3MP8A

Crystal structure of sgf29 tudor domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
513
structure length
513
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
total genus 148
structure length 513
sequence length 513
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp8A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp8A01
1B1HA 2RJCA 3S6WA 1SQYA 3MVXA 5AE4A 4F31B 2GF7A 3EN3A 1ZMGA 3MPLA 3B6WA 2O6AA 3CSBA 3UGWA 1ZTYA 2RC7A 3M3FA 3KN3A 3Q1JA 1FW0A 3HPIA 3KN7A 3OYJA 1OVBA 5FTIA 2ZNSA 3KOTA 4KYSA 2EQJA 3K1PA 4IUTA 3QIIA 4Z0IA 1QUJA 1ZIUA 2M8CA 1XHYA 3AXFA 3OEMA 4BDMA 3B7DA 3MVYA 3Q25A 5A5XB 3CRBA 2O7UA 3VE1B 5DEXB 2B3BA 4G8MA 4IO7A 3TTMA 5KDTA 3TODA 3M3KA 4Q30B 2BJJX 4NS5A 3VVFA 3K6UA 4EDPA 5JTYB 1JEUA 3EF7A 3HHGA 1P1UA 4ZE8A 2H98A 3FVOA 2PT2A 3CEYA 3OYBA 3RLFE 3W15C 1MQDA 1LCTA 3QUJA 5C6SA 2UVGA 1MRPA 3L6GA 4RK9A 1WJRA 2X4WA 4JWYA 5FHOA 2I58A 1QJMA 2I3WA 1AIVA 1QUIA 5H8FA 2RJEA 4ZTFA 2YRVA 5ISUA 1JETA 4BDRA 4FORA 2QQSA 4YU0A 3C31A 1O63A 4PE5B 1FTKA 3ZS6A 1HSEA 1P1QA 1YAEA 1SDXA 2RHXA 2X35A 3L6HA 2HZLA 4EXLA 3T22A 3H7MA 4I8CA 5CC2A 3W9VA 5TPAA 3PUXE 2OZZA 4GVOA 4UA8A 3P8HA 4AB5A 4F2OA 3EHTA 3D4GA 1OYXA 4GRKA 1LFIA 5CMCA 1BKAA 1XS5A 1TT1A 5HBCA 1WVJA 3NTKA 3SEVA 3GBAA 1R9LA 3HO7A 2OLBA 2XX7A 5L9MA 1VE4A 3A09A 1M5CA 3S3OA 3OENA 4QQ6A 2ABHA 2H25A 4BDQA 4I62A 3SEXA 1B5IA 2W7YA 3PPPA 1Y1MA 1ZKBA 5FHMA 3SEWA 3RY3A 1QVSA 3S2VA 3BKIB 2G93A 2G29A 2DWHA 2I6EA 4OFLA 3VVEA 4NMYA 3S9EA 3KGCA 4EUOA 4KI0E 3P8DA 3ECRA 3FJMA 3TTNA 3T9UA 4E0XA 4E7IA 5I57A 4EF1A 2Q8JA 4PFUA 3UN6A 4RK2A 2UVIA 5ELVA 1H3ZA 2HQXA 3L2UA 3VXBA 3MO8A 4BDYA 3E9FA 2XXQA 4P0IA 1EU8A 3DELB 1MDQA 3CI8A 4DIGA 1FQCA 3G3KA 3UIFA 4QW2A 2NWJA 4BDLA 2EFIA 4O3BA 4RJZA 3IOVA 5KE2A 3IB2A 5L8DA 2PVUA 3V83A 2DXRA 2RC9A 2O69A 4U1ZA 3UWNA 4JB7A 1KWHA 4OHNA 3KEIA 2GFEA 2I4CA 4H6DA 4XKNA 2XXYA 3IB1A 1MQJA 3VV5A 3G3HA 5KDTB 3OS1A 5HM4B 3PFSA 1O7TA 4U4XA 1Q1KA 2O7IA 3PMTA 2VP1A 5H8SA 1N3WA 5KCJB 3TPAA 2M1HA 3EPEA 4UC4A 5KCJA 5CMBA 4R74A 3H6TA 3R26A 1SI0A 3CIJA 2RJFA 4Q8RA 3L2WA 3N6UA 3T96B 1PB7A 1N84A 1FTLA 3GXAA 3OSQA 2MWOA 3M8UA 5HPQA 1T0KA 5IKBA 2QJEA 1Y3QA 5I59B 5FHNA 5KZTA 5I2NB 1EZPA 4QFNA 3OYMA 4G68C 3JZJA 3OO6A 4ELQA 2XXIA 3TELA 2PYYA 1RYXA 2XX9A 2QL3A 1I6BA 1B3HA 3N26A 1VFEA 2F6PA 3OYHA 1B9JA 2REGA 4UACA 3L42A 3EQ1A 3QSLA 4P11A 1LFGA 2AL5A 1GR2A 4FIMA 3IR1A 1R1NA 1B05A 4OESA 4DXUA 1AH5A 2PQWA 1XNIA 2QQRA 3M9QA 4YKPA 5TP9A 4IUUA 2Y7RA 5ITPA 3EHSA 3TMGA 3K6XA 2ZNUA 1MY4A 2F34A 2DE4A 3FATA 1EZOA 3K2DA 4ZZAA 3FVKA 3OYKA 3FIRA 2OWTA 4NE4A 4ZTJA 2XXPA 4LUBA 2FYIA 5JTYA 1AOVA 3UT1A 5AA4A 2LAOA 4IO2A 1OQGA 4FEDA 4GXSB 3TCFA 3UP9A 2OJTA 4O3AA 3HSTA 2V3QA 3U8QA 4P0GA 3OELA 1BLFA 4QF9A 3N5LA 4DLDA 2DVZA 4GF8A 2L89A 3IAZA 4X9TA 1UIUA 4G8NA 2NVUB 2VD3A 4IURA 3P7IA 1JEVA 5ITOA 5L9OA 3MP1A 3IJOB 5IAYA 3T9VA 1I6AA 5DTBA 1MQIA 4R73A 5I59A 2XXVA 2O4XB 4YB7A 2QS4A 5TPAB 1B5HA 4KFQA 2HCAA 1GGGA 5M2VA 1OVTA 1OIBA 5H8QB 4QFKA 1B3EA 4RG2A 1Y3PA 4YB6A 4OMBA 4HS7A 4BE1A 1IZ1A 3MVWA 4RNSA 4OETA 1UTHA 3H4ZA 3QUFA 1JW5A 3K6WA 3U93A 4H1XA 2D21A 4H5FA 5ICQA 1XOCA 4MLQA 3SESA 1D9YA 3O6HA 1MPCA 2GRVA 3FXUA 3C32A 3E3KA 1B3LA 2DYXA 4YMBA 3MW0A 3Q28A 2F5XA 2F35A 2R5MA 1RI0A 2HQ0A 2X7PA 2DQVA 3LC8A 3F70A 4O3CA 3H6ZA 5EYFA 1OLAA 3R7XA 2HEUA 5J39A 2O68A 4NF5B 5CMMA 5D6YA 3SKPA 5IAIA 1A8EA 3G3GA 2QSXA 2AIXA 2FNCA 1WJQA 3PMWA 4GFRA 4ZECA 2UXAA 4POWA 5I2KA 4HW8A 2ONKE 3OEKA 4RYAA 4BD3A 1US4A 3TUSA 1JQFA 5C0MA 1LSTA 2R5AA 1DSNA 5A5XA 1Y4CA 1OZ2A 2ANJA 3U94A 4OFJA 4N4GA 2DVCA 1MXYA 3MP6A 3SERA 1B7ZA 4X48A 1UQWA 3CFLA 3PD9A 3TEPA 4ZEFA 2Z8EA 4OYVA 4NTLA 1P1OA 4NF6B 3TKDA 3V8XB 1Z7ME 2OWSA 4F3GA 4FECA 1CB6A 1G5VA 3C35A 4HCWA 4XKRA 1MG1A 3LSLA 3S3MA 1MQHA 2IEEA 4RA1A 3FEOA 4R72A 1MS7A 4I1DA 1B6HA 4NF5A 2M16A 4GWOA 4IGTA 2Y7KA 5K2YA 4G4PA 2X4YA 4PFTA 4F3SA 3CG1A 1UTHB 5H8NA 3IOTA 1DPEA 3IK6B 1TXFA 1OQHA 2F36A 1B40A 1MPBA 1SSFA 1JW4A 3O6GA 3PUYE 2O1LA 3IL1B 1JVYA 3FUZA 1URDA 3T66A 4N6PA 3SEUA 4C1TA 2Q9TA 1UIVA 1IEJA 5F7VA 1PBPA 1LBBA 4U23A 2DOJA 3FXRA 4F22A 1GV8A 4IO6A 1TWYA 3LGLA 1PC3A 1EZ9A 4ECFA 4U22A 2KLFA 3OYCA 4R6YA 1WJSA 3PGFA 5KCHA 4GL8A 5DT6A 2YPNA 1A7LA 3OD7A 3ODBA 2XXWA 3UA8A 2I49A 3PD8A 1WODA 4BE2A 3K00A 4X34A 3FXQA 3K4UA 4LVQA 2Q89A 4BLAA 1LAXA 3L2VA 3OYDA 3C36A 3W9WA 3C34A 3FJ7A 4GQOA 2GFAA 3T9XB 1SYHA 1GTKA 3FASA 3PMXA 2GHBA 1B7HA 4NF4B 3OYAA 2BKDN 3G3JA 3S3NA 1ZLQA 4IGRA 4LA9A 4OZ9A 3Q29A 2ZNTA 3IO6A 2B3FA 2XD2A 5KH6A 4IUQA 4EQBA 3JYRA 1A54A 4OERA 3HN0A 4DCXA 5AA2D 4LQ2A 3HHFA 1WDNA 1B58A 2QS1A 2O4XA 3N6TA 3ILUB 2F8DA 4EF2A 1N76A 3OO9A 4F19A 4H8IA 1IITA 1LAHE 1DTZA 4B9XA 2NXOA 3A3UA 1US5A 4H0WA 3E13X 2V3TA 4GOTA 4G68B 1M5BA 3EAEA 4NF8B 4E7HA 1ELJA 3OMBA 4ZS9A 5FTHA 4C5IA 4LZ8A 3VLUA 4PLIA 1FQEA 3H3GA 3LLRA 5H8QA 2Y84A 4B9WA 4GY5A 3FVNA 3CR9A 1H76A 2L3RA 4I9DA 4A4GA 1B1XA 5DVIA 3OQ5A 1QKAA 1FQDA 4XIGQ 2HXWA 4PP0A 3H6WA 4F29A 4RXLA 2Z8DA 2XK0A 5FRNA 3DLMA 3PU5A 3ASKA 4N4HA 1MY0A 4R2BA 3OSRA 4QSDA 4KQPA 2OBGA 4H67A 4H8JA 5JEIA 3MUQA 5DEXA 2DWJA 3TZAA 1XT8A 4GD5A 4M1VA 2RHUA 1IIWA 3I5OA 