2XWVA

Siap complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
309
structure length
309
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tripartite ATP-Independent Periplasmic (Trap) Transporters Use an Arginine-Mediated Selectivity Filter for High Affinity Substrate Binding.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 124
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2010-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xwvA00
2V4CA 2HZKA 4P56A 4XF5A 4OVPA 4UABA 5I5PA 4PF6A 4PFBA 4MEVA 4MNPA 4PAKA 2XWVA 2ZZXA 5LTCA 4P47A 4PDDA 4PBHA 4X04A 4NX1A 4P1EA 4MHFA 2PFYA 4N8GA 3GYYA 4NAPA 4PGPA 2HPGA 4O7MA 4PCDA 2XWOA 4N15A 4PAIA 4X8RA 2CEYA 2WYKA 4MAGA 4N17A 4P9KA 4PFIA 4PDHA 4NQ8A 4N4UA 2ZZWA 2HZLA 4NG7A 4LN5A 4NN3A 4PC9A 4MIJA 4MMPA 4MNCA 5I7IA 4DI4B 4O94A 4PETA 4OVRA 4OVQA 2XWKA 5IZZA 4N91A 4XEQA 4MNIA 4NHBA 4PAFA 4PGNA 2CEXA 3B50A 2ZZVA 4PE3A 4XFEA 4N6DA 2WYPA 5CM6A 4NF0A 4P3LA 2VPNA 4MCOA 4OVTA 4P8BA 4OVSA 5IM2A 3U65A 4P1LA 2PFZA 4MX6A 2VPOA 4O8MA 4N6KA 5IGAA 4PFRA 4YICA 2XWIA 4PF8A 4NGUA 4DI3D 2WX9A 4OANA 4OA4A 4YZZA 2XXKA 3FXBA 4PBQA 2XA5A 4N8YA
chains in the Genus database with same CATH superfamily
1MH4A 2OCUA 4XF5A 3C33A 1B1HA 4ELQA 5KDTB 1ANFA 1YPNA 5I2KA 2I0CA 5AA4B 3LUZA 3O97A 1P1WA 5ELVA 4ESWA 3H06B 3T66A 1QULA 4N6PA 1QKBA 5HPQA 4N8GA 1YCJA 5EYGA 4PGPA 2OX3A 1PB7A 4IO4A 2R9JA 3IOVA 3UN6A 2O84X 1DPPA 4JBZA 5AA1A 3BIGA 1XVYA 3ISPA 3IX1A 1A7LA 4ISUA 3KN3A 1LFHA 3FXUA 5L9OA 3KGCA 4OQOA 3E79A 3PPNA 3MBPA 3IORA 4I9DA 3OSQA 3MVYA 1LBVA 5IZZA 2G93A 3IJOB 1Y4CA 5A5XB 4MFIA 4ECFA 4RPOA 3B50A 4PE3A 2RCAA 4G68A 3MPLA 1HSLA 1LCFA 2ZNUA 4IO3A 2RKMA 2FHYA 2I0BA 3KZGA 1LLSA 1D4NA 5IAIA 2P1SA 3RPWA 3C35A 1A8EA 2PX1A 1A40A 1M5BA 5I56B 2XD3A 2FIEA 3LSXA 3QUJA 4KPTA 1GR2A 5EYFA 5IGAA 4GD5A 1FBCA 4NGUA 4OANA 4YZZA 4OENA 1Q35A 4FE8A 4RJZA 3B7DA 4NEDA 3FVKA 4OEUA 4Z0IA 4ZDMA 3CVGA 4O3AA 1BK4A 1AL3A 1FQEA 1IMDA 4G8NA 1P1NA 4DCXA 4EXKA 2F7AA 2XWVA 4ESXA 3PV0E 1B52A 5F7VA 1OMPA 2OBGA 3W9VA 4DXUA 3RT6B 2H4IA 4C1UA 2KQZA 4NAPA 4KFQA 2Z22A 4PAIA 4H65A 3SEXA 4PTKA 1LBZA 4KR5A 4N17A 2F8DA 2Q9TA 4QBAA 2XX8A 1M5FA 2Q2CA 5DYHA 1POTA 1MXYA 4MIJA 5EQAA 1H44A 1JW5A 2B65A 1USYH 1WVJA 2RINA 1OQHA 2XXQA 2CZKA 3K01A 4NHBA 4ZEKA 3CIJA 4F1VA 2CEXA 4I8CA 3V5AA 1H43A 3M3FA 4FIMA 4JSOA 4FEDA 3ZSFA 1MPDA 1B7HA 3EHSA 2OK2A 4Q0CA 3I3VA 4P0GA 3O66A 2XXVA 4JB7A 3OO9A 4PFTA 1P1OA 3CG1A 4G8HA 1G0HA 2PYYA 5KZTA 2P3NA 2QVVA 2VGQA 5CMMA 5TPAA 3TFLA 3K0VA 1LAHE 1OLAA 2HZKA 2DQVA 4R74A 1I6BA 4PF6A 2G29A 1G0IA 4I62A 1QKAA 2IEEA 4TOZA 4LATA 4ELRA 4OESA 4HCWA 1R9QA 4YKJA 3MSTA 4QFKA 3BFUA 1EH3A 2H25A 3GYYA 4QF9A 1ZIUA 2QMXA 4LZ5A 4HXVA 2ONKE 4X8RA 4KXPA 5J1DA 1NV5A 1EYIA 1USYE 4IGRA 3TTRA 3IR1A 1SBPA 2VP1A 2B3FA 5FTHA 3MC2A 2WEFA 2Z8EA 3E13X 3FBPA 4U22A 1L5TA 3MZBA 2DE2A 4R6KA 2NXOA 3K02A 1S9TA 1NNKA 4ELPA 2O68A 4PAFA 1MY3A 3KG2A 1LBYA 3KBZA 5J16A 4U23A 2ZZVA 4DIGA 4F29A 5AA4A 3N26A 4ZEBA 1A54A 4F3GA 5I2KB 4GRKA 3B8BA 1RDXA 4Z7EA 3C4MA 2PFZA 3VXBA 5CBRA 1PBQA 3W15C 3PMVA 2I49A 4O8MA 4WEPA 3K2DA 4UACA 2PCRA 4PF8A 3TCFA 4OA4A 1VFEA 5K2XA 3SDFA 1MXWA 4E0XA 5CMCA 5JTYB 3VE1B 2F35A 3FD3A 2DYXA 4NTLA 4WXJA 2XXPA 3IFAA 3PD8A 1BIYA 1IMCA 4NWDA 2X7QA 3IJXB 1ZMGA 5LOMA 3UA8A 1FBFA 2HQ0A 3CSBA 5ET6A 3RNNA 2F78A 3T9VA 1TFAA 2UYFA 3UIFA 4I40A 5ISUA 3HSTA 4JVIA 3E3KA 4RXLA 1US4A 2XXHA 4O3BA 1AOVA 5I7IA 3GZGA 1A99A 4JWOA 1NV2A 4EF2A 1LCTA 1B6HA 2OZZA 3Q25A 1S7YA 1FPKA 1ZJLA 2AIXA 2O7IA 2ZMBA 3M3KA 4AS5A 1CE2A 2ANJA 3H3GA 5EQ8A 4XFEA 2PT2A 3MP1A 3DP6A 1NH7A 4NF0A 4E0WA 3PD9A 4MCOA 4G2ZA 1FPJA 5FTIA 5FHNA 1B51A 1RDYA 3FVGA 1H45A 3MJNA 1A55A 1FPFA 4GX3A 3TPAA 3MUQA 3S9EA 1CB6A 1ELJA 1B3EA 1FCKA 2ONRA 4YICA 5DW8A 1FJ9A 3CR9A 2GHBA 3N5LA 4IY5A 1US5A 5DEXA 1F9BA 5FHOA 1RYXA 4AB6A 3R6UA 1B2HA 1XC1A 1NNTA 2AYSA 4PFBA 1NKXA 3L6HA 1NFTA 2PMSA 1MM6A 1TXFA 2H99A 2NWJA 3M3LA 5H8SA 5TPAB 4ND9A 4EDPA 2E1SA 1B3LA 3PPQA 3T93B 4XKRA 3PUXE 1NV7A 5F24A 1DTGA 4O3CA 3OEMA 1IQ7A 3U92A 1MY1A 2V3UA 4MNCA 2RC9A 1Y9UA 4IR8A 2O6AA 3K6XA 3KJ7A 4FORA 4YKIA 1LSTA 5IZ3B 3Q29A 2WKYA 