2O84X

Crystal structure of k206e mutant of n-lobe human transferrin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Serotransferrin
publication title Structures of two mutants that probe the role in iron release of the dilysine pair in the N-lobe of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o84X01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o84X02
1VR5A 1A8EA 5FHMA 2NXOA 3WAFA 2Y84A 4G4PA 1J1NA 3CR9A 3A09A 3S4UA 4KYDA 4U4XA 4NEDA 1B3FA 4QHQA 1XS5A 2E1SA 1SW1A 1PB8A 1SW2A 3OMBA 3S9LC 1O7TA 3MP1A 4ELOA 2OWTA 1P1NA 1GV8A 1Y4TA 3OD7A 4OENA 4H65A 1FQBA 2XD2A 4DDDA 5I84A 3W9WA 3I3VA 3UN6A 3Q28A 3Q29A 3KOTA 1B9JA 4QRZA 4POWA 3ZKLA 2F6PA 3IR1A 4R72A 5EHSA 4YMAA 2UYFA 1B3GA 2UVIA 3S2VA 3UORA 1RKMA 3OEKA 4R6KA 4OERA 4DIGA 3TQWA 3IO4A 3SEUA 3IAZA 3RNNA 4F3BA 1USYH 4JB7A 4F1UA 4XKQA 2QS3A 3PUXE 2AIXA 1LAHE 2DWJA 2F78A 3RGYA 4I9DA 2H98A 1B6HA 5FTIA 4M4GA 1GR2A 2VD2A 3KOSA 4RNSA 3DELB 4ZECA 4UACA 3HCQA 5H8NA 2X26A 1MXXA 1GGGA 1UQWA 4XIGQ 2PBWA 5FTHA 2XXHA 4Q8RA 4LP2B 2O1MA 2Z8EA 4MBPA 4JBZA 2QPQA 3U94A 2XD3A 1H44A 1B0HA 1URGA 3AXFA 4ZE8A 3IOTA 3LC8A 4PFYA 3RT6B 3TTKA 1HSEA 4G8HA 5H8NB 3O9PA 2NVUB 2DWAA 2PYYA 4JSDA 3GBAA 4KCCA 4NWCA 2Y7PA 4WXJA 3H6UA 3N6TA 2XXYA 4GOTA 2F7AA 4THIA 2OLBA 4ZEIA 4H6DA 3EHSA 2A5TA 1B40A 1MS7A 2B3BA 3IJXB 4YB6A 1QW0A 1LBCA 4L17A 4U21A 1UIVA 2P2AA 3QYTA 4NF8A 1XVYA 1B58A 4C1UA 4EXLA 2R71A 5EYFA 1JNFA 3HHFA 2Q2AA 1TFDA 4OHNA 4ZEFA 1XOCA 4ZEBA 1OIBA 3VXBA 4BDRA 3OXNA 1JEVA 2ZYMA 2I4CA 2A5TB 1N7XA 3B7DA 2FYIA 4O3BA 3OOAA 3IK6B 1H43A 5DVJA 2PT2A 1Y3NA 4R9FA 4AB5A 3K0VA 2F97A 4OEUA 3ZKKA 4RPNA 1N04A 5KCJA 1URDA 3OO7A 2D5WA 4NF5B 4G8NA 5I59A 2IA4A 3VV5A 3FXRA 3HO7A 3RUMA 5CC2A 2AL5A 2F34A 1OQGA 4OFJA 5KZTA 1A99A 5L9OA 3O6HA 3IB2A 3KJTA 3HHGA 4FATA 1B05A 4RXLA 3TTLA 3S9NC 1S50A 1B0LA 5KCJB 3DP6A 5ICTA 4H8IA 3QIMA 2HAVA 3FJMA 1URSA 1Z7ME 4HW8A 4EF2A 4JWOA 1MH3A 3CG1A 1FQFA 3A3UA 1LB9A 2QJEA 4XKRA 2ALUA 4JWYA 3TTNA 1PEBA 3R26A 3PMWA 2RF1A 1RYOA 2ONKE 3G7WA 3KFMA 1FQDA 3V83A 1MM6A 2XX8A 3I5OA 1B3EA 1BKAA 2DE4A 4H0WA 1LFGA 3FASA 3BKIB 1TXFA 1MXWA 3JV9A 1POTA 1I6BA 2F7BA 3O2AA 1IXHA 3PD8A 5J1DA 1O63A 3EPEA 3K1MA 4GQOA 1B4HA 3LUYA 1US5A 1IXIA 2CZLA 5M2VA 3EHTA 1YTVA 3K2DA 4GVOA 4PFWA 2PMSA 3UA8A 4WEPA 5TU0A 3MP8A 2VD3A 2H5YA 1D9YA 4MF3A 4YZZA 3TCFA 2H9BA 3B6QA 3SDFA 4Z0IA 4NF4A 2I48A 4PE5B 1SYHA 5AA2A 4IB2A 2R6GE 3FUZA 2HCAA 1R9QA 5DVFA 4MH5A 2Y7IA 3O97A 1B32A 3MZ9A 3G3FA 2AL4A 1VE4A 4N07A 3UK4A 4P0GA 3FGSA 4NF4B 1MM7A 3VXCA 4GL0A 3KBRA 5DT6A 4BLAA 2D21A 3OO8A 3O28A 3MWBA 3E3KA 2YJPA 4PQJA 4RJZA 3B6TA 3O66A 2B65A 1DPEA 1DTZA 3TFLA 4TLMB 1POY1 5CMCA 2DQVA 3OO9A 1LB8A 1UTHA 4DXUA 1NFTA 4ESXA 3E9XA 2ZYOA 4R6HA 4ONYA 2PT1A 4BDOA 5ITPA 3T9HB 1HSLA 5CM6A 2DOJA 2H25A 2Q88A 3U93A 1IIWA 1GVCA 3MVWA 4TQUQ 1MPCA 1SW4A 2O69A 2GRVA 5ELVA 2DVCA 1MY3A 1UTHB 1PC3A 4ECFA 1LFIA 1SVXB 2I0BA 2I3WA 4F3PA 4RYAA 4KCDA 4HTGA 3PMVA 5H8QA 2XXIA 3T9XB 4BDQA 3LSXA 3RY3A 4F19A 1R9LA 4DXCA 3N5LA 4LQ2A 2RC9A 1ZKBA 1JW5A 3ILTB 5CMMA 2GHAA 1MPDA 2G29A 1BP5A 1QUIA 4C1TA 3W15C 5DYHA 4JXIA 1MQGA 5DVIA 1ZLQA 3TEPA 1II5A 4F1YA 4NE4A 5H8QB 3MQ9A 1FTKA 1N84A 1D4NA 1MQDA 4K3FA 4TLLB 3RTWB 4FEBA 1WVJA 3S9MC 5TPAA 4ZZAA 4PFTA 1SYIA 4EQ7A 3N94A 4H67A 1MH4A 4QSCA 1DPPA 3IB1A 4O3CA 3ODBA 1AMFA 1SBPA 1TT1A 4X9TA 1OLAA 2NUVA 1QKBA 2XHDA 3OSQA 2V3TA 3IORA 5TPAB 2RKMA 3KN8A 3H7MA 4I62A 3PUWE 3M8UA 1IXGA 4P11A 4G77A 1B2HA 1B46A 4FEDA 1ZBMA 3CFXA 3U8QA 5I58A 3MJNA 4OFLA 3DM0A 4BDMA 1B7HA 3Q25A 3IOUA 4PFUA 1JVYA 4U1OA 4FORA 1B5HA 2E0SA 3H06B 3C9HA 1I6QA 4OEVA 4U22A 3OO6A 1Y1ZA 1WDNA 1I69A 3CSGA 3VFJA 1O64A 3U92A 3QK6A 1A40A 5I58B 2F7CA 4JWXA 3HN0A 4U23A 3TMGA 1A55A 4GRKA 4N6PA 3LSFB 3MVXA 3MZBA 3OEMA 1S9TA 4DZ1A 2ZNSA 4Q5TA 3TKDA 2LAOA 3TUSA 1B3LA 4E0XA 5HBCA 3R7XA 2RCAA 1H3DA 3HSTA 2WKYA 4G8MA 4XKPA 4ELRA 2ZNTA 3B6WA 1MXUA 4OETA 4ZS9A 3MPKA 3TTMA 4TOZA 4QFNA 2ONSA 4KI0E 1FTMA 3H6WA 2VP1A 1NNFA 1SDXA 2A5SA 3RN8A 1B7ZA 4QF9A 3EHUA 4FAJA 4GLIA 1FQAA 1LBBA 1M5FA 5DTBA 3PPPA 2GH9A 3K4UA 2Z22A 4FE8A 2YLNA 2QS1A 3I6VA 5L9MA 3CVGA 1TWYA 3MW0A 1VSOA 2I58A 2XXVA 1P1QA 1JVXA 1EH3A 1NH8A 4GD5A 2YPNA 3K00A 4OQOA 1MXZA 3ILUB 2O7UA 2HAUA 3MP6A 1CE2A 2QL3A 3C4MA 4I8CA 5I56A 4NF5A 2ABHA 3KSXA 2O6AA 4IO2A 1XVXA 2ZYNA 1EZ9A 1EZOA 4H5GA 4DLDA 2OCUA 3PPRA 4IY6A 2OWSA 3CIJA 3K6XA 1B1XA 1A8FA 3O29A 3KZGA 1S7YA 3VE1B 4F31B 4BDNA 1US4A 3VDFA 3HV1A 1PBQA 4WKMA 4YKPA 3IX1A 3T93B 5I56B 2ESNA 2DYXA 3FV1A 4H1XA 3PUVE 3SESA 3GBBA 3MZ1A 2XXXA 3FVGA 4IGTA 4IO3A 3IB0A 2DVZA 2REGA 1Y3QA 4OFOA 4MLQA 1MXVA 1LCTA 2G93A 1Y3PA 1ZIUA 3OSRA 2OBGA 3KSJA 1NKXA 4GXAA 5CRYA 3MPLA 1P1WA 2DWIA 2NOOA 4MLVA 2QRYA 4EXKA 4NMYA 5AA3A 5BUUA 3KGCA 2P0SA 4QFPA 2F35A 1N3WA 4OZ9A 2Y7RA 5CBRA 4RPOA 4F3SA 4XKNA 1MQJA 1FQEA 1XC1A 1ZU0A 4R2BA 3OENA 4KQPA 3L6HA 1DSNA 2RCBA 1MXYA 3C31A 1MDP1 4FIMA 3IOWA 1SW5A 5FHOA 1HSJA 2HZLA 4U2RA 4U1ZA 4YKIA 3IO6A 2DXRA 3SEXA 2Z23A 2UVHA 5H8FA 3ECRA 3FVNA 2V93A 5H8HA 2F8DA 1DOTA 3D4CA 3K01A 4ZDMA 3C35A 3DP4A 2FA7A 5BWJA 3C32A 2OK2A 4KPTA 4ZE9A 4DE8A 5ISUA 5I2KA 4Q0CA 2HFBA 2D3IA 4IO4A 3VLWA 5JTYA 3TODA 5H8FB 4H5FA 1MG1A 5H8HB 3IL1B 1IITA 3MC2A 1FTJA 2H4IA 3CI8A 3VLUA 1AL3A 2IEEA 4NWDA 5AA4A 4RK9A 2XXWA 1R6ZA 3HPIA 3PGFA 5I2KB 4NF6A 4LVQA 1LCFA 4Q30B 1DMBA 5JTYB 3TELA 4QFOA 2QSXA 4R6YA 2HEUA 3G3KA 5IKBA 3PUYE 3F11A 5CBSA 3E4RA 1OMPA 4XTCQ 5I57B 2ZYKA 4IGRA 5AA4B 4OTEA 4HCYA 4NF6B 3MUQA 1B52A 3MVYA 2Z8DA 1JW1A 2H99A 2DE3A 4LUBA 3M3LA 5AE4A 3PUZE 1PBPA 1B5IA 5DEXA 2DXYA 3VVFA 3S9EA 4GFRA 2OJTA 4C0RA 1LFHA 3K6WA 3RLFE 3C34A 4EDPA 3O6IA 4N13A 3ZSFA 1NNTA 3IOVA 1LAXA 3CFZA 1OVTA 1P1UA 3FD3A 1M5EA 4OWDA 4X48A 5DEXB 5JEIA 1ATGA 4U4SA 3KN3A 4LA9A 2I3VA 4R74A 3M3KA 3TYHA 3PD9A 3JZJA 1MDQA 1FQCA 1AOVA 4F39A 2DP8A 1B5JA 2BJJX 1T0KA 1LAFE 2DWHA 2P1SA 2HXWA 2Q2CA 3FJGA 4GIZA 4IO6A 1B7UA 5ICQA 1MPBA 4QSDA 1OLCA 4O3AA 5HPQA 3C33A 2DS9A 1FTOA 3CSBA 3E13X 1RYXA 2ZNUA 4XXUA 1FW0A 4I1DA 3TCHA 4P0IA 1MY2A 1BTJA 2VHAA 4QFKA 1AIVA 1D3KA 1MY4A 4LZ5A 2PX1A 1I6AA 2Z8FA 5F1QA 4YAHX 2I4BA 4LZ7A 1PB7A 4YB5A 3R6UA 4KYEA 2HQ0A 2PVUA 3VVEA 2REJA 2XX7A 3ZS6A 5K2YA 2THIA 1FCKA 4F2QA 3RT8A 2RC8A 3TQLA 1Y9UA 4X1BA 3FVOA 4LATA 2UXAA 3KG2A 4WEDA 2V3UA 2R9JA 4GXSB 4POXA 2RC7A 1EU8A 2O7IA 2V84A 3LBSA 4UA8A 2I49A 1A7LA 4LONB 2XXUA 1B1HA 1D9VA 1SI0A 1IZ1A 4EUOA 4ISUA 3Q26A 2Q9TA 1JEUA 1IUDA 4KR5A 3SETA 1M5DA 2QS4A 1IXCA 1USYE 3KEIA 1XT8A 1IQ7A 3PPOA 2XXPA 3G3IA 2FNCA 3GXAA 4KD5A 3T9VA 4H8JA 5B7DA 4GWOA 3CFLA 3K1NA 2KLFA 4R75A 4OVJA 3V8XB 4KHZE 1B51A 3TCGA 5CI5A 3O6GA 1N76A 2NWJA 3BFTA 5B70A 1P1OA 3LSWA 2O68A 4ESWA 1N7WA 4OYVA 3T66A 4M1VA 1BLFA 1NNPA 3D4GA 1LAGE 3KJ7A 1Y4CA 2B3FA 3V89B 3T22A 1NH7A 4YICA 5L8DA 3TAJA 3PMXA 3VVDA 4GL8A 4F22A 2GFEA 2ANJA 5CMKA 5I2NA 1GTKA 2I6EA 1B3HA 4F3GA 1H76A 4EQ9A 5F7VA 4AQ4A 4F1VA 3H3GA 2QMWA 3PV0E 3BBRA 2Q89A 2ONRA 3FZVA 1LGBC 1A54A 2XXTA 3SEVA 5I2NB 3TDJA 4RK2A 1OVBA 3PPNA 4HCWA 3OELA 2Q8JA 1EZPA 3K6UA 1ELJA 4BDLA 1JETA 4RA1A 4JDFA 2Y7WA 3FXQA 1XHYA 5AA1A 3P7IA 5HM4B 3LSLA 2F6GA 4FECA 1MQHA 3SERA 3FV2A 4NF8B 3JYRA 4DCXA 2HZKA 3BFUA 3EF7A 4MFIA 4G2ZA 1QJMA 4YKKA 4X1DA 1R1NA 3VLVA 5JK4A 4EQBA 1JQFA 4R9GA 2UYEA 2O51A 1Q35A 3N6UA 4NTLA 4DXBA 5KDTA 3K6VA 1L5TA 1BIYA 1ZJLA 4ZEKA 1F9BA 1NNKA 2V3QA 1Y1MA 3PU5A 4Z7EA 5CMBA 2Y7KA 3TPAA 3GLBA 1VFEA 3RQTA 3W9VA 3L6GA 1ZMGA 2XXQA 3KN7A 1OQHA 2VOZA 2GHBA 5I59B 3RPWA 1LSTA 5LOMA 5KDTB 1VFDA 1SI1A 1KWHA 1Z7NE 4QFLA 4ELQA 1WODA 4DCYA 3THIA 4QSEA 3CG3A 3T9UA 1JW4A 3K1PA 4ND9A 1QKAA 4E0WA 1MQIA 1NMUA 3T96B 1YAEA 3EQ1A 3FJ7A 1QUKA 5K2XA 3CRBA 2F36A 3MBPA 3TZAA 3TTRA 4G68A 4ZZEA 1YCJA 1P99A 2O1LA 2W7YA 3FIRA 5L9SA 3FVKA 2UVJA 3IJOB 2ZMBA 3MVZA 3QXMA 1AH5A 3MAMA 4F29A 4G68C 1CB6A 3UIFA 3SKPA 2X7PA 3C36A 3V5AA 2X7QA 4G68B 4FJPA 1IEJA 4JSOA 1M5BA 1UTBA 3SEYA 3U1OA 3M3FA 3UGWA 4IO5A 4KFQA 3SEWA 4YMBA 3DP8A 5I57A 2O84X 3ONMA 1M5CA 4OMBA 5TP9A 4R2FA 3H03A 3PPQA 1UTBB 3Q27A 2VGQA 5FHNA 5AA2D 1MY1A 1LLSA 1QVSA 3A3CA 3QUFA 2DSFA 4KYSA 3GZGA 3QSLA 1ANFA 3G3GA 4ELPA 4F18A 2CMOA 5AA2B 4F2OA 1Q1KA 2F5XA 5TP9B 4YKJA 4LZ8A 3G3HA 1PB9A 5EHMA 5A5XA 3RTFB 3FATA 4EF1A 2DE2A 2RINA 4IO7A 1NL5A 3H6VA 2M8CA 1UIUA 4LQ5A 5ITOA 3LR1A 3FXUA 3DLNA 1YPNA 1SQYA 1MRPA 3K02A 4YU0A 3USDA 2V25A 5A5XB 3N26A 1QULA 4PETA 2QS2A 2I0CA 3WAEA 1QUJA 1TFAA 4YB7A 3QAXA 2XX9A 5IAIA 1Y20A 4AB6A 3H4ZA 2XXRA 1N0TA 4ZEDA 3G3JA 2UVGA 3U72A 4RY1A 4R73A 2ZXTA 3QUJA 1B4ZA 3UP9A 1FTLA 4OXVA 3H6TA 1N3XA 1MY0A 1DTGA 4GF8A 4OESA 3EN3A 2OZZA 1H45A 4PP0A 1SD3A 2QMXA 4HS7A 5H8SA 1PDAA 1ZTYA 4IY5A 2AYSA