1XVXA 3OMCA 3KBRA 2DWIA 5EHSA 1UTBA 5I56B 5I58B 2EQMA 5K2XA 1NNFA 3GLBA 3H06B 4EXKA 3ILTB 1P99A 2ZXTA 3K0VA 4NF4A 2X7QA 5J26A 1SW4A 2QRYA 4X1BA 2IA4A 3DP4A 3G3FA 4OFOA 1Y3NA 4QSCA 4KCDA 5AA2A 3MJNA 4ISUA 1B52A 4F39A 1N04A 5LOMA 2ZMBA 1N7XA 5DVFA 3OS2A 4KYEA 1HSJA 4DDDA 2R71A 4GIZA 1KHCA 2XXHA 3MVZA 5H8FB 2Y7PA 3LH0A 4X1DA 4IO5A 2LTOA 5AA3A 3LR1A 5ICTA 3HCQA 3WAFA 1A99A 5CRYA 3MC2A 1JW1A 1LGBC 3MEUA 4EQ7A 3EHUA 4IKFA 3META 4KR5A 3TAJA 4OWDA 4MBPA 1FTMA 2P2AA 3NTIA 3CFXA 2F5KA 3U1OA 1RKMA 4LZ5A 4THIA 5KE3A 4QFLA 4E7LA 4TOZA 3G7WA 1BTJA 3O6IA 5DVJA 2HFBA 2K3YA 3PMIA 3KUFA 2R58A 3ZSFA 4QHQA 4R6KA 3DB3A 4IY5A 1MXXA 2P0SA 2NUVA 1EH3A 4PFWA 3GOXA 2BIVA 3F11A 1D9VA 2WACA 1MH3A 3MEVA 4C0RA 2XDPA 3TFLA 1RYOA 3ZEHA 4PFYA 1LCFA 2GH9A 2DE3A 2R57A 5D6WA 1VSOA 1H44A 4JWOA 3DB4A 4DXBA 5CI5A 2B65A 3M3LA 1B4ZA 1B3FA 2ONSA 4LP2B 3O97A 4Q0CA 5F1QA 1NH8A 4U2RA 1LLSA 3L2QA 3UORA 4TLLB 4WEPA 4M4GA 4H65A 5TP9B 3OYLA 2XHDA 3E4RA 4WXJA 4YICA 1FQFA 4LONB 1DTGA 2UVHA 2F78A 1B2HA 1PB9A 4NEDA 1SW1A 3VXCA 3TCGA 4BDNA 4Q5WA 3K6VA 3TTLA 3PPRA 4YKJA 2R6GE 1DMBA 1B51A 3ZKKA 5JK4A 4AB6A 4QVZA 3TQWA 2H9BA 5B70A 3MPKA 4OXVA 4A4HA 4N07A 1M5DA 3OYGA 4KYDA 3U72A 1F9BA 3QAXA 3KJTA 1II5A 3SD4A 3NTHA 3MEAA 2NLUA 4E0WA 4LQ5A 4LD6A 3MEWA 1TFAA 4MH5A 2WKYA 2D9TA 4MF3A 3VVDA 3QBYA 1A40A 3IORA 4MFIA 3FVGA 2V93A 5H8HA 1URSA 3DP8A 1B0LA 2I4BA 1UTBB 2E0SA 3OOAA 2AYSA 3R6UA 2RHIA 2LRQA 3FV2A 2FA7A 1B4HA 3PMVA 2DAQA 2V25A 4WKMA 4QFPA 2I0CA 4F1VA 3H8ZA 3UK4A 5B7DA 2Z23A 3LGFA 3Q26A 4YKKA 4II1A 1P1WA 3LYIA 4OEUA 4ZZEA 3IB0A 4R9GA 3OA6A 3PPOA 3K1MA 4ZE9A 2Q88A 3SDFA 2X4XA 3IX1A 2A5SA 4NWDA 2H4IA 1MXWA 1YTVA 1ZJLA 2UYEA 4QQDA 1LBCA 1MPDA 3MQ9A 5TU0A 4RY1A 5EHMA 4R75A 4PL6A 3PPNA 1OMPA 3OY9A 2OK2A 3K1NA 2H99A 3QK6A 2VYTA 3SETA 4C5EA 2Y7WA 4JSDA 1QKBA 4FE8A 1I69A 2XXUA 3SEYA 3I3VA 2RI3A 1B3GA 4F1UA 1FQBA 4GLIA 2XD3A 2L8DA 3VLVA 4ESWA 1IUDA 3PUVE 4QSEA 4C5GA 5AA4B 4QFOA 5BWJA 3DLNA 1USYH 5FRMA 3S9MC 3KN8A 1J1NA 1H45A 3TDJA 5IN1A 1ANFA 4XXUA 1ZU0A 3QXMA 3RUMA 2YJPA 4Z02A 1MY2A 1MXUA 3MP8A 3MZ9A 4ZEBA 1POTA 1MH4A 2D3IA 1PBQA 4OTEA 5CMKA 3RNNA 4U1OA 4IUPA 2DP8A 3OYNA 1MQGA 3V89B 5I58A 2DWAA 4WEDA 1N27A 4C5HA 4QRZA 3Q27A 2QMXA 2ALUA 2QPQA 1N0TA 3MZ1A 1JNFA 4ONYA 4GL0A 1VR5A 1Y20A 4DE8A 1CE2A 3OB9A 1S7YA 1B46A 2RC8A 4BE0A 2XXXA 1NH7A 5H8HB 2NOOA 1YCJA 3K01A 4G77A 4ND9A 3LSWA 1B0HA 3BBRA 3IJXB 1JVXA 1SW5A 2V3UA 2RF1A 2LDMA 1XC1A 1MM7A 1NFTA 3FV1A 1AL3A 5I2NA 3B6TA 4K3FA 4OEVA 1FTJA 2ESNA 5CBSA 3QYTA 3IO4A 1L5TA 2JTFA 5I56A 4HTGA 3LBSA 2YLNA 1IXHA 4PETA 1NNPA 3C4SA 1O64A 1PEBA 4A4FA 4L17A 3RQTA 4YAHX 3FD3A 2HZKA 2DIGA 3KSJA 1N7WA 2RCAA 3GBBA 4GXAA 2ZYOA 3VDFA 2OCUA 3E9GA 3BFTA 1H3DA 2HAUA 4F1YA 1Z7NE 3MBPA 2ONRA 2QS3A 3PNWC 2VD2A 4DXCA 2I3VA 3KOSA 4IO3A 1USYE 3ONMA 3THIA 4N4IA 2V84A 4KPTA 4CRIA 3T9HB 4YB5A 4LZ7A 2AL4A 2EQUA 1POY1 3CG3A 3B6QA 2VGQA 3S4UA 1Y1ZA 1WGSA 2ZYKA 1SI1A 4AQ4A 2D5WA 2MWPA 4OVJA 3DP6A 1QULA 1FTOA 3QJ6A 3IOWA 4JWXA 3BFUA 3CFZA 3H6VA 2B8AA 1N3XA 3FZVA 1B5JA 2PMSA 1SYIA 2Z8FA 2RINA 3TTRA 1MY1A 2G3RA 2DS9A 4NF6A 2VHAA 1FCKA 3WAEA 4H5GA 1OZ3A 3K02A 3KG2A 3GZGA 1Q35A 2P1SA 2P0KA 4XKQA 1NMUA 1AMFA 1LAFE 4FATA 1FQAA 2UVJA 2DSFA 3PUWE 3TQLA 2O1MA 4ELPA 3RTFB 4F18A 4Q5TA 1NKXA 4U21A 4ZEIA 2IG0A 2JZ2A 5J1DA 5M9OA 4XTCQ 1B32A 1YPNA 3O2AA 4RPOA 3D4CA 1M5EA 4PLLA 4FJPA 3OMGA 2PT1A 2LVMA 3MAMA 1QW0A 4ESXA 2THIA 4NWCA 1OLCA 1D3KA 4G8HA 2K3XA 2UYFA 3C9HA 3PUZE 4E7JA 3MZBA 3I6VA 4DZ1A 1PB8A 5CM6A 2RI2A 1IXCA 2RKMA 3E9XA 3QIMA 1S50A 4JSOA 3VLWA 3JV9A 3FJGA 2RI5A 3KJ7A 3KZGA 3LX7A 1GVCA 1NNTA 2GHAA 2E1SA 2CKKA 1IXGA 2DIQA 3FDRA 1MDP1 3TCHA 4OENA 3QKJA 1SVXB 1OI1A 3HV1A 1SD3A 2F7AA 2Y7IA 4IUVA 4HCZA 3PV0E 1XVYA 1DOTA 3U92A 2O51A 1LAGE 2E5QA 2E6NA 2RO0A 2QMWA 5CIUA 3N94A 1M5FA 2O84X 3C4MA 4LATA 4JXIA 4FL6A 2HQEA 2Q2CA 4FAJA 2XXRA 4JDFA 3LSXA 3FLGA 4PQJA 4L59A 2Z22A 4FEBA 4DCYA 2H5YA 1R9QA 5AA2B 2EKOA 1MXZA 1B7UA 5D6XA 4A4EA 3LUYA 5DYHA 3H03A 3OXNA 1IXIA 3RTWB 4JBZA 3BDLA 3O8VA 3TYHA 1SBPA 4HCYA 3OYEA 3OYFA 2I0BA 5FROA 3O66A 4IO4A 4U4SA 2RHYA 4ZEKA 3H6UA 3VFJA 3ZKLA 4G2ZA 1DPPA 1URGA 3OO7A 2RCBA 1H43A 4IB2A 5I84A 1MY3A 3USDA 2DXYA 4TLMB 4XKPA 1IQ7A 1TFDA 2CMOA 1P1NA 4EDUA 1QUKA 2FHDA 1S9TA 3RN8A 1PDAA 3RT8A 3OYIA 3KSXA 2X26A 1MM6A 2I48A 3MWBA 3FC3A 3O9PA 1D4NA 1A8FA 3S9NC 2F7CA 2M0OA 2XXTA 5CBRA 3OO8A 2ZYMA 1BP5A 1HSLA 4R2FA 4YKIA 5I2KB 1I6QA 1SW2A 2R9JA 4TQUQ 4F3BA 3KFMA 3IOUA 3S9LC 1LB8A 2CZLA 2PBWA 2BUDA 3ME9A 3L2RA 2F7BA 4ZEDA 4BDOA 2EQKA 4R6HA 5BUUA 5AA1A 2RHZA 2VOZA 4ZDMA 3OS0A 4Z7EA 3T93B 3A3CA 3RT6B 1A55A 3DM0A 3LSFB 4ELOA 2A5TA 4KD5A 4MLVA 4POXA 3V5AA 5I57B 1VFDA 3C33A 3PPQA 4IY6A 1ATGA 4NF8A 4OVAA 1BIYA 4ELRA 5H8NB 4BACA 4F3PA 3G3IA 4EQ9A 2HAVA 2RJDA 2Q2AA 2XX8A 2LCCA 4E7KA 2DE2A 3O28A 2A5TB 2F97A 4N13A 1NNKA 4R9FA 2QS2A 4KCCA 5L9SA 3CSGA 1Y4TA 1NL5A 3RPWA 4C1UA 4RPNA 3O29A 2REJA 1MHNA 4OQOA 2ZYNA 3RGYA 1LFHA 2F6GA 1MXVA 4G68A 4YZZA 4BDZA 3CVGA 5KCOA 1Y9UA 3TTKA 2GFUA 4KHZE 4F2QA 4QQGA 1LB9A 2PX1A 4FU6A 4YMAA 1R6ZA 1ZBMA 3FGSA
chains in the Genus database with same CATH superfamily
