2O84X

Crystal structure of k206e mutant of n-lobe human transferrin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serotransferrin
publication title Structures of two mutants that probe the role in iron release of the dilysine pair in the N-lobe of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 105
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o84X01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o84X02
3PMXA 4K3FA 3PGFA 1B3GA 1ZMGA 1FQFA 4EQ7A 3ILTB 3LC8A 1UTHA 3D4CA 1A99A 1WDNA 3UORA 3IB2A 1QVSA 3OOAA 3TUSA 3G3KA 5KDTA 1M5CA 3M8UA 3UGWA 2OWSA 5ITPA 4U22A 3UK4A 3C31A 5TPAB 5DVIA 2PT1A 1QKAA 4OQOA 3K6XA 3T9UA 2DXYA 4JWXA 3MPKA 3L6HA 4O3BA 3IO4A 3HSTA 3T96B 2W7YA 2O84X 2F8DA 3TELA 4RK9A 2QS2A 1MQJA 2XXYA 3RGYA 3MP6A 4YKIA 3M3FA 4FIMA 4GIZA 4U1ZA 5CMCA 4BDMA 3CRBA 5JK4A 4YMBA 5HBCA 3K0VA 3MBPA 1BP5A 1MXWA 2RC7A 4ISUA 1A55A 2QRYA 1I6BA 1P1UA 2H25A 4JB7A 1PB8A 3EN3A 5CI5A 3PPPA 2F6GA 1NNFA 3RTWB 1ZTYA 5I56A 1FCKA 4R2BA 1POTA 1D9VA 3P7IA 4NF4B 3TQWA 2V3QA 4QFPA 5ISUA 1A40A 1OIBA 4WEPA 3KSXA 2QS3A 1Y20A 3BBRA 1XC1A 4I8CA 1CB6A 3SDFA 3MAMA 2GHAA 3EHUA 2OZZA 3O29A 3VXBA 2RCAA 2QJEA 1S9TA 2OLBA 4ELPA 1FTLA 2GFEA 3CG1A 4R75A 4O3CA 3W15C 1ATGA 1M5FA 1UQWA 5ICQA 3S9NC 2D3IA 4QF9A 2VHAA 4OFLA 3VXCA 4FEDA 4QFLA 3PMVA 5H8HA 3K6UA 2HEUA 1IXGA 4GL8A 1R1NA 2ZNTA 1SYIA 3IB1A 3H3GA 4KI0E 3H7MA 3H6TA 2RKMA 4FE8A 1OVTA 4C1UA 4O3AA 1MY0A 1DMBA 4H0WA 1IUDA 4TLMB 2DWIA 1ANFA 1ZLQA 3EQ1A 4GL0A 1MXYA 2E0SA 2XX7A 4KYDA 1US4A 5EHSA 4ZEBA 3U72A 4EQBA 4PETA 4RPOA 3DELB 2O1MA 2XX8A 3EHTA 2VD2A 1B32A 4HW8A 2XXXA 3FJ7A 2DOJA 5I58A 4LZ7A 4ZDMA 1LFGA 3PUYE 1QJMA 4GRKA 4YZZA 1R6ZA 2YPNA 1OMPA 3SEYA 3LSXA 4DCXA 3FVOA 4RPNA 2Q2AA 2ALUA 4C0RA 5A5XB 5H8QA 3QIMA 1URSA 3B6QA 4EQ9A 3SEVA 2XXRA 2RINA 3O6IA 4G8HA 2DE3A 1CE2A 3RN8A 1GTKA 3MVZA 3HV1A 3G7WA 4IY5A 4ELRA 3O9PA 4QFOA 5L9SA 1USYE 2XX9A 5DTBA 3KSJA 1PC3A 4WEDA 4OHNA 3SEUA 3PD9A 4ZZAA 3S4UA 3KN7A 4RK2A 4DLDA 1MDQA 2XD2A 5M2VA 3TMGA 3Q29A 4FAJA 3IOWA 1I6QA 5BWJA 5AA4A 1TWYA 5F1QA 3IL1B 3FV2A 4XTCQ 3T93B 1JVXA 1NNKA 3FVNA 3QUJA 5DT6A 5I59B 5IKBA 1AOVA 2Y7RA 1JQFA 3O97A 5AA2B 3VVFA 3JYRA 4NF8B 3ODBA 3OO6A 4ZZEA 3G3FA 1B05A 1Q1KA 1HSLA 3MW0A 1MPBA 3FZVA 1PB9A 4MLQA 4LONB 4G2ZA 3T9XB 5CMKA 4GVOA 5FHNA 2NVUB 3KJTA 2Q89A 1SW5A 3OO8A 3THIA 3ZKKA 4H65A 3UN6A 4ZEKA 3S9EA 2R71A 1QW0A 2ZNUA 3KG2A 4F19A 2F5XA 1SW2A 2KLFA 2B3BA 4RYAA 4IO3A 4H5GA 3PUXE 2UXAA 3KBRA 3U93A 2O6AA 1Y1ZA 2OK2A 1FW0A 2QL3A 4R6KA 3RPWA 4F3BA 1O63A 3A3UA 1MY4A 5KCJB 5DYHA 3FGSA 1LB9A 1QUJA 4QRZA 2HFBA 2Q2CA 1XOCA 1OQGA 1Y4TA 1DSNA 4OTEA 3RT8A 1A8FA 4I9DA 1MPDA 2AIXA 1SW4A 2XHDA 1XT8A 3R26A 1N84A 4LVQA 3PUVE 4PP0A 4WKMA 1LAXA 3TCGA 3TDJA 4NF5B 3HCQA 4DIGA 3ZSFA 4H67A 3K4UA 2XXTA 1B5IA 4LQ2A 3LUYA 1Z7ME 3CFZA 5L8DA 5I84A 4GFRA 5CMMA 1YCJA 2Y7WA 1LAGE 5I2KA 2REJA 3MPLA 4R6YA 3A09A 3C35A 5H8NB 3CFLA 2I0CA 3IORA 4MF3A 1I6AA 4MH5A 2YJPA 1S50A 2IA4A 3K6VA 3MVYA 1LFIA 3B6TA 2ZMBA 4KYSA 2YLNA 3RLFE 4YB5A 5TPAA 1N0TA 3U8QA 3R7XA 1M5DA 1HSEA 3K00A 4IY6A 3DP4A 1ZBMA 3RNNA 2V25A 5I57B 3FD3A 2UYEA 3KN8A 4E0XA 3FVGA 4F3PA 3KZGA 3MC2A 1Y3NA 4OVJA 2ONKE 1IXCA 4XKNA 4X48A 3N6TA 3KN3A 4NTLA 2H99A 5AA3A 2DVZA 4PE5B 1T0KA 2DE4A 2PYYA 4AB6A 5BUUA 4R2FA 4YB6A 2NWJA 1MXZA 3N6UA 3O2AA 1BIYA 2DVCA 3FV1A 2G93A 4U21A 5EYFA 2Z8FA 4PFWA 2V84A 5FTIA 3S2VA 3Q28A 1B46A 3RUMA 1IZ1A 4UA8A 2I49A 5CRYA 4YB7A 4ND9A 4EUOA 3CSBA 4H8IA 1FQAA 3VFJA 1H44A 3MZBA 1JEUA 3S9LC 3K01A 3FXUA 4OEUA 1NNTA 1MS7A 1MQHA 3GZGA 2XXUA 2FYIA 4NF4A 1B3FA 4GXAA 4YU0A 4JWOA 1B3HA 4NF6A 4ESXA 5JEIA 3RQTA 3E3KA 4R73A 2F35A 4WXJA 4ECFA 2I48A 2D5WA 4G68A 1P1WA 3N5LA 5TP9A 2Z8EA 3LBSA 4POXA 4FATA 4LATA 2X26A 1VSOA 1B7UA 3HPIA 4DZ1A 1RKMA 3OELA 2QPQA 3FXQA 4LP2B 1IXHA 3IOTA 4H5FA 4GD5A 1SW1A 3BFTA 3TTKA 5DEXB 3PU5A 4HTGA 3K6WA 4DXCA 2UVJA 4THIA 4IO6A 5I56B 3VVEA 3RT6B 3QSLA 3OXNA 1B0HA 3FXRA 5I2NA 4NWCA 4YKJA 3K1NA 1YAEA 2I4BA 2XD3A 3KFMA 2G29A 3G3JA 1MY1A 1QULA 3B6WA 5ICTA 2RC8A 1TXFA 5H8FB 3Q27A 1B51A 4GXSB 2ANJA 2NOOA 1H43A 1QKBA 5JTYB 4JXIA 4X1BA 4KQPA 4G68C 4OETA 2Y7PA 3E9XA 1TFAA 2PVUA 2P1SA 1H3DA 3GBAA 4KCDA 3PPQA 1R9LA 2D21A 1DPPA 5ELVA 4Q5TA 3MUQA 1PEBA 3GXAA 3Q25A 3ECRA 2UVHA 4PQJA 2F36A 1Y3QA 1OLCA 5A5XA 4R6HA 4BDQA 3TAJA 3DLNA 2I3VA 1BLFA 4N6PA 3TEPA 2M8CA 3H6WA 4HCYA 2UYFA 3PPRA 4YKPA 4F1YA 1IITA 3OENA 3MP1A 3QK6A 4YMAA 4EXKA 4ZS9A 2F7AA 1RYOA 2ZYOA 3DP8A 4OMBA 4M4GA 2FA7A 4U23A 1UTBB 4IO2A 2CMOA 2DWJA 4P11A 4KCCA 4R72A 1M5BA 1NMUA 3G3GA 1ZKBA 4TLLB 2HQ0A 1FQEA 1L5TA 5I59A 3FATA 3IJOB 3VLUA 1S7YA 4OERA 3USDA 5AA2A 2IEEA 3MVXA 4NF8A 5H8QB 4F2OA 4I62A 1B1XA 3C4MA 2HXWA 1DTGA 4PFTA 4DXBA 1B4ZA 4RNSA 1EU8A 2VGQA 2F78A 2RCBA 2A5TA 4KHZE 2I0BA 3MP8A 1GGGA 2R9JA 4ELOA 3IR1A 3ZKLA 4BDNA 2ZYMA 3VLWA 2OJTA 1B7ZA 3CI8A 4LZ5A 3TPAA 4KD5A 1TT1A 3MQ9A 1MH3A 1JNFA 3IB0A 3N26A 3KOTA 3PD8A 2Q8JA 1O7TA 1SI0A 4RY1A 1US5A 1Z7NE 1N3XA 4X1DA 4OEVA 2UVGA 1MPCA 2XXVA 4OYVA 2DSFA 1ZJLA 5AA4B 1B5HA 1LBBA 3HHFA 2XXPA 4C1TA 5K2YA 4QSEA 4FEBA 5KCJA 3Q26A 3QUFA 5HM4B 3OD7A 4GLIA 2AYSA 2VD3A 4GOTA 3FJMA 1VR5A 1MDP1 1D3KA 4IGTA 4IO5A 2ZNSA 4BDLA 4FORA 4JSDA 3H03A 1YTVA 4U4XA 4ZE9A 3KOSA 1SBPA 5L9OA 1FTJA 2QS1A 2ZXTA 3PPOA 3U94A 3TTLA 3H6UA 4XIGQ 1J1NA 4L17A 1LLSA 4OZ9A 2RF1A 4NMYA 1JW5A 4XKRA 4NF5A 4RJZA 4POWA 1P1QA 3W9VA 4ESWA 4LUBA 4Q8RA 2ZYNA 5TU0A 4U1OA 5DVFA 5CC2A 3WAFA 4IO4A 3GBBA 2A5SA 3V5AA 4P0IA 1VE4A 4QFKA 4Z0IA 3FVKA 2XXQA 4KPTA 3VLVA 2O7IA 3MVWA 3IAZA 5H8NA 1D9YA 1A54A 4AB5A 5B7DA 3OSQA 3WAEA 2Z8DA 3OO7A 3ZS6A 1P1OA 3HO7A 2Z23A 2RC9A 3CFXA 1II5A 1N04A 4P0GA 3IOVA 1LBCA 3TYHA 1DPEA 3VDFA 1B5JA 2B3FA 2ONRA 4MBPA 2PX1A 1IEJA 1FQCA 5I57A 1FTKA 2THIA 2X7PA 1USYH 2NUVA 4OENA 1KWHA 1B0LA 5I2KB 3PMWA 3ILUB 3O6HA 2HZKA 1Q35A 3OEMA 2Y7IA 4ELQA 3DM0A 2DE2A 2DQVA 2HAUA 1EZPA 1JW4A 3JZJA 2F97A 1PB7A 1AH5A 4LQ5A 1N76A 4GWOA 1F9BA 4Q30B 1B9JA 3I6VA 4ONYA 2GH9A 1GV8A 1WVJA 4G77A 2BJJX 4OFOA 3B7DA 3A3CA 2Z22A 1NNPA 1EZOA 1AL3A 1B3EA 2WKYA 3VV5A 1UTHB 2H5YA 4DXUA 3I5OA 5LOMA 3UP9A 2DP8A 3V83A 3HN0A 1B6HA 3T22A 5KDTB 3JV9A 2GHBA 2FNCA 3CG3A 3QXMA 3N94A 4XXUA 1LCFA 1LB8A 3GLBA 1AIVA 1NKXA 1Y9UA 4HCWA 5FTHA 4PFUA 1B3LA 2XXHA 4LZ8A 5AE4A 4N13A 4ZEDA 3SETA 4ZE8A 3IX1A 5KZTA 1SYHA 1MM7A 2DWAA 3MZ9A 2O51A 1ZU0A 2H4IA 3FJGA 4R9GA 5DEXA 3K1MA 2AL4A 1P99A 4XKPA 3RY3A 1M5EA 1SQYA 1EH3A 3OEKA 1MQGA 1A8EA 4H8JA 3TTRA 2DS9A 3SKPA 2QMXA 4MFIA 4N07A 2V3UA 4JBZA 3UIFA 3V89B 4BDOA 4F2QA 5ITOA 1Y3PA 4NF6B 1XS5A 3KJ7A 3CSGA 1BTJA 2OCUA 4F3GA 2QS4A 4OXVA 1LAFE 1I69A 4G68B 4G8MA 5H8FA 2LAOA 4F22A 5AA2D 3LSLA 4H6DA 1PDAA 5TP9B 3G3HA 5JTYA 5HPQA 3TODA 4YKKA 1POY1 5IAIA 3O6GA 5F7VA 2E1SA 4RXLA 2H98A 2OWTA 3W9WA 4NE4A 2OBGA 3ONMA 1NH7A 4MLVA 1LCTA 3TCFA 1B1HA 1OQHA 3HHGA 2DXRA 3IOUA 1JEVA 4TQUQ 3K2DA 2O1LA 4UACA 5L9MA 3LSWA 4X9TA 5I2NB 3DP6A 1H76A 5H8SA 5H8HB 3EF7A 4EF1A 3H06B 4H1XA 3OO9A 5EHMA 2DWHA 3H6VA 3FUZA 5B70A 1MXUA 4F39A 1LSTA 4BLAA 3C32A 1EZ9A 1UIUA 3R6UA 4F1UA 4FJPA 1MQDA 4ZEFA 1PBQA 3PUZE 4JDFA 1UTBA 1B52A 4QSCA 1LAHE 2F7BA 2ONSA 2F7CA 4PFYA 4U2RA 2REGA 2VP1A 3L6GA 3PV0E 3UA8A 4G8NA 3BFUA 1ZIUA 2PBWA 1IIWA 3PPNA 1VFEA 2Y7KA 3U92A 5AA1A 5I58B 4OESA 3EPEA 3F11A 1QUIA 1MH4A 2V93A 4JSOA 3U1OA 1FQBA 2AL5A 1SD3A 5CBRA 1TFDA 1MRPA 1SDXA 4F1VA 4ZEIA 4YAHX 1O64A 2Y84A 3AXFA 2DYXA 3IO6A 1QUKA 4GQOA 3KGCA 4EDPA 3VVDA 4NEDA 3MJNA 1MY2A 4TOZA 4U4SA 4ZECA 2ESNA 4KYEA 2V3TA 3C36A 3TFLA 3T9HB 5DVJA 1RYXA 1B40A 1IXIA 2H9BA 3H4ZA 2O69A 3CR9A 4JWYA 1FTMA 5CBSA 1FQDA 2NXOA 1B7HA 3OSRA 5CM6A 4EF2A 3M3LA 3VE1B 2O68A 2HZLA 4NWDA 1LFHA 3K02A 1H45A 3SEWA 1JETA 1N7WA 4IB2A 1MXVA 2QSXA 1PBPA 2I3WA 1YPNA 2P2AA 4E0WA 1OVBA 4Z7EA 4QHQA 4I1DA 1NL5A 3G3IA 4F18A 4XKQA 4F29A 4OFJA 2HAVA 1XVYA 1LGBC 2QMWA 3O28A 4OWDA 2B65A 3S9MC 2A5TB 2HCAA 1GR2A 1N3WA 3OMBA 3EHSA 1D4NA 4F3SA 1SVXB 4DCYA 5J1DA 3KEIA 3MWBA 3QYTA 4M1VA 1MQIA 4R74A 4RA1A 3TTNA 3C34A 4HS7A 4QSDA 2I58A 3E4RA 2UVIA 3SESA 2CZLA 3TZAA 4LA9A 4AQ4A 1FTOA 3IK6B 2ABHA 4Q0CA 1P1NA 3TTMA 4IO7A 1R9QA 2F6PA 2PT2A 1B2HA 2X7QA 3K1PA 2Q88A 3C33A 1JVYA 3FIRA 3I3VA 4BDRA 3PUWE 3V8XB 5FHOA 2O7UA 1MG1A 4KR5A 3IJXB 4FECA 1XVXA 3RTFB 1DOTA 2XXIA 1BKAA 2ZYKA 1UIVA 3CVGA 1IQ7A 2PMSA 1MY3A 4GF8A 4F31B 3TQLA 2F34A 3SEXA 3MZ1A 1URGA 4QFNA 1WODA 3C9HA 1JW1A 4IGRA 1NFTA 1HSJA 1Y1MA 3T9VA 2XXWA 1XHYA 3O66A 4R9FA 1B4HA 1GVCA 3M3KA 1URDA 1B58A 2I4CA 1NH8A 2GRVA 1SI1A 3QAXA 2VOZA 5FHMA 4EXLA 3LSFB 1N7XA 3TCHA 3CIJA 1Y4CA 5CMBA 3SERA 3T66A 3TKDA 3BKIB 1DTZA 4YICA 4DE8A 1ELJA 2Q9TA 1AMFA 4DDDA 3FASA 2R6GE 1A7LA 4G4PA 3D4GA 5K2XA 1MXXA 4KFQA 1MM6A 3LR1A 2P0SA 3E13X 1OLAA 1VFDA 2I6EA
