3MP8A

Crystal structure of sgf29 tudor domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
513
structure length
513
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
total genus 148
structure length 513
sequence length 513
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp8A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp8A01
3OYGA 1MDQA 3OSRA 1UIUA 1H44A 4IO3A 4F3GA 5KCJA 1A7LA 3ASKA 4BD3A 4ZTFA 4I1DA 4GF8A 1ATGA 1LCFA 3OO6A 3OQ5A 1RYOA 3OYEA 4IO4A 4FAJA 2L8DA 4DLDA 4YKJA 5H8QB 5ELVA 4DE8A 1Q1KA 1UQWA 5DVFA 3EN3A 2QPQA 3H6ZA 2ESNA 4QSDA 5ISUA 3WAEA 3MEVA 4YAHX 1AOVA 3LBSA 3BBRA 2GFUA 2QS2A 4QFNA 2F35A 2FHDA 4R2FA 1WDNA 2QL3A 1QKAA 1B58A 1SQYA 1BTJA 3S2VA 3W15C 2OJTA 5FHNA 2XX8A 1LAXA 1AIVA 1LBCA 2R9JA 2ZNUA 4P11A 1NH7A 5TP9B 4IUTA 2LCCA 4FATA 4R72A 3MBPA 3FVGA 3LSLA 5K2YA 2F7CA 3CIJA 3R7XA 4XIGQ 3VV5A 3O6HA 5LOMA 1URGA 4E0XA 4G68C 1M5DA 4OVJA 2ZNSA 4KD5A 4ZZEA 2HQXA 1IXIA 5A5XB 2F34A 4OQOA 1T0KA 3MUQA 4E7JA 4U4SA 4MLQA 1LB8A 3PD9A 1D9VA 5EYFA 5TU0A 1R1NA 3Q1JA 4H6DA 2GHAA 5IKBA 5H8HB 4U2RA 3GBAA 1UTHB 4KR5A 2Z8DA 4B9WA 3EAEA 4RK2A 3TODA 2O7UA 3C31A 5TPAA 1OVBA 5IN1A 3K6VA 1QW0A 2RC9A 5I57A 4THIA 3UGWA 1EZPA 3OYKA 3TCGA 2LTOA 4IGRA 1N0TA 3JV9A 3LSXA 4HS7A 1A8EA 5KCOA 2NXOA 4ZDMA 3PD8A 4HCWA 4GOTA 3A09A 4DCYA 2XXQA 2XXUA 5FROA 3TTMA 2H99A 1WJQA 1CE2A 3SEXA 4A4GA 3DB4A 2DVZA 4EXKA 1B1XA 5HPQA 4TOZA 1DTGA 3S3NA 3OYDA 2IEEA 4BLAA 1YCJA 1NH8A 2R58A 4RG2A 4POXA 3L2WA 3LH0A 3LGLA 1D4NA 1IXHA 4OHNA 4DXCA 2HQEA 4QSCA 4F29A 3ILTB 1HSLA 4H67A 1LAFE 5I56B 1L5TA 4U1ZA 4IKFA 3DLNA 2IG0A 2F7AA 2VOZA 4ECFA 1HSJA 1EZOA 2XXWA 3WAFA 2OCUA 2XXXA 3UIFA 1NL5A 3T66A 3KBRA 4O3AA 4BDLA 5KCHA 4OTEA 3L2RA 1B3HA 3TTNA 2QS1A 3ILUB 2RINA 3CI8A 4EUOA 3L2QA 3C32A 3MEUA 1MXUA 1MXXA 3OMCA 2M0OA 4R9GA 4IO6A 3O29A 1LBBA 2O4XA 2OLBA 1ZMGA 4ZS9A 3OB9A 4P0IA 3TCFA 1B0LA 5DVIA 3K00A 3QIIA 1YPNA 1QJMA 2DS9A 4FEDA 2O68A 4YICA 3V5AA 2ZYNA 4FJPA 3FZVA 5F1QA 4ZEBA 1FQDA 1P1QA 3MZBA 5D6WA 2E0SA 4E7LA 4H5FA 3RNNA 4G77A 1FQEA 1JEUA 2XDPA 1JVYA 4KHZE 1SW2A 3Q28A 3OXNA 1OLAA 2VYTA 1B7HA 2RO0A 2RI3A 2RHUA 3K2DA 2Y7RA 3IO4A 4NF8B 2W7YA 3FVKA 3T9HB 4FE8A 1SYHA 3MO8A 1XVYA 1WJSA 4X34A 3IK6B 3QUFA 2BJJX 3DP4A 1B6HA 2D5WA 3ODBA 3QIMA 2A5TA 3MC2A 1BKAA 2O1MA 4C1TA 4GY5A 2XXIA 4R6HA 1S9TA 4XKQA 4HCZA 3LX7A 1SW4A 3IAZA 4NF6B 1LAGE 3KOTA 3VVDA 2RHXA 2K3XA 3VXBA 3GLBA 2D21A 4G2ZA 1EH3A 3GXAA 4MFIA 4E7IA 5FHOA 3K0VA 1UTBA 1MG1A 1B9JA 2RHZA 4JWXA 3ZS6A 1SBPA 1P99A 4QQGA 5AA2B 4LQ5A 3VE1B 3TYHA 3O28A 2R71A 4NF4A 3FJGA 1A54A 3SDFA 4PLIA 3U72A 2AL5A 2XK0A 3QXMA 3FVOA 2JZ2A 3SETA 5DEXB 2CKKA 4ELPA 3MVXA 1O63A 3B6TA 1H43A 2D9TA 3D4GA 4GLIA 2G3RA 5D6YA 3SD4A 3IL1B 2UYEA 4Q5TA 3RGYA 1P1UA 1LFIA 1PB7A 3K6WA 4HTGA 1GR2A 3SKPA 1XS5A 5M2VA 3T93B 3MVWA 3PMTA 1IXCA 1AL3A 1Y20A 4KI0E 3OO7A 1MXVA 2XX9A 4MH5A 5ICQA 2M8CA 2L89A 3U1OA 1POY1 4QFPA 3OA6A 1D9YA 3O2AA 1MXZA 3SEVA 4JSOA 3PPQA 2O7IA 4EQ7A 2CZLA 4IO5A 4YMBA 1F9BA 2ONKE 3CSGA 3LUYA 4KQPA 4TLMB 1KWHA 3TAJA 2Q9TA 5BWJA 4EF1A 4F18A 2NLUA 1DPPA 2H5YA 4YKPA 3TEPA 4GIZA 4LATA 4EF2A 3NTHA 4KYEA 1B3GA 1SDXA 4JWOA 3T9XB 5DVJA 5AA4B 3S9NC 3UA8A 2DWAA 3N94A 2YLNA 3SEUA 4GD5A 4YB5A 4HCYA 3E9FA 1Y1MA 3UN6A 1OZ2A 1VFEA 1PBQA 4G8MA 5CBSA 3JYRA 1MY1A 4XKNA 2NOOA 4BDQA 3L2VA 4R9FA 5FRMA 2RJCA 3KOSA 1POTA 1US4A 2LAOA 1H45A 3E9GA 1NMUA 2ABHA 5C6SA 5L9MA 3S3MA 3T9UA 4R74A 2QJEA 2XXYA 3TTLA 2O51A 3MAMA 4NS5A 4ZEDA 3IORA 3FXRA 1ANFA 2QQSA 4HW8A 1FTLA 3MQ9A 3RQTA 4IB2A 1ELJA 1LB9A 4YMAA 1IEJA 3IJXB 3HSTA 2DYXA 3HN0A 3KN3A 3IR1A 4ZE8A 5JTYB 3CEYA 2VD2A 3IO6A 3H03A 2REJA 3EQ1A 1LCTA 2GF7A 2Y7WA 4O3BA 4PFYA 2Q8JA 2X7QA 3IOUA 1OZ3A 5KE2A 5AA2D 5KE3A 4F2QA 4BDMA 1B4HA 1AH5A 2X26A 3Q29A 1NNKA 4C5IA 2HAVA 3G3JA 5I2KA 2E6NA 3OMBA 4JWYA 4OVAA 4OYVA 3A3CA 4YB7A 2JTFA 5M9OA 2LRQA 3KG2A 1JW1A 1MQHA 1OQHA 3OMGA 3TFLA 1B32A 3VFJA 2B3BA 5CMBA 3FEOA 4PLLA 1Q35A 5K2XA 3OEKA 2L3RA 5ICTA 4WEPA 4E7HA 4QSEA 5H8QA 3CSBA 5AA3A 3H6VA 3MVYA 3UT1A 1IXGA 5J1DA 3EHUA 4RXLA 2ZYKA 3PV0E 3QBYA 4RY1A 3Q27A 1PDAA 4JBZA 2P0SA 1TWYA 1BP5A 1LSTA 4IGTA 4FEBA 1N3WA 3N6TA 3OSQA 1Y1ZA 4G68B 3USDA 3V89B 3OEMA 3V83A 1S50A 4X48A 4ISUA 4H8IA 2V3UA 3M3KA 3IB2A 1LFGA 1FQCA 1PBPA 4UC4A 2ANJA 3PFSA 5TP9A 1SI0A 4ND9A 3OELA 4C5EA 3OYCA 4QHQA 3TMGA 1D3KA 5DT6A 5CBRA 3K02A 2O69A 4EQ9A 3HHGA 1TFDA 2F8DA 4IUPA 4OFOA 2R5MA 5A5XA 3H3GA 3C9HA 4RYAA 4B9XA 3VLVA 3SEWA 3DLMA 4OERA 2OBGA 4UACA 4ZTJA 1Y4TA 1B3LA 2PX1A 5BUUA 2HFBA 5H8HA 1UTHA 1FQBA 4A4EA 1MPCA 3LSFB 2THIA 2R5AA 1ZKBA 3G3IA 2GFEA 3H4ZA 3G3FA 1B3FA 3MWBA 2QQRA 1BIYA 1USYE 1B52A 4QRZA 1MQDA 1DMBA 3W9WA 1WJRA 3VVEA 4I62A 1MM6A 1M5FA 3RN8A 2O84X 2NUVA 3TQWA 3QKJA 3RT6B 1M5BA 1MXWA 1NKXA 1SYIA 1PB8A 5CC2A 3KN8A 2XD2A 3KN7A 4IO7A 3OYJA 3PPPA 5JEIA 4XKRA 3ME9A 4U23A 2DE3A 3THIA 1URSA 3CVGA 2EFIA 4OWDA 1Y9UA 3B6WA 1FTJA 4R75A 1N76A 5I56A 4IUQA 3FIRA 5FHMA 2AL4A 5EHMA 4GL8A 2RJFA 3T22A 3IJOB 1I69A 4I9DA 1LGBC 3TZAA 3Q26A 5KDTB 3OS0A 4Q5WA 4ONYA 4PP0A 3MEAA 2V84A 2I3WA 4C0RA 3RLFE 3C36A 1B05A 3IB1A 4FL6A 3PGFA 2G29A 1FTKA 3E4RA 2NWJA 4II1A 2HXWA 