4ELQA

Ferric binding protein with carbonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
310
structure length
310
Chain Sequence
SPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title Crystal structure of ferric binding protein A
rcsb
source organism Thermus thermophilus
total genus 114
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elqA02
4U1ZA 5A5XA 5AA3A 4G68C 2I58A 3TFLA 2ZXTA 3QAXA 4ZEKA 2OCUA 3PPPA 3VDFA 1IXCA 3KEIA 5H8QA 5I84A 3RT8A 3DM0A 1MXZA 2B65A 1Z7NE 4F3GA 2F7AA 1B5HA 1LCFA 1P99A 1SVXB 3IJXB 2OK2A 4F19A 5H8QB 1LAXA 2DS9A 2RCBA 3O66A 5JEIA 1UTHA 5CMKA 3O28A 4JSDA 4FORA 4KD5A 1OMPA 1Y4CA 3LBSA 3EPEA 1A54A 2NUVA 4HTGA 3ZSFA 1QVSA 2A5TB 1B4HA 1B52A 4IO5A 2OJTA 1SYHA 3FVNA 3TODA 5I56A 3S9NC 4EQ9A 1H76A 2XD3A 2P0SA 5KZTA 5TU0A 4PFTA 1YPNA 4Q30B 5J1DA 1LSTA 1B3FA 3EHSA 3HO7A 2BJJX 3CFXA 1LB9A 1MXYA 3K6VA 4OQOA 3CIJA 3VVFA 1FTMA 3WAEA 3PUXE 1QJMA 3LSXA 4KCDA 4ZZEA 1UTBB 3ODBA 4TQUQ 2WKYA 3SETA 2UVGA 3SEWA 3IAZA 4F3BA 1MQJA 2I3VA 3RY3A 5L9MA 3BFTA 2H25A 1M5DA 4XXUA 4NF4A 4DLDA 3S2VA 3EN3A 2X26A 2Y7KA 1HSEA 2UVHA 3EF7A 1SQYA 1EZ9A 1ZMGA 3T9VA 1M5CA 3KN7A 5AE4A 3K0VA 2ZNTA 3CFLA 4NWDA 2FA7A 1BP5A 1Z7ME 2Q2CA 1IZ1A 1BKAA 4ELPA 3K6XA 1XVYA 4PE5B 2PBWA 3EHTA 3ZKKA 5I2NA 4KYSA 4JBZA 4P0IA 3TEPA 3IORA 4JWOA 2HAUA 4XKPA 3G7WA 4YB5A 1LB8A 2I3WA 3KN8A 1B40A 4KI0E 3CSBA 3N5LA 1PBPA 1B3GA 3IB2A 4H1XA 1Y4TA 1Y1MA 3T22A 4KYDA 4LATA 4POXA 3QK6A 1IIWA 4NWCA 4QFNA 1JETA 4RJZA 2B3FA 2OLBA 1R1NA 2DWJA 2DVCA 3VXCA 1JVXA 4H67A 3VLWA 3R6UA 4AB5A 1UQWA 2I0BA 4HCWA 2O68A 1DPPA 2XX7A 1MDQA 2RC8A 2XXTA 4G8MA 4QHQA 3N26A 4E0XA 1SD3A 2YPNA 1SW1A 1VFEA 2HZLA 1N7XA 1A8FA 4QSCA 1F9BA 1SDXA 3QIMA 3G3HA 3VVDA 4U22A 3WAFA 1ATGA 2H99A 4GQOA 2IEEA 1ZBMA 3C9HA 1LAHE 4OHNA 4M4GA 2XXHA 3QXMA 3O9PA 3L6HA 4ZZAA 3E9XA 3FUZA 1IEJA 3HHGA 3CVGA 4NF8A 4KHZE 3C4MA 3KBRA 3N6UA 1DSNA 3VV5A 3L6GA 3U1OA 2AIXA 4GWOA 1O7TA 4OVJA 4ZE9A 4ZECA 1I6AA 4PP0A 3Q29A 5H8FB 3EQ1A 4JDFA 1Y20A 4G68B 4WEDA 4ZEIA 3C36A 3H7MA 4XKNA 3THIA 1IUDA 1AMFA 4LA9A 4WEPA 3VVEA 3E3KA 3LSLA 1LBBA 1NNKA 1IXHA 5H8NB 5EHMA 3PPNA 4OERA 3FVOA 3DP6A 4R72A 1NL5A 1DMBA 2W7YA 4JWXA 2I49A 3JYRA 4F3SA 1MY1A 1XT8A 3GXAA 4NF5B 4FE8A 5CBSA 4Z7EA 3K2DA 4DCXA 2F97A 5TP9A 2B3BA 3FV2A 2NOOA 1FTJA 3K02A 2F8DA 1FQFA 3M3FA 3O29A 4YKJA 4I1DA 3E4RA 4DZ1A 1BLFA 2AL5A 3IX1A 4BDOA 1POY1 3ILUB 3OMBA 3FD3A 2XXPA 5AA2B 4LZ5A 1FW0A 3FIRA 5BUUA 3H03A 4GFRA 1AL3A 3UP9A 4XKQA 4L17A 4ZEDA 3PPRA 1KWHA 4WKMA 3KN3A 1B32A 3KSXA 1A99A 2ZNSA 1DTZA 4F2QA 4PQJA 3C31A 3K1PA 1H43A 1LBCA 4XTCQ 4GRKA 1MRPA 4RY1A 5IKBA 3B6TA 4G2ZA 1QKAA 1XHYA 2OBGA 3S9EA 3O2AA 4R73A 3RT6B 3VLVA 2UYEA 4NMYA 4QF9A 3SEYA 1MM7A 1VR5A 4RNSA 5AA1A 1DOTA 3G3JA 1N0TA 2ZYNA 4LQ5A 2R9JA 1AH5A 1I6BA 1DPEA 3HSTA 3PUYE 1FQCA 1EZOA 4N07A 3TTLA 1D4NA 4QFKA 2ZYKA 1SI1A 3GBBA 3IOTA 3MQ9A 3PGFA 1P1NA 1GV8A 3V89B 5KDTB 3TUSA 4I9DA 4ZEBA 4YICA 4YAHX 4ONYA 4YMAA 2QPQA 4O3BA 4XIGQ 3SDFA 4QFPA 3U93A 5TPAA 1N84A 3TTRA 3IB0A 4YB6A 5JTYA 5A5XB 3PV0E 5H8HA 4FEDA 1LAFE 2ZNUA 5I2KA 1QULA 1HSJA 4K3FA 5ICQA 3VXBA 4RXLA 4R75A 3U8QA 2XXUA 3TZAA 3IR1A 1GTKA 3QUJA 1QUIA 2NWJA 2Y7PA 1B7UA 4IGTA 3W9VA 1S9TA 3B6QA 4EF2A 4NF6A 2XX9A 2GFEA 3OEKA 1B46A 1B7HA 5EHSA 3CRBA 4BDRA 4OMBA 5F7VA 3OXNA 2Z8EA 1UTHB 1B4ZA 4BDQA 1EZPA 1VFDA 3RQTA 2UVJA 1H44A 2DE4A 4DXBA 3D4CA 4GD5A 1FQEA 4RA1A 2XXXA 1ZJLA 2PT1A 3IJOB 4Z0IA 3I5OA 1RYOA 3FZVA 5I56B 5JK4A 3PU5A 1LFHA 2RF1A 1QUJA 1SW2A 1B1HA 2P1SA 2ABHA 1N3XA 1MDP1 2H5YA 4U4SA 1USYE 3FXUA 2GH9A 1J1NA 5AA2D 4G4PA 4LZ8A 1US5A 4HCYA 2ZMBA 4NEDA 5B7DA 1GGGA 1LAGE 3CG1A 3K6UA 1B3HA 4YKPA 3CR9A 3Q26A 4QRZA 3I3VA 3JV9A 2O84X 1OIBA 5BWJA 2QSXA 4ND9A 2XX8A 4EDPA 4OYVA 1MQDA 4RPOA 3MAMA 1P1UA 4NF4B 4F1UA 4ESXA 1AOVA 3TTNA 1II5A 3ECRA 2M8CA 2R71A 2V3TA 3MPLA 4MFIA 4OTEA 4R2BA 4PFUA 1LLSA 4GIZA 2Q89A 4ESWA 2DWIA 4FECA 4ZDMA 4EF1A 1QW0A 1Y3PA 3SERA 1NNFA 3FJ7A 3FVKA 4OEUA 5I2NB 3MUQA 2RC9A 4YKIA 2P2AA 2XXVA 4R6HA 3VLUA 1OVTA 3KJTA 4AQ4A 2ALUA 2QRYA 3G3IA 1A7LA 2A5SA 1NMUA 2Y7RA 3QUFA 3T9UA 5DVIA 4THIA 4IO2A 2HEUA 1D9YA 1A40A 1IXIA 4C0RA 3PMXA 4IO4A 2ZYMA 4R6YA 4ZEFA 1PDAA 2G93A 3H06B 1B3EA 4C1TA 4C1UA 2XD2A 1URSA 3MBPA 3OEMA 3K6WA 1SBPA 2Z8DA 3DELB 4DIGA 2FNCA 3TMGA 3HV1A 2Z22A 4R2FA 1A8EA 1H45A 5FHNA 1LCTA 4N6PA 5CMCA 2GHAA 2FYIA 3LC8A 3LR1A 5F1QA 5I57A 4FATA 3AXFA 1B05A 3DLNA 3HHFA 3QSLA 2OWSA 3IB1A 1MS7A 1XC1A 3B7DA 1JEVA 1MPCA 4R6KA 2F6PA 1UIUA 1RKMA 2QJEA 5EYFA 3G3FA 3K1MA 1BIYA 1YAEA 4OZ9A 3UIFA 3KZGA 2F35A 5ISUA 3MVYA 1MXXA 3BBRA 2XXQA 5KCJA 1RYXA 3FJMA 4BDMA 4H5FA 3HCQA 3IK6B 2PX1A 4F3PA 4NF8B 3OELA 1SW4A 3KGCA 4U21A 1MXVA 5DTBA 2DE3A 2H98A 5CBRA 5M2VA 3TELA 3MJNA 3RTWB 4X9TA 4X1BA 5CRYA 1MQIA 3TAJA 1TFDA 1WVJA 3RGYA 2E1SA 4UA8A 2XXYA 4H8IA 4LQ2A 3UGWA 4TOZA 2VHAA 3M3KA 3V5AA 1JW4A 4Q8RA 4X1DA 3C34A 2V25A 4QFLA 4X48A 1H3DA 3MP6A 2G29A 4BDLA 1I69A 3Q25A 1ZKBA 4JWYA 3SEVA 5DEXA 3PUWE 1HSLA 3MWBA 1SW5A 1MM6A 3P7IA 5DVFA 1WDNA 3T93B 4KFQA 3SKPA 3PD8A 2Q9TA 3IOVA 4LONB 2ZYOA 4R9FA 1B0LA 2GRVA 2O6AA 2Y7IA 4F39A 2AL4A 4TLLB 4RYAA 3KFMA 3O6HA 5L9OA 4OENA 5TP9B 2UVIA 1USYH 5I59A 4OESA 4H8JA 5CMBA 2F6GA 3U72A 1D9VA 2DWHA 4MF3A 3KOTA 3FASA 5DYHA 5ITOA 3TCHA 1PB9A 3TCFA 2Y84A 4EQ7A 2DOJA 5I59B 4RK2A 4GF8A 3MZ9A 4DDDA 4AB6A 3FVGA 1MPBA 2DVZA 1NKXA 1URDA 2HXWA 4GXAA 4Q0CA 1AIVA 3Q27A 4EXKA 2H4IA 5HM4B 2UYFA 3RN8A 4ZS9A 3VE1B 5ICTA 5ELVA 1YCJA 2X7QA 1B9JA 4U4XA 4DXCA 3R26A 2V3QA 4H65A 2ONSA 2O69A 1TFAA 4G8NA 4OFOA 3MP1A 1MH3A 4Q5TA 4PETA 3TCGA 5LOMA 3B6WA 3MZBA 2VOZA 4HS7A 3OO8A 3EHUA 1EH3A 3MP8A 2DXRA 3G3GA 4GL0A 4I8CA 1B5IA 4P11A 3C35A 1MPDA 4JSOA 4YKKA 3S9MC 3PUZE 4KQPA 4H5GA 3H6TA 2OZZA 3S9LC 3DP8A 2OWTA 3FGSA 4MLVA 3RUMA 1Y1ZA 4EUOA 5TPAB 5DT6A 3LUYA 3ZKLA 5JTYB 5H8HB 2KLFA 5CM6A 4QSEA 5I2KB 2D21A 3OO9A 4GXSB 1ZU0A 1B51A 2QS3A 2V3UA 3OENA 4OWDA 4G77A 4DE8A 3T66A 4F31B 4GLIA 2O51A 3OD7A 4NF6B 3KSJA 3JZJA 2A5TA 1Y3NA 1FQDA 2O1LA 4WXJA 4OFLA 1LFIA 3LSFB 1PB7A 2DWAA 2RINA 3I6VA 1MXUA 4DXUA 4KYEA 3HN0A 2HQ0A 2XXIA 1FTOA 3K1NA 2I48A 3FXRA 3TKDA 4DCYA 2DXYA 4FIMA 4LVQA 1OVBA 1N7WA 4IO6A 3H6WA 3TQLA 4GVOA 3PPQA 4F18A 2HFBA 5L8DA 3K00A 5FHMA 2CZLA 1B1XA 2REGA 3OSQA 1NH7A 1M5FA 4ISUA 2DSFA 5FTIA 1S7YA 3SESA 1UTBA 4IY6A 4F2OA 4ELRA 4QFOA 3PUVE 4POWA 2RCAA 1VSOA 3GLBA 4KCCA 3Q28A 1NNTA 3QYTA 1UIVA 4EXLA 1MH4A 4MBPA 4YZZA 3MVXA 1NH8A 1DTGA 3KJ7A 4TLMB 2F78A 1MXWA 4O3CA 4R9GA 1B58A 4LUBA 3T9HB 3MW0A 2D5WA 1I6QA 1OLAA 4ELOA 1B2HA 1PB8A 1MY0A 1LFGA 3TYHA 5IAIA 4PFYA 1FQAA 2THIA 2QMXA 3CFZA 1P1WA 3M8UA 1ZTYA 1OLCA 4FAJA 4KR5A 3H6VA 1XOCA 5K2YA 4QSDA 2REJA 2Q2AA 3TPAA 1FCKA 1FQBA 1Q35A 4F1YA 4BLAA 4IO3A 5H8SA 3MC2A 5DVJA 1EU8A 3GBAA 4ZE8A 3OO6A 1JVYA 2NXOA 5FHOA 3RLFE 2F7CA 4M1VA 3U92A 3TDJA 1B7ZA 3HPIA 1IQ7A 3IO6A 3G3KA 2QS4A 3RTFB 4GOTA 2Q88A 2O7UA 4N13A 4F22A 2E0SA 2H9BA 5ITPA 3FV1A 3GZGA 4RK9A 2HAVA 2V93A 1POTA 2ONRA 1BTJA 4FJPA 3CG3A 1B5JA 4MH5A 2DE2A 4IO7A 4H0WA 4HW8A 1OQHA 3H3GA 1T0KA 4MLQA 3RPWA 2YLNA 3OSRA 4F29A 2PYYA 3CI8A 4YU0A 3MZ1A 3TTMA 1MQGA 1ELJA 3VFJA 2Q8JA 1SYIA 1JNFA 2ANJA 3K4UA 2Z23A 3ILTB 2X7PA 4OEVA 1Q1KA 3RNNA 2F36A 4I62A 5I57B 3IOUA 3H4ZA 3A3CA 4P0GA 2QS1A 5I58A 1B3LA 3TTKA 5HBCA 2RC7A 2XXWA 5FTHA 3SEXA 2F7BA 2R6GE 2F5XA 4EQBA 1YTVA 5I58B 3F11A 2I6EA 3ZS6A 1B6HA 3T9XB 2RKMA 3D4GA 3FXQA 3OO7A 4YB7A 5H8FA 3W15C 3KG2A 2VD2A 5KCJB 4G68A 1MY2A 2I0CA 2I4BA 3S4UA 4OETA 2IA4A 3V8XB 3C32A 3N94A 2O7IA 2D3IA 1JW1A 5AA4A 3W9WA 4U23A 1TXFA 1P1OA 2ESNA 1ZIUA 1GR2A 2V84A 5H8NA 2AYSA 4U1OA 1XS5A 3PPOA 2QL3A 1QKBA 2VP1A 3MVZA 1URGA 2DQVA 3CSGA 3PMVA 5CMMA 4RPNA 5K2XA 5AA4B 2XHDA 3DP4A 3PMWA 2ONKE 1R9LA 1CB6A 2DYXA 3A3UA 4NF5A 4LP2B 5CC2A 4NE4A 3SEUA 4U2RA 3M3LA 2XXRA 3UORA 4NTLA 3BKIB 1A55A 4O3AA 1B0HA 3IL1B 3FATA 2GHBA 1WODA 3H6UA 1R9QA 2O1MA 3E13X 3USDA 4OFJA 4BDNA 5DEXB 1MG1A 3MVWA 3C33A 1JQFA 1Y3QA 3PD9A 1S50A 4G8HA 5B70A 1FTKA 2YJPA 1ANFA 1OQGA 1XVXA 4R74A 3TQWA 3FJGA 5L9SA 3O97A 4GL8A 3OOAA 3N6TA 2VGQA 4FEBA 5AA2A 2QS2A 1VE4A 3IO4A 3A09A 2QMWA 1M5EA 1D3KA 2NVUB 1O64A 2PT2A 4OXVA 1FTLA 4E0WA 1QUKA 2CMOA 1P1QA 4IY5A 1L5TA 2HZKA 2Z8FA 3U94A 4H6DA 2Y7WA 1MY4A 3LSWA 1MQHA 1LGBC 1NNPA 1SI0A 2DP8A 3KOSA 3O6GA 4IGRA 1NFTA 2PMSA 1ZLQA 1M5BA 1PEBA 1GVCA 3BFUA 1IITA 2F34A 4PFWA 1IXGA 1JEUA 4XKRA 4ELQA 3UA8A 3T96B 2I4CA 3UK4A 4IB2A 1CE2A 4F1VA 3O6IA 1US4A 4KPTA 4JXIA 1R6ZA 1JW5A 1MY3A 1N3WA 3IOWA 3UN6A 3K01A 2PVUA 1O63A 1PC3A 5KDTA 3MPKA 4UACA 5HPQA 5CI5A 2HCAA 3R7XA 1TWYA 2LAOA 4LZ7A 2VD3A 1N76A 4YMBA 4JB7A 1Y9UA 1PBQA 3V83A 1TT1A 3ONMA 4ECFA 1N04A 2UXAA
