2XWVA

Siap complex
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
309
structure length
309
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Tripartite ATP-Independent Periplasmic (Trap) Transporters Use an Arginine-Mediated Selectivity Filter for High Affinity Substrate Binding.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 124
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2010-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2xwvA00
2WYPA 4NHBA 4N17A 4MNCA 5IGAA 4N8YA 2PFZA 4MEVA 4PAKA 4N6DA 3U65A 4MHFA 4PDDA 2WYKA 4X8RA 2XWKA 4XEQA 5LTCA 4MMPA 4NG7A 4P8BA 4XF5A 4NF0A 4P1LA 4N6KA 4MAGA 4PF6A 4PBQA 4PGPA 5I5PA 4O7MA 4NGUA 4XFEA 2HZLA 4OA4A 2ZZVA 2HPGA 4P3LA 4N4UA 4N8GA 2XWOA 4PF8A 4OVPA 4P9KA 4PFRA 4PCDA 4OVSA 3GYYA 2XXKA 3B50A 4PE3A 4MNIA 4PETA 4PDHA 4DI4B 4OVRA 4PAFA 3FXBA 4NQ8A 4O8MA 2ZZWA 4OVQA 5IM2A 4PFIA 4YZZA 4PFBA 2CEYA 4PC9A 4N15A 4MNPA 4P56A 4N91A 2VPOA 4NX1A 5IZZA 4OVTA 2VPNA 4O94A 5CM6A 2XWVA 2XA5A 5I7IA 4LN5A 4NN3A 4PGNA 4MIJA 2ZZXA 4YICA 4NAPA 4PBHA 4PAIA 2WX9A 4P47A 2PFYA 4OANA 2CEXA 4X04A 2V4CA 4MCOA 4UABA 2HZKA 2XWIA 4DI3D 4MX6A 4P1EA
chains in the Genus database with same CATH superfamily
3DM0A 3HSTA 5DVFA 3KN3A 4AQ4A 4GX4A 4BDLA 1JEVA 5CBRA 5ET8A 1URSA 2F6GA 1MY2A 1Y20A 2HFBA 3OMBA 3PV0E 2HXRA 1NV3A 4GVOA 2DWAA 3KOSA 3PU5A 2HZLA 1Q1KA 2AIXA 1FQAA 3PPPA 4PFWA 5T3JA 1SYIA 5H8FA 1LBVA 1LBZA 3B6QA 2I49A 3RNNA 3OO9A 2QS4A 4OESA 3RPLA 4QFKA 3S2VA 1FBFA 1R1NA 2O84X 3R6UA 5H8HA 4ZE9A 5EYHA 4NWCA 3DELB 1NH7A 3KBRA 3Q29A 2OWZA 1ZU0A 4XIGQ 1HSEA 1OVTA 5I3SA 3SKPA 3KFMA 3DLNA 1NV5A 2E0SA 3CFLA 1II5A 1L5TA 5A5LA 4GF8A 3G3HA 4ZZEA 4H8IA 1YPNA 1DPEA 2OK2A 4P56A 4OTEA 2VPOA 3T96B 3TTLA 5AA2B 3SERA 1K9ZA 1IMAA 5I58A 1AMFA 1B46A 3N6TA 5ITPA 1M5CA 4ZEKA 2L5VA 3C31A 3W9WA 1QUKA 1US5A 4RNSA 5AE4A 2DSFA 4HE0A 2V3TA 4QXDA 3M3LA 4JXIA 2F97A 3FD3A 1IMBA 3GXAA 1MXVA 3FVOA 3IFCA 4LVQA 4P1EA 3TUSA 5I2NB 3C9HA 2OZZA 4GLIA 1P1OA 3H6WA 1NI9A 1WODA 2DS9A 3U65A 1XC1A 3FVGA 2Q8JA 4IY5A 1EYJA 3RPWA 5KCJA 1LAHE 2ZYMA 4BDMA 1IIWA 4WKMA 2RCAA 4TQUQ 4G68C 4U2RA 1LBBA 3EHTA 4HTGA 3L6HA 2QVUA 1BTJA 2Q9TA 4OVSA 4OEUA 1FJ9A 2XXQA 2DXYA 1XVYA 4LZ5A 2BJJX 5BWJA 1RKMA 2A5TB 1FQFA 1P1UA 2XX9A 2DE2A 2HAUA 1IMEA 2UXAA 2R6GE 4G4PA 2Y7WA 3H6UA 1JVXA 2ZZWA 5IM2A 1EYIA 1JQFA 3T0JA 3MP8A 1QGXA 1BLFA 4R9GA 2REJA 1OQHA 3U8QA 3MP6A 4HW8A 3O6GA 4R73A 3UK4A 2DWIA 3IB1A 1LBCA 3T9XB 2WKYA 4NN3A 3TTKA 4F3GA 3K01A 1BK4A 2O6AA 3GBAA 3OOAA 2HQ0A 2NWJA 1FSAA 5IZ1A 1NH8A 4U4XA 3QUFA 3LSWA 4GWZA 3CG1A 3FJGA 4R9FA 1FBDA 1SW5A 5EHMA 3ROJA 3MPLA 4QF9A 4R6KA 2ZXTA 2GRVA 1BKAA 1FPIA 4EXLA 3K6XA 1NL5A 4I3EA 4LP2B 4PF6A 3SEWA 4F31B 5J1DA 2R8TA 4ISUA 4PE5B 3KC1A 1LGBC 4ZZAA 1YYZA 1QJMA 4H67A 4OENA 1AIVA 4QFPA 5CBSA 4ZS9A 4F3PA 3RT6B 1IEJA 3PD9A 3MYUA 4ELRA 4PDHA 3TTNA 5ESYA 1URDA 2FVZA 1FW0A 4R6YA 1NV2A 1MQIA 1B32A 4EQBA 3IOVA 2FNCA 3RGYA 1NNPA 3S9NC 3P7IA 5F1QA 3LSXA 1JW4A 4GWOA 4QSEA 4FE8A 3FV1A 4PFYA 4MLVA 2DVZA 3IO6A 2FBPA 2V84A 3U93A 1MRPA 5ICQA 1AWBA 4H0WA 2I4BA 1LCTA 4F18A 3RYDA 2Z8EA 2UYFA 3R26A 4PAIA 1SD3A 2CEXA 1SPIA 2XXXA 1SQYA 1USYE 1SBPA 3S9LC 4I9DA 1MS7A 3HHFA 5L9MA 1IUDA 2QMWA 4NTLA 4N6DA 1N3XA 5IKBA 2IA4A 2V25A 2P0SA 1FPFA 2O51A 5H8QA 2AYSA 2M8CA 1Y1MA 4NGUA 5BUUA 4F22A 5KDTA 2YPNA 5ITOA 1YCJA 1B4ZA 4JWXA 1SW2A 1A55A 2VD3A 5JTYA 1H76A 4P9KA 3QYTA 3GYYA 1EU8A 3HO7A 3KEIA 3K0VA 3K2DA 5I59B 1Y3QA 4QFOA 2IEEA 3PTYA 1B05A 4H8JA 5ICTA 3PMWA 2QFLA 4ONYA 5L9SA 4QSCA 1XVXA 5L8DA 1UTBB 2F36A 4ND9A 4PC9A 1QULA 1ZJLA 2B3BA 3KSXA 4PFUA 3S4UA 3IOTA 4C1UA 2DYXA 3C33A 5TPAA 3TCFA 3HV1A 4G8NA 3TTRA 4HXVA 4JDFA 4THIA 3KN8A 3IR1A 4MIJA 5DEXB 3G3JA 4YICA 3S9MC 4YB7A 4NF4A 1MQJA 1M5BA 4DI3D 1JETA 1LLSA 1FTKA 4RY1A 5B7DA 2Z22A 4GWSA 3EHSA 1N84A 5JK4A 5EQ7A 4MHFA 4GOTA 2Z8DA 4RPOA 3T9UA 3FXQA 4N6KA 4RYAA 4PBQA 4XKPA 5AA4A 3LV0A 4P11A 4RPNA 3HPIA 2GFEA 2ZNUA 4POWA 2H4IA 4OA4A 4X9TA 3SETA 3TTMA 1FPKA 2E1SA 2P2AA 3B50A 3O97A 4KI0E 5CMKA 4MNIA 1Q35A 3LSLA 1VR5A 2CZIA 3H6VA 4G2ZA 3SEYA 4NF6B 5F24A 3JYRA 4QSDA 4PAFA 5I2KB 2RINA 5M2VA 1A54A 3OO7A 1FRPA 