chains in the Genus database with same CATH superfamily
1VR5A 1INPA 4NX1A 4NGUA 1A8EA 5ET7A 5FHMA 2NXOA 3WAFA 2Y84A 4G4PA 1J1NA 5IZZA 1NV4A 1G0HA 4MNPA 2L5VA 3CR9A 3A09A 4JVIA 3S4UA 4KYDA 4U4XA 4NEDA 1B3FA 4QHQA 2PCRA 1XS5A 4HE2A 2E1SA 1SW1A 1PB8A 1SW2A 3OMBA 3S9LC 4I40A 1O7TA 3MP1A 4ELOA 2OWTA 4PBHA 1P1NA 4N4UA 1GV8A 1NV2A 1Y4TA 3OD7A 1BK4A 4OENA 1IMCA 4H65A 1FQBA 2XD2A 4PBQA 5J16A 4DDDA 5I84A 3W9WA 3I3VA 3UN6A 3Q28A 3Q29A 3KOTA 1B9JA 4I3YA 2XWIA 4QRZA 4POWA 3ZKLA 2F6PA 3IR1A 4R72A 5EHSA 4YMAA 2UYFA 1B3GA 2UVIA 3S2VA 3UORA 1FJ9A 1RKMA 3OEKA 4R6KA 4OERA 4DIGA 1LEVA 3TQWA 3IO4A 3SEUA 3IAZA 3RNNA 4F3BA 1USYH 4JB7A 4F1UA 4XKQA 2QS3A 3PUXE 2AIXA 1LAHE 2DWJA 2F78A 3RGYA 1QGXA 4I9DA 2H98A 1B6HA 5FTIA 4M4GA 1GR2A 2VD2A 3KOSA 4RNSA 4P9KA 3DELB 4ZECA 4UACA 3HCQA 5H8NA 2X26A 2P3NA 4GBVA 1MXXA 5IZ3A 1GGGA 2XA5A 5LTCA 1UQWA 4XIGQ 2PBWA 4OVQA 5FTHA 2XXHA 4Q8RA 4LP2B 2O1MA 1RDZA 2Z8EA 4MBPA 4JBZA 2QPQA 3U94A 2XD3A 1H44A 1B0HA 1URGA 3AXFA 4ZE8A 4PAIA 3IOTA 3LC8A 4PFYA 3RT6B 5EYHA 3TTKA 1HSEA 4G8HA 3FBPA 5H8NB 3O9PA 4X8RA 2NVUB 4PF8A 2DWAA 5IZ3B 1NV3A 1LBYA 2PYYA 4JSDA 3GBAA 4KCCA 4NWCA 2Y7PA 4WXJA 5ET8A 3H6UA 3N6TA 2XXYA 4GOTA 2F7AA 4THIA 2OLBA 4ZEIA 2OX3A 4H6DA 2Q8MA 3EHSA 2A5TA 1B40A 1MS7A 1FPLA 4P1LA 2B3BA 3IJXB 4YB6A 1QW0A 1LBCA 4L17A 2JJKA 4U21A 1UIVA 2P2AA 2WYPA 3QYTA 4NF8A 1XVYA 1B58A 4C1UA 4EXLA 2R71A 5EYFA 1JNFA 3HHFA 2Q2AA 1TFDA 3BIGA 4OHNA 4ZEFA 1XOCA 4ZEBA 1OIBA 1IMFA 3VXBA 4BDRA 3OXNA 1JEVA 2FIEA 2QFLA 2ZYMA 2I4CA 2A5TB 1N7XA 3B7DA 2FYIA 4O3BA 3OOAA 3IK6B 4DI3D 1H43A 5DVJA 2PT2A 1Y3NA 4R9FA 4AB5A 4NQ8A 3K0VA 2F97A 4OEUA 3ZKKA 1YYZA 4RPNA 1N04A 5KCJA 4N91A 1URDA 4P56A 4I3EA 3OO7A 2D5WA 4NF5B 4G8NA 5I59A 2IA4A 3VV5A 3FXRA 3HO7A 3RUMA 5CC2A 2AL5A 2F34A 1OQGA 3T0JA 4OFJA 1DCUA 5KZTA 4MCOA 1A99A 5L9OA 3O6HA 3IB2A 3KJTA 3HHGA 4FATA 1B05A 4RXLA 3TTLA 3S9NC 3IFAA 1S50A 3LV0A 1B0LA 5KCJB 4N81A 3DP6A 5ICTA 4H8IA 3QIMA 2HAVA 3FJMA 1URSA 1Z7ME 4HW8A 4EF2A 4OA4A 4JWOA 1MH3A 3CG1A 1FQFA 3A3UA 1LB9A 2QJEA 4XKRA 2ALUA 4JWYA 3TTNA 1PEBA 3R26A 3PMWA 2RF1A 1RYOA 2ONKE 3ROJA 3ISPA 2CZIA 3G7WA 3KFMA 1FQDA 3V83A 1MM6A 4O94A 2XX8A 3I5OA 1B3EA 1BKAA 2DE4A 4H0WA 1LFGA 3FASA 3BKIB 1FPEA 1TXFA 1MXWA 3JV9A 2FBPA 1FBCA 1POTA 1I6BA 2F7BA 2ZZWA 3O2AA 1IXHA 4OANA 3PD8A 5J1DA 1O63A 3EPEA 3K1MA 4GQOA 2HHMA 1B4HA 3LUYA 1DK4A 1US5A 1IXIA 2CZLA 5M2VA 3EHTA 1YTVA 3K2DA 4GVOA 4PFWA 2PMSA 3UA8A 4WEPA 5TU0A 3MP8A 4GX4A 2VD3A 2H5YA 1D9YA 4MF3A 4YZZA 3TCFA 1K9YA 2H9BA 3B6QA 4P3LA 3SDFA 4Z0IA 4NF4A 2I48A 4PE5B 3B8BA 1SYHA 5AA2A 5IZ1A 4IB2A 2R6GE 1NV7A 3FUZA 2HCAA 1R9QA 5DVFA 4MH5A 2Y7IA 3O97A 1B32A 3RYDA 3MZ9A 3G3FA 1FPJA 2AL4A 4NAPA 2V4CA 1VE4A 4N07A 3UK4A 4P0GA 4OVSA 3FGSA 4NF4B 1MM7A 3VXCA 4GL0A 3KBRA 5EQAA 5DT6A 4BLAA 2D21A 3OO8A 3O28A 3MWBA 3E3KA 2YJPA 4AS5A 3NOHA 4PQJA 1FPGA 4RJZA 3B6TA 3O66A 2B65A 1DPEA 1DTZA 3TFLA 4TLMB 1POY1 5CMCA 2DQVA 3OO9A 1LB8A 3KC0A 1UTHA 4DXUA 1NFTA 4ESXA 3E9XA 2ZYOA 4R6HA 2F3DA 5ESYA 4MHFA 4ONYA 1NV5A 2PT1A 4BDOA 5ITPA 3T9HB 1HSLA 5CM6A 2DOJA 2H25A 2Q88A 4PFRA 3U93A 3IFCA 1IIWA 1GVCA 3MVWA 4TQUQ 1MPCA 1SW4A 2Y5LA 2B4MA 2O69A 2GRVA 5ELVA 2DVCA 1MY3A 1UTHB 1PC3A 4ECFA 1LFIA 1SVXB 2I0BA 2I3WA 4F3PA 4RYAA 1FJ6A 4PAKA 4KCDA 2ZZVA 4HTGA 3PMVA 5H8QA 2XXIA 3T9XB 4BDQA 3LSXA 4GWYA 3RY3A 4F19A 1R9LA 4DXCA 3N5LA 4LQ2A 2RC9A 1ZKBA 1JW5A 1Q9DA 3ILTB 5CMMA 2GHAA 1MPDA 2G29A 1BP5A 1QUIA 4PAFA 4C1TA 3W15C 5DYHA 2WEFA 4JXIA 1MQGA 1FTAA 5DVIA 1ZLQA 3TEPA 1II5A 4F1YA 4NE4A 4HXVA 5H8QB 3MQ9A 4QBAA 1FTKA 2VT5A 1N84A 2GQ1A 1D4NA 1MQDA 4K3FA 4TLLB 3GYYA 3RTWB 4FEBA 1K9ZA 1WVJA 3S9MC 5TPAA 4ZZAA 4PFTA 1SYIA 4EQ7A 3N94A 4H67A 1MH4A 4QSCA 1DPPA 3IB1A 4O3CA 3ODBA 1G0IA 4PE3A 1AMFA 3KBZA 1SBPA 1TT1A 4X9TA 2VPOA 1OLAA 4MNCA 2NUVA 1QKBA 2XHDA 3OSQA 2V3TA 1DBZA 3IORA 1RDXA 5TPAB 2OWZA 2PFZA 2RKMA 3KN8A 3H7MA 4I62A 1NUYA 3PUWE 3LUZA 3M8UA 1IXGA 4P11A 4G77A 1B2HA 1B46A 2CZHA 4FEDA 1ZBMA 3CFXA 3U8QA 5I58A 3MJNA 4OFLA 3DM0A 4BDMA 5IM2A 3MYUA 1B7HA 3Q25A 3IOUA 4PFUA 1JVYA 4U1OA 4FORA 1B5HA 2E0SA 3H06B 1FBPA 4P47A 3C9HA 1I6QA 4OEVA 4U22A 3OO6A 1Y1ZA 4PDDA 1WDNA 1I69A 3CSGA 3VFJA 1O64A 3U92A 3QK6A 1A40A 5I58B 2F7CA 4JWXA 3HN0A 4U23A 3TMGA 1A55A 4GRKA 4N6PA 3SZPA 3LSFB 3MVXA 3MZBA 3OEMA 4OVPA 1S9TA 4DZ1A 2ZNSA 3QMFA 4Q5TA 3TKDA 2LAOA 3TUSA 1KA1A 4H45A 1FBEA 1YZ0A 1B3LA 4E0XA 5HBCA 3R7XA 1RDYA 1LBVA 4MIJA 2RCAA 1FPBA 1H3DA 3HSTA 2WKYA 5I7IA 4G8MA 4XKPA 3E79A 5DW8A 4MMPA 4ELRA 2ZNTA 3B6WA 1MXUA 4OETA 4ZS9A 3MPKA 3T1BA 3TTMA 2WBDA 4TOZA 4GWWA 4QFNA 2ONSA 4KI0E 1FTMA 2WBBA 3H6WA 2VP1A 1NNFA 1SDXA 2A5SA 3RN8A 1B7ZA 4QF9A 3EHUA 4FAJA 4GLIA 1FQAA 1LBBA 1M5FA 5DTBA 3PPPA 1FPIA 2GH9A 3K4UA 2Z22A 4FE8A 5IGAA 2YLNA 2QS1A 3I6VA 5L9MA 3CVGA 1TWYA 3MW0A 1VSOA 2I58A 2XXVA 1P1QA 1JVXA 1EH3A 1NH8A 4GD5A 2KR0A 2YPNA 3K00A 4OQOA 1MXZA 3ILUB 2O7UA 3MP6A 4IR8A 1NI9A 1CE2A 2HAUA 2QL3A 3C4MA 4I8CA 5I56A 4NF5A 2ABHA 3KSXA 2O6AA 4IO2A 1XVXA 2ZYNA 1EZ9A 1EZOA 4H5GA 4DLDA 4N6DA 2OCUA 3PPRA 4IY6A 2OWSA 3CIJA 3K6XA 1B1XA 1A8FA 3O29A 3KZGA 1S7YA 3VE1B 4BDNA 4F31B 1US4A 3VDFA 4JVCA 3HV1A 1PBQA 4NN3A 1SPIA 4WKMA 4GWUA 1NV0A 4YKPA 4GX6A 3IX1A 4O8MA 3T93B 5I56B 4H1XA 2ESNA 2DYXA 3FV1A 3PUVE 3SESA 3GBBA 3MZ1A 5EQ9A 2XXXA 3FVGA 4IGTA 4IO3A 4N6KA 3IB0A 2DVZA 2REGA 1Y3QA 4OFOA 4MLQA 1MXVA 1LCTA 2G93A 4GWSA 1Y3PA 1ZIUA 3OSRA 2OBGA 3KSJA 1NKXA 4GXAA 5CRYA 3MPLA 1P1WA 2DWIA 2NOOA 4HE0A 4MLVA 2QRYA 1FSAA 4EXKA 2R8TA 4PF6A 4NMYA 5AA3A 5BUUA 3KGCA 2P0SA 4QFPA 2F35A 1N3WA 4N17A 4OZ9A 5I3SA 2Y7RA 3E78A 5CBRA 4RPOA 4F3SA 4XKNA 1MQJA 1FQEA 1XC1A 1ZU0A 2WX9A 4R2BA 3OENA 4KQPA 3L6HA 1DSNA 2RCBA 5I5PA 3BIHA 1MXYA 3C31A 1MDP1 4FIMA 4XF5A 3IOWA 1SW5A 5FHOA 1HSJA 2HZLA 4U2RA 4U1ZA 4YKIA 3IO6A 2DXRA 1EYJA 3SEXA 2Z23A 2UVHA 5H8FA 3ECRA 5EYGA 3FVNA 2V93A 5H8HA 2F8DA 1DOTA 3D4CA 3K01A 4ZDMA 3C35A 3DP4A 2FA7A 5BWJA 3C32A 2OK2A 4MEVA 4KPTA 4ZE9A 4OVRA 4DE8A 4O7IA 5ISUA 5I2KA 4Q0CA 2HFBA 2D3IA 4IO4A 4G61A 3VLWA 5JTYA 3TODA 5H8FB 4H5FA 1MG1A 5H8HB 2XXKA 3IL1B 1IITA 3MC2A 1FTJA 2H4IA 5EQ8A 3CI8A 3VLUA 1AL3A 2IEEA 4NWDA 5AA4A 4RK9A 2XXWA 1R6ZA 3HPIA 3PGFA 4H46A 2HPGA 5I2KB 4NF6A 4LVQA 4PCDA 1LCFA 4Q30B 1DMBA 5JTYB 3TELA 4QFOA 3RPLA 2QSXA 3KC1A 3HFUA 4R6YA 2HEUA 3G3KA 5IKBA 3PUYE 1EYIA 3U65A 3F11A 5CBSA 3E4RA 1OMPA 4GWZA 4XTCQ 1NUWA 5I57B 2ZYKA 4IGRA 5AA4B 4PDHA 4OTEA 5F24A 4MJOA 4HCYA 4NF6B 2FVZA 3MUQA 1B52A 3MVYA 2Z8DA 1JW1A 2H99A 3RPLB 2DE3A 1XI6A 4LUBA 3M3LA 5AE4A 3PUZE 1PBPA 1B5IA 5DEXA 2DXYA 3VVFA 3S9EA 4GFRA 2OJTA 4C0RA 2QVVA 1LFHA 3K6WA 1FBFA 3RLFE 3C34A 4EDPA 3O6IA 4N13A 3ZSFA 1NNTA 3IOVA 1LAXA 3CFZA 1OVTA 1P1UA 3FD3A 1M5EA 2CEXA 4OWDA 4X48A 5DEXB 5JEIA 1ATGA 4U4SA 4NHBA 3KN3A 4LA9A 2I3VA 4R74A 3M3KA 3TYHA 3PD9A 4MAGA 2QVRA 3JZJA 1MDQA 1FQCA 1AOVA 4F39A 2DP8A 1B5JA 2BJJX 1T0KA 1LAFE 2DWHA 2P1SA 1NUXA 2HXWA 2Q2CA 3FJGA 4GIZA 4IO6A 1B7UA 5ICQA 1MPBA 4QSDA 1OLCA 4O3AA 4PFIA 5HPQA 3C33A 3PTYA 2DS9A 1FTOA 4MX6A 3CSBA 3E13X 1RYXA 2ZNUA 4XXUA 1FW0A 4I1DA 3TCHA 4P0IA 1MY2A 1BTJA 2VHAA 1EYKA 4QFKA 1AIVA 1D3KA 1MY4A 4LZ5A 2PX1A 1I6AA 2Z8FA 4OVTA 5F1QA 4YAHX 2I4BA 4LZ7A 1PB7A 4YB5A 3R6UA 4KYEA 2HQ0A 2PVUA 2F3BA 3VVEA 2REJA 2XX7A 3ZS6A 5K2YA 2THIA 4PTKA 1FCKA 4F2QA 3RT8A 2RC8A 3TQLA 1Y9UA 4X1BA 3FVOA 2CZKA 4LATA 3FXBA 2UXAA 3KG2A 4WEDA 2V3UA 2R9JA 2BJIA 4GXSB 4POXA 2RC7A 4N15A 1EU8A 4P1EA 2O7IA 2V84A 3LBSA 5FBPA 4UA8A 2I49A 1KZ8A 1A7LA 1JP4A 4LONB 2XXUA 4DI4B 2PFYA 2P3VA 1B1HA 1D9VA 1SI0A 1IZ1A 4EUOA 4ISUA 3Q26A 2Q9TA 1JEUA 1IUDA 4KR5A 3SETA 1M5DA 2QS4A 1IXCA 1USYE 4N8GA 3KEIA 1XT8A 5A5LA 1IQ7A 3D1RA 3PPOA 2XXPA 3G3IA 2FNCA 3GXAA 4GBWA 1KA0A 4KD5A 3T9VA 2Q74A 4H8JA 5B7DA 4GWOA 3CFLA 3K1NA 2KLFA 4R75A 2XWOA 4OVJA 3V8XB 4KHZE 1B51A 3TCGA 5CI5A 3O6GA 1N76A 2NWJA 3BFTA 5B70A 1IMEA 1P1OA 3LSWA 2O68A 4ESWA 1N7WA 4OYVA 3T66A 4M1VA 1BLFA 1NNPA 3D4GA 1LAGE 3KJ7A 1Y4CA 2B3FA 1IMBA 3V89B 3T22A 1NH7A 4YICA 5L8DA 3TAJA 3PMXA 3VVDA 2WYKA 4GL8A 4F22A 2GFEA 2ANJA 5CMKA 5I2NA 1GTKA 2I6EA 1B3HA 4F3GA 3A29A 2ZZXA 1H76A 4EQ9A 5F7VA 4KXPA 4AQ4A 4F1VA 3H3GA 2QMWA 3PV0E 3BBRA 2Q89A 2ONRA 3FZVA 2FHYA 2CEYA 1LGBC 5LDZA 1A54A 2XXTA 3SEVA 1LBXA 5I2NB 3TDJA 4RK2A 