chains in the Genus database with same CATH superfamily
4U1ZA 5A5XA 5I5PA 5AA3A 4G68C 2I58A 1EYJA 3TFLA 2ZXTA 3QAXA 4ZEKA 2OCUA 3PPPA 2FHYA 3VDFA 1IXCA 3KEIA 5H8QA 1RDZA 5I84A 3RT8A 3DM0A 1MXZA 2B65A 1Z7NE 4F3GA 2CZKA 2F7AA 1NUYA 1B5HA 4PAFA 1LCFA 1P99A 1SVXB 1CNQA 1FPIA 2OK2A 3IJXB 1DK4A 4MNPA 2B4LA 4F19A 5H8QB 1LAXA 2DS9A 2RCBA 1LBZA 3O66A 5JEIA 1UTHA 2MKZA 5CMKA 3O28A 4JSDA 4FORA 4KD5A 4MCOA 1OMPA 1Y4CA 3LBSA 3EPEA 1A54A 2OWZA 4P47A 2NUVA 1FPBA 4HTGA 3ZSFA 1QVSA 2A5TB 1B4HA 1B52A 4IO5A 2OJTA 1SYHA 3FVNA 3TODA 5I56A 3S9NC 4EQ9A 1H76A 2XD3A 4JVDA 2JJKA 2P0SA 5KZTA 5TU0A 4PFTA 1YPNA 4Q30B 5J1DA 1LSTA 1B3FA 3EHSA 1QGXA 3HO7A 2BJJX 3CFXA 1LB9A 1FBHA 1MXYA 3K6VA 4OQOA 4MJOA 3CIJA 3FXBA 3VVFA 1FTMA 2FBPA 4P9KA 3WAEA 2WYKA 2CZIA 3PUXE 1QJMA 4PDDA 3LSXA 2XWVA 4NGUA 4KCDA 4ZZEA 1UTBB 3ODBA 4TQUQ 2WKYA 3SETA 2UVGA 3SEWA 3IAZA 4F3BA 4MNCA 1MQJA 2I3VA 2KQZA 3RY3A 5L9MA 3BFTA 2H25A 1M5DA 4XXUA 4NF4A 4DLDA 4NX1A 4PGNA 3S2VA 3EN3A 2X26A 2Y7KA 1NV4A 1HSEA 2UVHA 3EF7A 1SQYA 1EZ9A 1ZMGA 3T9VA 1M5CA 3KN7A 5AE4A 3K0VA 2ZNTA 3CFLA 2PCRA 4NWDA 2FA7A 1BP5A 3B50A 1Z7ME 2Q2CA 1IZ1A 1BKAA 3BIGA 4ELPA 3K6XA 1XVYA 1FJ9A 1FPLA 4PE5B 2PBWA 3EHTA 3ZKKA 5I2NA 2BJIA 4KYSA 4PTKA 4JBZA 4P0IA 3TEPA 3IORA 4JWOA 2HAUA 4XKPA 3G7WA 4YB5A 1LB8A 2I3WA 3KN8A 1B40A 4KI0E 3CSBA 3N5LA 1PBPA 3FBPA 4MEVA 1B3GA 4UABA 3IB2A 4H1XA 1VDWA 1Y4TA 1Y1MA 3T22A 1LBWA 4KYDA 4LATA 4POXA 5EQAA 3QK6A 1FPGA 1IIWA 4HE1A 4NWCA 4QFNA 5LDZA 4X8RA 1NV6A 1JETA 4RJZA 4XEQA 2B3FA 2OLBA 1R1NA 2DWJA 5IGAA 4OANA 2Y5KA 2DVCA 3VXCA 1JVXA 4H67A 3VLWA 3R6UA 4AB5A 1UQWA 2I0BA 4HCWA 1NUXA 2O68A 1DPPA 2XX7A 4I3YA 4I3EA 1MDQA 2RC8A 2XXTA 4O8MA 4G8MA 4QHQA 3N26A 4E0XA 1SD3A 2YPNA 1SW1A 1JP4A 1VFEA 2HZLA 2Q8MA 1N7XA 1A8FA 4QSCA 1F9BA 1SDXA 3QIMA 3MSTA 3G3HA 3VVDA 4U22A 3WAFA 1RDXA 1ATGA 2H99A 5IM2A 4GQOA 5IZ1A 2IEEA 2WEFA 4QXDA 1ZBMA 1NV0A 3C9HA 1LAHE 4OHNA 4M4GA 2QVVA 2XXHA 2FVZA 3QXMA 4GWUA 3O9PA 3L6HA 4ZZAA 3E9XA 3FUZA 1IEJA 2WBDA 3HHGA 3CVGA 4NF8A 4KHZE 3C4MA 3KBRA 3N6UA 1DSNA 4PF8A 3GYYA 3VV5A 3L6GA 3U1OA 2AIXA 4GWOA 1O7TA 4OVJA 1IMEA 4ZE9A 4ZECA 1FBCA 1I6AA 4PP0A 3Q29A 5H8FB 3EQ1A 4JDFA 2ZZXA 1Y20A 4G68B 4WEDA 4ZEIA 3C36A 3H7MA 4XKNA 3THIA 1IUDA 1AMFA 2WX9A 4LA9A 4WEPA 3VVEA 3E3KA 3LSLA 1LBBA 5IZ3A 1NNKA 1IXHA 5H8NB 5EHMA 3PPNA 4OERA 3FVOA 3DP6A 4R72A 1IMBA 1NL5A 1DMBA 2W7YA 4JWXA 1IMAA 2I49A 4NQ8A 3JYRA 2XWKA 4F3SA 1MY1A 1XT8A 3GXAA 4NF5B 4FE8A 5CBSA 4Z7EA 3K2DA 4DCXA 2F97A 5TP9A 2B3BA 3FV2A 2NOOA 1FTJA 2Q74A 3K02A 2F8DA 1FQFA 3M3FA 3O29A 4YKJA 4I1DA 3E4RA 4DZ1A 1BLFA 2AL5A 3IX1A 4BDOA 1POY1 3ILUB 1FPKA 3OMBA 3FD3A 2XXPA 1LBXA 5AA2B 4LZ5A 1FW0A 3FIRA 5BUUA 3H03A 4GFRA 4I40A 1AL3A 3UP9A 1NV1A 4XKQA 4XFEA 4L17A 5A5LA 4ZEDA 3PPRA 1KWHA 3HFUA 3KN3A 4WKMA 1B32A 3KSXA 1A99A 2ZNSA 1DTZA 4F2QA 4PQJA 3C31A 3K1PA 1H43A 1LBCA 4XTCQ 4GRKA 1MRPA 1YYZA 4RY1A 5IKBA 3B6TA 4G2ZA 1QKAA 1XHYA 2OBGA 3S9EA 2XWOA 3O2AA 4R73A 3RT6B 3VLVA 2UYEA 4NMYA 4QF9A 3SEYA 1MM7A 1VR5A 4KXPA 4RNSA 5AA1A 4AS4A 1DOTA 3G3JA 4P1LA 1N0TA 2KR0A 2OX3A 2ZYNA 1EYKA 4LQ5A 2R9JA 1AH5A 1I6BA 1DPEA 3HSTA 3PUYE 1FQCA 1EZOA 4N07A 3TTLA 1D4NA 4QFKA 2ZYKA 1SI1A 3GBBA 3IOTA 3MQ9A 3PGFA 1P1NA 1GV8A 3V89B 5KDTB 4O94A 3TUSA 4DI4B 4I9DA 4ZEBA 1DCUA 4YICA 4YAHX 4ONYA 4YMAA 2QPQA 4O3BA 4XIGQ 4QBAA 4MAGA 3SDFA 4QFPA 3U93A 5TPAA 1N84A 3TTRA 4N4UA 3IB0A 4YB6A 5JTYA 5A5XB 3PV0E 5H8HA 4FEDA 1LAFE 2ZNUA 5I2KA 1QULA 1HSJA 4K3FA 5ICQA 3VXBA 4RXLA 4R75A 3U8QA 2XXUA 3TZAA 3IR1A 1GTKA 3QUJA 1QUIA 2NWJA 2Y7PA 1B7UA 4IGTA 3W9VA 1S9TA 3B6QA 4EF2A 4MX6A 4NF6A 3KC0A 2XX9A 2GFEA 3OEKA 5IZZA 1B46A 1B7HA 5EHSA 3CRBA 1FBEA 4BDRA 4OMBA 5F7VA 3OXNA 5I3SA 2Z8EA 1UTHB 1B4ZA 4BDQA 1EZPA 4FBPA 1VFDA 3RQTA 2UVJA 1H44A 2DE4A 4DXBA 3D4CA 4GD5A 1FQEA 3ROJA 4RA1A 3RPLA 2XXXA 1ZJLA 2PT1A 3IJOB 4Z0IA 3I5OA 1RYOA 3FZVA 5I56B 5JK4A 3PU5A 1LFHA 2RF1A 1QUJA 1SW2A 4N81A 1B1HA 2XWIA 2P1SA 3T1BA 5EYGA 2ABHA 1N3XA 1MDP1 2H5YA 4U4SA 1USYE 3FXUA 2GH9A 1J1NA 5AA2D 4G4PA 4LZ8A 5DW8A 1US5A 4HCYA 2ZMBA 4O7IA 4NEDA 1FPFA 5B7DA 1GGGA 1LAGE 4GWXA 3CG1A 3K6UA 1B3HA 4YKPA 3CR9A 4PCDA 1AWBA 3Q26A 4QRZA 3I3VA 3JV9A 2O84X 2QVRA 1OIBA 5BWJA 2QSXA 4ND9A 2XX8A 4EDPA 4N6DA 4OYVA 1MQDA 4RPOA 3MAMA 1P1UA 4NF4B 4F1UA 4ESXA 1AOVA 3TTNA 1II5A 1K9YA 5EQ8A 4PFBA 3ECRA 2M8CA 4G61A 2R71A 2V3TA 3MPLA 4MFIA 4OTEA 4R2BA 4PFUA 1RDYA 1LLSA 4GIZA 2Q89A 4ESWA 4AS5A 2DWIA 4FECA 4ZDMA 4EF1A 1QW0A 1Y3PA 4OVRA 4NF0A 3SERA 1NNFA 3FJ7A 3FVKA 4NG7A 4OEUA 5I2NB 3MUQA 2RC9A 4YKIA 2P2AA 2XXVA 3E79A 4OVQA 4R6HA 4OA4A 1OVTA 3VLUA 3KJTA 4AQ4A 2ALUA 1FBFA 1KA1A 2QRYA 3G3IA 1A7LA 2A5SA 4OVPA 4PE3A 1NMUA 2Y7RA 3QUFA 2P3NA 3T9UA 5DVIA 4THIA 4IO2A 2HEUA 1IMDA 1D9YA 3LV0A 1A40A 1IXIA 4C0RA 3PMXA 4IO4A 2ZYMA 4R6YA 4ZEFA 1PDAA 2G93A 4PGPA 3H06B 4PDHA 1B3EA 3MYUA 4C1TA 4C1UA 2XD2A 1URSA 3MBPA 3OEMA 4P8BA 1NV7A 3K6WA 1SBPA 2Z8DA 3DELB 4DIGA 4OVTA 2FNCA 3TMGA 3HV1A 2Z22A 4R2FA 1A8EA 1H45A 5FHNA 1LCTA 4N6PA 5CMCA 2GHAA 2FYIA 3LC8A 3LR1A 5F1QA 5I57A 4FATA 2GQ1A 5ET7A 3AXFA 1B05A 3DLNA 3HHFA 4H46A 3QSLA 2OWSA 3IB1A 1MS7A 1XC1A 3B7DA 1JEVA 5ET5A 1MPCA 4R6KA 2F6PA 2PFYA 1UIUA 4MHFA 1RKMA 2QJEA 1NV2A 5EYFA 3G3FA 3K1MA 1BIYA 1YAEA 4OZ9A 3UIFA 2ZZWA 3KZGA 2F35A 5ISUA 3MVYA 4N91A 1MXXA 4GX6A 3BBRA 2XXQA 5KCJA 1RYXA 3FJMA 4BDMA 4H5FA 3HCQA 3IK6B 4O7MA 2PX1A 4P3LA 4F3PA 3E78A 4NF8B 3OELA 1SW4A 3KGCA 4U21A 1MXVA 5DTBA 2DE3A 1IMFA 2H98A 5CBRA 5M2VA 4PFRA 3TELA 5EQ7A 3MJNA 3RTWB 5I7IA 3EKIA 4X9TA 4X1BA 2ZZVA 5CRYA 1MQIA 3TAJA 1TFDA 1WVJA 3RGYA 2E1SA 4UA8A 3A29A 2XXYA 4H8IA 4LQ2A 3UGWA 4TOZA 2VHAA 3M3KA 4NHBA 3V5AA 1JW4A 4Q8RA 1KA0A 4X1DA 3C34A 2V25A 4QFLA 4X48A 5IZ3B 1H3DA 3MP6A 2G29A 4BDLA 1I69A 3Q25A 1ZKBA 4JWYA 3SEVA 2F3BA 4GWZA 5DEXA 3PUWE 1HSLA 3MWBA 1SW5A 1MM6A 3P7IA 5DVFA 1WDNA 2HXRA 3T93B 1D9QA 4KFQA 3SKPA 3PD8A 2Q9TA 3IOVA 4LONB 1LBVA 2ZYOA 4JVCA 1B0LA 2GRVA 4R9FA 4MIJA 2O6AA 2Y7IA 4F39A 2AL4A 4TLLB 4RYAA 3KFMA 1KZ8A 3O6HA 1BK4A 5L9OA 4OENA 5TP9B 2UVIA 3U65A 1FBGA 1USYH 2CEYA 4GWWA 5I59A 3ISPA 4OESA 4H8JA 5CMBA 2F6GA 3U72A 4PBHA 1D9VA 2DWHA 4MF3A 3KOTA 1Q9DA 3FASA 5DYHA 2HHMA 5ITOA 3TCHA 1PB9A 3TCFA 4PC9A 2Y84A 4EQ7A 2DOJA 5I59B 4RK2A 4GF8A 3MZ9A 4DDDA 4AB6A 1SPIA 3FVGA 1MPBA 2DVZA 1NKXA 1URDA 2HXWA 4GXAA 4Q0CA 1AIVA 3Q27A 4EXKA 2H4IA 5HM4B 2UYFA 3RN8A 4ZS9A 3VE1B 5ICTA 5ELVA 1YCJA 2X7QA 1B9JA 4U4XA 4DXCA 3R26A 2DDKA 2V3QA 4H65A 2ONSA 2O69A 1TFAA 2F3DA 4G8NA 4OFOA 3MP1A 1MH3A 4OVSA 4Q5TA 4PETA 3TCGA 4JVIA 5LOMA 3B6WA 3MZBA 4GBVA 2FIXA 2VOZA 4HS7A 3OO8A 3EHUA 1EH3A 3MP8A 2DXRA 3G3GA 4GL0A 4I8CA 1B5IA 4P11A 3C35A 1MPDA 4JSOA 4YKKA 3S9MC 3PUZE 4KQPA 4H5GA 3H6TA 2OZZA 3S9LC 3DP8A 2OWTA 5LTCA 2QFLA 3FGSA 4MLVA 3RUMA 1Y1ZA 4EUOA 5TPAB 5DT6A 4MNIA 4DI3D 3LUYA 3ZKLA 5JTYB 1FPDA 5H8HB 2HPGA 2KLFA 5CM6A 4QSEA 5I2KB 2D21A 3OO9A 4GXSB 3PTYA 1ZU0A 1B51A 1FRPA 2QS3A 2V3UA 3OENA 4OWDA 4G77A 4DE8A 1FBDA 1G0IA 3T66A 4F31B 1NUWA 4GLIA 2O51A 3OD7A 4NF6B 3KSJA 3JZJA 2A5TA 1Y3NA 1FQDA 2O1LA 4WXJA 1YZ0A 4OFLA 1LFIA 3NOHA 4N17A 3LSFB 1PB7A 1LBYA 2DWAA 2RINA 3I6VA 1MXUA 4DXUA 4KYEA 3HN0A 2HQ0A 2XXIA 1FTOA 3K1NA 2I48A 3FXRA 3TKDA 2B4MA 4DCYA 3B8BA 2Y5LA 2DXYA 4FIMA 2R8TA 4LVQA 1OVBA 1N7WA 4IO6A 3H6WA 3TQLA 4GVOA 3PPQA 4F18A 2V4CA 2HFBA 5L8DA 3K00A 3RPLB 5FHMA 2CZLA 4X04A 1B1XA 2REGA 3OSQA 1NH7A 1M5FA 4ISUA 5F24A 2CZHA 2XXKA 2DSFA 3IFAA 5FTIA 1S7YA 1FPEA 3SESA 1UTBA 2QVUA 4IY6A 4F2OA 1IMCA 4ELRA 4QFOA 3PUVE 4POWA 2RCAA 1VSOA 3GLBA 4KCCA 3Q28A 1NNTA 3QYTA 1UIVA 4EXLA 1MH4A 4MBPA 4YZZA 3MVXA 1NH8A 1DTGA 3KJ7A 4TLMB 2F78A 1MXWA 4O3CA 4R9GA 1B58A 4LUBA 3T9HB 3MW0A 4PAIA 5ET8A 2P3VA 2D5WA 1I6QA 1OLAA 4ELOA 1B2HA 1PB8A 1MY0A 1LFGA 3TYHA 3KBZA 5IAIA 4PFYA 1FQAA 4HE2A 2THIA 2QMXA 3CFZA 1P1WA 3M8UA 2WYPA 1ZTYA 1NUZA 1OLCA 4FAJA 4KR5A 2PFZA 3H6VA 1XOCA 5K2YA 4QSDA 4GBWA 2REJA 5ESYA 1K9ZA 2Q2AA 3TPAA 1FCKA 1FQBA 1Q35A 4F1YA 1FPJA 4BLAA 4IO3A 5H8SA 3MC2A 5DVJA 1EU8A 3GBAA 4ZE8A 3OO6A 1JVYA 2NXOA 5FHOA 3RLFE 2F7CA 4M1VA 3U92A 3TDJA 1B7ZA 3HPIA 1IQ7A 3IO6A 3G3KA 2QS4A 3RTFB 4GOTA 2WBBA 2Q88A 2O7UA 4N13A 3RYDA 4F22A 2E0SA 2H9BA 5ITPA 3FV1A 3GZGA 4RK9A 2HAVA 2V93A 1POTA 2ONRA 1BTJA 2FIEA 4FJPA 3CG3A 1B5JA 