3MP8A

Crystal structure of sgf29 tudor domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
513
structure length
513
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 148
structure length 513
sequence length 513
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp8A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp8A01
2Q88A 2B65A 4U23A 3TTRA 4MH5A 2V3QA 3S9NC 1A8FA 3G3KA 1P1NA 1MRPA 5FRNA 2GHBA 5BWJA 3UGWA 4Q5WA 1MXXA 3MUQA 3META 1O7TA 3K1NA 2VD2A 2O69A 5CMCA 2R9JA 3OO7A 4JSOA 5I59B 3FJMA 1F9BA 4NWCA 4KQPA 3G3GA 1ZTYA 4OYVA 4KYEA 3SETA 3RTFB 2V3UA 1YPNA 4E7KA 4RXLA 4LQ5A 1FQAA 1PBQA 4LZ5A 4C1UA 3BKIB 2UXAA 1N0TA 3KN8A 2BKDN 4KI0E 1H3ZA 1A55A 2HFBA 3K2DA 1LFIA 3PPPA 3UP9A 4LONB 3TCHA 4DZ1A 4KFQA 3OOAA 4ZZEA 1QUIA 3QK6A 2X7PA 4RNSA 4R74A 4IKFA 5H8HB 4LZ7A 1SW1A 5JK4A 1PB7A 3ONMA 3VFJA 4F19A 1POTA 2A5TB 5D6YA 4PE5B 3C36A 3OYFA 2Q9TA 1US5A 3O97A 3SERA 3WAEA 1GR2A 3PUWE 4EDUA 2Z22A 1IXCA 1FTOA 1PEBA 3RN8A 3A3UA 3PPRA 4PP0A 4EUOA 4FEBA 1UTBA 1B32A 1SVXB 1SI0A 4XKRA 1XVXA 1NNFA 4YB7A 4HS7A 2XXTA 3GZGA 2F34A 1B2HA 1LAGE 3PUYE 3BFTA 4YU0A 4IO2A 3SKPA 1SW5A 5L9OA 2RO0A 2F6PA 4MLQA 3MEUA 4X34A 4ELPA 4H0WA 1NH8A 3OXNA 1UQWA 4TLMB 3VLUA 1T0KA 3MVWA 1WJQA 4ONYA 5D6WA 3HPIA 2EQJA 2XK0A 3TUSA 1I6BA 3D4GA 4G68C 1WGSA 2I4CA 4CRIA 2DE4A 5FRMA 5AE4A 1MDQA 2HCAA 3T96B 2Y84A 1CE2A 5EHSA 2ABHA 2H5YA 3IB0A 3E9FA 3FVNA 4PFUA 4NF5A 5CRYA 1IXGA 3P8DA 3O6IA 4QQ6A 2RCBA 2K3YA 4NS5A 4BDNA 2DVCA 1IUDA 3L42A 1QW0A 2GFEA 2ZYMA 3D4CA 3K02A 4U22A 1SI1A 1TFDA 1WVJA 1JQFA 3IOTA 4G2ZA 4F1VA 2EFIA 4BDZA 4OVAA 3W9VA 2V3TA 2DIQA 1MQJA 2L8DA 4HTGA 2RCAA 5C0MA 1Y3NA 4Q0CA 2XXVA 4OENA 4EXKA 1DTZA 3O6GA 1FQDA 4A4FA 1D9YA 1LFHA 3CVGA 3EHSA 1RYXA 4NF6A 3OO9A 5TPAB 2PBWA 2NOOA 1B4HA 3SDFA 3IJOB 1R6ZA 5DEXB 3TCGA 2FYIA 1UIUA 3BDLA 3RPWA 3KBRA 3OA6A 3PD9A 1NKXA 4G77A 3W9WA 2X26A 4OMBA 4FJPA 2F5KA 4JWYA 3CFLA 3O8VA 4GL0A 1B5HA 3T22A 3GXAA 3FJ7A 3DP4A 5H8FA 2RJEA 3Q29A 3EHUA 3OMCA 1QUJA 1MXVA 3ILUB 1SQYA 4ZE9A 3THIA 1DTGA 1WJSA 1D4NA 4JBZA 3TKDA 5KCHA 5F7VA 3S3OA 3HCQA 4O3CA 4ELOA 5I57A 2P1SA 3OSQA 3BBRA 3OYLA 3V8XB 5M9OA 1J1NA 1H76A 1LLSA 1B05A 1FCKA 3VLWA 4PFWA 3LX7A 1LCFA 1I69A 3UIFA 5I58A 1O63A 4BDQA 3M9QA 4A4EA 5ISUA 4IGRA 3OYNA 3ECRA 1JW4A 1Y9UA 4BDMA 3KZGA 2DS9A 3MBPA 1JW5A 3GBBA 4LP2B 2XD3A 3OSRA 4DXUA 4QFKA 4IUTA 2X4XA 3T9HB 5DYHA 1B40A 1Z7ME 3TTKA 2WKYA 4DIGA 4Z0IA 3K6VA 3LSXA 3A3CA 4HCZA 1NNPA 1QKBA 4L59A 3KSXA 3LSWA 3OEKA 4P11A 1B6HA 4YAHX 4HW8A 3IB1A 3HHGA 3K6XA 5AA1A 5KCOA 1AMFA 1JEVA 4ZZAA 3OYGA 2HQ0A 1FQBA 3FVOA 2XXPA 2FA7A 3T9XB 3ASKA 1FTKA 2YJPA 3SEUA 4FL6A 4FIMA 4Q8RA 3KG2A 3Q26A 5CBRA 4WEDA 1WJRA 2D9TA 3ZKLA 4AB6A 1IXHA 3EQ1A 3LUYA 4DCXA 5JTYB 3K1PA 5KE3A 4IY5A 1G5VA 2Y7KA 4JWXA 1MY1A 4NF4A 3RY3A 2ZYNA 1LB9A 3PD8A 3E9GA 4PFYA 1M5EA 4DDDA 2I0BA 5I56A 5AA4A 2O4XB 2BJJX 2XXIA 4G8NA 4RY1A 4ZEBA 4F3GA 2DWIA 3IO4A 1EH3A 3GOXA 4GFRA 4EQBA 1Y3QA 1TXFA 4PL6A 3CFZA 4AB5A 2EQMA 4N07A 3TCFA 3P8HA 4YKPA 1MM6A 2RJCA 3TMGA 2O84X 1PC3A 4BE1A 5ICTA 2VOZA 1SW4A 2R6GE 1A8EA 1B7ZA 1USYE 2XX8A 3UK4A 4LUBA 3LBSA 5ICQA 4IUPA 3TTLA 3M3FA 1URSA 1QULA 2RI5A 1ZMGA 4F1YA 4BDYA 1SYHA 2AL5A 3FLGA 1PBPA 2UYEA 5CC2A 4YKIA 2LRQA 2M0OA 2X4WA 4POWA 2ONRA 2H4IA 3DM0A 3ZSFA 1BKAA 4Q30B 1Q35A 4U1OA 2UVGA 4IGTA 2X4YA 1XT8A 3O28A 4Q5TA 5I2KB 3FD3A 3H03A 1S7YA 3VXBA 2L89A 5A5XB 3E3KA 5H8NA 4GQOA 4X1DA 4GRKA 4XKQA 1VFDA 4RK9A 1B9JA 1DSNA 4PETA 3PUXE 3TPAA 2RHIA 1B0HA 1MY0A 3N6UA 4Z02A 4OZ9A 3JYRA 3OENA 3OYKA 1OLAA 4ZS9A 3C35A 4N13A 4EF1A 1S50A 5DVJA 2DXYA 2FNCA 3MZ1A 4KPTA 5CBSA 3S4UA 3MJNA 4IO7A 5L9MA 3DP6A 3K00A 5K2YA 4G8MA 4QVZA 2OCUA 3QUJA 4U1ZA 3CFXA 4FEDA 2UVHA 2L3RA 5TP9A 4DLDA 4OTEA 1MHNA 1NMUA 3I6VA 1FQFA 4IUUA 2YPNA 2QRYA 4R73A 3RT8A 5IAIA 2BIVA 1M5BA 4TOZA 3TDJA 1TT1A 3OYMA 2MWOA 3OYHA 1XHYA 4WXJA 5ITPA 5F1QA 1R9QA 2P0KA 4JSDA 3E13X 1Y1ZA 3MVYA 1IZ1A 4YZZA 1N76A 4QFLA 3FATA 2EKOA 5M2VA 4R75A 3VDFA 3MO8A 2XD2A 4XTCQ 1RYOA 3TQLA 2Q8JA 3K4UA 3SEWA 2RHZA 2RJFA 4KHZE 3LGLA 2PT2A 2GH9A 2O7IA 4JB7A 1N04A 2AIXA 2WACA 3TAJA 3MC2A 3LSFB 1A54A 2PQWA 2AL4A 2I48A 1B3GA 3FV2A 3OELA 4YB6A 3NTIA 3H6VA 3B6QA 3S3MA 1LCTA 1N27A 4RJZA 2NUVA 1OLCA 4GD5A 5CMBA 5BUUA 3KFMA 5L9SA 1QKAA 1N7XA 4U4SA 1FQEA 4OXVA 1LAHE 4X1BA 4X48A 2P0SA 4THIA 1OYXA 3QIIA 5I84A 3O6HA 4OESA 2H98A 4OHNA 3OMGA 4NMYA 1UTBB 2E6NA 4OFOA 2Q2AA 1LFGA 1GV8A 1B46A 1A7LA 3KJTA 1IQ7A 2D21A 1JVYA 3H3GA 2UYFA 4OEUA 2LCCA 3QYTA 4ZECA 3M8UA 4G68A 3IL1B 4QQGA 5CIUA 1B5IA 1B58A 3PGFA 1MQIA 3ZKKA 3QXMA 5FROA 5KDTA 3B7DA 3ILTB 3L2VA 5H8QB 2YRVA 4TLLB 1H43A 3SEYA 3F70A 5DVFA 3IJXB 3C34A 1DPPA 3KJ7A 3PPOA 4XKNA 4KCDA 1HSLA 1A99A 1Y4TA 1HSEA 3N6TA 2B3FA 3SEVA 3IOVA 2VHAA 3LSLA 2HAVA 2NWJA 3T9UA 2NLUA 3TEPA 4UA8A 1LBBA 1XS5A 4PFTA 1P1UA 2ANJA 1MM7A 2W7YA 4NF5B 5EYFA 4E7IA 2EQUA 1JNFA 5KH6A 4FECA 1RI0A 3O2AA 5AA2B 1B3FA 3EN3A 2REGA 2GFAA 2A5SA 1B3HA 1DPEA 4H5FA 2UVIA 4HCWA 1AIVA 3R6UA 2O51A 2ONSA 2MWPA 4YKJA 5KCJB 2ZYOA 1N3WA 3VE1B 4OETA 4F2QA 4LQ2A 4QSEA 3OO8A 1B3LA 2VD3A 3MP1A 2I3VA 2QMWA 1R1NA 3G3JA 3L6HA 1MPDA 5TPAA 5TU0A 4K3FA 