4ELQA

Ferric binding protein with carbonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
310
structure length
310
Chain Sequence
SPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
publication title Crystal structure of ferric binding protein A
rcsb
source organism Thermus thermophilus
molecule tags Metal transport
total genus 114
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elqA02
4YZZA 2GRVA 5F7VA 1URGA 3WAFA 2OLBA 4YAHX 2HFBA 4ELRA 1VFDA 2B3BA 3VVFA 4MLQA 1A40A 1H44A 2QMWA 3CSGA 1D4NA 4I1DA 2DXYA 1FQAA 4IO5A 4O3AA 4U2RA 3K1MA 4F22A 3HHFA 1B3HA 5AA3A 3T93B 3RTWB 1B32A 2HAVA 1LB9A 1FTJA 4JSDA 4X48A 3KFMA 3N6TA 2V93A 4OESA 1POTA 1WDNA 1SI1A 3MPLA 3W15C 3JV9A 2XXRA 3FD3A 5CMKA 3TCGA 4IO2A 3TKDA 5DVJA 1MXYA 3FV2A 4NF8A 2HZKA 1SVXB 2O84X 3RGYA 3IL1B 2DE2A 1IXIA 4KD5A 2G29A 4QFPA 2O7IA 1FQBA 4WEPA 1SQYA 4KYEA 3OSRA 4PETA 3TTRA 1UIUA 2X7PA 4GQOA 2QPQA 3EF7A 1N76A 2AL5A 5AA4B 4H0WA 1LGBC 2NWJA 2PX1A 1B46A 3E13X 2Y7KA 3ZSFA 3T22A 5IKBA 1AIVA 3KN3A 4YKPA 2ESNA 2DSFA 4OETA 3KSJA 3H3GA 2ONRA 2XXTA 1PBQA 1MQHA 3IB2A 3AXFA 3OEKA 3N6UA 3MWBA 4KR5A 4GVOA 1OMPA 4R73A 3O2AA 3MVWA 1M5BA 2QS4A 4NEDA 4PFYA 4QSDA 1DTZA 2QS3A 2PYYA 5CBSA 1ZKBA 5B70A 3G3GA 4RJZA 1LAHE 1JVYA 3TCHA 3K6XA 3UIFA 1F9BA 3T9XB 4DLDA 2UVHA 4JSOA 5TPAB 4KFQA 4NF4A 5ELVA 3O6IA 2H9BA 1MXWA 4YB6A 4G77A 1PDAA 3R26A 4HCWA 3LR1A 3I3VA 2OWTA 3H7MA 4FJPA 3EHUA 3FJMA 4OEVA 1B7UA 2Q2AA 3V8XB 1TWYA 1MH3A 1XVYA 4RXLA 4LZ5A 2Y7PA 5AA1A 3FV1A 4F19A 3PD9A 3F11A 4TQUQ 3RNNA 2RC7A 3HSTA 4I8CA 4JWYA 4UA8A 1MPDA 1SW4A 2XD3A 3FVGA 4F1VA 1BTJA 4LP2B 1PC3A 4NF5B 3W9WA 1I6BA 2I3VA 4QFLA 4ZE8A 5I57B 2DP8A 5AA4A 1A55A 4GL8A 4YB5A 3FXQA 1CE2A 4RYAA 1I6AA 3HN0A 4R6HA 5DEXA 4RA1A 1IZ1A 1Y3QA 1B1HA 2I4CA 2THIA 3M8UA 1Y4TA 3U94A 2Z22A 3PUZE 5CMMA 3PPQA 2FNCA 2ZNTA 1XT8A 4LONB 3BFUA 4GOTA 3QIMA 4U1OA 3KG2A 3OELA 5HBCA 1UTBB 3UORA 2F36A 3UK4A 2XXVA 4NF6B 4EF1A 4YMAA 5CMCA 4QFNA 4RK2A 4ISUA 5H8SA 1FQCA 4F3GA 2ANJA 2Q88A 3FZVA 4X1DA 3PD8A 3RY3A 1IIWA 1EU8A 5TPAA 1MRPA 4U23A 3OOAA 4ZEIA 4KPTA 3OD7A 3U72A 3ECRA 3PPNA 3CRBA 4EQBA 1SW1A 2VP1A 3FJ7A 3EHTA 3SEUA 5F1QA 4PP0A 4IO4A 4DDDA 2E0SA 4F1UA 1LAFE 4ELPA 4GLIA 1P1WA 1NH7A 2PVUA 1JQFA 4ZEBA 1XS5A 4EQ7A 5I84A 2I49A 3Q27A 1B0LA 4R9FA 4XKNA 4NF5A 3G3FA 5I57A 2ZXTA 3FXUA 2X7QA 3K6UA 3KBRA 4BDNA 1B6HA 3CFXA 3U93A 4EUOA 3H6TA 1ZTYA 2ZYMA 2XXPA 1UIVA 2F97A 4DXCA 1B2HA 3ILUB 3HO7A 2QL3A 2HZLA 4TLMB 5I2KA 3IB0A 4LATA 2A5TB 2UYFA 4PE5B 1B40A 5J1DA 3LUYA 1N3WA 1MQDA 4ONYA 3TODA 2H98A 1FTOA 2XX9A 3OO6A 1OVBA 3OEMA 3H06B 1MS7A 1DPEA 1UTBA 1Z7NE 1PB9A 3TMGA 4OHNA 3FUZA 3R7XA 3H6WA 2BJJX 4MBPA 3MC2A 3BBRA 2Q2CA 3JYRA 1B7ZA 1USYE 1B5JA 4ECFA 4OERA 3L6HA 3MQ9A 3VVEA 3IO6A 3CVGA 2IEEA 4HCYA 4ELQA 1B52A 2OK2A 1Y3NA 2Y7WA 2ZNUA 4R6KA 4OZ9A 4OXVA 3TTKA 4LZ8A 4F39A 2ZMBA 3KSXA 3E3KA 1IXGA 1USYH 4ZS9A 1Y9UA 4R9GA 5EYFA 1FW0A 1SW2A 3G7WA 4KCCA 1FCKA 4G8MA 2ZNSA 4E0WA 3TTLA 2RC8A 4Z0IA 2UVJA 5AA2D 3PGFA 4OFJA 2RCAA 1OQHA 2B3FA 4DCYA 4EXLA 1NKXA 2LAOA 3G3JA 1EZ9A 5HM4B 3RUMA 3W9VA 4N6PA 3IJXB 3SEVA 3UP9A 4QF9A 3MVYA 1EZOA 4DXUA 1PB8A 4N07A 3RN8A 4R74A 1Y1ZA 2FA7A 4GFRA 4NF4B 3KJ7A 1DTGA 2QS2A 4MFIA 3DP6A 2A5TA 1Y20A 4OFOA 4U21A 2DWIA 4ND9A 4ELOA 5I2NB 1CB6A 3B6QA 1TXFA 5HPQA 4ZE9A 5TU0A 5AE4A 3LBSA 1II5A 2V3UA 1OLAA 2NUVA 3UGWA 2O1MA 3A3CA 1B1XA 1N04A 3E9XA 5H8NB 2W7YA 3ZKLA 2VGQA 4ZZAA 4ZZEA 3O6HA 3N94A 3VV5A 1FQEA 4R72A 1O64A 3K4UA 5CM6A 4H8JA 2F8DA 4FEDA 1SW5A 2RCBA 1MDP1 1H76A 2Y7RA 1QW0A 3LSWA 2R6GE 3V83A 3EHSA 4LQ5A 3U92A 1SBPA 5FHNA 3CFZA 2PMSA 1MQIA 4KYSA 1B5HA 2Z8EA 1MY2A 5DEXB 1LAGE 3QAXA 4OEUA 4HS7A 4R2FA 5FTIA 1M5DA 1ZBMA 5EHSA 1BKAA 3VDFA 3UN6A 3T9UA 4ZEDA 3QK6A 4H5GA 2V25A 2XXIA 3PMVA 1IQ7A 3C35A 5LOMA 4X1BA 3Q25A 5KDTB 2F7AA 2F7BA 1VSOA 2PT2A 1R9QA 3N5LA 4MLVA 4IO3A 1XVXA 1LCFA 2GFEA 3IR1A 4OFLA 3PPPA 2PBWA 4NWCA 3SETA 1SD3A 4U22A 2OBGA 1J1NA 3VFJA 3MP6A 1OQGA 4PFWA 3USDA 3KN7A 3K01A 5I2NA 2E1SA 1BLFA 2XXWA 3DELB 4U4XA 3A09A 1B5IA 3QUJA 1QJMA 3QYTA 2RKMA 5K2XA 4F3SA 3K6WA 1FQDA 1MXVA 5AA2B 5ITPA 4NE4A 1SYIA 2O7UA 5H8NA 4JB7A 3RT6B 4H5FA 1SYHA 1GGGA 1HSLA 2YLNA 1D3KA 4GXSB 1N0TA 2UVGA 2DWJA 1O63A 3G3IA 4ESWA 1NNFA 4BLAA 3T96B 3K02A 2NXOA 4FE8A 1H45A 5DVFA 4EXKA 3MW0A 5I2KB 2DVZA 2I6EA 4XTCQ 3PPOA 4DZ1A 1DMBA 5JEIA 2ONSA 4EDPA 3MAMA 5L8DA 2Z23A 5B7DA 3TUSA 1B3LA 1FTLA 3H6VA 4IGTA 1Z7ME 3S2VA 2DVCA 3M3KA 1URDA 5CMBA 5KDTA 3KZGA 5DYHA 1YTVA 2DWAA 4JDFA 2O51A 1JETA 2UYEA 4LUBA 5DVIA 2VOZA 1UQWA 3RPWA 2F7CA 1PBPA 4TOZA 4RY1A 2ZYNA 4G8NA 4DCXA 2D21A 2XXHA 1NMUA 2UXAA 1QKAA 4F18A 3OSQA 1NL5A 2O68A 3T9HB 3IOTA 5IAIA 2QS1A 3SDFA 2I3WA 3K6VA 4BDRA 1Y4CA 3FASA 2O1LA 3IJOB 3QUFA 4G68C 1AOVA 4GRKA 3MJNA 3KOTA 1WODA 4XKRA 1QUIA 4G8HA 1Q1KA 1P1NA 3MP8A 4QRZA 4DE8A 1HSJA 4IO6A 4GWOA 4FECA 1Q35A 1NH8A 1US5A 4YB7A 2F6GA 1A99A 3A3UA 5I59B 3TPAA 5AA2A 3DP4A 3EN3A 2F6PA 4DIGA 1RKMA 3V5AA 3L6GA 4HTGA 3DP8A 4OYVA 3CR9A 3CG3A 1B0HA 2QSXA 1URSA 1TFDA 5KZTA 3B6WA 3LSXA 1NNTA 4I62A 4KI0E 3VLVA 1MQGA 1H43A 1YCJA 1VR5A 4P0GA 1M5CA 1R6ZA 4XKPA 3S9EA 4R6YA 3TYHA 2GHAA 4AQ4A 4C1UA 3FVNA 1LCTA 3PPRA 1JW1A 3Q29A 1LSTA 2ABHA 3PUYE 2VD2A 3S9LC 1NFTA 2F78A 2F34A 2OZZA 3MPKA 1JW4A 3C36A 5H8HB 2Z8DA 3HHGA 3Q28A 5K2YA 1RYOA 1TFAA 2YPNA 4QFKA 3UA8A 4ZEKA 2O6AA 5L9OA 3KEIA 1B4ZA 5FHMA 3ZS6A 1JNFA 4XKQA 4QFOA 2VD3A 4X9TA 1ANFA 3Q26A 1XC1A 2H99A 2DWHA 4RPNA 3FXRA 1NNKA 2HQ0A 2A5SA 3QSLA 4POWA 2XX8A 1JEUA 1DSNA 3IO4A 3KOSA 4C1TA 3GBAA 3SEWA 1ELJA 3T66A 3K1NA 1LFGA 4BDOA 3HPIA 2VHAA 1FTKA 3GZGA 1IITA 2XHDA 3VLUA 1MPCA 3TZAA 2NOOA 1GVCA 2PT1A 2Y7IA 3O97A 4AB6A 3TTMA 4THIA 1M5EA 4R75A 4ZEFA 4K3FA 3K00A 5I59A 5I58A 2I0CA 2YJPA 2DYXA 2F5XA 3GXAA 4GL0A 3TAJA 3PUVE 4GF8A 4Q30B 1POY1 4BDMA 5ICTA 3E4RA 3OENA 3FATA 2GH9A 2FYIA 1R9LA 4ESXA 3DM0A 3EPEA 4OWDA 3O9PA 3SERA 1M5FA 4XXUA 3ZKKA 1MXXA 1MXZA 1YAEA 1QKBA 2HEUA 1QVSA 5I56B 3P7IA 2XXXA 4Q0CA 2R71A 5H8QA 3U1OA 1S50A 4OQOA 1GV8A 1B51A 5FTHA 4PFUA 4M4GA 1N7XA 3IORA 4BDQA 5CI5A 2QJEA 1R1NA 1GR2A 1D9YA 1MY1A 2REJA 3TELA 5H8HA 4POXA 2NVUB 4LVQA 2Q8JA 1LB8A 4OVJA 3H4ZA 3S9NC 2Q89A 3BFTA 4Q5TA 2AYSA 4JBZA 1AL3A 4IGRA 1S7YA 4QHQA 2CZLA 4O3BA 1VE4A 2ZYKA 3G3HA 1FQFA 4IB2A 2X26A 1AMFA 2I4BA 3PU5A 1A54A 1S9TA 2XXUA 5A5XA 4RPOA 3LSLA 4NMYA 1Y3PA 4GXAA 5CRYA 4G68A 2D3IA 5H8FB 4WEDA 4KQPA 2B65A 2XXYA 2R9JA 5KCJB 3TEPA 1OLCA 1P1UA 1AH5A 1OIBA 4IY5A 1ZJLA 4TLLB 5EHMA 3D4CA 3OO8A 4ZDMA 3R6UA 1IUDA 3OXNA 1MY4A 1A8FA 3IOVA 1IXCA 3MUQA 2Q9TA 1ZLQA 4IY6A 2KLFA 1QUJA 2AL4A 4LZ7A 2DQVA 2ALUA 1O7TA 3MVZA 5DT6A 4GD5A 5TP9B 5I56A 2DE4A 1FTMA 3B6TA 3PUWE 3GLBA 3VE1B 3CG1A 3JZJA 1ZMGA 1PEBA 1LFHA 4YKIA 3CIJA 3THIA 3V89B 4LA9A 1SDXA 2QMXA 3SEXA 4GIZA 3T9VA 1ATGA 1H3DA 3DLNA 1JEVA 1B3FA 2ZYOA 4EQ9A 4G2ZA 3S9MC 2Z8FA 4Z7EA 4N13A 1UTHB 1EH3A 3C32A 4AB5A 1NNPA 5CBRA 5BWJA 4PQJA 4E0XA 3ONMA 3B7DA 1DOTA 3U8QA 3MBPA 2HCAA 4R2BA 1B58A 3VLWA 4C0RA 2CMOA 3OO7A 1I69A 3PMWA 1Y1MA 1IEJA 3LSFB 3TQWA 5L9MA 4NWDA 4YKJA 2OCUA 1B9JA 1WVJA 1B05A 5H8FA 5L9SA 3O66A 3G3KA 3PMXA 3C34A 2RF1A 3TFLA 3MZ9A 2I58A 4M1VA 5KCJA 3HCQA 2DS9A 3M3LA 5JK4A 1MY3A 3FVKA 1P1OA 5JTYB 4FIMA 4H65A 3H03A 2HAUA 1P1QA 2XD2A 2Y84A 1MXUA 4F2QA 2OWSA 3RTFB 2XX7A 1MM6A 1B3GA 2REGA 1OVTA 3TCFA 3SKPA 1QULA 3VVDA 4KHZE 4WKMA 3KJTA 1MDQA 3IB1A 1LBBA 5TP9A 4F2OA 1MQJA 2D5WA 4MF3A 3RQTA 3IAZA 4H6DA 3TQLA 4H67A 4HW8A 4U4SA 3D4GA 1JW5A 2UVIA 3FVOA 1B4HA 4RK9A 2V3QA 1JVXA 1LBCA 3O28A 1N3XA 1B7HA 3EQ1A 2OJTA 1UTHA 3IOUA 5I58B 1XHYA 1MH4A 1ZU0A 4QSEA 3FIRA 4F3BA 4DXBA 1RYXA 2I0BA 3IX1A 1L5TA 4JWXA 2V3TA 3C4MA 2P0SA 3IOWA 4OMBA 4O3CA 1GTKA 3C31A 3MP1A 4JWOA 1N84A 1MM7A 3CSBA 1BP5A 4WXJA 4YICA 4JXIA 3TTNA 3VXBA 3WAEA 4H1XA 3I6VA 3O6GA 1YPNA 4OENA 3IK6B 2V84A 3KN8A 3CFLA 3S4UA 5DTBA 2HXWA 5H8QB 1I6QA 1HSEA 1MG1A 1TT1A 4MH5A 3OO9A 4F31B 4H8IA 3OMBA 4OTEA 4EF2A 4FORA 3MZ1A 4PFTA 5JTYA 3CI8A 3K2DA 2H25A 4U1ZA 1PB7A 1LLSA 1MY0A 3C33A 4FAJA 1KWHA 3QXMA 3H6UA 3TDJA 3M3FA 1N7WA 5ITOA 5BUUA 1IXHA 5FHOA 3RT8A 4BDLA 2AIXA 4NF8B 4UACA 3ODBA 3K0VA 3ILTB 1BIYA 3PUXE 1LFIA 1A8EA 2XXQA 1QUKA 3I5OA 3SESA 3KGCA 1SI0A 2RC9A 5M2VA 1B3EA 4Q8RA 4NF6A 2DE3A 3FGSA 5A5XB 4L17A 1EZPA 3LC8A 4XIGQ 3FJGA 2H5YA 4G4PA 1US4A 3C9HA 3VXCA 4F29A 1XOCA 4P11A 4G68B 4YMBA 4NTLA 4RNSA 1VFEA 4IO7A 4YKKA 2I48A 2QRYA 3RLFE 2DXRA 3PV0E 4FEBA 5ICQA 2G93A 1LAXA 3BKIB 4F1YA 5CC2A 2M8CA 2DOJA 2ONKE 2IA4A 4FATA 3MZBA 2WKYA 1ZIUA 2H4IA 4KCDA 1A7LA 2F35A 2RINA 5ISUA 1P99A 1MPBA 3O29A 1T0KA 4ZECA 3HV1A 4KYDA 2P1SA 4YU0A 1D9VA 3GBBA 2O69A 1DPPA 3SEYA 2P2AA 4I9DA 4P0IA 4F3PA 4LQ2A 2GHBA 3K1PA 3MVXA 4QSCA 3N26A
