2XWVA

Siap complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
309
structure length
309
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tripartite ATP-Independent Periplasmic (Trap) Transporters Use an Arginine-Mediated Selectivity Filter for High Affinity Substrate Binding.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 124
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2010-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xwvA00
4PAIA 2WX9A 4P1LA 4PFBA 4MHFA 4DI3D 2ZZWA 4OVPA 4MNIA 2V4CA 4OA4A 4PDDA 4PE3A 4XF5A 4XEQA 2VPOA 4PF6A 4OVTA 4PDHA 4X04A 4PGPA 4N17A 4P8BA 2VPNA 5IZZA 4P47A 3GYYA 4N4UA 2XWOA 4NHBA 4N6DA 4MEVA 5I7IA 4P9KA 4NN3A 4PCDA 4OVQA 4MCOA 2ZZXA 4O8MA 4O7MA 3FXBA 4UABA 2XWIA 4NAPA 2XXKA 4PAKA 4PFIA 4X8RA 4MAGA 4OANA 4NG7A 4PAFA 2XA5A 4P1EA 4MNCA 4N91A 5IGAA 4PETA 4YICA 4MIJA 2HZLA 4NF0A 2PFYA 5I5PA 4PFRA 4MMPA 5LTCA 3U65A 5CM6A 4MNPA 4MX6A 2ZZVA 4N8YA 2HZKA 4PBHA 2CEXA 2HPGA 2PFZA 4OVRA 4DI4B 4NQ8A 4PC9A 3B50A 4N15A 2XWKA 4N6KA 4XFEA 4P56A 4N8GA 4OVSA 4PBQA 4LN5A 2XWVA 4O94A 4PGNA 2WYPA 4NGUA 2WYKA 2CEYA 4P3LA 4PF8A 5IM2A 4YZZA 4NX1A
chains in the Genus database with same CATH superfamily
1Y1ZA 2VD2A 4TLLB 1FBHA 4R9FA 3AXFA 4GWYA 4Z0IA 3PUWE 5I2NB 3RTWB 2V93A 3ODBA 1MM6A 2AIXA 3ILTB 4ZEIA 2QS2A 1SW5A 2GRVA 1IMDA 1NV0A 4JBZA 5AA2A 4DIGA 3P7IA 2XXUA 5TP9B 3VV5A 3U94A 2OX3A 1US4A 3SEYA 3ILUB 4KYEA 4PE5B 4GX6A 3TQLA 5H8NB 3W9VA 3V83A 3FVGA 3VE1B 3H3GA 4PETA 3PUXE 2V25A 5FBPA 1Y20A 2ZYNA 3TDJA 3MP1A 4NF0A 2OWZA 1MG1A 3Q25A 3MP8A 4C1UA 4U2RA 2THIA 1AIVA 4G68A 4GL8A 2CZIA 2CEXA 2HPGA 4QSDA 4XIGQ 3G3JA 1FPJA 1N7WA 4XKRA 4RY1A 2Q9TA 3ISPA 2RC8A 1MXVA 4F29A 4HCYA 1PB9A 4H1XA 3G3FA 4M1VA 3PUVE 4IO5A 1NNTA 3H03A 2OZZA 1ZU0A 4PFYA 1MXYA 1LGBC 1SPIA 3FD3A 1FBEA 4WEPA 3E78A 2O1MA 3KC1A 4LONB 4FATA 3OO7A 3C4MA 3IR1A 2B3FA 1S7YA 2V4CA 3CSBA 4JVDA 4BDOA 4XKNA 3H6TA 4OETA 1WODA 3NOHA 4H8JA 1NKXA 2D5WA 3KOTA 3G3GA 3MPKA 3L6HA 3UORA 5A5XA 4G77A 1Y4CA 2E1SA 3KN8A 3JYRA 1FQEA 2H9BA 1TWYA 3PU5A 4N4UA 4P9KA 1N0TA 3FZVA 1B3FA 3FXRA 3LSWA 3PD8A 1SYIA 3OMBA 1NNKA 4DZ1A 5AE4A 3SKPA 4MBPA 5DTBA 1B1XA 4BDLA 4QRZA 1MRPA 1POTA 1NV5A 3L6GA 1BKAA 1QULA 1LB8A 1FPIA 3KSXA 1FBGA 1KZ8A 1SYHA 4N8YA 2PT1A 3HCQA 4Q5TA 2NVUB 3N5LA 3K6UA 4QBAA 5A5XB 4P0IA 3B50A 5I3SA 3HO7A 2FA7A 3A09A 1IXCA 3I6VA 3M8UA 4OFLA 5TP9A 4YB5A 1D9YA 2E0SA 1D3KA 2XXYA 2CEYA 3FVNA 1NUXA 4PQJA 2UXAA 4RXLA 1NV3A 2REGA 1XVXA 4YKJA 3HHFA 2DVZA 3PMVA 3TELA 4R2BA 3K6XA 5FHNA 1I6AA 3W9WA 3K1MA 1JW1A 1YZ0A 4F1UA 3MVXA 5JK4A 1KWHA 4O3BA 3PUYE 2F35A 5L9MA 2XX8A 5H8FB 4RYAA 2OCUA 3GYYA 3N94A 4KFQA 2MKZA 1FQDA 2O1LA 4NMYA 5L8DA 4LP2B 5DVFA 2ZYOA 1J1NA 2NWJA 1JVXA 1SW4A 4GRKA 2FIXA 3O66A 4U4SA 4NF5A 1Z7NE 4MNCA 4IO6A 1A55A 5CBRA 4YKPA 3MQ9A 4MLQA 3KC0A 4JXIA 2PCRA 4MMPA 4ZEDA 5LTCA 1F9BA 3O28A 3K6VA 1B0HA 3EPEA 3FVKA 3IO4A 1S9TA 2M8CA 1Y3QA 2HCAA 4XFEA 1OLCA 4O3CA 4YMAA 5L9OA 1D9QA 3TPAA 4O94A 3K02A 3F11A 4Q0CA 3FGSA 3BBRA 1NFTA 1GVCA 3OO6A 4I1DA 3CRBA 3T0JA 2XXVA 2Z8EA 4P1LA 3VLWA 3SEVA 5EHSA 2Q88A 4NF6B 3S2VA 2Q2CA 2I58A 2Y84A 3O9PA 2QVVA 4YB6A 2VPOA 4PF6A 3RLFE 4DDDA 2WBDA 3SEUA 4F39A 4ZEKA 2O7UA 1DOTA 5TPAB 2VT5A 4GL0A 4JWYA 1FQAA 1MPDA 4I3YA 1SQYA 4NHBA 2ZNTA 1QW0A 3KSJA 1B3LA 2FHYA 3OSQA 1USYE 2QS1A 4GWSA 2AL4A 3IJXB 3CSGA 1QKBA 5CMKA 2BJJX 1I6BA 3KEIA 4UACA 3CG1A 4OENA 4MAGA 4RPOA 4PAFA 3FATA 4X1DA 2P1SA 4GX3A 2XHDA 5I59B 4L17A 4YICA 3ROJA 2UVJA 3MBPA 4PFRA 4ELOA 4HXVA 4MNPA 1K9YA 2HZKA 4PBHA 1VFDA 2I3VA 2HQ0A 2HAVA 2O6AA 4DCYA 5FHOA 2RC9A 4F1YA 3UGWA 4F19A 1EZ9A 3HPIA 4JSDA 2I48A 5H8SA 1NV1A 1LBZA 3MPLA 2PBWA 4ZE9A 4NX1A 4JVCA 4G2ZA 5IZ3B 1UTBB 1K9ZA 4R9GA 1IXGA 1D9VA 4DI3D 2H98A 3O29A 2GQ1A 1SI0A 4YB7A 4PFWA 3PPQA 3KOSA 2OWTA 3RTFB 2OLBA 4YU0A 4XEQA 5EQAA 3EKIA 3SETA 3S9EA 1MPBA 1NUZA 3PD9A 4P0GA 3U72A 2XXRA 3T1BA 3D4CA 2QJEA 1H76A 5IZZA 1NNPA 3E3KA 1OLAA 2PT2A 1LBYA 2DE2A 3TEPA 2QS4A 3QK6A 2G29A 4O7MA 1FTLA 3MWBA 1B0LA 1VE4A 2XXKA 1M5FA 4IGRA 3H7MA 1B7UA 3IL1B 1VR5A 1TT1A 3UN6A 5JEIA 5M2VA 2XXWA 2DXYA 4PFUA 4WKMA 2XXIA 5CMCA 3KGCA 1R1NA 2PFYA 