4ELQA

Ferric binding protein with carbonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
310
structure length
310
Chain Sequence
b'SPTLTIYSGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSRSPADLFWANTAGALGQASAKGLLRPLGETLLEKPIAFVPASRTWVPVTVRLRVLAYNPDRIKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMHHFRDGDAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYPLVKGVALDPNLLPLEEALAKSPKLDLEKLPLDRALRLLRETGVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron ABC transporter, periplasmic iron-binding protein
molecule tags Metal transport
source organism Thermus thermophilus
publication title Crystal structure of ferric binding protein A
rcsb
total genus 114
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elqA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4elqA02
4DDDA 4UA8A 1B05A 4C0RA 2GRVA 5B7DA 1SBPA 4IGRA 2X26A 1N0TA 3CG1A 2Y7KA 4OZ9A 4JWXA 5FHMA 2FA7A 3U72A 1NH7A 2O69A 3DLNA 4G2ZA 4XXUA 5H8HB 1EU8A 5CC2A 5BUUA 1FQFA 1NNKA 3LSFB 1MPCA 2F5XA 5JTYA 3U92A 1IEJA 1Z7ME 2F35A 3KN3A 3K4UA 2KLFA 2VOZA 1B5IA 2DE3A 2GH9A 2ZXTA 3JYRA 3LSWA 3MVYA 2QPQA 3PPOA 4ELPA 2PVUA 3SEYA 4EQBA 1MXXA 2H99A 1QW0A 2REJA 1FCKA 3E3KA 3GBAA 3MAMA 4N13A 3RNNA 5I58A 2P0SA 3DELB 4RYAA 2ZNTA 3M3LA 5A5XA 4IO5A 1JETA 2DWAA 2ZNSA 3K6XA 3FVKA 1LAHE 3KJ7A 4LQ5A 4X48A 1OVBA 2I58A 4KI0E 1DOTA 4F39A 3K1PA 2DXYA 3CI8A 3P7IA 4RPNA 1FTMA 3QUFA 2Q9TA 3QK6A 4OMBA 5H8FB 3HO7A 5J1DA 2QS3A 3G3FA 3S9NC 3M3KA 4OYVA 4UACA 4ZDMA 3EHUA 1DTGA 1JVXA 1B9JA 3FV1A 1SQYA 2DWIA 2ZYMA 4Q30B 1GVCA 3UN6A 4G77A 1FQBA 1LB8A 3F11A 4YB5A 2VD3A 3KSXA 3VLUA 1QUIA 1YTVA 5ITOA 3AXFA 3H6WA 4KYEA 3OSRA 2H4IA 2XXUA 3WAEA 5ITPA 3IOWA 1SVXB 3CFXA 3CFLA 3K00A 4FAJA 4KFQA 5I56B 3TUSA 2Y7IA 2DVCA 3KBRA 4MF3A 2I4CA 3KSJA 5F7VA 3FVGA 4R6YA 2DYXA 1SW2A 3HHFA 3TPAA 1T0KA 3K6WA 3U94A 4BDLA 3LC8A 3H6TA 3C31A 4IO4A 4QF9A 4E0WA 1JW1A 2F6PA 1L5TA 2DWJA 5AA2B 1MS7A 4IO3A 1I6AA 1MQJA 1PC3A 2I0BA 4G68B 4R2FA 5CMCA 5FTHA 5L8DA 1S7YA 2NVUB 5H8HA 3UORA 1TXFA 4XKQA 3OO7A 3FJ7A 3MUQA 1J1NA 3B7DA 5DTBA 3VV5A 4BDQA 4TLMB 1R9LA 1B3EA 3SKPA 4GFRA 4KCDA 3PMVA 4LZ5A 4YKJA 3TTMA 2UYEA 1B4HA 4U21A 4BDOA 4F18A 4QSEA 1PBQA 2OZZA 5K2XA 4BDRA 1B52A 2PT2A 1H43A 1QKAA 3FXUA 3PMWA 1XHYA 3MBPA 1Y3NA 4QRZA 1PBPA 4U22A 5H8FA 3QIMA 2ZNUA 2OBGA 4JWYA 3IOTA 5F1QA 2D3IA 3C34A 1P1NA 3I3VA 4HCWA 1PDAA 3PMXA 2ONRA 4JB7A 2H98A 3KEIA 5LOMA 4F3GA 3UK4A 1ZBMA 5DEXA 4U1ZA 3S9MC 1M5BA 1DPPA 2F97A 3MZ9A 2ZYKA 4YAHX 3IAZA 4TQUQ 4OVJA 4G4PA 3RQTA 4PFUA 3SEXA 1ZLQA 5KZTA 4IO2A 3U93A 1CE2A 4IO6A 1QUJA 1FQDA 4G8NA 4OFOA 1RYXA 3OO9A 1IZ1A 1RYOA 3OSQA 3OEKA 4KYDA 1US4A 2QMXA 3FATA 2Y7PA 4TLLB 4EXKA 1LLSA 2VGQA 4NTLA 5ISUA 2UVHA 3Q26A 4PFTA 2XXHA 2BJJX 4NF4A 5BWJA 3OEMA 4R73A 4FIMA 4U1OA 4FJPA 2D5WA 2I49A 2PX1A 3BFTA 1MM7A 2YPNA 3HHGA 2I3WA 4MH5A 4R6KA 4RNSA 1FTLA 4DCYA 2XXWA 