chains in the Genus database with same CATH superfamily
4YZZA 4MCOA 2GRVA 5F7VA 1URGA 4GX3A 5IZZA 3WAFA 2OLBA 4YAHX 2HFBA 4ELRA 1VFDA 2B3BA 3VVFA 4MLQA 1A40A 1H44A 2QMWA 2QVUA 3CSGA 1D4NA 4I1DA 2DXYA 1FQAA 4IO5A 4O3AA 4U2RA 3K1MA 4F22A 4MNCA 4P9KA 3HHFA 4XFEA 1B3HA 5AA3A 3T93B 3RTWB 1B32A 2HAVA 1LB9A 1FTJA 4JSDA 4X48A 3KFMA 4N6KA 3N6TA 2V93A 4OESA 1LBWA 1IMCA 1POTA 1WDNA 1SI1A 3MPLA 3W15C 3JV9A 2XXRA 3FD3A 4MNIA 5CMKA 3TCGA 4IO2A 1LBZA 3TKDA 5DVJA 1QGXA 1MXYA 3FV2A 4NF8A 2HZKA 1SVXB 2O84X 3RGYA 3IL1B 2DE2A 1IXIA 4KD5A 4MAGA 2G29A 4QFPA 2O7IA 1FQBA 4WEPA 1SQYA 4N91A 4KYEA 3OSRA 2QFLA 4PETA 3TTRA 4JVIA 1UIUA 2X7PA 4GQOA 2QPQA 3EF7A 1N76A 1G0IA 2AL5A 5AA4B 4H0WA 1LGBC 2NWJA 2PX1A 1B46A 3E13X 2Y7KA 3ZSFA 1IMEA 3T22A 4GBVA 5IKBA 1AIVA 3KN3A 4YKPA 3IFAA 2ESNA 2XWVA 2DSFA 4OETA 3KSJA 3H3GA 2ONRA 2XXTA 1PBQA 4GX6A 1MQHA 3IB2A 3AXFA 3OEKA 3N6UA 3MWBA 4KR5A 4P3LA 4GVOA 1OMPA 4R73A 3O2AA 3MVWA 3ROJA 1M5BA 2QS4A 4NEDA 4PFYA 4QSDA 1DTZA 2QS3A 2PYYA 5CBSA 1ZKBA 1K9ZA 5B70A 3G3GA 2VT5A 4RJZA 1LAHE 1JVYA 3TCHA 3K6XA 3LUZA 3UIFA 1FBDA 3BIGA 1F9BA 3EKIA 3T9XB 4P56A 4DLDA 2UVHA 4JSOA 4MIJA 5TPAB 4KFQA 4NF4A 5ELVA 3O6IA 2H9BA 1MXWA 4YB6A 4G77A 4N8GA 1PDAA 3R26A 4HCWA 4MMPA 3LR1A 3I3VA 2OWTA 3H7MA 1Q9DA 4FJPA 3EHUA 1EYJA 3FJMA 4OEVA 1B7UA 2Q2AA 3V8XB 1TWYA 2FHYA 1MH3A 1XVYA 4RXLA 4LZ5A 1DBZA 2Y7PA 2R8TA 5AA1A 3FV1A 4F19A 4P47A 3PD9A 1FBCA 4PCDA 3F11A 4G61A 4TQUQ 3RNNA 2WBDA 2RC7A 3HSTA 4I8CA 1VDWA 4JWYA 4UA8A 4GWYA 2PFYA 1MPDA 1SW4A 4PTKA 2XD3A 4X8RA 3MYUA 3FVGA 4F1VA 1BTJA 4LP2B 1PC3A 4NF5B 4P1EA 3W9WA 1I6BA 2I3VA 4QFLA 4ZE8A 5I57B 4PAKA 3FXBA 2DP8A 5AA4A 4OVRA 1A55A 2KQZA 4GL8A 4YB5A 3FXQA 1EYIA 1CE2A 1NV0A 4RYAA 1I6AA 3HN0A 4R6HA 5FBPA 2P3VA 1NI9A 5DEXA 4RA1A 1IZ1A 1Y3QA 1B1HA 2I4CA 2THIA 3M8UA 1Y4TA 3U94A 2Z22A 3PUZE 5CMMA 4MX6A 3PPQA 2FNCA 2ZNTA 1XT8A 4LONB 3BFUA 4GOTA 3QIMA 4U1OA 3KG2A 3OELA 5HBCA 1UTBB 3UORA 1IMFA 2F36A 3UK4A 2XXVA 4NF6B 4EF1A 4YMAA 5CMCA 2OX3A 4RK2A 4QFNA 4ISUA 5H8SA 1FQCA 4F3GA 2ANJA 5ET7A 4OA4A 2Q88A 3FZVA 4X1DA 3PD8A 1NUZA 3RY3A 1IIWA 1EU8A 5TPAA 1MRPA 4U23A 3OOAA 4ZEIA 4KPTA 3OD7A 3U72A 3ECRA 3PPNA 3CRBA 4EQBA 1FBPA 1SW1A 2VP1A 3FJ7A 3EHTA 3SEUA 5F1QA 4PP0A 4IO4A 4DDDA 2E0SA 4F1UA 1LAFE 4ELPA 4GLIA 1P1WA 1NH7A 2PVUA 4NQ8A 1JQFA 4ZEBA 1XS5A 3KBZA 1SPIA 4EQ7A 5I84A 2I49A 3Q27A 1B0LA 1LBYA 4R9FA 4XKNA 2HPGA 4NF5A 3G3FA 5I57A 2ZXTA 3FXUA 2X7QA 3K6UA 3KBRA 5I5PA 4BDNA 1B6HA 3CFXA 3KC1A 3U93A 4EUOA 3H6TA 1ZTYA 2ZYMA 3BIHA 2XXPA 1UIVA 2F97A 4DXCA 1B2HA 3ILUB 3HO7A 2QL3A 2HZLA 4TLMB 4XF5A 5I2KA 3IB0A 4LATA 2A5TB 2UYFA 1FRPA 4PE5B 1B40A 1DK4A 5J1DA 2PFZA 3LUYA 1N3WA 1MQDA 4ONYA 3TODA 1YXIA 2MKZA 2H98A 1FTOA 2XX9A 4PAIA 3OO6A 1OVBA 3OEMA 4NGUA 3H06B 1MS7A 1DPEA 1UTBA 1FSAA 1Z7NE 1PB9A 3TMGA 4OHNA 3FUZA 3R7XA 3H6WA 2BJJX 4MBPA 3MC2A 3BBRA 2Q2CA 1NV7A 3JYRA 1B7ZA 4N17A 4MNPA 1USYE 1B5JA 4ECFA 4OERA 3L6HA 4GBWA 3MQ9A 3VVEA 3IO6A 3CVGA 2FIXA 2IEEA 4HCYA 4I40A 4ELQA 1B52A 2OK2A 1Y3NA 2Y7WA 2ZNUA 4R6KA 4OZ9A 1KZ8A 4OXVA 3TTKA 4LZ8A 4F39A 2XWKA 2ZMBA 3KSXA 3E3KA 1IXGA 1USYH 4ZS9A 1Y9UA 4R9GA 3A29A 4O7IA 5EYFA 1FW0A 1SW2A 3G7WA 4KCCA 1FCKA 4G8MA 2ZNSA 4E0WA 2GQ1A 3TTLA 2RC8A 4Z0IA 2UVJA 5AA2D 3PGFA 1NV2A 4OFJA 4PBQA 2RCAA 1OQHA 2B3FA 4DCYA 4EXLA 1NKXA 2LAOA 3G3JA 1EZ9A 5HM4B 3RUMA 4MHFA 3W9VA 4N6PA 3IJXB 3SEVA 3UP9A 4QF9A 3MVYA 1EZOA 4DXUA 4OANA 1PB8A 5IZ3A 4GWWA 4N07A 3RN8A 4R74A 1Y1ZA 2FA7A 4GFRA 4NF4B 3KJ7A 1DTGA 2FBPA 2QS2A 4MFIA 3DP6A 2A5TA 1Y20A 4OFOA 4U21A 2DWIA 4ND9A 4I3EA 4ELOA 5I2NB 1CB6A 4N4UA 3B6QA 1TXFA 5HPQA 4ZE9A 2PCRA 5TU0A 5AE4A 3LBSA 4N15A 1II5A 2V3UA 1OLAA 1FPLA 2NUVA 3UGWA 4HXVA 2O1MA 3A3CA 1B1XA 1N04A 3E9XA 5H8NB 2W7YA 3E78A 3ZKLA 2VGQA 4ZZAA 4ZZEA 3O6HA 3N94A 1IMBA 3VV5A 1FQEA 3CHGA 4R72A 1O64A 3K4UA 5CM6A 4H8JA 2F8DA 4FEDA 1SW5A 2RCBA 1MDP1 1H76A 2Y7RA 1QW0A 2XWOA 3LSWA 2R6GE 3V83A 5J16A 4NAPA 3EHSA 4LQ5A 3U92A 1SBPA 5FHNA 3CFZA 2PMSA 1MQIA 4KYSA 4N6DA 1B5HA 3RYDA 2Z8EA 3KC0A 1MY2A 5DEXB 4HE2A 1LAGE 3QAXA 4OEUA 4HS7A 4R2FA 5FTIA 1M5DA 1ZBMA 5EHSA 1BKAA 3VDFA 3UN6A 3U65A 3T9UA 1CNQA 4ZEDA 2Y5KA 3QK6A 4H5GA 2V25A 2XXIA 3PMVA 1IQ7A 3C35A 5LOMA 2ZZWA 4X1BA 3Q25A 4KXPA 5KDTB 2F7AA 2F7BA 1VSOA 2XA5A 2PT2A 4O94A 1R9QA 3N5LA 4MLVA 4PAFA 4IO3A 1XVXA 1LCFA 2GFEA 2P3NA 3IR1A 4OFLA 4GWUA 3PPPA 2PBWA 4NWCA 3SETA 1AWBA 1SD3A 4U22A 2OBGA 1J1NA 2OWZA 3VFJA 3MP6A 1OQGA 4PFWA 3USDA 3KN7A 3K01A 5I2NA 4PDHA 2E1SA 1FPJA 1BLFA 2XXWA 3ISPA 3DELB 4U4XA 3A09A 1B5IA 3NOHA 3QUJA 1QJMA 3QYTA 2RKMA 5K2XA 4F3SA 3K6WA 1FQDA 1MXVA 5AA2B 3IFCA 5ITPA 4NE4A 1RDXA 1SYIA 2O7UA 5H8NA 4JB7A 3RT6B 4H5FA 1FPIA 1SYHA 1GGGA 1HSLA 4NN3A 5A5LA 2YLNA 1NUXA 1D3KA 4GXSB 1N0TA 2UVGA 2DWJA 1O63A 3G3IA 4ESWA 1NNFA 4BLAA 1FPFA 3T96B 3K02A 2NXOA 4FE8A 1H45A 5DVFA 4EXKA 3MW0A 5I2KB 2DVZA 2I6EA 4XTCQ 3T0JA 3PPOA 4DZ1A 1FBGA 1DMBA 5JEIA 1FBEA 2ONSA 2HHMA 4EDPA 3MAMA 4O7MA 5L8DA 2Z23A 5B7DA 3TUSA 1B3LA 1FTLA 3H6VA 4IGTA 2L5VA 2WYPA 1Z7ME 3S2VA 2DVCA 3M3KA 1URDA 5CMBA 5KDTA 3KZGA 5DYHA 4O8MA 1YTVA 2DWAA 4JDFA 2O51A 1JETA 2B4MA 2UYEA 4LUBA 5DVIA 2VOZA 1UQWA 3RPWA 2F7CA 1PBPA 4OVPA 4TOZA 4RY1A 2ZYNA 4G8NA 3QMFA 4DCXA 2D21A 2XXHA 1NV1A 1NMUA 2UXAA 4OVQA 1QKAA 4F18A 3OSQA 1NL5A 2O68A 3T9HB 3IOTA 5IAIA 2QS1A 4HE0A 3SDFA 2I3WA 3K6VA 4BDRA 1Y4CA 3FASA 2O1LA 3IJOB 3QUFA 4G68C 1AOVA 4GRKA 3MJNA 3KOTA 1WODA 4XKRA 1QUIA 4G8HA 1Q1KA 1P1NA 3MP8A 4QRZA 4DE8A 1HSJA 4IO6A 4GWOA 4FECA 4PBHA 1Q35A 4DI3D 1NH8A 1US5A 4YB7A 2F6GA 1A99A 3A3UA 5I59B 3TPAA 5AA2A 3DP4A 3EN3A 2F6PA 4DIGA 1RKMA 4NG7A 5LDZA 3V5AA 3L6GA 4HTGA 3DP8A 4OYVA 3CR9A 3CG3A 1B0HA 2QSXA 5EQ7A 1URSA 1TFDA 5KZTA 3B6WA 3LSXA 1NNTA 4I62A 4KI0E 3VLVA 1MQGA 1H43A 1YCJA 1VR5A 4P0GA 3HFUA 1M5CA 4OVSA 5IZ3B 1R6ZA 4XKPA 3S9EA 4R6YA 3TYHA 4NHBA 2GHAA 4AQ4A 4C1UA 3FVNA 1LCTA 3PPRA 1JW1A 3Q29A 1LSTA 2ABHA 3PUYE 2VD2A 3S9LC 1NFTA 2F78A 2F34A 2OZZA 3MPKA 1JW4A 3C36A 5H8HB 2Z8DA 3HHGA 3Q28A 5K2YA 1RYOA 1TFAA 2YPNA 4QFKA 3UA8A 4ZEKA 2O6AA 5L9OA 4AS4A 1G0HA 4PFBA 3KEIA 1B4ZA 5FHMA 3ZS6A 1JNFA 4XKQA 4QFOA 2VD3A 4X9TA 2JJKA 5EQ8A 1ANFA 3Q26A 1XC1A 2H99A 2DWHA 4RPNA 2Q74A 3FXRA 3B8BA 1IMDA 1NNKA 2HQ0A 1NV5A 2A5SA 3QSLA 4POWA 2XX8A 1JEUA 1DSNA 3IO4A 3KOSA 4C1TA 3GBAA 3SEWA 1ELJA 3T66A 3K1NA 1LFGA 1YYZA 4UABA 4X04A 4BDOA 3HPIA 2VHAA 1FTKA 3E79A 3GZGA 1IITA 2XHDA 3VLUA 1FBHA 1MPCA 3TZAA 2NOOA 1GVCA 4HE1A 5EYGA 2PT1A 2Y7IA 3O97A 4AB6A 4JVDA 3TTMA 4THIA 4R75A 1M5EA 2B4LA 4ZEFA 4K3FA 3K00A 5I59A 1FJ9A 5I58A 2I0CA 5F24A 2YJPA 2DYXA 2F5XA 3GXAA 4GL0A 3TAJA 3PUVE 4GF8A 4Q30B 1POY1 4GWXA 4BDMA 3E4RA 5ICTA 3OENA 3FATA 2GH9A 2FYIA 1R9LA 4ESXA 3DM0A 3EPEA 5I7IA 4OWDA 3O9PA 3SERA 1M5FA 4XXUA 3ZKKA 1MXXA 1MXZA 1YAEA 1QKBA 2HEUA 1QVSA 5I56B 3P7IA 2XXXA 4Q0CA 4DI4B 2R71A 5H8QA 3U1OA 3LV0A 3MSTA 1S50A 4OQOA 1GV8A 1B51A 5FTHA 4PFUA 1LBVA 5ET6A 4M4GA 1N7XA 5IGAA 3IORA 4BDQA 5CI5A 2QJEA 1R1NA 1GR2A 1D9YA 1MY1A 2REJA 2QVRA 3TELA 1NV4A 5H8HA 4POXA 2NVUB 4LVQA 2Q8JA 1LB8A 4OVJA 4P1LA 3H4ZA 3S9NC 2Q89A 3BFTA 4Q5TA 2AYSA 4JBZA 1AL3A 4IGRA 1S7YA 4QHQA 2CZLA 4O3BA 5LTCA 1VE4A 2ZYKA 3G3HA 1FJ6A 2ZZVA 1FQFA 4IB2A 2X26A 1AMFA 2I4BA 3PU5A 1A54A 4PFRA 1S9TA 1FTAA 2XXUA 5A5XA 4RPOA 3LSLA 2F3BA 1KA1A 4NMYA 1Y3PA 4GXAA 5CRYA 4PGPA 3PTYA 5ET8A 4G68A 2D3IA 5H8FB 4WEDA 4KQPA 2B65A 2XXYA 2R9JA 5KCJB 3TEPA 1OLCA 1P1UA 1AH5A 2CZHA 1OIBA 1D9QA 4IY5A 1ZJLA 4TLLB 1LBXA 1FBFA 5EHMA 3D4CA 3OO8A 4ZDMA 3R6UA 1IUDA 3OXNA 1MY4A 1A8FA 3IOVA 1IXCA 5ESYA 3MUQA 2Q9TA 4H45A 3B50A 1ZLQA 4IY6A 3D1RA 2KLFA 1QUJA 2AL4A 4LZ7A 3FBPA 2DQVA 2ALUA 1K9YA 1O7TA 3MVZA 5DT6A 4GD5A 2CZKA 2V4CA 5TP9B 5I56A 2DE4A 1FTMA 3B6TA 3PUWE 4P8BA 3GLBA 4GX4A 3VE1B 3CG1A 3JZJA 1ZMGA 1PEBA 2BJIA 1LFHA 4YKIA 1LEVA 3CIJA 3THIA 3V89B 4LA9A 1SDXA 2QMXA 3SEXA 1BK4A 4GIZA 3T9VA 1ATGA 4H46A 1H3DA 3DLNA 1JEVA 1B3FA 2ZYOA 4EQ9A 4G2ZA 4PFIA 3S9MC 2Z8FA 4Z7EA 4N13A 1UTHB 1EH3A 3C32A 4AB5A 1NNPA 5EQAA 4GWZA 5CBRA 5BWJA 4PQJA 4E0XA 3ONMA 3B7DA 1DOTA 1JP4A 3U8QA 2ZZXA 3MBPA 2HCAA 4R2BA 1B58A 3VLWA 4C0RA 2CMOA 3OO7A 2WBBA 1I69A 3PMWA 1Y1MA 1YZ0A 1IEJA 3LSFB 2Q8MA 3TQWA 5L9MA 1RDYA 4NWDA 4YKJA 2OCUA 1B9JA 1WVJA 1B05A 