1B7UA 3S9MC 2GFAA 3M8UA 1J1NA 2XHDA 2Z23A 4F39A 2DQVA 4N4IA 3O66A 4C1UA 2UXAA 3VVFA 1B40A 3BKIB 3TELA 3PPRA 1N27A 4LUBA 4NF5B 1B51A 2Y7IA 3EHSA 1P1NA 3N26A 3HV1A 4QVZA 2GHBA 4NF8A 4ZEKA 4Z7EA 5CMCA 2EQUA 3L2UA 3HHFA 4LP2B 2WACA 2PT1A 1M5EA 4OEVA 4F1UA 3OYIA 4F19A 3G3HA 2P1SA 1B1HA 3D4CA 2Q2AA 1ZU0A 3FC3A 2DSFA 4NF6A 4U21A 4WXJA 1WVJA 3QUJA 2PT2A 1MH4A 4F22A 2LVMA 5H8NB 1MQIA 3T9VA 5C0MA 3LC8A 4GXSB 1FTOA 3S9LC 3MPKA 3KJTA 4PFWA 4RPOA 2FYIA 5CIUA 3U8QA 1NNTA 5AA2A 4H8JA 3GBBA 2F7BA 3PMXA 2G93A 5IAYA 3VXCA 1QUKA 2F6GA 2IA4A 4BDZA 1MRPA 5HM4B 1JQFA 2Q88A 3K01A 4BE1A 3S3OA 2OZZA 1MH3A 2KLFA 3OYBA 3FUZA 4EQBA 3C33A 3FD3A 4MLVA 1EZ9A 5DEXA 2V3QA 1R9LA 1Y3QA 3KFMA 2ZYOA 4YZZA 5L9OA 1OQGA 3K1MA 4RNSA 3PPOA 2MWPA 1RYXA 1XVXA 2P2AA 2UYFA 3K6UA 3K4UA 1OI1A 4A4FA 1DOTA 4YKIA 1RKMA 4X1BA 3S6WA 3BFTA 3RTWB 4YU0A 1FCKA 3RUMA 4Q30B 2UVIA 2DWHA 5KH6A 4L59A 4U22A 1YAEA 3OYLA 3FJMA 3BFUA 4KYSA 4DZ1A 2DP8A 1QULA 3E3KA 3FV1A 4LZ7A 1Z7NE 1H76A 1B4ZA 2R57A 3P7IA 4POWA 2RF1A 3MW0A 2I6EA 3IOVA 2EKOA 3DM0A 3O9PA 2E5QA 1MPDA 2LDMA 2RCAA 2X4WA 1IIWA 3KGCA 4QFKA 1N7XA 1QUIA 2ZXTA 3CG1A 2EQJA 2ZYMA 1JNFA 3KJ7A 5I58B 4NTLA 1US5A 4IUUA 3O97A 4PQJA 3VLWA 4M4GA 3MZ1A 5AA4A 1MPBA 2AYSA 3OY9A 2I58A 2RHIA 3RTFB 1MQGA 1YTVA 3TTRA 4ZEIA 5DTBA 3GZGA 4QF9A 1JVXA 3H06B 2M16A 5HBCA 3UWNA 3HO7A 4X1DA 3SERA 2YRVA 3G3KA 4OFLA 3OYAA 3QSLA 4CRIA 1DTZA 3R6UA 2AIXA 5AA1A 1B5JA 2HEUA 1MXYA 3EHTA 3FASA 1MM7A 2O1LA 2RC8A 3FDRA 4F3SA 4OMBA 3FV2A 5I2NB 2Y84A 3E13X 2CMOA 2QRYA 3OS1A 1HSEA 4U4XA 2RCBA 3SEYA 3UORA 1AMFA 3S4UA 5JTYA 2UVGA 3ZEHA 3CFZA 3FLGA 1TT1A 3F11A 5CRYA 3MP8A 1SVXB 3EF7A 1IUDA 2F5XA 3OYMA 2V3TA 5KZTA 4RK9A 3UK4A 2HCAA 2PYYA 2BIVA 2R6GE 3PUVE 4PETA 2Z8EA 4PFUA 2VHAA 4LQ2A 2Y7PA 1SW5A 5H8FB 2B3FA 2B65A 3CFXA 1N7WA 4IY5A 3K1PA 3M3LA 2REGA 1N04A 4LD6A 2XXTA 4WEDA 1NNFA 1ZJLA 3VDFA 4RJZA 5B7DA 2I0BA 4TQUQ 3TDJA 4LVQA 1NFTA 5CMMA 3B6QA 4M1VA 4NWDA 3MPLA 3TCHA 2QS3A 1FQFA 4H0WA 4ZZAA 5I59B 4OXVA 4C5HA 3I6VA 4N4HA 2V25A 4K3FA 4LONB 3IB0A 4U1OA 2XXRA 2X7PA 4G68A 5JK4A 4X9TA 2O6AA 5KCJB 1JEVA 2FNCA 3HCQA 5EHSA 2K3YA 2RC7A 3PUXE 1Y3PA 1B3EA 3JZJA 1B46A 4FORA 1USYH 3MVZA 3O6GA 2ZMBA 2X4YA 2QMXA 3P8HA 3TPAA 3PMVA 2RJDA 1EU8A 2H4IA 1OIBA 3LLRA 3C35A 4DIGA 1SD3A 4KCDA 1I6QA 4ESWA 4EDUA 1RI0A 4F3BA 2ONSA 2DVCA 2A5SA 2D3IA 2I0CA 2UVJA 1XNIA 2HZLA 3FXQA 3I5OA 5I84A 3MP1A 2P0KA 3CG3A 1PEBA 3DP8A 4C5GA 2DOJA 4BE2A 1JW4A 1Y4CA 2Z22A 4QW2A 3H6TA 3H6WA 4Z02A 3PUYE 1VR5A 4QFLA 2RI5A 3BDLA 3OS2A 1WGSA 3RT8A 2VP1A 4KPTA 4QQ6A 5IAIA 1G5VA 3DP6A 3FJ7A 1ZBMA 1SW1A 4BE0A 4BDNA 3R26A 2ALUA 1PC3A 1OVTA 4H5GA 5D6XA 2I3VA 4LZ8A 2QMWA 3HPIA 2DWJA 3TKDA 3U93A 3B7DA 1A55A 1OMPA 3ZSFA 4JDFA 1DPEA 5CMKA 1GGGA 4F1YA 5TPAB 2NVUB 5I57B 4NEDA 4QFOA 2F36A 1B0HA 1N84A 1R6ZA 1IZ1A 2HQ0A 2GH9A 5FTIA 4EXLA 5ITOA 4OEUA 3CFLA 4UA8A 4QQDA 2HAUA 1GV8A 1A8FA 1DSNA 1S7YA 4N6PA 4LZ5A 4P0GA 4R73A 3T96B 3K1NA 3N5LA 3MJNA 1VE4A 4BDOA 4TLLB 2BKDN 2H98A 3KZGA 2Z8FA 4F1VA 2I49A 3G7WA 2PQWA 3PUZE 4N13A 3FATA 4LA9A 5KDTA 5CI5A 5F7VA 3AXFA 4XXUA 2X4XA 4I8CA 3O8VA 4ESXA 3OO8A 1I6BA 3S9EA 3N6UA 3L6HA 5H8SA 1BLFA 1R9QA 3QAXA 4YB6A 1B5IA 3OO9A 3PUWE 1ZTYA 3LYIA 3C4MA 5J39A 1NNPA 1IQ7A 3G3GA 4NWCA 4IURA 4GXAA 2V93A 3C34A 4MF3A 4ELQA 3FXUA 2YJPA 3A3UA 1O7TA 3NTIA 4AB5A 4DCXA 4NF5A 3EPEA 2Y7KA 4N4GA 2UVHA 3FVNA 2DE2A 2DXYA 3RY3A 4XTCQ 2XXHA 1WODA 2O4XB 4FU6A 4N07A 2F5KA 3IX1A 2FA7A 5FRNA 4F31B 1P1OA 3Q25A 2QSXA 3M9QA 3PPNA 3DB3A 2DIGA 3ZKLA 1B5HA 4OFJA 2ONRA 3OD7A 4JXIA 4PL6A 2QS4A 2HZKA 1LLSA 1KHCA 4OZ9A 3GOXA 2DAQA 3ONMA 5H8NA 3QK6A 3TUSA 3U94A 3PNWC 3OYHA 3TTKA 4FIMA 4GWOA 2A5TB 1TFAA 2OWSA 3H6UA 1FW0A 1CB6A 2Q2CA 1ZLQA 3CRBA 3ZKKA 2DE4A 4JB7A 3M3FA 4ELRA 4YKKA 1VFDA 1MS7A 1MHNA 3SESA 2VGQA 1JETA 4G4PA 1FQAA 1O64A 2PMSA 1MY3A 2EQMA 4FECA 4DXUA 1GTKA 3FGSA 3PU5A 4GQOA 2BUDA 1H3ZA 4BDYA 4ZECA 2DWIA 2XX7A 3OYNA 1SSFA 1UTBB 2RKMA 3META 2GRVA 2DIQA 3L42A 3VLUA 4GVOA 3MP6A 1N3XA 2EQKA 2X35A 4GRKA 2OWTA 2Q89A 1SI1A 3E9XA 4GFRA 5ITPA 4IY6A 4NF4B 1MQJA 5L9SA 2XXPA 3H7MA 3C4SA 2YPNA 3PMWA 2B8AA 3F70A 1QUJA 3RPWA 1LAHE 1H3DA 1URDA 4H65A 3V8XB 4R2BA 1GVCA 4NE4A 3OENA 4Z0IA 4ZEFA 4GL0A 4E0WA 4ELOA 3OYFA 3ECRA 2F97A 1XHYA 4G8HA 1XT8A 4ZE9A 4OESA 2RI2A 4KCCA 2PVUA 2VD3A 1QVSA 4F2OA 3IOTA 5CM6A 2F6PA 1QKBA 2I4CA 3MZ9A 3L6GA 3W9VA 2RJEA 5I58A 2OK2A 3PMIA 1UIVA 1M5CA 1Z7ME 4AB6A 4F3PA 2PBWA 4R6YA 3O6IA 1LFHA 3KEIA 4PE5B 4AQ4A 4NMYA 3LSWA 1PB9A 2F78A 3IOWA 3QYTA 3CR9A 4Q0CA 1I6AA 4IO2A 3U92A 1P1WA 2MWOA 4BDRA 2H25A 1A40A 5I2NA 1FTMA 4E7KA 3DELB 3MEWA 4R6KA 1MY0A 4EDPA 1Y3NA 3H8ZA 3KSXA 1MY4A 4H1XA 4RA1A 1B7ZA 2E1SA 4A4HA 4PFTA 3K6XA 4DDDA 2XD3A 1A99A 4MBPA 4IUVA 2DXRA 1VSOA 4KYDA 2WKYA 2ZNTA 3OOAA 4BACA 3TQLA 3P8DA 1TXFA 5AE4A 4XKPA 4KFQA 1ZIUA 3I3VA 4O3CA 1MDP1 5H8FA 3NTKA 5B70A 2I4BA 1OLCA 5J26A 4OENA 3LR1A 1MY2A 3KSJA 2M1HA 5L8DA 4G8NA 1OYXA 1B2HA 4DXBA 4JSDA 3UP9A 3LGFA 4L17A 5DYHA 4OETA 5I2KB 4WKMA 5FTHA 2H9BA 3KUFA 4Q8RA 1XOCA 2RHYA 1IITA 5I59A 1II5A 2I48A 3QJ6A 1JW5A 2XXVA 1XC1A 4RPNA
chains in the Genus database with same CATH superfamily
