3MP8A

Crystal structure of sgf29 tudor domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
513
structure length
513
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
total genus 148
structure length 513
sequence length 513
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp8A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp8A01
1LB9A 2G29A 3ILUB 3K6XA 2REGA 3PV0E 3MVXA 1BIYA 2VP1A 3OMGA 2A5TA 3LSLA 2HZLA 4ZEBA 3B6TA 3O6HA 4QF9A 4GL0A 2XD2A 3PUYE 4OHNA 4XKQA 4ZECA 1IXGA 1HSEA 3RT6B 1N3WA 2P0SA 2Q2AA 2I49A 2F5KA 1FTLA 2Y7KA 4KYEA 4GIZA 1B1HA 1M5FA 1SVXB 3MVYA 2DE2A 2HQEA 1AIVA 5EHMA 5I2NB 5I2NA 5AA4A 4ONYA 2V93A 2EQUA 1EZ9A 3L42A 4L59A 4GQOA 5F1QA 5CRYA 5KDTA 2PT1A 4DIGA 4G8MA 4DZ1A 2DIGA 5H8QA 1OQGA 3CRBA 2E5QA 1YTVA 1A8FA 2RHZA 4M1VA 4ZEKA 1POTA 3OA6A 3H8ZA 3NTKA 1IEJA 1UQWA 3L6HA 2OJTA 2R9JA 3HSTA 2XXVA 3VLWA 3LGLA 4P0GA 4WEPA 1FTMA 3CG3A 4KI0E 2L89A 2GHAA 3RTFB 5M9OA 3PD9A 1VFEA 2EQKA 2OK2A 4YMAA 3FVOA 4OWDA 3LH0A 3HHGA 1A54A 3W15C 3O66A 3E3KA 3TTKA 5I58A 4QW2A 2XDPA 5TPAA 3THIA 3OYMA 1KHCA 4G77A 4QFKA 2YPNA 3TTRA 3H4ZA 3HN0A 2UVJA 4QQGA 1MM6A 4YKPA 5KZTA 1BTJA 1AMFA 3LYIA 4LONB 1XNIA 1ZBMA 4G68A 3PGFA 1RYXA 5CMMA 4X34A 3SEWA 3UN6A 3VE1B 2K3XA 4C0RA 4JXIA 4FE8A 1Y3QA 1Z7NE 1PB7A 4UA8A 4E7LA 1OLAA 2RC8A 2LVMA 2IEEA 3U72A 1B7ZA 1KWHA 2VGQA 3L2RA 4U4XA 2ZYKA 3OO8A 3MQ9A 4BACA 1Y4TA 4WEDA 5H8FA 2O7UA 2RHXA 2HQXA 3PNWC 4LZ7A 1N3XA 4AB5A 4FORA 2UYEA 4YKJA 3S3NA 3OEKA 4DCYA 3M9QA 1LAFE 3RGYA 1S50A 1OYXA 1LAHE 3P7IA 2V3TA 4ZDMA 3TAJA 1LBCA 3UWNA 3OO9A 1B05A 2HQ0A 2XX8A 3FUZA 4OQOA 2IA4A 3EHUA 3T9HB 4KR5A 1Q35A 4FEBA 3VV5A 1NNTA 2XXRA 3WAFA 3FATA 2I6EA 3CG1A 2QRYA 5H8NB 5I84A 1QW0A 4NF6B 2Y7RA 2RC9A 3SEUA 1I69A 3LSXA 4IY5A 5JEIA 4JSOA 2H5YA 2HZKA 1USYE 3UK4A 2ZNUA 3RN8A 4OEVA 2DWHA 3UT1A 4JWYA 4YB7A 4F3SA 4QFPA 1B3FA 3IB2A 2XHDA 5J26A 4Z02A 4MFIA 2B3BA 1NL5A 4FJPA 3V5AA 3A3CA 4ZE8A 4OEUA 1CB6A 4YICA 4LP2B 1LGBC 4R2FA 1XC1A 3KG2A 3C33A 5L8DA 4E0XA 3FXRA 2QL3A 4OZ9A 4EQBA 3NTHA 3A3UA 1SW5A 4C1UA 1OZ2A 3MW0A 1SD3A 1SI1A 1JQFA 3FIRA 2HCAA 3OOAA 2XXHA 2M1HA 3OSQA 1S9TA 2PT2A 4BDZA 2RJFA 3S3OA 1QKAA 2Q2CA 4OFOA 1IITA 3TFLA 3G3FA 1URDA 2GFUA 3K2DA 3H6UA 2YJPA 4E7JA 4I62A 4I9DA 4RA1A 5KE3A 5IAIA 4FECA 1VFDA 4ECFA 4C5IA 2DXYA 1LBBA 1B52A 1B5JA 4QFLA 5FRMA 4F2OA 4EDPA 5A5XB 3G3KA 3T9UA 1FQCA 3FXQA 2I48A 2O69A 3KSJA 4NF4A 1FCKA 5AA2D 1TFAA 4NWDA 2RHYA 3KBRA 4ZEIA 3K1MA 5DEXA 1NMUA 1NFTA 4GLIA 1SYIA 2P0KA 4A4FA 4OFJA 2F8DA 1NNKA 3VVDA 3CI8A 1MY1A 2ANJA 2ZYOA 4G2ZA 1S7YA 2V3UA 1US5A 1H3DA 5FTHA 5J39A 1PEBA 1N04A 1B3HA 1LCTA 1OZ3A 4IUPA 3N6UA 1JEVA 3IORA 4PE5B 4TOZA 4P11A 4RXLA 2FNCA 3IOUA 3S6WA 3PMIA 1QUKA 4IURA 2RI5A 4DXUA 2RCBA 2XXUA 3RT8A 2F36A 1GTKA 1IZ1A 2ZYMA 4KCDA 3C35A 3CFLA 3IO6A 2V3QA 2F5XA 4THIA 3N26A 5I58B 5KH6A 1B1XA 1VSOA 2ZNTA 1LB8A 4L17A 1UIUA 4H6DA 4ZS9A 1MY2A 5CMBA 2AL4A 1SSFA 5IAYA 1N84A 2GFAA 2OWTA 2DOJA 2Z8FA 4DCXA 2Z22A 4G68C 2Y84A 3KFMA 3OS1A 4YU0A 2XK0A 4H67A 4R6KA 4JWOA 3NTIA 2IG0A 4IO3A 4BLAA 1EH3A 1MH3A 4R6HA 1FQFA 1B0LA 1LFIA 1D4NA 1DPPA 2F7CA 3PUVE 1NH7A 2F7AA 3SETA 1BP5A 3BFTA 5JTYA 1R6ZA 4LQ2A 3TCFA 4GF8A 5B7DA 1MY3A 4G8NA 4Q5WA 4X48A 4U21A 1LLSA 4NF5A 3IR1A 3C4SA 4M4GA 3A09A 1SDXA 2BIVA 4H8IA 2O51A 2L8DA 2XXPA 1ZIUA 1H76A 5CBRA 4PFTA 4YB5A 3UIFA 4WKMA 3Q29A 1ZTYA 5K2XA 3IK6B 3FEOA 5ITOA 5FRNA 2O4XA 3FD3A 2RHIA 1MDP1 4PL6A 2P2AA 3TQLA 5BUUA 3QKJA 4UACA 2QMXA 4KPTA 4IO5A 1D3KA 3LBSA 3FJMA 3L2UA 4TLMB 3QIIA 3SD4A 4RPNA 2Z8EA 4PFUA 4DLDA 1DSNA 2QQSA 4F1VA 3O8VA 4POWA 3K01A 3META 4G68B 1M5BA 4LVQA 3S2VA 4N4HA 2LAOA 4RPOA 3TCGA 2VOZA 3SDFA 2XXXA 1JNFA 4R74A 4A4HA 3M3FA 5AA4B 3KN7A 3O2AA 5D6YA 5TU0A 5CMKA 3CIJA 4RNSA 1MXVA 3K6UA 2D21A 4GFRA 2XXWA 3VLUA 3UGWA 1FQEA 4F18A 3ECRA 3FV2A 2P1SA 1PC3A 2O7IA 4NF5B 4IO6A 1J1NA 4X1DA 3P8DA 2DWIA 1P1OA 4IO4A 3U92A 3MPLA 1QUJA 4YKKA 1EZOA 4K3FA 2PX1A 4MF3A 2DXRA 1F9BA 3OYBA 2RKMA 5H8FB 1N27A 4E7IA 2E6NA 2LRQA 3IAZA 3TTMA 2XXIA 2QS3A 1GVCA 2RINA 4U23A 1URGA 3MEWA 2PQWA 1BKAA 3MO8A 3O6GA 1II5A 4GY5A 4QFNA 4E0WA 3CSGA 3GXAA 3O97A 3DLNA 5CMCA 5CC2A 5I59A 4OVJA 1AOVA 4Z0IA 3PPNA 2EQJA 3E4RA 1SW1A 2A5SA 1A7LA 3FVKA 3K0VA 3TODA 4NF8B 4GXAA 1Y1MA 5FHNA 2F35A 1GV8A 4HCZA 3K1PA 3MVWA 4XTCQ 4YZZA 1IXHA 4ELOA 3DP8A 1OMPA 1AH5A 3FZVA 3DP6A 5KCOA 3OD7A 1XVXA 1RYOA 3VXCA 4F3PA 2G3RA 2RJDA 2I4BA 2QMWA 4BDMA 3H6ZA 1A55A 3VVFA 4BDYA 4EUOA 1LSTA 4ZE9A 1L5TA 1LCFA 5EHSA 3MEAA 3B7DA 2Z23A 1JW1A 4KYSA 4PFYA 3MEUA 3KSXA 1FQBA 1WDNA 3E9XA 2Q8JA 5KCHA 2I4CA 3FV1A 4Q8RA 4ELQA 2H9BA 2DYXA 3FLGA 2X7PA 4NF6A 1WGSA 4HCWA 1JEUA 1O7TA 2YLNA 3H3GA 3VFJA 3RTWB 2RO0A 1NH8A 2VD2A 5I57B 5ICQA 4IUTA 1PB9A 3G7WA 3MUQA 3R6UA 4LATA 4XKNA 1UTBA 4FAJA 3G3JA 4F31B 4F29A 3W9VA 2ONRA 4JSDA 3TEPA 5KDTB 2MWPA 4QQ6A 1MXZA 4IO7A 4NE4A 4C5GA 1MS7A 2H99A 3O6IA 1B3GA 2GRVA 4E7HA 2R6GE 3Q1JA 3RQTA 3P8HA 1MXWA 1Z7ME 1DMBA 4BDOA 4KD5A 1IXCA 4DXCA 4OERA 3MWBA 3IB1A 1B9JA 3EPEA 4BDQA 4GVOA 1G5VA 3FC3A 4TLLB 2OBGA 2DP8A 1PBPA 4F3GA 4BE0A 1MDQA 4AB6A 4F39A 4ZEDA 4PP0A 3OQ5A 5I56A 2ALUA 3JZJA 3H6TA 2Y7WA 4EQ7A 1BLFA 