5TU0A

1.9 angstrom resolution crystal structure of maltose-binding periplasmic protein male from listeria monocytogenes in complex with maltose
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
385
structure length
385
Chain Sequence
SDEKTLTVSVDAGYKDYVNKIKGDFEKDNDVKVKVVEKDMFETLEALPLDGPAGTAPDVMMSAFDRIGSLGQQGHLAEVKLGNKDDYDEKDQKQVTIDDKIYGAPAIIETLVLYYNKDLLDKAPATFKDLETLSKDSRFAFTSEKGKNTGFLAKWTDFYFSYGLLAGYGGYVFGDEGTNPKDIGLNNKGSVEGITYATKWFQDVWPKGMQDNKSADDFIQDQFVKGKAAAILGGPWSAANYKEAKINYGVAKIPTLNNGKEYSPFAGGKGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMTNEVPANLKARDTAKSKNDELTNAVIEQYKNAQPMPNIPEMSEVWTGAENLKFDAASGSKTPQPSADDAVKVIEDNVTQKYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9 Angstrom Resolution Crystal Structure of Maltose-Binding Periplasmic Protein MalE from Listeria monocytogenes in Complex with Maltose.
rcsb
source organism Listeria monocytogenes serovar 1/2a
molecule tags Transport protein
molecule keywords Lmo2125 protein
total genus 142
structure length 385
sequence length 385
ec nomenclature
pdb deposition date 2016-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5tu0A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5tu0A02
4RXLA 1TFAA 4LONB 4R9GA 1Y3NA 3EN3A 2REJA 3GLBA 3ODBA 1LCFA 2HZKA 1ZU0A 1JETA 3FV1A 4Q0CA 1PB7A 2XX9A 4U23A 3PD9A 5I84A 2XXPA 5AA2D 3IB1A 3RTWB 1XVYA 2RKMA 4EF2A 3GZGA 3C9HA 4OTEA 3C32A 4G68B 1ZMGA 4F3SA 2F34A 3LBSA 3Q28A 1D3KA 4NF8B 3O29A 2DYXA 4Z0IA 1MQGA 1WDNA 1GGGA 1JW5A 4OYVA 5DYHA 1P1QA 4EDPA 1MXVA 1Y4TA 1Z7ME 4I8CA 4I1DA 2OCUA 3TPAA 2D21A 1MS7A 2I0BA 3CG1A 3PUXE 4ISUA 1FTOA 4LA9A 2NXOA 4QFLA 1SQYA 2ZYKA 3EQ1A 4FAJA 5I58A 1PDAA 4PFYA 1DPPA 3W15C 1URGA 5A5XB 2Q2CA 1M5BA 5FHNA 3QXMA 1B3FA 3TELA 4NF5A 1VFEA 4GL8A 4C0RA 5KDTB 5B70A 1O7TA 2HFBA 2UXAA 3G3IA 4YKKA 3ZKKA 1QKAA 3E3KA 1SW2A 5KCJA 3FJ7A 5K2XA 1MH3A 2OBGA 4MBPA 3IK6B 1N0TA 2UVGA 3GBAA 3H6VA 3MVYA 4EXLA 1AMFA 1BIYA 3TQWA 2ZYOA 2IEEA 3VLUA 2PMSA 4ESXA 1MPBA 2ZYMA 3EHSA 4KCCA 2P1SA 3KG2A 2O68A 4NF4B 3SEVA 2DWIA 3IO6A 4C1TA 4ECFA 3C34A 3TEPA 2DOJA 1NH8A 1Q1KA 1DTGA 1NFTA 1OLAA 2QS4A 3M3KA 3FXQA 3OENA 4QHQA 5J1DA 3A3UA 4JXIA 4F1UA 4H6DA 3IOUA 3KZGA 1XT8A 2A5SA 2V3TA 4N6PA 1CE2A 1LAXA 4H8IA 3PMVA 2VHAA 1YCJA 2O84X 2XXHA 2OWSA 2OZZA 3FVKA 4UA8A 3KBRA 1EZPA 2DVCA 3S9NC 1AL3A 4IY6A 3V5AA 3RPWA 1XVXA 4EQ9A 3N26A 4THIA 1B2HA 3JZJA 1PBPA 4GIZA 4ND9A 3QUJA 3R6UA 4H1XA 4NF6B 3KN8A 1B5JA 4ELPA 1IITA 2B65A 1MQJA 4OESA 4QF9A 5AA2A 1H43A 1FW0A 1IXHA 3M3FA 1JEUA 5CM6A 2XXUA 5AA4A 1IZ1A 1FTJA 2ZNTA 3IB2A 4RY1A 3ZS6A 4MFIA 1OVBA 3DELB 4XXUA 4U22A 5H8FA 4OFJA 3TZAA 3VVDA 3E4RA 4H5GA 4IY5A 4QFKA 3PUYE 2VP1A 3MZBA 3THIA 4YMBA 4ZE9A 1MM6A 4GLIA 4RNSA 2G29A 2O1LA 5TPAA 3HSTA 5TU0A 3EHUA 5CBRA 2RCAA 2VGQA 3KSXA 3Q25A 4RK2A 3QIMA 5FTIA 4NE4A 3PPPA 3K01A 2V3UA 2Z8FA 3I6VA 4QSCA 3RTFB 4R2BA 5I56B 1P1NA 4U4XA 4F2OA 3R26A 1JW4A 3KFMA 5ITPA 3KJTA 2WKYA 4FEBA 4QSEA 2I4BA 4QSDA 3T9VA 5CMKA 3FJGA 4DCYA 5I57B 5DEXB 4YB7A 3VDFA 1B7HA 3H6TA 2ZYNA 3RLFE 3CRBA 4IO6A 4RJZA 1UIUA 2I48A 1NNKA 1ANFA 2F6PA 2QPQA 4MH5A 3U93A 4JSOA 3VVFA 1B51A 1JQFA 1LFGA 1POTA 3HHFA 2GH9A 4GFRA 4M4GA 2XX7A 1N3WA 4H0WA 3VLWA 2Q9TA 2XXVA 1OIBA 3G3GA 3RQTA 1NL5A 3U92A 1PB8A 2B3BA 4ELQA 1VSOA 2ABHA 3BFTA 4ZS9A 1SW4A 2Q8JA 5CBSA 1OMPA 1MDQA 3FXRA 3B6TA 4K3FA 2F7BA 3TKDA 2DXRA 2XXTA 4LZ8A 4Q5TA 5LOMA 4YZZA 1B9JA 2HCAA 2QJEA 1B32A 3UGWA 2VOZA 2I0CA 3RN8A 4FATA 3O2AA 3W9WA 4U1ZA 4WEDA 5HBCA 4Z7EA 1GR2A 5I2KA 2XXYA 1Y4CA 4GL0A 3L6HA 3PU5A 5F7VA 4TLMB 1LBCA 4H5FA 4LZ7A 4ONYA 4MLVA 1N84A 3CI8A 1MXZA 1FQEA 3E9XA 4LQ2A 3H4ZA 4P11A 1N3XA 4PFUA 2PT1A 3JV9A 4YAHX 4IO2A 3MZ9A 4BDOA 5I57A 1UTBB 1N7XA 5I58B 2DXYA 1I6QA 2ALUA 1A8FA 2AIXA 2DWJA 2NOOA 4EQBA 1AIVA 3K1PA 3O6GA 2Q88A 3IOVA 1LFIA 1FQFA 1MG1A 2Y7KA 3KSJA 5KCJB 3JYRA 5ICQA 3K6WA 1USYE 4RPNA 3O66A 5CMBA 2REGA 3M3LA 1KWHA 1IUDA 3FZVA 3PUZE 1UQWA 4KYSA 3PGFA 3IOWA 1J1NA 4TOZA 2Y7PA 2O69A 2XXXA 1CB6A 3FVNA 3MAMA 3N94A 4MF3A 5EHSA 1QKBA 3QK6A 3ECRA 4HTGA 2QSXA 3SETA 1WODA 3T22A 4PQJA 3K6XA 1MPCA 3HN0A 3Q26A 1R9QA 3OEMA 3TUSA 5IAIA 3SEWA 3WAEA 1IQ7A 3DM0A 2OJTA 4TQUQ 2V25A 3PPOA 4XIGQ 4EF1A 1N04A 5CC2A 4M1VA 3VV5A 1QUIA 2Z23A 3MVZA 3KEIA 1ZIUA 1FQCA 3V8XB 3QYTA 3DP6A 2HZLA 5JTYA 5I59A 4TLLB 1GVCA 2H99A 2PVUA 3FVOA 1O64A 1EZ9A 1URSA 3DP8A 3IJXB 3FV2A 3T96B 3UP9A 4N07A 4F3GA 2AL5A 1B1XA 4EQ7A 3OO6A 2QS3A 2ZNUA 5AA2B 3FVGA 1SYHA 3P7IA 4QFNA 1QULA 2DS9A 1N76A 3TTKA 4F3BA 1JEVA 4F18A 1B5IA 1D4NA 2AL4A 3RT8A 3K1NA 2QMWA 2VD3A 3O97A 1ZTYA 1LFHA 2DQVA 2XD2A 4LQ5A 5EYFA 2Q2AA 2HXWA 3HPIA 4AQ4A 1SD3A 1JNFA 4JSDA 2XXRA 4NF4A 2PX1A 4IO7A 1R6ZA 3K0VA 3MZ1A 2DE2A 5TPAB 3FJMA 4G8MA 4F22A 3PMWA 1A40A 2ANJA 3MPLA 2OK2A 1OLCA 3MPKA 2NVUB 2O7UA 1T0KA 1DMBA 4DDDA 2E0SA 3D4CA 2F7CA 3OELA 1ZLQA 4LP2B 1L5TA 1LAFE 4HCWA 3OSRA 1OVTA 4OFLA 1B3EA 5ITOA 4DXBA 3OEKA 2Q89A 1FQDA 3A09A 5JTYB 4F29A 2A5TB 5A5XA 1NH7A 3TTNA 3KN3A 4R72A 3RGYA 4BLAA 5I2NA 2R6GE 3MQ9A 3MUQA 4NF6A 2UVIA 3O9PA 1NNFA 3LC8A 4ZEIA 4XTCQ 4H8JA 1NMUA 1TWYA 3G3JA 3MWBA 3ZSFA 1OQGA 4BDQA 2LAOA 4KYDA 1PB9A 4XKQA 4YB5A 3IOTA 3CFZA 3CR9A 3L6GA 4GXSB 1H44A 1A8EA 3G3FA 4OFOA 4ZZEA 3UA8A 3CFXA 4YKJA 3VVEA 3CFLA 2H4IA 4ZEFA 4KD5A 4QRZA 3VE1B 3U1OA 2UYEA 2X26A 1M5DA 2ZNSA 3CG3A 3G3KA 4U2RA 3R7XA 1MQHA 1EZOA 3D4GA 3N6UA 1LBBA 5AA1A 2GHBA 4FEDA 4F1VA 4U4SA 2UVJA 3H6UA 5CRYA 4I9DA 5TP9A 2I6EA 2F78A 3H6WA 2RC9A 2HAVA 1XOCA 4Q30B 3U72A 3HV1A 4OERA 4BDNA 1SVXB 1LAHE 4X9TA 5H8HA 4JWXA 2QMXA 2ZMBA 2CMOA 2A5TA 2QRYA 2ZXTA 3SEUA 2ONKE 3LSWA 1TT1A 3C33A 3UK4A 3Q27A 1SBPA 1HSLA 3MW0A 4DCXA 1P1OA 5DEXA 4U1OA 1QUKA 3DP4A 1PEBA 3MVXA 2F97A 3C4MA 3KGCA 3MC2A 4YU0A 5ISUA 1JVYA 1NNPA 2I49A 1PBQA 2H25A 3I5OA 1PC3A 4O3BA 1R1NA 5DTBA 4F3PA 4YKPA 3S2VA 1LCTA 1M5CA 1R9LA 3G3HA 3FXUA 4IO4A 5ICTA 4DE8A 4OETA 1LGBC 3AXFA 2DP8A 3PD8A 1FQBA 2FA7A 1I6AA 3MP1A 4RPOA 1H76A 2RF1A 3N6TA 3EPEA 4RA1A 4UACA 5I2KB 4R2FA 5I56A 3MVWA 1DTZA 1MH4A 3RNNA 1MY0A 4G4PA 4MLQA 3EF7A 3IJOB 1QUJA 1BP5A 2D3IA 4OQOA 4RK9A 3RT6B 4KFQA 4YKIA 1SI1A 1POY1 1O63A 3IORA 5CI5A 2ESNA 3LUYA 4XKPA 3TMGA 4EXKA 4JBZA 2O51A 4QFOA 5BWJA 3T9UA 1NNTA 2F8DA 2V93A 5K2YA 3A3CA 3O6HA 2Z22A 3H03A 4C1UA 3TTRA 2I4CA 4F2QA 1HSEA 1GTKA 1QJMA 3C31A 2Y7RA 4X48A 2QS1A 1MXWA 2V3QA 1GV8A 1VFDA 2H98A 4G8NA 4DXCA 5IKBA 1FQAA 4PFWA 1LB9A 1MM7A 4G68C 2O6AA 1A54A 4U21A 3C36A 3IL1B 4FECA 4ZEBA 3U8QA 4F31B 4DZ1A 4R75A 1RKMA 2PBWA 3BBRA 4ZZAA 5FHMA 3UIFA 2R71A 3PPNA 4NWDA 3OSQA 4OXVA 1Y9UA 4ZEKA 3KJ7A 4OEVA 1H45A 1NKXA 3IR1A 1BKAA 3S9LC 2KLFA 1OQHA 3ONMA 1Y3PA 4YICA 4GVOA 4H65A 3QUFA 3ZKLA 3KOTA 5M2VA 3V83A 3TCHA 2I58A 4GF8A 5DVJA 1ZKBA 1UIVA 2FNCA 1QW0A 2GRVA 1YTVA 3G7WA 5H8SA 3S4UA 2XD3A 1UTHA 2ONSA 4ESWA 1P1UA 5FHOA 1P1WA 2GFEA 4KCDA 4NMYA 4XKNA 1JVXA 2XHDA 3LR1A 3QAXA 4POWA 4KYEA 4R73A 3OO9A 3SESA 1IEJA 2G93A 2ONRA 3V89B 5I59B 3S9EA 3OO8A 1A55A 4OVJA 5DT6A 3TAJA 5ELVA 3VXBA 4AB5A 1FTKA 3H3GA 1BTJA 3C35A 3GBBA 3B7DA 3K00A 3CSBA 2M8CA 4KPTA 3TCGA 4POXA 3FD3A 2OWTA 3IO4A 5H8NA 4HW8A 3PV0E 4G68A 1B1HA 1Y20A 3N5LA 5B7DA 1IXCA 4NF8A 3B6WA 3K1MA 4ZE8A 3BFUA 3KOSA 4PETA 5L9OA 2I3WA 2CZLA 3CVGA 3SEXA 1LAGE 1SYIA 2X7PA 2Y7WA 4DXUA 1BLFA 1FTMA 3QSLA 2F36A 4P0IA 5H8NB 2X7QA 1URDA 5DVIA 4YMAA 5L9MA 3TYHA 4ZDMA 2Z8DA 4KQPA 3EHTA 2OLBA 1IXIA 4FJPA 2XXWA 2E1SA 4GQOA 5TP9B 5JK4A 2XXQA 4IGTA 2XXIA 1MY2A 3HHGA 1MQDA 4JWYA 3H7MA 4FORA 1ATGA 1DOTA 5I2NB 1Z7NE 3OD7A 1US5A 1LSTA 4LZ5A 1YPNA 1AOVA 1EH3A 3K2DA 1M5FA 1AH5A 3K6VA 3UN6A 1SW1A 3OXNA 5AA4B 4NWCA 3U94A 4PFTA 2O7IA 3IB0A 2UVHA 1MY4A 1XC1A 3MJNA 4O3AA 4OEUA 4R6HA 1MXYA 1XS5A 2Y7IA 4WKMA 4R6KA 1MXUA 1YAEA 4E0XA 2YJPA 1SI0A 3HCQA 4HCYA 4I62A 3SKPA 5HM4B 2P2AA 4X1BA 1S50A 3Q29A 3CIJA 3S9MC 3PUWE 2B3FA 4Q8RA 3TDJA 2DSFA 1MQIA 5H8QA 3USDA 3T9XB 1MPDA 2YLNA 1ZBMA 2R9JA 4WXJA 2DWHA 4FE8A 4NEDA 1I69A 4OMBA 4R9FA 2BJJX 5DVFA 3T93B 3TTLA 1B46A 1S9TA 4GRKA 4G77A 1MY3A 4KI0E 4E0WA 4ELOA 4PP0A 5H8HB 4FIMA 4F19A 1LB8A 1SDXA 3BKIB 3O28A 4NTLA 1B3LA 4LUBA 4ELRA 2VD2A 4NF5B 3E13X 1USYH 4OHNA 5FTHA 3OMBA 2DE3A 1IXGA 1B40A 2AYSA 2Z8EA 4GXAA 4L17A 5F1QA 3RUMA 4AB6A 4ZEDA 4DIGA 5KZTA 1Q35A 1B3HA 3DLNA 2V84A 4EUOA 1II5A 5H8FB 3LSLA 1VR5A 4BDRA 4QFPA 3ILTB 1SW5A 3VXCA 1H3DA 3K02A 2YPNA 3MBPA 1B52A 2XX8A 3SDFA 3MP8A 1MY1A 3K6UA 2RC7A 4F39A 5JEIA 1DSNA 2F6GA 4G2ZA 1B05A 3RY3A 4YB6A 1US4A 1B4HA 3KN7A 4XKRA 4PE5B 1TFDA 1I6BA 3O6IA 1B5HA 3MP6A 3B6QA 3HO7A 4WEPA 5H8QB 3T9HB 5EHMA 2F35A 2IA4A 1TXFA 3TTMA 2H5YA 4RYAA 3PPRA 1HSJA 4JWOA 4O3CA 4BDMA 1M5EA 1B4ZA 2THIA 3LSXA 1EU8A 1IIWA 5L9SA 3ILUB 1Y1MA 3LSFB 1B3GA 1UTBA 4KHZE 4IO5A 1ZJLA 5CMMA 1DPEA 3TFLA 3F11A 3M8UA 2RC8A 3PMXA 4LATA 2H9BA 4P0GA 4LVQA 2RCBA 3PUVE 3IAZA 3K4UA 3OOAA 3I3VA 2QS2A 4R6YA 3T66A 1ELJA 2DE4A 1JW1A 1Y1ZA 2DWAA 2HQ0A 2UYFA 3H06B 4IO3A 1B7ZA 3WAFA 3GXAA 4ZECA 4IB2A 2GHAA 3FGSA 1LLSA 4R74A 4H67A 3TCFA 2PT2A 1B0HA 2F5XA 4KR5A 5L8DA 3OO7A 1A99A 1FCKA 2PYYA 1RYOA 3IX1A 3SERA 4DLDA 5BUUA 2W7YA 3TQLA 4GWOA 4JDFA 1P99A 2NWJA 4N13A 1B6HA 1FTLA 1Y3QA 2QL3A 1N7WA 1D9VA 4OENA 1RYXA 3TODA 1S7YA 3VLVA 1QVSA 3VFJA 1WVJA 4OZ9A 4X1DA 1B0LA 2F7AA 3SEYA 1D9YA 2Y84A 2NUVA 2O1MA 3FATA 3FUZA 3UORA 1VE4A 1A7LA 1MDP1 1MXXA 3FASA 3FIRA 2FYIA 2P0SA 2D5WA 1B58A 5HPQA 2HAUA 2RINA 4GD5A 1F9BA 4F1YA 1UTHB 5CMCA 1MRPA 2I3VA 3W9VA 5AA3A 4HS7A 4IGRA 3PPQA 2HEUA 4BDLA 4GOTA 2DVZA 4G8HA 5KDTA 3CSGA 4JB7A 4OWDA 1XHYA 1B7UA 5AE4A