1OVBA 3PPNA 4HCWA 1FRPA 1LBZA 1NV6A 1LBWA 3OELA 2Q8JA 1EZPA 2HXRA 2XWVA 3K6UA 1ELJA 4BDLA 1JETA 4RA1A 4JDFA 4XFEA 2Y7WA 3FXQA 1XHYA 5AA1A 3CHGA 2MKZA 3P7IA 4PC9A 5HM4B 4HE1A 3LSLA 2F6GA 4FECA 1MQHA 3SERA 3FV2A 1D9QA 4NF8B 3JYRA 4DCXA 2HZKA 3BFUA 3EF7A 4MFIA 4G2ZA 1QJMA 4YKKA 4X1DA 1R1NA 3VLVA 5JK4A 5EQ7A 4EQBA 1JQFA 1IMAA 4R9GA 2UYEA 2O51A 1Q35A 3N6UA 4NTLA 4DXBA 5KDTA 3K6VA 1L5TA 1BIYA 1ZJLA 4NF0A 2DDKA 4ZEKA 2Y5KA 1F9BA 1NNKA 2V3QA 1Y1MA 3PU5A 4Z7EA 5CMBA 2Y7KA 3TPAA 2QVUA 3GLBA 2VPNA 1FPFA 1VFEA 1CNQA 3RQTA 3W9VA 3L6GA 1ZMGA 2XXQA 3KN7A 1OQHA 2VOZA 2GHBA 5I59B 1NV1A 3RPWA 1LSTA 5LOMA 5KDTB 1VFDA 1SI1A 1KWHA 1Z7NE 4QFLA 4ELQA 1WODA 5ET6A 4DCYA 3THIA 4QSEA 3CG3A 3T9UA 1JW4A 3K1PA 4ND9A 1QKAA 4E0WA 1MQIA 1NMUA 3T96B 1YAEA 3EQ1A 4N8YA 4PGNA 3FJ7A 1QUKA 5K2XA 3CRBA 2F36A 3MBPA 3TZAA 3TTRA 4G68A 4ZZEA 1YCJA 1P99A 2O1LA 2W7YA 4GWXA 3FIRA 5L9SA 4GX3A 3FVKA 2UVJA 3IJOB 2ZMBA 1FPKA 3MVZA 3QXMA 1AH5A 3MAMA 4F29A 4G68C 1CB6A 3UIFA 3SKPA 2X7PA 4X04A 3C36A 3V5AA 2X7QA 2B4LA 4G68B 4FJPA 1IEJA 4JSOA 4NG7A 1M5BA 1UTBA 3SEYA 1VDWA 3U1OA 3M3FA 3UGWA 4IO5A 4KFQA 3SEWA 4YMBA 3DP8A 1FBHA 5I57A 2O84X 3ONMA 1M5CA 4OMBA 5TP9A 1YXIA 4R2FA 4QXDA 3H03A 3PPQA 1FBGA 1UTBB 3Q27A 2VGQA 5FHNA 5AA2D 1MY1A 1LLSA 1QVSA 3A3CA 3QUFA 2DSFA 4KYSA 2XWKA 4MNIA 3GZGA 3QSLA 4XEQA 3B50A 1ANFA 3G3GA 4ELPA 4F18A 2CMOA 5AA2B 4F2OA 1Q1KA 2F5XA 5TP9B 4YKJA 4LZ8A 3G3HA 1PB9A 5EHMA 5A5XA 3RTFB 3FATA 4EF1A 2DE2A 2RINA 4IO7A 1NL5A 3H6VA 5T3JA 2M8CA 4O7MA 1UIUA 4LQ5A 5ITOA 3MSTA 3LR1A 3FXUA 3DLNA 1YPNA 1SQYA 1MRPA 1NUZA 3K02A 4YU0A 3USDA 2FIXA 1FPDA 2V25A 1FBDA 5A5XB 3N26A 4LN5A 1QULA 3EKIA 4PETA 2QS2A 4FBPA 5ET5A 2I0CA 3WAEA 1QUJA 2KQZA 4JVDA 4PGPA 1TFAA 4YB7A 3QAXA 2XX9A 5IAIA 1Y20A 1IMDA 3H4ZA 4AB6A 4UABA 2XXRA 1N0TA 4ZEDA 3G3JA 2UVGA 3U72A 4RY1A 4R73A 2ZXTA 3QUJA 1B4ZA 4AS4A 3UP9A 1FTLA 1AWBA 4OXVA 3H6TA 1N3XA 1MY0A 1DTGA 4PFBA 4GF8A 4OESA 4P8BA 3EN3A 2OZZA 1H45A 4PP0A 1SD3A 2QMXA 4HS7A 5H8SA 1PDAA 1ZTYA 4IY5A 2AYSA
chains in the Genus database with same CATH topology
1VR5A 1A8EA 5FHMA 2NXOA 3WAFA 2Y84A 4G4PA 1J1NA 3CR9A 3A09A 3S4UA 4KYDA 4U4XA 4NEDA 1B3FA 4QHQA 1XS5A 2E1SA 1SW1A 1PB8A 1SW2A 3OMBA 3S9LC 1O7TA 3MP1A 4ELOA 2OWTA 1P1NA 1GV8A 1Y4TA 3OD7A 4OENA 4H65A 1FQBA 2XD2A 4DDDA 5I84A 3W9WA 3I3VA 3UN6A 3Q28A 3Q29A 3KOTA 1B9JA 4QRZA 4POWA 3ZKLA 2F6PA 3IR1A 4R72A 5EHSA 4YMAA 2UYFA 1B3GA 2UVIA 3S2VA 3UORA 1RKMA 3OEKA 4R6KA 4OERA 4DIGA 3TQWA 3IO4A 3SEUA 3IAZA 3RNNA 4F3BA 1USYH 4JB7A 4F1UA 4XKQA 2QS3A 3PUXE 2AIXA 1LAHE 2DWJA 2F78A 3RGYA 4I9DA 2H98A 1B6HA 5FTIA 4M4GA 1GR2A 2VD2A 3KOSA 4RNSA 3DELB 4ZECA 4UACA 3HCQA 5H8NA 2X26A 1MXXA 1GGGA 1UQWA 4XIGQ 2PBWA 5FTHA 2XXHA 4Q8RA 4LP2B 2O1MA 2Z8EA 4MBPA 4JBZA 2QPQA 3U94A 2XD3A 1H44A 1B0HA 1URGA 3AXFA 4ZE8A 3IOTA 3LC8A 4PFYA 3RT6B 3TTKA 1HSEA 4G8HA 5H8NB 3O9PA 2NVUB 2DWAA 2PYYA 4JSDA 3GBAA 4KCCA 4NWCA 2Y7PA 4WXJA 3H6UA 3N6TA 2XXYA 4GOTA 2F7AA 4THIA 2OLBA 4ZEIA 4H6DA 3EHSA 2A5TA 1B40A 1MS7A 2B3BA 3IJXB 4YB6A 1QW0A 1LBCA 4L17A 4U21A 1UIVA 2P2AA 3QYTA 4NF8A 1XVYA 1B58A 4C1UA 4EXLA 2R71A 5EYFA 1JNFA 3HHFA 2Q2AA 1TFDA 4OHNA 4ZEFA 1XOCA 4ZEBA 1OIBA 3VXBA 4BDRA 3OXNA 1JEVA 2ZYMA 2I4CA 2A5TB 1N7XA 3B7DA 2FYIA 4O3BA 3OOAA 3IK6B 1H43A 5DVJA 2PT2A 1Y3NA 4R9FA 4AB5A 3K0VA 2F97A 4OEUA 3ZKKA 4RPNA 1N04A 5KCJA 1URDA 3OO7A 2D5WA 4NF5B 4G8NA 5I59A 2IA4A 3VV5A 3FXRA 3HO7A 3RUMA 5CC2A 2AL5A 2F34A 1OQGA 4OFJA 5KZTA 1A99A 5L9OA 3O6HA 3IB2A 3KJTA 3HHGA 4FATA 1B05A 4RXLA 3TTLA 3S9NC 1S50A 1B0LA 5KCJB 3DP6A 5ICTA 4H8IA 3QIMA 2HAVA 3FJMA 1URSA 1Z7ME 4HW8A 4EF2A 4JWOA 1MH3A 3CG1A 1FQFA 3A3UA 1LB9A 2QJEA 4XKRA 2ALUA 4JWYA 3TTNA 1PEBA 3R26A 3PMWA 2RF1A 1RYOA 2ONKE 3G7WA 3KFMA 1FQDA 3V83A 1MM6A 2XX8A 3I5OA 1B3EA 1BKAA 2DE4A 4H0WA 1LFGA 3FASA 3BKIB 1TXFA 1MXWA 3JV9A 1POTA 1I6BA 2F7BA 3O2AA 1IXHA 3PD8A 5J1DA 1O63A 3EPEA 3K1MA 4GQOA 1B4HA 3LUYA 1US5A 1IXIA 2CZLA 5M2VA 3EHTA 1YTVA 3K2DA 4GVOA 4PFWA 2PMSA 3UA8A 4WEPA 5TU0A 3MP8A 2VD3A 2H5YA 1D9YA 4MF3A 4YZZA 3TCFA 2H9BA 3B6QA 3SDFA 4Z0IA 4NF4A 2I48A 4PE5B 1SYHA 5AA2A 4IB2A 2R6GE 3FUZA 2HCAA 1R9QA 5DVFA 4MH5A 2Y7IA 3O97A 1B32A 3MZ9A 3G3FA 2AL4A 1VE4A 4N07A 3UK4A 4P0GA 3FGSA 4NF4B 1MM7A 3VXCA 4GL0A 3KBRA 5DT6A 4BLAA 2D21A 3OO8A 3O28A 3MWBA 3E3KA 2YJPA 4PQJA 4RJZA 3B6TA 3O66A 2B65A 1DPEA 1DTZA 3TFLA 4TLMB 1POY1 5CMCA 2DQVA 3OO9A 1LB8A 1UTHA 4DXUA 1NFTA 4ESXA 3E9XA 2ZYOA 4R6HA 4ONYA 2PT1A 4BDOA 5ITPA 3T9HB 1HSLA 5CM6A 2DOJA 2H25A 2Q88A 3U93A 1IIWA 1GVCA 3MVWA 4TQUQ 1MPCA 1SW4A 2O69A 2GRVA 5ELVA 2DVCA 1MY3A 1UTHB 1PC3A 4ECFA 1LFIA 1SVXB 2I0BA 2I3WA 4F3PA 4RYAA 4KCDA 4HTGA 3PMVA 5H8QA 2XXIA 3T9XB 4BDQA 3LSXA 3RY3A 4F19A 1R9LA 4DXCA 3N5LA 4LQ2A 2RC9A 1ZKBA 1JW5A 3ILTB 5CMMA 2GHAA 1MPDA 2G29A 1BP5A 1QUIA 4C1TA 3W15C 5DYHA 4JXIA 1MQGA 5DVIA 1ZLQA 3TEPA 1II5A 4F1YA 4NE4A 5H8QB 3MQ9A 1FTKA 1N84A 1D4NA 1MQDA 4K3FA 4TLLB 3RTWB 4FEBA 1WVJA 3S9MC 5TPAA 4ZZAA 4PFTA 1SYIA 4EQ7A 3N94A 4H67A 1MH4A 4QSCA 1DPPA 3IB1A 4O3CA 3ODBA 1AMFA 1SBPA 1TT1A 4X9TA 1OLAA 2NUVA 1QKBA 2XHDA 3OSQA 2V3TA 3IORA 5TPAB 2RKMA 3KN8A 3H7MA 4I62A 3PUWE 3M8UA 1IXGA 4P11A 4G77A 1B2HA 1B46A 4FEDA 1ZBMA 3CFXA 3U8QA 5I58A 3MJNA 4OFLA 3DM0A 4BDMA 1B7HA 3Q25A 3IOUA 4PFUA 1JVYA 4U1OA 4FORA 1B5HA 2E0SA 3H06B 3C9HA 1I6QA 4OEVA 4U22A 3OO6A 1Y1ZA 1WDNA 1I69A 3CSGA 3VFJA 1O64A 3U92A 3QK6A 1A40A 5I58B 2F7CA 4JWXA 3HN0A 4U23A 3TMGA 1A55A 4GRKA 4N6PA 3LSFB 3MVXA 3MZBA 3OEMA 1S9TA 4DZ1A 2ZNSA 4Q5TA 3TKDA 2LAOA 3TUSA 1B3LA 4E0XA 5HBCA 3R7XA 2RCAA 1H3DA 3HSTA 2WKYA 4G8MA 4XKPA 4ELRA 2ZNTA 3B6WA 1MXUA 4OETA 4ZS9A 3MPKA 3TTMA 4TOZA 4QFNA 2ONSA 4KI0E 1FTMA 3H6WA 2VP1A 1NNFA 1SDXA 2A5SA 3RN8A 1B7ZA 4QF9A 3EHUA 4FAJA 4GLIA 1FQAA 1LBBA 1M5FA 5DTBA 3PPPA 2GH9A 3K4UA 2Z22A 4FE8A 2YLNA 2QS1A 3I6VA 5L9MA 3CVGA 1TWYA 3MW0A 1VSOA 2I58A 2XXVA 1P1QA 1JVXA 1EH3A 1NH8A 4GD5A 2YPNA 3K00A 4OQOA 1MXZA 3ILUB 2O7UA 2HAUA 3MP6A 1CE2A 2QL3A 3C4MA 4I8CA 5I56A 4NF5A 2ABHA 3KSXA 2O6AA 4IO2A 1XVXA 2ZYNA 1EZ9A 1EZOA 4H5GA 4DLDA 2OCUA 3PPRA 4IY6A 2OWSA 3CIJA 3K6XA 1B1XA 1A8FA 3O29A 3KZGA 1S7YA 3VE1B 4F31B 4BDNA 1US4A 3VDFA 3HV1A 1PBQA 4WKMA 4YKPA 3IX1A 3T93B 5I56B 2ESNA 2DYXA 3FV1A 4H1XA 3PUVE 3SESA 3GBBA 3MZ1A 2XXXA 3FVGA 4IGTA 4IO3A 3IB0A 2DVZA 2REGA 1Y3QA 4OFOA 4MLQA 1MXVA 1LCTA 2G93A 1Y3PA 1ZIUA 3OSRA 2OBGA 3KSJA 1NKXA 4GXAA 5CRYA 3MPLA 1P1WA 2DWIA 2NOOA 4MLVA 2QRYA 4EXKA 4NMYA 5AA3A 5BUUA 3KGCA 2P0SA 4QFPA 2F35A 1N3WA 4OZ9A 2Y7RA 5CBRA 4RPOA 4F3SA 4XKNA 1MQJA 1FQEA 1XC1A 1ZU0A 4R2BA 3OENA 4KQPA 3L6HA 1DSNA 2RCBA 1MXYA 3C31A 1MDP1 4FIMA 3IOWA 1SW5A 5FHOA 1HSJA 2HZLA 4U2RA 4U1ZA 4YKIA 3IO6A 2DXRA 3SEXA 2Z23A 2UVHA 5H8FA 3ECRA 3FVNA 2V93A 5H8HA 2F8DA 1DOTA 3D4CA 3K01A 4ZDMA 3C35A 3DP4A 2FA7A 5BWJA 3C32A 2OK2A 4KPTA 4ZE9A 4DE8A 5ISUA 5I2KA 4Q0CA 2HFBA 2D3IA 4IO4A 3VLWA 5JTYA 3TODA 5H8FB 4H5FA 1MG1A 5H8HB 3IL1B 1IITA 3MC2A 1FTJA 2H4IA 3CI8A 3VLUA 1AL3A 2IEEA 4NWDA 5AA4A 4RK9A 2XXWA 1R6ZA 3HPIA 3PGFA 5I2KB 4NF6A 4LVQA 1LCFA 4Q30B 1DMBA 5JTYB 3TELA 4QFOA 2QSXA 4R6YA 2HEUA 3G3KA 5IKBA 3PUYE 3F11A 5CBSA 3E4RA 1OMPA 4XTCQ 5I57B 2ZYKA 4IGRA 5AA4B 4OTEA 4HCYA 4NF6B 3MUQA 1B52A 3MVYA 2Z8DA 1JW1A 2H99A 2DE3A 4LUBA 3M3LA 5AE4A 3PUZE 1PBPA 1B5IA 5DEXA 2DXYA 3VVFA 3S9EA 4GFRA 2OJTA 4C0RA 1LFHA 3K6WA 3RLFE 3C34A 4EDPA 3O6IA 4N13A 3ZSFA 1NNTA 3IOVA 1LAXA 3CFZA 1OVTA 1P1UA 3FD3A 1M5EA 4OWDA 4X48A 5DEXB 5JEIA 1ATGA 4U4SA 3KN3A 4LA9A 2I3VA 4R74A 3M3KA 3TYHA 3PD9A 3JZJA 1MDQA 1FQCA 1AOVA 4F39A 2DP8A 1B5JA 2BJJX 1T0KA 1LAFE 2DWHA 2P1SA 2HXWA 2Q2CA 3FJGA 4GIZA 4IO6A 1B7UA 5ICQA 1MPBA 4QSDA 1OLCA 4O3AA 5HPQA 3C33A 2DS9A 1FTOA 3CSBA 3E13X 1RYXA 2ZNUA 4XXUA 1FW0A 4I1DA 3TCHA 4P0IA 1MY2A 1BTJA 2VHAA 4QFKA 1AIVA 1D3KA 1MY4A 4LZ5A 2PX1A 1I6AA 2Z8FA 5F1QA 4YAHX 2I4BA 4LZ7A 1PB7A 4YB5A 3R6UA 4KYEA 2HQ0A 2PVUA 3VVEA 2REJA 2XX7A 3ZS6A 5K2YA 2THIA 1FCKA 4F2QA 3RT8A 2RC8A 3TQLA 1Y9UA 4X1BA 3FVOA 4LATA 2UXAA 3KG2A 4WEDA 2V3UA 2R9JA 4GXSB 4POXA 2RC7A 1EU8A 2O7IA 2V84A 3LBSA 4UA8A 2I49A 1A7LA 4LONB 2XXUA 1B1HA 1D9VA 1SI0A 1IZ1A 4EUOA 4ISUA 3Q26A 2Q9TA 1JEUA 1IUDA 4KR5A 3SETA 1M5DA 2QS4A 1IXCA 1USYE 3KEIA 1XT8A 1IQ7A 3PPOA 2XXPA 3G3IA 2FNCA 3GXAA 4KD5A 3T9VA 4H8JA 5B7DA 4GWOA 3CFLA 3K1NA 2KLFA 4R75A 4OVJA 3V8XB 4KHZE 1B51A 3TCGA 5CI5A 3O6GA 1N76A 2NWJA 3BFTA 5B70A 1P1OA 3LSWA 2O68A 4ESWA 1N7WA 4OYVA 3T66A 4M1VA 1BLFA 1NNPA 3D4GA 1LAGE 3KJ7A 