K02 A;  4MFI A;  3IOU A;  4PP0 A;  1A7L A;  4THI A;  1A40 A;  5ISU A;  1AMF A;  1BKA A;  4DIG A;  2O84 X;  1DTZ A;  2I3W A;  3ILT B;  2OK2 A;  3FV1 A;  4XKP A;  1B1X A;  3JYR A;  2R9J A;  2DE2 A;  4ZEK A;  2Z8F A;  3H6T A;  1LLS A;  4NF4 A;  5BWJ A;  1MDP 1;  1MXX A;  1WDN A;  4OEN A;  1NNK A;  1OQG A;  2AIX A;  1BLF A;  1JW4 A;  1SVX B;  1Z7M E;  2REJ A;  4NMY A;  3ZSF A;  3OXN A;  4FE8 A;  4PFY A;  1B5H A;  2VP1 A;  5LOM A;  3TOD A;  2F36 A;  1M5C A;  2H25 A;  3GLB A;  2V3Q A;  4HCW A;  1SYH A;  2ESN A;  1MY2 A;  4OZ9 A;  4IY5 A;  4U23 A;  1S9T A;  5JTY A;  2H4I A;  5TP9 A;  1XVY A;  4AQ4 A;  1SD3 A;  1TFA A;  1H45 A;  2Q9T A;  3MUQ A;  4LUB A;  1H43 A;  3GXA A;  3C33 A;  4LZ5 A;  4NWC A;  4HS7 A;  4QSE A;  3A09 A;  4ZEI A;  1XHY A;  3TTM A;  4HTG A;  4EDP A;  1OIB A;  4F19 A;  2P0S A;  1JW1 A;  1B40 A;  2Y7I A;  4FEB A;  4QFK A;  1SW5 A;  4Z7E A;  1MM7 A;  3CSB A;  3FJM A;  3OO7 A;  3H03 A;  5H8S A;  2UVG A;  5DYH A;  4F1U A;  1LFG A;  3O28 A;  1FTK A;  2NOO A;  2PYY A;  4RNS A;  5AA3 A;  4U2R A;  2RIN A;  4NF5 B;  1N76 A;  2ZYK A;  4N6P A;  1LFI A;  2OBG A;  3P7I A;  4PFT A;  4ZEF A;  2NWJ A;  2XHD A;  1B3G A;  1URS A;  3CR9 A;  4OFJ A;  4YIC A;  4G8H A;  4RA1 A;  3S4U A;  2DWH A;  3OOA A;  4H65 A;  3K0V A;  3TFL A;  1EU8 A;  4ELP A;  3LSF B;  2OWT A;  3C34 A;  1DOT A;  5EHM A;  4EQ7 A;  2CMO A;  1JET A;  3GZG A;  3SDF A;  2ZYN A;  2Y7P A;  1J1N A;  3KZG A;  3D4C A;  4X1B A;  4F22 A;  5A5X A;  1IUD A;  3RT8 A;  1QVS A;  2I3V A;  3C4M A;  5H8F B;  3R7X A;  3VFJ A;  5ELV A;  1Y3N A;  1N84 A;  3S9M C;  1UTH B;  2QL3 A;  3EPE A;  3MPL A;  4G68 B;  2Q2A A;  4G68 C;  4R2B A;  1USY H;  2OZZ A;  5DEX A;  5DVI A;  1B7U A;  3N5L A;  4GRK A;  4KQP A;  3N94 A;  4OFL A;  4ZS9 A;  1T0K A;  1NFT A;  3KN7 A;  2V3U A;  1US5 A;  1OLA A;  3O6I A;  3PPN A;  4EF1 A;  4G8N A;  4JDF A;  2KLF A;  2P2A A;  5IAI A;  4F18 A;  4IO5 A;  3TYH A;  3TTL A;  4PQJ A;  4XXU A;  2OWS A;  3BFT A;  2O6A A;  3FVO A;  4ISU A;  2RC8 A;  4U4X A;  2REG A;  4H67 A;  5I84 A;  3MQ9 A;  2RCA A;  1FQA A;  3T9V A;  3O6H A;  5H8H B;  3ZKK A;  2RC7 A;  4N07 A;  1R9L A;  3BKI B;  5EHS A;  1GGG A;  1IZ1 A;  1SW4 A;  4KYD A;  3ILU B;  2ZXT A;  2HQ0 A;  4R6Y A;  3U92 A;  4DLD A;  1M5B A;  3THI A;  1HSL A;  1S7Y A;  2XXY A;  2ZNS A;  1BIY A;  1B4H A;  3K01 A;  3DM0 A;  1LAF E;  1Y1M A;  4G68 A;  4I1D A;  4LVQ A;  4Q30 B;  3O66 A;  3MZB A;  4U1O A;  5H8Q A;  1Q1K A;  4E0X A;  4JWY A;  1AIV A;  4G2Z A;  1LAG E;  3TQW A;  1N3X A;  2RKM A;  4IGT A;  2B3F A;  2WKY A;  3JV9 A;  3UOR A;  1P1O A;  4XIG Q;  1NH7 A;  4C0R A;  5ICT A;  3O97 A;  4QRZ A;  3H6V A;  4LON B;  1GR2 A;  1GVC A;  2DXY A;  4F29 A;  3HHF A;  5H8F A;  3OD7 A;  2DP8 A;  3DEL B;  2Z8E A;  1MS7 A;  2ABH A;  3IB1 A;  3IJX B;  3LC8 A;  2F7A A;  4FED A;  1TFD A;  3V89 B;  4GD5 A;  5F7V A;  1AL3 A;  4YKK A;  3K6X A;  2R71 A;  3E4R A;  3R26 A;  3FVG A;  2H98 A;  3C31 A;  2XX7 A;  3CG1 A;  3QUF A;  4H6D A;  4XKR A;  3U93 A;  4OEU A;  3K6W A;  4K3F A;  4GLI A;  3VV5 A;  3IO6 A;  4ONY A;  2ONS A;  1Y3Q A;  1IEJ A;  3CFX A;  4U1Z A;  4EQ9 A;  3RN8 A;  3IO4 A;  1B05 A;  1VE4 A;  3I3V A;  1L5T A;  1ANF A;  2IEE A;  2I4C A;  2UVI A;  4KYE A;  4IO6 A;  1FQF A;  3TEP A;  3KJ7 A;  4KD5 A;  2V84 A;  1IXH A;  3MBP A;  3OO6 A;  5CBS A;  3FVK A;  4LQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...