1B1HA 4D8KA 2RJCA 3S6WA 1SQYA 3MVXA 5AE4A 5D7UA 4F31B 2GF7A 4M75F 3EN3A 3JB9D 4X9CA 1ZMGA 3MPLA 1VQ6A 3B6WA 2X3XD 2O6AA 2DTIA 2I2LA 5HKCA 1UDLA 3CSBA 3UGWA 3M5AA 1ZTYA 4BI8B 4FW2A 4N0AA 3CCQQ 4E7ZA 2RC7A 3PGGA 3M3FA 3KN3A 3Q1JA 2NUPB 1UECA 1FW0A 3HPIA 3KN7A 2EJFA 3I56A 3OYJA 2RQWA 5KYUA 1OVBA 3PIPA 2QK0A 4M77D 1FMKA 3FB9A 5FTIA 2ZNSA 4N17A 4J83A 3KOTA 5KYWB 1K9MU 1M2VB 2NUTA 2XHCA 2EQJA 1S72Q 4GBWA 4KYSA 2DL7A 4IUTA 3K1PA 3QIIA 4PJOB 4Z0IA 2E70A 1QUJA 2A36A 1ZIUA 2M8CA 1XHYA 3R6NA 4BB7A 1KJWA 3AXFA 3OEMA 4JJBA 1NI9A 2CEXA 4BDMA 3B7DA 3MVYA 1PKSA 3Q25A 4HA8A 3CRBA 2O7UA 5A5XB 3VE1B 5DY9A 4CC3A 5DEXB 2B3BA 1G8XA 1VQ8Q 4G8MA 1H3HA 2DEQA 4IO7A 1WPYA 3TTMA 5KDTA 3TODA 1K8AC 2RH2A 3CMAA 3LWHA 3M3KA 4J7FA 2E3IA 3EHQA 4Q30B 2BJJX 4NS5A 3VVFA 4PE3A 3K6UA 4EDPA 1I07A 5JTYB 1JEUA 1VQMA 1Q7YR 2PUKB 3EF7A 2V26A 1M30A 3HHGA 1QVGS 2DXUA 2ZPEB 3G7ZA 3CCEA 4JJNK 1P1UA 4ZE8A 2MIOA 2H98A 3FVOA 2QDLA 2PT2A 3CEYA 2GQIA 2PZ1A 3OYBA 1VQ4A 3RLFE 3W15C 3IQLA 1MQDA 1LCTA 4CC7A 3G1JA 3QUJA 4JPBW 5C6SA 4J9DA 1YJWA 2UVGA 1W6XA 1PKTA 2QQBA 5A0GA 4N4UA 1LVKA 3M53A 1MRPA 3L6GA 1AOJA 4RK9A 1WJRA 2X4WA 2JS2A 4M7AE 1H92A 4JWYA 1K1ZA 4YTLA 5FHOA 2I58A 1X43A 1QJMA 1IREB 2I3WA 4OVTA 3VS7A 4QT7A 1AIVA 1FPLA 3J80E 2PNIA 1KQ2A 2GGRA 1GCQA 1M1GA 2RJEA 3QWXX 4ZTFA 1QUIA 5H8FA 2YRVA 5ISUA 3GF5A 4C92D 1VQLQ 1JETA 1NPRA 1QVFS 4BDRA 4ECFA 1G83A 2AK5A 2QQSA 4FORA 3C31A 3AT1B 4YU0A 1O63A 4PE5B 1FTKA 3ZS6A 1HSEA 1P1QA 1I0CA 2OWZA 1YAEA 1SDXA 2RHXA 2X35A 3L6HA 2HZLA 4EXLA 1KG1A 4NHBA 2PTKA 3T22A 3JCMg 1QCOA 3H7MA 2XDBA 4I8CA 5CC2A 3W9VA 2CP0A 5TPAA 2LT1A 3ZL7C 2C0IA 3PUXE 2LQWA 2OZZA 2J6KA 4AG1C 4GVOA 3VS4A 2HHMA 4UA8A 1VQ7Q 1WHKA 3UDCA 3P8HA 3A8LB 4AB5A 1NYGA 4P9KA 1TG0A 1S72A 4F2OA 4XU2A 3H0FA 4KRTA 1AZGB 1Q86U 2Y5KA 2LT4A 3EHTA 3D4GA 1OYXA 5GANe 4GRKA 2COYA 1LFIA 1IMEA 4NF0A 5CMCA 1BKAA 3CCRA 1LBVA 1BIBA 3I56Q 1XS5A 4NAPA 1TT1A 3RDVA 1D0XA 4XQ3A 4XU1A 5CKBA 2WSEE 2BZYA 1Q9DA 5HBCA 2P84A 1BCMA 3HSBA 2LQNA 1WVJA 4J8OA 4C92G 1B34B 3NTKA 3SEVA 3EFSA 4M7AG 3GBAA 1R9LA 2QVUA 3HO7A 5GJVB 2OLBA 2XX7A 2BZXA 3CD6Q 1VE4A 5L9MA 3QMFA 3A09A 1WNLA 1M5CA 2MAMA 3S3OA 1NV0A 1X27A 3OENA 4QQ6A 2ABHA 2I0NA 2H25A 4BDQA 4RTZA 2MYSA 4I62A 1YWPA 3SEXA 3C95A 1U1SA 4M75G 1QP3A 1FPJA 2DETA 2V8JA 1B5IA 2VVKA 5EQAA 1SG5A 2W7YA 3PPPA 2VV5A 1Y1MA 1ZKBA 2MF2A 1AWWA 3CCMA 5FHMA 2CT3A 3SEWA 1OU9A 3QO3A 4C0DB 4F04B 3RY3A 4DI4B 1QVSA 3S2VA 4HT8A 1KQSP 3BKIB 4FBPA 2G93A 2MPXC 4ZNXA 5FU6C 2RA2A 1YHQT 2DWHA 2J06A 3M0QA 4ZGJB 2G29A 1QGXA 2I6EA 2K5IA 4OFLA 2WYKA 4M7DG 3VVEA 1UJYA 1YJWQ 3RNJA 4NMYA 3S9EA 1KC8C 1PHTA 4JJCA 3KGCA 3EG0A 1A0NB 4EUOA 1WHJA 2BTTA 4KI0E 2HMAA 1ZSZB 3X26B 3P8DA 4I3EA 1EFNA 3ECRA 4M7DE 3FJMA 2O01E 3TTNA 3T9UA 4E0XA 4MZTA 2A3LA 4C8QC 4E7IA 1GBRA 5I57A 4EF1A 2Q8JA 4PFUA 1UFFA 4P3LA 1E6GA 3UN6A 4RK2A 2Q8MA 2UVIA 4GX6A 5ELVA 1H3ZA 4X8RA 2HQXA 3L2UA 3VXBA 1MMGA 3MO8A 4LDYA 1NV6A 2DF6A 4BDYA 3E9FA 2XXQA 4PFPA 4P0IA 1EU8A 3DELB 1MDQA 4JVCA 4CI0C 3CI8A 4DIGA 1KIKA 1FQCA 3G3KA 4DEXA 3JCMd 1T3SA 3M57A 4C8QG 2QXFA 3HHTB 1BI2A 4QW2A 3UIFA 2NWJA 4BDLA 2EFIA 2CDTA 2DVEA 4O3BA 4RJZA 1XTDA 3IOVA 5KE2A 4J6XA 2HD0A 1QLYA 2M51A 3IB2A 5L8DA 3HKSA 2PVUA 3V83A 2DXRA 1Y96A 2RC9A 8AT1B 2O69A 4U1ZA 2HCKA 3DKMA 2E6ZA 3UWNA 4JB7A 1KWHA 3C0CA 4OHNA 4OB0B 2E4HA 3KEIA 2QYZA 1QVFP 2GFEA 4Y92A 2I4CA 4H6DA 2P4RA 1QW1A 3G4ST 2XXYA 4XKNA 4AFZC 1M1KU 3IB1A 1MQJA 4WCIA 3CC4Q 2JMCA 1PSEA 3FXBA 4LE9A 4KBMB 3G3HA 3VV5A 5LTCA 3GPLA 5KDTB 3OS1A 5IHNA 2KSSA 3PFSA 1AWOA 4AS5A 1B3QA 5HM4B 4EMKC 1JXMA 1IZ6A 1O7TA 2ENMA 3FGSA 2QDYB 4U4XA 1Q1KA 2O7IA 3PMTA 3M54A 2MI6A 2VP1A 5H8SA 2F1LA 2EYWA 4N15A 1K0SA 1N3WA 1B07A 5KCJB 3TPAA 2M1HA 3EPEA 4UC4A 4JVDA 5KCJA 2XKOC 5CMBA 4R74A 3CMEQ 3H6TA 5CKFA 1HJDA 3R26A 2JW4A 1SI0A 2DK3A 2RJFA 4OMNA 1VQ7A 3CIJA 4Q8RA 4LN2A 3L2WA 3N6UA 4G61A 2H3JA 3T96B 1OULA 1T3LA 1W2BA 1IGQA 4OVPA 1D1CA 1PB7A 2OAWA 3EG9A 4DOWA 2RB6A 1N84A 1FTLA 2KRSA 2LJ3A 5GAMd 3A1PA 2L2PA 3GXAA 5LJ5h 3OSQA 2MWOA 5HCKA 2P3NA 3M8UA 3ER0A 5HPQA 1I4K1 1B7TA 2COWA 1AT1B 3JCMQ 2QJEA 2DJQA 2RQUA 1Y3QA 5I59B 5IKBA 5FHNA 2ED0A 5KZTA 1FPGA 1QKWA 5I2NB 2MMPA 1EZPA 1VA7A 2RQTA 3RBBB 4QFNA 3VS1A 4ZGDB 3OYMA 1KD1C 3V7CA 4G68C 3JZJA 4HE2A 3OO6A 2DM1A 2XXIA 4ELQA 3I56T 3TELA 4PKCC 2FZKB 2VUBA 2PYYA 1RYXA 2XX9A 3LUZA 2QL3A 3CBPA 1I6BA 2XA5A 1ZUYA 1B3HA 1SHFA 3N26A 4PJOD 1VFEA 2VXFA 1SHGA 2F6PA 3OYHA 1B9JA 2REGA 4UACA 3L42A 3EQ1A 4N0AC 3E2UA 1M90C 4UABA 3QSLA 3CCUQ 3BW1A 4P11A 2VC8A 1LFGA 2AL5A 2FPFA 5ET6A 2V1QA 1GR2A 4GX3A 4LD9K 4FIMA 5GANj 4DBRA 3IR1A 1R1NA 1B05A 5FWBA 4XTYA 4OESA 4DXUA 1I5OB 2AZSA 1IO6A 1AH5A 3A8OB 3TREA 4PAFA 4PFBA 3E79A 2PQWA 4M7AD 1XNIA 2QQRA 3M9QA 4YKPA 5TP9A 4IUUA 2Y7RA 4F7UA 5ITPA 3EHSA 5ET7A 2EYQA 1X75C 1ZA2B 3TMGA 3K6XA 2ZNUA 1MY4A 2F34A 1HK9A 2RD1A 2LCLA 2QEXT 1NLOC 5EYHA 3REBB 2DE4A 3FATA 1EZOA 3B8BA 4FSSA 3JCMP 4PFIA 1K9YA 3K2DA 2JT4A 4ZZAA 3FVKA 3OYKA 3FIRA 2OWTA 1D1BA 4M78C 4NE4A 4ZTJA 2XXPA 4RG8A 1LOJA 4LUBA 1K4US 2FYIA 4M7DB 1WZOA 2DRMA 5JTYA 1AOVA 3UT1A 2F2VA 5AA4A 1QCNA 1YHQQ 2LAOA 2GQ1A 2WX9A 