3MP8A

Crystal structure of sgf29 tudor domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
513
structure length
513
Chain Sequence
b'MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
total genus 148
structure length 513
sequence length 513
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp8A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp8A01
3TELA 1WJQA 4OHNA 3E3KA 3LSWA 1N0TA 2LAOA 1SW5A 4QQ6A 3VLVA 3QIMA 4JSDA 2EKOA 1YPNA 4KI0E 1DOTA 2B8AA 3HSTA 1RYOA 2O1MA 4ZTJA 4KYSA 1PB9A 1URSA 1I69A 1AL3A 1A8FA 2LRQA 2QS2A 2LDMA 4RNSA 5I58A 1US5A 3PPRA 3TCHA 2HXWA 1P1UA 5D6YA 1FQBA 3THIA 3TODA 2AYSA 2I0BA 3JYRA 1BP5A 2R5AA 1WVJA 2NXOA 1B32A 4G8HA 3FVNA 1Y20A 3EHUA 2O7UA 2Q2CA 3KUFA 3IO6A 1LB9A 2L3RA 1FQCA 2XXIA 4EF1A 2ZNUA 5JEIA 4ZTFA 1GVCA 1MPCA 4IURA 1OLAA 2F7BA 4DXCA 1ZKBA 3O28A 2ONSA 3RNNA 1A99A 4BE1A 3N6TA 3E9GA 4C1UA 4OZ9A 3BKIB 3KN7A 2QRYA 5DYHA 3H6TA 3PUXE 2FA7A 3ZKLA 1I6AA 5FRNA 1B6HA 1PC3A 2CMOA 3MEVA 1LAXA 4GRKA 1A8EA 3IK6B 2RJEA 3ZS6A 4ZS9A 3KJ7A 3OSRA 2OK2A 1IQ7A 3VV5A 3SEXA 1O63A 4X9TA 2G3RA 5I59A 4MLVA 5F1QA 4EQ9A 1VFDA 3KN8A 2XXYA 5KZTA 2RKMA 4NS5A 4UA8A 3OYHA 1OZ3A 1JQFA 3DELB 1LFIA 4I1DA 4IUPA 4OFLA 3SESA 1HSEA 3P7IA 3TTLA 2DXRA 5I58B 1MQGA 4G4PA 3SDFA 4THIA 3SEWA 1QUJA 3MWBA 1D9VA 5CC2A 2DVZA 2VOZA 1ZBMA 5FTHA 3OB9A 4P0IA 3TZAA 4FEDA 3TTMA 1FTLA 1AIVA 4GLIA 3LUYA 2CZLA 2OWSA 1LAFE 4F39A 4QSCA 3PUZE 1PB8A 4EDUA 5J1DA 3QYTA 2REJA 2DWHA 3C31A 2O68A 3G3HA 5I2NA 4QFLA 1JVXA 2YJPA 3PNWC 2H5YA 1J1NA 4M4GA 1LBCA 4QHQA 4HW8A 3KOTA 3RT8A 2O4XA 4C5IA 2PX1A 3K1NA 4FIMA 4KYEA 4Q30B 3C35A 3USDA 1B1HA 2D3IA 1N7WA 3IOUA 2GHBA 4OFJA 4IKFA 5L9SA 2EQUA 1SQYA 2V25A 5CBSA 4LD6A 1FQEA 2Y7WA 2WACA 1OI1A 5AA2D 1AH5A 1JEUA 4F3BA 5B70A 2FHDA 4NF5B 3O9PA 4QFKA 4QFOA 4ELPA 4BDOA 2FYIA 3FEOA 2RC8A 5L9MA 3CIJA 2V3UA 3R6UA 1JEVA 4QF9A 1D9YA 2PT1A 2XHDA 2NLUA 3L6GA 3QBYA 4PP0A 1N3XA 3T9HB 1B5HA 3AXFA 3PV0E 4RK9A 1IXIA 2I4BA 3HHFA 3B6WA 4LA9A 3TYHA 4N13A 4U4SA 1USYE 5FHOA 1SDXA 1UQWA 2P1SA 4BLAA 3G7WA 3Q1JA 3G3IA 4N6PA 2ALUA 3OY9A 4O3CA 1Q35A 2XX7A 2UVGA 1B5IA 1MY2A 2UXAA 1PDAA 1OIBA 5DVJA 3FV1A 5I2NB 3QUFA 4O3BA 2IA4A 2Y7KA 3FV2A 2VD3A 1B0HA 1NL5A 4BDNA 4L17A 3V83A 2HAVA 3JZJA 3HN0A 5K2YA 2GFUA 5F7VA 1FTJA 1FQFA 5ITPA 4QSDA 3O2AA 1ANFA 5CI5A 3QXMA 1JW1A 4LATA 3OYCA 1H3ZA 3MZ9A 4R72A 1YTVA 3Q27A 1B5JA 3LR1A 4OYVA 4OEVA 4FEBA 4EXKA 4IUTA 1M5BA 4KD5A 2Z8FA 1QJMA 3PMWA 4I62A 5DEXA 4BDRA 2RO0A 1RYXA 2O51A 2REGA 2XXVA 3VVEA 3K02A 3VDFA 3FASA 4H5GA 5H8SA 4R2FA 2O84X 4CRIA 1A7LA 3IB1A 1XVXA 3U93A 4ESXA 2NOOA 1H76A 3M3FA 2XD2A 1IXCA 1QULA 3QKJA 4NMYA 4GF8A 2AL4A 1A54A 1RI0A 4Q5WA 5ICTA 3QJ6A 4DXUA 3MJNA 1MXVA 1QW0A 2OJTA 4MF3A 2DQVA 2GFEA 3S9NC 2YLNA 1POTA 1B3HA 3FZVA 5H8NB 3TMGA 3H03A 4F1UA 1XHYA 3KN3A 4H0WA 3UWNA 2PQWA 1SBPA 4R6KA 3G3GA 5TP9A 3QSLA 3DB4A 4KFQA 1B4ZA 1B3LA 2F8DA 3I3VA 1FCKA 5AA1A 4DCXA 2R71A 4BDYA 2XK0A 5DT6A 4LUBA 3MP6A 3L2VA 3OMCA 3TFLA 4A4FA 1XC1A 4LQ5A 2HFBA 4KHZE 3OYKA 2H9BA 3KG2A 5I2KB 4OTEA 3D4CA 4LZ7A 2A5TB 1QUIA 1RKMA 3FVKA 4NEDA 3CEYA 4F18A 4II1A 2EQMA 2RCAA 2Y84A 2DP8A 2DWAA 4RJZA 4DLDA 1R1NA 1IUDA 1DSNA 4GFRA 3PUWE 3B7DA 2O7IA 1GTKA 2I58A 1I6QA 2UYEA 3S6WA 1JW4A 4MFIA 3KZGA 1Z7NE 4WKMA 3OSQA 3IB2A 4N07A 4QFPA 5H8HA 3MO8A 3LYIA 3ONMA 4C5GA 1A40A 3K00A 2WKYA 4Z7EA 4TLMB 1OQGA 2QSXA 3MEAA 3DB3A 2BKDN 2UYFA 3MP8A 3OOAA 3DLNA 3RLFE 3M8UA 2Y7RA 2F6PA 3VXCA 2DWIA 2FNCA 2GH9A 2RHXA 4RG2A 5TP9B 3C33A 1ELJA 2LCCA 3CFLA 4B9XA 1MM7A 2L8DA 4AB5A 3ZEHA 2QS3A 1SYHA 5IKBA 3MPLA 3K6WA 2OWTA 5KDTA 3BDLA 3KEIA 3H6VA 2F36A 2H99A 5LOMA 1OVBA 3MUQA 4ZDMA 3FLGA 2OZZA 4BDZA 3ZKKA 4FORA 4E7JA 1IITA 5TU0A 3OYIA 4IO2A 2VGQA 4P0GA 5H8FA 4YZZA 1O7TA 2RC7A 1VFEA 3EN3A 2UVJA 3A3UA 2X4WA 5DTBA 3U8QA 3LSLA 2XXQA 3S3OA 3SEYA 4Q8RA 5I84A 2RHZA 5H8HB 2GF7A 4N4IA 4RA1A 3C9HA 2Y7IA 4IO6A 1TT1A 2RF1A 1MDP1 2QMXA 4U22A 2RJFA 1TFAA 3MW0A 1B51A 1B4HA 1XVYA 4YICA 1XS5A 1LSTA 1WODA 3MP1A 4Q5TA 4GXSB 4BE0A 4I9DA 3LSFB 4G2ZA 4DE8A 2DWJA 3M3LA 4A4EA 5HBCA 4IUQA 4N4GA 4YKPA 2DSFA 3GZGA 4H5FA 1CB6A 2HQXA 4RXLA 2Q9TA 3OENA 1B40A 4BDLA 4Z02A 3VFJA 2GHAA 3IAZA 4Z0IA 1JVYA 5KDTB 4NF5A 4L59A 4G68C 3S9LC 2K3XA 4DZ1A 2DE3A 3U94A 2X26A 1LB8A 1PBQA 1N04A 2V3QA 1N7XA 3SEUA 2XXWA 3MVZA 5I57A 5KE3A 2XXXA 3KGCA 1R9LA 3VVDA 5H8FB 4F29A 1NFTA 4GY5A 1B7UA 2A5SA 3OO9A 2XX8A 3OMGA 4ECFA 1TWYA 3EPEA 4JDFA 1MXZA 3DP6A 2JZ2A 3OO6A 1NH7A 3OS0A 4N4HA 2O1LA 5AA2B 1MXXA 1B3GA 3CVGA 4E7KA 2QPQA 3IOWA 3OELA 4JWXA 5FHNA 3FVGA 5ELVA 2ZNSA 3U72A 1URGA 4PFYA 2XDPA 1NNTA 4JB7A 2M8CA 1POY1 3L2QA 2ABHA 3S3MA 3QAXA 4E0WA 4FECA 3S9MC 4EUOA 3EHTA 3A3CA 3OXNA 3GXAA 4OXVA 3RGYA 1UIUA 2QMWA 2ONKE 2ZYKA 1FW0A 5I56B 4OETA 4X48A 4OVJA 1FTKA 2F78A 2P2AA 2X4YA 4NF8A 1LBBA 4U21A 3R7XA 1UIVA 3H6UA 3QK6A 3RTWB 1LCFA 3E9FA 3FXUA 3R26A 2RJCA 5IAYA 3H7MA 3ILUB 4PQJA 1R9QA 5KCHA 3IJXB 3UGWA 1B58A 5TPAB 2RI3A 4UC4A 2I4CA 3O6GA 4OERA 4IB2A 4C5EA 1MY0A 3QUJA 2EFIA 5I57B 1WGSA 3P8DA 1N27A 4G68B 3A09A 4ZEFA 2F5KA 2IG0A 3H06B 2R6GE 4RPOA 3RY3A 1N3WA 3VE1B 3RPWA 2D21A 2ZMBA 3C4MA 4YMBA 3FXRA 4IY6A 2DXYA 