3MP8A

Crystal structure of sgf29 tudor domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
513
structure length
513
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALAAAQTNAAAEFGSSYWTSEYNPNAPILVGSEVAYKPRRGSADGEWIQCEVLKVVADGTRFEVRDPEPDELGNSGKVYKCNRKELLLIPPGFPTKNYPPGTKVLARYPETTTFYPAIVIGTKRDGTCRLRFDGEEEVDKETEVTRRLVLPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltose-binding periplasmic protein,LINKER,SAGA-associated f
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Histone binding protein
total genus 148
structure length 513
sequence length 513
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mp8A05
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3mp8A01
4DLDA 3KBRA 3LLRA 4GWOA 5JTYB 3QIMA 4C1UA 4OESA 4ND9A 5TP9B 3FIRA 2RHZA 1B58A 4ELQA 2R58A 4XKRA 3PPPA 5I57A 1A8FA 1US4A 1HSEA 4DE8A 4OVAA 4LD6A 2ZYMA 4CRIA 2AL4A 5IAYA 4I8CA 4LVQA 4OVJA 4HS7A 1DTZA 3K02A 3SESA 4FU6A 1S7YA 1XOCA 4POWA 1NNKA 4EXKA 5B70A 5L9MA 4N6PA 5EHMA 3N5LA 3MP8A 2H99A 3UP9A 2BIVA 4IURA 1MH4A 3META 1IEJA 2Z8EA 2BJJX 1N04A 3O8VA 1MY1A 2VHAA 1B3HA 4ONYA 1QKBA 5KCHA 3T22A 4PETA 1WJSA 5JEIA 2AIXA 4O3CA 2WKYA 2LVMA 2DAQA 4IGTA 1A99A 2HCAA 3CEYA 1O7TA 3PPRA 1R9LA 3LC8A 4U4XA 3ECRA 2CKKA 3DLMA 3PUWE 3TTKA 5M9OA 1A54A 2F8DA 3FZVA 3CG3A 5TPAB 3PV0E 2DWJA 1PEBA 4F1YA 5I84A 4F1VA 4EXLA 3RTWB 2XX9A 1RKMA 1WDNA 4RJZA 3TCHA 4F29A 5ICQA 2R6GE 4JWYA 5J26A 5KE3A 3NTKA 4G77A 4IO4A 1B52A 4QW2A 1TXFA 3OS0A 5TPAA 3K00A 2EQKA 3S3NA 5ICTA 1B2HA 2D21A 3OYAA 2DP8A 3Q25A 4YAHX 4FORA 2XXTA 1USYE 1LFGA 2DXRA 3KOSA 3H6ZA 1B5JA 2D5WA 3MZ1A 4NEDA 5TU0A 3QXMA 4EDUA 4G8NA 2VOZA 1Z7ME 1QUKA 1SYHA 4IO2A 1ZMGA 3MAMA 1D3KA 1JVYA 1UIVA 3LSLA 3OO7A 5CM6A 3HCQA 2VGQA 1G5VA 3MPKA 1NNFA 3S9LC 2I4CA 1F9BA 5I56B 3OYIA 4KCCA 4Z7EA 3PGFA 4OFLA 1QULA 4R6KA 2OLBA 2E6NA 3DB3A 1P1NA 5ISUA 3U1OA 1LGBC 1OVTA 1H76A 4NMYA 3FASA 1ZKBA 1B51A 2M8CA 3CFLA 3DP6A 1IXIA 5I56A 2O4XA 4U2RA 3I3VA 2XX7A 3SKPA 1IZ1A 4ESXA 4NWCA 3QYTA 2QS1A 3EQ1A 1N7XA 1IIWA 3IL1B 4N4GA 2GF7A 3C9HA 2I0BA 2XXHA 3V5AA 4QSDA 3W9WA 1JW1A 4PLIA 3OXNA 1TFAA 4GY5A 3CSGA 4BDRA 3CI8A 4YMBA 1B05A 1JNFA 5CMMA 2XXWA 1OYXA 3QK6A 1UTBB 2Y7IA 4HW8A 2HZKA 3FJ7A 1XC1A 3LGLA 3ZS6A 4R73A 3HO7A 1MPCA 3OS1A 2WACA 2GFUA 1FTOA 1YCJA 2FNCA 2XDPA 5AA1A 3IJXB 4ZDMA 1OQHA 2I6EA 3LUYA 3PUVE 2LDMA 5H8NB 2XXXA 4RYAA 1URGA 2P1SA 3LSXA 3OYDA 3D4CA 5EHSA 5CBRA 5CRYA 3P7IA 2LRQA 3OYKA 4G8HA 2R5MA 1L5TA 1II5A 5I59A 1Y4CA 2RI2A 3IR1A 3EAEA 4R2FA 3UA8A 4I62A 3CVGA 2V93A 4RK2A 1H3ZA 1NKXA 2XXQA 5DEXB 2HAUA 5KDTA 1AIVA 3F11A 4XKPA 1AL3A 5FHMA 4HCZA 3ZSFA 1MXYA 3IO4A 2H4IA 1SW5A 4C5HA 1BLFA 5K2YA 1VFEA 1PB8A 4JSDA 1FQCA 3MVXA 3MVYA 4ELRA 4G8MA 2Q88A 1NH8A 4H0WA 1P1UA 5L9SA 5FTIA 5ELVA 3IB1A 3PD9A 4IUVA 2YLNA 5CI5A 5JK4A 4HCWA 3I5OA 3VVFA 4B9WA 3PU5A 3V8XB 3S4UA 1P1QA 3ZKKA 3I6VA 3UT1A 1EU8A 2LTOA 3K01A 1M5CA 5M2VA 5KCOA 1BTJA 1QUJA 4PQJA 4QFOA 4JB7A 2HXWA 4H5FA 4QFPA 4KI0E 4ZEBA 3OQ5A 3EHTA 5A5XA 1N3WA 4LA9A 4C5EA 4ZECA 3G3HA 4B9XA 3Q28A 5H8HB 2O84X 1MH3A 2O1MA 3BBRA 5CC2A 5C6SA 1B3LA 2YJPA 1EH3A 4QSCA 4ZEIA 4IO6A 2EQUA 2X4YA 3OENA 3N6UA 5AA2B 2QS2A 3L2WA 2ZNUA 3C35A 1WODA 1OVBA 2DWHA 1DOTA 2UVJA 1FW0A 4PFUA 3K6XA 4E0XA 4OFJA 3H6WA 3O2AA 2OBGA 3OYCA 5CIUA 2Y7KA 3M9QA 1POY1 2EQMA 3OO6A 3TQLA 1SW2A 4L59A 3MEVA 3O6IA 4THIA 1M5BA 3CRBA 4E7JA 2Z8FA 4M4GA 1P1OA 2ESNA 2VYTA 1TWYA 1Y3PA 4QRZA 3QUFA 3NTIA 1EZPA 2RHXA 1B3GA 4GLIA 2MWPA 3O66A 4F3PA 4YICA 1D9YA 3LSWA 2X4XA 5AA3A 4GXSB 4O3BA 1ZU0A 3W15C 4ZEKA 3TODA 4A4EA 4IKFA 3OMBA 1P99A 2THIA 2GHBA 2ANJA 2RI3A 3VE1B 5L8DA 4F18A 4YKIA 3TAJA 3R6UA 4FEBA 3KSXA 1B0LA 3VV5A 2PT1A 2ZYOA 2RJDA 4F39A 1N3XA 2F35A 3PFSA 2H98A 1R6ZA 3VVEA 1HSJA 3TTRA 4Q0CA 1N27A 2QS3A 4ZEDA 3TTNA 2Q8JA 4PFTA 1LFIA 4I9DA 2V84A 1WGSA 4Q5WA 3FGSA 3MZ9A 4OHNA 4LZ5A 1FQEA 2Y84A 3THIA 1ZJLA 1I6BA 4ZTJA 2QMWA 3Q26A 1VFDA 1Y9UA 3IOWA 3VVDA 5JTYA 1MQJA 3MBPA 3VXCA 4DCXA 3HPIA 1JETA 3Q29A 4YB7A 4N4IA 5TP9A 4C1TA 1B9JA 3H06B 3ZEHA 3P8HA 4G68C 4BDZA 4BE0A 3M3KA 3OYEA 4JXIA 3R26A 1JEVA 4YKJA 3JYRA 1P1WA 4N4HA 3BKIB 4NWDA 4WXJA 3EN3A 4H8IA 1B4ZA 1SD3A 4KR5A 3G3JA 3U8QA 3FC3A 1SSFA 1MDP1 3L42A 4NTLA 1XT8A 1MXUA 2IA4A 5FRMA 2OWTA 4UA8A 3PUZE 2I0CA 3L2UA 4U23A 3ME9A 1LAXA 2NUVA 1LLSA 3RN8A 3O97A 3T9VA 3S9EA 1I69A 4IB2A 1GV8A 5AA4B 4ZZAA 1LAGE 3GZGA 2D3IA 3UORA 1H45A 3PMTA 2Z22A 3KFMA 2L89A 3BFTA 4U1ZA 4WKMA 5DVJA 1R9QA 3B6WA 3MZBA 2UVIA 4GQOA 1BIYA 1ATGA 1NFTA 2Z8DA 4LP2B 3B7DA 2PVUA 4H5GA 3U93A 3F70A 2OZZA 2OCUA 3HHGA 3LBSA 5DYHA 3TCFA 3OYGA 5FROA 4E7KA 2NVUB 1DPPA 1MY2A 2V25A 4PLLA 3TEPA 4DXUA 3QIIA 1D4NA 1OI1A 1B6HA 3L2VA 3IAZA 3K6UA 1N0TA 4JWXA 2AYSA 3HHFA 4EQ9A 4NF4B 5AA2D 3FXRA 3OYMA 4MH5A 3T9HB 2RJFA 1MXXA 4RY1A 4DCYA 4E7LA 2A5TB 3LX7A 4NF8B 4IUTA 3C32A 2I4BA 1HSLA 4QQDA 4KD5A 4JDFA 3K4UA 3OSRA 5I58B 1OIBA 2MWOA 4UC4A 2ABHA 2A5TA 3L6HA 2QL3A 3IORA 3U72A 1LFHA 2Y7RA 3C36A 4N07A 1J1NA 1IUDA 1ZLQA 4BDMA 3OO8A 3OYLA 4R75A 1SW1A 1B3EA 1XS5A 2ONKE 1YTVA 4TQUQ 3MEUA 4R9GA 5FTHA 3DP4A 3FV1A 2HAVA 3C31A 1Y20A 1DMBA 1EZ9A 3FJGA 2RHYA 4ESWA 4YMAA 2DWIA 4GXAA 3H03A 2RF1A 4PFYA 3QJ6A 1MRPA 3FVKA 