5TU0A

1.9 angstrom resolution crystal structure of maltose-binding periplasmic protein male from listeria monocytogenes in complex with maltose
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
385
structure length
385
Chain Sequence
SDEKTLTVSVDAGYKDYVNKIKGDFEKDNDVKVKVVEKDMFETLEALPLDGPAGTAPDVMMSAFDRIGSLGQQGHLAEVKLGNKDDYDEKDQKQVTIDDKIYGAPAIIETLVLYYNKDLLDKAPATFKDLETLSKDSRFAFTSEKGKNTGFLAKWTDFYFSYGLLAGYGGYVFGDEGTNPKDIGLNNKGSVEGITYATKWFQDVWPKGMQDNKSADDFIQDQFVKGKAAAILGGPWSAANYKEAKINYGVAKIPTLNNGKEYSPFAGGKGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMTNEVPANLKARDTAKSKNDELTNAVIEQYKNAQPMPNIPEMSEVWTGAENLKFDAASGSKTPQPSADDAVKVIEDNVTQKYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Lmo2125 protein
publication title 1.9 Angstrom Resolution Crystal Structure of Maltose-Binding Periplasmic Protein MalE from Listeria monocytogenes in Complex with Maltose.
rcsb
source organism Listeria monocytogenes serovar 1/2a
total genus 142
structure length 385
sequence length 385
ec nomenclature
pdb deposition date 2016-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5tu0A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5tu0A02
3TAJA 1LAFE 4WEDA 4H67A 1YCJA 1LBBA 3OOAA 3HCQA 3VXBA 1SW5A 4F3GA 4OWDA 1GV8A 3C33A 3TTRA 2VOZA 2XX7A 1FTOA 2O7UA 4ZZEA 3OD7A 4G8MA 4OXVA 1ANFA 3RT6B 2E0SA 2CMOA 4F18A 3ZS6A 3V89B 4QSEA 1B6HA 4KCCA 4NTLA 5TP9B 2DWIA 3K6WA 1ZJLA 2XD2A 2QPQA 1A8EA 5CBSA 3SETA 3H6WA 2DXRA 1UTHB 3TELA 3S9NC 5DT6A 1LAGE 4Z0IA 1NFTA 4MFIA 1JW1A 1SVXB 1MPDA 3C36A 2V84A 3R26A 4ZS9A 1NKXA 5KCJB 1BP5A 1OLAA 3HPIA 2F6GA 2RKMA 3PD9A 3RTWB 1IEJA 2PT2A 3TUSA 4F22A 5H8NB 4EXLA 3EHUA 4YKJA 3G3JA 3IOVA 2O51A 2ZXTA 5I2NB 5I2KA 5KDTB 3IB1A 4KI0E 3MP1A 1IXGA 1S50A 3U1OA 3PPPA 1M5EA 4NMYA 2NOOA 3MZ1A 1B7ZA 4NF5A 4ESXA 3Q28A 1LCTA 3IK6B 2DE4A 4RJZA 4IO6A 2GH9A 3MAMA 4M1VA 2ONRA 3H7MA 5FHMA 2QS3A 2OZZA 1B5JA 2B3FA 2XXVA 3JZJA 4EQ9A 5CM6A 3S9MC 1MRPA 2O1LA 3VVFA 1EZPA 5DEXB 2THIA 4JSDA 4R2FA 1A99A 1B1XA 4F19A 2Q89A 1JNFA 1I6AA 3C9HA 3KZGA 5AA2A 2Q9TA 1NNKA 1PBQA 3G3GA 1MXWA 5IAIA 3RGYA 2XXRA 1IIWA 2XXUA 3FASA 1O64A 1JVYA 3K4UA 1I6QA 2NWJA 1DPEA 1AH5A 1S9TA 3OENA 3MBPA 3A3CA 5I57B 2DVCA 1N3WA 1LB9A 3KFMA 3LC8A 4XTCQ 3U94A 3KEIA 1US4A 2V3TA 1N0TA 4AQ4A 3T9HB 4JWOA 4KHZE 2ZNTA 3W9VA 4DE8A 4NE4A 4IO7A 2OLBA 3K1PA 3TTNA 4RXLA 5KZTA 4PFWA 1XS5A 3LSFB 4U1OA 2Q2CA 4NF6B 5L9OA 2I58A 5ELVA 2R71A 4HCWA 1ZTYA 4RY1A 3OSRA 1JETA 1XVXA 1J1NA 1BIYA 2ZYKA 4KYDA 3TDJA 4KYEA 3P7IA 4NEDA 4QFLA 2AL5A 1B51A 3KN8A 3TODA 3RNNA 2XXPA 2WKYA 4DCYA 3R6UA 3IR1A 4GRKA 3WAEA 5A5XA 1FQAA 4LP2B 4ELQA 3LSLA 4G68B 2Q88A 4Q30B 4R72A 3IO6A 3ONMA 1H3DA 4LZ5A 5TPAA 1XHYA 2D5WA 1LAXA 2HAUA 1MXZA 3KG2A 5FHOA 4KR5A 2UVHA 3IAZA 2B3BA 2ESNA 4KCDA 5CMKA 1D4NA 2AL4A 1NNTA 3IO4A 3ILUB 4N6PA 2DS9A 2QMXA 3O6IA 2XXXA 5FTIA 1B40A 4U4XA 2GRVA 4FEBA 3OEMA 1RYOA 2P2AA 4Z7EA 3KSXA 1AMFA 1VE4A 3FGSA 3JYRA 4H65A 4PQJA 2Z23A 4DLDA 4ZEFA 5DVJA 3TCGA 1FW0A 1B5IA 4JWYA 4JXIA 1SBPA 4U21A 3O2AA 5HPQA 5AA4A 1XOCA 3TTKA 2B65A 5CBRA 1LFIA 3HHGA 3OSQA 2OK2A 3G3IA 2D21A 1B0HA 1FQDA 4PE5B 5EHMA 3U8QA 1QW0A 4E0XA 4WKMA 3N26A 1FQCA 3B6QA 5IKBA 2DP8A 2HZLA 2QS1A 3B6WA 4U1ZA 3UGWA 4IY5A 3FATA 3MQ9A 4OESA 4R9FA 4OMBA 3KN7A 4MBPA 1URGA 5H8FA 2DWHA 3HN0A 1YPNA 1SW4A 2O69A 2DE2A 4G2ZA 4TOZA 1OLCA 1B05A 2I3WA 4ZEBA 2AIXA 1B3EA 4F3PA 3IX1A 3PMXA 1NNFA 4QRZA 2V25A 3ODBA 4ZEKA 2PX1A 1B2HA 2GFEA 4EQ7A 1MY2A 1B7HA 1NNPA 1AL3A 3H6UA 2BJJX 3FVOA 1F9BA 3TCHA 3OMBA 4THIA 3SESA 4ZZAA 4QFKA 4ZECA 5FTHA 1EU8A 1POTA 3C31A 3TCFA 4U23A 3MVYA 4QF9A 4YMBA 3CFXA 1WVJA 3PPOA 3U72A 3CSGA 4NWCA 3KSJA 1N3XA 1VR5A 4I62A 3C4MA 3MVZA 1ZKBA 3DP4A 3KN3A 4IO3A 4C0RA 2GHAA 3RPWA 1SW2A 4NF5B 5LOMA 5I56B 3H06B 4I1DA 3N6TA 2UVIA 5CRYA 3T96B 1BTJA 1Y9UA 2GHBA 1B0LA 2A5TB 1GVCA 5JK4A 5DVFA 3S4UA 1SDXA 4OFJA 2UYEA 4C1UA 4NF4A 4E0WA 1B3LA 1O7TA 4GXSB 2Y7PA 2X26A 4ELOA 1SW1A 4I9DA 4BLAA 2ANJA 3N94A 2PYYA 1LGBC 1P1OA 2P1SA 4OHNA 1R1NA 1ELJA 4TLMB 3T9UA 5CI5A 3EHSA 3S9LC 3H6TA 3DP6A 3HO7A 2KLFA 5H8QB 1MQDA 1PB9A 3GBBA 4YKIA 1PB7A 3L6GA 4RPOA 2Z8FA 1TWYA 4O3AA 3KJ7A 2XXQA 4R2BA 4IO4A 4FJPA 4M4GA 4GXAA 5H8HA 2IEEA 1P99A 3G7WA 5JTYA 1TT1A 1M5FA 3SKPA 5ISUA 4ZE8A 1Y1MA 4UA8A 2XXHA 3VVEA 2F34A 2LAOA 3T9XB 1YAEA 3C32A 1II5A 3IL1B 3M8UA 4F39A 4RK2A 5FHNA 3FIRA 3PGFA 4DXBA 2G93A 1P1UA 4KYSA 3T22A 3Q25A 2HQ0A 2H5YA 1TFAA 1R9QA 3EPEA 4XXUA 2XX8A 4G8NA 1Y4CA 4MLQA 3MZ9A 5CC2A 3RUMA 1I6BA 4LQ2A 1XT8A 2A5SA 2RC9A 3MP8A 5TP9A 1MXVA 2Y7WA 2DXYA 3MPKA 1POY1 4H8IA 4LZ7A 1ZBMA 1NMUA 4F3SA 3CI8A 4IB2A 1FQBA 1N76A 2ONKE 4HW8A 1EH3A 4KPTA 1UTHA 3F11A 3E13X 4EF2A 3Q26A 2I0CA 4YB5A 2HCAA 4GF8A 3UA8A 1MY4A 3BBRA 3EQ1A 3H6VA 5K2YA 5A5XB 5AA2D 3CFLA 4R6HA 3FJ7A 4KFQA 1NH7A 1SI0A 3TPAA 3FVKA 3FV1A 1MQHA 3FV2A 5TPAB 1PB8A 3IJXB 1JW5A 4ELRA 3Q27A 2F78A 3BKIB 2ZNUA 1MY0A 3FVGA 4LZ8A 4ELPA 2ABHA 5I2NA 4OYVA 1P1QA 5KDTA 4Q8RA 4GL0A 1LLSA 3CVGA 3VLVA 4OVJA 3SEUA 2NUVA 3UIFA 1EZOA 4YAHX 4IO5A 3ECRA 4LONB 5J1DA 5I59B 1MY3A 3TKDA 4YZZA 4F1VA 2O68A 3HV1A 5BWJA 3W9WA 3LSWA 5AA1A 1R9LA 4POXA 5ICTA 1ZMGA 4XIGQ 5DTBA 3DP8A 1LFGA 3FXUA 2H9BA 2UVGA 3CRBA 3MJNA 3PUVE 3PPQA 1SD3A 5L9SA 3OEKA 3MUQA 2VP1A 2ZMBA 2RCBA 1JEVA 1MG1A 5DEXA 3SERA 2QS2A 2ZYOA 1MM6A 4MLVA 3MWBA 4F3BA 5ITOA 3PUWE 3I5OA 2AYSA 2DE3A 1OQGA 4RNSA 2IA4A 1B4HA 3O6GA 5BUUA 4QHQA 3EN3A 4ZEIA 4ZDMA 2O1MA 3V83A 3OO8A 1B7UA 3SEWA 3BFTA 3C35A 1B4ZA 1QJMA 1FQFA 4NF8A 1BKAA 2H25A 1ZIUA 3TMGA 3TTLA 2QRYA 1RKMA 1H44A 2DOJA 1MM7A 3KOTA 3MP6A 3TYHA 1OMPA 4KD5A 3MW0A 3DM0A 4HTGA 5K2XA 4EDPA 3QXMA 2UXAA 4NF6A 4ZE9A 2P0SA 2UYFA 5I58B 2F8DA 4JWXA 4N07A 2OWTA 3RLFE 2UVJA 2Y84A 1IITA 3UK4A 4U22A 3DLNA 5DVIA 2FNCA 2I6EA 3GXAA 2OJTA 4C1TA 3S2VA 2VHAA 4JBZA 1LFHA 1JVXA 3QIMA 2NXOA 3O9PA 4P11A 2RC8A 4K3FA 2HZKA 1AIVA 4H8JA 2YPNA 2I49A 4DZ1A 1YTVA 1UTBA 3G3KA 4HCYA 1A40A 4BDMA 4P0IA 2QMWA 1A54A 1H76A 3FJMA 3QUFA 1FQEA 5ITPA 1JQFA 2YLNA 2PBWA 3QUJA 2XXTA 2XD3A 4ND9A 2REJA 3K01A 1QUKA 3O66A 1MXXA 3PPRA 3SEYA 1ZU0A 3VXCA 3H03A 3QAXA 5AE4A 2XXWA 4NF4B 4H6DA 1MXUA 4Q0CA 4YICA 1Q35A 2Z22A 4H0WA 3D4CA 2HFBA 2ZYMA 3RTFB 2R6GE 3IB2A 1D9VA 5B70A 4WXJA 2DWAA 3C34A 3VV5A 4GIZA 4YB7A 1A55A 1PEBA 1IZ1A 1L5TA 4F1YA 1Y3NA 4X1BA 3CG1A 4P0GA 4RA1A 4MF3A 3VLUA 5I2KB 3GBAA 4F2OA 2YJPA 4LA9A 1VFDA 5H8HB 1URDA 3MVWA 1P1NA 4DXUA 1US5A 2M8CA 5EHSA 3HSTA 3G3FA 4GQOA 3K00A 4PP0A 3SDFA 4FIMA 4G4PA 5AA3A 3BFUA 3T66A 1Y3PA 4L17A 3QK6A 3RN8A 1Y20A 4NWDA 1I69A 3FD3A 3IOTA 2OCUA 4GD5A 1O63A 1DTGA 5M2VA 3V8XB 3FZVA 3PUYE 4ZEDA 2HXWA 2RCAA 4PETA 2Y7RA 3A3UA 4YMAA 2RINA 3ZSFA 3B6TA 4PFYA 4BDLA 5AA2B 1MY1A 2RF1A 3OO7A 1R6ZA 3W15C 3H3GA 1QUJA 4TQUQ 1B3HA 3K1NA 1LB8A 1Z7ME 1A8FA 4OTEA 3KJTA 1Q1KA 4IGRA 1S7YA 3PV0E 2Z8EA 4QFOA 1URSA 1MPBA 2RC7A 1VSOA 1USYE 1XVYA 1P1WA 4TLLB 4QSCA 3M3FA 3IOUA 2REGA 4OENA 2O84X 1B32A 3PMVA 5ICQA 3CG3A 1B58A 4G8HA 2DYXA 2VGQA 4GOTA 3L6HA 2ZYNA 4LQ5A 3T9VA 5EYFA 1VFEA 2DVZA 5HBCA 3UN6A 2QS4A 4ECFA 5I56A 4GFRA 4YB6A 2F7AA 1OVBA 3K2DA 3RY3A 4AB5A 2R9JA 4QSDA 3M3LA 1D3KA 1ATGA 2V93A 4RK9A 1TFDA 3I3VA 1MQIA 2A5TA 1MDQA 1QUIA 4XKNA 2QJEA 2F97A 3ZKLA 4R73A 2Y7KA 1FTLA 1N7WA 3PUXE 1HSJA 4QFPA 2H98A 3IORA 4YKPA 3VDFA 1M5DA 3O29A 4JB7A 1SQYA 3CFZA 5L8DA 5KCJA 4EUOA 4F2QA 3SEVA 1RYXA 2FA7A 4BDRA 1QVSA 1FTKA 1QULA 5H8NA 4HS7A 4NF8B 5H8QA 3UORA 1SYIA 1IXHA 5B7DA 4F29A 3K6XA 3OO6A 1OIBA 2E1SA 4O3BA 2G29A 2X7QA 3GLBA 2W7YA 3TFLA 3O28A 1N04A 3LR1A 2Q2AA 3QSLA 2DWJA 1QKBA 2QSXA 1H43A 2F5XA 2DSFA 3R7XA 3IOWA 1H45A 5F1QA 3S9EA 4YKKA 1B5HA 2ONSA 3T93B 4DCXA 1OVTA 3O6HA 1MPCA 2CZLA 4XKQA 3PMWA 3OO9A 1IXCA 3I6VA 5I84A 1N7XA 3TEPA 3TZAA 1GGGA 1IQ7A 3IB0A 2XX9A 1WDNA 2XXIA 4U4SA 2ZNSA 5TU0A 2Z8DA 3U92A 1HSLA 4X9TA 1Y4TA 4GWOA 1ZLQA 3MPLA 1FTMA 1JW4A 4IY6A 4OEUA 3G3HA 2H99A 2O7IA 1DOTA 5AA4B 1MXYA 1Y3QA 2F7CA 2PT1A 2F36A 3V5AA 1QKAA 3USDA 1B52A 1NL5A 2PMSA 3VVDA 4BDNA 2VD3A 1FCKA 3ZKKA 4R9GA 5JEIA 3GZGA 3K0VA 1Y1ZA 4OZ9A 4XKRA 3VLWA 1OQHA 2HEUA 4F31B 1UIUA 4Q5TA 4X48A 5I57A 4BDOA 1UTBB 2V3QA 3E4RA 4G68C 4IGTA 4EXKA 1LAHE 1M5BA 3MVXA 4N13A 1PC3A 1MQJA 1AOVA 3CIJA 3HHFA 4EF1A 1USYH 3E3KA 1DMBA 1NH8A 2D3IA 3FXQA 3RT8A 5H8FB 4LATA 4H1XA 5CMMA 2Q8JA 2ALUA 3KBRA 2I4CA 2FYIA 4R6YA 1XC1A 3KGCA 3TTMA 4UACA 3D4GA 3H4ZA 1GR2A 1Z7NE 1B1HA 4ESWA 5I59A 2F6PA 1T0KA 3LSXA 4LUBA 2Y7IA 4GVOA 5L9MA 3OELA 1PBPA 1DTZA 3IJOB 1MH3A 3TQLA 4FAJA 2I0BA 3QYTA 1IXIA 3RQTA 1B3FA 2PVUA 1DSNA 4YU0A 4G77A 3K02A 2DQVA 1GTKA 1UIVA 3FJGA 4LVQA 1DPPA 4XKPA 4MH5A 4R75A 4OFOA 3VE1B 4R6KA 3PUZE 4I8CA 2O6AA 4H5FA 1B9JA 3DELB 4OQOA 4PFUA 4RYAA 1B46A 1EZ9A 4DDDA 4OETA 3TQWA 3UP9A 3M3KA 2NVUB 3O97A 3KOSA 4G68A 4OEVA 3CR9A 2F35A 5HM4B 2X7PA 2I4BA 3THIA 1TXFA 4OFLA 1MH4A 4ISUA 3FXRA 2HAVA 2I48A 4JSOA 1MQGA 1B3GA 4FEDA 1JEUA 1PDAA 3LUYA 2VD2A 4BDQA 1UQWA 1N84A 3U93A 2XXYA 4GL8A 3EHTA 3LBSA 4RPNA 3PD8A 2QL3A 3FUZA 1A7LA 3JV9A 2F7BA 4JDFA 2H4IA 1LCFA 3E9XA 3EF7A 1SI1A 1MDP1 5F7VA 1BLFA 3K6VA 3K6UA 3CSBA 1FTJA 1IUDA 4R74A 3OXNA 3A09A 4DIGA 3AXFA 3ILTB 1LSTA 4FE8A 1D9YA 2XHDA 5I58A 4FECA 5CMCA 1CE2A 5H8SA 1CB6A 3N6UA 3PU5A 4GLIA 3PPNA 4PFTA 1LBCA 3SEXA 4O3CA 1KWHA 4U2RA 2I3VA 3VFJA 1M5CA 2OBGA 1HSEA 4WEPA 3FVNA 3B7DA 2V3UA 4FATA 4AB6A 3WAFA 4DXCA 3MZBA 4POWA 4F1UA 1WODA 4FORA 3N5LA 4QFNA 4ONYA 4OERA 4EQBA 4KQPA 3Q29A 1MS7A 5DYHA 2OWSA 5JTYB 4H5GA 3MC2A 5CMBA 4X1DA 3K1MA 1SYHA 4IO2A