4ESWA 2R9JA 3MVXA 3RPWA 1UTBA 2DS9A 5H8NA 4I9DA 5I2KA 2XXXA 3DP4A 4Q0CA 1MQHA 2O51A 1PB8A 3KG2A 4H5FA 4N6PA 3V8XB 3W9WA 2DWHA 3KN8A 4OESA 1NH8A 2V84A 1MPDA 2B3FA 3QYTA 1EZPA 1MY0A 2Z8DA 1AH5A 1NMUA 4Z7EA 3HSTA 4NMYA 3E13X 3TELA 1YCJA 4WEDA 3TCGA 3SETA 1LB9A 1MPBA 2QJEA 3MW0A 4PE5B 3SEWA 4ELRA 5KDTA 1UTBB 4JSDA 5I2KB 1VR5A 1SI0A 4ZZEA 3PGFA 5KCJA 4U4SA 3ZSFA 3IJOB 1Y1MA 1IXGA 3O66A 1TT1A 4DXUA 1VFEA 2G93A 4H6DA 3ZS6A 2FYIA 4OXVA 5H8QA 4FECA 1B5JA 1PB7A 3FIRA 3IL1B 3PUXE 4YMBA 1BIYA 1MXUA 1Y4TA 1B3GA 3O6HA 4LZ8A 4KYSA 4YKIA 2Q2CA 3FVNA 3TCHA 1IITA 4F1VA 2RC9A 3MPLA 4F22A 4FEBA 1D4NA 1JVYA 2CMOA 3OELA 2RCBA 5EHSA 5AE4A 3KFMA 4H65A 3VFJA 4FATA 4X1DA 4R75A 1JW4A 2DQVA 1FTJA 1MDQA 2X7PA 3GBBA 3PUWE 3H3GA 3IJXB 4GL8A 3N94A 4LZ7A 4IB2A 3H6VA 1S9TA 1ANFA 4YB7A 4MLQA 5TU0A 3LUYA 3U1OA 5CBSA 5KDTB 5DEXB 2GHBA 1BTJA 5FHNA 2NUVA 1I6QA 1B4ZA 2O1MA 3N5LA 4THIA 4X1BA 5TPAB 5HM4B 3USDA 3S9EA 1A8EA 1IIWA 3RTFB 1B7ZA 4ZZAA 1IUDA 4OTEA 3K6VA 4ZS9A 1B0LA 1LGBC 2XX8A 2HZLA 3SDFA 1M5FA 4I1DA 2IA4A 3B6WA 3MZBA 4R2BA 3Q27A 1ZU0A 2A5TB 2AL5A 2XXRA 3MWBA 1NNTA 1B32A 3A3CA 3H06B 1POY1 1P1UA 3K01A 1MXZA 1Q1KA 1R9QA 2V25A 4ISUA 1BP5A 3ONMA 3SEUA 1D9YA 4IY6A 3PUVE 2I0CA 1NKXA 1MXWA 1URDA 4OENA 4U4XA 1MH4A 2RCAA 3LBSA 4TOZA 4KR5A 5FTIA 3FJMA 1B5HA 3V5AA 1B0HA 2WKYA 1B3HA 4H8JA 3M8UA 3O28A 2AIXA 3MQ9A 2ABHA 4F3SA 4DLDA 1WVJA 1H76A 3G3HA 4POWA 4R9GA 5M2VA 4QFKA 3U8QA 3MVWA 3VVDA 1R1NA 4K3FA 3VXCA 1MQIA 2RC8A 2XD3A 1Y4CA 4LP2B 3C35A 3G3KA 1MY2A 1SW1A 2A5SA 3TAJA 3TCFA 1ZMGA 1MH3A 1Z7NE 1NNPA 4GWOA 5ICTA 3E4RA 2PMSA 2F7BA 2HEUA 2NXOA 1N84A 4GIZA 3CIJA 4GXAA 1KWHA 3UP9A 4EXLA 4F31B 3ECRA 3FZVA 1MRPA 3TTRA 3VLWA 3CSGA 5H8NB 1M5EA 1VFDA 2QSXA 4NF8A 4EDPA 5CBRA 1HSJA 1ZJLA 5EYFA 5CMMA 5AA4A 1A55A 1MY1A 2Y84A 1IQ7A 1H44A 1JQFA 2I48A 2Q89A 4HTGA 1OMPA 4JBZA 3MJNA 1US5A 2Z23A 2PT1A 1AL3A 1I6BA 2P2AA 3CSBA 3H7MA 1JW5A 5CM6A 4ZEFA 3TTLA 5I2NA 1N3XA 4GD5A 4YU0A 3K02A 3R7XA 4GL0A 4AB6A 2M8CA 2O68A 3I5OA 4OEVA 1QUKA 1D9VA 1UIVA 1FQAA 4RY1A 3L6HA 5H8QB 4XKPA 1USYE 4KCCA 3C36A 1PEBA 1RKMA 1MY4A 1MXVA 2HFBA 1OVTA 3G3GA 3O2AA 3BFUA 4NF6B 2FNCA 4IGTA 4O3BA 4OFLA 3OO8A 1YAEA 4PETA 4EF1A 5ICQA 3JV9A 3IR1A 1MQDA 1P1QA 1O63A 2DSFA 4GQOA 3EN3A 4PP0A 1P99A 4JDFA 4E0XA 5I84A 1S50A 1B7UA 3B6QA 1LAXA 3ZKLA 3OOAA 4NEDA 3UA8A 3IOUA 4OWDA 1FW0A 4ZEBA 4YKKA 2R71A 2XHDA 2F34A 5L9MA 3QAXA 4ONYA 5I57B 1TWYA 1Y9UA 4JWOA 1IXHA 1EZ9A 1SD3A 1M5CA 1MQGA 2NOOA 5DVFA 1SI1A 3T9XB 3ODBA 1EH3A 1ZTYA 1LCTA 4EUOA 4HS7A 3T9UA 4G68C 3I6VA 4DXBA 5L9SA 1FTKA 4OQOA 5I57A 4F2QA 1ELJA 2H9BA 2XXYA 3D4CA 3TQLA 4KQPA 3VE1B 4EQ9A 1SYIA 5DVJA 1B46A 1URSA 1LCFA 4G68A 1Y20A 3PUZE 2QS1A 3Q25A 3OENA 3FJGA 3GZGA 4AQ4A 1AIVA 2ONSA 3G3JA 3PU5A 4ZECA 3CVGA 3THIA 1LFGA 1XC1A 4R6HA 2XX7A 3RUMA 1O64A 5B70A 4DXCA 1TFDA 2I3VA 3IB1A 3K1NA 3CR9A 1UIUA 4JSOA 4NF5B 1GR2A 3KN7A 