2JS0A 3OYGA 1MDQA 3OSRA 1UIUA 5GMKi 3I56T 4NQ8A 1H44A 4IO3A 3SEMA 4F3GA 2KVQG 4OB0B 5KCJA 3RKWA 1WHGA 1A7LA 4M7AE 3ASKA 4BD3A 2P0PA 4ZTFA 4I1DA 4KGZB 4GF8A 4E7ZA 1OPKA 1ATGA 3CCQQ 1LCFA 2FHYA 3OQ5A 2HPGA 3OO6A 4ZNXA 3G6EQ 1N8RC 1RYOA 4EMKB 3OYEA 4IO4A 4FAJA 1GFDA 1TWBA 2L8DA 5ECAA 4JRKA 1LEVA 4YKJA 4DLDA 1TUCA 2KRNA 4PKCC 2P84A 4R56A 5H8QB 3QHSA 5ELVA 2J06A 5CR2A 3EGDB 4DE8A 1KD1C 2W10A 3H9NA 3JAME 3CD6Q 1Q1KA 1UQWA 1FPLA 3EH2A 1M3BA 5DVFA 2BZXA 4ME7A 3EN3A 2QPQA 3H6ZA 2ESNA 4QSDA 5ISUA 2M51A 4EPCA 3WAEA 1M8MA 5LJ5h 1IHVA 3MEVA 4YAHX 1AOVA 1WX6A 1W1FA 3LBSA 3BBRA 2AK5A 2GFUA 3TEEA 1YJNQ 5A0GA 1QQJA 2YUNA 2K79A 2QS2A 1D0XA 2F35A 4QFNA 2FHDA 4XTWA 4N6DA 1WDNA 2PUKB 4R2FA 2QL3A 1Y96B 1QKAA 2F69A 3JCMX 1B58A 1VQ7A 4M77G 1SQYA 4LD9K 1BTJA 2COYA 3S2VA 3W15C 2OJTA 4GLMA 5FHNA 1YJWQ 2XX8A 1LAXA 3T0JA 1AIVA 1LBCA 2R9JA 2D1XA 2ZNUA 4P11A 3CCET 3I56A 1NH7A 5TP9B 2XI9A 3L2ZA 4IUTA 2LCCA 4FATA 2CSQA 1WIEA 4XU0A 3MBPA 3FVGA 4R72A 3LSLA 5K2YA 2F7CA 3CIJA 3R7XA 2Y4XA 4XIGQ 3VV5A 3M0RA 3VV0A 3O6HA 2KEAA 1UJYA 1UDLA 2I0NA 5LOMA 4BY6C 2FPDA 1URGA 1WXBA 4E0XA 3B50A 4G68C 2CP3A 1XQHA 1M5DA 3PE0A 3M56A 4OVJA 2ZNSA 2ECZA 4KD5A 2ZAEA 2HQXA 1IXIA 4ZZEA 1VQNQ 5A5XB 2F34A 2DF6A 2MPXC 4OQOA 2BJIA 1T0KA 3MUQA 4E7JA 3I55Q 2LNHB 4U4SA 2O9SA 2CZKA 4ZGJB 4MLQA 2HL5C 2Q8MA 1LB8A 2YUOA 3PD9A 4M78G 1EZZB 1D9VA 5EYFA 1O9SA 1NJIC 5TU0A 2RMOA 1R1NA 3Q1JA 1HK9A 1GBRA 4H6DA 2P3VA 2GHAA 5IKBA 5H8HB 1AWJA 4U2RA 3GBAA 1UTHB 1X2QA 1RAGB 1ZSZA 4KR5A 4MMPA 4NX1A 1QP2A 1U5SA 2KRMA 2MOXA 2Z8DA 3D1RA 2QA4T 4B9WA 2VXEA 3EAEA 4RK2A 4C0FA 3TODA 2O7UA 3C31A 3OYYA 2QI2A 2NYSA 4J9DA 4HXVA 1NV7A 2YDLA 5TPAA 1UHCA 2O31A 1OVBA 2HCKA 5CKEA 5IN1A 2CH4W 1ZLMA 4JRPA 1QW0A 3K6VA 2DRMA 1FBPA 1R8OB 2RC9A 8AT1B 2JS2A 2JM9A 4THIA 4M77A 3UGWA 3OYKA 2ROLA 5I57A 1EZPA 3TCGA 2LTOA 4IGRA 1N0TA 1K9MR 1AD5A 3QXEB 3JCMJ 3JV9A 1KIKA 3CCEA 3LSXA 4HS7A 3RESA 2RK2A 4RTXA 1A8EA 1FPBA 5KCOA 4NOYA 2K5LA 2EYZA 2NXOA 4ZDMA 3PD8A 3CMEQ 4XF5A 4HCWA 4O94A 4N0AC 1K8AC 1MMNA 4X9CA 4GOTA 3A09A 3CC7T 1FX7A 3VS5A 4CC7A 4DCYA 1M5Q1 3CCVQ 3CCMT 1TH7A 2AZVA 2XXQA 1T0JA 2JJ9A 1Y0MA 1ZQ1A 4PJOE 4WTOB 4M75C 5T3JA 2OJ2A 1U06A 2XXUA 3RPLA 5FROA 2FRYA 3TTMA 5FU6C 4BI8B 2H99A 1WJQA 1ZA2B 1K9MC 3M0UA 1CE2A 1LBYA 1XJWB 1IMAA 2K57A 3SEXA 2FVZA 4A4GA 3AT1B 4OVQA 3DB4A 2DVZA 4EXKA 4M78A 2QTVA 1B1XA 5HPQA 2PZ1A 4TOZA 1X75C 3S3NA 1DTGA 2CT4A 3OYDA 2IEEA 4BLAA 1WDXA 1IMBA 1NH8A 1YCJA 1UHFA 1Q81R 2JVVA 2R58A 2QA4A 4RG2A 4POXA 3L2WA 3LH0A 5HY6A 3LGLA 4M4ZA 5LJ3h 4ANJA 1D4NA 1IXHA 2DDKA 1YCSB 4OHNA 2HQEA 4QSCA 4DXCA 4F29A 1B3QA 2DJQA 2KGTA 1PWTA 3ILTB 1HSLA 4HVUA 1LAFE 4H67A 5I56B 3I5RA 1H3HA 2QEXA 1Y57A 4L5GA 1L5TA 4U1ZA 4IKFA 4N17A 5KYXB 3DLNA 1VOMA 2IG0A 2F7AA 4K11A 3GP8A 3H0FA 4O8MA 2VOZA 4ECFA 1HSJA 1EZOA 2XXWA 1KQSS 4PDHA 3WAFA 2FZGB 2OCUA 4F16A 2XXXA 4N6KA 3UIFA 1NL5A 4OP0A 3GLXA 1FBDA 3T66A 2Y5KA 1FPJA 3KBRA 1FPKA 4O3AA 4BDLA 1DCUA 2MF2A 5KCHA 4OB3B 4OTEA 3L2RA 1NV0A 2XKOC 1FBCA 1B3HA 4FYXB 3TTNA 2QS1A 3J7AF 3M57A 1JP4A 3ILUB 3BDUA 2RINA 1QCNA 3SB2A 3CI8A 4EUOA 3L2QA 4C0DB 3C32A 3MEUA 1MXUA 1MXXA 3OMCA 2M0OA 1B34A 2KDSA 3JCMV 4R9GA 1JXOA 1X2KA 4IO6A 3O29A 2L5QA 1LBBA 2O4XA 2OLBA 2X3XD 1ZMGA 4MHFA 4ZS9A 1JRIA 3OB9A 4P0IA 1BU1A 1OOTA 2EKHA 4IR8A 3TCFA 2ZPBB 1WHKA 2HNIA 3HP9A 5DY9A 1B0LA 5DVIA 1AWXA 2AZSA 3QIIA 2HSEB 1YPNA 1QJMA 3K00A 2DS9A 1YCYA 4FEDA 3CPWA 2O68A 4HE2A 4YICA 3V5AA 5GMKj 2ZYNA 2CZ6B 4FJPA 3FZVA 5F1QA 2MCNA 2D6FA 4ZEBA 5IHIA 1FQDA 1P1QA 2GQIA 3JB9J 3MZBA 2SEMA 5D6WA 2E0SA 3E78A 1QVFA 4E7LA 4H5FA 1TU0B 3RNNA 4G77A 1FQEA 3RDVA 1JEUA 4A54A 1J3TA 3LV0A 2XDPA 3M4YA 1JVYA 1K1ZA 3CXCS 4KHZE 2DFUA 1SW2A 3Q28A 2K3BA 3TCJA 4M7AC 1WFWA 1IMCA 1YBYA 3OXNA 1OLAA 4WF2A 1JQQA 2VYTA 1B7HA 1PHTA 1D1BA 3ZL7C 2YT6A 2E4HA 2CP2A 2RO0A 1R0CB 2RI3A 1CKBA 2EWNA 1VYVA 2RHUA 3K2DA 2Y7RA 2XDBA 2EGCA 1E7OA 1JJ2P 3IO4A 4NF8B 2W7YA 3FVKA 2MMPA 3T9HB 4FE8A 4RTYA 2F2XA 3MO8A 1SYHA 1PRMC 2JMCA 1WJSA 4X34A 5GAOq 1N6AA 1XVYA 2HHMA 3IK6B 3QUFA 3HSBA 3EG3A 2X3WD 2BJJX 2QVRA 3DP4A 1V29B 1B6HA 4GBVA 2D5WA 3ODBA 3V8KA 2LQ8A 2E41A 2LZ6B 4PFPA 3CCUQ 4KGXB 2QFLA 1Q82U 2O88A 2IVWA 2A5TA 3MC2A 3QIMA 1YWPA 2DL8A 3CBPA 4NL2A 1BKAA 2O1MA 1AWBA 4C1TA 4GY5A 2XXIA 2XICA 5CAIA 4R6HA 5FLXE 1S9TA 4XKQA 2Y4YA 4HCZA 3A29A 2JUFA 4KULA 3LX7A 2JOYA 2QQBA 4YTLA 1SW4A 3IAZA 5GAMh 4NF6B 4C8QG 1LAGE 3KOTA 1VIEA 3D7SB 1FBHA 2ATCB 4J9HA 3VVDA 4PNOA 4E6RA 2RHXA 2K3XA 4D8DA 2RF0A 3GLBA 2D21A 3VXBA 4RCCA 4G2ZA 3I55T 1EH3A 3GXAA 1ZA1B 1ABQA 2O2OA 2DXUA 4M77D 3A8LB 4MFIA 2MIOA 1NEBA 1G3TA 4E7IA 5FHOA 3LW5E 3K0VA 1UTBA 4Y28E 1BB9A 2RQUA 4PFIA 1MG1A 1B9JA 1MV0B 2RHZA 2NWMA 4JWXA 4MNCA 1ZX6A 3ZS6A 1YJNA 1SBPA 2AHJB 1P99A 1I8FA 4QQGA 4LQ5A 1MNDA 5AA2B 3VE1B 2EGEA 3GNFB 4GWUA 3TYHA 4OANA 3O28A 2DZ9A 5FWCA 3NPFA 2R71A 1WPYA 2Q74A 1WQ7A 3TREA 2RH2A 4NF4A 3FJGA 1A54A 4FYWB 3SDFA 4KRTA 4PLIA 1K0XA 1D1AA 4X04A 3U72A 1MUZA 1BK2A 1VQ4T 2AL5A 2XK0A 1JU5C 1M8VA 3QXMA 4NF0A 5GAMg 3FVOA 2JZ2A 3SETA 3HFOA 4M78D 5CO7A 3CMET 2OTLQ 4JVIA 5DEXB 3UF4A 4HT9A 1NPPA 3A98A 2PFZA 4MCOA 1UE9A 