1XVYA 3KOSA 3FGSA 3ZSFA 2X7QA 3OO6A 5TP9A 5ISUA 1XS5A 2F6PA 5D6XA 5KCJB 1WJSA 3MP1A 3PMTA 3D4GA 4N13A 4FU6A 3V89B 1FQDA 3PFSA 2E1SA 3JV9A 3QSLA 1A40A 1LFHA 5FHOA 3ZKLA 3T9XB 1R9LA 2DS9A 1IIWA 4Q0CA 2DE3A 1WODA 3OELA 5DVFA 4FEDA 3MPKA 5C6SA 3CFZA 3LGFA 2X35A 1MH4A 4R9FA 1QULA 3IJXB 4LD6A 1MHNA 4G8HA 2GFEA 3C9HA 2R57A 3DELB 2I3VA 3W9WA 5FROA 3ZS6A 5H8SA 2RI2A 1IXIA 3KJTA 5TP9B 4XKRA 1P1UA 3OXNA 4GRKA 3EN3A 1B3LA 1ZJLA 4IUUA 2DE4A 2RCAA 1NNFA 3PPOA 2GF7A 5AA2A 2VHAA 4RK9A 2BKDN 1Q1KA 3FXUA 3HCQA 3OB9A 3T93B 3PMXA 3S4UA 4BE1A 3IX1A 2D5WA 3G3IA 2R5MA 4NEDA 3DB4A 3AXFA 3RNNA 3C36A 1QKBA 3S9LC 4RJZA 3K00A 1VE4A 2W7YA 2RJEA 3LC8A 3OYAA 4ESWA 1H44A 4GOTA 5FTIA 2Q89A 4U2RA 4MBPA 1EU8A 2F34A 3V8XB 1OQHA 5HPQA 3PPRA 4F22A 3BFUA 3ME9A 3T22A 1QJMA 2K3YA 4ZTJA 3FVGA 4II1A 1N7WA 1IUDA 1GR2A 3K6WA 1M5DA 3Q27A 3T96B 4IGRA 1B0HA 3FJGA 3H6WA 1MQGA 2I3WA 1FTOA 3VXBA 1MPDA 2XXQA 2I0BA 3BBRA 3U1OA 3TUSA 2XXYA 1POY1 3H03A 3DM0A 2Q88A 3K6VA 1DOTA 3BDLA 3MP6A 2LCCA 4O3BA 1HSJA 4B9WA 3MZ1A 4B9XA 3PUZE 4OENA 4IUVA 3CSBA 1I6QA 1AL3A 3OYLA 3QK6A 3PU5A 3S9NC 2WACA 3L2VA 2EQMA 1D9VA 3TCHA 2RI3A 1PBQA 4JWXA 5DTBA 4BDLA 3EQ1A 3TTNA 2QQRA 3QYTA 1ANFA 2QS1A 2I0CA 4ZZAA 2AYSA 1B7UA 2BJJX 3H06B 1FTKA 3S9EA 3LSFB 4OVAA 5AA1A 3TDJA 4BE2A 1B6HA 5AE4A 2HXWA 4MLVA 1H3ZA 3S9MC 3EAEA 2QSXA 2ESNA 3ODBA 3OYEA 1GGGA 4RK2A 2LDMA 2L3RA 1LAXA 3KUFA 3D4CA 1JW4A 1OVBA 2PYYA 3G3GA 3LLRA 3CFXA 3TPAA 3O28A 4F1YA 3HPIA 2B3FA 2XX9A 1B58A 4YKIA 3E13X 1LAGE 2X4XA 4GWOA 4R75A 4HW8A 4R72A 1FTJA 2QPQA 4KYDA 3R7XA 5L9SA 4NF8A 4OETA 3Q28A 4Q30B 2M16A 5IKBA 5AA3A 4GXSB 3EHTA 4IKFA 2XXTA 4H65A 2DVZA 4QSEA 5DVJA 1OIBA 4IGTA 3OYGA 1RKMA 3WAEA 2PVUA 1PDAA 1YPNA 3PPQA 2CMOA 2ONKE 1B32A 4U4SA 1R1NA 2DWJA 4ELPA 1DPEA 4BDRA 4C1TA 1MG1A 4IUQA 3SEYA 1B3EA 1MXXA 1ZU0A 3FDRA 1DTZA 2ZNSA 2B65A 4IO2A 5H8NA 2Y7PA 2OWSA 3CR9A 3RY3A 4NF4B 4QRZA 3S3MA 1IQ7A 1HSLA 4PETA 4NS5A 3CEYA 4LQ5A 1B7HA 4BD3A 3KOTA 4TQUQ 4LA9A 4LZ5A 5DEXB 3N5LA 3OEMA 4EF2A 1ZMGA 4MLQA 4A4EA 2Z8DA 4YB6A 1UTHB 3ILTB 1MPBA 2O84X 2MWOA 4JB7A 1EZPA 4DDDA 2Y7IA 3QUJA 4Z7EA 3PUXE 3R26A 1A99A 3ONMA 2VD3A 4DXBA 1ZLQA 2AIXA 4G4PA 5JK4A 4HCYA 3U94A 3IO4A 5IN1A 2DSFA 4O3CA 3B6WA 3U8QA 1USYH 4BDNA 2JZ2A 1VR5A 1OVTA 3E9FA 2R5AA 4RYAA 2DVCA 1URSA 3V83A 5CIUA 2R58A 1B5IA 2NWJA 3N6TA 2I58A 2AL5A 2BUDA 1B46A 3OYDA 1P1QA 3LR1A 3IB0A 3SEVA 2LTOA 1YCJA 3I6VA 4KHZE 3TELA 2F97A 4HTGA 2V25A 3OO7A 5H8HA 3OYHA 4QSDA 4QQDA 1WJQA 2RJCA 3GOXA 5H8QB 5CBSA 3MZ9A 4EDUA 1TT1A 1XHYA 2GHBA 5AA2B 3DLMA 4F3BA 2QJEA 3OY9A 5JTYB 3PMVA 5LOMA 3KZGA 5I56B 2X26A 1MQHA 5C0MA 1O63A 4R9GA 3C4MA 2H4IA 4QSCA 3MVZA 2D9TA 4Q5TA 3I5OA 3IOWA 3M3LA 2X4YA 4N07A 4CRIA 1MQJA 4PFWA 1P99A 4QHQA 2OLBA 2ZYNA 1TFDA 5I2KA 3TKDA 3SESA 3HV1A 3USDA 3ZKKA 1SI0A 3FVNA 2EFIA 5H8HB 3L2WA 4WXJA 3KEIA 3OYCA 3UP9A 2NXOA 5HM4B 2O6AA 1I6BA 2H98A 2GH9A 4XIGQ 4E7KA 2G93A 5HBCA 5TPAB 3RLFE 3B6QA 4KCCA 4XKPA 3H6VA 1SBPA 3HO7A 2FYIA 4EXLA 5ITPA 2QS2A 2HAUA 3N94A 4X1BA 4OXVA 1SW2A 4U22A 3GBAA 3MBPA 1T0KA 1MM7A 4ZZEA 1WJRA 4H5GA 1Y3NA 4KQPA 2XD3A 2M8CA 3O9PA 4H8JA 1Y4CA 2O4XB 1XT8A 1FW0A 2WKYA 4F19A 4FATA 4PLLA 3OMCA 4EF1A 3QXMA 4C5HA 1MY0A 5DVIA 3MJNA 1D9YA 3PUWE 2O1LA 2ZMBA 3IL1B 4JBZA 1QUIA 4FIMA 2THIA 3OMBA 4OTEA 5EYFA 3OYFA 3MAMA 3ZEHA 4A4GA 3VLVA 5I59B 2UVHA 2HFBA 1Y20A 4PLIA 3VDFA 2EKOA 4N6PA 3GBBA 3KN8A 3TTLA 3G3HA 4IY6A 2NLUA 2HEUA 3MC2A 1MRPA 2OCUA 1B51A 4JDFA 2KLFA 3OENA 3TMGA 1A8EA 3IOVA 3O29A 3OYKA 1MY4A 1N7XA 4XXUA 3M8UA 2ABHA 4ESXA 1MQDA 3C34A 5M2VA 2F6GA 2UVGA 4NWCA 5F7VA 3KJ7A 1ZKBA 4ZEFA 2VYTA 3GLBA 1M5CA 2NOOA 1SQYA 3ASKA 5D6WA 1DTGA 5K2YA 4X9TA 1H43A 1ELJA 2O1MA 4F1UA 3VVEA 3OSRA 1UTBB 2FA7A 3RUMA 4QFOA 3IJOB 1B4ZA 4R73A 1UTHA 1UIVA 3F70A 3QAXA 1RI0A 2NUVA 2RC7A 2DIQA 3LX7A 5L9OA 2V84A 3L6GA 1N76A 1OI1A 2QS4A 4MH5A 3E9GA 2D3IA 5ICTA 4I1DA 3OYIA 3TYHA 4ZTFA 2RHUA 2PBWA 3C31A 3FJ7A 1LFGA 4AQ4A 2PMSA 4ND9A 2R71A 3LUYA 1MXYA 4EQ9A 4GL8A 2JTFA 3MZBA 3EF7A 3TZAA 2RF1A 4EXKA 3IOTA 3OYNA 3LSWA 4KFQA 2NVUB 5ELVA 4H0WA 1JETA 1PB8A 3MP8A 3SEXA 1WVJA 1M5EA 1NNPA 4FL6A 4OFLA 3PMWA 4IB2A 1TXFA 1O64A 4ELRA 1QVSA 1ATGA 4U1OA 2H25A 2F7BA 4QVZA 5KE2A 3DP4A 1JVYA 3QUFA 3QIMA 2DWAA 3C32A 4YAHX 4R2BA 3FASA 4RG2A 4ISUA 4U1ZA 5L9MA 2O68A 2XX7A 4H5FA 3K4UA 3OYJA 1US4A 4H1XA 1Y9UA 1XOCA 2X4WA 1P1WA 3K02A 4O3AA 1N0TA 4POXA 4N4IA 3Q26A 5I2KB 3QJ6A 5B70A 2B8AA 1CE2A 3T66A 3F11A 4DE8A 1B4HA 4LUBA 2ONSA 3RPWA 2CZLA 3EHSA 2A5TB 5J1DA 1MQIA 2UYFA 5A5XA 4R6YA 4N4GA 5DT6A 3T9VA 3HHFA 3U93A 4C5EA 4P0IA 1JVXA 3UA8A 3L2QA 1B5HA 4OESA 2UXAA 2Q9TA 2FHDA 5I57A 1B40A 2F78A 3H7MA 3M3KA 3QBYA 1B2HA 4GD5A 4RY1A 1Y3PA 1R9QA 1H45A 1MPCA 2YRVA 2M0OA 5KCJA 3OS2A 3MEVA 4YMBA 1MXUA 4OYVA 1TWYA 5BWJA 1I6AA 4PQJA 3DB3A 2CKKA 3SERA 3K1NA 2UVIA 3SKPA 3UORA 3JYRA 4OMBA 3I3VA 5FHMA 1P1NA 3PPPA 1Y1ZA 4HS7A 3Q25A 3KGCA 1OLCA 1YAEA 1NKXA 3OS0A 4NTLA 4I8CA 2REJA 2DQVA 4NMYA 2HAVA 2OZZA 3GZGA 1FQAA 4F2QA 3BKIB 4LZ8A 2ZXTA 2E0SA 5CI5A 1SW4A 3CVGA 3PD8A 1JW5A 5CM6A 4UC4A 5DYHA 1SYHA 3TQWA 2DAQA 3KN3A
chains in the Genus database with same CATH superfamily
