4HCWA

Structure of a eukaryotic thiaminase-i
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
352
structure length
352
Chain Sequence
PKTLTVGLFPYLPSWNENGNEVKLINLIKDVLPTQVSGYNIEYTEFDCYSDASLQSLPDVFSTDSIFLPYLVSLGGVKSLDESLVRGVTGDLHSFVSSSASVNGSVYGFPQYLCSNFLLSSPNATQQASSLLELAQKVGYEQIVYPDVASSSSFTVFGLYQQLLQSSSSAAVDIKASDLPQSGDQVNKDITQKYRTILDSTVVASQREYINSVKQGKPISNYYVGYSESMCEIKDIIRDQQYNVQLIGTSDKPYVYTDVLALNSNLCDEKQKVAVEVIKNLLTNTLVLDLLGLGLTLPANKNGIAHLAKSSNFYAQLSQQFDAKESEVRVLRCVDFANKEVKNCAGVLRPFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords thiaminase-I
publication title Structure of a eukaryotic thiaminase I.
pubmed doi rcsb
source organism Naegleria gruberi
total genus 114
structure length 352
sequence length 352
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.2: Thiamine pyridinylase.
pdb deposition date 2012-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4hcwA01
3.40.190.220 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4hcwA02
1FW0A 3PMXA 5K2YA 3V83A 2THIA 3E9XA 3SEUA 2O69A 3K6XA 4BDLA 3MUQA 1JEVA 4JXIA 5FTIA 1P1QA 3E3KA 4JWXA 1ELJA 4BDNA 1VE4A 1N7XA 2DE3A 2E0SA 4PQJA 4ONYA 3O6GA 1B0LA 3VXBA 3MVZA 1QUIA 5ITOA 2HAVA 1B46A 1LAXA 3DP8A 3LSXA 3H6WA 2XXWA 1I6BA 5I58A 5CMCA 5A5XB 3BFUA 2HAUA 4LZ5A 3EHSA 2H4IA 3G7WA 2AL5A 2OJTA 4KPTA 3G3KA 3CVGA 3PUZE 2RC9A 2I6EA 1NNTA 3QK6A 1MQHA 2I48A 3U1OA 3HN0A 4RNSA 3V5AA 2QSXA 4R6YA 4RXLA 3C9HA 1Y9UA 3H06B 4QF9A 2F6GA 3H03A 1US5A 2I4BA 2NXOA 4Q5TA 1B4ZA 2M8CA 2Q2CA 3IORA 4F2QA 4C0RA 1A8FA 1N7WA 2UXAA 3ONMA 1MY1A 3HCQA 2I0CA 4HCYA 1VFEA 3OSQA 2F97A 3H6TA 5ISUA 3R7XA 4JWOA 4ZEBA 3O29A 1B7UA 5H8HA 1SD3A 3EHTA 1Y3QA 3SEVA 1SI0A 5DVJA 5I59A 2F78A 3Q26A 4N07A 3TTRA 3RY3A 4F3SA 1ZU0A 4R9FA 1MXYA 4OXVA 3CIJA 4ELPA 2QJEA 3KEIA 2Q2AA 3FVKA 3W9WA 1ZIUA 1Y1ZA 5CI5A 2HXWA 1AOVA 2B3FA 1FTKA 1LAHE 4QFOA 3PPNA 2Z8FA 3OD7A 2B3BA 4GD5A 1Y1MA 4G4PA 1OQHA 3SEWA 4QFPA 1B3FA 4R73A 3TEPA 1MH4A 3O6HA 4KCDA 2Z8EA 1LFGA 2XXTA 1FTMA 2H98A 4H6DA 4BDQA 1D9YA 3SEXA 2Y7IA 4KYSA 2GRVA 1PC3A 1USYE 4F19A 1FQDA 1QJMA 4AB5A 5KZTA 3LSLA 3S9MC 2DVZA 3O97A 1B3GA 2D3IA 3H4ZA 4FORA 4U1ZA 1N3WA 2QS2A 1VFDA 3UN6A 3W15C 3U72A 1D3KA 1JW5A 5AE4A 2PMSA 4GWOA 2O51A 4KCCA 1IXCA 5DYHA 2XXXA 3T22A 2Q9TA 4YAHX 5KDTA 2XXYA 3G3HA 4F39A 4YKPA 4ZEDA 4R74A 2ZYNA 4BDOA 3PPQA 1OIBA 2OWSA 3OSRA 2OZZA 1MM7A 4UACA 3IOUA 2RCAA 3CFZA 3EN3A 5DVIA 4RPOA 1QVSA 5AA2D 4OHNA 1SYHA 1BLFA 4LQ2A 3K00A 4MFIA 2F7AA 1BP5A 1MDQA 2REGA 2XXUA 1UTBA 1H76A 2RF1A 5I2NA 1MQIA 4U4SA 3G3JA 3U94A 3PD9A 5HBCA 1MRPA 3IAZA 1DTZA 1MQGA 3RT6B 4EXKA 2DWJA 4OENA 4NF8B 3FJGA 4IGTA 3VLUA 3G3IA 3TTLA 3N26A 3FIRA 3T9UA 4FAJA 3T9XB 1WVJA 1B1HA 1MPBA 5H8FA 1LFHA 2F6PA 4QSCA 3TUSA 2RKMA 1A8EA 4GXAA 1ZJLA 4EF2A 3GBAA 4R2FA 4LQ5A 1XOCA 2DSFA 3SESA 1QW0A 5EHSA 1B0HA 3CG1A 4ZZAA 5TU0A 2CMOA 1ZKBA 1JW4A 3F11A 4QFKA 4IY5A 1Y20A 2PT1A 3BFTA 4JWYA 5TP9A 4F18A 1BIYA 1UQWA 3H6UA 1VSOA 1CE2A 1ZTYA 2UVIA 3FVGA 3IJOB 4DDDA 4JDFA 1SI1A 2O1MA 4F29A 3TTMA 4GOTA 3IL1B 4U21A 2I58A 4U2RA 1MXZA 1J1NA 2V25A 2GFEA 1B58A 4NEDA 4OESA 1B32A 1MG1A 1SW5A 2R71A 4TLLB 1MY2A 4PFYA 4KR5A 4OERA 2DWIA 2W7YA 2FNCA 3IOWA 5LOMA 3VE1B 3L6HA 4WEPA 4MH5A 4DCXA 3M3FA 4P0GA 5AA4B 5EYFA 4RA1A 1B52A 5ITPA 2YJPA 2E1SA 3TCHA 1DOTA 3LSFB 3I6VA 1ZLQA 2DXRA 4FIMA 1MQDA 3ODBA 4QRZA 1XC1A 4XKRA 4G8NA 3D4CA 1XVYA 3V8XB 3OEKA 5AA3A 3N6UA 4H5GA 4LZ8A 1MY3A 1URSA 3DP6A 4QHQA 3PPRA 1H3DA 2DE4A 4ELRA 4JSDA 3A09A 4LZ7A 3PMVA 4O3AA 5I2KA 4I8CA 1ZMGA 2I3VA 3QIMA 2HCAA 4BDRA 4JSOA 1R9QA 2Y7RA 1T0KA 2HFBA 2F8DA 1MPCA 4G68C 1I6QA 3WAEA 3C34A 3E4RA 2A5TA 3C32A 3LSWA 1Q35A 3M3KA 1NMUA 3TODA 2XXQA 2UVJA 5L9OA 4RJZA 4EDPA 4G2ZA 4F3PA 3UORA 1GTKA 3I5OA 3VLVA 3VVEA 1UTHA 4ND9A 4X48A 1Z7NE 2BJJX 3T9VA 2ZYKA 4QSDA 3FD3A 1M5CA 5JTYB 4KHZE 2ZMBA 3GBBA 4TQUQ 3K2DA 1NL5A 2A5SA 3G3FA 4YB7A 1A7LA 4PP0A 5L9MA 4OETA 1Y3PA 5I84A 3IK6B 1B6HA 4POWA 2XX7A 1JW1A 4XKPA 1QUKA 1SW4A 5ELVA 2B65A 4H5FA 3OO7A 1F9BA 1XHYA 1MM6A 3RTWB 1MPDA 3Q28A 3KJ7A 5TPAB 1DSNA 1PBPA 2RC7A 1MS7A 3OOAA 1B5JA 3USDA 3FVOA 2ZXTA 5H8QA 3O66A 2GHAA 4NF5B 2XX9A 2HQ0A 3TELA 2FA7A 3QSLA 2Z8DA 4DIGA 2XXIA 4BDMA 3K1MA 5I56A 3D4GA 1S50A 1JVYA 2DVCA 4R72A 4FEBA 4X1BA 2F5XA 4ESWA 3SETA 5AA2A 4K3FA 3HPIA 5CMBA 4FATA 3VVDA 1DPPA 3TYHA 4QFNA 2ZNTA 1VR5A 3FVNA 4OZ9A 3MZ9A 3IX1A 3MVWA 1PB9A 4NWCA 1HSLA 1AIVA 1B3LA 1MXWA 3ILTB 1P1WA 2QPQA 3RTFB 2ZNUA 2VD2A 3N6TA 3Q25A 2VGQA 3TCFA 4LONB 5AA1A 3RPWA 4OMBA 4U22A 3CSBA 3LUYA 3K0VA 1B9JA 5DVFA 2QMWA 4H0WA 2H5YA 1SW2A 3FUZA 2O7UA 4M4GA 3IB0A 1YPNA 1H43A 5I57A 3IB1A 1DPEA 3KOTA 2R9JA 4IO4A 5DEXA 4OTEA 1R6ZA 3CRBA 1IXHA 3IR1A 2QRYA 2G29A 4PFWA 2XXHA 1TWYA 3B7DA 4G68B 4OQOA 5CMMA 1MH3A 4NF4A 3EPEA 5K2XA 4YB5A 4HCWA 3U92A 4KYEA 4G8MA 4U4XA 4Q30B 3FJ7A 4IY6A 1FTOA 2D5WA 2X26A 4GXSB 3HHFA 1O7TA 5KCJB 2P0SA 1OVBA 3BKIB 3S9NC 3WAFA 2RCBA 5B70A 1O63A 3C33A 1OMPA 1OQGA 4YKIA 1B5IA 1EZ9A 3FJMA 3GLBA 4I62A 5FHNA 3T66A 1I69A 1SVXB 4YKKA 3MBPA 3OEMA 1A99A 1WODA 3U93A 3DP4A 4M1VA 1JETA 1OLCA 4LA9A 4MLVA 1SQYA 1B1XA 3TQLA 2XHDA 1L5TA 4IB2A 1IUDA 1Y3NA 2HZLA 2GHBA 4XKNA 2FYIA 4G8HA 4X1DA 3UIFA 2OK2A 4GQOA 3TDJA 1MXXA 1B7ZA 4F2OA 4IO6A 1LCFA 3QUFA 1QUJA 1H45A 1TXFA 2KLFA 4XTCQ 2O68A 2QMXA 5JK4A 1S9TA 2ALUA 1QKAA 1MDP1 1P1NA 4AB6A 2F34A 2PVUA 1DTGA 1GR2A 1EU8A 4FECA 4NWDA 3B6QA 4YKJA 1MQJA 3UA8A 4YB6A 3O9PA 4KFQA 3UP9A 2ABHA 1B7HA 3P7IA 1GV8A 2Q8JA 2V3QA 2PYYA 2ONKE 3ZKLA 3L6GA 5CC2A 2ZYMA 3PUWE 2H99A 4OVJA 2R6GE 1MXVA 4OFJA 3TPAA 3V89B 1B51A 1LB9A 1FQFA 4F22A 3OO8A 4I9DA 1AL3A 4R75A 3OO6A 4IO7A 3ECRA 4ZEKA 4DZ1A 3Q27A 1N0TA 2DWAA 3RUMA 4AQ4A 4IO2A 3O6IA 5F1QA 3T96B 1B4HA 1QULA 4RK2A 4DXBA 4EQ7A 3OO9A 3VDFA 1S7YA 3O28A 1PBQA 3A3CA 3SKPA 1NNKA 2DOJA 2UVGA 2XD2A 3TZAA 4EXLA 3FATA 4P0IA 1A54A 1LCTA 4DXCA 3UK4A 1AH5A 3ZS6A 5I58B 1OLAA 1RKMA 4POXA 5L9SA 1A55A 1R9LA 4EQ9A 1OVTA 1LBBA 2Q89A 3UGWA 1B5HA 4U23A 4RY1A 3CR9A 2NUVA 2P1SA 4ISUA 4R6HA 3KN7A 3TQWA 3DELB 2ZYOA 4N6PA 4WKMA 1TFDA 1H44A 3G3GA 1LBCA 1Z7ME 2GH9A 4PE5B 2YPNA 4Z0IA 5IKBA 3PV0E 2DS9A 3FZVA 3MWBA 1NNPA 2O6AA 2O84X 2OWTA 2Y7KA 3TTNA 2O7IA 5H8HB 3PUYE 4I1DA 1MXUA 5I59B 2F36A 2AL4A 3C35A 1O64A 4IO5A 3S4UA 1LGBC 4F1VA 4ZZEA 4XKQA 5FHMA 1B3EA 5DEXB 4GFRA 3Q29A 4R9GA 1NH7A 3KJTA 4R6KA 2QS1A 5IAIA 5DTBA 3C31A 4WXJA 4HTGA 1M5FA 4OWDA 4ZECA 3H3GA 3S2VA 5CM6A 3M8UA 3H6VA 4KI0E 3VVFA 4O3CA 1B2HA 1IZ1A 1FTLA 2NVUB 2Z23A 1B40A 3CFLA 3TKDA 2VHAA 3MJNA 5FHOA 5ICQA 2X7PA 1Y4TA 3MP6A 2AIXA 4LP2B 2QL3A 2V93A 3TAJA 1FCKA 3K1NA 4NE4A 3MP8A 1EZOA 1NKXA 3EF7A 3SDFA 3FXUA 1XS5A 4IO3A 3C4MA 3DLNA 3PUXE 3R6UA 3PPOA 5KDTB 4EQBA 1TFAA 4DCYA 1P1UA 5ICTA 1IEJA 2I4CA 4NF6A 4ZDMA 2DXYA 2XD3A 1USYH 4YICA 4F3GA 4RYAA 4ZE8A 2V3UA 3RT8A 3K01A 1PB8A 4PFUA 2RC8A 1A40A 1POTA 4GL8A 4MBPA 3MW0A 3EQ1A 3TTKA 3MVYA 2OBGA 3T9HB 2NWJA 3MQ9A 2DQVA 1M5EA 5AA4A 4Q0CA 1IXIA 3MPKA 3MPLA 4YZZA 2DE2A 2HEUA 3AXFA 1UTBB 5I2NB 3HV1A 1IQ7A 4RPNA 1PEBA 4ZEFA 5HM4B 3QYTA 3T93B 3FV2A 4HS7A 1B3HA 1LAFE 3KN3A 1P1OA 3TMGA 5H8NA 3I3VA 4F1YA 2DWHA 2QS3A 2HZKA 3EHUA 3CG3A 4YMBA 4MLQA 1MY4A 2Q88A 2WKYA 3DM0A 3N94A 3FXRA 4GRKA 3IOTA 4ESXA 2RINA 5H8FB 2F35A 3GZGA 3MP1A 4KD5A 1XVXA 1ZBMA 5EHMA 2VP1A 1LFIA 2XXVA 3K02A 1D9VA 4TLMB 1M5BA 1CB6A 1POY1 4ZEIA 2XXRA 1US4A 1PDAA 1Y4CA 3HO7A 4EF1A 1QKBA 3QUJA 4KQPA 4MF3A 3PUVE 3S9EA 3K4UA 3R26A 4XIGQ 1DMBA 1NNFA 5H8SA 3TFLA 5JTYA 5TP9B 4UA8A 1II5A 1UIUA 4ZE9A 3GXAA 2ZNSA 4OFLA 5HPQA 2LAOA 2F7CA 3E13X 3N5LA 2PT2A 3OENA 2OLBA 5JEIA 3MC2A 4DXUA 5A5XA 4RK9A 5TPAA 1IITA 4PFTA 1URGA 1LSTA 3CFXA 3RQTA 4GL0A 2ONRA 3MZ1A 2Y7WA 3RLFE 2AYSA 3MVXA 4NF5A 4L17A 4THIA 4TOZA 2XXPA 1FQCA 4GVOA 3TCGA 3KSXA 3OELA 4WEDA 4OFOA 3VLWA 2QS4A 1N84A 2V84A 3M3LA 1RYXA 2ANJA 4JBZA 4NMYA 1SDXA 1HSEA 4ZS9A 1SBPA 4LATA 3PGFA 4XXUA 2I49A 2I3WA 2Z22A 3CI8A 4C1UA 1JNFA 2D21A 4N13A 4O3BA 3KOSA 1ATGA 5CRYA 1LAGE 1FTJA 5I2KB 3S9LC 4FE8A 1YTVA 1D4NA 3K6UA 1SYIA 3KFMA 3KG2A 3ZSFA 1KWHA 1FQBA 2H25A 3B6TA 1I6AA 1NFTA 2A5TB 5DT6A 4JB7A 3IB2A 4P11A 4E0WA 4QFLA 2PBWA 2I0BA 4C1TA 4GIZA 1XT8A 3FASA 3KGCA 3OMBA 4F1UA 1SW1A 3K1PA 1YAEA 3HSTA 1GGGA 2IA4A 4E0XA 1ANFA 3FGSA 1UTHB 1EZPA 1MY0A 4R2BA 2Y7PA 1N76A 1BTJA 3MAMA 5CMKA 4G68A 4H65A 1JVXA 1UIVA 4LVQA 4HW8A 3FXQA 4G77A 3OXNA 1Q1KA 3IJXB 5CBSA 2YLNA 1HSJA 3IOVA 1M5DA 3QXMA 1URDA 3JYRA 4OYVA 3JZJA 5KCJA 1N04A 3HHGA 5M2VA 3ZKKA 5F7VA 3SEYA 1B05A 1JQFA 2UVHA 3KBRA 4H67A 2PX1A 2VD3A 4F3BA 4EUOA 4X9TA 3IO6A 1TT1A 5CBRA 1PB7A 1RYOA 5B7DA 5H8QB 1NH8A 3PU5A 2O1LA 1EH3A 2V3TA 3QAXA 3JV9A 4NF6B 4ELQA 2G93A 4OEUA 5I56B 1LB8A 4YU0A 4Q8RA 3ILUB 2DP8A 4FJPA 3VFJA 3LBSA 3SERA 4QSEA 5J1DA 3K6WA 1WDNA 1BKAA 1FQEA 2ESNA 4U1OA 5BWJA 2F7BA 3KN8A 4H8JA 3CSGA 3B6WA 4IGRA 2IEEA 5AA2B 2DYXA 3BBRA 3RGYA 3W9VA 1GVCA 1N3XA 4DLDA 1LLSA 3H7MA 2UYFA 1R1NA 3VXCA 5L8DA 2OCUA 2CZLA 5FTHA 3PPPA 1P99A 5BUUA 3C36A 2UYEA 1IXGA 2REJA 3U8QA 3O2AA 3KZGA 3MZBA 1YCJA 4GLIA 2VOZA 4YMAA 5H8NB 3RN8A 2NOOA 4FEDA 4DE8A 4ECFA 3LC8A 4H1XA 4ELOA 3A3UA 3RNNA 2ONSA 2XX8A 1IIWA 3PD8A 1AMFA 4NF8A 4KYDA 4NTLA 2X7QA 2P2AA 5I57B 3PMWA 3VV5A 1JEUA 3IO4A 4OEVA 4GF8A 4PETA 3KSJA 4Z7EA 4F31B 1FQAA 3FV1A 4H8IA 2Y84A 3K6VA 4BLAA 4LUBA 3LR1A 4NF4B 3THIA 2H9BA