2HEUA 4NE4A 3HCQA 4XIGQ 1H76A 2Y5LA 4BDMA 2QFLA 3DELB 4HE2A 1KZ8A 4F3PA 1XOCA 4N6DA 5CM6A 2GFEA 3RQTA 3KOTA 4OVSA 4O7IA 2DXYA 4P1LA 1QUJA 2VPOA 1AWBA 1MQDA 1BTJA 2ZXTA 4IO7A 1MXUA 3CSGA 3S4UA 1N0TA 2D21A 3RTWB 1B3FA 4I1DA 4OMBA 1FQAA 1PC3A 4TLMB 1O7TA 3O6GA 1URGA 5H8NA 3QIMA 4I3EA 3OMBA 1B0LA 4MNPA 1FTLA 4QHQA 4ZE8A 4U1ZA 4P1EA 1VE4A 2I3WA 3MP8A 2DE3A 3L6GA 3WAEA 3FATA 4O7MA 1B3GA 4HS7A 1I69A 4G61A 1HSJA 5EHSA 4F39A 4ZZAA 1SQYA 1QUIA 2KLFA 4N13A 1MG1A 4FATA 3FIRA 1LAXA 1MQGA 1PEBA 3KJTA 4PFWA 1YAEA 1JW1A 1NV0A 1Z7ME 1IZ1A 1D9VA 1MXXA 4HE1A 4DXBA 4PETA 3VVDA 2A5TA 2ZNTA 4MBPA 1DMBA 4TQUQ 3QAXA 1FBHA 4I3YA 4XEQA 3TTLA 1B46A 3TCGA 4LQ5A 4EQBA 3D1RA 2CZLA 1UTBB 5I59A 5ESYA 3TCHA 1O63A 1KWHA 1MPCA 4KCCA 2DVCA 2DVZA 5H8NB 1M5CA 3DLNA 3FVNA 3GXAA 3HO7A 4AQ4A 3WAFA 4XKQA 1UTHB 3S2VA 4R6YA 2RC8A 4N07A 3Q28A 4GWYA 4Q8RA 2REGA 3EF7A 4NF5B 1B05A 1SYHA 3OEKA 5FHMA 3ROJA 1JNFA 2R71A 2GH9A 2FA7A 2MKZA 4BDNA 4PQJA 2O1MA 1D3KA 3GBAA 4RY1A 2XXYA 4F3BA 2Q89A 3PUZE 2HAUA 1SVXB 1AMFA 4GWXA 1INPA 2VT5A 4QSDA 1MH3A 2O1LA 1IMAA 3LSFB 1LBBA 3MVZA 2THIA 5ET7A 2I4CA 4GF8A 3H7MA 5I56A 4ZECA 1B32A 3SERA 3I6VA 4EQ7A 3IB2A 4YB6A 3VLUA 4G4PA 4KYDA 1POY1 1AH5A 3DM0A 3U94A 1FJ6A 2XXTA 2QRYA 2XXRA 3VVEA 1ZU0A 3T96B 1SYIA 1KA1A 5TP9A 4H8IA 3E78A 4FAJA 4G68C 5DEXB 1Y20A 1IEJA 3FV2A 3O28A 4GFRA 3K1NA 1LGBC 2R6GE 5DVFA 4C1TA 3T9XB 1LFGA 2D3IA 4ZS9A 5ITOA 2QJEA 2WBDA 4RK9A 2NOOA 4MX6A 1IXIA 4QXDA 5EYHA 3ECRA 5I84A 2HAVA 3RY3A 4U21A 2ESNA 3ILUB 1B4HA 3T1BA 1Y1ZA 2XWIA 1FBGA 3RTFB 1N3WA 1OVTA 1FTOA 2RF1A 2ZYMA 4R73A 1B58A 2LAOA 2V25A 2CMOA 1H3DA 2XXKA 2ZYOA 4JWXA 3SEVA 3O29A 2QS1A 5FBPA 1M5EA 2Z23A 3IL1B 3IB1A 2XXUA 1NV6A 4MEVA 2ONSA 1Y3NA 4PDDA 5CC2A 2FVZA 5HBCA 4X04A 1LB8A 1FPBA 2QMWA 3KBRA 1OIBA 3CHGA 4GWWA 3BFTA 2ALUA 2V93A 4YB7A 1MPBA 4HCYA 1T0KA 2F36A 5A5LA 1JQFA 1FTJA 2QS3A 3HHFA 5BWJA 3S9MC 3UORA 2WYKA 3IOTA 4OZ9A 3QUFA 2PBWA 4AS4A 5JK4A 1N84A 2DP8A 5K2YA 1FPLA 1JVXA 3N94A 3OENA 2FYIA 1CNQA 2HFBA 2O69A 2Z8FA 2I6EA 3KC0A 1FBEA 2XXXA 4H46A 2CZHA 2UXAA 4JWYA 3HFUA 3G3HA 1NV4A 4IB2A 1QVSA 2X7PA 2DSFA 3E4RA 1D9QA 5DVJA 2VOZA 2QPQA 1GGGA 5I58A 2Y7RA 2B3BA 4YKKA 4GVOA 3SZPA 1MXZA 3VLVA 4GL8A 4DI3D 5AE4A 3PUVE 4DE8A 4HE0A 4YU0A 1B5JA 3MQ9A 2NUVA 3K1MA 5I5PA 3GBBA 1A8FA 2OWZA 2DOJA 2DS9A 3TZAA 4RNSA 4DCYA 4PBHA 3FJMA 1R9LA 5H8QA 3IAZA 4R6HA 3UP9A 1MXVA 5CI5A 3RN8A 3G3GA 4HTGA 3TELA 3TTKA 5TU0A 4MAGA 4LUBA 2ZYKA 2QVUA 4NMYA 3NOHA 3HN0A 4NQ8A 3FVOA 3QYTA 2P3VA 3CRBA 1B1XA 4R9FA 4LP2B 4PFUA 3SKPA 2FIXA 4OFLA 4KD5A 5ET5A 4LONB 5I2NA 3D4CA 3C9HA 3FXQA 5ET8A 1NUXA 2XWKA 3FJGA 4POWA 4DLDA 2VD3A 2GQ1A 2DWHA 4IGTA 4NF8B 3KSJA 1FW0A 4GX6A 5CMKA 4IO2A 4R75A 2A5SA 4BDQA 3FZVA 1FQDA 1NUZA 4JVDA 3C36A 4K3FA 4GBWA 4PFRA 2F6GA 3RUMA 1IXCA 3O2AA 1N3XA 1EZOA 2Y84A 2HHMA 3PPRA 3PUYE 1WODA 3FUZA 3O6HA 4PP0A 3LSLA 3RPLB 3Q27A 1VSOA 2DE4A 2XX9A 2H98A 2QS2A 3TAJA 1Y4TA 1NNPA 3EHUA 4QFPA 3PTYA 4NX1A 2XXIA 1URSA 4RA1A 4X1BA 1SW2A 1AIVA 2O51A 2XWOA 3QMFA 4F18A 5BUUA 3THIA 2OJTA 3AXFA 4BDLA 2F3BA 3EPEA 2HCAA 4OETA 4AB5A 3HV1A 4ZE9A 1P1QA 1NV1A 5H8HA 5IKBA 1VDWA 3VLWA 2JJKA 5ICQA 1JP4A 5CRYA 2DWJA 3S9LC 3I5OA 1N7WA 1K9ZA 4FJPA 1JEVA 4OFJA 3TDJA 3EHTA 2YPNA 3B6WA 3UGWA 1B4ZA 2P0SA 3V89B 4GWSA 3S9NC 4OHNA 3A3CA 2A5TB 3G7WA 1XT8A 3CI8A 3EKIA 2RC7A 5IZ1A 1FPGA 2E0SA 1VFDA 3MYUA 5AA2A 3A09A 4KCDA 4PFYA 1ZKBA 3U65A 3PPPA 2Y7WA 3OELA 1OQGA 3OXNA 1B7UA 3PUWE 3LUYA 5H8FB 4NF8A 1FRPA 1VR5A 3V8XB 2NVUB 3H03A 4JVCA 1SW1A 2XA5A 3IK6B 2V4CA 1NNFA 1B40A 5DT6A 5L8DA 3FGSA 4ZZEA 3KN7A 4KHZE 4R2FA 3H6WA 4U4SA 3QSLA 1XVXA 1MRPA 2QL3A 4MHFA 5A5XA 2Q8JA 4LZ7A 4OXVA 2V3TA 2ZYNA 3FV1A 5AA2D 2F97A 2L5VA 1YXIA 3C32A 1MQJA 2CEYA 3MWBA 4OWDA 5I2NB 3SEUA 4PDHA 5H8QB 3Q26A 4BLAA 2ZZWA 2I58A 4QSCA 1ZBMA 2Y7PA 4ONYA 2PVUA 2UVGA 1M5DA 4QFNA 1NL5A 4NN3A 5M2VA 1EYJA 4OFOA 4LQ2A 5KDTA 4JXIA 1LBWA 4H6DA 4N91A 3K6VA 2BJIA 5IZ3A 1MY2A 1OLCA 3CFLA 3EN3A 2Y5KA 1LB9A 1DSNA 4DZ1A 1QGXA 3MAMA 3DP4A 2FBPA 4EUOA 4N81A 3IO6A 4GOTA 3U8QA 3TUSA 5JEIA 1Z7NE 1NUWA 1DK4A 3JYRA 5KCJA 1LAFE 4Q5TA 4YB5A 1PBPA 4F1UA 1B0HA 1YYZA 4XXUA 