1LB9A 2G29A 2LNVA 3ILUB 3K6XA 2REGA 1V76A 3PV0E 3MVXA 4ZGEB 1KSWA 1NM7A 1BIYA 1KC8U 2VP1A 3M5AA 3OMGA 9ATCB 4CI0C 2A5TA 3LSLA 3I35A 2HZLA 4ZEBA 3B6TA 3O6HA 2P4RA 3IFAA 4M7DA 4QF9A 4M7DB 4GL0A 2XD2A 2JS0A 2DRMA 3CCMT 3PUYE 4OHNA 4XKQA 4ZECA 1M1GA 1IXGA 4AFZC 1HSEA 2FO0A 3RT6B 1QVPA 1N3WA 2P0SA 2Q2AA 2I49A 2E3IA 2F5KA 1FTLA 2Y7KA 4KYEA 4K11A 2D8JA 2CUDA 4GIZA 4AFUC 3JB9J 1B1HA 1M5FA 1SVXB 3MVYA 3MCAB 5LJ5f 2DE2A 2QA4T 2HQEA 1AIVA 4LDUA 4ANJA 2L0AA 5EHMA 4HT8A 5GAOp 4RUGA 3QXEB 2H3JA 4J9GA 5I22A 5I2NB 5I2NA 5AA4A 4ONYA 3QO3A 2DYBA 2V93A 2EQUA 1AWJA 1EZ9A 2MF2A 3G6EQ 3L42A 4L59A 4NN3A 4GQOA 3BE3A 2EYZA 5CRYA 5F1QA 5KDTA 2HD0A 2IVWA 2OTLA 2PT1A 2F69A 1M8VA 4DIGA 4G8MA 3GF5A 4DZ1A 5CKDA 2DIGA 3EG0A 3CCRA 5H8QA 1BIAA 4E2FB 1TUGB 2KDSA 1OQGA 3CRBA 2E5QA 5IHNA 3JB9H 1B34A 1YTVA 2HQHA 1OULA 3H0FA 1A8FA 3CCQQ 2RHZA 4M1VA 1PG5B 4ZEKA 2DILA 1D3BA 1VQNQ 4XU1A 4FCYA 1POTA 3OA6A 1KQSA 3H8ZA 3NTKA 1W2BP 1IEJA 4XFEA 1UQWA 5I3SA 4EMHA 4V2SA 3L6HA 2OJTA 2R9JA 4PJOC 1JO8A 2DJQA 5DY9A 1WIEA 3HSTA 1AZEA 2XXVA 4J9DA 2JXBA 3V8LA 4M77A 1M3AA 2DRKA 4M77B 4M7AE 3LGLA 4P0GA 3VLWA 5A5LA 1FBHA 3NGPA 1UHCA 4C92B 4WEPA 1FTMA 4NOYA 2DYIA 5CKEA 1Q7YU 1FPDA 1NUWA 3CG3A 4F04B 4KI0E 2L89A 1ZHIA 2GHAA 1FPEA 3VS0A 2KAFA 4OMOA 1M90U 3RTFB 5M9OA 3PD9A 4GWYA 2FVUA 4GBQA 1IMAA 1VFEA 2EQKA 1FBEA 1NV3A 3KBZA 2OK2A 4YMAA 1YBYA 3FVOA 2H8HA 2VC8A 3J80E 1VQ4T 3V7RA 4OWDA 3LH0A 2XU8A 2XHCA 3HHGA 3INZA 1A54A 1AOJA 2ZPGB 3W15C 1Y71A 2QTVA 2YRCA 3CC4A 3O66A 1VQ6T 1FPBA 3E3KA 3TTKA 3EHRA 2DXBA 1GBQA 5I58A 4X9CA 1I0CA 4QW2A 3CCRT 2XDPA 3H9NA 3CC7A 1QVFA 1D0ZA 5TPAA 2CEYA 3THIA 3OYMA 5GAN4 1KHCA 2XMFA 1YP5A 4G77A 2NUTB 3CXCA 4QFKA 2YPNA 1KIKA 2OTJT 2RK1A 4JJNK 3TTRA 4RMOA 3H4ZA 3HN0A 2UVJA 2DL7A 4QQGA 1MM6A 4YKPA 4LE9A 4MZTA 4HVUA 4JZ3A 5GAN2 4JVDA 1CKBA 1AMFA 1BTJA 3LYIA 1TOVA 4LONB 5KZTA 5GANg 4D8KA 1XNIA 3RUXA 1ZBMA 1YI2A 4G68A 2X4JA 5EG2A 4C8QE 3PGFA 1RYXA 5CMMA 4X34A 4MEVA 3SEWA 3UN6A 1AVZC 1MUZA 3VE1B 1HK9A 3VS7A 2K3XA 3CCLQ 1RI9A 4C0RA 4JXIA 1R8OB 3TEEA 2PCRA 4FE8A 2KXDA 1Y3QA 5L23A 2HZYA 5LJ3g 2DZ9A 1Z7NE 1PB7A 4UA8A 1EYJA 1OPLA 4E7LA 1M1KR 1W2BA 1MNEA 1ARKA 2CZIA 1OLAA 1G0IA 2MKZA 1NBEB 1IHVA 2RC8A 2LVMA 2IEEA 3ZBDA 4F7UE 1VQ8Q 1TUDA 3U72A 3UF4A 2YXYA 4XTWA 1SHFA 4PJOF 5LJ5e 1VQMQ 1B7ZA 2D6FA 1KWHA 2VGQA 3L2RA 1K9YA 4U4XA 1ZSZA 2ZYKA 1B07A 1WLPB 3OO8A 3MQ9A 4BACA 1Y4TA 4WEDA 3HL8A 4HE0A 5H8FA 2O7UA 2RHXA 1BI0A 1ABQA 2HQXA 3PNWC 4LZ7A 1N3XA 2OAUA 1Q81C 2B4LA 4FORA 2UYEA 4AB5A 4ZN1A 4YKJA 3S3NA 3OEKA 2HCKA 3O5ZA 4J7FA 2L3SA 3PVQA 1RAGB 2MPXC 3M9QA 4DBQA 1LAFE 2KY9A 2HPGA 3RGYA 4DCYA 1S50A 1OYXA 4ZGJB 2D1XA 1LAHE 3P7IA 4OGEA 2V3TA 1UE9A 2Y90A 1HD3A 4ZDMA 3TAJA 5IXBA 1KC8C 3A1PA 1LBCA 3UWNA 3OO9A 1B05A 2HQ0A 2XX8A 3FUZA 5CAIA 4OQOA 2IA4A 3EHUA 1YIJQ 2HDAA 2ZGWA 3CXCS 2IIMA 1ZSZB 4KR5A 2L5VA 2BTTA 1VQPQ 1Q35A 3T9HB 1AWXA 4FEBA 3M4GA 3VV5A 5GAN6 1NNTA 2XXRA 1JP4A 3WAFA 4JS4A 3FATA 2I6EA 3CG1A 3M57A 2QRYA 1QCOA 4PKCC 4AT1B 5GAMe 5H8NB 1EYIA 5I84A 3EGXB 1QW0A 4NF6B 2O88A 5IGAA 4KH0B 3TVTA 2Y7RA 2RC9A 3SEUA 2E64A 4M7AC 1I69A 3LSXA 4IY5A 5JEIA 1YZ0A 1M5Q1 4JSOA 3BFMA 1H641 2H5YA 2HZKA 1USYE 3UK4A 2RPNA 4FYXB 2ZNUA 3RN8A 3T1BA 4MJOA 2HMAA 1NV0A 4OEVA 2DWHA 2LNHB 3UT1A 4M7AF 4JWYA 4YB7A 4F3SA 1W2BS 1K73C 1YJNA 4QFPA 1B3FA 3IB2A 2XHDA 5J26A 4Z02A 3CMAT 4MFIA 1GCPA 2B3BA 2ED1A 1NL5A 1YHQT 4J9FA 4LDVA 4D6WA 4FJPA 2DTIA 2J6OA 2EJGA 3V5AA 3JCMX 2PFZA 3DLLA 3A3CA 4PFBA 5CQXA 3QYGB 4ZE8A 1VUBA 3G71Q 1E6GA 1CB6A 4OEUA 4YICA 4GWZA 1QVGP 1G3WA 4LP2B 5L8RE 1LGBC 3IQLA 4R2FA 1XC1A 1VQOA 3KG2A 4N81A 5IHIA 3C33A 5L8DA 4E0XA 2FG0A 4HXVA 4AG2C 3FXRA 3EFSA 2QL3A 3JB9F 4OZ9A 4EQBA 3NTHA 3BDUA 3WVDB 3G71A 1WHGA 3CCEQ 3A3UA 1SW5A 4C1UA 1OZ2A 3MW0A 1SD3A 1SI1A 2L2PA 1JQFA 3FIRA 4EMGA 1OV3A 5GAOm 2HCAA 2LQNA 3CCSQ 1M8MA 2FPDA 2HKNA 3OOAA 5EC7A 2XXHA 2H3EB 3OYYA 1BKBA 2WYKA 1I1JA 3RBBB 4DOVA 1M4ZA 2M1HA 1VQMA 3OSQA 4M7DC 5KYWA 2CGHA 1S9TA 5KYWB 4BDZA 2RJFA 5DLQE 2PT2A 1WNLA 2QDLA 2VUBA 3S3OA 1QKAA 4XTZA 5GANd 2Q2CA 4XTXA 4OFOA 1IITA 3TFLA 3G3FA 1X2KA 1URDA 3J7AF 1IGQA 1YITQ 2GFUA 3K2DA 2V1RA 2NUPB 2YUQA 2QDYB 3H6UA 2YJPA 4E7JA 1KQ2A 4I62A 4I9DA 1C1AA 1EFNA 5LJ3d 4RA1A 4LXCA 1RDYA 2ENMA 2CS7A 3GIBA 3I56Q 1G3YA 2RB6A 5KE3A 4OVRA 5IAIA 4M78B 1VQ9T 4FECA 1UJYA 1Z9ZA 2DL3A 3OSSC 3VUBA 1VFDA 2X51A 4JPBW 1EIFA 5ECAA 4C5IA 2DXYA 4ECFA 3M4YA 1LBBA 4KT0E 1B52A 3V7SA 1Q7YR 1B5JA 2OX7A 2RQUA 4QFLA 3M59A 5GAN7 3SZPA 4QVCA 5FRMA 4F2OA 2RN8A 4EDPA 5A5XB 4C8QC 3G3KA 2DLPA 3T9UA 1FQCA 3FXQA 2I48A 4PJJA 2O69A 4DEYA 3KSJA 1ZUUA 3SFMA 4NF4A 1FCKA 4M7AB 2DA9A 1RADB 5I11A 2LQKA 1VQ5T 1TFAA 4NWDA 5AA2D 1NZ9A 2RHYA 4R55A 3A98A 3KBRA 4FYVB 4ZEIA 1Q81U 2CZKA 3K1MA 3VYHB 5DEXA 2KK4A 1GL5A 1NMUA 1NFTA 4GLIA 1SYIA 1WHHA 2P0KA 4MMKA 4NL3A 2FVZA 4H46A 2FZKB 2YT6A 4JS5A 1XQHA 4A4FA 1BCOA 1ZUKA 4OFJA 1UTIA 2ATCB 1NNKA 2F8DA 2VVKA 3MHXA 3VVDA 3CI8A 2OI3A 1AWBA 1MY1A 4PJOA 2ANJA 4IIMA 2ZYOA 4G2ZA 2GTOA 4ATOA 1S7YA 5GANh 4M7DD 3JCMc 2Q74A 1US5A 1H3DA 2V3UA 2QEXQ 5FTHA 5J39A 4J9EA 4RG8A 2CSIA 1PEBA 1N04A 4MMLA 2E41A 1B3HA 