4IO7A 2FIEA 5A5LA 1TXFA 1O63A 5CM6A 4OYVA 5KCJA 1IMBA 5DT6A 4KPTA 1FBDA 2B65A 4G68B 5ET5A 3QUJA 4GF8A 4KD5A 2CZLA 2YLNA 2XWKA 1URDA 3CFXA 4OVSA 4NE4A 4KYSA 2VP1A 4OESA 3OEMA 4R72A 1FPLA 1LB9A 2ONKE 2CMOA 1RYXA 4O3AA 2ZNSA 4ZE8A 2ZYMA 4XKQA 3A3CA 2VGQA 3H06B 4TQUQ 2F97A 4OVJA 3OO9A 2O51A 1B7ZA 3LSXA 5HPQA 1IMAA 4PE3A 4I62A 1XI6A 5F24A 3C31A 2VD3A 1O7TA 1BP5A 3MZ9A 1OVTA 4LZ5A 4N17A 1ZMGA 2VHAA 3TTRA 1P1NA 2O7IA 5K2YA 3TAJA 4GIZA 4F1VA 4GX4A 3THIA 3CVGA 3IOTA 1JW4A 3H6UA 4H65A 2WEFA 5EQ9A 1B5HA 4KXPA 5CI5A 5I2NA 4FECA 3SEXA 1FBPA 3G7WA 1EZOA 3DLNA 4C1TA 3T96B 3RQTA 5B7DA 3KN3A 3SERA 4X8RA 3SDFA 1BTJA 4GXSB 3HFUA 1MQHA 3IX1A 3TKDA 2RINA 1UTHB 2IEEA 3ZS6A 2KR0A 3IB2A 1LFIA 2X7QA 4EQ9A 3EHUA 2H4IA 3VVEA 1R9LA 1AMFA 4OVRA 4NQ8A 4QXDA 3PMWA 2KLFA 4ELQA 1P1OA 3KJ7A 1B4HA 1R6ZA 3TTKA 4AB6A 4PGNA 4KYDA 4U1OA 4F3PA 4NTLA 1JW5A 4OQOA 1GGGA 4YAHX 5ICQA 2I0BA 2I6EA 5CC2A 1DMBA 3PMXA 4YKIA 2H25A 1VSOA 2P0SA 2JJKA 1FPBA 1LBVA 1O64A 5TPAA 3GXAA 1NV2A 3Q26A 2KQZA 1MQDA 1G0IA 4MNIA 2HHMA 3OSRA 3LR1A 2ANJA 4NF4B 4GFRA 3FXUA 3VVDA 3KJTA 3BIGA 5T3JA 1FBCA 1AL3A 2YJPA 1MY3A 3DP8A 1FTAA 1NV7A 4H8IA 3VLVA 3E4RA 4NN3A 1JNFA 2ZZXA 1MQGA 4XXUA 4GWXA 2O68A 5AA3A 4MH5A 1EYIA 4MFIA 1MDQA 3OELA 4R75A 1IZ1A 1MPCA 4ELRA 4FBPA 1PBPA 4I9DA 5ET7A 1LCFA 3RPLB 4X1BA 2QVUA 1QUJA 2L5VA 2ONRA 4RPNA 4M4GA 2R71A 2Q2AA 4NWCA 4PC9A 1DTZA 2Y5LA 4TLMB 3C32A 4IGTA 3KBZA 4OMBA 2QMXA 4YMBA 4N8GA 3C34A 4RNSA 4U1ZA 2XWVA 5LDZA 3BFUA 5I56B 2HFBA 3RUMA 2HEUA 5AA1A 2PX1A 4GWUA 5FHMA 4C0RA 5H8FA 5H8HA 4U23A 1M5DA 1HSJA 3EHTA 2ZZWA 2H5YA 1N3WA 5B70A 2QS3A 3S9LC 4LZ7A 3T9UA 4PDDA 3TTMA 3R7XA 3IFCA 1H44A 4N13A 4PDHA 3LUZA 1NV4A 2Z23A 5IAIA 1Y4TA 2GH9A 2GFEA 2V3TA 2R8TA 1B5JA 1ZJLA 2X7PA 3MSTA 4P47A 4ZDMA 2B4MA 4I3EA 3S4UA 3C33A 4OFJA 1CE2A 4GWZA 5K2XA 4OVQA 4TOZA 1FSAA 2OJTA 4IR8A 2QFLA 3MYUA 2X26A 1A8FA 5ICTA 3RT6B 3K0VA 4ZZAA 3E13X 1BK4A 1PDAA 4JWOA 5IGAA 4Z7EA 2O69A 1WVJA 1JETA 3PPOA 3LV0A 1IMCA 1POY1 3UIFA 4KHZE 4AS5A 4EDPA 3W15C 3GBBA 5IKBA 3U92A 1IXHA 1VFEA 2F5XA 2P2AA 1YCJA 2PFZA 4UA8A 4FE8A 1SD3A 4DXBA 5ET8A 2FBPA 2FNCA 1DPEA 1INPA 1DK4A 4BDMA 4BDRA 4LN5A 1Z7ME 4OZ9A 1PEBA 2Z22A 2Y7PA 3LUYA 5EYFA 1B51A 3K4UA 4ISUA 1XVYA 1XOCA 1CB6A 5DVJA 2Y7KA 1FTOA 2WBBA 4NEDA 3OEKA 4OVPA 3E79A 1DPPA 3I3VA 4GWOA 4GBVA 3Q27A 4IO3A 2G93A 4H67A 4OVTA 2V3UA 4ZECA 4LATA 2F7CA 1FPKA 3PV0E 4FAJA 1MXXA 1FCKA 1JP4A 4PFTA 1RDXA 4MEVA 1QJMA 1HSLA 4YKKA 4PCDA 4ONYA 5CMBA 3BFTA 2DWAA 1FQCA 3V89B 5I57B 3G3KA 4H46A 1GTKA 3TZAA 4MIJA 3FBPA 5HBCA 3OOAA 3RY3A 1N7XA 5I5PA 3BIHA 4GWWA 2AYSA 1MH4A 1A99A 1JVYA 4DI4B 4LZ8A 3DP6A 1RYOA 1LAGE 1TFAA 4G8HA 4KCCA 4QSCA 2Q8JA 5AA4A 2DWHA 5I56A 3M3KA 3T93B 1NV6A 3T9HB 3IK6B 3LC8A 4Q30B 1N04A 3IO6A 1IXIA 1FQBA 1ZKBA 3FVOA 2R6GE 1LAHE 4E0WA 2XXPA 1ZLQA 1BIYA 1N76A 4FORA 1AH5A 5AA2B 3IAZA 3B6WA 5IZ1A 3CR9A 4GVOA 1OIBA 2Q8MA 1DCUA 1ANFA 4ECFA 3VVFA 2DSFA 4POWA 1YTVA 1B9JA 1RDYA 3T22A 4ESXA 3IOUA 2LAOA 2I0CA 3OO8A 1B2HA 4F18A 1FQFA 1XT8A 3T9XB 4G68C 1IUDA 4IO4A 2OWSA 1MXZA 4R6KA 2ONSA 2VPNA 1NI9A 1MY0A 4N81A 1Q9DA 1YYZA 1A40A 3K01A 4HE2A 1FW0A 4QHQA 5AA4B 2F3BA 4O8MA 4QFPA 1FJ6A 4N6PA 5LOMA 3D4GA 4IY6A 2DOJA 2Q89A 3QMFA 1FPFA 4ZEFA 3TCFA 3ZKLA 1NUYA 2DWIA 5ELVA 1YXIA 4HE0A 4RJZA 1Y1MA 3U65A 3IB0A 1MY2A 1IQ7A 2O84X 3LBSA 4DXCA 2UVIA 2PYYA 1R9QA 3TQWA 2R9JA 2DS9A 4LQ2A 3HSTA 3LSLA 4OHNA 3DM0A 1Q35A 3UP9A 4GLIA 3O97A 5ITPA 1A7LA 4DE8A 1DBZA 1EYKA 2ABHA 3PUZE 1YPNA 2DQVA 3KFMA 4KR5A 3UK4A 3MZ1A 5F7VA 3H6VA 2ZYKA 2WX9A 3B8BA 4FIMA 3Q29A 2CZKA 4IO2A 1B3GA 4EUOA 5EYHA 2XXXA 4NF8A 1MQJA 1H43A 3B6TA 1NH7A 2HXRA 2REJA 3FIRA 4DXUA 2QMWA 4H0WA 1SI1A 2ZMBA 3QAXA 2XD2A 2DP8A 2OK2A 4R6HA 3V5AA 3A29A 3U93A 3TCHA 4NF6A 3G3HA 1ZTYA 4H45A 4FEDA 3FJ7A 4GOTA 1P1QA 5CMMA 1SW2A 3MJNA 3HV1A 1SW1A 1MM7A 4ELPA 1Y3PA 1GV8A 2NUVA 5J16A 1B52A 4PFIA 3TYHA 4EQBA 3R26A 2DVCA 3QSLA 4NF4A 1Q1KA 2H99A 4F2QA 4I8CA 3C9HA 4X48A 4AS4A 1N3XA 3U1OA 1FTJA 1P1WA 4EXKA 3D1RA 1MDP1 4U22A 4U21A 5I59A 3C35A 2XXTA 1DSNA 3IOVA 4MLVA 1QKAA 5BWJA 4QF9A 1B46A 1UIUA 4N15A 4AQ4A 4GBWA 3K2DA 3IJOB 1DTGA 4FJPA 5FTIA 