1Y4CA 2B3FA 3V89B 3T22A 1NH7A 4YICA 5L8DA 3TAJA 3PMXA 3VVDA 4GL8A 4F22A 2GFEA 2ANJA 5CMKA 5I2NA 1GTKA 2I6EA 1B3HA 4F3GA 1H76A 4EQ9A 5F7VA 4AQ4A 4F1VA 3H3GA 2QMWA 3PV0E 3BBRA 2Q89A 2ONRA 3FZVA 1LGBC 1A54A 2XXTA 3SEVA 5I2NB 3TDJA 4RK2A 1OVBA 3PPNA 4HCWA 3OELA 2Q8JA 1EZPA 3K6UA 1ELJA 4BDLA 1JETA 4RA1A 4JDFA 2Y7WA 3FXQA 1XHYA 5AA1A 3P7IA 5HM4B 3LSLA 2F6GA 4FECA 1MQHA 3SERA 3FV2A 4NF8B 3JYRA 4DCXA 2HZKA 3BFUA 3EF7A 4MFIA 4G2ZA 1QJMA 4YKKA 4X1DA 1R1NA 3VLVA 5JK4A 4EQBA 1JQFA 4R9GA 2UYEA 2O51A 1Q35A 3N6UA 4NTLA 4DXBA 5KDTA 3K6VA 1L5TA 1BIYA 1ZJLA 4ZEKA 1F9BA 1NNKA 2V3QA 1Y1MA 3PU5A 4Z7EA 5CMBA 2Y7KA 3TPAA 3GLBA 1VFEA 3RQTA 3W9VA 3L6GA 1ZMGA 2XXQA 3KN7A 1OQHA 2VOZA 2GHBA 5I59B 3RPWA 1LSTA 5LOMA 5KDTB 1VFDA 1SI1A 1KWHA 1Z7NE 4QFLA 4ELQA 1WODA 4DCYA 3THIA 4QSEA 3CG3A 3T9UA 1JW4A 3K1PA 4ND9A 1QKAA 4E0WA 1MQIA 1NMUA 3T96B 1YAEA 3EQ1A 3FJ7A 1QUKA 5K2XA 3CRBA 2F36A 3MBPA 3TZAA 3TTRA 4G68A 4ZZEA 1YCJA 1P99A 2O1LA 2W7YA 3FIRA 5L9SA 3FVKA 2UVJA 3IJOB 2ZMBA 3MVZA 3QXMA 1AH5A 3MAMA 4F29A 4G68C 1CB6A 3UIFA 3SKPA 2X7PA 3C36A 3V5AA 2X7QA 4G68B 4FJPA 1IEJA 4JSOA 1M5BA 1UTBA 3SEYA 3U1OA 3M3FA 3UGWA 4IO5A 4KFQA 3SEWA 4YMBA 3DP8A 5I57A 2O84X 3ONMA 1M5CA 4OMBA 5TP9A 4R2FA 3H03A 3PPQA 1UTBB 3Q27A 2VGQA 5FHNA 5AA2D 1MY1A 1LLSA 1QVSA 3A3CA 3QUFA 2DSFA 4KYSA 3GZGA 3QSLA 1ANFA 3G3GA 4ELPA 4F18A 2CMOA 5AA2B 4F2OA 1Q1KA 2F5XA 5TP9B 4YKJA 4LZ8A 3G3HA 1PB9A 5EHMA 5A5XA 3RTFB 3FATA 4EF1A 2DE2A 2RINA 4IO7A 1NL5A 3H6VA 2M8CA 1UIUA 4LQ5A 5ITOA 3LR1A 3FXUA 3DLNA 1YPNA 1SQYA 1MRPA 3K02A 4YU0A 3USDA 2V25A 5A5XB 3N26A 1QULA 4PETA 2QS2A 2I0CA 3WAEA 1QUJA 1TFAA 4YB7A 3QAXA 2XX9A 5IAIA 1Y20A 4AB6A 3H4ZA 2XXRA 1N0TA 4ZEDA 3G3JA 2UVGA 3U72A 4RY1A 4R73A 2ZXTA 3QUJA 1B4ZA 3UP9A 1FTLA 4OXVA 3H6TA 1N3XA 1MY0A 1DTGA 4GF8A 4OESA 3EN3A 2OZZA 1H45A 4PP0A 1SD3A 2QMXA 4HS7A 5H8SA 1PDAA 1ZTYA 4IY5A 2AYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VR5 A;  1A8E A;  5FHM A;  2NXO A;  3WAF A;  2Y84 A;  4G4P A;  1J1N A;  3CR9 A;  3A09 A;  3S4U A;  4KYD A;  4U4X A;  4NED A;  1B3F A;  4QHQ A;  1XS5 A;  2E1S A;  1SW1 A;  1PB8 A;  1SW2 A;  3OMB A;  3S9L C;  1O7T A;  3MP1 A;  4ELO A;  2OWT A;  1P1N A;  1GV8 A;  1Y4T A;  3OD7 A;  4OEN A;  4H65 A;  1FQB A;  2XD2 A;  4DDD A;  5I84 A;  3W9W A;  3I3V A;  3UN6 A;  3Q28 A;  3Q29 A;  3KOT A;  1B9J A;  4QRZ A;  4POW A;  3ZKL A;  2F6P A;  3IR1 A;  4R72 A;  5EHS A;  4YMA A;  2UYF A;  1B3G A;  2UVI A;  3S2V A;  3UOR A;  1RKM A;  3OEK A;  4R6K A;  4OER A;  4DIG A;  3TQW A;  3IO4 A;  3SEU A;  3IAZ A;  3RNN A;  4F3B A;  1USY H;  4JB7 A;  4F1U A;  4XKQ A;  2QS3 A;  3PUX E;  2AIX A;  1LAH E;  2DWJ A;  2F78 A;  3RGY A;  4I9D A;  2H98 A;  1B6H A;  5FTI A;  4M4G A;  1GR2 A;  2VD2 A;  3KOS A;  4RNS A;  3DEL B;  4ZEC A;  4UAC A;  3HCQ A;  5H8N A;  2X26 A;  1MXX A;  1GGG A;  1UQW A;  4XIG Q;  2PBW A;  5FTH A;  2XXH A;  4Q8R A;  4LP2 B;  2O1M A;  2Z8E A;  4MBP A;  4JBZ A;  2QPQ A;  3U94 A;  2XD3 A;  1H44 A;  1B0H A;  1URG A;  3AXF A;  4ZE8 A;  3IOT A;  3LC8 A;  4PFY A;  3RT6 B;  3TTK A;  1HSE A;  4G8H A;  5H8N B;  3O9P A;  2NVU B;  2DWA A;  2PYY A;  4JSD A;  3GBA A;  4KCC A;  4NWC A;  2Y7P A;  4WXJ A;  3H6U A;  3N6T A;  2XXY A;  4GOT A;  2F7A A;  4THI A;  2OLB A;  4ZEI A;  4H6D A;  3EHS A;  2A5T A;  1B40 A;  1MS7 A;  2B3B A;  3IJX B;  4YB6 A;  1QW0 A;  1LBC A;  4L17 A;  4U21 A;  1UIV A;  2P2A A;  3QYT A;  4NF8 A;  1XVY A;  1B58 A;  4C1U A;  4EXL A;  2R71 A;  5EYF A;  1JNF A;  3HHF A;  2Q2A A;  1TFD A;  4OHN A;  4ZEF A;  1XOC A;  4ZEB A;  1OIB A;  3VXB A;  4BDR A;  3OXN A;  1JEV A;  2ZYM A;  2I4C A;  2A5T B;  1N7X A;  3B7D A;  2FYI A;  4O3B A;  3OOA A;  3IK6 B;  1H43 A;  5DVJ A;  2PT2 A;  1Y3N A;  4R9F A;  4AB5 A;  3K0V A;  2F97 A;  4OEU A;  3ZKK A;  4RPN A;  1N04 A;  5KCJ A;  1URD A;  3OO7 A;  2D5W A;  4NF5 B;  4G8N A;  5I59 A;  2IA4 A;  3VV5 A;  3FXR A;  3HO7 A;  3RUM A;  5CC2 A;  2AL5 A;  2F34 A;  1OQG A;  4OFJ A;  5KZT A;  1A99 A;  5L9O A;  3O6H A;  3IB2 A;  3KJT A;  3HHG A;  4FAT A;  1B05 A;  4RXL A;  3TTL A;  3S9N C;  1S50 A;  1B0L A;  5KCJ B;  3DP6 A;  5ICT A;  4H8I A;  3QIM A;  2HAV A;  3FJM A;  1URS A;  1Z7M E;  4HW8 A;  4EF2 A;  4JWO A;  1MH3 A;  3CG1 A;  1FQF A;  3A3U A;  1LB9 A;  2QJE A;  4XKR A;  2ALU A;  4JWY A;  3TTN A;  1PEB A;  3R26 A;  3PMW A;  2RF1 A;  1RYO A;  2ONK E;  3G7W A;  3KFM A;  1FQD A;  3V83 A;  1MM6 A;  2XX8 A;  3I5O A;  1B3E A;  1BKA A;  2DE4 A;  4H0W A;  1LFG A;  3FAS A;  3BKI B;  1TXF A;  1MXW A;  3JV9 A;  1POT A;  1I6B A;  2F7B A;  3O2A A;  1IXH A;  3PD8 A;  5J1D A;  1O63 A;  3EPE A;  3K1M A;  4GQO A;  1B4H A;  3LUY A;  1US5 A;  1IXI A;  2CZL A;  5M2V A;  3EHT A;  1YTV A;  3K2D A;  4GVO A;  4PFW A;  2PMS A;  3UA8 A;  4WEP A;  5TU0 A;  3MP8 A;  2VD3 A;  2H5Y A;  1D9Y A;  4MF3 A;  4YZZ A;  3TCF A;  2H9B A;  3B6Q A;  3SDF A;  4Z0I A;  4NF4 A;  2I48 A;  4PE5 B;  1SYH A;  5AA2 A;  4IB2 A;  2R6G E;  3FUZ A;  2HCA A;  1R9Q A;  5DVF A;  4MH5 A;  2Y7I A;  3O97 A;  1B32 A;  3MZ9 A;  3G3F A;  2AL4 A;  1VE4 A;  4N07 A;  3UK4 A;  4P0G A;  3FGS A;  4NF4 B;  1MM7 A;  3VXC A;  4GL0 A;  3KBR A;  5DT6 A;  4BLA A;  2D21 A;  3OO8 A;  3O28 A;  3MWB A;  3E3K A;  2YJP A;  4PQJ A;  4RJZ A;  3B6T A;  3O66 A;  2B65 A;  1DPE A;  1DTZ A;  3TFL A;  4TLM B;  1POY 1;  5CMC A;  2DQV A;  3OO9 A;  1LB8 A;  1UTH A;  4DXU A;  1NFT A;  4ESX A;  3E9X A;  2ZYO A;  4R6H A;  4ONY A;  2PT1 A;  4BDO A;  5ITP A;  3T9H B;  1HSL A;  5CM6 A;  2DOJ A;  2H25 A;  2Q88 A;  3U93 A;  1IIW A;  1GVC A;  3MVW A;  4TQU Q;  1MPC A;  1SW4 A;  2O69 A;  2GRV A;  5ELV A;  2DVC A;  1MY3 A;  1UTH B;  1PC3 A;  4ECF A;  1LFI A;  1SVX B;  2I0B A;  2I3W A;  4F3P A;  4RYA A;  4KCD A;  4HTG A;  3PMV A;  5H8Q A;  2XXI A;  3T9X B;  4BDQ A;  3LSX A;  3RY3 A;  4F19 A;  1R9L A;  4DXC A;  3N5L A;  4LQ2 A;  2RC9 A;  1ZKB A;  1JW5 A;  3ILT B;  5CMM A;  2GHA A;  1MPD A;  2G29 A;  1BP5 A;  1QUI A;  4C1T A;  3W15 C;  5DYH A;  4JXI A;  1MQG A;  5DVI A;  1ZLQ A;  3TEP A;  1II5 A;  4F1Y A;  4NE4 A;  5H8Q B;  3MQ9 A;  1FTK A;  1N84 A;  1D4N A;  1MQD A;  4K3F A;  4TLL B;  3RTW B;  4FEB A;  1WVJ A;  3S9M C;  5TPA A;  4ZZA A;  4PFT A;  1SYI A;  4EQ7 A;  3N94 A;  4H67 A;  1MH4 A;  4QSC A;  1DPP A;  3IB1 A;  4O3C A;  3ODB A;  1AMF A;  1SBP A;  1TT1 A;  4X9T A;  1OLA A;  2NUV A;  1QKB A;  2XHD A;  3OSQ A;  2V3T A;  3IOR A;  5TPA B;  2RKM A;  3KN8 A;  3H7M A;  4I62 A;  3PUW E;  3M8U A;  1IXG A;  4P11 A;  4G77 A;  1B2H A;  1B46 A;  4FED A;  1ZBM A;  3CFX A;  3U8Q A;  5I58 A;  3MJN A;  4OFL A;  3DM0 A;  4BDM A;  1B7H A;  3Q25 A;  3IOU A;  4PFU A;  1JVY A;  4U1O A;  4FOR A;  1B5H A;  2E0S A;  3H06 B;  3C9H A;  1I6Q A;  4OEV A;  4U22 A;  3OO6 A;  1Y1Z A;  1WDN A;  1I69 A;  3CSG A;  3VFJ A;  1O64 A;  3U92 A;  3QK6 A;  1A40 A;  5I58 B;  2F7C A;  4JWX A;  3HN0 A;  4U23 A;  3TMG A;  1A55 A;  4GRK A;  4N6P A;  3LSF B;  3MVX A;  3MZB A;  3OEM A;  1S9T A;  4DZ1 A;  2ZNS A;  4Q5T A;  3TKD A;  2LAO A;  3TUS A;  1B3L A;  4E0X A;  5HBC A;  3R7X A;  2RCA A;  1H3D A;  3HST A;  2WKY A;  4G8M A;  4XKP A;  4ELR A;  2ZNT A;  3B6W A;  1MXU A;  4OET A;  4ZS9 A;  3MPK A;  3TTM A;  4TOZ A;  4QFN A;  2ONS A;  4KI0 E;  1FTM A;  3H6W A;  2VP1 A;  1NNF A;  1SDX A;  2A5S A;  3RN8 A;  1B7Z A;  4QF9 A;  3EHU A;  4FAJ A;  4GLI A;  1FQA A;  1LBB A;  1M5F A;  5DTB A;  3PPP A;  2GH9 A;  3K4U A;  2Z22 A;  4FE8 A;  2YLN A;  2QS1 A;  3I6V A;  5L9M A;  3CVG A;  1TWY A;  3MW0 A;  1VSO A;  2I58 A;  2XXV A;  1P1Q A;  1JVX A;  1EH3 A;  1NH8 A;  4GD5 A;  2YPN A;  3K00 A;  4OQO A;  1MXZ A;  3ILU B;  2O7U A;  2HAU A;  3MP6 A;  1CE2 A;  2QL3 A;  3C4M A;  4I8C A;  5I56 A;  4NF5 A;  2ABH A;  3KSX A;  2O6A A;  4IO2 A;  1XVX A;  2ZYN A;  1EZ9 A;  1EZO A;  4H5G A;  4DLD A;  2OCU A;  3PPR A;  4IY6 A;  2OWS A;  3CIJ A;  3K6X A;  1B1X A;  1A8F A;  3O29 A;  3KZG A;  1S7Y A;  3VE1 B;  4F31 B;  4BDN A;  1US4 A;  3VDF A;  3HV1 A;  1PBQ A;  4WKM A;  4YKP A;  3IX1 A;  3T93 B;  5I56 B;  2ESN A;  2DYX A;  3FV1 A;  4H1X A;  3PUV E;  3SES A;  3GBB A;  3MZ1 A;  2XXX A;  3FVG A;  4IGT A;  4IO3 A;  3IB0 A;  2DVZ A;  2REG A;  1Y3Q A;  4OFO A;  4MLQ A;  1MXV A;  1LCT A;  2G93 A;  1Y3P A;  1ZIU A;  3OSR A;  2OBG A;  3KSJ A;  1NKX A;  4GXA A;  5CRY A;  3MPL A;  1P1W A;  2DWI A;  