4MH5A 2DE2A 4IO7A 1XI6A 4H0WA 4HW8A 1OQHA 3H3GA 1T0KA 4MLQA 3RPWA 2YLNA 3OSRA 4F29A 2PYYA 3CI8A 4YU0A 3MZ1A 3TTMA 1MQGA 1ELJA 3SZPA 3VFJA 2Q8JA 2VT5A 1SYIA 1JNFA 2ANJA 3K4UA 1LEVA 2Z23A 3ILTB 2X7PA 4OEVA 4P56A 4PFIA 1YXIA 1Q1KA 3RNNA 2F36A 4I62A 5I57B 3IOUA 3H4ZA 3A3CA 5EYHA 4P0GA 4GX3A 2QS1A 5I58A 1B3LA 4N8YA 3TTKA 5HBCA 2RC7A 2XXWA 5FTHA 3SEXA 2F7BA 4HXVA 5T3JA 2R6GE 1FBPA 4PAKA 2F5XA 1G0HA 4EQBA 1YTVA 5I58B 3F11A 2I6EA 3ZS6A 1B6HA 4HE0A 3T9XB 2RKMA 4GX4A 3D4GA 3FXQA 1NV5A 3OO7A 4YB7A 5FBPA 3BIHA 4N15A 5H8FA 4N6KA 3W15C 3KG2A 2VD2A 5KCJB 4G68A 4N8GA 1MY2A 2I0CA 2I4BA 5ET6A 3S4UA 4OETA 2IA4A 3V8XB 3C32A 3N94A 2O7IA 2D3IA 1JW1A 3LUZA 5AA4A 3W9WA 4U23A 1TXFA 1P1OA 2ESNA 1ZIUA 1GR2A 2V84A 5H8NA 2XA5A 2AYSA 4U1OA 4XF5A 1XS5A 1FSAA 3PPOA 2QL3A 1QKBA 2VP1A 3CHGA 3MVZA 1URGA 2DQVA 3CSGA 3PMVA 5CMMA 4RPNA 5K2XA 5AA4B 2XHDA 3DP4A 3PMWA 2ONKE 1R9LA 1CB6A 2DYXA 3A3UA 4NF5A 4LP2B 5CC2A 4NE4A 3T0JA 2VPNA 3SEUA 3QMFA 4U2RA 3M3LA 2XXRA 3UORA 4NTLA 3BKIB 1NI9A 1A55A 4O3AA 1B0HA 2L5VA 3IL1B 3FATA 2GHBA 1WODA 3H6UA 1NV3A 1R9QA 2O1MA 3E13X 3USDA 4OFJA 4BDNA 5DEXB 1MG1A 3MVWA 4IR8A 3C33A 1JQFA 1Y3QA 3PD9A 1S50A 3D1RA 1EYIA 4G8HA 5B70A 1FTKA 2YJPA 1ANFA 1OQGA 1XVXA 4R74A 3TQWA 3FJGA 5L9SA 3O97A 4GL8A 3OOAA 4H45A 3N6TA 4LN5A 2VGQA 4FEBA 5AA2A 2QS2A 1VE4A 3IO4A 3A09A 2QMWA 3KC1A 1M5EA 1FTAA 1D3KA 2NVUB 1O64A 2PT2A 4OXVA 2VPOA 1FTLA 4E0WA 1QUKA 2CMOA 4NAPA 1P1QA 4IY5A 4GWYA 1L5TA 2HZKA 4NN3A 2Z8FA 3U94A 4H6DA 1FJ6A 1DBZA 1MY4A 2Y7WA 3LSWA 1MQHA 1LGBC 1NNPA 1SI0A 2DP8A 3KOSA 3O6GA 4IGRA 1NFTA 4MMPA 2PMSA 1ZLQA 1M5BA 1INPA 1PEBA 1GVCA 3BFUA 1IITA 2F34A 4PFWA 1IXGA 4PBQA 1JEUA 4XKRA 4ELQA 3UA8A 3T96B 2I4CA 3UK4A 4IB2A 1CE2A 4F1VA 3O6IA 1US4A 4KPTA 4JXIA 1R6ZA 1JW5A 1MY3A 1N3WA 3IFCA 3IOWA 3UN6A 4P1EA 3K01A 4PF6A 2PVUA 1O63A 1PC3A 5KDTA 2CEXA 3MPKA 4UACA 5HPQA 4GWSA 5CI5A 2HCAA 3R7XA 1TWYA 2LAOA 4LZ7A 2VD3A 1N76A 5EQ9A 4YMBA 4JB7A 1Y9UA 1PBQA 3V83A 5J16A 1TT1A 3ONMA 4ECFA 1N04A 2UXAA
chains in the Genus database with same CATH topology
4U1ZA 5A5XA 5AA3A 4G68C 2I58A 3TFLA 2ZXTA 3QAXA 4ZEKA 2OCUA 3PPPA 3VDFA 1IXCA 3KEIA 5H8QA 5I84A 3RT8A 3DM0A 1MXZA 2B65A 1Z7NE 4F3GA 2F7AA 1B5HA 1LCFA 1P99A 1SVXB 3IJXB 2OK2A 4F19A 5H8QB 1LAXA 2DS9A 2RCBA 3O66A 5JEIA 1UTHA 5CMKA 3O28A 4JSDA 4FORA 4KD5A 1OMPA 1Y4CA 3LBSA 3EPEA 1A54A 2NUVA 4HTGA 3ZSFA 1QVSA 2A5TB 1B4HA 1B52A 4IO5A 2OJTA 1SYHA 3FVNA 3TODA 5I56A 3S9NC 4EQ9A 1H76A 2XD3A 2P0SA 5KZTA 5TU0A 4PFTA 1YPNA 4Q30B 5J1DA 1LSTA 1B3FA 3EHSA 3HO7A 2BJJX 3CFXA 1LB9A 1MXYA 3K6VA 4OQOA 3CIJA 3VVFA 1FTMA 3WAEA 3PUXE 1QJMA 3LSXA 4KCDA 4ZZEA 1UTBB 3ODBA 4TQUQ 2WKYA 3SETA 2UVGA 3SEWA 3IAZA 4F3BA 1MQJA 2I3VA 3RY3A 5L9MA 3BFTA 2H25A 1M5DA 4XXUA 4NF4A 4DLDA 3S2VA 3EN3A 2X26A 2Y7KA 1HSEA 2UVHA 3EF7A 1SQYA 1EZ9A 1ZMGA 3T9VA 1M5CA 3KN7A 5AE4A 3K0VA 2ZNTA 3CFLA 4NWDA 2FA7A 1BP5A 1Z7ME 2Q2CA 1IZ1A 1BKAA 4ELPA 3K6XA 1XVYA 4PE5B 2PBWA 3EHTA 3ZKKA 5I2NA 4KYSA 4JBZA 4P0IA 3TEPA 3IORA 4JWOA 2HAUA 4XKPA 3G7WA 4YB5A 1LB8A 2I3WA 3KN8A 1B40A 4KI0E 3CSBA 3N5LA 1PBPA 1B3GA 3IB2A 4H1XA 1Y4TA 1Y1MA 3T22A 4KYDA 4LATA 4POXA 3QK6A 1IIWA 4NWCA 4QFNA 1JETA 4RJZA 2B3FA 2OLBA 1R1NA 2DWJA 2DVCA 3VXCA 1JVXA 4H67A 3VLWA 3R6UA 4AB5A 1UQWA 2I0BA 4HCWA 2O68A 1DPPA 2XX7A 1MDQA 2RC8A 2XXTA 4G8MA 4QHQA 3N26A 4E0XA 1SD3A 2YPNA 1SW1A 1VFEA 2HZLA 1N7XA 1A8FA 4QSCA 1F9BA 1SDXA 3QIMA 3G3HA 3VVDA 4U22A 3WAFA 1ATGA 2H99A 4GQOA 2IEEA 1ZBMA 3C9HA 1LAHE 4OHNA 4M4GA 2XXHA 3QXMA 3O9PA 3L6HA 4ZZAA 3E9XA 3FUZA 1IEJA 3HHGA 3CVGA 4NF8A 4KHZE 3C4MA 3KBRA 3N6UA 1DSNA 3VV5A 3L6GA 3U1OA 2AIXA 4GWOA 1O7TA 4OVJA 4ZE9A 4ZECA 1I6AA 4PP0A 3Q29A 5H8FB 3EQ1A 4JDFA 1Y20A 4G68B 4WEDA 4ZEIA 3C36A 3H7MA 4XKNA 3THIA 1IUDA 1AMFA 4LA9A 4WEPA 3VVEA 3E3KA 3LSLA 1LBBA 1NNKA 1IXHA 5H8NB 5EHMA 3PPNA 4OERA 3FVOA 3DP6A 4R72A 1NL5A 1DMBA 2W7YA 4JWXA 2I49A 3JYRA 4F3SA 1MY1A 1XT8A 3GXAA 4NF5B 4FE8A 5CBSA 4Z7EA 3K2DA 4DCXA 2F97A 5TP9A 2B3BA 3FV2A 2NOOA 1FTJA 3K02A 2F8DA 1FQFA 3M3FA 3O29A 4YKJA 4I1DA 3E4RA 4DZ1A 1BLFA 2AL5A 3IX1A 4BDOA 1POY1 3ILUB 3OMBA 3FD3A 2XXPA 5AA2B 4LZ5A 1FW0A 3FIRA 5BUUA 3H03A 4GFRA 1AL3A 3UP9A 4XKQA 4L17A 4ZEDA 3PPRA 1KWHA 4WKMA 3KN3A 1B32A 3KSXA 1A99A 2ZNSA 1DTZA 4F2QA 4PQJA 3C31A 3K1PA 1H43A 1LBCA 4XTCQ 4GRKA 1MRPA 4RY1A 5IKBA 3B6TA 4G2ZA 1QKAA 1XHYA 2OBGA 3S9EA 3O2AA 4R73A 3RT6B 3VLVA 2UYEA 4NMYA 4QF9A 3SEYA 1MM7A 1VR5A 4RNSA 5AA1A 1DOTA 3G3JA 1N0TA 2ZYNA 4LQ5A 2R9JA 1AH5A 1I6BA 1DPEA 3HSTA 3PUYE 1FQCA 1EZOA 4N07A 3TTLA 1D4NA 4QFKA 2ZYKA 1SI1A 3GBBA 3IOTA 3MQ9A 3PGFA 1P1NA 1GV8A 3V89B 5KDTB 3TUSA 4I9DA 4ZEBA 4YICA 4YAHX 4ONYA 4YMAA 2QPQA 4O3BA 4XIGQ 3SDFA 4QFPA 3U93A 5TPAA 1N84A 3TTRA 3IB0A 4YB6A 5JTYA 5A5XB 3PV0E 5H8HA 4FEDA 1LAFE 2ZNUA 5I2KA 1QULA 1HSJA 4K3FA 5ICQA 3VXBA 4RXLA 4R75A 3U8QA 2XXUA 3TZAA 3IR1A 1GTKA 3QUJA 1QUIA 2NWJA 2Y7PA 1B7UA 4IGTA 3W9VA 1S9TA 3B6QA 4EF2A 4NF6A 2XX9A 2GFEA 3OEKA 1B46A 1B7HA 5EHSA 3CRBA 4BDRA 4OMBA 5F7VA 3OXNA 2Z8EA 1UTHB 1B4ZA 4BDQA 1EZPA 1VFDA 3RQTA 2UVJA 1H44A 2DE4A 4DXBA 3D4CA 4GD5A 1FQEA 4RA1A 2XXXA 1ZJLA 2PT1A 3IJOB 4Z0IA 3I5OA 1RYOA 3FZVA 5I56B 5JK4A 3PU5A 1LFHA 2RF1A 1QUJA 1SW2A 1B1HA 2P1SA 2ABHA 1N3XA 1MDP1 2H5YA 4U4SA 1USYE 3FXUA 2GH9A 1J1NA 5AA2D 4G4PA 4LZ8A 1US5A 4HCYA 2ZMBA 4NEDA 5B7DA 1GGGA 1LAGE 3CG1A 3K6UA 1B3HA 4YKPA 3CR9A 3Q26A 4QRZA 3I3VA 3JV9A 2O84X 1OIBA 5BWJA 2QSXA 4ND9A 2XX8A 4EDPA 4OYVA 1MQDA 4RPOA 3MAMA 1P1UA 4NF4B 4F1UA 4ESXA 1AOVA 3TTNA 1II5A 3ECRA 2M8CA 2R71A 2V3TA 3MPLA 4MFIA 4OTEA 4R2BA 4PFUA 1LLSA 4GIZA 2Q89A 4ESWA 2DWIA 4FECA 4ZDMA 4EF1A 1QW0A 1Y3PA 3SERA 1NNFA 3FJ7A 3FVKA 4OEUA 5I2NB 3MUQA 2RC9A 4YKIA 2P2AA 2XXVA 4R6HA 3VLUA 1OVTA 3KJTA 4AQ4A 2ALUA 2QRYA 3G3IA 1A7LA 2A5SA 1NMUA 2Y7RA 3QUFA 3T9UA 5DVIA 4THIA 4IO2A 2HEUA 1D9YA 1A40A 1IXIA 4C0RA 3PMXA 4IO4A 2ZYMA 4R6YA 4ZEFA 1PDAA 2G93A 3H06B 1B3EA 4C1TA 4C1UA 2XD2A 1URSA 3MBPA 3OEMA 3K6WA 1SBPA 2Z8DA 3DELB 4DIGA 2FNCA 3TMGA 3HV1A 2Z22A 4R2FA 1A8EA 1H45A 5FHNA 1LCTA 4N6PA 5CMCA 2GHAA 2FYIA 3LC8A 3LR1A 5F1QA 5I57A 4FATA 3AXFA 1B05A 3DLNA 3HHFA 3QSLA 2OWSA 3IB1A 1MS7A 1XC1A 3B7DA 1JEVA 1MPCA 4R6KA 2F6PA 1UIUA 1RKMA 2QJEA 5EYFA 3G3FA 3K1MA 1BIYA 1YAEA 4OZ9A 3UIFA 3KZGA 2F35A 5ISUA 3MVYA 1MXXA 3BBRA 2XXQA 5KCJA 1RYXA 3FJMA 4BDMA 4H5FA 3HCQA 3IK6B 2PX1A 4F3PA 4NF8B 3OELA 1SW4A 3KGCA 4U21A 1MXVA 5DTBA 2DE3A 2H98A 5CBRA 5M2VA 3TELA 3MJNA 3RTWB 4X9TA 4X1BA 5CRYA 1MQIA 3TAJA 1TFDA 1WVJA 3RGYA 2E1SA 4UA8A 2XXYA 4H8IA 4LQ2A 3UGWA 4TOZA 2VHAA 3M3KA 3V5AA 1JW4A 4Q8RA 4X1DA 3C34A 2V25A 4QFLA 4X48A 1H3DA 3MP6A 2G29A 4BDLA 1I69A 3Q25A 1ZKBA 4JWYA 3SEVA 5DEXA 3PUWE 1HSLA 3MWBA 1SW5A 1MM6A 3P7IA 5DVFA 1WDNA 3T93B 4KFQA 3SKPA 3PD8A 2Q9TA 3IOVA 4LONB 2ZYOA 4R9FA 1B0LA 2GRVA 2O6AA 2Y7IA 4F39A 2AL4A 4TLLB 4RYAA 3KFMA 3O6HA 5L9OA 4OENA 5TP9B 2UVIA 1USYH 5I59A 4OESA 4H8JA 5CMBA 2F6GA 3U72A 1D9VA 2DWHA 4MF3A 3KOTA 3FASA 5DYHA 5ITOA 3TCHA 1PB9A 3TCFA 2Y84A 4EQ7A 2DOJA 5I59B 4RK2A 4GF8A 3MZ9A 4DDDA 4AB6A 3FVGA 1MPBA 2DVZA 1NKXA 1URDA 2HXWA 4GXAA 4Q0CA 1AIVA 3Q27A 4EXKA 2H4IA 5HM4B 2UYFA 3RN8A 4ZS9A 3VE1B 5ICTA 5ELVA 1YCJA 2X7QA 1B9JA 4U4XA 4DXCA 3R26A 2V3QA 4H65A 2ONSA 2O69A 1TFAA 4G8NA 4OFOA 3MP1A 1MH3A 4Q5TA 4PETA 3TCGA 5LOMA 3B6WA 3MZBA 2VOZA 4HS7A 3OO8A 3EHUA 1EH3A 3MP8A 2DXRA 3G3GA 4GL0A 4I8CA 1B5IA 4P11A 3C35A 1MPDA 4JSOA 4YKKA 3S9MC 3PUZE 4KQPA 4H5GA 3H6TA 2OZZA 3S9LC 3DP8A 2OWTA 3FGSA 4MLVA 3RUMA 1Y1ZA 4EUOA 5TPAB 5DT6A 3LUYA 3ZKLA 5JTYB 5H8HB 2KLFA 5CM6A 4QSEA 5I2KB 2D21A 3OO9A 4GXSB 1ZU0A 1B51A 2QS3A 2V3UA 3OENA 4OWDA 4G77A 4DE8A 3T66A 4F31B 4GLIA 2O51A 3OD7A 4NF6B 3KSJA 3JZJA 2A5TA 1Y3NA 1FQDA 2O1LA 4WXJA 4OFLA 1LFIA 3LSFB 1PB7A 2DWAA 2RINA 3I6VA 1MXUA 4DXUA 4KYEA 3HN0A 2HQ0A 2XXIA 1FTOA 3K1NA 2I48A 3FXRA 3TKDA 4DCYA 2DXYA 4FIMA 4LVQA 1OVBA 1N7WA 4IO6A 3H6WA 3TQLA 4GVOA 3PPQA 4F18A 2HFBA 5L8DA 3K00A 5FHMA 2CZLA 1B1XA 2REGA 3OSQA 1NH7A 1M5FA 4ISUA 2DSFA 5FTIA 1S7YA 3SESA 1UTBA 4IY6A 4F2OA 4ELRA 4QFOA 3PUVE 4POWA 2RCAA 1VSOA 3GLBA 4KCCA 3Q28A 1NNTA 3QYTA 1UIVA 4EXLA 1MH4A 4MBPA 4YZZA 3MVXA 1NH8A 1DTGA 3KJ7A 4TLMB 2F78A 1MXWA 4O3CA 4R9GA 1B58A 4LUBA 3T9HB 3MW0A 2D5WA 1I6QA 1OLAA 4ELOA 1B2HA 1PB8A 1MY0A 1LFGA 3TYHA 5IAIA 4PFYA 1FQAA 2THIA 2QMXA 3CFZA 1P1WA 3M8UA 1ZTYA 1OLCA 4FAJA 4KR5A 3H6VA 1XOCA 5K2YA 4QSDA 2REJA 2Q2AA 3TPAA 1FCKA 1FQBA 1Q35A 4F1YA 4BLAA 4IO3A 5H8SA 3MC2A 5DVJA 