5H8FA 5T3JA 5L9SA 4XEQA 3RPLB 3O66A 3G3KA 3PMXA 4LN5A 5ET5A 1FPEA 3C34A 2RF1A 3TFLA 3MZ9A 2I58A 4M1VA 5IZ1A 5KCJA 3HCQA 2DS9A 3M3LA 5JK4A 1MY3A 3FVKA 1P1OA 5JTYB 5EYHA 4FIMA 4H65A 3H03A 2HAUA 1P1QA 2XD2A 2Y84A 1MXUA 4PF8A 4PE3A 2Y5LA 4F2QA 2OWSA 3RTFB 2XX7A 1NUWA 2VPOA 1MM6A 1B3GA 2REGA 1OVTA 3TCFA 4NX1A 3SKPA 1QULA 2WX9A 3VVDA 4KHZE 1RDZA 4WKMA 3KJTA 1MDQA 2F3DA 1KA0A 3IB1A 1LBBA 5TP9A 4F2OA 4FBPA 4QBAA 1MQJA 2D5WA 4MF3A 3RQTA 3IAZA 4H6DA 3TQLA 4H67A 4HW8A 4U4SA 3D4GA 5IM2A 1JW5A 2UVIA 5I3SA 3FVOA 1B4HA 4RK9A 2V3QA 1INPA 1JVXA 1LBCA 3O28A 2XWIA 4AS5A 1N3XA 3SZPA 1B7HA 3EQ1A 2OJTA 1UTHA 3IOUA 4JVCA 1FPDA 1XHYA 4PC9A 5I58B 1MH4A 1ZU0A 4QSEA 4PGNA 1FPKA 4N81A 3FIRA 4F3BA 4DXBA 1RYXA 2I0BA 3IX1A 1L5TA 4JWXA 2V3TA 3C4MA 2P0SA 3IOWA 4OMBA 4O3CA 1GTKA 3C31A 3MP1A 4JWOA 1N84A 1MM7A 3CSBA 1BP5A 4WXJA 4YICA 2KR0A 3GYYA 4JXIA 3TTNA 3VXBA 3WAEA 4H1XA 2FIEA 3I6VA 3O6GA 1YPNA 4OENA 1DCUA 3IK6B 3RPLA 2V84A 3KN8A 3CFLA 3S4UA 5DTBA 2HXWA 5H8QB 1I6QA 1HSEA 1MG1A 1TT1A 4MH5A 3OO9A 4F31B 4H8IA 3OMBA 1IMAA 4OVTA 4OTEA 4EF2A 4FORA 3MZ1A 4MJOA 4PFTA 2WYKA 5JTYA 2WEFA 2XXKA 3CI8A 3K2DA 2H25A 4U1ZA 1PB7A 1LLSA 1MY0A 3C33A 4FAJA 1KWHA 4GWSA 3QXMA 3H6UA 3TDJA 3M3FA 1N7WA 2CEYA 1XI6A 5ITOA 5BUUA 2QVVA 1IXHA 5FHOA 3RT8A 4BDLA 4UACA 4NF8B 2AIXA 1NUYA 3ODBA 3K0VA 3ILTB 1BIYA 3PUXE 2HXRA 1LFIA 1A8EA 2XXQA 4PDDA 1QUKA 3I5OA 4PF6A 3SESA 3KGCA 1SI0A 2RC9A 4MEVA 5M2VA 1B3EA 4Q8RA 4NF6A 2DE3A 3FGSA 5A5XB 4L17A 1EZPA 3LC8A 2FVZA 4XIGQ 3FJGA 2H5YA 4G4PA 1US4A 3C9HA 3VXCA 4F29A 5DW8A 1XOCA 4P11A 4G68B 4NF0A 4NTLA 4RNSA 1VFEA 4YMBA 4IO7A 4I3YA 1EYKA 4YKKA 3T1BA 2I48A 5EQ9A 2QRYA 3RLFE 2DXRA 3PV0E 4FEBA 5ICQA 2G93A 1LAXA 3BKIB 4F1YA 5CC2A 4N8YA 4QXDA 2DDKA 2M8CA 4IR8A 2CEXA 2DOJA 2ONKE 2IA4A 4FATA 1FPBA 2WKYA 3MZBA 1ZIUA 2H4IA 4KCDA 2CZIA 1A7LA 2F35A 2RINA 5ISUA 1P99A 1MPBA 3O29A 1T0KA 2VPNA 4ZECA 3HV1A 4KYDA 2P1SA 4YU0A 1D9VA 3GBBA 2O69A 1DPPA 3SEYA 2P2AA 4I9DA 4P0IA 1NV6A 4F3PA 4LQ2A 2GHBA 3K1PA 1NV3A 1FPGA 3MVXA 4QSCA 3N26A
chains in the Genus database with same CATH topology
4YZZA 2GRVA 5F7VA 1URGA 3WAFA 2OLBA 4YAHX 2HFBA 4ELRA 1VFDA 2B3BA 3VVFA 4MLQA 1A40A 1H44A 2QMWA 3CSGA 1D4NA 4I1DA 2DXYA 1FQAA 4IO5A 4O3AA 4U2RA 3K1MA 4F22A 3HHFA 1B3HA 5AA3A 3T93B 3RTWB 1B32A 2HAVA 1LB9A 1FTJA 4JSDA 4X48A 3KFMA 3N6TA 2V93A 4OESA 1POTA 1WDNA 1SI1A 3MPLA 3W15C 3JV9A 2XXRA 3FD3A 5CMKA 3TCGA 4IO2A 3TKDA 5DVJA 1MXYA 3FV2A 4NF8A 2HZKA 1SVXB 2O84X 3RGYA 3IL1B 2DE2A 1IXIA 4KD5A 2G29A 4QFPA 2O7IA 1FQBA 4WEPA 1SQYA 4KYEA 3OSRA 4PETA 3TTRA 1UIUA 2X7PA 4GQOA 2QPQA 3EF7A 1N76A 2AL5A 5AA4B 4H0WA 1LGBC 2NWJA 2PX1A 1B46A 3E13X 2Y7KA 3ZSFA 3T22A 5IKBA 1AIVA 3KN3A 4YKPA 2ESNA 2DSFA 4OETA 3KSJA 3H3GA 2ONRA 2XXTA 1PBQA 1MQHA 3IB2A 3AXFA 3OEKA 3N6UA 3MWBA 4KR5A 4GVOA 1OMPA 4R73A 3O2AA 3MVWA 1M5BA 2QS4A 4NEDA 4PFYA 4QSDA 1DTZA 2QS3A 2PYYA 5CBSA 1ZKBA 5B70A 3G3GA 4RJZA 1LAHE 1JVYA 3TCHA 3K6XA 3UIFA 1F9BA 3T9XB 4DLDA 2UVHA 4JSOA 5TPAB 4KFQA 4NF4A 5ELVA 3O6IA 2H9BA 1MXWA 4YB6A 4G77A 1PDAA 3R26A 4HCWA 3LR1A 3I3VA 2OWTA 3H7MA 4FJPA 3EHUA 3FJMA 4OEVA 1B7UA 2Q2AA 3V8XB 1TWYA 1MH3A 1XVYA 4RXLA 4LZ5A 2Y7PA 5AA1A 3FV1A 4F19A 3PD9A 3F11A 4TQUQ 3RNNA 2RC7A 3HSTA 4I8CA 4JWYA 4UA8A 1MPDA 1SW4A 2XD3A 3FVGA 4F1VA 1BTJA 4LP2B 1PC3A 4NF5B 3W9WA 1I6BA 2I3VA 4QFLA 4ZE8A 5I57B 2DP8A 5AA4A 1A55A 4GL8A 4YB5A 3FXQA 1CE2A 4RYAA 1I6AA 3HN0A 4R6HA 5DEXA 4RA1A 1IZ1A 1Y3QA 1B1HA 2I4CA 2THIA 3M8UA 1Y4TA 3U94A 2Z22A 3PUZE 5CMMA 3PPQA 2FNCA 2ZNTA 1XT8A 4LONB 3BFUA 4GOTA 3QIMA 4U1OA 3KG2A 3OELA 5HBCA 1UTBB 3UORA 2F36A 3UK4A 2XXVA 4NF6B 4EF1A 4YMAA 5CMCA 4QFNA 4RK2A 4ISUA 5H8SA 1FQCA 4F3GA 2ANJA 2Q88A 3FZVA 4X1DA 3PD8A 3RY3A 1IIWA 1EU8A 5TPAA 1MRPA 4U23A 3OOAA 4ZEIA 4KPTA 3OD7A 3U72A 3ECRA 3PPNA 3CRBA 4EQBA 1SW1A 2VP1A 3FJ7A 3EHTA 3SEUA 5F1QA 4PP0A 4IO4A 4DDDA 2E0SA 4F1UA 1LAFE 4ELPA 4GLIA 1P1WA 1NH7A 2PVUA 1JQFA 4ZEBA 1XS5A 4EQ7A 5I84A 2I49A 3Q27A 1B0LA 4R9FA 4XKNA 4NF5A 3G3FA 5I57A 2ZXTA 3FXUA 2X7QA 3K6UA 3KBRA 4BDNA 1B6HA 3CFXA 3U93A 4EUOA 3H6TA 1ZTYA 2ZYMA 2XXPA 1UIVA 2F97A 4DXCA 1B2HA 3ILUB 3HO7A 2QL3A 2HZLA 4TLMB 5I2KA 3IB0A 4LATA 2A5TB 2UYFA 4PE5B 1B40A 5J1DA 3LUYA 1N3WA 1MQDA 4ONYA 3TODA 2H98A 1FTOA 2XX9A 3OO6A 1OVBA 3OEMA 3H06B 1MS7A 1DPEA 1UTBA 1Z7NE 1PB9A 3TMGA 4OHNA 3FUZA 3R7XA 3H6WA 2BJJX 4MBPA 3MC2A 3BBRA 2Q2CA 3JYRA 1B7ZA 1USYE 1B5JA 4ECFA 4OERA 3L6HA 3MQ9A 3VVEA 3IO6A 3CVGA 2IEEA 4HCYA 4ELQA 1B52A 2OK2A 1Y3NA 2Y7WA 2ZNUA 4R6KA 4OZ9A 4OXVA 3TTKA 4LZ8A 4F39A 2ZMBA 3KSXA 3E3KA 1IXGA 1USYH 4ZS9A 1Y9UA 4R9GA 5EYFA 1FW0A 1SW2A 3G7WA 4KCCA 1FCKA 4G8MA 2ZNSA 4E0WA 3TTLA 2RC8A 4Z0IA 2UVJA 5AA2D 3PGFA 4OFJA 2RCAA 1OQHA 2B3FA 4DCYA 4EXLA 1NKXA 2LAOA 3G3JA 1EZ9A 5HM4B 3RUMA 3W9VA 4N6PA 3IJXB 3SEVA 3UP9A 4QF9A 3MVYA 1EZOA 4DXUA 1PB8A 4N07A 3RN8A 4R74A 1Y1ZA 2FA7A 4GFRA 4NF4B 3KJ7A 1DTGA 2QS2A 4MFIA 3DP6A 2A5TA 1Y20A 4OFOA 4U21A 2DWIA 4ND9A 4ELOA 5I2NB 1CB6A 3B6QA 1TXFA 5HPQA 4ZE9A 5TU0A 5AE4A 3LBSA 1II5A 2V3UA 1OLAA 2NUVA 3UGWA 2O1MA 3A3CA 1B1XA 1N04A 3E9XA 5H8NB 2W7YA 3ZKLA 2VGQA 4ZZAA 4ZZEA 3O6HA 3N94A 3VV5A 1FQEA 4R72A 1O64A 3K4UA 5CM6A 4H8JA 2F8DA 4FEDA 1SW5A 2RCBA 1MDP1 1H76A 2Y7RA 1QW0A 3LSWA 2R6GE 3V83A 3EHSA 4LQ5A 3U92A 1SBPA 5FHNA 3CFZA 2PMSA 1MQIA 4KYSA 1B5HA 2Z8EA 1MY2A 5DEXB 1LAGE 3QAXA 4OEUA 4HS7A 4R2FA 5FTIA 1M5DA 1ZBMA 5EHSA 1BKAA 3VDFA 3UN6A 3T9UA 4ZEDA 3QK6A 4H5GA 2V25A 2XXIA 3PMVA 1IQ7A 3C35A 5LOMA 4X1BA 3Q25A 5KDTB 2F7AA 2F7BA 1VSOA 2PT2A 1R9QA 3N5LA 4MLVA 4IO3A 1XVXA 1LCFA 2GFEA 3IR1A 4OFLA 3PPPA 2PBWA 4NWCA 3SETA 1SD3A 4U22A 2OBGA 1J1NA 3VFJA 3MP6A 1OQGA 4PFWA 3USDA 3KN7A 3K01A 5I2NA 2E1SA 1BLFA 2XXWA 3DELB 4U4XA 3A09A 1B5IA 3QUJA 1QJMA 3QYTA 2RKMA 5K2XA 4F3SA 3K6WA 1FQDA 1MXVA 5AA2B 5ITPA 4NE4A 1SYIA 2O7UA 5H8NA 4JB7A 3RT6B 4H5FA 1SYHA 1GGGA 1HSLA 2YLNA 1D3KA 4GXSB 1N0TA 2UVGA 2DWJA 1O63A 3G3IA 4ESWA 1NNFA 4BLAA 3T96B 3K02A 2NXOA 4FE8A 1H45A 5DVFA 4EXKA 3MW0A 5I2KB 2DVZA 2I6EA 4XTCQ 3PPOA 4DZ1A 1DMBA 5JEIA 2ONSA 4EDPA 3MAMA 5L8DA 2Z23A 5B7DA 3TUSA 1B3LA 1FTLA 3H6VA 4IGTA 1Z7ME 3S2VA 2DVCA 3M3KA 1URDA 5CMBA 5KDTA 3KZGA 5DYHA 1YTVA 2DWAA 4JDFA 2O51A 1JETA 2UYEA 4LUBA 5DVIA 2VOZA 1UQWA 3RPWA 2F7CA 1PBPA 4TOZA 4RY1A 2ZYNA 4G8NA 4DCXA 2D21A 2XXHA 1NMUA 2UXAA 1QKAA 4F18A 3OSQA 1NL5A 2O68A 3T9HB 3IOTA 5IAIA 2QS1A 3SDFA 2I3WA 3K6VA 4BDRA 1Y4CA 3FASA 2O1LA 3IJOB 3QUFA 4G68C 1AOVA 4GRKA 3MJNA 3KOTA 1WODA 4XKRA 1QUIA 4G8HA 1Q1KA 1P1NA 3MP8A 4QRZA 4DE8A 1HSJA 4IO6A 4GWOA 4FECA 1Q35A 1NH8A 1US5A 4YB7A 2F6GA 1A99A 3A3UA 5I59B 3TPAA 5AA2A 3DP4A 3EN3A 2F6PA 4DIGA 1RKMA 3V5AA 3L6GA 4HTGA 3DP8A 4OYVA 3CR9A 3CG3A 1B0HA 2QSXA 1URSA 1TFDA 5KZTA 3B6WA 3LSXA 1NNTA 4I62A 4KI0E 3VLVA 1MQGA 1H43A 1YCJA 1VR5A 4P0GA 1M5CA 1R6ZA 4XKPA 3S9EA 4R6YA 3TYHA 2GHAA 4AQ4A 4C1UA 3FVNA 1LCTA 3PPRA 1JW1A 3Q29A 1LSTA 2ABHA 3PUYE 2VD2A 3S9LC 1NFTA 2F78A 2F34A 2OZZA 3MPKA 1JW4A 3C36A 5H8HB 2Z8DA 3HHGA 3Q28A 5K2YA 1RYOA 1TFAA 2YPNA 4QFKA 3UA8A 4ZEKA 2O6AA 5L9OA 3KEIA 1B4ZA 5FHMA 3ZS6A 1JNFA 4XKQA 4QFOA 2VD3A 4X9TA 1ANFA 3Q26A 1XC1A 2H99A 2DWHA 4RPNA 3FXRA 1NNKA 2HQ0A 2A5SA 3QSLA 4POWA 2XX8A 1JEUA 1DSNA 3IO4A 3KOSA 4C1TA 3GBAA 3SEWA 1ELJA 3T66A 3K1NA 1LFGA 4BDOA 3HPIA 2VHAA 1FTKA 3GZGA 1IITA 2XHDA 3VLUA 1MPCA 3TZAA 2NOOA 1GVCA 2PT1A 2Y7IA 3O97A 4AB6A 3TTMA 4THIA 1M5EA 4R75A 4ZEFA 4K3FA 3K00A 5I59A 5I58A 2I0CA 2YJPA 2DYXA 2F5XA 3GXAA 4GL0A 3TAJA 3PUVE 4GF8A 4Q30B 1POY1 4BDMA 5ICTA 3E4RA 3OENA 3FATA 2GH9A 2FYIA 1R9LA 4ESXA 3DM0A 3EPEA 4OWDA 3O9PA 3SERA 1M5FA 4XXUA 3ZKKA 1MXXA 1MXZA 1YAEA 1QKBA 2HEUA 1QVSA 5I56B 3P7IA 2XXXA 4Q0CA 2R71A 5H8QA 3U1OA 1S50A 4OQOA 1GV8A 1B51A 5FTHA 4PFUA 4M4GA 1N7XA 3IORA 4BDQA 5CI5A 2QJEA 1R1NA 1GR2A 1D9YA 1MY1A 2REJA 3TELA 5H8HA 4POXA 2NVUB 4LVQA 2Q8JA 1LB8A 4OVJA 3H4ZA 3S9NC 2Q89A 3BFTA 4Q5TA 2AYSA 4JBZA 1AL3A 4IGRA 1S7YA 4QHQA 2CZLA 4O3BA 1VE4A 2ZYKA 3G3HA 1FQFA 4IB2A 2X26A 1AMFA 2I4BA 3PU5A 1A54A 1S9TA 2XXUA 5A5XA 4RPOA 3LSLA 4NMYA 1Y3PA 4GXAA 5CRYA 4G68A 2D3IA 5H8FB 4WEDA 4KQPA 2B65A 2XXYA 2R9JA 5KCJB 3TEPA 1OLCA 1P1UA 1AH5A 1OIBA 4IY5A 1ZJLA 4TLLB 5EHMA 3D4CA 3OO8A 4ZDMA 3R6UA 1IUDA 3OXNA 1MY4A 1A8FA 3IOVA 1IXCA 3MUQA 2Q9TA 1ZLQA 4IY6A 2KLFA 1QUJA 2AL4A 4LZ7A 2DQVA 2ALUA 1O7TA 3MVZA 5DT6A 4GD5A 5TP9B 5I56A 2DE4A 1FTMA 3B6TA 3PUWE 3GLBA 3VE1B 3CG1A 3JZJA 1ZMGA 1PEBA 1LFHA 4YKIA 3CIJA 3THIA 3V89B 4LA9A 1SDXA 