chains in the Genus database with same CATH superfamily
1FPEA 1FW0A 3PMXA 5K2YA 3V83A 1FRPA 2THIA 1K9ZA 2KR0A 3E9XA 3SEUA 1NV5A 2O69A 3K6XA 4BDLA 3MUQA 1JEVA 4JXIA 1KA1A 5FTIA 1P1QA 3E3KA 4JWXA 1ELJA 1YZ0A 4BDNA 1VE4A 1N7XA 1RDZA 2DE3A 2E0SA 4PQJA 4ONYA 3O6GA 1B0LA 3VXBA 1EYJA 3MVZA 4PC9A 1QUIA 5ITOA 4LN5A 2HAVA 5ET7A 1B46A 1LAXA 3DP8A 3LSXA 3RPLA 2WYPA 3H6WA 2XXWA 1I6BA 5IZ3A 5I58A 5CMCA 3U65A 2CEYA 5A5XB 3BFUA 2HAUA 4LZ5A 3EHSA 2H4IA 3G7WA 2AL5A 2OJTA 4KPTA 3G3KA 3CVGA 3PUZE 2QVVA 2RC9A 2I6EA 1NNTA 2L5VA 3QK6A 1MQHA 2CZIA 2I48A 3U1OA 3HN0A 4RNSA 3V5AA 2QSXA 4R6YA 4RXLA 3C9HA 1Y9UA 3H06B 4QF9A 2F6GA 3H03A 1US5A 2I4BA 2NXOA 4MNIA 4Q5TA 1B4ZA 2M8CA 2Q2CA 3IORA 4F2QA 4C0RA 1A8FA 1N7WA 2UXAA 3ONMA 1MY1A 3HCQA 2I0CA 4HCYA 1VFEA 3OSQA 2F97A 4GWUA 4PAIA 4NG7A 1FPDA 3H6TA 5ISUA 3R7XA 4JWOA 4HE0A 4ZEBA 3O29A 1B7UA 5H8HA 1SD3A 3EHTA 1Y3QA 3SEVA 1SI0A 5DVJA 5I59A 1KZ8A 2F78A 3Q26A 4OVSA 4N07A 3TTRA 3RY3A 4F3SA 1ZU0A 4R9FA 1MXYA 4OXVA 1FBGA 3CIJA 4MMPA 4ELPA 4OVQA 2PFYA 2QJEA 3KEIA 2Q2AA 3FVKA 3W9WA 4PDDA 1ZIUA 1Y1ZA 5CI5A 2HXWA 1AOVA 2B3FA 1FTKA 1YYZA 1LAHE 4QFOA 3PPNA 4KXPA 2Z8FA 2PCRA 3OD7A 2B3BA 4GD5A 1Y1MA 4G4PA 1OQHA 3SEWA 4QFPA 2V4CA 1B3FA 4R73A 3TEPA 1MH4A 3O6HA 4KCDA 4PAFA 2Z8EA 1LFGA 1K9YA 2XXTA 1G0HA 1FTMA 2H98A 4H6DA 4BDQA 1D9YA 3SEXA 2Y7IA 2P3VA 4KYSA 2GRVA 1PC3A 1USYE 4F19A 1FQDA 1QJMA 4AB5A 5KZTA 3LSLA 4N81A 3S9MC 2DVZA 3O97A 4P1EA 1B3GA 4MNPA 2D3IA 3H4ZA 4FBPA 4FORA 4U1ZA 1N3WA 2QS2A 3BIHA 1VFDA 3UN6A 3W15C 3U72A 1D3KA 1JW5A 5AE4A 2PMSA 4GWOA 2O51A 4KCCA 1IXCA 5DYHA 2XXXA 3T22A 2Q9TA 1KA0A 4YAHX 5KDTA 2FBPA 2XXYA 3G3HA 3KC0A 4F39A 2HXRA 4YKPA 2ZZWA 4ZEDA 4R74A 2ZYNA 4BDOA 3PPQA 1OIBA 2OWSA 3OSRA 2OZZA 1MM7A 4UACA 3EKIA 3IOUA 2RCAA 3CFZA 3EN3A 5DVIA 4RPOA 1DBZA 1QVSA 5AA2D 4OHNA 1SYHA 4O8MA 1INPA 1BLFA 2Y5KA 4LQ2A 3K00A 4MFIA 2F7AA 1BP5A 1MDQA 4X04A 2REGA 2XXUA 1UTBA 1H76A 2RF1A 5I2NA 1MQIA 3E79A 4U4SA 3G3JA 1IMDA 3U94A 3PD9A 5HBCA 1MRPA 3IAZA 1DTZA 1IMFA 1MQGA 1CNQA 3RT6B 4EXKA 2DWJA 4PFRA 4OENA 4NF8B 3FJGA 4IGTA 3VLUA 3G3IA 3TTLA 3N26A 4PFBA 3FIRA 3T9UA 4FAJA 3T9XB 2XWKA 1WVJA 1B1HA 4H46A 1MPBA 4O94A 5H8FA 1NUYA 1LFHA 2F6PA 4QSCA 1FSAA 3TUSA 2RKMA 1A8EA 4GXAA 5IGAA 3PTYA 1ZJLA 1NUWA 4EF2A 3GBAA 4R2FA 4MJOA 1FPGA 4LQ5A 1XOCA 2DSFA 3SESA 1QW0A 5EHSA 1B0HA 3CG1A 4ZZAA 5TU0A 2CMOA 4OVPA 1ZKBA 1JW4A 3F11A 4QFKA 4IY5A 1Y20A 2PT1A 3BFTA 4JWYA 5TP9A 4F18A 1BIYA 1UQWA 3H6UA 1VSOA 1CE2A 1ZTYA 2UVIA 3FVGA 3IJOB 4I3YA 4DDDA 4JDFA 1SI1A 2O1MA 4F29A 3TTMA 4GOTA 3IL1B 4U21A 2I58A 4U2RA 1MXZA 1J1NA 2V25A 4JVCA 4HE1A 4I40A 2GFEA 4PDHA 1B58A 2FIXA 4NEDA 1NUXA 4OESA 4P47A 1B32A 1MG1A 1SW5A 2R71A 4TLLB 1MY2A 4PFYA 4KR5A 4OERA 2DWIA 2W7YA 4QXDA 2FNCA 3IOWA 5LOMA 1FTAA 3VE1B 3L6HA 4WEPA 4MH5A 4DCXA 4NN3A 3M3FA 4P0GA 5AA4B 5EYFA 4RA1A 1B52A 5ITPA 2YJPA 2E1SA 4N6KA 3TCHA 1DOTA 3LSFB 3I6VA 1ZLQA 1FPIA 2DXRA 4FIMA 1MQDA 3ODBA 2B4MA 4X8RA 4QRZA 1XC1A 4XKRA 4G8NA 3D4CA 5LTCA 1XVYA 3V8XB 3OEKA 5AA3A 3N6UA 1FPLA 4H5GA 4LZ8A 1MY3A 1URSA 3DP6A 4QHQA 1RDXA 3PPRA 1H3DA 2DE4A 4ELRA 4JSDA 3A09A 4LZ7A 3PMVA 4O3AA 5IM2A 5I2KA 4I8CA 1ZMGA 2I3VA 3QIMA 1LBXA 2HCAA 4BDRA 4JSOA 1R9QA 2Y7RA 1T0KA 4GWZA 2HFBA 2F8DA 1MPCA 3GYYA 4G68C 2JJKA 1I6QA 3WAEA 3C34A 3E4RA 2A5TA 1NV1A 3C32A 3LSWA 3LV0A 1Q35A 1SPIA 3M3KA 1NMUA 4MNCA 3TODA 2XXQA 2UVJA 5L9OA 4RJZA 4EDPA 4G2ZA 4F3PA 3UORA 4MEVA 1GTKA 3I5OA 3VLVA 3VVEA 1UTHA 4ND9A 4X48A 1Z7NE 2BJJX 3T9VA 2ZYKA 4QSDA 3FD3A 1M5CA 4GBWA 5JTYB 4KHZE 4PF8A 2ZMBA 3GBBA 4TQUQ 3K2DA 1NL5A 2A5SA 3G3FA 4YB7A 1A7LA 4PP0A 5L9MA 4OETA 4HXVA 1Y3PA 5I84A 3IK6B 1B6HA 4POWA 2XX7A 1JW1A 4XKPA 1QUKA 1SW4A 5ELVA 2B65A 4H5FA 1FPBA 3OO7A 1F9BA 1XHYA 1MM6A 3RTWB 1MPDA 3Q28A 3KJ7A 5TPAB 1DSNA 4N6DA 1IMEA 1PBPA 2RC7A 1MS7A 2F3DA 3OOAA 1B5JA 3USDA 3FVOA 2ZXTA 5H8QA 3O66A 2GHAA 4NF5B 2XX9A 2HQ0A 3TELA 2FA7A 3QSLA 2Z8DA 4DIGA 2XXIA 4BDMA 3K1MA 5I56A 3D4GA 1S50A 1JVYA 2QFLA 2DVCA 4R72A 4MCOA 2CZKA 4FEBA 4X1BA 2F5XA 4ESWA 3SETA 5AA2A 4K3FA 3HPIA 5CMBA 4FATA 3VVDA 1DPPA 3TYHA 4QFNA 3E78A 4NAPA 2ZNTA 1VR5A 3FVNA 4OZ9A 3MZ9A 3IX1A 5DW8A 3MVWA 5ET6A 4PFIA 1PB9A 4NWCA 4N17A 1HSLA 2OWZA 1AIVA 1B3LA 1MXWA 3B8BA 3ILTB 1P1WA 2QPQA 3QMFA 3RTFB 2ZNUA 1BK4A 2KQZA 2VD2A 3N6TA 3Q25A 2VGQA 3TCFA 4LONB 5AA1A 5EYGA 3RPWA 4OMBA 4U22A 3CSBA 3LUYA 4PGNA 5ET5A 3K0VA 1B9JA 5DVFA 4OVTA 2QMWA 4H0WA 2H5YA 2ZZVA 1SW2A 3FUZA 2O7UA 4M4GA 2DDKA 3IB0A 1YPNA 4PF6A 1H43A 1FJ9A 3IB1A 5I57A 1DPEA 3KOTA 2R9JA 4IO4A 5DEXA 4OTEA 1R6ZA 3CRBA 1IXHA 3IR1A 2QRYA 2G29A 1DCUA 4PFWA 2XXHA 1TWYA 3B7DA 4G68B 4OQOA 5CMMA 1MH3A 4NF4A 3EPEA 5K2XA 4YB5A 4HCWA 2ZZXA 3U92A 4KYEA 4G8MA 4U4XA 4Q30B 3FJ7A 4IY6A 1FTOA 2D5WA 2X26A 4GXSB 3HHFA 1O7TA 5KCJB 2P0SA 1OVBA 3LUZA 3BKIB 3S9NC 4I3EA 4UABA 3WAFA 2RCBA 2CZHA 5B70A 2VT5A 1DK4A 1O63A 3C33A 1OMPA 1OQGA 4YKIA 1B5IA 1EZ9A 3FJMA 3GLBA 5F24A 4I62A 2CEXA 5FHNA 3T66A 3NOHA 1I69A 4MHFA 1SVXB 4YKKA 4N4UA 3MBPA 3OEMA 1A99A 4O7MA 4PE3A 1WODA 3U93A 3DP4A 4M1VA 1JETA 4MX6A 1OLCA 1FBDA 4LA9A 4MLVA 2B4LA 1SQYA 1B1XA 3TQLA 2XHDA 3HFUA 1L5TA 4IB2A 1IUDA 1Y3NA 2HZLA 2GHBA 1FBEA 4XKNA 2FYIA 4G8HA 4X1DA 3UIFA 2OK2A 4GQOA 3TDJA 1MXXA 1B7ZA 4GWXA 4PAKA 4F2OA 4IO6A 1LCFA 3QUFA 1QUJA 1H45A 1TXFA 2KLFA 4XTCQ 2O68A 2QMXA 4NF0A 3RYDA 5JK4A 1S9TA 2ALUA 1QKAA 1MDP1 1P1NA 4AB6A 2F34A 2PVUA 1DTGA 1GR2A 1EU8A 4FECA 4NWDA 3B6QA 4YKJA 1MQJA 3UA8A 4YB6A 2HPGA 3O9PA 4KFQA 3UP9A 2ABHA 1B7HA 3P7IA 1GV8A 2Q8JA 2V3QA 4P56A 2PYYA 2ONKE 3ZKLA 3L6GA 5CC2A 4NX1A 2ZYMA 3PUWE 2H99A 4OVJA 5T3JA 4NHBA 2R6GE 1MXVA 4OFJA 3TPAA 3V89B 1B51A 1LB9A 1IMCA 1FQFA 4F22A 3OO8A 4I9DA 4OVRA 1AL3A 4R75A 4AS4A 4O7IA 5IZ1A 3OO6A 4IO7A 3ECRA 4ZEKA 4DZ1A 4XFEA 3Q27A 1N0TA 2DWAA 3RUMA 4AQ4A 4IO2A 2FHYA 3O6IA 5F1QA 3FBPA 4XEQA 3T96B 1RDYA 1B4HA 1QULA 4RK2A 4DXBA 4EQ7A 3OO9A 3VDFA 1S7YA 3O28A 3MSTA 5A5LA 1PBQA 3A3CA 3SKPA 1NNKA 2DOJA 2UVGA 2XD2A 3TZAA 4EXLA 4N8GA 3FATA 4P0IA 1A54A 3RPLB 1LCTA 4DXCA 1G0IA 1AH5A 3UK4A 5IZ3B 3ZS6A 5I58B 1OLAA 2F3BA 1RKMA 4POXA 5L9SA 1A55A 2XXKA 1R9LA 4DI4B 4EQ9A 5EQ7A 1OVTA 2VPOA 1LBBA 2Q89A 1LBZA 3SZPA 3UGWA 1B5HA 3IFCA 4U23A 1XI6A 2BJIA 4RY1A 3CR9A 2NUVA 2P1SA 4ISUA 1IMAA 4R6HA 3KN7A 3TQWA 3DELB 2ZYOA 3ROJA 4N6PA 1FPFA 4WKMA 1TFDA 1H44A 3G3GA 1LBCA 1Z7ME 2GH9A 4PE5B 4PBQA 2YPNA 5IZZA 4GX6A 4Z0IA 5IKBA 3PV0E 2DS9A 4N91A 1NV6A 3FZVA 4AS5A 3MWBA 1NNPA 1FBPA 2O6AA 2O84X 2OWTA 5I5PA 2Y7KA 3TTNA 2O7IA 5H8HB 3PUYE 4I1DA 1MXUA 5I59B 2F36A 2AL4A 3C35A 1O64A 4IO5A 3S4UA 4GX4A 4N8YA 1LGBC 4F1VA 4ZZEA 4XKQA 1EYKA 1LBWA 5FHMA 1B3EA 1IMBA 5DEXB 4GFRA 3Q29A 4R9GA 1NH7A 3KJTA 4R6KA 2QS1A 5IAIA 5DTBA 1NI9A 3C31A 4WXJA 4HTGA 1M5FA 4OWDA 4MAGA 4ZECA 3H3GA 4PGPA 3S2VA 5CM6A 3M8UA 3H6VA 4KI0E 5LDZA 3VVFA 4O3CA 1B2HA 1IZ1A 1FTLA 4P9KA 2NVUB 2Z23A 1B40A 3CFLA 3TKDA 2VHAA 3MJNA 5FHOA 5J16A 5ICQA 2X7PA 1Y4TA 3MP6A 4N15A 2AIXA 4GWWA 4LP2B 5FBPA 1Q9DA 2QL3A 2V93A 3TAJA 4NGUA 1FCKA 3K1NA 4NE4A 3MP8A 1EZOA 1NKXA 3EF7A 3SDFA 3FXUA 1XS5A 4IO3A 3C4MA 3DLNA 3PUXE 3R6UA 3PPOA 5KDTB 4P3LA 4EQBA 1TFAA 4DCYA 1P1UA 5ICTA 1IEJA 2I4CA 1NV0A 4NF6A 4ZDMA 2DXYA 2XD3A 1USYH 4YICA 4GWSA 4F3GA 4RYAA 4ZE8A 2V3UA 3RT8A 3K01A 1PB8A 4PFUA 2RC8A 1A40A 1POTA 4GL8A 2QVUA 1NV7A 4MBPA 2WYKA 3MW0A 2GQ1A 3EQ1A 4GX3A 3TTKA 3MVYA 2OBGA 3T9HB 2NWJA 3MQ9A 2DQVA 1M5EA 5AA4A 4Q0CA 1IXIA 3MPKA 4OA4A 3MPLA 4YZZA 2DE2A 2HEUA 3AXFA 1UTBB 4HE2A 5I2NB 3HV1A 1IQ7A 4RPNA 1PEBA 4ZEFA 5HM4B 3QYTA 3T93B 3FV2A 2MKZA 4HS7A 1B3HA 1LAFE 3KN3A 4PCDA 1P1OA 3TMGA 1FJ6A 3CHGA 5H8NA 3I3VA 4F1YA 2DWHA 2QS3A 2HZKA 4OANA 3KBZA 4IR8A 3EHUA 3CG3A 4YMBA 4DI3D 4MLQA 1MY4A 2Q88A 2WKYA 3DM0A 4GWYA 3N94A 3FXRA 4GRKA 3IOTA 4ESXA 2RINA 5H8FB 2F35A 3GZGA 5ESYA 3MP1A 4KD5A 1XVXA 1ZBMA 2P3NA 5EHMA 2VP1A 1LFIA 2XXVA 3K02A 1D9VA 4NQ8A 4TLMB 1M5BA 2QVRA 1CB6A 1POY1 4ZEIA 2XXRA 2XA5A 1US4A 1PDAA 1Y4CA 3HO7A 1AWBA 4EF1A 1QKBA 3QUJA 4KQPA 4MF3A 1LBVA 3PUVE 4JVDA 3S9EA 3K4UA 5EQ9A 3A29A 3IFAA 3R26A 4XIGQ 1DMBA 1NNFA 5H8SA 3TFLA 5JTYA 5TP9B 4UA8A 1II5A 1UIUA 4ZE9A 2R8TA 3GXAA 2ZNSA 4OFLA 5HPQA 2LAOA 2F7CA 5EYHA 3E13X 4PBHA 3N5LA 2PT2A 3OENA 2OLBA 4JVIA 5JEIA 3MC2A 4DXUA 5A5XA 4P8BA 4RK9A 5TPAA 1IITA 4PFTA 1URGA 1LSTA 3CFXA 3RQTA 4GL0A 2ONRA 3MZ1A 2Y7WA 3RLFE 2AYSA 3MVXA 4NF5A 4L17A 4THIA 4TOZA 2XXPA 1NV4A 1FQCA 4GVOA 3TCGA 3KSXA 3OELA 4WEDA 2VPNA 4OFOA 3VLWA 2QS4A 1N84A 2V84A 3M3LA 1RYXA 2ANJA 4JBZA 4NMYA 4XF5A 1LBYA 1SDXA 2XWIA 3T0JA 1HSEA 3T1BA 4ZS9A 1SBPA 3B50A 4LATA 3PGFA 1NV2A 4XXUA 2I49A 2I3WA 2Z22A 3CI8A 4C1UA 1JNFA 2D21A 4G61A 4N13A 4GBVA 4O3BA 2Y5LA 3KOSA 1FBCA 1ATGA 5CRYA 1LAGE 1YXIA 1FTJA 5I2KB 3S9LC 4FE8A 1FPKA 1YTVA 1D4NA 3K6UA 3MYUA 1SYIA 3KFMA 3KG2A 3ZSFA 1KWHA 1FQBA 2H25A 3B6TA 1I6AA 1NFTA 2A5TB 3ISPA 5DT6A 4JB7A 3IB2A 4P11A 4E0WA 4QFLA 2PBWA 2I0BA 4C1TA 4GIZA 1XT8A 4P1LA 3FASA 3KGCA 3OMBA 4F1UA 1SW1A 3K1PA 1YAEA 3HSTA 1GGGA 2IA4A 4E0XA 1ANFA 3FGSA 1UTHB 1EZPA 1MY0A 4R2BA 2Y7PA 1N76A 1BTJA 3MAMA 5CMKA 4G68A 1VDWA 1EYIA 4H65A 1JVXA 1UIVA 4LVQA 4HW8A 3FXQA 4G77A 3OXNA 1Q1KA 1JP4A 3IJXB 5CBSA 1QGXA 2YLNA 1HSJA 3IOVA 1M5DA 1FBFA 3QXMA 1URDA 3JYRA 4OYVA 3JZJA 5KCJA 1N04A 3HHGA 5M2VA 1NV3A 3ZKKA 2FVZA 5F7VA 3SEYA 1B05A 1JQFA 2UVHA 3KBRA 4H67A 2PX1A 2VD3A 4F3BA 4EUOA 3D1RA 4X9TA 3IO6A 1TT1A 5I3SA 5CBRA 1PB7A 1RYOA 5B7DA 5H8QB 2Q8MA 1NH8A 3PU5A 2O1LA 1EH3A 2V3TA 3QAXA 3JV9A 4NF6B 4ELQA 2G93A 4OEUA 5I56B 2XWVA 1LB8A 4YU0A 4Q8RA 3ILUB 2DP8A 1LEVA 4FJPA 3VFJA 3LBSA 3SERA 4QSEA 5J1DA 2WBDA 3K6WA 1WDNA 1BKAA 1FQEA 2ESNA 4U1OA 5BWJA 2F7BA 3KN8A 4H8JA 5EQAA 3CSGA 3B6WA 4IGRA 2IEEA 5AA2B 2DYXA 2WX9A 3BBRA 3RGYA 3W9VA 1GVCA 1N3XA 4DLDA 1LLSA 1FPJA 2HHMA 3H7MA 2PFZA 2UYFA 1R1NA 3FXBA 3VXCA 5L8DA 2OCUA 3BIGA 2CZLA 2OX3A 5FTHA 4MIJA 3PPPA 1P99A 5BUUA 3C36A 2UYEA 5ET8A 1IXGA 2REJA 3U8QA 3O2AA 3KZGA 4H45A 3KC1A 3MZBA 1YCJA 2WBBA 4GLIA 2VOZA 4YMAA 5H8NB 3RN8A 2NOOA 5I7IA 4FEDA 2WEFA 4DE8A 4ECFA 1FBHA 3LC8A 4H1XA 4ELOA 3A3UA 3RNNA 2ONSA 2XX8A 1IIWA 3PD8A 1AMFA 4NF8A 4QBAA 4KYDA 4NTLA 1NUZA 2Q74A 2X7QA 2P2AA 2XWOA 5I57B 3PMWA 3VV5A 1JEUA 3IO4A 4OEVA 4GF8A 4PETA 3KSJA 4Z7EA 4F31B 1FQAA 3FV1A 4H8IA 4PTKA 2Y84A 3K6VA 2FIEA 5EQ8A 4BLAA 4LUBA 3LR1A 4NF4B 3THIA 2H9BA 1D9QA