chains in the Genus database with same CATH superfamily
1Y3NA 2HZKA 3FV1A 1JETA 1KA1A 2XX9A 5AA2D 1NV6A 3C32A 4G68B 2F34A 3LBSA 3O29A 4OYVA 5DYHA 4EDPA 1Y4TA 2I0BA 2ZYKA 1URGA 1M5BA 1O7TA 2HFBA 2UXAA 3ZKKA 1QKAA 5KCJA 3IK6B 3GBAA 3GYYA 4EXLA 1AMFA 1BIYA 2ZYOA 2PMSA 1MPBA 4KCCA 4NF4B 2O68A 3SEVA 4LZ8A 5J1DA 3FXQA 3A3UA 4JXIA 1XT8A 3VLUA 4KFQA 3B8BA 2OZZA 3S9NC 1AL3A 1LEVA 3RPWA 3JZJA 4GIZA 4GWUA 2B65A 1MQJA 5AA2A 4I40A 5AA4A 3IB2A 4RY1A 1OVBA 3E4RA 4QFKA 3PUYE 3THIA 3MZBA 5CBRA 4PCDA 3KSXA 4RK2A 3PPPA 2V3UA 5I56B 5EQ7A 1DCUA 3KFMA 2WKYA 4FEBA 4QSEA 5I57B 3T9VA 2QPQA 4MH5A 4JSOA 1B51A 1JQFA 3HHFA 5LDZA 2XX7A 1N3WA 3VLWA 2Q9TA 4ELQA 3U92A 4ZS9A 2Q8JA 1FBCA 2XXTA 1LBZA 5ET5A 3T1BA 4FATA 4WEDA 2XXYA 4GL0A 4TLMB 2MKZA 4ONYA 4MLVA 3ROJA 3H4ZA 4PFUA 2PT1A 4YAHX 1IMDA 4XEQA 4EQBA 3O6GA 3IOVA 2Y7KA 3KSJA 3JYRA 1IMCA 2REGA 3PUZE 1J1NA 4AS5A 3ECRA 3T22A 4H46A 4PQJA 3K6XA 3HN0A 4MNCA 1IQ7A 5CC2A 4P47A 4XIGQ 1FPDA 2XA5A 1FBEA 4X04A 1ZIUA 1K9ZA 1GVCA 2AL5A 1YYZA 3OO6A 2QS3A 5IKBA 3FVGA 4QFNA 3TTKA 2CZKA 3RT8A 2QMWA 2XD2A 4LQ5A 2HXWA 3HPIA 4MX6A 4AQ4A 1SD3A 3MZ1A 2DE2A 1A40A 2OK2A 2NVUB 4PAIA 1L5TA 1NUZA 4PAFA 3A09A 3TTNA 5IGAA 2R6GE 2KQZA 3O9PA 1NNFA 1TWYA 4ELOA 1PB9A 4YB5A 3CR9A 3G3FA 4I3EA 4QRZA 3VE1B 3U1OA 2UYEA 4U2RA 1MQHA 3D4GA 3N6UA 5AA1A 2I6EA 3H6WA 2HAVA 3U72A 4BDNA 4X9TA 4JWXA 2ZMBA 4OVTA 2A5TA 3SEUA 3LSWA 2OX3A 1SBPA 3MW0A 1PEBA 3KGCA 4PBHA 5ISUA 1KZ8A 2H25A 3I5OA 1PC3A 4O3BA 1R1NA 3S2VA 1LCTA 1M5CA 1R9LA 4IO4A 3FXUA 4DE8A 1NV0A 1FQBA 2FA7A 2Q8MA 2RF1A 3BIGA 2WYPA 1DTZA 4G4PA 3EF7A 3IJOB 1POY1 1O63A 5CI5A 3LUYA 4XKPA 4EXKA 4JBZA 3T9UA 5K2YA 4C1UA 3H03A 1HSEA 4GX3A 4X48A 2QS1A 4G8NA 4DXCA 1A54A 4FECA 3UIFA 1RKMA 3OSQA 4OEVA 1NKXA 3IFCA 4HE1A 1BKAA 2KLFA 1OQHA 4YICA 3ISPA 3QUFA 5H8SA 1ZKBA 5AA3A 1YTVA 4ESWA 3KC0A 1P1WA 2GFEA 3LR1A 5I59B 2G93A 1FBGA 5ESYA 3EKIA 5ELVA 5IZ3B 3K00A 4KPTA 2M8CA 2OWTA 3IO4A 4MEVA 3PV0E 1Y20A 5B7DA 3B6WA 2CZLA 3SEXA 1SYIA 1BLFA 5DVIA 2XXQA 1MQDA 4JWYA 1Z7NE 1US5A 1AOVA 5ET6A 1EH3A 1M5FA 2O7IA 1MY4A 3MJNA 2Y5LA 2Y7IA 1FBHA 4WKMA 1YAEA 2YJPA 4HCYA 2OWZA 3HCQA 3Q29A 3CIJA 5ET8A 1MQIA 1MPDA 4N6KA 2YLNA 2R9JA 4ECFA 4NEDA 3VVFA 4OMBA 1EZOA 2BJJX 3T93B 4G77A 1MY3A 3BKIB 3O28A 4LN5A 4NTLA 1B3LA 4ELRA 3E13X 5FTHA 2DE3A 5F1QA 4ZEDA 5KZTA 3RPLB 3VXCA 3MBPA 1B52A 1FBDA 4PE5B 1TFDA 3KBZA 3O6IA 3B6QA 1TXFA 2H5YA 5EQ8A 3PPRA 1M5EA 4OVQA 1XI6A 2THIA 5L9SA 1B3GA 5CMMA 1DPEA 3TFLA 3M8UA 4LVQA 2RCBA 1K9YA 3K4UA 5IM2A 3OOAA 1ELJA 1B7ZA 4ZECA 3FGSA 5BUUA 4GWOA 4JDFA 2QL3A 1FTAA 3VLVA 4IR8A 4X1DA 1EYJA 2O1MA 2FYIA 1B58A 4BDLA 1IMFA 4RXLA 3EN3A 1ZU0A 2VT5A 5LTCA 2VPOA 1XVYA 3GZGA 3C9HA 4OTEA 4F3SA 2FHYA 1D3KA 1GGGA 1JW5A 2OCUA 2QVUA 2NXOA 3EQ1A 1PDAA 2L5VA 5FHNA 3QXMA 5KDTB 3IFAA 4NF5A 3G3IA 5J16A 3FJ7A 5K2XA 3MVYA 3TQWA 4ESXA 3KG2A 3IO6A 1FPIA 1NH8A 1Q1KA 2QS4A 1YZ0A 4QXDA 3NOHA 4F1UA 4H6DA 2A5SA 3R7XA 1CE2A 5EQ9A 5TP9B 1YCJA 2O84X 2QFLA 3V5AA 1XVXA 3N26A 1PBPA 4ND9A 3QUJA 3R6UA 1H43A 2XXUA 4PF8A 1IZ1A 3ZS6A 4OFJA 3TZAA 4H5GA 4IY5A 5IZZA 4ZE9A 1MM6A 4RNSA 2G29A 3HSTA 3EHUA 2RCAA 2VGQA 4DI4B 2XWOA 5F24A 5FTIA 3HFUA 4N81A 4R2BA 2KR0A 4F2OA 3KJTA 5CMKA 5DEXB 3H6TA 5FBPA 2XWIA 2CEXA 2WBBA 1NNKA 1ANFA 3U93A 3KC1A 2GH9A 1OIBA 3G3GA 3RQTA 1YXIA 1VSOA 2ABHA 1SW4A 1OMPA 4Q5TA 2HCAA 2QJEA 2VOZA 3RN8A 1GR2A 3L6HA 3PU5A 5F7VA 4H5FA 3E9XA 4P11A 1N3XA 3JV9A 4BDOA 5I57A 1N7XA 2ALUA 1IMBA 1FQFA 5ICQA 3K6WA 4RPNA 4P9KA 5I7IA 4H45A 3IOWA 5EHSA 2Y7PA 2XXXA 1CB6A 4MF3A 5IZ3A 3SETA 1LBVA 1WODA 1JP4A 3RYDA 3WAEA 4TQUQ 3E78A 3MVZA 1FQCA 3QYTA 4TLLB 1URSA 4F3GA 3UP9A 4N07A 1SYHA 1QULA 2DS9A 1N76A 4F3BA 2VD3A 1SPIA 1R6ZA 5TPAB 3FJMA 4F22A 2ANJA 4DDDA 4LP2B 1ZLQA 4I3YA 1OVTA 4DXBA 3OEKA 1FQDA 2A5TB 1NH7A 4N8GA 4R72A 4BLAA 5I2NA 4ZEIA 1NMUA 3G3JA 1OQGA 2CZHA 4XKQA 3L6GA 3CFZA 1A8EA 3CFLA 2H4IA 4KD5A 2X26A 1M5DA 1RDXA 2ZNSA 3G3KA 4FEDA 5CRYA 4I9DA 4MNIA 3HV1A 4OERA 1SVXB 1LAHE 2CMOA 2QRYA 1BK4A 2ONKE 3Q27A 1HSLA 3A29A 1P1OA 4U1OA 1QUKA 1RDYA 2F97A 3C4MA 3MC2A 4F3PA 4N15A 3MP1A 4RA1A 5I2KB 5I56A 3MVWA 4MLQA 1FPFA 3IORA 4QFOA 1NNTA 2F8DA 2V93A 3O6HA 3TTRA 3C31A 2XWKA 4PTKA 1VFDA 2H98A 4O7MA 4MAGA 4PFWA 4ZEBA 3C36A 2PBWA 5FHMA 2R71A 4NWDA 1Y9UA 3E79A 1H45A 1Y3PA 4GVOA 4H65A 4NF0A 2F3BA 3ZKLA 5M2VA 2CZIA 4EQ9A 2GRVA 1P1UA 5FHOA 4NMYA 2PCRA 4OVPA 4XKNA 4KYEA 3SESA 3S9EA 3OO8A 1DK4A 1FTKA 3GBBA 4HW8A 1FPLA 4G68A 4NF8A 3KOSA 5L9OA 2I3WA 1LAGE 2Y7WA 3QSLA 4NHBA 1URDA 4YMAA 3EHTA 5JK4A 1FPEA 5I2NB 1LSTA 1YPNA 4O3AA 1XS5A 1MXUA 4E0XA 2HXRA 1SI0A 5HM4B 4I62A 2Q74A 2P2AA 2GQ1A 3S9MC 2DSFA 3USDA 1ZBMA 5DVFA 2DWHA 4FE8A 1S9TA 3FXBA 1SDXA 1USYH 1IXGA 2Z8EA 2VPNA 1Q9DA 3LSLA 4BDRA 1H3DA 3K02A 3MP8A 4GX4A 2RC7A 1DSNA 4G2ZA 1B05A 4YKKA 3KN7A 1B5HA 3HO7A 2F35A 4PE3A 1HSJA 4PAKA 4BDMA 1EU8A 1Y1MA 4KHZE 1ZJLA 4MIJA 3F11A 2RC8A 4P56A 3I3VA 4R6YA 3T66A 4N6DA 2DWAA 1NV1A 4IB2A 2WEFA 4H67A 1B0HA 2F5XA 5L8DA 3OO7A 3SERA 2W7YA 4PFRA 2NWJA 1B6HA 1S7YA 4JVIA 3VFJA 1WVJA 4OZ9A 2PFYA 1B0LA 4NN3A 2Y84A 3FATA 3QMFA 1A7LA 3FIRA 1MXXA 2D5WA 2JJKA 3MYUA 5CMCA 3W9VA 2I3VA 4AS4A 1NI9A 3PPQA 2HEUA 4GOTA 5KDTA 2HPGA 4OWDA 4XF5A 4MNPA 1TFAA 4LONB 4GWZA 4O7IA 4R9GA 2REJA 1LCFA 4U23A 5I84A 3PD9A 4P1LA 3IB1A 4EF2A 2RKMA 5I5PA 4NF8B 2DYXA 1MQGA 4PDHA 1Z7ME 4I8CA 3TPAA 3PUXE 1MS7A 4FAJA 5A5XB 3TELA 1VFEA 5B70A 1SW2A 4MBPA 4P8BA 1N0TA 2UVGA 3H6VA 2V4CA 2IEEA 2ZYMA 3EHSA 2WX9A 4PC9A 1DTGA 1NFTA 1OLAA 2FIXA 3M3KA 4QHQA 3IOUA 4PDDA 4PFBA 2V3TA 4H8IA 1LAXA 4UA8A 4OA4A 2XXHA 2OWSA 1VDWA 4THIA 4H1XA 4NF6B 1B5JA 4ELPA 1IITA 1FW0A 1IXHA 5CM6A 4DI3D 3DELB 4U22A 5H8FA 3VVDA 2VP1A 4YMBA 4GLIA 5TPAA 3Q25A 4NE4A 3K01A 2Z8FA 2ZZVA 3RTFB 1P1NA 4U4XA 3R26A 1JW4A 5ITPA 4GBWA 4QSDA 3FJGA 4YB7A 1B7HA 2ZYNA 1NUYA 1EYIA 1UIUA 2I48A 1POTA 2HHMA 3LUZA 1LBXA 3RPLA 1NL5A 1PB8A 5CBSA 1MDQA 2F7BA 5LOMA 2PFZA 4GBVA 4YZZA 1B9JA 1B32A 2I0CA 4U1ZA 5HBCA 1Y4CA 1N84A 1MXZA 1FQEA 4IO2A 3MZ9A 1UTBB 1FBPA 5I58B 1I6QA 1A8FA 2DWJA 4PBQA 1AIVA 3K1PA 2Q88A 1MG1A 4P1EA 4N8YA 1IUDA 3PGFA 5T3JA 4TOZA 3FVNA 3N94A 3MAMA 1NV2A 4HTGA 1MPCA 2QVRA 3OEMA 3TUSA 5IAIA 3SEWA 2FBPA 3DM0A 2OJTA 2V25A 4EF1A 1N04A 4M1VA 3VV5A 1QUIA 3KEIA 3MSTA 3V8XB 2HZLA 4XFEA 5I59A 1O64A 1EZ9A 3DP8A 3IJXB 3T96B 4EQ7A 4F18A 1D4NA 3K1NA 3O97A 2DQVA 2Q2AA 4JSDA 2XXRA 4NF4A 2PX1A 4G8MA 3MPLA 4GX6A 1T0KA 2O7UA 2E0SA 3D4CA 2F7CA 1LAFE 1B3EA 2Q89A 4F29A 5JTYB 2B4MA 3KN3A 3MUQA 4NF6A 2UVIA 3MWBA 2LAOA 3FBPA 3IOTA 4GXSB 1NV7A 4OFOA 4Q8RA 3CFXA 4YKJA 4ZEFA 3CG3A 2GHBA 4F1VA 4U4SA 5TP9A 2F78A 2RC9A 1XOCA 4Q30B 5EQAA 5H8HA 3C33A 3CHGA 4JVDA 3DP4A 4YU0A 1JVYA 1NNPA 4NAPA 2I49A 4YKPA 4GWYA 3PD8A 1G0IA 1I6AA 1H76A 3N6TA 4UACA 3EPEA 1MH4A 1MY0A 1QUJA 1BP5A 2D3IA 4OQOA 3RT6B 2ESNA 3TMGA 5BWJA 2O51A 3A3CA 1NV3A 2Z22A 2I4CA 2WBDA 4F2QA 2ZZXA 2Y7RA 1FPKA 1FQAA 4G68C 4U21A 3U8QA 4F31B 4ZZAA 3PPNA 4ZEKA 3IR1A 3ONMA 5DVJA 1NV5A 2I58A 2FNCA 2FIEA 1UTHA 2ONSA 3QAXA 4POWA 4R73A 3OO9A 1NUXA 1IEJA 3V89B 5ET7A 1A55A 4OVJA 4AB5A 3VXBA 1BTJA 3B7DA 3CSBA 4NG7A 4GWXA 4N91A 3FD3A 4POXA 4HE0A 3N5LA 3K1MA 3CVGA 2X7PA 4DXUA 4P0IA 2F36A 5H8NB 3TYHA 4KQPA 4QBAA 2OLBA 4FJPA 4GQOA 4IGTA 4MJOA 3H7MA 1IMEA 1ATGA 1DOTA 4PFIA 4LZ5A 3UN6A 1SW1A 5AA4B 3U94A 4PFTA 1G0HA 2XWVA 4R6HA 4OEUA 1MXYA 3SKPA 2B3FA 5H8QA 2Y5KA 3TTLA 1I69A 1B46A 4GRKA 4E0WA 4GWWA 5H8HB 4FIMA 4F19A 4LUBA 2VD2A 3OMBA 3RUMA 1B40A 1FPGA 4L17A 4AB6A 3SZPA 3DLNA 2V84A 4EUOA 1II5A 1VR5A 1LBWA 1AWBA 4PGPA 4FBPA 3SDFA 1MY1A 3K6UA 4P3LA 4JVCA 3RY3A 4XKRA 4WEPA 