4DCXA 4PFWA 2XXTA 1N04A 4R72A 3EQ1A 4YICA 2Y7RA 4MBPA 2HZKA 4I62A 1Y1ZA 3MP8A 5CI5A 4F3BA 2P1SA 1FQEA 4QSDA 2XXVA 3WAFA 1B58A 3MZ1A 4GF8A 1XVXA 5DVIA 2F7AA 4YZZA 3V83A 1JEUA 1ZIUA 3G7WA 3MP6A 2QS2A 4YKPA 3MVZA 3T93B 2OWTA 4F2OA 5AA2D 4R9FA 4RA1A 5FHOA 1H3DA 3K0VA 3TKDA 2OLBA 3SEVA 3VVEA 3L6GA 4Q8RA 2Z8FA 3IOVA 3DP8A 3FVOA 4MFIA 2G29A 1LFHA 4KD5A 3OO6A 4DZ1A 1N7XA 3RT8A 2F8DA 2QS4A 3RT6B 4ZEDA 3TODA 1LBCA 3EF7A 1ZKBA 3KGCA 3N26A 3A3UA 3SERA 2HCAA 1AMFA 2OK2A 3PPNA 3Q29A 5TP9B 3IK6B 2VP1A 5CMBA 1B3FA 2LAOA 3TTNA 1N7WA 1B6HA 5L9OA 3MC2A 1OQHA 1BLFA 1GTKA 2Y7WA 1F9BA 2GFEA 2I4BA 3IORA 2THIA 1DPEA 3S4UA 4C1UA 2DXRA 4GXSB 2OJTA 3PPRA 5I56A 2O84X 1MG1A 3R6UA 1XVYA 3O97A 4F29A 3K1MA 2ZYOA 5ELVA 1B40A 3W9VA 4EQ7A 2XXPA 2HQ0A 2X7QA 3PD9A 3VVFA 3PPPA 5JK4A 1POTA 1BKAA 1R6ZA 5I2NB 2E0SA 2OWSA 4GRKA 2QRYA 3UIFA 3CFZA 4H1XA 3HCQA 4P0IA 3T22A 4XKNA 4XTCQ 4ELOA 3SESA 1MDP1 2Z8EA 4H0WA 5H8SA 3V89B 5IAIA 3O6IA 4RPOA 3IX1A 2B3BA 3LR1A 4ECFA 4IY5A 2DE2A 2VHAA 3CG3A 3MP1A 3FV2A 4FE8A 4P0GA 4ZEKA 3T66A 1B51A 1N76A 3T9VA 4QFOA 1B3LA 3FASA 5AA1A 3IB2A 3VDFA 1O7TA 3GLBA 1WODA 3FGSA 3JZJA 2DOJA 3OD7A 2DVZA 3TFLA 3PPQA 3HPIA 4LUBA 3T9HB 5I58B 4C1TA 3H6UA 4NF6A 1IXIA 2UYFA 3S2VA 3G3IA 3N6UA 4AB5A 1SW5A 4N07A 2RKMA 3TTKA 1A54A 2VD2A 1OIBA 2XXQA 3TQWA 4POXA 4JXIA 2D21A 3HV1A 2XD2A 1D3KA 4GVOA 1SW4A 1QVSA 2DE4A 2PBWA 3EPEA 3KOSA 3PUYE 1B1XA 1UTHA 2ALUA 2Q88A 3OXNA 1GV8A 4FORA 3RTWB 4FEDA 2ZMBA 4H8IA 4QHQA 4QFLA 4HW8A 1HSEA 4WXJA 2HAUA 2I6EA 2REGA 2RF1A 1MM6A 1LFIA 4Q5TA 2F78A 1A99A 3RY3A 3GXAA 4OERA 5KCJB 3C4MA 5AA4B 2XX9A 3DM0A 4Z0IA 3VXBA 2O7IA 3ZKKA 3A09A 4NF8B 2NWJA 1P1WA 3QSLA 2F7CA 3K6UA 5A5XB 2A5TA 1QULA 2V3UA 4L17A 3IB0A 4F1YA 1H45A 5I59A 5JEIA 1TFAA 3LSXA 2O7UA 4ZE8A 2W7YA 3QXMA 4DE8A 5I59B 4NWDA 1EZOA 3N6TA 4RJZA 5DT6A 3IO4A 4ZE9A 3O6GA 3UGWA 1FTOA 2F36A 4OHNA 4U2RA 4GOTA 4WKMA 1NFTA 4GLIA 1I69A 1M5DA 4NWCA 4O3AA 4NF5A 2CZLA 2QL3A 2UVJA 3D4GA 4H5GA 1NL5A 4M4GA 4PQJA 2ZYNA 1XS5A 2O6AA 1VE4A 3Q28A 3C9HA 3IO6A 4HCYA 3KJTA 4BLAA 4ESXA 2AL4A 4NF4B 3VLVA 2ESNA 4LATA 2H5YA 4BDMA 1QKBA 2Q8JA 1SYHA 1JEVA 1SDXA 4KPTA 2V3QA 1USYH 1IXCA 1CB6A 2HXWA 2ONKE 2Q2AA 4O3CA 4QSCA 3TZAA 1GGGA 3RN8A 1FQCA 2YLNA 3R26A 4LVQA 3ILUB 4LA9A 3W15C 2XXIA 1UQWA 3FXQA 4IO7A 1II5A 2O1LA 1N3WA 2RC7A 1LAFE 1PB9A 3KZGA 1XT8A 4KHZE 4M1VA 4R74A 4X9TA 5CRYA 2DP8A 5TPAA 5CMKA 1AOVA 3O9PA 1DMBA 1HSLA 5K2YA 4F3PA 5HBCA 3CRBA 4P11A 3T96B 4RXLA 3E9XA 1Y3QA 1JNFA 3HN0A 4PFYA 1YPNA 3H03A 3BBRA 3DP6A 2ANJA 3ILTB 3PD8A 3EHSA 1OQGA 1OLCA 4RK9A 3OMBA 2B65A 3B6TA 4QFPA 4BDNA 3TEPA 2UVGA 5JTYB 4XIGQ 3S9LC 3FUZA 4OFJA 4LONB 4G8MA 1ATGA 1Y3PA 3H4ZA 4U23A 3RLFE 1UTHB 4YMAA 3TYHA 2E1SA 4RK2A 4YB6A 2PYYA 5IKBA 1B2HA 3BKIB 3MPKA 3KOTA 4G8HA 4ELQA 3O29A 1XOCA 4LQ2A 3RGYA 2OCUA 3FXRA 2AYSA 4ND9A 3TDJA 1NNFA 1A40A 4H67A 2IEEA 2V3TA 3EHTA 4OETA 3M3FA 4F1UA 5HPQA 3C33A 1A7LA 5DYHA 1Q35A 2YJPA 3FD3A 5EHMA 4MLVA 2UVIA 4F19A 1MXYA 4I8CA 5AA2A 1OLAA 1B1HA 1VSOA 1LAGE 1QJMA 4XKRA 3TMGA 1P1OA 1A8FA 3K2DA 5TP9A 2V93A 1B7HA 1DTZA 4QFNA 4OEUA 4EF2A 4ZEIA 2R6GE 1DSNA 1URGA 2Z22A 4NE4A 2RINA 1LBBA 2UXAA 3C32A 2F6GA 4DIGA 1WDNA 2H25A 3LSLA 2QMWA 3PV0E 2HAVA 4WEPA 5AA3A 1MY3A 1LSTA 3QUJA 2GHAA