2QMXA 3SEXA 4GIZA 3T9VA 1ATGA 1H3DA 3DLNA 1JEVA 1B3FA 2ZYOA 4EQ9A 4G2ZA 3S9MC 2Z8FA 4Z7EA 4N13A 1UTHB 1EH3A 3C32A 4AB5A 1NNPA 5CBRA 5BWJA 4PQJA 4E0XA 3ONMA 3B7DA 1DOTA 3U8QA 3MBPA 2HCAA 4R2BA 1B58A 3VLWA 4C0RA 2CMOA 3OO7A 1I69A 3PMWA 1Y1MA 1IEJA 3LSFB 3TQWA 5L9MA 4NWDA 4YKJA 2OCUA 1B9JA 1WVJA 1B05A 5H8FA 5L9SA 3O66A 3G3KA 3PMXA 3C34A 2RF1A 3TFLA 3MZ9A 2I58A 4M1VA 5KCJA 3HCQA 2DS9A 3M3LA 5JK4A 1MY3A 3FVKA 1P1OA 5JTYB 4FIMA 4H65A 3H03A 2HAUA 1P1QA 2XD2A 2Y84A 1MXUA 4F2QA 2OWSA 3RTFB 2XX7A 1MM6A 1B3GA 2REGA 1OVTA 3TCFA 3SKPA 1QULA 3VVDA 4KHZE 4WKMA 3KJTA 1MDQA 3IB1A 1LBBA 5TP9A 4F2OA 1MQJA 2D5WA 4MF3A 3RQTA 3IAZA 4H6DA 3TQLA 4H67A 4HW8A 4U4SA 3D4GA 1JW5A 2UVIA 3FVOA 1B4HA 4RK9A 2V3QA 1JVXA 1LBCA 3O28A 1N3XA 1B7HA 3EQ1A 2OJTA 1UTHA 3IOUA 5I58B 1XHYA 1MH4A 1ZU0A 4QSEA 3FIRA 4F3BA 4DXBA 1RYXA 2I0BA 3IX1A 1L5TA 4JWXA 2V3TA 3C4MA 2P0SA 3IOWA 4OMBA 4O3CA 1GTKA 3C31A 3MP1A 4JWOA 1N84A 1MM7A 3CSBA 1BP5A 4WXJA 4YICA 4JXIA 3TTNA 3VXBA 3WAEA 4H1XA 3I6VA 3O6GA 1YPNA 4OENA 3IK6B 2V84A 3KN8A 3CFLA 3S4UA 5DTBA 2HXWA 5H8QB 1I6QA 1HSEA 1MG1A 1TT1A 4MH5A 3OO9A 4F31B 4H8IA 3OMBA 4OTEA 4EF2A 4FORA 3MZ1A 4PFTA 5JTYA 3CI8A 3K2DA 2H25A 4U1ZA 1PB7A 1LLSA 1MY0A 3C33A 4FAJA 1KWHA 3QXMA 3H6UA 3TDJA 3M3FA 1N7WA 5ITOA 5BUUA 1IXHA 5FHOA 3RT8A 4BDLA 2AIXA 4NF8B 4UACA 3ODBA 3K0VA 3ILTB 1BIYA 3PUXE 1LFIA 1A8EA 2XXQA 1QUKA 3I5OA 3SESA 3KGCA 1SI0A 2RC9A 5M2VA 1B3EA 4Q8RA 4NF6A 2DE3A 3FGSA 5A5XB 4L17A 1EZPA 3LC8A 4XIGQ 3FJGA 2H5YA 4G4PA 1US4A 3C9HA 3VXCA 4F29A 1XOCA 4P11A 4G68B 4YMBA 4NTLA 4RNSA 1VFEA 4IO7A 4YKKA 2I48A 2QRYA 3RLFE 2DXRA 3PV0E 4FEBA 5ICQA 2G93A 1LAXA 3BKIB 4F1YA 5CC2A 2M8CA 2DOJA 2ONKE 2IA4A 4FATA 3MZBA 2WKYA 1ZIUA 2H4IA 4KCDA 1A7LA 2F35A 2RINA 5ISUA 1P99A 1MPBA 3O29A 1T0KA 4ZECA 3HV1A 4KYDA 2P1SA 4YU0A 1D9VA 3GBBA 2O69A 1DPPA 3SEYA 2P2AA 4I9DA 4P0IA 4F3PA 4LQ2A 2GHBA 3K1PA 3MVXA 4QSCA 3N26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZZ A;  2GRV A;  5F7V A;  1URG A;  3WAF A;  2OLB A;  4YAH X;  2HFB A;  4ELR A;  1VFD A;  2B3B A;  3VVF A;  4MLQ A;  1A40 A;  1H44 A;  2QMW A;  3CSG A;  1D4N A;  4I1D A;  2DXY A;  1FQA A;  4IO5 A;  4O3A A;  4U2R A;  3K1M A;  4F22 A;  3HHF A;  1B3H A;  5AA3 A;  3T93 B;  3RTW B;  1B32 A;  2HAV A;  1LB9 A;  1FTJ A;  4JSD A;  4X48 A;  3KFM A;  3N6T A;  2V93 A;  4OES A;  1POT A;  1WDN A;  1SI1 A;  3MPL A;  3W15 C;  3JV9 A;  2XXR A;  3FD3 A;  5CMK A;  3TCG A;  4IO2 A;  3TKD A;  5DVJ A;  1MXY A;  3FV2 A;  4NF8 A;  2HZK A;  1SVX B;  2O84 X;  3RGY A;  3IL1 B;  2DE2 A;  1IXI A;  4KD5 A;  2G29 A;  4QFP A;  2O7I A;  1FQB A;  4WEP A;  1SQY A;  4KYE A;  3OSR A;  4PET A;  3TTR A;  1UIU A;  2X7P A;  4GQO A;  2QPQ A;  3EF7 A;  1N76 A;  2AL5 A;  5AA4 B;  4H0W A;  1LGB C;  2NWJ A;  2PX1 A;  1B46 A;  3E13 X;  2Y7K A;  3ZSF A;  3T22 A;  5IKB A;  1AIV A;  3KN3 A;  4YKP A;  2ESN A;  2DSF A;  4OET A;  3KSJ A;  3H3G A;  2ONR A;  2XXT A;  1PBQ A;  1MQH A;  3IB2 A;  3AXF A;  3OEK A;  3N6U A;  3MWB A;  4KR5 A;  4GVO A;  1OMP A;  4R73 A;  3O2A A;  3MVW A;  1M5B A;  2QS4 A;  4NED A;  4PFY A;  4QSD A;  1DTZ A;  2QS3 A;  2PYY A;  5CBS A;  1ZKB A;  5B70 A;  3G3G A;  4RJZ A;  1LAH E;  1JVY A;  3TCH A;  3K6X A;  3UIF A;  1F9B A;  3T9X B;  4DLD A;  2UVH A;  4JSO A;  5TPA B;  4KFQ A;  4NF4 A;  5ELV A;  3O6I A;  2H9B A;  1MXW A;  4YB6 A;  4G77 A;  1PDA A;  3R26 A;  4HCW A;  3LR1 A;  3I3V A;  2OWT A;  3H7M A;  4FJP A;  3EHU A;  3FJM A;  4OEV A;  1B7U A;  2Q2A A;  3V8X B;  1TWY A;  1MH3 A;  1XVY A;  4RXL A;  4LZ5 A;  2Y7P A;  5AA1 A;  3FV1 A;  4F19 A;  3PD9 A;  3F11 A;  4TQU Q;  3RNN A;  2RC7 A;  3HST A;  4I8C A;  4JWY A;  4UA8 A;  1MPD A;  1SW4 A;  2XD3 A;  3FVG A;  4F1V A;  1BTJ A;  4LP2 B;  1PC3 A;  4NF5 B;  3W9W A;  1I6B A;  2I3V A;  4QFL A;  4ZE8 A;  5I57 B;  2DP8 A;  5AA4 A;  1A55 A;  4GL8 A;  4YB5 A;  3FXQ A;  1CE2 A;  4RYA A;  1I6A A;  3HN0 A;  4R6H A;  5DEX A;  4RA1 A;  1IZ1 A;  1Y3Q A;  1B1H A;  2I4C A;  2THI A;  3M8U A;  1Y4T A;  3U94 A;  2Z22 A;  3PUZ E;  5CMM A;  3PPQ A;  2FNC A;  2ZNT A;  1XT8 A;  4LON B;  3BFU A;  4GOT A;  3QIM A;  4U1O A;  3KG2 A;  3OEL A;  5HBC A;  1UTB B;  3UOR A;  2F36 A;  3UK4 A;  2XXV A;  4NF6 B;  4EF1 A;  4YMA A;  5CMC A;  4QFN A;  4RK2 A;  4ISU A;  5H8S A;  1FQC A;  4F3G A;  2ANJ A;  2Q88 A;  3FZV A;  4X1D A;  3PD8 A;  3RY3 A;  1IIW A;  1EU8 A;  5TPA A;  1MRP A;  4U23 A;  3OOA A;  4ZEI A;  4KPT A;  3OD7 A;  3U72 A;  3ECR A;  3PPN A;  3CRB A;  4EQB A;  1SW1 A;  2VP1 A;  3FJ7 A;  3EHT A;  3SEU A;  5F1Q A;  4PP0 A;  4IO4 A;  4DDD A;  2E0S A;  4F1U A;  1LAF E;  4ELP A;  4GLI A;  1P1W A;  1NH7 A;  2PVU A;  1JQF A;  4ZEB A;  1XS5 A;  4EQ7 A;  5I84 A;  2I49 A;  3Q27 A;  1B0L A;  4R9F A;  4XKN A;  4NF5 A;  3G3F A;  5I57 A;  2ZXT A;  3FXU A;  2X7Q A;  3K6U A;  3KBR A;  4BDN A;  1B6H A;  3CFX A;  3U93 A;  4EUO A;  3H6T A;  1ZTY A;  2ZYM A;  2XXP A;  1UIV A;  2F97 A;  4DXC A;  1B2H A;  3ILU B;  3HO7 A;  2QL3 A;  2HZL A;  4TLM B;  5I2K A;  3IB0 A;  4LAT A;  2A5T B;  2UYF A;  4PE5 B;  1B40 A;  5J1D A;  3LUY A;  1N3W A;  1MQD A;  4ONY A;  3TOD A;  2H98 A;  1FTO A;  2XX9 A;  3OO6 A;  1OVB A;  3OEM A;  3H06 B;  1MS7 A;  1DPE A;  1UTB A;  1Z7N E;  1PB9 A;  3TMG A;  4OHN A;  3FUZ A;  3R7X A;  3H6W A;  2BJJ X;  4MBP A;  3MC2 A;  3BBR A;  2Q2C A;  3JYR A;  1B7Z A;  1USY E;  1B5J A;  4ECF A;  4OER A;  3L6H A;  3MQ9 A;  3VVE A;  3IO6 A;  3CVG A;  2IEE A;  4HCY A;  4ELQ A;  1B52 A;  2OK2 A;  1Y3N A;  2Y7W A;  2ZNU A;  4R6K A;  4OZ9 A;  4OXV A;  3TTK A;  4LZ8 A;  4F39 A;  2ZMB A;  3KSX A;  3E3K A;  1IXG A;  1USY H;  4ZS9 A;  1Y9U A;  4R9G A;  5EYF A;  1FW0 A;  1SW2 A;  3G7W A;  4KCC A;  1FCK A;  4G8M A;  2ZNS A;  4E0W A;  3TTL A;  2RC8 A;  4Z0I A;  2UVJ A;  5AA2 D;  3PGF A;  4OFJ A;  2RCA A;  1OQH A;  2B3F A;  4DCY A;  4EXL A;  1NKX A;  2LAO A;  3G3J A;  1EZ9 A;  5HM4 B;  3RUM A;  3W9V A;  4N6P A;  3IJX B;  3SEV A;  3UP9 A;  4QF9 A;  3MVY A;  1EZO A;  4DXU A;  1PB8 A;  4N07 A;  3RN8 A;  4R74 A;  1Y1Z A;  2FA7 A;  4GFR A;  4NF4 B;  3KJ7 A;  1DTG A;  2QS2 A;  4MFI A;  3DP6 A;  2A5T A;  1Y20 A;  4OFO A;  4U21 A;  2DWI A;  4ND9 A;  4ELO A;  5I2N B;  1CB6 A;  3B6Q A;  1TXF A;  5HPQ A;  4ZE9 A;  5TU0 A;  5AE4 A;  3LBS A;  1II5 A;  2V3U A;  1OLA A;  2NUV A;  3UGW A;  2O1M A;  3A3C A;  1B1X A;  1N04 A;  3E9X A;  5H8N B;  2W7Y A;  3ZKL A;  2VGQ A;  4ZZA A;  4ZZE A;  3O6H A;  3N94 A;  3VV5 A;  1FQE A;  4R72 A;  1O64 A;  3K4U A;  5CM6 A;  4H8J A;  2F8D A;  4FED A;  1SW5 A;  2RCB A;  1MDP 1;  1H76 A;  2Y7R A;  1QW0 A;  3LSW A;  2R6G E;  3V83 A;  3EHS A;  4LQ5 A;  3U92 A;  1SBP A;  5FHN A;  3CFZ A;  2PMS A;  1MQI A;  4KYS A;  1B5H A;  2Z8E A;  1MY2 A;  5DEX B;  1LAG E;  3QAX A;  4OEU A;  4HS7 A;  4R2F A;  5FTI A;  1M5D A;  1ZBM A;  5EHS A;  1BKA A;  3VDF A;  3UN6 A;  3T9U A;  4ZED A;  3QK6 A;  4H5G A;  2V25 A;  2XXI A;  3PMV A;  1IQ7 A;  3C35 A;  5LOM A;  4X1B A;  3Q25 A;  5KDT B;  2F7A A;  2F7B A;  1VSO A;  2PT2 A;  1R9Q A;  3N5L A;  4MLV A;  4IO3 A;  1XVX A;  1LCF A;  2GFE A;  3IR1 A;  4OFL A;  3PPP A;  2PBW A;  4NWC A;  3SET A;  1SD3 A;  4U22 A;  2OBG A;  1J1N A;  3VFJ A;  3MP6 A;  1OQG A;  4PFW A;  3USD A;  3KN7 A;  3K01 A;  5I2N A;  2E1S A;  1BLF A;  2XXW A;  3DEL B;  4U4X A;  3A09 A;  1B5I A;  3QUJ A;  1QJM A;  3QYT A;  2RKM A;  5K2X A;  4F3S A;  3K6W A;  1FQD A;  1MXV A;  5AA2 B;  5ITP A;  4NE4 A;  1SYI A;  2O7U A;  5H8N A;  4JB7 A;  3RT6 B;  4H5F A;  1SYH A;  1GGG A;  1HSL A;  2YLN A;  1D3K A;  4GXS B;  1N0T A;  2UVG A;  2DWJ A;  1O63 A;  3G3I A;  4ESW A;  1NNF A;  4BLA A;  3T96 B;  3K02 A;  2NXO A;  4FE8 A;  1H45 A;  5DVF A;  4EXK A;  3MW0 A;  5I2K B;  2DVZ A;  2I6E A;  4XTC Q;  3PPO A;  4DZ1 A;  1DMB A;  5JEI A;  2ONS A;  4EDP A;  3MAM A;  5L8D A;  2Z23 A;  5B7D A;  3TUS A;  1B3L A;  1FTL A;  3H6V A;  4IGT A;  1Z7M E;  3S2V A;  2DVC A;  3M3K A;  1URD A;  5CMB A;  5KDT A;  3KZG A;  5DYH A;  1YTV A;  2DWA A;  4JDF A;  2O51 A;  1JET A;  2UYE A;  4LUB A;  5DVI A;  2VOZ A;  1UQW A;  3RPW A;  2F7C A;  1PBP A;  4TOZ A;  4RY1 A;  2ZYN A;  4G8N A;  4DCX A;  2D21 A;  2XXH A;  1NMU A;  2UXA A;  1QKA A;  4F18 A;  3OSQ A;  1NL5 A;  2O68 A;  3T9H B;  3IOT A;  5IAI A;  2QS1 A;  3SDF A;  2I3W A;  3K6V A;  4BDR A;  1Y4C A;  3FAS A;  2O1L A;  3IJO B;  