chains in the Genus database with same CATH superfamily
3RPLA 3TAJA 1LAFE 4WEDA 4H67A 1YCJA 4NAPA 1LBBA 1EYJA 4AS4A 3OOAA 3HCQA 3VXBA 1SW5A 4F3GA 2QVRA 4OWDA 1RDZA 1GV8A 3C33A 1FJ9A 2F3BA 3TTRA 2VOZA 2XX7A 1FTOA 2O7UA 4ZZEA 3OD7A 1FBDA 4G8MA 4OXVA 1ANFA 2FHYA 4MEVA 3RT6B 2E0SA 2CMOA 4F18A 3NOHA 3ZS6A 3V89B 2Q74A 4QSEA 1B6HA 4KCCA 4NTLA 5TP9B 2DWIA 3K6WA 1ZJLA 2XD2A 2QPQA 1A8EA 5CBSA 3SETA 3H6WA 2DXRA 1UTHB 3TELA 3E79A 3S9NC 5DT6A 1LAGE 4Z0IA 1NFTA 4MFIA 1JW1A 1SVXB 2XWVA 1MPDA 3C36A 2V84A 3R26A 4ZS9A 1NKXA 5KCJB 1BP5A 4HXVA 1OLAA 3HPIA 2F6GA 2RKMA 3PD9A 3RTWB 1IEJA 2PT2A 3TUSA 4F22A 5H8NB 4EXLA 3EHUA 4FBPA 4YKJA 3G3JA 3IOVA 2L5VA 2O51A 2ZXTA 5I2NB 5FBPA 5I2KA 5KDTB 3IB1A 5I5PA 1NV0A 4KI0E 1NV5A 3MP1A 1IXGA 1S50A 3U1OA 3PPPA 5ESYA 1M5EA 5EQ7A 4NMYA 2NOOA 3MZ1A 1B7ZA 4NF5A 1NV2A 1FJ6A 4ESXA 3Q28A 1LCTA 2KR0A 3IK6B 2DE4A 4RJZA 2ZZVA 4IO6A 2GH9A 2WYPA 3MAMA 4M1VA 2ONRA 3H7MA 5FHMA 2P3VA 4OVTA 2BJIA 2QS3A 1RDXA 2OZZA 1B5JA 2FBPA 2B3FA 2XXVA 3JZJA 4EQ9A 5CM6A 3S9MC 1MRPA 2O1LA 3VVFA 4GWUA 1EZPA 1NUXA 2VT5A 5DEXB 2THIA 4PGNA 4JSDA 4R2FA 1A99A 1B1XA 4F19A 3ROJA 2Q89A 1JNFA 1I6AA 3C9HA 3KZGA 5AA2A 2QVVA 2Q9TA 1K9YA 1NNKA 1EYKA 1PBQA 3G3GA 1MXWA 5IAIA 3RGYA 2XXRA 1IIWA 2XXUA 1FBHA 3FASA 1O64A 1JVYA 1LBVA 3K4UA 1I6QA 2NWJA 1DPEA 1AH5A 1S9TA 3OENA 3MBPA 3A3CA 3EKIA 5I57B 2DVCA 1N3WA 1LB9A 3KFMA 3LC8A 4XTCQ 3U94A 3KEIA 1US4A 2V3TA 1N0TA 4AQ4A 3T9HB 4PFIA 4JWOA 4KHZE 4P3LA 2ZNTA 3W9VA 4DE8A 4NE4A 4IO7A 2OLBA 3K1PA 3TTNA 4RXLA 1LBWA 5KZTA 4PFWA 1XS5A 3LSFB 4U1OA 2Q2CA 4NF6B 5L9OA 2I58A 1CNQA 2PFZA 5ELVA 4QXDA 2P3NA 4G61A 2R71A 1FBFA 4HCWA 1ZTYA 4RY1A 3OSRA 1JETA 1XVXA 1J1NA 5A5LA 1BIYA 2XWKA 4PF8A 2ZYKA 4KYDA 3TDJA 4KYEA 3P7IA 4NEDA 4QFLA 2AL5A 4O7MA 1B51A 3KN8A 3BIGA 3TODA 1FPIA 4GX6A 3RNNA 2XXPA 2WKYA 4DCYA 4QBAA 3R6UA 2XWIA 3IR1A 3ISPA 4GRKA 3WAEA 4KXPA 5A5XA 1LBYA 3LUZA 1FQAA 4LP2B 4ELQA 3LSLA 4IR8A 4G68B 2Q88A 3B50A 4Q30B 4R72A 4PGPA 3IO6A 3ONMA 2CZHA 1H3DA 4LZ5A 5TPAA 1XHYA 2D5WA 1LAXA 2HAUA 1MXZA 3KG2A 5FHOA 4KR5A 2UVHA 3IAZA 2B3BA 4PFBA 2ESNA 4KCDA 5CMKA 1D4NA 2AL4A 1NNTA 3IO4A 3ILUB 4N6PA 2DS9A 4MX6A 2QMXA 3O6IA 2XXXA 5FTIA 1B40A 3KBZA 4U4XA 2GRVA 4FEBA 3OEMA 1RYOA 2P2AA 4O8MA 4Z7EA 5IZ3A 3KSXA 4GBWA 1KA1A 1AMFA 1VE4A 4H46A 3FGSA 3JYRA 4H65A 4PQJA 2Z23A 4DLDA 4ZEFA 5DVJA 3TCGA 2XXKA 1FW0A 1B5IA 4JWYA 4JXIA 1SBPA 4U21A 5EYGA 2QVUA 4I3YA 2ZZWA 3O2AA 5HPQA 2VPNA 5AA4A 1XOCA 3TTKA 1FPJA 2B65A 5CBRA 1LFIA 3HHGA 3OSQA 2OK2A 4NX1A 3G3IA 2D21A 1B0HA 1FQDA 4PE5B 5EHMA 3U8QA 1QW0A 4E0XA 4WKMA 3N26A 1FQCA 3U65A 3B6QA 5IKBA 2DP8A 2HZLA 2QS1A 3B6WA 4U1ZA 3UGWA 2F3DA 4N15A 4IY5A 3FATA 5I7IA 1KZ8A 3MQ9A 4OESA 4R9FA 4OMBA 3KN7A 1LBZA 4MBPA 1URGA 5H8FA 2DWHA 3HN0A 1YPNA 1SW4A 2O69A 4PAKA 1NV1A 2DE2A 4G2ZA 4TOZA 1OLCA 1B05A 3BIHA 2I3WA 1FPLA 4ZEBA 2AIXA 1B3EA 4F3PA 3IX1A 3PMXA 1NNFA 4QRZA 2V25A 3ODBA 4ZEKA 2XA5A 2PX1A 1B2HA 2GFEA 4HE1A 4EQ7A 1MY2A 1FPBA 1B7HA 1NNPA 1AL3A 1DBZA 3H6UA 4N6DA 2BJJX 3FVOA 1FSAA 1F9BA 3TCHA 3OMBA 4THIA 3SESA 4ZZAA 4QFKA 4ZECA 4PC9A 5FTHA 1EU8A 1POTA 3C31A 3TCFA 2HPGA 4U23A 3MVYA 4QF9A 4YMBA 3CFXA 1WVJA 3PPOA 3U72A 2B4MA 4X04A 3CSGA 4DI4B 4NWCA 3KSJA 1N3XA 1VR5A 4I62A 3C4MA 3MVZA 1ZKBA 3DP4A 3KN3A 4IO3A 4C0RA 2GHAA 3RPWA 1SW2A 4NF5B 5LOMA 5I56B 4PAFA 3H06B 4I1DA 3N6TA 4NF0A 2UVIA 5F24A 5CRYA 3T96B 1BTJA 1Y9UA 1IMBA 2WEFA 2GHBA 2FIXA 4UABA 1B0LA 2A5TB 1GVCA 5JK4A 5DVFA 3S4UA 1SDXA 4O94A 4OFJA 2UYEA 4C1UA 4NF4A 4E0WA 1B3LA 1O7TA 4GXSB 4P56A 2Y7PA 2X26A 4ELOA 1SW1A 4I9DA 4BLAA 2ANJA 3N94A 3HFUA 2PYYA 4NG7A 4N91A 1LGBC 1P1OA 2P1SA 4OHNA 1R1NA 1ELJA 4TLMB 3T9UA 5CI5A 3EHSA 3S9LC 3H6TA 3DP6A 5IZ1A 3CHGA 3HO7A 2KLFA 4NN3A 5H8QB 1MQDA 1PB9A 5IZZA 3GBBA 4YKIA 1PB7A 3L6GA 4RPOA 2Z8FA 1TWYA 4O3AA 3KJ7A 2XXQA 4R2BA 4IO4A 4FJPA 4M4GA 5ET8A 4GXAA 5H8HA 2IEEA 1P99A 3G7WA 5JTYA 1TT1A 1M5FA 2JJKA 3SKPA 5ISUA 4ZE8A 1FPEA 1IMCA 2CZKA 1Y1MA 4UA8A 2XXHA 3VVEA 2F34A 2LAOA 3T9XB 1YAEA 3C32A 1FPDA 1II5A 3IL1B 3M8UA 4F39A 4RK2A 5FHNA 3FIRA 3PGFA 4DXBA 2G93A 1P1UA 4KYSA 1IMEA 3T22A 3Q25A 2HQ0A 1LEVA 1FBEA 2H5YA 2OWZA 1TFAA 1R9QA 3EPEA 4XXUA 2XX8A 4G8NA 1Y4CA 4MLQA 2QFLA 1LBXA 1IMFA 1NI9A 3MZ9A 5CC2A 3RUMA 1NV7A 1I6BA 4LQ2A 1XT8A 2A5SA 2RC9A 4GX3A 3MP8A 5TP9A 1MXVA 2Y7WA 2DXYA 3MPKA 1POY1 4H8IA 4LZ7A 3B8BA 1ZBMA 1NMUA 4F3SA 3CI8A 4IB2A 1FQBA 1N76A 2ONKE 4HW8A 1EH3A 4KPTA 5EQAA 1UTHA 3F11A 3E13X 4EF2A 3Q26A 2I0CA 4YB5A 2HCAA 4GF8A 1MY4A 3BBRA 4PDHA 3EQ1A 3UA8A 3H6VA 5K2YA 5A5XB 5AA2D 3CFLA 1YZ0A 4R6HA 2B4LA 3FJ7A 4KFQA 1NH7A 1SI0A 4PBHA 3TPAA 3FVKA 3FV1A 1MQHA 3FV2A 5TPAB 1PB8A 3IJXB 1JW5A 4ELRA 3Q27A 2F78A 3BKIB 2ZNUA 1MY0A 3FVGA 4N6KA 4LZ8A 4ELPA 2ABHA 5I2NA 4OYVA 1P1QA 5KDTA 4OVSA 4Q8RA 4GL0A 1LLSA 3CVGA 3VLVA 4OVJA 3SEUA 2NUVA 3UIFA 1EZOA 4YAHX 4IO5A 3ECRA 4LONB 5J1DA 5I59B 1MY3A 3TKDA 4YZZA 4F1VA 2O68A 2WYKA 3HV1A 5BWJA 3W9WA 3LSWA 4PDDA 5AA1A 1R9LA 4POXA 5ICTA 1ZMGA 4XIGQ 5DTBA 3DP8A 1LFGA 3FXUA 2H9BA 2UVGA 4HE0A 3CRBA 3MJNA 3PUVE 3PPQA 1SD3A 3QMFA 5L9SA 3OEKA 3MUQA 2VP1A 2ZMBA 2RCBA 1JEVA 1MG1A 5DEXA 3SERA 2QS2A 2ZYOA 1MM6A 4MLVA 3MWBA 4F3BA 2FIEA 5ITOA 2MKZA 4OA4A 3PUWE 3I5OA 2AYSA 2DE3A 1OQGA 4RNSA 2IA4A 1B4HA 3O6GA 5BUUA 4QHQA 3EN3A 4ZEIA 4ZDMA 2O1MA 3V83A 3OO8A 1B7UA 4GWZA 3SEWA 3BFTA 3C35A 1B4ZA 1QJMA 1FQFA 4NF8A 1BKAA 2Y5LA 2H25A 1ZIUA 3TMGA 3TTLA 2QRYA 1RKMA 1H44A 2DOJA 5ET6A 1MM7A 2CEXA 4PTKA 3KOTA 3MP6A 3TYHA 1OMPA 2V4CA 4KD5A 4DI3D 3MW0A 3DM0A 4HTGA 4PBQA 5K2XA 4EDPA 4PCDA 1G0HA 3D1RA 3QXMA 2UXAA 4NF6A 4ZE9A 2Y5KA 2P0SA 4AS5A 2UYFA 5I58B 2F8DA 4JWXA 4N07A 2OWTA 3RLFE 2UVJA 2Y84A 1IITA 3UK4A 4U22A 2DDKA 3DLNA 5DVIA 2WBBA 2FNCA 2I6EA 3GXAA 2OJTA 4C1TA 3S2VA 2VHAA 4JBZA 1LFHA 1JVXA 3IFAA 3QIMA 4MNIA 4GWYA 2NXOA 4NHBA 3O9PA 1IMDA 4P11A 2RC8A 4K3FA 2HZKA 4N17A 1AIVA 4H8JA 2YPNA 2I49A 4DZ1A 1YTVA 1UTBA 4O7IA 3RPLB 3G3KA 4HCYA 1A40A 4BDMA 4P0IA 2QMWA 2CZIA 1A54A 1H76A 3FJMA 3QUFA 1FQEA 5ITPA 1JQFA 2YLNA 2PBWA 3QUJA 4GX4A 2XXTA 2XD3A 4ND9A 2REJA 3K01A 1QUKA 3O66A 5IGAA 4JVDA 1MXXA 3PPRA 4P1LA 3SEYA 1ZU0A 3VXCA 3H03A 3QAXA 5AE4A 2XXWA 4NF4B 4H6DA 1MXUA 4Q0CA 4YICA 3GYYA 4H45A 4GWXA 1Q35A 2Z22A 4H0WA 3D4CA 5ET5A 2WBDA 2HFBA 2ZYMA 3RTFB 2R6GE 3IB2A 1D9VA 5B70A 4WXJA 2DWAA 3C34A 3VV5A 4GIZA 4YB7A 1A55A 1PEBA 1IZ1A 1L5TA 4F1YA 1Y3NA 2GQ1A 4X1BA 3CG1A 4P0GA 4RA1A 4MF3A 3VLUA 5I2KB 5J16A 3GBAA 4F2OA 2YJPA 2R8TA 4LA9A 4MAGA 1VFDA 5H8HB 1URDA 3MVWA 1P1NA 4DXUA 1US5A 2M8CA 3PTYA 5EHSA 3HSTA 3G3FA 4GQOA 3K00A 4PP0A 3SDFA 4FIMA 4G4PA 5AA3A 1EYIA 3BFUA 3T66A 1FRPA 1Y3PA 4L17A 1RDYA 3QK6A 3RN8A 1Y20A 4NWDA 4NQ8A 1I69A 3FD3A 3IOTA 2OCUA 4GD5A 1O63A 1DTGA 5M2VA 4MMPA 3V8XB 3FZVA 3PUYE 4P9KA 4ZEDA 2HXWA 2RCAA 4XEQA 4PETA 4GWSA 2Y7RA 3A3UA 4YMAA 2RINA 3ZSFA 3B6TA 4PFYA 4BDLA 5AA2B 1MY1A 2RF1A 3OO7A 4P8BA 4MCOA 1R6ZA 4GBVA 3W15C 3H3GA 1QUJA 4TQUQ 1B3HA 3K1NA 1LB8A 1Z7ME 1IMAA 1A8FA 4OTEA 1DK4A 3KJTA 1Q1KA 4IGRA 1S7YA 4JVCA 1YYZA 3PV0E 2Z8EA 2HXRA 4QFOA 3LV0A 1URSA 4N4UA 1MPBA 2RC7A 5EQ9A 1VSOA 1USYE 1XVYA 1P1WA 4TLLB 4QSCA 3M3FA 3IOUA 2REGA 4OENA 2O84X 1B32A 3PMVA 5ICQA 3CG3A 1B58A 4G8HA 2DYXA 2VGQA 4GOTA 3L6HA 4MNPA 2ZYNA 4LQ5A 3T9VA 4PE3A 5EYFA 1BK4A 1VFEA 5LDZA 2DVZA 1NV6A 3T1BA 5HBCA 3IFCA 2QS4A 5DW8A 3UN6A 4ECFA 5I56A 4GFRA 4YB6A 2F7AA 1OVBA 3K2DA 3RY3A 2FVZA 4AB5A 2R9JA 1FBPA 4QSDA 3MYUA 3M3LA 1D3KA 1ATGA 2V93A 4RK9A 4HE2A 1AWBA 1TFDA 1NUZA 3I3VA 2WX9A 4N81A 3E78A 1MQIA 2A5TA 1MDQA 1QUIA 1FPKA 4XKNA 2QJEA 1FTAA 2F97A 3ZKLA 4R73A 2Y7KA 1NV3A 1FTLA 1N7WA 3PUXE 1HSJA 4QFPA 2H98A 3IORA 