4FL6A 3FJGA 4PLIA 2RC9A 5IAIA 3I5OA 3UK4A 3SKPA 2PYYA 4EQBA 5H8NA 1LFHA 3LGFA 4RK2A 3I6VA 3IX1A 3KSXA 4ELOA 1OQHA 1MQIA 2QS1A 3C36A 2ANJA 1WJRA 1GGGA 2OBGA 3LLRA 2RCBA 4QFNA 4LZ8A 3BFUA 3HO7A 1XOCA 2V3TA 1B3EA 5M2VA 3K1MA 4ZEDA 4E7HA 4PE5B 3ASKA 3G3KA 4H8IA 4C1TA 4NF8B 3PFSA 4WEPA 1MXYA 3OA6A 3H3GA 4WEDA 3RT6B 3E13X 1SSFA 2R5MA 2XXRA 4NF4B 1B46A 1O64A 4KR5A 1AOVA 5I2KA 3TAJA 4WXJA 3PMTA 3EF7A 3W9VA 1DTZA 2A5TA 4RPNA 3IORA 4DIGA 1II5A 2DVCA 1B0LA 4HS7A 4MLQA 1LCTA 2AL5A 4EXLA 2Q2AA 3LGLA 3CRBA 3OO8A 3F70A 4OESA 3N94A 1KWHA 4EF2A 3LX7A 1LFGA 4PETA 3OYDA 4OMBA 4PFWA 4R73A 1DPEA 4YB5A 4GWOA 1FTOA 5AA3A 1AMFA 4YMAA 3TTKA 1MH3A 2DS9A 1EZPA 4FJPA 2RI2A 5HM4B 4R75A 2Z8EA 2XXUA 2IEEA 3VLUA 3O29A 4H8JA 3C34A 4POWA 2XXHA 3FJMA 1DPPA 4BDMA 1GV8A 2QJEA 5FRMA 3PPQA 1LGBC 1G5VA 4OVAA 2E5QA 3OYLA 2EQJA 4XKRA 2PVUA 2QS4A 1TXFA 4TQUQ 2DAQA 2XXTA 4QQGA 2VD2A 3S9EA 3Q29A 3LBSA 4POXA 1NKXA 3E4RA 3L2RA 3N26A 3U92A 5KCOA 2Q88A 4RY1A 1MQDA 4PFTA 4FU6A 3CR9A 2I3VA 4GL8A 4E7IA 4ZZEA 5ITOA 2LVMA 2I0CA 4ELRA 5CMMA 2ZYNA 3ILTB 1L5TA 1A55A 3WAFA 2YRVA 5FHMA 2QQSA 4FATA 3H8ZA 4X34A 3PD8A 1N84A 4AQ4A 3O6HA 3K6XA 1CE2A 1S50A 1MDQA 4XIGQ 3NTIA 4R9GA 3RUMA 4G8MA 2HZKA 1BLFA 1ZIUA 3DP4A 4U1ZA 1MPBA 3K2DA 2Z23A 4H67A 2V93A 1M5CA 2BUDA 3H4ZA 1IEJA 2ONRA 1SI1A 4IUVA 3UN6A 4EDPA 1OLCA 5CBRA 2JTFA 1PEBA 1Y4CA 4U23A 3NTHA 4IGRA 3T96B 3CI8A 1B7HA 4MH5A 3CSBA 3MEUA 2D9TA 1DMBA 5A5XA 3OYNA 4JWYA 4F19A 3G3FA 5FTIA 3V8XB 3UIFA 1D3KA 4QSEA 1QKBA 1UTBA 5JTYA 1BIYA 2R9JA 3K6UA 1USYH 4IY5A 1NNPA 2V84A 3OYGA 4MBPA 2GRVA 3FD3A 4R9FA 2DIGA 4XKNA 2RJDA 4YB6A 4KYDA 1BKAA 5HPQA 3IR1A 3GBBA 4YB7A 1P1WA 3CFXA 4IO3A 4U4XA 3MVWA 4KQPA 3TEPA 4H65A 3PUVE 3KFMA 2BIVA 5D6XA 2F7AA 4BDQA 3FJ7A 3TPAA 1Y1ZA 1OZ2A 2E6NA 3K01A 4OENA 2W7YA 4HCZA 3T22A 5H8QA 5C0MA 3IL1B 3IO4A 4G77A 4GOTA 3PGFA 3IOTA 2X35A 3DP8A 4TOZA 3MBPA 3F11A 2VYTA 2QL3A 3UT1A 2DYXA 1MH4A 4IUUA 1LAHE 2AIXA 5AA2A 1B2HA 2X7PA 3ME9A 3N6UA 2ZNTA 1MY4A 4HCYA 5K2XA 1NNFA 2F5XA 3N5LA 4ZE8A 2DE4A 3U1OA 1IXGA 5A5XB 4LONB 3K1PA 4C0RA 5CMBA 2H98A 1UTBB 3SETA 5JTYB 4OFOA 1MPDA 3OQ5A 3SD4A 4DCYA 1Y3NA 3T9VA 5KCJB 3TQLA 3WAEA 2XXPA 3M9QA 4OEUA 1BTJA 4GQOA 3MQ9A 1MY1A 2M16A 1B9JA 4U2RA 4QQDA 4ND9A 5I56A 1MY3A 1XT8A 3Q25A 2L89A 4LVQA 3K4UA 1Y3QA 4NE4A 3UA8A 4YU0A 3T9XB 1JNFA 2X7QA 2M1HA 4FAJA 2PT2A 2R58A 1UTHB 3LSXA 3TUSA 3O6IA 4QW2A 3L2WA 4F1VA 3L2UA 5DVFA 2EQKA 2H25A 3PPPA 4XXUA 2BJJX 5TPAA 3T93B 4E0XA 3PMIA 1PB7A 1XNIA 5H8QB 4DXBA 3TCGA 2Z8DA 4G68A 3C32A 2YPNA 3CG3A 3CG1A 2PMSA 3MPKA 1EU8A 5J39A 4YKKA 3ODBA 3T66A 4RYAA 3KOSA 3L42A 3RQTA 2B3BA 4B9WA 1QUKA 3MVYA 3OYJA 1SVXB 1F9BA 2HAUA 2RHYA 4F2QA 3SEVA 3PPOA 3MZ1A 2UVHA 4JSOA 3UP9A 5CMKA 3PPNA 2NWJA 4LQ2A 4XTCQ 4JXIA 2PBWA 3TKDA 4KCDA 3S4UA 3B6TA 1T0KA 3OEMA 1Z7ME 1P1NA 2E1SA 1URDA 1B1XA 1IZ1A 5M9OA 1FQAA 4BACA 1GR2A 5J26A 4BD3A 2M0OA 4OWDA 2HEUA 4NF4A 3FUZA 5IN1A 1FQDA 1B7ZA 1JETA 3RTFB 2I3WA 1MM6A 2F35A 2E0SA 2ZXTA 3BBRA 4GIZA 5I59B 3OYEA 1YCJA 2DE2A 3C4SA 5FROA 4UACA 1VSOA 2Z22A 3MC2A 2XD3A 4O3AA 3K6VA 2I48A 3OS1A 3FDRA 1LAGE 1VE4A 4HTGA 5BUUA 5B7DA 4KPTA 1WDNA 5KE2A 4F3PA 5AA4A 3VLWA 5C6SA 4ZE9A 1ATGA 5BWJA 5DVIA 4XKPA 2DOJA 1Y3PA 2OCUA 3GBAA 2XX9A 3T9UA 1ZJLA 4X1BA 1EZOA 3OYMA 1MQJA 4JWOA 3META 4FE8A 4A4HA 1SD3A 3EHSA 3TTRA 4NF6A 5KH6A 1ZLQA 2RINA 3FGSA 3GLBA 5JK4A 2HQ0A 1SYIA 1KHCA 1IXHA 4NWCA 2K3YA 1SI0A 3HV1A 4NTLA 4LP2B 5ISUA 1LLSA 3ZSFA 2RI5A 4XKQA 3KJTA 4R6YA 3D4GA 1HSLA 1MG1A 2HZLA 3MAMA 3FXQA 2O4XB 2DIQA 3FC3A 1M5FA 3M3KA 4E7LA 1M5DA 3HPIA 5CRYA 2OLBA 2F6GA 4OQOA 3ECRA 2X4XA 5EHMA 2R57A 3Q28A 1NH8A 2VP1A 4ISUA 1P1OA 3S2VA 3EAEA 1B3FA 3RN8A 3W15C 3PD9A 4F3SA 4PFUA 4GD5A 2G93A 1MHNA 2QQRA 2HQEA 2G29A 3HHGA 2HCAA 3OD7A 1EH3A 3VXBA 5CIUA 1IIWA 4ONYA 3PUYE 4GVOA 3IOVA 3O66A 2UVIA 4A4GA 4YKJA 1S9TA 3LC8A 2KLFA 4U1OA 1SW2A 5AA4B 2THIA 2GFAA 4ZZAA 4PL6A 2MWOA 1D4NA 1ZTYA 1Y9UA 4NWDA 4IGTA 5CMCA 5EYFA 3E9XA 4H1XA 4YKIA 3IB0A 3KBRA 3IJOB 3B6QA 2Q89A 3HCQA 2O6AA 4NF6B 3DLMA 1MS7A 4I8CA 1MXUA 1PBPA 4R6HA 1R6ZA 5L8DA 1H3DA 3TDJA 4R74A 3TTNA 5CM6A 4IO7A 4TLLB 3LH0A 1H43A 3DM0A 5EHSA 2D5WA 2F7CA 4K3FA 1P1QA 2ESNA 4QRZA 4IO5A 2LTOA 3JV9A 4P11A 1QVSA 1NNKA 1NMUA 4AB6A 1MQHA 5D6WA 1MXWA 2F97A 3V5AA 2ZYMA 4PLLA 4C5HA 2NVUB 3OYBA 3PMXA 4H6DA 4QVZA 4GXAA 3VVFA 1P99A 1YAEA 2Y7PA 3OO7A 4JBZA 4EQ7A 1SW1A 2MWPA 4R2BA 4F1YA 3O97A 1OVTA 1HSJA 3G3JA 4ZEIA 4DDDA 4F31B 3O8VA 1VR5A 4M1VA 3TCFA 4Q0CA 3H6WA 1FTMA 1B05A 4F22A 3QIIA 2NUVA 3OEKA 3FVOA 1B52A 3L6HA 4F2OA 5DEXB 4LZ5A 1H45A 1TFDA 2I49A 4F3GA 3BFTA 3NTKA 3EQ1A 4X1DA 3CSGA 1QKAA 3W9WA 4ESWA 2RHUA 4ZECA 2B3FA 3MZBA 4HCWA 2O69A 3FIRA 2CKKA 3K0VA 2B65A 3Q26A 4GL0A 3UORA 3KSJA 1EZ9A 1S7YA 3V89B 5ICQA 3P8HA 1MRPA 1OMPA 1N76A 3PU5A 4ELQA 5KCJA 3S3NA 1JW5A 1SW4A 2VHAA 1I6BA 3MVXA 1DTGA 1ZU0A 2I6EA 3OYFA 1H44A 2ZYOA 3MEWA 3GOXA 1ZMGA 2H4IA 1M5EA 1WJSA 2P0SA 3OS2A 1OYXA 4G8NA 3OYAA 2Q8JA 5L9OA 3H6ZA 3SERA 1Q1KA 4ZEBA 3CFZA 3FATA 1Y4TA 3PMVA 4IO4A 1Y1MA 3OMBA 2P0KA 4KCCA 4BE2A 2RHIA 5AE4A 4YAHX 1US4A 2F34A 3TQWA 1UTHA 4ZEKA
chains in the Genus database with same CATH superfamily