2HAUA 2NOOA 5L9SA 5HM4B 1YAEA 2B3BA 1AWBA 2F36A 2WYKA 3DP4A 1LAXA 1M5EA 5JTYA 1FPGA 2DE4A 3E9XA 1URGA 4ZS9A 3EF7A 1QUKA 3LSFB 4RK2A 1D4NA 4PFBA 1QVSA 3MAMA 3QXMA 1UIVA 1AOVA 3FJMA 1PB7A 3TODA 2FYIA 3IOWA 4XF5A 1TFDA 1LCTA 1QGXA 3PPNA 5H8HB 3FUZA 3T66A 2RC7A 2XXHA 4I40A 3T9VA 2A5TB 1KA0A 2OBGA 3K6WA 4F31B 2WKYA 5TU0A 2XWOA 1NH8A 4N6DA 3ZSFA 5AA2D 5I7IA 4FEBA 4Q8RA 4EF1A 3M3FA 3O6IA 1ATGA 1PBQA 4BDQA 1JEUA 4QFKA 2XWIA 1NUWA 4G4PA 4NAPA 3N6UA 2RKMA 4KQPA 2XA5A 2PMSA 4KI0E 3ONMA 4IB2A 1HSEA 3HN0A 2Z8FA 4R74A 2RF1A 2ZXTA 3S9MC 2P3NA 1NMUA 4H5FA 3VXBA 1FBFA 4MF3A 1LAFE 1B6HA 4HE1A 4WEDA 4F2OA 1EZPA 1IITA 4MX6A 2DE3A 4R6YA 3K00A 1S50A 4N6KA 2BJIA 2Y7WA 5KCJB 4LQ5A 2XD3A 3IB1A 3N6TA 4RA1A 1EYJA 5EQ7A 2RCAA 4P11A 5IM2A 3VXCA 4OEVA 4F3BA 3QYTA 3RYDA 5BUUA 5KDTA 5I2KA 1OVBA 1G0HA 1PB8A 1XHYA 1ELJA 1L5TA 1B7HA 1VDWA 1ZBMA 3MC2A 4G61A 4N07A 2NXOA 2DXRA 4PP0A 1FTMA 3N26A 4DLDA 3MZBA 3CFLA 5I57A 3H6WA 3GLBA 3U8QA 1I69A 1LBCA 4PGPA 3SZPA 1URSA 1EU8A 4H6DA 3TUSA 5CRYA 5I84A 3OXNA 1PC3A 1Y9UA 3OENA 1UQWA 3RPLA 2UYFA 3A3UA 4MCOA 5H8QA 4XTCQ 3FV1A 1NNFA 1WDNA 5EQ8A 5EYGA 4P1EA 1USYH 4K3FA 2F78A 2VOZA 1B40A 1UTHA 5EHMA 2UVGA 3TMGA 1SVXB 3FV2A 3KZGA 1SDXA 4WXJA 2A5TA 1II5A 3PPRA 1MH3A 2RCBA 4OERA 5ET6A 2F7AA 2F8DA 1BLFA 3OD7A 3TTLA 1B58A 1IMFA 1LBBA 3USDA 4RK9A 3EHSA 3FXQA 2Y7IA 4EF2A 2XXQA 3V8XB 4E0XA 3MVZA 3IFAA 4X9TA 4H5GA 1OQGA 2GHAA 5H8QB 3FJGA 4OEUA 1MY4A 4F3SA 3O2AA 4OA4A 2XX7A 4QFLA 4OXVA 2Q74A 1MY1A 4X04A 3HHGA 2W7YA 2V84A 4P8BA 2QSXA 1A54A 1XC1A 3PGFA 4BDNA 3RGYA 1LLSA 2AL5A 3KBRA 2Y5KA 3CHGA 4BLAA 2DYXA 4UABA 1QUIA 1JEVA 4HTGA 1OMPA 2DDKA 3GBAA 1EH3A 3KN7A 3CI8A 3QUFA 2UYEA 1FRPA 5DEXA 3FASA 4G8NA 1T0KA 2HZLA 2I49A 1Y3NA 2I4CA 3S9NC 1LSTA 1IMEA 3Q28A 4G8MA 1LBXA 3ECRA 2F3DA 5H8NA 2QPQA 3B6QA 5F1QA 4F3GA 3CG3A 4P56A 2ZNUA 3PPPA 1B32A 4QSEA 4QFOA 2UVHA 1IEJA 1N84A 2CZHA 2D21A 4JVIA 2I4BA 1US5A 3MVYA 4PTKA 4IY5A 4PF8A 5DVIA 2F34A 3GZGA 2IA4A 4MJOA 3QIMA 1GR2A 3R6UA 4OFOA 3K1NA 4R73A 3PTYA 2QVRA 1NL5A 3EQ1A 1B3HA 4NF5B 1B3EA 4HCWA 2D3IA 4JDFA 2B4LA 1H3DA 3ZKKA 1UTBA 3RPWA 4QFNA 1MXWA 4XKPA 4HS7A 5CBSA 5DW8A 4GD5A 1XS5A 2F6GA 1MS7A 1KA1A 3BKIB 1FPDA 3DELB 4JWXA 1MXUA 3MW0A 3RT8A 4HW8A 5ITOA 1LFHA 3MP6A 2ALUA 3CFZA 5I58B 1B1HA 1B4ZA 3TTNA 4NG7A 3JZJA 3VLUA 5JTYB 3SESA 4ND9A 1LFGA 1I6QA 3O6HA 1P1UA 2I3WA 1OQHA 4THIA 4ZEBA 3RN8A 3EN3A 2ZZVA 5FTHA 3UA8A 4ESWA 1B5IA 5ESYA 4NWDA 3O6GA 4U4XA 3MUQA 1JQFA 2ESNA 4LA9A 3MVWA 2Y7RA 2DWJA 3CIJA 4GXAA 4NGUA 1FPEA 4POXA 4OTEA 3K1PA 4AB5A 3M3LA 4P3LA 2GHBA 5KZTA 3SEWA 4PAIA 3JV9A 4MHFA 5IZ3A 2F6PA 3VDFA 2HXWA 1ZIUA 3TCGA 1B05A 3VFJA 4DCXA 3G3IA 1FJ9A 1MQIA 3H4ZA 2V3QA 4GQOA 4R2FA 4NF8B 4OWDA 3IORA 2Z8DA 4O7IA 2PVUA 1P99A 3KG2A 1RKMA 4F22A 4LUBA 3FXBA 3B7DA 3I5OA 4EQ7A 5J1DA 2YPNA 1FTKA 1H45A 3WAFA 5ISUA 4PAKA 4OANA 1M5BA 1IIWA 4N91A 1SBPA 1RDZA 4ZZEA 1CNQA 2QRYA 4EXLA 2A5SA 1LEVA 1LBWA 5DEXB 1M5CA 2QL3A 2F7BA 5I2KB 5I58A 4JB7A 1A8EA 3TFLA 3C36A 4PBQA 4LVQA 3WAEA 2WYPA 2P3VA 2XX9A 4KCDA 3RNNA 4JSOA 5KDTB 4YZZA 2FVZA 5DYHA
chains in the Genus database with same CATH topology
3T0JA 4MJOA 4PAIA 1SPIA 5IZ3B 3RYDA 2WX9A 3IFAA 4P1LA 1FBEA 1FBHA 1K9ZA 3B8BA 4GWUA 4PFBA 2WBBA 3E78A 2JJKA 1FPBA 1LBVA 2DVZA 2CZKA 3KC1A 1G0HA 4GWYA 4MHFA 4X9TA 5IZ3A 5IZ1A 4DI3D 1NV2A 2Q8MA 1DCUA 5EYHA 2KQZA 2ZZWA 4OVPA 2GQ1A 3PTYA 3E79A 1G0IA 4MNIA 2HHMA 2V4CA 4JVDA 2QVRA 1RDYA 3W9WA 1VDWA 4OA4A 4G61A 4PDDA 1IMAA 4PE3A 4HCWA 2HXRA 3NOHA 4XF5A 4GBVA 1YZ0A 4F1UA 1XI6A 4XEQA 1QGXA 2QVVA 2Q74A 3IFCA 3EKIA 5EQAA 5F24A 4F18A 2VPOA 4PF6A 2B4LA 3BIGA 4OVTA 1FJ9A 4PDHA 5T3JA 1NUZA 3LUZA 4X04A 5JK4A 1FBCA 1NV4A 2V3QA 3T1BA 4I40A 2WBDA 1IMDA 4PGPA 1NV0A 3A29A 4N17A 1FPKA 2R8TA 1KA0A 3SZPA 4P8BA 1FTAA 2VT5A 2VPNA 4O7IA 5DW8A 3MSTA 4GX4A 4F1VA 4P47A 5IZZA 1NI9A 4H45A 4N81A 3GYYA 1Q9DA 1YYZA 2B4MA 1JP4A 2MKZA 1KA1A 2WEFA 2XWOA 4N4UA 1NV7A 5EQ9A 4I3EA 4I3YA 1FPDA 4HE2A 1RDXA 4N6DA 4NHBA 1LBYA 4MEVA 4GWZA 3RPLA 5I7IA 2DE2A 4KXPA 4P9KA 4NN3A 2FHYA 4OVQA 4PCDA 2Y5KA 1FSAA 2F3BA 2OX3A 3CHGA 2ZZXA 4MCOA 4GWSA 4O8MA 4O7MA 3FXBA 4UABA 1FJ6A 