5EHMA 2IA4A 3TTMA 3LSXA 1UTBA 1FRPA 4IO5A 4LATA 4ZE8A 2DE4A 1JW1A 1Y1ZA 2UYFA 3WAFA 5I3SA 4R74A 3TCFA 1FCKA 4DLDA 2PYYA 3TQLA 1P99A 4N13A 1Y3QA 4OENA 1RYXA 1QVSA 2F7AA 3FUZA 1VE4A 3FASA 5HPQA 2P0SA 2RINA 4GD5A 1F9BA 4F1YA 1UTHB 1MRPA 4HS7A 4IGRA 2DVZA 4G8HA 3CSGA 4KR5A 5AE4A 3ODBA 3GLBA 4UABA 4Q0CA 1PB7A 2XXPA 3RTWB 2FVZA 1ZMGA 1RDZA 3Q28A 4Z0IA 1WDNA 1D9QA 1P1QA 1MXVA 4I1DA 2D21A 4ISUA 4LA9A 3CG1A 5H8NA 1FTOA 1NUWA 4QFLA 1SQYA 5I58A 4PFYA 1DPPA 3W15C 2Q2CA 1B3FA 4C0RA 4GL8A 3D1RA 3E3KA 1MH3A 2OBGA 5EYGA 2P1SA 2DWIA 3TEPA 3C34A 2DOJA 3OENA 3KZGA 4N6PA 3PMVA 2VHAA 3FVKA 3KBRA 1EYKA 2DVCA 4IY6A 1B2HA 3KN8A 4OESA 4QF9A 3M3FA 1JEUA 1FTJA 2ZNTA 4MFIA 5A5LA 4XXUA 2O1LA 5TU0A 3QIMA 4O94A 3I6VA 4QSCA 4MMPA 2I4BA 4DCYA 3VDFA 3T0JA 3RLFE 3CRBA 1CNQA 4IO6A 4RJZA 2F6PA 1LFGA 4M4GA 4GFRA 4H0WA 2XXVA 2B3BA 3BFTA 3FXRA 3B6TA 4K3FA 3TKDA 2DXRA 3UGWA 3O2AA 3W9WA 5I2KA 4Z7EA 1LBCA 4LZ7A 3CI8A 4LQ2A 2CEYA 1FPJA 2DXYA 2NOOA 2AIXA 1LFIA 3LV0A 5KCJB 4O8MA 1USYE 5CMBA 3O66A 3M3LA 1KWHA 3FZVA 1UQWA 4KYSA 2O69A 1QKBA 3QK6A 5DW8A 2QSXA 2QVVA 5EYHA 4X8RA 3Q26A 4PF6A 1R9QA 3PPOA 2Z23A 4GWSA 3DP6A 4HE2A 4N4UA 5JTYA 4OVRA 2H99A 2PVUA 3FVOA 4C1TA 3FV2A 1IMAA 1B1XA 2ZNUA 5AA2B 3P7IA 1JEVA 1B5IA 2AL4A 4OVSA 1ZTYA 1LFHA 5EYFA 1JNFA 1FSAA 4MHFA 4IO7A 1FPBA 4NGUA 3K0VA 3PMWA 5IZ1A 1OLCA 3MPKA 1DMBA 3OELA 4HCWA 3OSRA 4OFLA 5ITOA 5A5XA 2B4LA 3RGYA 3MQ9A 3LC8A 4XTCQ 4H8JA 4BDQA 3ZSFA 4KYDA 3UA8A 1H44A 4ZZEA 3VVEA 1LBBA 2UVJA 3H6UA 4NQ8A 2QMXA 2ZXTA 4HXVA 1TT1A 3UK4A 4DCXA 5DEXA 3BIHA 3MVXA 1PBQA 2BJIA 5DTBA 3G3HA 5ICTA 3B50A 2F3DA 4OETA 1LGBC 3AXFA 2DP8A 1FJ9A 1INPA 4RPOA 4R2FA 3RNNA 4RK9A 4YKIA 1SI1A 4N17A 1DBZA 1GTKA 1QJMA 1MXWA 2V3QA 1GV8A 1LB9A 1MM7A 2O6AA 3IL1B 4DZ1A 4R75A 3BBRA 4OXVA 3KJ7A 1FJ6A 3S9LC 2DDKA 3KOTA 3V83A 3TCHA 4GF8A 1UIVA 1QW0A 3G7WA 3S4UA 2XD3A 1KA0A 4KCDA 1EZPA 1JVXA 2XHDA 3PTYA 2ONRA 4G61A 1NV4A 5DT6A 3TAJA 3H3GA 2XXKA 3C35A 3TCGA 1B1HA 4KXPA 1IXCA 4NX1A 3BFUA 4PETA 4MCOA 3U65A 1FTMA 2X7QA 2P3VA 5L9MA 4ZDMA 2Z8DA 1IXIA 2XXWA 2E1SA 2XXIA 1MY2A 3HHGA 4FORA 3OD7A 3K2DA 1AH5A 3K6VA 3OXNA 4NWCA 3IB0A 2UVHA 1XC1A 4R6KA 4X1BA 1S50A 3PUWE 3TDJA 2ZZWA 3T9XB 4WXJA 4R9FA 4KI0E 4PP0A 1LB8A 4NF5B 2P3NA 4PGNA 1LBYA 4OHNA 4GXAA 2AYSA 4DIGA 1Q35A 1B3HA 5H8FB 4QFPA 3ILTB 1SW5A 2YPNA 2XX8A 4OANA 4F39A 5JEIA 2F6GA 4YB6A 1US4A 1B4HA 1I6BA 2R8TA 3MP6A 5H8QB 3T9HB 4RYAA 4O3CA 4JWOA 2WYKA 1B4ZA 1IIWA 3ILUB 3LSFB 3PMXA 2H9BA 4P0GA 3PUVE 3IAZA 1FBFA 2QS2A 1QGXA 3H06B 2HQ0A 4IO3A 3GXAA 2GHAA 1LLSA 2PT2A 1A99A 3IX1A 1RYOA 1FTLA 1N7WA 1D9VA 3TODA 3SEYA 1D9YA 2NUVA 3UORA 1MDP1 2HAUA 4JB7A 1XHYA 1B7UA
chains in the Genus database with same CATH topology
4RXLA 1TFAA 4LONB 4R9GA 1Y3NA 3EN3A 2REJA 3GLBA 3ODBA 1LCFA 2HZKA 1ZU0A 1JETA 3FV1A 4Q0CA 1PB7A 2XX9A 4U23A 3PD9A 5I84A 2XXPA 5AA2D 3IB1A 3RTWB 1XVYA 2RKMA 4EF2A 3GZGA 3C9HA 4OTEA 3C32A 4G68B 1ZMGA 4F3SA 2F34A 3LBSA 3Q28A 1D3KA 4NF8B 3O29A 2DYXA 4Z0IA 1MQGA 1WDNA 1GGGA 1JW5A 4OYVA 5DYHA 1P1QA 4EDPA 1MXVA 1Y4TA 1Z7ME 4I8CA 4I1DA 2OCUA 3TPAA 2D21A 1MS7A 2I0BA 3CG1A 3PUXE 4ISUA 1FTOA 4LA9A 2NXOA 4QFLA 1SQYA 2ZYKA 3EQ1A 4FAJA 5I58A 1PDAA 4PFYA 1DPPA 3W15C 1URGA 5A5XB 2Q2CA 1M5BA 5FHNA 3QXMA 1B3FA 3TELA 4NF5A 1VFEA 4GL8A 4C0RA 5KDTB 5B70A 1O7TA 2HFBA 2UXAA 3G3IA 4YKKA 3ZKKA 1QKAA 3E3KA 1SW2A 5KCJA 3FJ7A 5K2XA 1MH3A 2OBGA 4MBPA 3IK6B 1N0TA 2UVGA 3GBAA 3H6VA 3MVYA 4EXLA 1AMFA 1BIYA 3TQWA 2ZYOA 2IEEA 3VLUA 2PMSA 4ESXA 1MPBA 2ZYMA 3EHSA 4KCCA 2P1SA 3KG2A 2O68A 4NF4B 3SEVA 2DWIA 3IO6A 4C1TA 4ECFA 3C34A 3TEPA 2DOJA 1NH8A 1Q1KA 1DTGA 1NFTA 1OLAA 2QS4A 3M3KA 3FXQA 3OENA 4QHQA 5J1DA 3A3UA 4JXIA 4F1UA 4H6DA 3IOUA 3KZGA 1XT8A 2A5SA 2V3TA 4N6PA 1CE2A 1LAXA 4H8IA 3PMVA 2VHAA 1YCJA 2O84X 2XXHA 2OWSA 2OZZA 3FVKA 4UA8A 3KBRA 1EZPA 2DVCA 3S9NC 1AL3A 4IY6A 3V5AA 3RPWA 1XVXA 4EQ9A 3N26A 4THIA 1B2HA 3JZJA 1PBPA 4GIZA 4ND9A 3QUJA 3R6UA 4H1XA 4NF6B 3KN8A 1B5JA 4ELPA 1IITA 2B65A 1MQJA 4OESA 4QF9A 5AA2A 1H43A 1FW0A 1IXHA 3M3FA 1JEUA 5CM6A 2XXUA 5AA4A 1IZ1A 1FTJA 2ZNTA 3IB2A 4RY1A 3ZS6A 4MFIA 1OVBA 3DELB 4XXUA 4U22A 5H8FA 4OFJA 3TZAA 3VVDA 3E4RA 4H5GA 4IY5A 4QFKA 3PUYE 2VP1A 3MZBA 3THIA 4YMBA 4ZE9A 1MM6A 4GLIA 4RNSA 2G29A 2O1LA 5TPAA 3HSTA 5TU0A 3EHUA 5CBRA 2RCAA 2VGQA 3KSXA 3Q25A 4RK2A 3QIMA 5FTIA 4NE4A 3PPPA 3K01A 2V3UA 2Z8FA 3I6VA 4QSCA 3RTFB 4R2BA 5I56B 1P1NA 4U4XA 4F2OA 3R26A 1JW4A 3KFMA 5ITPA 3KJTA 2WKYA 4FEBA 4QSEA 2I4BA 4QSDA 3T9VA 5CMKA 3FJGA 4DCYA 5I57B 5DEXB 4YB7A 3VDFA 1B7HA 3H6TA 2ZYNA 3RLFE 3CRBA 4IO6A 4RJZA 1UIUA 2I48A 1NNKA 1ANFA 2F6PA 2QPQA 4MH5A 3U93A 4JSOA 3VVFA 1B51A 1JQFA 1LFGA 1POTA 3HHFA 2GH9A 4GFRA 4M4GA 2XX7A 1N3WA 4H0WA 3VLWA 2Q9TA 2XXVA 1OIBA 3G3GA 3RQTA 1NL5A 3U92A 1PB8A 2B3BA 4ELQA 1VSOA 2ABHA 3BFTA 4ZS9A 1SW4A 2Q8JA 5CBSA 1OMPA 1MDQA 3FXRA 3B6TA 4K3FA 2F7BA 3TKDA 2DXRA 2XXTA 4LZ8A 4Q5TA 5LOMA 4YZZA 1B9JA 2HCAA 2QJEA 1B32A 3UGWA 2VOZA 2I0CA 3RN8A 4FATA 3O2AA 3W9WA 4U1ZA 4WEDA 5HBCA 4Z7EA 1GR2A 5I2KA 2XXYA 1Y4CA 4GL0A 3L6HA 3PU5A 5F7VA 4TLMB 1LBCA 4H5FA 4LZ7A 4ONYA 4MLVA 1N84A 3CI8A 1MXZA 1FQEA 3E9XA 4LQ2A 3H4ZA 4P11A 1N3XA 4PFUA 2PT1A 3JV9A 4YAHX 4IO2A 3MZ9A 4BDOA 5I57A 1UTBB 1N7XA 5I58B 2DXYA 1I6QA 2ALUA 1A8FA 2AIXA 2DWJA 2NOOA 4EQBA 1AIVA 3K1PA 3O6GA 2Q88A 3IOVA 1LFIA 1FQFA 1MG1A 2Y7KA 3KSJA 5KCJB 3JYRA 5ICQA 3K6WA 1USYE 4RPNA 3O66A 5CMBA 2REGA 3M3LA 1KWHA 1IUDA 3FZVA 3PUZE 1UQWA 4KYSA 3PGFA 3IOWA 1J1NA 4TOZA 2Y7PA 2O69A 2XXXA 1CB6A 3FVNA 3MAMA 3N94A 4MF3A 5EHSA 1QKBA 3QK6A 3ECRA 4HTGA 2QSXA 3SETA 1WODA 3T22A 4PQJA 3K6XA 1MPCA 3HN0A 3Q26A 1R9QA 3OEMA 3TUSA 5IAIA 3SEWA 3WAEA 1IQ7A 3DM0A 2OJTA 4TQUQ 2V25A 3PPOA 4XIGQ 4EF1A 1N04A 5CC2A 4M1VA 3VV5A 1QUIA 2Z23A 3MVZA 3KEIA 1ZIUA 1FQCA 3V8XB 3QYTA 3DP6A 2HZLA 5JTYA 5I59A 4TLLB 1GVCA 2H99A 2PVUA 3FVOA 1O64A 1EZ9A 1URSA 3DP8A 3IJXB 3FV2A 3T96B 3UP9A 4N07A 4F3GA 2AL5A 1B1XA 4EQ7A 3OO6A 2QS3A 2ZNUA 5AA2B 3FVGA 1SYHA 3P7IA 4QFNA 1QULA 2DS9A 1N76A 3TTKA 4F3BA 1JEVA 4F18A 1B5IA 1D4NA 2AL4A 3RT8A 3K1NA 2QMWA 2VD3A 3O97A 1ZTYA 1LFHA 2DQVA 2XD2A 4LQ5A 5EYFA 2Q2AA 2HXWA 3HPIA 4AQ4A 1SD3A 1JNFA 4JSDA 2XXRA 4NF4A 2PX1A 4IO7A 1R6ZA 3K0VA 3MZ1A 2DE2A 5TPAB 3FJMA 4G8MA 4F22A 3PMWA 1A40A 2ANJA 3MPLA 2OK2A 1OLCA 3MPKA 2NVUB 2O7UA 1T0KA 1DMBA 4DDDA 2E0SA 3D4CA 2F7CA 3OELA 1ZLQA 4LP2B 1L5TA 1LAFE 4HCWA 3OSRA 1OVTA 4OFLA 1B3EA 5ITOA 4DXBA 3OEKA 2Q89A 1FQDA 3A09A 5JTYB 4F29A 2A5TB 5A5XA 1NH7A 3TTNA 3KN3A 4R72A 3RGYA 4BLAA 5I2NA 2R6GE 3MQ9A 3MUQA 4NF6A 2UVIA 3O9PA 1NNFA 3LC8A 4ZEIA 4XTCQ 4H8JA 1NMUA 1TWYA 3G3JA 3MWBA 3ZSFA 1OQGA 4BDQA 2LAOA 4KYDA 1PB9A 4XKQA 4YB5A 3IOTA 3CFZA 3CR9A 3L6GA 4GXSB 1H44A 1A8EA 3G3FA 4OFOA 4ZZEA 3UA8A 3CFXA 4YKJA 3VVEA 3CFLA 2H4IA 4ZEFA 4KD5A 4QRZA 3VE1B 3U1OA 2UYEA 2X26A 1M5DA 2ZNSA 3CG3A 3G3KA 4U2RA 3R7XA 1MQHA 1EZOA 3D4GA 3N6UA 1LBBA 5AA1A 2GHBA 4FEDA 4F1VA 4U4SA 2UVJA 3H6UA 5CRYA 4I9DA 5TP9A 2I6EA 2F78A 3H6WA 2RC9A 2HAVA 1XOCA 4Q30B 3U72A 3HV1A 4OERA 4BDNA 1SVXB 1LAHE 4X9TA 5H8HA 4JWXA 2QMXA 2ZMBA 2CMOA 2A5TA 2QRYA 2ZXTA 3SEUA 2ONKE 3LSWA 1TT1A 3C33A 3UK4A 3Q27A 1SBPA 1HSLA 3MW0A 4DCXA 1P1OA 5DEXA 4U1OA 1QUKA 3DP4A 1PEBA 3MVXA 2F97A 3C4MA 3KGCA 3MC2A 4YU0A 5ISUA 1JVYA 1NNPA 2I49A 1PBQA 2H25A 3I5OA 1PC3A 4O3BA 1R1NA 5DTBA 4F3PA 4YKPA 3S2VA 1LCTA 1M5CA 1R9LA 3G3HA 3FXUA 4IO4A 5ICTA 4DE8A 4OETA 1LGBC 3AXFA 2DP8A 3PD8A 1FQBA 2FA7A 1I6AA 3MP1A 4RPOA 1H76A 2RF1A 3N6TA 3EPEA 4RA1A 4UACA 5I2KB 4R2FA 5I56A 3MVWA 1DTZA 1MH4A 3RNNA 1MY0A 4G4PA 4MLQA 3EF7A 3IJOB 1QUJA 1BP5A 2D3IA 4OQOA 4RK9A 3RT6B 4KFQA 4YKIA 1SI1A 1POY1 1O63A 3IORA 5CI5A 2ESNA 3LUYA 4XKPA 3TMGA 4EXKA 4JBZA 2O51A 4QFOA 5BWJA 3T9UA 1NNTA 2F8DA 2V93A 5K2YA 3A3CA 3O6HA 2Z22A 3H03A 4C1UA 3TTRA 2I4CA 4F2QA 1HSEA 1GTKA 1QJMA 3C31A 2Y7RA 4X48A 2QS1A 1MXWA 2V3QA 1GV8A 1VFDA 2H98A 4G8NA 4DXCA 5IKBA 1FQAA 4PFWA 1LB9A 1MM7A 4G68C 2O6AA 1A54A 4U21A 3C36A 3IL1B 4FECA 4ZEBA 3U8QA 4F31B 4DZ1A 4R75A 1RKMA 2PBWA 3BBRA 4ZZAA 5FHMA 3UIFA 2R71A 3PPNA 4NWDA 3OSQA 4OXVA 1Y9UA 4ZEKA 3KJ7A 4OEVA 1H45A 1NKXA 3IR1A 1BKAA 3S9LC 2KLFA 1OQHA 3ONMA 1Y3PA 4YICA 4GVOA 4H65A 3QUFA 3ZKLA 3KOTA 5M2VA 3V83A 3TCHA 2I58A 4GF8A 5DVJA 1ZKBA 1UIVA 2FNCA 1QW0A 2GRVA 1YTVA 3G7WA 5H8SA 3S4UA 2XD3A 1UTHA 2ONSA 4ESWA 1P1UA 5FHOA 1P1WA 2GFEA 4KCDA 4NMYA 4XKNA 1JVXA 2XHDA 3LR1A 3QAXA 4POWA 4KYEA 4R73A 3OO9A 3SESA 1IEJA 2G93A 2ONRA 3V89B 5I59B 3S9EA 3OO8A 1A55A 4OVJA 5DT6A 3TAJA 5ELVA 3VXBA 4AB5A 1FTKA 3H3GA 1BTJA 3C35A 3GBBA 3B7DA 3K00A 3CSBA 2M8CA 