3VLUA 4R72A 4KR5A 3QMFA 4PFIA 2H5YA 5DW8A 1SI0A 3USDA 3IORA 4N91A 1MQHA 2B4LA 4LQ5A 3O9PA 4H45A 3BFTA 1O64A 1JNFA 2XWVA 1SW4A 1MDP1 3IJOB 4LONB 3N94A 3K6UA 4N81A 1KA1A 3FXUA 1F9BA 2CZLA 3TELA 2V4CA 2RC9A 3TQLA 4TLMB 3H7MA 3KZGA 4P0GA 1SW1A 4LATA 2WYKA 2PT1A 2XWKA 5H8NA 3A3CA 3OSQA 3C34A 2Y84A 3OD7A 3TPAA 1N04A 2Q8MA 4O7MA 4FIMA 4XKNA 4KHZE 1Z7NE 1DCUA 4ECFA 1PEBA 3O6IA 4KCDA 4ELOA 1B5JA 4P3LA 3O28A 4Z0IA 1A40A 1AOVA 1FPJA 4OQOA 1MH3A 5A5XB 4U1ZA 5I57B 4DCXA 1K9YA 3VVFA 3VDFA 4N07A 2HCAA 3RLFE 2VOZA 4OVRA 3TFLA 4ESXA 4KQPA 4OZ9A 3A09A 5EYGA 4F2OA 4NE4A 1JVYA 3VV5A 1YAEA 1A99A 5HBCA 3FJMA 2F34A 1MQDA 2XXTA 3V5AA 1D9VA 1XHYA 5CMCA 3V8XB 4EF2A 1AL3A 5IZZA 2ZNTA 1RDYA 1NUXA 2XXYA 2QJEA 2Y7IA 1KWHA 2XXRA 1T0KA 4RK2A 2XX7A 1I6QA 4AS4A 3TZAA 3RTFB 1I69A 1NUYA 5ELVA 3ECRA 1YTVA 4I62A 3A3UA 1MPCA 3L6GA 4PBHA 4EDPA 4OANA 3MWBA 5K2YA 4YZZA 1MY0A 1QKAA 3MP1A 2ZYKA 4NHBA 2D5WA 3D4CA 4GWUA 4ZE8A 3IX1A 1JW5A 3Q25A 2Y5LA 4R2BA 4X8RA 3E78A 2Q88A 4P8BA 4NF0A 1EZPA 3BIHA 3QXMA 1MY3A 2DDKA 3MBPA 3ZS6A 2F7AA 1UQWA 2CMOA 5CMBA 4H65A 1B3GA 4EQ7A 2FA7A 1SI1A 4PCDA 1LBWA 5FHMA 4N6PA 2RF1A 1Y9UA 2VD2A 4K3FA 4EQ9A 3IO4A 4G68B 3OEKA 1CB6A 1BIYA 1MM6A 4FBPA 1NV6A 2F8DA 3LR1A 5EYFA 1GV8A 1NV1A 2PYYA 3MVWA 3PUVE 5TP9A 1LB8A 4LA9A 1LEVA 1VFEA 1QUJA 1UIVA 2I0CA 4GL8A 1ZKBA 1IXHA 2PBWA 2QPQA 4NX1A 1I6BA 4WXJA 3ILTB 3MC2A 1J1NA 5I7IA 3CR9A 3FVKA 2QSXA 3K4UA 4XKQA 5DT6A 4ESWA 1IXGA 4GFRA 4F1UA 4I8CA 5H8NB 2WBDA 3QAXA 4LZ7A 5I56A 2VGQA 4U1OA 3JV9A 3K1PA 4KXPA 2ANJA 1H44A 1MXXA 2OX3A 1MY1A 1Y3NA 2A5SA 5EQ8A 3H6TA 3JZJA 4GX6A 4H5FA 3LUYA 4KD5A 4OFJA 3DP8A 1RYXA 2B4MA 3W9VA 4YB6A 2Z23A 2VHAA 4DDDA 4ZEFA 3PUWE 3KJ7A 3RY3A 2HPGA 4GXAA 1POTA 4IO6A 5ISUA 3ISPA 5H8FB 2I48A 4PF8A 1MQGA 4YMBA 2PMSA 3RPLB 1N0TA 1PC3A 5H8HB 4QRZA 4QFNA 4DE8A 2QS3A 4C1TA 1EZ9A 1WDNA 2PCRA 3OXNA 3EKIA 1DPPA 2B3FA 3V89B 3TKDA 5EQ9A 3I5OA 4IO2A 1RDZA 2F6PA 2OLBA 3M3FA 3G3FA 3EN3A 4I1DA 4O94A 1MPBA 5I58B 1FTOA 1B4HA 1SYHA 1P99A 1PB9A 3QK6A 1OLAA 1PB8A 3MJNA 2ZNSA 1LAXA 2Y7KA 3UN6A 4P47A 2X7PA 1CNQA 2XXHA 2ESNA 4PGPA 1B0HA 2WYPA 2F3DA 2XHDA 3QIMA 3CSGA 3MPKA 1QUIA 3LC8A 1B3HA 3TODA 1SVXB 3TYHA 3HCQA 1LSTA 3FASA 4Q30B 3T66A 4DIGA 2O68A 4YMAA 5KCJB 3RTWB 3FATA 2R71A 3AXFA 4U23A 1JW1A 4OVJA 4PFTA 4E0XA 4NF5A 3B8BA 4F1YA 3RT8A 2NUVA 4UACA 4YAHX 4ZEBA 4IO5A 3FZVA 1IZ1A 5FBPA 4IGTA 1LFHA 1NUZA 4YB5A 5CI5A 1Y3PA 3HN0A 3PPNA 4OWDA 3TDJA 2GQ1A 2UVJA 4YKIA 1ZBMA 2KLFA 2O7UA 1IXCA 1UIUA 1SDXA 5B70A 1IMDA 1B1HA 3MQ9A 1IQ7A 2FIXA 1G0HA 1S9TA 4KCCA 3UGWA 3G3KA 2R9JA 2GH9A 1UTHA 1Z7ME 3BIGA 4QHQA 1FPBA 3C4MA 3H4ZA 3SEXA 2ZZXA 1N7WA 4YU0A 4KYDA 5H8SA 1FQDA 3MVXA 5AA2D 5FHOA 2F78A 2XWIA 3T9VA 4NF8A 4I40A 4HCYA 1B7HA 2P3VA 1WVJA 4N17A 3FGSA 5HM4B 3V83A 4N8YA 4OFLA 4HCWA 4RA1A 4KYSA 1ZLQA 5DTBA 5LTCA 2OCUA 2ZMBA 2X7QA 4P1LA 3EPEA 1LB9A 4FAJA 3K02A 5I5PA 3I6VA 2P1SA 1TFAA 3C35A 4KYEA 1A7LA 4N4UA 1GR2A 2QVVA 1B52A 4BDOA 5FTIA 1D4NA 4OHNA 1R9QA 2AL4A 3MZ9A 4PE3A 4DXBA 1PBPA 4JSOA 5I84A 3BKIB 4JBZA 4YKPA 1FPEA 4L17A 1NUWA 1B6HA 2DWJA 3IOWA 4O3CA 3N5LA 1MG1A 4BDNA 1NV0A 4WEPA 3VXCA 4FORA 3ZKLA 4ZECA 3MSTA 3U94A 4ZDMA 2YJPA 4FJPA 4NWDA 5IZ3A 1LAFE 3G3GA 2ABHA 2I6EA 3N26A 3VVDA 1US4A 1TWYA 4GD5A 4BLAA 1FPDA 2WX9A 1FTLA 1FTAA 2AL5A 3FVNA 3EQ1A 4MCOA 3OELA 3KBZA 4MX6A 5I2NA 1R9LA 3MAMA 2UVIA 3IL1B 2F7BA 2VP1A 5IGAA 3FIRA 1MXWA 5ET6A 4PAKA 1IMCA 3H3GA 3T22A 1B5IA 5H8QB 4BDRA 1OMPA 1A8EA 1FPLA 4X1BA 1H43A 1NV4A 4OMBA 4AB6A 5KDTB 3MW0A 2Q2CA 2GHAA 1JEUA 1RDXA 3H03A 1MY4A 3GLBA 2PVUA 4OVPA 2P3NA 2OBGA 1FTJA 5JTYB 1B3FA 2XXKA 1B0LA 3VLVA 2H98A 1LBXA 2A5TA 2THIA 3O2AA 3SEUA 3MVYA 4QBAA 1O63A 3K6VA 2G29A 4OVQA 1LCFA 4Q0CA 2FHYA 3S9EA 4MNPA 1B51A 4KFQA 4GBVA 3KGCA 1OVBA 1B7UA 1B7ZA 1DK4A 5DVJA 4WEDA 2Y7RA 5CM6A 2QL3A 1VE4A 5TPAB 1M5EA 3PUYE 4PGNA 4GL0A 3E3KA 4M4GA 4M1VA 4R74A 4F2QA 4OERA 4OYVA 4H6DA 4X04A 4NF4B 2NOOA 4XKRA 2Q74A 4DCYA 1G0IA 3LBSA 1CE2A 4MEVA 4H46A 3A29A 3B6WA 4PDDA 4U21A 4BDQA 3PUXE 4MMPA 1R6ZA 3Q26A 3CFZA 4G77A 1VDWA 4MAGA 4GWYA 3TEPA 5AA4B 1M5FA 1QW0A 4GWXA 2ZZVA 2NXOA 5EHSA 4MF3A 3PMVA 3IJXB 4N8GA 