3QUF A;  4G68 C;  1AOV A;  4GRK A;  3MJN A;  3KOT A;  1WOD A;  4XKR A;  1QUI A;  4G8H A;  1Q1K A;  1P1N A;  3MP8 A;  4QRZ A;  4DE8 A;  1HSJ A;  4IO6 A;  4GWO A;  4FEC A;  1Q35 A;  1NH8 A;  1US5 A;  4YB7 A;  2F6G A;  1A99 A;  3A3U A;  5I59 B;  3TPA A;  5AA2 A;  3DP4 A;  3EN3 A;  2F6P A;  4DIG A;  1RKM A;  3V5A A;  3L6G A;  4HTG A;  3DP8 A;  4OYV A;  3CR9 A;  3CG3 A;  1B0H A;  2QSX A;  1URS A;  1TFD A;  5KZT A;  3B6W A;  3LSX A;  1NNT A;  4I62 A;  4KI0 E;  3VLV A;  1MQG A;  1H43 A;  1YCJ A;  1VR5 A;  4P0G A;  1M5C A;  1R6Z A;  4XKP A;  3S9E A;  4R6Y A;  3TYH A;  2GHA A;  4AQ4 A;  4C1U A;  3FVN A;  1LCT A;  3PPR A;  1JW1 A;  3Q29 A;  1LST A;  2ABH A;  3PUY E;  2VD2 A;  3S9L C;  1NFT A;  2F78 A;  2F34 A;  2OZZ A;  3MPK A;  1JW4 A;  3C36 A;  5H8H B;  2Z8D A;  3HHG A;  3Q28 A;  5K2Y A;  1RYO A;  1TFA A;  2YPN A;  4QFK A;  3UA8 A;  4ZEK A;  2O6A A;  5L9O A;  3KEI A;  1B4Z A;  5FHM A;  3ZS6 A;  1JNF A;  4XKQ A;  4QFO A;  2VD3 A;  4X9T A;  1ANF A;  3Q26 A;  1XC1 A;  2H99 A;  2DWH A;  4RPN A;  3FXR A;  1NNK A;  2HQ0 A;  2A5S A;  3QSL A;  4POW A;  2XX8 A;  1JEU A;  1DSN A;  3IO4 A;  3KOS A;  4C1T A;  3GBA A;  3SEW A;  1ELJ A;  3T66 A;  3K1N A;  1LFG A;  4BDO A;  3HPI A;  2VHA A;  1FTK A;  3GZG A;  1IIT A;  2XHD A;  3VLU A;  1MPC A;  3TZA A;  2NOO A;  1GVC A;  2PT1 A;  2Y7I A;  3O97 A;  4AB6 A;  3TTM A;  4THI A;  1M5E A;  4R75 A;  4ZEF A;  4K3F A;  3K00 A;  5I59 A;  5I58 A;  2I0C A;  2YJP A;  2DYX A;  2F5X A;  3GXA A;  4GL0 A;  3TAJ A;  3PUV E;  4GF8 A;  4Q30 B;  1POY 1;  4BDM A;  5ICT A;  3E4R A;  3OEN A;  3FAT A;  2GH9 A;  2FYI A;  1R9L A;  4ESX A;  3DM0 A;  3EPE A;  4OWD A;  3O9P A;  3SER A;  1M5F A;  4XXU A;  3ZKK A;  1MXX A;  1MXZ A;  1YAE A;  1QKB A;  2HEU A;  1QVS A;  5I56 B;  3P7I A;  2XXX A;  4Q0C A;  2R71 A;  5H8Q A;  3U1O A;  1S50 A;  4OQO A;  1GV8 A;  1B51 A;  5FTH A;  4PFU A;  4M4G A;  1N7X A;  3IOR A;  4BDQ A;  5CI5 A;  2QJE A;  1R1N A;  1GR2 A;  1D9Y A;  1MY1 A;  2REJ A;  3TEL A;  5H8H A;  4POX A;  2NVU B;  4LVQ A;  2Q8J A;  1LB8 A;  4OVJ A;  3H4Z A;  3S9N C;  2Q89 A;  3BFT A;  4Q5T A;  2AYS A;  4JBZ A;  1AL3 A;  4IGR A;  1S7Y A;  4QHQ A;  2CZL A;  4O3B A;  1VE4 A;  2ZYK A;  3G3H A;  1FQF A;  4IB2 A;  2X26 A;  1AMF A;  2I4B A;  3PU5 A;  1A54 A;  1S9T A;  2XXU A;  5A5X A;  4RPO A;  3LSL A;  4NMY A;  1Y3P A;  4GXA A;  5CRY A;  4G68 A;  2D3I A;  5H8F B;  4WED A;  4KQP A;  2B65 A;  2XXY A;  2R9J A;  5KCJ B;  3TEP A;  1OLC A;  1P1U A;  1AH5 A;  1OIB A;  4IY5 A;  1ZJL A;  4TLL B;  5EHM A;  3D4C A;  3OO8 A;  4ZDM A;  3R6U A;  1IUD A;  3OXN A;  1MY4 A;  1A8F A;  3IOV A;  1IXC A;  3MUQ A;  2Q9T A;  1ZLQ A;  4IY6 A;  2KLF A;  1QUJ A;  2AL4 A;  4LZ7 A;  2DQV A;  2ALU A;  1O7T A;  3MVZ A;  5DT6 A;  4GD5 A;  5TP9 B;  5I56 A;  2DE4 A;  1FTM A;  3B6T A;  3PUW E;  3GLB A;  3VE1 B;  3CG1 A;  3JZJ A;  1ZMG A;  1PEB A;  1LFH A;  4YKI A;  3CIJ A;  3THI A;  3V89 B;  4LA9 A;  1SDX A;  2QMX A;  3SEX A;  4GIZ A;  3T9V A;  1ATG A;  1H3D A;  3DLN A;  1JEV A;  1B3F A;  2ZYO A;  4EQ9 A;  4G2Z A;  3S9M C;  2Z8F A;  4Z7E A;  4N13 A;  1UTH B;  1EH3 A;  3C32 A;  4AB5 A;  1NNP A;  5CBR A;  5BWJ A;  4PQJ A;  4E0X A;  3ONM A;  3B7D A;  1DOT A;  3U8Q A;  3MBP A;  2HCA A;  4R2B A;  1B58 A;  3VLW A;  4C0R A;  2CMO A;  3OO7 A;  1I69 A;  3PMW A;  1Y1M A;  1IEJ A;  3LSF B;  3TQW A;  5L9M A;  4NWD A;  4YKJ A;  2OCU A;  1B9J A;  1WVJ A;  1B05 A;  5H8F A;  5L9S A;  3O66 A;  3G3K A;  3PMX A;  3C34 A;  2RF1 A;  3TFL A;  3MZ9 A;  2I58 A;  4M1V A;  5KCJ A;  3HCQ A;  2DS9 A;  3M3L A;  5JK4 A;  1MY3 A;  3FVK A;  1P1O A;  5JTY B;  4FIM A;  4H65 A;  3H03 A;  2HAU A;  1P1Q A;  2XD2 A;  2Y84 A;  1MXU A;  4F2Q A;  2OWS A;  3RTF B;  2XX7 A;  1MM6 A;  1B3G A;  2REG A;  1OVT A;  3TCF A;  3SKP A;  1QUL A;  3VVD A;  4KHZ E;  4WKM A;  3KJT A;  1MDQ A;  3IB1 A;  1LBB A;  5TP9 A;  4F2O A;  1MQJ A;  2D5W A;  4MF3 A;  3RQT A;  3IAZ A;  4H6D A;  3TQL A;  4H67 A;  4HW8 A;  4U4S A;  3D4G A;  1JW5 A;  2UVI A;  3FVO A;  1B4H A;  4RK9 A;  2V3Q A;  1JVX A;  1LBC A;  3O28 A;  1N3X A;  1B7H A;  3EQ1 A;  2OJT A;  1UTH A;  3IOU A;  5I58 B;  1XHY A;  1MH4 A;  1ZU0 A;  4QSE A;  3FIR A;  4F3B A;  4DXB A;  1RYX A;  2I0B A;  3IX1 A;  1L5T A;  4JWX A;  2V3T A;  3C4M A;  2P0S A;  3IOW A;  4OMB A;  4O3C A;  1GTK A;  3C31 A;  3MP1 A;  4JWO A;  1N84 A;  1MM7 A;  3CSB A;  1BP5 A;  4WXJ A;  4YIC A;  4JXI A;  3TTN A;  3VXB A;  3WAE A;  4H1X A;  3I6V A;  3O6G A;  1YPN A;  4OEN A;  3IK6 B;  2V84 A;  3KN8 A;  3CFL A;  3S4U A;  5DTB A;  2HXW A;  5H8Q B;  1I6Q A;  1HSE A;  1MG1 A;  1TT1 A;  4MH5 A;  3OO9 A;  4F31 B;  4H8I A;  3OMB A;  4OTE A;  4EF2 A;  4FOR A;  3MZ1 A;  4PFT A;  5JTY A;  3CI8 A;  3K2D A;  2H25 A;  4U1Z A;  1PB7 A;  1LLS A;  1MY0 A;  3C33 A;  4FAJ A;  1KWH A;  3QXM A;  3H6U A;  3TDJ A;  3M3F A;  1N7W A;  5ITO A;  5BUU A;  1IXH A;  5FHO A;  3RT8 A;  4BDL A;  2AIX A;  4NF8 B;  4UAC A;  3ODB A;  3K0V A;  3ILT B;  1BIY A;  3PUX E;  1LFI A;  1A8E A;  2XXQ A;  1QUK A;  3I5O A;  3SES A;  3KGC A;  1SI0 A;  2RC9 A;  5M2V A;  1B3E A;  4Q8R A;  4NF6 A;  2DE3 A;  3FGS A;  5A5X B;  4L17 A;  1EZP A;  3LC8 A;  4XIG Q;  3FJG A;  2H5Y A;  4G4P A;  1US4 A;  3C9H A;  3VXC A;  4F29 A;  1XOC A;  4P11 A;  4G68 B;  4YMB A;  4NTL A;  4RNS A;  1VFE A;  4IO7 A;  4YKK A;  2I48 A;  2QRY A;  3RLF E;  2DXR A;  3PV0 E;  4FEB A;  5ICQ A;  2G93 A;  1LAX A;  3BKI B;  4F1Y A;  5CC2 A;  2M8C A;  2DOJ A;  2ONK E;  2IA4 A;  4FAT A;  3MZB A;  2WKY A;  1ZIU A;  2H4I A;  4KCD A;  1A7L A;  2F35 A;  2RIN A;  5ISU A;  1P99 A;  1MPB A;  3O29 A;  1T0K A;  4ZEC A;  3HV1 A;  4KYD A;  2P1S A;  4YU0 A;  1D9V A;  3GBB A;  2O69 A;  1DPP A;  3SEY A;  2P2A A;  4I9D A;  4P0I A;  4F3P A;  4LQ2 A;  2GHB A;  3K1P A;  3MVX A;  4QSC A;  3N26 A; 
#chains in the Genus database with same CATH topology
 4YZZ A;  4MCO A;  2GRV A;  5F7V A;  1URG A;  4GX3 A;  5IZZ A;  3WAF A;  2OLB A;  4YAH X;  2HFB A;  4ELR A;  1VFD A;  2B3B A;  3VVF A;  4MLQ A;  1A40 A;  1H44 A;  2QMW A;  2QVU A;  3CSG A;  1D4N A;  4I1D A;  2DXY A;  1FQA A;  4IO5 A;  4O3A A;  4U2R A;  3K1M A;  4F22 A;  4MNC A;  4P9K A;  3HHF A;  4XFE A;  1B3H A;  5AA3 A;  3T93 B;  3RTW B;  1B32 A;  2HAV A;  1LB9 A;  1FTJ A;  4JSD A;  4X48 A;  3KFM A;  4N6K A;  3N6T A;  2V93 A;  4OES A;  1LBW A;  1IMC A;  1POT A;  1WDN A;  1SI1 A;  3MPL A;  3W15 C;  3JV9 A;  2XXR A;  3FD3 A;  4MNI A;  5CMK A;  3TCG A;  4IO2 A;  1LBZ A;  3TKD A;  5DVJ A;  1QGX A;  1MXY A;  3FV2 A;  4NF8 A;  2HZK A;  1SVX B;  2O84 X;  3RGY A;  3IL1 B;  2DE2 A;  1IXI A;  4KD5 A;  4MAG A;  2G29 A;  4QFP A;  2O7I A;  1FQB A;  4WEP A;  1SQY A;  4N91 A;  4KYE A;  3OSR A;  2QFL A;  4PET A;  3TTR A;  4JVI A;  1UIU A;  2X7P A;  4GQO A;  2QPQ A;  3EF7 A;  1N76 A;  1G0I A;  2AL5 A;  5AA4 B;  4H0W A;  1LGB C;  2NWJ A;  2PX1 A;  1B46 A;  3E13 X;  2Y7K A;  3ZSF A;  1IME A;  3T22 A;  4GBV A;  5IKB A;  1AIV A;  3KN3 A;  4YKP A;  3IFA A;  2ESN A;  2XWV A;  2DSF A;  4OET A;  3KSJ A;  3H3G A;  2ONR A;  2XXT A;  1PBQ A;  4GX6 A;  1MQH A;  3IB2 A;  3AXF A;  3OEK A;  3N6U A;  3MWB A;  4KR5 A;  4P3L A;  4GVO A;  1OMP A;  4R73 A;  3O2A A;  3MVW A;  3ROJ A;  1M5B A;  2QS4 A;  4NED A;  4PFY A;  4QSD A;  1DTZ A;  2QS3 A;  2PYY A;  5CBS A;  1ZKB A;  1K9Z A;  5B70 A;  3G3G A;  2VT5 A;  4RJZ A;  1LAH E;  1JVY A;  3TCH A;  3K6X A;  3LUZ A;  3UIF A;  1FBD A;  3BIG A;  1F9B A;  3EKI A;  3T9X B;  4P56 A;  4DLD A;  2UVH A;  4JSO A;  4MIJ A;  5TPA B;  4KFQ A;  4NF4 A;  5ELV A;  3O6I A;  2H9B A;  1MXW A;  4YB6 A;  4G77 A;  4N8G A;  1PDA A;  3R26 A;  4HCW A;  4MMP A;  3LR1 A;  3I3V A;  2OWT A;  3H7M A;  1Q9D A;  4FJP A;  3EHU A;  1EYJ A;  3FJM A;  4OEV A;  1B7U A;  2Q2A A;  3V8X B;  1TWY A;  2FHY A;  1MH3 A;  1XVY A;  4RXL A;  4LZ5 A;  1DBZ A;  2Y7P A;  2R8T A;  5AA1 A;  3FV1 A;  4F19 A;  4P47 A;  3PD9 A;  1FBC A;  4PCD A;  3F11 A;  4G61 A;  4TQU Q;  3RNN A;  2WBD A;  2RC7 A;  3HST A;  4I8C A;  1VDW A;  4JWY A;  4UA8 A;  4GWY A;  2PFY A;  1MPD A;  1SW4 A;  4PTK A;  2XD3 A;  4X8R A;  3MYU A;  3FVG A;  4F1V A;  1BTJ A;  4LP2 B;  1PC3 A;  4NF5 B;  4P1E A;  3W9W A;  1I6B A;  2I3V A;  4QFL A;  4ZE8 A;  5I57 B;  4PAK A;  3FXB A;  2DP8 A;  5AA4 A;  4OVR A;  1A55 A;  2KQZ A;  4GL8 A;  4YB5 