4IO2A 3JSCA 1OQGA 4IIMA 1VQ6Q 4FEDA 3T9NA 1VQOA 1XJWB 3ROJA 1QP2A 1YBYA 4GXSB 3TCFA 3UP9A 2OJTA 2LCSA 4O3AA 5KYYA 3HSTA 1SSHA 2V3QA 1ZX6A 2YUPA 1IHWA 3U8QA 4P0GA 2IIMA 3OELA 3RPLB 2VB6A 1BLFA 4QF9A 5GMKe 3CCJA 1Y7XA 1SRLA 2XXKA 3N5LA 3RPLA 2V8KA 4DLDA 4N8GA 3NOHA 3MHXA 1ZSZA 4MHFA 3TU4K 1RAAB 3J81E 4O8MA 2DVZA 4JLGA 4M78G 4GF8A 1UGRB 1ZSZC 2L89A 4J7IA 4XTXA 3IAZA 3G71Q 4X9TA 1FJ6A 1Q86R 1CSKA 1UIUA 4DBFA 4G8NA 3I55T 3SFMA 2NVUB 2L3QA 2VD3A 3CC4T 2ATCB 4IURA 4ELYC 1QQJA 3M59A 3P7IA 1JEVA 3CXCA 5EQ8A 5ITOA 1WQ7A 3MP1A 5L9OA 5AT1B 3RUXA 3IJOB 1VQNA 4N81A 5IAYA 3T9VA 3JCMX 1I6AA 2FG0A 5DTBA 4Y28E 2JXBA 2ROLA 1MQIA 1UUEA 4R73A 2DPPB 5I59A 4O7MA 2XXVA 4GWWA 2O4XB 2PVOB 2DD4A 3M58A 2O9VA 4KGXB 4YB7A 2QS4A 4OVRA 4X1VA 5TPAB 1B5HA 2LJ0A 4F7UE 2CEYA 1NV7A 4KFQA 5LJ3g 2HCAA 1GGGA 1NYFA 5M2VA 1IMAA 3EG9B 1OVTA 3VV0A 2X9HA 1YJ9T 3E1SA 4XU0A 4TVRA 1OIBA 7AT1B 5H8QB 1RADB 4QFKA 2E64A 1GL5A 4M77G 1R8OB 1B3EA 4RG2A 1Y3PA 4YB6A 2D8JA 2FIXA 2HKQB 4OMBA 1GBQA 3LW5E 5GMKl 4BE1A 4HS7A 2JOYA 3FIFA 1IZ1A 3MVWA 2FL7A 4RNSA 3RESA 4OETA 1UTHA 3H4ZA 3QUFA 1TTHB 1JW5A 3K6WA 2JJ9A 2CSQA 3SWNA 3A8GB 4H1XA 3U93A 2D21A 4H5FA 4EIKA 3BFMA 5J3BA 3G6EA 3VS6A 5ICQA 4KGVB 1XOCA 4GWZA 4MLQA 4P8BA 3SESA 2M0YA 4Z8AA 1D9YA 3O6HA 1OU8A 4C92A 1MPCA 3EGDA 3LH5A 4LDUA 2GRVA 3C32A 3FXUA 3EGDB 2HSPA 3E3KA 4F7UB 5I21A 1B3LA 3NPFA 2DYXA 4YMBA 3MW0A 4E47A 5LDZA 3Q28A 3CCLQ 1E7OA 2F5XA 1VUBA 2F35A 2R5MA 1RI0A 2HQ0A 2W10A 2X7PA 3CCUT 2DQVA 3QYGB 3LC8A 3F70A 3G71A 4GWYA 2LJ1A 4O3CA 1RAGB 3H6ZA 4MCOA 5EYFA 1OLAA 1V1CA 1U06A 1FBHA 4F7UG 4LUDA 3R7XA 2IVWA 1R0BG 2HBWA 4DQ2A 2HEUA 5J39A 3CCJQ 2FZGB 4ORZA 2O68A 1U5SA 4X9DA 4NF5B 5CMMA 4XU3A 5D6YA 1QVGP 3SKPA 1T0HA 1MMNA 5IAIA 2DD5A 1A8EA 2YRDA 1CNQA 2YXYA 2QGFB 3BIGA 1GRIA 3G3GA 2QSXA 1O9SA 1D0ZA 2E65A 2AIXA 2FNCA 1WJQA 4LN5A 2KAFA 2FVZA 5CK9A 3PMWA 2YSQA 4O94A 4P56A 4GFRA 1M4ZA 4ZECA 2V4CA 4M75D 3KXTA 1DCUA 2AKKA 2D0QB 2UXAA 4POWA 3HFOA 3JCMV 2DL3A 1Q86C 1LBXA 5I2KA 4HW8A 2ONKE 1KK7A 4M7DD 3RKWA 4KULA 2A08A 3HL8A 3OEKA 4RYAA 3CCLT 4PCDA 1Y57A 1BCOA 4BD3A 1US4A 2BJIA 1B34A 2DXTA 3TUSA 3M0PA 1JQFA 5C0MA 5IZZA 5GAMf 1LSTA 4M78E 4PJLA 1JP4A 2R5AA 1DSNA 3CPFA 5A5XA 5GANd 4MNPA 4AG2C 3A5ZB 4PK4A 1Y4CA 2KYMA 4MNIA 1OZ2A 2KEAA 2ANJA 3U94A 4OFJA 4PGPA 4N4GA 2DVCA 3HRTA 1FBPA 1MXYA 3MP6A 1ZLMA 2DRKA 5CQXA 3SERA 1B7ZA 4X48A 1UQWA 3SZPA 4MZPA 2QASA 3CFLA 2EPDA 3PD9A 2EYZA 4ZEFA 3TEPA 1IMFA 2Z8EA 4OYVA 4PBHA 4NTLA 2DA9A 4MDWA 3H41A 4RKUE 1P1OA 4FYVB 1UEBA 2P0PA 4N6DA 4NF6B 4XAXB 2E10A 1VQ9Q 3TKDA 3V8XB 1Z7ME 1TUCA 3VS5A 5GAN6 5FU6B 5CAIA 2OWSA 4FECA 4K11A 4F3GA 1CB6A 5IT9E 3RERA 1G5VA 3C35A 4HCWA 1YJNT 1M27C 4XKRA 5A0LA 1MG1A 3LSLA 3S3MA 1MQHA 2XWOA 4RCBA 1YI2T 2IEEA 4RA1A 3FEOA 4R72A 1EZZB 1MS7A 4I1DA 3V8LA 1B6HA 4NF5A 1PC0A 2M16A 1VQKT 4GWOA 4NG7A 3M0SA 4IGTA 2Y7KA 1YCSB 1YNZA 3JCMW 5K2YA 4G4PA 3CCVT 5GAN8 3RR6A 4DBHA 1VYVA 3CCEQ 2JUFA 4PJMA 1NV1A 1MGQA 2X4YA 1YYZA 1VQ4T 4PFTA 1X6OA 2P3VA 4F3SA 2KROA 1UTHB 2ZPGB 3CG1A 5H8NA 1JB0E 3IOTA 1DPEA 3IK6B 1TXFA 2GQVA 1OQHA 3SWNB 4ZN1A 2F36A 2KBTA 2DYBA 1B40A 1MPBA 2EW3A 5F24A 1SSFA 1M90R 4AFQC 2QA4A 2X4JA 1JW4A 3O6GA 5EYGA 3PUYE 3WVDB 2O1LA 3IL1B 2DX1A 1JVYA 1M2VA 2NUTB 3FUZA 4C92F 1URDA 1IRXA 3T66A 1Z9ZA 4N6PA 5LJ5e 3SEUA 3UF4A 4C1TA 4AMCA 5LJ3j 1UIVA 1IEJA 2Q9TA 5LJ5d 3H9NA 5F7VA 2YWWA 1PBPA 3IFAA 1XQHA 1LBBA 4U23A 2KYBA 2DOJA 3OYYA 3FXRA 4F22A 1GV8A 4IO6A 4RTUA 1TWYA 2G6FX 3LGLA 2QEXQ 1X6BA 1PC3A 1IMBA 4FT2A 1VQOQ 1EZ9A 3CPWS 2KLFA 3OYCA 4R6YA 1WJSA 3PGFA 5KCHA 4GL8A 4U22A 5IZ3B 5DT6A 1I81A 2YLBA 1KQSS 2YPNA 1LEVA 2EYYA 1A7LA 1FMWA 1G3TA 3OD7A 3ODBA 2XXWA 3UA8A 2QA4T 4PFOA 3CCQA 2I49A 3PD8A 1WODA 2ZCFB 2EBPA 3VS3A 4BE2A 2CZKA 4FSXA 3K00A 4X34A 3FXQA 3K4UA 4LVQA 2Q89A 4BLAA 5IXBA 1KSWA 2RN8A 3L2VA 1LAXA 3OYDA 1I1JA 3C36A 2JMAA 3W9WA 4M7AB 3C34A 3FJ7A 4GQOA 4GWUA 1WXUA 2RNAA 2GFAA 1PSFA 4OMMA 3T9XB 1SYHA 2DL4A 1Q82C 3CCMT 2FRWA 3QYHB 1GTKA 3PE0A 3FASA 3QWYA 2GHBA 2DL5A 3PMXA 1B7HA 1H8KA 2DZ9A 4NF4B 5GAMg 3OYAA 2BKDN 2DXBA 4O7IA 2W0ZA 3G3JA 1LBWA 1YJ9A 1K73C 3S3NA 4PAKA 1ZLQA 4IGRA 1LCKA 4LA9A 4OZ9A 1VQPQ 1YIJQ 1M9SA 4PC9A 1JU5C 3Q29A 2KRMA 1WFWA 4PFRA 4NQ8A 2ZNTA 3IO6A 1N9SA 2B3FA 5KYXB 2XD2A 3HRSA 2HAXA 5KH6A 1E6HA 3RMQA 4IUQA 1Q82U 4EQBA 4OVQA 2Y4YA 3JYRA 1A54A 4OERA 4Y91A 1ARKA 3HN0A 3JCMh 1UGPB 4DCXA 5AA2D 4LQ2A 4JZ3A 4E7SA 1IB8A 3X20B 3HHFA 5IHKA 1YJNA 1WDNA 4MAGA 3JB9H 3L2ZA 2XICA 1B58A 4M7AF 2QS1A 4HCCA 3QDFA 3X28B 2O4XA 3N6TA 1OX9A 3ILUB 3P8BB 4NL3A 2DERA 2F8DA 4EF2A 5ET8A 1N76A 1UTIA 3QZ5B 4E2FB 2GTJA 3OO9A 4AFUC 4F19A 1ACMB 4H8IA 1IITA 3URGA 1FYNA 1LAHE 4EMKB 1YI2A 1DTZA 5GJWB 3JB9F 4LDXA 4B9XA 2NXOA 4RTXA 2HSEB 2P4TA 3A3UA 1US5A 3AHUA 4H0WA 3E13X 2V3TA 1VQ5T 4GOTA 2J6OA 3CCMQ 4G68B 1GCPA 1VQ8A 1YIJA 1MV0B 1M5BA 2CZIA 3EAEA 1Z9QA 4NF8B 4H45A 5GAMh 4E7HA 1ELJA 2E3HA 3OMBA 4ZS9A 4J9FA 5FTHA 4M4ZA 4C5IA 2CZ6B 1AHJB 2KR3A 4LZ8A 3VLUA 4PLIA 5EG2A 1FQEA 1YZ0A 2FBPA 3LLRA 3H3GA 5H8QA 1N5ZA 3OW2P 2Y84A 4B9WA 3A8MB 4GY5A 1YITA 1ZBJA 2Y5LA 3FVNA 3CR9A 1H76A 1FRPA 2L3RA 1U8RA 4I9DA 2KQZA 2FVUA 