3TELA 3UDCA 1WJQA 4OHNA 1X6BA 3SWNB 3E3KA 1YCSB 3LSWA 1N0TA 2LAOA 1SW5A 3QO3A 3CC7A 1W2BS 2BJIA 2A7YA 4QQ6A 3VLVA 1N8RU 2SEMA 3C95A 3QIMA 4JSDA 1Q81U 2EKOA 1YPNA 1YCYA 5IHIA 2B8AA 1Q7YC 1DOTA 3HSTA 4KI0E 2BZYA 4L6V5 1KQ2A 1RYOA 2O1MA 1KA0A 2FVUA 2XG8D 4ZTJA 3CCMT 4KYSA 1PB9A 3A8HB 2KEAA 2GQIA 2VXEA 1LBZA 1URSA 4O7MA 2CP3A 1YZ0A 1I69A 1AL3A 1A8FA 3TQ7P 5GANe 1KD1C 1UGRB 2LRQA 2NUTB 5A0DA 2L5VA 3HSBA 2HPGA 2BE9B 2QS2A 2LDMA 4M75D 1KA1A 4J83A 4RNSA 5I58A 1X6GA 1US5A 3PPRA 3TCHA 2HXWA 1P1UA 1ZBJA 5FW9A 5D6YA 1FQBA 3RDVA 3THIA 2AYSA 5GMKi 1V1CA 2I0BA 3JYRA 3VJPA 1BP5A 4PBQA 2R5AA 3VYHB 1M1KU 2DJQA 3LW5E 1WVJA 2NXOA 4JRKA 1B32A 4OVPA 5CCAA 4PKCC 2LJ1A 5GMKm 4G8HA 3FVNA 2Z0WA 3I56T 1WHGA 3AT1B 4BI8B 4O94A 1Y20A 2CYZB 1ZSGA 3EHUA 3EFOB 2O7UA 2Q2CA 3RIRA 4N0AA 3KUFA 1VQ5T 3IO6A 1LB9A 2PVOB 2ZGWA 3A98A 4OGCA 4M7DB 2L3RA 1FQCA 2XXIA 4EF1A 1PM3A 2QXFA 2ZNUA 4ZN1A 2BZ8A 4MZPA 2RNAA 5JEIA 2K9GA 3M54A 2PNIA 4ZTFA 2LQKA 2DKGA 3EG3A 1IMDA 1GVCA 1MPCA 4IURA 1OLAA 2F7BA 4DXCA 1ZKBA 1YNZA 3O28A 2ONSA 4JLIA 3OBYA 5KYYB 3RNNA 2WYKA 1A99A 4BE1A 4RTXA 3N6TA 1M3AA 2MPXC 4QBAA 3E9GA 4C1UA 2K57A 3O5ZA 3BKIB 4OZ9A 3VRYA 1I1JA 3KN7A 1RL2A 4RTZA 2QRYA 5DYHA 3H6TA 3HFOA 3PUXE 5HKCA 2FA7A 2DTOA 4KGZB 2ROTA 3ZKLA 1I6AA 5FRNA 1AD5A 2DEQA 3NHNA 1B6HA 1PC3A 2CMOA 1QP2A 3MEVA 1LAXA 4GRKA 1A8EA 3IK6B 4M75E 2DL4A 2F1LA 3HRSA 2RJEA 2MIOA 1M1FA 4GX6A 1Y96A 3ZS6A 1GCQA 1SPIA 4ZS9A 3KJ7A 1ZA2B 3P8BB 3OSRA 2OK2A 1IQ7A 1Y57A 3EG1A 3VV5A 2KNBB 3SEXA 1C6VX 4N6DA 1O63A 4X9TA 2G3RA 2XI9A 1EYJA 5I59A 2DO3A 2YUNA 2O01E 4MLVA 3JCMg 5F1QA 1UGPB 3CC4T 3CCVA 1VFDA 4I3EA 4EQ9A 2EQIA 3KN8A 4C8QD 2QGGA 2XXYA 4ZGDB 5KZTA 2RKMA 4NS5A 4UA8A 3JCMh 3OYHA 5J3BA 2HMAA 1OZ3A 4LE9A 3M4YA 3CPFA 1JQFA 2ED1A 1FBCA 1NV2A 3DELB 1YITQ 1LFIA 4I1DA 1ACMB 1SSHA 3PVLA 4IUPA 4OFLA 2CSIA 3SESA 1HSEA 4FBPA 3P7IA 5EQ8A 3TTLA 4RTYA 2DXRA 2Q8MA 2EBPA 1OEBA 5I58B 1MQGA 3G71Q 4G4PA 4JPBW 1VQKQ 3SDFA 3RR6A 4THIA 4OB0B 3SEWA 3JV3A 2OTJQ 1W70A 1QUJA 3OYYA 3MWBA 1S72A 2GTJA 1D9VA 2HKNA 5CC2A 2DVZA 2KMTA 2VOZA 1ZBMA 3ZFJA 1H3HA 5FTHA 3OB9A 1YJ9A 3VYGA 4P0IA 4FEDA 3TZAA 3TTMA 1FTLA 1AIVA 2WSCE 3M56A 4L5GA 4M7AA 3LUYA 4GLIA 1QW1A 1NJIU 2CZLA 4XTUA 1PKSA 2G6FX 8AT1B 1VQ9Q 1N9SA 2OWSA 2YSQA 1Q82C 2EYYA 1LAFE 3H0IA 1QWFA 1WHHA 3QZ9B 4F39A 4QSCA 3PUZE 2CP6A 2O9SA 4EMKA 1B7TA 1PB8A 4MX6A 4O6JA 4EDUA 1AWJA 2EIFA 1TSFA 2K6DA 1BI0A 3M0TA 3G1JA 3I55T 3QYTA 5J1DA 2REJA 2DWHA 3C31A 2O68A 3G3HA 4PBHA 1GFDA 3I5RA 2EJGA 5IH2A 2LNVA 1QVFS 4C8QE 1T3SA 1R77A 1IHWA 2E6ZA 2ZPBB 1NYFA 1K8AR 3TREA 5GAMj 1TUDA 2DD4A 5I2NA 2HL3A 4QFLA 3CPWA 1JVXA 1QGXA 1Q7YU 2FG0A 2YJPA 4MMPA 4PCDA 3PNWC 1O9SA 2H5YA 4DI4B 1J1NA 5LJ3j 4M4GA 1LBCA 4QHQA 4HW8A 3KOTA 3RT8A 4MDXA 2O4XA 4J6XA 4P3LA 1M1GA 1BCOA 4KH0B 4OB3B 1KD1U 4C5IA 2PX1A 1LBVA 1VYTA 3K1NA 4FIMA 4KYEA 4Q30B 4PF6A 3RNJA 3C35A 3VUZA 3USDA 1B1HA 2ZZWA 2D3IA 1N7WA 3IOUA 2GHBA 1U1TA 3JCMV 1AEYA 2DA9A 3M59A 4OFJA 4IKFA 4JJDA 2KR3A 3JCMd 5L9SA 2EQUA 2EGCA 4E7ZA 1SQYA 1G2BA 2V25A 1YJNA 5CBSA 4Y91A 5IM2A 3KBGA 4LD6A 5EYHA 3OSVA 1FQEA 1SG5A 1ZBXA 1NV0A 2Y7WA 2WACA 4QKUA 1OI1A 1M8MA 4R55A 4KH1B 3JB9G 2K2MA 1V76A 1AH5A 5AA2D 3A29A 1JEUA 3QPHA 4KUDK 4F3BA 5B70A 2FHDA 4NF5B 3O9PA 3CCLT 4QFKA 4QFOA 4A54A 5GAOr 4ELPA 1RAGB 4BDOA 2DX1A 4QT7A 3FEOA 2FYIA 1KQSA 1BK4A 2RC8A 5L9MA 4C0DC 3A1PA 4QVDA 2ZZVA 3CIJA 2V3UA 3CPWP 5GAN2 3R6UA 1JEVA 4PK4A 1BB9A 2CZKA 5ET7A 3G4SQ 4P1EA 1ZSZA 5IHNA 4QF9A 1D9YA 1W4SA 2PT1A 2XHDA 2NLUA 3IFCA 1VQ7T 3L6GA 1LBWA 3QBYA 5IZ3A 2DD5A 4PP0A 1N3XA 3T9HB 2DE0X 3CCET 1CNQA 1B5HA 3AXFA 3PV0E 4M7AB 8ATCB 4RK9A 1IXIA 2I4BA 3HHFA 3GLXA 2DL5A 3B6WA 4LA9A 3MSTA 2K79A 4N13A 3TYHA 4U4SA 4EMHA 1USYE 3V7CA 3DLLA 3E1SA 5FHOA 2RA2A 3JCMf 1SDXA 2J6KA 1UQWA 2DYIA 2P1SA 4PFOA 4BLAA 1HXDA 3G7WA 4JJBA 3RUXA 1X2QA 2BE7D 2XICA 1YIJQ 2C06A 3Q1JA 4HCBA 1K9ZA 3G3IA 4N6PA 2FIEA 3UA6A 2FZGB 2ALUA 1QVGS 2E12A 3OY9A 2R8TA 3KC0A 1Q35A 3WVEB 4A63B 3VV0A 2XX7A 2UVGA 4O3CA 1B5IA 1MY2A 2A36A 2P84A 1KK7A 3RKWA 2UXAA 4J9FA 1PDAA 1OIBA 5LTCA 5KYXA 5DVJA 3FV1A 1HK9A 5I2NB 1K76A 3QUFA 2VASA 4O3BA 2VKNA 4M75G 2OTLQ 2IA4A 1D1BA 3M55A 3QXEB 2Y7KA 2W10A 4E6RA 3FV2A 2VD3A 1KQSP 1B0HA 1YHQT 2LZ6B 1NL5A 3QDRB 4BDNA 4AT1B 4L17A 1VYVA 3V83A 4AMCA 2HAVA 3D1RA 3JZJA 3CQTA 3HN0A 3M0QA 1DCUA 5K2YA 2GFUA 5F7VA 1FTJA 1X6OA 3IFAA 1FQFA 5ITPA 4QSDA 2DZCA 1VQ6Q 3O2AA 1ANFA 2DVJA 1ZA1B 3JCMQ 2QEXA 2DETA 5CI5A 3QXMA 4H45A 1UUEA 1M90C 2VUBA 1JW1A 2QQAA 1EX4A 2FYKA 4LATA 1WXBA 2RQTA 4RKUE 3OYCA 2DVEA 2VC8A 2RH2A 2GBQA 4PAIA 2CH4A 1H3ZA 3MZ9A 4C92A 4R72A 4N4UA 1YTVA 2HZYA 1PC0A 1Q82U 3Q27A 1B5JA 3LR1A 4XTWA 4OYVA 5GAN4 4ORZA 4OEVA 1K4US 1I5OB 1VQ8T 4FEBA 1WIEA 1KSWA 4EXKA 2MF2A 2V8KA 4IUTA 1M5BA 1FPEA 4KD5A 2Z8FA 1KC8C 2AKLA 1QJMA 2F3DA 1M4ZA 4JZ4A 3PMWA 2CP7A 2A0FB 2M51A 5FU7C 4I62A 1FMKA 4KUIA 1OX9A 3OW2P 5DEXA 4BDRA 4KGXB 1AWOA 1B07A 2RO0A 2DTIA 1RYXA 2O51A 4M78D 2OTJT 2REGA 2XXVA 1FPLA 3VVEA 4XQ3A 3K02A 3KBZA 3RERA 3VDFA 5IZ3B 3FASA 4H5GA 5H8SA 4R2FA 4GBQA 3CXCA 3VS1A 1VQ5Q 4CRIA 1A7LA 2O84X 1XVXA 3IB1A 1M2VA 