1ANFA 1FCKA 2XWOA 1FTMA 3DP6A 4EUOA 4DXUA 1TFDA 3CI8A 1MXZA 3CHGA 2XX8A 4EF1A 5IZ3B 2KR0A 3OEMA 1FBCA 3FV2A 2O1LA 3O6HA 3RN8A 3TMGA 4GBWA 3WAEA 3W15C 4MFIA 3CRBA 2XD3A 5CMMA 5LDZA 4IR8A 3VVEA 3IAZA 3UORA 3VE1B 4GIZA 3OO6A 3EF7A 2REGA 2HEUA 2ZYOA 4IB2A 1XI6A 4FEDA 3SEVA 2I0BA 4XXUA 1LFGA 2UVHA 1B2HA 3CSBA 1B1XA 3R7XA 4NAPA 3TCHA 4F29A 4TOZA 3RQTA 3MUQA 1D9YA 2QVRA 2ONSA 1PBQA 2O1MA 2KQZA 3U72A 1ZTYA 3M3KA 4H1XA 5CC2A 4RK9A 2RCBA 3K00A 1DSNA 1RYOA 2DQVA 5ET5A 2ONRA 4O3AA 4XF5A 1GVCA 2WBBA 4N13A 4H5GA 4U22A 4R6HA 3D1RA 1XT8A 3C32A 2DXRA 2XXPA 4GXSB 3ONMA 4XFEA 1NNKA 1MXYA 5ET7A 1YZ0A 3E13X 3IK6B 1HSLA 3THIA 3T1BA 1NNTA 3QUJA 5LOMA 1MXUA 1TT1A 5L9OA 4HE1A 3KC0A 4PETA 1VFDA 4R75A 3TQWA 4DI4B 1S50A 4KPTA 5I59A 2PX1A 2OWSA 2V3UA 4ELPA 5KZTA 1P1NA 1B5HA 3U1OA 4AS5A 1B9JA 3D4GA 1EYKA 3LUZA 4FEBA 1UTBA 3PGFA 3BFUA 3T93B 4N15A 4ZEDA 3UP9A 1M5DA 1EZOA 2WEFA 4NMYA 4JB7A 3VLWA 1B3LA 4RXLA 2QS2A 1FJ6A 2XA5A 4GX3A 2XXUA 4LZ8A 4TLLB 4LN5A 2W7YA 4PTKA 3B7DA 2HXWA 5DEXA 1DTZA 1D3KA 1POY1 3TCGA 1VSOA 4I3YA 3UIFA 1Y4CA 1DOTA 1P1WA 4OEVA 3IFAA 3K6WA 2Y7PA 4F3BA 2HZKA 4GQOA 4DZ1A 1FQEA 4F1VA 1B40A 3KJTA 2JJKA 3E9XA 3DP4A 3KOTA 3M8UA 4C0RA 3SZPA 5IAIA 2I3VA 4JWOA 1XOCA 4XEQA 3OENA 1ZMGA 4X48A 1Y1ZA 3ZSFA 4HE2A 2FYIA 4JWYA 1Y4TA 1EH3A 2DE4A 1PDAA 1NNFA 5K2XA 2OWTA 1N7XA 4U4SA 3MVZA 3VXBA 1KA0A 4MJOA 1IITA 4E0WA 5AA3A 1TXFA 4LUBA 2F5XA 1LFIA 4FECA 1MH4A 1BP5A 4YKJA 4F39A 4NF6A 5I2KA 3CVGA 3ZKKA 1QKBA 1B3EA 1XS5A 4GRKA 2XXIA 2HHMA 3FXBA 4MLQA 3O29A 3FXRA 2Q2AA 5TP9B 3BBRA 2I58A 3H06B 2UVGA 3ODBA 1AH5A 2BJIA 3K1NA 1MPDA 2QMXA 3PUZE 5FTHA 1OIBA 4QFLA 1GGGA 2DWHA 3IB0A 4JVIA 4G61A 4O3BA 4UA8A 1INPA 4POXA 3E4RA 1LAGE 2CZHA 4O7IA 4ZEIA 3U92A 3FBPA 4P0IA 1MDQA 2H9BA 3RUMA 3IOUA 3PPOA 4UABA 5I56B 2V93A 4AB5A 4JVCA 1IXIA 2Q89A 3PD8A 3ILUB 4LQ2A 3LSFB 4MNCA 1LBYA 2Z8FA 5DYHA 4DXCA 3HHGA 1ATGA 2ALUA 5EQAA 4OETA 2RC8A 2Y5KA 2DOJA 3SDFA 4G8MA 3UA8A 3SESA 3I3VA 3G7WA 1OQGA 3WAFA 3NOHA 2QRYA 1YXIA 5CRYA 3T9HB 4GWWA 4PFRA 1FPGA 5A5XA 5I57A 2O69A 4IY6A 4JVDA 4IO4A 1FBPA 2H99A 4IO3A 1NV7A 2D21A 4F19A 1OLCA 3IB2A 1HSJA 1DMBA 5FHNA 1FQCA 1NMUA 5TU0A 5HPQA 4OXVA 4XTCQ 3PPRA 2NVUB 2G93A 3Q27A 2PT2A 3F11A 3GBBA 2V3QA 1H3DA 3E79A 3PMXA 4RJZA 1P1QA 3MZBA 4MH5A 2CZKA 3CG3A 4EXKA 1PB7A 1A8FA 5DVIA 3HFUA 1URGA 5F7VA 1IMFA 4ELQA 3KN7A 1FQBA 2D3IA 4JSDA 2PFYA 2XXWA 3G3IA 3QSLA 5AA2A 3EHUA 2RKMA 3O66A 4X1DA 4IO7A 1USYH 4HS7A 4Q8RA 2PFZA 1QVSA 2O7IA 3MZ1A 1S7YA 3CFXA 4NG7A 3Q28A 3N6UA 1D9QA 1JP4A 4MBPA 3KG2A 4Z7EA 2LAOA 5JEIA 1MM7A 2XXVA 2I4CA 2XD2A 3PPQA 2VT5A 4DLDA 3OO8A 4YKKA 3OSRA 4FATA 2F3BA 4PQJA 1NFTA 2OJTA 4PP0A 4NF5B 1N3WA 2DE3A 4G68A 1GTKA 1N76A 2GHBA 2DVCA 4R2FA 2B65A 2H25A 3VFJA 1FBHA 2HAVA 1NKXA 3CIJA 4F3SA 4NQ8A 2FIEA 2ONKE 3B6TA 2YLNA 4O8MA 1ZIUA 1I6AA 1H45A 1FBGA 4IGRA 1FBEA 4PFBA 3KSJA 1O7TA 2CEYA 1Q9DA 1B58A 1ELJA 4G8HA 2ZYNA 3GZGA 4Q5TA 2F7CA 2QS1A 4OVTA 5AA1A 2DP8A 3FJ7A 2VPNA 4NEDA 1DBZA 4OFOA 3TAJA 2UYEA 1UTHB 3C36A 2F35A 5J16A 2RC7A 2X26A 1DTGA 3K1MA 1KZ8A 3FUZA 2MKZA 2I3WA 4NF8B
chains in the Genus database with same CATH topology
2WYPA 2F3DA 2QVRA 4GWSA 4GX4A 2KQZA 5JK4A 5EQ7A 4MHFA 5ET5A 5ET8A 4XF5A 2WBBA 4N6KA 4PBQA 3D1RA 2HXRA 3LV0A 1NV3A 4XFEA 2HZLA 4OA4A 4X9TA 5T3JA 5ET7A 1LBVA 1YZ0A 1LBZA 1FPKA 3T1BA 3B8BA 3RPLA 3B50A 4HE1A 1FBFA 3KC0A 4MNIA 4PETA 5EYHA 2CZIA 4DI4B 5F24A 4PAFA 2OWZA 5FBPA 1NUZA 5I3SA 1NV5A 1FRPA 4AS5A 1EYKA 3LUZA 2GQ1A 3QMFA 5A5LA 4PFIA 5DW8A 4N15A 4P56A 4N91A 1IMDA 2B4LA 2VPOA 2WEFA 1K9ZA 2FIXA 1G0HA 1IMAA 4H45A 1FJ6A 2XWVA 2XA5A 4GX3A 4LN5A 4PTKA 2L5VA 3BIGA 1FPBA 3W9WA 4I3YA 4N81A 2ZZXA 4HE0A 1KA1A 3IFAA 4QXDA 2V4CA 2HZKA 2XWIA 4I40A 4P1EA 1IMBA 3IFCA 4HCYA 2P3VA 4F1VA 4N17A 2JJKA 1NI9A 4N8YA 3SZPA 3U65A 4HCWA 2WYKA 2XWKA 4XEQA 5LTCA 1EYJA 4HE2A 4P1LA 2Q8MA 5I5PA 4O7MA 2DE4A 1DCUA 4P3LA 4N4UA 1KA0A 4MJOA 2QVUA 2QVVA 2Q9TA 1FPJA 4OVSA 2F5XA 1K9YA 1FJ9A 4PE3A 4OVRA 5EYGA 2HHMA 3FXBA 1FPEA 2DE2A 1NUWA 1IMEA 2ZZWA 5IM2A 1EYIA 3T0JA 1NV0A 1QGXA 3MSTA 2BJIA 5IZ3A 5IZZA 1RDYA 1NUXA 4JVIA 4G61A 1INPA 4NN3A 2CZHA 4AS4A 1BK4A 1NUYA 