5ITPA 2BKDN 2DSFA 3RLFE 3TQWA 1GGGA 3OO9A 1IITA 4AB5A 1KHCA 2UYFA 1FQDA 2O51A 4Z0IA 1EZOA 3O9PA 4YB6A 3IB0A 3PMXA 1PDAA 2Q9TA 3MP6A 2AL5A 3EPEA 1B7ZA 4OFOA 5CBSA 4II1A 3K1MA 4FECA 2HQXA 1MY0A 1ZBMA 2I3VA 3SEVA 1YAEA 4PFWA 4IUQA 1TFDA 3FUZA 1MQGA 1I6AA 1MDQA 1UTBA 3A3UA 5L9OA 3G3FA 2P0SA 4IO5A 4FATA 5H8QB 2O1LA 3U92A 2E0SA 4GVOA 4OYVA 3QBYA 3LGFA 3LYIA 1O64A 2B3BA 2VP1A 4F31B 4F3SA 2P0KA 2XXIA 3TYHA 3IOUA 2OWSA 2KLFA 3U94A 2XXRA 3OYJA 1A8EA 4XIGQ 5H8NA 4OXVA 3VLUA 1AMFA 3RTFB 5IN1A 3B6QA 4H6DA 2IG0A 1CE2A 2LCCA 2NXOA 3MWBA 2CZLA 1USYH 2B8AA 1ZIUA 4NF6B 4LATA 2ZNSA 1B7UA 3MVZA 3H6VA 2E5QA 1XVXA 1JW5A 2K3XA 4KQPA 2RC7A 5DEXA 4R74A 4RPOA 2XX8A 3RPWA 1Z7NE 3OS2A 3KJ7A 4RNSA 1XNIA 4X34A 1Y3NA 2F6GA 4O3AA 3JV9A 1T0KA 1LBCA 4GOTA 4YKPA 5CMBA 3MO8A 5BWJA 1JVXA 2DE2A 3RQTA 1Y1ZA 3ASKA 3FVOA 3KN3A 2B3FA 4H1XA 1TT1A 4LQ2A 1IXHA 3O6HA 1SQYA 1FTJA 2RJEA 1NL5A 3D4GA 4UACA 4EDPA 1MM6A 4YU0A 3ILUB 1DSNA 3GBBA 2G3RA 1OLAA 4K3FA 1O63A 4IO3A 3IOVA 3S9NC 5KCJB 1CB6A 4NF5B 3G3KA 1NH7A 3K6WA 2HQ0A 3LH0A 4LONB 2RCBA 4RA1A 1WVJA 3PPQA 4MBPA 4POXA 4HTGA 1LCTA 4ELPA 1GVCA 4AB6A 3DB4A 1JEUA 2EQJA 1N76A 5H8HA 4BDLA 4DXCA 3FEOA 2F7BA 3Q27A 3UWNA 1BKAA 5DTBA 3M3FA 5H8SA 5AA2A 3UGWA 4MF3A 3SD4A 3N26A 4RPNA 3VDFA 1URDA 3N6TA 4G68B 3G3GA 1PC3A 3IX1A 3PUYE 3VLWA 3KG2A 2B65A 4F1UA 4X1DA 3T66A 2GRVA 4OQOA 1PBPA 2H25A 4FE8A 2O7UA 4QFLA 3H6UA 1OZ3A 3OYNA 2V3UA 4A4GA 1RYOA 1SI0A 2M16A 4FEDA 2XHDA 4GF8A 2XXVA 3FXUA 2DIGA 3T96B 5D6XA 2Y7WA 4BDQA 4JSOA 2PX1A 4ECFA 4LZ7A 3OA6A 1IQ7A 3IO6A 1SVXB 2QRYA 3CSBA 4DIGA 1FQBA 1Y1MA 3ONMA 3O6GA 5BUUA 4LUBA 4ELOA 1M5DA 4X48A 1B1XA 2PMSA 4DZ1A 4IO7A 2QQSA 3QUJA 2YPNA 4F2OA 2ONSA 2NWJA 4EF2A 4GD5A 4A4HA 1UTHB 3PD8A 3O28A 2ALUA 5FRNA 3PUXE 4YZZA 2REGA 2ZNTA 3USDA 2QPQA 2DWAA 5DT6A 2ZYNA 3K6VA 4YB5A 4EQ7A 2RINA 2OK2A 3TUSA 1UTHA 3MC2A 2E1SA 5I57B 5IKBA 2EFIA 4JWOA 2F36A 2RKMA 3IK6B 3E9XA 1YPNA 2IEEA 5EYFA 1WJQA 4RK9A 4M1VA 3S3MA 1SW4A 4H65A 5J39A 3PMIA 2REJA 3V83A 4Z02A 1MPBA 3TMGA 2GFEA 3B6TA 1MS7A 3L6GA 3R7XA 5H8FB 2RC9A 4QQGA 2I48A 1QJMA 5CMCA 3GBAA 5CMKA 3M3LA 3Q1JA 5J1DA 3K1NA 4L17A 4EUOA 2ZMBA 2NLUA 2DOJA 2QSXA 2XXUA 1KWHA 5I2NB 3OOAA 3RUMA 1SDXA 4U1OA 5H8FA 1H44A 4MLVA 1VE4A 2F7CA 2Q2AA 3K2DA 3CIJA 4QFKA 3E9FA 5LOMA 3TTMA 3QSLA 4ZS9A 3LSFB 2RCAA 3KOTA 3SDFA 2X35A 2XK0A 5I2NA 3JZJA 2UVGA 1H43A 3KEIA 2GHAA 2GFAA 1LB9A 3PPNA 1M5FA 3SERA 2VD2A 2H5YA 3C4MA 5HPQA 3OELA 1B40A 3DM0A 3RY3A 1Y4TA 2PYYA 1A40A 1BP5A 4PL6A 4C5IA 4GRKA 3KGCA 5AA4A 2HQEA 5AE4A 1IXGA 1QVSA 2DVCA 3C33A 3DELB 3VXBA 3TELA 3CG1A 3FDRA 2R5AA 3T9UA 3EHSA 2XXYA 4BLAA 2R9JA 1FTKA 5FHNA 2D9TA 1URSA 4H67A 4OZ9A 4P11A 3E13X 3RT8A 4OEUA 3UK4A 4X1BA 1RYXA 1DTGA 2RO0A 4E7HA 4XTCQ 4ZTFA 4R6YA 2F5XA 4NE4A 3KN7A 4KFQA 4KYEA 1LB8A 5KH6A 3FLGA 3FXQA 4OWDA 2F34A 4I1DA 4ZEFA 2XD2A 1OQGA 3KZGA 4XXUA 4KHZE 3LR1A 4KCDA 2G93A 3T93B 2A5SA 3MJNA 3ZKLA 2DIQA 2DS9A 3SEUA 2FA7A 4TLMB 4PP0A 2DYXA 4NF4A 2XD3A 1B5IA 3MVWA 4R9FA 1UQWA 2PBWA 3SEXA 5IAIA 3KJTA 1Y3QA 3H4ZA 4DXBA 1QUIA 2G29A 1MG1A 3HSTA 2Y7PA 4KYSA 3OYFA 4BDNA 3K1PA 3GOXA 1ZTYA 4GIZA 4ZE8A 4NF8A 5FHOA 4E7IA 3OY9A 3S2VA 3IB2A 4HCYA 2UYEA 4ISUA 5I58A 1MQHA 1WJRA 1SBPA 1MY3A 1B7HA 1FTLA 1MXWA 3MEAA 1M5EA 2RC8A 1OLCA 2F6PA 3WAEA 2O4XB 3K0VA 3FD3A 4G4PA 3IOTA 3S6WA 2F5KA 1NMUA 3DLNA 3L2QA 4C0RA 3C4SA 3OB9A 1VR5A 4BD3A 3PMWA 1NNTA 2Q89A 3TDJA 4F3BA 5F1QA 3MP1A 4QFNA 1A7LA 4IY6A 1N7WA 4KYDA 1B1HA 3G3IA 4AQ4A 3G7WA 4G2ZA 4FL6A 3FV2A 1LAFE 3VLVA 3T9XB 2K3YA 2GH9A 3OYBA 2H9BA 4XKQA 2FYIA 3C34A 2EKOA 4Q5TA 5D6YA 1MHNA 3O29A 4QF9A 3TKDA 1VSOA 4U22A 4PE5B 3OMGA 1FCKA 4OMBA 1DPEA 1RI0A 3H6TA 3QKJA 2OJTA 1PB7A 5F7VA 5KE2A 3TTLA 3MUQA 3OMCA 4NS5A 1S50A 5I59B 5H8QA 2X26A 4OENA 4U4SA 1MXVA 3CFXA 1MPDA 3RT6B 3FATA 2ZYKA 3ILTB 5KDTB 3QAXA 1FTMA 2NOOA 4XKNA 3OSQA 3TFLA 1LSTA 3KSJA 2VD3A 4GFRA 2JZ2A 4EF1A 4RXLA 4QSEA 4LZ8A 4BE2A 4FJPA 2QS4A 1OMPA 4P0IA 2O7IA 4NF6A 1PB9A 2CMOA 3OEMA 3V89B 4OERA 2I58A 3MQ9A 2X7PA 2LAOA 1LBBA 2UVHA 1MQDA 1SI1A 3FVNA 1FQFA 1JQFA 3W9VA 3MPLA 4F19A 2ZXTA 1B5HA 3TPAA 3UIFA 1QKAA 2F7AA 4R2BA 1PBQA 1H3DA 3H8ZA 3BDLA 2Q2CA 3E9GA 2UXAA 3PMVA 1ELJA 4P0GA 1GR2A 1XVYA 3RGYA 5D6WA 3OEKA 2QMXA 5A5XB 2X7QA 1B0HA 2HZLA 2DE4A 1US5A 1FQAA 3AXFA 4OTEA 2R57A 4GL8A 1Q35A 2RHUA 4WEDA 2RI5A 2O6AA 3DP8A 3MW0A 3H3GA 3E3KA 3IJOB 1LCFA 4QQ6A 1I6QA 5KCJA 4FIMA 1MQIA 4NF5A 4LQ5A 3SEYA 1POTA 4QHQA 4IGRA 1A55A 4BE1A 1B3FA 2DQVA 4F2QA 2X4WA 3S3OA 2I3WA 4MFIA 4OEVA 1IXCA 1S9TA 3KN8A 2QQRA 5K2XA 2XXPA 5HBCA 1MY4A 4FAJA 1AOVA 2M0OA 4GL0A 4JBZA 4F22A 1GTKA 1MXZA 1N84A 5DVFA 2V3TA 4TLLB 2FHDA 2YRVA 4IUUA 5C0MA 2ONRA 3SETA 4IUPA 1B46A 4ZE9A 4U21A 3PNWC 3EHUA 4OETA 4Q30B 1XHYA 2JTFA 1D9VA 4QVZA 3FJMA 5KZTA 4TOZA 4WEPA 4DDDA 1NNPA 2BUDA 2I49A 4G68A 3A3CA 4N13A 3MEWA 3N94A 3TZAA 4KPTA 1R1NA 3WAFA 3A09A 2HEUA 3ODBA 2DXYA 2L3RA 3PPOA 1SYIA 4X9TA 2PQWA 2R71A 3EF7A 4EQBA 3KUFA 2RHIA 3S9MC 5I2KB 5ITOA 4A4FA 1MM7A 4R72A 4H8JA 4ZZEA 3OD7A 3VFJA 1B32A 2QJEA 3P8DA 3CFZA 4R6HA 3BFUA 3NTHA 1QW0A 2PT2A 3M8UA 3OYHA 5I2KA 2Z23A 2O68A 2W7YA 2HFBA 3H7MA 3E4RA 1Q1KA 2RJCA 4C5GA 2DE3A 3HN0A 1B4HA 1ANFA 4MLQA 2L8DA 2M1HA 3SEWA 3HV1A 4E0WA 3GXAA 3FVGA 1OZ2A 1AH5A 1JW4A 3UN6A 3TCGA 1LAHE 1UIUA 3CR9A 4Q8RA 5DVIA 2O69A 4YKKA 4BACA 2DVZA 2F78A 4BDYA 3L2RA 5B7DA 4F3GA 2V3QA 5HM4B 3RNNA 4IY5A 3GLBA 2P2AA 2F97A 4RG2A 4BDOA