chains in the Genus database with same CATH superfamily
2Y7KA 4OZ9A 2FA7A 3U72A 1YZ0A 1NH7A 2O69A 5H8HB 1FQFA 4KXPA 2F5XA 4P47A 3KN3A 3K4UA 4JVDA 3PPOA 2ZXTA 3JYRA 1MXXA 2VT5A 2V4CA 3M3LA 4GX4A 2DWAA 3K6XA 5JTYB 4F39A 2DXYA 2QS3A 3M3KA 4OYVA 3EHUA 1JVXA 3FV1A 4Q30B 4X04A 1FQBA 4YB5A 3VLUA 1YTVA 3H6WA 4N6DA 4PDDA 3WAEA 5ITPA 3TUSA 2DVCA 5F7VA 3LC8A 3H6TA 2F6PA 5AA2B 4IO3A 5CMCA 4I3YA 3FJ7A 1FBFA 1KA1A 3PMVA 3TTMA 2UYEA 4AS5A 1NV4A 1B52A 2PT2A 3FXUA 1XHYA 4U22A 1P1NA 4HCWA 1IMEA 3MZ9A 3IAZA 1CE2A 1RYXA 3OO9A 1RYOA 3A29A 3OSQA 2QMXA 4EXKA 1LLSA 4NF4A 4FIMA 2I3WA 3MVXA 4GWZA 4I9DA 2O51A 4H5FA 1PB8A 3KG2A 3W9WA 3KN8A 4OESA 1MPDA 3HSTA 3E13X 2ZZVA 2QJEA 4ELRA 4JSDA 4U4SA 2P3VA 1Y1MA 1IXGA 4H6DA 4OXVA 3EKIA 5H8QA 4FECA 4YMBA 3PUXE 3IL1B 4GBVA 1BIYA 4KYSA 4F1VA 3MPLA 1D4NA 4G61A 4P1LA 3OELA 1RDYA 5AE4A 4X1DA 3BIHA 4PAKA 4NF5B 3H6VA 3MSTA 4MLQA 2GHBA 5FHNA 2FHYA 1B4ZA 4X1BA 3N5LA 1FPKA 3RTFB 2XX8A 3B6WA 5BWJA 3Q27A 2XXRA 1MXZA 2V25A 4ISUA 1D9YA 4P3LA 1NKXA 1MXWA 5FTIA 4KR5A 3FJMA 3V5AA 2WKYA 1B3HA 2Y5KA 4I3EA 2ABHA 4DLDA 3G3HA 1H76A 4POWA 3E78A 4QFKA 4FBPA 3VXCA 1Y4CA 3TAJA 1NNPA 3UP9A 3ECRA 3FZVA 5CBRA 5EYFA 5CMMA 1IQ7A 1JQFA 1OMPA 1US5A 2Z23A 3TTLA 1UIVA 1FQAA 3IFCA 3RT8A 4PFRA 3T96B 4IGTA 4MHFA 1YAEA 5I7IA 3IR1A 1P1QA 3EN3A 1LAXA 2XHDA 2F34A 5L9MA 4P1EA 5I57B 1TWYA 4JWOA 2NOOA 1M5CA 2WBBA 5DVFA 5EQ7A 1EH3A 3I6VA 3TQLA 4KQPA 1FBHA 1SYIA 1B46A 1LCFA 1Y20A 3OENA 3FJGA 3GZGA 4AQ4A 4GWSA 3PU5A 3NOHA 1NUWA 3RUMA 1O64A 2I3VA 4JSOA 3EQ1A 4I62A 1Y1ZA 2HXRA 4XF5A 4O94A 1B58A 4GF8A 1XVXA 2F7AA 1JEUA 2QS2A 4KD5A 3OO6A 4DZ1A 1N7XA 2F8DA 3KGCA 2LAOA 5L9OA 2R8TA 4NX1A 2I4BA 3PPRA 3T1BA 4F29A 1XVYA 2XA5A 2E0SA 2QRYA 3T22A 4XTCQ 4ELOA 1G0HA 3V89B 3IX1A 1EYIA 3KC1A 4IY5A 3T66A 1B51A 3FASA 5AA1A 3VDFA 3FGSA 2DOJA 2DVZA 3PPQA 2UYFA 3N6UA 4AB5A 2RKMA 2VD2A 4HXVA 4POXA 4JXIA 2D21A 4GVOA 2DE4A 3PUYE 1UTHA 2ALUA 2Q88A 4H8IA 4QHQA 4QFLA 5F24A 4WXJA 2HAUA 2REGA 1A99A 3GXAA 5KCJB 3DM0A 1INPA 3ZKKA 4NF8B 1P1WA 2F7CA 3K6UA 5A5XB 3IB0A 5I59A 4DE8A 4NWDA 5DT6A 3UGWA 4OHNA 2F36A 4GLIA 4NF5A 2QL3A 4M4GA 2O6AA 2Q8MA 4HCYA 4ESXA 4NF4B 2ESNA 4MEVA 2JJKA 1QKBA 1SYHA 1JEVA 1SDXA 4MNIA 1D9QA 1USYH 2HXWA 4O3CA 5ET8A 2XXIA 1UQWA 3FXQA 2O1LA 2RC7A 5CRYA 1PB9A 2WYKA 1XT8A 2DP8A 1HSLA 4RXLA 5IZ3B 4PFYA 1FPIA 3H03A 3EHSA 1OLCA 2B65A 4HE0A 2UVGA 1FJ9A 1Y3PA 3H4ZA 4U23A 1UTHB 2E1SA 4RK2A 4YB6A 1B2HA 4G8HA 2OCUA 3TDJA 3GYYA 4H67A 3M3FA 4F1UA 3C33A 1A7LA 3FD3A 5AA2A 5EQ8A 1A8FA 4EF2A 4ZEIA 4ZE8A 2UXAA 