3U93A 4PJOD 2VGNA 4ESXA 2V26A 2NOOA 1H76A 3M3FA 5CKEA 2FIXA 2XD2A 4M75C 1IXCA 1QULA 1UB4A 1SHGA 4F7UE 1D0XA 2QVUA 1YWPA 3QKJA 4C0ZA 4NMYA 4GF8A 4C8QG 3ZBDA 5DLOA 2AL4A 1FBPA 3QYGB 1A54A 1NUWA 1R0CB 1RI0A 3EH2A 4Q5WA 2JMCA 1YI2T 5ICTA 3QJ6A 4MIJA 2CGHA 2I2LA 1IMCA 2KYBA 1Q86R 4DXUA 3MJNA 1MXVA 1QW0A 2OJTA 4LDVA 4MF3A 2DQVA 4M75A 4EMGA 2GFEA 3S9NC 2YLNA 4J8OA 4NL3A 1POTA 1IHVA 1B3HA 1TOVA 5GMKl 1BKBA 4OF1A 3CCQT 5KYXB 3FZVA 2P0QA 2FPFA 3E2UA 5FBPA 4KGVB 5H8NB 3TMGA 1U8RA 5CVIA 4CC4B 3PIPA 3H03A 4F1UA 1M2OA 4M77D 1XHYA 3PT9A 3U65A 3KN3A 4M4ZA 4H0WA 2YRCA 3UWNA 1VQMT 1WHJA 2PQWA 2OWZA 1SBPA 2ZZDA 4R6KA 4J9CA 1RDXA 3G3GA 4M78F 5I21A 5TP9A 3QSLA 4M78E 2DYBA 2FEIA 4Y92A 1AWXA 3DB4A 4KFQA 1ZX6A 4FYXB 1ZUUA 1B3LA 1B4ZA 2F8DA 3I3VA 4P8BA 1FCKA 2AIRB 2F2WA 5AA1A 1FPJA 2WSFE 4DCXA 3CC4Q 3SWNA 1RUWA 2FPEA 3QWYA 4BDYA 2R71A 2A28A 5EC7A 2YWWA 4PJOE 2XD0A 2FRYA 2XK0A 4OMQA 4OMOA 1BI3A 5DT6A 4LUBA 3MP6A 3L2VA 4C92B 3OMCA 4PFBA 3TFLA 2KVQG 1G0IA 4A4FA 1HD3A 1D0ZA 3CCRA 1XC1A 4LQ5A 3HPWA 2LP5A 2HFBA 4KHZE 2E3HA 4Z8AA 1FMVA 1K9AA 3OYKA 2H9BA 3KG2A 2KRSA 5I2KB 3JCMb 1QCFA 4OTEA 1DK4A 4X9DA 1LVKA 3D4CA 4IIOA 4LZ7A 2A5TB 1VQNT 1QUIA 1RKMA 3FVKA 3CEYA 2V4CA 4NEDA 4F18A 1GBRA 2YRDA 2IVWA 4II1A 4XU3A 2EQMA 2HBWA 4C8QC 2A08A 2RCAA 2Y84A 2DP8A 2DWAA 4RJZA 4DLDA 3PE0A 1AZGB 4HT8A 3M58A 1M8VA 1R1NA 4PDHA 2HCKA 1IUDA 1PWTA 2L3PA 1MUZA 1DSNA 1N9RA 2RQRA 2D8HA 4GFRA 4M77E 1K1ZA 1H92A 2HSEB 2LQ8A 3PUWE 3B7DA 1ABOA 2X9HA 3R6NA 1GTKA 2O7IA 2I58A 3EFOA 1I6QA 1M2VB 4E2FB 2UYEA 2OAUA 3S6WA 1JW4A 4MFIA 4DQ2A 2JVVA 1KFZA 3RMQA 3KZGA 3JCMe 4M7DA 5IGAA 4J7IA 1Z7NE 4WKMA 3NFCA 3OSQA 2EAYA 1G0HA 3I55Q 1I07A 3IB2A 4N07A 1EYIA 2RK1A 3CD6T 4JS5A 1VQOQ 4QFPA 1MMGA 1SHFA 5H8HA 1M90U 3MO8A 3LYIA 4PGNA 4LDXA 4MEVA 1TTHB 1UJ0A 3NMZC 4C5GA 3ONMA 4MDWA 3J80E 1A40A 1Y7XA 4MHFA 4AG2C 3K00A 2WKYA 4M75B 4Z7EA 4TLMB 2XMFA 4N15A 5EQ7A 1OQGA 2QSXA 3MEAA 4XU1A 1CSKA 3DB3A 3THKA 4DBQA 2BKDN 5FU6C 3M0RA 4JVDA 3M5AA 3PVQA 2UYFA 1RI9A 3MP8A 3OOAA 1K0SA 1FBFA 3J7AF 3REBB 1KC8U 3DLNA 2P3NA 3RLFE 5I11A 3M8UA 2Y7RA 2F6PA 4OGEA 3VXCA 2DWIA 2FNCA 4ESRA 1KG1A 2RQWA 2GGRA 5EG2A 2C0IA 2GH9A 2RHXA 4RG2A 1IGQA 5TP9B 4HXVA 4JLGA 3C33A 4J6YA 2LCCA 1ELJA 1K0XA 3CFLA 4HE1A 5ESYA 1BI2A 3G71A 4B9XA 1VQKA 1MM7A 1VQPA 2L8DA 4AB5A 3ZEHA 2QS3A 4PF8A 3RMSA 1SYHA 2KROA 2CZ0B 3EFSA 3QMFA 5IKBA 3MPLA 3HFUA 1JO8A 3K6WA 2OI3A 2OWTA 5KDTA 2ZPHB 1PRMC 3BDLA 3CCLQ 1DBZA 3KEIA 4FT2A 3H6VA 5FWCA 2F36A 4WTOB 1VQ9A 2H99A 5LOMA 2NYSA 1NV6A 1OVBA 1LBXA 3MUQA 4ZDMA 1AVZC 2COYA 3FLGA 3L2ZA 4D6WA 2OZZA 4OMNA 4JRIA 7AT1B 4BDZA 1BYMA 3FIFA 3ZKKA 4FORA 4E7JA 1N6AA 4X9CA 1VQ7Q 1IITA 5TU0A 3GF5A 3OYIA 3CCEQ 3WXMB 2F2VA 2K4YA 4IO2A 4OMMA 4F7UG 2VGQA 1JU5C 2K2VA 4P0GA 5H8FA 3VS2A 1CKAA 4YZZA 3REAB 5HK3A 2DILA 1O7TA 3A8OB 2RC7A 2FPDA 1VFEA 3EN3A 2UVJA 4CC7A 2KAFA 3A3UA 4NGUA 4C8QB 5GANj 4JVIA 2X4WA 3A8MB 1XQHA 4FIBA 1FPIA 1UECA 2IPOB 5DTBA 1K8AU 3U8QA 3LSLA 4NG7A 2XXQA 3S3OA 3SEYA 4Q8RA 5I84A 2EVRA 2RHZA 2V1RA 5H8HB 2DNUA 2GF7A 4JZ3A 4N4IA 4RA1A 4N91A 1T0JA 3C9HA 1M9SA 2WEFA 1FMWA 3EGXB 2Y7IA 4IO6A 4HVUA 1TT1A 5ET5A 4IIMA 4GWZA 2RF1A 5CKDA 1MDP1 2QMXA 4U22A 2RJFA 2MOXA 1TFAA 2DLPA 2EW3A 1YJWT 1PG5B 1YHQQ 3MW0A 1B51A 1D9QA 2Y90A 1B4HA 4DOVA 1XVYA 4YICA 1XS5A 1LSTA 1MMNA 4M78G 1WODA 4AFUC 1Q86C 5A2QE 3MP1A 4Q5TA 4BB7A 3GNFB 3CXCS 2XXKA 4GXSB 3BE3A 4HXJA 4BE0A 4I9DA 3LSFB 4FT4A 4FSXA 3H9NA 4G2ZA 2LJ3A 1QVGP 4DE8A 2RB6A 4PJOG 2DWJA 3M3LA 4A4EA 5FU6B 5HBCA 1FSAA 4IUQA 4N4GA 1RDZA 4YKPA 2DSFA 3GZGA 1I8FA 4RCBA 4H5FA 1RACB 1CB6A 2FB7A 2HQXA 2QA4T 1NV1A 4GWXA 4RXLA 2Q9TA 3EHQA 3G4SA 3OENA 2E41A 5I3SA 3QSUA 1B40A 4BDLA 4J9BA 4Z02A 3VFJA 3ISPA 2GHAA 1VQ8Q 3VS0A 3R6OA 1RAAB 2DL7A 4FYVB 3IAZA 4Z0IA 1JVYA 1OU9A 3JRZA 5KDTB 1FPFA 5LJ5g 3X28B 1SF9A 4NF5A 4L59A 3VS6A 2DERA 4OVTA 4G68C 3S9LC 2K3XA 2LCSA 4DZ1A 1JJ2A 2DE3A 3U94A 2X26A 4GBVA 1MMDA 3M4GA 2AHJB 3TU4K 1WHMA 4M77G 1UEBA 2QYZA 2H3JA 1LB8A 1YIJA 2E3IA 1WQ7A 1N04A 1PBQA 1QCNA 2KT8A 2MK5A 2QDYB 2V3QA 2YLCA 1N7XA 3SEUA 2XXWA 3V7RA 1F1BB 3EG0A 3MVZA 5I57A 4KULA 4RTVA 5KE3A 2C0TA 2D1XA 4JDSA 5CR2A 2JTEA 2C0OA 1R9LA 2XXXA 3KGCA 3VVDA 5H8FB 4F29A 2EJ9A 2KE9A 1BIAA 1NFTA 4GY5A 1B7UA 1K9YA 4GWWA 1WFWA 2A5SA 1Q81R 3QJYA 2ZZXA 3OO9A 3E78A 1BBZA 1LPLA 2OTLA 4GWYA 2VGMA 3OMGA 2XX8A 4ECFA 1TWYA 3EPEA 4JDFA 1MXZA 3DP6A 4MAGA 2JZ2A 3OO6A 1NH7A 3OS0A 4N4HA 2O1LA 1YI2Q 2LT1A 5AA2B 1NEGA 4M78C 3G7ZA 1MXXA 1ZHIA 1QP3A 1B3GA 5CKFA 3J81E 4E7KA 2QPQA 3CVGA 3IOWA 2XHCA 2JJKA 1VQOT 3OELA 4JWXA 5FHNA 3FVGA 4OMPA 5EYGA 1VQ6A 4PJOC 5ELVA 2ZNSA 1RAIB 3U72A 3CCQQ 2XWKA 1URGA 1M1KR 4PFYA 2HQHA 2XDPA 1NNTA 3CCJT 3SDZA 5GAOm 4AFSC 4JB7A 2M8CA 1JJ2P 2JM9A 1POY1 2QTVA 1OOTA 4R0KA 1VQMQ 2DXCA 3L2QA 4J5YA 1VQ4T 2DJZA 2ABHA 2RM4A 3S3MA 3QAXA 3E19A 2DL3A 3CCMA 4M7DF 4FECA 4N6KA 4E0WA 4EUOA 3S9MC 3EHTA 2B4LA 3A3CA 2MYSA 3GXAA 3OXNA 2XDDA 4OXVA 1NEBA 1UIUA 3RGYA 2QMWA 2OAWA 2YUOA 1VQLA 2ONKE 2ZYKA 1BCMA 1FW0A 5I56B 4OETA 4X48A 4JUVA 4OVJA 4M77C 5IHKA 3CCUT 1FTKA 1VDWA 3QHSA 2ATCB 4C0GA 3RBBB 4V2SA 2F78A 2P2AA 1RADB 2X4YA 1FPGA 4NF8A 