1KK7A 1OZ3A 4IUPA 1LCTA 1JEVA 3IORA 3N6UA 2JUFA 4GBWA 4PE5B 4TOZA 4P11A 5AYFA 4RXLA 2FNCA 1WFWA 3IOUA 3S6WA 3PMIA 3QG1A 4LDYA 1QUKA 1QP2A 5LJ3h 5A0DA 3CCVT 3VKIA 4IURA 4M7AA 2BE7D 2RI5A 2AZVA 4DXUA 2RCBA 2XXUA 1EYKA 2XKOC 1NJIC 2QGGA 3RT8A 2F36A 3SDZA 1GTKA 1IZ1A 4BI8B 2ZYMA 4KCDA 1D1AA 4C0DC 3G4SQ 2GQ1A 3C35A 3H41A 3CFLA 3IO6A 1D0YA 2V3QA 5FU6B 1U5SA 2LMJA 4P1LA 4JRKA 1JXMA 1Y96A 1QWFA 1WDXA 2F5XA 4THIA 3N26A 5I58B 1M90R 5KH6A 1B1XA 2FZCB 1LVKA 4ME7A 1RAFB 3PTAA 1VSOA 2ZNTA 1LB8A 2MMPA 4L17A 1UIUA 5GAOr 3RR6A 4H6DA 4ZS9A 4HA8A 1MY2A 5CMBA 3HFNA 2NUTA 4M75G 2EWNA 2AL4A 3BIHA 2O9VA 4X8RA 1SSFA 2DF6A 5GAMh 3OW2A 2LJ1A 3CBPA 5IAYA 1N84A 5F7VA 1ZLMA 2GFAA 2OWTA 2WSFE 4M78F 1YJ9T 2DOJA 4CC2A 2Z8FA 5ET7A 1Q86U 4DCXA 2FIEA 2Z22A 4G68C 4O8MA 4A4KA 2LX7A 2P4TA 2VPNA 1SF9A 2Y84A 3EG9A 3KFMA 3OS1A 4OF1A 5IM2A 2SEMA 2XK0A 4YU0A 2KNBB 2YDLA 4H67A 4R6KA 1Y0MA 2KEAA 1QVGA 4JWOA 3NTIA 4OVSA 2IG0A 2KMTA 5HCKA 4IO3A 4BLAA 3GP8A 1EH3A 2JJ9A 2SRCA 1K9AA 2DVEA 1OX8A 2YWWA 2VXFA 5CCAA 1WHMA 1K4US 1MH3A 4R6HA 4H45A 1FQFA 1B0LA 1WZOA 1LFIA 1T0HA 3L1AA 2HNIA 2V8IA 1D4NA 1DPPA 2F7CA 3PUVE 1NH7A 2HBPA 2RK2A 2DD5A 1FSAA 2F7AA 3SETA 1G83A 1BP5A 3BFTA 5JTYA 1R6ZA 4PJMA 2P84A 4LQ2A 2CT4A 1FJ6A 4EMKA 2F3DA 3TCFA 1GFCA 4GF8A 5B7DA 3JRZA 2Y4YA 1MY3A 5FU7B 4G8NA 4Q5WA 4X48A 2PZ1A 5FBPA 5LJ5h 3U23A 2KQWA 1LLSA 4NF5A 1NUXA 3IR1A 4U21A 3EKIA 4RCCA 3C4SA 4M4GA 1KG1A 3A09A 2RD1A 1YJWT 4KULA 1SDXA 2BIVA 4H8IA 2RH2A 2O51A 2L8DA 2QXFA 2XXPA 1ZIUA 2BE9B 2DL8A 2F2WA 2K57A 1H76A 3CC7T 5CBRA 1VIEA 4PFTA 4YB5A 3UIFA 4C92F 4WKMA 2YLCA 3Q29A 3HRTA 3T9NA 1IZ6A 1NPPA 5GAOl 1ZTYA 1LBYA 2DTOA 5K2XA 1PSEA 3IK6B 3X25B 3CC2T 3FEOA 3OW2S 5ITOA 5FRNA 2O4XA 3FD3A 2MYSA 1FTAA 2RHIA 2ZPIB 2PUKB 1MDP1 4PL6A 2P2AA 3TQLA 5BUUA 3QKJA 5FU6C 4UACA 2QMXA 4KPTA 4IO5A 1D3KA 2CZ6B 4MDXA 2EAYA 3UA7A 3LBSA 3PGGA 3FJMA 1KHIA 2K4YA 3L2UA 4TLMB 2DK3A 3CCUA 3QIIA 4PGNA 3SD4A 4RPNA 3EGUA 2Z8EA 1WHJA 2NYSA 1UJ0A 4PFUA 4GWSA 4DLDA 3CPWA 1DSNA 2QQSA 1BI2A 1DCUA 1BB9A 4F1VA 2DX1A 2LJ3A 2F2VA 1KD1U 1JRIA 3O8VA 2DXUA 4POWA 3K01A 3META 4N0AA 4G68B 3QZ5B 1M5BA 3P8BB 4LVQA 3S2VA 4N4HA 2LAOA 4RPOA 5AT1B 3TCGA 4RTUA 2VOZA 3SDFA 3PTYA 4A53A 2NUZA 2K5LA 2XXXA 5DW8A 1JNFA 4R74A 4A4HA 3CPWP 3M3FA 3RPLA 4GWUA 3CD6T 5AA4B 3KN7A 4R56A 3O2AA 4GX4A 2AZSA 5D6YA 5LL6S 5TU0A 5CMKA 3CIJA 4RNSA 5KYUB 1MXVA 4PGPA 3K6UA 2HL3A 2QK0A 5GANf 2D21A 4GFRA 2FRYA 2XXWA 2KR3A 4MNPA 2J7IA 1TUCA 3VLUA 1IXDA 1SEMA 3UGWA 1IMCA 1FQEA 4F18A 3ECRA 3UATA 3FV2A 1IREB 2P1SA 1UEBA 3VS4A 1PC3A 2O7IA 3RNJA 4NF5B 4AFQC 4IO6A 3BY7A 4LUEA 2DTHA 4PF6A 1NJIU 1J1NA 4X1DA 3G6EA 3CCEA 1MV0B 2JTMA 5I5PA 3P8DA 1VQMT 2DWIA 4J9HA 2KGTA 2NUPA 1P1OA 2EPDA 2OWZA 1R0BG 4IO4A 3U92A 2C0IA 1CKAA 1SRMA 3MPLA 4JRIA 1QUJA 4YKKA 1OPKA 1EZOA 2QVRA 4K3FA 2PX1A 3CHGA 2E4HA 1FPKA 4MF3A 3CMEQ 2DXRA 1F9BA 3OYBA 2MCNA 2RF0A 2QFLA 2KBTA 4N8YA 2RKMA 3CCUQ 4OMFB 2D0NA 5H8FB 3CCJT 1LOJA 2ZAEA 1EX4A 2CZ1B 1NEBA 1ZA2B 3SWNB 1N27A 4E7IA 1VQOT 2E6NA 2LRQA 3M58A 4F14A 3CD6A 4M7DE 2XXIA 3IAZA 3TTMA 3EGDB 3HRUA 2QS3A 1GVCA 2CH4A 2RINA 1URGA 4U23A 1YJNQ 4AS4A 1NI9A 3MEWA 2A08A 2PQWA 3H0HA 1BKAA 2J6FA 3MO8A 3O6GA 1II5A 4GY5A 4QFNA 3M0TA 4E0WA 1V29B 3CSGA 3GXAA 2LC4A 3O97A 4GWWA 1YCSB 1QMCA 2K5FA 3TSZA 3DLNA 1FBPA 2CP0A 5CMCA 1U06A 3G7ZA 5CC2A 5I59A 5CR2A 4OVJA 1AOVA 2V1QA 2P0PA 4Z0IA 1ZUYA 1UB4A 2LQWA 3LV0A 3PPNA 1JJ2S 2EQJA 3E4RA 2CYZB 3EH1A 2RQRA 2IPOB 1SW1A 2A5SA 5EQ9A 1SG5A 1A7LA 4M7AG 3FVKA 3K0VA 5CVIA 3TODA 4NF8B 3HPWA 4OANA 2MI6A 4GXAA 1Y1MA 3QWYA 3EH2A 5FHNA 1SHGA 3EGXA 1VQ7T 2F35A 1GV8A 1VQ6A 4XAXB 3JCMV 4HCZA 2XWVA 4QKUA 3K1PA 4JLGA 3J81E 2CP2A 3JCMP 3MVWA 2VV5A 4XTCQ 4MDWA 2JT4A 4YZZA 4GLKA 2CP6A 1IXHA 4ELOA 3DP8A 1KJWA 1Y07A 5TP9B 4E7SA 2EIFA 1OMPA 1AH5A 1R77A 4M77F 3FZVA 2Y5LA 3DP6A 1E6HA 4BY6B 4OB0B 1FPIA 5KCOA 4OA4A 3OD7A 1XVXA 1C0MA 4N4UA 4O5VA 1VQLQ 4ELZC 1RYOA 3VXCA 4F3PA 4KRTA 2G3RA 2RJDA 2I4BA 2QMWA 1X01A 4BDMA 1T3SA 3H6ZA 4C8QF 3RMSA 4PCDA 4PK4A 1A55A 3VVFA 4BDYA 3CCET 4EUOA 1FPLA 1LSTA 4ZE9A 1L5TA 1BIBA 1LCFA 1IHWA 5EHSA 2XICA 3MKDA 1G0HA 3M0RA 3MEAA 3B7DA 1YWOA 2Z23A 4JRQA 3RESA 3C0CA 3JV3A 1JW1A 3HFUA 3JCMJ 1K9ZA 4KYSA 2YUPA 4OB2B 4NX1A 1WXTA 3MEUA 1YI2T 4PFYA 3KSXA 4F7UF 1FQBA 1WDNA 5CKFA 3E9XA 5FW9A 1IO6A 2YUOA 2Q8JA 2XIDA 2W10A 5KCHA 2I4CA 3FV1A 3FBPA 4Q8RA 5LJ5j 2OTJA 4J7IA 4ELQA 2H9BA 4F7UA 3NFCA 4YTLA 3T0JA 2DYXA 3HFOA 1QLYA 3VRZA 3FLGA 4J6WA 3RKYA 1TXQA 3HSBA 2X7PA 4NF6A 4P8BA 2PUOB 1WGSA 1K73R 2V4CA 1FBCA 4KXPA 4M75C 2EGEA 4HCWA 1JEUA 4M7DF 3ZL7C 1K73U 2DO3A 4OMQA 1O7TA 1VQ9Q 3A8OB 1FBGA 2YLNA 4J6YA 1WXUA 2MK5A 3EHQA 3H3GA 3VFJA 1RDXA 2EW3A 2L5QA 1NV5A 1K8AU 3RTWB 4P1EA 2RO0A 1NH8A 4P3LA 2VD2A 4OVQA 4KGZB 4BB7A 5I57B 5ICQA 4IUTA 3CC4Q 1QWEA 1X27A 3M55A 3VU3C 4EMKC 1PB9A 2CH4W 3G7WA 3PIOA 3MUQA 3R6UA 4LATA 1E7OA 2AKKA 3U65A 2HBWA 1UTBA 4XKNA 4FAJA 1FMKA 1WA7A 3UPUA 3G3JA 3KC1A 4F31B 4F29A 3W9VA 4PFIA 3SB2A 2WEFA 4PAIA 4JRPA 2ONRA 4JSDA 3TEPA 5KDTB 3PIPA 3EFOB 2MWPA 2A7YA 4QQ6A 1MXZA 1OX9A 2O9SA 4IO7A 2XWIA 4NE4A 4C5GA 4I3EA 1MS7A 2H99A 3O6IA 2P3NA 1PC0A 