A;  3FXQ A;  1EYI A;  1CE2 A;  1NV0 A;  4RYA A;  1I6A A;  3HN0 A;  4R6H A;  5FBP A;  2P3V A;  1NI9 A;  5DEX A;  4RA1 A;  1IZ1 A;  1Y3Q A;  1B1H A;  2I4C A;  2THI A;  3M8U A;  1Y4T A;  3U94 A;  2Z22 A;  3PUZ E;  5CMM A;  4MX6 A;  3PPQ A;  2FNC A;  2ZNT A;  1XT8 A;  4LON B;  3BFU A;  4GOT A;  3QIM A;  4U1O A;  3KG2 A;  3OEL A;  5HBC A;  1UTB B;  3UOR A;  1IMF A;  2F36 A;  3UK4 A;  2XXV A;  4NF6 B;  4EF1 A;  4YMA A;  5CMC A;  2OX3 A;  4RK2 A;  4QFN A;  4ISU A;  5H8S A;  1FQC A;  4F3G A;  2ANJ A;  5ET7 A;  4OA4 A;  2Q88 A;  3FZV A;  4X1D A;  3PD8 A;  1NUZ A;  3RY3 A;  1IIW A;  1EU8 A;  5TPA A;  1MRP A;  4U23 A;  3OOA A;  4ZEI A;  4KPT A;  3OD7 A;  3U72 A;  3ECR A;  3PPN A;  3CRB A;  4EQB A;  1FBP A;  1SW1 A;  2VP1 A;  3FJ7 A;  3EHT A;  3SEU A;  5F1Q A;  4PP0 A;  4IO4 A;  4DDD A;  2E0S A;  4F1U A;  1LAF E;  4ELP A;  4GLI A;  1P1W A;  1NH7 A;  2PVU A;  4NQ8 A;  1JQF A;  4ZEB A;  1XS5 A;  3KBZ A;  1SPI A;  4EQ7 A;  5I84 A;  2I49 A;  3Q27 A;  1B0L A;  1LBY A;  4R9F A;  4XKN A;  2HPG A;  4NF5 A;  3G3F A;  5I57 A;  2ZXT A;  3FXU A;  2X7Q A;  3K6U A;  3KBR A;  5I5P A;  4BDN A;  1B6H A;  3CFX A;  3KC1 A;  3U93 A;  4EUO A;  3H6T A;  1ZTY A;  2ZYM A;  3BIH A;  2XXP A;  1UIV A;  2F97 A;  4DXC A;  1B2H A;  3ILU B;  3HO7 A;  2QL3 A;  2HZL A;  4TLM B;  4XF5 A;  5I2K A;  3IB0 A;  4LAT A;  2A5T B;  2UYF A;  1FRP A;  4PE5 B;  1B40 A;  1DK4 A;  5J1D A;  2PFZ A;  3LUY A;  1N3W A;  1MQD A;  4ONY A;  3TOD A;  1YXI A;  2MKZ A;  2H98 A;  1FTO A;  2XX9 A;  4PAI A;  3OO6 A;  1OVB A;  3OEM A;  4NGU A;  3H06 B;  1MS7 A;  1DPE A;  1UTB A;  1FSA A;  1Z7N E;  1PB9 A;  3TMG A;  4OHN A;  3FUZ A;  3R7X A;  3H6W A;  2BJJ X;  4MBP A;  3MC2 A;  3BBR A;  2Q2C A;  1NV7 A;  3JYR A;  1B7Z A;  4N17 A;  4MNP A;  1USY E;  1B5J A;  4ECF A;  4OER A;  3L6H A;  4GBW A;  3MQ9 A;  3VVE A;  3IO6 A;  3CVG A;  2FIX A;  2IEE A;  4HCY A;  4I40 A;  4ELQ A;  1B52 A;  2OK2 A;  1Y3N A;  2Y7W A;  2ZNU A;  4R6K A;  4OZ9 A;  1KZ8 A;  4OXV A;  3TTK A;  4LZ8 A;  4F39 A;  2XWK A;  2ZMB A;  3KSX A;  3E3K A;  1IXG A;  1USY H;  4ZS9 A;  1Y9U A;  4R9G A;  3A29 A;  4O7I A;  5EYF A;  1FW0 A;  1SW2 A;  3G7W A;  4KCC A;  1FCK A;  4G8M A;  2ZNS A;  4E0W A;  2GQ1 A;  3TTL A;  2RC8 A;  4Z0I A;  2UVJ A;  5AA2 D;  3PGF A;  1NV2 A;  4OFJ A;  4PBQ A;  2RCA A;  1OQH A;  2B3F A;  4DCY A;  4EXL A;  1NKX A;  2LAO A;  3G3J A;  1EZ9 A;  5HM4 B;  3RUM A;  4MHF A;  3W9V A;  4N6P A;  3IJX B;  3SEV A;  3UP9 A;  4QF9 A;  3MVY A;  1EZO A;  4DXU A;  4OAN A;  1PB8 A;  5IZ3 A;  4GWW A;  4N07 A;  3RN8 A;  4R74 A;  1Y1Z A;  2FA7 A;  4GFR A;  4NF4 B;  3KJ7 A;  1DTG A;  2FBP A;  2QS2 A;  4MFI A;  3DP6 A;  2A5T A;  1Y20 A;  4OFO A;  4U21 A;  2DWI A;  4ND9 A;  4I3E A;  4ELO A;  5I2N B;  1CB6 A;  4N4U A;  3B6Q A;  1TXF A;  5HPQ A;  4ZE9 A;  2PCR A;  5TU0 A;  5AE4 A;  3LBS A;  4N15 A;  1II5 A;  2V3U A;  1OLA A;  1FPL A;  2NUV A;  3UGW A;  4HXV A;  2O1M A;  3A3C A;  1B1X A;  1N04 A;  3E9X A;  5H8N B;  2W7Y A;  3E78 A;  3ZKL A;  2VGQ A;  4ZZA A;  4ZZE A;  3O6H A;  3N94 A;  1IMB A;  3VV5 A;  1FQE A;  3CHG A;  4R72 A;  1O64 A;  3K4U A;  5CM6 A;  4H8J A;  2F8D A;  4FED A;  1SW5 A;  2RCB A;  1MDP 1;  1H76 A;  2Y7R A;  1QW0 A;  2XWO A;  3LSW A;  2R6G E;  3V83 A;  5J16 A;  4NAP A;  3EHS A;  4LQ5 A;  3U92 A;  1SBP A;  5FHN A;  3CFZ A;  2PMS A;  1MQI A;  4KYS A;  4N6D A;  1B5H A;  3RYD A;  2Z8E A;  3KC0 A;  1MY2 A;  5DEX B;  4HE2 A;  1LAG E;  3QAX A;  4OEU A;  4HS7 A;  4R2F A;  5FTI A;  1M5D A;  1ZBM A;  5EHS A;  1BKA A;  3VDF A;  3UN6 A;  3U65 A;  3T9U A;  1CNQ A;  4ZED A;  2Y5K A;  3QK6 A;  4H5G A;  2V25 A;  2XXI A;  3PMV A;  1IQ7 A;  3C35 A;  5LOM A;  2ZZW A;  4X1B A;  3Q25 A;  4KXP A;  5KDT B;  2F7A A;  2F7B A;  1VSO A;  2XA5 A;  2PT2 A;  4O94 A;  1R9Q A;  3N5L A;  4MLV A;  4PAF A;  4IO3 A;  1XVX A;  1LCF A;  2GFE A;  2P3N A;  3IR1 A;  4OFL A;  4GWU A;  3PPP A;  2PBW A;  4NWC A;  3SET A;  1AWB A;  1SD3 A;  4U22 A;  2OBG A;  1J1N A;  2OWZ A;  3VFJ A;  3MP6 A;  1OQG A;  4PFW A;  3USD A;  3KN7 A;  3K01 A;  5I2N A;  4PDH A;  2E1S A;  1FPJ A;  1BLF A;  2XXW A;  3ISP A;  3DEL B;  4U4X A;  3A09 A;  1B5I A;  3NOH A;  3QUJ A;  1QJM A;  3QYT A;  2RKM A;  5K2X A;  4F3S A;  3K6W A;  1FQD A;  1MXV A;  5AA2 B;  3IFC A;  5ITP A;  4NE4 A;  1RDX A;  1SYI A;  2O7U A;  5H8N A;  4JB7 A;  3RT6 B;  4H5F A;  1FPI A;  1SYH A;  1GGG A;  1HSL A;  4NN3 A;  5A5L A;  2YLN A;  1NUX A;  1D3K A;  4GXS B;  1N0T A;  2UVG A;  2DWJ A;  1O63 A;  3G3I A;  4ESW A;  1NNF A;  4BLA A;  1FPF A;  3T96 B;  3K02 A;  2NXO A;  4FE8 A;  1H45 A;  5DVF A;  4EXK A;  3MW0 A;  5I2K B;  2DVZ A;  2I6E A;  4XTC Q;  3T0J A;  3PPO A;  4DZ1 A;  1FBG A;  1DMB A;  5JEI A;  1FBE A;  2ONS A;  2HHM A;  4EDP A;  3MAM A;  4O7M A;  5L8D A;  2Z23 A;  5B7D A;  3TUS A;  1B3L A;  1FTL A;  3H6V A;  4IGT A;  2L5V A;  2WYP A;  1Z7M E;  3S2V A;  2DVC A;  3M3K A;  1URD A;  5CMB A;  5KDT A;  3KZG A;  5DYH A;  4O8M A;  1YTV A;  2DWA A;  4JDF A;  2O51 A;  1JET A;  2B4M A;  2UYE A;  4LUB A;  5DVI A;  2VOZ A;  1UQW A;  3RPW A;  2F7C A;  1PBP A;  4OVP A;  4TOZ A;  4RY1 A;  2ZYN A;  4G8N A;  3QMF A;  4DCX A;  2D21 A;  2XXH A;  1NV1 A;  1NMU A;  2UXA A;  4OVQ A;  1QKA A;  4F18 A;  3OSQ A;  1NL5 A;  2O68 A;  3T9H B;  3IOT A;  5IAI A;  2QS1 A;  4HE0 A;  3SDF A;  2I3W A;  3K6V A;  4BDR A;  1Y4C A;  3FAS A;  2O1L A;  3IJO B;  3QUF A;  4G68 C;  1AOV A;  4GRK A;  3MJN A;  3KOT A;  1WOD A;  4XKR A;  1QUI A;  4G8H A;  1Q1K A;  1P1N A;  3MP8 A;  4QRZ A;  4DE8 A;  1HSJ A;  4IO6 A;  4GWO A;  4FEC A;  4PBH A;  1Q35 A;  4DI3 D;  1NH8 A;  1US5 A;  4YB7 A;  2F6G A;  1A99 A;  3A3U A;  5I59 B;  3TPA A;  5AA2 A;  3DP4 A;  3EN3 A;  2F6P A;  4DIG A;  1RKM A;  4NG7 A;  5LDZ A;  3V5A A;  3L6G A;  4HTG A;  3DP8 A;  4OYV A;  3CR9 A;  3CG3 A;  1B0H A;  2QSX A;  5EQ7 A;  1URS A;  1TFD A;  5KZT A;  3B6W A;  3LSX A;  1NNT A;  4I62 A;  4KI0 E;  3VLV A;  1MQG A;  1H43 A;  1YCJ A;  1VR5 A;  4P0G A;  3HFU A;  1M5C A;  4OVS A;  5IZ3 B;  1R6Z A;  4XKP A;  3S9E A;  4R6Y A;  3TYH A;  4NHB A;  2GHA A;  4AQ4 A;  4C1U A;  3FVN A;  1LCT A;  3PPR A;  1JW1 A;  3Q29 A;  1LST A;  2ABH A;  3PUY E;  2VD2 A;  3S9L C;  1NFT A;  2F78 A;  2F34 A;  2OZZ A;  3MPK A;  1JW4 A;  3C36 A;  5H8H B;  2Z8D A;  3HHG A;  3Q28 A;  5K2Y A;  1RYO A;  1TFA A;  2YPN A;  4QFK A;  3UA8 A;  4ZEK A;  2O6A A;  5L9O A;  4AS4 A;  1G0H A;  4PFB A;  3KEI A;  1B4Z A;  5FHM A;  3ZS6 A;  1JNF A;  4XKQ A;  4QFO A;  2VD3 A;  4X9T A;  2JJK A;  5EQ8 A;  1ANF A;  3Q26 A;  1XC1 A;  2H99 A;  2DWH A;  4RPN A;  2Q74 A;  3FXR A;  3B8B A;  1IMD A;  1NNK A;  2HQ0 A;  1NV5 A;  2A5S A;  3QSL A;  4POW A;  2XX8 A;  1JEU A;  1DSN A;  3IO4 A;  3KOS A;  4C1T A;  3GBA A;  3SEW A;  1ELJ A;  3T66 A;  3K1N A;  1LFG A;  1YYZ A;  4UAB A;  4X04 A;  4BDO A;  3HPI A;  2VHA A;  1FTK A;  3E79 A;  3GZG A;  1IIT A;  2XHD A;  3VLU A;  1FBH A;  1MPC A;  3TZA A;  2NOO A;  1GVC A;  4HE1 A;  5EYG A;  2PT1 A;  2Y7I A;  3O97 A;  4AB6 A;  4JVD A;  3TTM A;  4THI A;  4R75 A;  1M5E A;  2B4L A;  4ZEF A;  4K3F A;  3K00 A;  5I59 A;  1FJ9 A;  5I58 A;  2I0C A;  5F24 A;  2YJP A;  2DYX A;  2F5X A;  3GXA A;  4GL0 A;  3TAJ A;  3PUV E;  4GF8 A;  4Q30 B;  1POY 1;  4GWX A;  4BDM A;  3E4R A;  5ICT A;  3OEN A;  3FAT A;  2GH9 A;  2FYI A;  1R9L A;  4ESX A;  3DM0 A;  3EPE A;  5I7I A;  4OWD A;  3O9P A;  3SER A;  1M5F A;  4XXU A;  3ZKK A;  1MXX A;  1MXZ A;  1YAE A;  1QKB A;  2HEU A;  1QVS A;  5I56 B;  3P7I A;  2XXX A;  4Q0C A;  4DI4 B;  2R71 A;  5H8Q A;  3U1O A;  3LV0 A;  3MST A;  1S50 A;  4OQO A;  1GV8 A;  1B51 A;  5FTH A;  4PFU A;  1LBV A;  5ET6 A;  4M4G A;  1N7X A;  5IGA A;  3IOR A;  4BDQ A;  5CI5 A;  2QJE A;  1R1N A;  1GR2 A;  1D9Y A;  1MY1 A;  2REJ A;  2QVR A;  3TEL A;  1NV4 A;  5H8H A;  4POX A;  2NVU B;  4LVQ A;  2Q8J A;  1LB8 A;  4OVJ A;  4P1L A;  3H4Z A;  3S9N C;  2Q89 A;  3BFT A;  4Q5T A;  2AYS A;  4JBZ A;  1AL3 A;  4IGR A;  1S7Y A;  4QHQ A;  2CZL A;  4O3B A;  5LTC A;  1VE4 A;  2ZYK A;  3G3H A;  1FJ6 A;  2ZZV A;  1FQF A;  4IB2 A;  2X26 A;  1AMF A;  2I4B A;  3PU5 A;  1A54 A;  4PFR A;  1S9T A;  1FTA A;  2XXU A;  5A5X A;  4RPO A;  3LSL A;  2F3B A;  1KA1 A;  4NMY A;  1Y3P A;  4GXA A;  5CRY A;  4PGP A;  3PTY A;  5ET8 A;  4G68 A;  2D3I A;  5H8F B;  