2CKKA 2E3IA 2HAXA 4C8QA 4ELPA 1W4SA 4MIJA 3WVDB 3MVXA 1AEYA 4OMNA 4P1EA 3CCVT 1O63A 2CDTA 2P4RA 3A5ZB 1H43A 1VQPQ 3B6TA 2D9TA 2LT4A 5HCKA 3D4GA 4GLIA 3I55A 1BK4A 2G3RA 2LC4A 5D6YA 3SD4A 3IL1B 2YUPA 2UYEA 4Q5TA 3RGYA 1FYNA 1LFIA 1P1UA 3J81E 3BIGA 1W70A 4EMGA 3NFCA 5L23A 1PB7A 3K6WA 2AKLA 4HTGA 2E3HA 1YJ9Q 2KK4A 2R8TA 2JXBA 1WZOA 1UG1A 4M7DF 1GR2A 5A2QE 3SKPA 1XS5A 5M2VA 1UTIA 3T93B 3MVWA 3PMTA 1IXCA 1AL3A 3LWHA 1Y20A 4KI0E 1C6VX 2BZ8A 3OO7A 4C0ZA 1H8KA 1SF9A 1MXVA 2XX9A 4MH5A 5ICQA 1PKSA 2M8CA 2PU9B 4FYYB 2L89A 3U1OA 1POY1 4QFPA 3MPUB 3OA6A 2DETA 4P1LA 1D9YA 1VQKT 3O2AA 4NGUA 4PJOC 1MXZA 1M3AA 3VJPA 2E65A 2V26A 3M53A 1UUEA 3SEVA 1AWWA 4JSOA 4MZMA 1RDXA 3X24B 4C92G 3PPQA 4J7FA 1A0NB 3OW2P 2O7IA 3HTRA 1VQ4A 4EQ7A 2CZLA 2KSSA 1BIBA 4IO5A 4LN5A 4YMBA 4KUDK 3CBOA 1F9BA 2ONKE 3CSGA 1Q95G 4OMMA 3LUYA 4KQPA 4TLMB 5LDZA 3CMEA 1KWHA 1Z9ZA 3MHXA 3EGXB 4GBWA 2IIMA 3TAJA 2Q9TA 5BWJA 4PTKA 4PGPA 4EF1A 1I5OB 3PVQA 3CCVA 4F18A 2NLUA 1YITQ 1DPPA 2H5YA 4YKPA 3TEPA 4GIZA 4LATA 4EF2A 1IGUA 3NTHA 4KYEA 5LTCA 3EHQA 1FJ9A 1B3GA 1FPGA 1GXIE 2FBPA 1SDXA 4JWOA 3T9XB 2JW4A 2PCRA 5DVJA 2F2WA 4GWSA 5AA4B 2GTOA 3S9NC 3LUZA 3UA8A 2EIFA 5GAN6 2DWAA 4MDXA 1I07A 3N94A 2YLNA 3DKMA 3SEUA 2WSCE 4GD5A 4YB5A 4HCYA 3E9FA 1G3SA 1AZGB 3FB9A 1Y1MA 3UN6A 1OZ2A 4OA4A 1VFEA 3M4GA 2XD0A 1PBQA 4G8MA 5CBSA 4JRIA 3JYRA 2HSPA 1MY1A 4XKNA 3EFOB 1OU9A 2GQVA 1S72Q 2NOOA 4BDQA 3H0IA 2P0QA 3L2VA 1QWEA 2E70A 4R9FA 5FRMA 2HD0A 2RJCA 2QK0A 3KOSA 1POTA 1US4A 2LAOA 1VQMT 5EQ7A 2FPEA 3KBZA 1H45A 1PG5B 2DXCA 2QTXA 1X69A 3E9GA 1NMUA 2ABHA 3FBPA 4OMFB 5C6SA 5L9MA 3S3MA 2KAFA 3SWNC 4I3EA 1VQ9Q 4R74A 4F04B 2QJEA 3T9UA 4XU2A 2XXYA 3TTLA 2O51A 3MAMA 3X25B 4C92A 2DLPA 4NS5A 5HK3A 1YI2Q 2LCSA 4ZEDA 3IORA 3FXRA 3G71Q 1UB4A 1D0ZA 2ESWA 1IO6A 1ANFA 2FRWA 3MCAB 2E64A 2QQSA 4HW8A 1IHWA 1FTLA 4QVDA 1QVPA 1FBEA 3MQ9A 4J6YA 3RQTA 2HMAA 4IB2A 1ELJA 1LB9A 4YMAA 2RNAA 1IEJA 5FU7C 3IJXB 3HSTA 1O75A 4M77E 2DYXA 1Q7YU 1LBWA 3HN0A 2C0TA 3E2UA 3KN3A 3IR1A 4ZE8A 5JTYB 3QZ5B 1M90C 4G61A 3CEYA 2PUOB 4JS4A 2VD2A 2RA2A 2WX9A 4LUDA 2D8JA 3IO6A 4WCIA 3CCUT 3KC0A 3H03A 2REJA 5KYYB 4KBMB 2XA5A 1K9YA 4JJNK 3EQ1A 4Z88A 1LCTA 5EC7A 2DL5A 2NUPB 2GF7A 4VUBA 4HCBA 2Y7WA 4O3BA 2W0ZA 4PFYA 2Q8JA 2X7QA 3IOUA 1OZ3A 2J6OA 5KE2A 5AA2D 4XK8E 2CUBA 5KE3A 2DTIA 4BB7A 4F2QA 4BDMA 2L2PA 9ATCB 1B4HA 1ZHIA 4FT2A 3JB9I 1AH5A 4MMKA 2X26A 3Q29A 2WYPA 1RDZA 1WI7A 1AZEA 5KYUB 1NNKA 1UGQB 4C5IA 4OGCA 2HAVA 3G3JA 5I2KA 2E6NA 3OMBA 4JWYA 5ET6A 1K4US 3C95A 1WLPB 4M78E 3CPWS 5GMKl 4OVAA 4OYVA 4XTXA 3VS1A 1Q9DA 3A3CA 3REBB 1JJ2A 4YB7A 1VUBA 2KNBB 2JTFA 5M9OA 1VQ7T 1M30A 2LRQA 3KG2A 2XWIA 3VYGA 2CT3A 1JW1A 1K9AA 3VS6A 1QVFS 2AIRB 2KRSA 1MQHA 1OQHA 3M0SA 3OMGA 1YHQQ 3TFLA 1B32A 3VFJA 2B3BA 3G1JA 4RKUE 5CMBA 5IZ3B 2FVUA 3JCMf 4C8QD 3FEOA 4PLLA 3CC4Q 3E79A 1Q35A 4MX6A 5K2XA 3OEKA 2L3RA 5ICTA 4EMKA 4WEPA 1RAEB 1LPLA 4E7HA 3RYDA 2LCLA 2FG0A 4F7UB 4QSEA 5H8QA 3H0HA 3CSBA 3QZ9B 5AA3A 3H6VA 3MVYA 3UT1A 3EGDA 3CCUA 1IXGA 5J1DA 3EHUA 1NLPC 3VU3C 1CNQA 2ZYKA 4RXLA 1KA0A 5CQYA 1VIFA 2PVOB 3QBYA 3MYUA 3PV0E 2ZPGB 3Q27A 4RY1A 3L1AA 1VQLQ 1PDAA 3EG9B 4JBZA 1FPEA 3DLLA 2P0SA 1TWYA 1Q82R 2F3DA 2OTLT 1BP5A 1EYIA 1LSTA 4IGTA 4FEBA 4FIBA 1N3WA 4BY6B 3N6TA 4XU1A 5GAN4 3OSQA 2PVDB 1Y1ZA 3VS4A 4M75G 4G68B 4GX3A 3USDA 1RL2A 1W2BP 3V89B 4MEVA 3OEMA 4PFZA 3GIBA 3V83A 1S50A 3A8MB 4X48A 2L0AA 4J8OA 4ISUA 3LH5A 1OEBA 4A4KA 3VRZA 4AFQC 1OULA 4CC2A 1LNXA 1FPDA 4H8IA 2V3UA 3M3KA 4X9DA 1Y96A 3IB2A 1LFGA 3EG2A 1FQCA 1NUZA 2WBBA 4F7UF 1PBPA 1WHHA 4UC4A 2JT4A 5ET7A 2DD4A 2H8HA 2ANJA 1YJ9T 1IB8A 3EG0A 1E6HA 2Z0WA 3PFSA 3M55A 5TP9A 1D0YA 2CP5A 2XWOA 5GAN8 1M9SA 1SI0A 4ND9A 3OELA 1E6GA 4OVTA 4C5EA 2F1LA 1LOJA 3OYCA 4E2FB 4QHQA 1SKUB 2EQIA 3TMGA 1D3KA 5DT6A 5CBRA 1LBXA 3K02A 2O69A 1WHLA 4EQ9A 3JCMW 3HHGA 2D0NA 2J7IA 1TFDA 2F5TX 2F8DA 4IUPA 4OFOA 2DZCA 2EJGA 2JJKA 2R5MA 5A5XA 2CGHA 3H3GA 2DTOA 3C9HA 5IXBA 4JVCA 1IGQA 5GANf 5GMKh 4RYAA 4B9XA 1YZ0A 3VLVA 3SEWA 3DLMA 4OERA 1KA1A 4N15A 2QDYB 1K73U 2HKNA 1KC8U 1GL5A 2OBGA 3JCMb 4UACA 2OTLA 4ZTJA 2LNVA 1JBMA 2KY9A 4MZPA 1B3LA 1Y4TA 2CP6A 2PX1A 2HFBA 5H8HA 5BUUA 3RMQA 3WXMB 1UTHA 1T3SA 1FQBA 4A4EA 1MPCA 3LSFB 4DOWA 2THIA 2R5AA 4M75B 1ZKBA 4P9KA 4ZGEB 1NV2A 3G3IA 1M1KU 5AYFA 4LDYA 2GFEA 3H4ZA 1MMDA 5FU6B 1BCMA 4JLIA 3G3FA 5IXFA 1B3FA 3MWBA 2QQRA 3AHUA 1BIYA 1G3WA 1USYE 1B52A 4C92D 2WSEE 1YJ9A 4QRZA 1QCOA 1MQDA 2GTJA 1DMBA 1OV3A 2QEXT 3W9WA 2EYYA 4RTZA 4QT7A 1NUXA 1WJRA 4MZTA 3VVEA 3SHWA 3CC2Q 1VYUA 4I62A 2CZ0B 1MM6A 1PD0A 1M5FA 2HL3A 2ROTA 2JM8A 3RN8A 2YLBA 4O7IA 1RAIB 3G4SQ 4L6V5 2O84X 2NUVA 3V7RA 3TQWA 1ACMB 5DLOA 2DNUA 4M75F 4HE0A 2C0OA 3NHNA 3QKJA 3RT6B 3PIOA 1M5BA 1WHMA 1IMFA 1Z9QA 1VQ9T 3HFUA 1MXWA 4LDWA 1NKXA 2ZGWA 2VV5A 1SYIA 1PB8A 2VPOA 5CC2A 3KN8A 2M9UA 2XD2A 3GYYA 1NV3A 3C94A 3KN7A 2GCXA 4IO7A 4V2SA 1ZUKA 3OYJA 5LL6S 2FZKB 3PPPA 2A28A 1AVZC 2VT5A 5JEIA 1EIFA 4XKRA 3ME9A 4U23A 5AT1B 2DE3A 2CZ7B 5GMKe 1YITA 3THIA 1DK4A 1URSA 1Q86U 1NLOC 1F1BB 1Y71A 3CVGA 1QKWA 2EFIA 4OWDA 1RADB 2DERA 1ZUYA 4A63B 1Y9UA 3B6WA 1FTJA 5EQAA 1ZSZC 4XTVA 