chains in the Genus database with same CATH superfamily
2Y5KA 3PMXA 2P3VA 4K3FA 3PGFA 1B3GA 1ZMGA 1FQFA 4EQ7A 3ILTB 4N15A 1KA1A 3LC8A 1UTHA 3D4CA 4O7IA 1A99A 4H45A 1WDNA 3UORA 2HHMA 3IB2A 1QVSA 1FPIA 3OOAA 4FBPA 3TUSA 3G3KA 5KDTA 1M5CA 4GX3A 3M8UA 3UGWA 2OWSA 5ITPA 4MJOA 4U22A 3UK4A 3C31A 5TPAB 5DVIA 2PT1A 1QKAA 4OQOA 3K6XA 4OVPA 3T9UA 2DXYA 5FBPA 5ET7A 4JWXA 3MPKA 3L6HA 4O3BA 3IO4A 3HSTA 3T96B 2PFZA 1LBXA 2W7YA 2O84X 2F8DA 3TELA 1VDWA 4RK9A 2QS2A 1MQJA 2XXYA 3RGYA 3MP6A 4YKIA 3M3FA 4FIMA 2QFLA 2OX3A 3QMFA 4GIZA 4U1ZA 5CMCA 4BDMA 3CRBA 5JK4A 4YMBA 2Q8MA 5HBCA 4NHBA 3K0VA 3MBPA 1G0HA 5I7IA 1BP5A 1MXWA 2RC7A 4ISUA 5EYHA 4XEQA 1A55A 2QRYA 1I6BA 1P1UA 2H25A 1FPEA 4JB7A 1PB8A 3EN3A 5CI5A 1FJ6A 3PPPA 2F6GA 2DDKA 1NNFA 3RTWB 1ZTYA 5I56A 1FCKA 4PDHA 4R2BA 1POTA 1FBEA 4UABA 1D9VA 3KC0A 3P7IA 4NF4B 3TQWA 2V3QA 4QFPA 5ISUA 1A40A 1OIBA 4WEPA 3KSXA 2QS3A 1Y20A 3LV0A 5IZ3A 3BBRA 1XC1A 4I8CA 1CB6A 5T3JA 3SDFA 3MAMA 1IMBA 2FBPA 2GHAA 3EHUA 2JJKA 1FPBA 2ZZXA 4JVIA 2OZZA 3O29A 3VXBA 1RDYA 2RCAA 2QJEA 1S9TA 2OLBA 4ELPA 1FTLA 4H46A 2GFEA 4R75A 3CG1A 4HE0A 4O3CA 3W15C 1ATGA 1M5FA 1UQWA 5ICQA 1K9YA 3T0JA 3S9NC 2D3IA 4QF9A 2VHAA 4OFLA 3VXCA 4FEDA 4QFLA 3PMVA 5H8HA 3K6UA 2HEUA 1FTAA 1IXGA 4GL8A 1R1NA 2ZNTA 1SYIA 3IB1A 3H3GA 3MYUA 4KI0E 3H7MA 3H6TA 4N81A 1RDZA 3RYDA 4X8RA 2RKMA 4FE8A 4PAIA 1OVTA 4C1UA 4O3AA 1MY0A 1DMBA 4H0WA 1IUDA 4TLMB 2DWIA 3T1BA 1ANFA 2XA5A 1ZLQA 4XF5A 3EQ1A 4GL0A 1MXYA 2E0SA 2XX7A 4KYDA 4N6DA 1US4A 5EHSA 4ZEBA 3U72A 4EQBA 4PETA 4RPOA 3DELB 3EHTA 2O1MA 2XX8A 1BK4A 2VD2A 1B32A 4HW8A 2XXXA 3FJ7A 2DOJA 5I58A 4LZ7A 4ZDMA 1LFGA 3PUYE 1QJMA 4GRKA 4YZZA 1R6ZA 2YPNA 1OMPA 3SEYA 3LSXA 4DCXA 3FVOA 4RPNA 2Q2AA 4QXDA 2ALUA 4C0RA 5A5XB 5H8QA 3QIMA 1URSA 3B6QA 4EQ9A 3SEVA 4I3EA 2XXRA 2RINA 3O6IA 4G8HA 2DE3A 1CE2A 3RN8A 1GTKA 3MVZA 3HV1A 3G7WA 4IY5A 4ELRA 3O9PA 4QFOA 5L9SA 1USYE 2XX9A 5DTBA 3KSJA 1PC3A 4WEDA 4OHNA 4PAKA 3SEUA 3PD9A 4ZZAA 3S4UA 3KN7A 4RK2A 4PTKA 4DLDA 1MDQA 2XD2A 4O8MA 4OVQA 5M2VA 3TMGA 3Q29A 4FAJA 3IOWA 1I6QA 5BWJA 5AA4A 1TWYA 5F1QA 3IL1B 3FV2A 4XTCQ 1NUXA 3T93B 1JVXA 1NNKA 4P8BA 4P1EA 3FVNA 3ISPA 3QUJA 5DT6A 5I59B 5IKBA 1AOVA 3B8BA 1EYJA 2Y7RA 4P1LA 1JQFA 3O97A 2CZKA 4MEVA 5AA2B 3VVFA 3JYRA 4NF8B 3ODBA 3OO6A 4ZZEA 3G3FA 1B05A 1Q1KA 1HSLA 3MW0A 2XWKA 1MPBA 3FZVA 1PB9A 4MNCA 4I3YA 4MLQA 4LONB 4N8YA 4G2ZA 3T9XB 5CMKA 4GVOA 1LEVA 5FHNA 2NVUB 3KJTA 2CZHA 2Q89A 3RPLA 1SW5A 3OO8A 3THIA 3ZKKA 4H65A 3UN6A 5A5LA 4ZEKA 3S9EA 2R71A 1QW0A 2ZNUA 1LBVA 2PCRA 3KG2A 4QBAA 4F19A 2F5XA 4P3LA 1SW2A 2KLFA 3GYYA 2B3BA 4RYAA 4IO3A 4H5GA 3PUXE 2UXAA 3KBRA 3U93A 5ET5A 2O6AA 1Y1ZA 2OK2A 1FW0A 2QL3A 4R6KA 3RPWA 4F3BA 1O63A 3A3UA 1MY4A 5KCJB 5DYHA 1NV4A 3FGSA 1LB9A 2WBBA 1QUJA 4QRZA 2HFBA 2Q2CA 1XOCA 1NV2A 1OQGA 1Y4TA 1DSNA 4OTEA 3RT8A 1A8FA 4I9DA 2B4LA 2F3DA 1MPDA 2AIXA 1SW4A 5EQ8A 1NV5A 2XHDA 1FPLA 5I3SA 3KC1A 1XT8A 1DK4A 3R26A 1N84A 4LVQA 3PUVE 4PP0A 4WKMA 1FBPA 1LAXA 3TCGA 3TDJA 3D1RA 4NF5B 3HCQA 4DIGA 3ZSFA 4H67A 3K4UA 2XXTA 4O7MA 1B5IA 4LQ2A 3LUYA 1Z7ME 3CFZA 2HPGA 4PBHA 4PGPA 5L8DA 5I84A 4GFRA 5CMMA 1YCJA 2Y7WA 3FXBA 1FPGA 1LAGE 5I2KA 2REJA 3MPLA 4R6YA 3A09A 3HFUA 3C35A 5H8NB 3CFLA 2I0CA 3IORA 4MF3A 1I6AA 4MH5A 2YJPA 1S50A 2IA4A 3K6VA 3MVYA 1LFIA 3B6TA 2ZMBA 4KYSA 2YLNA 3RLFE 4YB5A 5TPAA 5EYGA 1N0TA 3U8QA 3R7XA 1M5DA 1HSEA 3K00A 4IY6A 3DP4A 1DCUA 1ZBMA 3RNNA 2V25A 5I57B 3FD3A 2UYEA 3KN8A 4E0XA 1IMCA 3FVGA 4F3PA 3MC2A 3KZGA 1Y3NA 4OVJA 2ONKE 1IXCA 4XKNA 4X48A 3N6TA 3KN3A 4NTLA 2H99A 1FBGA 1FBDA 5AA3A 1FJ9A 2DVZA 4PE5B 1T0KA 4GWSA 2OWZA 2DE4A 5IGAA 2PYYA 4AB6A 2HXRA 5BUUA 4R2FA 4P47A 4YB6A 2NWJA 1MXZA 3N6UA 3O2AA 4PF6A 4JVDA 1YYZA 1BIYA 2DVCA 5DW8A 3FV1A 2G93A 4U21A 5EYFA 2Z8FA 4PFWA 2V84A 5FTIA 3S2VA 3Q28A 1FBHA 1B46A 3RUMA 1IZ1A 4UA8A 2I49A 5CRYA 4YB7A 4ND9A 4EUOA 3CSBA 4H8IA 1FQAA 2XWOA 3VFJA 1H44A 3MZBA 1JEUA 3S9LC 3K01A 2FVZA 3FXUA 4OEUA 1NNTA 1MS7A 1MQHA 3GZGA 2XXUA 2FYIA 4NF4A 1B3FA 5IZZA 4GXAA 4YU0A 4JWOA 1B3HA 4NF6A 4ESXA 5JEIA 3RQTA 3E3KA 4R73A 4PCDA 1INPA 2L5VA 2F35A 4WXJA 4ECFA 2I48A 2D5WA 4G68A 4PE3A 2VPNA 1P1WA 3N5LA 1XI6A 5TP9A 2Z8EA 4OVSA 3LBSA 4POXA 4HE1A 4FATA 1FPJA 4LATA 2X26A 1LBZA 1VSOA 1B7UA 1NV3A 3HPIA 4DZ1A 1RKMA 3OELA 2R8TA 2QPQA 3FXQA 4LP2B 1IXHA 1SPIA 3IOTA 4H5FA 4GD5A 1FPDA 1SW1A 3BFTA 3TTKA 5DEXB 3PU5A 5EQ7A 4HTGA 3K6WA 4DXCA 2UVJA 4THIA 3NOHA 4IO6A 5I56B 3VVEA 4MHFA 3RT6B 3QSLA 3OXNA 1B0HA 3FXRA 5I2NA 1LBWA 4NWCA 4YKJA 3K1NA 3B50A 1YAEA 2I4BA 2XD3A 3KFMA 4AS4A 2G29A 3G3JA 3BIHA 3IFAA 4DI4B 1MY1A 1QULA 3B6WA 5ICTA 2RC8A 1TXFA 5H8FB 3Q27A 1B51A 4GXSB 2ANJA 2NOOA 1NUWA 1H43A 1QKBA 5JTYB 4JXIA 4X1BA 4KQPA 4G68C 4OETA 1LBYA 2Y7PA 4PDDA 3E9XA 4HXVA 1TFAA 2PVUA 2P1SA 1H3DA 3GBAA 4KCDA 3PPQA 1R9LA 2D21A 1DPPA 5ELVA 4Q5TA 3MUQA 1PEBA 2ZZWA 3EKIA 3GXAA 1YXIA 3Q25A 3ECRA 2UVHA 4PQJA 2F36A 3A29A 1Y3QA 1OLCA 1Q9DA 5A5XA 4R6HA 4BDQA 3TAJA 3DLNA 3SZPA 2I3VA 1BLFA 4N6PA 3TEPA 2M8CA 3H6WA 4HCYA 2UYFA 3PPRA 4YKPA 1NV6A 4F1YA 1IITA 3OENA 3MP1A 3QK6A 4YMAA 4EXKA 3LUZA 4ZS9A 2F7AA 1RYOA 2ZYOA 1NUZA 3DP8A 4OMBA 4M4GA 2FA7A 4U23A 1JP4A 1UTBB 4IO2A 2CMOA 2DWJA 4P11A 4KCCA 1CNQA 4R72A 1M5BA 4OVRA 1NMUA 3G3GA 1FBCA 1ZKBA 4TLLB 4PFBA 4NF0A 2HQ0A 2QVVA 1FQEA 1L5TA 5I59A 3FATA 3IJOB 3VLUA 1S7YA 4OERA 3USDA 5AA2A 4PC9A 2IEEA 3MVXA 4NF8A 1IMFA 4DI3D 5H8QB 4F2OA 4I62A 1B1XA 3C4MA 2HXWA 1NUYA 1DTGA 4PFTA 4DXBA 1B4ZA 4RNSA 1EU8A 2VGQA 2F78A 2RCBA 2A5TA 4KHZE 1NI9A 2I0BA 3MP8A 1GGGA 2R9JA 4GBVA 4ELOA 3IR1A 3ZKLA 4BDNA 2ZYMA 3VLWA 2OJTA 1B7ZA 2GQ1A 3CI8A 4LZ5A 2XWVA 3MSTA 3TPAA 4KD5A 1TT1A 3MQ9A 1MH3A 1JNFA 3IB0A 3N26A 3KOTA 3PD8A 2Q8JA 1O7TA 1SI0A 4RY1A 1US5A 1Z7NE 1N3XA 4X1DA 4OEVA 2UVGA 1MPCA 2XXVA 4OYVA 2DSFA 1ZJLA 5AA4B 1B5HA 1LBBA 3HHFA 2XXPA 4C1TA 5K2YA 5EQ9A 4QSEA 4FEBA 3PTYA 5KCJA 3Q26A 3QUFA 5HM4B 3OD7A 4GLIA 2AYSA 2VD3A 4GOTA 3FJMA 4JVCA 1VR5A 1MDP1 4I40A 1D3KA 4IGTA 4IO5A 2ZNSA 4BDLA 4FORA 4JSDA 5ESYA 3H03A 1YTVA 4U4XA 4ZE9A 1RDXA 3KOSA 1SBPA 2QVUA 5L9OA 1FTJA 2QS1A 2ZXTA 3PPOA 3U94A 3H6UA 4XIGQ 3TTLA 4L17A 1J1NA 1LLSA 4OZ9A 2RF1A 4NMYA 1JW5A 1D9QA 2FIEA 4XKRA 4NF5A 2CZIA 4RJZA 1FPFA 4POWA 1P1QA 3W9VA 4ESWA 4LUBA 4Q8RA 4PBQA 2ZYNA 5TU0A 4U1OA 5DVFA 5CC2A 3WAFA 4IO4A 2CEXA 2Q74A 1EYKA 3GBBA 2A5SA 3V5AA 4P0IA 1VE4A 4O94A 5LTCA 4QFKA 1AWBA 3CHGA 4NX1A 4Z0IA 3FVKA 2XXQA 4KPTA 5F24A 3VLVA 2O7IA 3MVWA 3IAZA 5H8NA 1D9YA 1A54A 2P3NA 4AB5A 5B7DA 3OSQA 3WAEA 2Z8DA 3OO7A 3IFCA 3ZS6A 1P1OA 3HO7A 2WX9A 2Z23A 3BIGA 2RC9A 3CFXA 1II5A 1N04A 4P9KA 4P0GA 4GWYA 4KXPA 3IOVA 4PF8A 1LBCA 3TYHA 1DPEA 2PFYA 2ZZVA 3VDFA 1B5JA 4MMPA 2B3FA 2ONRA 4MBPA 2PX1A 1IEJA 2V4CA 1FQCA 5I57A 1FTKA 2THIA 2X7PA 1USYH 2NUVA 4OENA 1FRPA 4N4UA 1KWHA 1B0LA 3E78A 1IMEA 5I2KB 3PMWA 3ILUB 3O6HA 2HZKA 1Q35A 3OEMA 2Y7IA 4ELQA 3DM0A 2DE2A 2DQVA 2HAUA 1QGXA 1EZPA 1JW4A 3JZJA 2F97A 1PB7A 1AH5A 4LQ5A 1N76A 4GWOA 1F9BA 4Q30B 1B9JA 3I6VA 5ET6A 4ONYA 2GH9A 1GV8A 2BJIA 1WVJA 2F3BA 4G77A 2BJJX 2XXKA 4MX6A 4OFOA 3B7DA 3A3CA 2Z22A 1NNPA 1EZOA 1AL3A 1B3EA 2WKYA 2WBDA 3VV5A 1UTHB 2H5YA 4DXUA 5I5PA 3I5OA 5LOMA 3UP9A 2DP8A 3V83A 3HN0A 1B6HA 3T22A 5KDTB 1NV7A 3JV9A 2GHBA 5IZ1A 2FNCA 3CG3A 5EQAA 3QXMA 3N94A 4XXUA 1LCFA 1LB8A 3GLBA 1AIVA 1NKXA 1Y9UA 4MNPA 4HCWA 2KR0A 5FTHA 4PFUA 1B3LA 4MIJA 2XXHA 4LZ8A 5ET8A 5AE4A 2WEFA 2FIXA 4N13A 4ZEDA 3SETA 4ZE8A 3IX1A 5KZTA 1SYHA 1MM7A 2DWAA 3MZ9A 1FBFA 2O51A 1ZU0A 2H4IA 3FJGA 4R9GA 1NV1A 5DEXA 3K1MA 2AL4A 1P99A 4XKPA 3RY3A 4P56A 1M5EA 1SQYA 1EH3A 3OEKA 1MQGA 1A8EA 2B4MA 4H8JA 3TTRA 2DS9A 3SKPA 2QMXA 4MFIA 4N07A 2V3UA 2WYPA 4NN3A 2Y5LA 4JBZA 3UIFA 3V89B 4BDOA 4F2QA 5ITOA 1Y3PA 4NF6B 1XS5A 3KJ7A 3CSGA 1BTJA 2OCUA 4F3GA 4MAGA 2QS4A 4OXVA 1K9ZA 1LAFE 1I69A 4G68B 4G8MA 5H8FA 2LAOA 4F22A 5AA2D 3LSLA 5J16A 4H6DA 1PDAA 5TP9B 3G3HA 5JTYA 5HPQA 3TODA 4XFEA 4MCOA 1POY1 4YKKA 5IAIA 3O6GA 4NAPA 5F7VA 4GWZA 2E1SA 4RXLA 2H98A 2OWTA 3W9WA 5IZ3B 4NE4A 2OBGA 3ONMA 1NH7A 4MLVA 1LCTA 4PFIA 3TCFA 1B1HA 1OQHA 3HHGA 2DXRA 3IOUA 1JEVA 4TQUQ 3K2DA 2MKZA 2O1LA 1FSAA 4UACA 4G61A 5L9MA 3LSWA 1IMAA 4X9TA 5I2NB 3DP6A 1H76A 5H8SA 5H8HB 1G0IA 3EF7A 4EF1A 