chains in the Genus database with same CATH superfamily
1YP5A 1K9ZA 1B34B 4DLDA 1VQ8A 3KBRA 1YJNT 3LLRA 4GWOA 5JTYB 5J3BA 3QIMA 4C1UA 1H92A 4OESA 2XU8A 2QVUA 4C8QE 2RQVA 2L0AA 1FPKA 2K5FA 4QVDA 3FIRA 2V4CA 4ND9A 5TP9B 4NF0A 5LDZA 2RHZA 1B58A 4ELQA 1K9AA 2R58A 4RMOA 4XKRA 3PPPA 1WIEA 5I57A 2A0FB 1A8FA 1US4A 4M77G 1HSEA 1LBZA 1QVGS 2F2WA 2DA9A 3KC1A 4N0AA 4DE8A 1KC8U 3EFOB 1C0MA 1VQ7Q 4OVAA 4LD6A 2RF0A 2RNAA 2ZYMA 4CRIA 2AL4A 2ENMA 2YUOA 5IAYA 4I8CA 2NWMA 4LVQA 4OA4A 1VQPA 4OVJA 4HS7A 1DTZA 3K02A 1D09B 2KI7A 3SESA 2QG9B 4FU6A 1S7YA 5GMKl 1YFNA 5CVIA 3EG9A 1XOCA 3A29A 4MZTA 4POWA 1NNKA 4EXKA 5B70A 4PF8A 5L9MA 2DVJA 4N6PA 1VQLA 3UA6A 3KXTA 2ZPFB 2YSQA 5EHMA 3N5LA 2FEIA 3MP8A 2H99A 1IMDA 3UP9A 1PNJA 2BIVA 5CQYA 4IURA 1MH4A 3META 1IEJA 2Z8EA 2CREA 1BI2A 3BIHA 2K79A 1N04A 2BJJX 1S1NA 5I3SA 1MMNA 2MF2A 1YHQT 3O8VA 1D3BB 1FYNA 1MY1A 3HKSA 2VHAA 1WHLA 1M5Q1 4LDYA 3M5AA 5CQXA 1VQ6T 4N17A 2QVRA 5I7IA 5GJVB 1I5OB 3BFMA 4P1EA 1B3HA 4V2SA 4ONYA 4L6V5 2KY9A 1QKBA 4OMPA 3EGXA 5KCHA 5GAN2 3G4ST 3JB9J 5CKBA 1QCOA 3VV0A 3T22A 4M7AD 2GQVA 4PNOA 1M9SA 3JB9F 4PETA 1Q86U 2MMPA 1WJSA 2CP2A 4P3LA 5JEIA 4KUDK 3PVLA 3OW2A 2AIXA 2GQIA 4O3CA 2WKYA 1LBVA 4AFQC 2LVMA 2DAQA 4IGTA 5AYFA 1A99A 1NV2A 1X6OA 2HCAA 3CEYA 1O7TA 3PPRA 1R9LA 2GTOA 3LC8A 2LJ0A 3CMAT 3ECRA 3JCMJ 3M55A 1VQOQ 2CKKA 3DLMA 4U4XA 2IPOB 2HNIA 3PUWE 3TTKA 1VQKA 5M9OA 2A36A 1YJNQ 1K73U 1A54A 2F8DA 3FZVA 4OVSA 3E78A 2YUNA 1NV4A 3VS4A 2VV5A 2RMOA 4C0ZA 1GRIA 2LX7A 2WBBA 3CG3A 5TPAB 3PV0E 1YJ9T 2YLBA 1KZ8A 2DWJA 4PDHA 4DI4B 1RACB 1NV1A 1PEBA 2OX3A 4M75F 2GNCA 4F1YA 5I84A 4F1VA 3OBYA 4I3EA 4EXLA 2FBPA 2XWKA 3QWYA 4HA8A 3RTWB 2XX9A 1RKMA 1FMKA 1WDNA 1OOTA 4RJZA 3TCHA 4F29A 5ICQA 2R6GE 4JWYA 2FVZA 5J26A 5KE3A 4JS4A 3NTKA 4G77A 4IO4A 4F04B 1B52A 4QW2A 3G1JA 2EJGA 1TXFA 3OS0A 5TPAA 1YCSB 2NUPB 3K00A 3CC7A 2EQKA 3S3NA 1M2VB 2KSSA 3VS3A 4M7AE 4PC9A 3PIPA 1FXXA 1B2HA 5ICTA 3CXCP 1GFCA 2D21A 3OYAA 2DP8A 3Q25A 4YAHX 4FORA 4X8RA 1SG5A 4E6RA 2HD0A 2XXTA 1N8RU 4PBHA 2QAZA 4KH1B 4M78D 1PRLC 1USYE 1I0CA 2DFUA 3QDRB 3EKIA 1LFGA 2DXRA 4QXDA 1BK2A 4JLGA 3NFCA 2K9GA 2NUPA 5DLOA 4LDXA 3KOSA 3H6ZA 3U23A 1RABB 3EH1A 1B5JA 2D5WA 3RKXA 3MZ1A 4NEDA 2J7IA 5TU0A 1RL2A 2DBMA 2D8JA 3QXMA 4EDUA 3N5BB 2DX1A 3E79A 4G8NA 2VOZA 2HBPA 4F16A 1KQ1A 4J7FA 4M77B 1YHQQ 1Z7ME 1QUKA 1SYHA 1MUZA 2C0OA 3EG1A 2V26A 3AT1B 4IO2A 1ZMGA 4OF1A 3MAMA 3UA7A 4HE2A 1D3KA 1AZGB 1FBFA 1JVYA 1UIVA 3LWIA 4M7DD 3LSLA 2QI2A 3SWNB 1BK4A 2QGGA 2XI9A 1O75A 3OO7A 5CM6A 4D8DA 2LZ6B 4XTUA 5FWBA 3H0FA 4M75C 3HCQA 4PDDA 5GAOm 2XWVA 2VGQA 1MV0B 3RBBB 3CCJA 1G5VA 3PT9A 3MPKA 2Z0WA 1NNFA 1HXDA 3S9LC 2I4CA 1F9BA 5I56B 1BU1A 2QDLA 3OYIA 1QVGA 2DJZA 1G3TA 4KCCA 5IT9E 4XFEA 4Z7EA 4Y92A 3PGFA 4OFLA 1QULA 1JP4A 4R6KA 2OLBA 2E6NA 1AHJB 4HCCA 3DB3A 2MAMA 3MKDA 1P1NA 3EGUA 1FBHA 2EW3A 4KXPA 5ISUA 4MMPA 3U1OA 1LGBC 3I56A 4R55A 1OVTA 4OVPA 1X69A 3A8HB 1H76A 4M78E 4KGZB 2DM1A 4OP0A 1K9MU 4NMYA 2JXBA 1WQ7A 3FASA 1YJ9Q 1ZKBA 4GWSA 1B51A 3I5RA 2M8CA 2E12A 3CFLA 3DP6A 1IXIA 4HCKA 4PTKA 5I56A 2O4XA 1NPPA 4U2RA 1TXQA 1R8OB 3I3VA 2XX7A 3SKPA 3CMEQ 1AWXA 4C92G 1QP3A 1IZ1A 4ESXA 2A3LA 1QMCA 4NWCA 5CR2A 3QYTA 2WSCE 1FBPA 2QS1A 3EQ1A 1N7XA 4ZGJB 2CZ6B 1IIWA 1XI6A 3IL1B 4NL3A 4N4GA 2GF7A 3C9HA 1W1FA 3CCLA 2I0BA 2XXHA 2KVQG 4C8QA 4M7DE 5CKHA 3V5AA 1HYOA 2DLPA 3OBWA 2COWA 4QSDA 3W9WA 2ZPIB 3VUZA 4PLIA 1JW1A 3OXNA 1TFAA 2RM4A 4GY5A 3CSGA 4BDRA 3CI8A 3QWXX 4YMBA 1M3AA 3CBOA 1B05A 2XHCA 1JNFA 3HL8A 3JCMd 4IIMA 5CMMA 4Y28E 2RK2A 2D0NA 2XXWA 4MNPA 1OYXA 2DTOA 3QK6A 1UTBB 1U06A 2VPNA 4AS5A 1NI9A 2Y7IA 4FYWB 4HW8A 1QCFA 1UJ0A 9ATCB 2HZKA 3FJ7A 1WXUA 1XC1A 3LW5E 3LGLA 3ZS6A 4R73A 5GAOl 1MPCA 2FVUA 3HO7A 3G6EA 1JB0E 2CSQA 2DPPB 4ANJA 3OS1A 3QSUA 2WACA 1DJ7B 2GFUA 2KMTA 1DCUA 3CXCS 1FTOA 4NGUA 1YCJA 4MNCA 2FNCA 2XDPA 4RTYA 4CI0C 2HL3A 1BYMA 5AA1A 3IJXB 4ZDMA 1SSHA 1PRMC 1RADB 1OQHA 2JTMA 3JCMV 5GAMe 1G0HA 3M0QA 1QKXA 2CP7A 5EQ8A 2VWFA 2KBTA 2I6EA 3LUYA 3PUVE 1UECA 2LDMA 5H8NB 4C0DC 2XXXA 4RYAA 2K7AA 1URGA 2P1SA 4GBWA 3LSXA 3OYDA 1XOVA 4KULA 3D4CA 5EYHA 5EHSA 5CBRA 5CRYA 3BW1A 3P7IA 1VQMA 2LRQA 3OYKA 3R7XA 4G8HA 2FB7A 1Q82R 2EGEA 2R5MA 1L5TA 2GTJA 1PSFA 1II5A 1FBCA 5I59A 1ZA1B 2RI2A 1Y4CA 4XTXA 3IR1A 4GLMA 3EAEA 4O8MA 3VKIA 4R2FA 3GP8A 2EGCA 2YT6A 2QA4A 5FU7B 3OW2P 4E47A 4HE0A 3UA8A 3JCMh 4I62A 4MIJA 1G2BA 5ECAA 1AOJA 3CVGA 1VOMA 2V93A 4RK2A 1H3ZA 1NKXA 1NJIC 2XXQA 5DEXB 2HAUA 4Z88A 5KDTA 1AIVA 3F11A 4H46A 1YITT 1AL3A 4KGXB 4XKPA 5FHMA 4HCZA 2LJ3A 4P9KA 3ZSFA 3VRZA 2P3NA 1MXYA 3IO4A 2OX7A 4HE1A 2H4IA 1SW5A 2V8KA 1O9SA 3OS5A 3CCVA 2RA2A 4C5HA 3C94A 3JRZA 2KNBB 3HTRA 3RPLA 1LOJA 2HAXA 1OPKA 3BE3A 1BLFA 3RKWA 1LJOA 5K2YA 5GAN8 1VQ8T 3JCMW 1PB8A 1VFEA 4JSDA 4PFIA 2JVVA 1TG0A 1NJIR 3M0RA 2YLCA 4FT2A 2EWNA 4J9FA 3RESA 2DILA 5GAMh 1FQCA 3MVXA 1H641 3MVYA 4ELRA 2JMCA 5CAIA 2DERA 1U3OA 2Q88A 4G8MA 1NH8A 4ZGEB 2AKLA 3ER0A 1P1UA 4H0WA 