3RUXA 1HYOA 4R75A 4C8QE 3JB9F 1N76A 5I56A 4HCCA 3RR6A 1K0SA 4IUQA 3FIRA 5D7UA 5FHMA 2AL4A 1SHFA 4XTUA 3JCMd 4GWZA 5EHMA 5KYXA 1GBQA 2RJFA 4GL8A 3T22A 1TXQA 1ZBXA 3IJOB 1I69A 2PVGB 4OMOA 4I9DA 1KZ8A 2KI7A 4JZ4A 3REAB 1LGBC 3TZAA 2D8HA 4M77C 3Q26A 1YIJQ 5KDTB 5EYHA 5J16A 3OS0A 2CP7A 4Q5WA 4ONYA 4PP0A 2E10A 3MEAA 4J9IA 1EYKA 2V84A 2I3WA 4C0RA 1YN8A 1Q81C 1VQ6T 3RLFE 5GAOr 4XQ3A 4FCYA 1MNEA 1MGQA 3I5SA 2K5FA 3I9QA 1BKBA 1B05A 3C36A 4FL6A 1IMDA 1VQ9A 1S1NA 3IB1A 4M7AB 2G29A 3PGFA 1FTKA 3E4RA 2L5VA 2KROA 2NWJA 4II1A 2HXWA 2V1RA 1B7UA 5LJ5j 1YHQT 3S9MC 2X51A 4ORZA 1V76A 2GFAA 3M8UA 1J1NA 2XHDA 4LNPA 4FM4B 2EGAA 3T9NA 5KYWB 1UEBA 2Z23A 1VQ8Q 4F39A 3BW1A 1M1GA 1WYXA 2GQ1A 3CCQT 3CPFA 4NL3A 3G6ET 2DQVA 4N4IA 1Q7YR 3O66A 4C1UA 3OBYA 4JRQA 2UXAA 4HCKA 4M78C 3VVFA 1B40A 1RAFB 2EJFA 4GWYA 3BKIB 3PT9A 3TELA 1VQLT 3PPRA 8ATCB 4HA8A 5LJ5f 1TG0A 3CD6T 1BBZA 1N27A 2LQKA 4LUBA 4M7AF 4HT8A 3EH1A 4NF5B 4XU3A 3CMAQ 1B51A 2E5KA 5J3BA 1M3CA 2Y7IA 3EHSA 1P1NA 3N26A 3HV1A 3CCRQ 5EQ9A 2RK1A 3QO3A 5DW8A 4QVZA 1N8RU 1MMAA 2GHBA 1YJNT 4PJMA 2JNGA 4LDUA 4XAXB 2V8JA 3J80E 4NF8A 4ZEKA 1BI0A 2A36A 4AS4A 4Z7EA 4HE1A 5CMCA 2EQUA 2DKGA 5DLQE 1RI9A 1RABB 1VQ6A 3L2UA 1KD1U 3HHFA 4LP2B 4XTZA 1FWZA 2WACA 1VQOQ 1NV6A 3E1SA 2PT1A 5A5LA 2ZPHB 5CKDA 1M5EA 2HEQA 2RN8A 1JJ2S 4OEVA 2GBQA 4M7DG 4F1UA 3QWYA 3OYIA 4F19A 1YJWT 3G3HA 2P1SA 1B1HA 2CEXA 3JCMQ 1YHQA 3D4CA 1NYFA 2Q2AA 1BI3A 2FB7A 1ZU0A 2VC8A 4KH1B 3FC3A 4M75D 4C0DC 2DSFA 4NF6A 3CC4A 4U21A 4WXJA 4ZN3A 2Y5LA 2KT8A 1D3BB 2X9HA 4ZN1A 1SRMA 3CCQA 5FBPA 2RPNA 4PJNA 4C92E 3P8BB 3G6EA 1WVJA 4MMLA 3QUJA 3RNJA 1W2BA 1MH4A 2PT2A 4F22A 2EPDA 2LVMA 4LDVA 3HKSA 3JCMP 1VQNT 3IFAA 4E7SA 5H8NB 3QDRB 4XFEA 2YWWA 3X26B 1MQIA 2WBDA 3T9VA 5C0MA 5I2MA 3LC8A 4GXSB 4PBHA 1VQLA 2RD1A 2MKZA 3PGGA 3CD6A 1FTOA 3S9LC 3MPKA 1U1SA 3RERA 1FPFA 3KJTA 5GAOp 4P8BA 1QCFA 4PFWA 1X27A 5CKHA 4OB1B 3VKIA 2COWA 1TOVA 2FYIA 4RPOA 5CIUA 3U8QA 1NNTA 5AA2A 4H8JA 1X6BA 3EFSA 3GBBA 2BE9B 4JDSA 2CZIA 2F7BA 1G3YA 3PMXA 2K5IA 2G93A 5IAYA 4NN3A 3VXCA 1QUKA 2F6GA 2VB6A 2K2MA 2IA4A 4PAIA 4P47A 2DX1A 4BDZA 1MRPA 4RTWA 5HM4B 1JQFA 2Q88A 3K01A 4BE1A 3S3OA 5CQXA 3PIPA 2OZZA 1MH3A 3CHGA 2KLFA 4PDDA 1HJDA 1MV3A 3OYBA 3QSUA 2EAYA 3C33A 3FUZA 4I40A 4EQBA 1NJIU 1YJWA 3FD3A 2CSIA 2OTJQ 4MLVA 4FW1A 4M7DB 4OB2B 3U23A 2EW3A 1EZ9A 5DEXA 2V3QA 1R9LA 1Y3QA 3KFMA 2ZYOA 4YZZA 1FMVA 5L9OA 4HXJA 1U8RA 3V8LA 1OQGA 1KHIA 3JV3A 1TTHB 1QP3A 4PJOB 5CKBA 3K1MA 4RNSA 2XU8A 3PPOA 2MWPA 1RYXA 5LJ3j 3QPHA 1XVXA 2P2AA 2UYFA 3K6UA 3K4UA 1EFNA 1OI1A 3UA7A 1DBZA 4A4FA 5IZ1A 3CQTA 4DBQA 1VQNA 1NEGA 1DOTA 2ZZVA 1OQKA 2VXFA 4D8KA 4YKIA 4PK4A 1RKMA 4O5VA 2OI3A 4X1BA 3S6WA 2OAWA 3BFTA 3GF5A 3RTWB 4YU0A 3HL8A 2J05A 2EYWA 2KYMA 4AMCA 1FCKA 2QVUA 3RUMA 1U3OA 3HHTB 2SRCA 1K73R 3G7ZA 1KC8R 4Q30B 4FT4A 2UVIA 2DWHA 1K8AU 5KH6A 4L59A 4U22A 1YAEA 2ENMA 3OYLA 3BFUA 3FJMA 4KYSA 4DZ1A 4PFRA 1K9ZA 2KQWA 5LJ3f 2DP8A 1QULA 3E3KA 3FV1A 5DM7R 4PJOF 3UPUA 4LZ7A 2RM4A 3MSTA 2L3PA 1Z7NE 1H76A 1B4ZA 2R57A 3P7IA 4POWA 2RF1A 2NUTB 4QVCA 1N5ZA 3QYHB 1QKXA 2OWZA 1KFZA 3MW0A 1K9MU 2I6EA 3IOVA 3VUZA 3RKXA 2EKOA 2JN0A 1QGXA 1ZSGA 3DM0A 1XTDA 2ZCFB 3INZA 3JB9H 3CCEQ 3O9PA 4IIMA 2E5QA 1MPDA 1G8XA 2LDMA 2RCAA 3GPLA 4AFZC 3EGXA 4ELYC 2A37A 1KSWA 2VGNA 2M02A 2X4WA 1PD1A 2FL7A 1IIWA 3KGCA 4QBAA 3G4SA 1UECA 4I3YA 4QFKA 1N7XA 1QUIA 2KXCA 1I81A 2ZXTA 3CG1A 4N91A 1ABOA 2EQJA 1N9SA 2ZYMA 3SWNB 5LJ5d 1JNFA 4J5YA 3KJ7A 5I58B 2DL7A 4NTLA 1I4K1 1HSQA 3X20B 1US5A 1FBGA 4IUUA 2DJZA 1KK7A 1M2OA 2EBPA 3O97A 4C8QC 4PQJA 3VLWA 4M4GA 3BE3A 3MZ1A 5AA4A 1N9RA 1MPBA 4BI4A 3THKA 2AYSA 3OY9A 1SG5A 2CZ1B 2RQWA 5FU7B 4O7MA 2V8IA 1YFNA 2I58A 2RQVA 4RUGA 4PJLA 2RHIA 1VQ8T 3RTFB 1MQGA 1YTVA 3TTRA 4ZEIA 5DTBA 3GZGA 4QF9A 2J6KA 1JVXA 3H06B 2M16A 5HBCA 3UWNA 2DEUA 2PFYA 3EFOA 3HO7A 4X1DA 4PJJA 3TSWA 2H3EB 3SERA 2YRVA 3G3KA 3U65A 4OFLA 1EYJA 2HBWA 3OYAA 4FW2A 3QSLA 3UA6A 4CRIA 1DTZA 1Q86R 2ED1A 2GGRA 2KT1A 3R6UA 2AIXA 2A0FB 5AA1A 1LJOA 1PRLC 2IPOB 3O5ZA 4E47A 1QVGP 1B5JA 2XWKA 1FMWA 3FXBA 2HEUA 1MXYA 3EHTA 3FASA 4H45A 1M2VB 1MM7A 2O1LA 2RC8A 2LJ1A 2DL4A 2ZPEB 3FDRA 4F3SA 4OMBA 3FV2A 5GAMj 3CCRT 2Y84A 5A0LA 4DI3D 2BE7D 5I2NB 5EYGA 3E13X 3VYHB 2CMOA 2QRYA 3OS1A 1KG1A 4PF8A 1HSEA 4U4XA 2CEYA 2VVKA 2RCBA 3SEYA 4X1VA 4OVSA 2HKQB 3UORA 2DVJA 1AMFA 1R0BG 4F7UG 3S4UA 5JTYA 3OS5A 2UVGA 3ZEHA 3CFZA 2A08A 4MNIA 3FLGA 1VQOT 5GAN3 1TT1A 3F11A 2XIDA 2D0QB 1VQ5Q 3CC7Q 3MP8A 3VUBA 1SVXB 5CRYA 3CCMQ 1EX4A 3EF7A 3T1BA 5KYYA 3RKYA 4J83A 1IUDA 4DEYA 2GNCA 2E12A 2NUPA 4OMQA 4ELZC 2F5XA 1QWFA 2B4MA 1IRXA 3M0PA 5GAMf 2QXFA 3M59A 3OYMA 1VQ8A 1XI6A 2V3TA 3ER0A 1IXDA 2LQNA 5KZTA 4RK9A 1NUWA 3UK4A 5KYUA 2HCAA 2L3QA 2PYYA 2BIVA 2R6GE 3PUVE 4N81A 4PETA 1RDYA 2Z8EA 4PFUA 3CCSQ 2VHAA 4LQ2A 2Y7PA 1SW5A 5H8FB 5I2SA 2HBPA 4PAKA 2B3FA 2B65A 2QQ9A 4LE9A 5GJVB 2DO3A 4RCBA 3CFXA 3ULRB 1N7WA 3JCMc 4IY5A 1JEGA 3K1PA 3M3LA 2MK5A 4FYVB 2PTKA 2CS7A 4M7DD 2REGA 2FYKA 1N04A 4LD6A 5CKFA 2XXTA 4D6WA 4WEDA 3EKIA 4J9CA 1NNFA 3ISPA 1Y07A 1ZJLA 3CCRA 4DI4B 4P3LA 3VDFA 5IZ3A 4RJZA 4DA4A 2ZPFB 5B7DA 2I0BA 4LN2A 