chains in the Genus database with same CATH topology
1FPEA 1FW0A 3PMXA 5K2YA 3V83A 1FRPA 2THIA 1K9ZA 2KR0A 3E9XA 3SEUA 2O69A 1NV5A 3K6XA 4BDLA 3MUQA 1JEVA 4JXIA 1KA1A 5FTIA 1P1QA 3E3KA 4JWXA 1ELJA 4BDNA 1YZ0A 1VE4A 1N7XA 1RDZA 2DE3A 2E0SA 4PQJA 4ONYA 3O6GA 1B0LA 3VXBA 1EYJA 3MVZA 4PC9A 1QUIA 5ITOA 4LN5A 2HAVA 5ET7A 1B46A 1LAXA 3DP8A 3LSXA 3RPLA 2WYPA 3H6WA 2XXWA 1I6BA 5I58A 5IZ3A 5CMCA 3U65A 2CEYA 5A5XB 3BFUA 2HAUA 4LZ5A 3EHSA 2H4IA 3G7WA 2AL5A 2OJTA 4KPTA 3G3KA 3CVGA 3PUZE 2QVVA 2RC9A 2I6EA 1NNTA 2L5VA 3QK6A 1MQHA 2CZIA 2I48A 3U1OA 3HN0A 4RNSA 3V5AA 2QSXA 4R6YA 4RXLA 3C9HA 1Y9UA 3H06B 4QF9A 2F6GA 3H03A 1US5A 2I4BA 2NXOA 4MNIA 4Q5TA 1B4ZA 2M8CA 2Q2CA 3IORA 4F2QA 4C0RA 1A8FA 1N7WA 2UXAA 3ONMA 1MY1A 3HCQA 2I0CA 4HCYA 1VFEA 3OSQA 2F97A 4GWUA 4PAIA 4NG7A 1FPDA 3H6TA 5ISUA 3R7XA 4JWOA 4HE0A 4ZEBA 3O29A 1B7UA 5H8HA 1SD3A 3EHTA 1Y3QA 3SEVA 1SI0A 5DVJA 5I59A 2F78A 1KZ8A 3Q26A 4OVSA 4N07A 3TTRA 3RY3A 4F3SA 1ZU0A 4R9FA 1MXYA 4OXVA 1FBGA 3CIJA 4MMPA 4ELPA 4OVQA 2PFYA 2QJEA 3KEIA 2Q2AA 3FVKA 3W9WA 4PDDA 1ZIUA 1Y1ZA 5CI5A 2HXWA 1AOVA 2B3FA 1FTKA 1YYZA 1LAHE 4QFOA 3PPNA 4KXPA 2Z8FA 2PCRA 3OD7A 2B3BA 4GD5A 1Y1MA 4G4PA 1OQHA 3SEWA 4QFPA 2V4CA 1B3FA 4R73A 3TEPA 1MH4A 3O6HA 4KCDA 4PAFA 2Z8EA 1LFGA 1K9YA 2XXTA 1G0HA 1FTMA 2H98A 4H6DA 4BDQA 1D9YA 3SEXA 2Y7IA 2P3VA 4KYSA 2GRVA 1PC3A 1USYE 4F19A 1FQDA 1QJMA 4AB5A 5KZTA 3LSLA 4N81A 3S9MC 2DVZA 3O97A 4P1EA 1B3GA 4MNPA 2D3IA 3H4ZA 4FBPA 4FORA 4U1ZA 1N3WA 2QS2A 3BIHA 1VFDA 3UN6A 3W15C 3U72A 1D3KA 1JW5A 5AE4A 2PMSA 4GWOA 2O51A 4KCCA 1IXCA 5DYHA 2XXXA 3T22A 2Q9TA 1KA0A 4YAHX 5KDTA 2FBPA 2XXYA 3G3HA 3KC0A 4F39A 2HXRA 4YKPA 2ZZWA 4ZEDA 4R74A 2ZYNA 4BDOA 3PPQA 1OIBA 2OWSA 3OSRA 2OZZA 1MM7A 4UACA 3EKIA 3IOUA 2RCAA 3CFZA 3EN3A 5DVIA 4RPOA 1DBZA 1QVSA 5AA2D 4OHNA 1SYHA 4O8MA 1INPA 1BLFA 2Y5KA 4LQ2A 3K00A 4MFIA 2F7AA 1BP5A 1MDQA 4X04A 2REGA 2XXUA 1UTBA 1H76A 2RF1A 5I2NA 1MQIA 3E79A 4U4SA 3G3JA 1IMDA 3U94A 3PD9A 5HBCA 1MRPA 3IAZA 1DTZA 1IMFA 1MQGA 1CNQA 3RT6B 4EXKA 2DWJA 4PFRA 4OENA 4NF8B 3FJGA 4IGTA 3VLUA 3G3IA 3TTLA 3N26A 4PFBA 3FIRA 3T9UA 4FAJA 3T9XB 2XWKA 1WVJA 1B1HA 4H46A 1MPBA 5H8FA 4O94A 1NUYA 1LFHA 2F6PA 4QSCA 1FSAA 3TUSA 2RKMA 1A8EA 4GXAA 5IGAA 3PTYA 1ZJLA 1NUWA 4EF2A 3GBAA 4R2FA 4MJOA 1FPGA 4LQ5A 1XOCA 2DSFA 3SESA 1QW0A 5EHSA 1B0HA 3CG1A 4ZZAA 5TU0A 2CMOA 4OVPA 1ZKBA 1JW4A 3F11A 4QFKA 4IY5A 1Y20A 2PT1A 3BFTA 4JWYA 5TP9A 4F18A 1BIYA 1UQWA 3H6UA 1VSOA 1CE2A 1ZTYA 2UVIA 3FVGA 3IJOB 4I3YA 4DDDA 4JDFA 1SI1A 2O1MA 4F29A 3TTMA 4GOTA 3IL1B 4U21A 2I58A 4U2RA 1MXZA 1J1NA 2V25A 4JVCA 4HE1A 4I40A 2GFEA 4PDHA 1B58A 2FIXA 4NEDA 1NUXA 4OESA 4P47A 1B32A 1MG1A 1SW5A 2R71A 4TLLB 1MY2A 4PFYA 4KR5A 4OERA 2DWIA 2W7YA 4QXDA 2FNCA 3IOWA 5LOMA 1FTAA 3VE1B 3L6HA 4WEPA 4MH5A 4DCXA 4NN3A 3M3FA 4P0GA 5AA4B 5EYFA 4RA1A 1B52A 5ITPA 2YJPA 2E1SA 4N6KA 3TCHA 1DOTA 3LSFB 3I6VA 1ZLQA 1FPIA 2DXRA 4FIMA 1MQDA 3ODBA 2B4MA 4X8RA 4QRZA 1XC1A 4XKRA 4G8NA 3D4CA 5LTCA 1XVYA 3V8XB 3OEKA 5AA3A 3N6UA 1FPLA 4H5GA 4LZ8A 1MY3A 1URSA 3DP6A 4QHQA 3PPRA 1RDXA 1H3DA 2DE4A 4ELRA 4JSDA 3A09A 4LZ7A 3PMVA 4O3AA 5I2KA 5IM2A 4I8CA 1ZMGA 2I3VA 3QIMA 1LBXA 2HCAA 4BDRA 4JSOA 1R9QA 2Y7RA 1T0KA 4GWZA 2HFBA 2F8DA 1MPCA 3GYYA 4G68C 2JJKA 1I6QA 3WAEA 3C34A 3E4RA 2A5TA 1NV1A 3C32A 3LSWA 3LV0A 1Q35A 3M3KA 1SPIA 1NMUA 4MNCA 3TODA 2XXQA 2UVJA 5L9OA 4RJZA 4EDPA 4G2ZA 4F3PA 3UORA 4MEVA 1GTKA 3I5OA 3VLVA 3VVEA 1UTHA 4ND9A 4X48A 1Z7NE 2BJJX 3T9VA 2ZYKA 4QSDA 3FD3A 1M5CA 4GBWA 5JTYB 4KHZE 4PF8A 2ZMBA 3GBBA 4TQUQ 3K2DA 1NL5A 2A5SA 3G3FA 4YB7A 1A7LA 4PP0A 5L9MA 4OETA 4HXVA 1Y3PA 5I84A 3IK6B 1B6HA 4POWA 2XX7A 1JW1A 4XKPA 1QUKA 1SW4A 5ELVA 2B65A 4H5FA 1FPBA 3OO7A 1F9BA 1XHYA 1MM6A 3RTWB 1MPDA 3Q28A 3KJ7A 5TPAB 1DSNA 4N6DA 1IMEA 1PBPA 2RC7A 1MS7A 2F3DA 3OOAA 1B5JA 3USDA 3FVOA 2ZXTA 5H8QA 3O66A 2GHAA 4NF5B 2XX9A 2HQ0A 3TELA 2FA7A 3QSLA 2Z8DA 4DIGA 2XXIA 4BDMA 3K1MA 5I56A 3D4GA 1S50A 1JVYA 2QFLA 2DVCA 4R72A 4MCOA 2CZKA 4FEBA 4X1BA 2F5XA 4ESWA 3SETA 5AA2A 4K3FA 3HPIA 5CMBA 4FATA 3VVDA 1DPPA 3TYHA 4QFNA 3E78A 4NAPA 2ZNTA 1VR5A 3FVNA 4OZ9A 3MZ9A 3IX1A 5DW8A 3MVWA 5ET6A 4PFIA 1PB9A 4NWCA 4N17A 1HSLA 1AIVA 2OWZA 1B3LA 1MXWA 3B8BA 3ILTB 1P1WA 2QPQA 3QMFA 3RTFB 2ZNUA 1BK4A 2KQZA 2VD2A 3N6TA 3Q25A 2VGQA 3TCFA 4LONB 5AA1A 5EYGA 3RPWA 4OMBA 4U22A 3CSBA 3LUYA 4PGNA 5ET5A 3K0VA 1B9JA 5DVFA 4OVTA 2QMWA 4H0WA 2H5YA 2ZZVA 1SW2A 3FUZA 2O7UA 4M4GA 2DDKA 3IB0A 1YPNA 4PF6A 1H43A 5I57A 3IB1A 1FJ9A 1DPEA 3KOTA 2R9JA 4IO4A 5DEXA 4OTEA 1R6ZA 3CRBA 1IXHA 3IR1A 2QRYA 2G29A 1DCUA 4PFWA 2XXHA 1TWYA 3B7DA 4G68B 4OQOA 5CMMA 1MH3A 4NF4A 3EPEA 5K2XA 4YB5A 4HCWA 2ZZXA 3U92A 4KYEA 4G8MA 4U4XA 4Q30B 3FJ7A 4IY6A 1FTOA 2D5WA 2X26A 4GXSB 3HHFA 1O7TA 5KCJB 2P0SA 1OVBA 3LUZA 3BKIB 3S9NC 4I3EA 4UABA 3WAFA 2RCBA 2CZHA 5B70A 2VT5A 1DK4A 1O63A 3C33A 1OMPA 1OQGA 4YKIA 1B5IA 1EZ9A 3FJMA 3GLBA 5F24A 4I62A 2CEXA 5FHNA 3T66A 3NOHA 1I69A 4MHFA 1SVXB 4YKKA 4N4UA 3MBPA 3OEMA 1A99A 4O7MA 4PE3A 1WODA 3U93A 3DP4A 4M1VA 1JETA 4MX6A 1OLCA 1FBDA 4LA9A 4MLVA 2B4LA 1SQYA 1B1XA 3TQLA 2XHDA 3HFUA 1L5TA 4IB2A 1IUDA 1Y3NA 2HZLA 2GHBA 1FBEA 4XKNA 2FYIA 4G8HA 4X1DA 3UIFA 2OK2A 4GQOA 3TDJA 1MXXA 1B7ZA 4GWXA 4PAKA 4F2OA 4IO6A 1LCFA 3QUFA 1QUJA 1H45A 1TXFA 2KLFA 4XTCQ 2O68A 2QMXA 4NF0A 3RYDA 5JK4A 1S9TA 2ALUA 1QKAA 1MDP1 1P1NA 4AB6A 2F34A 2PVUA 1DTGA 1GR2A 1EU8A 4FECA 4NWDA 3B6QA 4YKJA 1MQJA 3UA8A 4YB6A 3O9PA 2HPGA 4KFQA 3UP9A 2ABHA 1B7HA 3P7IA 1GV8A 2Q8JA 2V3QA 4P56A 2PYYA 2ONKE 3ZKLA 3L6GA 5CC2A 4NX1A 2ZYMA 3PUWE 2H99A 4OVJA 5T3JA 4NHBA 2R6GE 1MXVA 4OFJA 3TPAA 3V89B 1B51A 1LB9A 1IMCA 1FQFA 4F22A 3OO8A 4I9DA 4OVRA 1AL3A 4R75A 4AS4A 4O7IA 5IZ1A 3OO6A 4IO7A 3ECRA 4ZEKA 4DZ1A 4XFEA 3Q27A 1N0TA 2DWAA 3RUMA 4AQ4A 4IO2A 2FHYA 3O6IA 5F1QA 3FBPA 4XEQA 3T96B 1RDYA 1B4HA 1QULA 4RK2A 4DXBA 4EQ7A 3OO9A 3VDFA 1S7YA 3O28A 3MSTA 5A5LA 1PBQA 3A3CA 3SKPA 1NNKA 2DOJA 2UVGA 2XD2A 3TZAA 4EXLA 4N8GA 3FATA 4P0IA 1A54A 3RPLB 1LCTA 4DXCA 3UK4A 1AH5A 3ZS6A 5I58B 1G0IA 5IZ3B 1OLAA 2F3BA 1RKMA 4POXA 5L9SA 1A55A 2XXKA 1R9LA 4EQ9A 4DI4B 5EQ7A 1OVTA 2VPOA 1LBBA 2Q89A 1LBZA 3UGWA 3SZPA 1B5HA 4U23A 3IFCA 1XI6A 2BJIA 4RY1A 3CR9A 2NUVA 2P1SA 4ISUA 1IMAA 4R6HA 3KN7A 3TQWA 3DELB 2ZYOA 3ROJA 4N6PA 4WKMA 1FPFA 1TFDA 1H44A 3G3GA 1LBCA 1Z7ME 2GH9A 4PE5B 4PBQA 2YPNA 5IZZA 4GX6A 4Z0IA 5IKBA 3PV0E 2DS9A 4N91A 1NV6A 3FZVA 4AS5A 3MWBA 1NNPA 2O6AA 2O84X 1FBPA 2OWTA 5I5PA 2Y7KA 3TTNA 2O7IA 5H8HB 3PUYE 4I1DA 1MXUA 5I59B 2F36A 2AL4A 3C35A 1O64A 4IO5A 3S4UA 4GX4A 4N8YA 1LGBC 4F1VA 4ZZEA 4XKQA 1EYKA 5FHMA 1LBWA 1B3EA 5DEXB 1IMBA 4GFRA 3Q29A 4R9GA 1NH7A 3KJTA 4R6KA 2QS1A 5IAIA 5DTBA 1NI9A 3C31A 4WXJA 4HTGA 1M5FA 4OWDA 4MAGA 4ZECA 3H3GA 3S2VA 4PGPA 5CM6A 3M8UA 3H6VA 4KI0E 5LDZA 3VVFA 4O3CA 1B2HA 1IZ1A 1FTLA 4P9KA 2NVUB 2Z23A 1B40A 3CFLA 3TKDA 2VHAA 3MJNA 5FHOA 5J16A 5ICQA 2X7PA 1Y4TA 3MP6A 4N15A 2AIXA 4LP2B 4GWWA 5FBPA 1Q9DA 2QL3A 2V93A 3TAJA 4NGUA 1FCKA 3K1NA 4NE4A 3MP8A 1EZOA 1NKXA 3EF7A 3SDFA 3FXUA 1XS5A 4IO3A 3C4MA 3DLNA 3PUXE 3R6UA 3PPOA 5KDTB 4P3LA 4EQBA 1TFAA 4DCYA 1P1UA 5ICTA 1IEJA 2I4CA 1NV0A 4NF6A 4ZDMA 2DXYA 2XD3A 1USYH 4YICA 4GWSA 4F3GA 4RYAA 4ZE8A 2V3UA 3RT8A 3K01A 1PB8A 4PFUA 2RC8A 1A40A 1POTA 4GL8A 2QVUA 1NV7A 4MBPA 2WYKA 3MW0A 2GQ1A 3EQ1A 4GX3A 3TTKA 3MVYA 2OBGA 3T9HB 2NWJA 3MQ9A 2DQVA 1M5EA 5AA4A 4Q0CA 1IXIA 3MPKA 4OA4A 3MPLA 4YZZA 2DE2A 2HEUA 3AXFA 1UTBB 4HE2A 5I2NB 3HV1A 1IQ7A 4RPNA 1PEBA 4ZEFA 5HM4B 3QYTA 3T93B 3FV2A 2MKZA 4HS7A 1B3HA 1LAFE 3KN3A 4PCDA 1P1OA 3TMGA 1FJ6A 3CHGA 5H8NA 3I3VA 4F1YA 2DWHA 2QS3A 2HZKA 4OANA 3KBZA 4IR8A 3EHUA 3CG3A 4YMBA 4DI3D 4MLQA 1MY4A 2Q88A 2WKYA 3DM0A 4GWYA 3N94A 3FXRA 4GRKA 3IOTA 4ESXA 2RINA 5H8FB 2F35A 3GZGA 5ESYA 3MP1A 4KD5A 1XVXA 1ZBMA 2P3NA 5EHMA 2VP1A 1LFIA 2XXVA 3K02A 1D9VA 4NQ8A 