1LBBA 3JCMX 4U21A 1FXXA 3UATA 3R7XA 1UIVA 3H6UA 2BTTA 1RAHB 3I56A 1D09B 4MMLA 1JXMA 2XWOA 1TU0B 3QK6A 4NX1A 2PZ1A 1LCFA 5GAN7 3E9FA 3RTWB 2CP5A 4HVWA 3FXUA 2LJ0A 3BFMA 1VQ5A 3R26A 1Z9QA 2RJCA 5IAYA 1JP4A 3H7MA 3ILUB 4PQJA 1VQNQ 1R9QA 5F24A 5KCHA 1VYUA 3JCMP 3CCSA 3IJXB 5ET8A 3U23A 3UGWA 1B58A 2SRCA 5TPAB 2RI3A 4UC4A 2I4CA 1VA7A 3O6GA 4BUGA 4F7UB 4OERA 2DRMA 4IB2A 4C5EA 1MY0A 3QUJA 2EFIA 5I57B 1NV7A 1WGSA 3P8DA 1N27A 4G68B 1T3LA 3A09A 5IXFA 1BK2A 2F5TX 4ZEFA 1TS9A 1I81A 2CZ7B 3KC1A 3LWIA 2F5KA 2M0YA 4JRPA 2K5FA 3HFNA 1PSEA 4XK8E 2IG0A 1Q86U 3H06B 2R6GE 2ABLA 2PU9B 3LH5A 4RPOA 3CD6Q 3RY3A 5KYNA 1N3WA 1MNEA 3VE1B 3RPWA 2EKHA 1X43A 2D21A 2ZMBA 2FL7A 3C4MA 4YMBA 2ZPIB 4XF5A 1N5ZA 3CCRT 1JXOA 3FXRA 4AG1C 4IY6A 5LJ5f 2DXYA 2COZA 2EYWA 4FL6A 3FJGA 2KYMA 4PLIA 4A53A 1NM7A 2RC9A 1NPRA 3CMET 5IAIA 2WBBA 3I5OA 4P56A 4RCCA 3OW2A 3UK4A 3CC4A 3SKPA 2PYYA 2W0ZA 4EQBA 5H8NA 2HKQB 1LFHA 3LGFA 4RK2A 2E64A 3I6VA 3E79A 4HCKA 3IX1A 4LD9K 3KSXA 4ELOA 3RESA 1OQHA 1MQIA 2QS1A 4PJOB 3C36A 1G3SA 4JVCA 2ANJA 3CC2A 3CMAT 1WJRA 4CC3A 1GGGA 2OBGA 5LDZA 2B4MA 2KI7A 1GBQA 1QWEA 1KZ8A 4N17A 3LLRA 2RD1A 4MZMA 4RTWA 2RCBA 4QFNA 4LZ8A 3BFUA 3H41A 3HO7A 2JN0A 1KIKA 1XOCA 3EGDA 2V3TA 3SHWA 1B3EA 5M2VA 3K1MA 4ZEDA 4E7HA 4PE5B 1GFCA 3NOHA 2VVKA 2IIMA 4FW2A 3ASKA 4OP0A 2XDBA 2D0NA 3G3KA 4H8IA 2J6FA 3G6EA 4C1TA 4NF8B 3PFSA 4PFZA 4WEPA 4DEXA 4OB1B 3OA6A 1MXYA 3H3GA 4WEDA 3VUBA 3PGGA 3E13X 4EPCA 3RT6B 1SSFA 5GAOp 1NUXA 2R5MA 2XXRA 4ME7A 2LMJA 2E70A 4NF4B 1B46A 1O64A 4YTLA 1YP5A 1IB8A 1CKBA 2PFYA 4KR5A 2A37A 5I2KA 1AOVA 2EPDA 3TAJA 3A8LB 4M77B 2AZSA 5GAMg 3PMTA 4WXJA 3EF7A 3W9VA 2O31A 4GWUA 5DLQE 1NLPC 1KD1R 1BU1A 4PJJA 4M7AD 2MMPA 1DTZA 2A5TA 2CSQA 1B34B 4P47A 4RPNA 3IORA 4DIGA 4AFQC 1II5A 2YHTA 4E47A 2DVCA 4HT9A 3QZ5B 5LJ3g 5GAMh 1B0LA 4HS7A 4MLQA 1LCTA 2AT1B 4ATOA 5DW8A 1NG2A 2AL5A 4NL2A 4EXLA 3RKXA 1LEVA 1QMCA 1W2BP 2Q2AA 2P3VA 3LGLA 2PTKA 2ZCFB 1NUZA 3CRBA 3OO8A 3F70A 4OESA 3N94A 1FJ6A 1KWHA 1PKTA 4EF2A 2LC4A 4PJNA 3LX7A 2XKOC 3HTRA 3MHXA 4C0DB 5CK9A 1LFGA 3EG9B 4PETA 3OYDA 4J9HA 1OQKA 1K9MR 4OMBA 1D3BA 3OBWA 4PFWA 3LV0A 1U3OA 4R73A 1DPEA 4YB5A 2JS2A 1VQPT 4GWOA 1FTOA 4FYYB 5AA3A 1ZQ1A 4CC2A 5CQYA 2KK4A 1AMFA 3CC7T 4YMAA 3EKIA 1Q9DA 3TTKA 3X24B 2CZ6B 2D6FA 1MH3A 2DS9A 4PGPA 2M02A 1EZPA 4FJPA 2CZ1B 2RI2A 1MV0B 5GJWB 4HE0A 1FRPA 4R75A 4O5VA 3RYDA 5HM4B 1Y71A 2Z8EA 1D1AA 2XXUA 2YT6A 2IEEA 2YDLA 1IMBA 3VLUA 5CO7A 3QYHB 1YJWQ 3O29A 4H8JA 1JBMA 5LL6S 5FWBA 3C34A 4POWA 2XXHA 3FJMA 1DPPA 4BDMA 2K7AA 3VS3A 1GV8A 2QJEA 5FRMA 4DOWA 3PPQA 1LGBC 1OULA 1G5VA 1AZEA 4OVAA 4DBHA 2E5QA 4M7AF 3OYLA 1YYZA 4PFPA 4M7AE 2JTMA 2Y4XA 1C0MA 2HSPA 1JEGA 2EQJA 4XKRA 2PVUA 1G3WA 2QS4A 1TXFA 2QAZA 4LXCA 4TQUQ 2DAQA 1NYGA 2XXTA 2HL5C 4QQGA 3CCLA 1FTAA 2VD2A 1LCKA 3S9EA 1V29B 1Y07A 3Q29A 4J9EA 1K8AC 2X4JA 4BY6C 3LBSA 3EGDB 4POXA 4GX3A 2QA4Q 1NKXA 3E4RA 3L2RA 3N26A 4XAXB 4N81A 3U92A 5KCOA 2Q88A 4RY1A 1MQDA 1WHLA 4PFTA 1D1CA 2VV5A 4FU6A 4ZNXA 2CZHA 2QVVA 3UA7A 3CR9A 1VQ7A 2I3VA 1GL5A 4JJCA 4E7IA 4GL8A 4ZZEA 2EYXA 1HYOA 5I22A 3CCEA 2LVMA 2I0CA 5ITOA 2D8JA 2J7IA 5GMKh 2DEUA 4ELRA 5CMMA 2H8HA 2ZYNA 2V8IA 3ILTB 1A55A 1WYXA 1TUGB 1L5TA 3M53A 3WAFA 2YRVA 5ECAA 5FHMA 4RTUA 2QQSA 4NHBA 5GAMd 3VS7A 4FATA 2XU8A 1X2KA 4F17A 3H8ZA 3CPWS 1RDYA 2AZVA 4X34A 5A0GA 2E1HA 2HNIA 3AHUA 3I5SA 3PD8A 1AWWA 1N84A 1IMEA 4AQ4A 3O6HA 4PJLA 1ARKA 4X8RA 3K6XA 1NPPA 3HKSA 1CE2A 1S50A 1MDQA 1OU8A 4XIGQ 3NTIA 4R9GA 3RUMA 4NF0A 4PAKA 1WDXA 4G8MA 1UTIA 2HZKA 1BLFA 1ZIUA 3DP4A 4U1ZA 4PNOA 3VS5A 1MPBA 2KQZA 3K2DA 1KJWA 3FB9A 1QVFA 2Z23A 4H67A 2V93A 2QK0A 1WHKA 2BUDA 5FU7B 1M5CA 3H4ZA 1IEJA 4C8QA 2FO0A 2ONRA 1SI1A 4IUVA 1QKWA 1YHQA 1D3BB 3UN6A 2CT3A 1UE9A 3GYYA 1X01A 1RLPC 2I0NA 3NPFA 4EDPA 3SZPA 3CCVT 1OLCA 5CBRA 1NLOC 3M0SA 2JTFA 1PEBA 1Y4CA 4U23A 3NTHA 3URGA 1NI9A 4IGRA 5LJ5e 1HJDA 3CI8A 3T96B 1B7HA 2RQVA 3JCMJ 4MH5A 2KRMA 3CSBA 3EGXA 3MEUA 3RPLA 2D9TA 1DMBA 1WXTA 3CCJQ 5A5XA 5GAMf 1QVPA 1KQSS 3OYNA 4JWYA 3T1BA 4F19A 4J9DA 3G3FA 4GX4A 5FTIA 2E65A 3V8XB 2LCLA 2FRWA 3N5BB 3TSWA 3UIFA 1YWOA 1D3KA 4QSEA 1TG0A 1UHFA 1QKBA 5LJ3f 1UTBA 5JTYA 1WA7A 3JCMc 1BIYA 5GAN5 1VQ4Q 1MV3A 4NAPA 2R9JA 2CZIA 4F14A 3K6UA 1USYH 4IY5A 1NNPA 1VQ8A 2V84A 2HAXA 3OYGA 1G3TA 1S72T 4MBPA 2GRVA 4C92D 3FD3A 3LUZA 4R9FA 1QLYA 1TWBA 2DIGA 4PE3A 4XKNA 1YJ9T 2DM1A 2RJDA 3BIHA 4YB6A 1YITA 3CBMA 4B6MA 1QVFP 2XWIA 1BKAA 1NV5A 3IR1A 4KYDA 4UABA 5HPQA 3QDFA 3GBBA 3CCUQ 5KYUA 4YB7A 1P1WA 2DXBA 3A8GB 3CFXA 4IO3A 1U5SA 2JS0A 3QG1A 2OTJA 4U4XA 1M27C 5GAOl 1LOJA 3MVWA 4KQPA 2QDLA 2COWA 3SEMA 4BY6B 4H46A 3TEPA 2JOYA 1UGQB 2RPNA 1NV4A 4NN3A 4LDWA 4H65A 3PUVE 3A5ZB 3BY7A 1UHCA 3KFMA 3OW2S 2BIVA 5D6XA 1XI6A 4N8GA 4ZGEB 2F7AA 4I40A 4BDQA 4DBRA 3ROJA 3VU3C 3FBPA 3FJ7A 3TPAA 1YI2A 1Y1ZA 3H0FA 1OZ2A 2E6NA 3B50A 2P4TA 4C0FA 1U1SA 3K01A 4OA4A 2W7YA 4HCZA 4OENA 1AWBA 2HBPA 3T22A 2VWFA 5H8QA 2GNCA 5C0MA 3X20B 3IL1B 3HP9A 3RKYA 2P0PA 4KXPA 1QVGA 3IO4A 2RF0A 2V1QA 2D0QB 1A0NB 3HHTB 2LQWA 1NE8A 3CCQA 1BIBA 4G77A 2CH4W 1WQWA 3JB9F 4GOTA 4RMOA 3H0HA 1O75A 4C92F 1W1FA 1ZLMA 4MMKA 3V8KA 