5GMKm 4TQUQ 1N8RR 3KC1A 4C92C 3TDJA 4RTTA 4LVQA 1NFTA 5CMMA 3B6QA 2C0IA 2KBTA 3I35A 4F7UA 4M1VA 2FIXA 2V1QA 1VQOA 4NWDA 3MPLA 2MAMA 4N4UA 2JMAA 2QS3A 1FQFA 3TCHA 4H0WA 4ZZAA 4NG7A 1KD1R 5I59B 4OXVA 4C5HA 5A0DA 3I6VA 4N4HA 2V25A 4K3FA 3PVLA 2OTJT 3EG9A 4LONB 3IB0A 3HRTA 2KQZA 4U1OA 3R6NA 1YNZA 2XXRA 5LJ3d 2X7PA 4HVWA 3ZBDA 4G68A 4Y92A 2QASA 5JK4A 4X9TA 2O6AA 2WYKA 5KCJB 1OPLA 1JEVA 2FNCA 3HCQA 5EHSA 3QWXX 3KXTA 1X01A 2K3YA 4OMLA 2EVRA 3MKDA 1R77A 2RC7A 3PUXE 1Y3PA 4JUVA 1B3EA 1VQPT 3JZJA 1W2BS 2RB6A 4PGNA 1B46A 4FORA 1USYH 3MVZA 4KT0E 4J6XA 3O6GA 2ZMBA 1G83A 2X4YA 5GANj 2QMXA 3P8HA 2B4LA 3TPAA 5IH2A 3PMVA 2DM1A 2DD5A 5EQ8A 2KXDA 2DE0X 2RJDA 4KXPA 2CZHA 2LJ3A 1EU8A 4BI3A 2QGFB 1Q82C 2H4IA 1OIBA 4PBQA 3LLRA 3C35A 4DIGA 1SD3A 1IREB 3NGPA 5GAN2 2BTTA 3QMFA 4KCDA 2CH4A 1I6QA 4ESWA 1NG2A 1RI0A 4EDUA 4F3BA 4UABA 2VKNA 1IMEA 1QLYA 2ONSA 3H41A 3JB9G 2DVCA 2A5SA 3FRNA 1FMKA 2D3IA 4DBRA 2I0CA 3HRUA 2XHCA 3CCLQ 2UVJA 2KE9A 1XNIA 2HDAA 4EMKC 2HZLA 3FXQA 3I5OA 5I84A 1X6GA 2OTJA 3NOHA 3MP1A 2P0KA 1NJIR 4N0AA 1PEBA 1PC0A 3CG3A 3DP8A 4C5GA 2DOJA 1B7TA 4R55A 4BE2A 1JW4A 1Y4CA 4EIKA 3EFRA 4QXDA 2XMFA 2ZPIB 3PTYA 3V7CA 2Z22A 2LP5A 3VS2A 3VS0A 3IFCA 3C12A 4QW2A 4N8YA 1RACB 3H6TA 4M75A 3H6WA 1SPIA 4Z02A 3PUYE 1VR5A 5I21A 1YITT 3SZPA 4JPBW 2O01E 1VQPA 6AT1B 4QFLA 1UGRB 2DVEA 5I11A 2RI5A 1NYGA 3BDLA 1X43A 3OS2A 3GNGA 1RLPC 4MAGA 4J9EA 5LJ5g 2DEQA 1TS9A 4CI0C 1WGSA 3RT8A 2VP1A 2NUZA 2OAUA 4KPTA 3CBMA 4QQ6A 1WQWA 5IAIA 1C1AA 1G5VA 3DP6A 3FJ7A 1YP5A 1ZBMA 1SW1A 2M0YA 2ZZXA 1FTAA 4DQ2A 1G2BA 4BE0A 4BDNA 2RQRA 3V7SA 3R26A 2COZA 2ALUA 1PC3A 1M1FA 1OVTA 1KQ2A 1K8AR 4H5GA 5D6XA 2I3VA 3OW2A 3QUIA 1ZSZB 1S72T 2QMWA 3HPIA 4CC4B 4LZ8A 2DWJA 3TKDA 3U93A 4AG2C 3M54A 5CCAA 3B7DA 1T0HA 1UGSB 4FSSA 2EYQA 1QW1A 5FWBA 1A55A 4JZ3A 4JJBA 1OMPA 5GAMd 4M7AG 4OVRA 3ZSFA 2FPFA 1DPEA 4JDFA 5CMKA 1GGGA 1RLQC 4QKUA 5TPAB 4F1YA 1HXDA 5LJ5e 3PTAA 5FW9A 2NVUB 4JJDA 5I57B 4NEDA 4QFOA 4M77B 1B0HA 1VQ4Q 1N84A 2XG8D 1R6ZA 1IZ1A 2F36A 2HQ0A 1FXXA 4EMHA 1YI2T 3G71T 2DL3A 2GH9A 5FTIA 4EXLA 5ITOA 4OEUA 1PCXA 3CFLA 3M0TA 3M58A 4UA8A 3QYGB 2AKKA 4QQDA 1LBVA 1W6XA 3TSZA 2HAUA 2DYIA 1GV8A 4M7DE 1A8FA 1DSNA 1S7YA 2XWVA 5GAN7 1VQ5T 4N6PA 4LZ5A 4P0GA 5I22A 3CCJQ 5GAN5 3PUWE 4PE3A 4R73A 3T96B 5IZZA 3BIHA 3K1NA 3N5LA 3MJNA 1VE4A 4BDOA 2DA9A 4AFUC 4TLLB 2V8KA 2BKDN 2H98A 2LMJA 4LUEA 4XTYA 3KZGA 2Z8FA 4PFBA 4F1VA 3RPLB 2I49A 1LVKA 1VYTA 1YXIA 3HRSA 1QVGA 3G7WA 5ET5A 4M77F 4LDXA 2PQWA 2QVVA 3WVEB 3PUZE 1P92A 4N13A 3FATA 4LA9A 3TQ7P 4M78B 4BUGA 5KDTA 5CI5A 5F7VA 3CCST 1INPA 3ZFJA 3AXFA 1M90U 2JTEA 4JS5A 4XXUA 1S72A 2X4XA 4I8CA 4H46A 1CSKA 1WXUA 3O8VA 3TU4K 2ZZDA 5KYNA 4ESXA 3OO8A 1VQKQ 1I6BA 1PNJA 3S9EA 4M7AA 3LWIA 3N6UA 2YUQA 3OBWA 3L6HA 4RTVA 2QGGA 2VGMA 1BLFA 5H8SA 1R9QA 3QAXA 4YB6A 1KQSP 1NI9A 1B5IA 1PKTA 3OO9A 1RAHB 4N8GA 1SEMA 1D1CA 3BY7A 5KYWA 1YI2A 3LYIA 1ZTYA 4JJCA 3C4MA 1YWOA 3G71A 4TVRA 1QMCA 5J39A 2V4CA 4R0KA 1NNPA 4F17A 1FRPA 2RQTA 4PC9A 1IQ7A 3G3GA 2DPPB 4GXAA 4IURA 3CC4T 1NZ9A 4NWCA 2V93A 3C34A 4MF3A 4M78F 4ELQA 3FXUA 4PF6A 2FEIA 2YJPA 3JSCA 1FSAA 3A3UA 2YSQA 3A1PA 5IT9E 3VS7A 3JRZA 2O9VA 3CC7A 1D09B 3NTIA 1VQ5A 1O7TA 3CCMA 1ZBJA 2CYZB 3OSSC 2OX7A 4AB5A 4DCXA 1PSFA 1TSFA 2EJ9A 5L8RE 4NF5A 3EPEA 1UJ0A 2Y7KA 4N4GA 2UVHA 2DBMA 1K76A 3FVNA 1V1CA 2DE2A 2I2LA 1SPKA 1YYZA 2DXYA 3RY3A 1B34B 2P4TA 1FJ6A 4XTCQ 2XXHA 2K2VA 1OX8A 1T3LA 1WODA 4PFOA 2HZYA 4J9GA 2O4XB 3CCSA 5LJ3g 4FU6A 2ABLA 2QYZA 4AT1B 5HK0A 5GANd 5F24A 4N07A 2F5KA 1BCOA 1PSEA 1TUDA 2DMOA 3IX1A 2FA7A 1PM3A 2YXYA 5FRNA 1Q7YC 4F31B 1P1OA 1VQMQ 3SFMA 3Q25A 2HQHA 3CXCP 2QSXA 2AT1B 3NMZC 3M9QA 1VDWA 1NBEB 3PPNA 3A8GB 2KR3A 3DB3A 2DIGA 1UGVA 1B5HA 4OFJA 4P56A 3ZKLA 2ONRA 4DEXA 4KH0B 1G0IA 4IIOA 4JVDA 3EHRA 4DBFA 2Y90A 3OD7A 4JXIA 4PL6A 1JB0E 2YLCA 4AFSC 4PJOG 2QS4A 1D3BA 2HZKA 2YRDA 4AG1C 2K7AA 5LJ3e 2WSFE 1LLSA 1KHCA 3E19A 2YHTA 4OZ9A 3FJPA 3GOXA 2J6FA 2K4YA 4DOVA 2DAQA 3ONMA 3CCLT 5H8NA 3RBBB 3QK6A 2FIEA 5GAOn 3TUSA 1RAAB 3M0QA 3U94A 3PNWC 3OYHA 3TTKA 1WNLA 2LQWA 3M5AA 4FIMA 1I1JA 4GX6A 2QDLA 1UGPB 4GWOA 2A5TB 2MI6A 1TFAA 2DXBA 2OWSA 3H6UA 4CC3A 3A8HB 1FW0A 4NAPA 5I3SA 1CB6A 3VRYA 2Q2CA 1ZLQA 1OX9A 3CRBA 3ZKKA 2K6DA 5ESYA 2DE4A 4JB7A 3M3FA 2DBKA 4ELRA 1LBZA 4YKKA 1H92A 2X4JA 4GBQA 2WEFA 2BZYA 4KUIA 4J9BA 1MS7A 1MHNA 1VFDA 4RG8A 3JB9D 3SESA 2VGQA 1JETA 2QAZA 4G4PA 5I7IA 2LX7A 1FQAA 2CREA 5IHKA 1O64A 2PMSA 1MY3A 2DK3A 2EQMA 3V8JA 4FECA 1VQ7Q 2DXTA 1GTKA 3FGSA 4DXUA 3PU5A 4GQOA 1U1TA 2BUDA 4GLKA 4Z8AA 1H3ZA 1NV4A 4BDYA 5ET8A 4ZECA 3SDZA 4M7DA 2DWIA 2XX7A 3OYNA 1SSFA 1UTBB 2RKMA 4PAFA 3META 3I56Q 2GRVA 2DIQA 3CC2T 3L42A 3VLUA 4GWWA 4B6MA 4GVOA 3MP6A 4PJOA 1N3XA 2EQKA 2X35A 1GCQA 3G4ST 4GRKA 1SSHA 1NM7A 2HXRA 2OWTA 2Q89A 1SI1A 3E9XA 4FSXA 1JXMA 3JCMh 1AWOA 4GFRA 1C0MA 5CVIA 5ITPA 3CCLA 2VPNA 4IY6A 3A8OB 4NF4B 1XOVA 4DBHA 1MQJA 4X8RA 5L9SA 1Y7XA 3OSVA 4JLGA 3ROJA 4GX4A 2XXPA 3H7MA 3EG1A 3C4SA 2YPNA 3PMWA 2B8AA 3F70A 4F7UE 1QUJA 3KFVA 3RPWA 1LAHE 2VUBA 2G6FX 1H3DA 1URDA 4H65A 1FPIA 1WHJA 3V8XB 1AHJB 1CKAA 4R2BA 1GCPA 4NE4A 1GVCA 3OENA 