3MEAA 1YTVA 3PMWA 2F6GA 2XXXA 3MZBA 2PT1A 4GXAA 4IY6A 3FV1A 2DWJA 1B4ZA 2M8CA 2QJEA 2QS2A 3MVXA 3P7IA 1ZBMA 1B0LA 1EZPA 1MY3A 3FVKA 1Y3PA 1NNTA 5C6SA 3PFSA 4NF6B 4PLIA 2O1MA 3KSJA 3V5AA 3BFUA 3DLNA 1GGGA 4QFPA 2Z23A 2E5QA 4FATA 4R6YA 3NTKA 2R57A 4BE2A 4KCCA 4NWDA 3AXFA 5B70A 4ZTJA 4OFLA 1IIWA 2RI2A 3QJ6A 4QHQA 3TODA 4QRZA 2ALUA 2Q2CA 3OS2A 3L2RA 3Q28A 3KOTA 5H8FB 4YICA 4ZEKA 1FTJA 2PVUA 1N84A 2BUDA 2QS3A 1SDXA 2R71A 4FORA 4E0XA 4H65A 1XC1A 4XIGQ 3CSBA 1TFAA 4QW2A 4OQOA 2H99A 2XX9A 3MPLA 4PLLA 4BDLA 3EAEA 5ITOA 4N4IA 4IUQA 3MVZA 1WODA 4O3BA 2DE2A 3CSGA 2QQRA 4NTLA 3TYHA 2LDMA 3HO7A 2M16A 1OZ3A 3LLRA 5LOMA 1MS7A 3R26A 4RK2A 2LTOA 4E0WA 5K2XA 3UA8A 2DQVA 5CMMA 2I4BA 3L2WA 1B1HA 3FXUA 1MY2A 3OYIA 4EF2A 2DIGA 2F7CA 2F97A 3V83A 4KYDA 4ESWA 1A40A 4C0RA 2DWHA 5EHMA 4L17A 4FE8A 3U93A 4C5HA 4R9GA 1ANFA 3E4RA 1SD3A 2M1HA 1PB9A 4A4GA 1UTHA 2HAUA 3IOUA 2X7QA 2F36A 2H9BA 5AA2D 3G3IA 4C5IA 3MQ9A 3OMBA 3ZS6A 3S6WA 2XXRA 3RLFE 2OBGA 4ESXA 1AL3A 4ISUA 2UVJA 2Z8FA 1DMBA 1IEJA 3UT1A 4R2FA 5DVIA 2V84A 1XNIA 2REJA 2R5MA 3CIJA 3KUFA 3U72A 5KE2A 2GF7A 1OQGA 5I56B 3IK6B 2HZKA 4LVQA 4IURA 1ZLQA 3FDRA 4EDPA 2ZYKA 2CKKA 1YAEA 1SW2A 2DYXA 2Y7PA 3SESA 2E1SA 4XKPA 3VXCA 3N5LA 1LGBC 4N6PA 1II5A 4R6HA 2PX1A 3OO6A 3PPQA 4QQDA 3DELB 3H4ZA 1H45A 3RT6B 3FXQA 1D3KA 5CMKA 4MBPA 3CI8A 3B6TA 4IB2A 1BP5A 2QS4A 1MH3A 2I0CA 1AH5A 2DAQA 2VYTA 1JEUA 1OZ2A 3HHFA 1B51A 3C4SA 4ECFA 3OQ5A 3GBAA 4DXBA 4ZEDA 4LATA 3CRBA 5J1DA 3K6UA 1ELJA 2HXWA 1FW0A 3K6WA 3QAXA 2OZZA 5I2KA 2QMXA 5A5XA 1HSJA 1O64A 3MZ9A 2IG0A 2GFUA 4POXA 5AA3A 2ZNSA 4YMAA 3C33A 2ONKE 4H1XA 4B9WA 5I2NA 3T66A 2RHXA 2OJTA 3MWBA 2QL3A 2RC9A 3VVFA 3IX1A 3OY9A 3GLBA 2HQXA 2CMOA 1PB8A 2XXQA 3CR9A 5H8NB 4DCYA 4NF8B 3N26A 1B7UA 5L8DA 3OB9A 1B5JA 4R9FA 2DP8A 3FJGA 2F7BA 1MPCA 2F35A 2Y7IA 4JDFA 4BLAA 4R72A 3MPKA 3PMVA 4EQ9A 3K0VA 1LSTA 1OVBA 2ZMBA 5CI5A 1RKMA 5FHNA 4WKMA 2RF1A 3KEIA 5IKBA 2V93A 4GIZA 3KGCA 4IO3A 3FIRA 3OS0A 3MEVA 1US4A 5TP9B 3V89B 2HZLA 4RPOA 3OS1A 4C1TA 3IORA 3LC8A 1FQCA 4F22A 2E0SA 4LA9A 2XHDA 3MEWA 3FVGA 5I59A 4RG2A 3OYBA 5FTHA 4B9XA 4QF9A 2B3BA 1MG1A 5HBCA 1H44A 3H7MA 1MXUA 3PUZE 3VLVA 3O66A 3EHTA 4E7HA 3Q27A 3C32A 3DLMA 1VE4A 3E9XA 3VVEA 3TTMA 2EQKA 3TTNA 1EZOA 1NNKA 4H5GA 4KR5A 4AQ4A 3F11A 2I58A 5H8HA 1MXWA 2RC7A 3JV9A 3IOWA 1SYIA 2AYSA 4JWOA 4ZE8A 2YLNA 3NTHA 3S9EA 2A5TA 3S2VA 3QBYA 1M5CA 2XXUA 2HEUA 1XOCA 1MH4A 4QSDA 1S9TA 4MLVA 1D9VA 2LAOA 3G7WA 1USYH 3VVDA 5IAYA 3TELA 5ELVA 2QS1A 4YMBA 4YKKA 4M1VA 3PV0E 1H3DA 3QIMA 3KN7A 2FHDA 4H67A 4GL8A 4QFNA 1GVCA 4YB5A 3S9LC 4DXCA 3C9HA 4N4HA 4I8CA 3RGYA 4GY5A 1I6QA 3U1OA 1M5DA 2I49A 2JZ2A 3N94A 1N7WA 4DE8A 4F2OA 3K01A 3OD7A 3IB2A 4BACA 3LH0A 3CG3A 3IAZA 3QSLA 3DB3A 4C5GA 1JW1A 1OIBA 5KZTA 1PDAA 3EPEA 2Y7RA 1POY1 4JXIA 4F3SA 3OYAA 1URDA 4UC4A 2THIA 3TZAA 5H8QA 2G3RA 3VV5A 2R5AA 1ZKBA 3PU5A 3UORA 4IO5A 4F31B 2ESNA 3UWNA 1P1WA 2F78A 4G68B 5HPQA 4OVJA 1GTKA 2GHAA 3RNNA 1ZIUA 5KDTB 1JVXA 1B7HA 3PMIA 1TWYA 3RUMA 2RHUA 4II1A 1Y20A 4H8JA 3G3FA 1DOTA 2G29A 1MXYA 4P0IA 1EU8A 1ZU0A 1I6AA 2RHYA 5AA2A 3L2QA 2G93A 3C31A 4WEPA 4C5EA 3LR1A 5HM4B 1MDP1 5KCJA 2OK2A 1MQHA 5B7DA 3JZJA 4ZEIA 4GWOA 1BTJA 4LZ8A 4RA1A 3FASA 3M3LA 3I3VA 4G4PA 4ZTFA 5FHMA 2XXWA 2IA4A 1LB8A 2NXOA 3HSTA 3KOSA 1OI1A 5DEXA 4KYSA 3I5OA 2P2AA 1LBCA 3M3KA 5D6XA 4ELRA 3MAMA 4OFJA 4OWDA 4R2BA 2VP1A 4F39A 4RPNA 3H8ZA 4A4HA 3FC3A 1P99A 1XVYA 4F1UA 1WDNA 3Q25A 1B52A 2JTFA 2F7AA 4OERA 1P1OA 3USDA 4GF8A 3QKJA 4EQ7A 3MW0A 1NH7A 3UN6A 3ME9A 1Z7NE 1OVTA 2XXHA 5DT6A 2ZNUA 2ZXTA 4M4GA 2F5XA 1NFTA 2IEEA 3LGFA 4X9TA 3OYEA 4PQJA 4FU6A 4IO4A 4BD3A 3DP8A 4Z7EA 5J26A 1N3XA 3ODBA 1KHCA 5I57B 1OQHA 1IXIA 3SEXA 3CG1A 4GXSB 1MQGA 2KLFA 2RKMA 1VR5A 3DB4A 5I58B 1JETA 2O6AA 3G3HA 3FGSA 3T93B 3EF7A 1UIVA 1MPBA 2PMSA 3IR1A 2LVMA 3H6WA 2K3XA 4H6DA 3W15C 4ELQA 3H6ZA 4HCYA 4NEDA 1SSFA 4U2RA 1L5TA 4R6KA 2QPQA 3PPNA 2QSXA 2DXRA 4GOTA 2DE3A 2NVUB 3T9VA 3R7XA 1OMPA 1CB6A 1EZ9A 1R9LA 1LAFE 2H25A 2RINA 2VGQA 3KN3A 4ZEFA 1MY4A 2GRVA 4E7JA 4FAJA 3PNWC 3OYJA 2V25A 3S9MC 4GLIA 2XX7A 3TQWA 3Q1JA 2O68A 5JTYA 1VSOA 5FHOA 1M5FA 1URGA 2PYYA 3L6GA 1AOVA 3RTWB 1QJMA 3HV1A 2R58A 2RC8A 1B1XA 2QQSA 2O4XA 2RJDA 3C4MA 4ZDMA 4LD6A 5H8SA 1UTHB 3B6WA 4QFOA 4F18A 3H06B 2B8AA 4OEVA 4NF4B 2I3WA 3OYDA 1NL5A 1KWHA 2Q89A 5AA4B 4ND9A 3PMTA 1FTLA 3QUFA 2XXYA 3FUZA 4E7LA 4I62A 3L2UA 2DVZA 3MP8A 4UACA 1Y4CA 3H6UA 4U4XA 1MQDA 3CEYA 3OEMA 3U8QA 3O9PA 4I1DA 4RYAA 3FXRA 3TFLA 2DSFA 2CZLA 1BIYA 2OWSA 5JEIA 2HQEA 1P1QA 2XDPA 5IN1A 4F3BA 3PMXA 2D5WA 1YCJA 4IUVA 5J39A 3ZEHA 3HN0A 3A09A 1LAXA 2DWAA 2F8DA 1BLFA 2RI3A 4P0GA 5DTBA 3WAFA 3U94A 1Y1MA 3IO6A 2O7UA 4QSCA 3K1MA 4NE4A 4BDRA 1ZJLA 1FTMA 2Z8EA 4BDOA 3S3NA 4NF8A 2ZNTA 4TQUQ 5CM6A 4BE0A 5I2NB 1QUKA 4G8HA 4F29A 4I9DA 4H8IA 4U21A 4KD5A 4IO6A 3FZVA 3LYIA 3MP6A 4O3AA 1B3EA 1SBPA 3RQTA 2DOJA 4XXUA 2OWTA 1Q1KA 1ATGA 1IITA 2D3IA 3SD4A 1MXZA 1VFEA 3FEOA 4GVOA 2O1LA 3OYCA 2X35A 2I6EA 3U92A 4F3PA 2OLBA 3PUVE 4MF3A 5FTIA 4MFIA 1QVSA 4N4GA 2Y7WA 3O29A 4EXLA 2Z8DA 3H6TA
chains in the Genus database with same CATH superfamily