4O7IA 3FBPA 4PBHA 1FPDA 2WX9A 1FTAA 4OANA 1FSAA 4MCOA 4UABA 5IZ1A 4JVCA 4MX6A 3KBZA 4YZZA 4NHBA 4GWZA 4MNCA 1LBYA 5IGAA 1FBDA 4GWUA 3ROJA 5ET6A 4PAKA 2Y5LA 1IMCA 4X8RA 3E78A 4P8BA 1FPIA 4NF0A 3BIHA 5EQAA 4I3EA 4PF6A 2DDKA 5J1DA 2R8TA 1FPLA 2Y5KA 1NV4A 3KC1A 1YYZA 1RDXA 3NOHA 4OVPA 2P3NA 1YXIA 4GWWA 4PFRA 1FPGA 4PCDA 1LBWA 2XXKA 4JVDA 1FBPA 1NV7A 3MYUA 4F19A 4PDHA 1LBXA 5ESYA 4FBPA 1NV6A 2FVZA 4QBAA 1NV1A 1NV2A 1LEVA 4OVQA 2V3QA 2FHYA 3E79A 4MNPA 4GBVA 2QPQA 2CZKA 4NX1A 1DK4A 5CM6A 2DVZA 3HFUA 5I7IA 4PGNA 2FBPA 1AWBA 1IMFA 4M1VA 4F1UA 4F18A 3RYDA 2WBDA 4PAIA 2PFYA 2CEXA 4X04A 1SPIA 2Q74A 4KXPA 1G0IA 2OX3A 2PFZA 4MEVA 4H46A 3A29A 4N6DA 5EQ8A 4GX6A 4PDDA 4MMPA 4NG7A 1FPFA 2B4MA 1D9QA 3W9VA 1VDWA 4MAGA 1JP4A 4GWYA 4NGUA 4GWXA 2VT5A 2ZZVA 2HPGA 2F3BA 4N8GA 3ISPA 2XWOA 4PF8A 4P9KA 2DE3A 3GYYA 3RPLB 3CHGA 5IZ3B 2KR0A 1FBCA 1FBHA 2PCRA 3PTYA 4GBWA 4NQ8A 2FIEA 2QFLA 4O8MA 3EKIA 1FBGA 1FBEA 5EQ9A 4PFBA 2CEYA 4PC9A 1Q9DA 5LDZA 1RDZA 4IR8A 4OVTA 2VPNA 4O94A 1DBZA 4HXVA 1XI6A 4MIJA 5J16A 4YICA 4NAPA 4P47A 1CNQA 4DI3D 1KZ8A 2MKZA 4PGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WYP A;  4NHB A;  4N17 A;  4MNC A;  5IGA A;  4N8Y A;  2PFZ A;  4MEV A;  4PAK A;  4N6D A;  3U65 A;  4MHF A;  4PDD A;  2WYK A;  4X8R A;  2XWK A;  4XEQ A;  5LTC A;  4MMP A;  4NG7 A;  4P8B A;  4XF5 A;  4NF0 A;  4P1L A;  4N6K A;  4MAG A;  4PF6 A;  4PBQ A;  4PGP A;  5I5P A;  4O7M A;  4NGU A;  4XFE A;  2HZL A;  4OA4 A;  2ZZV A;  2HPG A;  4P3L A;  4N4U A;  4N8G A;  2XWO A;  4PF8 A;  4OVP A;  4P9K A;  4PFR A;  4PCD A;  4OVS A;  3GYY A;  2XXK A;  3B50 A;  4PE3 A;  4MNI A;  4PET A;  4PDH A;  4DI4 B;  4OVR A;  4PAF A;  3FXB A;  4NQ8 A;  4O8M A;  2ZZW A;  4OVQ A;  5IM2 A;  4PFI A;  4YZZ A;  4PFB A;  2CEY A;  4PC9 A;  4N15 A;  4MNP A;  4P56 A;  4N91 A;  2VPO A;  4NX1 A;  5IZZ A;  4OVT A;  2VPN A;  4O94 A;  5CM6 A;  2XWV A;  2XA5 A;  5I7I A;  4LN5 A;  4NN3 A;  4PGN A;  4MIJ A;  2ZZX A;  4YIC A;  4NAP A;  4PBH A;  4PAI A;  2WX9 A;  4P47 A;  2PFY A;  4OAN A;  2CEX A;  4X04 A;  2V4C A;  4MCO A;  4UAB A;  2HZK A;  2XWI A;  4DI3 D;  4MX6 A;  4P1E A; 
#chains in the Genus database with same CATH topology
 3DM0 A;  3HST A;  5DVF A;  3KN3 A;  4AQ4 A;  4GX4 A;  4BDL A;  1JEV A;  5CBR A;  5ET8 A;  1URS A;  2F6G A;  1MY2 A;  1Y20 A;  2HFB A;  3OMB A;  3PV0 E;  2HXR A;  1NV3 A;  4GVO A;  2DWA A;  3KOS A;  3PU5 A;  2HZL A;  1Q1K A;  2AIX A;  1FQA A;  3PPP A;  4PFW A;  5T3J A;  1SYI A;  5H8F A;  1LBV A;  1LBZ A;  3B6Q A;  2I49 A;  3RNN A;  3OO9 A;  2QS4 A;  4OES A;  3RPL A;  4QFK A;  3S2V A;  1FBF A;  1R1N A;  2O84 X;  3R6U A;  5H8H A;  4ZE9 A;  5EYH A;  4NWC A;  3DEL B;  1NH7 A;  3KBR A;  3Q29 A;  2OWZ A;  1ZU0 A;  4XIG Q;  1HSE A;  1OVT A;  5I3S A;  3SKP A;  3KFM A;  3DLN A;  1NV5 A;  2E0S A;  3CFL A;  1II5 A;  1L5T A;  5A5L A;  4GF8 A;  3G3H A;  4ZZE A;  4H8I A;  1YPN A;  1DPE A;  2OK2 A;  4P56 A;  4OTE A;  2VPO A;  3T96 B;  3TTL A;  5AA2 B;  3SER A;  1K9Z A;  1IMA A;  5I58 A;  1AMF A;  1B46 A;  3N6T A;  5ITP A;  1M5C A;  4ZEK A;  2L5V A;  3C31 A;  3W9W A;  1QUK A;  1US5 A;  4RNS A;  5AE4 A;  2DSF A;  4HE0 A;  2V3T A;  4QXD A;  3M3L A;  4JXI A;  2F97 A;  3FD3 A;  1IMB A;  3GXA A;  1MXV A;  3FVO A;  3IFC A;  4LVQ A;  4P1E A;  3TUS A;  5I2N B;  3C9H A;  2OZZ A;  4GLI A;  1P1O A;  3H6W A;  1NI9 A;  1WOD A;  2DS9 A;  3U65 A;  1XC1 A;  3FVG A;  2Q8J A;  4IY5 A;  1EYJ A;  3RPW A;  5KCJ A;  1LAH E;  2ZYM A;  4BDM A;  1IIW A;  4WKM A;  2RCA A;  4TQU Q;  4G68 C;  4U2R A;  1LBB A;  3EHT A;  4HTG A;  3L6H A;  2QVU A;  1BTJ A;  2Q9T A;  4OVS A;  4OEU A;  1FJ9 A;  2XXQ A;  2DXY A;  1XVY A;  4LZ5 A;  2BJJ X;  5BWJ A;  1RKM A;  2A5T B;  1FQF A;  1P1U A;  2XX9 A;  2DE2 A;  2HAU A;  1IME A;  2UXA A;  2R6G E;  4G4P A;  2Y7W A;  3H6U A;  1JVX A;  2ZZW A;  5IM2 A;  1EYI A;  1JQF A;  3T0J A;  3MP8 A;  1QGX A;  1BLF A;  4R9G A;  2REJ A;  1OQH A;  3U8Q A;  3MP6 A;  4HW8 A;  3O6G A;  4R73 A;  3UK4 A;  2DWI A;  3IB1 A;  1LBC A;  3T9X B;  2WKY A;  4NN3 A;  3TTK A;  4F3G A;  3K01 A;  1BK4 A;  2O6A