2F6GA 2H25A 1BK4A 4OA4A 4DI3D 2FIXA 4WEPA 1LEVA 4DDDA 4UA8A 2GRVA 5B7DA 4G2ZA 4XXUA 5BUUA 1IEJA 1B5IA 2DE3A 3MVYA 4ELPA 1QW0A 3GBAA 1FCKA 2ZNTA 4IO5A 2ZNSA 4LQ5A 4X48A 2I58A 2CEXA 1FTMA 2Q9TA 3QK6A 4OMBA 5H8FB 3HO7A 3CHGA 3RYDA 4UACA 1SQYA 3UN6A 2ZYMA 1LB8A 2VD3A 3KSXA 3AXFA 3K00A 4FAJA 2Y7IA 4MF3A 2I4CA 3KSJA 3FVGA 3TPAA 3U94A 4QF9A 4IO4A 1JW1A 3T0JA 2DWJA 1QGXA 1I6AA 1MQJA 2I0BA 4G68B 3UORA 2Q74A 5H8HA 4GX3A 3VV5A 4BDQA 4AS4A 4PAFA 2OZZA 5K2XA 1QKAA 4QRZA 1PBPA 3QIMA 2ZNUA 4JWYA 3IOTA 3I3VA 1PDAA 2ONRA 4F3GA 3UK4A 1DPPA 1NUYA 4G4PA 3RQTA 5KZTA 3U93A 4IO6A 1KZ8A 2Y7PA 1YXIA 3OEMA 4R73A 4FJPA 2D5WA 1MM7A 3HHGA 4MH5A 1JP4A 4ESWA 3RPWA 2DS9A 2XXXA 3DP4A 4P8BA 4N6PA 4PFBA 1NH8A 1NV0A 2V84A 3QYTA 1EZPA 1MY0A 4Z7EA 4WEDA 5KCJA 3PTYA 4GX6A 1TT1A 4DXUA 2FYIA 1B5JA 1PB7A 3TCHA 2Q2CA 4FEBA 2B4MA 2RCBA 3VFJA 4FATA 1MDQA 4ZS9A 3N94A 4PF8A 1S9TA 2BJIA 5TU0A 3U1OA 5CBSA 3LUYA 5DEXB 2NUVA 2VPNA 4THIA 3USDA 1A8EA 1IUDA 3MZBA 4R2BA 4OWDA 1ZU0A 3MWBA 1NNTA 3A3CA 3H06B 1P1UA 3ONMA 4PCDA 1MH4A 1NV1A 1B5HA 1B0HA 4H8JA 3O28A 2AIXA 3MQ9A 4F3SA 1LBZA 4IR8A 4K3FA 1FSAA 1SW1A 2A5SA 1ZMGA 4GWOA 5ICTA 3E4RA 4O8MA 4NQ8A 4GXAA 2NXOA 4EXLA 4F31B 3TTRA 1MRPA 3VLWA 2QSXA 1HSJA 5AA4A 1A55A 1MY1A 3U65A 3MJNA 1AL3A 1I6BA 2P2AA 4ZEFA 5I2NA 5LDZA 1N3XA 3R7XA 4YU0A 3K02A 2O68A 1QUKA 3L6HA 5H8QB 5IZ1A 1RKMA 1MY4A 3G3GA 1OVTA 3O2AA 3BFUA 4OFLA 5ICQA 4N81A 1MQDA 2DSFA 4PP0A 1P99A 5I84A 1B7UA 3B6QA 3OOAA 3IOUA 1FTAA 1FW0A 4ZEBA 3QAXA 3T9XB 1MQGA 3ODBA 2CZHA 4EUOA 1FTKA 5I57A 1ELJA 4EQ9A 3VE1B 5DVJA 4G68A 2QS1A 3Q25A 3G3JA 4PAIA 1XC1A 5B70A 3CR9A 4PFWA 4YICA 4F3BA 1K9ZA 4OVSA 1H3DA 3K0VA 2Z8FA 5EYHA 1LFHA 4MFIA 2G29A 3RT6B 3A3UA 3SERA 3IK6B 2VP1A 1DCUA 1B6HA 3MC2A 1OQHA 2GFEA 3S4UA 4N8YA 4MNPA 2HHMA 2OJTA 5IGAA 2ZYOA 4EQ7A 1B40A 5JK4A 2HQ0A 2X7QA 3VVFA 3PPPA 1POTA 3UIFA 3CFZA 2L5VA 3SESA 1KA0A 4H0WA 3O6IA 2VHAA 3CG3A 4P0GA 1FPDA 3FV2A 1N76A 4QFOA 2ZZXA 1O7TA 1RDZA 3H6UA 3S2VA 1SW5A 3TTKA 2XXQA 1D3KA 1DK4A 1QVSA 1FBDA 4FORA 2F3DA 2ZMBA 2RF1A 1LBYA 2HPGA 4OERA 3C4MA 5AA4B 2XX9A 1QULA 5JEIA 1TFAA 3LSXA 3SZPA 5I59B 2WEFA 3RPLB 4ZE9A 2QFLA 3O6GA 4WKMA 1NFTA 2UVJA 5K2YA 5IZZA 1XS5A 1FBPA 1VE4A 3C9HA 3VLVA 2H5YA 4BDMA 2Q8JA 3TZAA 1IXCA 1CB6A 2ONKE 2Q2AA 1GGGA 1FQCA 3ILUB 4M1VA 1FPBA 2KQZA 4F3PA 5FBPA 1Y3QA 1YPNA 3PD8A 3BBRA 3DP6A 4RK9A 4LONB 3RLFE 4LN5A 3TYHA 2PYYA 2WYPA 3BKIB 4ELQA 3O29A 4GWUA 3FXRA 1NNFA 4OETA 4GWYA 3E79A 5EHMA 4MLVA 1MXYA 4I8CA 4GWWA 1VSOA 1B1HA 1LAGE 1QJMA 3TMGA 4P9KA 1URGA 4DIGA 3C32A 4N17A 1IMAA 2HAVA 5I5PA 1SBPA 4IGRA 2X26A 3CG1A 5FHMA 4JWXA 1FBEA 5CC2A 1NNKA 3LSFB 1MPCA 5JTYA 4O7IA 1Z7ME 2QPQA 2PVUA 3SEYA 4NAPA 2H99A 2REJA 3E3KA 3MAMA 3RNNA 5I58A 3DELB 1NV3A 1JETA 3KJ7A 3FVKA 1LAHE 4KI0E 1DOTA 3K1PA 3CI8A 3QUFA 1IMDA 3G3FA 5I3SA 1GVCA 3F11A 5ITOA 4N8GA 2H4IA 2XXUA 3IOWA 3CFXA 5I56B 3KBRA 4R6YA 