2NOO A;  4MLV A;  2QRY A;  4EXK A;  4NMY A;  5AA3 A;  5BUU A;  3KGC A;  2P0S A;  4QFP A;  2F35 A;  1N3W A;  4OZ9 A;  2Y7R A;  5CBR A;  4RPO A;  4F3S A;  4XKN A;  1MQJ A;  1FQE A;  1XC1 A;  1ZU0 A;  4R2B A;  3OEN A;  4KQP A;  3L6H A;  1DSN A;  2RCB A;  1MXY A;  3C31 A;  1MDP 1;  4FIM A;  3IOW A;  1SW5 A;  5FHO A;  1HSJ A;  2HZL A;  4U2R A;  4U1Z A;  4YKI A;  3IO6 A;  2DXR A;  3SEX A;  2Z23 A;  2UVH A;  5H8F A;  3ECR A;  3FVN A;  2V93 A;  5H8H A;  2F8D A;  1DOT A;  3D4C A;  3K01 A;  4ZDM A;  3C35 A;  3DP4 A;  2FA7 A;  5BWJ A;  3C32 A;  2OK2 A;  4KPT A;  4ZE9 A;  4DE8 A;  5ISU A;  5I2K A;  4Q0C A;  2HFB A;  2D3I A;  4IO4 A;  3VLW A;  5JTY A;  3TOD A;  5H8F B;  4H5F A;  1MG1 A;  5H8H B;  3IL1 B;  1IIT A;  3MC2 A;  1FTJ A;  2H4I A;  3CI8 A;  3VLU A;  1AL3 A;  2IEE A;  4NWD A;  5AA4 A;  4RK9 A;  2XXW A;  1R6Z A;  3HPI A;  3PGF A;  5I2K B;  4NF6 A;  4LVQ A;  1LCF A;  4Q30 B;  1DMB A;  5JTY B;  3TEL A;  4QFO A;  2QSX A;  4R6Y A;  2HEU A;  3G3K A;  5IKB A;  3PUY E;  3F11 A;  5CBS A;  3E4R A;  1OMP A;  4XTC Q;  5I57 B;  2ZYK A;  4IGR A;  5AA4 B;  4OTE A;  4HCY A;  4NF6 B;  3MUQ A;  1B52 A;  3MVY A;  2Z8D A;  1JW1 A;  2H99 A;  2DE3 A;  4LUB A;  3M3L A;  5AE4 A;  3PUZ E;  1PBP A;  1B5I A;  5DEX A;  2DXY A;  3VVF A;  3S9E A;  4GFR A;  2OJT A;  4C0R A;  1LFH A;  3K6W A;  3RLF E;  3C34 A;  4EDP A;  3O6I A;  4N13 A;  3ZSF A;  1NNT A;  3IOV A;  1LAX A;  3CFZ A;  1OVT A;  1P1U A;  3FD3 A;  1M5E A;  4OWD A;  4X48 A;  5DEX B;  5JEI A;  1ATG A;  4U4S A;  3KN3 A;  4LA9 A;  2I3V A;  4R74 A;  3M3K A;  3TYH A;  3PD9 A;  3JZJ A;  1MDQ A;  1FQC A;  1AOV A;  4F39 A;  2DP8 A;  1B5J A;  2BJJ X;  1T0K A;  1LAF E;  2DWH A;  2P1S A;  2HXW A;  2Q2C A;  3FJG A;  4GIZ A;  4IO6 A;  1B7U A;  5ICQ A;  1MPB A;  4QSD A;  1OLC A;  4O3A A;  5HPQ A;  3C33 A;  2DS9 A;  1FTO A;  3CSB A;  3E13 X;  1RYX A;  2ZNU A;  4XXU A;  1FW0 A;  4I1D A;  3TCH A;  4P0I A;  1MY2 A;  1BTJ A;  2VHA A;  4QFK A;  1AIV A;  1D3K A;  1MY4 A;  4LZ5 A;  2PX1 A;  1I6A A;  2Z8F A;  5F1Q A;  4YAH X;  2I4B A;  4LZ7 A;  1PB7 A;  4YB5 A;  3R6U A;  4KYE A;  2HQ0 A;  2PVU A;  3VVE A;  2REJ A;  2XX7 A;  3ZS6 A;  5K2Y A;  2THI A;  1FCK A;  4F2Q A;  3RT8 A;  2RC8 A;  3TQL A;  1Y9U A;  4X1B A;  3FVO A;  4LAT A;  2UXA A;  3KG2 A;  4WED A;  2V3U A;  2R9J A;  4GXS B;  4POX A;  2RC7 A;  1EU8 A;  2O7I A;  2V84 A;  3LBS A;  4UA8 A;  2I49 A;  1A7L A;  4LON B;  2XXU A;  1B1H A;  1D9V A;  1SI0 A;  1IZ1 A;  4EUO A;  4ISU A;  3Q26 A;  2Q9T A;  1JEU A;  1IUD A;  4KR5 A;  3SET A;  1M5D A;  2QS4 A;  1IXC A;  1USY E;  3KEI A;  1XT8 A;  1IQ7 A;  3PPO A;  2XXP A;  3G3I A;  2FNC A;  3GXA A;  4KD5 A;  3T9V A;  4H8J A;  5B7D A;  4GWO A;  3CFL A;  3K1N A;  2KLF A;  4R75 A;  4OVJ A;  3V8X B;  4KHZ E;  1B51 A;  3TCG A;  5CI5 A;  3O6G A;  1N76 A;  2NWJ A;  3BFT A;  5B70 A;  1P1O A;  3LSW A;  2O68 A;  4ESW A;  1N7W A;  4OYV A;  3T66 A;  4M1V A;  1BLF A;  1NNP A;  3D4G A;  1LAG E;  3KJ7 A;  1Y4C A;  2B3F A;  3V89 B;  3T22 A;  1NH7 A;  4YIC A;  5L8D A;  3TAJ A;  3PMX A;  3VVD A;  4GL8 A;  4F22 A;  2GFE A;  2ANJ A;  5CMK A;  5I2N A;  1GTK A;  2I6E A;  1B3H A;  4F3G A;  1H76 A;  4EQ9 A;  5F7V A;  4AQ4 A;  4F1V A;  3H3G A;  2QMW A;  3PV0 E;  3BBR A;  2Q89 A;  2ONR A;  3FZV A;  1LGB C;  1A54 A;  2XXT A;  3SEV A;  5I2N B;  3TDJ A;  4RK2 A;  1OVB A;  3PPN A;  4HCW A;  3OEL A;  2Q8J A;  1EZP A;  3K6U A;  1ELJ A;  4BDL A;  1JET A;  4RA1 A;  4JDF A;  2Y7W A;  3FXQ A;  1XHY A;  5AA1 A;  3P7I A;  5HM4 B;  3LSL A;  2F6G A;  4FEC A;  1MQH A;  3SER A;  3FV2 A;  4NF8 B;  3JYR A;  4DCX A;  2HZK A;  3BFU A;  3EF7 A;  4MFI A;  4G2Z A;  1QJM A;  4YKK A;  4X1D A;  1R1N A;  3VLV A;  5JK4 A;  4EQB A;  1JQF A;  4R9G A;  2UYE A;  2O51 A;  1Q35 A;  3N6U A;  4NTL A;  4DXB A;  5KDT A;  3K6V A;  1L5T A;  1BIY A;  1ZJL A;  4ZEK A;  1F9B A;  1NNK A;  2V3Q A;  1Y1M A;  3PU5 A;  4Z7E A;  5CMB A;  2Y7K A;  3TPA A;  3GLB A;  1VFE A;  3RQT A;  3W9V A;  3L6G A;  1ZMG A;  2XXQ A;  3KN7 A;  1OQH A;  2VOZ A;  2GHB A;  5I59 B;  3RPW A;  1LST A;  5LOM A;  5KDT B;  1VFD A;  1SI1 A;  1KWH A;  1Z7N E;  4QFL A;  4ELQ A;  1WOD A;  4DCY A;  3THI A;  4QSE A;  3CG3 A;  3T9U A;  1JW4 A;  3K1P A;  4ND9 A;  1QKA A;  4E0W A;  1MQI A;  1NMU A;  3T96 B;  1YAE A;  3EQ1 A;  3FJ7 A;  1QUK A;  5K2X A;  3CRB A;  2F36 A;  3MBP A;  3TZA A;  3TTR A;  4G68 A;  4ZZE A;  1YCJ A;  1P99 A;  2O1L A;  2W7Y A;  3FIR A;  5L9S A;  3FVK A;  2UVJ A;  3IJO B;  2ZMB A;  3MVZ A;  3QXM A;  1AH5 A;  3MAM A;  4F29 A;  4G68 C;  1CB6 A;  3UIF A;  3SKP A;  2X7P A;  3C36 A;  3V5A A;  2X7Q A;  4G68 B;  4FJP A;  1IEJ A;  4JSO A;  1M5B A;  1UTB A;  3SEY A;  3U1O A;  3M3F A;  3UGW A;  4IO5 A;  4KFQ A;  3SEW A;  4YMB A;  3DP8 A;  5I57 A;  2O84 X;  3ONM A;  1M5C A;  4OMB A;  5TP9 A;  4R2F A;  3H03 A;  3PPQ A;  1UTB B;  3Q27 A;  2VGQ A;  5FHN A;  5AA2 D;  1MY1 A;  1LLS A;  1QVS A;  3A3C A;  3QUF A;  2DSF A;  4KYS A;  3GZG A;  3QSL A;  1ANF A;  3G3G A;  4ELP A;  4F18 A;  2CMO A;  5AA2 B;  4F2O A;  1Q1K A;  2F5X A;  5TP9 B;  4YKJ A;  4LZ8 A;  3G3H A;  1PB9 A;  5EHM A;  5A5X A;  3RTF B;  3FAT A;  4EF1 A;  2DE2 A;  2RIN A;  4IO7 A;  1NL5 A;  3H6V A;  2M8C A;  1UIU A;  4LQ5 A;  5ITO A;  3LR1 A;  3FXU A;  3DLN A;  1YPN A;  1SQY A;  1MRP A;  3K02 A;  4YU0 A;  3USD A;  2V25 A;  5A5X B;  3N26 A;  1QUL A;  4PET A;  2QS2 A;  2I0C A;  3WAE A;  1QUJ A;  1TFA A;  4YB7 A;  3QAX A;  2XX9 A;  5IAI A;  1Y20 A;  4AB6 A;  3H4Z A;  2XXR A;  1N0T A;  4ZED A;  3G3J A;  2UVG A;  3U72 A;  4RY1 A;  4R73 A;  2ZXT A;  3QUJ A;  1B4Z A;  3UP9 A;  1FTL A;  4OXV A;  3H6T A;  1N3X A;  1MY0 A;  1DTG A;  4GF8 A;  4OES A;  3EN3 A;  2OZZ A;  1H45 A;  4PP0 A;  1SD3 A;  2QMX A;  4HS7 A;  5H8S A;  1PDA A;  1ZTY A;  4IY5 A;  2AYS A; 
#chains in the Genus database with same CATH topology
 1VR5 A;  1INP A;  4NX1 A;  4NGU A;  1A8E A;  5ET7 A;  5FHM A;  2NXO A;  3WAF A;  2Y84 A;  4G4P A;  1J1N A;  5IZZ A;  1NV4 A;  1G0H A;  4MNP A;  2L5V A;  3CR9 A;  3A09 A;  4JVI A;  3S4U A;  4KYD A;  4U4X A;  4NED A;  1B3F A;  4QHQ A;  2PCR A;  1XS5 A;  4HE2 A;  2E1S A;  1SW1 A;  1PB8 A;  1SW2 A;  3OMB A;  3S9L C;  4I40 A;  1O7T A;  3MP1 A;  4ELO A;  2OWT A;  4PBH A;  1P1N A;  4N4U A;  1GV8 A;  1NV2 A;  1Y4T A;  3OD7 A;  1BK4 A;  4OEN A;  1IMC A;  4H65 A;  1FQB A;  2XD2 A;  4PBQ A;  5J16 A;  4DDD A;  5I84 A;  3W9W A;  3I3V A;  3UN6 A;  3Q28 A;  3Q29 A;  3KOT A;  1B9J A;  4I3Y A;  2XWI A;  4QRZ A;  4POW A;  3ZKL A;  2F6P A;  3IR1 A;  4R72 A;  5EHS A;  4YMA A;  2UYF A;  1B3G A;  2UVI A;  3S2V A;  3UOR A;  1FJ9 A;  1RKM A;  3OEK A;  4R6K A;  4OER A;  4DIG A;  1LEV A;  3TQW A;  3IO4 A;  3SEU A;  3IAZ A;  3RNN A;  4F3B A;  1USY H;  4JB7 A;  4F1U A;  4XKQ A;  2QS3 A;  3PUX E;  2AIX A;  1LAH E;  2DWJ A;  2F78 A;  3RGY A;  1QGX A;  4I9D A;  2H98 A;  1B6H A;  5FTI A;  4M4G A;  1GR2 A;  2VD2 A;  3KOS A;  4RNS A;  4P9K A;  3DEL B;  4ZEC A;  4UAC A;  3HCQ A;  5H8N A;  2X26 A;  2P3N A;  4GBV A;  1MXX A;  5IZ3 A;  1GGG A;  2XA5 A;  5LTC A;  1UQW A;  4XIG Q;  2PBW A;  4OVQ A;  5FTH A;  2XXH A;  4Q8R A;  4LP2 B;  2O1M A;  1RDZ A;  2Z8E A;  4MBP A;  4JBZ A;  2QPQ A;  3U94 A;  2XD3 A;  1H44 A;  1B0H A;  1URG A;  3AXF A;  4ZE8 A;  4PAI A;  3IOT A;  3LC8 A;  4PFY A;  3RT6 B;  5EYH A;  3TTK A;  1HSE A;  4G8H A;  3FBP A;  5H8N B;  3O9P A;  4X8R A;  2NVU B;  4PF8 A;  2DWA A;  5IZ3 B;  1NV3 A;  1LBY A;  2PYY A;  4JSD A;  3GBA A;  4KCC A;  4NWC A;  2Y7P A;  4WXJ A;  5ET8 A;  3H6U A;  3N6T A;  2XXY A;  4GOT A;  2F7A A;  4THI A;  2OLB A;  4ZEI A;  2OX3 A;  4H6D A;  2Q8M A;  3EHS A;  2A5T A;  1B40 A;  1MS7 A;  1FPL A;  4P1L A;  2B3B A;  3IJX B;  4YB6 A;  1QW0 A;  1LBC A;  4L17 A;  2JJK A;  4U21 A;  1UIV A;  2P2A A;  2WYP A;  3QYT A;  4NF8 A;  1XVY A;  1B58 A;  4C1U A;  4EXL A;  2R71 A;  5EYF A;  1JNF A;  3HHF A;  2Q2A A;  1TFD A;  3BIG A;  4OHN A;  4ZEF A;  1XOC A;  4ZEB A;  1OIB A;  1IMF A;  3VXB A;  4BDR A;  3OXN A;  1JEV A;  2FIE A;  2QFL A;  2ZYM A;  2I4C A;  2A5T B;  1N7X A;  3B7D A;  2FYI A;  4O3B A;  3OOA A;  3IK6 B;  4DI3 D;  1H43 A;  5DVJ A;  2PT2 A;  1Y3N A;  4R9F A;  4AB5 A;  4NQ8 A;  3K0V A;  2F97 A;  4OEU A;  3ZKK A;  1YYZ A;  4RPN A;  1N04 A;  5KCJ A;  4N91 A;  1URD A;  4P56 A;  4I3E