1SPKA 3FBPA 3NOHA 5L9SA 3CCRQ 5FTIA 5ELVA 3IB1A 4MMKA 2K6DA 3UF4A 3PD9A 1OX8A 2EGAA 5GAMf 1V29B 2M0YA 4IUVA 2YLNA 3C95A 4NOYA 4DEXA 1QWEA 5GAN7 5CI5A 5I21A 5JK4A 2ZAEA 4HCWA 3I5OA 3VVFA 4EMKB 4JPBW 4B9WA 1YCYA 2RQTA 3PU5A 1PC0A 1OULA 3BDUA 1RI9A 3A1PA 2F5TX 3V8XB 1U1TA 4KGVB 2VUBA 3S4UA 5CKDA 1VQ4A 1P1QA 3ZKKA 1VQPT 2I2LA 5IZZA 3I6VA 3CCQA 3UT1A 1EU8A 2LTOA 1M3CA 2A37A 2EJFA 3K01A 1VQ9A 1M5CA 1ZBXA 2A28A 5M2VA 5KCOA 1BTJA 1E6HA 4J9BA 1QUJA 4PQJA 4QFOA 4JB7A 3V7CA 2HXWA 4H5FA 4QFPA 3A8MB 1VQLT 1FPGA 2DEUA 1NUXA 2VGNA 4KI0E 4ZEBA 4PJOF 3OQ5A 3SZPA 3EHTA 5A5XA 1N3WA 4LA9A 4D6WA 3B50A 2AZSA 4C5EA 1P92A 4ZECA 5GAN3 2FZCB 2DDKA 3G3HA 4B9XA 1I1JA 1RUWA 1X43A 3Q28A 5H8HB 3PIOA 1WLPB 2I0NA 2RPNA 1JBMA 1MH3A 2O84X 4P8BA 3T1BA 4B6MA 2O1MA 3JB9G 1M2OA 3BBRA 5CC2A 5C6SA 5IXFA 2XD0A 1B3LA 2YJPA 1EH3A 1EFNA 4QSCA 4ZEIA 1UEBA 5FWCA 1NM7A 4IO6A 2EQUA 2X4YA 3OENA 1WPYA 3N6UA 1M1GA 5AA2B 1LPLA 1W6XA 1YITQ 2QS2A 3L2WA 2LCSA 4NN3A 1QVGP 2CP0A 2ZNUA 2HEQA 4C92F 1WODA 3C35A 4JZ3A 1OVBA 2XWIA 1U1SA 2DWHA 1DOTA 1VQ5A 2UVJA 1MMAA 1FW0A 4JJBA 4PFUA 2QEXQ 3K6XA 4E0XA 5LJ3g 4OFJA 3H6WA 4M77D 2MYSA 4M78A 3O2AA 2OBGA 3OYCA 4E7ZA 5CIUA 1VQKT 3T9NA 2Y7KA 3HRUA 3CCSA 3M9QA 3CXCA 1POY1 2EQMA 4M75G 1ARKA 3OO6A 5CKEA 3TQLA 1RLQC 1SW2A 4L59A 3MEVA 1ZLMA 3O6IA 1BKBA 4THIA 1Q7YU 1M5BA 1YJWA 1R77A 3CRBA 2RH2A 3QYHB 4E7JA 2Z8FA 4M4GA 1WFWA 4I40A 2KR3A 2JM9A 4JUVA 2XXKA 4JRQA 1P1OA 2OTJQ 2CZKA 2ESNA 1PWTA 4PJOC 5EQ7A 2VYTA 2ROLA 1WHHA 1TWYA 1Y3PA 4QRZA 3QUFA 3NTIA 1EZPA 4M7DA 2RHXA 1B3GA 2LNVA 4GLIA 2MWPA 4ZGDB 3O66A 4F3PA 4YICA 1D9YA 3LSWA 1JXMA 2X4XA 5AA3A 4GXSB 3CC7T 1ZU0A 4O3BA 4PFOA 3EG2A 4XQ3A 1UUEA 2CZ7B 1B7TA 5GAMj 2K3BA 3W15C 4MZMA 4ZEKA 3TODA 3LH5A 2YUPA 4F7UF 2B4MA 4A4EA 4IKFA 1MGQA 3OMBA 1IRXA 2RD1A 1P99A 2THIA 2GHBA 2ANJA 2RI3A 4HKEA 3VE1B 5L8DA 4F18A 6AT1B 4YKIA 3CC4A 3TAJA 1UE9A 4M77E 3R6UA 4R0KA 3VS1A 4BUGA 3B8BA 4FEBA 3KSXA 1M8MA 5ESYA 1OX9A 1B0LA 2E6ZA 3VV5A 2PT1A 2ZYOA 4RKUE 2RJDA 1S72Q 4F39A 1N3XA 4AT1B 3PFSA 2F35A 2H98A 1ZSZC 1EZZB 4PE3A 1R6ZA 2V1QA 2FRWA 2GCXA 3MPUB 1OU8A 2L5VA 3VVEA 1IGUA 1HSJA 4QBAA 2DTIA 1M8VA 3TTRA 4Q0CA 4H45A 2JTEA 2JJKA 1N27A 3CCJT 1KC8C 2O88A 4LN5A 2QS3A 4ZEDA 2EAYA 3TTNA 2Q8JA 4PFTA 1LFIA 2YRDA 4RCCA 4I9DA 1NEGA 2V84A 3CC2T 3O5ZA 1WGSA 4Q5WA 1M1FA 2MKZA 1WYXA 3FGSA 3R6NA 1G3WA 2LQKA 2DK3A 4OB1B 3MZ9A 4OHNA 1OQKA 3QPHA 2FHYA 4DBFA 1TSFA 1VQKQ 2CP6A 2IIMA 1FQEA 2X9HA 4AG2C 4LZ5A 3I56T 1V1CA 3X25B 2AHJB 1BI3A 2Y84A 3THIA 3IFAA 1BIAA 4N8GA 4J6WA 1KC8R 1ZJLA 4J9GA 2L2PA 4Y91A 1I6BA 4ZTJA 2QMWA 2BTTA 3Q26A 3JCMg 4AFUC 1B34A 1VFDA 3M0UA 4D8KA 1ZUKA 1Y9UA 3GF5A 3IOWA 3R6OA 3VVDA 5JTYA 1PD1A 2DL4A 3INZA 1MQJA 2QASA 3MBPA 3ZL7C 1BCMA 3VXCA 4DCXA 3HPIA 2K5LA 4JRKA 1JETA 3Q29A 4N4UA 4YB7A 2BZ8A 4N4IA 1PM3A 4MNIA 5TP9A 4C1TA 3EG3A 4GLKA 4XAXB 1MMGA 1RAEB 5ET8A 2KRMA 2XA5A 3M58A 1B9JA 3CCLT 3H06B 4I3YA 3ZEHA 3P8HA 1NLOC 3CC7Q 4G68C 2AIRB 1UTIA 2FL7A 4X04A 2PVOB 4A54A 4BDZA 4BE0A 3M3KA 3OYEA 1Q86C 4RTWA 3R26A 4JXIA 2XIDA 1JEVA 4XF5A 4YKJA 3JYRA 3EFOA 4GWYA 3M0PA 1BIBA 2PTKA 1P1WA 1QP2A 2XG8D 2E5KA 4N4HA 1EYJA 2Y5LA 3BKIB 1MV3A 4M75B 3EN3A 4H8IA 1B4ZA 1SD3A 1AWOA 4NWDA 1F1BB 4KR5A 3G3JA 3U8QA 3FC3A 1SSFA 1MDP1 3VS7A 3L42A 4NTLA 1XT8A 2B4LA 1FRPA 1MXUA 3VS6A 3G6ET 3KFVA 1K73C 2IA4A 4GBQA 1Q86R 4GWUA 5FRMA 2OWTA 4PBQA 4UA8A 2JT4A 4HT9A 2EYQA 3PUZE 4OVQA 2I0CA 1VIFA 3L2UA 4U23A 3ME9A 1T0HA 1LAXA 2RN8A 2JOYA 1LLSA 2NUVA 2H8HA 3RN8A 3HRSA 3O97A 4FCYA 3T9VA 2FYKA 3S9EA 2LT1A 1RAGB 1I69A 1NUYA 4VUBA 2DVEA 2E64A 2EYXA 3CPWS 2VC8A 1RAAB 3E1SA 4IB2A 4LE9A 1D3BA 1RDZA 1GV8A 2IVWA 1K73R 1KQ2A 4FIBA 5AA4B 1C6VX 4ZZAA 1FPLA 3HSBA 5EG2A 3ZBDA 1LAGE 3GZGA 2D3IA 2J05A 4PJMA 3UORA 4BI8B 1EYIA 1H45A 2KRNA 3UDCA 1Y0MA 3CC2Q 5GANe 1VQMT 2RK1A 4M4ZA 1UGRB 3PMTA 2DL3A 4J9CA 4OB2B 4A63B 2Z22A 3KFMA 2L89A 3BFTA 4U1ZA 4WKMA 5DVJA 1R9QA 3B6WA 3CCUA 3MZBA 1IREB 2UVIA 4GQOA 1N8RC 3I56Q 1BIYA 3A8GB 1ATGA 2QXFA 4N91A 3X20B 1NFTA 2Z8DA 4LP2B 3B7DA 4FW1A 2PVUA 4ELYC 2QA4T 4H5GA 3U93A 3F70A 2E3IA 2OZZA 2OCUA 4K11A 1D0YA 2Y4YA 4PFBA 2DXCA 3WVDB 4NHBA 4JS5A 1PKSA 3HHGA 3LBSA 5DYHA 3TCFA 2X4JA 2JS0A 4J6YA 3JB9I 3CBPA 2L3QA 3OYGA 5KYWB 1KSWA 4GX3A 5FROA 1FPEA 4E7KA 2NVUB 2D6FA 4JDSA 3CCVT 1UGPB 2F1LA 3DLLA 1N8RR 1DPPA 1MY2A 4PLLA 2V25A 2YDLA 4FSXA 3TEPA 3SDZA 4DXUA 3QIIA 3CCLQ 1D4NA 1OI1A 2LP5A 2R8TA 5EQ9A 3T0JA 1IMAA 2KEAA 3L2VA 5EC7A 1B6HA 2WYKA 3IAZA 2WBDA 3K6UA 1JRIA 1VQ7A 1N0TA 4MDXA 4JWXA 3CCMA 1XTDA 4N0AC 3HFUA 1WQWA 2AYSA 3HHFA 4EQ9A 4NF4B 2HMAA 5AA2D 1J3TA 3FXRA 2PU9B 3OYMA 4J83A 4MH5A 1M2VA 3T9HB 2CP5A 2RJFA 1FPJA 4C0DB 2OWZA 1MXXA 4X9DA 4RY1A 4DCYA 1NV0A 1QQJA 4E7LA 1KQSS 1X01A 5GAN6 2A5TB 3CD6A 3G6EQ 5IHKA 3LX7A 1D1CA 1VQ6Q 2HZYA 2FPFA 4NF8B 1EYKA 4IUTA 3MCAB 3C32A 2HKNA 2QTXA 3SEMA 2DTHA 2I4BA 1K9MC 1HSLA 2HHMA 4QQDA 5DY9A 5CK9A 1EX4A 3G4SQ 2ZZVA 4KD5A 2AKKA 5GANf 1RAFB 4JDFA 3K4UA 3OSRA 2CZHA 3J7AF 1OIBA 5I58B 5GAN4 3CCQT 2MWOA 4UC4A 4PJOG 1VQ9T 1YYZA 4J9IA 5I2SA 2ABHA 2A5TA 2J6FA 3L6HA 2QL3A 4M77A 2ZPGB 3IQLA 1AWJA 1JU5C 3IORA 3LUZA 4MHFA 3U72A 1LFHA 2Y7RA 3C36A 4N07A 1J1NA 2WSEE 2XWOA 2BZYA 