3KSXA 1JETA 3LR1A 2F7CA 3TKDA 3LC8A 2FNCA 4ZEIA 4ZEDA 1FPEA 1ZLQA 1LFIA 2F3DA 4OERA 2Z8DA 5LTCA 5L9MA 1Y3QA 5EHMA 1GVCA 5JTYA 3K6WA 2AL4A 4XKNA 1ZTYA 4OEVA 2B4LA 4QFOA 1IMEA 3TMGA 5KCJB 1SD3A 4F2QA 4H5FA 4GBVA 2H9BA 1SW5A 1S50A 2VD2A 4GWUA 3TEPA 2QSXA 3B6QA 4H5GA 3ONMA 4OYVA 3PMWA 4MF3A 1SI0A 2XX7A 4DI4B 4YKPA 1B5IA 2F7BA 4OVRA 3M8UA 2UVHA 4KYSA 1YTVA 4MNIA 1PB8A 2F5XA 3OO7A 3ZS6A 3R26A 1URDA 2GRVA 1IITA 1FBPA 2WYPA 5ITPA 3OO8A 4OVTA 2QVRA 4P8BA 1LBXA 3O6IA 3ZKLA 1FPIA 2UVJA 4OVJA 1GTKA 2XD2A 1NUYA 2DXRA 3EQ1A 3VDFA 4H1XA 4M1VA 3USDA 1Q9DA 5CBSA 4PBQA 4ELOA 5HM4B 4U4XA 4P56A 3P7IA 3RGYA 4F19A 3IO4A 1XS5A 3H6VA 1FQCA 3F11A 3KEIA 2Q2AA 1J1NA 3T9HB 4NF6B 3H4ZA 1Y3PA 3JV9A 2Q74A 2Q8MA 4LZ8A 1XHYA 2YLNA 4ZEFA 2CZIA 2HPGA 4OTEA 4PCDA 3T9UA 4N15A 3IB0A 1EYKA 1MY0A 1RKMA 4C0RA 1SDXA 1MM7A 2OWSA 1IMBA 5DVIA 3N6TA 1FTMA 4GX4A 3ILTB 4RK2A 3CFXA 3BKIB 2DWAA 3VXCA 1B3HA 5AA2B 2R8TA 4PC9A 4MMPA 3KC1A 2V3QA 3MVWA 1N76A 3FJ7A 3E9XA 4IY6A 3BIHA 1IMFA 1IIWA 4JSDA 3H6UA 4GLIA 1B7ZA 3RLFE 4QSEA 4EF1A 2ZNSA 5I3SA 2F34A 1UTHA 2VPNA 1LAGE 4IO6A 4H67A 4BDRA 5IM2A 2WBBA 4POXA 3OD7A 2W7YA 5H8HB 5L9SA 1R1NA 1N7XA 3G3FA 4P11A 3TTMA 3RT8A 1UQWA 4H0WA 4NF5A 4QFLA 3ZKKA 1JW4A 3QK6A 4YMBA 2I3VA 1R6ZA 2KR0A 1FQFA 1ATGA 3FXBA 4H45A 4P9KA 3HHGA 1EZPA 1EU8A 1P1UA 4F2OA 4R9GA 4OVPA 2GHAA 3RYDA 1I6QA 1GV8A 2Y7IA 2ZZXA 4RYAA 5I59B 1UTBA 1K9YA 5EQ9A 2XXWA 3CG3A 1DOTA 4DDDA 1DBZA 2IA4A 3H6TA 3U1OA 3G3JA 5H8FA 3MVXA 3IOWA 4DXCA 2REJA 4LN5A 5EQ7A 1O64A 4KQPA 4GWZA 3FXRA 4THIA 3G3IA 3MW0A 4MH5A 2OWTA 3ODBA 4G68B 4RPNA 1NH8A 3SEYA 4GXSB 3KFMA 3JZJA 4PGNA 4R72A 3TQLA 4MJOA 3PMXA 1FTAA 1WDNA 1MQHA 3TTNA 1FSAA 3VFJA 2HXWA 4LA9A 1P99A 1B5HA 1UIVA 2UYEA 4KYEA 3PU5A 3TODA 1QJMA 4F22A 4U1OA 4FBPA 1JVYA 4FECA 4L17A 2XHDA 1RDZA 1PDAA 3IFCA 1XI6A 5B70A 2DDKA 2WX9A 3C31A 5ICTA 1IUDA 3QXMA 3LBSA 1LEVA 3IOUA 4WEDA 4GQOA 4X48A 2H5YA 4GIZA 5AA3A 4KI0E 1TFDA 1BKAA 2F6PA 4PAKA 4QRZA 4P47A 2I4BA 3MP6A 4YMAA 1JEUA 3C34A 1SW4A 3MPKA 3RPLA 1MY4A 1DPEA 1DTZA 3MZ9A 4F31B 4EXLA 3T22A 3GLBA 5LDZA 3OO6A 1UIUA 5CMBA 3U72A 1NV3A 3G3KA 4NG7A 1N04A 1SPIA 1SI1A 4G8MA 3U93A 3SESA 2I48A 4TLLB 2O7UA 1HSEA 4JDFA 4OVQA 4MLVA 3TYHA 1MDQA 3PPOA 1DCUA 2AL5A 1MS7A 1I6AA 3SETA 1FPDA 4NF6A 1TWYA 4G77A 4P3LA 4MLQA 3B6TA 4FEBA 3V83A 1EZ9A 4GWOA 2M8CA 3FASA 3SEWA 3O9PA 2QS4A 2P2AA 3A29A 3OSRA 3LV0A 1RYOA 4F3SA 3KN8A 3LSWA 1NMUA 4NWCA 1D9YA 4UABA 3K00A 1QUKA 4YAHX 1FTKA 5F1QA 3K4UA 2V84A 2YJPA 2PFYA 3T0JA 2BJJX 3KOSA 4U2RA 3HPIA 4GXAA 4X9TA 2B4MA 3OOAA 3R7XA 2RCBA 3PGFA 1YZ0A 4LVQA 2ABHA 2UVIA 1II5A 4X1DA 4PFIA 2OLBA 3K6UA 3UK4A 1FQBA 4N4UA 5I58B 2Q88A 4UA8A 2HXRA 4H8JA 2HZLA 1IXGA 3N6UA 1QW0A 4WKMA 4Q30B 4NF4A 1FBDA 4EQ9A 4M4GA 3D4GA 4R2BA 4O94A 5I57A 5DTBA 3BBRA 4BDOA 1PB9A 3A3UA 3K1PA 1NI9A 1TT1A 2DWIA 1BP5A 4P0IA 1MDP1 1OVBA 3DP8A 5TP9B 2PT1A 3CFZA 2VHAA 5I57B 4HW8A 1Y1MA 2D5WA 1Q1KA 2Y7KA 4NF4B 4IO5A 5B7DA 3W9WA 3VVFA 4PE5B 1IXHA 1B9JA 4XKPA 3MZ1A 4F1YA 3VV5A 4XTCQ 1KA0A 1BLFA 4N6KA 3TQWA 4GL0A 1MQIA 2X26A 1LBCA 5T3JA 4N8YA
chains in the Genus database with same CATH topology
2V4CA 1BK4A 2HZKA 4P56A 1IMDA 4XF5A 5FBPA 4F19A 5IZ3B 3RPLB 4I3EA 4OVPA 4UABA 1FPEA 4PF6A 4PFBA 2MKZA 3RYDA 5I5PA 1NV6A 1G0IA 4MEVA 4MNPA 2DE4A 2F3DA 2OWZA 4PAKA 2XWVA 2ZZXA 3IFAA 5LTCA 4P47A 4HCWA 1IMCA 3LUZA 4PDDA 1K9YA 2FVZA 5EQ9A 4PBHA 3RPLA 4X04A 3PTYA 3MSTA 4NX1A 1FPBA 3W9VA 4P1EA 2Q74A 3CHGA 4GWWA 4MHFA 2Q8MA 2PFYA 2DE3A 4N8GA 3T0JA 3GYYA 5EYGA 2KQZA 4NAPA 4PGPA 2B4LA 2OX3A 1FBFA 2CZIA 2HPGA 4GWXA 1INPA 4HCYA 2VT5A 1DBZA 2XWOA 3QMFA 4O7MA 4PCDA 2L5VA 4X9TA 5ET6A 4F18A 5A5LA 1YXIA 4HXVA 1IMEA 1IMAA 2B4MA 4N15A 4G61A 4KXPA 2CEYA 2F3BA 1NV5A 4PAIA 4X8RA 1EYKA 5J1DA 1YZ0A 2WYKA 5ET7A 3BIGA 4PBQA 1EYIA 4MAGA 4PTKA 1LBZA 4GBVA 3ISPA 4N17A 2QVUA 4P9KA 4PFIA 4PDHA 3NOHA 1IMBA 4GWUA 4I40A 4AS4A 5JK4A 2Q9TA 1NV1A 1NV7A 4N4UA 4NQ8A 4QBAA 1NV3A 1FPLA 5F24A 2HXRA 2ZZWA 4GX4A 2HZLA 1VDWA 2P3VA 2JJKA 4JVIA 2WEFA 4NG7A 1SPIA 1JP4A 4LN5A 1CNQA 5EQ7A 2FIXA 1NV0A 1FBDA 4GWZA 1K9ZA 4NN3A 5ET5A 3E79A 2R8TA 3FBPA 4HE1A 1FJ6A 1EYJA 4MIJA 