3H06B 4H1XA 4PGNA 3OO9A 5EHMA 4GBWA 2DWHA 3H6VA 3FUZA 2VT5A 5B70A 1MXUA 4F39A 1LSTA 4BLAA 3C32A 1EZ9A 1UIUA 3R6UA 4F1UA 4FJPA 1MQDA 4ZEFA 1PBQA 3PUZE 4JDFA 1UTBA 1B52A 4QSCA 1LAHE 2F7BA 2ONSA 2F7CA 4PFYA 4U2RA 2REGA 2VP1A 3L6GA 3PV0E 3UA8A 4G8NA 3BFUA 1ZIUA 4N8GA 2PBWA 1IIWA 3PPNA 1VFEA 2Y7KA 1NV0A 3U92A 5AA1A 5I58B 4OESA 3EPEA 3F11A 1QUIA 1MH4A 2V93A 4JSOA 3U1OA 1FQBA 2AL5A 1SD3A 5CBRA 1TFDA 1MRPA 4N17A 1SDXA 4F1VA 4ZEIA 4YAHX 1O64A 2Y84A 3AXFA 2DYXA 3IO6A 1QUKA 4GQOA 3KGCA 4EDPA 3KBZA 3VVDA 4NEDA 3MJNA 1MY2A 4TOZA 4U4SA 4ZECA 4GX6A 2ESNA 4KYEA 4AS5A 2V3TA 3C36A 3TFLA 3T9HB 5DVJA 1RYXA 1B40A 4NGUA 1IMDA 1IXIA 2H9BA 3H4ZA 2O69A 3CR9A 4JWYA 1FTMA 5CBSA 1FQDA 4X04A 2NXOA 1B7HA 3OSRA 5CM6A 4EF2A 3M3LA 3VE1B 2O68A 2HZLA 4NWDA 1LFHA 3K02A 1H45A 3FBPA 3SEWA 1JETA 1N7WA 4IB2A 4NG7A 1MXVA 2QSXA 1PBPA 2I3WA 2CEYA 1YPNA 2P2AA 4E0WA 1OVBA 4GWXA 4Z7EA 4QHQA 4I1DA 2VPOA 1NL5A 3G3IA 4F18A 4XKQA 4F29A 4OFJA 4OVTA 2HAVA 1XVYA 5LDZA 1LGBC 2QMWA 3O28A 1DBZA 4OWDA 2B65A 3S9MC 2A5TB 2HCAA 1GR2A 2QVRA 3U65A 1N3WA 3OMBA 3EHSA 1D4NA 4F3SA 4GX4A 1SVXB 4DCYA 5J1DA 3KEIA 3MWBA 3QYTA 4M1VA 1MQIA 4R74A 4RA1A 3TTNA 3C34A 1KA0A 4HS7A 4QSDA 1FPKA 2I58A 3E4RA 2UVIA 3SESA 2CZLA 4GWUA 3TZAA 4LA9A 4AQ4A 1FTOA 3IK6B 2ABHA 4Q0CA 4N91A 1P1NA 3TTMA 4IO7A 4HE2A 1R9QA 3RPLB 2FHYA 2F6PA 2PT2A 1B2HA 2X7QA 3K1PA 2Q88A 3C33A 1JVYA 3FIRA 3I3VA 4N6KA 2WYKA 4BDRA 3PUWE 5FHOA 3V8XB 2O7UA 1MG1A 4KR5A 3IJXB 4FECA 1XVXA 3RTFB 1YZ0A 2KQZA 1DOTA 2XXIA 3ROJA 1BKAA 2ZYKA 1UIVA 3CVGA 1IQ7A 2PMSA 1MY3A 4GF8A 4F31B 4IR8A 4PAFA 3TQLA 2F34A 3SEXA 3MZ1A 1URGA 4QFNA 4MNIA 1WODA 3C9HA 1JW1A 4IGRA 1NFTA 1HSJA 1Y1MA 3T9VA 2XXWA 1EYIA 5IM2A 4LN5A 1XHYA 3O66A 4R9FA 1B4HA 1GVCA 3M3KA 1URDA 1B58A 2I4CA 1NH8A 2GRVA 1SI1A 3QAXA 3E79A 2VOZA 5FHMA 4EXLA 4OA4A 3LSFB 1N7XA 3TCHA 3CIJA 1KZ8A 1Y4CA 5CMBA 3SERA 3T66A 4GWWA 4OANA 3TKDA 4PFRA 3BKIB 1DTZA 4YICA 4DE8A 1ELJA 2Q9TA 1AMFA 4DDDA 3FASA 2R6GE 1A7LA 4G4PA 3D4GA 5K2XA 1MXXA 4KFQA 1MM6A 3LR1A 2XWIA 2P0SA 3E13X 4NQ8A 1OLAA 1VFDA 2I6EA
chains in the Genus database with same CATH topology
3PMXA 4K3FA 3PGFA 1B3GA 1ZMGA 1FQFA 4EQ7A 3ILTB 3LC8A 1UTHA 3D4CA 1A99A 1WDNA 3UORA 3IB2A 1QVSA 3OOAA 3TUSA 3G3KA 5KDTA 1M5CA 3M8UA 3UGWA 2OWSA 5ITPA 4U22A 3UK4A 3C31A 5TPAB 5DVIA 2PT1A 1QKAA 4OQOA 3K6XA 3T9UA 2DXYA 4JWXA 3MPKA 3L6HA 4O3BA 3IO4A 3HSTA 3T96B 2W7YA 2O84X 2F8DA 3TELA 4RK9A 2QS2A 1MQJA 2XXYA 3RGYA 3MP6A 4YKIA 3M3FA 4FIMA 4GIZA 4U1ZA 5CMCA 4BDMA 3CRBA 5JK4A 4YMBA 5HBCA 3K0VA 3MBPA 1BP5A 1MXWA 2RC7A 4ISUA 1A55A 2QRYA 1I6BA 1P1UA 2H25A 4JB7A 1PB8A 3EN3A 5CI5A 3PPPA 2F6GA 1NNFA 3RTWB 1ZTYA 5I56A 1FCKA 4R2BA 1POTA 1D9VA 3P7IA 4NF4B 3TQWA 2V3QA 4QFPA 5ISUA 1A40A 1OIBA 4WEPA 3KSXA 2QS3A 1Y20A 3BBRA 1XC1A 4I8CA 1CB6A 3SDFA 3MAMA 2GHAA 3EHUA 2OZZA 3O29A 3VXBA 2RCAA 2QJEA 1S9TA 2OLBA 4ELPA 1FTLA 2GFEA 3CG1A 4R75A 4O3CA 3W15C 1ATGA 1M5FA 1UQWA 5ICQA 3S9NC 2D3IA 4QF9A 2VHAA 4OFLA 3VXCA 4FEDA 4QFLA 3PMVA 5H8HA 3K6UA 2HEUA 1IXGA 4GL8A 1R1NA 2ZNTA 1SYIA 3IB1A 3H3GA 4KI0E 3H7MA 3H6TA 2RKMA 4FE8A 1OVTA 4C1UA 4O3AA 1MY0A 1DMBA 4H0WA 1IUDA 4TLMB 2DWIA 1ANFA 1ZLQA 3EQ1A 4GL0A 1MXYA 2E0SA 2XX7A 4KYDA 1US4A 5EHSA 4ZEBA 3U72A 4EQBA 4PETA 4RPOA 3DELB 2O1MA 2XX8A 3EHTA 2VD2A 1B32A 4HW8A 2XXXA 3FJ7A 2DOJA 5I58A 4LZ7A 4ZDMA 1LFGA 3PUYE 1QJMA 4GRKA 4YZZA 1R6ZA 2YPNA 1OMPA 3SEYA 3LSXA 4DCXA 3FVOA 4RPNA 2Q2AA 2ALUA 4C0RA 5A5XB 5H8QA 3QIMA 1URSA 3B6QA 4EQ9A 3SEVA 2XXRA 2RINA 3O6IA 4G8HA 2DE3A 1CE2A 3RN8A 1GTKA 3MVZA 3HV1A 3G7WA 4IY5A 4ELRA 3O9PA 4QFOA 5L9SA 1USYE 2XX9A 5DTBA 3KSJA 1PC3A 4WEDA 4OHNA 3SEUA 3PD9A 4ZZAA 3S4UA 3KN7A 4RK2A 4DLDA 1MDQA 2XD2A 5M2VA 3TMGA 3Q29A 4FAJA 3IOWA 1I6QA 5BWJA 5AA4A 1TWYA 5F1QA 3IL1B 3FV2A 4XTCQ 3T93B 1JVXA 1NNKA 3FVNA 3QUJA 5DT6A 5I59B 5IKBA 1AOVA 2Y7RA 1JQFA 3O97A 5AA2B 3VVFA 3JYRA 4NF8B 3ODBA 3OO6A 4ZZEA 3G3FA 1B05A 1Q1KA 1HSLA 3MW0A 1MPBA 3FZVA 1PB9A 4MLQA 4LONB 4G2ZA 3T9XB 5CMKA 4GVOA 5FHNA 2NVUB 3KJTA 2Q89A 1SW5A 3OO8A 3THIA 3ZKKA 4H65A 3UN6A 4ZEKA 3S9EA 2R71A 1QW0A 2ZNUA 3KG2A 4F19A 2F5XA 1SW2A 2KLFA 2B3BA 4RYAA 4IO3A 4H5GA 3PUXE 2UXAA 3KBRA 3U93A 2O6AA 1Y1ZA 2OK2A 1FW0A 2QL3A 4R6KA 3RPWA 4F3BA 1O63A 3A3UA 1MY4A 5KCJB 5DYHA 3FGSA 1LB9A 1QUJA 4QRZA 2HFBA 2Q2CA 1XOCA 1OQGA 1Y4TA 1DSNA 4OTEA 3RT8A 1A8FA 4I9DA 1MPDA 2AIXA 1SW4A 2XHDA 1XT8A 3R26A 1N84A 4LVQA 3PUVE 4PP0A 4WKMA 1LAXA 3TCGA 3TDJA 4NF5B 3HCQA 4DIGA 3ZSFA 4H67A 3K4UA 2XXTA 1B5IA 4LQ2A 3LUYA 1Z7ME 3CFZA 5L8DA 5I84A 4GFRA 5CMMA 1YCJA 2Y7WA 1LAGE 5I2KA 2REJA 3MPLA 4R6YA 3A09A 3C35A 5H8NB 3CFLA 2I0CA 3IORA 4MF3A 1I6AA 4MH5A 2YJPA 1S50A 2IA4A 3K6VA 3MVYA 1LFIA 3B6TA 2ZMBA 4KYSA 2YLNA 3RLFE 4YB5A 5TPAA 1N0TA 3U8QA 3R7XA 1M5DA 1HSEA 3K00A 4IY6A 3DP4A 1ZBMA 3RNNA 2V25A 5I57B 3FD3A 2UYEA 3KN8A 4E0XA 3FVGA 4F3PA 3KZGA 3MC2A 1Y3NA 4OVJA 2ONKE 1IXCA 4XKNA 4X48A 3N6TA 3KN3A 4NTLA 2H99A 5AA3A 2DVZA 4PE5B 1T0KA 2DE4A 2PYYA 4AB6A 5BUUA 4R2FA 4YB6A 2NWJA 1MXZA 3N6UA 3O2AA 1BIYA 2DVCA 3FV1A 2G93A 4U21A 5EYFA 2Z8FA 4PFWA 2V84A 5FTIA 3S2VA 3Q28A 1B46A 3RUMA 1IZ1A 4UA8A 2I49A 5CRYA 4YB7A 4ND9A 4EUOA 3CSBA 4H8IA 1FQAA 3VFJA 1H44A 3MZBA 1JEUA 3S9LC 3K01A 3FXUA 4OEUA 1NNTA 1MS7A 1MQHA 3GZGA 2XXUA 2FYIA 4NF4A 1B3FA 4GXAA 4YU0A 4JWOA 1B3HA 4NF6A 4ESXA 5JEIA 3RQTA 3E3KA 4R73A 2F35A 4WXJA 4ECFA 2I48A 2D5WA 4G68A 1P1WA 3N5LA 5TP9A 2Z8EA 3LBSA 4POXA 4FATA 4LATA 2X26A 1VSOA 1B7UA 3HPIA 4DZ1A 1RKMA 3OELA 2QPQA 3FXQA 4LP2B 1IXHA 3IOTA 4H5FA 4GD5A 1SW1A 3BFTA 3TTKA 5DEXB 3PU5A 4HTGA 3K6WA 4DXCA 2UVJA 4THIA 4IO6A 5I56B 3VVEA 3RT6B 3QSLA 3OXNA 1B0HA 3FXRA 5I2NA 4NWCA 4YKJA 3K1NA 1YAEA 2I4BA 2XD3A 3KFMA 2G29A 3G3JA 1MY1A 1QULA 3B6WA 5ICTA 2RC8A 1TXFA 5H8FB 3Q27A 1B51A 4GXSB 2ANJA 2NOOA 1H43A 1QKBA 5JTYB 4JXIA 4X1BA 4KQPA 4G68C 4OETA 2Y7PA 3E9XA 1TFAA 2PVUA 2P1SA 1H3DA 3GBAA 4KCDA 3PPQA 1R9LA 2D21A 1DPPA 5ELVA 4Q5TA 3MUQA 1PEBA 3GXAA 3Q25A 3ECRA 2UVHA 4PQJA 2F36A 1Y3QA 1OLCA 5A5XA 4R6HA 4BDQA 3TAJA 3DLNA 2I3VA 1BLFA 4N6PA 3TEPA 2M8CA 3H6WA 4HCYA 2UYFA 3PPRA 4YKPA 4F1YA 1IITA 3OENA 3MP1A 3QK6A 4YMAA 4EXKA 4ZS9A 2F7AA 1RYOA 2ZYOA 3DP8A 4OMBA 4M4GA 2FA7A 4U23A 1UTBB 4IO2A 2CMOA 2DWJA 4P11A 4KCCA 4R72A 1M5BA 1NMUA 3G3GA 1ZKBA 4TLLB 2HQ0A 1FQEA 1L5TA 5I59A 3FATA 3IJOB 3VLUA 1S7YA 4OERA 3USDA 5AA2A 2IEEA 3MVXA 4NF8A 5H8QB 4F2OA 4I62A 1B1XA 3C4MA 2HXWA 1DTGA 4PFTA 4DXBA 1B4ZA 4RNSA 1EU8A 2VGQA 2F78A 2RCBA 2A5TA 4KHZE 2I0BA 3MP8A 1GGGA 2R9JA 4ELOA 3IR1A 3ZKLA 4BDNA 2ZYMA 3VLWA 2OJTA 1B7ZA 3CI8A 4LZ5A 3TPAA 4KD5A 1TT1A 3MQ9A 1MH3A 1JNFA 3IB0A 3N26A 3KOTA 3PD8A 2Q8JA 1O7TA 1SI0A 4RY1A 1US5A 1Z7NE 1N3XA 4X1DA 4OEVA 2UVGA 1MPCA 2XXVA 4OYVA 2DSFA 1ZJLA 5AA4B 1B5HA 1LBBA 3HHFA 2XXPA 4C1TA 5K2YA 4QSEA 4FEBA 5KCJA 3Q26A 3QUFA 5HM4B 3OD7A 4GLIA 2AYSA 2VD3A 4GOTA 3FJMA 1VR5A 1MDP1 1D3KA 4IGTA 4IO5A 2ZNSA 4BDLA 4FORA 4JSDA 3H03A 1YTVA 4U4XA 4ZE9A 3KOSA 1SBPA 5L9OA 1FTJA 2QS1A 2ZXTA 3PPOA 3U94A 3TTLA 3H6UA 4XIGQ 1J1NA 4L17A 1LLSA 4OZ9A 2RF1A 4NMYA 1JW5A 4XKRA 4NF5A 4RJZA 4POWA 1P1QA 3W9VA 4ESWA 4LUBA 4Q8RA 2ZYNA 5TU0A 4U1OA 5DVFA 5CC2A 3WAFA 4IO4A 3GBBA 2A5SA 3V5AA 4P0IA 1VE4A 4QFKA 4Z0IA 3FVKA 2XXQA 4KPTA 3VLVA 2O7IA 3MVWA 3IAZA 5H8NA 1D9YA 1A54A 4AB5A 5B7DA 3OSQA 3WAEA 2Z8DA 3OO7A 3ZS6A 1P1OA 3HO7A 2Z23A 2RC9A 3CFXA 1II5A 1N04A 4P0GA 3IOVA 1LBCA 3TYHA 1DPEA 3VDFA 1B5JA 2B3FA 2ONRA 4MBPA 2PX1A 1IEJA 1FQCA 5I57A 1FTKA 2THIA 2X7PA 1USYH 2NUVA 4OENA 1KWHA 1B0LA 5I2KB 3PMWA 3ILUB 3O6HA 2HZKA 1Q35A 3OEMA 2Y7IA 4ELQA 3DM0A 2DE2A 2DQVA 2HAUA 1EZPA 1JW4A 3JZJA 2F97A 1PB7A 1AH5A 4LQ5A 1N76A 4GWOA 1F9BA 4Q30B 1B9JA 3I6VA 4ONYA 2GH9A 1GV8A 1WVJA 4G77A 2BJJX 4OFOA 3B7DA 3A3CA 2Z22A 1NNPA 1EZOA 1AL3A 1B3EA 2WKYA 3VV5A 1UTHB 2H5YA 4DXUA 3I5OA 5LOMA 3UP9A 2DP8A 3V83A 3HN0A 1B6HA 3T22A 5KDTB 3JV9A 2GHBA 2FNCA 3CG3A 3QXMA 3N94A 4XXUA 1LCFA 1LB8A 3GLBA 1AIVA 1NKXA 1Y9UA 4HCWA 5FTHA 4PFUA 1B3LA 2XXHA 4LZ8A 5AE4A 4N13A 4ZEDA 3SETA 4ZE8A 3IX1A 5KZTA 1SYHA 1MM7A 2DWAA 3MZ9A 2O51A 1ZU0A 2H4IA 3FJGA 4R9GA 5DEXA 3K1MA 2AL4A 1P99A 4XKPA 3RY3A 1M5EA 1SQYA 1EH3A 3OEKA 1MQGA 1A8EA 4H8JA 3TTRA 2DS9A 3SKPA 2QMXA 4MFIA 4N07A 2V3UA 4JBZA 3UIFA 3V89B 4BDOA 4F2QA 5ITOA 1Y3PA 4NF6B 1XS5A 3KJ7A 3CSGA 1BTJA 2OCUA 4F3GA 2QS4A 4OXVA 1LAFE 1I69A 4G68B 4G8MA 5H8FA 2LAOA 4F22A 5AA2D 3LSLA 4H6DA 1PDAA 5TP9B 3G3HA 5JTYA 5HPQA 3TODA 4YKKA 1POY1 5IAIA 3O6GA 5F7VA 2E1SA 4RXLA 2H98A 2OWTA 