2DYXA 1SW2A 3HHFA 1FBGA 3K6WA 4BDLA 3C31A 4PDHA 4R2FA 5FTHA 1TXFA 4XKQA 3OO7A 3HFUA 1J1NA 3B7DA 4MX6A 1VDWA 4GFRA 1B4HA 1PBQA 4BDRA 3PMWA 1H43A 3MBPA 1Y3NA 3B8BA 1EYKA 3C34A 4JB7A 5EYGA 3KEIA 1M5BA 5DW8A 4P56A 4PFUA 4OVPA 1FQDA 4OFOA 1IZ1A 4KYDA 4NTLA 2VGQA 5ISUA 3Q26A 2XXHA 2BJJX 4NGUA 4U1OA 2I49A 2PX1A 4RNSA 1YYZA 2XXWA 1UTBA 5I2KA 5ET7A 3V8XB 1NV2A 2B3FA 1K9YA 1NMUA 2Z8DA 4NMYA 3TELA 3IFAA 3SETA 1LB9A 4PE5B 3SEWA 1UTBB 5I2KB 2FBPA 1VR5A 2QVVA 3ZSFA 3IJOB 3O66A 2G93A 1AWBA 1MXUA 1B3GA 4YKIA 4N15A 3FVNA 4NG7A 1IITA 2RC9A 4F22A 1JVYA 2WX9A 5EHSA 2CEYA 1JW4A 2DQVA 2X7PA 3GBBA 4GL8A 5ET5A 3IJXB 5A5LA 4IB2A 4YB7A 5IZ3A 1BTJA 1I6QA 3RPLA 2O1MA 1IIWA 3K6VA 1B0LA 4MCOA 3SDFA 4F18A 1M5FA 2IA4A 5EQAA 5HM4B 2AL5A 2A5TB 1B32A 1Q1KA 1R9QA 3BIGA 3SEUA 3PUVE 4PF6A 4PGNA 2RCAA 4TOZA 3M8UA 4R9GA 3U8QA 3MVWA 4LP2B 3G3KA 1MY2A 1NV7A 3TCFA 1MH3A 1Z7NE 2PMSA 2HEUA 3CIJA 3CSGA 5H8NB 1M5EA 2Y84A 1H44A 2I48A 2Q89A 3KBZA 4JVCA 3H7MA 1JW5A 2PCRA 2OX3A 4GD5A 4GL0A 4AB6A 2M8CA 4OEVA 1D9VA 2HFBA 4ZDMA 4O3BA 4EF1A 2FNCA 3OO8A 3JV9A 4GQOA 4JDFA 1S50A 3ZKLA 4NEDA 4N4UA 2R71A 1Y9UA 1IXHA 1EZ9A 4MIJA 1LCTA 4HS7A 5L9SA 4OQOA 1FRPA 4F2QA 2XXYA 2H9BA 3D4CA 4OVQA 2VPOA 1URSA 3PUZE 2ONSA 3CVGA 3THIA 1LFGA 4QXDA 4DXCA 2XWKA 3IB1A 3K1NA 4DCXA 1N04A 1LBXA 4MBPA 2HZKA 3LV0A 4QSDA 3WAFA 4YZZA 5DVIA 3V83A 1ZIUA 3G7WA 3MP6A 3MVZA 1DBZA 4NHBA 4F2OA 4RA1A 5FHOA 1FPEA 3TKDA 2OLBA 3SEVA 3VVEA 3LUZA 3DP8A 2QS4A 4ZEDA 3QMFA 3Q29A 1AMFA 2OK2A 5CMBA 1N7WA 1XI6A 4XFEA 1BLFA 2XWOA 1GTKA 2Y7WA 1F9BA 4OVTA 2THIA 4C1UA 4JVIA 4GXSB 2O84X 3O97A 3W9VA 4PBHA 2ZZWA 1BKAA 1R6ZA 1RDXA 2OWSA 1FPFA 3HCQA 4XKNA 5H8SA 4ECFA 2FVZA 3MP1A 5T3JA 1LBVA 4ZEKA 3T9VA 3IB2A 3GLBA 1EYJA 3OD7A 4NF0A 3HPIA 4HE2A 5I58B 1IXIA 3HV1A 2PBWA 3EPEA 1GV8A 3OXNA 4FEDA 4HW8A 1HSEA 2I6EA 1LFIA 4Q5TA 4Z0IA 3A09A 2NWJA 4PC9A 2A5TA 2V3UA 4L17A 2O7UA 1EZOA 3N6TA 3IO4A 1FTOA 4GOTA 4H46A 4O3AA 3D4GA 1NL5A 4PQJA 2ZYNA 3IO6A 3KJTA 4BLAA 1LBWA 1Q9DA 1SPIA 4LATA 4MAGA 4KPTA 2YLNA 3R26A 4LA9A 1II5A 4X9TA 1N3WA 1LAFE 4R74A 3KZGA 4PFIA 1AOVA 3FXBA 3CRBA 4P11A 4GWXA 1JNFA 2ANJA 2XWVA 3TEPA 3OMBA 3B6TA 4XIGQ 3FUZA 4OFJA 1IMCA 4G8MA 4YMAA 5IKBA 2KR0A 4LQ2A 1XOCA 2WBDA 4ND9A 4PBQA 1A40A 2IEEA 3EHTA 2YJPA 3FBPA 1OLAA 1P1OA 4QFNA 1DTZA 4H45A 2R6GE 2Z22A 1LBBA 1WDNA 3LSLA 3PV0E 4NN3A 4QBAA 1MY3A 2GHAA 1IMBA 1B05A 3ISPA 4C0RA 1NV5A 1N0TA 1IMFA 3DLNA 1EU8A 3U92A 2F35A 2KLFA 2VOZA 2GH9A 3LSWA 1NUZA 4EQBA 4N13A 2P0SA 4RYAA 2QVRA 1OVBA 3P7IA 4RPNA 3S9NC 4PGPA 1DTGA 1B9JA 2DWIA 4XEQA 4G77A 1QUIA 4KYEA 3OSRA 1SVXB 3CFLA 4KFQA 2CZKA 1G0IA 1T0KA 4E0WA 1L5TA 1MS7A 1PC3A 2OWZA 5L8DA 1S7YA 2NVUB 1NV6A 3MUQA 5DTBA 4PE3A 4TLMB 1R9LA 1B3EA 3SKPA 4KCDA 4LZ5A 4YKJA 4BDOA 4U21A 4QSEA 5H8FA 2OBGA 5F1QA 2D3IA 3PMXA 2H98A 5LOMA 1ZBMA 5DEXA 2XWIA 4U1ZA 3S9MC 2F97A 2ZYKA 4PTKA 4YAHX 4TQUQ 4OVJA 3SEXA 1ZLQA 