3KC0A 4MMPA 4MNCA 3KC1A 4O94A 4PC9A 1FBEA 5EQAA 4PETA 4DI4B 5I7IA 2V3QA 1LBWA 4IR8A 4OVRA 1KA1A 4H46A 1NV2A 2CZHA 4OVQA 5ET8A 1NUXA 2XWKA 2DE2A 3E78A 1LBVA 5IZZA 4N91A 1FBHA 4I3YA 1NI9A 2BJIA 4XEQA 2CZKA 3HFUA 1DCUA 1IMFA 3BIHA 4MNIA 4NHBA 4PAFA 2GQ1A 2F5XA 4PGNA 4GWSA 1FPKA 5IZ3A 4MJOA 1LBYA 3KBZA 4F1VA 2CEXA 4AS5A 2Y5LA 3B50A 1NV4A 1FTAA 5J16A 2ZZVA 4PE3A 3D1RA 5EQ8A 1FPDA 2QFLA 1FSAA 4XFEA 4HE2A 4GX6A 1KZ8A 2Y5KA 3EKIA 5I3SA 5ESYA 4N6DA 1FBPA 2WYPA 5CM6A 4NF0A 4P3LA 1QGXA 2FHYA 1FPGA 2VPNA 4MCOA 3MYUA 5IZ1A 1D9QA 4OVTA 2FBPA 2QVRA 1FPJA 3B8BA 1RDXA 2WBDA 3W9WA 4P8BA 4OVSA 2DVZA 4N81A 4O7IA 1LBXA 5IM2A 3U65A 1RDYA 4P1LA 2QPQA 2PFZA 4MX6A 2WBBA 4QXDA 1FPFA 5EYHA 2VPOA 4GX3A 1AWBA 1FPIA 1NUZA 4FBPA 4JVDA 4O8MA 2FIEA 1KA0A 5LDZA 1G0HA 1NUWA 4GBWA 4N6KA 5IGAA 1NUYA 1RDZA 1DK4A 3SZPA 3T1BA 1FBCA 4PFRA 3A29A 4YICA 3IFCA 2XWIA 5DW8A 2PCRA 1FBGA 4GWYA 3LV0A 1XI6A 1FJ9A 4F1UA 4PF8A 4NGUA 2DDKA 4DI3D 1FRPA 2P3NA 2WX9A 4M1VA 2HHMA 4OA4A 4OANA 4YZZA 1YYZA 2QVVA 4JVCA 2KR0A 4HE0A 2XXKA 1LEVA 1Q9DA 3ROJA 3FXBA 4H45A 2XA5A 5T3JA 4N8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4C A;  2HZK A;  4P56 A;  4XF5 A;  4OVP A;  4UAB A;  5I5P A;  4PF6 A;  4PFB A;  4MEV A;  4MNP A;  4PAK A;  2XWV A;  2ZZX A;  5LTC A;  4P47 A;  4PDD A;  4PBH A;  4X04 A;  4NX1 A;  4P1E A;  4MHF A;  2PFY A;  4N8G A;  3GYY A;  4NAP A;  4PGP A;  2HPG A;  4O7M A;  4PCD A;  2XWO A;  4N15 A;  4PAI A;  4X8R A;  2CEY A;  2WYK A;  4MAG A;  4N17 A;  4P9K A;  4PFI A;  4PDH A;  4NQ8 A;  4N4U A;  2ZZW A;  2HZL A;  4NG7 A;  4LN5 A;  4NN3 A;  4PC9 A;  4MIJ A;  4MMP A;  4MNC A;  5I7I A;  4DI4 B;  4O94 A;  4PET A;  4OVR A;  4OVQ A;  2XWK A;  5IZZ A;  4N91 A;  4XEQ A;  4MNI A;  4NHB A;  4PAF A;  4PGN A;  2CEX A;  3B50 A;  2ZZV A;  4PE3 A;  4XFE A;  4N6D A;  2WYP A;  5CM6 A;  4NF0 A;  4P3L A;  2VPN A;  4MCO A;  4OVT A;  4P8B A;  4OVS A;  5IM2 A;  3U65 A;  4P1L A;  2PFZ A;  4MX6 A;  2VPO A;  4O8M A;  4N6K A;  5IGA A;  4PFR A;  4YIC A;  2XWI A;  4PF8 A;  4NGU A;  4DI3 D;  2WX9 A;  4OAN A;  4OA4 A;  4YZZ A;  2XXK A;  3FXB A;  4PBQ A;  2XA5 A;  4N8Y A; 
#chains in the Genus database with same CATH topology
 1MH4 A;  2OCU A;  4XF5 A;  3C33 A;  1B1H A;  4ELQ A;  5KDT B;  1ANF A;  1YPN A;  5I2K A;  2I0C A;  5AA4 B;  3LUZ A;  3O97 A;  1P1W A;  5ELV A;  4ESW A;  3H06 B;  3T66 A;  1QUL A;  4N6P A;  1QKB A;  5HPQ A;  4N8G A;  1YCJ A;  5EYG A;  4PGP A;  2OX3 A;  1PB7 A;  4IO4 A;  2R9J A;  3IOV A;  3UN6 A;  2O84 X;  1DPP A;  4JBZ A;  5AA1 A;  3BIG A;  1XVY A;  3ISP A;  3IX1 A;  1A7L A;  4ISU A;  3KN3 A;  1LFH A;  3FXU A;  5L9O A;  3KGC A;  4OQO A;  3E79 A;  3PPN A;  3MBP A;  3IOR A;  4I9D A;  3OSQ A;  3MVY A;  1LBV A;  5IZZ A;  2G93 A;  3IJO B;  1Y4C A;  5A5X B;  4MFI A;  4ECF A;  4RPO A;  3B50 A;  4PE3 A;  2RCA A;  4G68 A;  3MPL A;  1HSL A;  1LCF A;  2ZNU A;  4IO3 A;  2RKM A;  2FHY A;  2I0B A;  3KZG A;  1LLS A;  1D4N A;  5IAI A;  2P1S A;  3RPW A;  3C35 A;  1A8E A;  2PX1 A;  1A40 A;  1M5B A;  5I56 B;  2XD3 A;  2FIE A;  3LSX A;  3QUJ A;  4KPT A;  1GR2 A;  5EYF A;  5IGA A;  4GD5 A;  1FBC A;  4NGU A;  4OAN A;  4YZZ A;  4OEN A;  1Q35 A;  4FE8 A;  4RJZ A;  3B7D A;  4NED A;  3FVK A;  4OEU A;  4Z0I A;  4ZDM A;  3CVG A;  4O3A A;  1BK4 A;  1AL3 A;  1FQE A;  1IMD A;  4G8N A;  1P1N A;  4DCX A;  4EXK A;  2F7A A;  2XWV A;  4ESX A;  3PV0 E;  1B52 A;  5F7V A;  1OMP A;  2OBG A;  3W9V A;  4DXU A;  3RT6 B;  2H4I A;  4C1U A;  2KQZ A;  4NAP A;  4KFQ A;  2Z22 A;  4PAI A;  4H65 A;  3SEX A;  4PTK A;  1LBZ A;  4KR5 A;  4N17 A;  2F8D A;  2Q9T A;  4QBA A;  2XX8 A;  1M5F A;  2Q2C A;  5DYH A;  1POT A;  1MXY A;  4MIJ A;  5EQA A;  1H44 A;  1JW5 A;  2B65 A;  1USY H;  1WVJ A;  2RIN A;  1OQH A;  2XXQ A;  2CZK A;  3K01 A;  4NHB A;  4ZEK A;  3CIJ A;  4F1V A;  2CEX A;  4I8C A;  3V5A A;  1H43 A;  3M3F A;  4FIM A;  4JSO A;  4FED A;  3ZSF A;  1MPD A;  1B7H A;  3EHS A;  2OK2 A;  4Q0C A;  3I3V A;  4P0G A;  3O66 A;  2XXV A;  4JB7 A;  3OO9 A;  4PFT A;  1P1O A;  3CG1 A;  4G8H A;  1G0H A;  2PYY A;  5KZT A;  2P3N A;  2QVV