4J9HA 4A4GA 5GAMe 2AHJB 3KFVA 1B1XA 3SDZA 5DVIA 4D6WA 2ABLA 2JM9A 3OQ5A 5GAMj 1QKAA 2WSFE 1FQDA 2FHYA 4XIGQ 2HXWA 4PP0A 3LV0A 2F3BA 1KQSA 2DVJA 4XTZA 1RAIB 2A28A 3G71T 1TWBA 3H6WA 3D1RA 1NJIU 4RXLA 4F29A 2Z8DA 3U65A 3KC0A 4ME7A 4KH1B 2XK0A 3DLMA 3CCQT 3G4SQ 5FRNA 3PU5A 2A37A 2QTXA 3ASKA 4N4HA 4XEQA 5GAOq 2DKGA 2JNGA 3EGXB 1MY0A 4R2BA 5ECAA 3OSRA 4QSDA 5FWCA 1NPPA 4DBQA 1HYOA 2OBGA 4H67A 4H8JA 4KQPA 5LL6S 1TXQA 5LJ3d 5JEIA 3MUQA 5DEXA 2NYSA 4OF1A 2DWJA 2YT6A 3SHWA 3TZAA 2ESWA 1HXDA 1XT8A 1NV4A 4GD5A 4M1VA 2RHUA 3J7AF 1OPLA 4OMLA 2P0QA 1IIWA 1UGQB 3I5OA 1VYUA 3FRNA 3HTRA 4C0DC 3N5BB 1XVXA 3OMCA 3KBRA 2DWIA 1VQ7T 5EHSA 1UTBA 2FPDA 1VQLA 1D3BB 2RQRA 1VIFA 1K76A 1AWXA 3M4YA 4JVIA 3CXCS 1KHIA 1Y07A 2WEFA 2OI3A 5I56B 4JRQA 2ZZWA 5I58B 1RUWA 4PJNA 1QKXA 2EQMA 5K2XA 4HVWA 1NNFA 3GLBA 3U23A 4C92B 3V7SA 1NV3A 3H06B 4EXKA 3PT9A 2KXDA 2FEIA 4CC2A 3ILTB 4P1LA 1PG5B 1ZHIA 2A0FB 1VDWA 1Y96B 2K5LA 1V76A 3E19A 2EYXA 1P99A 2ZXTA 3K0VA 1YJWT 4NF4A 2O88A 4PJOF 2X7QA 5J26A 4DA4A 2KXCA 1WI7A 4FYYB 3CMAQ 5GMKh 1SW4A 2QRYA 4J5YA 2DBMA 4X1BA 2IA4A 3DP4A 3G3FA 4OFOA 5I22A 1PCXA 3NGPA 1Y3NA 3EG2A 4QSCA 4KCDA 1X2QA 2PVDB 5GMKm 5AA2A 5KYYB 4QVCA 3MJNA 4ISUA 1B52A 4F39A 1N04A 2ZPBB 3JB9J 4GWXA 3NMZC 4PAIA 5FBPA 5LOMA 2ZMBA 1N7XA 2Y90A 5DVFA 4QVDA 2OTJT 4LNPA 5GAN2 5CKEA 5FW9A 3OS2A 4KYEA 4QBAA 3INZA 1HSJA 2SEMA 4DDDA 1RL2A 4RTTA 2CP3A 2HXRA 2OTLQ 2CSIA 1OEBA 2R71A 3I55Q 4GIZA 1KHCA 3I5RA 2DO3A 4PJJA 2A7YA 3T0JA 2XXHA 3CD6A 3MVZA 1VQPT 5H8FB 2Y7PA 3LH0A 1VQNQ 1TSFA 4X1DA 4CC4B 2DYIA 4M78A 2LTOA 2B4MA 4IO5A 2XU8A 3MPUB 2KK4A 4GBVA 4HXJA 5AA3A 3LR1A 5ICTA 3HCQA 3WAFA 1K8AR 1YN8A 3KBGA 1A99A 4GLKA 2F5TX 5CRYA 3MC2A 2QEXA 1JW1A 3MEUA 1LGBC 4C8QD 2YHTA 1M2OA 1NG2A 2CP6A 1NV5A 5I3SA 4EQ7A 5GMKj 3EHUA 2DTHA 4IKFA 3META 1W1FA 4KR5A 4KUDK 4P5NA 3TAJA 4M77F 4OVSA 1ZA1B 1M1KC 4OWDA 3QZ9B 3SEMA 4JUVA 4MBPA 1W70A 3VS0A 1FTMA 2P2AA 4ATOA 3NTIA 1PRMC 3CFXA 2F5KA 1NM7A 3U1OA 1VOMA 1RKMA 4LZ5A 1RLQC 5DLQE 3NFCA 2DZCA 5HY6A 1JJ2P 1OX8A 1INPA 4THIA 4RUGA 5KE3A 4BI4A 2OTJQ 1DBZA 4QFLA 4E7LA 1AZEA 4TOZA 3NHNA 1AVZC 2ZZDA 3G7WA 1BTJA 2NUZA 3O6IA 5DVJA 3EFOA 2HFBA 2K3YA 5CKDA 2CREA 4RTVA 3PMIA 3KUFA 2YUOA 2R58A 2BE9B 4IR8A 2YDLA 2FB7A 3ZSFA 5IZ1A 4QHQA 5EC7A 4R6KA 5EQ7A 3DB3A 3CMET 1YHQA 4IY5A 2H8HA 5DM7R 1MXXA 2P0SA 4PJOA 1K9AA 2L5VA 2NUVA 1EH3A 4PFWA 4PJOG 1XI6A 3GOXA 5CR2A 2BIVA 1RI9A 2DJZA 3F11A 1X6GA 1D9VA 2WACA 1K9MR 1MH3A 3MEVA 3FJ5A 3CCSQ 4C0RA 2XDPA 5I11A 4C0GA 1PD0A 3TFLA 3QSUA 1RYOA 3ZEHA 1LJOA 4PFYA 1LCFA 2GH9A 4MMPA 5J16A 1T0KA 3B50A 3G6EQ 1N8RC 2DE3A 2PVGB 2R57A 3RKYA 5D6WA 4NN3A 2LC4A 2D1XA 4AFSC 1AEYA 1NEGA 1G3WA 1VSOA 1W2BP 1H44A 2F69A 4FT4A 1U3OA 2DBKA 2DL8A 3CBOA 4JWOA 3DB4A 2CUBA 4DXBA 2EJ9A 2B65A 5CI5A 1Q82R 3THKA 4FW1A 3M3LA 2CUDA 1B4ZA 2ZPHB 2Q74A 3HFUA 1B3FA 2LX9A 5CCAA 2ONSA 4LP2B 3SWNC 3O97A 4Q0CA 5F1QA 2EKHA 1NH8A 1LLSA 4U2RA 4A53A 5DW8A 3L2QA 1Q7YU 3UORA 4TLLB 4WEPA 2JTMA 2K6DA 2PUOB 2XDDA 2J05A 8ATCB 4M4GA 4H65A 3VKIA 3OYLA 1IMDA 3CHGA 4QXDA 2XHDA 3E4RA 5TP9B 1GFDA 3X24B 4WXJA 3OBWA 3CCSA 4QKUA 1FQFA 4LONB 1DTGA 4YICA 2UVHA 1RDYA 2F78A 4M78B 4OMPA 1B2HA 1BK2A 4KT0E 1PNJA 1PB9A 4L6V5 4NEDA 2DILA 1SW1A 3VXCA 2CT4A 4J6YA 3TCGA 2D0NA 2AT1B 5FU7B 3CC2Q 2WBDA 1M3AA 4BDNA 1QVPA 4M77C 4Q5WA 4FM4B 3LWIA 4MNCA 1FWZA 4NL2A 2FO0A 2K57A 3K6VA 2CZHA 1QVFA 3TTLA 2XMFA 3CD6T 1QMCA 1WHLA 2ZZVA 3PPRA 4YKJA 2R6GE 1DMBA 3RKXA 4EPCA 5I2MA 1NE8A 1B51A 3ZKKA 3MJXA 3OSSC 4AB6A 4QVZA 3TQWA 5JK4A 1KC8U 2H9BA 2K3BA 2ZPIB 2JN0A 5B70A 3MPKA 4OXVA 1YIJT 4A4HA 3CMEA 4N07A 1M5DA 3OYGA 2C0OA 1VQ8T 4OB1B 2M02A 4KYDA 3M56A 3U72A 1F9BA 3QAXA 4M7AC 3KJTA 1II5A 1NEBA 3SD4A 1F1BB 3I5SA 3NTHA 4R56A 3OS5A 3MEAA 3EFOB 2NLUA 1RAHB 2M9UA 4E0WA 4LQ5A 4LD6A 3MEWA 1TFAA 2D6FA 2CP5A 4MH5A 4OB3B 4RTYA 1UGSB 1H641 4J9CA 1YFNA 2WKYA 2D9TA 4MF3A 3VVDA 3QBYA 1A40A 3IORA 4MFIA 3FVGA 2DDKA 4GX4A 2V93A 5H8HA 3REAB 5KYNA 1URSA 3DP8A 1B0LA 2L3PA 1UTBB 2I4BA 2E0SA 3OOAA 2AYSA 3R6UA 4MIJA 4C0FA 2RHIA 5LJ5g 2LRQA 3FV2A 4HCBA 4NGUA 3A8HB 4BY6C 4HCKA 2FA7A 4M75B 1ZSGA 1VQ5Q 1VQMT 2JVVA 1B4HA 3PMVA 2DAQA 3I55A 3PVQA 2OTLA 2V25A 4WKMA 4QFPA 1SRMA 1M8VA 2I0CA 4XF5A 1PD1A 1FPDA 4F1VA 3H8ZA 1VQ9T 4EMKA 1CKAA 3UK4A 4WF2A 4Z88A 4ELZC 3BIHA 5B7DA 4MJOA 2Z23A 1JJ2A 1BBZA 3LGFA 3Q26A 1OQKA 1SKUB 4YKKA 1NUZA 3A29A 4II1A 1P1WA 3LYIA 4OEUA 2KVQG 4ZZEA 2FYKA 2B4LA 3IB0A 4R9GA 3OA6A 1VQLT 3PPOA 3FJPA 3K1MA 1BB9A 4FYXB 4ZE9A 4OB2B 2Q88A 3SDFA 2O2OA 3EGUA 4PF8A 5HK3A 2X4XA 3IX1A 2LZ6B 2A5SA 4NWDA 5DLOA 1VQ4Q 1WIEA 2H4IA 1LPLA 2AKLA 1MXWA 4EMHA 1YTVA 1ZJLA 1ZUKA 2MKZA 2UYEA 3CCST 4OANA 4QQDA 1LBCA 1MPDA 5I5PA 5ESYA 3MQ9A 1NUWA 3EHRA 5A0DA 3OW2A 1FX7A 5TU0A 1ABQA 1VQPA 4RY1A 1FPBA 5EHMA 4R75A 4PL6A 4MEVA 1O75A 3PPNA 1OMPA 1HD3A 3OY9A 2OK2A 3K1NA 3G6ET 2KMTA 2H99A 3QK6A 2VYTA 1VYTA 1BYMA 2X51A 4NOYA 2O9SA 1RLPC 4LUEA 6AT1B 3SETA 4C5EA 3M4GA 4PGNA 1GCQC 2QGGA 2Y7WA 4OGEA 4JSDA 2WBBA 1QKBA 1KQ1A 4FE8A 1I69A 2XXUA 3SEYA 1JXOA 3A98A 1M1FA 2RMOA 1KA0A 2RI3A 3I3VA 2E41A 3QDRB 1RDXA 1B3GA 3BY7A 4F1UA 2CZ7B 2PFZA 4PF6A 1FQBA 2JS0A 