A;  3OO7 A;  2D5W A;  4NF5 B;  4G8N A;  5I59 A;  2IA4 A;  3VV5 A;  3FXR A;  3HO7 A;  3RUM A;  5CC2 A;  2AL5 A;  2F34 A;  1OQG A;  3T0J A;  4OFJ A;  1DCU A;  5KZT A;  4MCO A;  1A99 A;  5L9O A;  3O6H A;  3IB2 A;  3KJT A;  3HHG A;  4FAT A;  1B05 A;  4RXL A;  3TTL A;  3S9N C;  3IFA A;  1S50 A;  3LV0 A;  1B0L A;  5KCJ B;  4N81 A;  3DP6 A;  5ICT A;  4H8I A;  3QIM A;  2HAV A;  3FJM A;  1URS A;  1Z7M E;  4HW8 A;  4EF2 A;  4OA4 A;  4JWO A;  1MH3 A;  3CG1 A;  1FQF A;  3A3U A;  1LB9 A;  2QJE A;  4XKR A;  2ALU A;  4JWY A;  3TTN A;  1PEB A;  3R26 A;  3PMW A;  2RF1 A;  1RYO A;  2ONK E;  3ROJ A;  3ISP A;  2CZI A;  3G7W A;  3KFM A;  1FQD A;  3V83 A;  1MM6 A;  4O94 A;  2XX8 A;  3I5O A;  1B3E A;  1BKA A;  2DE4 A;  4H0W A;  1LFG A;  3FAS A;  3BKI B;  1FPE A;  1TXF A;  1MXW A;  3JV9 A;  2FBP A;  1FBC A;  1POT A;  1I6B A;  2F7B A;  2ZZW A;  3O2A A;  1IXH A;  4OAN A;  3PD8 A;  5J1D A;  1O63 A;  3EPE A;  3K1M A;  4GQO A;  2HHM A;  1B4H A;  3LUY A;  1DK4 A;  1US5 A;  1IXI A;  2CZL A;  5M2V A;  3EHT A;  1YTV A;  3K2D A;  4GVO A;  4PFW A;  2PMS A;  3UA8 A;  4WEP A;  5TU0 A;  3MP8 A;  4GX4 A;  2VD3 A;  2H5Y A;  1D9Y A;  4MF3 A;  4YZZ A;  3TCF A;  1K9Y A;  2H9B A;  3B6Q A;  4P3L A;  3SDF A;  4Z0I A;  4NF4 A;  2I48 A;  4PE5 B;  3B8B A;  1SYH A;  5AA2 A;  5IZ1 A;  4IB2 A;  2R6G E;  1NV7 A;  3FUZ A;  2HCA A;  1R9Q A;  5DVF A;  4MH5 A;  2Y7I A;  3O97 A;  1B32 A;  3RYD A;  3MZ9 A;  3G3F A;  1FPJ A;  2AL4 A;  4NAP A;  2V4C A;  1VE4 A;  4N07 A;  3UK4 A;  4P0G A;  4OVS A;  3FGS A;  4NF4 B;  1MM7 A;  3VXC A;  4GL0 A;  3KBR A;  5EQA A;  5DT6 A;  4BLA A;  2D21 A;  3OO8 A;  3O28 A;  3MWB A;  3E3K A;  2YJP A;  4AS5 A;  3NOH A;  4PQJ A;  1FPG A;  4RJZ A;  3B6T A;  3O66 A;  2B65 A;  1DPE A;  1DTZ A;  3TFL A;  4TLM B;  1POY 1;  5CMC A;  2DQV A;  3OO9 A;  1LB8 A;  3KC0 A;  1UTH A;  4DXU A;  1NFT A;  4ESX A;  3E9X A;  2ZYO A;  4R6H A;  2F3D A;  5ESY A;  4MHF A;  4ONY A;  1NV5 A;  2PT1 A;  4BDO A;  5ITP A;  3T9H B;  1HSL A;  5CM6 A;  2DOJ A;  2H25 A;  2Q88 A;  4PFR A;  3U93 A;  3IFC A;  1IIW A;  1GVC A;  3MVW A;  4TQU Q;  1MPC A;  1SW4 A;  2Y5L A;  2B4M A;  2O69 A;  2GRV A;  5ELV A;  2DVC A;  1MY3 A;  1UTH B;  1PC3 A;  4ECF A;  1LFI A;  1SVX B;  2I0B A;  2I3W A;  4F3P A;  4RYA A;  1FJ6 A;  4PAK A;  4KCD A;  2ZZV A;  4HTG A;  3PMV A;  5H8Q A;  2XXI A;  3T9X B;  4BDQ A;  3LSX A;  4GWY A;  3RY3 A;  4F19 A;  1R9L A;  4DXC A;  3N5L A;  4LQ2 A;  2RC9 A;  1ZKB A;  1JW5 A;  1Q9D A;  3ILT B;  5CMM A;  2GHA A;  1MPD A;  2G29 A;  1BP5 A;  1QUI A;  4PAF A;  4C1T A;  3W15 C;  5DYH A;  2WEF A;  4JXI A;  1MQG A;  1FTA A;  5DVI A;  1ZLQ A;  3TEP A;  1II5 A;  4F1Y A;  4NE4 A;  4HXV A;  5H8Q B;  3MQ9 A;  4QBA A;  1FTK A;  2VT5 A;  1N84 A;  2GQ1 A;  1D4N A;  1MQD A;  4K3F A;  4TLL B;  3GYY A;  3RTW B;  4FEB A;  1K9Z A;  1WVJ A;  3S9M C;  5TPA A;  4ZZA A;  4PFT A;  1SYI A;  4EQ7 A;  3N94 A;  4H67 A;  1MH4 A;  4QSC A;  1DPP A;  3IB1 A;  4O3C A;  3ODB A;  1G0I A;  4PE3 A;  1AMF A;  3KBZ A;  1SBP A;  1TT1 A;  4X9T A;  2VPO A;  1OLA A;  4MNC A;  2NUV A;  1QKB A;  2XHD A;  3OSQ A;  2V3T A;  1DBZ A;  3IOR A;  1RDX A;  5TPA B;  2OWZ A;  2PFZ A;  2RKM A;  3KN8 A;  3H7M A;  4I62 A;  1NUY A;  3PUW E;  3LUZ A;  3M8U A;  1IXG A;  4P11 A;  4G77 A;  1B2H A;  1B46 A;  2CZH A;  4FED A;  1ZBM A;  3CFX A;  3U8Q A;  5I58 A;  3MJN A;  4OFL A;  3DM0 A;  4BDM A;  5IM2 A;  3MYU A;  1B7H A;  3Q25 A;  3IOU A;  4PFU A;  1JVY A;  4U1O A;  4FOR A;  1B5H A;  2E0S A;  3H06 B;  1FBP A;  4P47 A;  3C9H A;  1I6Q A;  4OEV A;  4U22 A;  3OO6 A;  1Y1Z A;  4PDD A;  1WDN A;  1I69 A;  3CSG A;  3VFJ A;  1O64 A;  3U92 A;  3QK6 A;  1A40 A;  5I58 B;  2F7C A;  4JWX A;  3HN0 A;  4U23 A;  3TMG A;  1A55 A;  4GRK A;  4N6P A;  3SZP A;  3LSF B;  3MVX A;  3MZB A;  3OEM A;  4OVP A;  1S9T A;  4DZ1 A;  2ZNS A;  3QMF A;  4Q5T A;  3TKD A;  2LAO A;  3TUS A;  1KA1 A;  4H45 A;  1FBE A;  1YZ0 A;  1B3L A;  4E0X A;  5HBC A;  3R7X A;  1RDY A;  1LBV A;  4MIJ A;  2RCA A;  1FPB A;  1H3D A;  3HST A;  2WKY A;  5I7I A;  4G8M A;  4XKP A;  3E79 A;  5DW8 A;  4MMP A;  4ELR A;  2ZNT A;  3B6W A;  1MXU A;  4OET A;  4ZS9 A;  3MPK A;  3T1B A;  3TTM A;  2WBD A;  4TOZ A;  4GWW A;  4QFN A;  2ONS A;  4KI0 E;  1FTM A;  2WBB A;  3H6W A;  2VP1 A;  1NNF A;  1SDX A;  2A5S A;  3RN8 A;  1B7Z A;  4QF9 A;  3EHU A;  4FAJ A;  4GLI A;  1FQA A;  1LBB A;  1M5F A;  5DTB A;  3PPP A;  1FPI A;  2GH9 A;  3K4U A;  2Z22 A;  4FE8 A;  5IGA A;  2YLN A;  2QS1 A;  3I6V A;  5L9M A;  3CVG A;  1TWY A;  3MW0 A;  1VSO A;  2I58 A;  2XXV A;  1P1Q A;  1JVX A;  1EH3 A;  1NH8 A;  4GD5 A;  2KR0 A;  2YPN A;  3K00 A;  4OQO A;  1MXZ A;  3ILU B;  2O7U A;  3MP6 A;  4IR8 A;  1NI9 A;  1CE2 A;  2HAU A;  2QL3 A;  3C4M A;  4I8C A;  5I56 A;  4NF5 A;  2ABH A;  3KSX A;  2O6A A;  4IO2 A;  1XVX A;  2ZYN A;  1EZ9 A;  1EZO A;  4H5G A;  4DLD A;  4N6D A;  2OCU A;  3PPR A;  4IY6 A;  2OWS A;  3CIJ A;  3K6X A;  1B1X A;  1A8F A;  3O29 A;  3KZG A;  1S7Y A;  3VE1 B;  4BDN A;  4F31 B;  1US4 A;  3VDF A;  4JVC A;  3HV1 A;  1PBQ A;  4NN3 A;  1SPI A;  4WKM A;  4GWU A;  1NV0 A;  4YKP A;  4GX6 A;  3IX1 A;  4O8M A;  3T93 B;  5I56 B;  4H1X A;  2ESN A;  2DYX A;  3FV1 A;  3PUV E;  3SES A;  3GBB A;  3MZ1 A;  5EQ9 A;  2XXX A;  3FVG A;  4IGT A;  4IO3 A;  4N6K A;  3IB0 A;  2DVZ A;  2REG A;  1Y3Q A;  4OFO A;  4MLQ A;  1MXV A;  1LCT A;  2G93 A;  4GWS A;  1Y3P A;  1ZIU A;  3OSR A;  2OBG A;  3KSJ A;  1NKX A;  4GXA A;  5CRY A;  3MPL A;  1P1W A;  2DWI A;  2NOO A;  4HE0 A;  4MLV A;  2QRY A;  1FSA A;  4EXK A;  2R8T A;  4PF6 A;  4NMY A;  5AA3 A;  5BUU A;  3KGC A;  2P0S A;  4QFP A;  2F35 A;  1N3W A;  4N17 A;  4OZ9 A;  5I3S A;  2Y7R A;  3E78 A;  5CBR A;  4RPO A;  4F3S A;  4XKN A;  1MQJ A;  1FQE A;  1XC1 A;  1ZU0 A;  2WX9 A;  4R2B A;  3OEN A;  4KQP A;  3L6H A;  1DSN A;  2RCB A;  5I5P A;  3BIH A;  1MXY A;  3C31 A;  1MDP 1;  4FIM A;  4XF5 A;  3IOW A;  1SW5 A;  5FHO A;  1HSJ A;  2HZL A;  4U2R A;  4U1Z A;  4YKI A;  3IO6 A;  2DXR A;  1EYJ A;  3SEX A;  2Z23 A;  2UVH A;  5H8F A;  3ECR A;  5EYG A;  3FVN A;  2V93 A;  5H8H A;  2F8D A;  1DOT A;  3D4C A;  3K01 A;  4ZDM A;  3C35 A;  3DP4 A;  2FA7 A;  5BWJ A;  3C32 A;  2OK2 A;  4MEV A;  4KPT A;  4ZE9 A;  4OVR A;  4DE8 A;  4O7I A;  5ISU A;  5I2K A;  4Q0C A;  2HFB A;  2D3I A;  4IO4 A;  4G61 A;  3VLW A;  5JTY A;  3TOD A;  5H8F B;  4H5F A;  1MG1 A;  5H8H B;  2XXK A;  3IL1 B;  1IIT A;  3MC2 A;  1FTJ A;  2H4I A;  5EQ8 A;  3CI8 A;  3VLU A;  1AL3 A;  2IEE A;  4NWD A;  5AA4 A;  4RK9 A;  2XXW A;  1R6Z A;  3HPI A;  3PGF A;  4H46 A;  2HPG A;  5I2K B;  4NF6 A;  4LVQ A;  4PCD A;  1LCF A;  4Q30 B;  1DMB A;  5JTY B;  3TEL A;  4QFO A;  3RPL A;  2QSX A;  3KC1 A;  3HFU A;  4R6Y A;  2HEU A;  3G3K A;  5IKB A;  3PUY E;  1EYI A;  3U65 A;  3F11 A;  5CBS A;  3E4R A;  1OMP A;  4GWZ A;  4XTC Q;  1NUW A;  5I57 B;  2ZYK A;  4IGR A;  5AA4 B;  4PDH A;  4OTE A;  5F24 A;  4MJO A;  4HCY A;  4NF6 B;  2FVZ A;  3MUQ A;  1B52 A;  3MVY A;  2Z8D A;  1JW1 A;  2H99 A;  3RPL B;  2DE3 A;  1XI6 A;  4LUB A;  3M3L A;  5AE4 A;  3PUZ E;  1PBP A;  1B5I A;  5DEX A;  2DXY A;  3VVF A;  3S9E A;  4GFR A;  2OJT A;  4C0R A;  2QVV A;  1LFH A;  3K6W A;  1FBF A;  3RLF E;  3C34 A;  4EDP A;  3O6I A;  4N13 A;  3ZSF A;  1NNT A;  3IOV A;  1LAX A;  3CFZ A;  1OVT A;  1P1U A;  3FD3 A;  1M5E A;  2CEX A;  4OWD A;  4X48 A;  5DEX B;  5JEI A;  1ATG A;  4U4S A;  4NHB A;  3KN3 A;  4LA9 A;  2I3V A;  4R74 A;  3M3K A;  3TYH A;  3PD9 A;  4MAG A;  2QVR A;  3JZJ A;  1MDQ A;  1FQC A;  1AOV A;  4F39 A;  2DP8 A;  1B5J A;  2BJJ X;  1T0K A;  1LAF E;  2DWH A;  2P1S A;  1NUX A;  2HXW A;  2Q2C A;  3FJG A;  4GIZ A;  4IO6 A;  1B7U A;  5ICQ A;  1MPB A;  4QSD A;  1OLC A;  4O3A A;  4PFI A;  5HPQ A;  3C33 A;  3PTY A;  2DS9 A;  1FTO A;  4MX6 A;  3CSB A;  3E13 X;  1RYX A;  2ZNU A;  4XXU A;  1FW0 A;  4I1D A;  3TCH A;  4P0I A;  1MY2 A;  1BTJ A;  2VHA A;  1EYK A;  4QFK A;  1AIV A;  1D3K A;  1MY4 A;  4LZ5 A;  2PX1 A;  1I6A A;  2Z8F A;  4OVT A;  5F1Q A;  4YAH X;  2I4B A;  4LZ7 A;  1PB7 A;  4YB5 A;  3R6U A;  4KYE A;  2HQ0 A;  2PVU A;  2F3B A;  3VVE A;  2REJ A;  2XX7 A;  3ZS6 A;  5K2Y A;  2THI A;  4PTK A;  1FCK A;  4F2Q A;  3RT8 A;  2RC8 A;  3TQL A;  1Y9U A;  4X1B A;  3FVO A;  2CZK A;  4LAT A;  3FXB A;  2UXA A;  3KG2 