4KPTA 3TCGA 4POXA 3FD3A 2OWTA 3IO4A 5H8NA 4HW8A 3PV0E 4G68A 1B1HA 1Y20A 3N5LA 5B7DA 1IXCA 4NF8A 3B6WA 3K1MA 4ZE8A 3BFUA 3KOSA 4PETA 5L9OA 2I3WA 2CZLA 3CVGA 3SEXA 1LAGE 1SYIA 2X7PA 2Y7WA 4DXUA 1BLFA 1FTMA 3QSLA 2F36A 4P0IA 5H8NB 2X7QA 1URDA 5DVIA 4YMAA 5L9MA 3TYHA 4ZDMA 2Z8DA 4KQPA 3EHTA 2OLBA 1IXIA 4FJPA 2XXWA 2E1SA 4GQOA 5TP9B 5JK4A 2XXQA 4IGTA 2XXIA 1MY2A 3HHGA 1MQDA 4JWYA 3H7MA 4FORA 1ATGA 1DOTA 5I2NB 1Z7NE 3OD7A 1US5A 1LSTA 4LZ5A 1YPNA 1AOVA 1EH3A 3K2DA 1M5FA 1AH5A 3K6VA 3UN6A 1SW1A 3OXNA 5AA4B 4NWCA 3U94A 4PFTA 2O7IA 3IB0A 2UVHA 1MY4A 1XC1A 3MJNA 4O3AA 4OEUA 4R6HA 1MXYA 1XS5A 2Y7IA 4WKMA 4R6KA 1MXUA 1YAEA 4E0XA 2YJPA 1SI0A 3HCQA 4HCYA 4I62A 3SKPA 5HM4B 2P2AA 4X1BA 1S50A 3Q29A 3CIJA 3S9MC 3PUWE 2B3FA 4Q8RA 3TDJA 2DSFA 1MQIA 5H8QA 3USDA 3T9XB 1MPDA 2YLNA 1ZBMA 2R9JA 4WXJA 2DWHA 4FE8A 4NEDA 1I69A 4OMBA 4R9FA 2BJJX 5DVFA 3T93B 3TTLA 1B46A 1S9TA 4GRKA 4G77A 1MY3A 4KI0E 4E0WA 4ELOA 4PP0A 5H8HB 4FIMA 4F19A 1LB8A 1SDXA 3BKIB 3O28A 4NTLA 1B3LA 4LUBA 4ELRA 2VD2A 4NF5B 3E13X 1USYH 4OHNA 5FTHA 3OMBA 2DE3A 1IXGA 1B40A 2AYSA 2Z8EA 4GXAA 4L17A 5F1QA 3RUMA 4AB6A 4ZEDA 4DIGA 5KZTA 1Q35A 1B3HA 3DLNA 2V84A 4EUOA 1II5A 5H8FB 3LSLA 1VR5A 4BDRA 4QFPA 3ILTB 1SW5A 3VXCA 1H3DA 3K02A 2YPNA 3MBPA 1B52A 2XX8A 3SDFA 3MP8A 1MY1A 3K6UA 2RC7A 4F39A 5JEIA 1DSNA 2F6GA 4G2ZA 1B05A 3RY3A 4YB6A 1US4A 1B4HA 3KN7A 4XKRA 4PE5B 1TFDA 1I6BA 3O6IA 1B5HA 3MP6A 3B6QA 3HO7A 4WEPA 5H8QB 3T9HB 5EHMA 2F35A 2IA4A 1TXFA 3TTMA 2H5YA 4RYAA 3PPRA 1HSJA 4JWOA 4O3CA 4BDMA 1M5EA 1B4ZA 2THIA 3LSXA 1EU8A 1IIWA 5L9SA 3ILUB 1Y1MA 3LSFB 1B3GA 1UTBA 4KHZE 4IO5A 1ZJLA 5CMMA 1DPEA 3TFLA 3F11A 3M8UA 2RC8A 3PMXA 4LATA 2H9BA 4P0GA 4LVQA 2RCBA 3PUVE 3IAZA 3K4UA 3OOAA 3I3VA 2QS2A 4R6YA 3T66A 1ELJA 2DE4A 1JW1A 1Y1ZA 2DWAA 2HQ0A 2UYFA 3H06B 4IO3A 1B7ZA 3WAFA 3GXAA 4ZECA 4IB2A 2GHAA 3FGSA 1LLSA 4R74A 4H67A 3TCFA 2PT2A 1B0HA 2F5XA 4KR5A 5L8DA 3OO7A 1A99A 1FCKA 2PYYA 1RYOA 3IX1A 3SERA 4DLDA 5BUUA 2W7YA 3TQLA 4GWOA 4JDFA 1P99A 2NWJA 4N13A 1B6HA 1FTLA 1Y3QA 2QL3A 1N7WA 1D9VA 4OENA 1RYXA 3TODA 1S7YA 3VLVA 1QVSA 3VFJA 1WVJA 4OZ9A 4X1DA 1B0LA 2F7AA 3SEYA 1D9YA 2Y84A 2NUVA 2O1MA 3FATA 3FUZA 3UORA 1VE4A 1A7LA 1MDP1 1MXXA 3FASA 3FIRA 2FYIA 2P0SA 2D5WA 1B58A 5HPQA 2HAUA 2RINA 4GD5A 1F9BA 4F1YA 1UTHB 5CMCA 1MRPA 2I3VA 3W9VA 5AA3A 4HS7A 4IGRA 3PPQA 2HEUA 4BDLA 4GOTA 2DVZA 4G8HA 5KDTA 3CSGA 4JB7A 4OWDA 1XHYA 1B7UA 5AE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RXL A;  1TFA A;  4LON B;  4R9G A;  1Y3N A;  3EN3 A;  2REJ A;  3GLB A;  3ODB A;  1LCF A;  2HZK A;  1ZU0 A;  1JET A;  3FV1 A;  4Q0C A;  1PB7 A;  2XX9 A;  4U23 A;  3PD9 A;  5I84 A;  2XXP A;  5AA2 D;  3IB1 A;  3RTW B;  1XVY A;  2RKM A;  4EF2 A;  3GZG A;  3C9H A;  4OTE A;  3C32 A;  4G68 B;  1ZMG A;  4F3S A;  2F34 A;  3LBS A;  3Q28 A;  1D3K A;  4NF8 B;  3O29 A;  2DYX A;  4Z0I A;  1MQG A;  1WDN A;  1GGG A;  1JW5 A;  4OYV A;  5DYH A;  1P1Q A;  4EDP A;  1MXV A;  1Y4T A;  1Z7M E;  4I8C A;  4I1D A;  2OCU A;  3TPA A;  2D21 A;  1MS7 A;  2I0B A;  3CG1 A;  3PUX E;  4ISU A;  1FTO A;  4LA9 A;  2NXO A;  4QFL A;  1SQY A;  2ZYK A;  3EQ1 A;  4FAJ A;  5I58 A;  1PDA A;  4PFY A;  1DPP A;  3W15 C;  1URG A;  5A5X B;  2Q2C A;  1M5B A;  5FHN A;  3QXM A;  1B3F A;  3TEL A;  4NF5 A;  1VFE A;  4GL8 A;  4C0R A;  5KDT B;  5B70 A;  1O7T A;  2HFB A;  2UXA A;  3G3I A;  4YKK A;  3ZKK A;  1QKA A;  3E3K A;  1SW2 A;  5KCJ A;  3FJ7 A;  5K2X A;  1MH3 A;  2OBG A;  4MBP A;  3IK6 B;  1N0T A;  2UVG A;  3GBA A;  3H6V A;  3MVY A;  4EXL A;  1AMF A;  1BIY A;  3TQW A;  2ZYO A;  2IEE A;  3VLU A;  2PMS A;  4ESX A;  1MPB A;  2ZYM A;  3EHS A;  4KCC A;  2P1S A;  3KG2 A;  2O68 A;  4NF4 B;  3SEV A;  2DWI A;  3IO6 A;  4C1T A;  4ECF A;  3C34 A;  3TEP A;  2DOJ A;  1NH8 A;  1Q1K A;  1DTG A;  1NFT A;  1OLA A;  2QS4 A;  3M3K A;  3FXQ A;  3OEN A;  4QHQ A;  5J1D A;  3A3U A;  4JXI A;  4F1U A;  4H6D A;  3IOU A;  3KZG A;  1XT8 A;  2A5S A;  2V3T A;  4N6P A;  1CE2 A;  1LAX A;  4H8I A;  3PMV A;  2VHA A;  1YCJ A;  2O84 X;  2XXH A;  2OWS A;  2OZZ A;  3FVK A;  4UA8 A;  3KBR A;  1EZP A;  2DVC A;  3S9N C;  1AL3 A;  4IY6 A;  3V5A A;  3RPW A;  1XVX A;  4EQ9 A;  3N26 A;  4THI A;  1B2H A;  3JZJ A;  1PBP A;  4GIZ A;  4ND9 A;  3QUJ A;  3R6U A;  4H1X A;  4NF6 B;  3KN8 A;  1B5J A;  4ELP A;  1IIT A;  2B65 A;  1MQJ A;  4OES A;  4QF9 A;  5AA2 A;  1H43 A;  1FW0 A;  1IXH A;  3M3F A;  1JEU A;  5CM6 A;  2XXU A;  5AA4 A;  1IZ1 A;  1FTJ A;  2ZNT A;  3IB2 A;  4RY1 A;  3ZS6 A;  4MFI A;  1OVB A;  3DEL B;  4XXU A;  4U22 A;  5H8F A;  4OFJ A;  3TZA A;  3VVD A;  3E4R A;  4H5G A;  4IY5 A;  4QFK A;  3PUY E;  2VP1 A;  3MZB A;  3THI A;  4YMB A;  4ZE9 A;  1MM6 A;  4GLI A;  4RNS A;  2G29 A;  2O1L A;  5TPA A;  3HST A;  5TU0 A;  3EHU A;  5CBR A;  2RCA A;  2VGQ A;  3KSX A;  3Q25 A;  4RK2 A;  3QIM A;  5FTI A;  4NE4 A;  3PPP A;  3K01 A;  2V3U A;  2Z8F A;  3I6V A;  4QSC A;  3RTF B;  4R2B A;  5I56 B;  1P1N A;  4U4X A;  4F2O A;  3R26 A;  1JW4 A;  3KFM A;  5ITP A;  3KJT A;  2WKY A;  4FEB A;  4QSE A;  2I4B A;  4QSD A;  3T9V A;  5CMK A;  3FJG A;  4DCY A;  5I57 B;  5DEX B;  4YB7 A;  3VDF A;  1B7H A;  3H6T A;  2ZYN A;  3RLF E;  3CRB A;  4IO6 A;  4RJZ A;  1UIU A;  2I48 A;  1NNK A;  1ANF A;  2F6P A;  2QPQ A;  4MH5 A;  3U93 A;  4JSO A;  3VVF A;  1B51 A;  1JQF A;  1LFG A;  1POT A;  3HHF A;  2GH9 A;  4GFR A;  4M4G A;  2XX7 A;  1N3W A;  4H0W A;  3VLW A;  2Q9T A;  2XXV A;  1OIB A;  3G3G A;  3RQT A;  1NL5 A;  3U92 A;  1PB8 A;  2B3B A;  4ELQ A;  1VSO A;  2ABH A;  3BFT A;  4ZS9 A;  1SW4 A;  2Q8J A;  5CBS A;  1OMP A;  1MDQ A;  3FXR A;  3B6T A;  4K3F A;  2F7B A;  3TKD A;  2DXR A;  2XXT A;  4LZ8 A;  4Q5T A;  5LOM A;  4YZZ A;  1B9J A;  2HCA A;  2QJE A;  1B32 A;  3UGW A;  2VOZ A;  2I0C A;  3RN8 A;  4FAT A;  3O2A A;  3W9W A;  4U1Z A;  4WED A;  5HBC A;  4Z7E A;  1GR2 A;  5I2K A;  2XXY A;  1Y4C A;  4GL0 A;  3L6H A;  3PU5 A;  5F7V A;  4TLM B;  1LBC A;  4H5F A;  4LZ7 A;  4ONY A;  4MLV A;  1N84 A;  3CI8 A;  1MXZ A;  1FQE A;  3E9X A;  4LQ2 A;  3H4Z A;  4P11 A;  1N3X A;  4PFU A;  2PT1 A;  3JV9 A;  4YAH X;  4IO2 A;  3MZ9 A;  4BDO A;  5I57 A;  1UTB B;  1N7X A;  5I58 B;  2DXY A;  1I6Q A;  2ALU A;  1A8F A;  2AIX A;  2DWJ A;  2NOO A;  4EQB A;  1AIV A;  3K1P A;  3O6G A;  2Q88 A;  3IOV A;  1LFI A;  1FQF A;  1MG1 A;  2Y7K A;  3KSJ A;  5KCJ B;  3JYR A;  5ICQ A;  3K6W A;  1USY E;  4RPN A;  3O66 A;  5CMB A;  2REG A;  3M3L A;  1KWH A;  1IUD A;  3FZV A;  3PUZ E;  1UQW A;  4KYS A;  3PGF A;  3IOW A;  1J1N A;  4TOZ A;  2Y7P A;  2O69 A;  2XXX A;  1CB6 A;  3FVN A;  3MAM A;  3N94 A;  4MF3 A;  5EHS A;  1QKB A;  3QK6 A;  3ECR A;  4HTG A;  2QSX A;  3SET A;  1WOD A;  3T22 A;  4PQJ A;  3K6X A;  1MPC A;  3HN0 A;  3Q26 A;  1R9Q A;  3OEM A;  3TUS A;  5IAI A;  3SEW A;  3WAE A;  1IQ7 A;  3DM0 A;  2OJT A;  4TQU Q;  2V25 A;  3PPO A;  4XIG Q;  4EF1 A;  1N04 A;  5CC2 A;  4M1V A;  3VV5 A;  1QUI A;  2Z23 A;  3MVZ A;  3KEI A;  1ZIU A;  1FQC A;  3V8X B;  3QYT A;  3DP6 A;  2HZL A;  5JTY A;  5I59 A;  4TLL B;  1GVC A;  2H99 A;  2PVU A;  3FVO A;  1O64 A;  1EZ9 A;  1URS A;  3DP8 A;  3IJX B;  3FV2 A;  3T96 B;  3UP9 A;  4N07 A;  4F3G A;  2AL5 A;  1B1X A;  4EQ7 A;  3OO6 A;  2QS3 A;  2ZNU A;  5AA2 B;  3FVG A;  1SYH A;  3P7I A;  4QFN A;  1QUL A;  2DS9 A;  1N76 A;  3TTK A;  4F3B A;  1JEV A;  4F18 A;  1B5I A;  1D4N A;  2AL4 A;  3RT8 A;  3K1N A;  2QMW A;  2VD3 A;  3O97 A;  1ZTY A;  1LFH A;  2DQV A;  2XD2 A;  4LQ5 A;  5EYF A;  2Q2A A;  2HXW A;  3HPI A;  4AQ4 A;  1SD3 A;  1JNF A;  4JSD A;  2XXR A;  4NF4 A;  2PX1 A;  4IO7 A;  1R6Z A;  3K0V A;  3MZ1 A;  2DE2 A;  5TPA B;  3FJM A;  4G8M A;  4F22 A;  3PMW A;  1A40 A;  2ANJ A;  3MPL A;  2OK2 A;  1OLC A;  3MPK A;  2NVU B;  2O7U A;  1T0K A;  1DMB A;  4DDD A;  2E0S A;  3D4C A;  2F7C A;  3OEL A;  1ZLQ A;  4LP2 B;  1L5T A;  1LAF E;  4HCW A;  3OSR A;  1OVT A;  4OFL A;  1B3E A;  5ITO A;  4DXB A;  3OEK A;  2Q89 A;  1FQD A;  3A09 A;  5JTY B;  4F29 A;  2A5T B;  5A5X A;  1NH7 A;  3TTN A;  3KN3 A;  4R72 A;  3RGY A;  4BLA A;  5I2N A;  2R6G E;  3MQ9 A;  3MUQ A;  4NF6 A;  2UVI A;  3O9P A;  1NNF A;  3LC8 A;  4ZEI A;  4XTC Q;  4H8J A;  1NMU A;  1TWY A;  3G3J A;  3MWB A;  3ZSF A;  1OQG A;  4BDQ A;  2LAO A;  4KYD A;  1PB9 A;  4XKQ A;  4YB5 A;  3IOT A;  3CFZ A;  3CR9 A;  3L6G A;  4GXS B;  1H44 A;  1A8E A;  3G3F A;  4OFO A;  4ZZE A;  3UA8 A;  3CFX A;  4YKJ A;  3VVE A;  3CFL A;  2H4I A;  4ZEF A;  4KD5 