2Q88A 2B65A 4MCOA 4U23A 2E64A 3I55Q 1K8AU 2V3QA 4MH5A 3TTRA 3S9NC 1A8FA 2QXFA 4JLIA 3MYUA 3WVDB 3G3KA 4PFIA 1P1NA 4PFRA 1MRPA 5FRNA 1V1CA 2CREA 4C8QF 3KXTA 2GHBA 5BWJA 3UGWA 4Q5WA 1ZA2B 5GAN8 2X3XD 4KXPA 2XWOA 3A8MB 1MXXA 1PKSA 3MUQA 1Q86C 1BK4A 3META 2CZIA 1O7TA 1WHHA 3V8LA 1YITQ 3K1NA 2VD2A 2O69A 4PJNA 1IGUA 2LJ3A 1WYXA 5CMCA 1ZUUA 3TU4K 1NUYA 4N6KA 2KQZA 2RH2A 1S72Q 2DETA 1XOVA 2R9JA 2ZCFB 2KBTA 2Y5LA 3OO7A 4JSOA 5I59B 3FJMA 1F9BA 4NWCA 1Y96A 2HD0A 2LQNA 2XXKA 3G3GA 1ZTYA 3PTAA 4KQPA 2HBPA 4OYVA 5DT6A 1M3AA 4KYEA 3SETA 3RTFB 4KULA 1VQNQ 2O31A 4O5VA 3X28B 4HE1A 2V3UA 1YPNA 1I1JA 4E7KA 4RXLA 4LQ5A 3CD6Q 1FQAA 2MCNA 1PBQA 1SKUB 2E12A 4LZ5A 3JCMQ 5CKBA 3CCVQ 4C1UA 1VYUA 5GANg 3BKIB 5IT9E 2UXAA 5EYHA 1MV3A 1N0TA 3KN8A 2BKDN 1JJ2A 4KI0E 2K7AA 1H3ZA 1A55A 5EC7A 2HFBA 3K2DA 1VQ9Q 1LFIA 3PPPA 3UP9A 4LONB 3TCHA 3EG3A 4XTYA 1BKBA 4J7FA 4KFQA 2ED0A 2PVGB 3OOAA 4DZ1A 4ZZEA 1QUIA 1PKTA 3A5ZB 3QK6A 2X7PA 4J6WA 3MKDA 5IZ3B 2QGFB 2XIDA 4R74A 4RNSA 4IKFA 5H8HB 1BI1A 4LZ7A 4JLGA 1BI2A 1SW1A 2ZZWA 2KT1A 1R0CB 2V8JA 1PB7A 5JK4A 3ONMA 3VFJA 4F19A 3EG1A 1POTA 2A5TB 1K8AR 5CAIA 1NJIC 5D6YA 3EFSA 4M7DF 1I8FA 1JEGA 3C36A 4PE5B 2AZVA 3RESA 3OYFA 2Q9TA 1US5A 3O97A 4MZPA 2EKHA 5EQ7A 3SERA 3WAEA 1GR2A 2E10A 3PUWE 1VQKA 3JCMb 4EDUA 3OYYA 5IXBA 1H641 4PFBA 1G0IA 2Z22A 1IXCA 1FTOA 1PEBA 1YJWQ 3RN8A 2QQ9A 3A3UA 3PPRA 4PP0A 4EUOA 4BB7A 4FEBA 3WVEB 3JB9I 1UTBA 4XU2A 4Z89A 3M55A 1B32A 1SVXB 2OTJA 1K76A 1SI0A 4XKRA 3CC4Q 1NNFA 1XVXA 5IH2A 2DEUA 4DI3D 4YB7A 4HS7A 2CZ7B 2XXTA 3GZGA 3H0FA 2NWMA 3JCMg 1YNZA 4DOWA 4XAXB 2F34A 1B2HA 4C8QB 1B7TA 1PD0A 1LAGE 3PUYE 3BFTA 1VQMA 1Q86U 4YU0A 4IO2A 5LJ5h 4PJOC 4PKCC 3SKPA 1SW5A 2RQVA 1R77A 3QDRB 4DEXA 2RO0A 2F6PA 5L9OA 4F7UA 5F24A 1UGSB 4MLQA 3MEUA 4C0DC 4X34A 4ELPA 4M75F 2DK3A 1LJOA 2HBWA 2DZCA 4H0WA 1NH8A 3OXNA 1VQ7T 2BZ8A 1UQWA 4TLMB 3VLUA 1T0KA 1PM3A 1WX6A 5GJVB 3MVWA 2EYWA 1WJQA 1FX7A 2KQWA 4M78G 4ONYA 5D6WA 3HPIA 2EQJA 1VQ8A 1VQ6Q 2JN0A 3ER0A 4X8RA 2XK0A 2KVQG 3TUSA 2FG0A 1I6BA 1OU9A 2FVUA 3D4GA 4G68C 1D0ZA 2A3LA 4NOYA 1FPDA 1WGSA 2I4CA 5GAMd 1UDLA 1X2QA 4CRIA 2DE4A 2E4HA 5FRMA 1YI2A 1K0XA 1QKXA 5AE4A 4JRIA 1MDQA 2EGEA 2K57A 5DLOA 2HCAA 2Y84A 3T96B 1DBZA 1CE2A 4J9BA 4GLMA 5EHSA 4M77B 2ABHA 1ZSZA 2H5YA 1B34B 4BY6B 3IB0A 3E9FA 2CP7A 2DDKA 3FVNA 1ZSZC 4PFUA 1VQKT 4MJOA 4DBHA 2XDDA 2YRCA 4FCYA 4NF5A 4O7MA 3V8KA 5GANj 5CRYA 3CMAQ 1IXGA 4RTZA 2K79A 3P8DA 3O6IA 3CBPA 3JCMJ 1LBYA 2DZ9A 4QQ6A 2JJKA 2RCBA 2K3YA 1BB9A 4NS5A 1NJIU 3LV0A 4BDNA 3CCRT 1IUDA 1V76A 2DVCA 3SWNA 3L42A 4M7DB 2EWNA 4PTKA 1FMKA 1QW0A 3SWNC 2GFEA 3JCMV 2ZYMA 3D4CA 5KYXA 3D7SB 3K02A 1Q86R 4U22A 2XD0A 1SI1A 5ET5A 1G3SA 1X6OA 3KFVA 1TFDA 1WVJA 1JQFA 3IOTA 2QAZA 2O9SA 2NUPA 3M4YA 4G2ZA 3G71A 3CCLT 4DEYA 3HTRA 2MKZA 2JVVA 4F1VA 2EFIA 4BDZA 4N15A 4OVAA 3W9VA 1NLOC 2V3TA 1ZUYA 2DIQA 1GBQA 3EGXA 3RYDA 1PWTA 1MQJA 2L8DA 2KMTA 4RMOA 4HTGA 2RCAA 1FJ9A 2HQHA 1D3BA 2MI6A 4BI3A 1VQLQ 5C0MA 3QWXX 2E41A 1Y3NA 2J7IA 2LNHB 2J6KA 5J16A 4J7IA 2QGGA 2XHCA 4Q0CA 1Q82C 3EKIA 4FSXA 3VS5A 2XXVA 2EIFA 4OENA 4N0AC 4DBRA 4EXKA 1DTZA 3O6GA 4GWWA 1OX8A 4BI8B 1FQDA 1M2VA 4A4FA 1D9YA 1LFHA 3CVGA 3EHSA 1RYXA 1FBDA 3OO9A 2EQIA 4NF6A 5TPAB 3ZBDA 1ACMB 4PF6A 4GBVA 1TXQA 2NOOA 1PNJA 2E3HA 1B4HA 1K0SA 1D9QA 2PBWA 3IJOB 1YI2T 3SDFA 1R6ZA 2QTXA 5AT1B 4KGZB 3RKXA 1UUEA 5DEXB 3TCGA 1NPPA 5ET6A 3MJXA 1NV3A 4AS5A 1R0BG 5LL6S 3JB9G 2FYIA 3ISPA 4KBMB 1UIUA 3BDLA 3RPWA 3KBRA 4O7IA 3OA6A 3PD9A 1NJIR 1NKXA 4G77A 2H8HA 1BYMA 3SZPA 3W9WA 1LBVA 4BUGA 2X26A 2E70A 1IREB 4X9DA 3M56A 4OMBA 4RCBA 5GAMf 2ZZDA 2A08A 2YLBA 4FJPA 2F5KA 4JWYA 3CFLA 3O8VA 4GL0A 2DMOA 3CC7T 4XQ3A 2FHYA 3QYGB 1B5HA 3T22A 3GXAA 3FJ7A 3DP4A 5H8FA 2RJEA 1YIJT 3Q29A 3EHUA 3OMCA 4LUEA 1QUJA 1MXVA 3ILUB 4ZGJB 3G71T 1T3SA 1SQYA 4ZE9A 3THIA 1DTGA 4RKUE 5IZ1A 1WJSA 1D4NA 1JBMA 4JBZA 3TKDA 5KCHA 5F7VA 4MDWA 3S3OA 3HCQA 4O3CA 4ELOA 5I57A 2P1SA 1X69A 3V7CA 2DM1A 3QSUA 3BBRA 2COWA 3OYLA 3OSQA 3V8XB 5M9OA 4CI0C 1J1NA 1H76A 4GX3A 1LLSA 3E19A 1KG1A 2D0NA 1B05A 2FPDA 3JCMX 3ZL7C 1FCKA 4GLKA 3LWHA 3NOHA 4X9CA 3BIGA 3VLWA 4PFWA 3LX7A 1LCFA 5GMKj 2QQAA 1I69A 3UIFA 4KRTA 5I58A 4LXCA 1O63A 4BDQA 5GAMg 3JCMc 5IHIA 3M9QA 4OGCA 4A4EA 5ISUA 4MZTA 4IGRA 5EQ8A 3OYNA 3QYHB 3ECRA 1X27A 4PJOD 2ED1A 1JW4A 1Y9UA 2WBBA 2DILA 4M7AF 4J6XA 1DCUA 4BDMA 3GYYA 3KZGA 1Q82U 1UECA 3BE3A 2DS9A 3MBPA 1JW5A 3GBBA 4LP2B 4LDYA 2XD3A 3OSRA 4LUDA 1Y71A 4DXUA 4QFKA 4IUTA 1MMDA 2X4XA 3VKIA 4WTOB 1YWPA 3T9HB 3I5SA 3THKA 5DYHA 2DRMA 1B40A 1CSKA 2CSQA 1Z7ME 3KBGA 1KQSA 4A53A 2CZHA 2F69A 3TTKA 2WKYA 2AT1B 4NX1A 2QEXA 4Z0IA 4DIGA 3K6VA 1N5ZA 1NV7A 3LSXA 3QUIA 3A3CA 4HCZA 1NNPA 4AMCA 4UABA 2VPOA 1QKBA 4L59A 3KSXA 4E6RA 1BI3A 3LSWA 2YHTA 1LPLA 3M0RA 3CCJA 3OEKA 4P11A 1B6HA 4YAHX 4HW8A 4DA4A 3IB1A 3M0PA 4HA8A 4P47A 3HHGA 3K6XA 1G3TA 1GBRA 4PJMA 1Q81R 5AA1A 5KCOA 1R8OB 4PBHA 1AMFA 1LOJA 1JEVA 2RB6A 2E6ZA 4M77D 3WXMB 3OYGA 2WBDA 4ZZAA 4FT4A 1U8RA 2HQ0A 1MNDA 2E65A 5CKHA 1FQBA 2XXPA 2FA7A 3FVOA 1IGQA 3T9XB 3ASKA 1HYOA 4H45A 1FTKA 2YJPA 3SEUA 4FL6A 4FIMA 1GFCA 4Q8RA 1QGXA 1Z9ZA 2XWKA 3KG2A 