4WED A;  4KQP A;  2B65 A;  2XXY A;  2R9J A;  5KCJ B;  3TEP A;  1OLC A;  1P1U A;  1AH5 A;  2CZH A;  1OIB A;  1D9Q A;  4IY5 A;  1ZJL A;  4TLL B;  1LBX A;  1FBF A;  5EHM A;  3D4C A;  3OO8 A;  4ZDM A;  3R6U A;  1IUD A;  3OXN A;  1MY4 A;  1A8F A;  3IOV A;  1IXC A;  5ESY A;  3MUQ A;  2Q9T A;  4H45 A;  3B50 A;  1ZLQ A;  4IY6 A;  3D1R A;  2KLF A;  1QUJ A;  2AL4 A;  4LZ7 A;  3FBP A;  2DQV A;  2ALU A;  1K9Y A;  1O7T A;  3MVZ A;  5DT6 A;  4GD5 A;  2CZK A;  2V4C A;  5TP9 B;  5I56 A;  2DE4 A;  1FTM A;  3B6T A;  3PUW E;  4P8B A;  3GLB A;  4GX4 A;  3VE1 B;  3CG1 A;  3JZJ A;  1ZMG A;  1PEB A;  2BJI A;  1LFH A;  4YKI A;  1LEV A;  3CIJ A;  3THI A;  3V89 B;  4LA9 A;  1SDX A;  2QMX A;  3SEX A;  1BK4 A;  4GIZ A;  3T9V A;  1ATG A;  4H46 A;  1H3D A;  3DLN A;  1JEV A;  1B3F A;  2ZYO A;  4EQ9 A;  4G2Z A;  4PFI A;  3S9M C;  2Z8F A;  4Z7E A;  4N13 A;  1UTH B;  1EH3 A;  3C32 A;  4AB5 A;  1NNP A;  5EQA A;  4GWZ A;  5CBR A;  5BWJ A;  4PQJ A;  4E0X A;  3ONM A;  3B7D A;  1DOT A;  1JP4 A;  3U8Q A;  2ZZX A;  3MBP A;  2HCA A;  4R2B A;  1B58 A;  3VLW A;  4C0R A;  2CMO A;  3OO7 A;  2WBB A;  1I69 A;  3PMW A;  1Y1M A;  1YZ0 A;  1IEJ A;  3LSF B;  2Q8M A;  3TQW A;  5L9M A;  1RDY A;  4NWD A;  4YKJ A;  2OCU A;  1B9J A;  1WVJ A;  1B05 A;  5H8F A;  5T3J A;  5L9S A;  4XEQ A;  3RPL B;  3O66 A;  3G3K A;  3PMX A;  4LN5 A;  5ET5 A;  1FPE A;  3C34 A;  2RF1 A;  3TFL A;  3MZ9 A;  2I58 A;  4M1V A;  5IZ1 A;  5KCJ A;  3HCQ A;  2DS9 A;  3M3L A;  5JK4 A;  1MY3 A;  3FVK A;  1P1O A;  5JTY B;  5EYH A;  4FIM A;  4H65 A;  3H03 A;  2HAU A;  1P1Q A;  2XD2 A;  2Y84 A;  1MXU A;  4PF8 A;  4PE3 A;  2Y5L A;  4F2Q A;  2OWS A;  3RTF B;  2XX7 A;  1NUW A;  2VPO A;  1MM6 A;  1B3G A;  2REG A;  1OVT A;  3TCF A;  4NX1 A;  3SKP A;  1QUL A;  2WX9 A;  3VVD A;  4KHZ E;  1RDZ A;  4WKM A;  3KJT A;  1MDQ A;  2F3D A;  1KA0 A;  3IB1 A;  1LBB A;  5TP9 A;  4F2O A;  4FBP A;  4QBA A;  1MQJ A;  2D5W A;  4MF3 A;  3RQT A;  3IAZ A;  4H6D A;  3TQL A;  4H67 A;  4HW8 A;  4U4S A;  3D4G A;  5IM2 A;  1JW5 A;  2UVI A;  5I3S A;  3FVO A;  1B4H A;  4RK9 A;  2V3Q A;  1INP A;  1JVX A;  1LBC A;  3O28 A;  2XWI A;  4AS5 A;  1N3X A;  3SZP A;  1B7H A;  3EQ1 A;  2OJT A;  1UTH A;  3IOU A;  4JVC A;  1FPD A;  1XHY A;  4PC9 A;  5I58 B;  1MH4 A;  1ZU0 A;  4QSE A;  4PGN A;  1FPK A;  4N81 A;  3FIR A;  4F3B A;  4DXB A;  1RYX A;  2I0B A;  3IX1 A;  1L5T A;  4JWX A;  2V3T A;  3C4M A;  2P0S A;  3IOW A;  4OMB A;  4O3C A;  1GTK A;  3C31 A;  3MP1 A;  4JWO A;  1N84 A;  1MM7 A;  3CSB A;  1BP5 A;  4WXJ A;  4YIC A;  2KR0 A;  3GYY A;  4JXI A;  3TTN A;  3VXB A;  3WAE A;  4H1X A;  2FIE A;  3I6V A;  3O6G A;  1YPN A;  4OEN A;  1DCU A;  3IK6 B;  3RPL A;  2V84 A;  3KN8 A;  3CFL A;  3S4U A;  5DTB A;  2HXW A;  5H8Q B;  1I6Q A;  1HSE A;  1MG1 A;  1TT1 A;  4MH5 A;  3OO9 A;  4F31 B;  4H8I A;  3OMB A;  1IMA A;  4OVT A;  4OTE A;  4EF2 A;  4FOR A;  3MZ1 A;  4MJO A;  4PFT A;  2WYK A;  5JTY A;  2WEF A;  2XXK A;  3CI8 A;  3K2D A;  2H25 A;  4U1Z A;  1PB7 A;  1LLS A;  1MY0 A;  3C33 A;  4FAJ A;  1KWH A;  4GWS A;  3QXM A;  3H6U A;  3TDJ A;  3M3F A;  1N7W A;  2CEY A;  1XI6 A;  5ITO A;  5BUU A;  2QVV A;  1IXH A;  5FHO A;  3RT8 A;  4BDL A;  4UAC A;  4NF8 B;  2AIX A;  1NUY A;  3ODB A;  3K0V A;  3ILT B;  1BIY A;  3PUX E;  2HXR A;  1LFI A;  1A8E A;  2XXQ A;  4PDD A;  1QUK A;  3I5O A;  4PF6 A;  3SES A;  3KGC A;  1SI0 A;  2RC9 A;  4MEV A;  5M2V A;  1B3E A;  4Q8R A;  4NF6 A;  2DE3 A;  3FGS A;  5A5X B;  4L17 A;  1EZP A;  3LC8 A;  2FVZ A;  4XIG Q;  3FJG A;  2H5Y A;  4G4P A;  1US4 A;  3C9H A;  3VXC A;  4F29 A;  5DW8 A;  1XOC A;  4P11 A;  4G68 B;  4NF0 A;  4NTL A;  4RNS A;  1VFE A;  4YMB A;  4IO7 A;  4I3Y A;  1EYK A;  4YKK A;  3T1B A;  2I48 A;  5EQ9 A;  2QRY A;  3RLF E;  2DXR A;  3PV0 E;  4FEB A;  5ICQ A;  2G93 A;  1LAX A;  3BKI B;  4F1Y A;  5CC2 A;  4N8Y A;  4QXD A;  2DDK A;  2M8C A;  4IR8 A;  2CEX A;  2DOJ A;  2ONK E;  2IA4 A;  4FAT A;  1FPB A;  2WKY A;  3MZB A;  1ZIU A;  2H4I A;  4KCD A;  2CZI A;  1A7L A;  2F35 A;  2RIN A;  5ISU A;  1P99 A;  1MPB A;  3O29 A;  1T0K A;  2VPN A;  4ZEC A;  3HV1 A;  4KYD A;  2P1S A;  4YU0 A;  1D9V A;  3GBB A;  2O69 A;  1DPP A;  3SEY A;  2P2A A;  4I9D A;  4P0I A;  1NV6 A;  4F3P A;  4LQ2 A;  2GHB A;  3K1P A;  1NV3 A;  1FPG A;  3MVX A;  4QSC A;  3N26 A; 
#chains in the Genus database with same CATH homology
 4YZZ A;  2GRV A;  5F7V A;  1URG A;  3WAF A;  2OLB A;  4YAH X;  2HFB A;  4ELR A;  1VFD A;  2B3B A;  3VVF A;  4MLQ A;  1A40 A;  1H44 A;  2QMW A;  3CSG A;  1D4N A;  4I1D A;  2DXY A;  1FQA A;  4IO5 A;  4O3A A;  4U2R A;  3K1M A;  4F22 A;  3HHF A;  1B3H A;  5AA3 A;  3T93 B;  3RTW B;  1B32 A;  2HAV A;  1LB9 A;  1FTJ A;  4JSD A;  4X48 A;  3KFM A;  3N6T A;  2V93 A;  4OES A;  1POT A;  1WDN A;  1SI1 A;  3MPL A;  3W15 C;  3JV9 A;  2XXR A;  3FD3 A;  5CMK A;  3TCG A;  4IO2 A;  3TKD A;  5DVJ A;  1MXY A;  3FV2 A;  4NF8 A;  2HZK A;  1SVX B;  2O84 X;  3RGY A;  3IL1 B;  2DE2 A;  1IXI A;  4KD5 A;  2G29 A;  4QFP A;  2O7I A;  1FQB A;  4WEP A;  1SQY A;  4KYE A;  3OSR A;  4PET A;  3TTR A;  1UIU A;  2X7P A;  4GQO A;  2QPQ A;  3EF7 A;  1N76 A;  2AL5 A;  5AA4 B;  4H0W A;  1LGB C;  2NWJ A;  2PX1 A;  1B46 A;  3E13 X;  2Y7K A;  3ZSF A;  3T22 A;  5IKB A;  1AIV A;  3KN3 A;  4YKP A;  2ESN A;  2DSF A;  4OET A;  3KSJ A;  3H3G A;  2ONR A;  2XXT A;  1PBQ A;  1MQH A;  3IB2 A;  3AXF A;  3OEK A;  3N6U A;  3MWB A;  4KR5 A;  4GVO A;  1OMP A;  4R73 A;  3O2A A;  3MVW A;  1M5B A;  2QS4 A;  4NED A;  4PFY A;  4QSD A;  1DTZ A;  2QS3 A;  2PYY A;  5CBS A;  1ZKB A;  5B70 A;  3G3G A;  4RJZ A;  1LAH E;  1JVY A;  3TCH A;  3K6X A;  3UIF A;  1F9B A;  3T9X B;  4DLD A;  2UVH A;  4JSO A;  5TPA B;  4KFQ A;  4NF4 A;  5ELV A;  3O6I A;  2H9B A;  1MXW A;  4YB6 A;  4G77 A;  1PDA A;  3R26 A;  4HCW A;  3LR1 A;  3I3V A;  2OWT A;  3H7M A;  4FJP A;  3EHU A;  3FJM A;  4OEV A;  1B7U A;  2Q2A A;  3V8X B;  1TWY A;  1MH3 A;  1XVY A;  4RXL A;  4LZ5 A;  2Y7P A;  5AA1 A;  3FV1 A;  4F19 A;  3PD9 A;  3F11 A;  4TQU Q;  3RNN A;  2RC7 A;  3HST A;  4I8C A;  4JWY A;  4UA8 A;  1MPD A;  1SW4 A;  2XD3 A;  3FVG A;  4F1V A;  1BTJ A;  4LP2 B;  1PC3 A;  4NF5 B;  3W9W A;  1I6B A;  2I3V A;  4QFL A;  4ZE8 A;  5I57 B;  2DP8 A;  5AA4 A;  1A55 A;  4GL8 A;  4YB5 A;  3FXQ A;  1CE2 A;  4RYA A;  1I6A A;  3HN0 A;  4R6H A;  5DEX A;  4RA1 A;  1IZ1 A;  1Y3Q A;  1B1H A;  2I4C A;  2THI A;  3M8U A;  1Y4T A;  3U94 A;  2Z22 A;  3PUZ E;  5CMM A;  3PPQ A;  2FNC A;  2ZNT A;  1XT8 A;  4LON B;  3BFU A;  4GOT A;  3QIM A;  4U1O A;  3KG2 A;  3OEL A;  5HBC A;  1UTB B;  3UOR A;  2F36 A;  3UK4 A;  2XXV A;  4NF6 B;  4EF1 A;  4YMA A;  5CMC A;  4QFN A;  4RK2 A;  4ISU A;  5H8S A;  1FQC A;  4F3G A;  2ANJ A;  2Q88 A;  3FZV A;  4X1D A;  3PD8 A;  3RY3 A;  1IIW A;  1EU8 A;  5TPA A;  1MRP A;  4U23 A;  3OOA A;  4ZEI A;  4KPT A;  3OD7 A;  3U72 A;  3ECR A;  3PPN A;  3CRB A;  4EQB A;  1SW1 A;  2VP1 A;  3FJ7 A;  3EHT A;  3SEU A;  5F1Q A;  4PP0 A;  4IO4 A;  4DDD A;  2E0S A;  4F1U A;  1LAF E;  4ELP A;  4GLI A;  1P1W A;  1NH7 A;  2PVU A;  1JQF A;  4ZEB A;  1XS5 A;  4EQ7 A;  5I84 A;  2I49 A;  3Q27 A;  1B0L A;  4R9F A;  4XKN A;  4NF5 A;  3G3F A;  5I57 A;  2ZXT A;  3FXU A;  2X7Q A;  3K6U A;  3KBR A;  4BDN A;  1B6H A;  3CFX A;  3U93 A;  4EUO A;  3H6T A;  1ZTY A;  2ZYM A;  2XXP A;  1UIV A;  2F97 A;  4DXC A;  1B2H A;  3ILU B;  3HO7 A;  2QL3 A;  2HZL A;  4TLM B;  5I2K A;  3IB0 A;  4LAT A;  2A5T B;  2UYF A;  4PE5 B;  1B40 A;  5J1D A;  3LUY A;  1N3W A;  1MQD A;  4ONY A;  3TOD A;  2H98 A;  1FTO A;  2XX9 A;  3OO6 A;  1OVB A;  3OEM A;  3H06 B;  1MS7 A;  1DPE A;  1UTB A;  1Z7N E;  1PB9 A;  3TMG A;  4OHN A;  3FUZ A;  3R7X A;  3H6W A;  2BJJ X;  4MBP A;  3MC2 A;  3BBR A;  2Q2C A;  3JYR A;  1B7Z A;  1USY E;  1B5J A;  4ECF A;  4OER A;  3L6H A;  3MQ9 A;  3VVE A;  3IO6 A;  3CVG A;  2IEE A;  4HCY A;  4ELQ A;  1B52 A;  2OK2 A;  1Y3N A;  2Y7W A;  2ZNU A;  4R6K A;  4OZ9 A;  4OXV A;  3TTK A;  4LZ8 A;  4F39 A;  2ZMB A;  3KSX A;  3E3K A;  1IXG A;  1USY H;  4ZS9 A;  1Y9U A;  4R9G A;  5EYF A;  1FW0 A;  1SW2 A;  3G7W A;  4KCC A;  1FCK A;  4G8M A;  2ZNS A;  4E0W A;  3TTL A;  2RC8 A;  4Z0I A;  2UVJ A;  5AA2 D;  3PGF A;  4OFJ A;  2RCA A;  1OQH A;  2B3F A;  4DCY A;  4EXL A;  1NKX A;  2LAO A;  3G3J A;  1EZ9 A;  5HM4 B;  