3GYYA 3MSTA 1K9MR 3CMAQ 2JJ9A 3SWNA 4AMCA 1IUDA 2Q74A 1ZLQA 2OI3A 4BDMA 1AD5A 2OAWA 1VQNA 3H0IA 3OO8A 3OYLA 2PFYA 4R75A 4EPCA 3M0TA 4OVRA 1SW1A 1B3EA 1K8AC 1XS5A 2LNHB 2ONKE 1YTVA 1LCKA 2FZKB 4PAKA 4TQUQ 3MEUA 4R9GA 5FTHA 3DP4A 3FV1A 2FZGB 1ZUUA 1K0XA 1YXIA 1YWPA 2HAVA 2PVGB 3C31A 1Y20A 1T0JA 1XJWB 2QA4Q 5LJ5e 1DMBA 1EZ9A 3HHTB 3RERA 3FJGA 2RHYA 4ESWA 5A0DA 4YMAA 2DWIA 4GXAA 3H03A 2RF1A 4PFYA 1X27A 3GBQA 1LBWA 3M4YA 3QJ6A 1MRPA 1K8AR 3FVKA 5ITPA 2W10A 2BKDN 1VDWA 4NX1A 2E4HA 3FJ5A 3FB9A 3X28B 1VQ5T 2DSFA 4FT4A 3D1RA 3CCVQ 1GGGA 2SEMA 4XU0A 4GWZA 3OO9A 3RLFE 4LDWA 1IITA 3TQWA 2EVRA 4AB5A 1KHCA 2JUFA 2ABLA 2UYFA 1FQDA 4PFPA 1KD1U 4F17A 3VYGA 2O51A 4Z0IA 1EZOA 2BZXA 3O9PA 3CCST 4YB6A 3IB0A 4OMOA 3PMXA 1TUDA 1PDAA 4BI4A 1IMEA 2Q9TA 3MP6A 2AL5A 1N6AA 3EPEA 1YIJA 1B7ZA 1ZA2B 4OFOA 3CPWA 5CBSA 4MMLA 4PKCC 2EYWA 2ATCB 4II1A 2QK0A 1QCNA 4O7MA 2LMJA 3K1MA 1UGSB 4FECA 2HQXA 1MY0A 1D9QA 1ZBMA 2I3VA 3SEVA 1YAEA 4PFWA 3QZ5B 2MCNA 1X75C 4IUQA 4J9EA 1TFDA 3TQ7P 3FUZA 1MQGA 1I6AA 1MDQA 3WXMB 1UTBA 3A3UA 5L9OA 2K57A 4F7UG 5GAMd 4WF2A 3G3FA 2PNIA 2ECZA 2CP3A 3TCJA 2P0SA 4IO5A 2COZA 3HPWA 4FATA 5H8QB 2O1LA 1YHQA 2KQWA 3U92A 1E7OA 2E0SA 3CCQQ 4GVOA 5HY6A 4OYVA 2FPEA 2D0QB 3QBYA 3JB9D 1VYUA 3LGFA 4C8QF 2KR0A 3LYIA 1O64A 3HFOA 2B3BA 7AT1B 2VP1A 4NAPA 4F31B 5LJ5f 3CC4T 3JCMP 4LDVA 4F3SA 3IFCA 2P0KA 2KYBA 2YHTA 2XXIA 3TYHA 3IOUA 2OWSA 1NV6A 2QGFB 2KLFA 2VASA 3U94A 2XXRA 3QUIA 3OYJA 1A8EA 4XIGQ 4JVDA 5H8NA 4OXVA 2DXTA 4XTZA 1INPA 5KYYB 4F14A 3VLUA 4RTXA 1FTAA 3L2ZA 1AMFA 3RTFB 5IN1A 3QMFA 3B6QA 3M54A 2VXFA 4ZN3A 3CQTA 1TUGB 2DD5A 1M1KU 4H6DA 2DL7A 2IG0A 1Q95G 2LCCA 1CE2A 2NXOA 4OGEA 4PAIA 3MWBA 1OV3A 4CC4B 1A0NB 1GCQA 1NUZA 2CZLA 1USYH 2M9UA 2B8AA 1ZIUA 4NF6B 4PCDA 4M75D 4LATA 2CSIA 2ZNSA 1B7UA 3MVZA 5I2MA 3H6VA 1Q82U 5IH2A 2E5QA 2CEYA 1AWBA 4PJOB 8ATCB 2QYZA 1XVXA 3CMEA 2NUTB 1KQSA 5HCKA 1JW5A 3WVEB 2K3XA 4KQPA 2RC7A 3FXBA 5DEXA 4R74A 4RPOA 4MEVA 5GMKi 1M30A 2ED1A 2XX8A 3RPWA 1IMCA 3CCSQ 2WX9A 1Z7NE 3OS2A 3KJ7A 4RNSA 1XNIA 1M27C 4X34A 1G0IA 1Y3NA 2F6GA 4O3AA 3E19A 3JV9A 1T0KA 1LBCA 3TVTA 2V8JA 4GOTA 2O9SA 4YKPA 4C8QC 5CMBA 3MO8A 1Y96B 5BWJA 3HFNA 1JVXA 4O5VA 2DE2A 3RQTA 1Y1ZA 3ASKA 1PCXA 3FVOA 2JMAA 4NL2A 3TREA 4C92B 4OVTA 3KN3A 3G71A 2ZPHB 2B3FA 4H1XA 2Y90A 1TT1A 2CEXA 4LQ2A 1IXHA 4MDWA 1NJIU 2F3DA 3O6HA 1SQYA 1FTJA 2HXRA 3PE0A 2MIOA 2RJEA 1NL5A 1HK9A 3D4GA 4UACA 4EDPA 1MM6A 5IHIA 4YU0A 3P8BB 1Z9ZA 3ILUB 3I55A 1SHFA 1DSNA 1I5LA 3GBBA 5IZ3B 1ZSZB 4M75E 2G3RA 1NYGA 1OLAA 4EMKA 4K3FA 5FU6C 4C92A 1O63A 3JCMc 4BY6C 4IO3A 1H3HA 3IOVA 3MHXA 3S9NC 3A98A 3RDVA 5KCJB 1CB6A 4MX6A 1FMVA 1E6GA 3CC4Q 1G83A 2EJ9A 4NF5B 3G3KA 2P4TA 1NH7A 3K6WA 2HQ0A 5IGAA 3LH0A 1M90U 3EG0A 1FBDA 2RCBA 1IXDA 1K4US 4LONB 5FBPA 1G8XA 2HQHA 4RA1A 4XU3A 1WVJA 3PPQA 1BB9A 5GAOq 1TH7A 1VA7A 4MBPA 4POXA 2WYPA 1LCTA 4HTGA 2GQ1A 4ELPA 1WI7A 5F24A 1Q7YC 1GVCA 1W4SA 2BJIA 4RTUA 1W2BS 4WXJA 4DI3D 1LBXA 3DB4A 2D1XA 4AB6A 1JEUA 2EQIA 4M7AF 2L3PA 2EQJA 1N76A 2ZZDA 4F7UB 5H8HA 4BDLA 1UGVA 3GPLA 4PFRA 4DXCA 2KE9A 2XMFA 3OSSC 1FWZA 1SEMA 1K76A 4A53A 2BE7D 3FEOA 4ZNXA 2F7BA 3Q27A 3UWNA 1Q7YR 3QZ9B 1BKAA 4PAFA 5DTBA 1VQ8Q 3VRYA 3M3FA 5H8SA 3UGWA 5AA2A 1CSKA 4MF3A 3GNFB 3SD4A 3CBMA 1X2QA 4FYYB 3RR6A 3N26A 4RPNA 3VDFA 1VYVA 1URDA 1PG5B 2ESWA 3CCUT 1GL5A 3N6TA 4G68B 3G3GA 2K2MA 2NUZA 2QDYB 4MJOA 5FW9A 1PC3A 2J6OA 3IX1A 4XTYA 3PUYE 3VLWA 3KG2A 2B65A 5HK0A 5DM7R 4F1UA 2EKHA 4X1DA 3TEEA 3T66A 3PVQA 8AT1B 2GRVA 3VS2A 4OQOA 2HSPA 1PBPA 3CCEA 2H25A 4FE8A 4N81A 1WDXA 2FIEA 1CKBA 3V8LA 4N15A 2VXEA 1UJYA 2O7UA 2PCRA 3CCRA 3H6UA 1OZ3A 4QFLA 3OYNA 2V3UA 4A4GA 4JJCA 1RYOA 4P56A 1SI0A 3C0CA 2M16A 4J7IA 1WXBA 2OJ2A 5ET6A 4PJJA 4DBQA 5DW8A 4FEDA 1VQPQ 4QKUA 2XHDA 4KBMB 3I35A 2DF6A 4GF8A 2XXVA 1JJ2S 3FXUA 3NMZC 4JRPA 2DIGA 1VQ7T 3T96B 3A5ZB 2FO0A 1ABQA 1IGQA 1IZ6A 5D6XA 3CCMT 1Q81U 5EQAA 3CPWP 5GMKe 2Y7WA 4M7AC 2CT3A 4BDQA 4FSSA 1VQLQ 2EPDA 4ME7A 4LN2A 3TSZA 2MI6A 4JSOA 2PX1A 5L23A 1TTHB 4M78F 3VS0A 4ECFA 4LZ7A 1D1AA 2BE9B 5KYUB 4PGPA 3OA6A 5IHNA 1IQ7A 3IO6A 1SVXB 2QRYA 1WHJA 2CS7A 4JLIA 3CSBA 4DIGA 4EIKA 1FQBA 1Y1MA 3ONMA 2ZZWA 3O6GA 2DRKA 1FPFA 5BUUA 4LUBA 2V8IA 4ELOA 1HJDA 3CD6T 1M5DA 4X48A 2AT1B 1TS9A 3PGGA 3M59A 1X2KA 4MAGA 3QYGB 2FG0A 5CKFA 2F3BA 5GAOp 2A7YA 4LUDA 1WXTA 1WHMA 5CCAA 1B1XA 1VYTA 2PMSA 4M7DF 2XICA 4JZ4A 4JVIA 4DZ1A 4IO7A 2P0QA 2QQSA 3QUJA 1HSQA 1JEGA 2YPNA 1FBGA 3BIGA 1U5SA 4F2OA 2ONSA 2NWJA 4EF2A 3PTYA 4GD5A 1H8KA 4A4HA 1UTHB 3PD8A 3O28A 2E41A 2ALUA 5FRNA 5AT1B 1IHVA 4Z8AA 3GIBA 3PUXE 4YZZA 2Y5KA 1KJWA 2REGA 2ZNTA 4HVVA 1RDXA 3USDA 2QPQA 1IMFA 2E3HA 1VQNT 2DWAA 5DLQE 1OEBA 2JW4A 1U8RA 5DT6A 1C1AA 2ED0A 2ZYNA 2HCKA 4C0GA 3K6VA 4YB5A 4EQ7A 2DXUA 4O6JA 2QEXA 4CC3A 4E7SA 3CCUQ 2OK2A 2RINA 3TUSA 1UTHA 3MC2A 2E1SA 5I57B 1AWWA 1QLYA 1WHGA 1NPRA 5IKBA 5GMKh 2EFIA 4JWOA 3CPFA 5KYXB 2F36A 2RKMA 3IK6B 2VKNA 2YRCA 3E9XA 1SRMA 1I8FA 3QDFA 4M78C 1YPNA 2IEEA 5EYFA 4DA4A 2LQNA 1WJQA 1AEYA 1DBZA 4RK9A 4M1VA 4WTOB 3S3MA 1KQSP 1SW4A 4H65A 5J39A 3PMIA 2EIFA 2REJA 3V83A 4Z02A 1MPBA 2OTJA 3TMGA 2GFEA 1GFDA 2DBKA 2O2OA 2GGRA 1MS7A 3B6TA 3L6GA 5H8FB 5LL6S 