A;  3GBA A;  3OOA A;  2HQ0 A;  2NWJ A;  1FSA A;  5IZ1 A;  1NH8 A;  4U4X A;  3QUF A;  3LSW A;  4GWZ A;  3CG1 A;  3FJG A;  4R9F A;  1FBD A;  1SW5 A;  5EHM A;  3ROJ A;  3MPL A;  4QF9 A;  4R6K A;  2ZXT A;  2GRV A;  1BKA A;  1FPI A;  4EXL A;  3K6X A;  1NL5 A;  4I3E A;  4LP2 B;  4PF6 A;  3SEW A;  4F31 B;  5J1D A;  2R8T A;  4ISU A;  4PE5 B;  3KC1 A;  1LGB C;  4ZZA A;  1YYZ A;  1QJM A;  4H67 A;  4OEN A;  1AIV A;  4QFP A;  5CBS A;  4ZS9 A;  4F3P A;  3RT6 B;  1IEJ A;  3PD9 A;  3MYU A;  4ELR A;  4PDH A;  3TTN A;  5ESY A;  1URD A;  2FVZ A;  1FW0 A;  4R6Y A;  1NV2 A;  1MQI A;  1B32 A;  4EQB A;  3IOV A;  2FNC A;  3RGY A;  1NNP A;  3S9N C;  3P7I A;  5F1Q A;  3LSX A;  1JW4 A;  4GWO A;  4QSE A;  4FE8 A;  3FV1 A;  4PFY A;  4MLV A;  2DVZ A;  3IO6 A;  2FBP A;  2V84 A;  3U93 A;  1MRP A;  5ICQ A;  1AWB A;  4H0W A;  2I4B A;  1LCT A;  4F18 A;  3RYD A;  2Z8E A;  2UYF A;  3R26 A;  4PAI A;  1SD3 A;  2CEX A;  1SPI A;  2XXX A;  1SQY A;  1USY E;  1SBP A;  3S9L C;  4I9D A;  1MS7 A;  3HHF A;  5L9M A;  1IUD A;  2QMW A;  4NTL A;  4N6D A;  1N3X A;  5IKB A;  2IA4 A;  2V25 A;  2P0S A;  1FPF A;  2O51 A;  5H8Q A;  2AYS A;  2M8C A;  1Y1M A;  4NGU A;  5BUU A;  4F22 A;  5KDT A;  2YPN A;  5ITO A;  1YCJ A;  1B4Z A;  4JWX A;  1SW2 A;  1A55 A;  2VD3 A;  5JTY A;  1H76 A;  4P9K A;  3QYT A;  3GYY A;  1EU8 A;  3HO7 A;  3KEI A;  3K0V A;  3K2D A;  5I59 B;  1Y3Q A;  4QFO A;  2IEE A;  3PTY A;  1B05 A;  4H8J A;  5ICT A;  3PMW A;  2QFL A;  4ONY A;  5L9S A;  4QSC A;  1XVX A;  5L8D A;  1UTB B;  2F36 A;  4ND9 A;  4PC9 A;  1QUL A;  1ZJL A;  2B3B A;  3KSX A;  4PFU A;  3S4U A;  3IOT A;  4C1U A;  2DYX A;  3C33 A;  5TPA A;  3TCF A;  3HV1 A;  4G8N A;  3TTR A;  4HXV A;  4JDF A;  4THI A;  3KN8 A;  3IR1 A;  4MIJ A;  5DEX B;  3G3J A;  4YIC A;  3S9M C;  4YB7 A;  4NF4 A;  1MQJ A;  1M5B A;  4DI3 D;  1JET A;  1LLS A;  1FTK A;  4RY1 A;  5B7D A;  2Z22 A;  4GWS A;  3EHS A;  1N84 A;  5JK4 A;  5EQ7 A;  4MHF A;  4GOT A;  2Z8D A;  4RPO A;  3T9U A;  3FXQ A;  4N6K A;  4RYA A;  4PBQ A;  4XKP A;  5AA4 A;  3LV0 A;  4P11 A;  4RPN A;  3HPI A;  2GFE A;  2ZNU A;  4POW A;  2H4I A;  4OA4 A;  4X9T A;  3SET A;  3TTM A;  1FPK A;  2E1S A;  2P2A A;  3B50 A;  3O97 A;  4KI0 E;  5CMK A;  4MNI A;  1Q35 A;  3LSL A;  1VR5 A;  2CZI A;  3H6V A;  4G2Z A;  3SEY A;  4NF6 B;  5F24 A;  3JYR A;  4QSD A;  4PAF A;  5I2K B;  2RIN A;  5M2V A;  1A54 A;  3OO7 A;  1FRP A;  3VLU A;  4R72 A;  4KR5 A;  3QMF A;  4PFI A;  2H5Y A;  5DW8 A;  1SI0 A;  3USD A;  3IOR A;  4N91 A;  1MQH A;  2B4L A;  4LQ5 A;  3O9P A;  4H45 A;  3BFT A;  1O64 A;  1JNF A;  2XWV A;  1SW4 A;  1MDP 1;  3IJO B;  4LON B;  3N94 A;  3K6U A;  4N81 A;  1KA1 A;  3FXU A;  1F9B A;  2CZL A;  3TEL A;  2V4C A;  2RC9 A;  3TQL A;  4TLM B;  3H7M A;  3KZG A;  4P0G A;  1SW1 A;  4LAT A;  2WYK A;  2PT1 A;  2XWK A;  5H8N A;  3A3C A;  3OSQ A;  3C34 A;  2Y84 A;  3OD7 A;  3TPA A;  1N04 A;  2Q8M A;  4O7M A;  4FIM A;  4XKN A;  4KHZ E;  1Z7N E;  1DCU A;  4ECF A;  1PEB A;  3O6I A;  4KCD A;  4ELO A;  1B5J A;  4P3L A;  3O28 A;  4Z0I A;  1A40 A;  1AOV A;  1FPJ A;  4OQO A;  1MH3 A;  5A5X B;  4U1Z A;  5I57 B;  4DCX A;  1K9Y A;  3VVF A;  3VDF A;  4N07 A;  2HCA A;  3RLF E;  2VOZ A;  4OVR A;  3TFL A;  4ESX A;  4KQP A;  4OZ9 A;  3A09 A;  5EYG A;  4F2O A;  4NE4 A;  1JVY A;  3VV5 A;  1YAE A;  1A99 A;  5HBC A;  3FJM A;  2F34 A;  1MQD A;  2XXT A;  3V5A A;  1D9V A;  1XHY A;  5CMC A;  3V8X B;  4EF2 A;  1AL3 A;  5IZZ A;  2ZNT A;  1RDY A;  1NUX A;  2XXY A;  2QJE A;  2Y7I A;  1KWH A;  2XXR A;  1T0K A;  4RK2 A;  2XX7 A;  1I6Q A;  4AS4 A;  3TZA A;  3RTF B;  1I69 A;  1NUY A;  5ELV A;  3ECR A;  1YTV A;  4I62 A;  3A3U A;  1MPC A;  3L6G A;  4PBH A;  4EDP A;  4OAN A;  3MWB A;  5K2Y A;  4YZZ A;  1MY0 A;  1QKA A;  3MP1 A;  2ZYK A;  4NHB A;  2D5W A;  3D4C A;  4GWU A;  4ZE8 A;  3IX1 A;  1JW5 A;  3Q25 A;  2Y5L A;  4R2B A;  4X8R A;  3E78 A;  2Q88 A;  4P8B A;  4NF0 A;  1EZP A;  3BIH A;  3QXM A;  1MY3 A;  2DDK A;  3MBP A;  3ZS6 A;  2F7A A;  1UQW A;  2CMO A;  5CMB A;  4H65 A;  1B3G A;  4EQ7 A;  2FA7 A;  1SI1 A;  4PCD A;  