3Q26A 5CBRA 4WEDA 1TUDA 1WJRA 3EG9A 2D9TA 3ZKLA 1NI9A 1RUWA 4AB6A 2KXCA 1IXHA 3EQ1A 3LUYA 3TVTA 1YP5A 4DCXA 4GWYA 3L2ZA 5JTYB 3K1PA 1JO8A 3PGGA 5KE3A 4IY5A 1G5VA 5A2QE 5T3JA 2Y7KA 1PG5B 2GBQA 4JWXA 1MY1A 4NF4A 4RTTA 1KC8C 3RY3A 2ZYNA 1SRMA 5CQYA 1LB9A 2MK5A 3PD8A 3E9GA 4PFYA 4C8QG 1VQ7Q 1M5EA 4P3LA 4DDDA 2I0BA 5I56A 2KRNA 2OX7A 1ZQ1A 4OB0B 5GAOq 4PJOE 5AA4A 3JB9J 5LDZA 2HZYA 8AT1B 2O4XB 2BJJX 1KD1C 1HXDA 2XXIA 4G8NA 4M78B 2XG8D 1BBZA 1U1SA 4RY1A 4ZEBA 2RF0A 5DY9A 4F3GA 2DWIA 3E79A 1RAGB 3IO4A 1EH3A 3GOXA 4IR8A 4GFRA 2OAWA 4EQBA 5CR2A 1T0JA 1M1KR 1Y3QA 2I0NA 4I3YA 2JT4A 2CUBA 4A4KA 1QVFA 1NV1A 1TXFA 4PL6A 2JMCA 3CFZA 1M1FA 4AB5A 1UGVA 2EQMA 4N07A 3TCFA 2PFYA 3P8HA 4YKPA 3RKYA 1MM6A 2RJCA 3TMGA 2DL8A 2O84X 4H46A 2Y4YA 3FXBA 3GPLA 1RI9A 1PC3A 1IMDA 1PCXA 3EHQA 1C0MA 1OOTA 4BE1A 5ICTA 4FT2A 2VOZA 3CCRQ 4WF2A 1NM7A 2QA4A 1SW4A 4C92F 1A8EA 1B7ZA 1USYE 2R6GE 2XX8A 1MMNA 3UK4A 4LUBA 3LBSA 4M77G 5ICQA 4IUPA 5ESYA 1VQ4Q 3TTLA 4F17A 3M3FA 1M8VA 1URSA 1QULA 2RI5A 1ZMGA 2ABLA 4F1YA 4BDYA 4GWXA 3CCST 2YUNA 1SYHA 2NUTB 4NF0A 2AL5A 3FLGA 1PBPA 4GX4A 4OMPA 4P1EA 1LCKA 4PNOA 5HK0A 2UYEA 5CC2A 2R8TA 1BU1A 2LRQA 4YKIA 3CCLQ 3CMEA 3UPUA 4M7DG 2I2LA 2M0OA 1RAAB 1TOVA 2X4WA 1FXXA 4POWA 2ONRA 4J8OA 2H4IA 3DM0A 3ZSFA 2VGNA 1BKAA 2F5TX 4Q30B 2CZ1B 1GXIE 1Q35A 4U1OA 3EG0A 3VS3A 2JNGA 2L0AA 2YWWA 2UVGA 4LDUA 3G4ST 4IGTA 2X4YA 4KT0E 1SG5A 1YWOA 1XT8A 3KC0A 3O28A 4NGUA 4Q5TA 3AHUA 1YHQA 2FL7A 5I2KB 3FD3A 3H03A 1S7YA 4OA4A 2KDSA 3HFNA 1IXDA 3VXBA 1KC8U 2L89A 5A5XB 1KK7A 3GIBA 3E3KA 4R56A 1Q7YC 2P84A 5H8NA 4FW1A 4GQOA 4J9IA 4X1DA 4GRKA 2K5IA 4XKQA 4KUDK 2MAMA 1VFDA 5GAN2 4RK9A 1LEVA 1B9JA 1DSNA 4PETA 3CC2T 3RR6A 2VASA 3MSTA 3PUXE 4I3EA 3EFOA 3TPAA 4CC4B 2RHIA 1G8XA 4R0KA 5GAOr 1B0HA 1MY0A 4M75G 3N6UA 4Z02A 2WYPA 1KZ8A 1UHFA 3JYRA 4OZ9A 3OENA 3OYKA 1OLAA 4ZS9A 1KA1A 3C35A 1M30A 4N13A 4HXJA 1T0HA 4EF1A 1S50A 3RPLA 5DVJA 2DXYA 2FNCA 3MZ1A 1WHKA 2QA4T 4KPTA 1JJ2P 5CBSA 2F2XA 3S4UA 3MJNA 4IO7A 3T1BA 5L9MA 2KYMA 1RLPC 3JSCA 3DP6A 3X25B 1FPEA 3RBBB 5AYFA 3CC7Q 4CC3A 3K00A 5ET7A 2ZPEB 1YXIA 5K2YA 3VYHB 4G8MA 1YIJQ 1N6AA 4QVZA 2OCUA 3CCMQ 4C0GA 3QUJA 4U1ZA 3CFXA 4FEDA 4OVSA 2FB7A 2EVRA 2UVHA 2L3RA 3CMET 5TP9A 4C92B 3J81E 4DLDA 2D6FA 2KI7A 4OTEA 1MHNA 5KYYB 2RQRA 4PGNA 5GMKm 1NMUA 2M0YA 3D1RA 3I6VA 3H0IA 1FQFA 4IUUA 4EMGA 2YPNA 5FU6B 3I56T 2QRYA 4R73A 2RD1A 5L23A 3RT8A 2M51A 5IAIA 1QCFA 2BIVA 2Y90A 1M5BA 4TOZA 5GANf 3TDJA 1TT1A 1QW1A 1SHGA 3OYMA 2MWOA 2X3WD 3OYHA 1AWOA 2VWFA 1XHYA 4L5GA 4WXJA 3GLXA 5ITPA 1RLQC 2K4YA 5F1QA 1R9QA 2Q74A 2P0KA 2M02A 1E6HA 4C0ZA 4JSDA 3E13X 1NV0A 5FW9A 4N4UA 2OTLA 1X6BA 1Y1ZA 3BIHA 3FJ5A 3REAB 3X26B 1IZ1A 1N76A 3MVYA 2PVDB 4YZZA 1JJ2S 4QFLA 3CCUA 1VQ5A 3FATA 3ZFJA 4JZ3A 1CNQA 4OB2B 2EKOA 5M2VA 4R75A 2K6DA 3JRZA 3PT9A 4Z8AA 3A8OB 3VDFA 3MO8A 4KH0B 2VV5A 1SEMA 4WCIA 4PJOF 1Q7YU 2XD2A 4PE3A 4ORZA 4XTCQ 4D8DA 1RYOA 1VIFA 3TQLA 2CH4W 4RUGA 2Q8JA 4F7UF 3K4UA 1FSAA 4G61A 3SEWA 2RHZA 1GCQC 2RJFA 4M78D 4KHZE 1T3LA 3LGLA 5EQ9A 4E47A 2PT2A 2GH9A 3LW5E 2O7IA 4JB7A 3CHGA 1N04A 2AIXA 2WACA 4O8MA 3TAJA 3MC2A 5DM7R 2YT6A 1O9SA 3LSFB 1A54A 2PQWA 1Y96B 2AL4A 2I48A 4MMPA 2C06A 4NAPA 5LJ3e 5I7IA 1B3GA 4DBFA 1J3TA 5IZ3A 1AWXA 4F04B 3OBYA 2DRKA 4PJLA 3FV2A 3OELA 4YB6A 3JCMf 3NTIA 1OV3A 3H6VA 3RIRA 2DNUA 4OMQA 1K9MU 4F14A 2HMAA 3B6QA 5GAOl 3M53A 1WI7A 2CSIA 2NUZA 3LH5A 3S3MA 1LCTA 4K11A 2VVKA 1N27A 4RJZA 3VYGA 2NUVA 1OLCA 4GD5A 2JMAA 5CMBA 1V29B 1K73U 5BUUA 2ATCB 1XTDA 1LNXA 2LT1A 1LVKA 5CKFA 2CH4A 3KFMA 5L9SA 1QKAA 1N7XA 4EMHA 2H3JA 2XWVA 4U4SA 1FQEA 4OXVA 1LAHE 4X1BA 1VDWA 2KROA 4X48A 1PHTA 1X6GA 2P0SA 2F2WA 2F1LA 4QT7A 1G0HA 2GNCA 3BW1A 4PCDA 3H9NA 4THIA 2OTLT 1OYXA 3QIIA 5I84A 3O6HA 1RABB 2ZGWA 1YJ9A 1VQ5T 1Q7YR 4PJOA 1CKBA 2XMFA 1I5LA 2LQ8A 1U06A 4C8QC 4OESA 4E7SA 2H98A 2ZPGB 2RN8A 4OHNA 3OMGA 4NMYA 5IXFA 1UTBB 1HSQA 2E6NA 4ESRA 1FJ6A 4OFOA 2Q2AA 3TEEA 1FMWA 1LFGA 1GV8A 1B46A 4JPBW 1NYFA 4J9DA 4LE9A 3CCEA 4MNCA 1A7LA 3CXCA 3KJTA 2EYQA 1IQ7A 3MHXA 2D21A 2DFUA 1OPLA 1JVYA 4MX6A 2GCXA 4DQ2A 4NG7A 3H3GA 2UYFA 4FYYB 4OEUA 4M78E 2BTTA 4M7AG 1TUGB 2LCCA 3QYTA 4ZECA 3M0UA 2HEQA 1QQJA 4F7UB 1ABOA 3M8UA 3IL1B 4G68A 4QQGA 1Y7XA 1JB0E 2KXDA 5CIUA 1K9MR 1B58A 1B5IA 1MQIA 3PGFA 3ZKKA 3QXMA 2KAFA 5FROA 5KDTA 1G2BA 2QVUA 3B7DA 2KEAA 3ILTB 1UGQB 3L2VA 3JB9D 5H8QB 4OB3B 2LNVA 2YRVA 1TG0A 4TLLB 1H43A 1DK4A 2FO0A 3SEYA 3F70A 5DVFA 3IJXB 2IPOB 3C34A 1DPPA 3KJ7A 1K73R 4PC9A 3PPOA 3CCSQ 4M77C 5J3BA 1FBFA 4XKNA 4KCDA 3U65A 4BY6C 1WHLA 1HSLA 1A99A 1Y4TA 5FU7B 1HSEA 3VRZA 2VPNA 1QLYA 2B3FA 3N6TA 3SEVA 3IOVA 2VHAA 3LSLA 2HAVA 1FBEA 5GANh 2DL7A 2NWJA 3T9UA 1X2KA 2NLUA 3TEPA 1M3CA 2LMJA 4UA8A 4PFPA 1LBBA 4M7DC 1XS5A 2OTJT 4ZGDB 4PFTA 1YZ0A 1P1UA 5IM2A 2QVRA 2ANJA 1IMBA 1MM7A 2W7YA 4Y28E 3G4SQ 1SF9A 2V4CA 4NF5B 5EYFA 4E7IA 1VQMT 2EQUA 1JNFA 5KH6A 2DBKA 4FECA 1RI0A 2ZPIB 1KSWA 3JCMP 3O2AA 4J9GA 2QDYB 3FJPA 4B6MA 5AA2B 1B3FA 3EN3A 3QWYA 1ZSGA 2KSSA 2REGA 2GFAA 5GAN5 2A5SA 5LJ3d 1B3HA 3CCQA 1HD3A 1DPEA 4H5FA 2UVIA 4HCWA 1AIVA 2A37A 3R6UA 3H41A 2O51A 2O9VA 2MWPA 5KYXB 1IMFA 