4YKPA 4XF5A 3VDFA 1M5DA 3O29A 4JB7A 1SQYA 3CFZA 5L8DA 5KCJA 4EUOA 4F2QA 3SEVA 1RYXA 2PCRA 2FA7A 4BDRA 1QVSA 4MJOA 1FTKA 1QULA 5H8NA 4HS7A 5IM2A 4NF8B 5H8QA 1JP4A 3UORA 1SYIA 1IXHA 5B7DA 4F29A 3K6XA 3OO6A 1OIBA 2E1SA 4O3BA 2G29A 2X7QA 3GLBA 2W7YA 3TFLA 3O28A 1N04A 3LR1A 2Q2AA 3QSLA 2DWJA 1QKBA 2QSXA 1H43A 2F5XA 2DSFA 3R7XA 3IOWA 3KC0A 1H45A 5F1QA 3S9EA 4YKKA 1B5HA 3T0JA 2ONSA 3T93B 4DCXA 1OVTA 3O6HA 1MPCA 5IZ3B 2CZLA 5I3SA 4XKQA 3PMWA 3OO9A 1IXCA 3I6VA 5I84A 1N7XA 3TEPA 3TZAA 1GGGA 1IQ7A 3IB0A 2HHMA 2XX9A 1WDNA 2XXIA 4U4SA 2ZNSA 5TU0A 2Z8DA 3U92A 1HSLA 4X9TA 1Y4TA 4GWOA 1ZLQA 4MNCA 3MPLA 1FTMA 1JW4A 4IY6A 1G0IA 4OEUA 3G3HA 2H99A 2O7IA 1DOTA 5AA4B 1QGXA 1MXYA 1Y3QA 2F7CA 2PT1A 2F36A 3V5AA 1QKAA 3USDA 1B52A 1NL5A 2PMSA 3VVDA 4BDNA 2VD3A 1FCKA 3ZKKA 4R9GA 5JEIA 3GZGA 3K0VA 1Y1ZA 4OZ9A 4XKRA 3VLWA 1OQHA 2HEUA 4MIJA 4N8GA 4F31B 1UIUA 4Q5TA 4X48A 4NGUA 5I57A 4BDOA 1UTBB 2V3QA 3E4RA 4G68C 4IGTA 1INPA 4EXKA 1LAHE 1VDWA 1M5BA 3MVXA 4N13A 1PC3A 1MQJA 1FBCA 3RYDA 1AOVA 3CIJA 3HHFA 4EF1A 1USYH 3E3KA 1DMBA 2CEYA 1NH8A 2D3IA 3FXQA 3RT8A 5H8FB 4LATA 4H1XA 5CMMA 1FPFA 2Q8JA 2ALUA 3KBRA 2I4CA 2FYIA 4R6YA 1XC1A 3KGCA 3TTMA 4UACA 3D4GA 1KA0A 3H4ZA 1GR2A 1Z7NE 1B1HA 4ESWA 5I59A 2F6PA 1T0KA 3LSXA 4LUBA 2Y7IA 4GVOA 5L9MA 1NUYA 3OELA 4OVPA 4P1EA 1PBPA 1DTZA 3IJOB 1MH3A 3TQLA 4FAJA 2I0BA 3QYTA 1IXIA 3SZPA 4P47A 3RQTA 1B3FA 3A29A 1FPGA 2PVUA 1DSNA 5EYHA 4YU0A 4G77A 3K02A 2DQVA 1GTKA 1UIVA 4JVIA 1YXIA 1D9QA 3FJGA 4LVQA 1DPPA 4XKPA 4MH5A 3FBPA 2VPOA 4LN5A 4R75A 4OFOA 3VE1B 4R6KA 3PUZE 4I8CA 2PFYA 1FBGA 2O6AA 4H5FA 5EQ8A 1NUWA 1B9JA 4MHFA 3DELB 4OQOA 4PFUA 1NV4A 4RYAA 1B46A 1EZ9A 4DDDA 4I40A 4OETA 3TQWA 3UP9A 3M3KA 2NVUB 3KC1A 3O97A 3KOSA 4G68A 4OEVA 3MSTA 4PAIA 3CR9A 2F35A 5HM4B 2X7PA 2I4BA 3THIA 1TXFA 4OFLA 1MH4A 4ISUA 4PFRA 3FXRA 2HAVA 2I48A 2Q8MA 4JSOA 1MQGA 4X8RA 1DCUA 1B3GA 4FEDA 5LTCA 1JEUA 1PDAA 3LUYA 2VD2A 4PF6A 4BDQA 1UQWA 1N84A 3U93A 2XXYA 4GL8A 2XWOA 3EHTA 1K9ZA 3LBSA 2OX3A 4RPNA 3PD8A 2QL3A 3FUZA 4GWWA 4N8YA 1A7LA 3JV9A 2F7BA 4JDFA 2H4IA 1LCFA 3E9XA 3EF7A 4XFEA 1SI1A 1MDP1 5F7VA 1BLFA 4OANA 3K6VA 3K6UA 3CSBA 1FTJA 1IUDA 4R74A 3OXNA 3A09A 4DIGA 4OVQA 1Q9DA 3FXBA 3AXFA 3ILTB 1LSTA 5T3JA 4FE8A 1D9YA 2XHDA 5I58A 1XI6A 4FECA 5CMCA 1CE2A 5H8SA 1CB6A 3N6UA 3PU5A 4GLIA 3PPNA 2KQZA 4PFTA 1LBCA 3SEXA 4O3CA 1KWHA 4U2RA 2I3VA 3VFJA 1M5CA 2ZZXA 2OBGA 1HSEA 4WEPA 3FVNA 3B7DA 2V3UA 4FATA 4AB6A 3WAFA 4DXCA 3MZBA 4POWA 4F1UA 1WODA 4FORA 3N5LA 4QFNA 4ONYA 4OERA 4EQBA 4KQPA 3Q29A 1MS7A 5DYHA 2OWSA 4I3EA 5JTYB 4H5GA 4OVRA 1SPIA 3MC2A 5CMBA 4X1DA 3K1MA 5ET7A 1SYHA 4IO2A
chains in the Genus database with same CATH topology
3TAJA 1LAFE 4WEDA 4H67A 1YCJA 1LBBA 3OOAA 3HCQA 3VXBA 1SW5A 4F3GA 4OWDA 1GV8A 3C33A 3TTRA 2VOZA 2XX7A 1FTOA 2O7UA 4ZZEA 3OD7A 4G8MA 4OXVA 1ANFA 3RT6B 2E0SA 2CMOA 4F18A 3ZS6A 3V89B 4QSEA 1B6HA 4KCCA 4NTLA 5TP9B 2DWIA 3K6WA 1ZJLA 2XD2A 2QPQA 1A8EA 5CBSA 3SETA 3H6WA 2DXRA 1UTHB 3TELA 3S9NC 5DT6A 1LAGE 4Z0IA 1NFTA 4MFIA 1JW1A 1SVXB 1MPDA 3C36A 2V84A 3R26A 4ZS9A 1NKXA 5KCJB 1BP5A 1OLAA 3HPIA 2F6GA 2RKMA 3PD9A 3RTWB 1IEJA 2PT2A 3TUSA 4F22A 5H8NB 4EXLA 3EHUA 4YKJA 3G3JA 3IOVA 2O51A 2ZXTA 5I2NB 5I2KA 5KDTB 3IB1A 4KI0E 3MP1A 1IXGA 1S50A 3U1OA 3PPPA 1M5EA 4NMYA 2NOOA 3MZ1A 1B7ZA 4NF5A 4ESXA 3Q28A 1LCTA 3IK6B 2DE4A 4RJZA 4IO6A 2GH9A 3MAMA 4M1VA 2ONRA 3H7MA 5FHMA 2QS3A 2OZZA 1B5JA 2B3FA 2XXVA 3JZJA 4EQ9A 5CM6A 3S9MC 1MRPA 2O1LA 3VVFA 1EZPA 5DEXB 2THIA 4JSDA 4R2FA 1A99A 1B1XA 4F19A 2Q89A 1JNFA 1I6AA 3C9HA 3KZGA 5AA2A 2Q9TA 1NNKA 1PBQA 3G3GA 1MXWA 5IAIA 3RGYA 2XXRA 1IIWA 2XXUA 3FASA 1O64A 1JVYA 3K4UA 1I6QA 2NWJA 1DPEA 1AH5A 1S9TA 3OENA 3MBPA 3A3CA 5I57B 2DVCA 1N3WA 1LB9A 3KFMA 3LC8A 4XTCQ 3U94A 3KEIA 1US4A 2V3TA 1N0TA 4AQ4A 3T9HB 4JWOA 4KHZE 2ZNTA 3W9VA 4DE8A 4NE4A 4IO7A 2OLBA 3K1PA 3TTNA 4RXLA 5KZTA 4PFWA 1XS5A 3LSFB 4U1OA 2Q2CA 4NF6B 5L9OA 2I58A 5ELVA 2R71A 4HCWA 1ZTYA 4RY1A 3OSRA 1JETA 1XVXA 1J1NA 1BIYA 2ZYKA 4KYDA 3TDJA 4KYEA 3P7IA 4NEDA 4QFLA 2AL5A 1B51A 3KN8A 3TODA 3RNNA 2XXPA 2WKYA 4DCYA 3R6UA 3IR1A 4GRKA 3WAEA 5A5XA 1FQAA 4LP2B 4ELQA 3LSLA 4G68B 2Q88A 4Q30B 4R72A 3IO6A 3ONMA 1H3DA 4LZ5A 5TPAA 1XHYA 2D5WA 1LAXA 2HAUA 1MXZA 3KG2A 5FHOA 4KR5A 2UVHA 3IAZA 2B3BA 2ESNA 4KCDA 5CMKA 1D4NA 2AL4A 1NNTA 3IO4A 3ILUB 4N6PA 2DS9A 2QMXA 3O6IA 2XXXA 5FTIA 1B40A 4U4XA 2GRVA 4FEBA 3OEMA 1RYOA 2P2AA 4Z7EA 3KSXA 1AMFA 1VE4A 3FGSA 3JYRA 4H65A 4PQJA 2Z23A 4DLDA 4ZEFA 5DVJA 3TCGA 1FW0A 1B5IA 4JWYA 4JXIA 1SBPA 4U21A 3O2AA 5HPQA 5AA4A 1XOCA 3TTKA 2B65A 5CBRA 1LFIA 3HHGA 3OSQA 2OK2A 3G3IA 2D21A 1B0HA 1FQDA 4PE5B 5EHMA 3U8QA 1QW0A 4E0XA 4WKMA 3N26A 1FQCA 3B6QA 5IKBA 2DP8A 2HZLA 2QS1A 3B6WA 4U1ZA 3UGWA 4IY5A 3FATA 3MQ9A 4OESA 4R9FA 4OMBA 3KN7A 4MBPA 1URGA 5H8FA 2DWHA 3HN0A 1YPNA 1SW4A 2O69A 2DE2A 4G2ZA 4TOZA 1OLCA 1B05A 2I3WA 4ZEBA 2AIXA 1B3EA 4F3PA 3IX1A 3PMXA 1NNFA 4QRZA 2V25A 3ODBA 4ZEKA 2PX1A 1B2HA 2GFEA 4EQ7A 1MY2A 1B7HA 1NNPA 1AL3A 3H6UA 2BJJX 3FVOA 1F9BA 3TCHA 3OMBA 4THIA 3SESA 4ZZAA 4QFKA 4ZECA 5FTHA 1EU8A 1POTA 3C31A 3TCFA 4U23A 3MVYA 4QF9A 4YMBA 3CFXA 1WVJA 3PPOA 3U72A 3CSGA 4NWCA 3KSJA 1N3XA 1VR5A 4I62A 3C4MA 3MVZA 1ZKBA 3DP4A 3KN3A 4IO3A 4C0RA 2GHAA 3RPWA 1SW2A 4NF5B 5LOMA 5I56B 3H06B 4I1DA 3N6TA 2UVIA 5CRYA 3T96B 1BTJA 1Y9UA 2GHBA 1B0LA 2A5TB 1GVCA 5JK4A 5DVFA 3S4UA 1SDXA 4OFJA 2UYEA 4C1UA 4NF4A 4E0WA 1B3LA 1O7TA 4GXSB 2Y7PA 2X26A 4ELOA 1SW1A 4I9DA 4BLAA 2ANJA 3N94A 2PYYA 1LGBC 1P1OA 2P1SA 4OHNA 1R1NA 1ELJA 4TLMB 3T9UA 5CI5A 3EHSA 3S9LC 3H6TA 3DP6A 3HO7A 2KLFA 5H8QB 1MQDA 1PB9A 3GBBA 4YKIA 1PB7A 3L6GA 4RPOA 2Z8FA 1TWYA 4O3AA 3KJ7A 2XXQA 4R2BA 4IO4A 4FJPA 4M4GA 4GXAA 5H8HA 2IEEA 1P99A 3G7WA 5JTYA 1TT1A 1M5FA 3SKPA 5ISUA 4ZE8A 1Y1MA 4UA8A 2XXHA 3VVEA 2F34A 2LAOA 3T9XB 1YAEA 3C32A 1II5A 3IL1B 3M8UA 4F39A 4RK2A 5FHNA 3FIRA 3PGFA 4DXBA 2G93A 1P1UA 4KYSA 3T22A 3Q25A 2HQ0A 2H5YA 1TFAA 1R9QA 3EPEA 4XXUA 2XX8A 4G8NA 1Y4CA 4MLQA 3MZ9A 5CC2A 3RUMA 1I6BA 4LQ2A 1XT8A 2A5SA 2RC9A 3MP8A 5TP9A 1MXVA 2Y7WA 2DXYA 3MPKA 1POY1 4H8IA 4LZ7A 1ZBMA 1NMUA 4F3SA 3CI8A 4IB2A 1FQBA 1N76A 2ONKE 4HW8A 1EH3A 4KPTA 1UTHA 3F11A 3E13X 4EF2A 3Q26A 2I0CA 4YB5A 2HCAA 4GF8A 3UA8A 1MY4A 3BBRA 3EQ1A 3H6VA 5K2YA 5A5XB 5AA2D 3CFLA 4R6HA 3FJ7A 4KFQA 1NH7A 1SI0A 3TPAA 3FVKA 3FV1A 1MQHA 3FV2A 5TPAB 1PB8A 3IJXB 1JW5A 4ELRA 3Q27A 2F78A 3BKIB 2ZNUA 1MY0A 3FVGA 4LZ8A 4ELPA 2ABHA 5I2NA 4OYVA 1P1QA 5KDTA 4Q8RA 4GL0A 1LLSA 3CVGA 3VLVA 4OVJA 3SEUA 2NUVA 3UIFA 1EZOA 4YAHX 4IO5A 3ECRA 4LONB 5J1DA 5I59B 1MY3A 3TKDA 4YZZA 4F1VA 2O68A 3HV1A 5BWJA 3W9WA 3LSWA 5AA1A 1R9LA 4POXA 5ICTA 1ZMGA 4XIGQ 5DTBA 3DP8A 1LFGA 3FXUA 2H9BA 2UVGA 3CRBA 3MJNA 3PUVE 3PPQA 1SD3A 5L9SA 3OEKA 3MUQA 2VP1A 2ZMBA 2RCBA 1JEVA 1MG1A 5DEXA 3SERA 2QS2A 2ZYOA 1MM6A 4MLVA 3MWBA 4F3BA 5ITOA 3PUWE 3I5OA 2AYSA 2DE3A 1OQGA 4RNSA 2IA4A 1B4HA 3O6GA 5BUUA 4QHQA 3EN3A 4ZEIA 4ZDMA 2O1MA 3V83A 3OO8A 1B7UA 3SEWA 3BFTA 3C35A 1B4ZA 1QJMA 1FQFA 4NF8A 1BKAA 2H25A 1ZIUA 3TMGA 3TTLA 2QRYA 1RKMA 1H44A 2DOJA 1MM7A 3KOTA 3MP6A 3TYHA 1OMPA 4KD5A 3MW0A 3DM0A 4HTGA 5K2XA 4EDPA 3QXMA 2UXAA 4NF6A 4ZE9A 2P0SA 2UYFA 5I58B 2F8DA 4JWXA 4N07A 2OWTA 3RLFE 2UVJA 2Y84A 1IITA 3UK4A 4U22A 3DLNA 5DVIA 2FNCA 2I6EA 3GXAA 2OJTA 4C1TA 3S2VA 2VHAA 4JBZA 1LFHA 1JVXA 3QIMA 2NXOA 3O9PA 4P11A 2RC8A 4K3FA 2HZKA 1AIVA 4H8JA 2YPNA 2I49A 4DZ1A 1YTVA 1UTBA 3G3KA 4HCYA 1A40A 4BDMA 4P0IA 2QMWA 1A54A 1H76A 3FJMA 3QUFA 1FQEA 5ITPA 1JQFA 2YLNA 2PBWA 3QUJA 2XXTA 2XD3A 4ND9A 2REJA 3K01A 1QUKA 3O66A 1MXXA 3PPRA 3SEYA 1ZU0A 3VXCA 3H03A 3QAXA 5AE4A 2XXWA 4NF4B 4H6DA 1MXUA 4Q0CA 4YICA 1Q35A 2Z22A 4H0WA 3D4CA 2HFBA 2ZYMA 3RTFB 2R6GE 3IB2A 1D9VA 5B70A 4WXJA 2DWAA 3C34A 3VV5A 4GIZA 4YB7A 1A55A 1PEBA 1IZ1A 1L5TA 4F1YA 1Y3NA 4X1BA 3CG1A 4P0GA 4RA1A 4MF3A 3VLUA 5I2KB 3GBAA 4F2OA 2YJPA 4LA9A 1VFDA 5H8HB 1URDA 3MVWA 1P1NA 4DXUA 1US5A 2M8CA 5EHSA 3HSTA 3G3FA 4GQOA 3K00A 4PP0A 3SDFA 4FIMA 4G4PA 5AA3A 3BFUA 3T66A 1Y3PA 4L17A 3QK6A 3RN8A 1Y20A 4NWDA 1I69A 3FD3A 3IOTA 2OCUA 4GD5A 1O63A 1DTGA 5M2VA 3V8XB 3FZVA 3PUYE 4ZEDA 2HXWA 2RCAA 4PETA 2Y7RA 3A3UA 4YMAA 2RINA 3ZSFA 3B6TA 4PFYA 4BDLA 5AA2B 1MY1A 2RF1A 3OO7A 1R6ZA 3W15C 3H3GA 1QUJA 4TQUQ 1B3HA 3K1NA 1LB8A 1Z7ME 1A8FA 4OTEA 3KJTA 1Q1KA 4IGRA 1S7YA 3PV0E 2Z8EA 4QFOA 1URSA 1MPBA 2RC7A 1VSOA 1USYE 1XVYA 1P1WA 4TLLB 4QSCA 3M3FA 3IOUA 2REGA 4OENA 2O84X 1B32A 3PMVA 5ICQA 3CG3A 1B58A 4G8HA 2DYXA 2VGQA 4GOTA 3L6HA 2ZYNA 4LQ5A 3T9VA 5EYFA 1VFEA 2DVZA 5HBCA 3UN6A 2QS4A 