A;  4QRZ A;  3VE1 B;  3U1O A;  2UYE A;  2X26 A;  1M5D A;  2ZNS A;  3CG3 A;  3G3K A;  4U2R A;  3R7X A;  1MQH A;  1EZO A;  3D4G A;  3N6U A;  1LBB A;  5AA1 A;  2GHB A;  4FED A;  4F1V A;  4U4S A;  2UVJ A;  3H6U A;  5CRY A;  4I9D A;  5TP9 A;  2I6E A;  2F78 A;  3H6W A;  2RC9 A;  2HAV A;  1XOC A;  4Q30 B;  3U72 A;  3HV1 A;  4OER A;  4BDN A;  1SVX B;  1LAH E;  4X9T A;  5H8H A;  4JWX A;  2QMX A;  2ZMB A;  2CMO A;  2A5T A;  2QRY A;  2ZXT A;  3SEU A;  2ONK E;  3LSW A;  1TT1 A;  3C33 A;  3UK4 A;  3Q27 A;  1SBP A;  1HSL A;  3MW0 A;  4DCX A;  1P1O A;  5DEX A;  4U1O A;  1QUK A;  3DP4 A;  1PEB A;  3MVX A;  2F97 A;  3C4M A;  3KGC A;  3MC2 A;  4YU0 A;  5ISU A;  1JVY A;  1NNP A;  2I49 A;  1PBQ A;  2H25 A;  3I5O A;  1PC3 A;  4O3B A;  1R1N A;  5DTB A;  4F3P A;  4YKP A;  3S2V A;  1LCT A;  1M5C A;  1R9L A;  3G3H A;  3FXU A;  4IO4 A;  5ICT A;  4DE8 A;  4OET A;  1LGB C;  3AXF A;  2DP8 A;  3PD8 A;  1FQB A;  2FA7 A;  1I6A A;  3MP1 A;  4RPO A;  1H76 A;  2RF1 A;  3N6T A;  3EPE A;  4RA1 A;  4UAC A;  5I2K B;  4R2F A;  5I56 A;  3MVW A;  1DTZ A;  1MH4 A;  3RNN A;  1MY0 A;  4G4P A;  4MLQ A;  3EF7 A;  3IJO B;  1QUJ A;  1BP5 A;  2D3I A;  4OQO A;  4RK9 A;  3RT6 B;  4KFQ A;  4YKI A;  1SI1 A;  1POY 1;  1O63 A;  3IOR A;  5CI5 A;  2ESN A;  3LUY A;  4XKP A;  3TMG A;  4EXK A;  4JBZ A;  2O51 A;  4QFO A;  5BWJ A;  3T9U A;  1NNT A;  2F8D A;  2V93 A;  5K2Y A;  3A3C A;  3O6H A;  2Z22 A;  3H03 A;  4C1U A;  3TTR A;  2I4C A;  4F2Q A;  1HSE A;  1GTK A;  1QJM A;  3C31 A;  2Y7R A;  4X48 A;  2QS1 A;  1MXW A;  2V3Q A;  1GV8 A;  1VFD A;  2H98 A;  4G8N A;  4DXC A;  5IKB A;  1FQA A;  4PFW A;  1LB9 A;  1MM7 A;  4G68 C;  2O6A A;  1A54 A;  4U21 A;  3C36 A;  3IL1 B;  4FEC A;  4ZEB A;  3U8Q A;  4F31 B;  4DZ1 A;  4R75 A;  1RKM A;  2PBW A;  3BBR A;  4ZZA A;  5FHM A;  3UIF A;  2R71 A;  3PPN A;  4NWD A;  3OSQ A;  4OXV A;  1Y9U A;  4ZEK A;  3KJ7 A;  4OEV A;  1H45 A;  1NKX A;  3IR1 A;  1BKA A;  3S9L C;  2KLF A;  1OQH A;  3ONM A;  1Y3P A;  4YIC A;  4GVO A;  4H65 A;  3QUF A;  3ZKL A;  3KOT A;  5M2V A;  3V83 A;  3TCH A;  2I58 A;  4GF8 A;  5DVJ A;  1ZKB A;  1UIV A;  2FNC A;  1QW0 A;  2GRV A;  1YTV A;  3G7W A;  5H8S A;  3S4U A;  2XD3 A;  1UTH A;  2ONS A;  4ESW A;  1P1U A;  5FHO A;  1P1W A;  2GFE A;  4KCD A;  4NMY A;  4XKN A;  1JVX A;  2XHD A;  3LR1 A;  3QAX A;  4POW A;  4KYE A;  4R73 A;  3OO9 A;  3SES A;  1IEJ A;  2G93 A;  2ONR A;  3V89 B;  5I59 B;  3S9E A;  3OO8 A;  1A55 A;  4OVJ A;  5DT6 A;  3TAJ A;  5ELV A;  3VXB A;  4AB5 A;  1FTK A;  3H3G A;  1BTJ A;  3C35 A;  3GBB A;  3B7D A;  3K00 A;  3CSB A;  2M8C A;  4KPT A;  3TCG A;  4POX A;  3FD3 A;  2OWT A;  3IO4 A;  5H8N A;  4HW8 A;  3PV0 E;  4G68 A;  1B1H A;  1Y20 A;  3N5L A;  5B7D A;  1IXC A;  4NF8 A;  3B6W A;  3K1M A;  4ZE8 A;  3BFU A;  3KOS A;  4PET A;  5L9O A;  2I3W A;  2CZL A;  3CVG A;  3SEX A;  1LAG E;  1SYI A;  2X7P A;  2Y7W A;  4DXU A;  1BLF A;  1FTM A;  3QSL A;  2F36 A;  4P0I A;  5H8N B;  2X7Q A;  1URD A;  5DVI A;  4YMA A;  5L9M A;  3TYH A;  4ZDM A;  2Z8D A;  4KQP A;  3EHT A;  2OLB A;  1IXI A;  4FJP A;  2XXW A;  2E1S A;  4GQO A;  5TP9 B;  5JK4 A;  2XXQ A;  4IGT A;  2XXI A;  1MY2 A;  3HHG A;  1MQD A;  4JWY A;  3H7M A;  4FOR A;  1ATG A;  1DOT A;  5I2N B;  1Z7N E;  3OD7 A;  1US5 A;  1LST A;  4LZ5 A;  1YPN A;  1AOV A;  1EH3 A;  3K2D A;  1M5F A;  1AH5 A;  3K6V A;  3UN6 A;  1SW1 A;  3OXN A;  5AA4 B;  4NWC A;  3U94 A;  4PFT A;  2O7I A;  3IB0 A;  2UVH A;  1MY4 A;  1XC1 A;  3MJN A;  4O3A A;  4OEU A;  4R6H A;  1MXY A;  1XS5 A;  2Y7I A;  4WKM A;  4R6K A;  1MXU A;  1YAE A;  4E0X A;  2YJP A;  1SI0 A;  3HCQ A;  4HCY A;  4I62 A;  3SKP A;  5HM4 B;  2P2A A;  4X1B A;  1S50 A;  3Q29 A;  3CIJ A;  3S9M C;  3PUW E;  2B3F A;  4Q8R A;  3TDJ A;  2DSF A;  1MQI A;  5H8Q A;  3USD A;  3T9X B;  1MPD A;  2YLN A;  1ZBM A;  2R9J A;  4WXJ A;  2DWH A;  4FE8 A;  4NED A;  1I69 A;  4OMB A;  4R9F A;  2BJJ X;  5DVF A;  3T93 B;  3TTL A;  1B46 A;  1S9T A;  4GRK A;  4G77 A;  1MY3 A;  4KI0 E;  4E0W A;  4ELO A;  4PP0 A;  5H8H B;  4FIM A;  4F19 A;  1LB8 A;  1SDX A;  3BKI B;  3O28 A;  4NTL A;  1B3L A;  4LUB A;  4ELR A;  2VD2 A;  4NF5 B;  3E13 X;  1USY H;  4OHN A;  5FTH A;  3OMB A;  2DE3 A;  1IXG A;  1B40 A;  2AYS A;  2Z8E A;  4GXA A;  4L17 A;  5F1Q A;  3RUM A;  4AB6 A;  4ZED A;  4DIG A;  5KZT A;  1Q35 A;  1B3H A;  3DLN A;  2V84 A;  4EUO A;  1II5 A;  5H8F B;  3LSL A;  1VR5 A;  4BDR A;  4QFP A;  3ILT B;  1SW5 A;  3VXC A;  1H3D A;  3K02 A;  2YPN A;  3MBP A;  1B52 A;  2XX8 A;  3SDF A;  3MP8 A;  1MY1 A;  3K6U A;  2RC7 A;  4F39 A;  5JEI A;  1DSN A;  2F6G A;  4G2Z A;  1B05 A;  3RY3 A;  4YB6 A;  1US4 A;  1B4H A;  3KN7 A;  4XKR A;  4PE5 B;  1TFD A;  1I6B A;  3O6I A;  1B5H A;  3MP6 A;  3B6Q A;  3HO7 A;  4WEP A;  5H8Q B;  3T9H B;  5EHM A;  2F35 A;  2IA4 A;  1TXF A;  3TTM A;  2H5Y A;  4RYA A;  3PPR A;  1HSJ A;  4JWO A;  4O3C A;  4BDM A;  1M5E A;  1B4Z A;  2THI A;  3LSX A;  1EU8 A;  1IIW A;  5L9S A;  3ILU B;  1Y1M A;  3LSF B;  1B3G A;  1UTB A;  4KHZ E;  4IO5 A;  1ZJL A;  5CMM A;  1DPE A;  3TFL A;  3F11 A;  3M8U A;  2RC8 A;  3PMX A;  4LAT A;  2H9B A;  4P0G A;  4LVQ A;  2RCB A;  3PUV E;  3IAZ A;  3K4U A;  3OOA A;  3I3V A;  2QS2 A;  4R6Y A;  3T66 A;  1ELJ A;  2DE4 A;  1JW1 A;  1Y1Z A;  2DWA A;  2HQ0 A;  2UYF A;  3H06 B;  4IO3 A;  1B7Z A;  3WAF A;  3GXA A;  4ZEC A;  4IB2 A;  2GHA A;  3FGS A;  1LLS A;  4R74 A;  4H67 A;  3TCF A;  2PT2 A;  1B0H A;  2F5X A;  4KR5 A;  5L8D A;  3OO7 A;  1A99 A;  1FCK A;  2PYY A;  1RYO A;  3IX1 A;  3SER A;  4DLD A;  5BUU A;  2W7Y A;  3TQL A;  4GWO A;  4JDF A;  1P99 A;  2NWJ A;  4N13 A;  1B6H A;  1FTL A;  1Y3Q A;  2QL3 A;  1N7W A;  1D9V A;  4OEN A;  1RYX A;  3TOD A;  1S7Y A;  3VLV A;  1QVS A;  3VFJ A;  1WVJ A;  4OZ9 A;  4X1D A;  1B0L A;  2F7A A;  3SEY A;  1D9Y A;  2Y84 A;  2NUV A;  2O1M A;  3FAT A;  3FUZ A;  3UOR A;  1VE4 A;  1A7L A;  1MDP 1;  1MXX A;  3FAS A;  3FIR A;  2FYI A;  2P0S A;  2D5W A;  1B58 A;  5HPQ A;  2HAU A;  2RIN A;  4GD5 A;  1F9B A;  4F1Y A;  1UTH B;  5CMC A;  1MRP A;  2I3V A;  3W9V A;  5AA3 A;  4HS7 A;  4IGR A;  3PPQ A;  2HEU A;  4BDL A;  4GOT A;  2DVZ A;  4G8H A;  5KDT A;  3CSG A;  4JB7 A;  4OWD A;  1XHY A;  1B7U A;  5AE4 A; 
#chains in the Genus database with same CATH topology
 1Y3N A;  2HZK A;  3FV1 A;  1JET A;  1KA1 A;  2XX9 A;  5AA2 D;  1NV6 A;  3C32 A;  4G68 B;  2F34 A;  3LBS A;  3O29 A;  4OYV A;  5DYH A;  4EDP A;  1Y4T A;  2I0B A;  2ZYK A;  1URG A;  1M5B A;  1O7T A;  2HFB A;  2UXA A;  3ZKK A;  1QKA A;  5KCJ A;  3IK6 B;  3GBA A;  3GYY A;  4EXL A;  1AMF A;  1BIY A;  2ZYO A;  2PMS A;  1MPB A;  4KCC A;  4NF4 B;  2O68 A;  3SEV A;  4LZ8 A;  5J1D A;  3FXQ A;  3A3U A;  4JXI A;  1XT8 A;  3VLU A;  4KFQ A;  3B8B A;  2OZZ A;  3S9N C;  1AL3 A;  1LEV A;  3RPW A;  3JZJ A;  4GIZ A;  4GWU A;  2B65 A;  1MQJ A;  5AA2 A;  4I40 A;  5AA4 A;  3IB2 A;  4RY1 A;  1OVB A;  3E4R A;  4QFK A;  3PUY E;  3THI A;  3MZB A;  5CBR A;  4PCD A;  3KSX A;  4RK2 A;  3PPP A;  2V3U A;  5I56 B;  5EQ7 A;  1DCU A;  3KFM A;  2WKY A;  4FEB A;  4QSE A;  5I57 B;  3T9V A;  2QPQ A;  4MH5 A;  4JSO A;  1B51 A;  1JQF A;  3HHF A;  5LDZ A;  2XX7 A;  1N3W A;  3VLW A;  2Q9T A;  4ELQ A;  3U92 A;  4ZS9 A;  2Q8J A;  1FBC A;  2XXT A;  1LBZ A;  5ET5 A;  3T1B A;  4FAT A;  4WED A;  2XXY A;  4GL0 A;  4TLM B;  2MKZ A;  4ONY A;  4MLV A;  3ROJ A;  3H4Z A;  4PFU A;  2PT1 A;  4YAH X;  1IMD A;  4XEQ A;  4EQB A;  3O6G A;  3IOV A;  2Y7K A;  3KSJ A;  3JYR A;  1IMC A;  2REG A;  3PUZ E;  1J1N A;  4AS5 A;  3ECR A;  3T22 A;  4H46 A;  4PQJ A;  3K6X A;  3HN0 A;  4MNC A;  1IQ7 A;  5CC2 A;  4P47 A;  4XIG Q;  1FPD A;  2XA5 A;  1FBE A;  4X04 A;  1ZIU A;  1K9Z A;  1GVC A;  2AL5 A;  1YYZ A;  3OO6 A;  2QS3 A;  5IKB A;  3FVG A;  4QFN A;  3TTK A;  2CZK A;  3RT8 A;  2QMW A;  2XD2 A;  4LQ5 A;  2HXW A;  3HPI A;  4MX6 A;  4AQ4 A;  1SD3 A;  3MZ1 A;  2DE2 A;  1A40 A;  2OK2 A;  2NVU B;  4PAI A;  1L5T A;  1NUZ A;  4PAF A;  3A09 A;  3TTN A;  5IGA A;  2R6G E;  2KQZ A;  3O9P A;  1NNF A;  1TWY A;  4ELO A;  1PB9 A;  4YB5 A;  3CR9 A;  3G3F A;  4I3E A;  4QRZ A;  3VE1 B;  3U1O A;  2UYE A;  4U2R A;  1MQH A;  3D4G A;  3N6U A;  5AA1 A;  2I6E A;  3H6W A;  2HAV A;  3U72 A;  4BDN A;  4X9T A;  4JWX A;  2ZMB A;  4OVT A;  2A5T A;  3SEU A;  3LSW A;  2OX3 A;  1SBP A;  3MW0 A;  1PEB A;  3KGC A;  4PBH A;  5ISU A;  1KZ8 A;  2H25 A;  3I5O A;  1PC3 A;  4O3B A;  1R1N