3W9WA 4NE4A 2OBGA 3ONMA 1NH7A 4MLVA 1LCTA 3TCFA 1B1HA 1OQHA 3HHGA 2DXRA 3IOUA 1JEVA 4TQUQ 3K2DA 2O1LA 4UACA 5L9MA 3LSWA 4X9TA 5I2NB 3DP6A 1H76A 5H8SA 5H8HB 3EF7A 4EF1A 3H06B 4H1XA 3OO9A 5EHMA 2DWHA 3H6VA 3FUZA 5B70A 1MXUA 4F39A 1LSTA 4BLAA 3C32A 1EZ9A 1UIUA 3R6UA 4F1UA 4FJPA 1MQDA 4ZEFA 1PBQA 3PUZE 4JDFA 1UTBA 1B52A 4QSCA 1LAHE 2F7BA 2ONSA 2F7CA 4PFYA 4U2RA 2REGA 2VP1A 3L6GA 3PV0E 3UA8A 4G8NA 3BFUA 1ZIUA 2PBWA 1IIWA 3PPNA 1VFEA 2Y7KA 3U92A 5AA1A 5I58B 4OESA 3EPEA 3F11A 1QUIA 1MH4A 2V93A 4JSOA 3U1OA 1FQBA 2AL5A 1SD3A 5CBRA 1TFDA 1MRPA 1SDXA 4F1VA 4ZEIA 4YAHX 1O64A 2Y84A 3AXFA 2DYXA 3IO6A 1QUKA 4GQOA 3KGCA 4EDPA 3VVDA 4NEDA 3MJNA 1MY2A 4TOZA 4U4SA 4ZECA 2ESNA 4KYEA 2V3TA 3C36A 3TFLA 3T9HB 5DVJA 1RYXA 1B40A 1IXIA 2H9BA 3H4ZA 2O69A 3CR9A 4JWYA 1FTMA 5CBSA 1FQDA 2NXOA 1B7HA 3OSRA 5CM6A 4EF2A 3M3LA 3VE1B 2O68A 2HZLA 4NWDA 1LFHA 3K02A 1H45A 3SEWA 1JETA 1N7WA 4IB2A 1MXVA 2QSXA 1PBPA 2I3WA 1YPNA 2P2AA 4E0WA 1OVBA 4Z7EA 4QHQA 4I1DA 1NL5A 3G3IA 4F18A 4XKQA 4F29A 4OFJA 2HAVA 1XVYA 1LGBC 2QMWA 3O28A 4OWDA 2B65A 3S9MC 2A5TB 2HCAA 1GR2A 1N3WA 3OMBA 3EHSA 1D4NA 4F3SA 1SVXB 4DCYA 5J1DA 3KEIA 3MWBA 3QYTA 4M1VA 1MQIA 4R74A 4RA1A 3TTNA 3C34A 4HS7A 4QSDA 2I58A 3E4RA 2UVIA 3SESA 2CZLA 3TZAA 4LA9A 4AQ4A 1FTOA 3IK6B 2ABHA 4Q0CA 1P1NA 3TTMA 4IO7A 1R9QA 2F6PA 2PT2A 1B2HA 2X7QA 3K1PA 2Q88A 3C33A 1JVYA 3FIRA 3I3VA 4BDRA 3PUWE 3V8XB 5FHOA 2O7UA 1MG1A 4KR5A 3IJXB 4FECA 1XVXA 3RTFB 1DOTA 2XXIA 1BKAA 2ZYKA 1UIVA 3CVGA 1IQ7A 2PMSA 1MY3A 4GF8A 4F31B 3TQLA 2F34A 3SEXA 3MZ1A 1URGA 4QFNA 1WODA 3C9HA 1JW1A 4IGRA 1NFTA 1HSJA 1Y1MA 3T9VA 2XXWA 1XHYA 3O66A 4R9FA 1B4HA 1GVCA 3M3KA 1URDA 1B58A 2I4CA 1NH8A 2GRVA 1SI1A 3QAXA 2VOZA 5FHMA 4EXLA 3LSFB 1N7XA 3TCHA 3CIJA 1Y4CA 5CMBA 3SERA 3T66A 3TKDA 3BKIB 1DTZA 4YICA 4DE8A 1ELJA 2Q9TA 1AMFA 4DDDA 3FASA 2R6GE 1A7LA 4G4PA 3D4GA 5K2XA 1MXXA 4KFQA 1MM6A 3LR1A 2P0SA 3E13X 1OLAA 1VFDA 2I6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMX A;  4K3F A;  3PGF A;  1B3G A;  1ZMG A;  1FQF A;  4EQ7 A;  3ILT B;  3LC8 A;  1UTH A;  3D4C A;  1A99 A;  1WDN A;  3UOR A;  3IB2 A;  1QVS A;  3OOA A;  3TUS A;  3G3K A;  5KDT A;  1M5C A;  3M8U A;  3UGW A;  2OWS A;  5ITP A;  4U22 A;  3UK4 A;  3C31 A;  5TPA B;  5DVI A;  2PT1 A;  1QKA A;  4OQO A;  3K6X A;  3T9U A;  2DXY A;  4JWX A;  3MPK A;  3L6H A;  4O3B A;  3IO4 A;  3HST A;  3T96 B;  2W7Y A;  2O84 X;  2F8D A;  3TEL A;  4RK9 A;  2QS2 A;  1MQJ A;  2XXY A;  3RGY A;  3MP6 A;  4YKI A;  3M3F A;  4FIM A;  4GIZ A;  4U1Z A;  5CMC A;  4BDM A;  3CRB A;  5JK4 A;  4YMB A;  5HBC A;  3K0V A;  3MBP A;  1BP5 A;  1MXW A;  2RC7 A;  4ISU A;  1A55 A;  2QRY A;  1I6B A;  1P1U A;  2H25 A;  4JB7 A;  1PB8 A;  3EN3 A;  5CI5 A;  3PPP A;  2F6G A;  1NNF A;  3RTW B;  1ZTY A;  5I56 A;  1FCK A;  4R2B A;  1POT A;  1D9V A;  3P7I A;  4NF4 B;  3TQW A;  2V3Q A;  4QFP A;  5ISU A;  1A40 A;  1OIB A;  4WEP A;  3KSX A;  2QS3 A;  1Y20 A;  3BBR A;  1XC1 A;  4I8C A;  1CB6 A;  3SDF A;  3MAM A;  2GHA A;  3EHU A;  2OZZ A;  3O29 A;  3VXB A;  2RCA A;  2QJE A;  1S9T A;  2OLB A;  4ELP A;  1FTL A;  2GFE A;  3CG1 A;  4R75 A;  4O3C A;  3W15 C;  1ATG A;  1M5F A;  1UQW A;  5ICQ A;  3S9N C;  2D3I A;  4QF9 A;  2VHA A;  4OFL A;  3VXC A;  4FED A;  4QFL A;  3PMV A;  5H8H A;  3K6U A;  2HEU A;  1IXG A;  4GL8 A;  1R1N A;  2ZNT A;  1SYI A;  3IB1 A;  3H3G A;  4KI0 E;  3H7M A;  3H6T A;  2RKM A;  4FE8 A;  1OVT A;  4C1U A;  4O3A A;  1MY0 A;  1DMB A;  4H0W A;  1IUD A;  4TLM B;  2DWI A;  1ANF A;  1ZLQ A;  3EQ1 A;  4GL0 A;  1MXY A;  2E0S A;  2XX7 A;  4KYD A;  1US4 A;  5EHS A;  4ZEB A;  3U72 A;  4EQB A;  4PET A;  4RPO A;  3DEL B;  2O1M A;  2XX8 A;  3EHT A;  2VD2 A;  1B32 A;  4HW8 A;  2XXX A;  3FJ7 A;  2DOJ A;  5I58 A;  4LZ7 A;  4ZDM A;  1LFG A;  3PUY E;  1QJM A;  4GRK A;  4YZZ A;  1R6Z A;  2YPN A;  1OMP A;  3SEY A;  3LSX A;  4DCX A;  3FVO A;  4RPN A;  2Q2A A;  2ALU A;  4C0R A;  5A5X B;  5H8Q A;  3QIM A;  1URS A;  3B6Q A;  4EQ9 A;  3SEV A;  2XXR A;  2RIN A;  3O6I A;  4G8H A;  2DE3 A;  1CE2 A;  3RN8 A;  1GTK A;  3MVZ A;  3HV1 A;  3G7W A;  4IY5 A;  4ELR A;  3O9P A;  4QFO A;  5L9S A;  1USY E;  2XX9 A;  5DTB A;  3KSJ A;  1PC3 A;  4WED A;  4OHN A;  3SEU A;  3PD9 A;  4ZZA A;  3S4U A;  3KN7 A;  4RK2 A;  4DLD A;  1MDQ A;  2XD2 A;  5M2V A;  3TMG A;  3Q29 A;  4FAJ A;  3IOW A;  1I6Q A;  5BWJ A;  5AA4 A;  1TWY A;  5F1Q A;  3IL1 B;  3FV2 A;  4XTC Q;  3T93 B;  1JVX A;  1NNK A;  3FVN A;  3QUJ A;  5DT6 A;  5I59 B;  5IKB A;  1AOV A;  2Y7R A;  1JQF A;  3O97 A;  5AA2 B;  3VVF A;  3JYR A;  4NF8 B;  3ODB A;  3OO6 A;  4ZZE A;  3G3F A;  1B05 A;  1Q1K A;  1HSL A;  3MW0 A;  1MPB A;  3FZV A;  1PB9 A;  4MLQ A;  4LON B;  4G2Z A;  3T9X B;  5CMK A;  4GVO A;  5FHN A;  2NVU B;  3KJT A;  2Q89 A;  1SW5 A;  3OO8 A;  3THI A;  3ZKK A;  4H65 A;  3UN6 A;  4ZEK A;  3S9E A;  2R71 A;  1QW0 A;  2ZNU A;  3KG2 A;  4F19 A;  2F5X A;  1SW2 A;  2KLF A;  2B3B A;  4RYA A;  4IO3 A;  4H5G A;  3PUX E;  2UXA A;  3KBR A;  3U93 A;  2O6A A;  1Y1Z A;  2OK2 A;  1FW0 A;  2QL3 A;  4R6K A;  3RPW A;  4F3B A;  1O63 A;  3A3U A;  1MY4 A;  5KCJ B;  5DYH A;  3FGS A;  1LB9 A;  1QUJ A;  4QRZ A;  2HFB A;  2Q2C A;  1XOC A;  1OQG A;  1Y4T A;  1DSN A;  4OTE A;  3RT8 A;  1A8F A;  4I9D A;  1MPD A;  2AIX A;  1SW4 A;  2XHD A;  1XT8 A;  3R26 A;  1N84 A;  4LVQ A;  3PUV E;  4PP0 A;  4WKM A;  1LAX A;  3TCG A;  3TDJ A;  4NF5 B;  3HCQ A;  4DIG A;  3ZSF A;  4H67 A;  3K4U A;  2XXT A;  1B5I A;  4LQ2 A;  3LUY A;  1Z7M E;  3CFZ A;  5L8D A;  5I84 A;  4GFR A;  5CMM A;  1YCJ A;  2Y7W A;  1LAG E;  5I2K A;  2REJ A;  3MPL A;  4R6Y A;  3A09 A;  3C35 A;  5H8N B;  3CFL A;  2I0C A;  3IOR A;  4MF3 A;  1I6A A;  4MH5 A;  2YJP A;  1S50 A;  2IA4 A;  3K6V A;  3MVY A;  1LFI A;  3B6T A;  2ZMB A;  4KYS A;  2YLN A;  3RLF E;  4YB5 A;  5TPA A;  1N0T A;  3U8Q A;  3R7X A;  1M5D A;  1HSE A;  3K00 A;  4IY6 A;  3DP4 A;  1ZBM A;  3RNN A;  2V25 A;  5I57 B;  3FD3 A;  2UYE A;  3KN8 A;  4E0X A;  3FVG A;  4F3P A;  3KZG A;  3MC2 A;  1Y3N A;  4OVJ A;  2ONK E;  1IXC A;  4XKN A;  4X48 A;  3N6T A;  3KN3 A;  4NTL A;  2H99 A;  5AA3 A;  2DVZ A;  4PE5 B;  1T0K A;  2DE4 A;  2PYY A;  4AB6 A;  5BUU A;  4R2F A;  4YB6 A;  2NWJ A;  1MXZ A;  3N6U A;  3O2A A;  1BIY A;  2DVC A;  3FV1 A;  2G93 A;  4U21 A;  5EYF A;  2Z8F A;  4PFW A;  2V84 A;  5FTI A;  3S2V A;  3Q28 A;  1B46 A;  3RUM A;  1IZ1 A;  4UA8 A;  2I49 A;  5CRY A;  4YB7 A;  4ND9 A;  4EUO A;  3CSB A;  4H8I A;  1FQA A;  3VFJ A;  1H44 A;  3MZB A;  1JEU A;  3S9L C;  3K01 A;  3FXU A;  4OEU A;  1NNT A;  1MS7 A;  1MQH A;  3GZG A;  2XXU A;  2FYI A;  4NF4 A;  1B3F A;  4GXA A;  4YU0 A;  4JWO A;  1B3H A;  4NF6 A;  4ESX A;  5JEI A;  3RQT A;  3E3K A;  4R73 A;  2F35 A;  4WXJ A;  4ECF A;  2I48 A;  2D5W A;  4G68 A;  1P1W A;  3N5L A;  5TP9 A;  2Z8E A;  3LBS A;  4POX A;  4FAT A;  4LAT A;  2X26 A;  1VSO A;  1B7U A;  3HPI A;  4DZ1 A;  1RKM A;  3OEL A;  2QPQ A;  3FXQ A;  4LP2 B;  1IXH A;  3IOT A;  4H5F A;  4GD5 A;  1SW1 A;  3BFT A;  3TTK A;  5DEX B;  3PU5 A;  4HTG A;  3K6W A;  4DXC A;  2UVJ A;  4THI A;  4IO6 A;  5I56 B;  3VVE A;  3RT6 B;  3QSL A;  3OXN A;  1B0H A;  3FXR A;  5I2N A;  4NWC A;  4YKJ A;  3K1N A;  1YAE A;  2I4B A;  2XD3 A;  3KFM A;  2G29 A;  3G3J A;  1MY1 A;  1QUL A;  3B6W A;  5ICT A;  2RC8 A;  1TXF A;  5H8F B;  3Q27 A;  1B51 A;  4GXS B;  2ANJ A;  2NOO A;  1H43 A;  1QKB A;  5JTY B;  4JXI A;  4X1B A;  4KQP A;  4G68 C;  4OET A;  2Y7P A;  3E9X A;  1TFA A;  2PVU A;  2P1S A;  1H3D A;  3GBA A;  4KCD A;  3PPQ A;  1R9L A;  2D21 A;  1DPP A;  5ELV A;  4Q5T A;  3MUQ A;  1PEB A;  3GXA A;  3Q25 A;  3ECR A;  2UVH A;  4PQJ A;  2F36 A;  1Y3Q A;  1OLC A;  5A5X A;  4R6H A;  4BDQ A;  3TAJ A;  3DLN A;  2I3V A;  1BLF A;  4N6P A;  3TEP A;  2M8C A;  3H6W A;  4HCY A;  2UYF A;  3PPR A;  4YKP A;  4F1Y A;  1IIT A;  3OEN A;  3MP1 A;  3QK6 A;  4YMA A;  4EXK A;  4ZS9 A;  2F7A A;  1RYO A;  2ZYO A;  3DP8 A;  4OMB A;  4M4G A;  2FA7 A;  4U23 A;  1UTB B;  4IO2 A;  2CMO A;  2DWJ A;  4P11 A;  4KCC A;  4R72 A;  1M5B A;  1NMU A;  3G3G A;  1ZKB A;  4TLL B;  2HQ0 A;  1FQE A;  1L5T A;  5I59 A;  3FAT A;  3IJO B;  3VLU A;  1S7Y A;  4OER A;  3USD A;  5AA2 A;  2IEE A;  3MVX A;  4NF8 A;  5H8Q B;  4F2O A;  4I62 A;  1B1X A;  3C4M A;  2HXW A;  1DTG A;  4PFT A;  4DXB A;  1B4Z A;  4RNS A;  1EU8 A;  2VGQ A;  2F78 