A;  4WED A;  2V3U A;  2R9J A;  2BJI A;  4GXS B;  4POX A;  2RC7 A;  4N15 A;  1EU8 A;  4P1E A;  2O7I A;  2V84 A;  3LBS A;  5FBP A;  4UA8 A;  2I49 A;  1KZ8 A;  1A7L A;  1JP4 A;  4LON B;  2XXU A;  4DI4 B;  2PFY A;  2P3V A;  1B1H A;  1D9V A;  1SI0 A;  1IZ1 A;  4EUO A;  4ISU A;  3Q26 A;  2Q9T A;  1JEU A;  1IUD A;  4KR5 A;  3SET A;  1M5D A;  2QS4 A;  1IXC A;  1USY E;  4N8G A;  3KEI A;  1XT8 A;  5A5L A;  1IQ7 A;  3D1R A;  3PPO A;  2XXP A;  3G3I A;  2FNC A;  3GXA A;  4GBW A;  1KA0 A;  4KD5 A;  3T9V A;  2Q74 A;  4H8J A;  5B7D A;  4GWO A;  3CFL A;  3K1N A;  2KLF A;  4R75 A;  2XWO A;  4OVJ A;  3V8X B;  4KHZ E;  1B51 A;  3TCG A;  5CI5 A;  3O6G A;  1N76 A;  2NWJ A;  3BFT A;  5B70 A;  1IME A;  1P1O A;  3LSW A;  2O68 A;  4ESW A;  1N7W A;  4OYV A;  3T66 A;  4M1V A;  1BLF A;  1NNP A;  3D4G A;  1LAG E;  3KJ7 A;  1Y4C A;  2B3F A;  1IMB A;  3V89 B;  3T22 A;  1NH7 A;  4YIC A;  5L8D A;  3TAJ A;  3PMX A;  3VVD A;  2WYK A;  4GL8 A;  4F22 A;  2GFE A;  2ANJ A;  5CMK A;  5I2N A;  1GTK A;  2I6E A;  1B3H A;  4F3G A;  3A29 A;  2ZZX A;  1H76 A;  4EQ9 A;  5F7V A;  4KXP A;  4AQ4 A;  4F1V A;  3H3G A;  2QMW A;  3PV0 E;  3BBR A;  2Q89 A;  2ONR A;  3FZV A;  2FHY A;  2CEY A;  1LGB C;  5LDZ A;  1A54 A;  2XXT A;  3SEV A;  1LBX A;  5I2N B;  3TDJ A;  4RK2 A;  1OVB A;  3PPN A;  4HCW A;  1FRP A;  1LBZ A;  1NV6 A;  1LBW A;  3OEL A;  2Q8J A;  1EZP A;  2HXR A;  2XWV A;  3K6U A;  1ELJ A;  4BDL A;  1JET A;  4RA1 A;  4JDF A;  4XFE A;  2Y7W A;  3FXQ A;  1XHY A;  5AA1 A;  3CHG A;  2MKZ A;  3P7I A;  4PC9 A;  5HM4 B;  4HE1 A;  3LSL A;  2F6G A;  4FEC A;  1MQH A;  3SER A;  3FV2 A;  1D9Q A;  4NF8 B;  3JYR A;  4DCX A;  2HZK A;  3BFU A;  3EF7 A;  4MFI A;  4G2Z A;  1QJM A;  4YKK A;  4X1D A;  1R1N A;  3VLV A;  5JK4 A;  5EQ7 A;  4EQB A;  1JQF A;  1IMA A;  4R9G A;  2UYE A;  2O51 A;  1Q35 A;  3N6U A;  4NTL A;  4DXB A;  5KDT A;  3K6V A;  1L5T A;  1BIY A;  1ZJL A;  4NF0 A;  2DDK A;  4ZEK A;  2Y5K A;  1F9B A;  1NNK A;  2V3Q A;  1Y1M A;  3PU5 A;  4Z7E A;  5CMB A;  2Y7K A;  3TPA A;  2QVU A;  3GLB A;  2VPN A;  1FPF A;  1VFE A;  1CNQ A;  3RQT A;  3W9V A;  3L6G A;  1ZMG A;  2XXQ A;  3KN7 A;  1OQH A;  2VOZ A;  2GHB A;  5I59 B;  1NV1 A;  3RPW A;  1LST A;  5LOM A;  5KDT B;  1VFD A;  1SI1 A;  1KWH A;  1Z7N E;  4QFL A;  4ELQ A;  1WOD A;  5ET6 A;  4DCY A;  3THI A;  4QSE A;  3CG3 A;  3T9U A;  1JW4 A;  3K1P A;  4ND9 A;  1QKA A;  4E0W A;  1MQI A;  1NMU A;  3T96 B;  1YAE A;  3EQ1 A;  4N8Y A;  4PGN A;  3FJ7 A;  1QUK A;  5K2X A;  3CRB A;  2F36 A;  3MBP A;  3TZA A;  3TTR A;  4G68 A;  4ZZE A;  1YCJ A;  1P99 A;  2O1L A;  2W7Y A;  4GWX A;  3FIR A;  5L9S A;  4GX3 A;  3FVK A;  2UVJ A;  3IJO B;  2ZMB A;  1FPK A;  3MVZ A;  3QXM A;  1AH5 A;  3MAM A;  4F29 A;  4G68 C;  1CB6 A;  3UIF A;  3SKP A;  2X7P A;  4X04 A;  3C36 A;  3V5A A;  2X7Q A;  2B4L A;  4G68 B;  4FJP A;  1IEJ A;  4JSO A;  4NG7 A;  1M5B A;  1UTB A;  3SEY A;  1VDW A;  3U1O A;  3M3F A;  3UGW A;  4IO5 A;  4KFQ A;  3SEW A;  4YMB A;  3DP8 A;  1FBH A;  5I57 A;  2O84 X;  3ONM A;  1M5C A;  4OMB A;  5TP9 A;  1YXI A;  4R2F A;  4QXD A;  3H03 A;  3PPQ A;  1FBG A;  1UTB B;  3Q27 A;  2VGQ A;  5FHN A;  5AA2 D;  1MY1 A;  1LLS A;  1QVS A;  3A3C A;  3QUF A;  2DSF A;  4KYS A;  2XWK A;  4MNI A;  3GZG A;  3QSL A;  4XEQ A;  3B50 A;  1ANF A;  3G3G A;  4ELP A;  4F18 A;  2CMO A;  5AA2 B;  4F2O A;  1Q1K A;  2F5X A;  5TP9 B;  4YKJ A;  4LZ8 A;  3G3H A;  1PB9 A;  5EHM A;  5A5X A;  3RTF B;  3FAT A;  4EF1 A;  2DE2 A;  2RIN A;  4IO7 A;  1NL5 A;  3H6V A;  5T3J A;  2M8C A;  4O7M A;  1UIU A;  4LQ5 A;  5ITO A;  3MST A;  3LR1 A;  3FXU A;  3DLN A;  1YPN A;  1SQY A;  1MRP A;  1NUZ A;  3K02 A;  4YU0 A;  3USD A;  2FIX A;  1FPD A;  2V25 A;  1FBD A;  5A5X B;  3N26 A;  4LN5 A;  1QUL A;  3EKI A;  4PET A;  2QS2 A;  4FBP A;  5ET5 A;  2I0C A;  3WAE A;  1QUJ A;  2KQZ A;  4JVD A;  4PGP A;  1TFA A;  4YB7 A;  3QAX A;  2XX9 A;  5IAI A;  1Y20 A;  1IMD A;  3H4Z A;  4AB6 A;  4UAB A;  2XXR A;  1N0T A;  4ZED A;  3G3J A;  2UVG A;  3U72 A;  4RY1 A;  4R73 A;  2ZXT A;  3QUJ A;  1B4Z A;  4AS4 A;  3UP9 A;  1FTL A;  1AWB A;  4OXV A;  3H6T A;  1N3X A;  1MY0 A;  1DTG A;  4PFB A;  4GF8 A;  4OES A;  4P8B A;  3EN3 A;  2OZZ A;  1H45 A;  4PP0 A;  1SD3 A;  2QMX A;  4HS7 A;  5H8S A;  1PDA A;  1ZTY A;  4IY5 A;  2AYS A; 
#chains in the Genus database with same CATH homology
 1VR5 A;  1A8E A;  5FHM A;  2NXO A;  3WAF A;  2Y84 A;  4G4P A;  1J1N A;  3CR9 A;  3A09 A;  3S4U A;  4KYD A;  4U4X A;  4NED A;  1B3F A;  4QHQ A;  1XS5 A;  2E1S A;  1SW1 A;  1PB8 A;  1SW2 A;  3OMB A;  3S9L C;  1O7T A;  3MP1 A;  4ELO A;  2OWT A;  1P1N A;  1GV8 A;  1Y4T A;  3OD7 A;  4OEN A;  4H65 A;  1FQB A;  2XD2 A;  4DDD A;  5I84 A;  3W9W A;  3I3V A;  3UN6 A;  3Q28 A;  3Q29 A;  3KOT A;  1B9J A;  4QRZ A;  4POW A;  3ZKL A;  2F6P A;  3IR1 A;  4R72 A;  5EHS A;  4YMA A;  2UYF A;  1B3G A;  2UVI A;  3S2V A;  3UOR A;  1RKM A;  3OEK A;  4R6K A;  4OER A;  4DIG A;  3TQW A;  3IO4 A;  3SEU A;  3IAZ A;  3RNN A;  4F3B A;  1USY H;  4JB7 A;  4F1U A;  4XKQ A;  2QS3 A;  3PUX E;  2AIX A;  1LAH E;  2DWJ A;  2F78 A;  3RGY A;  4I9D A;  2H98 A;  1B6H A;  5FTI A;  4M4G A;  1GR2 A;  2VD2 A;  3KOS A;  4RNS A;  3DEL B;  4ZEC A;  4UAC A;  3HCQ A;  5H8N A;  2X26 A;  1MXX A;  1GGG A;  1UQW A;  4XIG Q;  2PBW A;  5FTH A;  2XXH A;  4Q8R A;  4LP2 B;  2O1M A;  2Z8E A;  4MBP A;  4JBZ A;  2QPQ A;  3U94 A;  2XD3 A;  1H44 A;  1B0H A;  1URG A;  3AXF A;  4ZE8 A;  3IOT A;  3LC8 A;  4PFY A;  3RT6 B;  3TTK A;  1HSE A;  4G8H A;  5H8N B;  3O9P A;  2NVU B;  2DWA A;  2PYY A;  4JSD A;  3GBA A;  4KCC A;  4NWC A;  2Y7P A;  4WXJ A;  3H6U A;  3N6T A;  2XXY A;  4GOT A;  2F7A A;  4THI A;  2OLB A;  4ZEI A;  4H6D A;  3EHS A;  2A5T A;  1B40 A;  1MS7 A;  2B3B A;  3IJX B;  4YB6 A;  1QW0 A;  1LBC A;  4L17 A;  4U21 A;  1UIV A;  2P2A A;  3QYT A;  4NF8 A;  1XVY A;  1B58 A;  4C1U A;  4EXL A;  2R71 A;  5EYF A;  1JNF A;  3HHF A;  2Q2A A;  1TFD A;  4OHN A;  4ZEF A;  1XOC A;  4ZEB A;  1OIB A;  3VXB A;  4BDR A;  3OXN A;  1JEV A;  2ZYM A;  2I4C A;  2A5T B;  1N7X A;  3B7D A;  2FYI A;  4O3B A;  3OOA A;  3IK6 B;  1H43 A;  5DVJ A;  2PT2 A;  1Y3N A;  4R9F A;  4AB5 A;  3K0V A;  2F97 A;  4OEU A;  3ZKK A;  4RPN A;  1N04 A;  5KCJ A;  1URD A;  3OO7 A;  2D5W A;  4NF5 B;  4G8N A;  5I59 A;  2IA4 A;  3VV5 A;  3FXR A;  3HO7 A;  3RUM A;  5CC2 A;  2AL5 A;  2F34 A;  1OQG A;  4OFJ A;  5KZT A;  1A99 A;  5L9O A;  3O6H A;  3IB2 A;  3KJT A;  3HHG A;  4FAT A;  1B05 A;  4RXL A;  3TTL A;  3S9N C;  1S50 A;  1B0L A;  5KCJ B;  3DP6 A;  5ICT A;  4H8I A;  3QIM A;  2HAV A;  3FJM A;  1URS A;  1Z7M E;  4HW8 A;  4EF2 A;  4JWO A;  1MH3 A;  3CG1 A;  1FQF A;  3A3U A;  1LB9 A;  2QJE A;  4XKR A;  2ALU A;  4JWY A;  3TTN A;  1PEB A;  3R26 A;  3PMW A;  2RF1 A;  1RYO A;  2ONK E;  3G7W A;  3KFM A;  1FQD A;  3V83 A;  1MM6 A;  2XX8 A;  3I5O A;  1B3E A;  1BKA A;  2DE4 A;  4H0W A;  1LFG A;  3FAS A;  3BKI B;  1TXF A;  1MXW A;  3JV9 A;  1POT A;  1I6B A;  2F7B A;  3O2A A;  1IXH A;  3PD8 A;  5J1D A;  1O63 A;  3EPE A;  3K1M A;  4GQO A;  1B4H A;  3LUY A;  1US5 A;  1IXI A;  2CZL A;  5M2V A;  3EHT A;  1YTV A;  3K2D A;  4GVO A;  4PFW A;  2PMS A;  3UA8 A;  4WEP A;  5TU0 A;  3MP8 A;  2VD3 A;  2H5Y A;  1D9Y A;  4MF3 A;  4YZZ A;  3TCF A;  2H9B A;  3B6Q A;  3SDF A;  4Z0I A;  4NF4 A;  2I48 A;  4PE5 B;  1SYH A;  5AA2 A;  4IB2 A;  2R6G E;  3FUZ A;  2HCA A;  1R9Q A;  5DVF A;  4MH5 A;  2Y7I A;  3O97 A;  1B32 A;  3MZ9 A;  3G3F A;  2AL4 A;  1VE4 A;  4N07 A;  3UK4 A;  4P0G A;  3FGS A;  4NF4 B;  1MM7 A;  3VXC A;  4GL0 A;  3KBR A;  5DT6 A;  4BLA A;  2D21 A;  3OO8 A;  3O28 A;  3MWB A;  3E3K A;  2YJP A;  4PQJ A;  4RJZ A;  3B6T A;  3O66 A;  2B65 A;  1DPE A;  1DTZ A;  3TFL A;  4TLM B;  1POY 1;  5CMC A;  2DQV A;  3OO9 A;  1LB8 A;  1UTH A;  4DXU A;  1NFT A;  4ESX A;  3E9X A;  2ZYO A;  4R6H A;  4ONY A;  2PT1 A;  4BDO A;  5ITP A;  3T9H B;  1HSL A;  5CM6 A;  2DOJ A;  2H25 A;  2Q88 A;  3U93 A;  1IIW A;  1GVC A;  3MVW A;  4TQU Q;  1MPC A;  1SW4 A;  2O69 A;  2GRV A;  5ELV A;  2DVC A;  1MY3 A;  1UTH B;  1PC3 A;  4ECF A;  1LFI A;  1SVX B;  2I0B A;  2I3W A;  4F3P A;  4RYA A;  4KCD A;  4HTG A;  3PMV A;  5H8Q A;  2XXI A;  3T9X B;  4BDQ A;  3LSX A;  3RY3 A;  4F19 A;  1R9L A;  4DXC A;  3N5L A;  4LQ2 A;  2RC9 A;  1ZKB