2ONSA 4YKJA 5KCJB 1EYJA 2ZYOA 4JZ4A 2AKLA 2PNIA 1N3WA 1N9RA 1ZA1B 2YUPA 3VE1B 4OETA 4F2QA 3CC2Q 4LQ2A 3A8HB 4N0AA 1B3LA 3OO8A 4QSEA 2VD3A 4PDDA 3MP1A 2F2VA 2NUPB 1VQ8T 2I3VA 2QMWA 1OPKA 2JM8A 1R1NA 3G3JA 1ZHIA 1MPDA 2YUOA 4RG8A 3L6HA 1ZUKA 3EGXB 5TPAA 4M75B 4HE0A 4LD9K 5TU0A 1PSFA 3G6EA 2ROLA 2L5QA 2K9GA 4EMKB 4K3FA 3MEAA 1U3OA 1VQOQ 2YUQA 2CEYA 2DL3A 1YTVA 1NG2A 4FW2A 3JCMh 3PMWA 3JCMW 1JU5C 2F6GA 2XXXA 2DF6A 3I55A 3MZBA 4RCCA 1VQPQ 2PT1A 4GXAA 4IY6A 3FV1A 2HL5C 2DWJA 5KYWA 1KQSP 1B4ZA 2M8CA 5A5LA 2EBPA 3BY7A 2QJEA 3GP8A 2QS2A 3MVXA 3P7IA 1ZBMA 2LQKA 1B0LA 1EZPA 7AT1B 1MY3A 1M2VB 2QK0A 2HHMA 3FVKA 1IHWA 1Y3PA 1AOJA 1OULA 3TQ7P 1NNTA 5C6SA 4CC2A 2HDAA 3PFSA 4NF6B 4PLIA 5ECAA 2O1MA 2FRYA 1YITA 3KSJA 2D8HA 2PFZA 2OI3A 3V5AA 3BFUA 1SPKA 3DLNA 5HCKA 1IMAA 4OMOA 2RQUA 1S72A 3HKSA 1GGGA 4QFPA 2Z23A 4OMMA 3I56Q 1K9YA 2E5QA 4FATA 4R6YA 3NTKA 5GAOp 2R57A 1KIKA 1W4SA 4BE2A 4KCCA 1VQNA 4C92G 4OVPA 2EW3A 2QDLA 4AFUC 5LJ5e 4NWDA 3AXFA 3CD6A 5B70A 1Y57A 4Y92A 1W1FA 5KYNA 4ZTJA 4OFLA 3RKWA 3CCVA 3CCQT 2RI2A 1IIWA 1K9AA 2LCLA 3QJ6A 4PGPA 4QHQA 2IIMA 1JQQA 3TODA 2GQIA 4QRZA 1RAEB 2ALUA 2Q2CA 3OS2A 1B3QA 3L2RA 3Q28A 1VQ9A 2VXFA 5GAN3 3KOTA 1FWZA 1U1TA 4YICA 1FRPA 3QDFA 5H8FB 4ZEKA 2EGCA 3CQTA 1UG1A 1UHCA 3JAME 1FTJA 4X04A 1PD1A 5I2SA 2RMOA 2LC4A 1KQSS 2PVUA 1N84A 3I9QA 2BUDA 4C8QD 1TS9A 2WSEE 2X9HA 2QS3A 5KYUB 3G6ET 1SDXA 1WHMA 1IO6A 1K1ZA 1RAIB 2JTMA 4PDHA 2RK1A 2R71A 3G1JA 1FPLA 4FORA 4E0XA 4H65A 1B07A 2PU9B 1XC1A 4HVVA 4XIGQ 3CSBA 1M90C 5CKEA 1TFAA 4QW2A 2P0PA 1QP3A 4OQOA 2CP6A 2H99A 3I5RA 4LDXA 2XX9A 3MPLA 2Z0WA 1YJWA 4PLLA 4BDLA 1JXOA 4O94A 5IHNA 3EAEA 5ITOA 4N4IA 2QASA 4IUQA 3UDCA 2CS7A 3I35A 3MVZA 1WODA 2DERA 1X43A 4O3BA 2DE2A 2CUDA 3JV3A 3MCAB 1QVFP 3CC4A 2QQRA 3CSGA 4NTLA 3TYHA 2LDMA 5I22A 3HO7A 2F3BA 2DD4A 1NPRA 2M16A 3GNGA 1OZ3A 1Y0MA 3LLRA 5LOMA 1TUCA 1MS7A 3R26A 1NUZA 4RK2A 2RQWA 2LTOA 4E0WA 5K2XA 3UA8A 2AIRB 3EGDA 4X1VA 1QWFA 2DQVA 5CMMA 2I4BA 3L2WA 5LJ3g 1B1HA 3FXUA 4QXDA 3VS7A 4GBWA 1M4ZA 5GAN4 1MY2A 1IZ6A 1AD5A 1WHGA 1WA7A 3OYIA 3HSBA 4EF2A 3CCVT 2DIGA 5A0LA 2F7CA 2F97A 3PE0A 1N9SA 1VUBA 4PK4A 3V83A 1NV6A 2L3SA 4OGEA 4KYDA 4ESWA 1A40A 4C0RA 3N5BB 2DWHA 5EHMA 4L17A 4M7DD 4FE8A 3U93A 1VQ6A 4C5HA 4R9GA 4F16A 1ANFA 2L3QA 3M58A 3E4RA 2V1QA 1SD3A 1OX9A 2M1HA 4O6JA 1AHJB 1RADB 4A4GA 1PB9A 4P5NA 1QP2A 1UTHA 2CEXA 4PAKA 2HAUA 1NV4A 4OVRA 3E2UA 2YXYA 1Q82R 3IOUA 2X7QA 2F36A 3QZ5B 4PF8A 1RL2A 4RTXA 2H9BA 5AA2D 3A1PA 3G3IA 4C5IA 3MQ9A 1D1AA 3BDUA 3OMBA 1UTIA 4C8QE 3SEMA 2J05A 3ZS6A 3EG9B 1QVFS 3B8BA 3S6WA 2B4MA 2DTOA 1RAHB 2XXRA 3CMAA 3RLFE 2OBGA 3M5AA 4ESXA 2MYSA 3BFMA 4M78A 1AL3A 2UVJA 4JRKA 2Z8FA 4ISUA 1WHJA 4M7AB 1DMBA 3UT1A 1IEJA 4M78C 2QEXT 4MNIA 4R2FA 5DVIA 1ZLMA 1NBEB 4M7AC 2V84A 1XNIA 2REJA 2R5MA 3HFUA 2J6FA 3CIJA 1WIEA 2DL4A 3KUFA 3A8LB 3CC4T 4XFEA 4D6WA 3U72A 1IMEA 3A98A 4PAIA 5KE2A 4AG1C 2GF7A 5LJ5d 1WXUA 4M75D 1XI6A 1OQGA 5I56B 2ECZA 3IK6B 1MMGA 3CCJT 5GAMh 3V7RA 2HZKA 4LVQA 4IURA 2OX3A 1D09B 1ZLQA 3FBPA 3FDRA 4MHFA 3VU3C 4F7UG 4EDPA 2ZYKA 3INZA 1VQKQ 1H8KA 2CKKA 3R6OA 2P4TA 1YAEA 4ZN1A 4OMLA 1SW2A 1EX4A 2DYXA 1X75C 3JB9F 3EGUA 2LZ6B 2Y7PA 3EH1A 3SESA 2E1SA 4XKPA 3VXCA 3N5LA 1LGBC 1VQLA 4N6PA 1BCOA 1II5A 4R6HA 2PX1A 2DXUA 2OTJQ 3OO6A 2QVVA 1OQKA 3PPQA 4QQDA 1YCSB 4OMNA 4M77E 1JRIA 3DELB 1YBYA 1H45A 3H4ZA 3RT6B 3FXQA 1D3KA 4IIOA 5CMKA 4MBPA 3CI8A 3B6TA 4IB2A 4ELZC 2LT4A 1BP5A 1VQMQ 1FPFA 2DVEA 2GQVA 2QS4A 1MH3A 2I0CA 5IZZA 4JJBA 2QG9B 1AH5A 2DAQA 2VYTA 5HK3A 1JEUA 3OBWA 3M0TA 4M7DE 1OZ2A 3HHFA 3C4SA 1AZGB 1B51A 4ECFA 3OQ5A 3GBAA 4DXBA 3B50A 2LP5A 2VUBA 4ZEDA 4LATA 3CRBA 3IQLA 5J1DA 4HKEA 5LJ3j 4HCBA 3K6UA 5FBPA 2XICA 1ELJA 1XQHA 4XU1A 4CC7A 2HXWA 1FW0A 2OWZA 5FWCA 1NZ9A 1Q9DA 4MEVA 3K6WA 3IFCA 1KJWA 3QAXA 2OZZA 5I2KA 1VQ8Q 2QMXA 2LJ0A 5EQAA 5A5XA 2A7YA 1HSJA 1O64A 3M4GA 1C6VX 5I2MA 3MZ9A 2IG0A 2GFUA 2C0OA 4POXA 5AA3A 1TU0B 2ZNSA 1AWJA 3C33A 4YMAA 2ONKE 2DA9A 4B9WA 1YI2Q 4H1XA 3M0SA 2PTKA 2JM9A 5I2NA 2QTVA 3QG1A 1UE9A 1UJYA 4HVUA 1KD1U 3T66A 2EYYA 2RHXA 2OJTA 2EJFA 3MWBA 4JRQA 4MMKA 1IRXA 3OS5A 2DJQA 2QL3A 1NLPC 2RC9A 2JW4A 3VVFA 2W10A 3IX1A 1BCMA 3OY9A 3GLBA 2MPXC 2HQXA 2CMOA 4M75E 4HVWA 2IVWA 1PB8A 2LX7A 2AHJB 1E6GA 2XXQA 3CR9A 3M0QA 2E5KA 2QFLA 5H8NB 2OAUA 4DCYA 2M9UA 1I5OB 4NF8B 3N26A 1B7UA 3LUZA 5L8DA 2QQBA 3OB9A 1B5JA 4R9FA 1G3WA 1M27C 2HAXA 4PFZA 2DP8A 3FJGA 2F7BA 2BE7D 1MPCA 2F35A 1RACB 1NUWA 4LN5A 2CDTA 2Y7IA 4JDFA 3X24B 4BLAA 2COYA 4MDXA 3MPKA 3G71Q 3PMVA 1SRLA 4R72A 1PSEA 4EQ9A 3K0VA 1LSTA 1UEBA 1OVBA 2ZMBA 5CI5A 3M57A 4C92C 3RPLB 1RKMA 5FHNA 3CCQQ 4WKMA 1MNEA 4XTXA 1D1BA 2ROTA 4KGVB 2RF1A 9ATCB 1P92A 4NL3A 1INPA 3KEIA 5IKBA 1YFNA 4FIBA 2V93A 3EG2A 1FBPA 4GIZA 5I11A 5FU6C 1O75A 4JVIA 1EYIA 2BJIA 3KGCA 4IO3A 1KC8R 3FIRA 1LBXA 3OS0A 3MEVA 1YHQT 1JXMA 1US4A 5TP9B 1UJ0A 2HZLA 3V89B 1WPYA 4RPOA 5LJ5g 3OS1A 5CK9A 4C1TA 3IORA 2OJ2A 3HRSA 2KYBA 2DXTA 3G6EQ 2RA2A 1M1GA 3LC8A 2VT5A 2C0IA 2X4JA 1FQCA 3HRUA 3DLLA 1KD1R 4F22A 3HHTB 2JOYA 2E0SA 3TCJA 4PAFA 1G3YA 2EJGA 4LA9A 2DXCA 1I0CA 2XHDA 5FWBA 1VOMA 2DTHA 3MEWA 5GAMe 