1FBPA 4GWXA 4IR8A 5J1DA 2QFLA 1NUWA 2XWIA 4NAPA 2XXKA 4GX6A 3MYUA 5J16A 1EYIA 4PAKA 4PFIA 4X8RA 3W9VA 2DDKA 4MAGA 2FIXA 3QMFA 4OANA 1FPFA 4NG7A 4PAFA 5EQ8A 5EYGA 2XA5A 4FBPA 4H46A 4P1EA 1NUYA 4MNCA 4GX3A 1BK4A 4N91A 5ET7A 4PETA 3HFUA 5IGAA 4YICA 5FBPA 3ROJA 1RDZA 4AS4A 1NV5A 4MIJA 3FBPA 1FRPA 1YXIA 2HZLA 3D1RA 4NF0A 2OWZA 2PFYA 2FIEA 4HE0A 3RPLB 5I5PA 1CNQA 3BIHA 2KR0A 2P3NA 3KC0A 1IMCA 3LV0A 4PFRA 5A5LA 1FBFA 2PCRA 2QVUA 4HXVA 4MMPA 4AS5A 1FPIA 5LTCA 3U65A 1IMEA 4GWWA 2L5VA 4HE1A 5CM6A 1LEVA 1LBWA 4MNPA 4MX6A 1K9YA 1FBGA 1LBXA 2DE3A 1KZ8A 2F3DA 2HZKA 2ZZVA 1IMBA 2CZIA 4N8YA 4PBHA 2CEXA 2F5XA 2HPGA 2QPQA 1FBDA 2PFZA 4OVRA 4DI4B 5ET5A 5ESYA 4NQ8A 4PC9A 4QXDA 5ET6A 2Y5LA 4QBAA 1FPJA 5ET8A 2FBPA 3B50A 4N15A 3KBZA 2XWKA 4N6KA 5I3SA 4GBWA 4XFEA 4P56A 4N8GA 1INPA 1DK4A 4OVSA 2Q9TA 3ISPA 2BJIA 4LN5A 4PBQA 1D9QA 4F19A 2XWVA 4HCYA 4O94A 4PGNA 1IMFA 1FPLA 2WYPA 2P3VA 1AWBA 1NV6A 1DBZA 1EYKA 4M1VA 1FPEA 2WYKA 4NGUA 5LDZA 1NV1A 1LBZA 1EYJA 5EQ7A 1FPGA 2CEYA 2CZHA 2DE4A 1NUXA 4JVIA 4P3LA 4PF8A 4PTKA 5IM2A 4YZZA 4NX1A 4JVCA 2FVZA 1NV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAI A;  2WX9 A;  4P1L A;  4PFB A;  4MHF A;  4DI3 D;  2ZZW A;  4OVP A;  4MNI A;  2V4C A;  4OA4 A;  4PDD A;  4PE3 A;  4XF5 A;  4XEQ A;  2VPO A;  4PF6 A;  4OVT A;  4PDH A;  4X04 A;  4PGP A;  4N17 A;  4P8B A;  2VPN A;  5IZZ A;  4P47 A;  3GYY A;  4N4U A;  2XWO A;  4NHB A;  4N6D A;  4MEV A;  5I7I A;  4P9K A;  4NN3 A;  4PCD A;  4OVQ A;  4MCO A;  2ZZX A;  4O8M A;  4O7M A;  3FXB A;  4UAB A;  2XWI A;  4NAP A;  2XXK A;  4PAK A;  4PFI A;  4X8R A;  4MAG A;  4OAN A;  4NG7 A;  4PAF A;  2XA5 A;  4P1E A;  4MNC A;  4N91 A;  5IGA A;  4PET A;  4YIC A;  4MIJ A;  2HZL A;  4NF0 A;  2PFY A;  5I5P A;  4PFR A;  4MMP A;  5LTC A;  3U65 A;  5CM6 A;  4MNP A;  4MX6 A;  2ZZV A;  4N8Y A;  2HZK A;  4PBH A;  2CEX A;  2HPG A;  2PFZ A;  4OVR A;  4DI4 B;  4NQ8 A;  4PC9 A;  3B50 A;  4N15 A;  2XWK A;  4N6K A;  4XFE A;  4P56 A;  4N8G A;  4OVS A;  4PBQ A;  4LN5 A;  2XWV A;  4O94 A;  4PGN A;  2WYP A;  4NGU A;  2WYK A;  2CEY A;  4P3L A;  4PF8 A;  5IM2 A;  4YZZ A;  4NX1 A; 
#chains in the Genus database with same CATH topology
 1Y1Z A;  2VD2 A;  4TLL B;  1FBH A;  4R9F A;  3AXF A;  4GWY A;  4Z0I A;  3PUW E;  5I2N B;  3RTW B;  2V93 A;  3ODB A;  1MM6 A;  2AIX A;  3ILT B;  4ZEI A;  2QS2 A;  1SW5 A;  2GRV A;  1IMD A;  1NV0 A;  4JBZ A;  5AA2 A;  4DIG A;  3P7I A;  2XXU A;  5TP9 B;  3VV5 A;  3U94 A;  2OX3 A;  1US4 A;  3SEY A;  3ILU B;  4KYE A;  4PE5 B;  4GX6 A;  3TQL A;  5H8N B;  3W9V A;  3V83 A;  3FVG A;  3VE1 B;  3H3G A;  4PET A;  3PUX E;  2V25 A;  5FBP A;  1Y20 A;  2ZYN A;  3TDJ A;  3MP1 A;  4NF0 A;  2OWZ A;  1MG1 A;  3Q25 A;  3MP8 A;  4C1U A;  4U2R A;  2THI A;  1AIV A;  4G68 A;  4GL8 A;  2CZI A;  2CEX A;  2HPG A;  4QSD A;  4XIG Q;  3G3J A;  1FPJ A;  1N7W A;  4XKR A;  4RY1 A;  2Q9T A;  3ISP A;  2RC8 A;  1MXV A;  4F29 A;  4HCY A;  1PB9 A;  4H1X A;  3G3F A;  4M1V A;  3PUV E;  4IO5 A;  1NNT A;  3H03 A;  2OZZ A;  1ZU0 A;  4PFY A;  1MXY A;  1LGB C;  1SPI A;  3FD3 A;  1FBE A;  4WEP A;  3E78 A;  2O1M A;  3KC1 A;  4LON B;  4FAT A;  3OO7 A;  3C4M A;  3IR1 A;  2B3F A;  1S7Y A;  2V4C A;  3CSB A;  4JVD A;  4BDO A;  4XKN A;  3H6T A;  4OET A;  1WOD A;  3NOH A;  4H8J A;  1NKX A;  2D5W A;  3KOT A;  3G3G A;  3MPK A;  3L6H A;  3UOR A;  5A5X A;  4G77 A;  1Y4C A;  2E1S A;  3KN8 A;  3JYR A;  1FQE A;  2H9B A;  1TWY A;  3PU5 A;  4N4U A;  4P9K A;  1N0T A;  3FZV A;  1B3F A;  3FXR A;  3LSW A;  3PD8 A;  1SYI A;  3OMB A;  1NNK A;  4DZ1 A;  5AE4 A;  3SKP A;  4MBP A;  5DTB A;  1B1X A;  4BDL A;  4QRZ A;  1MRP A;  1POT A;  1NV5 A;  3L6G A;  1BKA A;  1QUL A;  1LB8 A;  1FPI A;  3KSX A;  1FBG A;  1KZ8 A;  1SYH A;  4N8Y A;  2PT1 A;  3HCQ A;  4Q5T A;  2NVU B;  3N5L A;  3K6U A;  4QBA A;  5A5X B;  4P0I A;  3B50 A;  5I3S A;  3HO7 A;  2FA7 A;  3A09 A;  1IXC A;  3I6V A;  3M8U A;  4OFL A;  5TP9 A;  4YB5 A;  1D9Y A;  2E0S A;  1D3K A;  2XXY A;  2CEY A;  3FVN A;  1NUX A;  4PQJ A;  2UXA A;  4RXL A;  1NV3 A;  2REG A;  1XVX A;  4YKJ A;  3HHF