4ECFA 5I56A 4GFRA 4YB6A 2F7AA 1OVBA 3K2DA 3RY3A 4AB5A 2R9JA 4QSDA 3M3LA 1D3KA 1ATGA 2V93A 4RK9A 1TFDA 3I3VA 1MQIA 2A5TA 1MDQA 1QUIA 4XKNA 2QJEA 2F97A 3ZKLA 4R73A 2Y7KA 1FTLA 1N7WA 3PUXE 1HSJA 4QFPA 2H98A 3IORA 4YKPA 3VDFA 1M5DA 3O29A 4JB7A 1SQYA 3CFZA 5L8DA 5KCJA 4EUOA 4F2QA 3SEVA 1RYXA 2FA7A 4BDRA 1QVSA 1FTKA 1QULA 5H8NA 4HS7A 4NF8B 5H8QA 3UORA 1SYIA 1IXHA 5B7DA 4F29A 3K6XA 3OO6A 1OIBA 2E1SA 4O3BA 2G29A 2X7QA 3GLBA 2W7YA 3TFLA 3O28A 1N04A 3LR1A 2Q2AA 3QSLA 2DWJA 1QKBA 2QSXA 1H43A 2F5XA 2DSFA 3R7XA 3IOWA 1H45A 5F1QA 3S9EA 4YKKA 1B5HA 2ONSA 3T93B 4DCXA 1OVTA 3O6HA 1MPCA 2CZLA 4XKQA 3PMWA 3OO9A 1IXCA 3I6VA 5I84A 1N7XA 3TEPA 3TZAA 1GGGA 1IQ7A 3IB0A 2XX9A 1WDNA 2XXIA 4U4SA 2ZNSA 5TU0A 2Z8DA 3U92A 1HSLA 4X9TA 1Y4TA 4GWOA 1ZLQA 3MPLA 1FTMA 1JW4A 4IY6A 4OEUA 3G3HA 2H99A 2O7IA 1DOTA 5AA4B 1MXYA 1Y3QA 2F7CA 2PT1A 2F36A 3V5AA 1QKAA 3USDA 1B52A 1NL5A 2PMSA 3VVDA 4BDNA 2VD3A 1FCKA 3ZKKA 4R9GA 5JEIA 3GZGA 3K0VA 1Y1ZA 4OZ9A 4XKRA 3VLWA 1OQHA 2HEUA 4F31B 1UIUA 4Q5TA 4X48A 5I57A 4BDOA 1UTBB 2V3QA 3E4RA 4G68C 4IGTA 4EXKA 1LAHE 1M5BA 3MVXA 4N13A 1PC3A 1MQJA 1AOVA 3CIJA 3HHFA 4EF1A 1USYH 3E3KA 1DMBA 1NH8A 2D3IA 3FXQA 3RT8A 5H8FB 4LATA 4H1XA 5CMMA 2Q8JA 2ALUA 3KBRA 2I4CA 2FYIA 4R6YA 1XC1A 3KGCA 3TTMA 4UACA 3D4GA 3H4ZA 1GR2A 1Z7NE 1B1HA 4ESWA 5I59A 2F6PA 1T0KA 3LSXA 4LUBA 2Y7IA 4GVOA 5L9MA 3OELA 1PBPA 1DTZA 3IJOB 1MH3A 3TQLA 4FAJA 2I0BA 3QYTA 1IXIA 3RQTA 1B3FA 2PVUA 1DSNA 4YU0A 4G77A 3K02A 2DQVA 1GTKA 1UIVA 3FJGA 4LVQA 1DPPA 4XKPA 4MH5A 4R75A 4OFOA 3VE1B 4R6KA 3PUZE 4I8CA 2O6AA 4H5FA 1B9JA 3DELB 4OQOA 4PFUA 4RYAA 1B46A 1EZ9A 4DDDA 4OETA 3TQWA 3UP9A 3M3KA 2NVUB 3O97A 3KOSA 4G68A 4OEVA 3CR9A 2F35A 5HM4B 2X7PA 2I4BA 3THIA 1TXFA 4OFLA 1MH4A 4ISUA 3FXRA 2HAVA 2I48A 4JSOA 1MQGA 1B3GA 4FEDA 1JEUA 1PDAA 3LUYA 2VD2A 4BDQA 1UQWA 1N84A 3U93A 2XXYA 4GL8A 3EHTA 3LBSA 4RPNA 3PD8A 2QL3A 3FUZA 1A7LA 3JV9A 2F7BA 4JDFA 2H4IA 1LCFA 3E9XA 3EF7A 1SI1A 1MDP1 5F7VA 1BLFA 3K6VA 3K6UA 3CSBA 1FTJA 1IUDA 4R74A 3OXNA 3A09A 4DIGA 3AXFA 3ILTB 1LSTA 4FE8A 1D9YA 2XHDA 5I58A 4FECA 5CMCA 1CE2A 5H8SA 1CB6A 3N6UA 3PU5A 4GLIA 3PPNA 4PFTA 1LBCA 3SEXA 4O3CA 1KWHA 4U2RA 2I3VA 3VFJA 1M5CA 2OBGA 1HSEA 4WEPA 3FVNA 3B7DA 2V3UA 4FATA 4AB6A 3WAFA 4DXCA 3MZBA 4POWA 4F1UA 1WODA 4FORA 3N5LA 4QFNA 4ONYA 4OERA 4EQBA 4KQPA 3Q29A 1MS7A 5DYHA 2OWSA 5JTYB 4H5GA 3MC2A 5CMBA 4X1DA 3K1MA 1SYHA 4IO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAJ A;  1LAF E;  4WED A;  4H67 A;  1YCJ A;  1LBB A;  3OOA A;  3HCQ A;  3VXB A;  1SW5 A;  4F3G A;  4OWD A;  1GV8 A;  3C33 A;  3TTR A;  2VOZ A;  2XX7 A;  1FTO A;  2O7U A;  4ZZE A;  3OD7 A;  4G8M A;  4OXV A;  1ANF A;  3RT6 B;  2E0S A;  2CMO A;  4F18 A;  3ZS6 A;  3V89 B;  4QSE A;  1B6H A;  4KCC A;  4NTL A;  5TP9 B;  2DWI A;  3K6W A;  1ZJL A;  2XD2 A;  2QPQ A;  1A8E A;  5CBS A;  3SET A;  3H6W A;  2DXR A;  1UTH B;  3TEL A;  3S9N C;  5DT6 A;  1LAG E;  4Z0I A;  1NFT A;  4MFI A;  1JW1 A;  1SVX B;  1MPD A;  3C36 A;  2V84 A;  3R26 A;  4ZS9 A;  1NKX A;  5KCJ B;  1BP5 A;  1OLA A;  3HPI A;  2F6G A;  2RKM A;  3PD9 A;  3RTW B;  1IEJ A;  2PT2 A;  3TUS A;  4F22 A;  5H8N B;  4EXL A;  3EHU A;  4YKJ A;  3G3J A;  3IOV A;  2O51 A;  2ZXT A;  5I2N B;  5I2K A;  5KDT B;  3IB1 A;  4KI0 E;  3MP1 A;  1IXG A;  1S50 A;  3U1O A;  3PPP A;  1M5E A;  4NMY A;  2NOO A;  3MZ1 A;  1B7Z A;  4NF5 A;  4ESX A;  3Q28 A;  1LCT A;  3IK6 B;  2DE4 A;  4RJZ A;  4IO6 A;  2GH9 A;  3MAM A;  4M1V A;  2ONR A;  3H7M A;  5FHM A;  2QS3 A;  2OZZ A;  1B5J A;  2B3F A;  2XXV A;  3JZJ A;  4EQ9 A;  5CM6 A;  3S9M C;  1MRP A;  2O1L A;  3VVF A;  1EZP A;  5DEX B;  2THI A;  4JSD A;  4R2F A;  1A99 A;  1B1X A;  4F19 A;  2Q89 A;  1JNF A;  1I6A A;  3C9H A;  3KZG A;  5AA2 A;  2Q9T A;  1NNK A;  1PBQ A;  3G3G A;  1MXW A;  5IAI A;  3RGY A;  2XXR A;  1IIW A;  2XXU A;  3FAS A;  1O64 A;  1JVY A;  3K4U A;  1I6Q A;  2NWJ A;  1DPE A;  1AH5 A;  1S9T A;  3OEN A;  3MBP A;  3A3C A;  5I57 B;  2DVC A;  1N3W A;  1LB9 A;  3KFM A;  3LC8 A;  4XTC Q;  3U94 A;  3KEI A;  1US4 A;  2V3T A;  1N0T A;  4AQ4 A;  3T9H B;  4JWO A;  4KHZ E;  2ZNT A;  3W9V A;  4DE8 A;  4NE4 A;  4IO7 A;  2OLB A;  3K1P A;  3TTN A;  4RXL A;  5KZT A;  4PFW A;  1XS5 A;  3LSF B;  4U1O A;  2Q2C A;  4NF6 B;  5L9O A;  2I58 A;  5ELV A;  2R71 A;  4HCW A;  1ZTY A;  4RY1 A;  3OSR A;  1JET A;  1XVX A;  1J1N A;  1BIY A;  2ZYK A;  4KYD A;  3TDJ A;  4KYE A;  3P7I A;  4NED A;  4QFL A;  2AL5 A;  1B51 A;  3KN8 A;  3TOD A;  3RNN A;  2XXP A;  2WKY A;  4DCY A;  3R6U A;  3IR1 A;  4GRK A;  3WAE A;  5A5X A;  1FQA A;  4LP2 B;  4ELQ A;  3LSL A;  4G68 B;  2Q88 A;  4Q30 B;  4R72 A;  3IO6 A;  3ONM A;  1H3D A;  4LZ5 A;  5TPA A;  1XHY A;  2D5W A;  1LAX A;  2HAU A;  1MXZ A;  3KG2 A;  5FHO A;  4KR5 A;  2UVH A;  3IAZ A;  2B3B A;  2ESN A;  4KCD A;  5CMK A;  1D4N A;  2AL4 A;  1NNT A;  3IO4 A;  3ILU B;  4N6P A;  2DS9 A;  2QMX A;  3O6I A;  2XXX A;  5FTI A;  1B40 A;  4U4X A;  2GRV A;  4FEB A;  3OEM A;  1RYO A;  2P2A A;  4Z7E A;  3KSX A;  1AMF A;  1VE4 A;  3FGS A;  3JYR A;  4H65 A;  4PQJ A;  2Z23 A;  4DLD A;  4ZEF A;  5DVJ A;  3TCG A;  1FW0 A;  1B5I A;  4JWY A;  4JXI A;  1SBP A;  4U21 A;  3O2A A;  5HPQ A;  5AA4 A;  1XOC A;  3TTK A;  2B65 A;  5CBR A;  1LFI A;  3HHG A;  3OSQ A;  2OK2 A;  3G3I A;  2D21 A;  1B0H A;  1FQD A;  4PE5 B;  5EHM A;  3U8Q A;  1QW0 A;  4E0X A;  4WKM A;  3N26 A;  1FQC A;  3B6Q A;  5IKB A;  2DP8 A;  2HZL A;  2QS1 A;  3B6W A;  4U1Z A;  3UGW A;  4IY5 A;  3FAT A;  3MQ9 A;  4OES A;  4R9F A;  4OMB A;  3KN7 A;  4MBP A;  1URG A;  5H8F A;  2DWH A;  3HN0 A;  1YPN A;  1SW4 A;  2O69 A;  2DE2 A;  4G2Z A;  4TOZ A;  1OLC A;  1B05 A;  2I3W A;  4ZEB A;  2AIX A;  1B3E A;  4F3P A;  3IX1 A;  3PMX A;  1NNF A;  4QRZ A;  2V25 A;  3ODB A;  4ZEK A;  2PX1 A;  1B2H A;  2GFE A;  4EQ7 A;  1MY2 A;  1B7H A;  1NNP A;  1AL3 A;  3H6U A;  2BJJ X;  3FVO A;  1F9B A;  3TCH A;  3OMB A;  4THI A;  3SES A;  4ZZA A;  4QFK A;  4ZEC A;  5FTH A;  1EU8 A;  1POT A;  3C31 A;  3TCF A;  4U23 A;  3MVY A;  4QF9 A;  4YMB A;  3CFX A;  1WVJ A;  3PPO A;  3U72 A;  3CSG A;  4NWC A;  3KSJ A;  1N3X A;  1VR5 A;  4I62 A;  3C4M A;  3MVZ A;  1ZKB A;  3DP4 A;  3KN3 A;  4IO3 A;  4C0R A;  2GHA A;  3RPW A;  1SW2 A;  4NF5 B;  5LOM A;  5I56 B;  3H06 B;  4I1D A;  3N6T A;  2UVI A;  5CRY A;  3T96 B;  1BTJ A;  1Y9U A;  2GHB A;  1B0L A;  2A5T B;  1GVC A;  5JK4 A;  5DVF A;  3S4U A;  1SDX A;  4OFJ A;  2UYE A;  4C1U A;  4NF4 A;  4E0W A;  1B3L A;  1O7T A;  4GXS B;  2Y7P A;  2X26 A;  4ELO A;  1SW1 A;  4I9D A;  4BLA A;  2ANJ A;  3N94 A;  2PYY A;  1LGB C;  1P1O A;  2P1S A;  4OHN A;  1R1N A;  1ELJ A;  4TLM B;  3T9U A;  5CI5 A;  3EHS A;  3S9L C;  3H6T A;  3DP6 A;  3HO7 A;  2KLF A;  5H8Q B;  1MQD A;  1PB9 A;  3GBB A;  4YKI A;  1PB7 A;  3L6G A;  4RPO A;  2Z8F A;  1TWY A;  4O3A A;  3KJ7 A;  2XXQ A;  4R2B A;  4IO4 A;  4FJP A;  4M4G A;  4GXA A;  5H8H A;  2IEE A;  1P99 A;  3G7W A;  5JTY A;  1TT1 A;  1M5F A;  3SKP A;  5ISU A;  4ZE8 A;  1Y1M A;  4UA8 A;  2XXH A;  3VVE A;  2F34 A;  2LAO A;  3T9X B;  1YAE A;  3C32 A;  1II5 A;  3IL1 B;  3M8U A;  4F39 A;  4RK2 A;  5FHN A;  3FIR A;  3PGF A;  4DXB A;  2G93 A;  1P1U A;  4KYS A;  3T22 A;  3Q25 A;  2HQ0 A;  2H5Y A;  1TFA A;  1R9Q A;  3EPE A;  4XXU A;  2XX8 A;  4G8N A;  1Y4C A;  4MLQ A;  3MZ9 A;  5CC2 A;  3RUM A;  1I6B A;  4LQ2 A;  1XT8 A;  2A5S A;  2RC9 A;  3MP8 A;  5TP9 A;  1MXV A;  2Y7W A;  2DXY A;  3MPK A;  1POY 1;  4H8I A;  4LZ7 A;  1ZBM A;  1NMU A;  4F3S A;  3CI8 A;  4IB2 A;  1FQB A;  1N76 A;  2ONK E;  4HW8 A;  1EH3 A;  4KPT A;  1UTH A;  3F11 A;  3E13 X;  4EF2 A;  3Q26 A;  2I0C A;  4YB5 A;  2HCA A;  4GF8 A;  3UA8 A;  1MY4 A;  3BBR A;  3EQ1 A;  3H6V A;  5K2Y A;  5A5X B;  5AA2 D;  3CFL A;  4R6H A;  3FJ7 A;  4KFQ A;  1NH7 A;  1SI0 A;  3TPA A;  3FVK A;  3FV1 A;  1MQH A;  3FV2 A;  5TPA B;  1PB8 A;  3IJX B;  1JW5 A;  4ELR A;  3Q27 A;  2F78 A;  3BKI B;  2ZNU A;  1MY0 A;  3FVG A;  4LZ8 A;  4ELP A;  2ABH A;  5I2N A;  4OYV A;  1P1Q A;  5KDT A;  4Q8R A;  4GL0 A;  1LLS A;  3CVG A;  3VLV A;  4OVJ A;  3SEU A;  2NUV A;  3UIF A;  1EZO A;  4YAH X;  4IO5 A;  3ECR A;  4LON B;  5J1D A;  5I59 B;  1MY3 A;  3TKD A;  4YZZ A;  4F1V A;  2O68 A;  3HV1 A;  5BWJ A;  3W9W A;  3LSW A;  5AA1 A;  1R9L A;  4POX A;  5ICT A;  1ZMG A;  4XIG Q;  5DTB A;  3DP8 A;  1LFG A;  3FXU A;  2H9B A;  2UVG A;  3CRB A;  3MJN A;  3PUV E;  3PPQ A;  1SD3 A;  5L9S A;  3OEK A;  3MUQ A;  