A;  3S2V A;  1LCT A;  1M5C A;  1R9L A;  4IO4 A;  3FXU A;  4DE8 A;  1NV0 A;  1FQB A;  2FA7 A;  2Q8M A;  2RF1 A;  3BIG A;  2WYP A;  1DTZ A;  4G4P A;  3EF7 A;  3IJO B;  1POY 1;  1O63 A;  5CI5 A;  3LUY A;  4XKP A;  4EXK A;  4JBZ A;  3T9U A;  5K2Y A;  4C1U A;  3H03 A;  1HSE A;  4GX3 A;  4X48 A;  2QS1 A;  4G8N A;  4DXC A;  1A54 A;  4FEC A;  3UIF A;  1RKM A;  3OSQ A;  4OEV A;  1NKX A;  3IFC A;  4HE1 A;  1BKA A;  2KLF A;  1OQH A;  4YIC A;  3ISP A;  3QUF A;  5H8S A;  1ZKB A;  5AA3 A;  1YTV A;  4ESW A;  3KC0 A;  1P1W A;  2GFE A;  3LR1 A;  5I59 B;  2G93 A;  1FBG A;  5ESY A;  3EKI A;  5ELV A;  5IZ3 B;  3K00 A;  4KPT A;  2M8C A;  2OWT A;  3IO4 A;  4MEV A;  3PV0 E;  1Y20 A;  5B7D A;  3B6W A;  2CZL A;  3SEX A;  1SYI A;  1BLF A;  5DVI A;  2XXQ A;  1MQD A;  4JWY A;  1Z7N E;  1US5 A;  1AOV A;  5ET6 A;  1EH3 A;  1M5F A;  2O7I A;  1MY4 A;  3MJN A;  2Y5L A;  2Y7I A;  1FBH A;  4WKM A;  1YAE A;  2YJP A;  4HCY A;  2OWZ A;  3HCQ A;  3Q29 A;  3CIJ A;  5ET8 A;  1MQI A;  1MPD A;  4N6K A;  2YLN A;  2R9J A;  4ECF A;  4NED A;  3VVF A;  4OMB A;  1EZO A;  2BJJ X;  3T93 B;  4G77 A;  1MY3 A;  3BKI B;  3O28 A;  4LN5 A;  4NTL A;  1B3L A;  4ELR A;  3E13 X;  5FTH A;  2DE3 A;  5F1Q A;  4ZED A;  5KZT A;  3RPL B;  3VXC A;  3MBP A;  1B52 A;  1FBD A;  4PE5 B;  1TFD A;  3KBZ A;  3O6I A;  3B6Q A;  1TXF A;  2H5Y A;  5EQ8 A;  3PPR A;  1M5E A;  4OVQ A;  1XI6 A;  2THI A;  5L9S A;  1B3G A;  5CMM A;  1DPE A;  3TFL A;  3M8U A;  4LVQ A;  2RCB A;  1K9Y A;  3K4U A;  5IM2 A;  3OOA A;  1ELJ A;  1B7Z A;  4ZEC A;  3FGS A;  5BUU A;  4GWO A;  4JDF A;  2QL3 A;  1FTA A;  3VLV A;  4IR8 A;  4X1D A;  1EYJ A;  2O1M A;  2FYI A;  1B58 A;  4BDL A;  1IMF A;  4RXL A;  3EN3 A;  1ZU0 A;  2VT5 A;  5LTC A;  2VPO A;  1XVY A;  3GZG A;  3C9H A;  4OTE A;  4F3S A;  2FHY A;  1D3K A;  1GGG A;  1JW5 A;  2OCU A;  2QVU A;  2NXO A;  3EQ1 A;  1PDA A;  2L5V A;  5FHN A;  3QXM A;  5KDT B;  3IFA A;  4NF5 A;  3G3I A;  5J16 A;  3FJ7 A;  5K2X A;  3MVY A;  3TQW A;  4ESX A;  3KG2 A;  3IO6 A;  1FPI A;  1NH8 A;  1Q1K A;  2QS4 A;  1YZ0 A;  4QXD A;  3NOH A;  4F1U A;  4H6D A;  2A5S A;  3R7X A;  1CE2 A;  5EQ9 A;  5TP9 B;  1YCJ A;  2O84 X;  2QFL A;  3V5A A;  1XVX A;  3N26 A;  1PBP A;  4ND9 A;  3QUJ A;  3R6U A;  1H43 A;  2XXU A;  4PF8 A;  1IZ1 A;  3ZS6 A;  4OFJ A;  3TZA A;  4H5G A;  4IY5 A;  5IZZ A;  4ZE9 A;  1MM6 A;  4RNS A;  2G29 A;  3HST A;  3EHU A;  2RCA A;  2VGQ A;  4DI4 B;  2XWO A;  5F24 A;  5FTI A;  3HFU A;  4N81 A;  4R2B A;  2KR0 A;  4F2O A;  3KJT A;  5CMK A;  5DEX B;  3H6T A;  5FBP A;  2XWI A;  2CEX A;  2WBB A;  1NNK A;  1ANF A;  3U93 A;  3KC1 A;  2GH9 A;  1OIB A;  3G3G A;  3RQT A;  1YXI A;  1VSO A;  2ABH A;  1SW4 A;  1OMP A;  4Q5T A;  2HCA A;  2QJE A;  2VOZ A;  3RN8 A;  1GR2 A;  3L6H A;  3PU5 A;  5F7V A;  4H5F A;  3E9X A;  4P11 A;  1N3X A;  3JV9 A;  4BDO A;  5I57 A;  1N7X A;  2ALU A;  1IMB A;  1FQF A;  5ICQ A;  3K6W A;  4RPN A;  4P9K A;  5I7I A;  4H45 A;  3IOW A;  5EHS A;  2Y7P A;  2XXX A;  1CB6 A;  4MF3 A;  5IZ3 A;  3SET A;  1LBV A;  1WOD A;  1JP4 A;  3RYD A;  3WAE A;  4TQU Q;  3E78 A;  3MVZ A;  1FQC A;  3QYT A;  4TLL B;  1URS A;  4F3G A;  3UP9 A;  4N07 A;  1SYH A;  1QUL A;  2DS9 A;  1N76 A;  4F3B A;  2VD3 A;  1SPI A;  1R6Z A;  5TPA B;  3FJM A;  4F22 A;  2ANJ A;  4DDD A;  4LP2 B;  1ZLQ A;  4I3Y A;  1OVT A;  4DXB A;  3OEK A;  1FQD A;  2A5T B;  1NH7 A;  4N8G A;  4R72 A;  4BLA A;  5I2N A;  4ZEI A;  1NMU A;  3G3J A;  1OQG A;  2CZH A;  4XKQ A;  3L6G A;  3CFZ A;  1A8E A;  3CFL A;  2H4I A;  4KD5 A;  2X26 A;  1M5D A;  1RDX A;  2ZNS A;  3G3K A;  4FED A;  5CRY A;  4I9D A;  4MNI A;  3HV1 A;  4OER A;  1SVX B;  1LAH E;  2CMO A;  2QRY A;  1BK4 A;  2ONK E;  3Q27 A;  1HSL A;  3A29 A;  1P1O A;  4U1O A;  1QUK A;  1RDY A;  2F97 A;  3C4M A;  3MC2 A;  4F3P A;  4N15 A;  3MP1 A;  4RA1 A;  5I2K B;  5I56 A;  3MVW A;  4MLQ A;  1FPF A;  3IOR A;  4QFO A;  1NNT A;  2F8D A;  2V93 A;  3O6H A;  3TTR A;  3C31 A;  2XWK A;  4PTK A;  1VFD A;  2H98 A;  4O7M A;  4MAG A;  4PFW A;  4ZEB A;  3C36 A;  2PBW A;  5FHM A;  2R71 A;  4NWD A;  1Y9U A;  3E79 A;  1H45 A;  1Y3P A;  4GVO A;  4H65 A;  4NF0 A;  2F3B A;  3ZKL A;  5M2V A;  2CZI A;  4EQ9 A;  2GRV A;  1P1U A;  5FHO A;  4NMY A;  2PCR A;  4OVP A;  4XKN A;  4KYE A;  3SES A;  3S9E A;  3OO8 A;  1DK4 A;  1FTK A;  3GBB A;  4HW8 A;  1FPL A;  4G68 A;  4NF8 A;  3KOS A;  5L9O A;  2I3W A;  1LAG E;  2Y7W A;  3QSL A;  4NHB A;  1URD A;  4YMA A;  3EHT A;  5JK4 A;  1FPE A;  5I2N B;  1LST A;  1YPN A;  4O3A A;  1XS5 A;  1MXU A;  4E0X A;  2HXR A;  1SI0 A;  5HM4 B;  4I62 A;  2Q74 A;  2P2A A;  2GQ1 A;  3S9M C;  2DSF A;  3USD A;  1ZBM A;  5DVF A;  2DWH A;  4FE8 A;  1S9T A;  3FXB A;  1SDX A;  1USY H;  1IXG A;  2Z8E A;  2VPN A;  1Q9D A;  3LSL A;  4BDR A;  1H3D A;  3K02 A;  3MP8 A;  4GX4 A;  2RC7 A;  1DSN A;  4G2Z A;  1B05 A;  4YKK A;  3KN7 A;  1B5H A;  3HO7 A;  2F35 A;  4PE3 A;  1HSJ A;  4PAK A;  4BDM A;  1EU8 A;  1Y1M A;  4KHZ E;  1ZJL A;  4MIJ A;  3F11 A;  2RC8 A;  4P56 A;  3I3V A;  4R6Y A;  3T66 A;  4N6D A;  2DWA A;  1NV1 A;  4IB2 A;  2WEF A;  4H67 A;  1B0H A;  2F5X A;  5L8D A;  3OO7 A;  3SER A;  2W7Y A;  4PFR A;  2NWJ A;  1B6H A;  1S7Y A;  4JVI A;  3VFJ A;  1WVJ A;  4OZ9 A;  2PFY A;  1B0L A;  4NN3 A;  2Y84 A;  3FAT A;  3QMF A;  1A7L A;  3FIR A;  1MXX A;  2D5W A;  2JJK A;  3MYU A;  5CMC A;  3W9V A;  2I3V A;  4AS4 A;  1NI9 A;  3PPQ A;  2HEU A;  4GOT A;  5KDT A;  2HPG A;  4OWD A;  4XF5 A;  4MNP A;  1TFA A;  4LON B;  4GWZ A;  4O7I A;  4R9G A;  2REJ A;  1LCF A;  4U23 A;  5I84 A;  3PD9 A;  4P1L A;  3IB1 A;  4EF2 A;  2RKM A;  5I5P A;  4NF8 B;  2DYX A;  1MQG A;  4PDH A;  1Z7M E;  4I8C A;  3TPA A;  3PUX E;  1MS7 A;  4FAJ A;  5A5X B;  3TEL A;  1VFE A;  5B70 A;  1SW2 A;  4MBP A;  4P8B A;  1N0T A;  2UVG A;  3H6V A;  2V4C A;  2IEE A;  2ZYM A;  3EHS A;  2WX9 A;  4PC9 A;  1DTG A;  1NFT A;  1OLA A;  2FIX A;  3M3K A;  4QHQ A;  3IOU A;  4PDD A;  4PFB A;  2V3T A;  4H8I A;  1LAX A;  4UA8 A;  4OA4 A;  2XXH A;  2OWS A;  1VDW A;  4THI A;  4H1X A;  4NF6 B;  1B5J A;  4ELP A;  1IIT A;  1FW0 A;  1IXH A;  5CM6 A;  4DI3 D;  3DEL B;  4U22 A;  5H8F A;  3VVD A;  2VP1 A;  4YMB A;  4GLI A;  5TPA A;  3Q25 A;  4NE4 A;  3K01 A;  2Z8F A;  2ZZV A;  3RTF B;  1P1N A;  4U4X A;  3R26 A;  1JW4 A;  5ITP A;  4GBW A;  4QSD A;  3FJG A;  4YB7 A;  1B7H A;  2ZYN A;  1NUY A;  1EYI A;  1UIU A;  2I48 A;  1POT A;  2HHM A;  3LUZ A;  1LBX A;  3RPL A;  1NL5 A;  1PB8 A;  5CBS A;  1MDQ A;  2F7B A;  5LOM A;  2PFZ A;  4GBV A;  4YZZ A;  1B9J A;  1B32 A;  2I0C A;  4U1Z A;  5HBC A;  1Y4C A;  1N84 A;  1MXZ A;  1FQE A;  4IO2 A;  3MZ9 A;  1UTB B;  1FBP A;  5I58 B;  1I6Q A;  1A8F A;  2DWJ A;  4PBQ A;  1AIV A;  3K1P A;  2Q88 A;  1MG1 A;  4P1E A;  4N8Y A;  1IUD A;  3PGF A;  5T3J A;  4TOZ A;  3FVN A;  3N94 A;  3MAM A;  1NV2 A;  4HTG A;  1MPC A;  2QVR A;  3OEM A;  3TUS A;  5IAI A;  3SEW A;  2FBP A;  3DM0 A;  2OJT A;  2V25 A;  4EF1 A;  1N04 A;  4M1V A;  3VV5 A;  1QUI A;  3KEI A;  3MST A;  3V8X B;  2HZL A;  4XFE A;  5I59 A;  1O64 A;  1EZ9 A;  3DP8 A;  3IJX B;  3T96 B;  4EQ7 A;  4F18 A;  1D4N A;  3K1N A;  3O97 A;  2DQV A;  2Q2A A;  4JSD A;  2XXR A;  4NF4 A;  2PX1 A;  4G8M A;  3MPL A;  4GX6 A;  1T0K A;  2O7U A;  2E0S A;  3D4C A;  2F7C A;  1LAF E;  1B3E A;  2Q89 A;  4F29 A;  5JTY B;  2B4M A;  3KN3 A;  3MUQ A;  4NF6 A;  2UVI A;  3MWB A;  2LAO A;  3FBP A;  3IOT A;  4GXS B;  1NV7 A;  4OFO A;  4Q8R A;  3CFX A;  4YKJ A;  4ZEF A;  3CG3 A;  2GHB A;  4F1V A;  4U4S A;  5TP9 A;  2F78 A;  2RC9 A;  1XOC A;  4Q30 B;  5EQA A;  5H8H A;  3C33 A;  3CHG A;  4JVD A;  3DP4 A;  4YU0 A;  1JVY A;  1NNP A;  4NAP A;  2I49 A;  4YKP A;  4GWY A;  3PD8 A;  1G0I A;  1I6A A;  1H76 A;  3N6T A;  4UAC A;  3EPE A;  1MH4 A;  1MY0 A;  1QUJ A;  1BP5 A;  2D3I A;  4OQO A;  3RT6 B;  2ESN A;  3TMG A;  5BWJ A;  2O51 A;  3A3C A;  1NV3 A;  2Z22 A;  2I4C A;  2WBD A;  4F2Q A;  2ZZX A;  2Y7R A;  1FPK A;  1FQA A;  4G68 C;  4U21 A;  3U8Q A;  4F31 B;  4ZZA A;  3PPN A;  4ZEK A;  3IR1 A;  3ONM A;  5DVJ A;  1NV5 A;  2I58 A;  2FNC A;  2FIE A;  1UTH A;  2ONS A;  3QAX A;  4POW A;  4R73 A;  3OO9 A;  1NUX A;  1IEJ A;  3V89 B;  5ET7 A;  1A55 A;  4OVJ A;  4AB5 A;  3VXB A;  1BTJ A;  3B7D A;  3CSB A;  4NG7 A;  4GWX A;  4N91 A;  3FD3 A;  4POX A;  4HE0 A;  3N5L A;  3K1M A;  3CVG A;  2X7P A;  4DXU A;  4P0I A;  2F36 A;  5H8N B;  3TYH A;  4KQP A;  4QBA A;  2OLB