3FVGA 5I59A 1M2OA 4RG2A 3UA6A 2CZ6B 3OYBA 5FTHA 3T0JA 2V8KA 5DLQE 2FYKA 4B9XA 2ZZVA 4QF9A 2B3BA 1MG1A 3E78A 5HBCA 1H44A 2BE9B 1GCQA 2PVOB 3H0HA 3CXCP 1M9SA 3H7MA 1WFWA 3GBQA 3VUBA 1MXUA 1HK9A 4E7ZA 3M54A 3PUZE 1U5SA 3C94A 3O5ZA 3VLVA 3O66A 2CP0A 3EHTA 3NHNA 4E7HA 4M7AD 3Q27A 3VS4A 4P1LA 2FZGB 2O2OA 3C32A 3DLMA 2AZSA 1VE4A 4EPCA 3E9XA 3VVEA 3TTMA 2EQKA 2MOXA 3TTNA 4XTZA 1EZOA 2WYKA 4J9EA 1ARKA 1NNKA 4H5GA 4IIMA 4KR5A 4AQ4A 2CP5A 4AFSC 3F11A 2I58A 2HKQB 5H8HA 4J9HA 1MXWA 1HJDA 1FYNA 4DOVA 2RC7A 3JV9A 3IOWA 1SYIA 4JJCA 2AYSA 4JWOA 2WSFE 4AFZC 4ZE8A 2YLNA 3NTHA 3S9EA 3QZ9B 2K2MA 2A5TA 3S2VA 3QBYA 1YJNA 2RNAA 1VQ7A 1M5CA 2XXUA 4JJDA 4FBPA 2HEUA 1XOCA 2BZXA 1MH4A 4QSDA 1TSFA 1S9TA 4MLVA 2HCKA 4M77F 1D9VA 2LAOA 3G7WA 5EG2A 1USYH 1RAFB 2LJ1A 5IAYA 3VVDA 1QCOA 2MMPA 4XEQA 5ELVA 3TELA 2QS1A 2V1RA 4YMBA 4YKKA 4M1VA 3PV0E 1H3DA 3QIMA 1MMAA 3KN7A 2FHDA 4H67A 1FPBA 2EJ9A 4GL8A 4QFNA 2WEFA 1GVCA 5EYGA 3P8BB 4GX6A 4YB5A 3S9LC 4DXCA 4GBQA 3C9HA 2L2PA 4N4HA 4I8CA 3RGYA 4GY5A 3E1SA 4JS5A 3CXCS 2FEIA 2G6FX 2HSPA 1I6QA 1VYTA 2KK4A 3U1OA 3SB2A 1M5DA 3CCUT 4C8QA 2B4LA 2I49A 2JZ2A 2K5FA 1WQWA 2X51A 3QHSA 4LDWA 1N7WA 3N94A 4DE8A 4F2OA 3K01A 2CP3A 3OSSC 3OD7A 3G7ZA 3HRTA 4RTYA 3CCRA 3T9NA 2PCRA 2QEXQ 2KRSA 1W70A 3IB2A 4BACA 3LH0A 3CG3A 2DX1A 3IAZA 3QSLA 5HY6A 3DB3A 1VQ4A 4C5GA 4JVCA 5DW8A 1JW1A 4JUVA 1OIBA 5KZTA 2DYBA 3OSVA 1PDAA 1D0XA 5LJ5j 1I81A 2ZAEA 2XWIA 3CCJQ 3EPEA 3PTYA 5GAOn 4PJOB 2Y7RA 1POY1 4J9FA 2DYIA 4JXIA 5LTCA 3CCLA 2Y4XA 4F3SA 5I21A 4M7AE 3LWIA 3OYAA 4C0DB 1URDA 1VA7A 2CZKA 1KQ2A 2WSCE 4UC4A 4RTVA 2THIA 3TZAA 2FZCB 2QYZA 1EYKA 1M3BA 5H8QA 2G3RA 3VV5A 1GRIA 3SHWA 1YJNT 2CYZB 1G83A 2R5AA 2EYXA 1CKAA 4M77A 1ZKBA 3PU5A 3UORA 4MMLA 5GAN6 4IO5A 1B34A 2RQTA 2ESNA 4F31B 3UWNA 1P1WA 2F78A 4G68B 3PIPA 4JRPA 5FU7C 1AWWA 4OVJA 5HPQA 4DBQA 4YTLA 2GTOA 1GTKA 2GHAA 3RNNA 1ZIUA 2CT3A 4M7DA 5KDTB 1JVXA 3QXEB 1B7HA 3PMIA 1TWYA 3VRYA 3RUMA 4A54A 2RHUA 4II1A 4R55A 4C92D 1Y20A 4H8JA 3G3FA 2ENMA 1S1NA 1YJ9T 1PC0A 1DOTA 1ZSZB 2G29A 2ESWA 2HL3A 4KGXB 1MXYA 4P0IA 3VS0A 6AT1B 2LX9A 3EFRA 4XU3A 1EU8A 2DTIA 1ZU0A 4DI4B 1AZEA 3VS2A 2P0QA 1I6AA 2YDLA 2FPFA 2QI2A 2XKOC 2RHYA 4GWUA 5AA2A 2V26A 4MAGA 3L2QA 4AFQC 1DJ7B 1ZBJA 2DE0X 2G93A 4OVTA 3C31A 3H6TA 3SWNB 4WEPA 3M59A 1BIAA 3CPFA 4C5EA 1Q81C 3A8GB 3LR1A 5HM4B 2FPEA 1MDP1 1VQ4T 1AEYA 3GNFB 4NHBA 5KCJA 4L6V5 3CCET 2OK2A 1MQHA 3CC7A 4NN3A 4XTVA 5B7DA 3JZJA 1WZOA 3NFCA 4ZEIA 4GWOA 2Y5KA 1YIJA 1BTJA 4LZ8A 3CCMA 1Q95G 1FBHA 3RERA 1RDYA 4RA1A 3FASA 2DJZA 3M3LA 3MPUB 1H92A 3I3VA 1QVGP 2FZKB 3VUZA 1TTHB 4G4PA 2JXBA 4M75A 5CCAA 4ZTFA 5FHMA 2XXWA 4EMKA 2IA4A 2A0FB 3UA7A 3L1AA 4M75C 2L3PA 1LB8A 2NXOA 2QA4Q 2VGMA 3QMFA 1D3BB 4EMKC 3HSTA 3KOSA 1OI1A 1I4K1 4J83A 2HNIA 3URGA 4E2FB 5DEXA 4KYSA 2PUOB 3I5OA 4N17A 2P2AA 3DKMA 5A0GA 1LBCA 3M3KA 2XA5A 5D6XA 4ELRA 3MAMA 4OFJA 4OWDA 4R2BA 1ZX6A 2DEQA 1QWEA 1W6XA 4FYWB 2VP1A 5A0DA 3AT1B 4OF1A 3CMEQ 4ZN3A 4Z88A 1VIEA 4ELYC 4F39A 4RPNA 3H8ZA 4A4HA 1NEGA 3FC3A 4D8KA 1P99A 1XVYA 4F1UA 1QMCA 4BI4A 1WDNA 2FIXA 2CT4A 3CBMA 3Q25A 1B52A 1BK2A 2JTFA 4LN2A 2F7AA 4OERA 1P1OA 8ATCB 5KYWB 1Y07A 2DO3A 4C0FA 3USDA 4GF8A 1TH7A 1NEBA 3CBOA 2D8JA 3QKJA 4EQ7A 3MW0A 1NH7A 1M1KC 4P9KA 3ROJA 4C92E 3UN6A 1YHQQ 4AS4A 3ME9A 4GWSA 1Z7NE 1EIFA 1W2BP 4M4ZA 1OVTA 2O01E 2XXHA 2DXBA 3QO3A 4ZGEB 4QVCA 4RTWA 2LCSA 2ZNUA 2HXRA 1QVGS 2ZXTA 4M4GA 4N91A 3GF5A 4HXVA 2F5XA 3HP9A 2L5VA 1NFTA 4XK8E 2IEEA 3LGFA 5GMKi 2FBPA 4X9TA 4ATOA 3TSZA 3OYEA 3CPWP 3CCMT 4GWZA 4PQJA 2VKNA 4FU6A 2FRWA 4TVRA 2BZYA 4XTWA 1Q81U 4IO4A 1PRLC 4J9CA 4XTUA 5GMKh 4BD3A 3NPFA 3DP8A 2RM4A 5GAOm 4Z7EA 5KYUA 5J26A 3TREA 3ODBA 2W0ZA 1QVGA 1KHCA 5I57B 1OQHA 1IXIA 2RK2A 2EPDA 2ZPHB 4PBQA 3SEXA 2B86A 5LJ3f 3CG1A 4GXSB 1MQGA 1SHFA 4HCCA 2KLFA 2RKMA 3I55T 1VR5A 1UGRB 3U23A 3VS6A 2D1XA 2HSEB 2KR3A 3DB4A 3RDVA 5FLXE 2ZPFB 5I58B 1JETA 1KFZA 2O6AA 3G3HA 1OU8A 2RPNA 4MZMA 3FGSA 3T93B 3EF7A 1MUZA 2GTJA 4HT9A 1MPBA 1UIVA 4OANA 1FPKA 2PMSA 2DLPA 3IR1A 2P3NA 3C12A 2LVMA 4HT8A 2K3XA 3H6WA 2PUKB 4M78F 4I40A 2CZ0B 2YRDA 1K9ZA 4H6DA 1YITT 4N8GA 2JTEA 5GANe 3W15C 2WX9A 4ELQA 4AT1B 1LBWA 1W2BS 3H6ZA 4HCYA 1YYZA 1S72T 4NEDA 1SSFA 4U2RA 2VC8A 1L5TA 4R6KA 5GMKl 2QPQA 2KGTA 3PPNA 1AVZC 1D0YA 2QSXA 2DXRA 4HCKA 4GOTA 2AKKA 4N6DA 2DE3A 1D1CA 2NVUB 3J7AF 3T9VA 3R7XA 2H3EB 1NYGA 2KNBB 1OMPA 1IHVA 4XF5A 1VQNT 2DBMA 1RDZA 1CB6A 1EZ9A 1R9LA 1UGPB 1LAFE 4J5YA 2H25A 3CPWS 2RINA 2VGQA 3CD6T 3KN3A 1K4US 1E7OA 4ZEFA 2E3IA 1W2BA 1MY4A 3UF4A 2GRVA 2FVZA 4XU0A 4E7JA 4FAJA 3PNWC 2OTLQ 3OYJA 2V25A 2O88A 2CP2A 1M1KU 1IB8A 1VQ9T 3KBZA 1KHIA 1X01A 1N8RC 3S9MC 3CCUQ 3EGDB 1VQ5Q 2XX7A 3A29A 4GLIA 3C95A 1MV0B 2K3BA 1FBGA 3Q1JA 4JJNK 2O68A 3EH2A 3PVQA 3TQWA 2A28A 1F1BB 3OW2P 3CPWA 1WXBA 1JP4A 3ULRB 5JTYA 1VSOA 3C0CA 5FHOA 1M5FA 1URGA 2PYYA 3SFMA 5ET8A 3L6GA 2EYZA 1NV2A 1AOVA 3RTWB 4QKUA 2J06A 5CVIA 1QJMA 1IMCA 3JCMe 3V8JA 4FYXB 5IGAA 3CCSA 3HV1A 2MF2A 2R58A 2RC8A 1B1XA 2QQSA 3J80E 2COZA 1Z9QA 2O4XA 2RJDA 1GCPA 1M8MA 5I3SA 1C1AA 3C4MA 1SSHA 4OP0A 4RTUA 1YJWT 2ZZXA 4ZDMA 4LD6A 5H8SA 4M7AA 1UTHB 