A;  2RCB A;  2A5T A;  4KHZ E;  2I0B A;  3MP8 A;  1GGG A;  2R9J A;  4ELO A;  3IR1 A;  3ZKL A;  4BDN A;  2ZYM A;  3VLW A;  2OJT A;  1B7Z A;  3CI8 A;  4LZ5 A;  3TPA A;  4KD5 A;  1TT1 A;  3MQ9 A;  1MH3 A;  1JNF A;  3IB0 A;  3N26 A;  3KOT A;  3PD8 A;  2Q8J A;  1O7T A;  1SI0 A;  4RY1 A;  1US5 A;  1Z7N E;  1N3X A;  4X1D A;  4OEV A;  2UVG A;  1MPC A;  2XXV A;  4OYV A;  2DSF A;  1ZJL A;  5AA4 B;  1B5H A;  1LBB A;  3HHF A;  2XXP A;  4C1T A;  5K2Y A;  4QSE A;  4FEB A;  5KCJ A;  3Q26 A;  3QUF A;  5HM4 B;  3OD7 A;  4GLI A;  2AYS A;  2VD3 A;  4GOT A;  3FJM A;  1VR5 A;  1MDP 1;  1D3K A;  4IGT A;  4IO5 A;  2ZNS A;  4BDL A;  4FOR A;  4JSD A;  3H03 A;  1YTV A;  4U4X A;  4ZE9 A;  3KOS A;  1SBP A;  5L9O A;  1FTJ A;  2QS1 A;  2ZXT A;  3PPO A;  3U94 A;  3TTL A;  3H6U A;  4XIG Q;  1J1N A;  4L17 A;  1LLS A;  4OZ9 A;  2RF1 A;  4NMY A;  1JW5 A;  4XKR A;  4NF5 A;  4RJZ A;  4POW A;  1P1Q A;  3W9V A;  4ESW A;  4LUB A;  4Q8R A;  2ZYN A;  5TU0 A;  4U1O A;  5DVF A;  5CC2 A;  3WAF A;  4IO4 A;  3GBB A;  2A5S A;  3V5A A;  4P0I A;  1VE4 A;  4QFK A;  4Z0I A;  3FVK A;  2XXQ A;  4KPT A;  3VLV A;  2O7I A;  3MVW A;  3IAZ A;  5H8N A;  1D9Y A;  1A54 A;  4AB5 A;  5B7D A;  3OSQ A;  3WAE A;  2Z8D A;  3OO7 A;  3ZS6 A;  1P1O A;  3HO7 A;  2Z23 A;  2RC9 A;  3CFX A;  1II5 A;  1N04 A;  4P0G A;  3IOV A;  1LBC A;  3TYH A;  1DPE A;  3VDF A;  1B5J A;  2B3F A;  2ONR A;  4MBP A;  2PX1 A;  1IEJ A;  1FQC A;  5I57 A;  1FTK A;  2THI A;  2X7P A;  1USY H;  2NUV A;  4OEN A;  1KWH A;  1B0L A;  5I2K B;  3PMW A;  3ILU B;  3O6H A;  2HZK A;  1Q35 A;  3OEM A;  2Y7I A;  4ELQ A;  3DM0 A;  2DE2 A;  2DQV A;  2HAU A;  1EZP A;  1JW4 A;  3JZJ A;  2F97 A;  1PB7 A;  1AH5 A;  4LQ5 A;  1N76 A;  4GWO A;  1F9B A;  4Q30 B;  1B9J A;  3I6V A;  4ONY A;  2GH9 A;  1GV8 A;  1WVJ A;  4G77 A;  2BJJ X;  4OFO A;  3B7D A;  3A3C A;  2Z22 A;  1NNP A;  1EZO A;  1AL3 A;  1B3E A;  2WKY A;  3VV5 A;  1UTH B;  2H5Y A;  4DXU A;  3I5O A;  5LOM A;  3UP9 A;  2DP8 A;  3V83 A;  3HN0 A;  1B6H A;  3T22 A;  5KDT B;  3JV9 A;  2GHB A;  2FNC A;  3CG3 A;  3QXM A;  3N94 A;  4XXU A;  1LCF A;  1LB8 A;  3GLB A;  1AIV A;  1NKX A;  1Y9U A;  4HCW A;  5FTH A;  4PFU A;  1B3L A;  2XXH A;  4LZ8 A;  5AE4 A;  4N13 A;  4ZED A;  3SET A;  4ZE8 A;  3IX1 A;  5KZT A;  1SYH A;  1MM7 A;  2DWA A;  3MZ9 A;  2O51 A;  1ZU0 A;  2H4I A;  3FJG A;  4R9G A;  5DEX A;  3K1M A;  2AL4 A;  1P99 A;  4XKP A;  3RY3 A;  1M5E A;  1SQY A;  1EH3 A;  3OEK A;  1MQG A;  1A8E A;  4H8J A;  3TTR A;  2DS9 A;  3SKP A;  2QMX A;  4MFI A;  4N07 A;  2V3U A;  4JBZ A;  3UIF A;  3V89 B;  4BDO A;  4F2Q A;  5ITO A;  1Y3P A;  4NF6 B;  1XS5 A;  3KJ7 A;  3CSG A;  1BTJ A;  2OCU A;  4F3G A;  2QS4 A;  4OXV A;  1LAF E;  1I69 A;  4G68 B;  4G8M A;  5H8F A;  2LAO A;  4F22 A;  5AA2 D;  3LSL A;  4H6D A;  1PDA A;  5TP9 B;  3G3H A;  5JTY A;  5HPQ A;  3TOD A;  4YKK A;  1POY 1;  5IAI A;  3O6G A;  5F7V A;  2E1S A;  4RXL A;  2H98 A;  2OWT A;  3W9W A;  4NE4 A;  2OBG A;  3ONM A;  1NH7 A;  4MLV A;  1LCT A;  3TCF A;  1B1H A;  1OQH A;  3HHG A;  2DXR A;  3IOU A;  1JEV A;  4TQU Q;  3K2D A;  2O1L A;  4UAC A;  5L9M A;  3LSW A;  4X9T A;  5I2N B;  3DP6 A;  1H76 A;  5H8S A;  5H8H B;  3EF7 A;  4EF1 A;  3H06 B;  4H1X A;  3OO9 A;  5EHM A;  2DWH A;  3H6V A;  3FUZ A;  5B70 A;  1MXU A;  4F39 A;  1LST A;  4BLA A;  3C32 A;  1EZ9 A;  1UIU A;  3R6U A;  4F1U A;  4FJP A;  1MQD A;  4ZEF A;  1PBQ A;  3PUZ E;  4JDF A;  1UTB A;  1B52 A;  4QSC A;  1LAH E;  2F7B A;  2ONS A;  2F7C A;  4PFY A;  4U2R A;  2REG A;  2VP1 A;  3L6G A;  3PV0 E;  3UA8 A;  4G8N A;  3BFU A;  1ZIU A;  2PBW A;  1IIW A;  3PPN A;  1VFE A;  2Y7K A;  3U92 A;  5AA1 A;  5I58 B;  4OES A;  3EPE A;  3F11 A;  1QUI A;  1MH4 A;  2V93 A;  4JSO A;  3U1O A;  1FQB A;  2AL5 A;  1SD3 A;  5CBR A;  1TFD A;  1MRP A;  1SDX A;  4F1V A;  4ZEI A;  4YAH X;  1O64 A;  2Y84 A;  3AXF A;  2DYX A;  3IO6 A;  1QUK A;  4GQO A;  3KGC A;  4EDP A;  3VVD A;  4NED A;  3MJN A;  1MY2 A;  4TOZ A;  4U4S A;  4ZEC A;  2ESN A;  4KYE A;  2V3T A;  3C36 A;  3TFL A;  3T9H B;  5DVJ A;  1RYX A;  1B40 A;  1IXI A;  2H9B A;  3H4Z A;  2O69 A;  3CR9 A;  4JWY A;  1FTM A;  5CBS A;  1FQD A;  2NXO A;  1B7H A;  3OSR A;  5CM6 A;  4EF2 A;  3M3L A;  3VE1 B;  2O68 A;  2HZL A;  4NWD A;  1LFH A;  3K02 A;  1H45 A;  3SEW A;  1JET A;  1N7W A;  4IB2 A;  1MXV A;  2QSX A;  1PBP A;  2I3W A;  1YPN A;  2P2A A;  4E0W A;  1OVB A;  4Z7E A;  4QHQ A;  4I1D A;  1NL5 A;  3G3I A;  4F18 A;  4XKQ A;  4F29 A;  4OFJ A;  2HAV A;  1XVY A;  1LGB C;  2QMW A;  3O28 A;  4OWD A;  2B65 A;  3S9M C;  2A5T B;  2HCA A;  1GR2 A;  1N3W A;  3OMB A;  3EHS A;  1D4N A;  4F3S A;  1SVX B;  4DCY A;  5J1D A;  3KEI A;  3MWB A;  3QYT A;  4M1V A;  1MQI A;  4R74 A;  4RA1 A;  3TTN A;  3C34 A;  4HS7 A;  4QSD A;  2I58 A;  3E4R A;  2UVI A;  3SES A;  2CZL A;  3TZA A;  4LA9 A;  4AQ4 A;  1FTO A;  3IK6 B;  2ABH A;  4Q0C A;  1P1N A;  3TTM A;  4IO7 A;  1R9Q A;  2F6P A;  2PT2 A;  1B2H A;  2X7Q A;  3K1P A;  2Q88 A;  3C33 A;  1JVY A;  3FIR A;  3I3V A;  4BDR A;  3PUW E;  3V8X B;  5FHO A;  2O7U A;  1MG1 A;  4KR5 A;  3IJX B;  4FEC A;  1XVX A;  3RTF B;  1DOT A;  2XXI A;  1BKA A;  2ZYK A;  1UIV A;  3CVG A;  1IQ7 A;  2PMS A;  1MY3 A;  4GF8 A;  4F31 B;  3TQL A;  2F34 A;  3SEX A;  3MZ1 A;  1URG A;  4QFN A;  1WOD A;  3C9H A;  1JW1 A;  4IGR A;  1NFT A;  1HSJ A;  1Y1M A;  3T9V A;  2XXW A;  1XHY A;  3O66 A;  4R9F A;  1B4H A;  1GVC A;  3M3K A;  1URD A;  1B58 A;  2I4C A;  1NH8 A;  2GRV A;  1SI1 A;  3QAX A;  2VOZ A;  5FHM A;  4EXL A;  3LSF B;  1N7X A;  3TCH A;  3CIJ A;  1Y4C A;  5CMB A;  3SER A;  3T66 A;  3TKD A;  3BKI B;  1DTZ A;  4YIC A;  4DE8 A;  1ELJ A;  2Q9T A;  1AMF A;  4DDD A;  3FAS A;  2R6G E;  1A7L A;  4G4P A;  3D4G A;  5K2X A;  1MXX A;  4KFQ A;  1MM6 A;  3LR1 A;  2P0S A;  3E13 X;  1OLA A;  1VFD A;  2I6E A; 
#chains in the Genus database with same CATH topology
 2Y5K A;  3PMX A;  2P3V A;  4K3F A;  3PGF A;  1B3G A;  1ZMG A;  1FQF A;  4EQ7 A;  3ILT B;  4N15 A;  1KA1 A;  3LC8 A;  1UTH A;  3D4C A;  4O7I A;  1A99 A;  4H45 A;  1WDN A;  3UOR A;  2HHM A;  3IB2 A;  1QVS A;  1FPI A;  3OOA A;  4FBP A;  3TUS A;  3G3K A;  5KDT A;  1M5C A;  4GX3 A;  3M8U A;  3UGW A;  2OWS A;  5ITP A;  4MJO A;  4U22 A;  3UK4 A;  3C31 A;  5TPA B;  5DVI A;  2PT1 A;  1QKA A;  4OQO A;  3K6X A;  4OVP A;  3T9U A;  2DXY A;  5FBP A;  5ET7 A;  4JWX A;  3MPK A;  3L6H A;  4O3B A;  3IO4 A;  3HST A;  3T96 B;  2PFZ A;  1LBX A;  2W7Y A;  2O84 X;  2F8D A;  3TEL A;  1VDW A;  4RK9 A;  2QS2 A;  1MQJ A;  2XXY A;  3RGY A;  3MP6 A;  4YKI A;  3M3F A;  4FIM A;  2QFL A;  2OX3 A;  3QMF A;  4GIZ A;  4U1Z A;  5CMC A;  4BDM A;  3CRB A;  5JK4 A;  4YMB A;  2Q8M A;  5HBC A;  4NHB A;  3K0V A;  3MBP A;  1G0H A;  5I7I A;  1BP5 A;  1MXW A;  2RC7 A;  4ISU A;  5EYH A;  4XEQ A;  1A55 A;  2QRY A;  1I6B A;  1P1U A;  2H25 A;  1FPE A;  4JB7 A;  1PB8 A;  3EN3 A;  5CI5 A;  1FJ6 A;  3PPP A;  2F6G A;  2DDK A;  1NNF A;  3RTW B;  1ZTY A;  5I56 A;  1FCK A;  4PDH A;  4R2B A;  1POT A;  1FBE A;  4UAB A;  1D9V A;  3KC0 A;  3P7I A;  4NF4 B;  3TQW A;  2V3Q A;  4QFP A;  5ISU A;  1A40 A;  1OIB A;  4WEP A;  3KSX A;  2QS3 A;  1Y20 A;  3LV0 A;  5IZ3 A;  3BBR A;  1XC1 A;  4I8C A;  1CB6 A;  5T3J A;  3SDF A;  3MAM A;  1IMB A;  2FBP A;  2GHA A;  3EHU A;  2JJK A;  1FPB A;  2ZZX A;  4JVI A;  2OZZ A;  3O29 A;  3VXB A;  1RDY A;  2RCA A;  2QJE A;  1S9T A;  2OLB A;  4ELP A;  1FTL A;  4H46 A;  2GFE A;  4R75 A;  3CG1 A;  4HE0 A;  4O3C A;  3W15 C;  1ATG A;  1M5F A;  1UQW A;  5ICQ A;  1K9Y A;  3T0J A;  3S9N C;  2D3I A;  4QF9 A;  2VHA A;  4OFL A;  3VXC A;  4FED A;  4QFL A;  3PMV A;  5H8H A;  3K6U A;  2HEU A;  1FTA A;  1IXG A;  4GL8 A;  1R1N A;  2ZNT A;  1SYI A;  3IB1 A;  3H3G A;  3MYU A;  4KI0 E;  3H7M A;  3H6T A;  4N81 A;  1RDZ A;  3RYD A;  4X8R A;  2RKM A;  4FE8 A;  4PAI A;  1OVT A;  4C1U A;  4O3A A;  1MY0 A;  1DMB A;  4H0W A;  1IUD A;  4TLM B;  2DWI A;  3T1B A;  1ANF A;  2XA5 A;  1ZLQ A;  4XF5 A;  3EQ1 A;  4GL0 A;  1MXY A;  2E0S A;  2XX7 A;  4KYD A;  4N6D A;  1US4 A;  5EHS A;  4ZEB A;  3U72 A;  4EQB A;  4PET A;  4RPO A;  3DEL B;  3EHT A;  2O1M A;  2XX8 A;  1BK4 A;  2VD2 A;  1B32 A;  4HW8 A;  2XXX A;  3FJ7 A;  2DOJ A;  5I58 A;  4LZ7 A;  4ZDM A;  1LFG A;  3PUY E;  1QJM A;  4GRK A;  4YZZ A;  1R6Z A;  2YPN A;  1OMP