4TLMB 1M5BA 2QVRA 1CB6A 1POY1 4ZEIA 2XXRA 2XA5A 1US4A 1PDAA 1Y4CA 3HO7A 1AWBA 4EF1A 1QKBA 3QUJA 4KQPA 4MF3A 1LBVA 3PUVE 4JVDA 3S9EA 3K4UA 5EQ9A 3A29A 3IFAA 3R26A 4XIGQ 1DMBA 1NNFA 5H8SA 3TFLA 5JTYA 5TP9B 4UA8A 1II5A 1UIUA 4ZE9A 2R8TA 3GXAA 2ZNSA 4OFLA 5HPQA 2LAOA 2F7CA 5EYHA 3E13X 4PBHA 3N5LA 2PT2A 3OENA 2OLBA 4JVIA 5JEIA 3MC2A 4DXUA 5A5XA 4P8BA 4RK9A 5TPAA 1IITA 4PFTA 1URGA 1LSTA 3CFXA 3RQTA 4GL0A 2ONRA 3MZ1A 2Y7WA 3RLFE 2AYSA 3MVXA 4NF5A 4L17A 4THIA 4TOZA 2XXPA 1NV4A 1FQCA 4GVOA 3TCGA 3KSXA 3OELA 4WEDA 2VPNA 4OFOA 3VLWA 2QS4A 1N84A 2V84A 3M3LA 1RYXA 2ANJA 4JBZA 4NMYA 4XF5A 1LBYA 1SDXA 2XWIA 3T0JA 1HSEA 3T1BA 4ZS9A 1SBPA 3B50A 4LATA 3PGFA 1NV2A 4XXUA 2I49A 2I3WA 2Z22A 3CI8A 4C1UA 1JNFA 2D21A 4N13A 4G61A 4GBVA 4O3BA 2Y5LA 3KOSA 1FBCA 1ATGA 5CRYA 1LAGE 1YXIA 1FTJA 5I2KB 3S9LC 4FE8A 1YTVA 1FPKA 1D4NA 3K6UA 3MYUA 1SYIA 3KFMA 3KG2A 3ZSFA 1KWHA 1FQBA 2H25A 3B6TA 1I6AA 1NFTA 2A5TB 5DT6A 3ISPA 4JB7A 3IB2A 4P11A 4E0WA 4QFLA 2PBWA 2I0BA 4C1TA 4GIZA 1XT8A 4P1LA 3FASA 3KGCA 3OMBA 4F1UA 1SW1A 3K1PA 1YAEA 3HSTA 1GGGA 2IA4A 4E0XA 1ANFA 3FGSA 1UTHB 1EZPA 1MY0A 4R2BA 2Y7PA 1N76A 1BTJA 3MAMA 5CMKA 4G68A 1VDWA 1EYIA 4H65A 1JVXA 1UIVA 4LVQA 4HW8A 3FXQA 4G77A 3OXNA 1Q1KA 1JP4A 3IJXB 5CBSA 1QGXA 2YLNA 1HSJA 3IOVA 1M5DA 1FBFA 3QXMA 1URDA 3JYRA 4OYVA 3JZJA 5KCJA 1N04A 3HHGA 5M2VA 1NV3A 3ZKKA 2FVZA 5F7VA 3SEYA 1B05A 1JQFA 2UVHA 3KBRA 4H67A 2PX1A 2VD3A 4F3BA 4EUOA 3D1RA 4X9TA 3IO6A 1TT1A 5CBRA 5I3SA 1PB7A 1RYOA 5B7DA 5H8QB 2Q8MA 1NH8A 3PU5A 2O1LA 1EH3A 2V3TA 3QAXA 3JV9A 4NF6B 4ELQA 2G93A 4OEUA 5I56B 2XWVA 1LB8A 4YU0A 4Q8RA 3ILUB 2DP8A 4FJPA 1LEVA 3VFJA 3LBSA 3SERA 4QSEA 5J1DA 2WBDA 3K6WA 1WDNA 1BKAA 1FQEA 2ESNA 4U1OA 5BWJA 2F7BA 3KN8A 4H8JA 5EQAA 3CSGA 3B6WA 4IGRA 2IEEA 5AA2B 2DYXA 2WX9A 3BBRA 3RGYA 3W9VA 1GVCA 1N3XA 4DLDA 1LLSA 1FPJA 2HHMA 3H7MA 2UYFA 2PFZA 1R1NA 3FXBA 3VXCA 5L8DA 2OCUA 3BIGA 2CZLA 2OX3A 5FTHA 4MIJA 3PPPA 1P99A 5BUUA 3C36A 2UYEA 5ET8A 1IXGA 2REJA 3U8QA 3O2AA 3KZGA 4H45A 3KC1A 3MZBA 1YCJA 2WBBA 4GLIA 2VOZA 4YMAA 5H8NB 3RN8A 2NOOA 5I7IA 4FEDA 2WEFA 4DE8A 4ECFA 1FBHA 3LC8A 4H1XA 4ELOA 3A3UA 3RNNA 2ONSA 2XX8A 1IIWA 3PD8A 1AMFA 4NF8A 4QBAA 4KYDA 4NTLA 1NUZA 2Q74A 2X7QA 2P2AA 5I57B 2XWOA 3PMWA 3VV5A 1JEUA 3IO4A 4OEVA 4GF8A 4PETA 3KSJA 4Z7EA 4F31B 1FQAA 3FV1A 4H8IA 4PTKA 2Y84A 3K6VA 4BLAA 2FIEA 5EQ8A 4LUBA 3LR1A 4NF4B 3THIA 2H9BA 1D9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FW0 A;  3PMX A;  5K2Y A;  3V83 A;  2THI A;  3E9X A;  3SEU A;  2O69 A;  3K6X A;  4BDL A;  3MUQ A;  1JEV A;  4JXI A;  5FTI A;  1P1Q A;  3E3K A;  4JWX A;  1ELJ A;  4BDN A;  1VE4 A;  1N7X A;  2DE3 A;  2E0S A;  4PQJ A;  4ONY A;  3O6G A;  1B0L A;  3VXB A;  3MVZ A;  1QUI A;  5ITO A;  2HAV A;  1B46 A;  1LAX A;  3DP8 A;  3LSX A;  3H6W A;  2XXW A;  1I6B A;  5I58 A;  5CMC A;  5A5X B;  3BFU A;  2HAU A;  4LZ5 A;  3EHS A;  2H4I A;  3G7W A;  2AL5 A;  2OJT A;  4KPT A;  3G3K A;  3CVG A;  3PUZ E;  2RC9 A;  2I6E A;  1NNT A;  3QK6 A;  1MQH A;  2I48 A;  3U1O A;  3HN0 A;  4RNS A;  3V5A A;  2QSX A;  4R6Y A;  4RXL A;  3C9H A;  1Y9U A;  3H06 B;  4QF9 A;  2F6G A;  3H03 A;  1US5 A;  2I4B A;  2NXO A;  4Q5T A;  1B4Z A;  2M8C A;  2Q2C A;  3IOR A;  4F2Q A;  4C0R A;  1A8F A;  1N7W A;  2UXA A;  3ONM A;  1MY1 A;  3HCQ A;  2I0C A;  4HCY A;  1VFE A;  3OSQ A;  2F97 A;  3H6T A;  5ISU A;  3R7X A;  4JWO A;  4ZEB A;  3O29 A;  1B7U A;  5H8H A;  1SD3 A;  3EHT A;  1Y3Q A;  3SEV A;  1SI0 A;  5DVJ A;  5I59 A;  2F78 A;  3Q26 A;  4N07 A;  3TTR A;  3RY3 A;  4F3S A;  1ZU0 A;  4R9F A;  1MXY A;  4OXV A;  3CIJ A;  4ELP A;  2QJE A;  3KEI A;  2Q2A A;  3FVK A;  3W9W A;  1ZIU A;  1Y1Z A;  5CI5 A;  2HXW A;  1AOV A;  2B3F A;  1FTK A;  1LAH E;  4QFO A;  3PPN A;  2Z8F A;  3OD7 A;  2B3B A;  4GD5 A;  1Y1M A;  4G4P A;  1OQH A;  3SEW A;  4QFP A;  1B3F A;  4R73 A;  3TEP A;  1MH4 A;  3O6H A;  4KCD A;  2Z8E A;  1LFG A;  2XXT A;  1FTM A;  2H98 A;  4H6D A;  4BDQ A;  1D9Y A;  3SEX A;  2Y7I A;  4KYS A;  2GRV A;  1PC3 A;  1USY E;  4F19 A;  1FQD A;  1QJM A;  4AB5 A;  5KZT A;  3LSL A;  3S9M C;  2DVZ A;  3O97 A;  1B3G A;  2D3I A;  3H4Z A;  4FOR A;  4U1Z A;  1N3W A;  2QS2 A;  1VFD A;  3UN6 A;  3W15 C;  3U72 A;  1D3K A;  1JW5 A;  5AE4 A;  2PMS A;  4GWO A;  2O51 A;  4KCC A;  1IXC A;  5DYH A;  2XXX A;  3T22 A;  2Q9T A;  4YAH X;  5KDT A;  2XXY A;  3G3H A;  4F39 A;  4YKP A;  4ZED A;  4R74 A;  2ZYN A;  4BDO A;  3PPQ A;  1OIB A;  2OWS A;  3OSR A;  2OZZ A;  1MM7 A;  4UAC A;  3IOU A;  2RCA A;  3CFZ A;  3EN3 A;  5DVI A;  4RPO A;  1QVS A;  5AA2 D;  4OHN A;  1SYH A;  1BLF A;  4LQ2 A;  3K00 A;  4MFI A;  2F7A A;  1BP5 A;  1MDQ A;  2REG A;  2XXU A;  1UTB A;  1H76 A;  2RF1 A;  5I2N A;  1MQI A;  4U4S A;  3G3J A;  3U94 A;  3PD9 A;  5HBC A;  1MRP A;  3IAZ A;  1DTZ A;  1MQG A;  3RT6 B;  4EXK A;  2DWJ A;  4OEN A;  4NF8 B;  3FJG A;  4IGT A;  3VLU A;  3G3I A;  3TTL A;  3N26 A;  3FIR A;  3T9U A;  4FAJ A;  3T9X B;  1WVJ A;  1B1H A;  1MPB A;  5H8F A;  1LFH A;  2F6P A;  4QSC A;  3TUS A;  2RKM A;  1A8E A;  4GXA A;  1ZJL A;  4EF2 A;  3GBA A;  4R2F A;  4LQ5 A;  1XOC A;  2DSF A;  3SES A;  1QW0 A;  5EHS A;  1B0H A;  3CG1 A;  4ZZA A;  5TU0 A;  2CMO A;  1ZKB A;  1JW4 A;  3F11 A;  4QFK A;  4IY5 A;  1Y20 A;  2PT1 A;  3BFT A;  4JWY A;  5TP9 A;  4F18 A;  1BIY A;  1UQW A;  3H6U A;  1VSO A;  1CE2 A;  1ZTY A;  2UVI A;  3FVG A;  3IJO B;  4DDD A;  4JDF A;  1SI1 A;  2O1M A;  4F29 A;  3TTM A;  4GOT A;  3IL1 B;  4U21 A;  2I58 A;  4U2R A;  1MXZ A;  1J1N A;  2V25 A;  2GFE A;  1B58 A;  4NED A;  4OES A;  1B32 A;  1MG1 A;  1SW5 A;  2R71 A;  4TLL B;  1MY2 A;  4PFY A;  4KR5 A;  4OER A;  2DWI A;  2W7Y A;  2FNC A;  3IOW A;  5LOM A;  3VE1 B;  3L6H A;  4WEP A;  4MH5 A;  4DCX A;  3M3F A;  4P0G A;  5AA4 B;  5EYF A;  4RA1 A;  1B52 A;  5ITP A;  2YJP A;  2E1S A;  3TCH A;  1DOT A;  3LSF B;  3I6V A;  1ZLQ A;  2DXR A;  4FIM A;  1MQD A;  3ODB A;  4QRZ A;  1XC1 A;  4XKR A;  4G8N A;  3D4C A;  1XVY A;  3V8X B;  3OEK A;  5AA3 A;  3N6U A;  4H5G A;  4LZ8 A;  1MY3 A;  1URS A;  3DP6 A;  4QHQ A;  3PPR A;  1H3D A;  2DE4 A;  4ELR A;  4JSD A;  3A09 A;  4LZ7 A;  3PMV A;  4O3A A;  5I2K A;  4I8C A;  1ZMG A;  2I3V A;  3QIM A;  2HCA A;  4BDR A;  4JSO A;  1R9Q A;  2Y7R A;  1T0K A;  2HFB A;  2F8D A;  1MPC A;  4G68 C;  1I6Q A;  3WAE A;  3C34 A;  3E4R A;  2A5T A;  3C32 A;  3LSW A;  1Q35 A;  3M3K A;  1NMU A;  3TOD A;  2XXQ A;  2UVJ A;  5L9O A;  4RJZ A;  4EDP A;  4G2Z A;  4F3P A;  3UOR A;  1GTK A;  3I5O A;  3VLV A;  3VVE A;  1UTH A;  4ND9 A;  4X48 A;  1Z7N E;  2BJJ X;  3T9V A;  2ZYK A;  4QSD A;  3FD3 A;  1M5C A;  5JTY B;  4KHZ E;  2ZMB A;  3GBB A;  4TQU Q;  3K2D A;  1NL5 A;  2A5S A;  3G3F A;  4YB7 A;  1A7L A;  4PP0 A;  5L9M A;  4OET A;  1Y3P A;  5I84 A;  3IK6 B;  1B6H A;  4POW A;  2XX7 A;  1JW1 A;  4XKP A;  1QUK A;  1SW4 A;  5ELV A;  2B65 A;  4H5F A;  3OO7 A;  1F9B A;  1XHY A;  1MM6 A;  3RTW B;  1MPD A;  3Q28 A;  3KJ7 A;  5TPA B;  1DSN A;  1PBP A;  2RC7 A;  1MS7 A;  3OOA A;  1B5J A;  3USD A;  3FVO A;  2ZXT A;  5H8Q A;  3O66 A;  2GHA A;  4NF5 B;  2XX9 A;  2HQ0 A;  3TEL A;  2FA7 A;  3QSL A;  2Z8D A;  4DIG A;  2XXI A;  4BDM A;  3K1M A;  5I56 A;  3D4G A;  1S50 A;  1JVY A;  2DVC A;  4R72 A;  4FEB A;  4X1B A;  2F5X A;  4ESW A;  3SET A;  5AA2 A;  4K3F A;  3HPI A;  5CMB A;  4FAT A;  3VVD A;  1DPP A;  3TYH A;  4QFN A;  2ZNT A;  1VR5 A;  3FVN A;  4OZ9 A;  3MZ9 A;  3IX1 A;  3MVW A;  1PB9 A;  4NWC A;  1HSL A;  1AIV A;  1B3L A;  1MXW A;  3ILT B;  1P1W A;  2QPQ A;  3RTF B;  2ZNU A;  2VD2 A;  3N6T A;  3Q25 A;  2VGQ A;  3TCF A;  4LON B;  5AA1 A;  3RPW A;  4OMB A;  4U22 A;  3CSB A;  3LUY A;  3K0V A;  1B9J A;  5DVF A;  2QMW A;  4H0W A;  2H5Y A;  1SW2 A;  3FUZ A;  2O7U A;  4M4G A;  3IB0 A;  1YPN A;  1H43 A;  5I57 A;  3IB1 A;  1DPE A;  3KOT A;  2R9J A;  4IO4 A;  5DEX A;  4OTE A;  1R6Z A;  3CRB A;  1IXH A;  3IR1 A;  2QRY A;  2G29 A;  4PFW A;  2XXH A;  1TWY A;  3B7D A;  4G68 B;  4OQO A;  5CMM A;  1MH3 A;  4NF4 A;  3EPE A;  5K2X A;  4YB5 A;  4HCW A;  3U92 A;  4KYE A;  4G8M A;  4U4X A;  4Q30 B;  3FJ7 A;  4IY6 A;  1FTO A;  2D5W A;  2X26 A;  4GXS B;  3HHF A;  1O7T A;  5KCJ B;  2P0S A;  1OVB A;  3BKI B;  3S9N C;  3WAF A;  2RCB A;  5B70 A;  1O63 A;  3C33 A;  1OMP A;  1OQG A;  4YKI A;  1B5I A;  1EZ9 A;  3FJM A;  3GLB A;  4I62 A;  5FHN A;  3T66 A;  1I69 A;  1SVX B;  4YKK A;  3MBP A;  3OEM A;  1A99 A;  1WOD A;  3U93 A;  3DP4 A;  4M1V A;  1JET A;  1OLC A;  4LA9 A;  4MLV A;  1SQY A;  1B1X A;  3TQL A;  2XHD A;  1L5T A;  4IB2 A;  1IUD A;  1Y3N A;  2HZL A;  2GHB A;  4XKN A;  2FYI A;  4G8H A;  4X1D A;  3UIF A;  2OK2 A;  4GQO A;  3TDJ A;  1MXX A;  1B7Z A;  4F2O A;  4IO6 A;  1LCF A;  3QUF A;  1QUJ A;  1H45 A;  1TXF A;  2KLF A;  4XTC Q;  2O68 A;  2QMX A;  5JK4 A;  1S9T A;  2ALU A;  1QKA A;  1MDP 1;  1P1N A;  4AB6 A;  2F34 A;  2PVU A;  1DTG A;  1GR2 A;  1EU8 A;  4FEC A;  4NWD A;  3B6Q A;  4YKJ A;  1MQJ A;  3UA8 A;  4YB6 A;  3O9P A;  4KFQ A;  3UP9 A;  2ABH A;  1B7H A;  3P7I A;  1GV8 