A;  2DVZ A;  3PMV A;  3TEL A;  4R2B A;  3K6X A;  5FHN A;  1I6A A;  3W9W A;  3K1M A;  1JW1 A;  1YZ0 A;  4F1U A;  3MVX A;  5JK4 A;  1KWH A;  4O3B A;  3PUY E;  2F35 A;  5L9M A;  2XX8 A;  5H8F B;  4RYA A;  2OCU A;  3GYY A;  3N94 A;  4KFQ A;  2MKZ A;  1FQD A;  2O1L A;  4NMY A;  5L8D A;  4LP2 B;  5DVF A;  2ZYO A;  1J1N A;  2NWJ A;  1JVX A;  1SW4 A;  4GRK A;  2FIX A;  3O66 A;  4U4S A;  4NF5 A;  1Z7N E;  4MNC A;  4IO6 A;  1A55 A;  5CBR A;  4YKP A;  3MQ9 A;  4MLQ A;  3KC0 A;  4JXI A;  2PCR A;  4MMP A;  4ZED A;  5LTC A;  1F9B A;  3O28 A;  3K6V A;  1B0H A;  3EPE A;  3FVK A;  3IO4 A;  1S9T A;  2M8C A;  1Y3Q A;  2HCA A;  4XFE A;  1OLC A;  4O3C A;  4YMA A;  5L9O A;  1D9Q A;  3TPA A;  4O94 A;  3K02 A;  3F11 A;  4Q0C A;  3FGS A;  3BBR A;  1NFT A;  1GVC A;  3OO6 A;  4I1D A;  3CRB A;  3T0J A;  2XXV A;  2Z8E A;  4P1L A;  3VLW A;  3SEV A;  5EHS A;  2Q88 A;  4NF6 B;  3S2V A;  2Q2C A;  2I58 A;  2Y84 A;  3O9P A;  2QVV A;  4YB6 A;  2VPO A;  4PF6 A;  3RLF E;  4DDD A;  2WBD A;  3SEU A;  4F39 A;  4ZEK A;  2O7U A;  1DOT A;  5TPA B;  2VT5 A;  4GL0 A;  4JWY A;  1FQA A;  1MPD A;  4I3Y A;  1SQY A;  4NHB A;  2ZNT A;  1QW0 A;  3KSJ A;  1B3L A;  2FHY A;  3OSQ A;  1USY E;  2QS1 A;  4GWS A;  2AL4 A;  3IJX B;  3CSG A;  1QKB A;  5CMK A;  2BJJ X;  1I6B A;  3KEI A;  4UAC A;  3CG1 A;  4OEN A;  4MAG A;  4RPO A;  4PAF A;  3FAT A;  4X1D A;  2P1S A;  4GX3 A;  2XHD A;  5I59 B;  4L17 A;  4YIC A;  3ROJ A;  2UVJ A;  3MBP A;  4PFR A;  4ELO A;  4HXV A;  4MNP A;  1K9Y A;  2HZK A;  4PBH A;  1VFD A;  2I3V A;  2HQ0 A;  2HAV A;  2O6A A;  4DCY A;  5FHO A;  2RC9 A;  4F1Y A;  3UGW A;  4F19 A;  1EZ9 A;  3HPI A;  4JSD A;  2I48 A;  5H8S A;  1NV1 A;  1LBZ A;  3MPL A;  2PBW A;  4ZE9 A;  4NX1 A;  4JVC A;  4G2Z A;  5IZ3 B;  1UTB B;  1K9Z A;  4R9G A;  1IXG A;  1D9V A;  4DI3 D;  2H98 A;  3O29 A;  2GQ1 A;  1SI0 A;  4YB7 A;  4PFW A;  3PPQ A;  3KOS A;  2OWT A;  3RTF B;  2OLB A;  4YU0 A;  4XEQ A;  5EQA A;  3EKI A;  3SET A;  3S9E A;  1MPB A;  1NUZ A;  3PD9 A;  4P0G A;  3U72 A;  2XXR A;  3T1B A;  3D4C A;  2QJE A;  1H76 A;  5IZZ A;  1NNP A;  3E3K A;  1OLA A;  2PT2 A;  1LBY A;  2DE2 A;  3TEP A;  2QS4 A;  3QK6 A;  2G29 A;  4O7M A;  1FTL A;  3MWB A;  1B0L A;  1VE4 A;  2XXK A;  1M5F A;  4IGR A;  3H7M A;  1B7U A;  3IL1 B;  1VR5 A;  1TT1 A;  3UN6 A;  5JEI A;  5M2V A;  2XXW A;  2DXY A;  4PFU A;  4WKM A;  2XXI A;  5CMC A;  3KGC A;  1R1N A;  2PFY A;  4IO7 A;  2FIE A;  5A5L A;  1TXF A;  1O63 A;  5CM6 A;  4OYV A;  5KCJ A;  1IMB A;  5DT6 A;  4KPT A;  1FBD A;  2B65 A;  4G68 B;  5ET5 A;  3QUJ A;  4GF8 A;  4KD5 A;  2CZL A;  2YLN A;  2XWK A;  1URD A;  3CFX A;  4OVS A;  4NE4 A;  4KYS A;  2VP1 A;  4OES A;  3OEM A;  4R72 A;  1FPL A;  1LB9 A;  2ONK E;  2CMO A;  1RYX A;  4O3A A;  2ZNS A;  4ZE8 A;  2ZYM A;  4XKQ A;  3A3C A;  2VGQ A;  3H06 B;  4TQU Q;  2F97 A;  4OVJ A;  3OO9 A;  2O51 A;  1B7Z A;  3LSX A;  5HPQ A;  1IMA A;  4PE3 A;  4I62 A;  1XI6 A;  5F24 A;  3C31 A;  2VD3 A;  1O7T A;  1BP5 A;  3MZ9 A;  1OVT A;  4LZ5 A;  4N17 A;  1ZMG A;  2VHA A;  3TTR A;  1P1N A;  2O7I A;  5K2Y A;  3TAJ A;  4GIZ A;  4F1V A;  4GX4 A;  3THI A;  3CVG A;  3IOT A;  1JW4 A;  3H6U A;  4H65 A;  2WEF A;  5EQ9 A;  1B5H A;  4KXP A;  5CI5 A;  5I2N A;  4FEC A;  3SEX A;  1FBP A;  3G7W A;  1EZO A;  3DLN A;  4C1T A;  3T96 B;  3RQT A;  5B7D A;  3KN3 A;  3SER A;  4X8R A;  3SDF A;  1BTJ A;  4GXS B;  3HFU A;  1MQH A;  3IX1 A;  3TKD A;  2RIN A;  1UTH B;  2IEE A;  3ZS6 A;  2KR0 A;  3IB2 A;  1LFI A;  2X7Q A;  4EQ9 A;  3EHU A;  2H4I A;  3VVE A;  1R9L A;  1AMF A;  4OVR A;  4NQ8 A;  4QXD A;  3PMW A;  2KLF A;  4ELQ A;  1P1O A;  3KJ7 A;  1B4H A;  1R6Z A;  3TTK A;  4AB6 A;  4PGN A;  4KYD A;  4U1O A;  4F3P A;  4NTL A;  1JW5 A;  4OQO A;  1GGG A;  4YAH X;  5ICQ A;  2I0B A;  2I6E A;  5CC2 A;  1DMB A;  3PMX A;  4YKI A;  2H25 A;  1VSO A;  2P0S A;  2JJK A;  1FPB A;  1LBV A;  1O64 A;  5TPA A;  3GXA A;  1NV2 A;  3Q26 A;  2KQZ A;  1MQD A;  1G0I A;  4MNI A;  2HHM A;  3OSR A;  3LR1 A;  2ANJ A;  4NF4 B;  4GFR A;  3FXU A;  3VVD A;  3KJT A;  3BIG A;  5T3J A;  1FBC A;  