3RUM A;  3W9V A;  4N6P A;  3IJX B;  3SEV A;  3UP9 A;  4QF9 A;  3MVY A;  1EZO A;  4DXU A;  1PB8 A;  4N07 A;  3RN8 A;  4R74 A;  1Y1Z A;  2FA7 A;  4GFR A;  4NF4 B;  3KJ7 A;  1DTG A;  2QS2 A;  4MFI A;  3DP6 A;  2A5T A;  1Y20 A;  4OFO A;  4U21 A;  2DWI A;  4ND9 A;  4ELO A;  5I2N B;  1CB6 A;  3B6Q A;  1TXF A;  5HPQ A;  4ZE9 A;  5TU0 A;  5AE4 A;  3LBS A;  1II5 A;  2V3U A;  1OLA A;  2NUV A;  3UGW A;  2O1M A;  3A3C A;  1B1X A;  1N04 A;  3E9X A;  5H8N B;  2W7Y A;  3ZKL A;  2VGQ A;  4ZZA A;  4ZZE A;  3O6H A;  3N94 A;  3VV5 A;  1FQE A;  4R72 A;  1O64 A;  3K4U A;  5CM6 A;  4H8J A;  2F8D A;  4FED A;  1SW5 A;  2RCB A;  1MDP 1;  1H76 A;  2Y7R A;  1QW0 A;  3LSW A;  2R6G E;  3V83 A;  3EHS A;  4LQ5 A;  3U92 A;  1SBP A;  5FHN A;  3CFZ A;  2PMS A;  1MQI A;  4KYS A;  1B5H A;  2Z8E A;  1MY2 A;  5DEX B;  1LAG E;  3QAX A;  4OEU A;  4HS7 A;  4R2F A;  5FTI A;  1M5D A;  1ZBM A;  5EHS A;  1BKA A;  3VDF A;  3UN6 A;  3T9U A;  4ZED A;  3QK6 A;  4H5G A;  2V25 A;  2XXI A;  3PMV A;  1IQ7 A;  3C35 A;  5LOM A;  4X1B A;  3Q25 A;  5KDT B;  2F7A A;  2F7B A;  1VSO A;  2PT2 A;  1R9Q A;  3N5L A;  4MLV A;  4IO3 A;  1XVX A;  1LCF A;  2GFE A;  3IR1 A;  4OFL A;  3PPP A;  2PBW A;  4NWC A;  3SET A;  1SD3 A;  4U22 A;  2OBG A;  1J1N A;  3VFJ A;  3MP6 A;  1OQG A;  4PFW A;  3USD A;  3KN7 A;  3K01 A;  5I2N A;  2E1S A;  1BLF A;  2XXW A;  3DEL B;  4U4X A;  3A09 A;  1B5I A;  3QUJ A;  1QJM A;  3QYT A;  2RKM A;  5K2X A;  4F3S A;  3K6W A;  1FQD A;  1MXV A;  5AA2 B;  5ITP A;  4NE4 A;  1SYI A;  2O7U A;  5H8N A;  4JB7 A;  3RT6 B;  4H5F A;  1SYH A;  1GGG A;  1HSL A;  2YLN A;  1D3K A;  4GXS B;  1N0T A;  2UVG A;  2DWJ A;  1O63 A;  3G3I A;  4ESW A;  1NNF A;  4BLA A;  3T96 B;  3K02 A;  2NXO A;  4FE8 A;  1H45 A;  5DVF A;  4EXK A;  3MW0 A;  5I2K B;  2DVZ A;  2I6E A;  4XTC Q;  3PPO A;  4DZ1 A;  1DMB A;  5JEI A;  2ONS A;  4EDP A;  3MAM A;  5L8D A;  2Z23 A;  5B7D A;  3TUS A;  1B3L A;  1FTL A;  3H6V A;  4IGT A;  1Z7M E;  3S2V A;  2DVC A;  3M3K A;  1URD A;  5CMB A;  5KDT A;  3KZG A;  5DYH A;  1YTV A;  2DWA A;  4JDF A;  2O51 A;  1JET A;  2UYE A;  4LUB A;  5DVI A;  2VOZ A;  1UQW A;  3RPW A;  2F7C A;  1PBP A;  4TOZ A;  4RY1 A;  2ZYN A;  4G8N A;  4DCX A;  2D21 A;  2XXH A;  1NMU A;  2UXA A;  1QKA A;  4F18 A;  3OSQ A;  1NL5 A;  2O68 A;  3T9H B;  3IOT A;  5IAI A;  2QS1 A;  3SDF A;  2I3W A;  3K6V A;  4BDR A;  1Y4C A;  3FAS A;  2O1L A;  3IJO B;  3QUF A;  4G68 C;  1AOV A;  4GRK A;  3MJN A;  3KOT A;  1WOD A;  4XKR A;  1QUI A;  4G8H A;  1Q1K A;  1P1N A;  3MP8 A;  4QRZ A;  4DE8 A;  1HSJ A;  4IO6 A;  4GWO A;  4FEC A;  1Q35 A;  1NH8 A;  1US5 A;  4YB7 A;  2F6G A;  1A99 A;  3A3U A;  5I59 B;  3TPA A;  5AA2 A;  3DP4 A;  3EN3 A;  2F6P A;  4DIG A;  1RKM A;  3V5A A;  3L6G A;  4HTG A;  3DP8 A;  4OYV A;  3CR9 A;  3CG3 A;  1B0H A;  2QSX A;  1URS A;  1TFD A;  5KZT A;  3B6W A;  3LSX A;  1NNT A;  4I62 A;  4KI0 E;  3VLV A;  1MQG A;  1H43 A;  1YCJ A;  1VR5 A;  4P0G A;  1M5C A;  1R6Z A;  4XKP A;  3S9E A;  4R6Y A;  3TYH A;  2GHA A;  4AQ4 A;  4C1U A;  3FVN A;  1LCT A;  3PPR A;  1JW1 A;  3Q29 A;  1LST A;  2ABH A;  3PUY E;  2VD2 A;  3S9L C;  1NFT A;  2F78 A;  2F34 A;  2OZZ A;  3MPK A;  1JW4 A;  3C36 A;  5H8H B;  2Z8D A;  3HHG A;  3Q28 A;  5K2Y A;  1RYO A;  1TFA A;  2YPN A;  4QFK A;  3UA8 A;  4ZEK A;  2O6A A;  5L9O A;  3KEI A;  1B4Z A;  5FHM A;  3ZS6 A;  1JNF A;  4XKQ A;  4QFO A;  2VD3 A;  4X9T A;  1ANF A;  3Q26 A;  1XC1 A;  2H99 A;  2DWH A;  4RPN A;  3FXR A;  1NNK A;  2HQ0 A;  2A5S A;  3QSL A;  4POW A;  2XX8 A;  1JEU A;  1DSN A;  3IO4 A;  3KOS A;  4C1T A;  3GBA A;  3SEW A;  1ELJ A;  3T66 A;  3K1N A;  1LFG A;  4BDO A;  3HPI A;  2VHA A;  1FTK A;  3GZG A;  1IIT A;  2XHD A;  3VLU A;  1MPC A;  3TZA A;  2NOO A;  1GVC A;  2PT1 A;  2Y7I A;  3O97 A;  4AB6 A;  3TTM A;  4THI A;  1M5E A;  4R75 A;  4ZEF A;  4K3F A;  3K00 A;  5I59 A;  5I58 A;  2I0C A;  2YJP A;  2DYX A;  2F5X A;  3GXA A;  4GL0 A;  3TAJ A;  3PUV E;  4GF8 A;  4Q30 B;  1POY 1;  4BDM A;  5ICT A;  3E4R A;  3OEN A;  3FAT A;  2GH9 A;  2FYI A;  1R9L A;  4ESX A;  3DM0 A;  3EPE A;  4OWD A;  3O9P A;  3SER A;  1M5F A;  4XXU A;  3ZKK A;  1MXX A;  1MXZ A;  1YAE A;  1QKB A;  2HEU A;  1QVS A;  5I56 B;  3P7I A;  2XXX A;  4Q0C A;  2R71 A;  5H8Q A;  3U1O A;  1S50 A;  4OQO A;  1GV8 A;  1B51 A;  5FTH A;  4PFU A;  4M4G A;  1N7X A;  3IOR A;  4BDQ A;  5CI5 A;  2QJE A;  1R1N A;  1GR2 A;  1D9Y A;  1MY1 A;  2REJ A;  3TEL A;  5H8H A;  4POX A;  2NVU B;  4LVQ A;  2Q8J A;  1LB8 A;  4OVJ A;  3H4Z A;  3S9N C;  2Q89 A;  3BFT A;  4Q5T A;  2AYS A;  4JBZ A;  1AL3 A;  4IGR A;  1S7Y A;  4QHQ A;  2CZL A;  4O3B A;  1VE4 A;  2ZYK A;  3G3H A;  1FQF A;  4IB2 A;  2X26 A;  1AMF A;  2I4B A;  3PU5 A;  1A54 A;  1S9T A;  2XXU A;  5A5X A;  4RPO A;  3LSL A;  4NMY A;  1Y3P A;  4GXA A;  5CRY A;  4G68 A;  2D3I A;  5H8F B;  4WED A;  4KQP A;  2B65 A;  2XXY A;  2R9J A;  5KCJ B;  3TEP A;  1OLC A;  1P1U A;  1AH5 A;  1OIB A;  4IY5 A;  1ZJL A;  4TLL B;  5EHM A;  3D4C A;  3OO8 A;  4ZDM A;  3R6U A;  1IUD A;  3OXN A;  1MY4 A;  1A8F A;  3IOV A;  1IXC A;  3MUQ A;  2Q9T A;  1ZLQ A;  4IY6 A;  2KLF A;  1QUJ A;  2AL4 A;  4LZ7 A;  2DQV A;  2ALU A;  1O7T A;  3MVZ A;  5DT6 A;  4GD5 A;  5TP9 B;  5I56 A;  2DE4 A;  1FTM A;  3B6T A;  3PUW E;  3GLB A;  3VE1 B;  3CG1 A;  3JZJ A;  1ZMG A;  1PEB A;  1LFH A;  4YKI A;  3CIJ A;  3THI A;  3V89 B;  4LA9 A;  1SDX A;  2QMX A;  3SEX A;  4GIZ A;  3T9V A;  1ATG A;  1H3D A;  3DLN A;  1JEV A;  1B3F A;  2ZYO A;  4EQ9 A;  4G2Z A;  3S9M C;  2Z8F A;  4Z7E A;  4N13 A;  1UTH B;  1EH3 A;  3C32 A;  4AB5 A;  1NNP A;  5CBR A;  5BWJ A;  4PQJ A;  4E0X A;  3ONM A;  3B7D A;  1DOT A;  3U8Q A;  3MBP A;  2HCA A;  4R2B A;  1B58 A;  3VLW A;  4C0R A;  2CMO A;  3OO7 A;  1I69 A;  3PMW A;  1Y1M A;  1IEJ A;  3LSF B;  3TQW A;  5L9M A;  4NWD A;  4YKJ A;  2OCU A;  1B9J A;  1WVJ A;  1B05 A;  5H8F A;  5L9S A;  3O66 A;  3G3K A;  3PMX A;  3C34 A;  2RF1 A;  3TFL A;  3MZ9 A;  2I58 A;  4M1V A;  5KCJ A;  3HCQ A;  2DS9 A;  3M3L A;  5JK4 A;  1MY3 A;  3FVK A;  1P1O A;  5JTY B;  4FIM A;  4H65 A;  3H03 A;  2HAU A;  1P1Q A;  2XD2 A;  2Y84 A;  1MXU A;  4F2Q A;  2OWS A;  3RTF B;  2XX7 A;  1MM6 A;  1B3G A;  2REG A;  1OVT A;  3TCF A;  3SKP A;  1QUL A;  3VVD A;  4KHZ E;  4WKM A;  3KJT A;  1MDQ A;  3IB1 A;  1LBB A;  5TP9 A;  4F2O A;  1MQJ A;  2D5W A;  4MF3 A;  3RQT A;  3IAZ A;  4H6D A;  3TQL A;  4H67 A;  4HW8 A;  4U4S A;  3D4G A;  1JW5 A;  2UVI A;  3FVO A;  1B4H A;  4RK9 A;  2V3Q A;  1JVX A;  1LBC A;  3O28 A;  1N3X A;  1B7H A;  3EQ1 A;  2OJT A;  1UTH A;  3IOU A;  5I58 B;  1XHY A;  1MH4 A;  1ZU0 A;  4QSE A;  3FIR A;  4F3B A;  4DXB A;  1RYX A;  2I0B A;  3IX1 A;  1L5T A;  4JWX A;  2V3T A;  3C4M A;  2P0S A;  3IOW A;  4OMB A;  4O3C A;  1GTK A;  3C31 A;  3MP1 A;  4JWO A;  1N84 A;  1MM7 A;  3CSB A;  1BP5 A;  4WXJ A;  4YIC A;  4JXI A;  3TTN A;  3VXB A;  3WAE A;  4H1X A;  3I6V A;  3O6G A;  1YPN A;  4OEN A;  3IK6 B;  2V84 A;  3KN8 A;  3CFL A;  3S4U A;  5DTB A;  2HXW A;  5H8Q B;  1I6Q A;  1HSE A;  1MG1 A;  1TT1 A;  4MH5 A;  3OO9 A;  4F31 B;  4H8I A;  3OMB A;  4OTE A;  4EF2 A;  4FOR A;  3MZ1 A;  4PFT A;  5JTY A;  3CI8 A;  3K2D A;  2H25 A;  4U1Z A;  1PB7 A;  1LLS A;  1MY0 A;  3C33 A;  4FAJ A;  1KWH A;  3QXM A;  3H6U A;  3TDJ A;  3M3F A;  1N7W A;  5ITO A;  5BUU A;  1IXH A;  5FHO A;  3RT8 A;  4BDL A;  2AIX A;  4NF8 B;  4UAC A;  3ODB A;  3K0V A;  3ILT B;  1BIY A;  3PUX E;  1LFI A;  1A8E A;  2XXQ A;  1QUK A;  3I5O A;  3SES A;  3KGC A;  1SI0 A;  2RC9 A;  5M2V A;  1B3E A;  4Q8R A;  4NF6 A;  2DE3 A;  3FGS A;  5A5X B;  4L17 A;  1EZP A;  3LC8 A;  4XIG Q;  3FJG A;  2H5Y A;  4G4P A;  1US4 A;  3C9H A;  3VXC A;  4F29 A;  1XOC A;  4P11 A;  4G68 B;  4YMB A;  4NTL A;  4RNS A;  1VFE A;  4IO7 A;  4YKK A;  2I48 A;  2QRY A;  3RLF E;  2DXR A;  3PV0 E;  4FEB A;  5ICQ A;  2G93 A;  1LAX A;  3BKI B;  4F1Y A;  5CC2 A;  2M8C A;  2DOJ A;  2ONK E;  2IA4 A;  4FAT A;  3MZB A;  2WKY A;  1ZIU A;  2H4I A;  4KCD A;  1A7L A;  2F35 A;  2RIN A;  5ISU A;  1P99 A;  1MPB A;  3O29 A;  1T0K A;  4ZEC A;  3HV1 A;  4KYD A;  2P1S A;  4YU0 A;  1D9V A;  3GBB A;  2O69 A;  1DPP A;  3SEY A;  2P2A A;  4I9D A;  4P0I A;  4F3P A;  4LQ2 A;  2GHB A;  3K1P A;  3MVX A;  4QSC A;  3N26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...