A;  2Q8J A;  2V3Q A;  2PYY A;  2ONK E;  3ZKL A;  3L6G A;  5CC2 A;  2ZYM A;  3PUW E;  2H99 A;  4OVJ A;  2R6G E;  1MXV A;  4OFJ A;  3TPA A;  3V89 B;  1B51 A;  1LB9 A;  1FQF A;  4F22 A;  3OO8 A;  4I9D A;  1AL3 A;  4R75 A;  3OO6 A;  4IO7 A;  3ECR A;  4ZEK A;  4DZ1 A;  3Q27 A;  1N0T A;  2DWA A;  3RUM A;  4AQ4 A;  4IO2 A;  3O6I A;  5F1Q A;  3T96 B;  1B4H A;  1QUL A;  4RK2 A;  4DXB A;  4EQ7 A;  3OO9 A;  3VDF A;  1S7Y A;  3O28 A;  1PBQ A;  3A3C A;  3SKP A;  1NNK A;  2DOJ A;  2UVG A;  2XD2 A;  3TZA A;  4EXL A;  3FAT A;  4P0I A;  1A54 A;  1LCT A;  4DXC A;  3UK4 A;  1AH5 A;  3ZS6 A;  5I58 B;  1OLA A;  1RKM A;  4POX A;  5L9S A;  1A55 A;  1R9L A;  4EQ9 A;  1OVT A;  1LBB A;  2Q89 A;  3UGW A;  1B5H A;  4U23 A;  4RY1 A;  3CR9 A;  2NUV A;  2P1S A;  4ISU A;  4R6H A;  3KN7 A;  3TQW A;  3DEL B;  2ZYO A;  4N6P A;  4WKM A;  1TFD A;  1H44 A;  3G3G A;  1LBC A;  1Z7M E;  2GH9 A;  4PE5 B;  2YPN A;  4Z0I A;  5IKB A;  3PV0 E;  2DS9 A;  3FZV A;  3MWB A;  1NNP A;  2O6A A;  2O84 X;  2OWT A;  2Y7K A;  3TTN A;  2O7I A;  5H8H B;  3PUY E;  4I1D A;  1MXU A;  5I59 B;  2F36 A;  2AL4 A;  3C35 A;  1O64 A;  4IO5 A;  3S4U A;  1LGB C;  4F1V A;  4ZZE A;  4XKQ A;  5FHM A;  1B3E A;  5DEX B;  4GFR A;  3Q29 A;  4R9G A;  1NH7 A;  3KJT A;  4R6K A;  2QS1 A;  5IAI A;  5DTB A;  3C31 A;  4WXJ A;  4HTG A;  1M5F A;  4OWD A;  4ZEC A;  3H3G A;  3S2V A;  5CM6 A;  3M8U A;  3H6V A;  4KI0 E;  3VVF A;  4O3C A;  1B2H A;  1IZ1 A;  1FTL A;  2NVU B;  2Z23 A;  1B40 A;  3CFL A;  3TKD A;  2VHA A;  3MJN A;  5FHO A;  5ICQ A;  2X7P A;  1Y4T A;  3MP6 A;  2AIX A;  4LP2 B;  2QL3 A;  2V93 A;  3TAJ A;  1FCK A;  3K1N A;  4NE4 A;  3MP8 A;  1EZO A;  1NKX A;  3EF7 A;  3SDF A;  3FXU A;  1XS5 A;  4IO3 A;  3C4M A;  3DLN A;  3PUX E;  3R6U A;  3PPO A;  5KDT B;  4EQB A;  1TFA A;  4DCY A;  1P1U A;  5ICT A;  1IEJ A;  2I4C A;  4NF6 A;  4ZDM A;  2DXY A;  2XD3 A;  1USY H;  4YIC A;  4F3G A;  4RYA A;  4ZE8 A;  2V3U A;  3RT8 A;  3K01 A;  1PB8 A;  4PFU A;  2RC8 A;  1A40 A;  1POT A;  4GL8 A;  4MBP A;  3MW0 A;  3EQ1 A;  3TTK A;  3MVY A;  2OBG A;  3T9H B;  2NWJ A;  3MQ9 A;  2DQV A;  1M5E A;  5AA4 A;  4Q0C A;  1IXI A;  3MPK A;  3MPL A;  4YZZ A;  2DE2 A;  2HEU A;  3AXF A;  1UTB B;  5I2N B;  3HV1 A;  1IQ7 A;  4RPN A;  1PEB A;  4ZEF A;  5HM4 B;  3QYT A;  3T93 B;  3FV2 A;  4HS7 A;  1B3H A;  1LAF E;  3KN3 A;  1P1O A;  3TMG A;  5H8N A;  3I3V A;  4F1Y A;  2DWH A;  2QS3 A;  2HZK A;  3EHU A;  3CG3 A;  4YMB A;  4MLQ A;  1MY4 A;  2Q88 A;  2WKY A;  3DM0 A;  3N94 A;  3FXR A;  4GRK A;  3IOT A;  4ESX A;  2RIN A;  5H8F B;  2F35 A;  3GZG A;  3MP1 A;  4KD5 A;  1XVX A;  1ZBM A;  5EHM A;  2VP1 A;  1LFI A;  2XXV A;  3K02 A;  1D9V A;  4TLM B;  1M5B A;  1CB6 A;  1POY 1;  4ZEI A;  2XXR A;  1US4 A;  1PDA A;  1Y4C A;  3HO7 A;  4EF1 A;  1QKB A;  3QUJ A;  4KQP A;  4MF3 A;  3PUV E;  3S9E A;  3K4U A;  3R26 A;  4XIG Q;  1DMB A;  1NNF A;  5H8S A;  3TFL A;  5JTY A;  5TP9 B;  4UA8 A;  1II5 A;  1UIU A;  4ZE9 A;  3GXA A;  2ZNS A;  4OFL A;  5HPQ A;  2LAO A;  2F7C A;  3E13 X;  3N5L A;  2PT2 A;  3OEN A;  2OLB A;  5JEI A;  3MC2 A;  4DXU A;  5A5X A;  4RK9 A;  5TPA A;  1IIT A;  4PFT A;  1URG A;  1LST A;  3CFX A;  3RQT A;  4GL0 A;  2ONR A;  3MZ1 A;  2Y7W A;  3RLF E;  2AYS A;  3MVX A;  4NF5 A;  4L17 A;  4THI A;  4TOZ A;  2XXP A;  1FQC A;  4GVO A;  3TCG A;  3KSX A;  3OEL A;  4WED A;  4OFO A;  3VLW A;  2QS4 A;  1N84 A;  2V84 A;  3M3L A;  1RYX A;  2ANJ A;  4JBZ A;  4NMY A;  1SDX A;  1HSE A;  4ZS9 A;  1SBP A;  4LAT A;  3PGF A;  4XXU A;  2I49 A;  2I3W A;  2Z22 A;  3CI8 A;  4C1U A;  1JNF A;  2D21 A;  4N13 A;  4O3B A;  3KOS A;  1ATG A;  5CRY A;  1LAG E;  1FTJ A;  5I2K B;  3S9L C;  4FE8 A;  1YTV A;  1D4N A;  3K6U A;  1SYI A;  3KFM A;  3KG2 A;  3ZSF A;  1KWH A;  1FQB A;  2H25 A;  3B6T A;  1I6A A;  1NFT A;  2A5T B;  5DT6 A;  4JB7 A;  3IB2 A;  4P11 A;  4E0W A;  4QFL A;  2PBW A;  2I0B A;  4C1T A;  4GIZ A;  1XT8 A;  3FAS A;  3KGC A;  3OMB A;  4F1U A;  1SW1 A;  3K1P A;  1YAE A;  3HST A;  1GGG A;  2IA4 A;  4E0X A;  1ANF A;  3FGS A;  1UTH B;  1EZP A;  1MY0 A;  4R2B A;  2Y7P A;  1N76 A;  1BTJ A;  3MAM A;  5CMK A;  4G68 A;  4H65 A;  1JVX A;  1UIV A;  4LVQ A;  4HW8 A;  3FXQ A;  4G77 A;  3OXN A;  1Q1K A;  3IJX B;  5CBS A;  2YLN A;  1HSJ A;  3IOV A;  1M5D A;  3QXM A;  1URD A;  3JYR A;  4OYV A;  3JZJ A;  5KCJ A;  1N04 A;  3HHG A;  5M2V A;  3ZKK A;  5F7V A;  3SEY A;  1B05 A;  1JQF A;  2UVH A;  3KBR A;  4H67 A;  2PX1 A;  2VD3 A;  4F3B A;  4EUO A;  4X9T A;  3IO6 A;  1TT1 A;  5CBR A;  1PB7 A;  1RYO A;  5B7D A;  5H8Q B;  1NH8 A;  3PU5 A;  2O1L A;  1EH3 A;  2V3T A;  3QAX A;  3JV9 A;  4NF6 B;  4ELQ A;  2G93 A;  4OEU A;  5I56 B;  1LB8 A;  4YU0 A;  4Q8R A;  3ILU B;  2DP8 A;  4FJP A;  3VFJ A;  3LBS A;  3SER A;  4QSE A;  5J1D A;  3K6W A;  1WDN A;  1BKA A;  1FQE A;  2ESN A;  4U1O A;  5BWJ A;  2F7B A;  3KN8 A;  4H8J A;  3CSG A;  3B6W A;  4IGR A;  2IEE A;  5AA2 B;  2DYX A;  3BBR A;  3RGY A;  3W9V A;  1GVC A;  1N3X A;  4DLD A;  1LLS A;  3H7M A;  2UYF A;  1R1N A;  3VXC A;  5L8D A;  2OCU A;  2CZL A;  5FTH A;  3PPP A;  1P99 A;  5BUU A;  3C36 A;  2UYE A;  1IXG A;  2REJ A;  3U8Q A;  3O2A A;  3KZG A;  3MZB A;  1YCJ A;  4GLI A;  2VOZ A;  4YMA A;  5H8N B;  3RN8 A;  2NOO A;  4FED A;  4DE8 A;  4ECF A;  3LC8 A;  4H1X A;  4ELO A;  3A3U A;  3RNN A;  2ONS A;  2XX8 A;  1IIW A;  3PD8 A;  1AMF A;  4NF8 A;  4KYD A;  4NTL A;  2X7Q A;  2P2A A;  5I57 B;  3PMW A;  3VV5 A;  1JEU A;  3IO4 A;  4OEV A;  4GF8 A;  4PET A;  3KSJ A;  4Z7E A;  4F31 B;  1FQA A;  3FV1 A;  4H8I A;  2Y84 A;  3K6V A;  4BLA A;  4LUB A;  3LR1 A;  4NF4 B;  3THI A;  2H9B A; 
#chains in the Genus database with same CATH topology
 1FPE A;  1FW0 A;  3PMX A;  5K2Y A;  3V83 A;  1FRP A;  2THI A;  1K9Z A;  2KR0 A;  3E9X A;  3SEU A;  1NV5 A;  2O69 A;  3K6X A;  4BDL A;  3MUQ A;  1JEV A;  4JXI A;  1KA1 A;  5FTI A;  1P1Q A;  3E3K A;  4JWX A;  1ELJ A;  1YZ0 A;  4BDN A;  1VE4 A;  1N7X A;  1RDZ A;  2DE3 A;  2E0S A;  4PQJ A;  4ONY A;  3O6G A;  1B0L A;  3VXB A;  1EYJ A;  3MVZ A;  4PC9 A;  1QUI A;  5ITO A;  4LN5 A;  2HAV A;  5ET7 A;  1B46 A;  1LAX A;  3DP8 A;  3LSX A;  3RPL A;  2WYP A;  3H6W A;  2XXW A;  1I6B A;  5IZ3 A;  5I58 A;  5CMC A;  3U65 A;  2CEY A;  5A5X B;  3BFU A;  2HAU A;  4LZ5 A;  3EHS A;  2H4I A;  3G7W A;  2AL5 A;  2OJT A;  4KPT A;  3G3K A;  3CVG A;  3PUZ E;  2QVV A;  2RC9 A;  2I6E A;  1NNT A;  2L5V A;  3QK6 A;  1MQH A;  2CZI A;  2I48 A;  3U1O A;  3HN0 A;  4RNS A;  3V5A A;  2QSX A;  4R6Y A;  4RXL A;  3C9H A;  1Y9U A;  3H06 B;  4QF9 A;  2F6G A;  3H03 A;  1US5 A;  2I4B A;  2NXO A;  4MNI A;  4Q5T A;  1B4Z A;  2M8C A;  2Q2C A;  3IOR A;  4F2Q A;  4C0R A;  1A8F A;  1N7W A;  2UXA A;  3ONM A;  1MY1 A;  3HCQ A;  2I0C A;  4HCY A;  1VFE A;  3OSQ A;  2F97 A;  4GWU A;  4PAI A;  4NG7 A;  1FPD A;  3H6T A;  5ISU A;  3R7X A;  4JWO A;  4HE0 A;  4ZEB A;  3O29 A;  1B7U A;  5H8H A;  1SD3 A;  3EHT A;  1Y3Q A;  3SEV A;  1SI0 A;  5DVJ A;  5I59 A;  1KZ8 A;  2F78 A;  3Q26 A;  4OVS A;  4N07 A;  3TTR A;  3RY3 A;  4F3S A;  1ZU0 A;  4R9F A;  1MXY A;  4OXV A;  1FBG A;  3CIJ A;  4MMP A;  4ELP A;  4OVQ A;  2PFY A;  2QJE A;  3KEI A;  2Q2A A;  3FVK A;  3W9W A;  4PDD A;  1ZIU A;  1Y1Z A;  5CI5 A;  2HXW A;  1AOV A;  2B3F A;  1FTK A;  1YYZ A;  1LAH E;  4QFO A;  3PPN A;  4KXP A;  2Z8F A;  2PCR A;  3OD7 A;  2B3B A;  4GD5 A;  1Y1M A;  4G4P A;  1OQH A;  3SEW A;  4QFP A;  2V4C A;  1B3F A;  4R73 A;  3TEP A;  1MH4 A;  3O6H A;  4KCD A;  4PAF A;  2Z8E A;  1LFG A;  1K9Y A;  2XXT A;  1G0H A;  1FTM A;  2H98 A;  4H6D A;  4BDQ A;  1D9Y A;  3SEX A;  2Y7I A;  2P3V A;  4KYS A;  2GRV A;  1PC3 A;  1USY E;  4F19 A;  1FQD A;  1QJM A;  4AB5 A;  5KZT A;  3LSL A;  4N81 A;  3S9M C;  2DVZ A;  3O97 A;  4P1E A;  1B3G A;  4MNP A;  2D3I A;  3H4Z A;  4FBP A;  4FOR A;  4U1Z A;  1N3W A;  2QS2 A;  3BIH A;  1VFD A;  3UN6 A;  3W15 C;  3U72 A;  1D3K A;  1JW5 A;  5AE4 A;  2PMS A;  4GWO A;  2O51 A;  4KCC A;  1IXC A;  5DYH A;  2XXX A;  3T22 A;  2Q9T A;  1KA0 A;  4YAH X;  5KDT A;  2FBP A;  2XXY A;  3G3H A;  3KC0 A;  4F39 A;  2HXR A;  4YKP A;  2ZZW A;  4ZED A;  4R74 A;  2ZYN A;  4BDO A;  3PPQ A;  1OIB A;  2OWS A;  3OSR A;  2OZZ A;  1MM7 A;  4UAC A;  3EKI A;  3IOU A;  2RCA A;  3CFZ A;  3EN3 A;  5DVI A;  4RPO A;  1DBZ A;  1QVS A;  5AA2 D;  4OHN A;  1SYH A;  4O8M A;  1INP A;  1BLF A;  2Y5K A;  4LQ2 A;  3K00 A;  4MFI A;  2F7A A;  1BP5 A;  1MDQ A;  4X04 A;  2REG A;  2XXU A;  1UTB A;  1H76 A;  2RF1 A;  5I2N A;  1MQI A;  3E79 A;  4U4S A;  3G3J A;  1IMD A;  3U94 A;  3PD9 A;  5HBC A;  1MRP A;  3IAZ A;  1DTZ A;  1IMF A;  1MQG A;  1CNQ A;  3RT6 B;  4EXK A;  2DWJ A;  4PFR A;  4OEN A;  4NF8 B;  3FJG A;  4IGT A;  3VLU A;  3G3I A;  3TTL A;  3N26 A;  4PFB A;  3FIR A;  3T9U A;  4FAJ A;  3T9X B;  2XWK A;  1WVJ A;  1B1H A;  4H46 A;  1MPB A;  4O94 A;  5H8F A;  1NUY A;  1LFH A;  2F6P A;  4QSC A;  1FSA A;  3TUS A;  2RKM A;  1A8E A;  4GXA A;  5IGA A;  3PTY A;  1ZJL A;  1NUW A;  4EF2 