2RC9A 4QQGA 2I48A 4RTZA 1QJMA 3THKA 1KIKA 5CMCA 3EG9B 3GBAA 5KYXA 5CMKA 3M3LA 3Q1JA 2G6FX 5J1DA 3K1NA 3KC0A 4L17A 4EUOA 1NYFA 1EIFA 2NLUA 2ZMBA 2LQWA 5GAMg 2DOJA 4ELZC 1D0ZA 2QSXA 2HKQB 1ZSGA 3CCMQ 1W2BA 4M7DC 3EGDB 2XXUA 4IR8A 2LJ1A 1NUWA 1KWHA 1V76A 5I2NB 2VPOA 1CNQA 3TSWA 3OOAA 4GX6A 1SDXA 3RUMA 4U1OA 2QQ9A 1YIJT 4KT0E 1YI2A 5H8FA 2L5QA 1H44A 4MLVA 1VE4A 2F7CA 2PUKB 2Q2AA 1FPBA 3K2DA 4XEQA 3CIJA 4GWWA 4PJOD 4MZPA 4QFKA 4OMNA 3UATA 4OMMA 2ZPBB 3E9FA 5LOMA 2FPDA 3EGXB 3CD6Q 3QSLA 3TTMA 4ZS9A 3LSFB 2RCAA 3KOTA 2D8HA 3EGDA 4LXCA 2LQ8A 2P84A 3SDFA 2X35A 2XK0A 5I2NA 3JZJA 1LBYA 4M75A 2UVGA 3M53A 3J80E 1H43A 4AS4A 2H3JA 2DL5A 4DBRA 3KEIA 2GHAA 2GFAA 1LB9A 3PPNA 1M5FA 4C8QG 3GLXA 4A4KA 5FLXE 2V1RA 3SERA 2VD2A 4DBHA 1S72A 2H5YA 2C0IA 3E2UA 2AZVA 4YTLA 3C4MA 5HPQA 3OELA 3CCJQ 1B40A 3QG1A 3DM0A 4ORZA 3RY3A 4FYXB 3VYHB 1Y4TA 2PYYA 5GANd 1A40A 1GXIE 4C92D 4OB0B 1BP5A 4HXJA 4PL6A 4N8YA 1Y57A 1VQNQ 5ET5A 2B86A 2OTLA 1KA1A 4C5IA 1WHKA 4GRKA 3KGCA 1Y71A 5AA4A 2HQEA 2VB6A 2HL5C 5AE4A 1JJ2A 1Q9DA 1IXGA 2DKGA 1GCPA 1QVSA 2DVCA 3C33A 3DELB 4P1LA 3VXBA 3TELA 3CG1A 3REBB 1PSEA 2CZ0B 3FDRA 2R5AA 3T9UA 1BBZA 2J06A 4LNPA 3EHSA 4PJOE 1FPIA 2XXYA 4BLAA 3VJPA 1K0SA 1QVFS 2R9JA 1FTKA 3RKYA 5FHNA 1FPDA 2DE0X 2CH4W 4N6DA 2D9TA 1R0BG 1URSA 4H67A 4OZ9A 4P11A 3E13X 3CMET 3RT8A 4OEUA 2ZZXA 1YNZA 5A0GA 3UK4A 1SKUB 4X1BA 1RYXA 1DTGA 2EBPA 3JCMX 2RO0A 4E7HA 1X6BA 4XTCQ 4OMLA 2DD4A 1SRLA 4ZTFA 4PGNA 2F5XA 4R6YA 3KBZA 4NE4A 5LJ3d 3KN7A 5LJ3e 2HDAA 3V8KA 4HXVA 4KFQA 2CDTA 1LB8A 4KYEA 1JO8A 4ATOA 5KH6A 3FLGA 3RYDA 1Y07A 5CO7A 5KYWA 3FXQA 5GMKj 3TU4K 2DRMA 2E10A 2PUOB 4O7IA 4OWDA 2F34A 4I1DA 4ZEFA 4JVCA 1B3QA 4LDUA 1OQGA 2XD2A 3KZGA 4XXUA 1AVZC 2YXYA 4KHZE 1YIJQ 2VVKA 4C92E 3LR1A 4KCDA 2G93A 3T93B 2A5SA 3MJNA 2DXBA 5GANh 2PVDB 3ZKLA 1FX7A 2DIQA 1K9YA 1D1BA 2DS9A 3SEUA 4AG1C 2FA7A 4TLMB 2JS2A 4PP0A 3G71T 2DYXA 3RIRA 3V7SA 2XD3A 4NF4A 1UFFA 4OMQA 1B5IA 3MVWA 2C0TA 4R9FA 1UQWA 2PBWA 3SEXA 1VQ4T 1VUBA 3KJTA 5IAIA 2P4RA 1Y3QA 3H4ZA 3ROJA 2CUBA 4DXBA 1QUIA 2G29A 1MG1A 1PD0A 1X6GA 4XK8E 1SPIA 3HSTA 2Y7PA 4KYSA 3JSCA 3OYFA 2QQBA 1KA0A 4OGCA 1VIEA 3I55T 3SB2A 4BDNA 3K1PA 2EYYA 4WCIA 3GOXA 4ZN1A 1ZTYA 4GIZA 2DL8A 4ZE8A 4NF8A 5FHOA 4HT8A 1ZQ1A 4P5NA 4E7IA 2F2XA 4J9HA 3OY9A 2ZGWA 3S2VA 4LD9K 2DZ9A 2KT1A 4PFZA 3IB2A 4HCYA 2UYEA 5T3JA 1NG2A 4DEYA 1QW1A 3OYYA 1VQMQ 4ISUA 5I22A 5I58A 1MQHA 1WJRA 1SBPA 1MY3A 3NHNA 1B7HA 3BY7A 1KD1C 1FTLA 1GBQA 2K4YA 2DMOA 1MXWA 3MEAA 1YZ0A 1M5EA 2RC8A 2AK5A 1VQOA 1OLCA 2F6PA 3WAEA 2O4XB 3GNGA 5LJ3h 3K0VA 3CC2A 4M7AG 3FD3A 4G4PA 3IOTA 3S6WA 1YJNA 5LJ5d 4F7UE 2F5KA 2YUQA 4DOWA 1NMUA 5IM2A 3DLNA 1YN8A 2HSEB 3M4GA 3L2QA 4C0RA 3AHUA 3C4SA 3OB9A 5LJ3f 2RQRA 2RB6A 1VR5A 4BD3A 1CKAA 3ZFJA 1PHTA 1IO6A 3PMWA 1B07A 1KD1R 1I81A 3J81E 4C8QB 1QGXA 1NNTA 2F69A 5GAOn 2Q89A 1JQQA 1Y7XA 2MPXC 1FJ9A 3TDJA 4F3BA 2CYZB 5F1QA 3MP1A 4QFNA 1NZ9A 5GAOr 3RUXA 2CZIA 1A7LA 1Z9QA 3ULRB 4M77F 4IY6A 4MCOA 4G61A 1N7WA 4KYDA 1B1HA 4GBVA 3G3IA 1FJ6A 3EFSA 4AQ4A 1SHGA 1WA7A 3G7WA 4G2ZA 1PKTA 1YJWT 5HK3A 2K5IA 2LX9A 4FL6A 4CC2A 1M3BA 3L1AA 2OAUA 3FV2A 1K8AU 3U65A 1LAFE 5FU6B 1NEBA 3CCET 1IHWA 3VLVA 4CC7A 4BY6B 4R56A 1RAHB 3T9XB 2K3YA 1ABOA 2DYIA 2GH9A 4GWXA 3LWHA 1WX6A 3JCMe 3RMSA 3OYBA 3CCRT 2H9BA 4IIOA 4XKQA 2DEQA 2FYIA 3C34A 2EKOA 2DYBA 4Q5TA 2X3WD 3G71Q 2HPGA 5D6YA 4EMGA 4KUIA 3V8JA 1BI0A 3PTAA 3ISPA 1MHNA 2KAFA 1VQ4Q 3O29A 4QF9A 2X3XD 3TKDA 1M1KC 1W2BP 2P3VA 5LJ5h 1VQ6A 1VSOA 1TUCA 3MJXA 4PJLA 4XTWA 4JJNK 4PE5B 4U22A 2DZCA 2HBWA 3M57A 1VQ9Q 4M78G 3LV0A 1I07A 3I55Q 4AFZC 3OMGA 3G4SA 1FCKA 4OMBA 1DPEA 1LEVA 1RI0A 3QHSA 4NQ8A 1Q82C 1LVKA 4C0FA 3H6TA 5GAN5 4RTTA 3MYUA 3QKJA 2OJTA 1PB7A 5F7VA 5GANj 5KE2A 5J16A 1QVFA 3TTLA 3MUQA 3I9QA 3OMCA 4NS5A 3OSVA 1S50A 5I59B 1QKWA 5H8QA 2QQAA 1M1KR 2J6KA 2X26A 4OENA 3RMQA 3JAME 2FRYA 2XDBA 4U4SA 1QVPA 1MXVA 3CFXA 1MPDA 3RT6B 3CMAA 4M77C 3FATA 4M7DG 2ZYKA 1WNLA 1ZHIA 2A08A 3ILTB 5KDTB 3QAXA 3M0SA 1FTMA 1D0XA 2NOOA 1TWBA 2NYSA 1YBYA 4BB7A 4XKNA 4LUEA 3SWNC 3REAB 1OU9A 3OSQA 3TFLA 2O31A 1UHFA 1LSTA 1YJ9A 4FBPA 2MK5A 3KSJA 2VD3A 5D7UA 4GFRA 1BCOA 4PF6A 1GBRA 1G3SA 2JZ2A 3RPLB 4EF1A 5KYYA 3JV3A 1VQ5Q 4QSEA 4RXLA 4LZ8A 1KK7A 1MMDA 1N5ZA 1IB8A 4QVCA 1FBEA 4BE2A 4FJPA 2QS4A 1RAIB 1OMPA 1N9RA 4P0IA 2O7IA 2Q8MA 2KT8A 2KYMA 1R0CB 4NF6A 3JCMf 1PB9A 4N6KA 1K1ZA 2QTVA 1JJ2P 2CMOA 3OEMA 4X9CA 5LJ3j 1SF9A 2QEXT 5LTCA 3RNJA 5L8RE 4PJOA 4OANA 3V89B 4OB3B 4OERA 1YJWQ 2I58A 2NUTA 3UPUA 3CHGA 3MQ9A 2LT4A 4OMFB 4Z89A 2E65A 2LAOA 2X7PA 2L3SA 1LNXA 1NLPC 1AT1B 4M7AB 1LBBA 4RUGA 3A8OB 2UVHA 1M90C 1MQDA 1SI1A 3CCEQ 4P47A 3FVNA 1FQFA 1JQFA 3W9VA 2DNUA 4FW2A 4J6XA 3MPLA 2K2VA 4F19A 3VS5A 2ZXTA 3KBGA 1B5HA 3TPAA 3UIFA 1QKAA 2F7AA 1FSAA 4R2BA 2MOXA 4PK4A 2OTJT 1PBQA 1H3DA 4ESRA 1MNDA 3H8ZA 3BDLA 3C12A 2Q2CA 2SRCA 3E9GA 1XQHA 3H0HA 5IXBA 1Y96A 4XTVA 2UXAA 4M7AA 1KG1A 1ELJA 3PMVA 1GR2A 1XVYA 4P0GA 1TU0B 3RGYA 2COYA 5D6WA 4J5YA 1M90R 3OEKA 2QMXA 5A5XB 2LCLA 4TVRA 4EMHA 4XU1A 4X1VA 2P0PA 2X7QA 1B0HA 2HZLA 2DE4A 1US5A 1HD3A 2CH4A 1FQAA 4J9DA 3AXFA 4OTEA 1YI2T 5KYNA 2O01E 2C06A 2R57A 4GL8A 5GANg 1Q35A 4HVWA 5IZ3A 2RHUA 