A;  2VGQ A;  5CMM A;  5TPA A;  3TFL A;  3K0V A;  1LAH E;  1OLA A;  2HZK A;  2DQV A;  4R74 A;  1I6B A;  4PF6 A;  2G29 A;  1G0I A;  4I62 A;  1QKA A;  2IEE A;  4TOZ A;  4LAT A;  4ELR A;  4OES A;  4HCW A;  1R9Q A;  4YKJ A;  3MST A;  4QFK A;  3BFU A;  1EH3 A;  2H25 A;  3GYY A;  4QF9 A;  1ZIU A;  2QMX A;  4LZ5 A;  4HXV A;  2ONK E;  4X8R A;  4KXP A;  5J1D A;  1NV5 A;  1EYI A;  1USY E;  4IGR A;  3TTR A;  3IR1 A;  1SBP A;  2VP1 A;  2B3F A;  5FTH A;  3MC2 A;  2WEF A;  2Z8E A;  3E13 X;  3FBP A;  4U22 A;  1L5T A;  3MZB A;  2DE2 A;  4R6K A;  2NXO A;  3K02 A;  1S9T A;  1NNK A;  4ELP A;  2O68 A;  4PAF A;  1MY3 A;  3KG2 A;  1LBY A;  3KBZ A;  5J16 A;  4U23 A;  2ZZV A;  4DIG A;  4F29 A;  5AA4 A;  3N26 A;  4ZEB A;  1A54 A;  4F3G A;  5I2K B;  4GRK A;  3B8B A;  1RDX A;  4Z7E A;  3C4M A;  2PFZ A;  3VXB A;  5CBR A;  1PBQ A;  3W15 C;  3PMV A;  2I49 A;  4O8M A;  4WEP A;  3K2D A;  4UAC A;  2PCR A;  4PF8 A;  3TCF A;  4OA4 A;  1VFE A;  5K2X A;  3SDF A;  1MXW A;  4E0X A;  5CMC A;  5JTY B;  3VE1 B;  2F35 A;  3FD3 A;  2DYX A;  4NTL A;  4WXJ A;  2XXP A;  3IFA A;  3PD8 A;  1BIY A;  1IMC A;  4NWD A;  2X7Q A;  3IJX B;  1ZMG A;  5LOM A;  3UA8 A;  1FBF A;  2HQ0 A;  3CSB A;  5ET6 A;  3RNN A;  2F78 A;  3T9V A;  1TFA A;  2UYF A;  3UIF A;  4I40 A;  5ISU A;  3HST A;  4JVI A;  3E3K A;  4RXL A;  1US4 A;  2XXH A;  4O3B A;  1AOV A;  5I7I A;  3GZG A;  1A99 A;  4JWO A;  1NV2 A;  4EF2 A;  1LCT A;  1B6H A;  2OZZ A;  3Q25 A;  1S7Y A;  1FPK A;  1ZJL A;  2AIX A;  2O7I A;  2ZMB A;  3M3K A;  4AS5 A;  1CE2 A;  2ANJ A;  3H3G A;  5EQ8 A;  4XFE A;  2PT2 A;  3MP1 A;  3DP6 A;  1NH7 A;  4NF0 A;  4E0W A;  3PD9 A;  4MCO A;  4G2Z A;  1FPJ A;  5FTI A;  5FHN A;  1B51 A;  1RDY A;  3FVG A;  1H45 A;  3MJN A;  1A55 A;  1FPF A;  4GX3 A;  3TPA A;  3MUQ A;  3S9E A;  1CB6 A;  1ELJ A;  1B3E A;  1FCK A;  2ONR A;  4YIC A;  5DW8 A;  1FJ9 A;  3CR9 A;  2GHB A;  3N5L A;  4IY5 A;  1US5 A;  5DEX A;  1F9B A;  5FHO A;  1RYX A;  4AB6 A;  3R6U A;  1B2H A;  1XC1 A;  1NNT A;  2AYS A;  4PFB A;  1NKX A;  3L6H A;  1NFT A;  2PMS A;  1MM6 A;  1TXF A;  2H99 A;  2NWJ A;  3M3L A;  5H8S A;  5TPA B;  4ND9 A;  4EDP A;  2E1S A;  1B3L A;  3PPQ A;  3T93 B;  4XKR A;  3PUX E;  1NV7 A;  5F24 A;  1DTG A;  4O3C A;  3OEM A;  1IQ7 A;  3U92 A;  1MY1 A;  2V3U A;  4MNC A;  2RC9 A;  1Y9U A;  4IR8 A;  2O6A A;  3K6X A;  3KJ7 A;  4FOR A;  4YKI A;  1LST A;  5IZ3 B;  3Q29 A;  2WKY A;  2HEU A;  4NE4 A;  3HCQ A;  4XIG Q;  1H76 A;  2Y5L A;  4BDM A;  2QFL A;  3DEL B;  4HE2 A;  1KZ8 A;  4F3P A;  1XOC A;  4N6D A;  5CM6 A;  2GFE A;  3RQT A;  3KOT A;  4OVS A;  4O7I A;  2DXY A;  4P1L A;  1QUJ A;  2VPO A;  1AWB A;  1MQD A;  1BTJ A;  2ZXT A;  4IO7 A;  1MXU A;  3CSG A;  3S4U A;  1N0T A;  2D21 A;  3RTW B;  1B3F A;  4I1D A;  4OMB A;  1FQA A;  1PC3 A;  4TLM B;  1O7T A;  3O6G A;  1URG A;  5H8N A;  3QIM A;  4I3E A;  3OMB A;  1B0L A;  4MNP A;  1FTL A;  4QHQ A;  4ZE8 A;  4U1Z A;  4P1E A;  1VE4 A;  2I3W A;  3MP8 A;  2DE3 A;  3L6G A;  3WAE A;  3FAT A;  4O7M A;  1B3G A;  4HS7 A;  1I69 A;  4G61 A;  1HSJ A;  5EHS A;  4F39 A;  4ZZA A;  1SQY A;  1QUI A;  2KLF A;  4N13 A;  1MG1 A;  4FAT A;  3FIR A;  1LAX A;  1MQG A;  1PEB A;  3KJT A;  4PFW A;  1YAE A;  1JW1 A;  1NV0 A;  1Z7M E;  1IZ1 A;  1D9V A;  1MXX A;  4HE1 A;  4DXB A;  4PET A;  3VVD A;  2A5T A;  2ZNT A;  4MBP A;  1DMB A;  4TQU Q;  3QAX A;  1FBH A;  4I3Y A;  4XEQ A;  3TTL A;  1B46 A;  3TCG A;  4LQ5 A;  4EQB A;  3D1R A;  2CZL A;  1UTB B;  5I59 A;  5ESY A;  3TCH A;  1O63 A;  1KWH A;  1MPC A;  4KCC A;  2DVC A;  2DVZ A;  5H8N B;  1M5C A;  3DLN A;  3FVN A;  3GXA A;  3HO7 A;  4AQ4 A;  3WAF A;  4XKQ A;  1UTH B;  3S2V A;  4R6Y A;  2RC8 A;  4N07 A;  3Q28 A;  4GWY A;  4Q8R A;  2REG A;  3EF7 A;  4NF5 B;  1B05 A;  1SYH A;  3OEK A;  5FHM A;  3ROJ A;  1JNF A;  2R71 A;  2GH9 A;  2FA7 A;  2MKZ A;  4BDN A;  4PQJ A;  2O1M A;  1D3K A;  3GBA A;  4RY1 A;  2XXY A;  4F3B A;  2Q89 A;  3PUZ E;  2HAU A;  1SVX B;  1AMF A;  4GWX A;  1INP A;  2VT5 A;  4QSD A;  1MH3 A;  2O1L A;  1IMA A;  3LSF B;  1LBB A;  3MVZ A;  2THI A;  5ET7 A;  