1B3GA 2GRVA 1VQ5A 4E7HA 2R6GE 3Q1JA 3JCMQ 3RQTA 5F24A 4PNOA 3AHUA 1VQPA 2OAWA 3P8HA 1LBVA 1MXWA 1Z7ME 4VUBA 1DMBA 4BDOA 5A0LA 2OX3A 4KD5A 2COZA 1IXCA 4PAKA 4DXCA 1JQQA 4FYWB 1D0XA 1M30A 4GLMA 4OERA 4C0ZA 3MWBA 3RYDA 1VQNA 3IB1A 4EMKB 2XDDA 2GCXA 2DZCA 1WHKA 1B9JA 1BK2A 3EPEA 4BDQA 2KR0A 3KC0A 4BI3A 1Q82C 4GVOA 2V26A 3FC3A 1G5VA 2K79A 4TLLB 2OBGA 3CCVQ 2CT3A 5GMKi 1RAAB 2GGRA 2DXTA 2DP8A 1RAEB 5GJWB 3VS1A 1PBPA 4F3GA 4FW2A 4OP0A 4BE0A 1MDQA 2LCSA 1CNQA 1KA1A 4AB6A 4F39A 4ZEDA 4PP0A 3OQ5A 5I56A 2JJKA 5EQ8A 2ALUA 3QDRB 1NEGA 1FYNA 3JZJA 1D09B 3H6TA 3I56A 4C92D 1NLPC 3RIRA 5IZ3A 3QSUA 2Y7WA 4EQ7A 1BLFA 1XVYA 7AT1B 3KOSA 2DBMA 3M0QA 1NV7A 5GAN5 1M1FA 3FGSA 3ZSFA 1Z9QA 2X7QA 3OO6A 1U3OA 5TP9A 5ISUA 1N9SA 2JN0A 2EGCA 1RABB 4M77E 1XS5A 2F6PA 5D6XA 4F17A 5KCJB 4M78A 1WJSA 2E1HA 1X43A 2KI7A 3SWNC 3PMTA 1G3TA 1UGSB 2MIOA 3MP1A 1NV4A 2KRNA 1FBFA 3D4GA 4ORZA 2AHJB 4N13A 4FU6A 4NG7A 3V89B 5GAMf 2E10A 1FQDA 4M75B 3PFSA 2E1SA 3JV9A 3QSLA 4OVTA 1A40A 2PNIA 2DMOA 1LFHA 5FHOA 2ED0A 3ZKLA 1QVGS 4J8OA 4PJLA 1LBZA 3T9XB 4AMCA 1NG2A 1SPKA 1R9LA 2PVDB 1W4SA 4PC9A 2WYPA 1RDZA 4HT9A 1IIWA 2DS9A 4Q0CA 1YNZA 4CC3A 1YJ9A 2Y4XA 2DE3A 1WODA 3OELA 5DVFA 4I3YA 2FHYA 4FEDA 3MPKA 2DXCA 5C6SA 3CFZA 1LJOA 3LGFA 5CKHA 1GFDA 2K5IA 4DBFA 4MNCA 2X35A 3M53A 1MH4A 1YWPA 1Q81R 4R9FA 1RLQC 2BZ8A 1U1TA 1QULA 4QVDA 3IJXB 3A8GB 3FJ5A 4AG1C 4O7IA 4IIOA 4X1VA 2M9UA 4LD6A 1VOMA 4M75A 4M78D 2ZPHB 1FXXA 2BZXA 2C0OA 1MHNA 1OU9A 4G8HA 2GFEA 2LJ0A 1M9SA 4PFZA 4FSXA 3C9HA 2R57A 2FYKA 2WX9A 3THKA 1VQNT 4XQ3A 4HVVA 3DELB 2I3VA 1Q86C 3W9WA 5FROA 3ZS6A 1M2VA 1SKUB 5A0GA 5H8SA 1M90C 2RI2A 1IXIA 4XTVA 3CCVA 1KC8R 3KJTA 4XKRA 1P1UA 3OXNA 4GRKA 1F1BB 3EN3A 3TCJA 1B3LA 1ZJLA 4IUUA 2KYBA 3X28B 2DE4A 4PDHA 4UABA 2RCAA 1YCYA 1NNFA 3PPOA 1HSQA 2GF7A 5AA2A 2AKLA 1RLPC 5GMKm 2VHAA 1RUWA 4HE1A 4RTWA 5LJ3e 4HKEA 4RK9A 2BKDN 2Q8MA 1Q1KA 1YN8A 3FXUA 1XTDA 3HCQA 3OB9A 1I5LA 3T93B 3WXMB 3CC2Q 1PNJA 3PMXA 1LPLA 2EJ9A 2PVGB 3S4UA 4BE1A 2FL7A 3IX1A 4MMPA 1AD5A 2D5WA 3G3IA 2R5MA 4NEDA 3DB4A 5GAOn 1I81A 3AXFA 2CP5A 1KQ1A 1TH7A 3QJYA 3RNNA 3C36A 3C95A 3EG9B 2QAZA 1QKBA 4O7MA 2E3HA 4JVCA 3S9LC 1K9MU 2QQ9A 3CCRQ 2LT4A 4RJZA 3K00A 1VE4A 2W7YA 2RJEA 4QXDA 3LC8A 3OYAA 1PSFA 3RDVA 4ESWA 2KRMA 1H44A 2OTJQ 3VS6A 3EGDA 3BW1A 4GOTA 5FTIA 1M27C 2KT1A 2Q89A 1M1KU 4P5NA 2XDBA 4U2RA 4MBPA 1EU8A 2F34A 2ZPBB 4KUIA 1O9SA 5KYUA 4JUVA 1VQ9A 2OTLT 4RTZA 1K1ZA 3V8XB 4ESRA 1FMVA 4TVRA 3QZ9B 1OQHA 1M3BA 3QHSA 3TSWA 1KZ8A 5HPQA 2XWKA 3PPRA 2P0QA 4GX6A 4F22A 3BFUA 3KXTA 1KD1R 3ME9A 3T22A 1IGUA 1QJMA 4M78E 3REBB 3CD6Q 5GAN3 1VYUA 2K3YA 2XWOA 4ZTJA 3FVGA 2KXCA 4II1A 1N7WA 1UGPB 1XI6A 4DEXA 5AA2B 2XD0A 1IUDA 1GR2A 3K6WA 1SSHA 1M5DA 1BYMA 3Q27A 4HCCA 1FWZA 3GNGA 4FYYB 3T96B 1TWBA 1UGRB 2WSEE 1B0HA 3FJGA 3CCQT 4IGRA 2E65A 3H6WA 1MQGA 1C6VX 2I3WA 1GBRA 2DPPB 4Z89A 1FTOA 3VXBA 2QG9B 1MPDA 2XXQA 2I0BA 3RERA 3TQ7P 3BBRA 3U1OA 3TUSA 3GBQA 2XXYA 1POY1 3H03A 3DM0A 2Q88A 3K6VA 4N91A 1DOTA 3BDLA 3MP6A 2LCCA 4O3BA 2A36A 1T3LA 5IXFA 1IB8A 1HSJA 4OMMA 4B9WA 4X04A 1JEGA 2FBPA 4EIKA 4J9BA 3V7CA 4B9XA 2DM1A 3CC2A 3MZ1A 3PUZE 2DJZA 4E6RA 1VQ7A 4OENA 2QVUA 5GMKj 4IUVA 1VQKQ 3JCMh 3CSBA 2V8JA 1TU0B 2EGAA 4M77C 1Q7YC 1AL3A 2A37A 1I6QA 3OYLA 3QK6A 5KYNA 3PU5A 4E47A 3S9NC 2KROA 4M7DG 2J06A 2WACA 3PE0A 1X75C 3L2VA 4PFRA 2DNUA 2EQMA 1UG1A 1D9VA 1VQ4Q 3R6NA 3TCHA 3G4SA 2K7AA 2RI3A 1K9MC 5ET8A 1PBQA 3CCUT 5J3BA 1YJWA 3CCJQ 4JWXA 4C92E 5DTBA 1S72Q 4N0AC 2QASA 3FXBA 3QMFA 4BDLA 3EQ1A 3TTNA 2HSEB 2QQRA 3CMAA 3QYTA 1N5ZA 1YJNT 2F3BA 1ANFA 1N8RU 2DKGA 2ESWA 4HCKA 2QS1A 2ZZWA 2I0CA 2DL4A 2GTJA 4ZZAA 4DI4B 2AYSA 4J83A 1B7UA 2BJJX 1D9QA 3H06B 1U1SA 1S72A 1FTKA 1WPYA 3S9EA 2DE0X 3FIFA 3JAME 5GAOq 3CBMA 3LSFB 4OVAA 5AA1A 2FRWA 3OBWA 3TDJA 2VXEA 4BE2A 1B6HA 1PM3A 5AE4A 3EG2A 1LEVA 2HXWA 4MLVA 3A5ZB 2EBPA 1H3ZA 3WVEB 3S9MC 3EAEA 1R0CB 5GMKl 1K0SA 2QSXA 3VYGA 4Y92A 3CCLT 2D8HA 2ESNA 3C94A 4Z88A 2C0TA 5GMKe 3ODBA 1I5OB 3OYEA 1GGGA 2EKHA 4RK2A 2LDMA 2L3RA 3CBOA 1LAXA 4WCIA 3KUFA 3D4CA 1G8XA 4N17A 1WXBA 2KYMA 4LN2A 2VGMA 8ATCB 1JW4A 1B34B 1OVBA 2PYYA 3LLRA 3G3GA 3CFXA 3TPAA 3JCMd 3O28A 1S1NA 3CCQA 5EQAA 3HRSA 1FRPA 2JTEA 5EYHA 4F1YA 3HPIA 1LCKA 3VV0A 4OB3B 1NYGA 2B3FA 2XX9A 1GCQA 4ZNXA 4OB1B 2BZYA 5GANe 1B58A 5I2MA 2D0QB 3I55Q 2DBKA 3CCST 2C06A 4YKIA 2K3BA 5IH2A 3E13X 2EYQA 4XTUA 1LAGE 2X4XA 2ROTA 4GWOA 4R75A 5ESYA 4MHFA 3N5BB 3E2UA 4HW8A 4L5GA 1LBWA 4PE3A 2DETA 4Y91A 3CCMA 1WQWA 4FW1A 1IMBA 4R72A 1FTJA 3JCMW 2QPQA 2CREA 4KYDA 3R7XA 5L9SA 4JJBA 5LJ3j 4NF8A 2VWFA 4F7UB 2FZGB 1W70A 4HXJA 4OETA 3Q28A 4Q30B 2CZ0B 2M16A 3V8JA 1MV3A 4M78C 1YYZA 5IKBA 3SWNA 5AA3A 1MNDA 4GXSB 3EHTA 2CP7A 4IKFA 2XXTA 4P9KA 1JB0E 2LCLA 4H65A 2KQZA 2DVZA 4QSEA 4NAPA 3I56T 5DVJA 1OIBA 1JJ2P 2B86A 4IGTA 3OYGA 1RKMA 1VQPT 2KVQG 4C8QB 3WAEA 2PVUA 1PDAA 1YPNA 1ZBJA 3PPQA 2I2LA 2O2OA 5D7UA 5GJVB 1JJ2A 2Z0WA 4OMNA 1UUEA 1H92A 5HK0A 3OW2P 3PVLA 2CMOA 2ONKE 1B32A 1XOVA 1N8RC 3M0SA 4U4SA 1YFNA 1R1NA 1G2BA 1QGXA 2DWJA 5IZ1A 5I21A 4ELPA 1KQSS 4DBRA 3VRYA 1UECA 1WQ7A 1DPEA 3EG3A 4BDRA 4C1TA 1MG1A 3CPFA 4IUQA 