A;  1JW5 A;  3ILT B;  5CMM A;  2GHA A;  1MPD A;  2G29 A;  1BP5 A;  1QUI A;  4C1T A;  3W15 C;  5DYH A;  4JXI A;  1MQG A;  5DVI A;  1ZLQ A;  3TEP A;  1II5 A;  4F1Y A;  4NE4 A;  5H8Q B;  3MQ9 A;  1FTK A;  1N84 A;  1D4N A;  1MQD A;  4K3F A;  4TLL B;  3RTW B;  4FEB A;  1WVJ A;  3S9M C;  5TPA A;  4ZZA A;  4PFT A;  1SYI A;  4EQ7 A;  3N94 A;  4H67 A;  1MH4 A;  4QSC A;  1DPP A;  3IB1 A;  4O3C A;  3ODB A;  1AMF A;  1SBP A;  1TT1 A;  4X9T A;  1OLA A;  2NUV A;  1QKB A;  2XHD A;  3OSQ A;  2V3T A;  3IOR A;  5TPA B;  2RKM A;  3KN8 A;  3H7M A;  4I62 A;  3PUW E;  3M8U A;  1IXG A;  4P11 A;  4G77 A;  1B2H A;  1B46 A;  4FED A;  1ZBM A;  3CFX A;  3U8Q A;  5I58 A;  3MJN A;  4OFL A;  3DM0 A;  4BDM A;  1B7H A;  3Q25 A;  3IOU A;  4PFU A;  1JVY A;  4U1O A;  4FOR A;  1B5H A;  2E0S A;  3H06 B;  3C9H A;  1I6Q A;  4OEV A;  4U22 A;  3OO6 A;  1Y1Z A;  1WDN A;  1I69 A;  3CSG A;  3VFJ A;  1O64 A;  3U92 A;  3QK6 A;  1A40 A;  5I58 B;  2F7C A;  4JWX A;  3HN0 A;  4U23 A;  3TMG A;  1A55 A;  4GRK A;  4N6P A;  3LSF B;  3MVX A;  3MZB A;  3OEM A;  1S9T A;  4DZ1 A;  2ZNS A;  4Q5T A;  3TKD A;  2LAO A;  3TUS A;  1B3L A;  4E0X A;  5HBC A;  3R7X A;  2RCA A;  1H3D A;  3HST A;  2WKY A;  4G8M A;  4XKP A;  4ELR A;  2ZNT A;  3B6W A;  1MXU A;  4OET A;  4ZS9 A;  3MPK A;  3TTM A;  4TOZ A;  4QFN A;  2ONS A;  4KI0 E;  1FTM A;  3H6W A;  2VP1 A;  1NNF A;  1SDX A;  2A5S A;  3RN8 A;  1B7Z A;  4QF9 A;  3EHU A;  4FAJ A;  4GLI A;  1FQA A;  1LBB A;  1M5F A;  5DTB A;  3PPP A;  2GH9 A;  3K4U A;  2Z22 A;  4FE8 A;  2YLN A;  2QS1 A;  3I6V A;  5L9M A;  3CVG A;  1TWY A;  3MW0 A;  1VSO A;  2I58 A;  2XXV A;  1P1Q A;  1JVX A;  1EH3 A;  1NH8 A;  4GD5 A;  2YPN A;  3K00 A;  4OQO A;  1MXZ A;  3ILU B;  2O7U A;  2HAU A;  3MP6 A;  1CE2 A;  2QL3 A;  3C4M A;  4I8C A;  5I56 A;  4NF5 A;  2ABH A;  3KSX A;  2O6A A;  4IO2 A;  1XVX A;  2ZYN A;  1EZ9 A;  1EZO A;  4H5G A;  4DLD A;  2OCU A;  3PPR A;  4IY6 A;  2OWS A;  3CIJ A;  3K6X A;  1B1X A;  1A8F A;  3O29 A;  3KZG A;  1S7Y A;  3VE1 B;  4F31 B;  4BDN A;  1US4 A;  3VDF A;  3HV1 A;  1PBQ A;  4WKM A;  4YKP A;  3IX1 A;  3T93 B;  5I56 B;  2ESN A;  2DYX A;  3FV1 A;  4H1X A;  3PUV E;  3SES A;  3GBB A;  3MZ1 A;  2XXX A;  3FVG A;  4IGT A;  4IO3 A;  3IB0 A;  2DVZ A;  2REG A;  1Y3Q A;  4OFO A;  4MLQ A;  1MXV A;  1LCT A;  2G93 A;  1Y3P A;  1ZIU A;  3OSR A;  2OBG A;  3KSJ A;  1NKX A;  4GXA A;  5CRY A;  3MPL A;  1P1W A;  2DWI A;  2NOO A;  4MLV A;  2QRY A;  4EXK A;  4NMY A;  5AA3 A;  5BUU A;  3KGC A;  2P0S A;  4QFP A;  2F35 A;  1N3W A;  4OZ9 A;  2Y7R A;  5CBR A;  4RPO A;  4F3S A;  4XKN A;  1MQJ A;  1FQE A;  1XC1 A;  1ZU0 A;  4R2B A;  3OEN A;  4KQP A;  3L6H A;  1DSN A;  2RCB A;  1MXY A;  3C31 A;  1MDP 1;  4FIM A;  3IOW A;  1SW5 A;  5FHO A;  1HSJ A;  2HZL A;  4U2R A;  4U1Z A;  4YKI A;  3IO6 A;  2DXR A;  3SEX A;  2Z23 A;  2UVH A;  5H8F A;  3ECR A;  3FVN A;  2V93 A;  5H8H A;  2F8D A;  1DOT A;  3D4C A;  3K01 A;  4ZDM A;  3C35 A;  3DP4 A;  2FA7 A;  5BWJ A;  3C32 A;  2OK2 A;  4KPT A;  4ZE9 A;  4DE8 A;  5ISU A;  5I2K A;  4Q0C A;  2HFB A;  2D3I A;  4IO4 A;  3VLW A;  5JTY A;  3TOD A;  5H8F B;  4H5F A;  1MG1 A;  5H8H B;  3IL1 B;  1IIT A;  3MC2 A;  1FTJ A;  2H4I A;  3CI8 A;  3VLU A;  1AL3 A;  2IEE A;  4NWD A;  5AA4 A;  4RK9 A;  2XXW A;  1R6Z A;  3HPI A;  3PGF A;  5I2K B;  4NF6 A;  4LVQ A;  1LCF A;  4Q30 B;  1DMB A;  5JTY B;  3TEL A;  4QFO A;  2QSX A;  4R6Y A;  2HEU A;  3G3K A;  5IKB A;  3PUY E;  3F11 A;  5CBS A;  3E4R A;  1OMP A;  4XTC Q;  5I57 B;  2ZYK A;  4IGR A;  5AA4 B;  4OTE A;  4HCY A;  4NF6 B;  3MUQ A;  1B52 A;  3MVY A;  2Z8D A;  1JW1 A;  2H99 A;  2DE3 A;  4LUB A;  3M3L A;  5AE4 A;  3PUZ E;  1PBP A;  1B5I A;  5DEX A;  2DXY A;  3VVF A;  3S9E A;  4GFR A;  2OJT A;  4C0R A;  1LFH A;  3K6W A;  3RLF E;  3C34 A;  4EDP A;  3O6I A;  4N13 A;  3ZSF A;  1NNT A;  3IOV A;  1LAX A;  3CFZ A;  1OVT A;  1P1U A;  3FD3 A;  1M5E A;  4OWD A;  4X48 A;  5DEX B;  5JEI A;  1ATG A;  4U4S A;  3KN3 A;  4LA9 A;  2I3V A;  4R74 A;  3M3K A;  3TYH A;  3PD9 A;  3JZJ A;  1MDQ A;  1FQC A;  1AOV A;  4F39 A;  2DP8 A;  1B5J A;  2BJJ X;  1T0K A;  1LAF E;  2DWH A;  2P1S A;  2HXW A;  2Q2C A;  3FJG A;  4GIZ A;  4IO6 A;  1B7U A;  5ICQ A;  1MPB A;  4QSD A;  1OLC A;  4O3A A;  5HPQ A;  3C33 A;  2DS9 A;  1FTO A;  3CSB A;  3E13 X;  1RYX A;  2ZNU A;  4XXU A;  1FW0 A;  4I1D A;  3TCH A;  4P0I A;  1MY2 A;  1BTJ A;  2VHA A;  4QFK A;  1AIV A;  1D3K A;  1MY4 A;  4LZ5 A;  2PX1 A;  1I6A A;  2Z8F A;  5F1Q A;  4YAH X;  2I4B A;  4LZ7 A;  1PB7 A;  4YB5 A;  3R6U A;  4KYE A;  2HQ0 A;  2PVU A;  3VVE A;  2REJ A;  2XX7 A;  3ZS6 A;  5K2Y A;  2THI A;  1FCK A;  4F2Q A;  3RT8 A;  2RC8 A;  3TQL A;  1Y9U A;  4X1B A;  3FVO A;  4LAT A;  2UXA A;  3KG2 A;  4WED A;  2V3U A;  2R9J A;  4GXS B;  4POX A;  2RC7 A;  1EU8 A;  2O7I A;  2V84 A;  3LBS A;  4UA8 A;  2I49 A;  1A7L A;  4LON B;  2XXU A;  1B1H A;  1D9V A;  1SI0 A;  1IZ1 A;  4EUO A;  4ISU A;  3Q26 A;  2Q9T A;  1JEU A;  1IUD A;  4KR5 A;  3SET A;  1M5D A;  2QS4 A;  1IXC A;  1USY E;  3KEI A;  1XT8 A;  1IQ7 A;  3PPO A;  2XXP A;  3G3I A;  2FNC A;  3GXA A;  4KD5 A;  3T9V A;  4H8J A;  5B7D A;  4GWO A;  3CFL A;  3K1N A;  2KLF A;  4R75 A;  4OVJ A;  3V8X B;  4KHZ E;  1B51 A;  3TCG A;  5CI5 A;  3O6G A;  1N76 A;  2NWJ A;  3BFT A;  5B70 A;  1P1O A;  3LSW A;  2O68 A;  4ESW A;  1N7W A;  4OYV A;  3T66 A;  4M1V A;  1BLF A;  1NNP A;  3D4G A;  1LAG E;  3KJ7 A;  1Y4C A;  2B3F A;  3V89 B;  3T22 A;  1NH7 A;  4YIC A;  5L8D A;  3TAJ A;  3PMX A;  3VVD A;  4GL8 A;  4F22 A;  2GFE A;  2ANJ A;  5CMK A;  5I2N A;  1GTK A;  2I6E A;  1B3H A;  4F3G A;  1H76 A;  4EQ9 A;  5F7V A;  4AQ4 A;  4F1V A;  3H3G A;  2QMW A;  3PV0 E;  3BBR A;  2Q89 A;  2ONR A;  3FZV A;  1LGB C;  1A54 A;  2XXT A;  3SEV A;  5I2N B;  3TDJ A;  4RK2 A;  1OVB A;  3PPN A;  4HCW A;  3OEL A;  2Q8J A;  1EZP A;  3K6U A;  1ELJ A;  4BDL A;  1JET A;  4RA1 A;  4JDF A;  2Y7W A;  3FXQ A;  1XHY A;  5AA1 A;  3P7I A;  5HM4 B;  3LSL A;  2F6G A;  4FEC A;  1MQH A;  3SER A;  3FV2 A;  4NF8 B;  3JYR A;  4DCX A;  2HZK A;  3BFU A;  3EF7 A;  4MFI A;  4G2Z A;  1QJM A;  4YKK A;  4X1D A;  1R1N A;  3VLV A;  5JK4 A;  4EQB A;  1JQF A;  4R9G A;  2UYE A;  2O51 A;  1Q35 A;  3N6U A;  4NTL A;  4DXB A;  5KDT A;  3K6V A;  1L5T A;  1BIY A;  1ZJL A;  4ZEK A;  1F9B A;  1NNK A;  2V3Q A;  1Y1M A;  3PU5 A;  4Z7E A;  5CMB A;  2Y7K A;  3TPA A;  3GLB A;  1VFE A;  3RQT A;  3W9V A;  3L6G A;  1ZMG A;  2XXQ A;  3KN7 A;  1OQH A;  2VOZ A;  2GHB A;  5I59 B;  3RPW A;  1LST A;  5LOM A;  5KDT B;  1VFD A;  1SI1 A;  1KWH A;  1Z7N E;  4QFL A;  4ELQ A;  1WOD A;  4DCY A;  3THI A;  4QSE A;  3CG3 A;  3T9U A;  1JW4 A;  3K1P A;  4ND9 A;  1QKA A;  4E0W A;  1MQI A;  1NMU A;  3T96 B;  1YAE A;  3EQ1 A;  3FJ7 A;  1QUK A;  5K2X A;  3CRB A;  2F36 A;  3MBP A;  3TZA A;  3TTR A;  4G68 A;  4ZZE A;  1YCJ A;  1P99 A;  2O1L A;  2W7Y A;  3FIR A;  5L9S A;  3FVK A;  2UVJ A;  3IJO B;  2ZMB A;  3MVZ A;  3QXM A;  1AH5 A;  3MAM A;  4F29 A;  4G68 C;  1CB6 A;  3UIF A;  3SKP A;  2X7P A;  3C36 A;  3V5A A;  2X7Q A;  4G68 B;  4FJP A;  1IEJ A;  4JSO A;  1M5B A;  1UTB A;  3SEY A;  3U1O A;  3M3F A;  3UGW A;  4IO5 A;  4KFQ A;  3SEW A;  4YMB A;  3DP8 A;  5I57 A;  2O84 X;  3ONM A;  1M5C A;  4OMB A;  5TP9 A;  4R2F A;  3H03 A;  3PPQ A;  1UTB B;  3Q27 A;  2VGQ A;  5FHN A;  5AA2 D;  1MY1 A;  1LLS A;  1QVS A;  3A3C A;  3QUF A;  2DSF A;  4KYS A;  3GZG A;  3QSL A;  1ANF A;  3G3G A;  4ELP A;  4F18 A;  2CMO A;  5AA2 B;  4F2O A;  1Q1K A;  2F5X A;  5TP9 B;  4YKJ A;  4LZ8 A;  3G3H A;  1PB9 A;  5EHM A;  5A5X A;  3RTF B;  3FAT A;  4EF1 A;  2DE2 A;  2RIN A;  4IO7 A;  1NL5 A;  3H6V A;  2M8C A;  1UIU A;  4LQ5 A;  5ITO A;  3LR1 A;  3FXU A;  3DLN A;  1YPN A;  1SQY A;  1MRP A;  3K02 A;  4YU0 A;  3USD A;  2V25 A;  5A5X B;  3N26 A;  1QUL A;  4PET A;  2QS2 A;  2I0C A;  3WAE A;  1QUJ A;  1TFA A;  4YB7 A;  3QAX A;  2XX9 A;  5IAI A;  1Y20 A;  4AB6 A;  3H4Z A;  2XXR A;  1N0T A;  4ZED A;  3G3J A;  2UVG A;  3U72 A;  4RY1 A;  4R73 A;  2ZXT A;  3QUJ A;  1B4Z A;  3UP9 A;  1FTL A;  4OXV A;  3H6T A;  1N3X A;  1MY0 A;  1DTG A;  4GF8 A;  4OES A;  3EN3 A;  2OZZ A;  1H45 A;  4PP0 A;  1SD3 A;  2QMX A;  4HS7 A;  5H8S A;  1PDA A;  1ZTY A;  4IY5 A;  2AYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...