2I4C A;  4GF8 A;  3H7M A;  5I56 A;  4ZEC A;  1B32 A;  3SER A;  3I6V A;  4EQ7 A;  3IB2 A;  4YB6 A;  3VLU A;  4G4P A;  4KYD A;  1POY 1;  1AH5 A;  3DM0 A;  3U94 A;  1FJ6 A;  2XXT A;  2QRY A;  2XXR A;  3VVE A;  1ZU0 A;  3T96 B;  1SYI A;  1KA1 A;  5TP9 A;  4H8I A;  3E78 A;  4FAJ A;  4G68 C;  5DEX B;  1Y20 A;  1IEJ A;  3FV2 A;  3O28 A;  4GFR A;  3K1N A;  1LGB C;  2R6G E;  5DVF A;  4C1T A;  3T9X B;  1LFG A;  2D3I A;  4ZS9 A;  5ITO A;  2QJE A;  2WBD A;  4RK9 A;  2NOO A;  4MX6 A;  1IXI A;  4QXD A;  5EYH A;  3ECR A;  5I84 A;  2HAV A;  3RY3 A;  4U21 A;  2ESN A;  3ILU B;  1B4H A;  3T1B A;  1Y1Z A;  2XWI A;  1FBG A;  3RTF B;  1N3W A;  1OVT A;  1FTO A;  2RF1 A;  2ZYM A;  4R73 A;  1B58 A;  2LAO A;  2V25 A;  2CMO A;  1H3D A;  2XXK A;  2ZYO A;  4JWX A;  3SEV A;  3O29 A;  2QS1 A;  5FBP A;  1M5E A;  2Z23 A;  3IL1 B;  3IB1 A;  2XXU A;  1NV6 A;  4MEV A;  2ONS A;  1Y3N A;  4PDD A;  5CC2 A;  2FVZ A;  5HBC A;  4X04 A;  1LB8 A;  1FPB A;  2QMW A;  3KBR A;  1OIB A;  3CHG A;  4GWW A;  3BFT A;  2ALU A;  2V93 A;  4YB7 A;  1MPB A;  4HCY A;  1T0K A;  2F36 A;  5A5L A;  1JQF A;  1FTJ A;  2QS3 A;  3HHF A;  5BWJ A;  3S9M C;  3UOR A;  2WYK A;  3IOT A;  4OZ9 A;  3QUF A;  2PBW A;  4AS4 A;  5JK4 A;  1N84 A;  2DP8 A;  5K2Y A;  1FPL A;  1JVX A;  3N94 A;  3OEN A;  2FYI A;  1CNQ A;  2HFB A;  2O69 A;  2Z8F A;  2I6E A;  3KC0 A;  1FBE A;  2XXX A;  4H46 A;  2CZH A;  2UXA A;  4JWY A;  3HFU A;  3G3H A;  1NV4 A;  4IB2 A;  1QVS A;  2X7P A;  2DSF A;  3E4R A;  1D9Q A;  5DVJ A;  2VOZ A;  2QPQ A;  1GGG A;  5I58 A;  2Y7R A;  2B3B A;  4YKK A;  4GVO A;  3SZP A;  1MXZ A;  3VLV A;  4GL8 A;  4DI3 D;  5AE4 A;  3PUV E;  4DE8 A;  4HE0 A;  4YU0 A;  1B5J A;  3MQ9 A;  2NUV A;  3K1M A;  5I5P A;  3GBB A;  1A8F A;  2OWZ A;  2DOJ A;  2DS9 A;  3TZA A;  4RNS A;  4DCY A;  4PBH A;  3FJM A;  1R9L A;  5H8Q A;  3IAZ A;  4R6H A;  3UP9 A;  1MXV A;  5CI5 A;  3RN8 A;  3G3G A;  4HTG A;  3TEL A;  3TTK A;  5TU0 A;  4MAG A;  4LUB A;  2ZYK A;  2QVU A;  4NMY A;  3NOH A;  3HN0 A;  4NQ8 A;  3FVO A;  3QYT A;  2P3V A;  3CRB A;  1B1X A;  4R9F A;  4LP2 B;  4PFU A;  3SKP A;  2FIX A;  4OFL A;  4KD5 A;  5ET5 A;  4LON B;  5I2N A;  3D4C A;  3C9H A;  3FXQ A;  5ET8 A;  1NUX A;  2XWK A;  3FJG A;  4POW A;  4DLD A;  2VD3 A;  2GQ1 A;  2DWH A;  4IGT A;  4NF8 B;  3KSJ A;  1FW0 A;  4GX6 A;  5CMK A;  4IO2 A;  4R75 A;  2A5S A;  4BDQ A;  3FZV A;  1FQD A;  1NUZ A;  4JVD A;  3C36 A;  4K3F A;  4GBW A;  4PFR A;  2F6G A;  3RUM A;  1IXC A;  3O2A A;  1N3X A;  1EZO A;  2Y84 A;  2HHM A;  3PPR A;  3PUY E;  1WOD A;  3FUZ A;  3O6H A;  4PP0 A;  3LSL A;  3RPL B;  3Q27 A;  1VSO A;  2DE4 A;  2XX9 A;  2H98 A;  2QS2 A;  3TAJ A;  1Y4T A;  1NNP A;  3EHU A;  4QFP A;  3PTY A;  4NX1 A;  2XXI A;  1URS A;  4RA1 A;  4X1B A;  1SW2 A;  1AIV A;  2O51 A;  2XWO A;  3QMF A;  4F18 A;  5BUU A;  3THI A;  2OJT A;  3AXF A;  4BDL A;  2F3B A;  3EPE A;  2HCA A;  4OET A;  4AB5 A;  3HV1 A;  4ZE9 A;  1P1Q A;  1NV1 A;  5H8H A;  5IKB A;  1VDW A;  3VLW A;  2JJK A;  5ICQ A;  1JP4 A;  5CRY A;  2DWJ A;  3S9L C;  3I5O A;  1N7W A;  1K9Z A;  4FJP A;  1JEV A;  4OFJ A;  3TDJ A;  3EHT A;  2YPN A;  3B6W A;  3UGW A;  1B4Z A;  2P0S A;  3V89 B;  4GWS A;  3S9N C;  4OHN A;  3A3C A;  2A5T B;  3G7W A;  1XT8 A;  3CI8 A;  3EKI A;  2RC7 A;  5IZ1 A;  1FPG A;  2E0S A;  1VFD A;  3MYU A;  5AA2 A;  3A09 A;  4KCD A;  4PFY A;  1ZKB A;  3U65 A;  3PPP A;  2Y7W A;  3OEL A;  1OQG A;  3OXN A;  1B7U A;  3PUW E;  3LUY A;  5H8F B;  4NF8 A;  1FRP A;  1VR5 A;  3V8X B;  2NVU B;  3H03 A;  4JVC A;  1SW1 A;  2XA5 A;  3IK6 B;  2V4C A;  1NNF A;  1B40 A;  5DT6 A;  5L8D A;  3FGS A;  4ZZE A;  3KN7 A;  4KHZ E;  4R2F A;  3H6W A;  4U4S A;  3QSL A;  1XVX A;  1MRP A;  2QL3 A;  4MHF A;  5A5X A;  2Q8J A;  4LZ7 A;  4OXV A;  2V3T A;  2ZYN A;  3FV1 A;  5AA2 D;  2F97 A;  2L5V A;  1YXI A;  3C32 A;  1MQJ A;  2CEY A;  3MWB A;  4OWD A;  5I2N B;  3SEU A;  4PDH A;  5H8Q B;  3Q26 A;  4BLA A;  2ZZW A;  2I58 A;  4QSC A;  1ZBM A;  2Y7P A;  4ONY A;  2PVU A;  2UVG A;  1M5D A;  4QFN A;  1NL5 A;  4NN3 A;  5M2V A;  1EYJ A;  4OFO A;  4LQ2 