1BI2A 1JO8A 1VA7A 3GBQA 4Z0IA 3CCJT 1ARKA 4C8QB 4ZEFA 4RTUA 4GL0A 5IHNA 4F14A 4E0WA 4ELOA 2F2VA 2NUTA 3OYFA 3ECRA 4M7AD 2F97A 1M1KR 2LX9A 1XHYA 2P3NA 3B8BA 1ZUUA 1NV1A 3C0CA 1B07A 4G8HA 1BIAA 1XT8A 4ZE9A 5GAMe 4OESA 4Z89A 1TUGB 2RI2A 3HPWA 4J7IA 1GFCA 4KCCA 2PVUA 2VD3A 1QVSA 3FIFA 2E1HA 4F2OA 1K73C 2DRKA 1KC8C 3CC2A 3IOTA 5CM6A 1IZ6A 2F6PA 3RMSA 1YIJT 4M7DC 3JCMg 1QKBA 2I4CA 3OW2S 3MZ9A 3L6GA 3W9VA 3SWNA 2RJEA 4MJOA 5I58A 2ED0A 1AOJA 4C8QF 1D9QA 3RIRA 2C06A 2OK2A 2QG9B 1GCQC 1NV5A 3PMIA 1M1KC 3QG1A 1UIVA 2XDDA 1M5CA 1Z7ME 2ZZWA 4XEQA 3TVTA 4AB6A 1MMGA 4F3PA 3HFNA 2PBWA 3EGUA 4R6YA 5GANh 3VS3A 2JTMA 7AT1B 3BFMA 1NPRA 3O6IA 1LFHA 1WXTA 3X28B 3KEIA 2XXKA 3MJXA 4PE5B 4ESRA 1Q81U 3JCMe 4AQ4A 4NMYA 3LSWA 1PB9A 2F78A 3CCJA 3IOWA 3QYTA 5HKCA 1G0HA 3QDFA 2QA4Q 3CR9A 1FBFA 4Q0CA 1I5LA 2KR0A 2CUDA 1I6AA 4IO2A 5IGAA 3IQLA 3URGA 2QQAA 2H3JA 3U92A 4M75E 1M2VA 5GJWB 1P1WA 2MWOA 4BDRA 1KJWA 2H25A 1A40A 4MDWA 5I2NA 3CMAT 2DILA 1HD3A 1FTMA 4A53A 2QEXQ 1OU8A 4E7KA 4HVVA 3MEWA 4O6JA 1M4ZA 3DELB 2YRCA 1QVGS 4FBPA 4R6KA 1NUYA 1MY0A 4EDPA 1Y3NA 3H8ZA 1KQSA 3KSXA 1MY4A 1WA7A 4H1XA 4RA1A 2L3SA 1I0CA 1YIJA 1B7ZA 2E1SA 4A4HA 5I5PA 1M90R 4PFTA 3K6XA 1KQ1A 4RMOA 2VWFA 1VQKA 2FO0A 2F3BA 4DDDA 2XD3A 2VASA 1A99A 1BYMA 4P5NA 2K9GA 4MBPA 5GANg 4IUVA 2DXRA 1Q86C 1VSOA 4KYDA 2WKYA 1SRLA 2FZCB 3UATA 2ZNTA 3OOAA 4C0GA 1M27C 2A7YA 4AS5A 4BACA 2PNIA 4J9FA 3TQLA 3P8DA 4C92B 1TXFA 5AE4A 4XKPA 4J6WA 3R6OA 4KFQA 4OF1A 1ZIUA 2B86A 3I3VA 4O3CA 4ATOA 1MDP1 2MYSA 2LT1A 3KBGA 5H8FA 1GRIA 1AT1B 3NTKA 4KGVB 4OVPA 5B70A 2EYXA 4OMPA 3UDCA 2KMTA 4Y91A 1NE8A 2I4BA 1OLCA 2DTHA 1LCKA 5J26A 4OENA 2OX3A 5GANe 3QJYA 1SHGA 3LR1A 4ZGDB 1MY2A 2E6ZA 3KSJA 2M1HA 5L8DA 1RUWA 4G8NA 2CP0A 4LXCA 3CXCA 3CMAA 1OYXA 1B2HA 4DXBA 4JSDA 3N5BB 3UP9A 2KYBA 2LJ0A 3LGFA 4C92F 4PJOD 1X6OA 3CPWP 1H641 5GAOl 5IM2A 1DJ7B 4GWXA 4L17A 5DYHA 3FJ5A 2DYBA 4HKEA 4OETA 5I2KB 4WKMA 5FTHA 1VQMA 4OGEA 4PCDA 2H9BA 3KUFA 1QVFP 1VQ6Q 1XOCA 4Q8RA 2A3LA 2RHYA 1IITA 4NHBA 1II5A 5I59A 2I48A 5EG2A 3QJ6A 1UFFA 1JW5A 2XXVA 5GAOm 1XC1A 4MNPA 1BI1A 5CK9A 4RPNA
chains in the Genus database with same CATH topology
3OYGA 1MDQA 3OSRA 1UIUA 5GMKi 3I56T 1H44A 4IO3A 4F3GA 2KVQG 4OB0B 5KCJA 3RKWA 1A7LA 4M7AE 3ASKA 4BD3A 2P0PA 4ZTFA 4I1DA 4GF8A 1ATGA 1LCFA 3OO6A 3OQ5A 1N8RC 1RYOA 4EMKB 3OYEA 4IO4A 4FAJA 2L8DA 4JRKA 4DLDA 4YKJA 4PKCC 4R56A 5H8QB 3QHSA 5ELVA 5CR2A 4DE8A 1KD1C 3JAME 1Q1KA 1UQWA 5DVFA 4ME7A 3EN3A 2QPQA 3H6ZA 2ESNA 4QSDA 5ISUA 4EPCA 3WAEA 5LJ5h 3MEVA 4YAHX 1AOVA 3LBSA 3BBRA 2GFUA 3TEEA 5A0GA 2QS2A 4QFNA 2F35A 2FHDA 4XTWA 4R2FA 1WDNA 2PUKB 2QL3A 1Y96B 1QKAA 2F69A 3JCMX 1B58A 1VQ7A 4M77G 1SQYA 4LD9K 1BTJA 3S2VA 3W15C 2OJTA 5FHNA 2XX8A 1LAXA 1AIVA 1LBCA 2R9JA 2ZNUA 4P11A 3CCET 3I56A 1NH7A 5TP9B 2XI9A 3L2ZA 4IUTA 2LCCA 4FATA 4XU0A 4R72A 3MBPA 3FVGA 3LSLA 5K2YA 2F7CA 3CIJA 3R7XA 2Y4XA 4XIGQ 3VV5A 3VV0A 3O6HA 5LOMA 4BY6C 1URGA 4E0XA 4G68C 1XQHA 1M5DA 3M56A 4OVJA 2ZNSA 4KD5A 4ZZEA 2HQXA 1IXIA 5A5XB 2F34A 4OQOA 1T0KA 3MUQA 4E7JA 4U4SA 4ZGJB 4MLQA 1LB8A 3PD9A 4M78G 1D9VA 5EYFA 1O9SA 1NJIC 5TU0A 1R1NA 3Q1JA 1HK9A 4H6DA 2GHAA 5IKBA 5H8HB 4U2RA 3GBAA 1UTHB 4KR5A 1QP2A 2Z8DA 2QA4T 4B9WA 2VXEA 3EAEA 4RK2A 4C0FA 3TODA 2O7UA 3C31A 3OYYA 2QI2A 5TPAA 1OVBA 5CKEA 5IN1A 4JRPA 1QW0A 3K6VA 1R8OB 2RC9A 5I57A 4THIA 3UGWA 4M77A 1EZPA 3OYKA 3TCGA 2LTOA 4IGRA 1N0TA 3QXEB 3JCMJ 3JV9A 3CCEA 3LSXA 4HS7A 3RESA 2RK2A 1A8EA 5KCOA 4NOYA 2K5LA 2NXOA 4ZDMA 3PD8A 4HCWA 4N0AC 1K8AC 4X9CA 4GOTA 3A09A 3CC7T 1FX7A 4DCYA 1M5Q1 3CCMT 1TH7A 2XXQA 1ZQ1A 4PJOE 4M75C 2XXUA 5FROA 3TTMA 5FU6C 4BI8B 2H99A 1WJQA 1K9MC 1CE2A 3SEXA 2K57A 4A4GA 3DB4A 2DVZA 4EXKA 4M78A 1B1XA 5HPQA 4TOZA 1X75C 3S3NA 1DTGA 3OYDA 2IEEA 4BLAA 1YCJA 1NH8A 2JVVA 2R58A 2QA4A 4RG2A 4POXA 3L2WA 3LH0A 5HY6A 3LGLA 5LJ3h 1D4NA 1IXHA 4OHNA 4DXCA 2HQEA 4QSCA 4F29A 3ILTB 1HSLA 4H67A 1LAFE 5I56B 2QEXA 4L5GA 1L5TA 4U1ZA 4IKFA 3DLNA 2IG0A 2F7AA 3GP8A 2VOZA 4ECFA 1HSJA 1EZOA 2XXWA 1KQSS 3WAFA 2OCUA 2XXXA 3UIFA 1NL5A 4OP0A 3GLXA 3T66A 3KBRA 4O3AA 4BDLA 2MF2A 5KCHA 4OB3B 4OTEA 3L2RA 2XKOC 1B3HA 3TTNA 2QS1A 3J7AF 3M57A 3ILUB 3BDUA 2RINA 3SB2A 3CI8A 4EUOA 3L2QA 4C0DB 3C32A 3MEUA 1MXUA 1MXXA 3OMCA 2M0OA 1B34A 2KDSA 3JCMV 4R9GA 4IO6A 3O29A 2L5QA 1LBBA 2O4XA 2OLBA 1ZMGA 4ZS9A 1JRIA 3OB9A 4P0IA 3TCFA 2ZPBB 2HNIA 3HP9A 5DY9A 1B0LA 5DVIA 3K00A 3QIIA 1YPNA 1QJMA 2DS9A 1YCYA 4FEDA 3CPWA 2O68A 4YICA 3V5AA 5GMKj 2ZYNA 2CZ6B 4FJPA 3FZVA 5F1QA 2D6FA 4ZEBA 1FQDA 1P1QA 3JB9J 3MZBA 5D6WA 2E0SA 1QVFA 4E7LA 4H5FA 3RNNA 4G77A 1FQEA 1JEUA 4A54A 2XDPA 3M4YA 1JVYA 3CXCS 4KHZE 1SW2A 3Q28A 4M7AC 3TCJA 1YBYA 3OXNA 1OLAA 4WF2A 2VYTA 1B7HA 2RO0A 2RI3A 2EWNA 2RHUA 3K2DA 2Y7RA 2XDBA 3IO4A 4NF8B 2W7YA 3FVKA 2MMPA 3T9HB 4FE8A 1SYHA 3MO8A 1XVYA 1WJSA 4X34A 5GAOq 1N6AA 3IK6B 3QUFA 3HSBA 2BJJX 3DP4A 1V29B 1B6HA 2D5WA 3ODBA 3V8KA 2LQ8A 2E41A 1Q82U 3QIMA 2IVWA 2A5TA 3MC2A 3CBPA 4NL2A 1BKAA 2O1MA 4C1TA 4GY5A 2XXIA 2XICA 5CAIA 4R6HA 5FLXE 1S9TA 4XKQA 2Y4YA 4HCZA 2JUFA 4KULA 3LX7A 2JOYA 2QQBA 4YTLA 1SW4A 3IAZA 5GAMh 4NF6B 4C8QG 1LAGE 3KOTA 1VIEA 