4IO2A 1CNQA 1QUJA 4G8NA 4TLLB 3OEKA 1US4A 3FATA 2UVHA 4PFTA 3BFTA 5J1DA 2YPNA 4R6KA 1FTLA 4DCYA 2R9JA 5H8NA 4Q0CA 1MQHA 2B4LA 2DWHA 1AH5A 1YCJA 3TCGA 1MPBA 3MW0A 5KDTA 1SI0A 4ZZEA 3PGFA 5ET6A 1VFEA 3ZS6A 3FIRA 1Y4TA 3O6HA 4LZ8A 2CMOA 3KFMA 4H65A 4R75A 3PUWE 1FTJA 3H3GA 4LZ7A 1ANFA 5KDTB 4UABA 5TPAB 3S9EA 1B7ZA 4ZZAA 4OTEA 1LGBC 2HZLA 4I1DA 1POY1 3K01A 1BP5A 4IY6A 2I0CA 4U4XA 1URDA 4OENA 3LBSA 2MKZA 4HE1A 1WVJA 3ROJA 2Y5LA 5M2VA 3VVDA 1R1NA 1MQIA 2RC8A 2XD3A 2XXKA 3C35A 2F7BA 4GIZA 4O7MA 1N84A 5A5XA 1KWHA 4NF8A 1VFDA 4EDPA 1ZJLA 4HTGA 4JBZA 2P3NA 2PT1A 4DI4B 3CSBA 5CM6A 3I5OA 2FIEA 4RY1A 4XKPA 5ESYA 1USYE 4KCCA 2DDKA 3C36A 1PEBA 1MXVA 4NF6B 4PETA 1O63A 4E0XA 3UA8A 4YKKA 4ONYA 1SD3A 5IM2A 1SI1A 4X8RA 1ZTYA 3T9UA 1FPLA 4G68C 4DXBA 3B50A 1FJ6A 1AIVA 4ZECA 2PFZA 4R6HA 2XX7A 1TFDA 1UIUA 1GR2A 3KN7A 2XXTA 4R72A 2Y7RA 3MP8A 5CI5A 2P1SA 1FQEA 2XXVA 3MZ1A 3T93B 4YKPA 4MJOA 2OWTA 5AA2D 4N91A 4R9FA 4MNCA 4Q8RA 3L6GA 3IOVA 3FVOA 3TODA 1LBCA 3EF7A 1ZKBA 3N26A 4N6KA 5J16A 2HCAA 3PPNA 2PFYA 5TP9B 1NI9A 1B3FA 3TTNA 3IORA 1DPEA 2DXRA 5I56A 1MG1A 3R6UA 3K1MA 5ELVA 2XXPA 3PD9A 5I2NB 5LTCA 4GRKA 4H1XA 4P0IA 1MDP1 2Z8EA 5IAIA 2F3BA 4RPOA 2B3BA 3LR1A 2DE2A 4FE8A 1B3LA 3JZJA 1WODA 3TFLA 4LUBA 3T9HB 4C1TA 4NF6A 3G3IA 4N07A 5EQ9A 1A54A 1OIBA 3TQWA 2XD2A 1SW4A 3RTWB 3KOSA 1B1XA 4I40A 1MM6A 2F78A 3RY3A 4GBWA 3VXBA 2O7IA 3KC0A 3QSLA 4F1YA 1H45A 3MYUA 2W7YA 3QXMA 4RJZA 4U2RA 1I69A 1M5DA 1FPGA 4NWCA 2CZLA 4H5GA 3Q28A 2AL4A 4OANA 2V3QA 4MMPA 4QSCA 3RN8A 4LVQA 1FPJA 3W15C 4IO7A 5CMKA 4KHZE 5TPAA 3O9PA 1DMBA 5HBCA 3E9XA 3HN0A 3ILTB 1OQGA 4QFPA 4BDNA 3S9LC 1ATGA 1NUXA 4OVRA 3MPKA 3KOTA 3RGYA 2AYSA 2V3TA 2GQ1A 3D1RA 5HPQA 5DYHA 1Q35A 4F19A 2UVIA 1FBCA 4XKRA 5TP9A 3K2DA 2QVUA 2V93A 1B7HA 4OEUA 1DSNA 4NE4A 2RINA 2CZIA 2QMWA 5AA3A 1LSTA 3QUJA
chains in the Genus database with same CATH topology
4DDDA 4UA8A 1B05A 4C0RA 2GRVA 5B7DA 1SBPA 4IGRA 2X26A 1N0TA 3CG1A 2Y7KA 4OZ9A 4JWXA 5FHMA 2FA7A 3U72A 1NH7A 2O69A 3DLNA 4G2ZA 4XXUA 5H8HB 1EU8A 5CC2A 5BUUA 1FQFA 1NNKA 3LSFB 1MPCA 2F5XA 5JTYA 3U92A 1IEJA 1Z7ME 2F35A 3KN3A 3K4UA 2KLFA 2VOZA 1B5IA 2DE3A 2GH9A 2ZXTA 3JYRA 3LSWA 3MVYA 2QPQA 3PPOA 4ELPA 2PVUA 3SEYA 4EQBA 1MXXA 2H99A 1QW0A 2REJA 1FCKA 3E3KA 3GBAA 3MAMA 4N13A 3RNNA 5I58A 2P0SA 3DELB 4RYAA 2ZNTA 3M3LA 5A5XA 4IO5A 1JETA 2DWAA 2ZNSA 3K6XA 3FVKA 1LAHE 3KJ7A 4LQ5A 4X48A 1OVBA 2I58A 4KI0E 1DOTA 4F39A 3K1PA 2DXYA 3CI8A 3P7IA 4RPNA 1FTMA 3QUFA 2Q9TA 3QK6A 4OMBA 5H8FB 3HO7A 5J1DA 2QS3A 3G3FA 3S9NC 3M3KA 4OYVA 4UACA 4ZDMA 3EHUA 1DTGA 1JVXA 1B9JA 3FV1A 1SQYA 2DWIA 2ZYMA 4Q30B 1GVCA 3UN6A 4G77A 1FQBA 1LB8A 3F11A 4YB5A 2VD3A 3KSXA 3VLUA 1QUIA 1YTVA 5ITOA 3AXFA 3H6WA 4KYEA 3OSRA 2H4IA 2XXUA 3WAEA 5ITPA 3IOWA 1SVXB 3CFXA 3CFLA 3K00A 4FAJA 4KFQA 5I56B 3TUSA 2Y7IA 2DVCA 3KBRA 4MF3A 2I4CA 3KSJA 5F7VA 3FVGA 4R6YA 2DYXA 1SW2A 