2VP1 A;  2ZMB A;  2RCB A;  1JEV A;  1MG1 A;  5DEX A;  3SER A;  2QS2 A;  2ZYO A;  1MM6 A;  4MLV A;  3MWB A;  4F3B A;  5ITO A;  3PUW E;  3I5O A;  2AYS A;  2DE3 A;  1OQG A;  4RNS A;  2IA4 A;  1B4H A;  3O6G A;  5BUU A;  4QHQ A;  3EN3 A;  4ZEI A;  4ZDM A;  2O1M A;  3V83 A;  3OO8 A;  1B7U A;  3SEW A;  3BFT A;  3C35 A;  1B4Z A;  1QJM A;  1FQF A;  4NF8 A;  1BKA A;  2H25 A;  1ZIU A;  3TMG A;  3TTL A;  2QRY A;  1RKM A;  1H44 A;  2DOJ A;  1MM7 A;  3KOT A;  3MP6 A;  3TYH A;  1OMP A;  4KD5 A;  3MW0 A;  3DM0 A;  4HTG A;  5K2X A;  4EDP A;  3QXM A;  2UXA A;  4NF6 A;  4ZE9 A;  2P0S A;  2UYF A;  5I58 B;  2F8D A;  4JWX A;  4N07 A;  2OWT A;  3RLF E;  2UVJ A;  2Y84 A;  1IIT A;  3UK4 A;  4U22 A;  3DLN A;  5DVI A;  2FNC A;  2I6E A;  3GXA A;  2OJT A;  4C1T A;  3S2V A;  2VHA A;  4JBZ A;  1LFH A;  1JVX A;  3QIM A;  2NXO A;  3O9P A;  4P11 A;  2RC8 A;  4K3F A;  2HZK A;  1AIV A;  4H8J A;  2YPN A;  2I49 A;  4DZ1 A;  1YTV A;  1UTB A;  3G3K A;  4HCY A;  1A40 A;  4BDM A;  4P0I A;  2QMW A;  1A54 A;  1H76 A;  3FJM A;  3QUF A;  1FQE A;  5ITP A;  1JQF A;  2YLN A;  2PBW A;  3QUJ A;  2XXT A;  2XD3 A;  4ND9 A;  2REJ A;  3K01 A;  1QUK A;  3O66 A;  1MXX A;  3PPR A;  3SEY A;  1ZU0 A;  3VXC A;  3H03 A;  3QAX A;  5AE4 A;  2XXW A;  4NF4 B;  4H6D A;  1MXU A;  4Q0C A;  4YIC A;  1Q35 A;  2Z22 A;  4H0W A;  3D4C A;  2HFB A;  2ZYM A;  3RTF B;  2R6G E;  3IB2 A;  1D9V A;  5B70 A;  4WXJ A;  2DWA A;  3C34 A;  3VV5 A;  4GIZ A;  4YB7 A;  1A55 A;  1PEB A;  1IZ1 A;  1L5T A;  4F1Y A;  1Y3N A;  4X1B A;  3CG1 A;  4P0G A;  4RA1 A;  4MF3 A;  3VLU A;  5I2K B;  3GBA A;  4F2O A;  2YJP A;  4LA9 A;  1VFD A;  5H8H B;  1URD A;  3MVW A;  1P1N A;  4DXU A;  1US5 A;  2M8C A;  5EHS A;  3HST A;  3G3F A;  4GQO A;  3K00 A;  4PP0 A;  3SDF A;  4FIM A;  4G4P A;  5AA3 A;  3BFU A;  3T66 A;  1Y3P A;  4L17 A;  3QK6 A;  3RN8 A;  1Y20 A;  4NWD A;  1I69 A;  3FD3 A;  3IOT A;  2OCU A;  4GD5 A;  1O63 A;  1DTG A;  5M2V A;  3V8X B;  3FZV A;  3PUY E;  4ZED A;  2HXW A;  2RCA A;  4PET A;  2Y7R A;  3A3U A;  4YMA A;  2RIN A;  3ZSF A;  3B6T A;  4PFY A;  4BDL A;  5AA2 B;  1MY1 A;  2RF1 A;  3OO7 A;  1R6Z A;  3W15 C;  3H3G A;  1QUJ A;  4TQU Q;  1B3H A;  3K1N A;  1LB8 A;  1Z7M E;  1A8F A;  4OTE A;  3KJT A;  1Q1K A;  4IGR A;  1S7Y A;  3PV0 E;  2Z8E A;  4QFO A;  1URS A;  1MPB A;  2RC7 A;  1VSO A;  1USY E;  1XVY A;  1P1W A;  4TLL B;  4QSC A;  3M3F A;  3IOU A;  2REG A;  4OEN A;  2O84 X;  1B32 A;  3PMV A;  5ICQ A;  3CG3 A;  1B58 A;  4G8H A;  2DYX A;  2VGQ A;  4GOT A;  3L6H A;  2ZYN A;  4LQ5 A;  3T9V A;  5EYF A;  1VFE A;  2DVZ A;  5HBC A;  3UN6 A;  2QS4 A;  4ECF A;  5I56 A;  4GFR A;  4YB6 A;  2F7A A;  1OVB A;  3K2D A;  3RY3 A;  4AB5 A;  2R9J A;  4QSD A;  3M3L A;  1D3K A;  1ATG A;  2V93 A;  4RK9 A;  1TFD A;  3I3V A;  1MQI A;  2A5T A;  1MDQ A;  1QUI A;  4XKN A;  2QJE A;  2F97 A;  3ZKL A;  4R73 A;  2Y7K A;  1FTL A;  1N7W A;  3PUX E;  1HSJ A;  4QFP A;  2H98 A;  3IOR A;  4YKP A;  3VDF A;  1M5D A;  3O29 A;  4JB7 A;  1SQY A;  3CFZ A;  5L8D A;  5KCJ A;  4EUO A;  4F2Q A;  3SEV A;  1RYX A;  2FA7 A;  4BDR A;  1QVS A;  1FTK A;  1QUL A;  5H8N A;  4HS7 A;  4NF8 B;  5H8Q A;  3UOR A;  1SYI A;  1IXH A;  5B7D A;  4F29 A;  3K6X A;  3OO6 A;  1OIB A;  2E1S A;  4O3B A;  2G29 A;  2X7Q A;  3GLB A;  2W7Y A;  3TFL A;  3O28 A;  1N04 A;  3LR1 A;  2Q2A A;  3QSL A;  2DWJ A;  1QKB A;  2QSX A;  1H43 A;  2F5X A;  2DSF A;  3R7X A;  3IOW A;  1H45 A;  5F1Q A;  3S9E A;  4YKK A;  1B5H A;  2ONS A;  3T93 B;  4DCX A;  1OVT A;  3O6H A;  1MPC A;  2CZL A;  4XKQ A;  3PMW A;  3OO9 A;  1IXC A;  3I6V A;  5I84 A;  1N7X A;  3TEP A;  3TZA A;  1GGG A;  1IQ7 A;  3IB0 A;  2XX9 A;  1WDN A;  2XXI A;  4U4S A;  2ZNS A;  5TU0 A;  2Z8D A;  3U92 A;  1HSL A;  4X9T A;  1Y4T A;  4GWO A;  1ZLQ A;  3MPL A;  1FTM A;  1JW4 A;  4IY6 A;  4OEU A;  3G3H A;  2H99 A;  2O7I A;  1DOT A;  5AA4 B;  1MXY A;  1Y3Q A;  2F7C A;  2PT1 A;  2F36 A;  3V5A A;  1QKA A;  3USD A;  1B52 A;  1NL5 A;  2PMS A;  3VVD A;  4BDN A;  2VD3 A;  1FCK A;  3ZKK A;  4R9G A;  5JEI A;  3GZG A;  3K0V A;  1Y1Z A;  4OZ9 A;  4XKR A;  3VLW A;  1OQH A;  2HEU A;  4F31 B;  1UIU A;  4Q5T A;  4X48 A;  5I57 A;  4BDO A;  1UTB B;  2V3Q A;  3E4R A;  4G68 C;  4IGT A;  4EXK A;  1LAH E;  1M5B A;  3MVX A;  4N13 A;  1PC3 A;  1MQJ A;  1AOV A;  3CIJ A;  3HHF A;  4EF1 A;  1USY H;  3E3K A;  1DMB A;  1NH8 A;  2D3I A;  3FXQ A;  3RT8 A;  5H8F B;  4LAT A;  4H1X A;  5CMM A;  2Q8J A;  2ALU A;  3KBR A;  2I4C A;  2FYI A;  4R6Y A;  1XC1 A;  3KGC A;  3TTM A;  4UAC A;  3D4G A;  3H4Z A;  1GR2 A;  1Z7N E;  1B1H A;  4ESW A;  5I59 A;  2F6P A;  1T0K A;  3LSX A;  4LUB A;  2Y7I A;  4GVO A;  5L9M A;  3OEL A;  1PBP A;  1DTZ A;  3IJO B;  1MH3 A;  3TQL A;  4FAJ A;  2I0B A;  3QYT A;  1IXI A;  3RQT A;  1B3F A;  2PVU A;  1DSN A;  4YU0 A;  4G77 A;  3K02 A;  2DQV A;  1GTK A;  1UIV A;  3FJG A;  4LVQ A;  1DPP A;  4XKP A;  4MH5 A;  4R75 A;  4OFO A;  3VE1 B;  4R6K A;  3PUZ E;  4I8C A;  2O6A A;  4H5F A;  1B9J A;  3DEL B;  4OQO A;  4PFU A;  4RYA A;  1B46 A;  1EZ9 A;  4DDD A;  4OET A;  3TQW A;  3UP9 A;  3M3K A;  2NVU B;  3O97 A;  3KOS A;  4G68 A;  4OEV A;  3CR9 A;  2F35 A;  5HM4 B;  2X7P A;  2I4B A;  3THI A;  1TXF A;  4OFL A;  1MH4 A;  4ISU A;  3FXR A;  2HAV A;  2I48 A;  4JSO A;  1MQG A;  1B3G A;  4FED A;  1JEU A;  1PDA A;  3LUY A;  2VD2 A;  4BDQ A;  1UQW A;  1N84 A;  3U93 A;  2XXY A;  4GL8 A;  3EHT A;  3LBS A;  4RPN A;  3PD8 A;  2QL3 A;  3FUZ A;  1A7L A;  3JV9 A;  2F7B A;  4JDF A;  2H4I A;  1LCF A;  3E9X A;  3EF7 A;  1SI1 A;  1MDP 1;  5F7V A;  1BLF A;  3K6V A;  3K6U A;  3CSB A;  1FTJ A;  1IUD A;  4R74 A;  3OXN A;  3A09 A;  4DIG A;  3AXF A;  3ILT B;  1LST A;  4FE8 A;  1D9Y A;  2XHD A;  5I58 A;  4FEC A;  5CMC A;  1CE2 A;  5H8S A;  1CB6 A;  3N6U A;  3PU5 A;  4GLI A;  3PPN A;  4PFT A;  1LBC A;  3SEX A;  4O3C A;  1KWH A;  4U2R A;  2I3V A;  3VFJ A;  1M5C A;  2OBG A;  1HSE A;  4WEP A;  3FVN A;  3B7D A;  2V3U A;  4FAT A;  4AB6 A;  3WAF A;  4DXC A;  3MZB A;  4POW A;  4F1U A;  1WOD A;  4FOR A;  3N5L A;  4QFN A;  4ONY A;  4OER A;  4EQB A;  4KQP A;  3Q29 A;  1MS7 A;  5DYH A;  2OWS A;  5JTY B;  4H5G A;  3MC2 A;  5CMB A;  4X1D A;  3K1M A;  1SYH A;  4IO2 A; 
#chains in the Genus database with same CATH topology
 3RPL A;  3TAJ A;  1LAF E;  4WED A;  4H67 A;  1YCJ A;  4NAP A;  1LBB A;  1EYJ A;  4AS4 A;  3OOA A;  3HCQ A;  3VXB A;  1SW5 A;  4F3G A;  2QVR A;  4OWD A;  1RDZ A;  1GV8 A;  3C33 A;  1FJ9 A;  2F3B A;  3TTR A;  2VOZ A;  2XX7 A;  1FTO A;  2O7U A;  4ZZE A;  3OD7 A;  1FBD A;  4G8M A;  4OXV A;  1ANF A;  2FHY A;  4MEV A;  3RT6 B;  2E0S A;  2CMO A;  4F18 A;  3NOH A;  3ZS6 A;  3V89 B;  2Q74 A;  4QSE A;  1B6H A;  4KCC A;  4NTL A;  5TP9 B;  2DWI A;  3K6W A;  1ZJL A;  2XD2 A;  2QPQ A;  1A8E A;  5CBS A;  3SET A;  3H6W A;  2DXR A;  1UTH B;  3TEL A;  3E79 A;  3S9N C;  5DT6 A;  1LAG E;  4Z0I A;  1NFT A;  4MFI A;  1JW1 A;  1SVX B;  2XWV A;  1MPD A;  3C36 A;  2V84 A;  3R26 A;  4ZS9 A;  1NKX A;  5KCJ B;  1BP5 A;  4HXV A;  1OLA A;  3HPI A;  2F6G A;  2RKM A;  3PD9 A;  3RTW B;  1IEJ A;  2PT2 A;  3TUS A;  4F22 A;  5H8N B;  4EXL A;  3EHU A;  4FBP A;  4YKJ A;  3G3J A;  3IOV A;  2L5V A;  2O51 A;  2ZXT A;  5I2N B;  5FBP A;  5I2K A;  5KDT B;  3IB1 A;  5I5P A;  1NV0 A;  4KI0 E;  1NV5 A;  3MP1 A;  1IXG A;  1S50 A;  3U1O A;  3PPP A;  5ESY A;  1M5E A;  5EQ7 A;  4NMY A;  2NOO A;  3MZ1 A;  1B7Z A;  4NF5 A;  1NV2 A;  1FJ6 A;  4ESX A;  3Q28 A;  1LCT A;  2KR0 A;  3IK6 B;  2DE4 A;  4RJZ A;  2ZZV A;  4IO6 A;  2GH9 A;  2WYP A;  3MAM A;  4M1V A;  2ONR A;  3H7M A;  5FHM A;  2P3V A;  4OVT A;  2BJI A;  2QS3 A;  1RDX A;  2OZZ A;  1B5J A;  2FBP A;  2B3F A;  2XXV A;  3JZJ A;  4EQ9 A;  5CM6 A;  3S9M C;  1MRP A;  2O1L A;  3VVF A;  4GWU A;  1EZP A;  1NUX A;  2VT5 A;  5DEX B;  2THI A;  4PGN A;  4JSD A;  4R2F A;  1A99 A;  1B1X A;  4F19 A;  3ROJ A;  2Q89 A;  1JNF A;  1I6A A;  3C9H A;  3KZG A;  5AA2 A;  2QVV A;  2Q9T A;  1K9Y A;  1NNK A;  1EYK A;  1PBQ A;  3G3G A;  1MXW A;  5IAI A;  3RGY A;  2XXR A;  1IIW A;  2XXU A;  1FBH A;  3FAS A;  1O64 A;  1JVY A;  1LBV A;  3K4U A;  1I6Q A;  2NWJ A;  1DPE A;  1AH5 A;  1S9T A;  3OEN A;  3MBP A;  3A3C A;  3EKI A;  5I57 B;  2DVC A;  1N3W A;  1LB9 A;  3KFM A;  3LC8 A;  4XTC Q;  3U94 A;  3KEI A;  1US4 A;  2V3T A;  1N0T A;  4AQ4 A;  3T9H B;  4PFI A;  4JWO A;  4KHZ E;  4P3L A;  2ZNT A;  3W9V A;  4DE8 A;  4NE4 