1AL3 A;  2YJP A;  1MY3 A;  3DP8 A;  1FTA A;  1NV7 A;  4H8I A;  3VLV A;  3E4R A;  4NN3 A;  1JNF A;  2ZZX A;  1MQG A;  4XXU A;  4GWX A;  2O68 A;  5AA3 A;  4MH5 A;  1EYI A;  4MFI A;  1MDQ A;  3OEL A;  4R75 A;  1IZ1 A;  1MPC A;  4ELR A;  4FBP A;  1PBP A;  4I9D A;  5ET7 A;  1LCF A;  3RPL B;  4X1B A;  2QVU A;  1QUJ A;  2L5V A;  2ONR A;  4RPN A;  4M4G A;  2R71 A;  2Q2A A;  4NWC A;  4PC9 A;  1DTZ A;  2Y5L A;  4TLM B;  3C32 A;  4IGT A;  3KBZ A;  4OMB A;  2QMX A;  4YMB A;  4N8G A;  3C34 A;  4RNS A;  4U1Z A;  2XWV A;  5LDZ A;  3BFU A;  5I56 B;  2HFB A;  3RUM A;  2HEU A;  5AA1 A;  2PX1 A;  4GWU A;  5FHM A;  4C0R A;  5H8F A;  5H8H A;  4U23 A;  1M5D A;  1HSJ A;  3EHT A;  2ZZW A;  2H5Y A;  1N3W A;  5B70 A;  2QS3 A;  3S9L C;  4LZ7 A;  3T9U A;  4PDD A;  3TTM A;  3R7X A;  3IFC A;  1H44 A;  4N13 A;  4PDH A;  3LUZ A;  1NV4 A;  2Z23 A;  5IAI A;  1Y4T A;  2GH9 A;  2GFE A;  2V3T A;  2R8T A;  1B5J A;  1ZJL A;  2X7P A;  3MST A;  4P47 A;  4ZDM A;  2B4M A;  4I3E A;  3S4U A;  3C33 A;  4OFJ A;  1CE2 A;  4GWZ A;  5K2X A;  4OVQ A;  4TOZ A;  1FSA A;  2OJT A;  4IR8 A;  2QFL A;  3MYU A;  2X26 A;  1A8F A;  5ICT A;  3RT6 B;  3K0V A;  4ZZA A;  3E13 X;  1BK4 A;  1PDA A;  4JWO A;  5IGA A;  4Z7E A;  2O69 A;  1WVJ A;  1JET A;  3PPO A;  3LV0 A;  1IMC A;  1POY 1;  3UIF A;  4KHZ E;  4AS5 A;  4EDP A;  3W15 C;  3GBB A;  5IKB A;  3U92 A;  1IXH A;  1VFE A;  2F5X A;  2P2A A;  1YCJ A;  2PFZ A;  4UA8 A;  4FE8 A;  1SD3 A;  4DXB A;  5ET8 A;  2FBP A;  2FNC A;  1DPE A;  1INP A;  1DK4 A;  4BDM A;  4BDR A;  4LN5 A;  1Z7M E;  4OZ9 A;  1PEB A;  2Z22 A;  2Y7P A;  3LUY A;  5EYF A;  1B51 A;  3K4U A;  4ISU A;  1XVY A;  1XOC A;  1CB6 A;  5DVJ A;  2Y7K A;  1FTO A;  2WBB A;  4NED A;  3OEK A;  4OVP A;  3E79 A;  1DPP A;  3I3V A;  4GWO A;  4GBV A;  3Q27 A;  4IO3 A;  2G93 A;  4H67 A;  4OVT A;  2V3U A;  4ZEC A;  4LAT A;  2F7C A;  1FPK A;  3PV0 E;  4FAJ A;  1MXX A;  1FCK A;  1JP4 A;  4PFT A;  1RDX A;  4MEV A;  1QJM A;  1HSL A;  4YKK A;  4PCD A;  4ONY A;  5CMB A;  3BFT A;  2DWA A;  1FQC A;  3V89 B;  5I57 B;  3G3K A;  4H46 A;  1GTK A;  3TZA A;  4MIJ A;  3FBP A;  5HBC A;  3OOA A;  3RY3 A;  1N7X A;  5I5P A;  3BIH A;  4GWW A;  2AYS A;  1MH4 A;  1A99 A;  1JVY A;  4DI4 B;  4LZ8 A;  3DP6 A;  1RYO A;  1LAG E;  1TFA A;  4G8H A;  4KCC A;  4QSC A;  2Q8J A;  5AA4 A;  2DWH A;  5I56 A;  3M3K A;  3T93 B;  1NV6 A;  3T9H B;  3IK6 B;  3LC8 A;  4Q30 B;  1N04 A;  3IO6 A;  1IXI A;  1FQB A;  1ZKB A;  3FVO A;  2R6G E;  1LAH E;  4E0W A;  2XXP A;  1ZLQ A;  1BIY A;  1N76 A;  4FOR A;  1AH5 A;  5AA2 B;  3IAZ A;  3B6W A;  5IZ1 A;  3CR9 A;  4GVO A;  1OIB A;  2Q8M A;  1DCU A;  1ANF A;  4ECF A;  3VVF A;  2DSF A;  4POW A;  1YTV A;  1B9J A;  1RDY A;  3T22 A;  4ESX A;  3IOU A;  2LAO A;  2I0C A;  3OO8 A;  1B2H A;  4F18 A;  1FQF A;  1XT8 A;  3T9X B;  4G68 C;  1IUD A;  4IO4 A;  2OWS A;  1MXZ A;  4R6K A;  2ONS A;  2VPN A;  1NI9 A;  1MY0 A;  4N81 A;  1Q9D A;  1YYZ A;  1A40 A;  3K01 A;  4HE2 A;  1FW0 A;  4QHQ A;  5AA4 B;  2F3B A;  4O8M A;  4QFP A;  1FJ6 A;  4N6P A;  5LOM A;  3D4G A;  4IY6 A;  2DOJ A;  2Q89 A;  3QMF A;  1FPF A;  4ZEF A;  3TCF A;  3ZKL A;  1NUY A;  2DWI A;  5ELV A;  1YXI A;  4HE0 A;  4RJZ A;  1Y1M A;  3U65 A;  3IB0 A;  1MY2 A;  1IQ7 A;  2O84 X;  3LBS A;  4DXC A;  2UVI A;  2PYY A;  1R9Q A;  3TQW A;  2R9J A;  2DS9 A;  4LQ2 A;  3HST A;  3LSL A;  4OHN A;  3DM0 A;  1Q35 A;  3UP9 A;  4GLI A;  3O97 A;  5ITP A;  1A7L A;  4DE8 A;  1DBZ A;  1EYK A;  2ABH A;  3PUZ E;  1YPN A;  2DQV A;  3KFM A;  4KR5 A;  3UK4 A;  3MZ1 A;  5F7V A;  3H6V A;  2ZYK A;  2WX9 A;  3B8B A;  4FIM A;  3Q29 A;  2CZK A;  4IO2 A;  1B3G A;  4EUO A;  5EYH A;  2XXX A;  4NF8 A;  1MQJ A;  1H43 A;  3B6T A;  1NH7 A;  2HXR A;  2REJ A;  3FIR A;  4DXU A;  2QMW A;  4H0W A;  1SI1 A;  2ZMB A;  3QAX A;  2XD2 A;  2DP8 A;  2OK2 A;  4R6H A;  3V5A A;  3A29 A;  3U93 A;  3TCH A;  4NF6 A;  3G3H A;  1ZTY A;  4H45 A;  4FED A;  3FJ7 A;  4GOT A;  1P1Q A;  5CMM A;  1SW2 A;  3MJN A;  3HV1 A;  1SW1 A;  1MM7 A;  4ELP A;  1Y3P A;  1GV8 A;  2NUV A;  5J16 A;  1B52 A;  4PFI A;  3TYH