1EU8A 3GBAA 4ZE8A 3OO6A 1JVYA 2NXOA 5FHOA 3RLFE 2F7CA 4M1VA 3U92A 3TDJA 1B7ZA 3HPIA 1IQ7A 3IO6A 3G3KA 2QS4A 3RTFB 4GOTA 2Q88A 2O7UA 4N13A 4F22A 2E0SA 2H9BA 5ITPA 3FV1A 3GZGA 4RK9A 2HAVA 2V93A 1POTA 2ONRA 1BTJA 4FJPA 3CG3A 1B5JA 4MH5A 2DE2A 4IO7A 4H0WA 4HW8A 1OQHA 3H3GA 1T0KA 4MLQA 3RPWA 2YLNA 3OSRA 4F29A 2PYYA 3CI8A 4YU0A 3MZ1A 3TTMA 1MQGA 1ELJA 3VFJA 2Q8JA 1SYIA 1JNFA 2ANJA 3K4UA 2Z23A 3ILTB 2X7PA 4OEVA 1Q1KA 3RNNA 2F36A 4I62A 5I57B 3IOUA 3H4ZA 3A3CA 4P0GA 2QS1A 5I58A 1B3LA 3TTKA 5HBCA 2RC7A 2XXWA 5FTHA 3SEXA 2F7BA 2R6GE 2F5XA 4EQBA 1YTVA 5I58B 3F11A 2I6EA 3ZS6A 1B6HA 3T9XB 2RKMA 3D4GA 3FXQA 3OO7A 4YB7A 5H8FA 3W15C 3KG2A 2VD2A 5KCJB 4G68A 1MY2A 2I0CA 2I4BA 3S4UA 4OETA 2IA4A 3V8XB 3C32A 3N94A 2O7IA 2D3IA 1JW1A 5AA4A 3W9WA 4U23A 1TXFA 1P1OA 2ESNA 1ZIUA 1GR2A 2V84A 5H8NA 2AYSA 4U1OA 1XS5A 3PPOA 2QL3A 1QKBA 2VP1A 3MVZA 1URGA 2DQVA 3CSGA 3PMVA 5CMMA 4RPNA 5K2XA 5AA4B 2XHDA 3DP4A 3PMWA 2ONKE 1R9LA 1CB6A 2DYXA 3A3UA 4NF5A 4LP2B 5CC2A 4NE4A 3SEUA 4U2RA 3M3LA 2XXRA 3UORA 4NTLA 3BKIB 1A55A 4O3AA 1B0HA 3IL1B 3FATA 2GHBA 1WODA 3H6UA 1R9QA 2O1MA 3E13X 3USDA 4OFJA 4BDNA 5DEXB 1MG1A 3MVWA 3C33A 1JQFA 1Y3QA 3PD9A 1S50A 4G8HA 5B70A 1FTKA 2YJPA 1ANFA 1OQGA 1XVXA 4R74A 3TQWA 3FJGA 5L9SA 3O97A 4GL8A 3OOAA 3N6TA 2VGQA 4FEBA 5AA2A 2QS2A 1VE4A 3IO4A 3A09A 2QMWA 1M5EA 1D3KA 2NVUB 1O64A 2PT2A 4OXVA 1FTLA 4E0WA 1QUKA 2CMOA 1P1QA 4IY5A 1L5TA 2HZKA 2Z8FA 3U94A 4H6DA 2Y7WA 1MY4A 3LSWA 1MQHA 1LGBC 1NNPA 1SI0A 2DP8A 3KOSA 3O6GA 4IGRA 1NFTA 2PMSA 1ZLQA 1M5BA 1PEBA 1GVCA 3BFUA 1IITA 2F34A 4PFWA 1IXGA 1JEUA 4XKRA 4ELQA 3UA8A 3T96B 2I4CA 3UK4A 4IB2A 1CE2A 4F1VA 3O6IA 1US4A 4KPTA 4JXIA 1R6ZA 1JW5A 1MY3A 1N3WA 3IOWA 3UN6A 3K01A 2PVUA 1O63A 1PC3A 5KDTA 3MPKA 4UACA 5HPQA 5CI5A 2HCAA 3R7XA 1TWYA 2LAOA 4LZ7A 2VD3A 1N76A 4YMBA 4JB7A 1Y9UA 1PBQA 3V83A 1TT1A 3ONMA 4ECFA 1N04A 2UXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U1Z A;  5A5X A;  5AA3 A;  4G68 C;  2I58 A;  3TFL A;  2ZXT A;  3QAX A;  4ZEK A;  2OCU A;  3PPP A;  3VDF A;  1IXC A;  3KEI A;  5H8Q A;  5I84 A;  3RT8 A;  3DM0 A;  1MXZ A;  2B65 A;  1Z7N E;  4F3G A;  2F7A A;  1B5H A;  1LCF A;  1P99 A;  1SVX B;  3IJX B;  2OK2 A;  4F19 A;  5H8Q B;  1LAX A;  2DS9 A;  2RCB A;  3O66 A;  5JEI A;  1UTH A;  5CMK A;  3O28 A;  4JSD A;  4FOR A;  4KD5 A;  1OMP A;  1Y4C A;  3LBS A;  3EPE A;  1A54 A;  2NUV A;  4HTG A;  3ZSF A;  1QVS A;  2A5T B;  1B4H A;  1B52 A;  4IO5 A;  2OJT A;  1SYH A;  3FVN A;  3TOD A;  5I56 A;  3S9N C;  4EQ9 A;  1H76 A;  2XD3 A;  2P0S A;  5KZT A;  5TU0 A;  4PFT A;  1YPN A;  4Q30 B;  5J1D A;  1LST A;  1B3F A;  3EHS A;  3HO7 A;  2BJJ X;  3CFX A;  1LB9 A;  1MXY A;  3K6V A;  4OQO A;  3CIJ A;  3VVF A;  1FTM A;  3WAE A;  3PUX E;  1QJM A;  3LSX A;  4KCD A;  4ZZE A;  1UTB B;  3ODB A;  4TQU Q;  2WKY A;  3SET A;  2UVG A;  3SEW A;  3IAZ A;  4F3B A;  1MQJ A;  2I3V A;  3RY3 A;  5L9M A;  3BFT A;  2H25 A;  1M5D A;  4XXU A;  4NF4 A;  4DLD A;  3S2V A;  3EN3 A;  2X26 A;  2Y7K A;  1HSE A;  2UVH A;  3EF7 A;  1SQY A;  1EZ9 A;  1ZMG A;  3T9V A;  1M5C A;  3KN7 A;  5AE4 A;  3K0V A;  2ZNT A;  3CFL A;  4NWD A;  2FA7 A;  1BP5 A;  1Z7M E;  2Q2C A;  1IZ1 A;  1BKA A;  4ELP A;  3K6X A;  1XVY A;  4PE5 B;  2PBW A;  3EHT A;  3ZKK A;  5I2N A;  4KYS A;  4JBZ A;  4P0I A;  3TEP A;  3IOR A;  4JWO A;  2HAU A;  4XKP A;  3G7W A;  4YB5 A;  1LB8 A;  2I3W A;  3KN8 A;  1B40 A;  4KI0 E;  3CSB A;  3N5L A;  1PBP A;  1B3G A;  3IB2 A;  4H1X A;  1Y4T A;  1Y1M A;  3T22 A;  4KYD A;  4LAT A;  4POX A;  3QK6 A;  1IIW A;  4NWC A;  4QFN A;  1JET A;  4RJZ A;  2B3F A;  2OLB A;  1R1N A;  2DWJ A;  2DVC A;  3VXC A;  1JVX A;  4H67 A;  3VLW A;  3R6U A;  4AB5 A;  1UQW A;  2I0B A;  4HCW A;  2O68 A;  1DPP A;  2XX7 A;  1MDQ A;  2RC8 A;  2XXT A;  4G8M A;  4QHQ A;  3N26 A;  4E0X A;  1SD3 A;  2YPN A;  1SW1 A;  1VFE A;  2HZL A;  1N7X A;  1A8F A;  4QSC A;  1F9B A;  1SDX A;  3QIM A;  3G3H A;  3VVD A;  4U22 A;  3WAF A;  1ATG A;  2H99 A;  4GQO A;  2IEE A;  1ZBM A;  3C9H A;  1LAH E;  4OHN A;  4M4G A;  2XXH A;  3QXM A;  3O9P A;  3L6H A;  4ZZA A;  3E9X A;  3FUZ A;  1IEJ A;  3HHG A;  3CVG A;  4NF8 A;  4KHZ E;  3C4M A;  3KBR A;  3N6U A;  1DSN A;  3VV5 A;  3L6G A;  3U1O A;  2AIX A;  4GWO A;  1O7T A;  4OVJ A;  4ZE9 A;  4ZEC A;  1I6A A;  4PP0 A;  3Q29 A;  5H8F B;  3EQ1 A;  4JDF A;  1Y20 A;  4G68 B;  4WED A;  4ZEI A;  3C36 A;  3H7M A;  4XKN A;  3THI A;  1IUD A;  1AMF A;  4LA9 A;  4WEP A;  3VVE A;  3E3K A;  3LSL A;  1LBB A;  1NNK A;  1IXH A;  5H8N B;  5EHM A;  3PPN A;  4OER A;  3FVO A;  3DP6 A;  4R72 A;  1NL5 A;  1DMB A;  2W7Y A;  4JWX A;  2I49 A;  3JYR A;  4F3S A;  1MY1 A;  1XT8 A;  3GXA A;  4NF5 B;  4FE8 A;  5CBS A;  4Z7E A;  3K2D A;  4DCX A;  2F97 A;  5TP9 A;  2B3B A;  3FV2 A;  2NOO A;  1FTJ A;  3K02 A;  2F8D A;  1FQF A;  3M3F A;  3O29 A;  4YKJ A;  4I1D A;  3E4R A;  4DZ1 A;  1BLF A;  2AL5 A;  3IX1 A;  4BDO A;  1POY 1;  3ILU B;  3OMB A;  3FD3 A;  2XXP A;  5AA2 B;  4LZ5 A;  1FW0 A;  3FIR A;  5BUU A;  3H03 A;  4GFR A;  1AL3 A;  3UP9 A;  4XKQ A;  4L17 A;  4ZED A;  3PPR A;  1KWH A;  4WKM A;  3KN3 A;  1B32 A;  3KSX A;  1A99 A;  2ZNS A;  1DTZ A;  4F2Q A;  4PQJ A;  3C31 A;  3K1P A;  1H43 A;  1LBC A;  4XTC Q;  4GRK A;  1MRP A;  4RY1 A;  5IKB A;  3B6T A;  4G2Z A;  1QKA A;  1XHY A;  2OBG A;  3S9E A;  3O2A A;  4R73 A;  3RT6 B;  3VLV A;  2UYE A;  4NMY A;  4QF9 A;  3SEY A;  1MM7 A;  1VR5 A;  4RNS A;  5AA1 A;  1DOT A;  3G3J A;  1N0T A;  2ZYN A;  4LQ5 A;  2R9J A;  1AH5 A;  1I6B A;  1DPE A;  3HST A;  3PUY E;  1FQC A;  1EZO A;  4N07 A;  3TTL A;  1D4N A;  4QFK A;  2ZYK A;  1SI1 A;  3GBB A;  3IOT A;  3MQ9 A;  3PGF A;  1P1N A;  1GV8 A;  3V89 B;  5KDT B;  3TUS A;  4I9D A;  4ZEB A;  4YIC A;  4YAH X;  4ONY A;  4YMA A;  2QPQ A;  4O3B A;  4XIG Q;  3SDF A;  4QFP A;  3U93 A;  5TPA A;  1N84 A;  3TTR A;  3IB0 A;  4YB6 A;  5JTY A;  5A5X B;  3PV0 E;  5H8H A;  4FED A;  1LAF E;  2ZNU A;  5I2K A;  1QUL A;  1HSJ A;  4K3F A;  5ICQ A;  3VXB A;  4RXL A;  4R75 A;  3U8Q A;  2XXU A;  3TZA A;  3IR1 A;  1GTK A;  3QUJ A;  1QUI A;  2NWJ A;  2Y7P A;  1B7U A;  4IGT A;  3W9V A;  1S9T A;  3B6Q A;  4EF2 A;  4NF6 A;  2XX9 A;  2GFE A;  3OEK A;  1B46 A;  1B7H A;  5EHS A;  3CRB A;  4BDR A;  4OMB A;  5F7V A;  3OXN A;  2Z8E A;  1UTH B;  1B4Z A;  4BDQ A;  1EZP A;  1VFD A;  3RQT A;  2UVJ A;  1H44 A;  2DE4 A;  4DXB A;  3D4C A;  4GD5 A;  1FQE A;  4RA1 A;  2XXX A;  1ZJL A;  2PT1 A;  3IJO B;  4Z0I A;  3I5O A;  1RYO A;  3FZV A;  5I56 B;  5JK4 A;  3PU5 A;  1LFH A;  2RF1 A;  1QUJ A;  1SW2 A;  1B1H A;  2P1S A;  2ABH A;  1N3X A;  1MDP 1;  2H5Y A;  4U4S A;  1USY E;  3FXU A;  2GH9 A;  1J1N A;  5AA2 D;  4G4P A;  4LZ8 A;  1US5 A;  4HCY A;  2ZMB A;  4NED A;  5B7D A;  1GGG A;  1LAG E;  3CG1 A;  3K6U A;  1B3H A;  4YKP A;  3CR9 A;  3Q26 A;  4QRZ A;  3I3V A;  3JV9 A;  2O84 X;  1OIB A;  5BWJ A;  2QSX A;  4ND9 A;  2XX8 A;  4EDP A;  4OYV A;  1MQD A;  4RPO A;  3MAM A;  1P1U A;  4NF4 B;  4F1U A;  4ESX A;  1AOV A;  3TTN A;  1II5 A;  3ECR A;  2M8C A;  2R71 A;  2V3T A;  3MPL A;  4MFI A;  4OTE A;  4R2B A;  4PFU A;  1LLS A;  4GIZ A;  2Q89 A;  4ESW A;  2DWI A;  4FEC A;  4ZDM A;  4EF1 A;  1QW0 A;  1Y3P A;  3SER A;  1NNF A;  3FJ7 A;  3FVK A;  4OEU A;  5I2N B;  3MUQ A;  2RC9 A;  4YKI A;  2P2A A;  2XXV A;  4R6H A;  3VLU A;  1OVT A;  3KJT A;  4AQ4 A;  2ALU A;  2QRY A;  3G3I A;  1A7L A;  2A5S A;  1NMU A;  2Y7R A;  3QUF A;  3T9U A;  5DVI A;  4THI A;  4IO2 A;  2HEU A;  1D9Y A;  1A40 A;  1IXI A;  4C0R A;  3PMX A;  4IO4 A;  2ZYM A;  4R6Y A;  4ZEF A;  1PDA A;  2G93 A;  3H06 B;  1B3E A;  4C1T A;  4C1U A;  2XD2 A;  1URS A;  3MBP A;  3OEM A;  3K6W A;  1SBP A;  2Z8D A;  3DEL B;  4DIG A;  2FNC A;  3TMG A;  3HV1 A;  2Z22 A;  4R2F A;  1A8E A;  1H45 A;  5FHN A;  1LCT A;  4N6P A;  5CMC A;  2GHA A;  2FYI A;  3LC8 A;  3LR1 A;  5F1Q A;  5I57 A;  4FAT A;  3AXF A;  1B05 A;  3DLN A;  3HHF A;  3QSL A;  2OWS A;  3IB1 A;  1MS7 A;  1XC1 A;  3B7D A;  1JEV A;  1MPC A;  4R6K A;  2F6P A;  1UIU A;  1RKM A;  2QJE A;  5EYF A;  3G3F A;  3K1M A;  1BIY A;  1YAE A;  4OZ9 A;  3UIF A;  3KZG A;  2F35 A;  5ISU A;  3MVY A;  1MXX A;  3BBR A;  2XXQ A;  5KCJ A;  1RYX A;  3FJM A;  4BDM A;  4H5F A;  3HCQ A;  3IK6 B;  2PX1 A;  4F3P A;  4NF8 B;  3OEL A;  1SW4 A;  3KGC A;  4U21 A;  1MXV A;  5DTB A;  2DE3 A;  2H98 