4BUGA 1YWOA 4KUIA 4GLIA 3QG1A 2XD3A 2L8DA 4J9GA 2OTJA 3VLVA 4ESWA 3G4SA 1IUDA 3GYYA 3PUVE 4HE1A 1UHCA 4C5GA 4QSEA 4QFOA 1KFZA 1KA1A 5AA4B 1R77A 1Q81U 3DLNA 5GAOr 5BWJA 1USYH 3JCMe 5FRMA 3S9MC 3KN8A 2KT1A 1J1NA 2OTLT 1H45A 1TUGB 2DFUA 3TDJA 1IGUA 3EG1A 5IN1A 1ANFA 5GANg 4XXUA 3HP9A 1ZU0A 3QXMA 1UG1A 4RMOA 3RUMA 2YJPA 4Z02A 2YUNA 2YRCA 1MY2A 4PFZA 1ABOA 1MXUA 3MP8A 3MZ9A 4ZEBA 4AT1B 2K7AA 1GXIE 1POTA 1MH4A 4ZN3A 2D3IA 1BI3A 1PBQA 3PIOA 4OTEA 4MMKA 5CMKA 3RNNA 3JCMf 2OAUA 4U1OA 4IUPA 1OV3A 2DP8A 1PM3A 4ZGEB 3OYNA 1MQGA 2WYPA 4XTVA 3V89B 2RM4A 5I58A 2LNHB 3QJYA 2DWAA 4WEDA 1N27A 1BI0A 1FXXA 4C5HA 4I40A 4QRZA 2ZPFB 3Q27A 2K79A 1OPKA 2QMXA 3GP8A 2E5KA 2ALUA 2QPQA 1N0TA 3MZ1A 4M78F 3RMSA 3V8KA 1TS9A 1JNFA 2LNVA 4ONYA 4GL0A 1UE9A 1VR5A 2HPGA 5GAOp 1G3YA 1Y20A 1Q81R 4DE8A 1AWJA 1WX6A 2FRYA 1CKBA 1CE2A 3OB9A 5T3JA 1S7YA 3ZFJA 1B46A 1W2BS 2DE0X 2RC8A 2EIFA 4A63B 4BE0A 2XXXA 1NH7A 3EG3A 1I8FA 5H8HB 2NOOA 1D1AA 3VRZA 1YCJA 3K01A 3ZBDA 4G77A 4AS4A 4ND9A 5ET5A 3CMAT 3GIBA 2CP7A 4JRKA 1R0CB 3LSWA 1LBYA 2KDSA 1NJIR 1B0HA 3BBRA 4F14A 2E12A 3IJXB 4FCYA 2KT8A 1WXBA 3GBQA 2DEUA 1JVXA 1SW5A 3JCMb 4R55A 2RF1A 2V3UA 3C94A 2LDMA 1XC1A 1MM7A 1NFTA 3FV1A 4IIOA 1M3BA 1AL3A 5I2NA 3B6TA 3TEEA 2GCXA 1YJNQ 1QWFA 4K3FA 1VQMQ 4OEVA 2ECZA 1FBDA 2VPNA 1JBMA 1FTJA 3QHSA 4RCCA 2CH4A 1I5LA 2ESNA 5CBSA 3QYTA 3T1BA 3IO4A 1C0MA 1L5TA 1RDZA 2JTFA 4PTKA 5I56A 2IPOB 4HTGA 3TSWA 2ZAEA 2YLNA 3LBSA 3CC7T 1IXHA 3FBPA 4PETA 5IZ3A 5GAN7 1NNPA 3C4SA 2KE9A 1O64A 1YJ9Q 1NV2A 2HKNA 1PEBA 4A4FA 4MDXA 4L17A 3KBZA 3RQTA 4PJOC 4YAHX 3FD3A 2HZKA 2QVVA 3OSVA 2DIGA 1UJ0A 1N7WA 3KSJA 2RCAA 1FPFA 3GBBA 4GXAA 2ZZXA 2K9GA 2ZYOA 1TU0B 3ULRB 1RAFB 3JV3A 3MSTA 3VDFA 2OCUA 3E9GA 3BFTA 1N8RR 3L1AA 1H3DA 3H0IA 2HAUA 4KH0B 4HKEA 1G0IA 4F1YA 3WVEB 1Z7NE 1UGVA 5I7IA 5LJ3e 3MBPA 2ONRA 2QS3A 4N8YA 3PNWC 3VUBA 3BE3A 2VD2A 4DXCA 5FLXE 2I3VA 2VWFA 5FU7C 3KOSA 3UATA 1PRLC 1K9MC 1USYE 3ONMA 4IO3A 3THIA 4N4IA 2V84A 2C0TA 4CRIA 4KPTA 2ZGWA 1TOVA 2F3DA 3CPWA 4YB5A 3T9HB 3EH1A 4LZ7A 1BU1A 2AL4A 1Y0MA 2BE7D 4PNOA 1MNDA 2KRNA 3I35A 1YXIA 2EQUA 9ATCB 2VGNA 1SPKA 2GNCA 1NBEB 1POY1 1BI1A 3CG3A 3B6QA 2LQKA 3VUZA 1C6VX 5I2SA 4C92C 1X01A 1JEGA 2LMJA 4DI3D 2VGQA 3S4UA 1Y1ZA 4X04A 1WGSA 2ZYKA 1SI1A 4AQ4A 4N6KA 2D5WA 2L5QA 2MWPA 3VJPA 1JQQA 2F2XA 2FIEA 4OVJA 3DP6A 4A4KA 1QULA 1FTOA 3QJ6A 2LQ8A 3IOWA 4JRIA 4HXVA 5IM2A 1WA7A 4JWXA 3BFUA 2FPEA 3CFZA 4OMFB 3H6VA 4MX6A 2B8AA 4DOVA 1N3XA 1M1KR 2MCNA 3FZVA 2XWKA 1B5JA 2PMSA 1SYIA 2Z8FA 2RINA 3TTRA 1VIEA 1KD1U 2CGHA 1MY1A 2AZVA 2G3RA 2GTOA 2K4YA 2DS9A 4NF6A 2VHAA 1DJ7B 1FCKA 4FIBA 3WAEA 2DLPA 5KYXA 4M7AA 3CC2A 4H5GA 4XFEA 5CQYA 3VU3C 1OZ3A 3K02A 3KG2A 3MYUA 3JB9I 1Q35A 3GZGA 5A2QE 2P0KA 2P1SA 4XKQA 3EGXA 1JO8A 4J9EA 1ZUUA 3TQ7P 4JRPA 1AMFA 4C92E 1RACB 1LAFE 1NMUA 1FQAA 1KD1R 4FATA 5GAOm 2UVJA 2DSFA 4O5VA 2COZA 3CCVA 3PUWE 2XWIA 4JS4A 2JM8A 3GNGA 4LXCA 3TQLA 2E1HA 4D8DA 3VYHB 5LJ5f 4HE0A 1D09B 3QXEB 2O1MA 4ELPA 1JJ2S 2QVRA 2Z0WA 5GAN3 1VQ9A 4M77B 3RTFB 3GLXA 3X25B 1QVGA 4F18A 1TUDA 4Q5TA 1NKXA 1MMDA 4U21A 1WHMA 4ZEIA 2IG0A 2JZ2A 4VUBA 3O5ZA 3SB2A 5J1DA 5M9OA 1N8RU 5A5LA 1QWEA 2JTEA 4XTCQ 1B32A 1FBFA 1YPNA 3O2AA 1MMAA 3TSZA 3D4CA 4RPOA 1M5EA 2F2WA 3CC7A 4N91A 4PLLA 4FJPA 2D8HA 3OMGA 2PT1A 2LVMA 4WTOB 3MAMA 4B6MA 3UPUA 2XWVA 2VKNA 1QW0A 1ZQ1A 5L23A 4ESXA 2THIA 1NJIC 4NWCA 1K0XA 1OLCA 1D3KA 4G8HA 2EGEA 3ISPA 4OA4A 2ROTA 1MNEA 2K3XA 3JRZA 2UYFA 3M0UA 4LDVA 4E7JA 3M0RA 4HVVA 3C9HA 3PUZE 3MZBA 3I6VA 4A54A 3CCJT 2VT5A 3RYDA 4DZ1A 5CO7A 2KY9A 1PB8A 5CM6A 2CYZB 2RI2A 1BKBA 2J6FA 1IXCA 3CCRQ 1LBZA 2RKMA 3E9XA 4JDSA 2EWNA 4RTWA 3QIMA 1G0HA 1S50A 4JSOA 3VLWA 3JV9A 2JJKA 1Q81C 2B86A 1AWBA 3FJGA 2RI5A 1P92A 3KJ7A 4HVUA 3KZGA 5GANh 3LX7A 1GVCA 1NNTA 2GHAA 2E1SA 2CKKA 1X69A 1IXGA 1EX4A 2DIQA 3FDRA 2XG8D 1MDP1 3TCHA 4OENA 4KGZB 3QKJA 2K5FA 4PDHA 1WXTA 5KYWA 3M55A 2EAYA 3CQTA 2MK5A 1SVXB 3EH2A 1OI1A 3MKDA 2QA4Q 3EFRA 4C8QB 1SEMA 3HV1A 2CS7A 1EYKA 1FBCA 1SD3A 2QQAA 2O31A 2GBQA 2F7AA 2Y7IA 3D7SB 5GAN4 1M3CA 2YLCA 4IUVA 3PTAA 3BDUA 4HCZA 3RIRA 5LJ3f 3PV0E 2K2MA 1XVYA 1C1AA 1PWTA 3QPHA 1DOTA 2V8IA 5HK0A 1MUZA 2EGAA 4M77E 2O51A 1WQWA 3U92A 2ED1A 1LAGE 2E5QA 3JCMJ 2E6NA 2RO0A 2MOXA 1KC8R 2QMWA 5CIUA 3JAME 3PTYA 1JRIA 3N94A 1M5FA 2O84X 3C4MA 4LATA 4JS5A 4JXIA 5L8RE 3CXCP 3CCLA 4FL6A 2HQEA 3CC2T 2Q2CA 4FAJA 2CZ1B 3CCRT 4E6RA 4R0KA 4XTWA 2XXRA 1KZ8A 4JDFA 3LSXA 3FLGA 3V8JA 4PQJA 1EIFA 2XIDA 4L59A 4JJDA 2Z22A 4FEBA 2VXEA 2OX3A 4DCYA 5LJ5j 3HPWA 2H5YA 3UA6A 3TCJA 1MV3A 1R9QA 1N6AA 5AA2B 4MZMA 2OX7A 5AYFA 2EKOA 2XD0A 4M7DA 2K2VA 1MXZA 1T0JA 2AIRB 5D6XA 1B7UA 4M7DF 4A4EA 1FSAA 5IXFA 5GAOn 4M7DC 2QFLA 3LUYA 1AD5A 5GANf 5DYHA 4GLMA 3H03A 3OXNA 4J9BA 1EYIA 1IHVA 1N9RA 2QQ9A 1VQKQ 1IXIA 4JBZA 3RTWB 2RK2A 1DK4A 2LX7A 3BDLA 5IGAA 2SRCA 1Q95G 1VQ5A 1YCYA 3CCVQ 3O8VA 2PU9B 2HBPA 3TYHA 4KXPA 4P47A 2HZYA 1SBPA 4HCYA 3OYEA 3HFNA 4GWSA 4J6WA 3OYFA 4J9IA 2X3WD 4M75C 1FJ9A 2I0BA 5FROA 3O66A 4IO4A 4U4SA 1NUYA 1S72T 2H3EB 2RHYA 1D9QA 2EQIA 4ZEKA 3H6UA 4M75A 3VFJA 1X2KA 4OMOA 2DXCA 4G2ZA 2EGCA 4PJOE 1DPPA 1URGA 3ZKLA 