1ZSZA 1NE8A 4WEDA 2RI5A 4DOVA 2O6AA 1OPLA 1M4ZA 3EFRA 3DP8A 3MW0A 5HKCA 2E1HA 2CUDA 2PFZA 3E3KA 3H3GA 3IJOB 1LCFA 2Y4XA 4QQ6A 1I6QA 5KCJA 2X51A 4FIMA 4HVUA 5LJ5j 1KHIA 4UABA 2XDDA 3EHRA 2JN0A 1MQIA 4NF5A 4LQ5A 3NPFA 3SEYA 1POTA 1T3SA 4QHQA 2F2VA 1UG1A 4IGRA 2M51A 1S72T 1A55A 4BE1A 1B3FA 2DQVA 4F2QA 2X4WA 4JRIA 1UB4A 1I4K1 4O94A 2KGTA 3S3OA 2I3WA 2DO3A 4MFIA 4OEVA 4M78B 1IXCA 5IZ1A 1S9TA 5A0LA 3KN8A 1FMWA 1NV7A 1N9SA 4NG7A 2QQRA 5K2XA 2DJQA 4QT7A 2XXPA 1ZBJA 5HBCA 4L5GA 5A5LA 4FM4B 4HCBA 1DK4A 1MY4A 4FAJA 1AOVA 2M0OA 1GCQC 4F7UA 4GL0A 4JBZA 4F22A 2KXCA 1GTKA 2OTLT 5ET7A 1MXZA 4GX4A 4KH0B 4DQ2A 2EYZA 1Q81C 1N84A 2VGMA 1W70A 2FIXA 4BI3A 1NV3A 5DVFA 2V3TA 5EYGA 1G3YA 4TLLB 2FHDA 2YRVA 3EH2A 5I5PA 4IUUA 5C0MA 2ONRA 3SETA 4IUPA 1B46A 5FU7C 3FIFA 4ZE9A 4U21A 1UGQB 2M02A 4M7DB 3PNWC 3EHUA 4OETA 4Q30B 1BI1A 1XHYA 3EHQA 2JTFA 1D9VA 4QVZA 3FJMA 3URGA 3OW2S 5KZTA 4TOZA 4WEPA 3D7SB 3FRNA 5A2QE 3A8LB 4DDDA 1NNPA 4XU2A 2BUDA 2I49A 3QXEB 4G68A 3A3CA 4N13A 3MEWA 3N94A 3I5SA 3QO3A 3X26B 1UDLA 1Q81R 4KPTA 3TZAA 3JCMb 1R1NA 2KXDA 2RQUA 3WAFA 1MNEA 2CT4A 3A09A 3X24B 2HEUA 3ODBA 3DKMA 2DXYA 2L3RA 3PPOA 1SYIA 2GBQA 2KROA 4FYVB 4RG8A 3NGPA 4X9TA 2PQWA 2R71A 3EF7A 4EQBA 3KUFA 3V7RA 3VU3C 2RHIA 4E2FB 1RLPC 2WEFA 3S9MC 1TOVA 5I2KB 5ITOA 1YWOA 4A4FA 2ZCFB 1MM7A 4R72A 1NV5A 4H8JA 2ROTA 2PZ1A 4ZZEA 4JJDA 1AZEA 3OD7A 4C8QD 3VFJA 1YI2Q 1B32A 2QJEA 2LC4A 3H9NA 3SHWA 1JXOA 3JCMQ 1RDYA 2JNGA 3HRTA 1WZOA 3P8DA 1IMBA 3CFZA 2H3EB 4R6HA 3BFUA 3NTHA 1ZX6A 3HP9A 4EMKC 2VT5A 4C92C 2W0ZA 1QW0A 2O9VA 4KRTA 2PT2A 3M8UA 5KYUA 3OYHA 4J8OA 3QJYA 5I2KA 4PJNA 2Z23A 3H41A 2O68A 2W7YA 2HFBA 1T3LA 2WSFE 3H7MA 2KK4A 2KRSA 3E4RA 1Q1KA 1NBEB 5GMKm 2RJCA 3JB9H 4C5GA 2XKOC 5LJ5g 2DE3A 2CGHA 3HN0A 1B4HA 3FJPA 1ANFA 4AFSC 4MLQA 2L8DA 2M1HA 2QVVA 3SEWA 3SFMA 2DETA 1QVFP 3HV1A 2KQZA 4E0WA 3GXAA 2KDSA 3FVGA 3VUBA 2E70A 1OZ2A 1YITA 1AH5A 1JW4A 2RQWA 2JM8A 1UHCA 1ACMB 3TCGA 3UN6A 2YWWA 1KFZA 1LAHE 1UIUA 3CR9A 4Q8RA 5DVIA 5I11A 1QWFA 5GJWB 2O69A 4RCBA 4YKKA 4RTVA 2ZPEB 4BACA 2CZ1B 2DVZA 2F78A 3M56A 4BDYA 3L2RA 2QFLA 4F3GA 2V3QA 1ZUYA 5B7DA 5HM4B 3G7ZA 4IY5A 3RNNA 2OTLQ 1VQOT 3GLBA 2P2AA 2F97A 4RG2A 4BDOA
chains in the Genus database with same CATH topology
1B34B 4DLDA 1VQ8A 3KBRA 1YJNT 3LLRA 4GWOA 5JTYB 5J3BA 3QIMA 4C1UA 4OESA 2XU8A 4C8QE 4ND9A 2K5FA 4QVDA 3FIRA 5TP9B 2RHZA 1B58A 4ELQA 4RMOA 2R58A 4XKRA 3PPPA 5I57A 1A8FA 1US4A 4M77G 1HSEA 1QVGS 4N0AA 4DE8A 1KC8U 4OVAA 4LD6A 2ZYMA 4CRIA 2AL4A 5IAYA 4I8CA 4LVQA 1VQPA 4OVJA 4HS7A 1DTZA 3K02A 3SESA 4FU6A 1S7YA 5GMKl 5CVIA 1XOCA 4POWA 4MZTA 1NNKA 4EXKA 5B70A 5L9MA 4N6PA 1VQLA 3KXTA 2ZPFB 5EHMA 3N5LA 3MP8A 2H99A 3UP9A 2BIVA 5CQYA 4IURA 1MH4A 3META 1IEJA 2Z8EA 1BI2A 2BJJX 1N04A 2MF2A 1YHQT 3O8VA 1D3BB 1MY1A 2VHAA 3HKSA 4LDYA 1M5Q1 3M5AA 5CQXA 1VQ6T 3BFMA 1B3HA 4V2SA 4ONYA 4L6V5 2KY9A 1QKBA 3JB9J 5GAN2 5KCHA 3G4ST 5CKBA 3VV0A 3T22A 4M7AD 2GQVA 4PNOA 1M9SA 3JB9F 4PETA 1Q86U 2MMPA 1WJSA 5JEIA 4KUDK 3OW2A 2AIXA 4O3CA 2WKYA 2LVMA 2DAQA 4IGTA 5AYFA 1A99A 1X6OA 2HCAA 3CEYA 1O7TA 3PPRA 1R9LA 3LC8A 3CMAT 3ECRA 4U4XA 3JCMJ 3M55A 2CKKA 3DLMA 2HNIA 3PUWE 3TTKA 1VQKA 5M9OA 1K73U 1A54A 2F8DA 3FZVA 2VV5A 4C0ZA 3CG3A 5TPAB 3PV0E 1YJ9T 2YLBA 2DWJA 1PEBA 4M75F 4F1YA 5I84A 4F1VA 3OBYA 4EXLA 4HA8A 3RTWB 2XX9A 1RKMA 1WDNA 4RJZA 3TCHA 4F29A 5ICQA 2R6GE 4JWYA 5J26A 5KE3A 4JS4A 3NTKA 4G77A 4IO4A 1B52A 4QW2A 2EJGA 1TXFA 3OS0A 5TPAA 3K00A 3CC7A 2EQKA 3S3NA 2KSSA 4M7AE 5ICTA 3PIPA 1FXXA 1B2HA 2D21A 3OYAA 2DP8A 3Q25A 4YAHX 4FORA 2HD0A 2XXTA 1N8RU 4M78D 1USYE 3QDRB 1LFGA 2DXRA 4JLGA 3NFCA 5DLOA 4LDXA 3KOSA 3H6ZA 1B5JA 2D5WA 3RKXA 3MZ1A 4NEDA 5TU0A 1RL2A 3QXMA 4EDUA 3N5BB 4G8NA 2VOZA 2HBPA 1KQ1A 4J7FA 4M77B 1Z7ME 1QUKA 1SYHA 4IO2A 1ZMGA 4OF1A 3MAMA 1D3KA 1JVYA 1UIVA 3LWIA 4M7DD 3LSLA 2QI2A 3SWNB 2XI9A 1O75A 3OO7A 5CM6A 4XTUA 4M75C 3HCQA 5GAOm 2VGQA 3CCJA 1G5VA 3PT9A 3MPKA 1NNFA 1HXDA 3S9LC 2I4CA 1F9BA 5I56B 3OYIA 1QVGA 2DJZA 1G3TA 4KCCA 5IT9E 4Z7EA 3PGFA 4OFLA 1QULA 4R6KA 2OLBA 2E6NA 1AHJB 4HCCA 3DB3A 2MAMA 1P1NA 5ISUA 3U1OA 1LGBC 3I56A 4R55A 1OVTA 3A8HB 1H76A 4M78E 4OP0A 1K9MU 4NMYA 1WQ7A 3FASA 1ZKBA 1B51A 2M8CA 2E12A 3CFLA 3DP6A 1IXIA 5I56A 2O4XA 1NPPA 4U2RA 1R8OB 3I3VA 2XX7A 3SKPA 4C92G 1QP3A 1IZ1A 4ESXA 2A3LA 4NWCA 5CR2A 3QYTA 2WSCE 2QS1A 3EQ1A 1N7XA 4ZGJB 2CZ6B 1IIWA 3IL1B 4NL3A 4N4GA 2GF7A 3C9HA 3CCLA 2I0BA 2XXHA 4M7DE 2KVQG 4C8QA 5CKHA 3V5AA 3OBWA 4QSDA 3W9WA 2ZPIB 3VUZA 4PLIA 1JW1A 3OXNA 1TFAA 2RM4A 4GY5A 3CSGA 4BDRA 3CI8A 4YMBA 3CBOA 1B05A 2XHCA 1JNFA 3HL8A 3JCMd 5CMMA 4Y28E 2RK2A 2XXWA 1OYXA 2DTOA 3QK6A 1UTBB 2Y7IA 4HW8A 2HZKA 3FJ7A 1XC1A 3LW5E 3LGLA 3ZS6A 4R73A 5GAOl 1MPCA 2FVUA 3HO7A 3G6EA 1JB0E 2DPPB 3OS1A 3QSUA 2WACA 1DJ7B 2GFUA 2KMTA 3CXCS 1FTOA 1YCJA 2FNCA 2XDPA 4CI0C 1BYMA 5AA1A 3IJXB 4ZDMA 1OQHA 2JTMA 3JCMV 5GAMe 2I6EA 3LUYA 3PUVE 2LDMA 5H8NB 4C0DC 2XXXA 4RYAA 1URGA 2P1SA 3LSXA 3OYDA 1XOVA 4KULA 3D4CA 5EHSA 5CBRA 5CRYA 3BW1A 3P7IA 1VQMA 2LRQA 3OYKA 4G8HA 2FB7A 2R5MA 1L5TA 1PSFA 1II5A 5I59A 1Y4CA 2RI2A 4XTXA 3IR1A 3EAEA 3VKIA 4R2FA 3GP8A 2QA4A 5FU7B 4E47A 3UA8A 3JCMh 4I62A 3CVGA 2V93A 4RK2A 