A;  5CBR A;  5M2V A;  3TEL A;  3MJN A;  3RTW B;  4X9T A;  4X1B A;  5CRY A;  1MQI A;  3TAJ A;  1TFD A;  1WVJ A;  3RGY A;  2E1S A;  4UA8 A;  2XXY A;  4H8I A;  4LQ2 A;  3UGW A;  4TOZ A;  2VHA A;  3M3K A;  3V5A A;  1JW4 A;  4Q8R A;  4X1D A;  3C34 A;  2V25 A;  4QFL A;  4X48 A;  1H3D A;  3MP6 A;  2G29 A;  4BDL A;  1I69 A;  3Q25 A;  1ZKB A;  4JWY A;  3SEV A;  5DEX A;  3PUW E;  1HSL A;  3MWB A;  1SW5 A;  1MM6 A;  3P7I A;  5DVF A;  1WDN A;  3T93 B;  4KFQ A;  3SKP A;  3PD8 A;  2Q9T A;  3IOV A;  4LON B;  2ZYO A;  4R9F A;  1B0L A;  2GRV A;  2O6A A;  2Y7I A;  4F39 A;  2AL4 A;  4TLL B;  4RYA A;  3KFM A;  3O6H A;  5L9O A;  4OEN A;  5TP9 B;  2UVI A;  1USY H;  5I59 A;  4OES A;  4H8J A;  5CMB A;  2F6G A;  3U72 A;  1D9V A;  2DWH A;  4MF3 A;  3KOT A;  3FAS A;  5DYH A;  5ITO A;  3TCH A;  1PB9 A;  3TCF A;  2Y84 A;  4EQ7 A;  2DOJ A;  5I59 B;  4RK2 A;  4GF8 A;  3MZ9 A;  4DDD A;  4AB6 A;  3FVG A;  1MPB A;  2DVZ A;  1NKX A;  1URD A;  2HXW A;  4GXA A;  4Q0C A;  1AIV A;  3Q27 A;  4EXK A;  2H4I A;  5HM4 B;  2UYF A;  3RN8 A;  4ZS9 A;  3VE1 B;  5ICT A;  5ELV A;  1YCJ A;  2X7Q A;  1B9J A;  4U4X A;  4DXC A;  3R26 A;  2V3Q A;  4H65 A;  2ONS A;  2O69 A;  1TFA A;  4G8N A;  4OFO A;  3MP1 A;  1MH3 A;  4Q5T A;  4PET A;  3TCG A;  5LOM A;  3B6W A;  3MZB A;  2VOZ A;  4HS7 A;  3OO8 A;  3EHU A;  1EH3 A;  3MP8 A;  2DXR A;  3G3G A;  4GL0 A;  4I8C A;  1B5I A;  4P11 A;  3C35 A;  1MPD A;  4JSO A;  4YKK A;  3S9M C;  3PUZ E;  4KQP A;  4H5G A;  3H6T A;  2OZZ A;  3S9L C;  3DP8 A;  2OWT A;  3FGS A;  4MLV A;  3RUM A;  1Y1Z A;  4EUO A;  5TPA B;  5DT6 A;  3LUY A;  3ZKL A;  5JTY B;  5H8H B;  2KLF A;  5CM6 A;  4QSE A;  5I2K B;  2D21 A;  3OO9 A;  4GXS B;  1ZU0 A;  1B51 A;  2QS3 A;  2V3U A;  3OEN A;  4OWD A;  4G77 A;  4DE8 A;  3T66 A;  4F31 B;  4GLI A;  2O51 A;  3OD7 A;  4NF6 B;  3KSJ A;  3JZJ A;  2A5T A;  1Y3N A;  1FQD A;  2O1L A;  4WXJ A;  4OFL A;  1LFI A;  3LSF B;  1PB7 A;  2DWA A;  2RIN A;  3I6V A;  1MXU A;  4DXU A;  4KYE A;  3HN0 A;  2HQ0 A;  2XXI A;  1FTO A;  3K1N A;  2I48 A;  3FXR A;  3TKD A;  4DCY A;  2DXY A;  4FIM A;  4LVQ A;  1OVB A;  1N7W A;  4IO6 A;  3H6W A;  3TQL A;  4GVO A;  3PPQ A;  4F18 A;  2HFB A;  5L8D A;  3K00 A;  5FHM A;  2CZL A;  1B1X A;  2REG A;  3OSQ A;  1NH7 A;  1M5F A;  4ISU A;  2DSF A;  5FTI A;  1S7Y A;  3SES A;  1UTB A;  4IY6 A;  4F2O A;  4ELR A;  4QFO A;  3PUV E;  4POW A;  2RCA A;  1VSO A;  3GLB A;  4KCC A;  3Q28 A;  1NNT A;  3QYT A;  1UIV A;  4EXL A;  1MH4 A;  4MBP A;  4YZZ A;  3MVX A;  1NH8 A;  1DTG A;  3KJ7 A;  4TLM B;  2F78 A;  1MXW A;  4O3C A;  4R9G A;  1B58 A;  4LUB A;  3T9H B;  3MW0 A;  2D5W A;  1I6Q A;  1OLA A;  4ELO A;  1B2H A;  1PB8 A;  1MY0 A;  1LFG A;  3TYH A;  5IAI A;  4PFY A;  1FQA A;  2THI A;  2QMX A;  3CFZ A;  1P1W A;  3M8U A;  1ZTY A;  1OLC A;  4FAJ A;  4KR5 A;  3H6V A;  1XOC A;  5K2Y A;  4QSD A;  2REJ A;  2Q2A A;  3TPA A;  1FCK A;  1FQB A;  1Q35 A;  4F1Y A;  4BLA A;  4IO3 A;  5H8S A;  3MC2 A;  5DVJ A;  1EU8 A;  3GBA A;  4ZE8 A;  3OO6 A;  1JVY A;  2NXO A;  5FHO A;  3RLF E;  2F7C A;  4M1V A;  3U92 A;  3TDJ A;  1B7Z A;  3HPI A;  1IQ7 A;  3IO6 A;  3G3K A;  2QS4 A;  3RTF B;  4GOT A;  2Q88 A;  2O7U A;  4N13 A;  4F22 A;  2E0S A;  2H9B A;  5ITP A;  3FV1 A;  3GZG A;  4RK9 A;  2HAV A;  2V93 A;  1POT A;  2ONR A;  1BTJ A;  4FJP A;  3CG3 A;  1B5J A;  4MH5 A;  2DE2 A;  4IO7 A;  4H0W A;  4HW8 A;  1OQH A;  3H3G A;  1T0K A;  4MLQ A;  3RPW A;  2YLN A;  3OSR A;  4F29 A;  2PYY A;  3CI8 A;  4YU0 A;  3MZ1 A;  3TTM A;  1MQG A;  1ELJ A;  3VFJ A;  2Q8J A;  1SYI A;  1JNF A;  2ANJ A;  3K4U A;  2Z23 A;  3ILT B;  2X7P A;  4OEV A;  1Q1K A;  3RNN A;  2F36 A;  4I62 A;  5I57 B;  3IOU A;  3H4Z A;  3A3C A;  4P0G A;  2QS1 A;  5I58 A;  1B3L A;  3TTK A;  5HBC A;  2RC7 A;  2XXW A;  5FTH A;  3SEX A;  2F7B A;  2R6G E;  2F5X A;  4EQB A;  1YTV A;  5I58 B;  3F11 A;  2I6E A;  3ZS6 A;  1B6H A;  3T9X B;  2RKM A;  3D4G A;  3FXQ A;  3OO7 A;  4YB7 A;  5H8F A;  3W15 C;  3KG2 A;  2VD2 A;  5KCJ B;  4G68 A;  1MY2 A;  2I0C A;  2I4B A;  3S4U A;  4OET A;  2IA4 A;  3V8X B;  3C32 A;  3N94 A;  2O7I A;  2D3I A;  1JW1 A;  5AA4 A;  3W9W A;  4U23 A;  1TXF A;  1P1O A;  2ESN A;  1ZIU A;  1GR2 A;  2V84 A;  5H8N A;  2AYS A;  4U1O A;  1XS5 A;  3PPO A;  2QL3 A;  1QKB A;  2VP1 A;  3MVZ A;  1URG A;  2DQV A;  3CSG A;  3PMV A;  5CMM A;  4RPN A;  5K2X A;  5AA4 B;  2XHD A;  3DP4 A;  3PMW A;  2ONK E;  1R9L A;  1CB6 A;  2DYX A;  3A3U A;  4NF5 A;  4LP2 B;  5CC2 A;  4NE4 A;  3SEU A;  4U2R A;  3M3L A;  2XXR A;  3UOR A;  4NTL A;  3BKI B;  1A55 A;  4O3A A;  1B0H A;  3IL1 B;  3FAT A;  2GHB A;  1WOD A;  3H6U A;  1R9Q A;  2O1M A;  3E13 X;  3USD A;  4OFJ A;  4BDN A;  5DEX B;  1MG1 A;  3MVW A;  3C33 A;  1JQF A;  1Y3Q A;  3PD9 A;  1S50 A;  4G8H A;  5B70 A;  1FTK A;  2YJP A;  1ANF A;  1OQG A;  1XVX A;  4R74 A;  3TQW A;  3FJG A;  5L9S A;  3O97 A;  4GL8 A;  3OOA A;  3N6T A;  2VGQ A;  4FEB A;  5AA2 A;  2QS2 A;  1VE4 A;  3IO4 A;  3A09 A;  2QMW A;  1M5E A;  1D3K A;  2NVU B;  1O64 A;  2PT2 A;  4OXV A;  1FTL A;  4E0W A;  1QUK A;  2CMO A;  1P1Q A;  4IY5 A;  1L5T A;  2HZK A;  2Z8F A;  3U94 A;  4H6D A;  2Y7W A;  1MY4 A;  3LSW A;  1MQH A;  1LGB C;  1NNP A;  1SI0 A;  2DP8 A;  3KOS A;  3O6G A;  4IGR A;  1NFT A;  2PMS A;  1ZLQ A;  1M5B A;  1PEB A;  1GVC A;  3BFU A;  1IIT A;  2F34 A;  4PFW A;  1IXG A;  1JEU A;  4XKR A;  4ELQ A;  3UA8 A;  3T96 B;  2I4C A;  3UK4 A;  4IB2 A;  1CE2 A;  4F1V A;  3O6I A;  1US4 A;  4KPT A;  4JXI A;  1R6Z A;  1JW5 A;  1MY3 A;  1N3W A;  3IOW A;  3UN6 A;  3K01 A;  2PVU A;  1O63 A;  1PC3 A;  5KDT A;  3MPK A;  4UAC A;  5HPQ A;  5CI5 A;  2HCA A;  3R7X A;  1TWY A;  2LAO A;  4LZ7 A;  2VD3 A;  1N76 A;  4YMB A;  4JB7 A;  1Y9U A;  1PBQ A;  3V83 A;  1TT1 A;  3ONM A;  4ECF A;  1N04 A;  2UXA A; 
#chains in the Genus database with same CATH topology
 4U1Z A;  5A5X A;  5I5P A;  5AA3 A;  4G68 C;  2I58 A;  1EYJ A;  3TFL A;  2ZXT A;  3QAX A;  4ZEK A;  2OCU A;  3PPP A;  2FHY A;  3VDF A;  1IXC A;  3KEI A;  5H8Q A;  1RDZ A;  5I84 A;  3RT8 A;  3DM0 A;  1MXZ A;  2B65 A;  1Z7N E;  4F3G A;  2CZK A;  2F7A A;  1NUY A;  1B5H A;  4PAF A;  1LCF A;  1P99 A;  1SVX B;  1CNQ A;  1FPI A;  2OK2 A;  3IJX B;  1DK4 A;  4MNP A;  2B4L A;  4F19 A;  5H8Q B;  1LAX A;  2DS9 A;  2RCB A;  1LBZ A;  3O66 A;  5JEI A;  1UTH A;  2MKZ A;  5CMK A;  3O28 A;  4JSD A;  4FOR A;  4KD5 A;  4MCO A;  1OMP A;  1Y4C A;  3LBS A;  3EPE A;  1A54 A;  2OWZ A;  4P47 A;  2NUV A;  1FPB A;  4HTG A;  3ZSF A;  1QVS A;  2A5T B;  1B4H A;  1B52 A;  4IO5 A;  2OJT A;  1SYH A;  3FVN A;  3TOD A;  5I56 A;  3S9N C;  4EQ9 A;  1H76 A;  2XD3 A;  4JVD A;  2JJK A;  2P0S A;  5KZT A;  5TU0 A;  4PFT A;  1YPN A;  4Q30 B;  5J1D A;  1LST A;  1B3F A;  3EHS A;  1QGX A;  3HO7 A;  2BJJ X;  3CFX A;  1LB9 A;  1FBH A;  1MXY A;  3K6V A;  4OQO A;  4MJO A;  3CIJ A;  3FXB A;  3VVF A;  1FTM A;  2FBP A;  4P9K A;  3WAE A;  2WYK A;  2CZI A;  3PUX E;  1QJM A;  4PDD A;  3LSX A;  2XWV A;  4NGU A;  4KCD A;  4ZZE A;  1UTB B;  3ODB A;  4TQU Q;  2WKY A;  3SET A;  2UVG A;  3SEW A;  3IAZ A;  4F3B A;  4MNC A;  1MQJ A;  2I3V A;  2KQZ A;  3RY3 A;  5L9M A;  3BFT A;  2H25 A;  1M5D A;  4XXU A;  4NF4 A;  4DLD A;  4NX1 A;  4PGN A;  3S2V A;  3EN3 A;  2X26 A;  2Y7K A;  1NV4 A;  1HSE A;  2UVH A;  3EF7 A;  1SQY A;  1EZ9 A;  1ZMG A;  3T9V A;  1M5C A;  3KN7 A;  5AE4 A;  3K0V A;  2ZNT A;  3CFL A;  2PCR A;  4NWD A;  2FA7 A;  1BP5 A;  3B50 A;  1Z7M E;  2Q2C A;  1IZ1 A;  1BKA A;  3BIG A;  4ELP A;  3K6X A;  1XVY A;  1FJ9 A;  1FPL A;  4PE5 B;  2PBW A;  3EHT A;  3ZKK A;  5I2N A;  2BJI A;  4KYS A;  4PTK A;  4JBZ A;  4P0I A;  3TEP A;  3IOR A;  4JWO A;  2HAU A;  4XKP A;  3G7W A;  4YB5 A;  1LB8 A;  2I3W A;  3KN8 A;  1B40 A;  4KI0 E;  3CSB A;  3N5L A;  1PBP A;  3FBP A;  4MEV A;  1B3G A;  4UAB A;  3IB2 A;  4H1X A;  1VDW A;  1Y4T A;  1Y1M A;  3T22 A;  1LBW A;  4KYD A;  4LAT A;  4POX A;  5EQA A;  3QK6 A;  1FPG A;  1IIW A;  4HE1 A;  4NWC A;  4QFN A;  5LDZ A;  4X8R A;  1NV6 A;  1JET A;  4RJZ A;  4XEQ A;  2B3F A;  2OLB A;  1R1N A;  2DWJ A;  5IGA A;  4OAN A;  2Y5K A;  2DVC A;  3VXC A;  1JVX A;  4H67 A;  3VLW A;  3R6U A;  4AB5 A;  1UQW A;  2I0B A;  4HCW A;  1NUX A;  2O68 A;  1DPP A;  2XX7 A;  4I3Y A;  4I3E A;  1MDQ A;  2RC8 A;  2XXT A;  4O8M A;  4G8M A;  4QHQ A;  3N26 A;  4E0X A;  1SD3 A;  2YPN A;  1SW1 A;  1JP4 A;  1VFE A;  2HZL A;  2Q8M A;  1N7X A;  1A8F A;  4QSC A;  1F9B A;  1SDX A;  3QIM A;  3MST A;  3G3H A;  3VVD A;  4U22 A;  3WAF A;  1RDX A;  1ATG A;  2H99 A;  5IM2 A;  4GQO A;  5IZ1 A;  2IEE A;  2WEF A;  4QXD A;  1ZBM A;  1NV0 A;  3C9H A;  1LAH E;  4OHN A;  4M4G A;  2QVV A;  2XXH A;  2FVZ A;  3QXM A;  4GWU A;  3O9P A;  3L6H A;  4ZZA A;  3E9X A;  3FUZ A;  1IEJ A;  2WBD A;  3HHG A;  3CVG A;  4NF8 A;  4KHZ E;  3C4M A;  3KBR A;  3N6U A;  1DSN A;  4PF8 A;  3GYY A;  3VV5 A;  3L6G A;  3U1O A;  2AIX A;  4GWO A;  1O7T A;  4OVJ A;  1IME A;  4ZE9 A;  4ZEC A;  1FBC A;  1I6A A;  4PP0 A;  3Q29 A;  5H8F B;  3EQ1 A;  4JDF A;  2ZZX A;  1Y20 A;  4G68 B;  4WED A;  4ZEI A;  3C36 A;  3H7M A;  4XKN A;  3THI A;  1IUD A;  1AMF A;  2WX9 A;  4LA9 A;  4WEP A;  3VVE A;  3E3K A;  3LSL A;  1LBB A;  5IZ3 A;  1NNK A;  1IXH A;  5H8N B;  5EHM A;  3PPN A;  4OER A;  3FVO A;  3DP6 A;  4R72 A;  1IMB A;  1NL5 A;  1DMB A;  2W7Y A;  4JWX A;  1IMA A;  2I49 A;  4NQ8 A;  3JYR A;  2XWK A;  4F3S A;  1MY1 A;  1XT8 A;  3GXA A;  4NF5 B;  4FE8 A;  5CBS A;  4Z7E A;  3K2D A;  4DCX A;  2F97 A;  5TP9 A;  2B3B A;  3FV2 A;  2NOO A;  1FTJ A;  2Q74 A;  3K02 A;  2F8D A;  1FQF A;  3M3F A;  3O29 A;  4YKJ A;  4I1D A;  3E4R A;  4DZ1 A;  1BLF A;  2AL5 A;  3IX1 A;  4BDO A;  1POY 1;  3ILU B;  1FPK A;  3OMB A;  3FD3 A;  2XXP A;  1LBX A;  5AA2 B;  4LZ5 A;  1FW0 A;  3FIR A;  5BUU A;  3H03 A;  4GFR A;  4I40 A;  1AL3 A;  3UP9 A;  1NV1 A;  4XKQ A;  4XFE A;  4L17 A;  5A5L A;  4ZED A;  3PPR A;  1KWH A;  3HFU A;  3KN3 A;  4WKM A;  1B32 A;  3KSX A;  1A99 A;  2ZNS A;  1DTZ A;  4F2Q A;  4PQJ A;  3C31 A;  3K1P A;  1H43 A;  1LBC A;  4XTC Q;  4GRK A;  1MRP A;  1YYZ A;  4RY1 A;  5IKB A;  3B6T A;  4G2Z A;  1QKA A;  1XHY A;  2OBG A;  3S9E A;  2XWO A;  3O2A A;  4R73 A;  3RT6 B;  3VLV A;  2UYE A;  4NMY A;  4QF9 A;  3SEY A;  1MM7 A;  1VR5 A;  4KXP A;  4RNS A;  5AA1 A;  4AS4 A;  1DOT A;  3G3J A;  4P1L A;  1N0T A;  2KR0 A;  2OX3 A;  2ZYN A;  1EYK A;  4LQ5 A;  2R9J A;  1AH5 A;  1I6B A;  1DPE A;  3HST A;  3PUY E;  1FQC A;  1EZO A;  4N07 A;  3TTL A;  1D4N A;  4QFK A;  2ZYK A;  1SI1 A;  3GBB A;  3IOT A;  3MQ9 A;  3PGF A;  1P1N A;  1GV8 A;  3V89 B;  5KDT B;  4O94 A;  3TUS A;  4DI4 B;  4I9D A;  4ZEB A;  1DCU A;  4YIC A;  4YAH X;  4ONY A;  4YMA A;  2QPQ A;  4O3B A;  4XIG Q;  4QBA A;  4MAG A;  3SDF A;  4QFP A;  3U93 A;  5TPA A;  1N84 A;  3TTR A;  4N4U A;  3IB0 A;  4YB6 A;  5JTY A;  5A5X B;  3PV0 E;  5H8H A;  4FED A;  1LAF E;  2ZNU A;  5I2K A;  1QUL A;  1HSJ A;  4K3F A;  5ICQ A;  3VXB A;  4RXL A;  4R75 A;  3U8Q A;  2XXU A;  3TZA A;  3IR1 A;  1GTK A;  3QUJ A;  1QUI A;  2NWJ A;  2Y7P A;  1B7U A;  4IGT A;  3W9V A;  1S9T A;  3B6Q A;  4EF2 A;  4MX6 A;  4NF6 A;  3KC0 A;  2XX9 A;  2GFE A;  3OEK A;  5IZZ A;  1B46 A;  1B7H A;  5EHS A;  3CRB A;  1FBE A;  4BDR A;  4OMB A;  5F7V A;  3OXN A;  5I3S A;  2Z8E A;  1UTH B;  1B4Z A;  4BDQ A;  1EZP A;  4FBP A;  1VFD A;  3RQT A;  2UVJ A;  1H44 A;  2DE4 A;  4DXB A;  3D4C A;  4GD5 A;  1FQE A;  3ROJ A;  4RA1 A;  3RPL A;  2XXX A;  1ZJL A;  2PT1 A;  3IJO B;  4Z0I A;  3I5O A;  1RYO A;  3FZV A;  5I56 B;  5JK4 A;  3PU5 A;  1LFH A;  2RF1 A;  1QUJ A;  1SW2 A;  4N81 A;  1B1H A;  2XWI A;  2P1S A;  3T1B A;  5EYG A;  2ABH A;  1N3X A;  1MDP 1;  2H5Y A;  4U4S A;  1USY E;  3FXU A;  2GH9 A;  1J1N A;  5AA2 D;  4G4P A;  4LZ8 A;  5DW8 A;  1US5 A;  4HCY A;  2ZMB A;  4O7I A;  4NED A;  1FPF A;  5B7D A;  1GGG A;  1LAG E;  4GWX A;  3CG1 A;  3K6U A;  1B3H A;  4YKP A;  3CR9 A;  4PCD A;  1AWB A;  3Q26 A;  4QRZ A;  3I3V A;  3JV9 A;  2O84 X;  2QVR A;  1OIB A;  5BWJ A;  2QSX A;  4ND9 A;  2XX8 A;  4EDP A;  4N6D A;  4OYV A;  1MQD A;  4RPO A;  3MAM A;  1P1U A;  4NF4 B;  4F1U A;  4ESX A;  1AOV A;  3TTN A;  1II5 A;  1K9Y A;  5EQ8 A;  4PFB A;  3ECR A;  2M8C A;  4G61 A;  2R71 A;  2V3T A;  3MPL A;  4MFI A;  4OTE A;  4R2B A;  4PFU A;  1RDY A;  1LLS A;  4GIZ A;  2Q89 A;  4ESW A;  4AS5 A;  2DWI A;  4FEC A;  4ZDM A;  4EF1 A;  1QW0 A;  1Y3P A;  4OVR A;  4NF0 A;  3SER A;  1NNF A;  3FJ7 A;  3FVK A;  4NG7 A;  4OEU A;  5I2N B;  3MUQ A;  2RC9 A;  4YKI A;  2P2A A;  2XXV A;  3E79 A;  4OVQ A;  4R6H A;  4OA4 A;  1OVT A;  3VLU A;  3KJT A;  4AQ4 A;  2ALU A;  1FBF A;  1KA1 A;  2QRY A;  3G3I A;  1A7L A;  2A5S A;  4OVP A;  4PE3 A;  1NMU A;  2Y7R A;  3QUF A;  2P3N A;  3T9U A;  5DVI A;  4THI A;  4IO2 A;  2HEU A;  1IMD A;  1D9Y A;  3LV0 A;  1A40 A;  1IXI A;  4C0R A;  3PMX A;  4IO4 A;  2ZYM A;  4R6Y A;  4ZEF A;  1PDA A;  2G93 A;  4PGP A;  3H06 B;  4PDH A;  1B3E A;  3MYU A;  4C1T A;  4C1U A;  2XD2 A;  1URS A;  3MBP A;  3OEM A;  4P8B A;  1NV7 A;  3K6W A;  1SBP A;  2Z8D A;  3DEL B;  4DIG A;  4OVT A;  2FNC A;  3TMG A;  3HV1 A;  2Z22 A;  4R2F A;  1A8E A;  1H45 A;  5FHN A;  1LCT A;  4N6P A;  5CMC A;  2GHA A;  2FYI A;  3LC8 A;  3LR1 A;  5F1Q A;  5I57 A;  4FAT A;  2GQ1 A;  5ET7 A;  3AXF A;  1B05 A;  3DLN A;  3HHF A;  4H46 A;  3QSL A;  2OWS A;  3IB1 A;  1MS7 A;  1XC1 A;  3B7D A;  1JEV A;  5ET5 A;  1MPC A;  4R6K A;  2F6P A;  2PFY A;  1UIU A;  4MHF A;  1RKM A;  2QJE A;  1NV2 A;  5EYF A;  3G3F A;  3K1M A;  1BIY A;  1YAE A;  4OZ9 A;  3UIF A;  2ZZW A;  3KZG A;  2F35 A;  5ISU A;  3MVY A;  4N91 A;  1MXX A;  4GX6 A;  3BBR A;  2XXQ A;  5KCJ A;  1RYX A;  3FJM A;  4BDM A;  4H5F A;  3HCQ A;  3IK6 B;  4O7M A;  2PX1 A;  4P3L A;  4F3P A;  3E78 A;  4NF8 B;  3OEL A;  1SW4 A;  3KGC A;  4U21 A;  1MXV A;  5DTB A;  2DE3 A;  1IMF A;  2H98 A;  5CBR A;  5M2V A;  4PFR A;  3TEL A;  5EQ7 A;  3MJN A;  3RTW B;  5I7I A;  3EKI A;  4X9T A;  4X1B A;  2ZZV A;  5CRY A;  1MQI A;  3TAJ A;  1TFD A;  1WVJ A;  3RGY A;  2E1S A;  4UA8 A;  3A29 A;  2XXY A;  4H8I A;  4LQ2 A;  3UGW A;  4TOZ A;  2VHA A;  3M3K A;  4NHB A;  3V5A A;  1JW4 A;  4Q8R A;  1KA0 A;  4X1D A;  3C34 A;  2V25 A;  4QFL A;  4X48 A;  5IZ3 B;  1H3D A;  3MP6 A;  2G29 A;  4BDL A;  1I69 A;  3Q25 A;  1ZKB A;  4JWY A;  3SEV A;  2F3B A;  4GWZ A;  5DEX A;  3PUW E;  1HSL A;  3MWB A;  1SW5 A;  1MM6 A;  3P7I A;  5DVF A;  1WDN A;  2HXR A;  3T93 B;  1D9Q A;  4KFQ A;  3SKP A;  3PD8 A;  2Q9T A;  3IOV A;  4LON B;  1LBV A;  2ZYO A;  4JVC A;  1B0L A;  2GRV A;  4R9F A;  4MIJ A;  2O6A A;  2Y7I A;  4F39 A;  2AL4 A;  4TLL B;  4RYA A;  3KFM A;  1KZ8 A;  3O6H A;  1BK4 A;  5L9O A;  4OEN A;  5TP9 B;  2UVI A;  3U65 A;  1FBG A;  1USY H;  2CEY A;  4GWW A;  5I59 A;  3ISP A;  4OES A;  4H8J A;  5CMB A;  2F6G A;  3U72 A;  4PBH A;  1D9V A;  2DWH A;  4MF3 A;  3KOT A;  1Q9D A;  3FAS A;  5DYH A;  2HHM A;  5ITO A;  3TCH A;  1PB9 A;  3TCF A;  4PC9 A;  2Y84 A;  4EQ7 A;  2DOJ A;  5I59 B;  4RK2 A;  4GF8 A;  3MZ9 A;  4DDD A;  4AB6 A;  1SPI A;  3FVG A;  1MPB A;  2DVZ A;  1NKX A;  1URD A;  2HXW A;  4GXA A;  4Q0C A;  1AIV A;  3Q27 A;  4EXK A;  2H4I A;  5HM4 B;  2UYF A;  3RN8 A;  4ZS9 A;  3VE1 B;  5ICT A;  5ELV A;  1YCJ A;  2X7Q A;  1B9J A;  4U4X A;  4DXC A;  3R26 A;  2DDK A;  2V3Q A;  4H65 A;  2ONS A;  2O69 A;  1TFA A;  2F3D A;  4G8N A;  4OFO A;  3MP1 A;  1MH3 A;  4OVS A;  4Q5T A;  4PET A;  3TCG A;  4JVI A;  5LOM A;  3B6W A;  3MZB A;  4GBV A;  2FIX A;  2VOZ A;  4HS7 A;  3OO8 A;  3EHU A;  1EH3 A;  3MP8 A;  2DXR A;  3G3G A;  4GL0 A;  4I8C A;  1B5I A;  4P11 A;  3C35 A;  1MPD A;  4JSO A;  4YKK A;  3S9M C;  3PUZ E;  4KQP A;  4H5G A;  3H6T A;  2OZZ A;  3S9L C;  3DP8 A;  2OWT A;  5LTC A;  2QFL A;  3FGS A;  4MLV A;  3RUM A;  1Y1Z A;  4EUO A;  5TPA B;  5DT6 A;  4MNI A;  4DI3 D;  3LUY A;  3ZKL A;  5JTY B;  1FPD A;  5H8H B;  2HPG A;  2KLF A;  5CM6 A;  4QSE A;  5I2K B;  2D21 A;  3OO9 A;  4GXS B;  3PTY A;  1ZU0 A;  1B51 A;  1FRP A;  2QS3 A;  2V3U A;  3OEN A;  4OWD A;  4G77 A;  4DE8 A;  1FBD A;  1G0I A;  3T66 A;  4F31 B;  1NUW A;  4GLI A;  2O51 A;  3OD7 A;  4NF6 B;  3KSJ A;  3JZJ A;  2A5T A;  1Y3N A;  1FQD A;  2O1L A;  4WXJ A;  1YZ0 A;  4OFL A;  1LFI A;  3NOH A;  4N17 A;  3LSF B;  1PB7 A;  1LBY A;  2DWA A;  2RIN A;  3I6V A;  1MXU A;  4DXU A;  4KYE A;  3HN0 A;  2HQ0 A;  2XXI A;  1FTO A;  3K1N A;  2I48 A;  3FXR A;  3TKD A;  2B4M A;  4DCY A;  3B8B A;  2Y5L A;  2DXY A;  4FIM A;  2R8T A;  4LVQ A;  1OVB A;  1N7W A;  4IO6 A;  3H6W A;  3TQL A;  4GVO A;  3PPQ A;  4F18 A;  2V4C A;  2HFB A;  5L8D A;  3K00 A;  3RPL B;  5FHM A;  2CZL A;  4X04 A;  