A;  3SEY A;  3LSX A;  4DCX A;  3FVO A;  4RPN A;  2Q2A A;  4QXD A;  2ALU A;  4C0R A;  5A5X B;  5H8Q A;  3QIM A;  1URS A;  3B6Q A;  4EQ9 A;  3SEV A;  4I3E A;  2XXR A;  2RIN A;  3O6I A;  4G8H A;  2DE3 A;  1CE2 A;  3RN8 A;  1GTK A;  3MVZ A;  3HV1 A;  3G7W A;  4IY5 A;  4ELR A;  3O9P A;  4QFO A;  5L9S A;  1USY E;  2XX9 A;  5DTB A;  3KSJ A;  1PC3 A;  4WED A;  4OHN A;  4PAK A;  3SEU A;  3PD9 A;  4ZZA A;  3S4U A;  3KN7 A;  4RK2 A;  4PTK A;  4DLD A;  1MDQ A;  2XD2 A;  4O8M A;  4OVQ A;  5M2V A;  3TMG A;  3Q29 A;  4FAJ A;  3IOW A;  1I6Q A;  5BWJ A;  5AA4 A;  1TWY A;  5F1Q A;  3IL1 B;  3FV2 A;  4XTC Q;  1NUX A;  3T93 B;  1JVX A;  1NNK A;  4P8B A;  4P1E A;  3FVN A;  3ISP A;  3QUJ A;  5DT6 A;  5I59 B;  5IKB A;  1AOV A;  3B8B A;  1EYJ A;  2Y7R A;  4P1L A;  1JQF A;  3O97 A;  2CZK A;  4MEV A;  5AA2 B;  3VVF A;  3JYR A;  4NF8 B;  3ODB A;  3OO6 A;  4ZZE A;  3G3F A;  1B05 A;  1Q1K A;  1HSL A;  3MW0 A;  2XWK A;  1MPB A;  3FZV A;  1PB9 A;  4MNC A;  4I3Y A;  4MLQ A;  4LON B;  4N8Y A;  4G2Z A;  3T9X B;  5CMK A;  4GVO A;  1LEV A;  5FHN A;  2NVU B;  3KJT A;  2CZH A;  2Q89 A;  3RPL A;  1SW5 A;  3OO8 A;  3THI A;  3ZKK A;  4H65 A;  3UN6 A;  5A5L A;  4ZEK A;  3S9E A;  2R71 A;  1QW0 A;  2ZNU A;  1LBV A;  2PCR A;  3KG2 A;  4QBA A;  4F19 A;  2F5X A;  4P3L A;  1SW2 A;  2KLF A;  3GYY A;  2B3B A;  4RYA A;  4IO3 A;  4H5G A;  3PUX E;  2UXA A;  3KBR A;  3U93 A;  5ET5 A;  2O6A A;  1Y1Z A;  2OK2 A;  1FW0 A;  2QL3 A;  4R6K A;  3RPW A;  4F3B A;  1O63 A;  3A3U A;  1MY4 A;  5KCJ B;  5DYH A;  1NV4 A;  3FGS A;  1LB9 A;  2WBB A;  1QUJ A;  4QRZ A;  2HFB A;  2Q2C A;  1XOC A;  1NV2 A;  1OQG A;  1Y4T A;  1DSN A;  4OTE A;  3RT8 A;  1A8F A;  4I9D A;  2B4L A;  2F3D A;  1MPD A;  2AIX A;  1SW4 A;  5EQ8 A;  1NV5 A;  2XHD A;  1FPL A;  5I3S A;  3KC1 A;  1XT8 A;  1DK4 A;  3R26 A;  1N84 A;  4LVQ A;  3PUV E;  4PP0 A;  4WKM A;  1FBP A;  1LAX A;  3TCG A;  3TDJ A;  3D1R A;  4NF5 B;  3HCQ A;  4DIG A;  3ZSF A;  4H67 A;  3K4U A;  2XXT A;  4O7M A;  1B5I A;  4LQ2 A;  3LUY A;  1Z7M E;  3CFZ A;  2HPG A;  4PBH A;  4PGP A;  5L8D A;  5I84 A;  4GFR A;  5CMM A;  1YCJ A;  2Y7W A;  3FXB A;  1FPG A;  1LAG E;  5I2K A;  2REJ A;  3MPL A;  4R6Y A;  3A09 A;  3HFU A;  3C35 A;  5H8N B;  3CFL A;  2I0C A;  3IOR A;  4MF3 A;  1I6A A;  4MH5 A;  2YJP A;  1S50 A;  2IA4 A;  3K6V A;  3MVY A;  1LFI A;  3B6T A;  2ZMB A;  4KYS A;  2YLN A;  3RLF E;  4YB5 A;  5TPA A;  5EYG A;  1N0T A;  3U8Q A;  3R7X A;  1M5D A;  1HSE A;  3K00 A;  4IY6 A;  3DP4 A;  1DCU A;  1ZBM A;  3RNN A;  2V25 A;  5I57 B;  3FD3 A;  2UYE A;  3KN8 A;  4E0X A;  1IMC A;  3FVG A;  4F3P A;  3MC2 A;  3KZG A;  1Y3N A;  4OVJ A;  2ONK E;  1IXC A;  4XKN A;  4X48 A;  3N6T A;  3KN3 A;  4NTL A;  2H99 A;  1FBG A;  1FBD A;  5AA3 A;  1FJ9 A;  2DVZ A;  4PE5 B;  1T0K A;  4GWS A;  2OWZ A;  2DE4 A;  5IGA A;  2PYY A;  4AB6 A;  2HXR A;  5BUU A;  4R2F A;  4P47 A;  4YB6 A;  2NWJ A;  1MXZ A;  3N6U A;  3O2A A;  4PF6 A;  4JVD A;  1YYZ A;  1BIY A;  2DVC A;  5DW8 A;  3FV1 A;  2G93 A;  4U21 A;  5EYF A;  2Z8F A;  4PFW A;  2V84 A;  5FTI A;  3S2V A;  3Q28 A;  1FBH A;  1B46 A;  3RUM A;  1IZ1 A;  4UA8 A;  2I49 A;  5CRY A;  4YB7 A;  4ND9 A;  4EUO A;  3CSB A;  4H8I A;  1FQA A;  2XWO A;  3VFJ A;  1H44 A;  3MZB A;  1JEU A;  3S9L C;  3K01 A;  2FVZ A;  3FXU A;  4OEU A;  1NNT A;  1MS7 A;  1MQH A;  3GZG A;  2XXU A;  2FYI A;  4NF4 A;  1B3F A;  5IZZ A;  4GXA A;  4YU0 A;  4JWO A;  1B3H A;  4NF6 A;  4ESX A;  5JEI A;  3RQT A;  3E3K A;  4R73 A;  4PCD A;  1INP A;  2L5V A;  2F35 A;  4WXJ A;  4ECF A;  2I48 A;  2D5W A;  4G68 A;  4PE3 A;  2VPN A;  1P1W A;  3N5L A;  1XI6 A;  5TP9 A;  2Z8E A;  4OVS A;  3LBS A;  4POX A;  4HE1 A;  4FAT A;  1FPJ A;  4LAT A;  2X26 A;  1LBZ A;  1VSO A;  1B7U A;  1NV3 A;  3HPI A;  4DZ1 A;  1RKM A;  3OEL A;  2R8T A;  2QPQ A;  3FXQ A;  4LP2 B;  1IXH A;  1SPI A;  3IOT A;  4H5F A;  4GD5 A;  1FPD A;  1SW1 A;  3BFT A;  3TTK A;  5DEX B;  3PU5 A;  5EQ7 A;  4HTG A;  3K6W A;  4DXC A;  2UVJ A;  4THI A;  3NOH A;  4IO6 A;  5I56 B;  3VVE A;  4MHF A;  3RT6 B;  3QSL A;  3OXN A;  1B0H A;  3FXR A;  5I2N A;  1LBW A;  4NWC A;  4YKJ A;  3K1N A;  3B50 A;  1YAE A;  2I4B A;  2XD3 A;  3KFM A;  4AS4 A;  2G29 A;  3G3J A;  3BIH A;  3IFA A;  4DI4 B;  1MY1 A;  1QUL A;  3B6W A;  5ICT A;  2RC8 A;  1TXF A;  5H8F B;  3Q27 A;  1B51 A;  4GXS B;  2ANJ A;  2NOO A;  1NUW A;  1H43 A;  1QKB A;  5JTY B;  4JXI A;  4X1B A;  4KQP A;  4G68 C;  4OET A;  1LBY A;  2Y7P A;  4PDD A;  3E9X A;  4HXV A;  1TFA A;  2PVU A;  2P1S A;  1H3D A;  3GBA A;  4KCD A;  3PPQ A;  1R9L A;  2D21 A;  1DPP A;  5ELV A;  4Q5T A;  3MUQ A;  1PEB A;  2ZZW A;  3EKI A;  3GXA A;  1YXI A;  3Q25 A;  3ECR A;  2UVH A;  4PQJ A;  2F36 A;  3A29 A;  1Y3Q A;  1OLC A;  1Q9D A;  5A5X A;  4R6H A;  4BDQ A;  3TAJ A;  3DLN A;  3SZP A;  2I3V A;  1BLF A;  4N6P A;  3TEP A;  2M8C A;  3H6W A;  4HCY A;  2UYF A;  3PPR A;  4YKP A;  1NV6 A;  4F1Y A;  1IIT A;  3OEN A;  3MP1 A;  3QK6 A;  4YMA A;  4EXK A;  3LUZ A;  4ZS9 A;  2F7A A;  1RYO A;  2ZYO A;  1NUZ A;  3DP8 A;  4OMB A;  4M4G A;  2FA7 A;  4U23 A;  1JP4 A;  1UTB B;  4IO2 A;  2CMO A;  2DWJ A;  4P11 A;  4KCC A;  1CNQ A;  4R72 A;  1M5B A;  4OVR A;  1NMU A;  3G3G A;  1FBC A;  1ZKB A;  4TLL B;  4PFB A;  4NF0 A;  2HQ0 A;  2QVV A;  1FQE A;  1L5T A;  5I59 A;  3FAT A;  3IJO B;  3VLU A;  1S7Y A;  4OER A;  3USD A;  5AA2 A;  4PC9 A;  2IEE A;  3MVX A;  4NF8 A;  1IMF A;  4DI3 D;  5H8Q B;  4F2O A;  4I62 A;  1B1X A;  3C4M A;  2HXW A;  1NUY A;  1DTG A;  4PFT A;  4DXB A;  1B4Z A;  4RNS A;  1EU8 A;  2VGQ A;  2F78 A;  2RCB A;  2A5T A;  4KHZ E;  1NI9 A;  2I0B A;  3MP8 A;  1GGG A;  2R9J A;  4GBV A;  4ELO A;  3IR1 A;  3ZKL A;  4BDN A;  2ZYM A;  3VLW A;  2OJT A;  1B7Z A;  2GQ1 A;  3CI8 A;  4LZ5 A;  2XWV A;  3MST A;  3TPA A;  4KD5 A;  1TT1 A;  3MQ9 A;  1MH3 A;  1JNF A;  3IB0 A;  3N26 A;  3KOT A;  3PD8 A;  2Q8J A;  1O7T A;  1SI0 A;  4RY1 A;  1US5 A;  1Z7N E;  1N3X A;  4X1D A;  4OEV A;  2UVG A;  1MPC A;  2XXV A;  4OYV A;  2DSF A;  1ZJL A;  5AA4 B;  1B5H A;  1LBB A;  3HHF A;  2XXP A;  4C1T A;  5K2Y A;  5EQ9 A;  4QSE A;  4FEB A;  3PTY A;  5KCJ A;  3Q26 A;  3QUF A;  5HM4 B;  3OD7 A;  4GLI A;  2AYS A;  2VD3 A;  4GOT A;  3FJM A;  4JVC A;  1VR5 A;  1MDP 1;  4I40 A;  1D3K A;  4IGT A;  4IO5 A;  2ZNS A;  4BDL A;  4FOR A;  4JSD A;  5ESY A;  3H03 A;  1YTV A;  4U4X A;  4ZE9 A;  1RDX A;  3KOS A;  1SBP A;  2QVU A;  5L9O A;  1FTJ A;  2QS1 A;  2ZXT A;  3PPO A;  3U94 A;  3H6U A;  4XIG Q;  3TTL A;  4L17 A;  1J1N A;  1LLS A;  4OZ9 A;  2RF1 A;  4NMY A;  1JW5 A;  1D9Q A;  2FIE A;  4XKR A;  4NF5 A;  2CZI A;  4RJZ A;  1FPF A;  4POW A;  1P1Q A;  3W9V A;  4ESW A;  4LUB A;  4Q8R A;  4PBQ A;  2ZYN A;  5TU0 A;  4U1O A;  5DVF A;  5CC2 A;  3WAF A;  4IO4 A;  2CEX A;  2Q74 A;  1EYK A;  3GBB A;  2A5S A;  3V5A A;  4P0I A;  1VE4 A;  4O94 A;  5LTC A;  4QFK A;  1AWB A;  3CHG A;  4NX1 A;  4Z0I A;  3FVK A;  2XXQ A;  4KPT A;  5F24 A;  3VLV A;  2O7I A;  3MVW A;  3IAZ A;  5H8N A;  1D9Y A;  1A54 A;  2P3N A;  4AB5 A;  5B7D A;  3OSQ A;  3WAE A;  2Z8D A;  3OO7 A;  3IFC A;  3ZS6 A;  1P1O A;  3HO7 A;  2WX9 A;  2Z23 A;  3BIG A;  2RC9 A;  3CFX A;  1II5 A;  1N04 A;  4P9K A;  4P0G A;  4GWY A;  4KXP A;  3IOV A;  4PF8 A;  1LBC A;  3TYH A;  1DPE A;  2PFY A;  2ZZV A;  3VDF A;  1B5J A;  4MMP A;  2B3F A;  2ONR A;  4MBP A;  2PX1 A;  1IEJ A;  2V4C A;  1FQC A;  5I57 A;  1FTK A;  2THI A;  2X7P A;  1USY H;  2NUV A;  4OEN A;  1FRP A;  4N4U A;  1KWH A;  1B0L A;  3E78 A;  1IME A;  5I2K B;  3PMW A;  3ILU B;  3O6H A;  2HZK A;  1Q35 A;  3OEM A;  2Y7I A;  4ELQ A;  3DM0 A;  2DE2 A;  2DQV A;  2HAU A;  1QGX A;  1EZP A;  1JW4 A;  3JZJ A;  2F97 A;  1PB7 A;  1AH5 A;  4LQ5 A;  1N76 A;  4GWO A;  1F9B A;  4Q30 B;  1B9J A;  3I6V A;  5ET6 A;  4ONY A;  2GH9 A;  1GV8 A;  2BJI A;  1WVJ A;  2F3B A;  4G77 A;  2BJJ X;  2XXK A;  4MX6 A;  4OFO A;  3B7D A;  3A3C A;  2Z22 A;  1NNP A;  1EZO A;  1AL3 A;  1B3E A;  2WKY A;  2WBD A;  3VV5 A;  1UTH B;  2H5Y A;  4DXU A;  5I5P A;  3I5O A;  5LOM A;  3UP9 A;  2DP8 A;  3V83 A;  3HN0 A;  1B6H A;  3T22 A;  5KDT B;  1NV7 A;  3JV9 A;  2GHB A;  5IZ1 A;  2FNC A;  3CG3 A;  5EQA A;  3QXM A;  3N94 A;  4XXU A;  1LCF A;  1LB8 A;  3GLB A;  1AIV A;  1NKX A;  1Y9U A;  4MNP A;  4HCW A;  2KR0 A;  5FTH A;  4PFU A;  1B3L A;  4MIJ A;  2XXH A;  4LZ8 A;  5ET8 A;  5AE4 A;  2WEF A;  2FIX A;  4N13 A;  4ZED A;  3SET A;  4ZE8 A;  3IX1 A;  5KZT A;  1SYH A;  1MM7 A;  2DWA A;  3MZ9 A;  1FBF A;  2O51 A;  1ZU0 A;  2H4I A;  3FJG A;  4R9G A;  1NV1 A;  5DEX A;  3K1M A;  2AL4 A;  1P99 A;  4XKP A;  3RY3 A;  4P56 A;  1M5E A;  1SQY A;  1EH3 A;  3OEK A;  1MQG A;  1A8E A;  2B4M A;  4H8J A;  3TTR A;  2DS9 A;  3SKP A;  2QMX A;  4MFI A;  4N07 A;  2V3U A;  2WYP A;  4NN3 A;  2Y5L A;  4JBZ A;  3UIF A;  3V89 B;  4BDO A;  4F2Q A;  5ITO A;  1Y3P A;  4NF6 B;  1XS5 A;  3KJ7 A;  3CSG A;  1BTJ A;  2OCU A;  4F3G A;  4MAG A;  2QS4 A;  4OXV A;  1K9Z A;  1LAF E;  1I69 A;  4G68 B;  4G8M A;  5H8F A;  2LAO A;  4F22 A;  5AA2 D;  3LSL A;  5J16 A;  4H6D A;  1PDA A;  5TP9 B;  3G3H A;  5JTY A;  5HPQ A;  3TOD A;  4XFE A;  4MCO A;  1POY 1;  4YKK A;  5IAI A;  3O6G A;  4NAP A;  5F7V A;  4GWZ A;  2E1S A;  4RXL A;  2H98 A;  2OWT A;  3W9W A;  5IZ3 B;  4NE4 A;  2OBG A;  3ONM A;  1NH7 A;  4MLV A;  1LCT A;  4PFI A;  3TCF A;  1B1H A;  1OQH A;  3HHG A;  2DXR A;  3IOU A;  1JEV A;  4TQU Q;  3K2D A;  2MKZ A;  2O1L A;  1FSA A;  4UAC A;  4G61 A;  5L9M A;  3LSW A;  1IMA A;  4X9T A;  5I2N B;  3DP6 A;  1H76 A;  5H8S A;  5H8H B;  1G0I A;  3EF7 A;  4EF1 A;  3H06 B;  4H1X A;  4PGN A;  3OO9 A;  5EHM A;  4GBW A;  2DWH A;  3H6V A;  3FUZ A;  2VT5 A;  5B70 A;  1MXU A;  4F39 A;  1LST A;  4BLA A;  3C32 A;  1EZ9 A;  1UIU A;  3R6U A;  4F1U A;  4FJP A;  1MQD A;  4ZEF A;  1PBQ A;  3PUZ E;  4JDF A;  1UTB A;  1B52 A;  4QSC A;  1LAH E;  2F7B A;  2ONS A;  2F7C A;  4PFY A;  4U2R A;  2REG A;  2VP1 A;  3L6G A;  3PV0 E;  3UA8 A;  4G8N A;  3BFU A;  1ZIU A;  4N8G A;  2PBW A;  1IIW A;  3PPN A;  1VFE A;  2Y7K A;  1NV0 A;  3U92 A;  5AA1 A;  5I58 B;  4OES A;  3EPE A;  3F11 A;  1QUI A;  1MH4 A;  2V93 A;  4JSO A;  3U1O A;  1FQB A;  2AL5 A;  1SD3 A;  5CBR A;  1TFD A;  1MRP A;  4N17 A;  1SDX A;  4F1V A;  4ZEI A;  4YAH X;  1O64 A;  2Y84 A;  3AXF A;  2DYX A;  3IO6 A;  1QUK A;  4GQO A;  3KGC A;  4EDP A;  3KBZ A;  3VVD A;  4NED A;  3MJN A;  1MY2 A;  4TOZ A;  4U4S A;  4ZEC A;  4GX6 A;  2ESN A;  4KYE A;  4AS5 A;  2V3T A;  3C36 A;  3TFL A;  3T9H B;  5DVJ A;  1RYX A;  1B40 A;  4NGU A;  1IMD A;  1IXI A;  2H9B A;  3H4Z A;  2O69 A;  3CR9 A;  4JWY A;  1FTM A;  5CBS A;  1FQD A;  4X04 A;  2NXO A;  1B7H A;  3OSR A;  5CM6 A;  4EF2 A;  3M3L A;  3VE1 B;  2O68 A;  2HZL A;  4NWD A;  1LFH A;  3K02 A;  1H45 A;  3FBP A;  3SEW A;  1JET A;  1N7W A;  4IB2 A;  4NG7 A;  1MXV A;  2QSX A;  1PBP A;  2I3W A;  2CEY A;  1YPN A;  2P2A A;  4E0W A;  1OVB A;  4GWX A;  4Z7E A;  4QHQ A;  4I1D A;  2VPO A;  1NL5 A;  3G3I A;  4F18 A;  4XKQ A;  4F29 A;  4OFJ A;  4OVT A;  2HAV A;  1XVY A;  5LDZ A;  1LGB C;  2QMW A;  3O28 A;  1DBZ A;  4OWD A;  2B65 A;  3S9M C;  2A5T B;  2HCA A;  1GR2 A;  2QVR A;  3U65 A;  1N3W A;  3OMB A;  3EHS A;  1D4N A;  4F3S A;  4GX4 A;  1SVX B;  4DCY A;  5J1D A;  3KEI A;  3MWB A;  3QYT A;  4M1V A;  1MQI A;  4R74 A;  4RA1 A;  3TTN A;  3C34 A;  1KA0 A;  4HS7 A;  4QSD A;  1FPK A;  2I58 A;  3E4R A;  2UVI A;  3SES A;  2CZL A;  4GWU A;  3TZA A;  4LA9 A;  4AQ4 A;  1FTO A;  3IK6 B;  2ABH A;  4Q0C A;  4N91 A;  1P1N A;  3TTM A;  4IO7 A;  4HE2 A;  1R9Q A;  3RPL B;  2FHY A;  2F6P A;  2PT2 A;  1B2H A;  2X7Q A;  3K1P A;  2Q88 A;  3C33 A;  1JVY A;  3FIR A;  3I3V A;  4N6K A;  2WYK A;  4BDR A;  3PUW E;  5FHO A;  3V8X B;  2O7U A;  1MG1 A;  4KR5 A;  3IJX B;  4FEC A;  1XVX A;  3RTF B;  1YZ0 A;  2KQZ A;  1DOT A;  2XXI A;  3ROJ A;  1BKA A;  2ZYK A;  1UIV A;  3CVG A;  1IQ7 A;  2PMS A;  1MY3 A;  4GF8 A;  4F31 B;  4IR8 A;  4PAF A;  3TQL A;  2F34 A;  3SEX A;  3MZ1 A;  1URG A;  4QFN A;  4MNI A;  1WOD A;  3C9H A;  1JW1 A;  4IGR A;  1NFT A;  1HSJ A;  1Y1M A;  3T9V A;  2XXW A;  1EYI A;  5IM2 A;  4LN5 A;  1XHY A;  3O66 A;  4R9F A;  1B4H A;  1GVC A;  3M3K A;  1URD A;  1B58 A;  2I4C A;  1NH8 A;  2GRV A;  1SI1 A;  3QAX A;  3E79 A;  2VOZ A;  5FHM A;  4EXL A;  4OA4 A;  3LSF B;  1N7X A;  3TCH A;  3CIJ A;  1KZ8 A;  1Y4C A;  5CMB A;  3SER A;  3T66 A;  4GWW A;  4OAN A;  3TKD A;  4PFR A;  3BKI B;  1DTZ A;  4YIC A;  4DE8 A;  1ELJ A;  2Q9T A;  1AMF A;  4DDD A;  3FAS A;  2R6G E;  1A7L A;  4G4P A;  3D4G A;  5K2X A;  1MXX A;  4KFQ A;  1MM6 A;  3LR1 A;  2XWI A;  2P0S A;  3E13 X;  4NQ8 A;  1OLA A;  1VFD A;  2I6E A; 
#chains in the Genus database with same CATH homology
 3PMX A;  4K3F A;  3PGF A;  1B3G A;  1ZMG A;  1FQF A;  4EQ7 A;  3ILT B;  3LC8 A;  1UTH A;  3D4C A;  1A99 A;  1WDN A;  3UOR A;  3IB2 A;  1QVS A;  3OOA A;  3TUS A;  3G3K A;  5KDT A;  1M5C A;  3M8U A;  3UGW A;  2OWS A;  5ITP A;  4U22 A;  3UK4 A;  3C31 A;  5TPA B;  5DVI A;  2PT1 A;  1QKA A;  4OQO A;  3K6X A;  3T9U A;  2DXY A;  4JWX A;  3MPK A;  3L6H A;  4O3B A;  3IO4 A;  3HST A;  3T96 B;  2W7Y A;  2O84 X;  2F8D A;  3TEL A;  4RK9 A;  2QS2 A;  1MQJ A;  2XXY A;  3RGY A;  3MP6 A;  4YKI A;  3M3F A;  4FIM A;  4GIZ A;  4U1Z A;  5CMC A;  4BDM A;  3CRB A;  5JK4 A;  4YMB A;  5HBC A;  3K0V A;  3MBP A;  1BP5 A;  1MXW A;  2RC7 A;  4ISU A;  1A55 A;  2QRY A;  1I6B A;  1P1U A;  2H25 A;  4JB7 A;  1PB8 A;  3EN3 A;  5CI5 A;  3PPP A;  2F6G A;  1NNF A;  3RTW B;  1ZTY A;  5I56 A;  1FCK A;  4R2B A;  1POT A;  1D9V A;  3P7I A;  4NF4 B;  3TQW A;  2V3Q A;  4QFP A;  5ISU A;  1A40 A;  1OIB A;  4WEP A;  3KSX A;  2QS3 A;  1Y20 A;  3BBR A;  1XC1 A;  4I8C A;  1CB6 A;  3SDF A;  3MAM A;  2GHA A;  3EHU A;  2OZZ A;  3O29 A;  3VXB A;  2RCA A;  2QJE A;  1S9T A;  2OLB A;  4ELP A;  1FTL A;  2GFE A;  3CG1 A;  4R75 A;  4O3C A;  3W15 C;  1ATG A;  1M5F A;  1UQW A;  5ICQ A;  3S9N C;  2D3I A;  4QF9 A;  2VHA A;  4OFL A;  3VXC A;  4FED A;  4QFL A;  3PMV A;  5H8H A;  3K6U A;  2HEU A;  1IXG A;  4GL8 A;  1R1N A;  2ZNT A;  1SYI A;  3IB1 A;  3H3G A;  4KI0 E;  3H7M A;  3H6T A;  2RKM A;  4FE8 A;  1OVT A;  4C1U A;  4O3A A;  1MY0 A;  1DMB A;  4H0W A;  1IUD A;  4TLM B;  2DWI A;  1ANF A;  1ZLQ A;  3EQ1 A;  4GL0 A;  1MXY A;  2E0S A;  2XX7 A;  4KYD A;  1US4 A;  5EHS A;  4ZEB A;  3U72 A;  4EQB A;  4PET A;  4RPO A;  3DEL B;  2O1M A;  2XX8 A;  3EHT A;  2VD2 A;  1B32 A;  4HW8 A;  2XXX A;  3FJ7 A;  2DOJ A;  5I58 A;  4LZ7 A;  4ZDM A;  1LFG A;  3PUY E;  1QJM A;  4GRK A;  4YZZ A;  1R6Z A;  2YPN A;  1OMP A;  3SEY A;  3LSX A;  4DCX A;  3FVO A;  4RPN A;  2Q2A A;  2ALU A;  4C0R A;  5A5X B;  5H8Q A;  3QIM A;  1URS A;  3B6Q A;  4EQ9 A;  3SEV A;  2XXR A;  2RIN A;  3O6I A;  4G8H A;  2DE3 A;  1CE2 A;  3RN8 A;  1GTK A;  3MVZ A;  3HV1 A;  3G7W A;  4IY5 A;  4ELR A;  3O9P A;  4QFO A;  5L9S A;  1USY E;  2XX9 A;  5DTB A;  3KSJ A;  1PC3 A;  4WED A;  4OHN A;  3SEU A;  3PD9 A;  4ZZA A;  3S4U A;  3KN7 A;  4RK2 A;  4DLD A;  1MDQ A;  2XD2 A;  5M2V A;  3TMG A;  3Q29 A;  4FAJ A;  3IOW A;  1I6Q A;  5BWJ A;  5AA4 A;  1TWY A;  5F1Q A;  3IL1 B;  3FV2 A;  4XTC Q;  3T93 B;  1JVX A;  1NNK A;  3FVN A;  3QUJ A;  5DT6 A;  5I59 B;  5IKB A;  1AOV A;  2Y7R A;  1JQF A;  3O97 A;  5AA2 B;  3VVF A;  3JYR A;  4NF8 B;  3ODB A;  3OO6 A;  4ZZE A;  3G3F A;  1B05 A;  1Q1K A;  1HSL A;  3MW0 A;  1MPB A;  3FZV A;  1PB9 A;  4MLQ A;  4LON B;  4G2Z A;  3T9X B;  5CMK A;  4GVO A;  5FHN A;  2NVU B;  3KJT A;  2Q89 A;  1SW5 A;  3OO8 A;  3THI A;  3ZKK A;  4H65 A;  3UN6 A;  4ZEK A;  3S9E A;  2R71 A;  1QW0 A;  2ZNU A;  3KG2 A;  4F19 A;  2F5X A;  1SW2 A;  2KLF A;  2B3B A;  4RYA A;  4IO3 A;  4H5G A;  3PUX E;  2UXA A;  3KBR A;  3U93 A;  2O6A A;  1Y1Z A;  2OK2 A;  1FW0 A;  2QL3 A;  4R6K A;  3RPW A;  4F3B A;  1O63 A;  3A3U A;  1MY4 A;  5KCJ B;  5DYH A;  3FGS A;  1LB9 A;  1QUJ A;  4QRZ A;  2HFB A;  2Q2C A;  1XOC A;  1OQG A;  1Y4T A;  1DSN A;  4OTE A;  3RT8 A;  1A8F A;  4I9D A;  1MPD A;  2AIX A;  1SW4 A;  2XHD A;  1XT8 A;  3R26 A;  1N84 A;  4LVQ A;  3PUV E;  4PP0 A;  4WKM A;  1LAX A;  3TCG A;  3TDJ A;  4NF5 B;  3HCQ A;  4DIG A;  3ZSF A;  4H67 A;  3K4U A;  2XXT A;  1B5I A;  4LQ2 A;  3LUY A;  1Z7M E;  3CFZ A;  5L8D A;  5I84 A;  4GFR A;  5CMM A;  1YCJ A;  2Y7W A;  1LAG E;  5I2K A;  2REJ A;  3MPL A;  4R6Y A;  3A09 A;  3C35 A;  5H8N B;  3CFL A;  2I0C A;  3IOR A;  4MF3 A;  1I6A A;  4MH5 A;  2YJP A;  1S50 A;  2IA4 A;  3K6V A;  3MVY A;  1LFI A;  3B6T A;  2ZMB A;  4KYS A;  2YLN A;  3RLF E;  4YB5 A;  5TPA A;  1N0T A;  3U8Q A;  3R7X A;  1M5D A;  1HSE A;  3K00 A;  4IY6 A;  3DP4 A;  1ZBM A;  3RNN A;  