A;  4FJP A;  4GQO A;  4IGT A;  4MJO A;  3H7M A;  1IME A;  1ATG A;  1DOT A;  4PFI A;  4LZ5 A;  3UN6 A;  1SW1 A;  5AA4 B;  3U94 A;  4PFT A;  1G0H A;  2XWV A;  4R6H A;  4OEU A;  1MXY A;  3SKP A;  2B3F A;  5H8Q A;  2Y5K A;  3TTL A;  1I69 A;  1B46 A;  4GRK A;  4E0W A;  4GWW A;  5H8H B;  4FIM A;  4F19 A;  4LUB A;  2VD2 A;  3OMB A;  3RUM A;  1B40 A;  1FPG A;  4L17 A;  4AB6 A;  3SZP A;  3DLN A;  2V84 A;  4EUO A;  1II5 A;  1VR5 A;  1LBW A;  1AWB A;  4PGP A;  4FBP A;  3SDF A;  1MY1 A;  3K6U A;  4P3L A;  4JVC A;  3RY3 A;  4XKR A;  4WEP A;  5EHM A;  2IA4 A;  3TTM A;  3LSX A;  1UTB A;  1FRP A;  4IO5 A;  4LAT A;  4ZE8 A;  2DE4 A;  1JW1 A;  1Y1Z A;  2UYF A;  3WAF A;  5I3S A;  4R74 A;  3TCF A;  1FCK A;  4DLD A;  2PYY A;  3TQL A;  1P99 A;  4N13 A;  1Y3Q A;  4OEN A;  1RYX A;  1QVS A;  2F7A A;  3FUZ A;  1VE4 A;  3FAS A;  5HPQ A;  2P0S A;  2RIN A;  4GD5 A;  1F9B A;  4F1Y A;  1UTH B;  1MRP A;  4HS7 A;  4IGR A;  2DVZ A;  4G8H A;  3CSG A;  4KR5 A;  5AE4 A;  3ODB A;  3GLB A;  4UAB A;  4Q0C A;  1PB7 A;  2XXP A;  3RTW B;  2FVZ A;  1ZMG A;  1RDZ A;  3Q28 A;  4Z0I A;  1WDN A;  1D9Q A;  1P1Q A;  1MXV A;  4I1D A;  2D21 A;  4ISU A;  4LA9 A;  3CG1 A;  5H8N A;  1FTO A;  1NUW A;  4QFL A;  1SQY A;  5I58 A;  4PFY A;  1DPP A;  3W15 C;  2Q2C A;  1B3F A;  4C0R A;  4GL8 A;  3D1R A;  3E3K A;  1MH3 A;  2OBG A;  5EYG A;  2P1S A;  2DWI A;  3TEP A;  3C34 A;  2DOJ A;  3OEN A;  3KZG A;  4N6P A;  3PMV A;  2VHA A;  3FVK A;  3KBR A;  1EYK A;  2DVC A;  4IY6 A;  1B2H A;  3KN8 A;  4OES A;  4QF9 A;  3M3F A;  1JEU A;  1FTJ A;  2ZNT A;  4MFI A;  5A5L A;  4XXU A;  2O1L A;  5TU0 A;  3QIM A;  4O94 A;  3I6V A;  4QSC A;  4MMP A;  2I4B A;  4DCY A;  3VDF A;  3T0J A;  3RLF E;  3CRB A;  1CNQ A;  4IO6 A;  4RJZ A;  2F6P A;  1LFG A;  4M4G A;  4GFR A;  4H0W A;  2XXV A;  2B3B A;  3BFT A;  3FXR A;  3B6T A;  4K3F A;  3TKD A;  2DXR A;  3UGW A;  3O2A A;  3W9W A;  5I2K A;  4Z7E A;  1LBC A;  4LZ7 A;  3CI8 A;  4LQ2 A;  2CEY A;  1FPJ A;  2DXY A;  2NOO A;  2AIX A;  1LFI A;  3LV0 A;  5KCJ B;  4O8M A;  1USY E;  5CMB A;  3O66 A;  3M3L A;  1KWH A;  3FZV A;  1UQW A;  4KYS A;  2O69 A;  1QKB A;  3QK6 A;  5DW8 A;  2QSX A;  2QVV A;  5EYH A;  4X8R A;  3Q26 A;  4PF6 A;  1R9Q A;  3PPO A;  2Z23 A;  4GWS A;  3DP6 A;  4HE2 A;  4N4U A;  5JTY A;  4OVR A;  2H99 A;  2PVU A;  3FVO A;  4C1T A;  3FV2 A;  1IMA A;  1B1X A;  2ZNU A;  5AA2 B;  3P7I A;  1JEV A;  1B5I A;  2AL4 A;  4OVS A;  1ZTY A;  1LFH A;  5EYF A;  1JNF A;  1FSA A;  4MHF A;  4IO7 A;  1FPB A;  4NGU A;  3K0V A;  3PMW A;  5IZ1 A;  1OLC A;  3MPK A;  1DMB A;  3OEL A;  4HCW A;  3OSR A;  4OFL A;  5ITO A;  5A5X A;  2B4L A;  3RGY A;  3MQ9 A;  3LC8 A;  4XTC Q;  4H8J A;  4BDQ A;  3ZSF A;  4KYD A;  3UA8 A;  1H44 A;  4ZZE A;  3VVE A;  1LBB A;  2UVJ A;  3H6U A;  4NQ8 A;  2QMX A;  2ZXT A;  4HXV A;  1TT1 A;  3UK4 A;  4DCX A;  5DEX A;  3BIH A;  3MVX A;  1PBQ A;  2BJI A;  5DTB A;  3G3H A;  5ICT A;  3B50 A;  2F3D A;  4OET A;  1LGB C;  3AXF A;  2DP8 A;  1FJ9 A;  1INP A;  4RPO A;  4R2F A;  3RNN A;  4RK9 A;  4YKI A;  1SI1 A;  4N17 A;  1DBZ A;  1GTK A;  1QJM A;  1MXW A;  2V3Q A;  1GV8 A;  1LB9 A;  1MM7 A;  2O6A A;  3IL1 B;  4DZ1 A;  4R75 A;  3BBR A;  4OXV A;  3KJ7 A;  1FJ6 A;  3S9L C;  2DDK A;  3KOT A;  3V83 A;  3TCH A;  4GF8 A;  1UIV A;  1QW0 A;  3G7W A;  3S4U A;  2XD3 A;  1KA0 A;  4KCD A;  1EZP A;  1JVX A;  2XHD A;  3PTY A;  2ONR A;  4G61 A;  1NV4 A;  5DT6 A;  3TAJ A;  3H3G A;  2XXK A;  3C35 A;  3TCG A;  1B1H A;  4KXP A;  1IXC A;  4NX1 A;  3BFU A;  4PET A;  4MCO A;  3U65 A;  1FTM A;  2X7Q A;  2P3V A;  5L9M A;  4ZDM A;  2Z8D A;  1IXI A;  2XXW A;  2E1S A;  2XXI A;  1MY2 A;  3HHG A;  4FOR A;  3OD7 A;  3K2D A;  1AH5 A;  3K6V A;  3OXN A;  4NWC A;  3IB0 A;  2UVH A;  1XC1 A;  4R6K A;  4X1B A;  1S50 A;  3PUW E;  3TDJ A;  2ZZW A;  3T9X B;  4WXJ A;  4R9F A;  4KI0 E;  4PP0 A;  1LB8 A;  4NF5 B;  2P3N A;  4PGN A;  1LBY A;  4OHN A;  4GXA A;  2AYS A;  4DIG A;  1Q35 A;  1B3H A;  5H8F B;  4QFP A;  3ILT B;  1SW5 A;  2YPN A;  2XX8 A;  4OAN A;  4F39 A;  5JEI A;  2F6G A;  4YB6 A;  1US4 A;  1B4H A;  1I6B A;  2R8T A;  3MP6 A;  5H8Q B;  3T9H B;  4RYA A;  4O3C A;  4JWO A;  2WYK A;  1B4Z A;  1IIW A;  3ILU B;  3LSF B;  3PMX A;  2H9B A;  4P0G A;  3PUV E;  3IAZ A;  1FBF A;  2QS2 A;  1QGX A;  3H06 B;  2HQ0 A;  4IO3 A;  3GXA A;  2GHA A;  1LLS A;  2PT2 A;  1A99 A;  3IX1 A;  1RYO A;  1FTL A;  1N7W A;  1D9V A;  3TOD A;  3SEY A;  1D9Y A;  2NUV A;  3UOR A;  1MDP 1;  2HAU A;  4JB7 A;  1XHY A;  1B7U A; 
#chains in the Genus database with same CATH homology
 4RXL A;  1TFA A;  4LON B;  4R9G A;  1Y3N A;  3EN3 A;  2REJ A;  3GLB A;  3ODB A;  1LCF A;  2HZK A;  1ZU0 A;  1JET A;  3FV1 A;  4Q0C A;  1PB7 A;  2XX9 A;  4U23 A;  3PD9 A;  5I84 A;  2XXP A;  5AA2 D;  3IB1 A;  3RTW B;  1XVY A;  2RKM A;  4EF2 A;  3GZG A;  3C9H A;  4OTE A;  3C32 A;  4G68 B;  1ZMG A;  4F3S A;  2F34 A;  3LBS A;  3Q28 A;  1D3K A;  4NF8 B;  3O29 A;  2DYX A;  4Z0I A;  1MQG A;  1WDN A;  1GGG A;  1JW5 A;  4OYV A;  5DYH A;  1P1Q A;  4EDP A;  1MXV A;  1Y4T A;  1Z7M E;  4I8C A;  4I1D A;  2OCU A;  3TPA A;  2D21 A;  1MS7 A;  2I0B A;  3CG1 A;  3PUX E;  4ISU A;  1FTO A;  4LA9 A;  2NXO A;  4QFL A;  1SQY A;  2ZYK A;  3EQ1 A;  4FAJ A;  5I58 A;  1PDA A;  4PFY A;  1DPP A;  3W15 C;  1URG A;  5A5X B;  2Q2C A;  1M5B A;  5FHN A;  3QXM A;  1B3F A;  3TEL A;  4NF5 A;  1VFE A;  4GL8 A;  4C0R A;  5KDT B;  5B70 A;  1O7T A;  2HFB A;  2UXA A;  3G3I A;  4YKK A;  3ZKK A;  1QKA A;  3E3K A;  1SW2 A;  5KCJ A;  3FJ7 A;  5K2X A;  1MH3 A;  2OBG A;  4MBP A;  3IK6 B;  1N0T A;  2UVG A;  3GBA A;  3H6V A;  3MVY A;  4EXL A;  1AMF A;  1BIY A;  3TQW A;  2ZYO A;  2IEE A;  3VLU A;  2PMS A;  4ESX A;  1MPB A;  2ZYM A;  3EHS A;  4KCC A;  2P1S A;  3KG2 A;  2O68 A;  4NF4 B;  3SEV A;  2DWI A;  3IO6 A;  4C1T A;  4ECF A;  3C34 A;  3TEP A;  2DOJ A;  1NH8 A;  1Q1K A;  1DTG A;  1NFT A;  1OLA A;  2QS4 A;  3M3K A;  3FXQ A;  3OEN A;  4QHQ A;  5J1D A;  3A3U A;  4JXI A;  4F1U A;  4H6D A;  3IOU A;  3KZG A;  1XT8 A;  2A5S A;  2V3T A;  4N6P A;  1CE2 A;  1LAX A;  4H8I A;  3PMV A;  2VHA A;  1YCJ A;  2O84 X;  2XXH A;  2OWS A;  2OZZ A;  3FVK A;  4UA8 A;  3KBR A;  1EZP A;  2DVC A;  3S9N C;  1AL3 A;  4IY6 A;  3V5A A;  3RPW A;  1XVX A;  4EQ9 A;  3N26 A;  4THI A;  1B2H A;  3JZJ A;  1PBP A;  4GIZ A;  4ND9 A;  3QUJ A;  3R6U A;  4H1X A;  4NF6 B;  3KN8 A;  1B5J A;  4ELP A;  1IIT A;  2B65 A;  1MQJ A;  4OES A;  4QF9 A;  5AA2 A;  1H43 A;  1FW0 A;  1IXH A;  3M3F A;  1JEU A;  5CM6 A;  2XXU A;  5AA4 A;  1IZ1 A;  1FTJ A;  2ZNT A;  3IB2 A;  4RY1 A;  3ZS6 A;  4MFI A;  1OVB A;  3DEL B;  4XXU A;  4U22 A;  5H8F A;  4OFJ A;  3TZA A;  3VVD A;  3E4R A;  4H5G A;  4IY5 A;  4QFK A;  3PUY E;  2VP1 A;  3MZB A;  3THI A;  4YMB A;  4ZE9 A;  1MM6 A;  4GLI A;  4RNS A;  2G29 A;  2O1L A;  5TPA A;  3HST A;  5TU0 A;  3EHU A;  5CBR A;  2RCA A;  2VGQ A;  3KSX A;  3Q25 A;  4RK2 A;  3QIM A;  5FTI A;  4NE4 A;  3PPP A;  3K01 A;  2V3U A;  2Z8F A;  3I6V A;  4QSC A;  3RTF B;  4R2B A;  5I56 B;  1P1N A;  4U4X A;  4F2O A;  3R26 A;  1JW4 A;  3KFM A;  5ITP A;  3KJT A;  2WKY A;  4FEB A;  4QSE A;  2I4B A;  4QSD A;  3T9V A;  5CMK A;  3FJG A;  4DCY A;  5I57 B;  5DEX B;  4YB7 A;  3VDF A;  1B7H A;  3H6T A;  2ZYN A;  3RLF E;  3CRB A;  4IO6 A;  4RJZ A;  1UIU A;  2I48 A;  1NNK A;  1ANF A;  2F6P A;  2QPQ A;  4MH5 A;  3U93 A;  4JSO A;  3VVF A;  1B51 A;  1JQF A;  1LFG A;  1POT A;  3HHF A;  2GH9 A;  4GFR A;  4M4G A;  2XX7 A;  1N3W A;  4H0W A;  3VLW A;  2Q9T A;  2XXV A;  1OIB A;  3G3G A;  3RQT A;  1NL5 A;  3U92 A;  1PB8 A;  2B3B A;  4ELQ A;  1VSO A;  2ABH A;  3BFT A;  4ZS9 A;  1SW4 A;  2Q8J A;  5CBS A;  1OMP A;  1MDQ A;  3FXR A;  3B6T A;  4K3F A;  2F7B A;  3TKD A;  2DXR A;  2XXT A;  4LZ8 A;  4Q5T A;  5LOM A;  4YZZ A;  1B9J A;  2HCA A;  2QJE A;  1B32 A;  3UGW A;  2VOZ A;  2I0C A;  3RN8 A;  4FAT A;  3O2A A;  3W9W A;  4U1Z A;  4WED A;  5HBC A;  4Z7E A;  1GR2 A;  5I2K A;  2XXY A;  1Y4C A;  4GL0 A;  3L6H A;  3PU5 A;  5F7V A;  4TLM B;  1LBC A;  4H5F A;  4LZ7 A;  4ONY A;  4MLV A;  1N84 A;  3CI8 A;  1MXZ A;  1FQE A;  3E9X A;  4LQ2 A;  3H4Z A;  4P11 A;  1N3X A;  4PFU A;  2PT1 A;  3JV9 A;  4YAH X;  4IO2 A;  3MZ9 A;  4BDO A;  5I57 A;  1UTB B;  1N7X A;  5I58 B;  2DXY A;  1I6Q A;  2ALU A;  1A8F A;  2AIX A;  2DWJ A;  2NOO A;  4EQB A;  1AIV A;  3K1P A;  3O6G A;  2Q88 A;  3IOV A;  1LFI A;  1FQF