3B6WA 4PJJA 1RDXA 4QFOA 4KH1B 1ABQA 3PVLA 4F18A 3H06B 2B8AA 2K2VA 4P8BA 1EZZB 1M5Q1 4ME7A 4PFOA 1FPIA 4VUBA 4OEVA 1M90U 1WNLA 4JS4A 4NF4B 2I3WA 4A63B 3OYDA 4JDSA 1YJNQ 4NQ8A 1NL5A 4OMFB 1EFNA 4PJOG 1KWHA 1NV5A 4HE2A 3G4SA 2Q89A 5AA4B 3QPHA 2DPPB 4ND9A 3PMTA 2AK5A 2PZ1A 4F7UE 1FTLA 3PIOA 3QUFA 4MNPA 2KT8A 5HKCA 2XXYA 3FUZA 4OB1B 4FM4B 4E7LA 1GL5A 4I62A 2HPGA 2DL5A 4N8YA 3VS1A 2HKNA 1FPGA 3SDZA 3L2UA 2DVZA 1FMVA 3MP8A 5GAMj 1KQ1A 1VYVA 3OW2S 4UACA 1Y4CA 1UFFA 1OEBA 1QVPA 3FRNA 5CQXA 3JB9H 3H6UA 4N81A 4U4XA 2NYSA 1ZBXA 3CC2A 2SRCA 1YJ9Q 1FTAA 2C0TA 1MQDA 2NUTA 3CEYA 1VQ6T 5D7UA 3OEMA 1XJWB 4LDVA 3RMSA 2CGHA 2EGAA 3U8QA 3O9PA 5I5PA 5GMKe 1QCNA 4ZNXA 4I1DA 4RYAA 3FXRA 3TFLA 2DSFA 1VQOA 3OW2A 2DKGA 2CZLA 1N8RU 3QJYA 1BIYA 1KA0A 2OWSA 1VQPA 5JEIA 3CCEQ 1AWBA 2HQEA 1P1QA 2XDPA 3HPWA 5LJ3h 1YCYA 5IN1A 1GFDA 4F3BA 3PMXA 5GANd 3KC1A 1LBZA 4MIJA 3VV0A 2D5WA 2VXEA 2FIEA 3CMAT 3HL8A 2DD5A 1K8AC 2YLCA 2XDBA 1YCJA 4IUVA 4EIKA 5J39A 1BI0A 3ZEHA 3HN0A 3V7SA 3A09A 1M90R 1LAXA 2DWAA 2F8DA 2KY9A 1BLFA 2KR0A 2RI3A 2XI9A 1FBCA 4P0GA 2Q8MA 2JUFA 1YN8A 3RMQA 2GQ1A 3I56A 2YSQA 1QKWA 3REBB 1SPIA 5DTBA 3WAFA 1MGQA 3U94A 1Y1MA 2LQWA 3IO6A 2O7UA 3FB9A 2E1HA 4QSCA 5GJWB 2P3VA 3K1MA 1NE8A 4NE4A 4BDRA 1ZJLA 1WDXA 3TSWA 2KE9A 4J6YA 1FTMA 5GAN7 2Z8EA 4ANJA 4BDOA 2SEMA 3VJPA 3S3NA 4NF8A 2ZNTA 1A0NB 4TQUQ 1VQLT 3HFOA 5CM6A 2JS0A 2XU8A 1WLPB 1TWBA 4AG2C 4BE0A 3IFAA 5I2NB 4OVQA 4QBAA 5LJ5f 4JVDA 1QUKA 4G8HA 4F29A 2ZPBB 4I9DA 2A36A 3EFOB 4H8IA 2J6OA 4U21A 4KD5A 4IO6A 4KUIA 4FYVB 3JCMd 3R6NA 1FPJA 3LYIA 3FZVA 3MP6A 4C92A 4O3AA 5CO7A 1B3EA 1SBPA 1I07A 3RQTA 2K5LA 1N8RR 2DOJA 2MIOA 4XXUA 2VB6A 2GGRA 1VQOT 3EHRA 5KYYA 1AT1B 1UB4A 1WQ7A 2OWTA 1Q1KA 1ATGA 1VQPT 1IITA 2D3IA 3NMZC 3SD4A 5L8RE 3RUXA 1WXTA 1MXZA 1BIBA 1VFEA 3FEOA 1K9MC 4QVDA 4GVOA 2O1LA 2V8IA 2JS2A 3OYCA 2X35A 2EAYA 2JJ9A 2D0QB 2I6EA 3U92A 1NUXA 4NL2A 2F3DA 2DVJA 2OLBA 4FSSA 3X20B 3PUVE 4MF3A 4F3PA 4Y91A 1H3HA 4LNPA 1K73C 5FTIA 4MFIA 3FIFA 2KRMA 1QVSA 1PRMC 3NGPA 4N4GA 2P4RA 3RNJA 2Y7WA 5IHKA 4P56A 4V2SA 3UATA 3O29A 4EXLA 2Z8DA 1N3XA 5CKDA
chains in the Genus database with same CATH topology
2Q88A 2B65A 4U23A 2E64A 1K8AU 2V3QA 4MH5A 3TTRA 3S9NC 1A8FA 2QXFA 4JLIA 3WVDB 3G3KA 1P1NA 1MRPA 5FRNA 4C8QF 3KXTA 2GHBA 5BWJA 3UGWA 4Q5WA 5GAN8 3A8MB 1MXXA 3MUQA 1Q86C 3META 1O7TA 3V8LA 3K1NA 2VD2A 2O69A 5CMCA 3TU4K 2RH2A 1XOVA 2R9JA 2ZCFB 3OO7A 4JSOA 5I59B 3FJMA 1F9BA 4NWCA 1Y96A 2HD0A 4KQPA 3G3GA 1ZTYA 3PTAA 2HBPA 4OYVA 4KYEA 3SETA 3RTFB 4KULA 4O5VA 3X28B 2V3UA 1YPNA 4E7KA 4RXLA 4LQ5A 1FQAA 1PBQA 2E12A 4LZ5A 3JCMQ 5CKBA 4C1UA 5GANg 3BKIB 5IT9E 2UXAA 1N0TA 3KN8A 2BKDN 1JJ2A 4KI0E 1H3ZA 1A55A 2HFBA 3K2DA 1LFIA 3PPPA 3UP9A 4LONB 3TCHA 4XTYA 1BKBA 4J7FA 4KFQA 4DZ1A 2PVGB 3OOAA 4ZZEA 1QUIA 3A5ZB 3QK6A 2X7PA 4J6WA 2XIDA 4R74A 4RNSA 4IKFA 5H8HB 1BI1A 4LZ7A 4JLGA 1BI2A 1SW1A 5JK4A 2V8JA 1PB7A 3ONMA 3VFJA 4F19A 1POTA 2A5TB 5CAIA 1NJIC 5D6YA 3EFSA 4M7DF 1I8FA 4PE5B 3C36A 3RESA 3OYFA 2Q9TA 1US5A 3O97A 4MZPA 3SERA 3WAEA 1GR2A 2E10A 3PUWE 1VQKA 3JCMb 4EDUA 3OYYA 1H641 2Z22A 1IXCA 1FTOA 1PEBA 3RN8A 2QQ9A 3A3UA 3PPRA 4PP0A 4EUOA 4BB7A 4FEBA 3WVEB 3JB9I 1UTBA 4XU2A 3M55A 1B32A 1SVXB 2OTJA 1SI0A 4XKRA 1XVXA 1NNFA 4YB7A 4HS7A 2CZ7B 2XXTA 3GZGA 3JCMg 2F34A 4DOWA 4XAXB 1B2HA 4C8QB 1LAGE 3PUYE 3BFTA 1VQMA 1Q86U 4YU0A 4IO2A 5LJ5h 4PJOC 4PKCC 3SKPA 1SW5A 5L9OA 3QDRB 2RO0A 2F6PA 4F7UA 1UGSB 4MLQA 3MEUA 4C0DC 4X34A 4ELPA 4M75F 2DK3A 1LJOA 2DZCA 4H0WA 1NH8A 3OXNA 1VQ7T 1UQWA 4TLMB 3VLUA 1T0KA 3MVWA 1WJQA 1FX7A 2KQWA 4M78G 4ONYA 5D6WA 3HPIA 2EQJA 1VQ8A 2JN0A 3ER0A 2XK0A 2KVQG 3TUSA 1I6BA 2FVUA 3D4GA 4G68C 2A3LA 4NOYA 1WGSA 2I4CA 5GAMd 4CRIA 2DE4A 5FRMA 1YI2A 5AE4A 4JRIA 1MDQA 2K57A 2HCAA 5DLOA 2Y84A 3T96B 1CE2A 5EHSA 4M77B 2ABHA 2H5YA 1B34B 4BY6B 3IB0A 3E9FA 3FVNA 4PFUA 1VQKT 4NF5A 2XDDA 3V8KA 5GANj 5CRYA 1IXGA 3P8DA 3O6IA 3CBPA 3JCMJ 2DZ9A 4QQ6A 2RCBA 2K3YA 4NS5A 1NJIU 4BDNA 3CCRT 1IUDA 2DVCA 3SWNA 3L42A 4M7DB 2EWNA 1QW0A 3SWNC 2GFEA 3JCMV 2ZYMA 3D4CA 3K02A 4U22A 2XD0A 1SI1A 1G3SA 1X6OA 1TFDA 1WVJA 1JQFA 3IOTA 3M4YA 4G2ZA 3G71A 3CCLT 2JVVA 4F1VA 2EFIA 4BDZA 4OVAA 3W9VA 2V3TA 2DIQA 1MQJA 2L8DA 2KMTA 4RMOA 4HTGA 2RCAA 1D3BA 2MI6A 4BI3A 5C0MA 2E41A 1Y3NA 4J7IA 2XHCA 4Q0CA 1Q82C 4FSXA 2XXVA 2EIFA 4OENA 4N0AC 4EXKA 1DTZA 3O6GA 4BI8B 1FQDA 4A4FA 1D9YA 1LFHA 3CVGA 3EHSA 1RYXA 4NF6A 3OO9A 5TPAB 3ZBDA 2PBWA 2NOOA 1B4HA 3SDFA 3IJOB 1YI2T 1R6ZA 2QTXA 3RKXA 5DEXB 3TCGA 1NPPA 5LL6S 3JB9G 2FYIA 4KBMB 1UIUA 3BDLA 3RPWA 3KBRA 3OA6A 3PD9A 1NKXA 4G77A 1BYMA 3W9WA 4BUGA 2X26A 2E70A 1IREB 4X9DA 3M56A 4OMBA 4RCBA 5GAMf 2ZZDA 2YLBA 4FJPA 2F5KA 4JWYA 3CFLA 3O8VA 4GL0A 3CC7T 4XQ3A 3QYGB 1B5HA 3T22A 3GXAA 3FJ7A 3DP4A 5H8FA 2RJEA 1YIJT 3Q29A 3EHUA 3OMCA 1QUJA 1MXVA 3ILUB 4ZGJB 3G71T 1SQYA 4ZE9A 3THIA 1DTGA 4RKUE 1WJSA 1D4NA 1JBMA 4JBZA 3TKDA 5KCHA 5F7VA 4MDWA 3S3OA 3HCQA 4O3CA 4ELOA 5I57A 2P1SA 3V7CA 3OSQA 3BBRA 3QSUA 3OYLA 3V8XB 5M9OA 4CI0C 1J1NA 1H76A 1LLSA 3E19A 1KG1A 1B05A 3JCMX 1FCKA 4GLKA 3LWHA 3VLWA 4X9CA 4PFWA 3LX7A 1LCFA 5GMKj 2QQAA 1I69A 3UIFA 5I58A 