1LBW A;  5FHM A;  4N6P A;  2RF1 A;  1Y9U A;  2VD2 A;  4K3F A;  4EQ9 A;  3IO4 A;  4G68 B;  3OEK A;  1CB6 A;  1BIY A;  1MM6 A;  4FBP A;  1NV6 A;  2F8D A;  3LR1 A;  5EYF A;  1GV8 A;  1NV1 A;  2PYY A;  3MVW A;  3PUV E;  5TP9 A;  1LB8 A;  4LA9 A;  1LEV A;  1VFE A;  1QUJ A;  1UIV A;  2I0C A;  4GL8 A;  1ZKB A;  1IXH A;  2PBW A;  2QPQ A;  4NX1 A;  1I6B A;  4WXJ A;  3ILT B;  3MC2 A;  1J1N A;  5I7I A;  3CR9 A;  3FVK A;  2QSX A;  3K4U A;  4XKQ A;  5DT6 A;  4ESW A;  1IXG A;  4GFR A;  4F1U A;  4I8C A;  5H8N B;  2WBD A;  3QAX A;  4LZ7 A;  5I56 A;  2VGQ A;  4U1O A;  3JV9 A;  3K1P A;  4KXP A;  2ANJ A;  1H44 A;  1MXX A;  2OX3 A;  1MY1 A;  1Y3N A;  2A5S A;  5EQ8 A;  3H6T A;  3JZJ A;  4GX6 A;  4H5F A;  3LUY A;  4KD5 A;  4OFJ A;  3DP8 A;  1RYX A;  2B4M A;  3W9V A;  4YB6 A;  2Z23 A;  2VHA A;  4DDD A;  4ZEF A;  3PUW E;  3KJ7 A;  3RY3 A;  2HPG A;  4GXA A;  1POT A;  4IO6 A;  5ISU A;  3ISP A;  5H8F B;  2I48 A;  4PF8 A;  1MQG A;  4YMB A;  2PMS A;  3RPL B;  1N0T A;  1PC3 A;  5H8H B;  4QRZ A;  4QFN A;  4DE8 A;  2QS3 A;  4C1T A;  1EZ9 A;  1WDN A;  2PCR A;  3OXN A;  3EKI A;  1DPP A;  2B3F A;  3V89 B;  3TKD A;  5EQ9 A;  3I5O A;  4IO2 A;  1RDZ A;  2F6P A;  2OLB A;  3M3F A;  3G3F A;  3EN3 A;  4I1D A;  4O94 A;  1MPB A;  5I58 B;  1FTO A;  1B4H A;  1SYH A;  1P99 A;  1PB9 A;  3QK6 A;  1OLA A;  1PB8 A;  3MJN A;  2ZNS A;  1LAX A;  2Y7K A;  3UN6 A;  4P47 A;  2X7P A;  1CNQ A;  2XXH A;  2ESN A;  4PGP A;  1B0H A;  2WYP A;  2F3D A;  2XHD A;  3QIM A;  3CSG A;  3MPK A;  1QUI A;  3LC8 A;  1B3H A;  3TOD A;  1SVX B;  3TYH A;  3HCQ A;  1LST A;  3FAS A;  4Q30 B;  3T66 A;  4DIG A;  2O68 A;  4YMA A;  5KCJ B;  3RTW B;  3FAT A;  2R71 A;  3AXF A;  4U23 A;  1JW1 A;  4OVJ A;  4PFT A;  4E0X A;  4NF5 A;  3B8B A;  4F1Y A;  3RT8 A;  2NUV A;  4UAC A;  4YAH X;  4ZEB A;  4IO5 A;  3FZV A;  1IZ1 A;  5FBP A;  4IGT A;  1LFH A;  1NUZ A;  4YB5 A;  5CI5 A;  1Y3P A;  3HN0 A;  3PPN A;  4OWD A;  3TDJ A;  2GQ1 A;  2UVJ A;  4YKI A;  1ZBM A;  2KLF A;  2O7U A;  1IXC A;  1UIU A;  1SDX A;  5B70 A;  1IMD A;  1B1H A;  3MQ9 A;  1IQ7 A;  2FIX A;  1G0H A;  1S9T A;  4KCC A;  3UGW A;  3G3K A;  2R9J A;  2GH9 A;  1UTH A;  1Z7M E;  3BIG A;  4QHQ A;  1FPB A;  3C4M A;  3H4Z A;  3SEX A;  2ZZX A;  1N7W A;  4YU0 A;  4KYD A;  5H8S A;  1FQD A;  3MVX A;  5AA2 D;  5FHO A;  2F78 A;  2XWI A;  3T9V A;  4NF8 A;  4I40 A;  4HCY A;  1B7H A;  2P3V A;  1WVJ A;  4N17 A;  3FGS A;  5HM4 B;  3V83 A;  4N8Y A;  4OFL A;  4HCW A;  4RA1 A;  4KYS A;  1ZLQ A;  5DTB A;  5LTC A;  2OCU A;  2ZMB A;  2X7Q A;  4P1L A;  3EPE A;  1LB9 A;  4FAJ A;  3K02 A;  5I5P A;  3I6V A;  2P1S A;  1TFA A;  3C35 A;  4KYE A;  1A7L A;  4N4U A;  1GR2 A;  2QVV A;  1B52 A;  4BDO A;  5FTI A;  1D4N A;  4OHN A;  1R9Q A;  2AL4 A;  3MZ9 A;  4PE3 A;  4DXB A;  1PBP A;  4JSO A;  5I84 A;  3BKI B;  4JBZ A;  4YKP A;  1FPE A;  4L17 A;  1NUW A;  1B6H A;  2DWJ A;  3IOW A;  4O3C A;  3N5L A;  1MG1 A;  4BDN A;  1NV0 A;  4WEP A;  3VXC A;  4FOR A;  3ZKL A;  4ZEC A;  3MST A;  3U94 A;  4ZDM A;  2YJP A;  4FJP A;  4NWD A;  5IZ3 A;  1LAF E;  3G3G A;  2ABH A;  2I6E A;  3N26 A;  3VVD A;  1US4 A;  1TWY A;  4GD5 A;  4BLA A;  1FPD A;  2WX9 A;  1FTL A;  1FTA A;  2AL5 A;  3FVN A;  3EQ1 A;  4MCO A;  3OEL A;  3KBZ A;  4MX6 A;  5I2N A;  1R9L A;  3MAM A;  2UVI A;  3IL1 B;  2F7B A;  2VP1 A;  5IGA A;  3FIR A;  1MXW A;  5ET6 A;  4PAK A;  1IMC A;  3H3G A;  3T22 A;  1B5I A;  5H8Q B;  4BDR A;  1OMP A;  1A8E A;  1FPL A;  4X1B A;  1H43 A;  1NV4 A;  4OMB A;  4AB6 A;  5KDT B;  3MW0 A;  2Q2C A;  2GHA A;  1JEU A;  1RDX A;  3H03 A;  1MY4 A;  3GLB A;  2PVU A;  4OVP A;  2P3N A;  2OBG A;  1FTJ A;  5JTY B;  1B3F A;  2XXK A;  1B0L A;  3VLV A;  2H98 A;  1LBX A;  2A5T A;  2THI A;  3O2A A;  3SEU A;  3MVY A;  4QBA A;  1O63 A;  3K6V A;  2G29 A;  4OVQ A;  1LCF A;  4Q0C A;  2FHY A;  3S9E A;  4MNP A;  1B51 A;  4KFQ A;  4GBV A;  3KGC A;  1OVB A;  1B7U A;  1B7Z A;  1DK4 A;  5DVJ A;  4WED A;  2Y7R A;  5CM6 A;  2QL3 A;  1VE4 A;  5TPA B;  1M5E A;  3PUY E;  4PGN A;  4GL0 A;  3E3K A;  4M4G A;  4M1V A;  4R74 A;  4F2Q A;  4OER