A;  4IO7 A;  2OLB A;  3K1P A;  3TTN A;  4RXL A;  1LBW A;  5KZT A;  4PFW A;  1XS5 A;  3LSF B;  4U1O A;  2Q2C A;  4NF6 B;  5L9O A;  2I58 A;  1CNQ A;  2PFZ A;  5ELV A;  4QXD A;  2P3N A;  4G61 A;  2R71 A;  1FBF A;  4HCW A;  1ZTY A;  4RY1 A;  3OSR A;  1JET A;  1XVX A;  1J1N A;  5A5L A;  1BIY A;  2XWK A;  4PF8 A;  2ZYK A;  4KYD A;  3TDJ A;  4KYE A;  3P7I A;  4NED A;  4QFL A;  2AL5 A;  4O7M A;  1B51 A;  3KN8 A;  3BIG A;  3TOD A;  1FPI A;  4GX6 A;  3RNN A;  2XXP A;  2WKY A;  4DCY A;  4QBA A;  3R6U A;  2XWI A;  3IR1 A;  3ISP A;  4GRK A;  3WAE A;  4KXP A;  5A5X A;  1LBY A;  3LUZ A;  1FQA A;  4LP2 B;  4ELQ A;  3LSL A;  4IR8 A;  4G68 B;  2Q88 A;  3B50 A;  4Q30 B;  4R72 A;  4PGP A;  3IO6 A;  3ONM A;  2CZH A;  1H3D A;  4LZ5 A;  5TPA A;  1XHY A;  2D5W A;  1LAX A;  2HAU A;  1MXZ A;  3KG2 A;  5FHO A;  4KR5 A;  2UVH A;  3IAZ A;  2B3B A;  4PFB A;  2ESN A;  4KCD A;  5CMK A;  1D4N A;  2AL4 A;  1NNT A;  3IO4 A;  3ILU B;  4N6P A;  2DS9 A;  4MX6 A;  2QMX A;  3O6I A;  2XXX A;  5FTI A;  1B40 A;  3KBZ A;  4U4X A;  2GRV A;  4FEB A;  3OEM A;  1RYO A;  2P2A A;  4O8M A;  4Z7E A;  5IZ3 A;  3KSX A;  4GBW A;  1KA1 A;  1AMF A;  1VE4 A;  4H46 A;  3FGS A;  3JYR A;  4H65 A;  4PQJ A;  2Z23 A;  4DLD A;  4ZEF A;  5DVJ A;  3TCG A;  2XXK A;  1FW0 A;  1B5I A;  4JWY A;  4JXI A;  1SBP A;  4U21 A;  5EYG A;  2QVU A;  4I3Y A;  2ZZW A;  3O2A A;  5HPQ A;  2VPN A;  5AA4 A;  1XOC A;  3TTK A;  1FPJ A;  2B65 A;  5CBR A;  1LFI A;  3HHG A;  3OSQ A;  2OK2 A;  4NX1 A;  3G3I A;  2D21 A;  1B0H A;  1FQD A;  4PE5 B;  5EHM A;  3U8Q A;  1QW0 A;  4E0X A;  4WKM A;  3N26 A;  1FQC A;  3U65 A;  3B6Q A;  5IKB A;  2DP8 A;  2HZL A;  2QS1 A;  3B6W A;  4U1Z A;  3UGW A;  2F3D A;  4N15 A;  4IY5 A;  3FAT A;  5I7I A;  1KZ8 A;  3MQ9 A;  4OES A;  4R9F A;  4OMB A;  3KN7 A;  1LBZ A;  4MBP A;  1URG A;  5H8F A;  2DWH A;  3HN0 A;  1YPN A;  1SW4 A;  2O69 A;  4PAK A;  1NV1 A;  2DE2 A;  4G2Z A;  4TOZ A;  1OLC A;  1B05 A;  3BIH A;  2I3W A;  1FPL A;  4ZEB A;  2AIX A;  1B3E A;  4F3P A;  3IX1 A;  3PMX A;  1NNF A;  4QRZ A;  2V25 A;  3ODB A;  4ZEK A;  2XA5 A;  2PX1 A;  1B2H A;  2GFE A;  4HE1 A;  4EQ7 A;  1MY2 A;  1FPB A;  1B7H A;  1NNP A;  1AL3 A;  1DBZ A;  3H6U A;  4N6D A;  2BJJ X;  3FVO A;  1FSA A;  1F9B A;  3TCH A;  3OMB A;  4THI A;  3SES A;  4ZZA A;  4QFK A;  4ZEC A;  4PC9 A;  5FTH A;  1EU8 A;  1POT A;  3C31 A;  3TCF A;  2HPG A;  4U23 A;  3MVY A;  4QF9 A;  4YMB A;  3CFX A;  1WVJ A;  3PPO A;  3U72 A;  2B4M A;  4X04 A;  3CSG A;  4DI4 B;  4NWC A;  3KSJ A;  1N3X A;  1VR5 A;  4I62 A;  3C4M A;  3MVZ A;  1ZKB A;  3DP4 A;  3KN3 A;  4IO3 A;  4C0R A;  2GHA A;  3RPW A;  1SW2 A;  4NF5 B;  5LOM A;  5I56 B;  4PAF A;  3H06 B;  4I1D A;  3N6T A;  4NF0 A;  2UVI A;  5F24 A;  5CRY A;  3T96 B;  1BTJ A;  1Y9U A;  1IMB A;  2WEF A;  2GHB A;  2FIX A;  4UAB A;  1B0L A;  2A5T B;  1GVC A;  5JK4 A;  5DVF A;  3S4U A;  1SDX A;  4O94 A;  4OFJ A;  2UYE A;  4C1U A;  4NF4 A;  4E0W A;  1B3L A;  1O7T A;  4GXS B;  4P56 A;  2Y7P A;  2X26 A;  4ELO A;  1SW1 A;  4I9D A;  4BLA A;  2ANJ A;  3N94 A;  3HFU A;  2PYY A;  4NG7 A;  4N91 A;  1LGB C;  1P1O A;  2P1S A;  4OHN A;  1R1N A;  1ELJ A;  4TLM B;  3T9U A;  5CI5 A;  3EHS A;  3S9L C;  3H6T A;  3DP6 A;  5IZ1 A;  3CHG A;  3HO7 A;  2KLF A;  4NN3 A;  5H8Q B;  1MQD A;  1PB9 A;  5IZZ A;  3GBB A;  4YKI A;  1PB7 A;  3L6G A;  4RPO A;  2Z8F A;  1TWY A;  4O3A A;  3KJ7 A;  2XXQ A;  4R2B A;  4IO4 A;  4FJP A;  4M4G A;  5ET8 A;  4GXA A;  5H8H A;  2IEE A;  1P99 A;  3G7W A;  5JTY A;  1TT1 A;  1M5F A;  2JJK A;  3SKP A;  5ISU A;  4ZE8 A;  1FPE A;  1IMC A;  2CZK A;  1Y1M A;  4UA8 A;  2XXH A;  3VVE A;  2F34 A;  2LAO A;  3T9X B;  1YAE A;  3C32 A;  1FPD A;  1II5 A;  3IL1 B;  3M8U A;  4F39 A;  4RK2 A;  5FHN A;  3FIR A;  3PGF A;  4DXB A;  2G93 A;  1P1U A;  4KYS A;  1IME A;  3T22 A;  3Q25 A;  2HQ0 A;  1LEV A;  1FBE A;  2H5Y A;  2OWZ A;  1TFA A;  1R9Q A;  3EPE A;  4XXU A;  2XX8 A;  4G8N A;  1Y4C A;  4MLQ A;  2QFL A;  1LBX A;  1IMF A;  1NI9 A;  3MZ9 A;  5CC2 A;  3RUM A;  1NV7 A;  1I6B A;  4LQ2 A;  1XT8 A;  2A5S A;  2RC9 A;  4GX3 A;  3MP8 A;  5TP9 A;  1MXV A;  2Y7W A;  2DXY A;  3MPK A;  1POY 1;  4H8I A;  4LZ7 A;  3B8B A;  1ZBM A;  1NMU A;  4F3S A;  3CI8 A;  4IB2 A;  1FQB A;  1N76 A;  2ONK E;  4HW8 A;  1EH3 A;  4KPT A;  5EQA A;  1UTH A;  3F11 A;  3E13 X;  4EF2 A;  3Q26 A;  2I0C A;  4YB5 A;  2HCA A;  4GF8 A;  1MY4 A;  3BBR A;  4PDH A;  3EQ1 A;  3UA8 A;  3H6V A;  5K2Y A;  5A5X B;  5AA2 D;  3CFL A;  1YZ0 A;  4R6H A;  2B4L A;  3FJ7 A;  4KFQ A;  1NH7 A;  1SI0 A;  4PBH A;  3TPA A;  3FVK A;  3FV1 A;  1MQH A;  3FV2 A;  5TPA B;  1PB8 A;  3IJX B;  1JW5 A;  4ELR A;  3Q27 A;  2F78 A;  3BKI B;  2ZNU A;  1MY0 A;  3FVG A;  4N6K A;  4LZ8 A;  4ELP A;  2ABH A;  5I2N A;  4OYV A;  1P1Q A;  5KDT A;  4OVS A;  4Q8R A;  4GL0 A;  1LLS A;  3CVG A;  3VLV A;  4OVJ A;  3SEU A;  2NUV A;  3UIF A;  1EZO A;  4YAH X;  4IO5 A;  3ECR A;  4LON B;  5J1D A;  5I59 B;  1MY3 A;  3TKD A;  4YZZ A;  4F1V A;  2O68 A;  2WYK A;  3HV1 A;  5BWJ A;  3W9W A;  3LSW A;  4PDD A;  5AA1 A;  1R9L A;  4POX A;  5ICT A;  1ZMG A;  4XIG Q;  5DTB A;  3DP8 A;  1LFG A;  3FXU A;  2H9B A;  2UVG A;  4HE0 A;  3CRB A;  3MJN A;  3PUV E;  3PPQ A;  1SD3 A;  3QMF A;  5L9S A;  3OEK A;  3MUQ A;  2VP1 A;  2ZMB A;  2RCB A;  1JEV A;  1MG1 A;  5DEX A;  3SER A;  2QS2 A;  2ZYO A;  1MM6 A;  4MLV A;  3MWB A;  4F3B A;  2FIE A;  5ITO A;  2MKZ A;  4OA4 A;  3PUW E;  3I5O A;  2AYS A;  2DE3 A;  1OQG A;  4RNS A;  2IA4 A;  1B4H A;  3O6G A;  5BUU A;  4QHQ A;  3EN3 A;  4ZEI A;  4ZDM A;  2O1M A;  3V83 A;  3OO8 A;  1B7U A;  4GWZ A;  3SEW A;  3BFT A;  3C35 A;  1B4Z A;  1QJM A;  1FQF A;  4NF8 A;  1BKA A;  2Y5L A;  2H25 A;  1ZIU A;  3TMG A;  3TTL A;  2QRY A;  1RKM A;  1H44 A;  2DOJ A;  5ET6 A;  1MM7 A;  2CEX A;  4PTK A;  3KOT A;  3MP6 A;  3TYH A;  1OMP A;  2V4C A;  4KD5 A;  4DI3 D;  3MW0 A;  3DM0 A;  4HTG A;  4PBQ A;  5K2X A;  4EDP A;  4PCD A;  1G0H A;  3D1R A;  3QXM A;  2UXA A;  4NF6 A;  4ZE9 A;  2Y5K A;  2P0S A;  4AS5 A;  2UYF A;  5I58 B;  2F8D A;  4JWX A;  4N07 A;  2OWT A;  3RLF E;  2UVJ A;  2Y84 A;  1IIT A;  3UK4 A;  4U22 A;  2DDK A;  3DLN A;  5DVI A;  2WBB A;  2FNC A;  2I6E A;  3GXA A;  2OJT A;  4C1T A;  3S2V A;  2VHA A;  4JBZ A;  1LFH A;  1JVX A;  3IFA A;  3QIM A;  4MNI A;  4GWY A;  2NXO A;  4NHB A;  3O9P A;  1IMD A;  4P11 A;  2RC8 A;  4K3F A;  2HZK A;  4N17 A;  1AIV A;  4H8J A;  2YPN A;  2I49 A;  4DZ1 A;  1YTV A;  1UTB A;  4O7I A;  3RPL B;  3G3K A;  4HCY A;  1A40 A;  4BDM A;  4P0I A;  2QMW A;  2CZI A;  1A54 A;  1H76 A;  3FJM A;  3QUF A;  1FQE A;  5ITP A;  1JQF A;  2YLN A;  2PBW A;  3QUJ A;  4GX4 A;  2XXT A;  2XD3 A;  4ND9 A;  2REJ A;  3K01 A;  1QUK A;  3O66 A;  5IGA A;  4JVD A;  1MXX A;  3PPR A;  4P1L A;  3SEY A;  1ZU0 A;  3VXC A;  3H03 A;  3QAX A;  5AE4 A;  2XXW A;  4NF4 B;  4H6D A;  1MXU A;  4Q0C A;  4YIC A;  3GYY A;  4H45 A;  4GWX A;  1Q35 A;  2Z22 A;  4H0W A;  3D4C A;  5ET5 A;  2WBD A;  2HFB A;  2ZYM A;  3RTF B;  2R6G E;  3IB2 A;  1D9V A;  5B70 A;  4WXJ A;  2DWA A;  3C34 A;  3VV5 A;  4GIZ A;  4YB7 A;  1A55 A;  1PEB A;  1IZ1 A;  1L5T A;  4F1Y A;  1Y3N A;  2GQ1 A;  4X1B A;  3CG1 A;  4P0G A;  4RA1 A;  4MF3 A;  3VLU A;  5I2K B;  5J16 A;  3GBA A;  4F2O A;  2YJP A;  2R8T A;  4LA9 A;  4MAG A;  1VFD A;  5H8H B;  1URD A;  3MVW A;  1P1N A;  4DXU A;  1US5 A;  2M8C A;  3PTY A;  5EHS A;  3HST A;  3G3F A;  4GQO A;  3K00 A;  4PP0 A;  3SDF A;  4FIM A;  4G4P A;  5AA3 A;  1EYI A;  3BFU A;  3T66 A;  1FRP A;  1Y3P A;  4L17 A;  1RDY A;  3QK6 A;  3RN8 A;  1Y20 A;  4NWD A;  4NQ8 A;  1I69 A;  3FD3 A;  3IOT A;  2OCU A;  4GD5 A;  1O63 A;  1DTG A;  5M2V A;  4MMP A;  3V8X B;  3FZV A;  3PUY E;  4P9K A;  4ZED A;  2HXW A;  2RCA A;  4XEQ A;  4PET A;  4GWS A;  2Y7R A;  3A3U A;  4YMA A;  2RIN A;  3ZSF A;  3B6T A;  4PFY A;  4BDL A;  5AA2 B;  1MY1 A;  2RF1 A;  3OO7 A;  4P8B A;  4MCO A;  1R6Z A;  4GBV A;  3W15 C;  3H3G A;  1QUJ A;  4TQU Q;  1B3H A;  3K1N A;  1LB8 A;  1Z7M E;  1IMA A;  1A8F A;  4OTE A;  1DK4 A;  3KJT A;  1Q1K A;  4IGR A;  1S7Y A;  4JVC A;  1YYZ A;  3PV0 E;  2Z8E A;  2HXR A;  4QFO A;  3LV0 A;  1URS A;  4N4U A;  1MPB A;  2RC7 A;  5EQ9 A;  1VSO A;  1USY E;  1XVY A;  1P1W A;  4TLL B;  4QSC A;  3M3F A;  3IOU A;  2REG A;  4OEN A;  2O84 X;  1B32 A;  3PMV A;  5ICQ A;  3CG3 A;  1B58 A;  4G8H A;  2DYX A;  2VGQ A;  4GOT A;  3L6H A;  4MNP A;  2ZYN