A;  3GBA A;  4R2F A;  4MJO A;  1FPG A;  4LQ5 A;  1XOC A;  2DSF A;  3SES A;  1QW0 A;  5EHS A;  1B0H A;  3CG1 A;  4ZZA A;  5TU0 A;  2CMO A;  4OVP A;  1ZKB A;  1JW4 A;  3F11 A;  4QFK A;  4IY5 A;  1Y20 A;  2PT1 A;  3BFT A;  4JWY A;  5TP9 A;  4F18 A;  1BIY A;  1UQW A;  3H6U A;  1VSO A;  1CE2 A;  1ZTY A;  2UVI A;  3FVG A;  3IJO B;  4I3Y A;  4DDD A;  4JDF A;  1SI1 A;  2O1M A;  4F29 A;  3TTM A;  4GOT A;  3IL1 B;  4U21 A;  2I58 A;  4U2R A;  1MXZ A;  1J1N A;  2V25 A;  4JVC A;  4HE1 A;  4I40 A;  2GFE A;  4PDH A;  1B58 A;  2FIX A;  4NED A;  1NUX A;  4OES A;  4P47 A;  1B32 A;  1MG1 A;  1SW5 A;  2R71 A;  4TLL B;  1MY2 A;  4PFY A;  4KR5 A;  4OER A;  2DWI A;  2W7Y A;  4QXD A;  2FNC A;  3IOW A;  5LOM A;  1FTA A;  3VE1 B;  3L6H A;  4WEP A;  4MH5 A;  4DCX A;  4NN3 A;  3M3F A;  4P0G A;  5AA4 B;  5EYF A;  4RA1 A;  1B52 A;  5ITP A;  2YJP A;  2E1S A;  4N6K A;  3TCH A;  1DOT A;  3LSF B;  3I6V A;  1ZLQ A;  1FPI A;  2DXR A;  4FIM A;  1MQD A;  3ODB A;  2B4M A;  4X8R A;  4QRZ A;  1XC1 A;  4XKR A;  4G8N A;  3D4C A;  5LTC A;  1XVY A;  3V8X B;  3OEK A;  5AA3 A;  3N6U A;  1FPL A;  4H5G A;  4LZ8 A;  1MY3 A;  1URS A;  3DP6 A;  4QHQ A;  1RDX A;  3PPR A;  1H3D A;  2DE4 A;  4ELR A;  4JSD A;  3A09 A;  4LZ7 A;  3PMV A;  4O3A A;  5IM2 A;  5I2K A;  4I8C A;  1ZMG A;  2I3V A;  3QIM A;  1LBX A;  2HCA A;  4BDR A;  4JSO A;  1R9Q A;  2Y7R A;  1T0K A;  4GWZ A;  2HFB A;  2F8D A;  1MPC A;  3GYY A;  4G68 C;  2JJK A;  1I6Q A;  3WAE A;  3C34 A;  3E4R A;  2A5T A;  1NV1 A;  3C32 A;  3LSW A;  3LV0 A;  1Q35 A;  1SPI A;  3M3K A;  1NMU A;  4MNC A;  3TOD A;  2XXQ A;  2UVJ A;  5L9O A;  4RJZ A;  4EDP A;  4G2Z A;  4F3P A;  3UOR A;  4MEV A;  1GTK A;  3I5O A;  3VLV A;  3VVE A;  1UTH A;  4ND9 A;  4X48 A;  1Z7N E;  2BJJ X;  3T9V A;  2ZYK A;  4QSD A;  3FD3 A;  1M5C A;  4GBW A;  5JTY B;  4KHZ E;  4PF8 A;  2ZMB A;  3GBB A;  4TQU Q;  3K2D A;  1NL5 A;  2A5S A;  3G3F A;  4YB7 A;  1A7L A;  4PP0 A;  5L9M A;  4OET A;  4HXV A;  1Y3P A;  5I84 A;  3IK6 B;  1B6H A;  4POW A;  2XX7 A;  1JW1 A;  4XKP A;  1QUK A;  1SW4 A;  5ELV A;  2B65 A;  4H5F A;  1FPB A;  3OO7 A;  1F9B A;  1XHY A;  1MM6 A;  3RTW B;  1MPD A;  3Q28 A;  3KJ7 A;  5TPA B;  1DSN A;  4N6D A;  1IME A;  1PBP A;  2RC7 A;  1MS7 A;  2F3D A;  3OOA A;  1B5J A;  3USD A;  3FVO A;  2ZXT A;  5H8Q A;  3O66 A;  2GHA A;  4NF5 B;  2XX9 A;  2HQ0 A;  3TEL A;  2FA7 A;  3QSL A;  2Z8D A;  4DIG A;  2XXI A;  4BDM A;  3K1M A;  5I56 A;  3D4G A;  1S50 A;  1JVY A;  2QFL A;  2DVC A;  4R72 A;  4MCO A;  2CZK A;  4FEB A;  4X1B A;  2F5X A;  4ESW A;  3SET A;  5AA2 A;  4K3F A;  3HPI A;  5CMB A;  4FAT A;  3VVD A;  1DPP A;  3TYH A;  4QFN A;  3E78 A;  4NAP A;  2ZNT A;  1VR5 A;  3FVN A;  4OZ9 A;  3MZ9 A;  3IX1 A;  5DW8 A;  3MVW A;  5ET6 A;  4PFI A;  1PB9 A;  4NWC A;  4N17 A;  1HSL A;  2OWZ A;  1AIV A;  1B3L A;  1MXW A;  3B8B A;  3ILT B;  1P1W A;  2QPQ A;  3QMF A;  3RTF B;  2ZNU A;  1BK4 A;  2KQZ A;  2VD2 A;  3N6T A;  3Q25 A;  2VGQ A;  3TCF A;  4LON B;  5AA1 A;  5EYG A;  3RPW A;  4OMB A;  4U22 A;  3CSB A;  3LUY A;  4PGN A;  5ET5 A;  3K0V A;  1B9J A;  5DVF A;  4OVT A;  2QMW A;  4H0W A;  2H5Y A;  2ZZV A;  1SW2 A;  3FUZ A;  2O7U A;  4M4G A;  2DDK A;  3IB0 A;  1YPN A;  4PF6 A;  1H43 A;  1FJ9 A;  3IB1 A;  5I57 A;  1DPE A;  3KOT A;  2R9J A;  4IO4 A;  5DEX A;  4OTE A;  1R6Z A;  3CRB A;  1IXH A;  3IR1 A;  2QRY A;  2G29 A;  1DCU A;  4PFW A;  2XXH A;  1TWY A;  3B7D A;  4G68 B;  4OQO A;  5CMM A;  1MH3 A;  4NF4 A;  3EPE A;  5K2X A;  4YB5 A;  4HCW A;  2ZZX A;  3U92 A;  4KYE A;  4G8M A;  4U4X A;  4Q30 B;  3FJ7 A;  4IY6 A;  1FTO A;  2D5W A;  2X26 A;  4GXS B;  3HHF A;  1O7T A;  5KCJ B;  2P0S A;  1OVB A;  3LUZ A;  3BKI B;  3S9N C;  4I3E A;  4UAB A;  3WAF A;  2RCB A;  2CZH A;  5B70 A;  2VT5 A;  1DK4 A;  1O63 A;  3C33 A;  1OMP A;  1OQG A;  4YKI A;  1B5I A;  1EZ9 A;  3FJM A;  3GLB A;  5F24 A;  4I62 A;  2CEX A;  5FHN A;  3T66 A;  3NOH A;  1I69 A;  4MHF A;  1SVX B;  4YKK A;  4N4U A;  3MBP A;  3OEM A;  1A99 A;  4O7M A;  4PE3 A;  1WOD A;  3U93 A;  3DP4 A;  4M1V A;  1JET A;  4MX6 A;  1OLC A;  1FBD A;  4LA9 A;  4MLV A;  2B4L A;  1SQY A;  1B1X A;  3TQL A;  2XHD A;  3HFU A;  1L5T A;  4IB2 A;  1IUD A;  1Y3N A;  2HZL A;  2GHB A;  1FBE A;  4XKN A;  2FYI A;  4G8H A;  4X1D A;  3UIF A;  2OK2 A;  4GQO A;  3TDJ A;  1MXX A;  1B7Z A;  4GWX A;  4PAK A;  4F2O A;  4IO6 A;  1LCF A;  3QUF A;  1QUJ A;  1H45 A;  1TXF A;  2KLF A;  4XTC Q;  2O68 A;  2QMX A;  4NF0 A;  3RYD A;  5JK4 A;  1S9T A;  2ALU A;  1QKA A;  1MDP 1;  1P1N A;  4AB6 A;  2F34 A;  2PVU A;  1DTG A;  1GR2 A;  1EU8 A;  4FEC A;  4NWD A;  3B6Q A;  4YKJ A;  1MQJ A;  3UA8 A;  4YB6 A;  2HPG A;  3O9P A;  4KFQ A;  3UP9 A;  2ABH A;  1B7H A;  3P7I A;  1GV8 A;  2Q8J A;  2V3Q A;  4P56 A;  2PYY A;  2ONK E;  3ZKL A;  3L6G A;  5CC2 A;  4NX1 A;  2ZYM A;  3PUW E;  2H99 A;  4OVJ A;  5T3J A;  4NHB A;  2R6G E;  1MXV A;  4OFJ A;  3TPA A;  3V89 B;  1B51 A;  1LB9 A;  1IMC A;  1FQF A;  4F22 A;  3OO8 A;  4I9D A;  4OVR A;  1AL3 A;  4R75 A;  4AS4 A;  4O7I A;  5IZ1 A;  3OO6 A;  4IO7 A;  3ECR A;  4ZEK A;  4DZ1 A;  4XFE A;  3Q27 A;  1N0T A;  2DWA A;  3RUM A;  4AQ4 A;  4IO2 A;  2FHY A;  3O6I A;  5F1Q A;  3FBP A;  4XEQ A;  3T96 B;  1RDY A;  1B4H A;  1QUL A;  4RK2 A;  4DXB A;  4EQ7 A;  3OO9 A;  3VDF A;  1S7Y A;  3O28 A;  3MST A;  5A5L A;  1PBQ A;  3A3C A;  3SKP A;  1NNK A;  2DOJ A;  2UVG A;  2XD2 A;  3TZA A;  4EXL A;  4N8G A;  3FAT A;  4P0I A;  1A54 A;  3RPL B;  1LCT A;  4DXC A;  1G0I A;  1AH5 A;  3UK4 A;  5IZ3 B;  3ZS6 A;  5I58 B;  1OLA A;  2F3B A;  1RKM A;  4POX A;  5L9S A;  1A55 A;  2XXK A;  1R9L A;  4DI4 B;  4EQ9 A;  5EQ7 A;  1OVT A;  2VPO A;  1LBB A;  2Q89 A;  1LBZ A;  3SZP A;  3UGW A;  1B5H A;  3IFC A;  4U23 A;  1XI6 A;  2BJI A;  4RY1 A;  3CR9 A;  2NUV A;  2P1S A;  4ISU A;  1IMA A;  4R6H A;  3KN7 A;  3TQW A;  3DEL B;  2ZYO A;  3ROJ A;  4N6P A;  1FPF A;  4WKM A;  1TFD A;  1H44 A;  3G3G A;  1LBC A;  1Z7M E;  2GH9 A;  4PE5 B;  4PBQ A;  2YPN A;  5IZZ A;  4GX6 A;  4Z0I A;  5IKB A;  3PV0 E;  2DS9 A;  4N91 A;  1NV6 A;  3FZV A;  4AS5 A;  3MWB A;  1NNP A;  1FBP A;  2O6A A;  2O84 X;  2OWT A;  5I5P A;  2Y7K A;  3TTN A;  2O7I A;  5H8H B;  3PUY E;  4I1D A;  1MXU A;  5I59 B;  2F36 A;  2AL4 A;  3C35 A;  1O64 A;  4IO5 A;  3S4U A;  4GX4 A;  4N8Y A;  1LGB C;  4F1V A;  4ZZE A;  4XKQ A;  1EYK A;  1LBW A;  5FHM A;  1B3E A;  1IMB A;  5DEX B;  4GFR A;  3Q29 A;  4R9G A;  1NH7 A;  3KJT A;  4R6K A;  2QS1 A;  5IAI A;  5DTB A;  1NI9 A;  3C31 A;  4WXJ A;  4HTG A;  1M5F A;  4OWD A;  4MAG A;  4ZEC A;  3H3G A;  4PGP A;  3S2V A;  5CM6 A;  3M8U A;  3H6V A;  4KI0 E;  5LDZ A;  3VVF A;  4O3C A;  1B2H A;  1IZ1 A;  1FTL A;  4P9K A;  2NVU B;  2Z23 A;  1B40 A;  3CFL A;  3TKD A;  2VHA A;  3MJN A;  5FHO A;  5J16 A;  5ICQ A;  2X7P A;  1Y4T A;  3MP6 A;  4N15 A;  2AIX A;  4GWW A;  4LP2 B;  5FBP A;  1Q9D A;  2QL3 A;  2V93 A;  3TAJ A;  4NGU A;  1FCK A;  3K1N A;  4NE4 A;  3MP8 A;  1EZO A;  1NKX A;  3EF7 A;  3SDF A;  3FXU A;  1XS5 A;  4IO3 A;  3C4M A;  3DLN A;  3PUX E;  3R6U A;  3PPO A;  5KDT B;  4P3L A;  4EQB A;  1TFA A;  4DCY A;  1P1U A;  5ICT A;  1IEJ A;  2I4C A;  1NV0 A;  4NF6 A;  4ZDM A;  2DXY A;  2XD3 A;  1USY H;  4YIC A;  4GWS A;  4F3G A;  4RYA A;  4ZE8 A;  2V3U A;  3RT8 A;  3K01 A;  1PB8 A;  4PFU A;  2RC8 A;  1A40 A;  1POT A;  4GL8 A;  2QVU A;  1NV7 A;  4MBP A;  2WYK A;  3MW0 A;  2GQ1 A;  3EQ1 A;  4GX3 A;  3TTK A;  3MVY A;  2OBG A;  3T9H B;  2NWJ A;  3MQ9 A;  2DQV A;  1M5E A;  5AA4 A;  4Q0C A;  1IXI A;  3MPK A;  4OA4 A;  3MPL A;  4YZZ A;  2DE2 A;  2HEU A;  3AXF A;  1UTB B;  4HE2 A;  5I2N B;  3HV1 A;  1IQ7 A;  4RPN A;  1PEB A;  4ZEF A;  5HM4 B;  3QYT A;  3T93 B;  3FV2 A;  2MKZ A;  4HS7 A;  1B3H A;  1LAF E;  3KN3 A;  4PCD A;  1P1O A;  3TMG A;  1FJ6 A;  3CHG A;  5H8N A;  3I3V A;  4F1Y A;  2DWH A;  2QS3 A;  2HZK A;  4OAN A;  3KBZ A;  4IR8 A;  3EHU A;  3CG3 A;  4YMB A;  4DI3 D;  4MLQ A;  1MY4 A;  2Q88 A;  2WKY A;  3DM0 A;  4GWY A;  3N94 A;  3FXR A;  4GRK A;  3IOT A;  4ESX A;  2RIN A;  5H8F B;  2F35 A;  3GZG A;  5ESY A;  3MP1 A;  4KD5 A;  1XVX A;  1ZBM A;  2P3N A;  5EHM A;  2VP1 A;  1LFI A;  2XXV A;  3K02 A;  1D9V A;  4NQ8 A;  4TLM B;  1M5B A;  2QVR A;  1CB6 A;  1POY 1;  4ZEI A;  2XXR A;  2XA5 A;  1US4 A;  1PDA A;  1Y4C A;  3HO7 A;  1AWB A;  4EF1 A;  1QKB A;  3QUJ A;  4KQP A;  4MF3 A;  1LBV A;  3PUV E;  4JVD A;  3S9E A;  3K4U A;  5EQ9 A;  3A29 A;  3IFA A;  3R26 A;  4XIG Q;  1DMB A;  1NNF A;  5H8S A;  3TFL A;  5JTY A;  5TP9 B;  4UA8 A;  1II5 A;  1UIU A;  4ZE9 A;  2R8T A;  3GXA A;  2ZNS A;  4OFL A;  5HPQ A;  2LAO A;  2F7C A;  5EYH A;  3E13 X;  4PBH A;  3N5L A;  2PT2 A;  3OEN A;  2OLB A;  4JVI A;  5JEI A;  3MC2 A;  4DXU A;  5A5X A;  4P8B A;  4RK9 A;  5TPA A;  1IIT A;  4PFT A;  1URG A;  1LST A;  3CFX A;  3RQT A;  4GL0 A;  2ONR A;  3MZ1 A;  2Y7W A;  3RLF E;  2AYS A;  3MVX A;  4NF5 A;  4L17 A;  4THI A;  4TOZ A;  2XXP A;  1NV4 A;  1FQC A;  4GVO A;  3TCG A;  3KSX A;  