4C92E 1VQLT 3IOTA 2X35A 3PGFA 4N0AC 3DP8A 4TOZA 3MBPA 1UDLA 1I0CA 2DXUA 3F11A 2QASA 2VYTA 2QL3A 3UT1A 2NWMA 5CAIA 1MH4A 2DYXA 4IUUA 1LAHE 2AIXA 3CBPA 2HD0A 3ULRB 5AA2A 4VUBA 1YJNT 1VQMA 1B2HA 2X7PA 4XTXA 3ME9A 3MPUB 2A3LA 3CCRQ 2L0AA 5KYWB 3N6UA 4LDUA 2ZNTA 4F16A 1MY4A 4GWSA 4HCYA 1H641 5K2XA 1NNFA 2F5XA 4LDYA 3V8JA 3N5LA 1JB0E 4ZE8A 2DE4A 3U1OA 1IXGA 4DEYA 3OSSC 3RPLB 3HL8A 3SB2A 3CMEQ 1YN8A 5A5XB 4MNIA 4LONB 4M7AG 5EQ9A 5L8RE 1K9MC 4PJMA 3K1PA 1HSQA 1EZZB 4C0RA 1RABB 1QQJA 1FBGA 4X1VA 4XTYA 3CCST 1IZ6A 5CMBA 1H8KA 2H98A 1INPA 1M30A 2KT1A 1UTBB 2WBDA 5JTYB 3SETA 4ZN3A 1PNJA 4OFOA 2ROLA 1MPDA 4QXDA 3OQ5A 3SD4A 4DCYA 1Y3NA 3GP8A 3CMAQ 3V7SA 3T9VA 5KCJB 2EWNA 3TQLA 3CBOA 1E6GA 3WAEA 2P4RA 1MGQA 3M9QA 1W6XA 2XXPA 4OEUA 5IZ1A 1KQ1A 1BTJA 4J7FA 4GQOA 3MQ9A 2HHMA 1WXUA 5AYFA 1GXIE 1MY1A 1VQNA 2M16A 2EYQA 1GCQC 1B9JA 1ZUYA 1M90R 2DK3A 5GAOn 4U2RA 2CP0A 1D0YA 4QQDA 1PD0A 5KYUB 2OX3A 4ND9A 1MY3A 5I56A 1XT8A 3Q25A 4MJOA 4OMFB 2L89A 4LVQA 4JRQA 3K4UA 3JB9J 3EGUA 1Y3QA 4NE4A 4M75F 3UA8A 4YU0A 4P1LA 4MNCA 3T9XB 1JNFA 1K73R 2X7QA 4XU0A 1Q95G 2M1HA 1TXQA 4AS5A 4FAJA 1TUCA 3VRZA 2KXDA 2PT2A 2R58A 1UTHB 1EYKA 3WVDB 3IQLA 3LSXA 3TUSA 1KC8R 4QW2A 3L2WA 3O6IA 1I4K1 2MI6A 4F1VA 3L2UA 2J05A 5DVFA 2EQKA 2H25A 3PPPA 4XXUA 5GJVB 5LJ5h 2BJJX 3CD6A 1JQQA 5TPAA 3T93B 4E0XA 4HKEA 3PMIA 2QQ9A 2VPNA 2GQVA 4M7DD 4F7UA 1PB7A 1XNIA 2M9UA 2DRKA 5H8QB 4DXBA 3TCGA 4MZTA 5GAN3 5HY6A 2VPOA 2Z8DA 3CC2T 2CP2A 4G68A 4D8DA 1M3CA 3C32A 2YPNA 3CG3A 1C1AA 3CG1A 1UGVA 3QUIA 2PMSA 3MPKA 4M7AC 3INZA 2DBMA 4DA4A 1N8RR 2DMOA 2QEXT 1AOJA 1EU8A 5J39A 1S1NA 2DXTA 2KSSA 3TVTA 2CEXA 1GRIA 3ODBA 4YKKA 1VQPQ 1IREB 3T66A 1M3BA 4RYAA 1NBEB 2MCNA 3KOSA 3L42A 2ZPEB 4Y28E 3CC7Q 4EMKC 3RQTA 2B3BA 1NZ9A 3G6ET 2JW4A 2KDSA 4JS4A 1I5LA 4B9WA 1LBYA 1QUKA 3MVYA 4K11A 3OYJA 1SVXB 1F9BA 5GAN6 4TVRA 2HAUA 4XTZA 2RHYA 5GAMe 1FBEA 4XEQA 4F2QA 3SEVA 2MKZA 3PPOA 2KGTA 1SEMA 4NQ8A 1UFFA 5CKHA 4PFRA 3MZ1A 2FBPA 2UVHA 2DTHA 4JSOA 3UP9A 3TSZA 1YXIA 2QVRA 4M78A 1WI7A 5LJ3e 5CMKA 3PPNA 2CDTA 3MJXA 2NWJA 4NOYA 1B3QA 5I2MA 4LQ2A 4XTCQ 5A0LA 4FW1A 4PJOA 2HEQA 4C8QF 4JXIA 2PBWA 1RAEB 2O88A 3TKDA 3JSCA 4KCDA 4M7DE 2E4HA 3S4UA 3B6TA 2WX9A 1FPDA 4OVRA 3PTAA 3KFVA 1T0KA 3OEMA 3VS4A 1Z7ME 3M0UA 1P1NA 2E1SA 1URDA 5GANg 2CT4A 4GLKA 1B1XA 4AFZC 1IZ1A 4PAFA 2AKKA 4ANJA 4N8YA 5M9OA 1FQAA 4BACA 4OANA 1GR2A 3B8BA 5J26A 5GANh 1R0BG 4MCOA 4BD3A 2ECZA 2V8JA 2M0OA 4OWDA 1Y96B 2O2OA 3TODA 2HEUA 4NF4A 3FUZA 2KY9A 5LJ5d 5IN1A 1FYNA 1FQDA 1FBDA 4XTVA 5L23A 1B7ZA 3QWXX 1JETA 3RTFB 2I3WA 1MM6A 1FBHA 1IO6A 2F35A 4M77A 4X04A 3LWHA 2NUZA 2E0SA 3NGPA 2ZXTA 3BBRA 4GIZA 3M57A 3OYEA 1YCJA 2QQBA 2DE2A 5I59B 3C4SA 5FROA 1B34A 1VIEA 2DFUA 2EJFA 1G83A 2F2XA 4LUDA 5FLXE 1VSOA 4UACA 2Z22A 3MC2A 2JMAA 2CREA 2XD3A 4O3AA 3K6VA 2I48A 3OS1A 3FDRA 1WX6A 1LAGE 2K5IA 2B86A 1K9MU 1ZSZC 1DJ7B 1VE4A 4MNPA 4C92G 4HTGA 4O7IA 3DKMA 4I3YA 5BUUA 5D7UA 2E5KA 2JXBA 5B7DA 4KPTA 1RAFB 2ED0A 1WDNA 5GAN8 1YJWA 3M0PA 5KE2A 1PRLC 4F3PA 1UG1A 2CS7A 3EG9A 2JM8A 2DPPB 5GMKe 3C12A 5AA4A 3VLWA 4A4KA 3GPLA 5C6SA 2QTXA 2HXRA 4ZE9A 2K3BA 1ATGA 3CCVQ 5BWJA 2J06A 4WF2A 3CHGA 5DVIA 4XKPA 2H3EB 2DOJA 1MMAA 1Y3PA 2OCUA 3GBAA 2XX9A 3T9UA 4XU2A 1ZJLA 3JB9H 4X1BA 3X25B 1EZOA 2JJ9A 3OYMA 2LQNA 1FX7A 3META 2VXFA 4GLMA 1MQJA 4FE8A 4JWOA 4A4HA 1SD3A 3OS5A 3EHSA 1OPKA 3TTRA 4NF6A 4PC9A 3I35A 5KH6A 2X3WD 4FSSA 1SRLA 3BDUA 2QA4A 1ZLQA 3GIBA 2RINA 2DL8A 3FGSA 3GLBA 5GMKj 4EMKB 2LX9A 4KRTA 5JK4A 2YUQA 4M78B 2HQ0A 1SYIA 2YUPA 1KHCA 3V8LA 1IXHA 3KXTA 4NWCA 1NJIR 1SRMA 2K3YA 3TEEA 3HRUA 1SI0A 3HV1A 1W2BA 1S72Q 2GTOA 1FWZA 4NTLA 2ZPGB 4LP2B 5ISUA 1LLSA 1WPYA 3ZSFA 1YJ9Q 4HA8A 4D8KA 2QG9B 5A5LA 1OX8A 2RI5A 1T0HA 5GAOq 1LJOA 4XKQA 3KJTA 2X3XD 5GANd 3MKDA 4R6YA 3EFRA 3D4GA 1HSLA 1MG1A 2HZLA 3MAMA 3PTYA 1GCPA 4J9GA 2ESWA 2MAMA 1FJ9A 2NUPA 3FXQA 2DIQA 2O4XB 3FC3A 1M5FA 3M3KA 4E7LA 1IMAA 1M5DA 2PVDB 4QVCA 3HPIA 4C92C 2OLBA 5CRYA 2F6GA 4OQOA 1Q7YR 3ECRA 2X4XA 3T9NA 1VUBA 5EHMA 1VOMA 4Z89A 2PCRA 2R57A 3Q28A 1E7OA 2ZAEA 1NH8A 2Y5KA 3FJ5A 2VP1A 3UF4A 4ISUA 1P1OA 3S2VA 2F3BA 3EAEA 2RN8A 1B3FA 3RN8A 3D7SB 3W15C 5I7IA 1Y0MA 3PD9A 3BIGA 4F22A 3HRTA 2FZKB 4F3SA 4PFUA 2FVZA 3I55A 4GD5A 4O8MA 2G93A 1QCOA 5HCKA 4ELZC 2PFZA 1VQOA 1MHNA 2XWVA 1K73C 2QQRA 1PCXA 2HQEA 4XFEA 2G29A 3HHGA 2HCAA 3CCMQ 2CUDA 2YXYA 3OD7A 1EH3A 1WLPB 3VXBA 5CIUA 5LJ3h 4OB2B 1IIWA 4ONYA 3PUYE 4GVOA 3IOVA 4F04B 1XJWB 4J9IA 3CCJA 1XOVA 1VQLQ 3O66A 3PIOA 2UVIA 4A4GA 4YKJA 1PSFA 1YITT 1S9TA 5GANf 5J16A 2KR0A 4LN5A 1WNLA 3LC8A 2KLFA 2DZ9A 4U1OA 1SW2A 4GBWA 5AA4B 2THIA 2GFAA 4ZZAA 4HVVA 4PL6A 2MWOA 4RTTA 1YJNQ 1D4NA 3EH1A 3G71T 1VQ4A 1ZSZB 1VQKT 1ZTYA 1IRXA 2DBKA 1U06A 1Y9UA 5T3JA 4NWDA 4OMLA 3I56Q 4IGTA 5CMCA 2VT5A 5EYFA 4Z88A 1IMFA 2F69A 4LNPA 2E10A 3E9XA 4J6WA 1OV3A 4H1XA 4YKIA 3IB0A 3KBRA 3IJOB 4DI3D 3X26B 2YLBA 3B6QA 2Q89A 3HCQA 2O6AA 4NF6B 1J3TA 3GNGA 3DLMA 2WYPA 1N8RC 1JJ2S 4CI0C 1X27A 1MS7A 1PD1A 1Q81C 4F7UF 3CCUA 1YBYA 2ZPFB 3CCSQ 1VQ9T 5I5PA 2JUFA 4I8CA 2HDAA 2L3SA 1MXUA 1PBPA 2JNGA 5DM7R 4R6HA 2WSEE 1R6ZA 5L8DA 1H3DA 1VIFA 4M7DG 