A;  4EQB A;  3R26 A;  2DVC A;  3QSL A;  4NF4 A;  1Q1K A;  2H99 A;  4F2Q A;  4I8C A;  3C9H A;  4X48 A;  4AS4 A;  1N3X A;  3U1O A;  1FTJ A;  1P1W A;  4EXK A;  3D1R A;  1MDP 1;  4U22 A;  4U21 A;  5I59 A;  3C35 A;  2XXT A;  1DSN A;  3IOV A;  4MLV A;  1QKA A;  5BWJ A;  4QF9 A;  1B46 A;  1UIU A;  4N15 A;  4AQ4 A;  4GBW A;  3K2D A;  3IJO B;  1DTG A;  4FJP A;  5FTI A;  2HAU A;  2NOO A;  5L9S A;  5HM4 B;  1YAE A;  2B3B A;  1AWB A;  2F36 A;  2WYK A;  3DP4 A;  1LAX A;  1M5E A;  5JTY A;  1FPG A;  2DE4 A;  3E9X A;  1URG A;  4ZS9 A;  3EF7 A;  1QUK A;  3LSF B;  4RK2 A;  1D4N A;  4PFB A;  1QVS A;  3MAM A;  3QXM A;  1UIV A;  1AOV A;  3FJM A;  1PB7 A;  3TOD A;  2FYI A;  3IOW A;  4XF5 A;  1TFD A;  1LCT A;  1QGX A;  3PPN A;  5H8H B;  3FUZ A;  3T66 A;  2RC7 A;  2XXH A;  4I40 A;  3T9V A;  2A5T B;  1KA0 A;  2OBG A;  3K6W A;  4F31 B;  2WKY A;  5TU0 A;  2XWO A;  1NH8 A;  4N6D A;  3ZSF A;  5AA2 D;  5I7I A;  4FEB A;  4Q8R A;  4EF1 A;  3M3F A;  3O6I A;  1ATG A;  1PBQ A;  4BDQ A;  1JEU A;  4QFK A;  2XWI A;  1NUW A;  4G4P A;  4NAP A;  3N6U A;  2RKM A;  4KQP A;  2XA5 A;  2PMS A;  4KI0 E;  3ONM A;  4IB2 A;  1HSE A;  3HN0 A;  2Z8F A;  4R74 A;  2RF1 A;  2ZXT A;  3S9M C;  2P3N A;  1NMU A;  4H5F A;  3VXB A;  1FBF A;  4MF3 A;  1LAF E;  1B6H A;  4HE1 A;  4WED A;  4F2O A;  1EZP A;  1IIT A;  4MX6 A;  2DE3 A;  4R6Y A;  3K00 A;  1S50 A;  4N6K A;  2BJI A;  2Y7W A;  5KCJ B;  4LQ5 A;  2XD3 A;  3IB1 A;  3N6T A;  4RA1 A;  1EYJ A;  5EQ7 A;  2RCA A;  4P11 A;  5IM2 A;  3VXC A;  4OEV A;  4F3B A;  3QYT A;  3RYD A;  5BUU A;  5KDT A;  5I2K A;  1OVB A;  1G0H A;  1PB8 A;  1XHY A;  1ELJ A;  1L5T A;  1B7H A;  1VDW A;  1ZBM A;  3MC2 A;  4G61 A;  4N07 A;  2NXO A;  2DXR A;  4PP0 A;  1FTM A;  3N26 A;  4DLD A;  3MZB A;  3CFL A;  5I57 A;  3H6W A;  3GLB A;  3U8Q A;  1I69 A;  1LBC A;  4PGP A;  3SZP A;  1URS A;  1EU8 A;  4H6D A;  3TUS A;  5CRY A;  5I84 A;  3OXN A;  1PC3 A;  1Y9U A;  3OEN A;  1UQW A;  3RPL A;  2UYF A;  3A3U A;  4MCO A;  5H8Q A;  4XTC Q;  3FV1 A;  1NNF A;  1WDN A;  5EQ8 A;  5EYG A;  4P1E A;  1USY H;  4K3F A;  2F78 A;  2VOZ A;  1B40 A;  1UTH A;  5EHM A;  2UVG A;  3TMG A;  1SVX B;  3FV2 A;  3KZG A;  1SDX A;  4WXJ A;  2A5T A;  1II5 A;  3PPR A;  1MH3 A;  2RCB A;  4OER A;  5ET6 A;  2F7A A;  2F8D A;  1BLF A;  3OD7 A;  3TTL A;  1B58 A;  1IMF A;  1LBB A;  3USD A;  4RK9 A;  3EHS A;  3FXQ A;  2Y7I A;  4EF2 A;  2XXQ A;  3V8X B;  4E0X A;  3MVZ A;  3IFA A;  4X9T A;  4H5G A;  1OQG A;  2GHA A;  5H8Q B;  3FJG A;  4OEU A;  1MY4 A;  4F3S A;  3O2A A;  4OA4 A;  2XX7 A;  4QFL A;  4OXV A;  2Q74 A;  1MY1 A;  4X04 A;  3HHG A;  2W7Y A;  2V84 A;  4P8B A;  2QSX A;  1A54 A;  1XC1 A;  3PGF A;  4BDN A;  3RGY A;  1LLS A;  2AL5 A;  3KBR A;  2Y5K A;  3CHG A;  4BLA A;  2DYX A;  4UAB A;  1QUI A;  1JEV A;  4HTG A;  1OMP A;  2DDK A;  3GBA A;  1EH3 A;  3KN7 A;  3CI8 A;  3QUF A;  2UYE A;  1FRP A;  5DEX A;  3FAS A;  4G8N A;  1T0K A;  2HZL A;  2I49 A;  1Y3N A;  2I4C A;  3S9N C;  1LST A;  1IME A;  3Q28 A;  4G8M A;  1LBX A;  3ECR A;  2F3D A;  5H8N A;  2QPQ A;  3B6Q A;  5F1Q A;  4F3G A;  3CG3 A;  4P56 A;  2ZNU A;  3PPP A;  1B32 A;  4QSE A;  4QFO A;  2UVH A;  1IEJ A;  1N84 A;  2CZH A;  2D21 A;  4JVI A;  2I4B A;  1US5 A;  3MVY A;  4PTK A;  4IY5 A;  4PF8 A;  5DVI A;  2F34 A;  3GZG A;  2IA4 A;  4MJO A;  3QIM A;  1GR2 A;  3R6U A;  4OFO A;  3K1N A;  4R73 A;  3PTY A;  2QVR A;  1NL5 A;  3EQ1 A;  1B3H A;  4NF5 B;  1B3E A;  4HCW A;  2D3I A;  4JDF A;  2B4L A;  1H3D A;  3ZKK A;  1UTB A;  3RPW A;  4QFN A;  1MXW A;  4XKP A;  4HS7 A;  5CBS A;  5DW8 A;  4GD5 A;  1XS5 A;  2F6G A;  1MS7 A;  1KA1 A;  3BKI B;  1FPD A;  3DEL B;  4JWX A;  1MXU A;  3MW0 A;  3RT8 A;  4HW8 A;  5ITO A;  1LFH A;  3MP6 A;  2ALU A;  3CFZ A;  5I58 B;  1B1H A;  1B4Z A;  3TTN A;  4NG7 A;  3JZJ A;  3VLU A;  5JTY B;  3SES A;  4ND9 A;  1LFG A;  1I6Q A;  3O6H A;  1P1U A;  2I3W A;  1OQH A;  4THI A;  4ZEB A;  3RN8 A;  3EN3 A;  2ZZV A;  5FTH A;  3UA8 A;  4ESW A;  1B5I A;  5ESY A;  4NWD A;  3O6G A;  4U4X A;  3MUQ A;  1JQF A;  2ESN A;  4LA9 A;  3MVW A;  2Y7R A;  