3OEL A;  4WED A;  2VPN A;  4OFO A;  3VLW A;  2QS4 A;  1N84 A;  2V84 A;  3M3L A;  1RYX A;  2ANJ A;  4JBZ A;  4NMY A;  4XF5 A;  1LBY A;  1SDX A;  2XWI A;  3T0J A;  1HSE A;  3T1B A;  4ZS9 A;  1SBP A;  3B50 A;  4LAT A;  3PGF A;  1NV2 A;  4XXU A;  2I49 A;  2I3W A;  2Z22 A;  3CI8 A;  4C1U A;  1JNF A;  2D21 A;  4G61 A;  4N13 A;  4GBV A;  4O3B A;  2Y5L A;  3KOS A;  1FBC A;  1ATG A;  5CRY A;  1LAG E;  1YXI A;  1FTJ A;  5I2K B;  3S9L C;  4FE8 A;  1FPK A;  1YTV A;  1D4N A;  3K6U A;  3MYU A;  1SYI A;  3KFM A;  3KG2 A;  3ZSF A;  1KWH A;  1FQB A;  2H25 A;  3B6T A;  1I6A A;  1NFT A;  2A5T B;  3ISP A;  5DT6 A;  4JB7 A;  3IB2 A;  4P11 A;  4E0W A;  4QFL A;  2PBW A;  2I0B A;  4C1T A;  4GIZ A;  1XT8 A;  4P1L A;  3FAS A;  3KGC A;  3OMB A;  4F1U A;  1SW1 A;  3K1P A;  1YAE A;  3HST A;  1GGG A;  2IA4 A;  4E0X A;  1ANF A;  3FGS A;  1UTH B;  1EZP A;  1MY0 A;  4R2B A;  2Y7P A;  1N76 A;  1BTJ A;  3MAM A;  5CMK A;  4G68 A;  1VDW A;  1EYI A;  4H65 A;  1JVX A;  1UIV A;  4LVQ A;  4HW8 A;  3FXQ A;  4G77 A;  3OXN A;  1Q1K A;  1JP4 A;  3IJX B;  5CBS A;  1QGX A;  2YLN A;  1HSJ A;  3IOV A;  1M5D A;  1FBF A;  3QXM A;  1URD A;  3JYR A;  4OYV A;  3JZJ A;  5KCJ A;  1N04 A;  3HHG A;  5M2V A;  1NV3 A;  3ZKK A;  2FVZ A;  5F7V A;  3SEY A;  1B05 A;  1JQF A;  2UVH A;  3KBR A;  4H67 A;  2PX1 A;  2VD3 A;  4F3B A;  4EUO A;  3D1R A;  4X9T A;  3IO6 A;  1TT1 A;  5I3S A;  5CBR A;  1PB7 A;  1RYO A;  5B7D A;  5H8Q B;  2Q8M A;  1NH8 A;  3PU5 A;  2O1L A;  1EH3 A;  2V3T A;  3QAX A;  3JV9 A;  4NF6 B;  4ELQ A;  2G93 A;  4OEU A;  5I56 B;  2XWV A;  1LB8 A;  4YU0 A;  4Q8R A;  3ILU B;  2DP8 A;  1LEV A;  4FJP A;  3VFJ A;  3LBS A;  3SER A;  4QSE A;  5J1D A;  2WBD A;  3K6W A;  1WDN A;  1BKA A;  1FQE A;  2ESN A;  4U1O A;  5BWJ A;  2F7B A;  3KN8 A;  4H8J A;  5EQA A;  3CSG A;  3B6W A;  4IGR A;  2IEE A;  5AA2 B;  2DYX A;  2WX9 A;  3BBR A;  3RGY A;  3W9V A;  1GVC A;  1N3X A;  4DLD A;  1LLS A;  1FPJ A;  2HHM A;  3H7M A;  2PFZ A;  2UYF A;  1R1N A;  3FXB A;  3VXC A;  5L8D A;  2OCU A;  3BIG A;  2CZL A;  2OX3 A;  5FTH A;  4MIJ A;  3PPP A;  1P99 A;  5BUU A;  3C36 A;  2UYE A;  5ET8 A;  1IXG A;  2REJ A;  3U8Q A;  3O2A A;  3KZG A;  4H45 A;  3KC1 A;  3MZB A;  1YCJ A;  2WBB A;  4GLI A;  2VOZ A;  4YMA A;  5H8N B;  3RN8 A;  2NOO A;  5I7I A;  4FED A;  2WEF A;  4DE8 A;  4ECF A;  1FBH A;  3LC8 A;  4H1X A;  4ELO A;  3A3U A;  3RNN A;  2ONS A;  2XX8 A;  1IIW A;  3PD8 A;  1AMF A;  4NF8 A;  4QBA A;  4KYD A;  4NTL A;  1NUZ A;  2Q74 A;  2X7Q A;  2P2A A;  2XWO A;  5I57 B;  3PMW A;  3VV5 A;  1JEU A;  3IO4 A;  4OEV A;  4GF8 A;  4PET A;  3KSJ A;  4Z7E A;  4F31 B;  1FQA A;  3FV1 A;  4H8I A;  4PTK A;  2Y84 A;  3K6V A;  2FIE A;  5EQ8 A;  4BLA A;  4LUB A;  3LR1 A;  4NF4 B;  3THI A;  2H9B A;  1D9Q A; 
#chains in the Genus database with same CATH homology
 1FPE A;  1FW0 A;  3PMX A;  5K2Y A;  3V83 A;  1FRP A;  2THI A;  1K9Z A;  2KR0 A;  3E9X A;  3SEU A;  2O69 A;  1NV5 A;  3K6X A;  4BDL A;  3MUQ A;  1JEV A;  4JXI A;  1KA1 A;  5FTI A;  1P1Q A;  3E3K A;  4JWX A;  1ELJ A;  4BDN A;  1YZ0 A;  1VE4 A;  1N7X A;  1RDZ A;  2DE3 A;  2E0S A;  4PQJ A;  4ONY A;  3O6G A;  1B0L A;  3VXB A;  1EYJ A;  3MVZ A;  4PC9 A;  1QUI A;  5ITO A;  4LN5 A;  2HAV A;  5ET7 A;  1B46 A;  1LAX A;  3DP8 A;  3LSX A;  3RPL A;  2WYP A;  3H6W A;  2XXW A;  1I6B A;  5I58 A;  5IZ3 A;  5CMC A;  3U65 A;  2CEY A;  5A5X B;  3BFU A;  2HAU A;  4LZ5 A;  3EHS A;  2H4I A;  3G7W A;  2AL5 A;  2OJT A;  4KPT A;  3G3K A;  3CVG A;  3PUZ E;  2QVV A;  2RC9 A;  2I6E A;  1NNT A;  2L5V A;  3QK6 A;  1MQH A;  2CZI A;  2I48 A;  3U1O A;  3HN0 A;  4RNS A;  3V5A A;  2QSX A;  4R6Y A;  4RXL A;  3C9H A;  1Y9U A;  3H06 B;  4QF9 A;  2F6G A;  3H03 A;  1US5 A;  2I4B A;  2NXO A;  4MNI A;  4Q5T A;  1B4Z A;  2M8C A;  2Q2C A;  3IOR A;  4F2Q A;  4C0R A;  1A8F A;  1N7W A;  2UXA A;  3ONM A;  1MY1 A;  3HCQ A;  2I0C A;  4HCY A;  1VFE A;  3OSQ A;  2F97 A;  4GWU A;  4PAI A;  4NG7 A;  1FPD A;  3H6T A;  5ISU A;  3R7X A;  4JWO A;  4HE0 A;  4ZEB A;  3O29 A;  1B7U A;  5H8H A;  1SD3 A;  3EHT A;  1Y3Q A;  3SEV A;  1SI0 A;  5DVJ A;  5I59 A;  2F78 A;  1KZ8 A;  3Q26 A;  4OVS A;  4N07 A;  3TTR A;  3RY3 A;  4F3S A;  1ZU0 A;  4R9F A;  1MXY A;  4OXV A;  1FBG A;  3CIJ A;  4MMP A;  4ELP A;  4OVQ A;  2PFY A;  2QJE A;  3KEI A;  2Q2A A;  3FVK A;  3W9W A;  4PDD A;  1ZIU A;  1Y1Z A;  5CI5 A;  2HXW A;  1AOV A;  2B3F A;  1FTK A;  1YYZ A;  1LAH E;  4QFO A;  3PPN A;  4KXP A;  2Z8F A;  2PCR A;  3OD7 A;  2B3B A;  4GD5 A;  1Y1M A;  4G4P A;  1OQH A;  3SEW A;  4QFP A;  2V4C A;  1B3F A;  4R73 A;  3TEP A;  1MH4 A;  3O6H A;  4KCD A;  4PAF A;  2Z8E A;  1LFG A;  1K9Y A;  2XXT A;  1G0H A;  1FTM A;  2H98 A;  4H6D A;  4BDQ A;  1D9Y A;  3SEX A;  2Y7I A;  2P3V A;  4KYS A;  2GRV A;  1PC3 A;  1USY E;  4F19 A;  1FQD A;  1QJM A;  4AB5 A;  5KZT A;  3LSL A;  4N81 A;  3S9M C;  2DVZ A;  3O97 A;  4P1E A;  1B3G A;  4MNP A;  2D3I A;  3H4Z A;  4FBP A;  4FOR A;  4U1Z A;  1N3W A;  2QS2 A;  3BIH A;  1VFD A;  3UN6 A;  3W15 C;  3U72 A;  1D3K A;  1JW5 A;  5AE4 A;  2PMS A;  4GWO A;  2O51 A;  4KCC A;  1IXC A;  5DYH A;  2XXX A;  3T22 A;  2Q9T A;  1KA0 A;  4YAH X;  5KDT A;  2FBP A;  2XXY A;  3G3H A;  3KC0 A;  4F39 A;  2HXR A;  4YKP A;  2ZZW A;  4ZED A;  4R74 A;  2ZYN A;  4BDO A;  3PPQ A;  1OIB A;  2OWS A;  3OSR A;  2OZZ A;  1MM7 A;  4UAC A;  3EKI A;  3IOU A;  2RCA A;  3CFZ A;  3EN3 A;  5DVI A;  4RPO A;  1DBZ A;  1QVS A;  5AA2 D;  4OHN A;  1SYH A;  4O8M A;  1INP A;  1BLF A;  2Y5K A;  4LQ2 A;  3K00 A;  4MFI A;  2F7A A;  1BP5 A;  1MDQ A;  4X04 A;  2REG A;  2XXU A;  1UTB A;  1H76 A;  2RF1 A;  5I2N A;  1MQI A;  3E79 A;  4U4S A;  3G3J A;  1IMD A;  3U94 A;  3PD9 A;  5HBC A;  1MRP A;  3IAZ A;  1DTZ A;  1IMF A;  1MQG A;  1CNQ A;  3RT6 B;  4EXK A;  2DWJ A;  4PFR A;  4OEN A;  4NF8 B;  3FJG A;  4IGT A;  3VLU A;  3G3I A;  3TTL A;  3N26 A;  4PFB A;  3FIR A;  3T9U A;  4FAJ A;  3T9X B;  2XWK A;  1WVJ A;  1B1H A;  4H46 A;  1MPB A;  5H8F A;  4O94 A;  1NUY A;  1LFH A;  2F6P A;  4QSC A;  1FSA A;  3TUS A;  2RKM A;  1A8E A;  4GXA A;  5IGA A;  3PTY A;  1ZJL A;  1NUW A;  4EF2 A;  3GBA A;  4R2F A;  4MJO A;  1FPG A;  4LQ5 A;  1XOC A;  2DSF A;  3SES A;  1QW0 A;  5EHS A;  1B0H A;  3CG1 A;  4ZZA A;  5TU0 A;  2CMO A;  4OVP A;  1ZKB A;  1JW4 A;  3F11 A;  4QFK A;  4IY5 A;  1Y20 A;  2PT1 A;  3BFT A;  4JWY A;  5TP9 A;  4F18 A;  1BIY A;  1UQW A;  3H6U A;  1VSO A;  1CE2 A;  1ZTY A;  2UVI A;  3FVG A;  3IJO B;  4I3Y A;  4DDD A;  4JDF A;  1SI1 A;  2O1M A;  4F29 A;  3TTM A;  4GOT A;  3IL1 B;  4U21 A;  2I58 A;  4U2R A;  1MXZ A;  1J1N A;  2V25 A;  4JVC A;  4HE1 A;  4I40 A;  2GFE A;  4PDH A;  1B58 A;  2FIX A;  4NED A;  1NUX A;  4OES A;  4P47 A;  1B32 A;  1MG1 A;  1SW5 A;  2R71 A;  4TLL B;  1MY2 A;  4PFY A;  4KR5 A;  4OER A;  2DWI A;  2W7Y A;  4QXD A;  2FNC A;  3IOW A;  5LOM A;  1FTA A;  3VE1 B;  3L6H A;  4WEP A;  4MH5 A;  4DCX A;  4NN3 A;  3M3F A;  4P0G A;  5AA4 B;  5EYF A;  4RA1 A;  1B52 A;  5ITP A;  2YJP A;  2E1S A;  4N6K A;  3TCH A;  1DOT A;  3LSF B;  3I6V A;  1ZLQ A;  1FPI A;  2DXR A;  4FIM A;  1MQD A;  3ODB A;  2B4M A;  4X8R A;  4QRZ A;  1XC1 A;  4XKR A;  4G8N A;  3D4C A;  5LTC A;  1XVY A;  3V8X B;  3OEK A;  5AA3 A;  3N6U A;  1FPL A;  4H5G A;  4LZ8 A;  1MY3 A;  1URS A;  3DP6 A;  4QHQ A;  3PPR A;  1RDX A;  1H3D A;  2DE4 A;  4ELR A;  4JSD A;  3A09 A;  4LZ7 A;  3PMV A;  4O3A A;  5I2K A;  5IM2 A;  4I8C A;  1ZMG A;  2I3V A;  3QIM A;  1LBX A;  2HCA A;  4BDR A;  4JSO A;  1R9Q A;  2Y7R A;  1T0K A;  4GWZ A;  2HFB A;  2F8D A;  1MPC A;  3GYY A;  4G68 C;  2JJK A;  1I6Q A;  3WAE A;  3C34 A;  3E4R A;  2A5T A;  1NV1 A;  3C32 A;  3LSW A;  3LV0 A;  1Q35 A;  3M3K A;  1SPI A;  1NMU A;  4MNC A;  3TOD A;  2XXQ A;  2UVJ A;  5L9O A;  4RJZ A;  4EDP A;  4G2Z A;  4F3P A;  3UOR A;  4MEV A;  1GTK A;  3I5O A;  3VLV A;  3VVE A;  1UTH A;  4ND9 A;  4X48 A;  1Z7N E;  2BJJ X;  3T9V A;  2ZYK A;  4QSD A;  3FD3 A;  1M5C A;  4GBW A;  5JTY B;  4KHZ E;  4PF8 A;  2ZMB A;  3GBB A;  4TQU Q;  3K2D A;  1NL5 A;  2A5S A;  3G3F A;  4YB7 A;  1A7L A;  4PP0 A;  5L9M A;  4OET A;  4HXV A;  1Y3P A;  5I84 A;  3IK6 B;  1B6H A;  4POW A;  2XX7 A;  1JW1 A;  4XKP A;  1QUK A;  1SW4 A;  5ELV A;  2B65 A;  4H5F A;  1FPB A;  3OO7 A;  1F9B A;  1XHY A;  1MM6 A;  3RTW B;  1MPD A;  3Q28 A;  3KJ7 A;  5TPA B;  1DSN A;  4N6D A;  1IME A;  1PBP A;  2RC7 A;  1MS7 A;  2F3D A;  3OOA A;  1B5J A;  3USD A;  3FVO A;  2ZXT A;  5H8Q A;  3O66 A;  2GHA A;  4NF5 B;  2XX9 A;  2HQ0 A;  3TEL A;  2FA7 A;  3QSL A;  2Z8D A;  4DIG A;  2XXI A;  4BDM A;  3K1M A;  5I56 A;  3D4G A;  1S50 A;  1JVY A;  2QFL A;  2DVC A;  4R72 A;  4MCO A;  2CZK A;  4FEB A;  4X1B A;  2F5X A;  4ESW A;  3SET A;  5AA2 A;  4K3F A;  3HPI A;  5CMB A;  4FAT A;  3VVD A;  1DPP A;  3TYH A;  4QFN A;  3E78 A;  4NAP A;  2ZNT A;  1VR5 A;  3FVN A;  4OZ9 A;  3MZ9 A;  3IX1 A;  5DW8 A;  3MVW A;  5ET6 A;  4PFI A;  1PB9 A;  4NWC A;  4N17 A;  1HSL A;  1AIV A;  2OWZ A;  