A;  1MG1 A;  2Y7K A;  3KSJ A;  5KCJ B;  3JYR A;  5ICQ A;  3K6W A;  1USY E;  4RPN A;  3O66 A;  5CMB A;  2REG A;  3M3L A;  1KWH A;  1IUD A;  3FZV A;  3PUZ E;  1UQW A;  4KYS A;  3PGF A;  3IOW A;  1J1N A;  4TOZ A;  2Y7P A;  2O69 A;  2XXX A;  1CB6 A;  3FVN A;  3MAM A;  3N94 A;  4MF3 A;  5EHS A;  1QKB A;  3QK6 A;  3ECR A;  4HTG A;  2QSX A;  3SET A;  1WOD A;  3T22 A;  4PQJ A;  3K6X A;  1MPC A;  3HN0 A;  3Q26 A;  1R9Q A;  3OEM A;  3TUS A;  5IAI A;  3SEW A;  3WAE A;  1IQ7 A;  3DM0 A;  2OJT A;  4TQU Q;  2V25 A;  3PPO A;  4XIG Q;  4EF1 A;  1N04 A;  5CC2 A;  4M1V A;  3VV5 A;  1QUI A;  2Z23 A;  3MVZ A;  3KEI A;  1ZIU A;  1FQC A;  3V8X B;  3QYT A;  3DP6 A;  2HZL A;  5JTY A;  5I59 A;  4TLL B;  1GVC A;  2H99 A;  2PVU A;  3FVO A;  1O64 A;  1EZ9 A;  1URS A;  3DP8 A;  3IJX B;  3FV2 A;  3T96 B;  3UP9 A;  4N07 A;  4F3G A;  2AL5 A;  1B1X A;  4EQ7 A;  3OO6 A;  2QS3 A;  2ZNU A;  5AA2 B;  3FVG A;  1SYH A;  3P7I A;  4QFN A;  1QUL A;  2DS9 A;  1N76 A;  3TTK A;  4F3B A;  1JEV A;  4F18 A;  1B5I A;  1D4N A;  2AL4 A;  3RT8 A;  3K1N A;  2QMW A;  2VD3 A;  3O97 A;  1ZTY A;  1LFH A;  2DQV A;  2XD2 A;  4LQ5 A;  5EYF A;  2Q2A A;  2HXW A;  3HPI A;  4AQ4 A;  1SD3 A;  1JNF A;  4JSD A;  2XXR A;  4NF4 A;  2PX1 A;  4IO7 A;  1R6Z A;  3K0V A;  3MZ1 A;  2DE2 A;  5TPA B;  3FJM A;  4G8M A;  4F22 A;  3PMW A;  1A40 A;  2ANJ A;  3MPL A;  2OK2 A;  1OLC A;  3MPK A;  2NVU B;  2O7U A;  1T0K A;  1DMB A;  4DDD A;  2E0S A;  3D4C A;  2F7C A;  3OEL A;  1ZLQ A;  4LP2 B;  1L5T A;  1LAF E;  4HCW A;  3OSR A;  1OVT A;  4OFL A;  1B3E A;  5ITO A;  4DXB A;  3OEK A;  2Q89 A;  1FQD A;  3A09 A;  5JTY B;  4F29 A;  2A5T B;  5A5X A;  1NH7 A;  3TTN A;  3KN3 A;  4R72 A;  3RGY A;  4BLA A;  5I2N A;  2R6G E;  3MQ9 A;  3MUQ A;  4NF6 A;  2UVI A;  3O9P A;  1NNF A;  3LC8 A;  4ZEI A;  4XTC Q;  4H8J A;  1NMU A;  1TWY A;  3G3J A;  3MWB A;  3ZSF A;  1OQG A;  4BDQ A;  2LAO A;  4KYD A;  1PB9 A;  4XKQ A;  4YB5 A;  3IOT A;  3CFZ A;  3CR9 A;  3L6G A;  4GXS B;  1H44 A;  1A8E A;  3G3F A;  4OFO A;  4ZZE A;  3UA8 A;  3CFX A;  4YKJ A;  3VVE A;  3CFL A;  2H4I A;  4ZEF A;  4KD5 A;  4QRZ A;  3VE1 B;  3U1O A;  2UYE A;  2X26 A;  1M5D A;  2ZNS A;  3CG3 A;  3G3K A;  4U2R A;  3R7X A;  1MQH A;  1EZO A;  3D4G A;  3N6U A;  1LBB A;  5AA1 A;  2GHB A;  4FED A;  4F1V A;  4U4S A;  2UVJ A;  3H6U A;  5CRY A;  4I9D A;  5TP9 A;  2I6E A;  2F78 A;  3H6W A;  2RC9 A;  2HAV A;  1XOC A;  4Q30 B;  3U72 A;  3HV1 A;  4OER A;  4BDN A;  1SVX B;  1LAH E;  4X9T A;  5H8H A;  4JWX A;  2QMX A;  2ZMB A;  2CMO A;  2A5T A;  2QRY A;  2ZXT A;  3SEU A;  2ONK E;  3LSW A;  1TT1 A;  3C33 A;  3UK4 A;  3Q27 A;  1SBP A;  1HSL A;  3MW0 A;  4DCX A;  1P1O A;  5DEX A;  4U1O A;  1QUK A;  3DP4 A;  1PEB A;  3MVX A;  2F97 A;  3C4M A;  3KGC A;  3MC2 A;  4YU0 A;  5ISU A;  1JVY A;  1NNP A;  2I49 A;  1PBQ A;  2H25 A;  3I5O A;  1PC3 A;  4O3B A;  1R1N A;  5DTB A;  4F3P A;  4YKP A;  3S2V A;  1LCT A;  1M5C A;  1R9L A;  3G3H A;  3FXU A;  4IO4 A;  5ICT A;  4DE8 A;  4OET A;  1LGB C;  3AXF A;  2DP8 A;  3PD8 A;  1FQB A;  2FA7 A;  1I6A A;  3MP1 A;  4RPO A;  1H76 A;  2RF1 A;  3N6T A;  3EPE A;  4RA1 A;  4UAC A;  5I2K B;  4R2F A;  5I56 A;  3MVW A;  1DTZ A;  1MH4 A;  3RNN A;  1MY0 A;  4G4P A;  4MLQ A;  3EF7 A;  3IJO B;  1QUJ A;  1BP5 A;  2D3I A;  4OQO A;  4RK9 A;  3RT6 B;  4KFQ A;  4YKI A;  1SI1 A;  1POY 1;  1O63 A;  3IOR A;  5CI5 A;  2ESN A;  3LUY A;  4XKP A;  3TMG A;  4EXK A;  4JBZ A;  2O51 A;  4QFO A;  5BWJ A;  3T9U A;  1NNT A;  2F8D A;  2V93 A;  5K2Y A;  3A3C A;  3O6H A;  2Z22 A;  3H03 A;  4C1U A;  3TTR A;  2I4C A;  4F2Q A;  1HSE A;  1GTK A;  1QJM A;  3C31 A;  2Y7R A;  4X48 A;  2QS1 A;  1MXW A;  2V3Q A;  1GV8 A;  1VFD A;  2H98 A;  4G8N A;  4DXC A;  5IKB A;  1FQA A;  4PFW A;  1LB9 A;  1MM7 A;  4G68 C;  2O6A A;  1A54 A;  4U21 A;  3C36 A;  3IL1 B;  4FEC A;  4ZEB A;  3U8Q A;  4F31 B;  4DZ1 A;  4R75 A;  1RKM A;  2PBW A;  3BBR A;  4ZZA A;  5FHM A;  3UIF A;  2R71 A;  3PPN A;  4NWD A;  3OSQ A;  4OXV A;  1Y9U A;  4ZEK A;  3KJ7 A;  4OEV A;  1H45 A;  1NKX A;  3IR1 A;  1BKA A;  3S9L C;  2KLF A;  1OQH A;  3ONM A;  1Y3P A;  4YIC A;  4GVO A;  4H65 A;  3QUF A;  3ZKL A;  3KOT A;  5M2V A;  3V83 A;  3TCH A;  2I58 A;  4GF8 A;  5DVJ A;  1ZKB A;  1UIV A;  2FNC A;  1QW0 A;  2GRV A;  1YTV A;  3G7W A;  5H8S A;  3S4U A;  2XD3 A;  1UTH A;  2ONS A;  4ESW A;  1P1U A;  5FHO A;  1P1W A;  2GFE A;  4KCD A;  4NMY A;  4XKN A;  1JVX A;  2XHD A;  3LR1 A;  3QAX A;  4POW A;  4KYE A;  4R73 A;  3OO9 A;  3SES A;  1IEJ A;  2G93 A;  2ONR A;  3V89 B;  5I59 B;  3S9E A;  3OO8 A;  1A55 A;  4OVJ A;  5DT6 A;  3TAJ A;  5ELV A;  3VXB A;  4AB5 A;  1FTK A;  3H3G A;  1BTJ A;  3C35 A;  3GBB A;  3B7D A;  3K00 A;  3CSB A;  2M8C A;  4KPT A;  3TCG A;  4POX A;  3FD3 A;  2OWT A;  3IO4 A;  5H8N A;  4HW8 A;  3PV0 E;  4G68 A;  1B1H A;  1Y20 A;  3N5L A;  5B7D A;  1IXC A;  4NF8 A;  3B6W A;  3K1M A;  4ZE8 A;  3BFU A;  3KOS A;  4PET A;  5L9O A;  2I3W A;  2CZL A;  3CVG A;  3SEX A;  1LAG E;  1SYI A;  2X7P A;  2Y7W A;  4DXU A;  1BLF A;  1FTM A;  3QSL A;  2F36 A;  4P0I A;  5H8N B;  2X7Q A;  1URD A;  5DVI A;  4YMA A;  5L9M A;  3TYH A;  4ZDM A;  2Z8D A;  4KQP A;  3EHT A;  2OLB A;  1IXI A;  4FJP A;  2XXW A;  2E1S A;  4GQO A;  5TP9 B;  5JK4 A;  2XXQ A;  4IGT A;  2XXI A;  1MY2 A;  3HHG A;  1MQD A;  4JWY A;  3H7M A;  4FOR A;  1ATG A;  1DOT A;  5I2N B;  1Z7N E;  3OD7 A;  1US5 A;  1LST A;  4LZ5 A;  1YPN A;  1AOV A;  1EH3 A;  3K2D A;  1M5F A;  1AH5 A;  3K6V A;  3UN6 A;  1SW1 A;  3OXN A;  5AA4 B;  4NWC A;  3U94 A;  4PFT A;  2O7I A;  3IB0 A;  2UVH A;  1MY4 A;  1XC1 A;  3MJN A;  4O3A A;  4OEU A;  4R6H A;  1MXY A;  1XS5 A;  2Y7I A;  4WKM A;  4R6K A;  1MXU A;  1YAE A;  4E0X A;  2YJP A;  1SI0 A;  3HCQ A;  4HCY A;  4I62 A;  3SKP A;  5HM4 B;  2P2A A;  4X1B A;  1S50 A;  3Q29 A;  3CIJ A;  3S9M C;  3PUW E;  2B3F A;  4Q8R A;  3TDJ A;  2DSF A;  1MQI A;  5H8Q A;  3USD A;  3T9X B;  1MPD A;  2YLN A;  1ZBM A;  2R9J A;  4WXJ A;  2DWH A;  4FE8 A;  4NED A;  1I69 A;  4OMB A;  4R9F A;  2BJJ X;  5DVF A;  3T93 B;  3TTL A;  1B46 A;  1S9T A;  4GRK A;  4G77 A;  1MY3 A;  4KI0 E;  4E0W A;  4ELO A;  4PP0 A;  5H8H B;  4FIM A;  4F19 A;  1LB8 A;  1SDX A;  3BKI B;  3O28 A;  4NTL A;  1B3L A;  4LUB A;  4ELR A;  2VD2 A;  4NF5 B;  3E13 X;  1USY H;  4OHN A;  5FTH A;  3OMB A;  2DE3 A;  1IXG A;  1B40 A;  2AYS A;  2Z8E A;  4GXA A;  4L17 A;  5F1Q A;  3RUM A;  4AB6 A;  4ZED A;  4DIG A;  5KZT A;  1Q35 A;  1B3H A;  3DLN A;  2V84 A;  4EUO A;  1II5 A;  5H8F B;  3LSL A;  1VR5 A;  4BDR A;  4QFP A;  3ILT B;  1SW5 A;  3VXC A;  1H3D A;  3K02 A;  2YPN A;  3MBP A;  1B52 A;  2XX8 A;  3SDF A;  3MP8 A;  1MY1 A;  3K6U A;  2RC7 A;  4F39 A;  5JEI A;  1DSN A;  2F6G A;  4G2Z A;  1B05 A;  3RY3 A;  4YB6 A;  1US4 A;  1B4H A;  3KN7 A;  4XKR A;  4PE5 B;  1TFD A;  1I6B A;  3O6I A;  1B5H A;  3MP6 A;  3B6Q A;  3HO7 A;  4WEP A;  5H8Q B;  3T9H B;  5EHM A;  2F35 A;  2IA4 A;  1TXF A;  3TTM A;  2H5Y A;  4RYA A;  3PPR A;  1HSJ A;  4JWO A;  4O3C A;  4BDM A;  1M5E A;  1B4Z A;  2THI A;  3LSX A;  1EU8 A;  1IIW A;  5L9S A;  3ILU B;  1Y1M A;  3LSF B;  1B3G A;  1UTB A;  4KHZ E;  4IO5 A;  1ZJL A;  5CMM A;  1DPE A;  3TFL A;  3F11 A;  3M8U A;  2RC8 A;  3PMX A;  4LAT A;  2H9B A;  4P0G A;  4LVQ A;  2RCB A;  3PUV E;  3IAZ A;  3K4U A;  3OOA A;  3I3V A;  2QS2 A;  4R6Y A;  3T66 A;  1ELJ A;  2DE4 A;  1JW1 A;  1Y1Z A;  2DWA A;  2HQ0 A;  2UYF A;  3H06 B;  4IO3 A;  1B7Z A;  3WAF A;  3GXA A;  4ZEC A;  4IB2 A;  2GHA A;  3FGS A;  1LLS A;  4R74 A;  4H67 A;  3TCF A;  2PT2 A;  1B0H A;  2F5X A;  4KR5 A;  5L8D A;  3OO7 A;  1A99 A;  1FCK A;  2PYY A;  1RYO A;  3IX1 A;  3SER A;  4DLD A;  5BUU A;  2W7Y A;  3TQL A;  4GWO A;  4JDF A;  1P99 A;  2NWJ A;  4N13 A;  1B6H A;  1FTL A;  1Y3Q A;  2QL3 A;  1N7W A;  1D9V A;  4OEN A;  1RYX A;  3TOD A;  1S7Y A;  3VLV A;  1QVS A;  3VFJ A;  1WVJ A;  4OZ9 A;  4X1D A;  1B0L A;  2F7A A;  3SEY A;  1D9Y A;  2Y84 A;  2NUV A;  2O1M A;  3FAT A;  3FUZ A;  3UOR A;  1VE4 A;  1A7L A;  1MDP 1;  1MXX A;  3FAS A;  3FIR A;  2FYI A;  2P0S A;  2D5W A;  1B58 A;  5HPQ A;  2HAU A;  2RIN A;  4GD5 A;  1F9B A;  4F1Y A;  1UTH B;  5CMC A;  1MRP A;  2I3V A;  3W9V A;  5AA3 A;  4HS7 A;  4IGR A;  3PPQ A;  2HEU A;  4BDL A;  4GOT A;  2DVZ A;  4G8H A;  5KDT A;  3CSG A;  4JB7 A;  4OWD A;  1XHY A;  1B7U A;  5AE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...