4ELYC 1B3EA 3SEYA 1NLOC 2PU9B 5GAMj 1MXXA 3M56A 1ZU0A 3FDRA 3AT1B 1DTZA 2ZNSA 2A0FB 3CC4T 2B65A 4IO2A 5H8NA 4FT4A 5GAN8 2Y7PA 4MNIA 2OWSA 2JS2A 3CR9A 2JMCA 2WBBA 3G71T 3VS2A 2F5TX 3RY3A 1M2VB 1PHTA 4PFPA 5DLOA 4NF4B 4ZGDB 2R8TA 4QRZA 2WSCE 1N9RA 3S3MA 1IQ7A 1HSLA 4PETA 4NS5A 3CEYA 4LQ5A 2RQTA 2KT8A 4BD3A 1B7HA 3KOTA 4TQUQ 4LA9A 4LZ5A 5DEXB 3N5LA 3OEMA 2E70A 1ZMGA 4EF2A 2KE9A 4MLQA 3GLXA 2ZZXA 4EPCA 2LP5A 2KRSA 5KYXA 4A4EA 4C8QG 2Z8DA 4PDDA 1RAHB 2XA5A 4YB6A 1UTHB 3VS3A 3X26B 3ILTB 1MPBA 3FB9A 2O84X 2NWMA 2MWOA 4JB7A 1EZPA 1BI3A 1FX7A 1ZQ1A 4DDDA 3I9QA 2Y7IA 3QUJA 2CZHA 4O94A 1TSFA 4Z7EA 1HYOA 4M77G 3PUXE 3R26A 1WYXA 1A99A 3ONMA 2VD3A 4DXBA 4F7UG 1ZLQA 4PJOG 2AIXA 2HEQA 4G4PA 4JZ4A 4CC4B 4BUGA 4HCYA 4MAGA 3U94A 1FBDA 5JK4A 3IO4A 3QDFA 5IN1A 1YITT 2DSFA 3HTRA 1PCXA 1W1FA 2AIRB 3E78A 4GX3A 1X6BA 4O3CA 3B6WA 3U8QA 1Y96B 4XU2A 1USYH 4BDNA 2CZ7B 2JZ2A 1VR5A 2J6KA 3JB9D 3UA6A 1OVTA 4RTXA 2GBQA 4LD9K 4PAFA 1YJ9Q 3E9FA 2R5AA 4RYAA 2DVJA 1GCQC 2ZCFB 3JCMg 2DVCA 1URSA 4OGCA 2ZPFB 3V83A 2JNGA 5CIUA 1DJ7B 2G6FX 2J05A 2R58A 4KUDK 1VQLA 1B5IA 1D1CA 5IZ3B 3OS5A 3N6TA 2NWJA 1BBZA 3CMEA 2I58A 1ZBXA 3HKSA 3B50A 2QA4A 4C0FA 2AL5A 2B4MA 2BUDA 1B46A 3OYDA 1P1QA 1PKSA 3LH5A 4LNPA 3LR1A 3IB0A 3NMZC 2E5KA 3SEVA 1QQJA 2LTOA 2YRDA 1YCJA 3I6VA 2QQAA 4KHZE 3TELA 1TG0A 2L3PA 2YHTA 2F97A 4GWXA 1MMAA 2LX9A 2ABLA 4DA4A 4HTGA 2V25A 4C8QD 4WF2A 1BU1A 3OO7A 5H8HA 5HKCA 1DBZA 5CK9A 3OYHA 5LTCA 3HP9A 2E12A 4QBAA 4QSDA 3I5RA 4QQDA 4OVPA 4MZPA 1PKTA 2RA2A 1WJQA 2RJCA 1J3TA 1BCMA 4A63B 1IMEA 2VT5A 3GOXA 1O75A 5H8QB 5CBSA 3MZ9A 2VB6A 4JDSA 1Q9DA 4EDUA 1TT1A 1XHYA 2GHBA 3L2ZA 4IR8A 2FPFA 3DLMA 2FPEA 3CC7Q 4F3BA 2LT1A 2QJEA 5GMKh 3OY9A 5JTYB 4XTYA 1UGVA 2CP3A 1PWTA 3PMVA 1HJDA 2AK5A 5LOMA 4RKUE 1WX6A 3X20B 1Q82R 1H3HA 3KZGA 4N6KA 5I56B 2JW4A 2X26A 4FT2A 3IFCA 1MQHA 5C0MA 1O63A 3E79A 2AT1B 1MGQA 4FIBA 4R9GA 2X3WD 3C4MA 2H4IA 4QSCA 3LUZA 3MVZA 2D9TA 2DFUA 5LDZA 3VS5A 4KBMB 1ABOA 4Q5TA 4WTOB 1W6XA 3I5OA 3IOWA 3M3LA 3CCMQ 2X4YA 4N07A 2K9GA 5CO7A 4CRIA 3SEMA 1MQJA 4PFWA 4C0DB 3A29A 1VQ4A 1TS9A 1P99A 4QHQA 1Y57A 2OLBA 4XU3A 2HSPA 3CCJA 4NQ8A 1OU8A 2ZYNA 5DM7R 4M7AD 1TFDA 5I2KA 3TKDA 3SESA 3HV1A 3USDA 3ZKKA 3I55A 2DL5A 5I2SA 2QA4Q 1SI0A 4J6XA 3FVNA 2EFIA 5H8HB 4NL2A 1RL2A 2VGNA 2RMOA 3L2WA 4NWCA 1FPJA 5T3JA 4WXJA 1INPA 1MMGA 3KEIA 1D3BB 4JJCA 3OBYA 3HHTB 1BI1A 3OYCA 3UP9A 2NXOA 5HM4B 2PTKA 4B6MA 2O6AA 1I6BA 2H98A 2GH9A 4XIGQ 2PVOB 4E7KA 2G93A 2HKQB 3G6ET 2HL5C 5HBCA 1TTHB 5TPAB 1M3CA 1X6GA 3MPUB 3RLFE 3B6QA 1FPGA 2X3XD 4KCCA 4XKPA 3H6VA 3ROJA 5KYYB 1SBPA 3HO7A 2FYIA 4I40A 4EXLA 3VUZA 2VASA 3LWIA 5ITPA 4NF0A 2QS2A 4NGUA 4M78G 2HAUA 2HXRA 3N94A 3RPLB 4X1BA 4P56A 2COYA 1NV2A 4OXVA 3CCSA 4RTVA 2OTLQ 1WI7A 3PT9A 1SW2A 3TU4K 4PJOB 3GBAA 4U22A 2RQVA 3MBPA 1MM7A 1T0KA 1QKWA 3RKXA 3RKWA 1B3QA 4PJNA 4ZZEA 1WJRA 4H5GA 2V8KA 2YUNA 3FJPA 1Y3NA 3GPLA 2LZ6B 2DEQA 4KQPA 2JOYA 3JSCA 2XD3A 2M8CA 3O9PA 4H8JA 2P3VA 3MYUA 1Y4CA 3E19A 2RQWA 4RTYA 2O4XB 1XT8A 1FW0A 2QTXA 3ER0A 1YJWQ 2WKYA 4F19A 4FATA 4LDWA 4PLLA 3OMCA 1Q86R 4EF1A 4LUDA 3SHWA 5FU7C 1IMDA 3QXMA 1FMWA 1KFZA 2ZZVA 1ZSZC 4C5HA 1MY0A 5DVIA 5EYGA 1T0JA 3MJNA 1HXDA 2CEXA 1VYVA 1D9YA 3PUWE 2O1LA 2ZMBA 4Y28E 3IL1B 4JBZA 4PJOD 1QUIA 3B8BA 4FIMA 4PBQA 2THIA 1NYFA 3OMBA 3CPWS 4NHBA 4OTEA 5EYFA 1FJ9A 3A8LB 4P47A 3OYFA 3MAMA 3ZEHA 1SPIA 4A4GA 3VLVA 5I59B 1I8FA 1MMNA 4C92A 1QVFS 4A54A 1VQ6Q 1VYTA 1VQOQ 3VJPA 2UVHA 2HFBA 1Y20A 4PLIA 3VDFA 2EKOA 4N6PA 5GAMd 3GBBA 3KN8A 3JB9I 4D8DA 3TTLA 1VQKT 3G3HA 4IY6A 2NLUA 2HEUA 3MC2A 1MRPA 2OCUA 1B51A 2A3LA 1ZSGA 4JDFA 2KLFA 3OENA 3TMGA 1A8EA 3IOVA 3O29A 2M02A 3ULRB 5LJ3f 3OYKA 1MY4A 1N7XA 4XXUA 3M8UA 1K8AR 2ABHA 4ESXA 4DI3D 1MQDA 3C34A 3JB9G 4G61A 5M2VA 2F6GA 2UVGA 3NPFA 3G1JA 3LWHA 1S72T 1M1KC 4AFSC 2QGFB 2A28A 3QWXX 3KJ7A 1PRLC 2QEXA 1ZKBA 2VYTA 4XU0A 2XXKA 3GLBA 3QUIA 4ZEFA 4XEQA 1M5CA 2NOOA 3UDCA 4L6V5 5FLXE 1SQYA 2I0NA 3ASKA 5HY6A 4LDXA 5D6WA 3GNFB 2KSSA 1PD0A 1DTGA 5K2YA 4X9TA 1H43A 3MJXA 1ELJA 4M75F 2ZZDA 2O1MA 4F1UA 4OMPA 1AHJB 3VVEA 4KGXB 2EYYA 1UTBB 3OSRA 1N6AA 2JM9A 1FPFA 3MSTA 3I5SA 1IMFA 2FA7A 1QKXA 4BY6C 3RUMA 4AS5A 4QFOA 3IJOB 4MIJA 1B4ZA 1VQ8T 5LJ5g 2GNCA 4OMLA 2L3QA 3QPHA 1JBMA 4R73A 3EG1A 2MOXA 1QW1A 1UFFA 3FRNA 2LQ8A 1YIJA 1UTHA 3GYYA 1UIVA 5LJ5d 1QP3A 4JLIA 2E6ZA 3EFOA 2ZPEB 3F70A 1KQSP 2RNAA 3QAXA 1RI0A 2NUVA 1IRXA 2RC7A 2YLBA 2QVVA 2DIQA 3LX7A 5L9OA 2V84A 3L6GA 1LNXA 2FB7A 1N76A 1OI1A 2QS4A 4MH5A 3E9GA 2D3IA 5ICTA 2CUBA 1M2OA 2XI9A 3E1SA 1VA7A 4I1DA 3OYIA 3TYHA 2QQBA 4ZTFA 3D7SB 4F16A 2RHUA 2PBWA 3EFRA 1GXIE 1MMDA 3C31A 2CSQA 3FJ7A 1X2QA 5IZZA 3A8HB 3CXCP 1LFGA 4AQ4A 2PMSA 3I55T 4ND9A 1AWWA 1AEYA 2VPOA 3NOHA 5A2QE 3BIGA 2R71A 5I7IA 1EZZB 4LN5A 1YIJT 1PRMC 1YI2Q 3CMET 3ZFJA 3LUYA 4JJDA 3TREA 2DEUA 1ACMB 1MXYA 4EQ9A 4GL8A 2JTFA 1NE8A 4FSSA 4X9DA 3R6OA 3MZBA 3EF7A 1K76A 1QCNA 2JVVA 4MX6A 3TZAA 2K2MA 2RF1A 4EXKA 3IOTA 3OYNA 3LSWA 2QYZA 4KFQA 2NVUB 5CQYA 5ELVA 2FEIA 2M0YA 2DERA 1K9MR 4H0WA 1Y7XA 1JETA 1PB8A 4N15A 2JMAA 4DOWA 1YXIA 2JM8A 2OJ2A 4QT7A 4PFOA 3JCMe 1K8AC 1WHLA 3MP8A 1NUYA 