2DWJ A;  3CIJ A;  4GXA A;  4NGU A;  1FPE A;  4POX A;  4OTE A;  3K1P A;  4AB5 A;  3M3L A;  4P3L A;  2GHB A;  5KZT A;  3SEW A;  4PAI A;  3JV9 A;  4MHF A;  5IZ3 A;  2F6P A;  3VDF A;  2HXW A;  1ZIU A;  3TCG A;  1B05 A;  3VFJ A;  4DCX A;  3G3I A;  1FJ9 A;  1MQI A;  3H4Z A;  2V3Q A;  4GQO A;  4R2F A;  4NF8 B;  4OWD A;  3IOR A;  2Z8D A;  4O7I A;  2PVU A;  1P99 A;  3KG2 A;  1RKM A;  4F22 A;  4LUB A;  3FXB A;  3B7D A;  3I5O A;  4EQ7 A;  5J1D A;  2YPN A;  1FTK A;  1H45 A;  3WAF A;  5ISU A;  4PAK A;  4OAN A;  1M5B A;  1IIW A;  4N91 A;  1SBP A;  1RDZ A;  4ZZE A;  1CNQ A;  2QRY A;  4EXL A;  2A5S A;  1LEV A;  1LBW A;  5DEX B;  1M5C A;  2QL3 A;  2F7B A;  5I2K B;  5I58 A;  4JB7 A;  1A8E A;  3TFL A;  3C36 A;  4PBQ A;  4LVQ A;  3WAE A;  2WYP A;  2P3V A;  2XX9 A;  4KCD A;  3RNN A;  4JSO A;  5KDT B;  4YZZ A;  2FVZ A;  5DYH A; 
#chains in the Genus database with same CATH homology
 3T0J A;  4MJO A;  4PAI A;  1SPI A;  5IZ3 B;  3RYD A;  2WX9 A;  3IFA A;  4P1L A;  1FBE A;  1FBH A;  1K9Z A;  3B8B A;  4GWU A;  4PFB A;  2WBB A;  3E78 A;  2JJK A;  1FPB A;  1LBV A;  2DVZ A;  2CZK A;  3KC1 A;  1G0H A;  4GWY A;  4MHF A;  4X9T A;  5IZ3 A;  5IZ1 A;  4DI3 D;  1NV2 A;  2Q8M A;  1DCU A;  5EYH A;  2KQZ A;  2ZZW A;  4OVP A;  2GQ1 A;  3PTY A;  3E79 A;  1G0I A;  4MNI A;  2HHM A;  2V4C A;  4JVD A;  2QVR A;  1RDY A;  3W9W A;  1VDW A;  4OA4 A;  4G61 A;  4PDD A;  1IMA A;  4PE3 A;  4HCW A;  2HXR A;  3NOH A;  4XF5 A;  4GBV A;  1YZ0 A;  4F1U A;  1XI6 A;  4XEQ A;  1QGX A;  2QVV A;  2Q74 A;  3IFC A;  3EKI A;  5EQA A;  5F24 A;  4F18 A;  2VPO A;  4PF6 A;  2B4L A;  3BIG A;  4OVT A;  1FJ9 A;  4PDH A;  5T3J A;  1NUZ A;  3LUZ A;  4X04 A;  5JK4 A;  1FBC A;  1NV4 A;  2V3Q A;  3T1B A;  4I40 A;  2WBD A;  1IMD A;  4PGP A;  1NV0 A;  3A29 A;  4N17 A;  1FPK A;  2R8T A;  1KA0 A;  3SZP A;  4P8B A;  1FTA A;  2VT5 A;  2VPN A;  4O7I A;  5DW8 A;  3MST A;  4GX4 A;  4F1V A;  4P47 A;  5IZZ A;  1NI9 A;  4H45 A;  4N81 A;  3GYY A;  1Q9D A;  1YYZ A;  2B4M A;  1JP4 A;  2MKZ A;  1KA1 A;  2WEF A;  2XWO A;  4N4U A;  1NV7 A;  5EQ9 A;  4I3E A;  4I3Y A;  1FPD A;  4HE2 A;  1RDX A;  4N6D A;  4NHB A;  1LBY A;  4MEV A;  4GWZ A;  3RPL A;  5I7I A;  2DE2 A;  4KXP A;  4P9K A;  4NN3 A;  2FHY A;  4OVQ A;  4PCD A;  2Y5K A;  1FSA A;  2F3B A;  2OX3 A;  3CHG A;  2ZZX A;  4MCO A;  4GWS A;  4O8M A;  4O7M A;  3FXB A;  4UAB A;  1FJ6 A;  1FBP A;  4GWX A;  4IR8 A;  5J1D A;  2QFL A;  1NUW A;  2XWI A;  4NAP A;  2XXK A;  4GX6 A;  3MYU A;  5J16 A;  1EYI A;  4PAK A;  4PFI A;  4X8R A;  3W9V A;  2DDK A;  4MAG A;  2FIX A;  3QMF A;  4OAN A;  1FPF A;  4NG7 A;  4PAF A;  5EQ8 A;  5EYG A;  2XA5 A;  4FBP A;  4H46 A;  4P1E A;  1NUY A;  4MNC A;  4GX3 A;  1BK4 A;  4N91 A;  5ET7 A;  4PET A;  3HFU A;  5IGA A;  4YIC A;  5FBP A;  3ROJ A;  1RDZ A;  4AS4 A;  1NV5 A;  4MIJ A;  3FBP A;  1FRP A;  1YXI A;  2HZL A;  3D1R A;  4NF0 A;  2OWZ A;  2PFY A;  2FIE A;  4HE0 A;  3RPL B;  5I5P A;  1CNQ A;  3BIH A;  2KR0 A;  2P3N A;  3KC0 A;  1IMC A;  3LV0 A;  4PFR A;  5A5L A;  1FBF A;  2PCR A;  2QVU A;  4HXV A;  4MMP A;  4AS5 A;  1FPI A;  5LTC A;  3U65 A;  1IME A;  4GWW A;  2L5V A;  4HE1 A;  5CM6 A;  1LEV A;  1LBW A;  4MNP A;  4MX6 A;  1K9Y A;  1FBG A;  1LBX A;  2DE3 A;  1KZ8 A;  2F3D A;  2HZK A;  2ZZV A;  1IMB A;  2CZI A;  4N8Y A;  4PBH A;  2CEX A;  2F5X A;  2HPG A;  2QPQ A;  1FBD A;  2PFZ A;  4OVR A;  4DI4 B;  5ET5 A;  5ESY A;  4NQ8 A;  4PC9 A;  4QXD A;  5ET6 A;  2Y5L A;  4QBA A;  1FPJ A;  5ET8 A;  2FBP A;  3B50 A;  4N15 A;  3KBZ A;  2XWK A;  4N6K A;  5I3S A;  4GBW A;  4XFE A;  4P56 A;  4N8G A;  1INP A;  1DK4 A;  4OVS A;  2Q9T A;  3ISP A;  2BJI A;  4LN5 A;  4PBQ A;  1D9Q A;  4F19 A;  2XWV A;  4HCY A;  4O94 A;  4PGN A;  1IMF A;  1FPL A;  2WYP A;  2P3V A;  1AWB A;  1NV6 A;  1DBZ A;  1EYK A;  4M1V A;  1FPE A;  2WYK A;  4NGU A;  5LDZ A;  1NV1 A;  1LBZ A;  1EYJ A;  5EQ7 A;  1FPG A;  2CEY A;  2CZH A;  2DE4 A;  1NUX A;  4JVI A;  4P3L A;  4PF8 A;  4PTK A;  5IM2 A;  4YZZ A;  4NX1 A;  4JVC A;  2FVZ A;  1NV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...