A;  5KDT A;  4JXI A;  1LBW A;  4H6D A;  4N91 A;  3K6V A;  2BJI A;  5IZ3 A;  1MY2 A;  1OLC A;  3CFL A;  3EN3 A;  2Y5K A;  1LB9 A;  1DSN A;  4DZ1 A;  1QGX A;  3MAM A;  3DP4 A;  2FBP A;  4EUO A;  4N81 A;  3IO6 A;  4GOT A;  3U8Q A;  3TUS A;  5JEI A;  1Z7N E;  1NUW A;  1DK4 A;  3JYR A;  5KCJ A;  1LAF E;  4Q5T A;  4YB5 A;  1PBP A;  4F1U A;  1B0H A;  1YYZ A;  4XXU A;  3KSX A;  1JET A;  3LR1 A;  2F7C A;  3TKD A;  3LC8 A;  2FNC A;  4ZEI A;  4ZED A;  1FPE A;  1ZLQ A;  1LFI A;  2F3D A;  4OER A;  2Z8D A;  5LTC A;  5L9M A;  1Y3Q A;  5EHM A;  1GVC A;  5JTY A;  3K6W A;  2AL4 A;  4XKN A;  1ZTY A;  4OEV A;  2B4L A;  4QFO A;  1IME A;  3TMG A;  5KCJ B;  1SD3 A;  4F2Q A;  4H5F A;  4GBV A;  2H9B A;  1SW5 A;  1S50 A;  2VD2 A;  4GWU A;  3TEP A;  2QSX A;  3B6Q A;  4H5G A;  3ONM A;  4OYV A;  3PMW A;  4MF3 A;  1SI0 A;  2XX7 A;  4DI4 B;  4YKP A;  1B5I A;  2F7B A;  4OVR A;  3M8U A;  2UVH A;  4KYS A;  1YTV A;  4MNI A;  1PB8 A;  2F5X A;  3OO7 A;  3ZS6 A;  3R26 A;  1URD A;  2GRV A;  1IIT A;  1FBP A;  2WYP A;  5ITP A;  3OO8 A;  4OVT A;  2QVR A;  4P8B A;  1LBX A;  3O6I A;  3ZKL A;  1FPI A;  2UVJ A;  4OVJ A;  1GTK A;  2XD2 A;  1NUY A;  2DXR A;  3EQ1 A;  3VDF A;  4H1X A;  4M1V A;  3USD A;  1Q9D A;  5CBS A;  4PBQ A;  4ELO A;  5HM4 B;  4U4X A;  4P56 A;  3P7I A;  3RGY A;  4F19 A;  3IO4 A;  1XS5 A;  3H6V A;  1FQC A;  3F11 A;  3KEI A;  2Q2A A;  1J1N A;  3T9H B;  4NF6 B;  3H4Z A;  1Y3P A;  3JV9 A;  2Q74 A;  2Q8M A;  4LZ8 A;  1XHY A;  2YLN A;  4ZEF A;  2CZI A;  2HPG A;  4OTE A;  4PCD A;  3T9U A;  4N15 A;  3IB0 A;  1EYK A;  1MY0 A;  1RKM A;  4C0R A;  1SDX A;  1MM7 A;  2OWS A;  1IMB A;  5DVI A;  3N6T A;  1FTM A;  4GX4 A;  3ILT B;  4RK2 A;  3CFX A;  3BKI B;  2DWA A;  3VXC A;  1B3H A;  5AA2 B;  2R8T A;  4PC9 A;  4MMP A;  3KC1 A;  2V3Q A;  3MVW A;  1N76 A;  3FJ7 A;  3E9X A;  4IY6 A;  3BIH A;  1IMF A;  1IIW A;  4JSD A;  3H6U A;  4GLI A;  1B7Z A;  3RLF E;  4QSE A;  4EF1 A;  2ZNS A;  5I3S A;  2F34 A;  1UTH A;  2VPN A;  1LAG E;  4IO6 A;  4H67 A;  4BDR A;  5IM2 A;  2WBB A;  4POX A;  3OD7 A;  2W7Y A;  5H8H B;  5L9S A;  1R1N A;  1N7X A;  3G3F A;  4P11 A;  3TTM A;  3RT8 A;  1UQW A;  4H0W A;  4NF5 A;  4QFL A;  3ZKK A;  1JW4 A;  3QK6 A;  4YMB A;  2I3V A;  1R6Z A;  2KR0 A;  1FQF A;  1ATG A;  3FXB A;  4H45 A;  4P9K A;  3HHG A;  1EZP A;  1EU8 A;  1P1U A;  4F2O A;  4R9G A;  4OVP A;  2GHA A;  3RYD A;  1I6Q A;  1GV8 A;  2Y7I A;  2ZZX A;  4RYA A;  5I59 B;  1UTB A;  1K9Y A;  5EQ9 A;  2XXW A;  3CG3 A;  1DOT A;  4DDD A;  1DBZ A;  2IA4 A;  3H6T A;  3U1O A;  3G3J A;  5H8F A;  3MVX A;  3IOW A;  4DXC A;  2REJ A;  4LN5 A;  5EQ7 A;  1O64 A;  4KQP A;  4GWZ A;  3FXR A;  4THI A;  3G3I A;  3MW0 A;  4MH5 A;  2OWT A;  3ODB A;  4G68 B;  4RPN A;  1NH8 A;  3SEY A;  4GXS B;  3KFM A;  3JZJ A;  4PGN A;  4R72 A;  3TQL A;  4MJO A;  3PMX A;  1FTA A;  1WDN A;  1MQH A;  3TTN A;  1FSA A;  3VFJ A;  2HXW A;  4LA9 A;  1P99 A;  1B5H A;  1UIV A;  2UYE A;  4KYE A;  3PU5 A;  3TOD A;  1QJM A;  4F22 A;  4U1O A;  4FBP A;  1JVY A;  4FEC A;  4L17 A;  2XHD A;  1RDZ A;  1PDA A;  3IFC A;  1XI6 A;  5B70 A;  2DDK A;  2WX9 A;  3C31 A;  5ICT A;  1IUD A;  3QXM A;  3LBS A;  1LEV A;  3IOU A;  4WED A;  4GQO A;  4X48 A;  2H5Y A;  4GIZ A;  5AA3 A;  4KI0 E;  1TFD A;  1BKA A;  2F6P A;  4PAK A;  4QRZ A;  4P47 A;  2I4B A;  3MP6 A;  4YMA A;  1JEU A;  3C34 A;  1SW4 A;  3MPK A;  3RPL A;  1MY4 A;  1DPE A;  1DTZ A;  3MZ9 A;  4F31 B;  4EXL A;  3T22 A;  3GLB A;  5LDZ A;  3OO6 A;  1UIU A;  5CMB A;  3U72 A;  1NV3 A;  3G3K A;  4NG7 A;  1N04 A;  1SPI A;  1SI1 A;  4G8M A;  3U93 A;  3SES A;  2I48 A;  4TLL B;  2O7U A;  1HSE A;  4JDF A;  4OVQ A;  4MLV A;  3TYH A;  1MDQ A;  3PPO A;  1DCU A;  2AL5 A;  1MS7 A;  1I6A A;  3SET A;  1FPD A;  4NF6 A;  1TWY A;  4G77 A;  4P3L A;  4MLQ A;  3B6T A;  4FEB A;  3V83 A;  1EZ9 A;  4GWO A;  2M8C A;  3FAS A;  3SEW A;  3O9P A;  2QS4 A;  2P2A A;  3A29 A;  3OSR A;  3LV0 A;  1RYO A;  4F3S A;  3KN8 A;  3LSW A;  1NMU A;  4NWC A;  1D9Y A;  4UAB A;  3K00 A;  1QUK A;  4YAH X;  1FTK A;  5F1Q A;  3K4U A;  2V84 A;  2YJP A;  