3OSVA 3SEXA 1WVJA 1M5EA 2BJIA 4E7ZA 5EQ7A 1UHFA 1NNPA 3CMAQ 2X9HA 4FL6A 4RTTA 5GANj 1YHQQ 4OFLA 1UDLA 3PMWA 1RAIB 4O6JA 4IB2A 1TXFA 4HCBA 1O64A 4ELRA 1QVSA 4C8QA 1ATGA 4U1OA 4M75D 2H25A 2F7BA 1QCFA 4QVZA 5KE2A 4C0GA 3DP4A 4XF5A 5ET6A 1JVYA 1U8RA 3QUFA 3QIMA 3KBGA 2F2XA 2DWAA 3C32A 4BI4A 3DKMA 2EYWA 4YAHX 2FIXA 4R2BA 3FASA 4RG2A 4ISUA 1VQ7Q 5CKBA 2PFYA 4HE2A 1OEBA 1N8RR 1VQKA 2Y5KA 2F1LA 3M0UA 4M75E 3D1RA 5FWBA 4M4ZA 5J16A 4U1ZA 3URGA 5GAMg 3ISPA 1I07A 2ECZA 4PTKA 5L9MA 2GQIA 2O68A 3RMQA 2XX7A 4H5FA 1AT1B 8AT1B 4MCOA 3K4UA 3OYJA 4C92G 1Q82U 1VQLT 1QVFP 3KFVA 1US4A 1VDWA 4H1XA 1Y9UA 1XOCA 1XJWB 2X4WA 3V8KA 1P1WA 3K02A 4O3AA 4J5YA 1N0TA 1NJIR 2W0ZA 4J9IA 1A0NB 4POXA 4N4IA 3Q26A 1PD1A 2XG8D 4HVWA 5HK3A 5I2KB 3QJ6A 5B70A 2K2VA 2B8AA 1CE2A 3T66A 4PJOE 3F11A 4DE8A 1B4HA 4LUBA 2ONSA 3RPWA 1AZGB 2CZLA 4FM4B 1YITA 3EHSA 4CC7A 2A5TB 5J1DA 4J9CA 1MQIA 2WBDA 4DQ2A 3M0PA 2UYFA 5A5XA 4R6YA 1X69A 2MAMA 1VIFA 5IHKA 1KA0A 1ZX6A 4N4GA 5DT6A 3T9VA 2M51A 3NHNA 3HHFA 4N8GA 4KGVB 3U93A 4C5EA 4P0IA 1JVXA 3UA8A 2HHMA 2DD4A 3H0IA 1I4K1 2CDTA 1P92A 4ZN3A 1D1BA 3L2QA 5KYYA 3CQTA 1B5HA 4N6DA 3REAB 4OESA 2UXAA 4FBPA 2Q9TA 1SRLA 2FHDA 1VQ5Q 5KYXB 5I57A 1B40A 1KD1C 1LBXA 2F78A 1VQ8A 3H7MA 2O31A 1GRIA 1JXOA 3QBYA 3M3KA 1B2HA 1NUZA 4GD5A 4JVIA 2COWA 1YHQA 4RY1A 1ZA1B 1Y3PA 1R9QA 2YSQA 1H45A 1MPCA 2YRVA 5ET5A 2M0OA 1UGQB 5KCJA 3OS2A 1G3SA 2QI2A 1H8KA 3MEVA 4PBHA 2GQVA 4YMBA 2RM4A 1OQKA 2EJFA 6AT1B 1MXUA 1NPRA 1TWYA 4OYVA 5BWJA 2ROLA 2QEXT 3JCMf 1NV6A 1I6AA 1JU5C 4PQJA 3DB3A 2CKKA 3SERA 3K1NA 4MZMA 2UVIA 1V1CA 3SKPA 3UORA 3JYRA 4OMBA 4XK8E 3I3VA 5FHMA 1P1NA 3PPPA 1Y1ZA 4R0KA 1BK4A 1B7TA 4KH1B 4HS7A 3Q25A 2K6DA 4M77D 3KGCA 1OLCA 1YAEA 1NKXA 3OS0A 4NTLA 1AWOA 4DBHA 2HAXA 3M54A 4I8CA 2REJA 2DQVA 3A8MB 4NMYA 2EVRA 2HAVA 2EYXA 2OZZA 3GZGA 4GBVA 1K0XA 1X6OA 1OOTA 1FQAA 3CCLA 4F2QA 3G4ST 1CSKA 3BKIB 4LZ8A 2ZXTA 3LW5E 2E0SA 3QYHB 5CI5A 4RCBA 2EQIA 4C92C 1SW4A 2O01E 2VKNA 3CVGA 3X24B 3C12A 1JW5A 1DK4A 3JCMb 3PD8A 4UC4A 4PF8A 5CM6A 5DYHA 1SYHA 4Z8AA 3TQWA 1RACB 1NV1A 5IT9E 2DAQA 3KN3A 5FWCA 2DDKA 1Q95G
chains in the Genus database with same CATH topology
1LB9A 2G29A 2LNVA 3ILUB 3K6XA 2REGA 3PV0E 3MVXA 4ZGEB 1BIYA 1KC8U 2VP1A 3M5AA 3OMGA 4CI0C 2A5TA 3LSLA 2HZLA 4ZEBA 3B6TA 3O6HA 4M7DA 4QF9A 4M7DB 4GL0A 2XD2A 3CCMT 3PUYE 4OHNA 4XKQA 4ZECA 1M1GA 1IXGA 1HSEA 3RT6B 1QVPA 1N3WA 2P0SA 2Q2AA 2I49A 2F5KA 1FTLA 2Y7KA 4KYEA 4GIZA 1B1HA 3JB9J 1M5FA 1SVXB 3MVYA 3MCAB 5LJ5f 2DE2A 2QA4T 2HQEA 1AIVA 4LDUA 5EHMA 4HT8A 5GAOp 3QXEB 2H3JA 5I2NB 5I2NA 5AA4A 4ONYA 3QO3A 2V93A 2EQUA 1EZ9A 2MF2A 3L42A 4L59A 4GQOA 5F1QA 5CRYA 5KDTA 2HD0A 2IVWA 2OTLA 2PT1A 2F69A 1M8VA 4DIGA 4G8MA 3GF5A 4DZ1A 5CKDA 2DIGA 3CCRA 5H8QA 1BIAA 2KDSA 1OQGA 3CRBA 2E5QA 3JB9H 1B34A 1YTVA 1A8FA 2RHZA 4M1VA 4ZEKA 1D3BA 4XU1A 1POTA 3OA6A 1KQSA 3H8ZA 3NTKA 1IEJA 1UQWA 4EMHA 4V2SA 3L6HA 2OJTA 2R9JA 4PJOC 5DY9A 3HSTA 2XXVA 3V8LA 4M77A 4M77B 4M7AE 3VLWA 3LGLA 4P0GA 4WEPA 4C92B 1FTMA 4NOYA 1Q7YU 5CKEA 3CG3A 4KI0E 2L89A 1ZHIA 2GHAA 2KAFA 1M90U 3RTFB 5M9OA 3PD9A 2FVUA 1VFEA 2EQKA 2OK2A 4YMAA 1YBYA 3FVOA 1VQ4T 2VC8A 3J80E 4OWDA 3V7RA 3LH0A 2XU8A 2XHCA 3HHGA 3INZA 1A54A 2ZPGB 3W15C 1Y71A 3CC4A 3O66A 1VQ6T 3E3KA 3TTKA 2DXBA 5I58A 4X9CA 4QW2A 3CCRT 2XDPA 3CC7A 1QVFA 5TPAA 3THIA 3OYMA 5GAN4 1KHCA 4G77A 3CXCA 4QFKA 2YPNA 2OTJT 2RK1A 4JJNK 3TTRA 4RMOA 3H4ZA 3HN0A 2UVJA 4QQGA 1MM6A 4YKPA 4MZTA 5GAN2 5KZTA 1BTJA 1AMFA 3LYIA 4LONB 5GANg 1XNIA 3RUXA 1ZBMA 1YI2A 4G68A 2X4JA 5EG2A 4C8QE 3PGFA 1RYXA 5CMMA 4X34A 3SEWA 3UN6A 3VE1B 1HK9A 2K3XA 4C0RA 4JXIA 1R8OB 3TEEA 4FE8A 1Y3QA 5LJ3g 2DZ9A 1Z7NE 1PB7A 4UA8A 4E7LA 1W2BA 1OLAA 2RC8A 2LVMA 2IEEA 3ZBDA 4F7UE 3U72A 5LJ5e 4XTWA 4PJOF 1B7ZA 1KWHA 2VGQA 2D6FA 3L2RA 4U4XA 2ZYKA 3OO8A 3MQ9A 4BACA 1Y4TA 4WEDA 3HL8A 5H8FA 2O7UA 2RHXA 1BI0A 2HQXA 3PNWC 4LZ7A 1N3XA 2OAUA 1Q81C 4AB5A 4FORA 2UYEA 4ZN1A 4YKJA 3S3NA 3OEKA 4J7FA 4DCYA 3M9QA 1LAFE 2KY9A 3RGYA 1S50A 1OYXA 4ZGJB 1LAHE 3P7IA 4OGEA 2V3TA 2Y90A 4ZDMA 3TAJA 1KC8C 1LBCA 3UWNA 3OO9A 1B05A 2HQ0A 2XX8A 3FUZA 5CAIA 4OQOA 2IA4A 3EHUA 2ZGWA 3CXCS 3T9HB 4KR5A 1Q35A 4FEBA 3M4GA 3VV5A 5GAN6 1NNTA 2XXRA 3WAFA 4JS4A 3FATA 2I6EA 3CG1A 3M57A 2QRYA 4PKCC 5H8NB 5GAMe 5I84A 1QW0A 4NF6B 2Y7RA 2RC9A 3SEUA 2E64A 4M7AC 1I69A 3LSXA 4IY5A 5JEIA 1M5Q1 4JSOA 3BFMA 1H641 2H5YA 2HZKA 1USYE 3UK4A 2ZNUA 3RN8A 4OEVA 2DWHA 3UT1A 4M7AF 4JWYA 4YB7A 4F3SA 1W2BS 1K73C 1YJNA 4QFPA 1B3FA 3IB2A 2XHDA 5J26A 4Z02A 3CMAT 4MFIA 2B3BA 1NL5A 1YHQT 4FJPA 4LDVA 4D6WA 2DTIA 2EJGA 3V5AA 3JCMX 3DLLA 3A3CA 5CQXA 3QYGB 4ZE8A 1VUBA 4OEUA 1CB6A 4YICA 1G3WA 4LP2B 5L8RE 1LGBC 4R2FA 1XC1A 1VQOA 3KG2A 3C33A 5L8DA 4E0XA 3FXRA 3EFSA 2QL3A 3JB9F 4OZ9A 4EQBA 3NTHA 3BDUA 3WVDB 3G71A 3A3UA 1SW5A 4C1UA 1OZ2A 3MW0A 1SD3A 1SI1A 1JQFA 3FIRA 4EMGA 5GAOm 2HCAA 3OOAA 2XXHA 3OYYA 1BKBA 4DOVA 1M4ZA 2M1HA 1VQMA 3OSQA 4M7DC 2CGHA 1S9TA 2PT2A 4BDZA 2RJFA 5DLQE 1WNLA 3S3OA 1QKAA 2VUBA 2Q2CA 4XTZA 5GANd 4OFOA 4XTXA 1IITA 3TFLA 3G3FA 1URDA 3J7AF 2GFUA 3K2DA 2QDYB 3H6UA 2YJPA 4E7JA 1KQ2A 4I62A 4I9DA 5LJ3d 4RA1A 3GIBA 2CS7A 