A;  4OYV A;  4H6D A;  4X04 A;  4NF4 B;  2NOO A;  4XKR A;  2Q74 A;  4DCY A;  1G0I A;  3LBS A;  1CE2 A;  4MEV A;  4H46 A;  3A29 A;  3B6W A;  4PDD A;  4U21 A;  4BDQ A;  3PUX E;  4MMP A;  1R6Z A;  3Q26 A;  3CFZ A;  4G77 A;  1VDW A;  4MAG A;  4GWY A;  3TEP A;  5AA4 B;  1M5F A;  1QW0 A;  4GWX A;  2ZZV A;  2NXO A;  5EHS A;  4MF3 A;  3PMV A;  3IJX B;  4N8G A;  1ANF A;  1FCK A;  2XWO A;  1FTM A;  3DP6 A;  4EUO A;  4DXU A;  1TFD A;  3CI8 A;  1MXZ A;  3CHG A;  2XX8 A;  4EF1 A;  5IZ3 B;  2KR0 A;  3OEM A;  1FBC A;  3FV2 A;  2O1L A;  3O6H A;  3RN8 A;  3TMG A;  4GBW A;  3WAE A;  3W15 C;  4MFI A;  3CRB A;  2XD3 A;  5CMM A;  5LDZ A;  4IR8 A;  3VVE A;  3IAZ A;  3UOR A;  3VE1 B;  4GIZ A;  3OO6 A;  3EF7 A;  2REG A;  2HEU A;  2ZYO A;  4IB2 A;  1XI6 A;  4FED A;  3SEV A;  2I0B A;  4XXU A;  1LFG A;  2UVH A;  1B2H A;  3CSB A;  1B1X A;  3R7X A;  4NAP A;  3TCH A;  4F29 A;  4TOZ A;  3RQT A;  3MUQ A;  1D9Y A;  2QVR A;  2ONS A;  1PBQ A;  2O1M A;  2KQZ A;  3U72 A;  1ZTY A;  3M3K A;  4H1X A;  5CC2 A;  4RK9 A;  2RCB A;  3K00 A;  1DSN A;  1RYO A;  2DQV A;  5ET5 A;  2ONR A;  4O3A A;  4XF5 A;  1GVC A;  2WBB A;  4N13 A;  4H5G A;  4U22 A;  4R6H A;  3D1R A;  1XT8 A;  3C32 A;  2DXR A;  2XXP A;  4GXS B;  3ONM A;  4XFE A;  1NNK A;  1MXY A;  5ET7 A;  1YZ0 A;  3E13 X;  3IK6 B;  1HSL A;  3THI A;  3T1B A;  1NNT A;  3QUJ A;  5LOM A;  1MXU A;  1TT1 A;  5L9O A;  4HE1 A;  3KC0 A;  4PET A;  1VFD A;  4R75 A;  3TQW A;  4DI4 B;  1S50 A;  4KPT A;  5I59 A;  2PX1 A;  2OWS A;  2V3U A;  4ELP A;  5KZT A;  1P1N A;  1B5H A;  3U1O A;  4AS5 A;  1B9J A;  3D4G A;  1EYK A;  3LUZ A;  4FEB A;  1UTB A;  3PGF A;  3BFU A;  3T93 B;  4N15 A;  4ZED A;  3UP9 A;  1M5D A;  1EZO A;  2WEF A;  4NMY A;  4JB7 A;  3VLW A;  1B3L A;  4RXL A;  2QS2 A;  1FJ6 A;  2XA5 A;  4GX3 A;  2XXU A;  4LZ8 A;  4TLL B;  4LN5 A;  2W7Y A;  4PTK A;  3B7D A;  2HXW A;  5DEX A;  1DTZ A;  1D3K A;  1POY 1;  3TCG A;  1VSO A;  4I3Y A;  3UIF A;  1Y4C A;  1DOT A;  1P1W A;  4OEV A;  3IFA A;  3K6W A;  2Y7P A;  4F3B A;  2HZK A;  4GQO A;  4DZ1 A;  1FQE A;  4F1V A;  1B40 A;  3KJT A;  2JJK A;  3E9X A;  3DP4 A;  3KOT A;  3M8U A;  4C0R A;  3SZP A;  5IAI A;  2I3V A;  4JWO A;  1XOC A;  4XEQ A;  3OEN A;  1ZMG A;  4X48 A;  1Y1Z A;  3ZSF A;  4HE2 A;  2FYI A;  4JWY A;  1Y4T A;  1EH3 A;  2DE4 A;  1PDA A;  1NNF A;  5K2X A;  2OWT A;  1N7X A;  4U4S A;  3MVZ A;  3VXB A;  1KA0 A;  4MJO A;  1IIT A;  4E0W A;  5AA3 A;  1TXF A;  4LUB A;  2F5X A;  1LFI A;  4FEC A;  1MH4 A;  1BP5 A;  4YKJ A;  4F39 A;  4NF6 A;  5I2K A;  3CVG A;  3ZKK A;  1QKB A;  1B3E A;  1XS5 A;  4GRK A;  2XXI A;  2HHM A;  3FXB A;  4MLQ A;  3O29 A;  3FXR A;  2Q2A A;  5TP9 B;  3BBR A;  2I58 A;  3H06 B;  2UVG A;  3ODB A;  1AH5 A;  2BJI A;  3K1N A;  1MPD A;  2QMX A;  3PUZ E;  5FTH A;  1OIB A;  4QFL A;  1GGG A;  2DWH A;  3IB0 A;  4JVI A;  4G61 A;  4O3B A;  4UA8 A;  1INP A;  4POX A;  3E4R A;  1LAG E;  2CZH A;  4O7I A;  4ZEI A;  3U92 A;  3FBP A;  4P0I A;  1MDQ A;  2H9B A;  3RUM A;  3IOU A;  3PPO A;  4UAB A;  5I56 B;  2V93 A;  4AB5 A;  4JVC A;  1IXI A;  2Q89 A;  3PD8 A;  3ILU B;  4LQ2 A;  3LSF B;  4MNC A;  1LBY A;  2Z8F A;  5DYH A;  4DXC A;  3HHG A;  1ATG A;  2ALU A;  5EQA A;  4OET A;  2RC8 A;  2Y5K A;  2DOJ A;  3SDF A;  4G8M A;  3UA8 A;  3SES A;  3I3V A;  3G7W A;  1OQG A;  3WAF A;  3NOH A;  2QRY A;  1YXI A;  5CRY A;  3T9H B;  4GWW A;  4PFR A;  1FPG A;  5A5X A;  5I57 A;  2O69 A;  4IY6 A;  4JVD A;  4IO4 A;  1FBP A;  2H99 A;  4IO3 A;  1NV7 A;  2D21 A;  4F19 A;  1OLC A;  3IB2 A;  1HSJ A;  1DMB A;  5FHN A;  1FQC A;  1NMU A;  5TU0 A;  5HPQ A;  4OXV A;  4XTC Q;  3PPR A;  2NVU B;  2G93 A;  3Q27 A;  2PT2 A;  3F11 A;  3GBB A;  2V3Q A;  1H3D A;  3E79 A;  3PMX A;  4RJZ A;  1P1Q A;  3MZB A;  4MH5 A;  2CZK A;  3CG3 A;  4EXK A;  1PB7 A;  1A8F A;  5DVI A;  3HFU A;  1URG A;  5F7V A;  1IMF A;  4ELQ A;  3KN7 A;  1FQB A;  2D3I A;  4JSD A;  2PFY A;  2XXW A;  3G3I A;  3QSL A;  5AA2 A;  3EHU A;  2RKM A;  3O66 A;  4X1D A;  4IO7 A;  1USY H;  4HS7 A;  4Q8R A;  2PFZ A;  1QVS A;  2O7I A;  3MZ1 A;  1S7Y A;  3CFX A;  