2PFY A;  3T0J A;  2BJJ X;  3KOS A;  4U2R A;  3HPI A;  4GXA A;  4X9T A;  2B4M A;  3OOA A;  3R7X A;  2RCB A;  3PGF A;  1YZ0 A;  4LVQ A;  2ABH A;  2UVI A;  1II5 A;  4X1D A;  4PFI A;  2OLB A;  3K6U A;  3UK4 A;  1FQB A;  4N4U A;  5I58 B;  2Q88 A;  4UA8 A;  2HXR A;  4H8J A;  2HZL A;  1IXG A;  3N6U A;  1QW0 A;  4WKM A;  4Q30 B;  4NF4 A;  1FBD A;  4EQ9 A;  4M4G A;  3D4G A;  4R2B A;  4O94 A;  5I57 A;  5DTB A;  3BBR A;  4BDO A;  1PB9 A;  3A3U A;  3K1P A;  1NI9 A;  1TT1 A;  2DWI A;  1BP5 A;  4P0I A;  1MDP 1;  1OVB A;  3DP8 A;  5TP9 B;  2PT1 A;  3CFZ A;  2VHA A;  5I57 B;  4HW8 A;  1Y1M A;  2D5W A;  1Q1K A;  2Y7K A;  4NF4 B;  4IO5 A;  5B7D A;  3W9W A;  3VVF A;  4PE5 B;  1IXH A;  1B9J A;  4XKP A;  3MZ1 A;  4F1Y A;  3VV5 A;  4XTC Q;  1KA0 A;  1BLF A;  4N6K A;  3TQW A;  4GL0 A;  1MQI A;  2X26 A;  1LBC A;  5T3J A;  4N8Y A; 
#chains in the Genus database with same CATH homology
 2V4C A;  1BK4 A;  2HZK A;  4P56 A;  1IMD A;  4XF5 A;  5FBP A;  4F19 A;  5IZ3 B;  3RPL B;  4I3E A;  4OVP A;  4UAB A;  1FPE A;  4PF6 A;  4PFB A;  2MKZ A;  3RYD A;  5I5P A;  1NV6 A;  1G0I A;  4MEV A;  4MNP A;  2DE4 A;  2F3D A;  2OWZ A;  4PAK A;  2XWV A;  2ZZX A;  3IFA A;  5LTC A;  4P47 A;  4HCW A;  1IMC A;  3LUZ A;  4PDD A;  1K9Y A;  2FVZ A;  5EQ9 A;  4PBH A;  3RPL A;  4X04 A;  3PTY A;  3MST A;  4NX1 A;  1FPB A;  3W9V A;  4P1E A;  2Q74 A;  3CHG A;  4GWW A;  4MHF A;  2Q8M A;  2PFY A;  2DE3 A;  4N8G A;  3T0J A;  3GYY A;  5EYG A;  2KQZ A;  4NAP A;  4PGP A;  2B4L A;  2OX3 A;  1FBF A;  2CZI A;  2HPG A;  4GWX A;  1INP A;  4HCY A;  2VT5 A;  1DBZ A;  2XWO A;  3QMF A;  4O7M A;  4PCD A;  2L5V A;  4X9T A;  5ET6 A;  4F18 A;  5A5L A;  1YXI A;  4HXV A;  1IME A;  1IMA A;  2B4M A;  4N15 A;  4G61 A;  4KXP A;  2CEY A;  2F3B A;  1NV5 A;  4PAI A;  4X8R A;  1EYK A;  5J1D A;  1YZ0 A;  2WYK A;  5ET7 A;  3BIG A;  4PBQ A;  1EYI A;  4MAG A;  4PTK A;  1LBZ A;  4GBV A;  3ISP A;  4N17 A;  2QVU A;  4P9K A;  4PFI A;  4PDH A;  3NOH A;  1IMB A;  4GWU A;  4I40 A;  4AS4 A;  5JK4 A;  2Q9T A;  1NV1 A;  1NV7 A;  4N4U A;  4NQ8 A;  4QBA A;  1NV3 A;  1FPL A;  5F24 A;  2HXR A;  2ZZW A;  4GX4 A;  2HZL A;  1VDW A;  2P3V A;  2JJK A;  4JVI A;  2WEF A;  4NG7 A;  1SPI A;  1JP4 A;  4LN5 A;  1CNQ A;  5EQ7 A;  2FIX A;  1NV0 A;  1FBD A;  4GWZ A;  1K9Z A;  4NN3 A;  5ET5 A;  3E79 A;  2R8T A;  3FBP A;  4HE1 A;  1FJ6 A;  1EYJ A;  4MIJ A;  3KC0 A;  4MMP A;  4MNC A;  3KC1 A;  4O94 A;  4PC9 A;  1FBE A;  5EQA A;  4PET A;  4DI4 B;  5I7I A;  2V3Q A;  1LBW A;  4IR8 A;  4OVR A;  1KA1 A;  4H46 A;  1NV2 A;  2CZH A;  4OVQ A;  5ET8 A;  1NUX A;  2XWK A;  2DE2 A;  3E78 A;  1LBV A;  5IZZ A;  4N91 A;  1FBH A;  4I3Y A;  1NI9 A;  2BJI A;  4XEQ A;  2CZK A;  3HFU A;  1DCU A;  1IMF A;  3BIH A;  4MNI A;  4NHB A;  4PAF A;  2GQ1 A;  2F5X A;  4PGN A;  4GWS A;  1FPK A;  5IZ3 A;  4MJO A;  1LBY A;  3KBZ A;  4F1V A;  2CEX A;  4AS5 A;  2Y5L A;  3B50 A;  1NV4 A;  1FTA A;  5J16 A;  2ZZV A;  4PE3 A;  3D1R A;  5EQ8 A;  1FPD A;  2QFL A;  1FSA A;  4XFE A;  4HE2 A;  4GX6 A;  1KZ8 A;  2Y5K A;  3EKI A;  5I3S A;  5ESY A;  4N6D A;  1FBP A;  2WYP A;  5CM6 A;  4NF0 A;  4P3L A;  1QGX A;  2FHY A;  1FPG A;  2VPN A;  4MCO A;  3MYU A;  5IZ1 A;  1D9Q A;  4OVT A;  2FBP A;  2QVR A;  1FPJ A;  3B8B A;  1RDX A;  2WBD A;  3W9W A;  4P8B A;  4OVS A;  2DVZ A;  4N81 A;  4O7I A;  1LBX A;  5IM2 A;  3U65 A;  1RDY A;  4P1L A;  2QPQ A;  2PFZ A;  4MX6 A;  2WBB A;  4QXD A;  1FPF A;  5EYH A;  2VPO A;  4GX3 A;  1AWB A;  1FPI A;  1NUZ A;  4FBP A;  4JVD A;  4O8M A;  2FIE A;  1KA0 A;  5LDZ A;  1G0H A;  1NUW A;  4GBW A;  4N6K A;  5IGA A;  1NUY A;  1RDZ A;  1DK4 A;  3SZP A;  3T1B A;  1FBC A;  4PFR A;  3A29 A;  4YIC A;  3IFC A;  2XWI A;  5DW8 A;  2PCR A;  1FBG A;  4GWY A;  3LV0 A;  1XI6 A;  1FJ9 A;  4F1U A;  4PF8 A;  4NGU A;  2DDK A;  4DI3 D;  1FRP A;  2P3N A;  2WX9 A;  4M1V A;  2HHM A;  4OA4 A;  4OAN A;  4YZZ A;  1YYZ A;  2QVV A;  4JVC A;  2KR0 A;  4HE0 A;  2XXK A;  1LEV A;  1Q9D A;  3ROJ A;  3FXB A;  4H45 A;  2XA5 A;  5T3J A;  4N8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...