3OO7A 2WSCE 2RCBA 1K8AU 1SF9A 2RF0A 4LDWA 1FPEA 4L5GA 1H43A 2L0AA 1YITT 4IB2A 1YP5A 5I84A 1MY3A 1G2BA 4F17A 2CZ0B 1FMVA 5LJ3h 3USDA 2DXYA 4BI3A 2V1RA 3OW2S 4TLMB 4XKPA 1IQ7A 1TFDA 2CMOA 1SPIA 2YUQA 3C12A 1P1NA 4EDUA 4PDDA 2CH4W 2KI7A 2EVRA 2EJGA 4HT9A 5KYUB 3R6OA 1QUKA 4C8QE 2FHDA 1S9TA 3RN8A 1PDAA 1ZBXA 4F7UF 1M90U 3RT8A 3OYIA 1EYJA 2X26A 2RK1A 2J7IA 3KSXA 1VQOT 5CVIA 1MM6A 2I48A 2KNBB 3DLLA 2HQHA 4C0ZA 3FC3A 1K73R 3EKIA 1D4NA 1A8FA 3MWBA 3O9PA 1QCFA 3S9NC 1D0YA 1VQNT 1FTAA 1BK4A 2F7CA 1IXDA 2M0OA 3TVTA 2XXTA 3OO8A 5CBRA 2ZYMA 1BP5A 1HSLA 4R2FA 2R8TA 1FPIA 1HSQA 4YKIA 2DTOA 2HL3A 3H0HA 1WYXA 1G3SA 1M5Q1 1I6QA 5I2KB 4ANJA 4C8QA 1SW2A 2R9JA 4TQUQ 4ESRA 1K73U 4F3BA 4M78D 2NWMA 5IH2A 4MMLA 4OGCA 3KFMA 1D3BA 3IOUA 4PBQA 3S9LC 1V29B 2VASA 1LB8A 2CZLA 5IHIA 4NX1A 2PBWA 2BUDA 3JCMc 3ME9A 1IMCA 3L2RA 1TH7A 1UB4A 4OMQA 1WHGA 1YITQ 2F7BA 4DEYA 3CC4A 4ZEDA 4BDOA 2QAZA 1WLPB 1NLPC 4O6JA 2EQKA 1Q7YC 3CC7Q 2VPOA 1VQ6T 4R6HA 5BUUA 3IFCA 5AA1A 2RHZA 2VOZA 4ZDMA 5GAN5 4M75E 3OS0A 4Z7EA 4OP0A 2XI9A 3T93B 3A3CA 3RT6B 2KGTA 1A55A 3DM0A 2HEQA 3QUIA 2NUPA 1U1TA 1BIAA 3LSFB 4ELOA 3KC1A 2A5TA 4KD5A 2HL5C 1NUXA 3CCET 4MLVA 4POXA 2OJ2A 3V5AA 5I57B 1VFDA 1VQKA 2QTVA 4XK8E 3C33A 3PPQA 2Y4XA 4F16A 4IY6A 1XOVA 2PCRA 1ATGA 4NF8A 4OVAA 1FBGA 2RQVA 3MCAB 1BIYA 4BACA 4ELRA 5H8NB 1YI2Q 5GMKi 4BY6B 4F3PA 1M8MA 3G3IA 2LP5A 2DMOA 1UHFA 2DNUA 3V7RA 3CCUA 3UA7A 4V2SA 1OOTA 2RPNA 2C06A 4EQ9A 4C8QF 2BZ8A 2QI2A 2HAVA 4P1EA 2RJDA 1GFCA 2Q2AA 2XX8A 5EQ9A 2LCCA 5GAOl 4E7KA 2DE2A 3PVLA 3JB9G 3O28A 1RABB 2A5TB 2FZCB 2F97A 2VGMA 4I3YA 2KQWA 4N13A 1NNKA 4R9FA 3CPWP 2QS2A 4KCCA 2HDAA 5CKHA 4M77A 3WXMB 5L9SA 1W4SA 4JLIA 3VYGA 3CSGA 1Y4TA 2QG9B 1NL5A 3RPWA 2L3SA 1LNXA 3M0TA 1J3TA 4C1UA 4RPNA 3O29A 1Y71A 3CBMA 4Z89A 2REJA 1WHHA 1RAEB 3OBYA 1MHNA 2CP2A 3VRYA 4OQOA 1NZ9A 3E78A 1S1NA 3I9QA 2ZYNA 3RGYA 4XTUA 1LFHA 2HNIA 2F6GA 1MXVA 4G68A 4YZZA 3HRUA 4H46A 4BDZA 1WDXA 3CVGA 4FYWB 5KCOA 4JZ4A 1Y9UA 3TTKA 1K9ZA 2GFUA 4KHZE 4GBQA 4F2QA 2PFYA 4QQGA 1LB9A 4EMGA 1FBEA 2PX1A 2KR0A 3VS2A 4FU6A 4YMAA 1FPKA 1R6ZA 1ZBMA 3GNFB
chains in the Genus database with same CATH topology
1B1HA 2RJCA 3S6WA 1SQYA 3MVXA 5AE4A 4F31B 2GF7A 4M75F 3EN3A 3JB9D 4X9CA 1ZMGA 3MPLA 1VQ6A 3B6WA 2O6AA 2DTIA 2I2LA 5HKCA 3CSBA 3UGWA 3M5AA 1ZTYA 4BI8B 4N0AA 2RC7A 3PGGA 3M3FA 3KN3A 3Q1JA 1FW0A 3HPIA 3KN7A 2EJFA 3I56A 3OYJA 1OVBA 3PIPA 4M77D 3FB9A 5FTIA 2ZNSA 4J83A 3KOTA 1K9MU 4KYSA 2XHCA 2EQJA 3K1PA 4IUTA 3QIIA 4PJOB 4Z0IA 2E70A 1QUJA 1ZIUA 2M8CA 1XHYA 3AXFA 4BB7A 3OEMA 4BDMA 3B7DA 3MVYA 3Q25A 4HA8A 3CRBA 2O7UA 5A5XB 3VE1B 5DY9A 5DEXB 2B3BA 4G8MA 2DEQA 4IO7A 1WPYA 3TTMA 5KDTA 3TODA 1K8AC 2RH2A 3CMAA 3LWHA 3M3KA 4J7FA 4Q30B 2BJJX 4NS5A 3VVFA 3K6UA 4EDPA 5JTYB 1JEUA 1VQMA 2PUKB 3EF7A 3HHGA 1QVGS 2DXUA 2ZPEB 3G7ZA 3CCEA 4JJNK 1P1UA 4ZE8A 2H98A 3FVOA 2PT2A 3CEYA 3OYBA 1VQ4A 3RLFE 3W15C 1MQDA 1LCTA 3QUJA 5C6SA 1YJWA 2UVGA 2QQBA 5A0GA 3M53A 1MRPA 3L6GA 4RK9A 1WJRA 2X4WA 4M7AE 4JWYA 4YTLA 5FHOA 2I58A 1QJMA 1IREB 2I3WA 1AIVA 3J80E 1KQ2A 1QUIA 5H8FA 1M1GA 2RJEA 4ZTFA 2YRVA 5ISUA 3GF5A 4C92D 1JETA 1NPRA 1QVFS 4BDRA 4FORA 2QQSA 4YU0A 3C31A 1O63A 4PE5B 1FTKA 3ZS6A 1HSEA 1P1QA 1YAEA 1SDXA 2RHXA 2X35A 3L6HA 2HZLA 4EXLA 1KG1A 3T22A 3JCMg 3H7MA 2XDBA 4I8CA 5CC2A 3W9VA 5TPAA 2LT1A 3PUXE 2OZZA 4GVOA 4UA8A 3UDCA 3P8HA 3A8LB 4AB5A 1S72A 4F2OA 4XU2A 1Q86U 2LT4A 3EHTA 3D4GA 1OYXA 5GANe 4GRKA 1LFIA 5CMCA 1BKAA 3CCRA 1BIBA 1XS5A 1TT1A 4XQ3A 4XU1A 5CKBA 2WSEE 5HBCA 3HSBA 1WVJA 4J8OA 4C92G 1B34B 3NTKA 3SEVA 3EFSA 4M7AG 3GBAA 1R9LA 3HO7A 2OLBA 2XX7A 5L9MA 1VE4A 3A09A 1WNLA 1M5CA 2MAMA 3S3OA 3OENA 4QQ6A 2ABHA 2H25A 4BDQA 4I62A 3SEXA 3C95A 1U1SA 4M75G 1QP3A 2V8JA 1B5IA 2W7YA 3PPPA 2VV5A 1Y1MA 1ZKBA 2MF2A 3CCMA 5FHMA 3SEWA 4C0DB 3QO3A 3RY3A 1QVSA 3S2VA 4HT8A 3BKIB 2G93A 5FU6C 2RA2A 1YHQT 2DWHA 2G29A 2I6EA 4ZGJB 4OFLA 2K5IA 4M7DG 3VVEA 4NMYA 3S9EA 1KC8C 3KGCA 4EUOA 4KI0E 3X26B 3P8DA 3ECRA 4M7DE 3FJMA 2O01E 3TTNA 3T9UA 4E0XA 4MZTA 2A3LA 4C8QC 4E7IA 5I57A 4EF1A 2Q8JA 4PFUA 3UN6A 4RK2A 2UVIA 5ELVA 1H3ZA 2HQXA 3L2UA 3VXBA 3MO8A 4LDYA 4BDYA 3E9FA 2XXQA 4P0IA 1EU8A 3DELB 1MDQA 4CI0C 3CI8A 4DIGA 1FQCA 3G3KA 3JCMd 3M57A 4C8QG 3UIFA 2QXFA 3HHTB 1BI2A 4QW2A 2NWJA 4BDLA 2EFIA 2DVEA 4O3BA 4RJZA 1XTDA 3IOVA 5KE2A 4J6XA 2HD0A 3IB2A 5L8DA 3HKSA 2PVUA 3V83A 2DXRA 1Y96A 2RC9A 2O69A 4U1ZA 3UWNA 3DKMA 2E6ZA 4JB7A 1KWHA 4OHNA 4OB0B 3KEIA 2GFEA 2I4CA 4H6DA 1QW1A 3G4ST 2XXYA 4XKNA 1M1KU 3IB1A 1MQJA 1PSEA 3VV5A 4KBMB 3G3HA 3GPLA 5KDTB 3OS1A 2KSSA 3PFSA 5HM4B 4EMKC 1IZ6A 1O7TA 3FGSA 2QDYB 4U4XA 1Q1KA 2O7IA 3PMTA 3M54A 2MI6A 2VP1A 5H8SA 1N3WA 5KCJB 3TPAA 2M1HA 3EPEA 4UC4A 5KCJA 2XKOC 5CMBA 4R74A 3H6TA 5CKFA 3R26A 1SI0A 2DK3A 2RJFA 1VQ7A 3CIJA 4Q8RA 3L2WA 3N6UA 2H3JA 3T96B 1W2BA 1PB7A 4DOWA 2RB6A 1N84A 1FTLA 5GAMd 3GXAA 5LJ5h 3OSQA 2MWOA 3M8UA 3ER0A 5HPQA 1I4K1 1T0KA 3JCMQ 2QJEA 5IKBA 1Y3QA 5I59B 5FHNA 5KZTA 5I2NB 2MMPA 1EZPA 4QFNA 4ZGDB 3OYMA 1KD1C 4G68C 3V7CA 3JZJA 3OO6A 4ELQA 2XXIA 3I56T 3TELA 4PKCC 2VUBA 2PYYA 1RYXA 2XX9A 2QL3A 3CBPA 1I6BA 1B3HA 3N26A 4PJOD 1VFEA 