A;  4LQ5 A;  3T9V A;  4PE3 A;  5EYF A;  1BK4 A;  1VFE A;  5LDZ A;  2DVZ A;  1NV6 A;  3T1B A;  5HBC A;  3IFC A;  2QS4 A;  5DW8 A;  3UN6 A;  4ECF A;  5I56 A;  4GFR A;  4YB6 A;  2F7A A;  1OVB A;  3K2D A;  3RY3 A;  2FVZ A;  4AB5 A;  2R9J A;  1FBP A;  4QSD A;  3MYU A;  3M3L A;  1D3K A;  1ATG A;  2V93 A;  4RK9 A;  4HE2 A;  1AWB A;  1TFD A;  1NUZ A;  3I3V A;  2WX9 A;  4N81 A;  3E78 A;  1MQI A;  2A5T A;  1MDQ A;  1QUI A;  1FPK A;  4XKN A;  2QJE A;  1FTA A;  2F97 A;  3ZKL A;  4R73 A;  2Y7K A;  1NV3 A;  1FTL A;  1N7W A;  3PUX E;  1HSJ A;  4QFP A;  2H98 A;  3IOR A;  4YKP A;  4XF5 A;  3VDF A;  1M5D A;  3O29 A;  4JB7 A;  1SQY A;  3CFZ A;  5L8D A;  5KCJ A;  4EUO A;  4F2Q A;  3SEV A;  1RYX A;  2PCR A;  2FA7 A;  4BDR A;  1QVS A;  4MJO A;  1FTK A;  1QUL A;  5H8N A;  4HS7 A;  5IM2 A;  4NF8 B;  5H8Q A;  1JP4 A;  3UOR A;  1SYI A;  1IXH A;  5B7D A;  4F29 A;  3K6X A;  3OO6 A;  1OIB A;  2E1S A;  4O3B A;  2G29 A;  2X7Q A;  3GLB A;  2W7Y A;  3TFL A;  3O28 A;  1N04 A;  3LR1 A;  2Q2A A;  3QSL A;  2DWJ A;  1QKB A;  2QSX A;  1H43 A;  2F5X A;  2DSF A;  3R7X A;  3IOW A;  3KC0 A;  1H45 A;  5F1Q A;  3S9E A;  4YKK A;  1B5H A;  3T0J A;  2ONS A;  3T93 B;  4DCX A;  1OVT A;  3O6H A;  1MPC A;  5IZ3 B;  2CZL A;  5I3S A;  4XKQ A;  3PMW A;  3OO9 A;  1IXC A;  3I6V A;  5I84 A;  1N7X A;  3TEP A;  3TZA A;  1GGG A;  1IQ7 A;  3IB0 A;  2HHM A;  2XX9 A;  1WDN A;  2XXI A;  4U4S A;  2ZNS A;  5TU0 A;  2Z8D A;  3U92 A;  1HSL A;  4X9T A;  1Y4T A;  4GWO A;  1ZLQ A;  4MNC A;  3MPL A;  1FTM A;  1JW4 A;  4IY6 A;  1G0I A;  4OEU A;  3G3H A;  2H99 A;  2O7I A;  1DOT A;  5AA4 B;  1QGX A;  1MXY A;  1Y3Q A;  2F7C A;  2PT1 A;  2F36 A;  3V5A A;  1QKA A;  3USD A;  1B52 A;  1NL5 A;  2PMS A;  3VVD A;  4BDN A;  2VD3 A;  1FCK A;  3ZKK A;  4R9G A;  5JEI A;  3GZG A;  3K0V A;  1Y1Z A;  4OZ9 A;  4XKR A;  3VLW A;  1OQH A;  2HEU A;  4MIJ A;  4N8G A;  4F31 B;  1UIU A;  4Q5T A;  4X48 A;  4NGU A;  5I57 A;  4BDO A;  1UTB B;  2V3Q A;  3E4R A;  4G68 C;  4IGT A;  1INP A;  4EXK A;  1LAH E;  1VDW A;  1M5B A;  3MVX A;  4N13 A;  1PC3 A;  1MQJ A;  1FBC A;  3RYD A;  1AOV A;  3CIJ A;  3HHF A;  4EF1 A;  1USY H;  3E3K A;  1DMB A;  2CEY A;  1NH8 A;  2D3I A;  3FXQ A;  3RT8 A;  5H8F B;  4LAT A;  4H1X A;  5CMM A;  1FPF A;  2Q8J A;  2ALU A;  3KBR A;  2I4C A;  2FYI A;  4R6Y A;  1XC1 A;  3KGC A;  3TTM A;  4UAC A;  3D4G A;  1KA0 A;  3H4Z A;  1GR2 A;  1Z7N E;  1B1H A;  4ESW A;  5I59 A;  2F6P A;  1T0K A;  3LSX A;  4LUB A;  2Y7I A;  4GVO A;  5L9M A;  1NUY A;  3OEL A;  4OVP A;  4P1E A;  1PBP A;  1DTZ A;  3IJO B;  1MH3 A;  3TQL A;  4FAJ A;  2I0B A;  3QYT A;  1IXI A;  3SZP A;  4P47 A;  3RQT A;  1B3F A;  3A29 A;  1FPG A;  2PVU A;  1DSN A;  5EYH A;  4YU0 A;  4G77 A;  3K02 A;  2DQV A;  1GTK A;  1UIV A;  4JVI A;  1YXI A;  1D9Q A;  3FJG A;  4LVQ A;  1DPP A;  4XKP A;  4MH5 A;  3FBP A;  2VPO A;  4LN5 A;  4R75 A;  4OFO A;  3VE1 B;  4R6K A;  3PUZ E;  4I8C A;  2PFY A;  1FBG A;  2O6A A;  4H5F A;  5EQ8 A;  1NUW A;  1B9J A;  4MHF A;  3DEL B;  4OQO A;  4PFU A;  1NV4 A;  4RYA A;  1B46 A;  1EZ9 A;  4DDD A;  4I40 A;  4OET A;  3TQW A;  3UP9 A;  3M3K A;  2NVU B;  3KC1 A;  3O97 A;  3KOS A;  4G68 A;  4OEV A;  3MST A;  4PAI A;  3CR9 A;  2F35 A;  5HM4 B;  2X7P A;  2I4B A;  3THI A;  1TXF A;  4OFL A;  1MH4 A;  4ISU A;  4PFR A;  3FXR A;  2HAV A;  2I48 A;  2Q8M A;  4JSO A;  1MQG A;  4X8R A;  1DCU A;  1B3G A;  4FED A;  5LTC A;  1JEU A;  1PDA A;  3LUY A;  2VD2 A;  4PF6 A;  4BDQ A;  1UQW A;  1N84 A;  3U93 A;  2XXY A;  4GL8 A;  2XWO A;  3EHT A;  1K9Z A;  3LBS A;  2OX3 A;  4RPN A;  3PD8 A;  2QL3 A;  3FUZ A;  4GWW A;  4N8Y A;  1A7L A;  3JV9 A;  2F7B A;  4JDF A;  2H4I A;  1LCF A;  3E9X A;  3EF7 A;  4XFE A;  1SI1 A;  1MDP 1;  5F7V A;  1BLF A;  4OAN A;  3K6V A;  3K6U A;  3CSB A;  1FTJ A;  1IUD A;  4R74 A;  3OXN A;  3A09 A;  4DIG A;  4OVQ A;  1Q9D A;  3FXB A;  3AXF A;  3ILT B;  1LST A;  5T3J A;  4FE8 A;  1D9Y A;  2XHD A;  5I58 A;  1XI6 A;  4FEC A;  5CMC A;  1CE2 A;  5H8S A;  1CB6 A;  3N6U A;  3PU5 A;  4GLI A;  3PPN A;  2KQZ A;  4PFT A;  1LBC A;  3SEX A;  4O3C A;  1KWH A;  4U2R A;  2I3V A;  3VFJ A;  1M5C A;  2ZZX A;  2OBG A;  1HSE A;  4WEP A;  3FVN A;  3B7D A;  2V3U A;  4FAT A;  4AB6 A;  3WAF A;  4DXC A;  3MZB A;  4POW A;  4F1U A;  1WOD A;  4FOR A;  3N5L A;  4QFN A;  4ONY A;  4OER A;  4EQB A;  4KQP A;  3Q29 A;  1MS7 A;  5DYH A;  2OWS A;  4I3E A;  5JTY B;  4H5G A;  4OVR A;  1SPI A;  3MC2 A;  5CMB A;  4X1D A;  3K1M A;  5ET7 A;  1SYH A;  4IO2 A; 
#chains in the Genus database with same CATH homology
 3TAJ A;  1LAF E;  4WED A;  4H67 A;  1YCJ A;  1LBB A;  3OOA A;  3HCQ A;  3VXB A;  1SW5 A;  4F3G A;  4OWD A;  1GV8 A;  3C33 A;  3TTR A;  2VOZ A;  2XX7 A;  1FTO A;  2O7U A;  4ZZE A;  3OD7 A;  4G8M A;  4OXV A;  1ANF A;  3RT6 B;  2E0S A;  2CMO A;  4F18 A;  3ZS6 A;  3V89 B;  4QSE A;  1B6H A;  4KCC A;  4NTL A;  5TP9 B;  2DWI A;  3K6W A;  1ZJL A;  2XD2 A;  2QPQ A;  1A8E A;  5CBS A;  3SET A;  3H6W A;  2DXR A;  1UTH B;  3TEL A;  3S9N C;  5DT6 A;  1LAG E;  4Z0I A;  1NFT A;  4MFI A;  1JW1 A;  1SVX B;  1MPD A;  3C36 A;  2V84 A;  3R26 A;  4ZS9 A;  1NKX A;  5KCJ B;  1BP5 A;  1OLA A;  3HPI A;  2F6G A;  2RKM A;  3PD9 A;  3RTW B;  1IEJ A;  2PT2 A;  3TUS A;  4F22 A;  5H8N B;  4EXL A;  3EHU A;  4YKJ A;  3G3J A;  3IOV A;  2O51 A;  2ZXT A;  5I2N B;  5I2K A;  5KDT B;  3IB1 A;  4KI0 E;  3MP1 A;  1IXG A;  1S50 A;  3U1O A;  3PPP A;  1M5E A;  4NMY A;  2NOO A;  3MZ1 A;  1B7Z A;  4NF5 A;  4ESX A;  3Q28 A;  1LCT A;  3IK6 B;  2DE4 A;  4RJZ A;  4IO6 A;  2GH9 A;  3MAM A;  4M1V A;  2ONR A;  3H7M A;  5FHM A;  2QS3 A;  2OZZ A;  1B5J A;  2B3F A;  2XXV A;  3JZJ A;  4EQ9 A;  5CM6 A;  3S9M C;  1MRP A;  2O1L A;  3VVF A;  1EZP A;  5DEX B;  2THI A;  4JSD A;  4R2F A;  1A99 A;  1B1X A;  4F19 A;  2Q89 A;  1JNF A;  1I6A A;  3C9H A;  3KZG A;  5AA2 A;  2Q9T A;  1NNK A;  1PBQ A;  3G3G A;  1MXW A;  5IAI A;  3RGY A;  2XXR A;  1IIW A;  2XXU A;  3FAS A;  1O64 A;  1JVY A;  3K4U A;  1I6Q A;  2NWJ A;  1DPE A;  1AH5 A;  1S9T A;  3OEN A;  3MBP A;  3A3C A;  5I57 B;  2DVC A;  1N3W A;  1LB9 A;  3KFM A;  3LC8 A;  4XTC Q;  3U94 A;  3KEI A;  1US4 A;  2V3T A;  1N0T A;  4AQ4 A;  3T9H B;  4JWO A;  4KHZ E;  2ZNT A;  3W9V A;  4DE8 A;  4NE4 A;  4IO7 A;  2OLB A;  3K1P A;  3TTN A;  4RXL A;  5KZT A;  4PFW A;  1XS5 A;  3LSF B;  4U1O A;  2Q2C A;  4NF6 B;  5L9O A;  2I58 A;  5ELV A;  2R71 A;  4HCW A;  1ZTY A;  4RY1 A;  3OSR A;  1JET A;  1XVX A;  1J1N A;  1BIY A;  2ZYK A;  4KYD A;  3TDJ A;  4KYE A;  3P7I A;  4NED A;  4QFL A;  2AL5 A;  1B51 A;  3KN8 A;  3TOD A;  3RNN A;  2XXP A;  2WKY A;  4DCY A;  3R6U A;  3IR1 A;  4GRK A;  3WAE A;  5A5X A;  1FQA A;  4LP2 B;  4ELQ A;  3LSL A;  4G68 B;  2Q88 A;  4Q30 B;  4R72 A;  3IO6 A;  3ONM A;  1H3D A;  4LZ5 A;  5TPA A;  1XHY A;  2D5W A;  1LAX A;  2HAU A;  1MXZ A;  3KG2 A;  5FHO A;  4KR5 A;  2UVH A;  3IAZ A;  2B3B A;  2ESN A;  4KCD A;  5CMK A;  1D4N A;  2AL4 A;  1NNT A;  3IO4 A;  3ILU B;  4N6P A;  2DS9 A;  2QMX A;  3O6I A;  2XXX A;  5FTI A;  1B40 A;  4U4X A;  2GRV A;  4FEB A;  3OEM A;  1RYO A;  2P2A A;  4Z7E A;  3KSX A;  1AMF A;  1VE4 A;  3FGS A;  3JYR A;  4H65 A;  4PQJ A;  2Z23 A;  4DLD A;  4ZEF A;  5DVJ A;  3TCG A;  1FW0 A;  1B5I A;  4JWY A;  4JXI A;  1SBP A;  4U21 A;  3O2A A;  5HPQ A;  5AA4 A;  1XOC A;  3TTK A;  2B65 A;  5CBR A;  1LFI A;  3HHG A;  3OSQ A;  2OK2 A;  3G3I A;  2D21 A;  1B0H A;  1FQD A;  4PE5 B;  5EHM A;  3U8Q A;  1QW0 A;  4E0X A;  4WKM A;  3N26 A;  1FQC A;  3B6Q A;  5IKB A;  2DP8 A;  2HZL A;  2QS1 A;  3B6W A;  4U1Z A;  3UGW A;  4IY5 A;  3FAT A;  3MQ9 A;  4OES A;  4R9F A;  4OMB A;  3KN7 A;  4MBP A;  1URG A;  5H8F A;  2DWH A;  3HN0 A;  1YPN A;  1SW4 A;  2O69 A;  2DE2 A;  4G2Z A;  4TOZ A;  1OLC A;  1B05 A;  2I3W A;  4ZEB A;  2AIX A;  1B3E A;  4F3P A;  3IX1 A;  3PMX A;  1NNF A;  4QRZ A;  2V25 A;  3ODB A;  4ZEK A;  2PX1 A;  1B2H A;  2GFE A;  4EQ7 A;  1MY2 A;  1B7H A;  1NNP A;  1AL3 A;  3H6U A;  2BJJ X;  3FVO A;  1F9B A;  3TCH A;  3OMB A;  4THI A;  3SES A;  4ZZA A;  4QFK A;  4ZEC A;  5FTH A;  1EU8 A;  1POT A;  3C31 A;  3TCF A;  4U23 A;  3MVY A;  4QF9 A;  4YMB A;  3CFX A;  1WVJ A;  3PPO A;  3U72 A;  3CSG A;  4NWC A;  3KSJ A;  1N3X A;  1VR5 A;  4I62 A;  3C4M A;  3MVZ A;  1ZKB A;  3DP4 A;  3KN3 A;  4IO3 A;  4C0R A;  2GHA A;  3RPW A;  1SW2 A;  4NF5 B;  5LOM A;  5I56 B;  3H06 B;  4I1D A;  3N6T A;  