1B1X A;  2REG A;  3OSQ A;  1NH7 A;  1M5F A;  4ISU A;  5F24 A;  2CZH A;  2XXK A;  2DSF A;  3IFA A;  5FTI A;  1S7Y A;  1FPE A;  3SES A;  1UTB A;  2QVU A;  4IY6 A;  4F2O A;  1IMC A;  4ELR A;  4QFO A;  3PUV E;  4POW A;  2RCA A;  1VSO A;  3GLB A;  4KCC A;  3Q28 A;  1NNT A;  3QYT A;  1UIV A;  4EXL A;  1MH4 A;  4MBP A;  4YZZ A;  3MVX A;  1NH8 A;  1DTG A;  3KJ7 A;  4TLM B;  2F78 A;  1MXW A;  4O3C A;  4R9G A;  1B58 A;  4LUB A;  3T9H B;  3MW0 A;  4PAI A;  5ET8 A;  2P3V A;  2D5W A;  1I6Q A;  1OLA A;  4ELO A;  1B2H A;  1PB8 A;  1MY0 A;  1LFG A;  3TYH A;  3KBZ A;  5IAI A;  4PFY A;  1FQA A;  4HE2 A;  2THI A;  2QMX A;  3CFZ A;  1P1W A;  3M8U A;  2WYP A;  1ZTY A;  1NUZ A;  1OLC A;  4FAJ A;  4KR5 A;  2PFZ A;  3H6V A;  1XOC A;  5K2Y A;  4QSD A;  4GBW A;  2REJ A;  5ESY A;  1K9Z A;  2Q2A A;  3TPA A;  1FCK A;  1FQB A;  1Q35 A;  4F1Y A;  1FPJ A;  4BLA A;  4IO3 A;  5H8S A;  3MC2 A;  5DVJ A;  1EU8 A;  3GBA A;  4ZE8 A;  3OO6 A;  1JVY A;  2NXO A;  5FHO A;  3RLF E;  2F7C A;  4M1V A;  3U92 A;  3TDJ A;  1B7Z A;  3HPI A;  1IQ7 A;  3IO6 A;  3G3K A;  2QS4 A;  3RTF B;  4GOT A;  2WBB A;  2Q88 A;  2O7U A;  4N13 A;  3RYD A;  4F22 A;  2E0S A;  2H9B A;  5ITP A;  3FV1 A;  3GZG A;  4RK9 A;  2HAV A;  2V93 A;  1POT A;  2ONR A;  1BTJ A;  2FIE A;  4FJP A;  3CG3 A;  1B5J A;  4MH5 A;  2DE2 A;  4IO7 A;  1XI6 A;  4H0W A;  4HW8 A;  1OQH A;  3H3G A;  1T0K A;  4MLQ A;  3RPW A;  2YLN A;  3OSR A;  4F29 A;  2PYY A;  3CI8 A;  4YU0 A;  3MZ1 A;  3TTM A;  1MQG A;  1ELJ A;  3SZP A;  3VFJ A;  2Q8J A;  2VT5 A;  1SYI A;  1JNF A;  2ANJ A;  3K4U A;  1LEV A;  2Z23 A;  3ILT B;  2X7P A;  4OEV A;  4P56 A;  4PFI A;  1YXI A;  1Q1K A;  3RNN A;  2F36 A;  4I62 A;  5I57 B;  3IOU A;  3H4Z A;  3A3C A;  5EYH A;  4P0G A;  4GX3 A;  2QS1 A;  5I58 A;  1B3L A;  4N8Y A;  3TTK A;  5HBC A;  2RC7 A;  2XXW A;  5FTH A;  3SEX A;  2F7B A;  4HXV A;  5T3J A;  2R6G E;  1FBP A;  4PAK A;  2F5X A;  1G0H A;  4EQB A;  1YTV A;  5I58 B;  3F11 A;  2I6E A;  3ZS6 A;  1B6H A;  4HE0 A;  3T9X B;  2RKM A;  4GX4 A;  3D4G A;  3FXQ A;  1NV5 A;  3OO7 A;  4YB7 A;  5FBP A;  3BIH A;  4N15 A;  5H8F A;  4N6K A;  3W15 C;  3KG2 A;  2VD2 A;  5KCJ B;  4G68 A;  4N8G A;  1MY2 A;  2I0C A;  2I4B A;  5ET6 A;  3S4U A;  4OET A;  2IA4 A;  3V8X B;  3C32 A;  3N94 A;  2O7I A;  2D3I A;  1JW1 A;  3LUZ A;  5AA4 A;  3W9W A;  4U23 A;  1TXF A;  1P1O A;  2ESN A;  1ZIU A;  1GR2 A;  2V84 A;  5H8N A;  2XA5 A;  2AYS A;  4U1O A;  4XF5 A;  1XS5 A;  1FSA A;  3PPO A;  2QL3 A;  1QKB A;  2VP1 A;  3CHG A;  3MVZ A;  1URG A;  2DQV A;  3CSG A;  3PMV A;  5CMM A;  4RPN A;  5K2X A;  5AA4 B;  2XHD A;  3DP4 A;  3PMW A;  2ONK E;  1R9L A;  1CB6 A;  2DYX A;  3A3U A;  4NF5 A;  4LP2 B;  5CC2 A;  4NE4 A;  3T0J A;  2VPN A;  3SEU A;  3QMF A;  4U2R A;  3M3L A;  2XXR A;  3UOR A;  4NTL A;  3BKI B;  1NI9 A;  1A55 A;  4O3A A;  1B0H A;  2L5V A;  3IL1 B;  3FAT A;  2GHB A;  1WOD A;  3H6U A;  1NV3 A;  1R9Q A;  2O1M A;  3E13 X;  3USD A;  4OFJ A;  4BDN A;  5DEX B;  1MG1 A;  3MVW A;  4IR8 A;  3C33 A;  1JQF A;  1Y3Q A;  3PD9 A;  1S50 A;  3D1R A;  1EYI A;  4G8H A;  5B70 A;  1FTK A;  2YJP A;  1ANF A;  1OQG A;  1XVX A;  4R74 A;  3TQW A;  3FJG A;  5L9S A;  3O97 A;  4GL8 A;  3OOA A;  4H45 A;  3N6T A;  4LN5 A;  2VGQ A;  4FEB A;  5AA2 A;  2QS2 A;  1VE4 A;  3IO4 A;  3A09 A;  2QMW A;  3KC1 A;  1M5E A;  1FTA A;  1D3K A;  2NVU B;  1O64 A;  2PT2 A;  4OXV A;  2VPO A;  1FTL A;  4E0W A;  1QUK A;  2CMO A;  4NAP A;  1P1Q A;  4IY5 A;  4GWY A;  1L5T A;  2HZK A;  4NN3 A;  2Z8F A;  3U94 A;  4H6D A;  1FJ6 A;  1DBZ A;  1MY4 A;  2Y7W A;  3LSW A;  1MQH A;  1LGB C;  1NNP A;  1SI0 A;  2DP8 A;  3KOS A;  3O6G A;  4IGR A;  1NFT A;  4MMP A;  2PMS A;  1ZLQ A;  1M5B A;  1INP A;  1PEB A;  1GVC A;  3BFU A;  1IIT A;  2F34 A;  4PFW A;  1IXG A;  4PBQ A;  1JEU A;  4XKR A;  4ELQ A;  3UA8 A;  3T96 B;  2I4C A;  3UK4 A;  4IB2 A;  1CE2 A;  4F1V A;  3O6I A;  1US4 A;  4KPT A;  4JXI A;  1R6Z A;  1JW5 A;  1MY3 A;  1N3W A;  3IFC A;  3IOW A;  3UN6 A;  4P1E A;  3K01 A;  4PF6 A;  2PVU A;  1O63 A;  1PC3 A;  5KDT A;  2CEX A;  3MPK A;  4UAC A;  5HPQ A;  4GWS A;  5CI5 A;  2HCA A;  3R7X A;  1TWY A;  2LAO A;  4LZ7 A;  2VD3 A;  1N76 A;  5EQ9 A;  4YMB A;  4JB7 A;  1Y9U A;  1PBQ A;  3V83 A;  5J16 A;  1TT1 A;  3ONM A;  4ECF A;  1N04 A;  2UXA A; 
#chains in the Genus database with same CATH homology
 4U1Z A;  5A5X A;  5AA3 A;  4G68 C;  2I58 A;  3TFL A;  2ZXT A;  3QAX A;  4ZEK A;  2OCU A;  3PPP A;  3VDF A;  1IXC A;  3KEI A;  5H8Q A;  5I84 A;  3RT8 A;  3DM0 A;  1MXZ A;  2B65 A;  1Z7N E;  4F3G A;  2F7A A;  1B5H A;  1LCF A;  1P99 A;  1SVX B;  3IJX B;  2OK2 A;  4F19 A;  5H8Q B;  1LAX A;  2DS9 A;  2RCB A;  3O66 A;  5JEI A;  1UTH A;  5CMK A;  3O28 A;  4JSD A;  4FOR A;  4KD5 A;  1OMP A;  1Y4C A;  3LBS A;  3EPE A;  1A54 A;  2NUV A;  4HTG A;  3ZSF A;  1QVS A;  2A5T B;  1B4H A;  1B52 A;  4IO5 A;  2OJT A;  1SYH A;  3FVN A;  3TOD A;  5I56 A;  3S9N C;  4EQ9 A;  1H76 A;  2XD3 A;  2P0S A;  5KZT A;  5TU0 A;  4PFT A;  1YPN A;  4Q30 B;  5J1D A;  1LST A;  1B3F A;  3EHS A;  3HO7 A;  2BJJ X;  3CFX A;  1LB9 A;  1MXY A;  3K6V A;  4OQO A;  3CIJ A;  3VVF A;  1FTM A;  3WAE A;  3PUX E;  1QJM A;  3LSX A;  4KCD A;  4ZZE A;  1UTB B;  3ODB A;  4TQU Q;  2WKY A;  3SET A;  2UVG A;  3SEW A;  3IAZ A;  4F3B A;  1MQJ A;  2I3V A;  3RY3 A;  5L9M A;  3BFT A;  2H25 A;  1M5D A;  4XXU A;  4NF4 A;  4DLD A;  3S2V A;  3EN3 A;  2X26 A;  2Y7K A;  1HSE A;  2UVH A;  3EF7 A;  1SQY A;  1EZ9 A;  1ZMG A;  3T9V A;  1M5C A;  3KN7 A;  5AE4 A;  3K0V A;  2ZNT A;  3CFL A;  4NWD A;  2FA7 A;  1BP5 A;  1Z7M E;  2Q2C A;  1IZ1 A;  1BKA A;  4ELP A;  3K6X A;  1XVY A;  4PE5 B;  2PBW A;  3EHT A;  3ZKK A;  5I2N A;  4KYS A;  4JBZ A;  4P0I A;  3TEP A;  3IOR A;  4JWO A;  2HAU A;  4XKP A;  3G7W A;  4YB5 A;  1LB8 A;  2I3W A;  3KN8 A;  1B40 A;  4KI0 E;  3CSB A;  3N5L A;  1PBP A;  1B3G A;  3IB2 A;  4H1X A;  1Y4T A;  1Y1M A;  3T22 A;  4KYD A;  4LAT A;  4POX A;  3QK6 A;  1IIW A;  4NWC A;  4QFN A;  1JET A;  4RJZ A;  2B3F A;  2OLB A;  1R1N A;  2DWJ A;  2DVC A;  3VXC A;  1JVX A;  4H67 A;  3VLW A;  3R6U A;  4AB5 A;  1UQW A;  2I0B A;  4HCW A;  2O68 A;  1DPP A;  2XX7 A;  1MDQ A;  2RC8 A;  2XXT A;  4G8M A;  4QHQ A;  3N26 A;  4E0X A;  1SD3 A;  2YPN A;  1SW1 A;  1VFE A;  2HZL A;  1N7X A;  1A8F A;  4QSC A;  1F9B A;  1SDX A;  3QIM A;  3G3H A;  3VVD A;  4U22 A;  3WAF A;  1ATG A;  2H99 A;  4GQO A;  2IEE A;  1ZBM A;  3C9H A;  1LAH E;  4OHN A;  4M4G A;  2XXH A;  3QXM A;  3O9P A;  3L6H A;  4ZZA A;  3E9X A;  3FUZ A;  1IEJ A;  3HHG A;  3CVG A;  4NF8 A;  4KHZ E;  3C4M A;  3KBR A;  3N6U A;  1DSN A;  3VV5 A;  3L6G A;  3U1O A;  2AIX A;  4GWO A;  1O7T A;  4OVJ A;  4ZE9 A;  4ZEC A;  1I6A A;  4PP0 A;  3Q29 A;  5H8F B;  3EQ1 A;  4JDF A;  1Y20 A;  4G68 B;  4WED A;  4ZEI A;  3C36 A;  3H7M A;  4XKN A;  3THI A;  1IUD A;  1AMF A;  4LA9 A;  4WEP A;  3VVE A;  3E3K A;  3LSL A;  1LBB A;  1NNK A;  1IXH A;  5H8N B;  5EHM A;  3PPN A;  4OER A;  3FVO A;  3DP6 A;  4R72 A;  1NL5 A;  1DMB A;  2W7Y A;  4JWX A;  2I49 A;  3JYR A;  4F3S A;  1MY1 A;  1XT8 A;  3GXA A;  4NF5 B;  4FE8 A;  5CBS A;  4Z7E A;  3K2D A;  4DCX A;  2F97 A;  5TP9 A;  2B3B A;  3FV2 A;  2NOO A;  1FTJ A;  3K02 A;  2F8D A;  1FQF A;  3M3F A;  3O29 A;  4YKJ A;  4I1D A;  3E4R A;  4DZ1 A;  1BLF A;  2AL5 A;  3IX1 A;  4BDO A;  1POY 1;  3ILU B;  3OMB A;  3FD3 A;  2XXP A;  5AA2 B;  4LZ5 A;  1FW0 A;  3FIR A;  5BUU A;  3H03 A;  4GFR A;  1AL3 A;  3UP9 A;  4XKQ A;  4L17 A;  4ZED A;  3PPR A;  1KWH A;  4WKM A;  3KN3 A;  1B32 A;  3KSX A;  1A99 A;  2ZNS A;  1DTZ A;  4F2Q A;  4PQJ A;  3C31 A;  3K1P A;  1H43 A;  1LBC A;  4XTC Q;  4GRK A;  1MRP A;  4RY1 A;  5IKB A;  3B6T A;  4G2Z A;  1QKA A;  1XHY A;  2OBG A;  3S9E A;  3O2A A;  4R73 A;  3RT6 B;  3VLV A;  2UYE A;  4NMY A;  4QF9 A;  3SEY A;  1MM7 A;  1VR5 A;  4RNS A;  5AA1 A;  1DOT A;  3G3J A;  1N0T A;  2ZYN A;  4LQ5 A;  2R9J A;  1AH5 A;  1I6B A;  1DPE A;  3HST A;  3PUY E;  1FQC A;  1EZO A;  4N07 A;  3TTL A;  1D4N A;  4QFK A;  2ZYK A;  1SI1 A;  3GBB A;  3IOT A;  3MQ9 A;  3PGF A;  1P1N A;  1GV8 A;  3V89 B;  5KDT B;  3TUS A;  4I9D A;  4ZEB A;  4YIC A;  4YAH X;  4ONY A;  4YMA A;  2QPQ A;  4O3B A;  4XIG Q;  3SDF A;  4QFP A;  3U93 A;  5TPA A;  1N84 A;  3TTR A;  3IB0 A;  4YB6 A;  5JTY