2VXFA 2F6PA 3OYHA 1B9JA 2REGA 4UACA 3L42A 3EQ1A 4N0AC 1M90C 3QSLA 3BW1A 4P11A 2VC8A 1LFGA 2AL5A 1GR2A 4LD9K 4FIMA 5GANj 3IR1A 1R1NA 1B05A 4XTYA 4OESA 4DXUA 1AH5A 3A8OB 3TREA 2PQWA 4M7AD 1XNIA 2QQRA 3M9QA 4YKPA 5TP9A 4IUUA 2Y7RA 4F7UA 5ITPA 3EHSA 2EYQA 1X75C 3TMGA 3K6XA 2ZNUA 1MY4A 2F34A 1HK9A 2RD1A 2LCLA 2QEXT 2DE4A 3FATA 1EZOA 3JCMP 3K2DA 4ZZAA 3FVKA 3OYKA 3FIRA 2OWTA 4M78C 4NE4A 4ZTJA 2XXPA 4RG8A 1LOJA 4LUBA 2FYIA 4M7DB 5JTYA 1AOVA 3UT1A 5AA4A 2LAOA 4IO2A 3JSCA 1OQGA 4FEDA 3T9NA 1VQOA 1QP2A 1YBYA 4GXSB 3TCFA 3UP9A 2OJTA 4O3AA 3HSTA 2V3QA 3U8QA 4P0GA 3OELA 1BLFA 4QF9A 5GMKe 3CCJA 1Y7XA 3N5LA 4DLDA 2V8KA 3MHXA 3TU4K 3J81E 2DVZA 4JLGA 4M78G 4GF8A 1UGRB 2L89A 4J7IA 4XTXA 3IAZA 4X9TA 1UIUA 4G8NA 3I55T 3SFMA 2NVUB 2VD3A 3CC4T 4ELYC 4IURA 3M59A 3P7IA 1JEVA 3CXCA 5ITOA 1WQ7A 3MP1A 5L9OA 3RUXA 3IJOB 1VQNA 5IAYA 3T9VA 3JCMX 1I6AA 5DTBA 4Y28E 1MQIA 4R73A 2DPPB 5I59A 2XXVA 2O4XB 2PVOB 2DD4A 3M58A 4YB7A 2QS4A 5TPAB 1B5HA 4F7UE 4KFQA 5LJ3g 2HCAA 1GGGA 5M2VA 1OVTA 3VV0A 1YJ9T 3E1SA 4XU0A 4TVRA 1OIBA 5H8QB 4QFKA 2E64A 4M77G 1R8OB 1B3EA 4RG2A 1Y3PA 4YB6A 4OMBA 3LW5E 5GMKl 4BE1A 4HS7A 2JOYA 3FIFA 1IZ1A 3MVWA 2FL7A 4RNSA 3RESA 4OETA 1UTHA 3H4ZA 3QUFA 1JW5A 3K6WA 3U93A 3A8GB 3SWNA 4H1XA 2D21A 4H5FA 3BFMA 5J3BA 3G6EA 5ICQA 1XOCA 4MLQA 3SESA 1D9YA 3O6HA 4C92A 1MPCA 4LDUA 2GRVA 3FXUA 3C32A 3E3KA 4F7UB 5I21A 1B3LA 2DYXA 4YMBA 3MW0A 4E47A 3Q28A 2F5XA 1VUBA 2F35A 2R5MA 1RI0A 2HQ0A 2X7PA 3CCUT 2DQVA 3QYGB 3LC8A 3F70A 3G71A 4O3CA 3H6ZA 5EYFA 1OLAA 4F7UG 3R7XA 2IVWA 4DQ2A 2HEUA 5J39A 2O68A 4X9DA 4NF5B 5CMMA 4XU3A 5D6YA 3SKPA 5IAIA 2DD5A 1A8EA 3G3GA 2QSXA 1O9SA 2E65A 2AIXA 2FNCA 1WJQA 2KAFA 5CK9A 3PMWA 4GFRA 1M4ZA 4ZECA 4M75D 3KXTA 2D0QB 2UXAA 4POWA 3HFOA 3JCMV 1Q86C 5I2KA 4HW8A 2ONKE 4M7DD 3RKWA 4KULA 3HL8A 3OEKA 4RYAA 3CCLT 4BD3A 1US4A 1B34A 2DXTA 3TUSA 1JQFA 5C0MA 5GAMf 1LSTA 4M78E 2R5AA 1DSNA 3CPFA 5A5XA 5GANd 3A5ZB 1Y4CA 1OZ2A 2ANJA 3U94A 4OFJA 4N4GA 2DVCA 3HRTA 1MXYA 3MP6A 5CQXA 3SERA 1B7ZA 4X48A 1UQWA 4MZPA 3CFLA 3PD9A 3TEPA 4ZEFA 2Z8EA 4OYVA 4NTLA 4MDWA 4RKUE 1P1OA 1UEBA 2P0PA 4NF6B 4XAXB 2E10A 3TKDA 3V8XB 1Z7ME 5CAIA 2OWSA 5GAN6 5FU6B 4FECA 4F3GA 1CB6A 5IT9E 3RERA 1G5VA 3C35A 4HCWA 1YJNT 4XKRA 5A0LA 1MG1A 3LSLA 3S3MA 1MQHA 4RCBA 1YI2T 2IEEA 4RA1A 3FEOA 4R72A 1MS7A 4I1DA 3V8LA 1B6HA 4NF5A 2M16A 1VQKT 4GWOA 4IGTA 2Y7KA 3JCMW 5K2YA 4G4PA 3CCVT 5GAN8 2JUFA 1MGQA 2X4YA 1VQ4T 4PFTA 1X6OA 4F3SA 3CG1A 1UTHB 2ZPGB 5H8NA 1JB0E 3IOTA 1DPEA 3IK6B 1TXFA 2GQVA 1OQHA 3SWNB 4ZN1A 2F36A 1B40A 1MPBA 1SSFA 2QA4A 2X4JA 1JW4A 3O6GA 3PUYE 3WVDB 2O1LA 3IL1B 1JVYA 3FUZA 4C92F 1URDA 3T66A 4N6PA 5LJ5e 3SEUA 4C1TA 5LJ3j 1UIVA 1IEJA 2Q9TA 5LJ5d 5F7VA 1PBPA 1XQHA 1LBBA 4U23A 2DOJA 3OYYA 3FXRA 4F22A 1GV8A 4IO6A 1TWYA 3LGLA 1PC3A 4FT2A 1EZ9A 4ECFA 3CPWS 2KLFA 3OYCA 4R6YA 1WJSA 3PGFA 5KCHA 4GL8A 4U22A 5DT6A 2YLBA 1I81A 1KQSS 2YPNA 1A7LA 1G3TA 3OD7A 3ODBA 2XXWA 3UA8A 2QA4T 3CCQA 2I49A 3PD8A 1WODA 2ZCFB 4BE2A 4FSXA 3K00A 4X34A 3FXQA 3K4UA 4LVQA 2Q89A 4BLAA 1LAXA 3L2VA 3OYDA 3C36A 3W9WA 4M7AB 3C34A 3FJ7A 4GQOA 2GFAA 1PSFA 3T9XB 1SYHA 1Q82C 3CCMT 3QYHB 1GTKA 3FASA 3PMXA 2GHBA 1B7HA 2DZ9A 4NF4B 5GAMg 3OYAA 2BKDN 2DXBA 3G3JA 1YJ9A 1K73C 3S3NA 1ZLQA 4IGRA 4LA9A 4OZ9A 1M9SA 3Q29A 2ZNTA 3IO6A 1N9SA 2B3FA 2XD2A 3HRSA 2HAXA 5KH6A 3RMQA 1Q82U 4IUQA 4EQBA 2Y4YA 3JYRA 1A54A 4OERA 4Y91A 3HN0A 3JCMh 1UGPB 4DCXA 5AA2D 4LQ2A 3X20B 3HHFA 1YJNA 1WDNA 3JB9H 3L2ZA 2XICA 1B58A 4M7AF 2QS1A 4HCCA 3X28B 2O4XA 3N6TA 3ILUB 3P8BB 4NL3A 2F8DA 4EF2A 1N76A 3QZ5B 3OO9A 4F19A 4H8IA 1IITA 3URGA 1LAHE 4EMKB 1YI2A 1DTZA 3JB9F 4LDXA 4B9XA 2NXOA 3A3UA 2P4TA 1US5A 3AHUA 4H0WA 3E13X 2V3TA 1VQ5T 4GOTA 4G68B 1VQ8A 1YIJA 1M5BA 3EAEA 4NF8B 5GAMh 4E7HA 1ELJA 3OMBA 4ZS9A 5FTHA 4C5IA 2CZ6B 1AHJB 4LZ8A 3VLUA 4PLIA 5EG2A 1FQEA 3H3GA 3LLRA 5H8QA 2Y84A 4B9WA 3A8MB 4GY5A 1YITA 3FVNA 3CR9A 1H76A 2L3RA 1U8RA 4I9DA 2FVUA 4A4GA 5GAMe 2AHJB 1B1XA 3SDZA 5DVIA 4D6WA 3OQ5A 5GAMj 1QKAA 2WSFE 1FQDA 4XIGQ 2HXWA 4PP0A 1KQSA 4XTZA 3G71T 3H6WA 1NJIU 4RXLA 4F29A 2Z8DA 4ME7A 2XK0A 5FRNA 3DLMA 3CCQT 3PU5A 2QTXA 3ASKA 4N4HA 5GAOq 2DKGA 2JNGA 1MY0A 4R2BA 3OSRA 4QSDA 1NPPA 4KQPA 2OBGA 4H67A 4H8JA 5JEIA 5LL6S 5LJ3d 3MUQA 5DEXA 4OF1A 2DWJA 3TZAA 1HXDA 1XT8A 4GD5A 4M1VA 2RHUA 3J7AF 2P0QA 1IIWA 1UGQB 3I5OA 3FRNA 4C0DC 3N5BB 1XVXA 3OMCA 3KBRA 2DWIA 1VQ7T 5EHSA 1UTBA 1VQLA 1D3BB 1VIFA 3M4YA 3CXCS 1KHIA 1Y07A 5I56B 4JRQA 5I58B 2EQMA 5K2XA 1NNFA 3GLBA 4C92B 3V7SA 3H06B 4EXKA 3PT9A 3ILTB 1ZHIA 1Y96B 2K5LA 3E19A 1P99A 2ZXTA 3K0VA 1YJWT 4NF4A 4PJOF 2X7QA 5J26A 4DA4A 1SW4A 5GMKh 2QRYA 4J5YA 4X1BA 2IA4A 3DP4A 3G3FA 4OFOA 1Y3NA 4QSCA 4KCDA 2PVDB 5GMKm 5AA2A 4QVCA 3MJNA 4ISUA 1B52A 4F39A 1N04A 2ZPBB 3JB9J 5LOMA 2ZMBA 1N7XA 2Y90A 5DVFA 4QVDA 2OTJT 5GAN2 5CKEA 3OS2A 4KYEA 3INZA 1HSJA 4DDDA 1RL2A 2R71A 4GIZA 1KHCA 2DO3A 2A7YA 2XXHA 3CD6A 3MVZA 1VQPT 5H8FB 2Y7PA 3LH0A 4X1DA 4M78A 2LTOA 4IO5A 2XU8A 2KK4A 5AA3A 3LR1A 5ICTA 3HCQA 3WAFA 3KBGA 1A99A 4GLKA 2F5TX 5CRYA 3MC2A 2QEXA 1JW1A 3MEUA 1LGBC 4C8QD 2YHTA 4EQ7A 5GMKj 3EHUA 2DTHA 4IKFA 3META 4KR5A 4KUDK 4P5NA