1H3ZA 1NKXA 1NJIC 2XXQA 5DEXB 2HAUA 5KDTA 1AIVA 3F11A 1YITT 1AL3A 4XKPA 5FHMA 4HCZA 3ZSFA 1MXYA 3IO4A 2H4IA 1SW5A 2V8KA 1O9SA 3OS5A 3CCVA 2RA2A 4C5HA 3C94A 3JRZA 1LOJA 2HAXA 1BLFA 3RKWA 1LJOA 5K2YA 5GAN8 1VQ8T 3JCMW 1PB8A 1VFEA 4JSDA 2JVVA 2YLCA 4FT2A 2EWNA 3RESA 5GAMh 1FQCA 3MVXA 1H641 3MVYA 4ELRA 5CAIA 4G8MA 2Q88A 1NH8A 4ZGEB 4H0WA 3ER0A 1P1UA 5L9SA 5FTIA 5ELVA 3IB1A 4MMKA 3PD9A 5GAMf 1V29B 4IUVA 2YLNA 3C95A 4NOYA 5GAN7 5CI5A 5I21A 5JK4A 4HCWA 3I5OA 3VVFA 4EMKB 4B9WA 1YCYA 3PU5A 3BDUA 2F5TX 3V8XB 1U1TA 2VUBA 3S4UA 5CKDA 1VQ4A 1P1QA 3ZKKA 1VQPT 2I2LA 3I6VA 3CCQA 3UT1A 1EU8A 2LTOA 2EJFA 3K01A 1VQ9A 1M5CA 1ZBXA 5M2VA 5KCOA 1BTJA 1QUJA 4PQJA 4QFOA 4JB7A 3V7CA 2HXWA 4H5FA 4QFPA 3A8MB 1VQLT 2VGNA 4KI0E 4ZEBA 4PJOF 3OQ5A 3EHTA 5A5XA 1N3WA 4LA9A 4D6WA 4C5EA 1P92A 4ZECA 5GAN3 3G3HA 4B9XA 3Q28A 5H8HB 3PIOA 1JBMA 1MH3A 2O84X 2O1MA 3JB9G 3BBRA 5CC2A 5C6SA 2XD0A 1B3LA 2YJPA 1EH3A 4QSCA 4ZEIA 1UEBA 4IO6A 2EQUA 2X4YA 3OENA 1WPYA 3N6UA 1M1GA 5AA2B 2QS2A 3L2WA 2ZNUA 3C35A 4C92F 1WODA 1OVBA 1U1SA 2DWHA 1DOTA 1VQ5A 2UVJA 1FW0A 4PFUA 3K6XA 4E0XA 5LJ3g 4OFJA 3H6WA 4M77D 4M78A 3O2AA 2OBGA 3OYCA 5CIUA 1VQKT 3T9NA 2Y7KA 3HRUA 3CCSA 3M9QA 3CXCA 1POY1 2EQMA 4M75G 3OO6A 3TQLA 5CKEA 1SW2A 4L59A 3MEVA 3O6IA 1BKBA 4THIA 1Q7YU 1M5BA 1YJWA 3CRBA 2RH2A 3QYHB 4E7JA 2Z8FA 4M4GA 4JUVA 4JRQA 1P1OA 2ESNA 4PJOC 2VYTA 1TWYA 1Y3PA 4QRZA 3QUFA 3NTIA 1EZPA 4M7DA 2RHXA 1B3GA 2LNVA 4GLIA 2MWPA 4ZGDB 3O66A 4F3PA 4YICA 1D9YA 3LSWA 2X4XA 5AA3A 4GXSB 3CC7T 1ZU0A 4O3BA 4XQ3A 2CZ7B 5GAMj 3W15C 4MZMA 4ZEKA 3TODA 4F7UF 4A4EA 4IKFA 1MGQA 3OMBA 2RD1A 1P99A 2THIA 2GHBA 2ANJA 2RI3A 4HKEA 3VE1B 5L8DA 4F18A 4YKIA 3CC4A 3TAJA 4M77E 3R6UA 4BUGA 4FEBA 3KSXA 1B0LA 2E6ZA 3VV5A 2PT1A 2ZYOA 4RKUE 2RJDA 4F39A 1N3XA 2F35A 3PFSA 2H98A 1R6ZA 2GCXA 3VVEA 1HSJA 2DTIA 1M8VA 3TTRA 4Q0CA 1N27A 3CCJT 1KC8C 2QS3A 4ZEDA 2EAYA 3TTNA 2Q8JA 4PFTA 1LFIA 4RCCA 4I9DA 2V84A 3CC2T 1WGSA 4Q5WA 1M1FA 3FGSA 1G3WA 2LQKA 2DK3A 4OB1B 3MZ9A 4OHNA 3QPHA 4LZ5A 1FQEA 3I56T 3X25B 2AHJB 1BI3A 2Y84A 3THIA 1BIAA 4J6WA 1ZJLA 4Y91A 1I6BA 4ZTJA 2QMWA 3Q26A 3JCMg 1B34A 1VFDA 1Y9UA 3GF5A 3IOWA 3R6OA 3VVDA 5JTYA 3INZA 1MQJA 3MBPA 3VXCA 4DCXA 3HPIA 2K5LA 4JRKA 1JETA 3Q29A 4YB7A 4N4IA 5TP9A 4C1TA 4XAXB 4GLKA 3M58A 1B9JA 3CCLT 3H06B 3ZEHA 3P8HA 4G68C 2FL7A 2PVOB 4A54A 4BDZA 4BE0A 3M3KA 3OYEA 1Q86C 4JXIA 3R26A 2XIDA 1JEVA 4YKJA 3JYRA 1BIBA 1P1WA 1QP2A 2XG8D 4N4HA 3BKIB 4NWDA 4WXJA 3EN3A 4M75B 4H8IA 1B4ZA 1SD3A 4KR5A 3G3JA 3U8QA 3FC3A 1SSFA 1MDP1 3L42A 4NTLA 1XT8A 1MXUA 3G6ET 2IA4A 1K73C 5FRMA 2OWTA 4UA8A 4HT9A 2EYQA 3PUZE 2I0CA 1VIFA 3L2UA 4U23A 3ME9A 1LAXA 2JOYA 1LLSA 2NUVA 3RN8A 3HRSA 3O97A 3T9VA 2FYKA 3S9EA 2LT1A 1I69A 4VUBA 2DVEA 2E64A 3CPWS 2VC8A 3E1SA 4IB2A 1D3BA 1GV8A 2IVWA 1KQ2A 4FIBA 5AA4B 4ZZAA 3HSBA 5EG2A 3ZBDA 1LAGE 3GZGA 2D3IA 3UORA 4BI8B 1H45A 3UDCA 5GANe 1VQMT 2RK1A 1UGRB 3PMTA 4OB2B 2Z22A 3KFMA 2L89A 3BFTA 4U1ZA 4WKMA 5DVJA 1R9QA 3B6WA 3CCUA 3MZBA 1IREB 2UVIA 4GQOA 1N8RC 1BIYA 3A8GB 1ATGA 2QXFA 3X20B 1NFTA 2Z8DA 4LP2B 3B7DA 2PVUA 4ELYC 2QA4T 4H5GA 3U93A 3F70A 2OZZA 2OCUA 2Y4YA 2DXCA 3WVDB 4JS5A 3HHGA 3LBSA 5DYHA 3TCFA 2X4JA 3JB9I 4J6YA 3CBPA 3OYGA 5FROA 4E7KA 2NVUB 2D6FA 4JDSA 3CCVT 1UGPB 1DPPA 3DLLA 1MY2A 2V25A 4PLLA 4FSXA 3TEPA 3SDZA 4DXUA 3QIIA 1D4NA 1OI1A 1B6HA 3L2VA 3IAZA 3K6UA 1JRIA 1VQ7A 1N0TA 4MDXA 4JWXA 3CCMA 1XTDA 4N0AC 1WQWA 2AYSA 3HHFA 4EQ9A 4NF4B 5AA2D 3FXRA 2PU9B 3OYMA 4J83A 4MH5A 3T9HB 2RJFA 4C0DB 1MXXA 4X9DA 4RY1A 4DCYA 4E7LA 1KQSS 1X01A 5GAN6 2A5TB 3CD6A 3LX7A 4NF8B 4IUTA 3MCAB 3C32A 2QTXA 2DTHA 2I4BA 1K9MC 1HSLA 4QQDA 5DY9A 5CK9A 4KD5A 5GANf 4JDFA 3K4UA 3OSRA 5I58B 3J7AF 1OIBA 5GAN4 3CCQT 2MWOA 4UC4A 4PJOG 1VQ9T 5I2SA 2ABHA 2A5TA 3L6HA 2QL3A 4M77A 2ZPGB 3IORA 3U72A 1LFHA 2Y7RA 3C36A 4N07A 1J1NA 2WSEE 3SWNA 1IUDA 1ZLQA 4BDMA 1VQNA 3OO8A 3OYLA 4R75A 4EPCA 1SW1A 1B3EA 1K8AC 1XS5A 2ONKE 1YTVA 4TQUQ 3MEUA 4R9GA 5FTHA 3DP4A 3FV1A 2HAVA 2PVGB 3C31A 1Y20A 5LJ5e 1DMBA 1EZ9A 3HHTB 3RERA 3FJGA 2RHYA 4ESWA 5A0DA 4YMAA 2DWIA 4GXAA 3H03A 2RF1A 4PFYA 3M4YA 3QJ6A 1MRPA 3FVKA 5ITPA 2BKDN 2DSFA 3FB9A 3X28B 1VQ5T 4FT4A 3RLFE 3TQWA 1GGGA 4XU0A 3OO9A 4LDWA 1IITA 4AB5A 1KHCA 2JUFA 2UYFA 1FQDA 1KD1U 3VYGA 2O51A 4Z0IA 1EZOA 3O9PA 3CCST 4YB6A 3IB0A 3PMXA 1PDAA 4BI4A 2Q9TA 3MP6A 2AL5A 1N6AA 3EPEA 1YIJA 1B7ZA 4OFOA 3CPWA 5CBSA 4MMLA 4PKCC 4II1A 3K1MA 1UGSB 4FECA 2HQXA 1MY0A 1ZBMA 2I3VA 3SEVA 1YAEA 4PFWA 3QZ5B 1X75C 4IUQA 1TFDA 3FUZA 1MQGA 1I6AA 1MDQA 3WXMB 1UTBA 3A3UA 5L9OA 2K57A 4F7UG 5GAMd 4WF2A 3G3FA 3TCJA 2P0SA 4IO5A 4FATA 3HPWA 5H8QB 2O1LA 1YHQA 2KQWA 3U92A 2E0SA 4GVOA 5HY6A 4OYVA 2D0QB 3QBYA 3JB9D 3LGFA 4C8QF 3LYIA 1O64A 3HFOA 2B3BA 2VP1A 4F31B 5LJ5f 3CC4T 3JCMP 4LDVA 4F3SA 2P0KA 2YHTA 2XXIA 3TYHA 3IOUA 2OWSA 2KLFA 3U94A 2XXRA 3QUIA 3OYJA 1A8EA 4XIGQ 5H8NA 4OXVA 2DXTA 4XTZA 3VLUA 3L2ZA 1AMFA 3RTFB 5IN1A 3B6QA 3M54A 2VXFA 4ZN3A 2DD5A 1M1KU 4H6DA 2IG0A 1CE2A 2LCCA 2NXOA 4OGEA 3MWBA 2CZLA 1USYH 2M9UA 2B8AA 1ZIUA 4NF6B 4M75D 4LATA 2ZNSA 1B7UA 3MVZA 5I2MA 3H6VA 1Q82U 2E5QA 4PJOB 1XVXA 3CMEA 1KQSA 1JW5A 3WVEB 2K3XA 4KQPA 2RC7A 5DEXA 4R74A 4RPOA 5GMKi 2XX8A