1B3L A;  1MXW A;  3B8B A;  3ILT B;  1P1W A;  2QPQ A;  3QMF A;  3RTF B;  2ZNU A;  1BK4 A;  2KQZ A;  2VD2 A;  3N6T A;  3Q25 A;  2VGQ A;  3TCF A;  4LON B;  5AA1 A;  5EYG A;  3RPW A;  4OMB A;  4U22 A;  3CSB A;  3LUY A;  4PGN A;  5ET5 A;  3K0V A;  1B9J A;  5DVF A;  4OVT A;  2QMW A;  4H0W A;  2H5Y A;  2ZZV A;  1SW2 A;  3FUZ A;  2O7U A;  4M4G A;  2DDK A;  3IB0 A;  1YPN A;  4PF6 A;  1H43 A;  5I57 A;  3IB1 A;  1FJ9 A;  1DPE A;  3KOT A;  2R9J A;  4IO4 A;  5DEX A;  4OTE A;  1R6Z A;  3CRB A;  1IXH A;  3IR1 A;  2QRY A;  2G29 A;  1DCU A;  4PFW A;  2XXH A;  1TWY A;  3B7D A;  4G68 B;  4OQO A;  5CMM A;  1MH3 A;  4NF4 A;  3EPE A;  5K2X A;  4YB5 A;  4HCW A;  2ZZX A;  3U92 A;  4KYE A;  4G8M A;  4U4X A;  4Q30 B;  3FJ7 A;  4IY6 A;  1FTO A;  2D5W A;  2X26 A;  4GXS B;  3HHF A;  1O7T A;  5KCJ B;  2P0S A;  1OVB A;  3LUZ A;  3BKI B;  3S9N C;  4I3E A;  4UAB A;  3WAF A;  2RCB A;  2CZH A;  5B70 A;  2VT5 A;  1DK4 A;  1O63 A;  3C33 A;  1OMP A;  1OQG A;  4YKI A;  1B5I A;  1EZ9 A;  3FJM A;  3GLB A;  5F24 A;  4I62 A;  2CEX A;  5FHN A;  3T66 A;  3NOH A;  1I69 A;  4MHF A;  1SVX B;  4YKK A;  4N4U A;  3MBP A;  3OEM A;  1A99 A;  4O7M A;  4PE3 A;  1WOD A;  3U93 A;  3DP4 A;  4M1V A;  1JET A;  4MX6 A;  1OLC A;  1FBD A;  4LA9 A;  4MLV A;  2B4L A;  1SQY A;  1B1X A;  3TQL A;  2XHD A;  3HFU A;  1L5T A;  4IB2 A;  1IUD A;  1Y3N A;  2HZL A;  2GHB A;  1FBE A;  4XKN A;  2FYI A;  4G8H A;  4X1D A;  3UIF A;  2OK2 A;  4GQO A;  3TDJ A;  1MXX A;  1B7Z A;  4GWX A;  4PAK A;  4F2O A;  4IO6 A;  1LCF A;  3QUF A;  1QUJ A;  1H45 A;  1TXF A;  2KLF A;  4XTC Q;  2O68 A;  2QMX A;  4NF0 A;  3RYD A;  5JK4 A;  1S9T A;  2ALU A;  1QKA A;  1MDP 1;  1P1N A;  4AB6 A;  2F34 A;  2PVU A;  1DTG A;  1GR2 A;  1EU8 A;  4FEC A;  4NWD A;  3B6Q A;  4YKJ A;  1MQJ A;  3UA8 A;  4YB6 A;  3O9P A;  2HPG A;  4KFQ A;  3UP9 A;  2ABH A;  1B7H A;  3P7I A;  1GV8 A;  2Q8J A;  2V3Q A;  4P56 A;  2PYY A;  2ONK E;  3ZKL A;  3L6G A;  5CC2 A;  4NX1 A;  2ZYM A;  3PUW E;  2H99 A;  4OVJ A;  5T3J A;  4NHB A;  2R6G E;  1MXV A;  4OFJ A;  3TPA A;  3V89 B;  1B51 A;  1LB9 A;  1IMC A;  1FQF A;  4F22 A;  3OO8 A;  4I9D A;  4OVR A;  1AL3 A;  4R75 A;  4AS4 A;  4O7I A;  5IZ1 A;  3OO6 A;  4IO7 A;  3ECR A;  4ZEK A;  4DZ1 A;  4XFE A;  3Q27 A;  1N0T A;  2DWA A;  3RUM A;  4AQ4 A;  4IO2 A;  2FHY A;  3O6I A;  5F1Q A;  3FBP A;  4XEQ A;  3T96 B;  1RDY A;  1B4H A;  1QUL A;  4RK2 A;  4DXB A;  4EQ7 A;  3OO9 A;  3VDF A;  1S7Y A;  3O28 A;  3MST A;  5A5L A;  1PBQ A;  3A3C A;  3SKP A;  1NNK A;  2DOJ A;  2UVG A;  2XD2 A;  3TZA A;  4EXL A;  4N8G A;  3FAT A;  4P0I A;  1A54 A;  3RPL B;  1LCT A;  4DXC A;  3UK4 A;  1AH5 A;  3ZS6 A;  5I58 B;  1G0I A;  5IZ3 B;  1OLA A;  2F3B A;  1RKM A;  4POX A;  5L9S A;  1A55 A;  2XXK A;  1R9L A;  4EQ9 A;  4DI4 B;  5EQ7 A;  1OVT A;  2VPO A;  1LBB A;  2Q89 A;  1LBZ A;  3UGW A;  3SZP A;  1B5H A;  4U23 A;  3IFC A;  1XI6 A;  2BJI A;  4RY1 A;  3CR9 A;  2NUV A;  2P1S A;  4ISU A;  1IMA A;  4R6H A;  3KN7 A;  3TQW A;  3DEL B;  2ZYO A;  3ROJ A;  4N6P A;  4WKM A;  1FPF A;  1TFD A;  1H44 A;  3G3G A;  1LBC A;  1Z7M E;  2GH9 A;  4PE5 B;  4PBQ A;  2YPN A;  5IZZ A;  4GX6 A;  4Z0I A;  5IKB A;  3PV0 E;  2DS9 A;  4N91 A;  1NV6 A;  3FZV A;  4AS5 A;  3MWB A;  1NNP A;  2O6A A;  2O84 X;  1FBP A;  2OWT A;  5I5P A;  2Y7K A;  3TTN A;  2O7I A;  5H8H B;  3PUY E;  4I1D A;  1MXU A;  5I59 B;  2F36 A;  2AL4 A;  3C35 A;  1O64 A;  4IO5 A;  3S4U A;  4GX4 A;  4N8Y A;  1LGB C;  4F1V A;  4ZZE A;  4XKQ A;  1EYK A;  5FHM A;  1LBW A;  1B3E A;  5DEX B;  1IMB A;  4GFR A;  3Q29 A;  4R9G A;  1NH7 A;  3KJT A;  4R6K A;  2QS1 A;  5IAI A;  5DTB A;  1NI9 A;  3C31 A;  4WXJ A;  4HTG A;  1M5F A;  4OWD A;  4MAG A;  4ZEC A;  3H3G A;  3S2V A;  4PGP A;  5CM6 A;  3M8U A;  3H6V A;  4KI0 E;  5LDZ A;  3VVF A;  4O3C A;  1B2H A;  1IZ1 A;  1FTL A;  4P9K A;  2NVU B;  2Z23 A;  1B40 A;  3CFL A;  3TKD A;  2VHA A;  3MJN A;  5FHO A;  5J16 A;  5ICQ A;  2X7P A;  1Y4T A;  3MP6 A;  4N15 A;  2AIX A;  4LP2 B;  4GWW A;  5FBP A;  1Q9D A;  2QL3 A;  2V93 A;  3TAJ A;  4NGU A;  1FCK A;  3K1N A;  4NE4 A;  3MP8 A;  1EZO A;  1NKX A;  3EF7 A;  3SDF A;  3FXU A;  1XS5 A;  4IO3 A;  3C4M A;  3DLN A;  3PUX E;  3R6U A;  3PPO A;  5KDT B;  4P3L A;  4EQB A;  1TFA A;  4DCY A;  1P1U A;  5ICT A;  1IEJ A;  2I4C A;  1NV0 A;  4NF6 A;  4ZDM A;  2DXY A;  2XD3 A;  1USY H;  4YIC A;  4GWS A;  4F3G A;  4RYA A;  4ZE8 A;  2V3U A;  3RT8 A;  3K01 A;  1PB8 A;  4PFU A;  2RC8 A;  1A40 A;  1POT A;  4GL8 A;  2QVU A;  1NV7 A;  4MBP A;  2WYK A;  3MW0 A;  2GQ1 A;  3EQ1 A;  4GX3 A;  3TTK A;  3MVY A;  2OBG A;  3T9H B;  2NWJ A;  3MQ9 A;  2DQV A;  1M5E A;  5AA4 A;  4Q0C A;  1IXI A;  3MPK A;  4OA4 A;  3MPL A;  4YZZ A;  2DE2 A;  2HEU A;  3AXF A;  1UTB B;  4HE2 A;  5I2N B;  3HV1 A;  1IQ7 A;  4RPN A;  1PEB A;  4ZEF A;  5HM4 B;  3QYT A;  3T93 B;  3FV2 A;  2MKZ A;  4HS7 A;  1B3H A;  1LAF E;  3KN3 A;  4PCD A;  1P1O A;  3TMG A;  1FJ6 A;  3CHG A;  5H8N A;  3I3V A;  4F1Y A;  2DWH A;  2QS3 A;  2HZK A;  4OAN A;  3KBZ A;  4IR8 A;  3EHU A;  3CG3 A;  4YMB A;  4DI3 D;  4MLQ A;  1MY4 A;  2Q88 A;  2WKY A;  3DM0 A;  4GWY A;  3N94 A;  3FXR A;  4GRK A;  3IOT A;  4ESX A;  2RIN A;  5H8F B;  2F35 A;  3GZG A;  5ESY A;  3MP1 A;  4KD5 A;  1XVX A;  1ZBM A;  2P3N A;  5EHM A;  2VP1 A;  1LFI A;  2XXV A;  3K02 A;  1D9V A;  4NQ8 A;  4TLM B;  1M5B A;  2QVR A;  1CB6 A;  1POY 1;  4ZEI A;  2XXR A;  2XA5 A;  1US4 A;  1PDA A;  1Y4C A;  3HO7 A;  1AWB A;  4EF1 A;  1QKB A;  3QUJ A;  4KQP A;  4MF3 A;  1LBV A;  3PUV E;  4JVD A;  3S9E A;  3K4U A;  5EQ9 A;  3A29 A;  3IFA A;  3R26 A;  4XIG Q;  1DMB A;  1NNF A;  5H8S A;  3TFL A;  5JTY A;  5TP9 B;  4UA8 A;  1II5 A;  1UIU A;  4ZE9 A;  2R8T A;  3GXA A;  2ZNS A;  4OFL A;  5HPQ A;  2LAO A;  2F7C A;  5EYH A;  3E13 X;  4PBH A;  3N5L A;  2PT2 A;  3OEN A;  2OLB A;  4JVI A;  5JEI A;  3MC2 A;  4DXU A;  5A5X A;  4P8B A;  4RK9 A;  5TPA A;  1IIT A;  4PFT A;  1URG A;  1LST A;  3CFX A;  3RQT A;  4GL0 A;  2ONR A;  3MZ1 A;  2Y7W A;  3RLF E;  2AYS A;  3MVX A;  4NF5 A;  4L17 A;  4THI A;  4TOZ A;  2XXP A;  1NV4 A;  1FQC A;  4GVO A;  3TCG A;  3KSX A;  3OEL A;  4WED A;  2VPN A;  4OFO A;  3VLW A;  2QS4 A;  1N84 A;  2V84 A;  3M3L A;  1RYX A;  2ANJ A;  4JBZ A;  4NMY A;  4XF5 A;  1LBY A;  1SDX A;  2XWI A;  3T0J A;  1HSE A;  3T1B A;  4ZS9 A;  1SBP A;  3B50 A;  4LAT A;  3PGF A;  1NV2 A;  4XXU A;  2I49 A;  2I3W A;  2Z22 A;  3CI8 A;  4C1U A;  1JNF A;  2D21 A;  4N13 A;  4G61 A;  4GBV A;  4O3B A;  2Y5L A;  3KOS A;  1FBC A;  1ATG A;  5CRY A;  1LAG E;  1YXI A;  1FTJ A;  5I2K B;  3S9L C;  4FE8 A;  1YTV A;  1FPK A;  1D4N A;  3K6U A;  3MYU A;  1SYI A;  3KFM A;  3KG2 A;  3ZSF A;  1KWH A;  1FQB A;  2H25 A;  3B6T A;  1I6A A;  1NFT A;  2A5T B;  5DT6 A;  3ISP A;  4JB7 A;  3IB2 A;  4P11 A;  4E0W A;  4QFL A;  2PBW A;  2I0B A;  4C1T A;  4GIZ A;  1XT8 A;  4P1L A;  3FAS A;  3KGC A;  3OMB A;  4F1U A;  1SW1 A;  3K1P A;  1YAE A;  3HST A;  1GGG A;  2IA4 A;  4E0X A;  1ANF A;  3FGS A;  1UTH B;  1EZP A;  1MY0 A;  4R2B A;  2Y7P A;  1N76 A;  1BTJ A;  3MAM A;  5CMK A;  4G68 A;  1VDW A;  1EYI A;  4H65 A;  1JVX A;  1UIV A;  4LVQ A;  4HW8 A;  3FXQ A;  4G77 A;  3OXN A;  1Q1K A;  1JP4 A;  3IJX B;  5CBS A;  1QGX A;  2YLN A;  1HSJ A;  3IOV A;  1M5D A;  1FBF A;  3QXM A;  1URD A;  3JYR A;  4OYV A;  3JZJ A;  5KCJ A;  1N04 A;  3HHG A;  5M2V A;  1NV3 A;  3ZKK A;  2FVZ A;  5F7V A;  3SEY A;  1B05 A;  1JQF A;  2UVH A;  3KBR A;  4H67 A;  2PX1 A;  2VD3 A;  4F3B A;  4EUO A;  3D1R A;  4X9T A;  3IO6 A;  1TT1 A;  5CBR A;  5I3S A;  1PB7 A;  1RYO A;  5B7D A;  5H8Q B;  2Q8M A;  1NH8 A;  3PU5 A;  2O1L A;  1EH3 A;  2V3T A;  3QAX A;  3JV9 A;  4NF6 B;  4ELQ A;  2G93 A;  4OEU A;  5I56 B;  2XWV A;  1LB8 A;  4YU0 A;  4Q8R A;  3ILU B;  2DP8 A;  4FJP A;  1LEV A;  3VFJ A;  3LBS A;  3SER A;  4QSE A;  5J1D A;  2WBD A;  3K6W A;  1WDN A;  1BKA A;  1FQE A;  2ESN A;  4U1O A;  5BWJ A;  2F7B A;  3KN8 A;  4H8J A;  5EQA A;  3CSG A;  3B6W A;  4IGR A;  2IEE A;  5AA2 B;  2DYX A;  2WX9 A;  3BBR A;  3RGY A;  3W9V A;  1GVC A;  1N3X A;  4DLD A;  1LLS A;  1FPJ A;  2HHM A;  3H7M A;  2UYF A;  2PFZ A;  1R1N A;  3FXB A;  3VXC A;  5L8D A;  2OCU A;  3BIG A;  2CZL A;  2OX3 A;  5FTH A;  4MIJ A;  3PPP A;  1P99 A;  5BUU A;  3C36 A;  2UYE A;  5ET8 A;  1IXG A;  2REJ A;  3U8Q A;  3O2A A;  3KZG A;  4H45 A;  3KC1 A;  3MZB A;  1YCJ A;  2WBB A;  4GLI A;  2VOZ A;  4YMA A;  5H8N B;  3RN8 A;  2NOO A;  5I7I A;  4FED A;  2WEF A;  4DE8 A;  4ECF A;  1FBH A;  3LC8 A;  4H1X A;  4ELO A;  3A3U A;  3RNN A;  2ONS A;  2XX8 A;  1IIW A;  3PD8 A;  1AMF A;  4NF8 A;  4QBA A;  4KYD A;  4NTL A;  1NUZ A;  2Q74 A;  2X7Q A;  2P2A A;  5I57 B;  2XWO A;  3PMW A;  3VV5 A;  1JEU A;  3IO4 A;  4OEV A;  4GF8 A;  4PET A;  3KSJ A;  4Z7E A;  4F31 B;  1FQA A;  3FV1 A;  4H8I A;  4PTK A;  2Y84 A;  3K6V A;  4BLA A;  2FIE A;  5EQ8 A;  4LUB A;  3LR1 A;  4NF4 B;  3THI A;  2H9B A;  1D9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...