2UVI A;  5CRY A;  3T96 B;  1BTJ A;  1Y9U A;  2GHB A;  1B0L A;  2A5T B;  1GVC A;  5JK4 A;  5DVF A;  3S4U A;  1SDX A;  4OFJ A;  2UYE A;  4C1U A;  4NF4 A;  4E0W A;  1B3L A;  1O7T A;  4GXS B;  2Y7P A;  2X26 A;  4ELO A;  1SW1 A;  4I9D A;  4BLA A;  2ANJ A;  3N94 A;  2PYY A;  1LGB C;  1P1O A;  2P1S A;  4OHN A;  1R1N A;  1ELJ A;  4TLM B;  3T9U A;  5CI5 A;  3EHS A;  3S9L C;  3H6T A;  3DP6 A;  3HO7 A;  2KLF A;  5H8Q B;  1MQD A;  1PB9 A;  3GBB A;  4YKI A;  1PB7 A;  3L6G A;  4RPO A;  2Z8F A;  1TWY A;  4O3A A;  3KJ7 A;  2XXQ A;  4R2B A;  4IO4 A;  4FJP A;  4M4G A;  4GXA A;  5H8H A;  2IEE A;  1P99 A;  3G7W A;  5JTY A;  1TT1 A;  1M5F A;  3SKP A;  5ISU A;  4ZE8 A;  1Y1M A;  4UA8 A;  2XXH A;  3VVE A;  2F34 A;  2LAO A;  3T9X B;  1YAE A;  3C32 A;  1II5 A;  3IL1 B;  3M8U A;  4F39 A;  4RK2 A;  5FHN A;  3FIR A;  3PGF A;  4DXB A;  2G93 A;  1P1U A;  4KYS A;  3T22 A;  3Q25 A;  2HQ0 A;  2H5Y A;  1TFA A;  1R9Q A;  3EPE A;  4XXU A;  2XX8 A;  4G8N A;  1Y4C A;  4MLQ A;  3MZ9 A;  5CC2 A;  3RUM A;  1I6B A;  4LQ2 A;  1XT8 A;  2A5S A;  2RC9 A;  3MP8 A;  5TP9 A;  1MXV A;  2Y7W A;  2DXY A;  3MPK A;  1POY 1;  4H8I A;  4LZ7 A;  1ZBM A;  1NMU A;  4F3S A;  3CI8 A;  4IB2 A;  1FQB A;  1N76 A;  2ONK E;  4HW8 A;  1EH3 A;  4KPT A;  1UTH A;  3F11 A;  3E13 X;  4EF2 A;  3Q26 A;  2I0C A;  4YB5 A;  2HCA A;  4GF8 A;  3UA8 A;  1MY4 A;  3BBR A;  3EQ1 A;  3H6V A;  5K2Y A;  5A5X B;  5AA2 D;  3CFL A;  4R6H A;  3FJ7 A;  4KFQ A;  1NH7 A;  1SI0 A;  3TPA A;  3FVK A;  3FV1 A;  1MQH A;  3FV2 A;  5TPA B;  1PB8 A;  3IJX B;  1JW5 A;  4ELR A;  3Q27 A;  2F78 A;  3BKI B;  2ZNU A;  1MY0 A;  3FVG A;  4LZ8 A;  4ELP A;  2ABH A;  5I2N A;  4OYV A;  1P1Q A;  5KDT A;  4Q8R A;  4GL0 A;  1LLS A;  3CVG A;  3VLV A;  4OVJ A;  3SEU A;  2NUV A;  3UIF A;  1EZO A;  4YAH X;  4IO5 A;  3ECR A;  4LON B;  5J1D A;  5I59 B;  1MY3 A;  3TKD A;  4YZZ A;  4F1V A;  2O68 A;  3HV1 A;  5BWJ A;  3W9W A;  3LSW A;  5AA1 A;  1R9L A;  4POX A;  5ICT A;  1ZMG A;  4XIG Q;  5DTB A;  3DP8 A;  1LFG A;  3FXU A;  2H9B A;  2UVG A;  3CRB A;  3MJN A;  3PUV E;  3PPQ A;  1SD3 A;  5L9S A;  3OEK A;  3MUQ A;  2VP1 A;  2ZMB A;  2RCB A;  1JEV A;  1MG1 A;  5DEX A;  3SER A;  2QS2 A;  2ZYO A;  1MM6 A;  4MLV A;  3MWB A;  4F3B A;  5ITO A;  3PUW E;  3I5O A;  2AYS A;  2DE3 A;  1OQG A;  4RNS A;  2IA4 A;  1B4H A;  3O6G A;  5BUU A;  4QHQ A;  3EN3 A;  4ZEI A;  4ZDM A;  2O1M A;  3V83 A;  3OO8 A;  1B7U A;  3SEW A;  3BFT A;  3C35 A;  1B4Z A;  1QJM A;  1FQF A;  4NF8 A;  1BKA A;  2H25 A;  1ZIU A;  3TMG A;  3TTL A;  2QRY A;  1RKM A;  1H44 A;  2DOJ A;  1MM7 A;  3KOT A;  3MP6 A;  3TYH A;  1OMP A;  4KD5 A;  3MW0 A;  3DM0 A;  4HTG A;  5K2X A;  4EDP A;  3QXM A;  2UXA A;  4NF6 A;  4ZE9 A;  2P0S A;  2UYF A;  5I58 B;  2F8D A;  4JWX A;  4N07 A;  2OWT A;  3RLF E;  2UVJ A;  2Y84 A;  1IIT A;  3UK4 A;  4U22 A;  3DLN A;  5DVI A;  2FNC A;  2I6E A;  3GXA A;  2OJT A;  4C1T A;  3S2V A;  2VHA A;  4JBZ A;  1LFH A;  1JVX A;  3QIM A;  2NXO A;  3O9P A;  4P11 A;  2RC8 A;  4K3F A;  2HZK A;  1AIV A;  4H8J A;  2YPN A;  2I49 A;  4DZ1 A;  1YTV A;  1UTB A;  3G3K A;  4HCY A;  1A40 A;  4BDM A;  4P0I A;  2QMW A;  1A54 A;  1H76 A;  3FJM A;  3QUF A;  1FQE A;  5ITP A;  1JQF A;  2YLN A;  2PBW A;  3QUJ A;  2XXT A;  2XD3 A;  4ND9 A;  2REJ A;  3K01 A;  1QUK A;  3O66 A;  1MXX A;  3PPR A;  3SEY A;  1ZU0 A;  3VXC A;  3H03 A;  3QAX A;  5AE4 A;  2XXW A;  4NF4 B;  4H6D A;  1MXU A;  4Q0C A;  4YIC A;  1Q35 A;  2Z22 A;  4H0W A;  3D4C A;  2HFB A;  2ZYM A;  3RTF B;  2R6G E;  3IB2 A;  1D9V A;  5B70 A;  4WXJ A;  2DWA A;  3C34 A;  3VV5 A;  4GIZ A;  4YB7 A;  1A55 A;  1PEB A;  1IZ1 A;  1L5T A;  4F1Y A;  1Y3N A;  4X1B A;  3CG1 A;  4P0G A;  4RA1 A;  4MF3 A;  3VLU A;  5I2K B;  3GBA A;  4F2O A;  2YJP A;  4LA9 A;  1VFD A;  5H8H B;  1URD A;  3MVW A;  1P1N A;  4DXU A;  1US5 A;  2M8C A;  5EHS A;  3HST A;  3G3F A;  4GQO A;  3K00 A;  4PP0 A;  3SDF A;  4FIM A;  4G4P A;  5AA3 A;  3BFU A;  3T66 A;  1Y3P A;  4L17 A;  3QK6 A;  3RN8 A;  1Y20 A;  4NWD A;  1I69 A;  3FD3 A;  3IOT A;  2OCU A;  4GD5 A;  1O63 A;  1DTG A;  5M2V A;  3V8X B;  3FZV A;  3PUY E;  4ZED A;  2HXW A;  2RCA A;  4PET A;  2Y7R A;  3A3U A;  4YMA A;  2RIN A;  3ZSF A;  3B6T A;  4PFY A;  4BDL A;  5AA2 B;  1MY1 A;  2RF1 A;  3OO7 A;  1R6Z A;  3W15 C;  3H3G A;  1QUJ A;  4TQU Q;  1B3H A;  3K1N A;  1LB8 A;  1Z7M E;  1A8F A;  4OTE A;  3KJT A;  1Q1K A;  4IGR A;  1S7Y A;  3PV0 E;  2Z8E A;  4QFO A;  1URS A;  1MPB A;  2RC7 A;  1VSO A;  1USY E;  1XVY A;  1P1W A;  4TLL B;  4QSC A;  3M3F A;  3IOU A;  2REG A;  4OEN A;  2O84 X;  1B32 A;  3PMV A;  5ICQ A;  3CG3 A;  1B58 A;  4G8H A;  2DYX A;  2VGQ A;  4GOT A;  3L6H A;  2ZYN A;  4LQ5 A;  3T9V A;  5EYF A;  1VFE A;  2DVZ A;  5HBC A;  3UN6 A;  2QS4 A;  4ECF A;  5I56 A;  4GFR A;  4YB6 A;  2F7A A;  1OVB A;  3K2D A;  3RY3 A;  4AB5 A;  2R9J A;  4QSD A;  3M3L A;  1D3K A;  1ATG A;  2V93 A;  4RK9 A;  1TFD A;  3I3V A;  1MQI A;  2A5T A;  1MDQ A;  1QUI A;  4XKN A;  2QJE A;  2F97 A;  3ZKL A;  4R73 A;  2Y7K A;  1FTL A;  1N7W A;  3PUX E;  1HSJ A;  4QFP A;  2H98 A;  3IOR A;  4YKP A;  3VDF A;  1M5D A;  3O29 A;  4JB7 A;  1SQY A;  3CFZ A;  5L8D A;  5KCJ A;  4EUO A;  4F2Q A;  3SEV A;  1RYX A;  2FA7 A;  4BDR A;  1QVS A;  1FTK A;  1QUL A;  5H8N A;  4HS7 A;  4NF8 B;  5H8Q A;  3UOR A;  1SYI A;  1IXH A;  5B7D A;  4F29 A;  3K6X A;  3OO6 A;  1OIB A;  2E1S A;  4O3B A;  2G29 A;  2X7Q A;  3GLB A;  2W7Y A;  3TFL A;  3O28 A;  1N04 A;  3LR1 A;  2Q2A A;  3QSL A;  2DWJ A;  1QKB A;  2QSX A;  1H43 A;  2F5X A;  2DSF A;  3R7X A;  3IOW A;  1H45 A;  5F1Q A;  3S9E A;  4YKK A;  1B5H A;  2ONS A;  3T93 B;  4DCX A;  1OVT A;  3O6H A;  1MPC A;  2CZL A;  4XKQ A;  3PMW A;  3OO9 A;  1IXC A;  3I6V A;  5I84 A;  1N7X A;  3TEP A;  3TZA A;  1GGG A;  1IQ7 A;  3IB0 A;  2XX9 A;  1WDN A;  2XXI A;  4U4S A;  2ZNS A;  5TU0 A;  2Z8D A;  3U92 A;  1HSL A;  4X9T A;  1Y4T A;  4GWO A;  1ZLQ A;  3MPL A;  1FTM A;  1JW4 A;  4IY6 A;  4OEU A;  3G3H A;  2H99 A;  2O7I A;  1DOT A;  5AA4 B;  1MXY A;  1Y3Q A;  2F7C A;  2PT1 A;  2F36 A;  3V5A A;  1QKA A;  3USD A;  1B52 A;  1NL5 A;  2PMS A;  3VVD A;  4BDN A;  2VD3 A;  1FCK A;  3ZKK A;  4R9G A;  5JEI A;  3GZG A;  3K0V A;  1Y1Z A;  4OZ9 A;  4XKR A;  3VLW A;  1OQH A;  2HEU A;  4F31 B;  1UIU A;  4Q5T A;  4X48 A;  5I57 A;  4BDO A;  1UTB B;  2V3Q A;  3E4R A;  4G68 C;  4IGT A;  4EXK A;  1LAH E;  1M5B A;  3MVX A;  4N13 A;  1PC3 A;  1MQJ A;  1AOV A;  3CIJ A;  3HHF A;  4EF1 A;  1USY H;  3E3K A;  1DMB A;  1NH8 A;  2D3I A;  3FXQ A;  3RT8 A;  5H8F B;  4LAT A;  4H1X A;  5CMM A;  2Q8J A;  2ALU A;  3KBR A;  2I4C A;  2FYI A;  4R6Y A;  1XC1 A;  3KGC A;  3TTM A;  4UAC A;  3D4G A;  3H4Z A;  1GR2 A;  1Z7N E;  1B1H A;  4ESW A;  5I59 A;  2F6P A;  1T0K A;  3LSX A;  4LUB A;  2Y7I A;  4GVO A;  5L9M A;  3OEL A;  1PBP A;  1DTZ A;  3IJO B;  1MH3 A;  3TQL A;  4FAJ A;  2I0B A;  3QYT A;  1IXI A;  3RQT A;  1B3F A;  2PVU A;  1DSN A;  4YU0 A;  4G77 A;  3K02 A;  2DQV A;  1GTK A;  1UIV A;  3FJG A;  4LVQ A;  1DPP A;  4XKP A;  4MH5 A;  4R75 A;  4OFO A;  3VE1 B;  4R6K A;  3PUZ E;  4I8C A;  2O6A A;  4H5F A;  1B9J A;  3DEL B;  4OQO A;  4PFU A;  4RYA A;  1B46 A;  1EZ9 A;  4DDD A;  4OET A;  3TQW A;  3UP9 A;  3M3K A;  2NVU B;  3O97 A;  3KOS A;  4G68 A;  4OEV A;  3CR9 A;  2F35 A;  5HM4 B;  2X7P A;  2I4B A;  3THI A;  1TXF A;  4OFL A;  1MH4 A;  4ISU A;  3FXR A;  2HAV A;  2I48 A;  4JSO A;  1MQG A;  1B3G A;  4FED A;  1JEU A;  1PDA A;  3LUY A;  2VD2 A;  4BDQ A;  1UQW A;  1N84 A;  3U93 A;  2XXY A;  4GL8 A;  3EHT A;  3LBS A;  4RPN A;  3PD8 A;  2QL3 A;  3FUZ A;  1A7L A;  3JV9 A;  2F7B A;  4JDF A;  2H4I A;  1LCF A;  3E9X A;  3EF7 A;  1SI1 A;  1MDP 1;  5F7V A;  1BLF A;  3K6V A;  3K6U A;  3CSB A;  1FTJ A;  1IUD A;  4R74 A;  3OXN A;  3A09 A;  4DIG A;  3AXF A;  3ILT B;  1LST A;  4FE8 A;  1D9Y A;  2XHD A;  5I58 A;  4FEC A;  5CMC A;  1CE2 A;  5H8S A;  1CB6 A;  3N6U A;  3PU5 A;  4GLI A;  3PPN A;  4PFT A;  1LBC A;  3SEX A;  4O3C A;  1KWH A;  4U2R A;  2I3V A;  3VFJ A;  1M5C A;  2OBG A;  1HSE A;  4WEP A;  3FVN A;  3B7D A;  2V3U A;  4FAT A;  4AB6 A;  3WAF A;  4DXC A;  3MZB A;  4POW A;  4F1U A;  1WOD A;  4FOR A;  3N5L A;  4QFN A;  4ONY A;  4OER A;  4EQB A;  4KQP A;  3Q29 A;  1MS7 A;  5DYH A;  2OWS A;  5JTY B;  4H5G A;  3MC2 A;  5CMB A;  4X1D A;  3K1M A;  1SYH A;  4IO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...