3TDJA 4R74A 4WCIA 3TTNA 5CM6A 2VB6A 4IO7A 4TLLB 3T0JA 3LH0A 1H43A 3GBQA 2PUKB 3DM0A 5EHSA 4P5NA 4PTKA 5IXBA 2D5WA 2F7CA 1X69A 3FXBA 1G8XA 2RQUA 4K3FA 1P1QA 2ESNA 4QRZA 4IO5A 2X51A 2LTOA 4LN2A 1M1KC 2KRNA 3JV9A 1PHTA 1QVSA 1NNKA 1NMUA 4P11A 1P92A 4OVSA 2Q74A 4AB6A 1MQHA 5D6WA 4E7SA 1MXWA 1KHIA 2F97A 3V5AA 2ZYMA 5ET6A 1M5Q1 1RLQC 3JB9I 2LX7A 4PLLA 4C5HA 2NVUB 3OYBA 3PMXA 4H6DA 3SWNC 2NUPB 1E6HA 2AK5A 4QVZA 3JCMW 3UPUA 4P9KA 4GXAA 3VVFA 2OX7A 5CQXA 1P99A 1ZUKA 1YAEA 1TH7A 2O9VA 2Y7PA 3OO7A 4HE2A 2XIDA 1LNXA 2ENMA 3CXCP 4KT0E 5IZZA 1XTDA 2KQWA 2QFLA 5AT1B 2CEYA 4PJOF 3MCAB 4JBZA 4EQ7A 1SW1A 1NV3A 3MYUA 2L2PA 2MWPA 4R2BA 3FRNA 4F1YA 3O97A 1OVTA 5LJ3d 3TCJA 4ELYC 1G3YA 3L1AA 1HSJA 9ATCB 4FCYA 3G3JA 2KXCA 4ZEIA 3CC2Q 2K5LA 4R56A 2LNHB 4DDDA 4F31B 2L5QA 3O8VA 3C94A 3C0CA 1VR5A 4M1VA 3TCFA 4Q0CA 3CMEA 3H6WA 2PUOB 1FTMA 2QEXQ 1BI1A 3QIIA 1B05A 4RG8A 2NUVA 1B52A 3FVOA 3L6HA 3FJPA 3OEKA 2NUTA 1YFNA 1Q82R 4BI3A 4FYWB 4F2OA 1SKUB 4OVQA 5DY9A 1EFNA 1NUYA 5DEXB 4LZ5A 1H45A 1TFDA 2I49A 4M7DC 3G6EQ 1ABQA 3BFTA 4F3GA 3I9QA 1AHJB 1AT1B 3NTKA 4PDDA 3EQ1A 3CMAA 3G4ST 4X1DA 3CSGA 4M77F 2OJ2A 1QKAA 3W9WA 4ESWA 3EG2A 2GCXA 4EIKA 5KYWA 2DF6A 1UJYA 2DDKA 2RHUA 2EGEA 4ZECA 2B3FA 4KBMB 2BZXA 3MZBA 4HCWA 3ZL7C 2O69A 2CKKA 2Y5LA 3FIRA 2L3QA 1FPBA 3K0VA 1EIFA 2B65A 3Q26A 4GL0A 3UORA 3KSJA 5HK0A 1UGSB 1EZ9A 4JJNK 1MNDA 3SFMA 2XA5A 2RMOA 1S7YA 3V89B 5I2SA 5ICQA 3JAME 4BI4A 3P8HA 3ER0A 1MRPA 1QKXA 1OMPA 4AS4A 1N76A 1YIJT 3PU5A 4IR8A 4ELQA 2FHYA 5KCJA 3S3NA 1FPKA 1JW5A 1OPLA 2PVGB 5KYYA 1SW4A 2VHAA 1I6BA 2KBTA 4G61A 2EYZA 3JB9D 1IXDA 5LJ5j 1IGUA 3MVXA 2RK2A 1DTGA 1ZU0A 2CUBA 2I6EA 4LUEA 2J6OA 3OYFA 2GQ1A 2QGFB 1H44A 4DBFA 2ZYOA 3MEWA 3GOXA 2FZCB 1K73U 1ZMGA 6AT1B 2H4IA 1M5EA 4PFIA 1WJSA 1WZOA 2P0SA 1Z9ZA 3OS2A 1OYXA 4G8NA 5EQAA 2OTLT 4ZGJB 4RUGA 3OYAA 1NJIC 2Y4YA 2Q8JA 1R8OB 2EGAA 5L9OA 2LT4A 3H6ZA 3SERA 1Q1KA 2QI2A 4ZEBA 3CFZA 3EHRA 5CKBA 3VKIA 3FATA 1Y4TA 3PMVA 4IO4A 4FM4B 4HCCA 1Y1MA 3OMBA 2JT4A 2P0KA 1JRIA 4KCCA 4BE2A 2RHIA 5AE4A 1X75C 1US4A 2F34A 4YAHX 1SPKA 3TQWA 1VQ6T 3BW1A 1UTHA 4ZEKA 5IT9E
chains in the Genus database with same CATH topology
3TELA 3UDCA 1WJQA 4OHNA 3SWNB 3E3KA 3LSWA 1N0TA 2LAOA 1SW5A 3QO3A 3CC7A 1W2BS 2A7YA 4QQ6A 3VLVA 1N8RU 3C95A 3QIMA 4JSDA 1Q81U 2EKOA 1YPNA 1YCYA 1Q7YC 2B8AA 1DOTA 4KI0E 3HSTA 4L6V5 1KQ2A 1RYOA 2O1MA 2FVUA 2XG8D 4ZTJA 3CCMT 4KYSA 1PB9A 3A8HB 1URSA 2VXEA 1I69A 1AL3A 1A8FA 5GANe 1KD1C 1UGRB 2LRQA 5A0DA 2QS2A 3HSBA 2LDMA 4M75D 4RNSA 4J83A 5I58A 1US5A 3PPRA 3TCHA 2HXWA 1P1UA 5D6YA 1FQBA 3THIA 3TODA 2AYSA 5GMKi 2I0BA 3JYRA 3VJPA 1BP5A 2R5AA 3VYHB 1M1KU 3LW5E 1WVJA 2NXOA 4JRKA 1B32A 5CCAA 4PKCC 5GMKm 4G8HA 3FVNA 3I56T 4BI8B 1Y20A 2CYZB 3EHUA 2O7UA 2Q2CA 3RIRA 4N0AA 3KUFA 1VQ5T 3IO6A 1LB9A 2PVOB 2ZGWA 4OGCA 4M7DB 2L3RA 1FQCA 2XXIA 4EF1A 2QXFA 2ZNUA 4ZN1A 4MZPA 5JEIA 4ZTFA 3M54A 2LQKA 2DKGA 1GVCA 1MPCA 4IURA 1OLAA 2F7BA 4DXCA 1ZKBA 3O28A 2ONSA 4JLIA 3OBYA 3RNNA 1A99A 4BE1A 3N6TA 3E9GA 4C1UA 2K57A 4OZ9A 3BKIB 3KN7A 1RL2A 2QRYA 5DYHA 3H6TA 3HFOA 3PUXE 5HKCA 2FA7A 2DTOA 3ZKLA 1I6AA 5FRNA 2DEQA 1B6HA 1PC3A 2CMOA 1QP2A 3MEVA 1LAXA 4GRKA 1A8EA 3IK6B 4M75E 3HRSA 2RJEA 1M1FA 1Y96A 3ZS6A 4ZS9A 3KJ7A 3P8BB 3OSRA 2OK2A 1IQ7A 3VV5A 3SEXA 1O63A 4X9TA 2G3RA 2XI9A 5I59A 2DO3A 4MLVA 2O01E 3JCMg 5F1QA 1UGPB 3CC4T 3CCVA 1VFDA 4EQ9A 3KN8A 4C8QD 2XXYA 4ZGDB 5KZTA 2RKMA 4NS5A 4UA8A 3JCMh 3OYHA 5J3BA 1OZ3A 3M4YA 3CPFA 1JQFA 3DELB 1LFIA 4I1DA 4IUPA 4OFLA 3SESA 1HSEA 3P7IA 3TTLA 2DXRA 5I58B 1MQGA 4G4PA 3SDFA 4THIA 4OB0B 3SEWA 1QUJA 3OYYA 3MWBA 1S72A 1D9VA 5CC2A 2DVZA 2KMTA 2VOZA 1ZBMA 3ZFJA 5FTHA 3OB9A 1YJ9A 3VYGA 4P0IA 4FEDA 3TZAA 3TTMA 1FTLA 1AIVA 2WSCE 3M56A 4L5GA 4M7AA 3LUYA 4GLIA 1QW1A 1NJIU 2CZLA 4XTUA 1N9SA 2OWSA 1Q82C 1LAFE 3QZ9B 4F39A 4QSCA 3PUZE 4EMKA 1PB8A 4O6JA 4EDUA 3I55T 2EIFA 5J1DA 1BI0A 3QYTA 2REJA 2DWHA 3C31A 2O68A 3G3HA 2EJGA 2LNVA 1QVFS 4C8QE 2E6ZA 2ZPBB 3TREA 5GAMj 2DD4A 5I2NA 4QFLA 3CPWA 1JVXA 2YJPA 1Q7YU 3PNWC 1O9SA 2H5YA 1J1NA 5LJ3j 4M4GA 1LBCA 4QHQA 4HW8A 3KOTA 3RT8A 4MDXA 2O4XA 4J6XA 1M1GA 4OB3B 1KD1U 4C5IA 2PX1A 3K1NA 4FIMA 4KYEA 4Q30B 3C35A 3VUZA 3USDA 1B1HA 2D3IA 1N7WA 3IOUA 2GHBA 1U1TA 3JCMV 3M59A 4OFJA 4IKFA 3JCMd 5L9SA 2EQUA 1SQYA 2V25A 1YJNA 5CBSA 4Y91A 3KBGA 4LD6A 3OSVA 1FQEA 1ZBXA 2Y7WA 2WACA 1OI1A 4R55A 3JB9G 5AA2D 1AH5A 1JEUA 3QPHA 4KUDK 4F3BA 5B70A 2FHDA 4NF5B 3O9PA 3CCLT 4QFKA 4QFOA 4A54A 5GAOr 4ELPA 4BDOA 2FYIA 3FEOA 1KQSA 2RC8A 5L9MA 4C0DC 4QVDA 3CIJA 2V3UA 3R6UA 5GAN2 1JEVA 4QF9A 1D9YA 1W4SA 2PT1A 2XHDA 2NLUA 1VQ7T 3L6GA 3QBYA 2DD5A 4PP0A 1N3XA 3T9HB 3CCET 1B5HA 3AXFA 3PV0E 4M7AB 4RK9A 1IXIA 2I4BA 3HHFA 3GLXA 3B6WA 4LA9A 3TYHA 4N13A 4U4SA 4EMHA 1USYE 3V7CA 3DLLA 3E1SA 5FHOA 2RA2A 3JCMf 1SDXA 1UQWA 2P1SA 4BLAA 1HXDA 3G7WA 3RUXA 2XICA 2C06A 3Q1JA 4HCBA 3G3IA 4N6PA 2ALUA 1QVGS 2E12A 3OY9A 4O3CA 1Q35A 3WVEB 2XX7A 3VV0A 2UVGA 1B5IA 1MY2A 3RKWA 2UXAA 1PDAA 1OIBA 5DVJA 3FV1A 1HK9A 5I2NB 3QUFA 4O3BA 4M75G 2IA4A 3M55A 3QXEB 2Y7KA 3FV2A 2VD3A 1B0HA 1YHQT 1NL5A 3QDRB 4BDNA 4L17A 3V83A 2HAVA 3JZJA 3HN0A 5K2YA 2GFUA 