4NG7 A;  3Q28 A;  3N6U A;  1D9Q A;  1JP4 A;  4MBP A;  3KG2 A;  4Z7E A;  2LAO A;  5JEI A;  1MM7 A;  2XXV A;  2I4C A;  2XD2 A;  3PPQ A;  2VT5 A;  4DLD A;  3OO8 A;  4YKK A;  3OSR A;  4FAT A;  2F3B A;  4PQJ A;  1NFT A;  2OJT A;  4PP0 A;  4NF5 B;  1N3W A;  2DE3 A;  4G68 A;  1GTK A;  1N76 A;  2GHB A;  2DVC A;  4R2F A;  2B65 A;  2H25 A;  3VFJ A;  1FBH A;  2HAV A;  1NKX A;  3CIJ A;  4F3S A;  4NQ8 A;  2FIE A;  2ONK E;  3B6T A;  2YLN A;  4O8M A;  1ZIU A;  1I6A A;  1H45 A;  1FBG A;  4IGR A;  1FBE A;  4PFB A;  3KSJ A;  1O7T A;  2CEY A;  1Q9D A;  1B58 A;  1ELJ A;  4G8H A;  2ZYN A;  3GZG A;  4Q5T A;  2F7C A;  2QS1 A;  4OVT A;  5AA1 A;  2DP8 A;  3FJ7 A;  2VPN A;  4NED A;  1DBZ A;  4OFO A;  3TAJ A;  2UYE A;  1UTH B;  3C36 A;  2F35 A;  5J16 A;  2RC7 A;  2X26 A;  1DTG A;  3K1M A;  1KZ8 A;  3FUZ A;  2MKZ A;  2I3W A;  4NF8 B; 
#chains in the Genus database with same CATH homology
 2WYP A;  2F3D A;  2QVR A;  4GWS A;  4GX4 A;  2KQZ A;  5JK4 A;  5EQ7 A;  4MHF A;  5ET5 A;  5ET8 A;  4XF5 A;  2WBB A;  4N6K A;  4PBQ A;  3D1R A;  2HXR A;  3LV0 A;  1NV3 A;  4XFE A;  2HZL A;  4OA4 A;  4X9T A;  5T3J A;  5ET7 A;  1LBV A;  1YZ0 A;  1LBZ A;  1FPK A;  3T1B A;  3B8B A;  3RPL A;  3B50 A;  4HE1 A;  1FBF A;  3KC0 A;  4MNI A;  4PET A;  5EYH A;  2CZI A;  4DI4 B;  5F24 A;  4PAF A;  2OWZ A;  5FBP A;  1NUZ A;  5I3S A;  1NV5 A;  1FRP A;  4AS5 A;  1EYK A;  3LUZ A;  2GQ1 A;  3QMF A;  5A5L A;  4PFI A;  5DW8 A;  4N15 A;  4P56 A;  4N91 A;  1IMD A;  2B4L A;  2VPO A;  2WEF A;  1K9Z A;  2FIX A;  1G0H A;  1IMA A;  4H45 A;  1FJ6 A;  2XWV A;  2XA5 A;  4GX3 A;  4LN5 A;  4PTK A;  2L5V A;  3BIG A;  1FPB A;  3W9W A;  4I3Y A;  4N81 A;  2ZZX A;  4HE0 A;  1KA1 A;  3IFA A;  4QXD A;  2V4C A;  2HZK A;  2XWI A;  4I40 A;  4P1E A;  1IMB A;  3IFC A;  4HCY A;  2P3V A;  4F1V A;  4N17 A;  2JJK A;  1NI9 A;  4N8Y A;  3SZP A;  3U65 A;  4HCW A;  2WYK A;  2XWK A;  4XEQ A;  5LTC A;  1EYJ A;  4HE2 A;  4P1L A;  2Q8M A;  5I5P A;  4O7M A;  2DE4 A;  1DCU A;  4P3L A;  4N4U A;  1KA0 A;  4MJO A;  2QVU A;  2QVV A;  2Q9T A;  1FPJ A;  4OVS A;  2F5X A;  1K9Y A;  1FJ9 A;  4PE3 A;  4OVR A;  5EYG A;  2HHM A;  3FXB A;  1FPE A;  2DE2 A;  1NUW A;  1IME A;  2ZZW A;  5IM2 A;  1EYI A;  3T0J A;  1NV0 A;  1QGX A;  3MST A;  2BJI A;  5IZ3 A;  5IZZ A;  1RDY A;  1NUX A;  4JVI A;  4G61 A;  1INP A;  4NN3 A;  2CZH A;  4AS4 A;  1BK4 A;  1NUY A;  4O7I A;  3FBP A;  4PBH A;  1FPD A;  2WX9 A;  1FTA A;  4OAN A;  1FSA A;  4MCO A;  4UAB A;  5IZ1 A;  4JVC A;  4MX6 A;  3KBZ A;  4YZZ A;  4NHB A;  4GWZ A;  4MNC A;  1LBY A;  5IGA A;  1FBD A;  4GWU A;  3ROJ A;  5ET6 A;  4PAK A;  2Y5L A;  1IMC A;  4X8R A;  3E78 A;  4P8B A;  1FPI A;  4NF0 A;  3BIH A;  5EQA A;  4I3E A;  4PF6 A;  2DDK A;  5J1D A;  2R8T A;  1FPL A;  2Y5K A;  1NV4 A;  3KC1 A;  1YYZ A;  1RDX A;  3NOH A;  4OVP A;  2P3N A;  1YXI A;  4GWW A;  4PFR A;  1FPG A;  4PCD A;  1LBW A;  2XXK A;  4JVD A;  1FBP A;  1NV7 A;  3MYU A;  4F19 A;  4PDH A;  1LBX A;  5ESY A;  4FBP A;  1NV6 A;  2FVZ A;  4QBA A;  1NV1 A;  1NV2 A;  1LEV A;  4OVQ A;  2V3Q A;  2FHY A;  3E79 A;  4MNP A;  4GBV A;  2QPQ A;  2CZK A;  4NX1 A;  1DK4 A;  5CM6 A;  2DVZ A;  3HFU A;  5I7I A;  4PGN A;  2FBP A;  1AWB A;  1IMF A;  4M1V A;  4F1U A;  4F18 A;  3RYD A;  2WBD A;  4PAI A;  2PFY A;  2CEX A;  4X04 A;  1SPI A;  2Q74 A;  4KXP A;  1G0I A;  2OX3 A;  2PFZ A;  4MEV A;  4H46 A;  3A29 A;  4N6D A;  5EQ8 A;  4GX6 A;  4PDD A;  4MMP A;  4NG7 A;  1FPF A;  2B4M A;  1D9Q A;  3W9V A;  1VDW A;  4MAG A;  1JP4 A;  4GWY A;  4NGU A;  4GWX A;  2VT5 A;  2ZZV A;  2HPG A;  2F3B A;  4N8G A;  3ISP A;  2XWO A;  4PF8 A;  4P9K A;  2DE3 A;  3GYY A;  3RPL B;  3CHG A;  5IZ3 B;  2KR0 A;  1FBC A;  1FBH A;  2PCR A;  3PTY A;  4GBW A;  4NQ8 A;  2FIE A;  2QFL A;  4O8M A;  3EKI A;  1FBG A;  1FBE A;  5EQ9 A;  4PFB A;  2CEY A;  4PC9 A;  1Q9D A;  5LDZ A;  1RDZ A;  4IR8 A;  4OVT A;  2VPN A;  4O94 A;  1DBZ A;  4HXV A;  1XI6 A;  4MIJ A;  5J16 A;  4YIC A;  4NAP A;  4P47 A;  1CNQ A;  4DI3 D;  1KZ8 A;  2MKZ A;  4PGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...