2V25 A;  5I57 B;  3FD3 A;  2UYE A;  3KN8 A;  4E0X A;  3FVG A;  4F3P A;  3KZG A;  3MC2 A;  1Y3N A;  4OVJ A;  2ONK E;  1IXC A;  4XKN A;  4X48 A;  3N6T A;  3KN3 A;  4NTL A;  2H99 A;  5AA3 A;  2DVZ A;  4PE5 B;  1T0K A;  2DE4 A;  2PYY A;  4AB6 A;  5BUU A;  4R2F A;  4YB6 A;  2NWJ A;  1MXZ A;  3N6U A;  3O2A A;  1BIY A;  2DVC A;  3FV1 A;  2G93 A;  4U21 A;  5EYF A;  2Z8F A;  4PFW A;  2V84 A;  5FTI A;  3S2V A;  3Q28 A;  1B46 A;  3RUM A;  1IZ1 A;  4UA8 A;  2I49 A;  5CRY A;  4YB7 A;  4ND9 A;  4EUO A;  3CSB A;  4H8I A;  1FQA A;  3VFJ A;  1H44 A;  3MZB A;  1JEU A;  3S9L C;  3K01 A;  3FXU A;  4OEU A;  1NNT A;  1MS7 A;  1MQH A;  3GZG A;  2XXU A;  2FYI A;  4NF4 A;  1B3F A;  4GXA A;  4YU0 A;  4JWO A;  1B3H A;  4NF6 A;  4ESX A;  5JEI A;  3RQT A;  3E3K A;  4R73 A;  2F35 A;  4WXJ A;  4ECF A;  2I48 A;  2D5W A;  4G68 A;  1P1W A;  3N5L A;  5TP9 A;  2Z8E A;  3LBS A;  4POX A;  4FAT A;  4LAT A;  2X26 A;  1VSO A;  1B7U A;  3HPI A;  4DZ1 A;  1RKM A;  3OEL A;  2QPQ A;  3FXQ A;  4LP2 B;  1IXH A;  3IOT A;  4H5F A;  4GD5 A;  1SW1 A;  3BFT A;  3TTK A;  5DEX B;  3PU5 A;  4HTG A;  3K6W A;  4DXC A;  2UVJ A;  4THI A;  4IO6 A;  5I56 B;  3VVE A;  3RT6 B;  3QSL A;  3OXN A;  1B0H A;  3FXR A;  5I2N A;  4NWC A;  4YKJ A;  3K1N A;  1YAE A;  2I4B A;  2XD3 A;  3KFM A;  2G29 A;  3G3J A;  1MY1 A;  1QUL A;  3B6W A;  5ICT A;  2RC8 A;  1TXF A;  5H8F B;  3Q27 A;  1B51 A;  4GXS B;  2ANJ A;  2NOO A;  1H43 A;  1QKB A;  5JTY B;  4JXI A;  4X1B A;  4KQP A;  4G68 C;  4OET A;  2Y7P A;  3E9X A;  1TFA A;  2PVU A;  2P1S A;  1H3D A;  3GBA A;  4KCD A;  3PPQ A;  1R9L A;  2D21 A;  1DPP A;  5ELV A;  4Q5T A;  3MUQ A;  1PEB A;  3GXA A;  3Q25 A;  3ECR A;  2UVH A;  4PQJ A;  2F36 A;  1Y3Q A;  1OLC A;  5A5X A;  4R6H A;  4BDQ A;  3TAJ A;  3DLN A;  2I3V A;  1BLF A;  4N6P A;  3TEP A;  2M8C A;  3H6W A;  4HCY A;  2UYF A;  3PPR A;  4YKP A;  4F1Y A;  1IIT A;  3OEN A;  3MP1 A;  3QK6 A;  4YMA A;  4EXK A;  4ZS9 A;  2F7A A;  1RYO A;  2ZYO A;  3DP8 A;  4OMB A;  4M4G A;  2FA7 A;  4U23 A;  1UTB B;  4IO2 A;  2CMO A;  2DWJ A;  4P11 A;  4KCC A;  4R72 A;  1M5B A;  1NMU A;  3G3G A;  1ZKB A;  4TLL B;  2HQ0 A;  1FQE A;  1L5T A;  5I59 A;  3FAT A;  3IJO B;  3VLU A;  1S7Y A;  4OER A;  3USD A;  5AA2 A;  2IEE A;  3MVX A;  4NF8 A;  5H8Q B;  4F2O A;  4I62 A;  1B1X A;  3C4M A;  2HXW A;  1DTG A;  4PFT A;  4DXB A;  1B4Z A;  4RNS A;  1EU8 A;  2VGQ A;  2F78 A;  2RCB A;  2A5T A;  4KHZ E;  2I0B A;  3MP8 A;  1GGG A;  2R9J A;  4ELO A;  3IR1 A;  3ZKL A;  4BDN A;  2ZYM A;  3VLW A;  2OJT A;  1B7Z A;  3CI8 A;  4LZ5 A;  3TPA A;  4KD5 A;  1TT1 A;  3MQ9 A;  1MH3 A;  1JNF A;  3IB0 A;  3N26 A;  3KOT A;  3PD8 A;  2Q8J A;  1O7T A;  1SI0 A;  4RY1 A;  1US5 A;  1Z7N E;  1N3X A;  4X1D A;  4OEV A;  2UVG A;  1MPC A;  2XXV A;  4OYV A;  2DSF A;  1ZJL A;  5AA4 B;  1B5H A;  1LBB A;  3HHF A;  2XXP A;  4C1T A;  5K2Y A;  4QSE A;  4FEB A;  5KCJ A;  3Q26 A;  3QUF A;  5HM4 B;  3OD7 A;  4GLI A;  2AYS A;  2VD3 A;  4GOT A;  3FJM A;  1VR5 A;  1MDP 1;  1D3K A;  4IGT A;  4IO5 A;  2ZNS A;  4BDL A;  4FOR A;  4JSD A;  3H03 A;  1YTV A;  4U4X A;  4ZE9 A;  3KOS A;  1SBP A;  5L9O A;  1FTJ A;  2QS1 A;  2ZXT A;  3PPO A;  3U94 A;  3TTL A;  3H6U A;  4XIG Q;  1J1N A;  4L17 A;  1LLS A;  4OZ9 A;  2RF1 A;  4NMY A;  1JW5 A;  4XKR A;  4NF5 A;  4RJZ A;  4POW A;  1P1Q A;  3W9V A;  4ESW A;  4LUB A;  4Q8R A;  2ZYN A;  5TU0 A;  4U1O A;  5DVF A;  5CC2 A;  3WAF A;  4IO4 A;  3GBB A;  2A5S A;  3V5A A;  4P0I A;  1VE4 A;  4QFK A;  4Z0I A;  3FVK A;  2XXQ A;  4KPT A;  3VLV A;  2O7I A;  3MVW A;  3IAZ A;  5H8N A;  1D9Y A;  1A54 A;  4AB5 A;  5B7D A;  3OSQ A;  3WAE A;  2Z8D A;  3OO7 A;  3ZS6 A;  1P1O A;  3HO7 A;  2Z23 A;  2RC9 A;  3CFX A;  1II5 A;  1N04 A;  4P0G A;  3IOV A;  1LBC A;  3TYH A;  1DPE A;  3VDF A;  1B5J A;  2B3F A;  2ONR A;  4MBP A;  2PX1 A;  1IEJ A;  1FQC A;  5I57 A;  1FTK A;  2THI A;  2X7P A;  1USY H;  2NUV A;  4OEN A;  1KWH A;  1B0L A;  5I2K B;  3PMW A;  3ILU B;  3O6H A;  2HZK A;  1Q35 A;  3OEM A;  2Y7I A;  4ELQ A;  3DM0 A;  2DE2 A;  2DQV A;  2HAU A;  1EZP A;  1JW4 A;  3JZJ A;  2F97 A;  1PB7 A;  1AH5 A;  4LQ5 A;  1N76 A;  4GWO A;  1F9B A;  4Q30 B;  1B9J A;  3I6V A;  4ONY A;  2GH9 A;  1GV8 A;  1WVJ A;  4G77 A;  2BJJ X;  4OFO A;  3B7D A;  3A3C A;  2Z22 A;  1NNP A;  1EZO A;  1AL3 A;  1B3E A;  2WKY A;  3VV5 A;  1UTH B;  2H5Y A;  4DXU A;  3I5O A;  5LOM A;  3UP9 A;  2DP8 A;  3V83 A;  3HN0 A;  1B6H A;  3T22 A;  5KDT B;  3JV9 A;  2GHB A;  2FNC A;  3CG3 A;  3QXM A;  3N94 A;  4XXU A;  1LCF A;  1LB8 A;  3GLB A;  1AIV A;  1NKX A;  1Y9U A;  4HCW A;  5FTH A;  4PFU A;  1B3L A;  2XXH A;  4LZ8 A;  5AE4 A;  4N13 A;  4ZED A;  3SET A;  4ZE8 A;  3IX1 A;  5KZT A;  1SYH A;  1MM7 A;  2DWA A;  3MZ9 A;  2O51 A;  1ZU0 A;  2H4I A;  3FJG A;  4R9G A;  5DEX A;  3K1M A;  2AL4 A;  1P99 A;  4XKP A;  3RY3 A;  1M5E A;  1SQY A;  1EH3 A;  3OEK A;  1MQG A;  1A8E A;  4H8J A;  3TTR A;  2DS9 A;  3SKP A;  2QMX A;  4MFI A;  4N07 A;  2V3U A;  4JBZ A;  3UIF A;  3V89 B;  4BDO A;  4F2Q A;  5ITO A;  1Y3P A;  4NF6 B;  1XS5 A;  3KJ7 A;  3CSG A;  1BTJ A;  2OCU A;  4F3G A;  2QS4 A;  4OXV A;  1LAF E;  1I69 A;  4G68 B;  4G8M A;  5H8F A;  2LAO A;  4F22 A;  5AA2 D;  3LSL A;  4H6D A;  1PDA A;  5TP9 B;  3G3H A;  5JTY A;  5HPQ A;  3TOD A;  4YKK A;  1POY 1;  5IAI A;  3O6G A;  5F7V A;  2E1S A;  4RXL A;  2H98 A;  2OWT A;  3W9W A;  4NE4 A;  2OBG A;  3ONM A;  1NH7 A;  4MLV A;  1LCT A;  3TCF A;  1B1H A;  1OQH A;  3HHG A;  2DXR A;  3IOU A;  1JEV A;  4TQU Q;  3K2D A;  2O1L A;  4UAC A;  5L9M A;  3LSW A;  4X9T A;  5I2N B;  3DP6 A;  1H76 A;  5H8S A;  5H8H B;  3EF7 A;  4EF1 A;  3H06 B;  4H1X A;  3OO9 A;  5EHM A;  2DWH A;  3H6V A;  3FUZ A;  5B70 A;  1MXU A;  4F39 A;  1LST A;  4BLA A;  3C32 A;  1EZ9 A;  1UIU A;  3R6U A;  4F1U A;  4FJP A;  1MQD A;  4ZEF A;  1PBQ A;  3PUZ E;  4JDF A;  1UTB A;  1B52 A;  4QSC A;  1LAH E;  2F7B A;  2ONS A;  2F7C A;  4PFY A;  4U2R A;  2REG A;  2VP1 A;  3L6G A;  3PV0 E;  3UA8 A;  4G8N A;  3BFU A;  1ZIU A;  2PBW A;  1IIW A;  3PPN A;  1VFE A;  2Y7K A;  3U92 A;  5AA1 A;  5I58 B;  4OES A;  3EPE A;  3F11 A;  1QUI A;  1MH4 A;  2V93 A;  4JSO A;  3U1O A;  1FQB A;  2AL5 A;  1SD3 A;  5CBR A;  1TFD A;  1MRP A;  1SDX A;  4F1V A;  4ZEI A;  4YAH X;  1O64 A;  2Y84 A;  3AXF A;  2DYX A;  3IO6 A;  1QUK A;  4GQO A;  3KGC A;  4EDP A;  3VVD A;  4NED A;  3MJN A;  1MY2 A;  4TOZ A;  4U4S A;  4ZEC A;  2ESN A;  4KYE A;  2V3T A;  3C36 A;  3TFL A;  3T9H B;  5DVJ A;  1RYX A;  1B40 A;  1IXI A;  2H9B A;  3H4Z A;  2O69 A;  3CR9 A;  4JWY A;  1FTM A;  5CBS A;  1FQD A;  2NXO A;  1B7H A;  3OSR A;  5CM6 A;  4EF2 A;  3M3L A;  3VE1 B;  2O68 A;  2HZL A;  4NWD A;  1LFH A;  3K02 A;  1H45 A;  3SEW A;  1JET A;  1N7W A;  4IB2 A;  1MXV A;  2QSX A;  1PBP A;  2I3W A;  1YPN A;  2P2A A;  4E0W A;  1OVB A;  4Z7E A;  4QHQ A;  4I1D A;  1NL5 A;  3G3I A;  4F18 A;  4XKQ A;  4F29 A;  4OFJ A;  2HAV A;  1XVY A;  1LGB C;  2QMW A;  3O28 A;  4OWD A;  2B65 A;  3S9M C;  2A5T B;  2HCA A;  1GR2 A;  1N3W A;  3OMB A;  3EHS A;  1D4N A;  4F3S A;  1SVX B;  4DCY A;  5J1D A;  3KEI A;  3MWB A;  3QYT A;  4M1V A;  1MQI A;  4R74 A;  4RA1 A;  3TTN A;  3C34 A;  4HS7 A;  4QSD A;  2I58 A;  3E4R A;  2UVI A;  3SES A;  2CZL A;  3TZA A;  4LA9 A;  4AQ4 A;  1FTO A;  3IK6 B;  2ABH A;  4Q0C A;  1P1N A;  3TTM A;  4IO7 A;  1R9Q A;  2F6P A;  2PT2 A;  1B2H A;  2X7Q A;  3K1P A;  2Q88 A;  3C33 A;  1JVY A;  3FIR A;  3I3V A;  4BDR A;  3PUW E;  3V8X B;  5FHO A;  2O7U A;  1MG1 A;  4KR5 A;  3IJX B;  4FEC A;  1XVX A;  3RTF B;  1DOT A;  2XXI A;  1BKA A;  2ZYK A;  1UIV A;  3CVG A;  1IQ7 A;  2PMS A;  1MY3 A;  4GF8 A;  4F31 B;  3TQL A;  2F34 A;  3SEX A;  3MZ1 A;  1URG A;  4QFN A;  1WOD A;  3C9H A;  1JW1 A;  4IGR A;  1NFT A;  1HSJ A;  1Y1M A;  3T9V A;  2XXW A;  1XHY A;  3O66 A;  4R9F A;  1B4H A;  1GVC A;  3M3K A;  1URD A;  1B58 A;  2I4C A;  1NH8 A;  2GRV A;  1SI1 A;  3QAX A;  2VOZ A;  5FHM A;  4EXL A;  3LSF B;  1N7X A;  3TCH A;  3CIJ A;  1Y4C A;  5CMB A;  3SER A;  3T66 A;  3TKD A;  3BKI B;  1DTZ A;  4YIC A;  4DE8 A;  1ELJ A;  2Q9T A;  1AMF A;  4DDD A;  3FAS A;  2R6G E;  1A7L A;  4G4P A;  3D4G A;  5K2X A;  1MXX A;  4KFQ A;  1MM6 A;  3LR1 A;  2P0S A;  3E13 X;  1OLA A;  1VFD A;  2I6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...