A;  5A5X B;  3PV0 E;  5H8H A;  4FED A;  1LAF E;  2ZNU A;  5I2K A;  1QUL A;  1HSJ A;  4K3F A;  5ICQ A;  3VXB A;  4RXL A;  4R75 A;  3U8Q A;  2XXU A;  3TZA A;  3IR1 A;  1GTK A;  3QUJ A;  1QUI A;  2NWJ A;  2Y7P A;  1B7U A;  4IGT A;  3W9V A;  1S9T A;  3B6Q A;  4EF2 A;  4NF6 A;  2XX9 A;  2GFE A;  3OEK A;  1B46 A;  1B7H A;  5EHS A;  3CRB A;  4BDR A;  4OMB A;  5F7V A;  3OXN A;  2Z8E A;  1UTH B;  1B4Z A;  4BDQ A;  1EZP A;  1VFD A;  3RQT A;  2UVJ A;  1H44 A;  2DE4 A;  4DXB A;  3D4C A;  4GD5 A;  1FQE A;  4RA1 A;  2XXX A;  1ZJL A;  2PT1 A;  3IJO B;  4Z0I A;  3I5O A;  1RYO A;  3FZV A;  5I56 B;  5JK4 A;  3PU5 A;  1LFH A;  2RF1 A;  1QUJ A;  1SW2 A;  1B1H A;  2P1S A;  2ABH A;  1N3X A;  1MDP 1;  2H5Y A;  4U4S A;  1USY E;  3FXU A;  2GH9 A;  1J1N A;  5AA2 D;  4G4P A;  4LZ8 A;  1US5 A;  4HCY A;  2ZMB A;  4NED A;  5B7D A;  1GGG A;  1LAG E;  3CG1 A;  3K6U A;  1B3H A;  4YKP A;  3CR9 A;  3Q26 A;  4QRZ A;  3I3V A;  3JV9 A;  2O84 X;  1OIB A;  5BWJ A;  2QSX A;  4ND9 A;  2XX8 A;  4EDP A;  4OYV A;  1MQD A;  4RPO A;  3MAM A;  1P1U A;  4NF4 B;  4F1U A;  4ESX A;  1AOV A;  3TTN A;  1II5 A;  3ECR A;  2M8C A;  2R71 A;  2V3T A;  3MPL A;  4MFI A;  4OTE A;  4R2B A;  4PFU A;  1LLS A;  4GIZ A;  2Q89 A;  4ESW A;  2DWI A;  4FEC A;  4ZDM A;  4EF1 A;  1QW0 A;  1Y3P A;  3SER A;  1NNF A;  3FJ7 A;  3FVK A;  4OEU A;  5I2N B;  3MUQ A;  2RC9 A;  4YKI A;  2P2A A;  2XXV A;  4R6H A;  3VLU A;  1OVT A;  3KJT A;  4AQ4 A;  2ALU A;  2QRY A;  3G3I A;  1A7L A;  2A5S A;  1NMU A;  2Y7R A;  3QUF A;  3T9U A;  5DVI A;  4THI A;  4IO2 A;  2HEU A;  1D9Y A;  1A40 A;  1IXI A;  4C0R A;  3PMX A;  4IO4 A;  2ZYM A;  4R6Y A;  4ZEF A;  1PDA A;  2G93 A;  3H06 B;  1B3E A;  4C1T A;  4C1U A;  2XD2 A;  1URS A;  3MBP A;  3OEM A;  3K6W A;  1SBP A;  2Z8D A;  3DEL B;  4DIG A;  2FNC A;  3TMG A;  3HV1 A;  2Z22 A;  4R2F A;  1A8E A;  1H45 A;  5FHN A;  1LCT A;  4N6P A;  5CMC A;  2GHA A;  2FYI A;  3LC8 A;  3LR1 A;  5F1Q A;  5I57 A;  4FAT A;  3AXF A;  1B05 A;  3DLN A;  3HHF A;  3QSL A;  2OWS A;  3IB1 A;  1MS7 A;  1XC1 A;  3B7D A;  1JEV A;  1MPC A;  4R6K A;  2F6P A;  1UIU A;  1RKM A;  2QJE A;  5EYF A;  3G3F A;  3K1M A;  1BIY A;  1YAE A;  4OZ9 A;  3UIF A;  3KZG A;  2F35 A;  5ISU A;  3MVY A;  1MXX A;  3BBR A;  2XXQ A;  5KCJ A;  1RYX A;  3FJM A;  4BDM A;  4H5F A;  3HCQ A;  3IK6 B;  2PX1 A;  4F3P A;  4NF8 B;  3OEL A;  1SW4 A;  3KGC A;  4U21 A;  1MXV A;  5DTB A;  2DE3 A;  2H98 A;  5CBR A;  5M2V A;  3TEL A;  3MJN A;  3RTW B;  4X9T A;  4X1B A;  5CRY A;  1MQI A;  3TAJ A;  1TFD A;  1WVJ A;  3RGY A;  2E1S A;  4UA8 A;  2XXY A;  4H8I A;  4LQ2 A;  3UGW A;  4TOZ A;  2VHA A;  3M3K A;  3V5A A;  1JW4 A;  4Q8R A;  4X1D A;  3C34 A;  2V25 A;  4QFL A;  4X48 A;  1H3D A;  3MP6 A;  2G29 A;  4BDL A;  1I69 A;  3Q25 A;  1ZKB A;  4JWY A;  3SEV A;  5DEX A;  3PUW E;  1HSL A;  3MWB A;  1SW5 A;  1MM6 A;  3P7I A;  5DVF A;  1WDN A;  3T93 B;  4KFQ A;  3SKP A;  3PD8 A;  2Q9T A;  3IOV A;  4LON B;  2ZYO A;  4R9F A;  1B0L A;  2GRV A;  2O6A A;  2Y7I A;  4F39 A;  2AL4 A;  4TLL B;  4RYA A;  3KFM A;  3O6H A;  5L9O A;  4OEN A;  5TP9 B;  2UVI A;  1USY H;  5I59 A;  4OES A;  4H8J A;  5CMB A;  2F6G A;  3U72 A;  1D9V A;  2DWH A;  4MF3 A;  3KOT A;  3FAS A;  5DYH A;  5ITO A;  3TCH A;  1PB9 A;  3TCF A;  2Y84 A;  4EQ7 A;  2DOJ A;  5I59 B;  4RK2 A;  4GF8 A;  3MZ9 A;  4DDD A;  4AB6 A;  3FVG A;  1MPB A;  2DVZ A;  1NKX A;  1URD A;  2HXW A;  4GXA A;  4Q0C A;  1AIV A;  3Q27 A;  4EXK A;  2H4I A;  5HM4 B;  2UYF A;  3RN8 A;  4ZS9 A;  3VE1 B;  5ICT A;  5ELV A;  1YCJ A;  2X7Q A;  1B9J A;  4U4X A;  4DXC A;  3R26 A;  2V3Q A;  4H65 A;  2ONS A;  2O69 A;  1TFA A;  4G8N A;  4OFO A;  3MP1 A;  1MH3 A;  4Q5T A;  4PET A;  3TCG A;  5LOM A;  3B6W A;  3MZB A;  2VOZ A;  4HS7 A;  3OO8 A;  3EHU A;  1EH3 A;  3MP8 A;  2DXR A;  3G3G A;  4GL0 A;  4I8C A;  1B5I A;  4P11 A;  3C35 A;  1MPD A;  4JSO A;  4YKK A;  3S9M C;  3PUZ E;  4KQP A;  4H5G A;  3H6T A;  2OZZ A;  3S9L C;  3DP8 A;  2OWT A;  3FGS A;  4MLV A;  3RUM A;  1Y1Z A;  4EUO A;  5TPA B;  5DT6 A;  3LUY A;  3ZKL A;  5JTY B;  5H8H B;  2KLF A;  5CM6 A;  4QSE A;  5I2K B;  2D21 A;  3OO9 A;  4GXS B;  1ZU0 A;  1B51 A;  2QS3 A;  2V3U A;  3OEN A;  4OWD A;  4G77 A;  4DE8 A;  3T66 A;  4F31 B;  4GLI A;  2O51 A;  3OD7 A;  4NF6 B;  3KSJ A;  3JZJ A;  2A5T A;  1Y3N A;  1FQD A;  2O1L A;  4WXJ A;  4OFL A;  1LFI A;  3LSF B;  1PB7 A;  2DWA A;  2RIN A;  3I6V A;  1MXU A;  4DXU A;  4KYE A;  3HN0 A;  2HQ0 A;  2XXI A;  1FTO A;  3K1N A;  2I48 A;  3FXR A;  3TKD A;  4DCY A;  2DXY A;  4FIM A;  4LVQ A;  1OVB A;  1N7W A;  4IO6 A;  3H6W A;  3TQL A;  4GVO A;  3PPQ A;  4F18 A;  2HFB A;  5L8D A;  3K00 A;  5FHM A;  2CZL A;  1B1X A;  2REG A;  3OSQ A;  1NH7 A;  1M5F A;  4ISU A;  2DSF A;  5FTI A;  1S7Y A;  3SES A;  1UTB A;  4IY6 A;  4F2O A;  4ELR A;  4QFO A;  3PUV E;  4POW A;  2RCA A;  1VSO A;  3GLB A;  4KCC A;  3Q28 A;  1NNT A;  3QYT A;  1UIV A;  4EXL A;  1MH4 A;  4MBP A;  4YZZ A;  3MVX A;  1NH8 A;  1DTG A;  3KJ7 A;  4TLM B;  2F78 A;  1MXW A;  4O3C A;  4R9G A;  1B58 A;  4LUB A;  3T9H B;  3MW0 A;  2D5W A;  1I6Q A;  1OLA A;  4ELO A;  1B2H A;  1PB8 A;  1MY0 A;  1LFG A;  3TYH A;  5IAI A;  4PFY A;  1FQA A;  2THI A;  2QMX A;  3CFZ A;  1P1W A;  3M8U A;  1ZTY A;  1OLC A;  4FAJ A;  4KR5 A;  3H6V A;  1XOC A;  5K2Y A;  4QSD A;  2REJ A;  2Q2A A;  3TPA A;  1FCK A;  1FQB A;  1Q35 A;  4F1Y A;  4BLA A;  4IO3 A;  5H8S A;  3MC2 A;  5DVJ A;  1EU8 A;  3GBA A;  4ZE8 A;  3OO6 A;  1JVY A;  2NXO A;  5FHO A;  3RLF E;  2F7C A;  4M1V A;  3U92 A;  3TDJ A;  1B7Z A;  3HPI A;  1IQ7 A;  3IO6 A;  3G3K A;  2QS4 A;  3RTF B;  4GOT A;  2Q88 A;  2O7U A;  4N13 A;  4F22 A;  2E0S A;  2H9B A;  5ITP A;  3FV1 A;  3GZG A;  4RK9 A;  2HAV A;  2V93 A;  1POT A;  2ONR A;  1BTJ A;  4FJP A;  3CG3 A;  1B5J A;  4MH5 A;  2DE2 A;  4IO7 A;  4H0W A;  4HW8 A;  1OQH A;  3H3G A;  1T0K A;  4MLQ A;  3RPW A;  2YLN A;  3OSR A;  4F29 A;  2PYY A;  3CI8 A;  4YU0 A;  3MZ1 A;  3TTM A;  1MQG A;  1ELJ A;  3VFJ A;  2Q8J A;  1SYI A;  1JNF A;  2ANJ A;  3K4U A;  2Z23 A;  3ILT B;  2X7P A;  4OEV A;  1Q1K A;  3RNN A;  2F36 A;  4I62 A;  5I57 B;  3IOU A;  3H4Z A;  3A3C A;  4P0G A;  2QS1 A;  5I58 A;  1B3L A;  3TTK A;  5HBC A;  2RC7 A;  2XXW A;  5FTH A;  3SEX A;  2F7B A;  2R6G E;  2F5X A;  4EQB A;  1YTV A;  5I58 B;  3F11 A;  2I6E A;  3ZS6 A;  1B6H A;  3T9X B;  2RKM A;  3D4G A;  3FXQ A;  3OO7 A;  4YB7 A;  5H8F A;  3W15 C;  3KG2 A;  2VD2 A;  5KCJ B;  4G68 A;  1MY2 A;  2I0C A;  2I4B A;  3S4U A;  4OET A;  2IA4 A;  3V8X B;  3C32 A;  3N94 A;  2O7I A;  2D3I A;  1JW1 A;  5AA4 A;  3W9W A;  4U23 A;  1TXF A;  1P1O A;  2ESN A;  1ZIU A;  1GR2 A;  2V84 A;  5H8N A;  2AYS A;  4U1O A;  1XS5 A;  3PPO A;  2QL3 A;  1QKB A;  2VP1 A;  3MVZ A;  1URG A;  2DQV A;  3CSG A;  3PMV A;  5CMM A;  4RPN A;  5K2X A;  5AA4 B;  2XHD A;  3DP4 A;  3PMW A;  2ONK E;  1R9L A;  1CB6 A;  2DYX A;  3A3U A;  4NF5 A;  4LP2 B;  5CC2 A;  4NE4 A;  3SEU A;  4U2R A;  3M3L A;  2XXR A;  3UOR A;  4NTL A;  3BKI B;  1A55 A;  4O3A A;  1B0H A;  3IL1 B;  3FAT A;  2GHB A;  1WOD A;  3H6U A;  1R9Q A;  2O1M A;  3E13 X;  3USD A;  4OFJ A;  4BDN A;  5DEX B;  1MG1 A;  3MVW A;  3C33 A;  1JQF A;  1Y3Q A;  3PD9 A;  1S50 A;  4G8H A;  5B70 A;  1FTK A;  2YJP A;  1ANF A;  1OQG A;  1XVX A;  4R74 A;  3TQW A;  3FJG A;  5L9S A;  3O97 A;  4GL8 A;  3OOA A;  3N6T A;  2VGQ A;  4FEB A;  5AA2 A;  2QS2 A;  1VE4 A;  3IO4 A;  3A09 A;  2QMW A;  1M5E A;  1D3K A;  2NVU B;  1O64 A;  2PT2 A;  4OXV A;  1FTL A;  4E0W A;  1QUK A;  2CMO A;  1P1Q A;  4IY5 A;  1L5T A;  2HZK A;  2Z8F A;  3U94 A;  4H6D A;  2Y7W A;  1MY4 A;  3LSW A;  1MQH A;  1LGB C;  1NNP A;  1SI0 A;  2DP8 A;  3KOS A;  3O6G A;  4IGR A;  1NFT A;  2PMS A;  1ZLQ A;  1M5B A;  1PEB A;  1GVC A;  3BFU A;  1IIT A;  2F34 A;  4PFW A;  1IXG A;  1JEU A;  4XKR A;  4ELQ A;  3UA8 A;  3T96 B;  2I4C A;  3UK4 A;  4IB2 A;  1CE2 A;  4F1V A;  3O6I A;  1US4 A;  4KPT A;  4JXI A;  1R6Z A;  1JW5 A;  1MY3 A;  1N3W A;  3IOW A;  3UN6 A;  3K01 A;  2PVU A;  1O63 A;  1PC3 A;  5KDT A;  3MPK A;  4UAC A;  5HPQ A;  5CI5 A;  2HCA A;  3R7X A;  1TWY A;  2LAO A;  4LZ7 A;  2VD3 A;  1N76 A;  4YMB A;  4JB7 A;  1Y9U A;  1PBQ A;  3V83 A;  1TT1 A;  3ONM A;  4ECF A;  1N04 A;  2UXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...