1G3YA 2RB6A 5KE3A 5IAIA 4M78B 1VQ9T 4FECA 3OSSC 3VUBA 1VFDA 4ECFA 1EIFA 4C5IA 2DXYA 3M4YA 1LBBA 4KT0E 1B52A 3V7SA 1B5JA 4QFLA 3M59A 5GAN7 4QVCA 5FRMA 4F2OA 4EDPA 5A5XB 4C8QC 3G3KA 3T9UA 1FQCA 3FXQA 2I48A 2O69A 3KSJA 3SFMA 4NF4A 1FCKA 4M7AB 5AA2D 2LQKA 1VQ5T 1TFAA 4NWDA 1NZ9A 2RHYA 4R55A 3KBRA 4ZEIA 1Q81U 3K1MA 3VYHB 5DEXA 2KK4A 1NMUA 1NFTA 4GLIA 1SYIA 2P0KA 4MMKA 4NL3A 4JS5A 1XQHA 4A4FA 4OFJA 2F8DA 1NNKA 3VVDA 3MHXA 3CI8A 1MY1A 4PJOA 2ANJA 2ZYOA 4G2ZA 1S7YA 4ATOA 5GANh 4M7DD 3JCMc 2V3UA 1US5A 1H3DA 5FTHA 5J39A 4RG8A 1PEBA 1N04A 1LCTA 1B3HA 2E41A 1OZ3A 4MMLA 4IUPA 3N6UA 1JEVA 3IORA 4PE5B 2JUFA 4TOZA 4P11A 5AYFA 4RXLA 2FNCA 3IOUA 4LDYA 3PMIA 3QG1A 3S6WA 1QUKA 1QP2A 5LJ3h 5A0DA 3CCVT 3VKIA 4IURA 4M7AA 2RI5A 4DXUA 2RCBA 2XXUA 2XKOC 1NJIC 3RT8A 2F36A 3SDZA 1GTKA 1IZ1A 4BI8B 2ZYMA 4KCDA 4C0DC 3C35A 3CFLA 3IO6A 2V3QA 5FU6B 4JRKA 1Y96A 2F5XA 4THIA 3N26A 5I58B 5KH6A 1B1XA 4ME7A 3PTAA 1VSOA 2ZNTA 1LB8A 2MMPA 4L17A 1UIUA 5GAOr 4H6DA 4ZS9A 4HA8A 1MY2A 5CMBA 3HFNA 4M75G 2EWNA 2AL4A 1SSFA 5GAMh 3OW2A 3CBPA 5IAYA 1N84A 2GFAA 2OWTA 2WSFE 4M78F 1YJ9T 2DOJA 2Z8FA 1Q86U 4DCXA 2Z22A 4G68C 4A4KA 2P4TA 2Y84A 3KFMA 3OS1A 4OF1A 4YU0A 2XK0A 4H67A 4R6KA 1QVGA 4JWOA 3NTIA 2IG0A 2KMTA 4IO3A 4BLAA 3GP8A 1EH3A 2DVEA 2VXFA 5CCAA 1MH3A 4R6HA 1FQFA 1B0LA 1LFIA 3L1AA 2HNIA 2V8IA 1D4NA 1DPPA 2F7CA 3PUVE 1NH7A 2HBPA 2RK2A 2DD5A 2F7AA 3SETA 1BP5A 3BFTA 5JTYA 1R6ZA 4LQ2A 4EMKA 3TCFA 4GF8A 5B7DA 3JRZA 2Y4YA 1MY3A 5FU7B 4G8NA 4Q5WA 4X48A 5LJ5h 2KQWA 1LLSA 4NF5A 4U21A 3IR1A 4RCCA 3C4SA 4M4GA 1KG1A 3A09A 2RD1A 1YJWT 4KULA 1SDXA 2BIVA 4H8IA 2RH2A 2O51A 2L8DA 2QXFA 2XXPA 1ZIUA 2K57A 1H76A 3CC7T 5CBRA 1VIEA 4PFTA 4YB5A 3UIFA 4C92F 4WKMA 2YLCA 3Q29A 3HRTA 3T9NA 1IZ6A 1NPPA 5GAOl 1ZTYA 2DTOA 5K2XA 1PSEA 3IK6B 3X25B 3CC2T 3FEOA 3OW2S 5ITOA 5FRNA 2O4XA 3FD3A 2ZPIB 2RHIA 2PUKB 1MDP1 4PL6A 2P2AA 3TQLA 5BUUA 3QKJA 5FU6C 4UACA 2QMXA 4KPTA 4IO5A 1D3KA 2CZ6B 4MDXA 2EAYA 3LBSA 3PGGA 3FJMA 1KHIA 2K4YA 3L2UA 4TLMB 2DK3A 3CCUA 3QIIA 3SD4A 4RPNA 2Z8EA 4PFUA 4DLDA 3CPWA 1DSNA 2QQSA 1BI2A 4F1VA 1KD1U 1JRIA 3O8VA 2DXUA 4POWA 3K01A 3META 4N0AA 4G68B 3QZ5B 1M5BA 3P8BB 4LVQA 3S2VA 4N4HA 2LAOA 4RPOA 3TCGA 2VOZA 3SDFA 4A53A 2K5LA 2XXXA 1JNFA 4R74A 4A4HA 3M3FA 3CD6T 5AA4B 3KN7A 4R56A 3O2AA 5D6YA 5LL6S 5TU0A 5CMKA 3CIJA 4RNSA 1MXVA 3K6UA 5GANf 2D21A 4GFRA 2XXWA 3VLUA 3UGWA 1FQEA 4F18A 3ECRA 3FV2A 1IREB 2P1SA 1UEBA 1PC3A 2O7IA 4NF5B 4IO6A 3BY7A 2DTHA 1NJIU 1J1NA 4X1DA 3G6EA 3CCEA 2JTMA 3P8DA 1VQMT 2DWIA 1P1OA 4IO4A 3U92A 3MPLA 4JRIA 1QUJA 4YKKA 1EZOA 4K3FA 2PX1A 4MF3A 2DXRA 1F9BA 3OYBA 2RKMA 5H8FB 4OMFB 3CCJT 1LOJA 2CZ1B 3SWNB 1N27A 4E7IA 1VQOT 2E6NA 2LRQA 3M58A 3CD6A 3IAZA 4M7DE 2XXIA 3TTMA 3HRUA 2QS3A 1GVCA 2RINA 4U23A 1URGA 3MEWA 2PQWA 1BKAA 3MO8A 3O6GA 1II5A 4GY5A 4QFNA 4E0WA 1V29B 3CSGA 3GXAA 2LC4A 3O97A 2K5FA 3DLNA 5CMCA 3G7ZA 5CC2A 5I59A 5CR2A 4OVJA 1AOVA 2P0PA 4Z0IA 1UB4A 3PPNA 1JJ2S 2EQJA 3E4RA 2CYZB 1SW1A 2A5SA 1A7LA 4M7AG 3FVKA 3K0VA 5CVIA 3TODA 4NF8B 3HPWA 2MI6A 4GXAA 1Y1MA 5FHNA 1VQ7T 2F35A 1GV8A 1VQ6A 4XAXB 3JCMV 4HCZA 3K1PA 4JLGA 3J81E 3MVWA 3JCMP 4XTCQ 2VV5A 4MDWA 4YZZA 4GLKA 1IXHA 4ELOA 3DP8A 1Y07A 2EIFA 1OMPA 1AH5A 3FZVA 4M77F 3DP6A 4BY6B 4OB0B 5KCOA 3OD7A 1XVXA 4O5VA 4ELZC 1RYOA 3VXCA 4F3PA 2G3RA 2RJDA 2I4BA 2QMWA 1X01A 4BDMA 3H6ZA 4C8QF 3RMSA 1A55A 3VVFA 4BDYA 3CCET 4EUOA 1LSTA 4ZE9A 1L5TA 1BIBA 1LCFA 5EHSA 2XICA 3MEAA 3B7DA 2Z23A 4JRQA 3RESA 1JW1A 3JCMJ 4KYSA 4OB2B 4PFYA 3MEUA 1YI2T 3KSXA 4F7UF 1FQBA 1WDNA 5CKFA 3E9XA 2Q8JA 2XIDA 5KCHA 2I4CA 3FV1A 4Q8RA 5LJ5j 2OTJA 4J7IA 4ELQA 2H9BA 4F7UA 3NFCA 4YTLA 2DYXA 3HFOA 3FLGA 4J6WA 3RKYA 3HSBA 2X7PA 4NF6A 2PUOB 1WGSA 4M75C 4HCWA 1JEUA 4M7DF 1K73U 2DO3A 1O7TA 3A8OB 2YLNA 4J6YA 3H3GA 3VFJA 2L5QA 3RTWB 1K8AU 2RO0A 1NH8A 2VD2A 4BB7A 5I57B 5ICQA 4IUTA 1PB9A 3M55A 3VU3C 4EMKC 3G7WA 3PIOA 3MUQA 3R6UA 4LATA 1UTBA 4XKNA 4FAJA 3G3JA 3UPUA 4F31B 4F29A 3W9VA 3SB2A 4JRPA 2ONRA 4JSDA 3TEPA 5KDTB 3PIPA 2MWPA 2A7YA 4QQ6A 1MXZA 4IO7A 4NE4A 4C5GA 1MS7A 2H99A 3O6IA 1B3GA 2GRVA 1VQ5A 4E7HA 2R6GE 3Q1JA 3JCMQ 3RQTA 4PNOA 3AHUA 1VQPA 3P8HA 1MXWA 1Z7ME 4VUBA 1DMBA 4BDOA 5A0LA 4KD5A 1IXCA 4DXCA 4OERA 4C0ZA 3MWBA 1VQNA 3IB1A 4EMKB 2XDDA 2GCXA 2DZCA 1B9JA 3EPEA 4BDQA 4BI3A 1Q82C 4GVOA 1G5VA 3FC3A 4TLLB 2OBGA 5GMKi 2DP8A 2DXTA 1PBPA 4F3GA 4OP0A 4BE0A 1MDQA 4AB6A 4F39A 4ZEDA 4PP0A 3OQ5A 5I56A 2ALUA 3QDRB 3JZJA 3H6TA 3I56A 4C92D 3RIRA 3QSUA 2Y7WA 4EQ7A 1BLFA 1XVYA 3KOSA 5GAN5 1M1FA 3FGSA 3ZSFA 2X7QA 3OO6A 5TP9A 5ISUA 1N9SA 2JN0A 4M77E 1XS5A 2F6PA 5D6XA 5KCJB 1WJSA 2E1HA 4M78A 3SWNC 1UGSB 1G3TA 3MP1A 3PMTA 3D4GA 2AHJB 4N13A 4FU6A 3V89B 5GAMf 2E10A 1FQDA 4M75B 3PFSA 2E1SA 3JV9A 3QSLA 1A40A 1LFHA 5FHOA 3ZKLA 1QVGS 4J8OA 3T9XB 1R9LA 2PVDB 1W4SA 2DS9A 4HT9A 1IIWA 4Q0CA 1YJ9A 2Y4XA 2DE3A 1WODA 3OELA 5DVFA 4FEDA 3MPKA 2DXCA 5C6SA 3CFZA 1LJOA 3LGFA 5CKHA 2K5IA 2X35A 3M53A 1MH4A 4R9FA 1QULA 1U1TA 4QVDA 3IJXB 3A8GB 2M9UA 4LD6A 4M75A 4M78D 2ZPHB 1FXXA 1MHNA 4G8HA 2GFEA 1M9SA 4FSXA 3C9HA 2R57A 2FYKA 1VQNT 4XQ3A 3DELB 2I3VA 1Q86C 3W9WA 5FROA 3ZS6A 5A0GA 5H8SA 1M90C