5F7VA 1FTJA 1X6OA 1FQFA 5ITPA 4QSDA 2DZCA 3O2AA 1ANFA 3JCMQ 2QEXA 5CI5A 3QXMA 1M90C 2VUBA 1JW1A 2QQAA 2FYKA 4LATA 4RKUE 3OYCA 2DVEA 2VC8A 2RH2A 1H3ZA 3MZ9A 4C92A 4R72A 1YTVA 1Q82U 3Q27A 1B5JA 3LR1A 4XTWA 4OYVA 5GAN4 4OEVA 1VQ8T 4FEBA 4EXKA 2MF2A 2V8KA 4IUTA 1M5BA 4KD5A 2Z8FA 1KC8C 1QJMA 1M4ZA 3PMWA 5FU7C 4I62A 4KUIA 5DEXA 4BDRA 2RO0A 2DTIA 1RYXA 2O51A 4M78D 2OTJT 2REGA 2XXVA 3VVEA 4XQ3A 3K02A 3RERA 3VDFA 3FASA 4H5GA 5H8SA 4R2FA 3CXCA 2O84X 4CRIA 1A7LA 3IB1A 1XVXA 3U93A 4PJOD 2VGNA 4ESXA 2NOOA 1H76A 3M3FA 5CKEA 2XD2A 4M75C 1IXCA 1QULA 1UB4A 4F7UE 4C0ZA 3QKJA 4NMYA 4GF8A 4C8QG 3ZBDA 5DLOA 2AL4A 3QYGB 1A54A 1RI0A 4Q5WA 1YI2T 5ICTA 3QJ6A 2CGHA 2I2LA 4DXUA 3MJNA 1MXVA 1QW0A 2OJTA 4LDVA 4MF3A 2DQVA 4M75A 4EMGA 2GFEA 3S9NC 2YLNA 4J8OA 4NL3A 1POTA 1B3HA 5GMKl 1BKBA 4OF1A 3CCQT 3FZVA 2P0QA 5H8NB 3TMGA 1U8RA 5CVIA 3PIPA 3H03A 4F1UA 4M77D 1XHYA 3PT9A 3KN3A 4H0WA 3UWNA 1VQMT 2PQWA 1SBPA 2ZZDA 4R6KA 3G3GA 4M78F 5I21A 5TP9A 3QSLA 4M78E 3DB4A 4KFQA 1B4ZA 1B3LA 2F8DA 3I3VA 1FCKA 5AA1A 4DCXA 2WSFE 3SWNA 2R71A 4BDYA 4PJOE 2XD0A 2XK0A 1BI3A 5DT6A 4LUBA 3MP6A 3L2VA 4C92B 3OMCA 3TFLA 2KVQG 4A4FA 1XC1A 3CCRA 4LQ5A 3HPWA 2HFBA 4KHZE 3OYKA 2H9BA 3KG2A 5I2KB 3JCMb 4OTEA 4X9DA 3D4CA 4LZ7A 2A5TB 1VQNT 1QUIA 1RKMA 3FVKA 3CEYA 4NEDA 4F18A 2IVWA 4II1A 4XU3A 2EQMA 4C8QC 2RCAA 2Y84A 2DP8A 2DWAA 4RJZA 4DLDA 4HT8A 3M58A 1M8VA 1R1NA 1IUDA 1DSNA 1N9RA 4GFRA 4M77E 2LQ8A 3PUWE 3B7DA 2O7IA 1GTKA 2I58A 1I6QA 2UYEA 2OAUA 3S6WA 1JW4A 4MFIA 4DQ2A 2JVVA 3RMQA 3KZGA 3JCMe 4M7DA 4J7IA 1Z7NE 4WKMA 3NFCA 3OSQA 2EAYA 3IB2A 4N07A 2RK1A 3CD6T 4JS5A 4QFPA 5H8HA 1M90U 3MO8A 3LYIA 4LDXA 3ONMA 4C5GA 4MDWA 3J80E 1A40A 1Y7XA 3K00A 2WKYA 4M75B 4Z7EA 4TLMB 1OQGA 2QSXA 3MEAA 4XU1A 3DB3A 2BKDN 5FU6C 3M5AA 2UYFA 3MP8A 3OOAA 3J7AF 3DLNA 1KC8U 3RLFE 3M8UA 2Y7RA 2F6PA 4OGEA 3VXCA 2DWIA 2FNCA 1KG1A 5EG2A 2GH9A 2RHXA 4RG2A 5TP9B 4JLGA 3C33A 4J6YA 2LCCA 1ELJA 3CFLA 1BI2A 3G71A 4B9XA 1VQKA 1MM7A 1VQPA 2L8DA 4AB5A 3ZEHA 2QS3A 3RMSA 1SYHA 2CZ0B 3EFSA 5IKBA 3MPLA 3K6WA 2OWTA 5KDTA 2ZPHB 3BDLA 3KEIA 4FT2A 3H6VA 2F36A 1VQ9A 2H99A 5LOMA 1OVBA 3MUQA 4ZDMA 3FLGA 3L2ZA 4D6WA 2OZZA 4JRIA 4BDZA 1BYMA 3ZKKA 3FIFA 4FORA 4E7JA 1N6AA 4X9CA 1IITA 5TU0A 3GF5A 3OYIA 3WXMB 2K4YA 4IO2A 4F7UG 2VGQA 4P0GA 2K2VA 5H8FA 4YZZA 5HK3A 1O7TA 3A8OB 2RC7A 1VFEA 3EN3A 2UVJA 3A3UA 2KAFA 4C8QB 5GANj 2X4WA 3A8MB 1XQHA 4FIBA 5DTBA 1K8AU 3U8QA 3LSLA 2XXQA 3S3OA 3SEYA 4Q8RA 5I84A 2RHZA 5H8HB 2GF7A 4N4IA 4RA1A 3C9HA 1M9SA 2Y7IA 4IO6A 1TT1A 2RF1A 5CKDA 1MDP1 2QMXA 4U22A 2RJFA 1TFAA 1YJWT 3MW0A 1B51A 2Y90A 1B4HA 4DOVA 1XVYA 4YICA 1XS5A 1LSTA 4M78G 1WODA 1Q86C 5A2QE 3MP1A 4Q5TA 4BB7A 3GNFB 3CXCS 4GXSB 4BE0A 4I9DA 3LSFB 4FT4A 4FSXA 4G2ZA 4DE8A 2RB6A 4PJOG 2DWJA 3M3LA 4A4EA 5FU6B 5HBCA 4IUQA 4N4GA 4YKPA 2DSFA 3GZGA 1I8FA 4RCBA 4H5FA 1CB6A 2FB7A 2HQXA 2QA4T 4RXLA 2Q9TA 3G4SA 3OENA 2E41A 3QSUA 1B40A 4BDLA 4Z02A 3VFJA 2GHAA 3R6OA 3IAZA 4Z0IA 1JVYA 3JRZA 5KDTB 5LJ5g 3X28B 4NF5A 4L59A 4G68C 3S9LC 2K3XA 4DZ1A 1JJ2A 2DE3A 3U94A 2X26A 3M4GA 2AHJB 3TU4K 4M77G 1UEBA 2H3JA 1LB8A 1YIJA 1WQ7A 1N04A 1PBQA 2QDYB 2V3QA 2YLCA 1N7XA 3SEUA 2XXWA 3V7RA 3MVZA 5I57A 4KULA 5KE3A 4JDSA 5CR2A 2XXXA 3KGCA 1R9LA 3VVDA 5H8FB 4F29A 2EJ9A 1BIAA 1NFTA 4GY5A 1B7UA 2A5SA 3OO9A 3QJYA 2OTLA 2VGMA 3OMGA 2XX8A 4ECFA 1TWYA 3EPEA 4JDFA 1MXZA 3DP6A 2JZ2A 3OO6A 1NH7A 3OS0A 4N4HA 2O1LA 5AA2B 2LT1A 4M78C 3G7ZA 1MXXA 1ZHIA 1QP3A 1B3GA 5CKFA 3J81E 4E7KA 2QPQA 3CVGA 3IOWA 2XHCA 1VQOT 3OELA 4JWXA 5FHNA 3FVGA 1VQ6A 4PJOC 5ELVA 2ZNSA 3U72A 1URGA 4PFYA 2XDPA 1NNTA 3CCJT 3SDZA 5GAOm 4JB7A 2M8CA 1POY1 2DXCA 3L2QA 4J5YA 1VQ4T 2DJZA 2ABHA 2RM4A 3S3MA 3QAXA 3E19A 3CCMA 4FECA 4M7DF 4E0WA 3S9MC 4EUOA 3EHTA 3A3CA 3OXNA 3GXAA 2XDDA 4OXVA 3RGYA 1UIUA 2QMWA 2ONKE 1VQLA 2ZYKA 1FW0A 5I56B 4OETA 4X48A 4JUVA 4OVJA 4M77C 3CCUT 1FTKA 3QHSA 4C0GA 4V2SA 2F78A 2P2AA 2X4YA 4NF8A 1LBBA 3JCMX 4U21A 1FXXA 3R7XA 1UIVA 3H6UA 3I56A 4MMLA 3QK6A 3RTWB 1LCFA 5GAN7 3E9FA 3FXUA 3BFMA 1VQ5A 3R26A 2RJCA 5IAYA 3H7MA 3ILUB 4PQJA 1R9QA 5KCHA 3JCMP 3CCSA 3IJXB 3UGWA 1B58A 5TPAB 2RI3A 4UC4A 2I4CA 3O6GA 4BUGA 4F7UB 4OERA 4IB2A 4C5EA 1MY0A 3QUJA 2EFIA 5I57B 1WGSA 3P8DA 1N27A 4G68B 3A09A 2F5TX 4ZEFA 1I81A 2CZ7B 3LWIA 2F5KA 4JRPA 2K5FA 3HFNA 1PSEA 4XK8E 2IG0A 1Q86U 3H06B 2R6GE 2PU9B 4RPOA 3RY3A 1N3WA 3VE1B 3RPWA 2D21A 2ZMBA 2FL7A 3C4MA 4YMBA 2ZPIB 3CCRT 3FXRA 4IY6A 5LJ5f 2DXYA 4FL6A 3FJGA 4PLIA 4A53A 2RC9A 1NPRA 3CMET 5IAIA 3I5OA 3UK4A 4RCCA 3OW2A 3CC4A 3SKPA 2PYYA 4EQBA 5H8NA 1LFHA 3LGFA 4RK2A 2E64A 3I6VA 3IX1A 4LD9K 3KSXA 4ELOA 3RESA 1OQHA 1MQIA 2QS1A 4PJOB 3C36A 1G3SA 2ANJA 3CC2A 3CMAT 1WJRA 1GGGA 2OBGA 3LLRA 2RD1A 4MZMA 2RCBA 4QFNA 4LZ8A 3BFUA 3HO7A 2JN0A 1XOCA 2V3TA 1B3EA 5M2VA 3K1MA 4ZEDA 4E7HA 4PE5B 3ASKA 4OP0A 2XDBA 3G3KA 4H8IA 3G6EA 4C1TA 4NF8B 3PFSA 4WEPA 4OB1B 3OA6A 1MXYA 3H3GA 4WEDA 3VUBA 3PGGA 3E13X 4EPCA 3RT6B 1SSFA 5GAOp 2R5MA 2XXRA 4ME7A 2E70A 4NF4B 1B46A 1O64A 4YTLA 4KR5A 1AOVA 5I2KA 3TAJA 3A8LB 4M77B 5GAMg 3PMTA 4WXJA 3EF7A 3W9VA 5DLQE 4M7AD 1DTZA 2MMPA 2A5TA 1B34B 4RPNA 3IORA 4DIGA 1II5A 2YHTA 4E47A