1O63A 4BDQA 5GAMg 3JCMc 3M9QA 4OGCA 4A4EA 5ISUA 4MZTA 4IGRA 3OYNA 3QYHB 3ECRA 4PJOD 1JW4A 1Y9UA 4M7AF 4J6XA 4BDMA 3KZGA 1Q82U 2DS9A 3MBPA 1JW5A 3GBBA 4LP2B 4LDYA 2XD3A 3OSRA 1Y71A 4DXUA 4QFKA 4IUTA 2X4XA 3VKIA 3T9HB 5DYHA 1B40A 1Z7ME 3KBGA 1KQSA 4A53A 2F69A 3TTKA 2WKYA 2QEXA 4Z0IA 4DIGA 3K6VA 3LSXA 3QUIA 3A3CA 4HCZA 1NNPA 1QKBA 4L59A 3KSXA 1BI3A 3LSWA 2YHTA 3OEKA 3CCJA 4P11A 1B6HA 4YAHX 4HW8A 4DA4A 3IB1A 4HA8A 3HHGA 3K6XA 1G3TA 5AA1A 5KCOA 1R8OB 1AMFA 1LOJA 1JEVA 2RB6A 2E6ZA 4M77D 3WXMB 3OYGA 4ZZAA 4FT4A 1U8RA 2HQ0A 2E65A 1FQBA 5CKHA 3FVOA 2XXPA 2FA7A 3T9XB 3ASKA 1FTKA 2YJPA 3SEUA 4FL6A 4FIMA 4Q8RA 3KG2A 3Q26A 5CBRA 4WEDA 1WJRA 2D9TA 3ZKLA 4AB6A 1IXHA 3EQ1A 3LUYA 4DCXA 3L2ZA 5JTYB 3K1PA 3PGGA 5KE3A 4IY5A 1G5VA 5A2QE 2Y7KA 4JWXA 1MY1A 4NF4A 1KC8C 3RY3A 2ZYNA 5CQYA 1LB9A 3PD8A 3E9GA 4PFYA 4C8QG 1M5EA 4DDDA 2I0BA 5I56A 4OB0B 1ZQ1A 5GAOq 4PJOE 5AA4A 3JB9J 2O4XB 2BJJX 1KD1C 1HXDA 2XXIA 4G8NA 4M78B 2XG8D 1U1SA 4RY1A 4ZEBA 5DY9A 4F3GA 2DWIA 3IO4A 1EH3A 3GOXA 4GFRA 4EQBA 5CR2A 1Y3QA 4A4KA 1QVFA 1TXFA 4PL6A 3CFZA 1M1FA 4AB5A 2EQMA 4N07A 3TCFA 3P8HA 4YKPA 3RKYA 1MM6A 2RJCA 3TMGA 2O84X 2Y4YA 3GPLA 1PC3A 4BE1A 5ICTA 4FT2A 2VOZA 4WF2A 1SW4A 2QA4A 2R6GE 4C92F 1A8EA 1B7ZA 1USYE 2XX8A 3UK4A 4LUBA 3LBSA 4M77G 5ICQA 4IUPA 3TTLA 3M3FA 1M8VA 1URSA 1QULA 2RI5A 1ZMGA 4F1YA 4BDYA 3CCST 1SYHA 2AL5A 3FLGA 1PBPA 4PNOA 5HK0A 2UYEA 5CC2A 4YKIA 2LRQA 3CMEA 3UPUA 4M7DG 2I2LA 2M0OA 2X4WA 1FXXA 4POWA 2ONRA 4J8OA 2H4IA 3DM0A 3ZSFA 2VGNA 1BKAA 2F5TX 4Q30B 2CZ1B 1GXIE 1Q35A 4U1OA 2JNGA 2UVGA 4LDUA 3G4ST 4IGTA 2X4YA 4KT0E 1XT8A 3O28A 4Q5TA 3AHUA 1YHQA 2FL7A 5I2KB 3FD3A 3H03A 1S7YA 2KDSA 3HFNA 3VXBA 1KC8U 2L89A 5A5XB 3GIBA 3E3KA 4R56A 1Q7YC 5H8NA 4GQOA 4X1DA 4GRKA 2K5IA 4XKQA 4KUDK 2MAMA 1VFDA 5GAN2 4RK9A 1B9JA 1DSNA 4PETA 3CC2T 3PUXE 3TPAA 2RHIA 1B0HA 5GAOr 1MY0A 4M75G 3N6UA 4Z02A 4OZ9A 3JYRA 3OENA 3OYKA 1OLAA 4ZS9A 3C35A 4N13A 4EF1A 1S50A 5DVJA 2DXYA 2FNCA 3MZ1A 2QA4T 4KPTA 5CBSA 3S4UA 3MJNA 4IO7A 5L9MA 3JSCA 3DP6A 3X25B 5AYFA 3K00A 2ZPEB 5K2YA 3VYHB 4G8MA 1N6AA 4QVZA 2OCUA 3QUJA 4C0GA 4U1ZA 3CFXA 4FEDA 2FB7A 2UVHA 2L3RA 3CMET 5TP9A 4C92B 3J81E 4DLDA 2D6FA 4OTEA 1MHNA 5GMKm 1NMUA 3I6VA 1FQFA 4IUUA 4EMGA 2YPNA 5FU6B 3I56T 2QRYA 4R73A 2RD1A 3RT8A 5IAIA 2BIVA 2Y90A 1M5BA 4TOZA 5GANf 3TDJA 1TT1A 1QW1A 3OYMA 2MWOA 3OYHA 1XHYA 4L5GA 4WXJA 3GLXA 5ITPA 2K4YA 5F1QA 1R9QA 2P0KA 4C0ZA 4JSDA 3E13X 2OTLA 1Y1ZA 3X26B 1IZ1A 3MVYA 1N76A 4YZZA 2PVDB 1JJ2S 4QFLA 3CCUA 1VQ5A 3FATA 3ZFJA 4OB2B 2EKOA 5M2VA 4R75A 3JRZA 3PT9A 3A8OB 3VDFA 3MO8A 2VV5A 4PJOF 1Q7YU 2XD2A 4XTCQ 1RYOA 1VIFA 3TQLA 2Q8JA 4F7UF 3K4UA 3SEWA 2RHZA 2RJFA 4M78D 4KHZE 3LGLA 4E47A 2PT2A 2GH9A 3LW5E 2O7IA 4JB7A 1N04A 2AIXA 2WACA 3TAJA 3MC2A 5DM7R 1O9SA 3LSFB 1A54A 2PQWA 1Y96B 2AL4A 2I48A 2C06A 5LJ3e 1B3GA 3OBYA 3FV2A 3OELA 4YB6A 3JCMf 3NTIA 3H6VA 3RIRA 1K9MU 3B6QA 5GAOl 3M53A 3S3MA 1LCTA 1N27A 4RJZA 3VYGA 2NUVA 1OLCA 4GD5A 5CMBA 1V29B 1K73U 5BUUA 1XTDA 1LNXA 2LT1A 5CKFA 3KFMA 5L9SA 1QKAA 1N7XA 4EMHA 2H3JA 4U4SA 1FQEA 4OXVA 1LAHE 4X1BA 4X48A 2P0SA 3BW1A 4THIA 2OTLT 1OYXA 3QIIA 5I84A 3O6HA 1YJ9A 2ZGWA 1VQ5T 4PJOA 1I5LA 2LQ8A 4C8QC 4OESA 2H98A 2ZPGB 4OHNA 3OMGA 4NMYA 1UTBB 2E6NA 4OFOA 2Q2AA 3TEEA 1LFGA 1GV8A 1B46A 3CCEA 1A7LA 3CXCA 3KJTA 2EYQA 1IQ7A 3MHXA 2D21A 1JVYA 2GCXA 4DQ2A 3H3GA 2UYFA 4OEUA 4M78E 4M7AG 2LCCA 3QYTA 4ZECA 3M8UA 4F7UB 4G68A 3IL1B 4QQGA 1Y7XA 1JB0E 5CIUA 1B58A 1B5IA 3PGFA 1MQIA 3ZKKA 3QXMA 2KAFA 5FROA 5KDTA 3B7DA 3ILTB 1UGQB 3L2VA 3JB9D 5H8QB 4OB3B 2LNVA 2YRVA 4TLLB 1H43A 3SEYA 3F70A 5DVFA 3IJXB 3C34A 1DPPA 3KJ7A 3PPOA 4M77C 5J3BA 4XKNA 4KCDA 4BY6C 1HSLA 1A99A 1Y4TA 5FU7B 1HSEA 3N6TA 2B3FA 3SEVA 3IOVA 2VHAA 3LSLA 2HAVA 5GANh 2NWJA 3T9UA 2NLUA 3TEPA 4UA8A 1LBBA 4M7DC 1XS5A 2OTJT 4ZGDB 4PFTA 1P1UA 2ANJA 1MM7A 2W7YA 4Y28E 4NF5B 5EYFA 4E7IA 1VQMT 2EQUA 1JNFA 5KH6A 4FECA 1RI0A 2ZPIB 3JCMP 3O2AA 2QDYB 3FJPA 5AA2B 1B3FA 3EN3A 2KSSA 2REGA 2GFAA 5GAN5 2A5SA 5LJ3d 1B3HA 3CCQA 1DPEA 4H5FA 2UVIA 4HCWA 1AIVA 3R6UA 2O51A 2ONSA 2MWPA 4YKJA 5KCJB 2ZYOA 1N3WA 1N9RA 3VE1B 4OETA 4F2QA 4LQ2A 3A8HB 4N0AA 1B3LA 3OO8A 4QSEA 2VD3A 3MP1A 1VQ8T 2I3VA 2QMWA 1R1NA 3G3JA 1ZHIA 1MPDA 4RG8A 3L6HA 5TPAA 4M75B 5TU0A 4LD9K 1PSFA 3G6EA 2L5QA 4EMKB 4K3FA 3MEAA 1YTVA 3JCMh 3PMWA 3JCMW 2F6GA 2XXXA 3I55A 3MZBA 4RCCA 2PT1A 4GXAA 4IY6A 3FV1A 2DWJA 1B4ZA 2M8CA 2QJEA 3BY7A 3GP8A 2QS2A 3MVXA 3P7IA 1ZBMA 2LQKA 1B0LA 1EZPA 1MY3A 3FVKA 1Y3PA 1NNTA 5C6SA 3PFSA 4NF6B 4PLIA 2O1MA 1YITA 3KSJA 3V5AA 3BFUA 3DLNA 1S72A 3HKSA 1GGGA 4QFPA 2Z23A 2E5QA 4FATA 4R6YA 3NTKA 5GAOp 2R57A 1W4SA 4BE2A 4KCCA 1VQNA 4C92G 5LJ5e 4NWDA 3AXFA 3CD6A 5B70A 4ZTJA 4OFLA 3RKWA 3CCVA 3CCQT 2RI2A 1IIWA 2LCLA 3QJ6A 4QHQA 3TODA 4QRZA 2ALUA 2Q2CA 3OS2A 3L2RA 3Q28A 1VQ9A 2VXFA 5GAN3 3KOTA 1FWZA 1U1TA 4YICA 5H8FB 4ZEKA 3JAME 1FTJA 5I2SA 2LC4A 1KQSS 2PVUA 1N84A 2BUDA 4C8QD 2QS3A 2WSEE 3G6ET 1SDXA 2JTMA 2RK1A 2R71A 4FORA 4E0XA 4H65A 2PU9B 1XC1A 4XIGQ 3CSBA 1M90C 5CKEA 1TFAA 4QW2A 2P0PA 1QP3A 4OQOA 2H99A 4LDXA 2XX9A 3MPLA 1YJWA 4PLLA 4BDLA 3EAEA 5ITOA 4N4IA 4IUQA 3UDCA 2CS7A