3VVDA 4PNOA 2RHXA 2K3XA 3VXBA 3GLBA 2D21A 4RCCA 4G2ZA 3I55T 1EH3A 3GXAA 2DXUA 4M77D 3A8LB 4MFIA 1G3TA 4E7IA 5FHOA 3LW5E 3K0VA 1UTBA 4Y28E 1MG1A 1B9JA 2RHZA 4JWXA 3ZS6A 1YJNA 1SBPA 2AHJB 1P99A 1I8FA 4QQGA 4LQ5A 5AA2B 3VE1B 3GNFB 3TYHA 3O28A 2DZ9A 2R71A 1WPYA 1WQ7A 3TREA 2RH2A 4NF4A 3FJGA 1A54A 3SDFA 4PLIA 3U72A 1VQ4T 2AL5A 2XK0A 1M8VA 3QXMA 5GAMg 3FVOA 2JZ2A 3SETA 3HFOA 4M78D 5CO7A 3CMET 5DEXB 4HT9A 1NPPA 2CKKA 2HAXA 4C8QA 4ELPA 1W4SA 3WVDB 3MVXA 3CCVT 1O63A 3B6TA 3A5ZB 1H43A 2D9TA 2LT4A 3D4GA 4GLIA 3I55A 2G3RA 2LC4A 5D6YA 3SD4A 3IL1B 2UYEA 4Q5TA 3RGYA 1P1UA 1LFIA 3J81E 4EMGA 3NFCA 1PB7A 3K6WA 4HTGA 2KK4A 4M7DF 1GR2A 5A2QE 3SKPA 1XS5A 5M2VA 3T93B 3MVWA 3PMTA 1IXCA 1AL3A 3LWHA 1Y20A 4KI0E 3OO7A 4C0ZA 1MXVA 2XX9A 4MH5A 5ICQA 2M8CA 2PU9B 2L89A 3U1OA 1POY1 4QFPA 3OA6A 1D9YA 1VQKT 3O2AA 4PJOC 1MXZA 3VJPA 2E65A 3M53A 3SEVA 4JSOA 4MZMA 3X24B 4C92G 3PPQA 4J7FA 2O7IA 1VQ4A 4EQ7A 2CZLA 2KSSA 1BIBA 4IO5A 4YMBA 4KUDK 3CBOA 1F9BA 2ONKE 3CSGA 3LUYA 4KQPA 4TLMB 3CMEA 1KWHA 3MHXA 3TAJA 2Q9TA 5BWJA 4EF1A 3CCVA 4F18A 2NLUA 1DPPA 2H5YA 4YKPA 3TEPA 4GIZA 4LATA 4EF2A 3NTHA 4KYEA 1B3GA 1GXIE 1SDXA 4JWOA 3T9XB 5DVJA 5AA4B 3S9NC 3UA8A 2EIFA 5GAN6 2DWAA 4MDXA 3N94A 2YLNA 3DKMA 3SEUA 2WSCE 4GD5A 4YB5A 4HCYA 3E9FA 1G3SA 3FB9A 1Y1MA 3UN6A 1OZ2A 1VFEA 3M4GA 2XD0A 1PBQA 4G8MA 5CBSA 4JRIA 3JYRA 1MY1A 4XKNA 2GQVA 2NOOA 4BDQA 2P0QA 3L2VA 2E70A 4R9FA 5FRMA 2HD0A 2RJCA 3KOSA 1POTA 1US4A 2LAOA 1VQMT 1H45A 2DXCA 2QTXA 3E9GA 1NMUA 2ABHA 4OMFB 5C6SA 5L9MA 3S3MA 2KAFA 3SWNC 4R74A 3T9UA 2QJEA 4XU2A 2XXYA 3TTLA 2O51A 3MAMA 3X25B 4C92A 4NS5A 5HK3A 4ZEDA 3IORA 3FXRA 1UB4A 1ANFA 3MCAB 2E64A 2QQSA 4HW8A 1FTLA 4QVDA 1QVPA 3MQ9A 3RQTA 4J6YA 4IB2A 1ELJA 1LB9A 4YMAA 1IEJA 5FU7C 3IJXB 3HSTA 1O75A 4M77E 2DYXA 1Q7YU 3HN0A 3KN3A 3IR1A 4ZE8A 5JTYB 3QZ5B 1M90C 3CEYA 2PUOB 4JS4A 2VD2A 2RA2A 3IO6A 3CCUT 3H03A 2REJA 4KBMB 4JJNK 3EQ1A 1LCTA 2GF7A 4VUBA 4HCBA 2Y7WA 4O3BA 4PFYA 2Q8JA 2X7QA 3IOUA 1OZ3A 5KE2A 5AA2D 4XK8E 5KE3A 2DTIA 4BB7A 4F2QA 4BDMA 1B4HA 1ZHIA 4FT2A 3JB9I 1AH5A 4MMKA 2X26A 3Q29A 1NNKA 1UGQB 4C5IA 4OGCA 2HAVA 3G3JA 5I2KA 2E6NA 3OMBA 4JWYA 3C95A 4M78E 3CPWS 5GMKl 4OVAA 4OYVA 4XTXA 3A3CA 1JJ2A 4YB7A 1VUBA 2JTFA 5M9OA 1VQ7T 2LRQA 3KG2A 3VYGA 1JW1A 1QVFS 1MQHA 1OQHA 3OMGA 3TFLA 1B32A 3VFJA 2B3BA 4RKUE 5CMBA 2FVUA 3JCMf 4C8QD 3FEOA 4PLLA 1Q35A 5K2XA 3OEKA 2L3RA 5ICTA 4EMKA 4WEPA 4E7HA 2LCLA 4F7UB 4QSEA 5H8QA 3CSBA 3QZ9B 5AA3A 3H6VA 3MVYA 3UT1A 3CCUA 1IXGA 5J1DA 3EHUA 3VU3C 2ZYKA 4RXLA 5CQYA 1VIFA 2PVOB 3QBYA 3PV0E 4RY1A 2ZPGB 3Q27A 3L1AA 1PDAA 4JBZA 3DLLA 2P0SA 1TWYA 2OTLT 1BP5A 1LSTA 4IGTA 4FEBA 4FIBA 1N3WA 4BY6B 3N6TA 4XU1A 5GAN4 3OSQA 2PVDB 1Y1ZA 4G68B 4M75G 3USDA 1RL2A 3V89B 3OEMA 3GIBA 3V83A 1S50A 3A8MB 4X48A 4J8OA 4ISUA 4A4KA 1LNXA 4H8IA 2V3UA 3M3KA 4X9DA 1Y96A 3IB2A 1LFGA 1FQCA 4F7UF 1PBPA 4UC4A 2DD4A 2ANJA 1YJ9T 3PFSA 3M55A 5TP9A 5GAN8 1M9SA 1SI0A 4ND9A 3OELA 4C5EA 1LOJA 3OYCA 4QHQA 3TMGA 1D3KA 5DT6A 5CBRA 3K02A 2O69A 4EQ9A 3JCMW 3HHGA 1TFDA 2F8DA 2F5TX 4IUPA 4OFOA 2DZCA 2EJGA 2R5MA 5A5XA 2CGHA 3H3GA 2DTOA 3C9HA 5GANf 5GMKh 4RYAA 4B9XA 3VLVA 3SEWA 3DLMA 4OERA 2QDYB 1K73U 1KC8U 2OBGA 3JCMb 4UACA 2OTLA 4ZTJA 2LNVA 1JBMA 2KY9A 4MZPA 1B3LA 1Y4TA 2PX1A 5BUUA 2HFBA 5H8HA 3RMQA 3WXMB 1UTHA 1FQBA 4A4EA 1MPCA 3LSFB 4DOWA 2THIA 2R5AA 4M75B 1ZKBA 4ZGEB 3G3IA 1M1KU 5AYFA 4LDYA 2GFEA 3H4ZA 5FU6B 4JLIA 3G3FA 1B3FA 3MWBA 2QQRA 3AHUA 1BIYA 1G3WA 1USYE 1B52A 4C92D 2WSEE 1YJ9A 4QRZA 1MQDA 1DMBA 3W9WA 2QEXT 1WJRA 4MZTA 3VVEA 4I62A 2CZ0B 1MM6A 1M5FA 3RN8A 2YLBA 4L6V5 2O84X 2NUVA 3V7RA 3TQWA 5DLOA 4M75F 3QKJA 3RT6B 3PIOA 1M5BA 1VQ9T 1MXWA 4LDWA 1NKXA 2ZGWA 2VV5A 1SYIA 1PB8A 5CC2A 3KN8A 2M9UA 2XD2A 3KN7A 3C94A 4IO7A 2GCXA 4V2SA 3OYJA 5LL6S 3PPPA 5JEIA 1EIFA 4XKRA 3ME9A 4U23A 2DE3A 2CZ7B 5GMKe 1YITA 3THIA 1URSA 1Q86U 1Y71A 3CVGA 2EFIA 4OWDA 1Y9UA 3B6WA 1FTJA 4XTVA 3RUXA 4R75A 4C8QE 3JB9F 1N76A 5I56A 4HCCA 4IUQA 3FIRA 5FHMA 2AL4A 4XTUA 3JCMd 5EHMA 4GL8A 2RJFA 3T22A 1ZBXA 3IJOB 1I69A 2PVGB 4I9DA 1LGBC 3TZAA 4M77C 3Q26A 5KDTB 3OS0A 4Q5WA 4ONYA 4PP0A 2E10A 3MEAA 2V84A 2I3WA 4C0RA 1Q81C 1VQ6T 3RLFE 5GAOr 4XQ3A 1MGQA 2K5FA 3C36A 1BKBA 1B05A 3IB1A 4FL6A 3PGFA 1VQ9A 4M7AB 2G29A 1FTKA 3E4RA 2NWJA 4II1A 2HXWA 1B7UA 5LJ5j 1YHQT 3S9MC 2GFAA 3M8UA 1J1NA 2XHDA 4FM4B 3T9NA 1UEBA 2Z23A 4F39A 3BW1A 1M1GA 3CCQT 3CPFA 4NL3A 3G6ET 2DQVA 4N4IA 3O66A 4C1UA 3OBYA 4JRQA 2UXAA 4M78C 3VVFA 1B40A 2EJFA 3BKIB 3PT9A 3TELA 1VQLT 3PPRA 4HA8A 5LJ5f 3CD6T 1N27A 2LQKA 4LUBA 4M7AF 4HT8A 4NF5B 4XU3A 1B51A 5J3BA 2Y7IA 3EHSA 1P1NA 3N26A 3HV1A 2RK1A 3QO3A 4QVZA 1N8RU 2GHBA 1YJNT 2JNGA 4LDUA 4XAXB 2V8JA 3J80E 4NF8A 4ZEKA 1BI0A 4Z7EA 5CMCA 2EQUA 2DKGA 5DLQE 1VQ6A 3L2UA 1KD1U 3HHFA 4LP2B 4XTZA 1FWZA 2WACA 3E1SA 2PT1A 2ZPHB 5CKDA 1M5EA 1JJ2S 4OEVA 4M7DG 4F1UA 3OYIA 4F19A 1YJWT 3G3HA 2P1SA 1B1HA 3JCMQ 1YHQA 3D4CA 2Q2AA 1BI3A 2FB7A 1ZU0A 2VC8A 3FC3A 4M75D 4C0DC 2DSFA 4NF6A 3CC4A 4U21A 4WXJA 4ZN3A 1D3BB 4ZN1A 3CCQA 4C92E 3P8BB 3G6EA 1WVJA 4MMLA 3QUJA 1W2BA 1MH4A 2PT2A 4F22A 4LDVA 2LVMA 3HKSA 3JCMP 1VQNT 5H8NB 3QDRB 3X26B 1MQIA