3HHFA 3TPAA 1T0KA 3K6WA 3U94A 4BDLA 3LC8A 3H6TA 3C31A 4IO4A 4QF9A 4E0WA 1JW1A 2F6PA 1L5TA 2DWJA 5AA2B 1MS7A 4IO3A 1I6AA 1MQJA 1PC3A 2I0BA 4G68B 4R2FA 5CMCA 5FTHA 5L8DA 1S7YA 2NVUB 5H8HA 3UORA 1TXFA 4XKQA 3OO7A 3FJ7A 3MUQA 1J1NA 3B7DA 5DTBA 3VV5A 4BDQA 4TLMB 1R9LA 1B3EA 3SKPA 4GFRA 4KCDA 3PMVA 4LZ5A 4YKJA 3TTMA 2UYEA 1B4HA 4U21A 4BDOA 4F18A 4QSEA 1PBQA 2OZZA 5K2XA 4BDRA 1B52A 2PT2A 1H43A 1QKAA 3FXUA 3PMWA 1XHYA 3MBPA 1Y3NA 4QRZA 1PBPA 4U22A 5H8FA 3QIMA 2ZNUA 2OBGA 4JWYA 3IOTA 5F1QA 2D3IA 3C34A 1P1NA 3I3VA 4HCWA 1PDAA 3PMXA 2ONRA 4JB7A 2H98A 3KEIA 5LOMA 4F3GA 3UK4A 1ZBMA 5DEXA 4U1ZA 3S9MC 1M5BA 1DPPA 2F97A 3MZ9A 2ZYKA 4YAHX 3IAZA 4TQUQ 4OVJA 4G4PA 3RQTA 4PFUA 3SEXA 1ZLQA 5KZTA 4IO2A 3U93A 1CE2A 4IO6A 1QUJA 1FQDA 4G8NA 4OFOA 1RYXA 3OO9A 1IZ1A 1RYOA 3OSQA 3OEKA 4KYDA 1US4A 2QMXA 3FATA 2Y7PA 4TLLB 4EXKA 1LLSA 2VGQA 4NTLA 5ISUA 2UVHA 3Q26A 4PFTA 2XXHA 2BJJX 4NF4A 5BWJA 3OEMA 4R73A 4FIMA 4U1OA 4FJPA 2D5WA 2I49A 2PX1A 3BFTA 1MM7A 2YPNA 3HHGA 2I3WA 4MH5A 4R6KA 4RNSA 1FTLA 4DCYA 2XXWA 4ESWA 2R9JA 3MVXA 3RPWA 1UTBA 2DS9A 5H8NA 4I9DA 5I2KA 2XXXA 3DP4A 4Q0CA 1MQHA 2O51A 1PB8A 3KG2A 4H5FA 4N6PA 3V8XB 3W9WA 2DWHA 3KN8A 4OESA 1NH8A 2V84A 1MPDA 2B3FA 3QYTA 1EZPA 1MY0A 2Z8DA 1AH5A 1NMUA 4Z7EA 3HSTA 4NMYA 3E13X 3TELA 1YCJA 4WEDA 3TCGA 3SETA 1LB9A 1MPBA 2QJEA 3MW0A 4PE5B 3SEWA 4ELRA 5KDTA 1UTBB 4JSDA 5I2KB 1VR5A 1SI0A 4ZZEA 3PGFA 5KCJA 4U4SA 3ZSFA 3IJOB 1Y1MA 1IXGA 3O66A 1TT1A 4DXUA 1VFEA 2G93A 4H6DA 3ZS6A 2FYIA 4OXVA 5H8QA 4FECA 1B5JA 1PB7A 3FIRA 3IL1B 3PUXE 4YMBA 1BIYA 1MXUA 1Y4TA 1B3GA 3O6HA 4LZ8A 4KYSA 4YKIA 2Q2CA 3FVNA 3TCHA 1IITA 4F1VA 2RC9A 3MPLA 4F22A 4FEBA 1D4NA 1JVYA 2CMOA 3OELA 2RCBA 5EHSA 5AE4A 3KFMA 4H65A 3VFJA 4FATA 4X1DA 4R75A 1JW4A 2DQVA 1FTJA 1MDQA 2X7PA 3GBBA 3PUWE 3H3GA 3IJXB 4GL8A 3N94A 4LZ7A 4IB2A 3H6VA 1S9TA 1ANFA 4YB7A 4MLQA 5TU0A 3LUYA 3U1OA 5CBSA 5KDTB 5DEXB 2GHBA 1BTJA 5FHNA 2NUVA 1I6QA 1B4ZA 2O1MA 3N5LA 4THIA 4X1BA 5TPAB 5HM4B 3USDA 3S9EA 1A8EA 1IIWA 3RTFB 1B7ZA 4ZZAA 1IUDA 4OTEA 3K6VA 4ZS9A 1B0LA 1LGBC 2XX8A 2HZLA 3SDFA 1M5FA 4I1DA 2IA4A 3B6WA 3MZBA 4R2BA 3Q27A 1ZU0A 2A5TB 2AL5A 2XXRA 3MWBA 1NNTA 1B32A 3A3CA 3H06B 1POY1 1P1UA 3K01A 1MXZA 1Q1KA 1R9QA 2V25A 4ISUA 1BP5A 3ONMA 3SEUA 1D9YA 4IY6A 3PUVE 2I0CA 1NKXA 1MXWA 1URDA 4OENA 4U4XA 1MH4A 2RCAA 3LBSA 4TOZA 4KR5A 5FTIA 3FJMA 1B5HA 3V5AA 1B0HA 2WKYA 1B3HA 4H8JA 3M8UA 3O28A 2AIXA 3MQ9A 2ABHA 4F3SA 4DLDA 1WVJA 1H76A 3G3HA 4POWA 4R9GA 5M2VA 4QFKA 3U8QA 3MVWA 3VVDA 1R1NA 4K3FA 3VXCA 1MQIA 2RC8A 2XD3A 1Y4CA 4LP2B 3C35A 3G3KA 1MY2A 1SW1A 2A5SA 3TAJA 3TCFA 1ZMGA 1MH3A 1Z7NE 1NNPA 4GWOA 5ICTA 3E4RA 2PMSA 2F7BA 2HEUA 2NXOA 1N84A 4GIZA 3CIJA 4GXAA 1KWHA 3UP9A 4EXLA 4F31B 3ECRA 3FZVA 1MRPA 3TTRA 3VLWA 3CSGA 5H8NB 1M5EA 1VFDA 2QSXA 4NF8A 4EDPA 5CBRA 1HSJA 1ZJLA 5EYFA 5CMMA 5AA4A 1A55A 1MY1A 2Y84A 1IQ7A 1H44A 1JQFA 2I48A 2Q89A 4HTGA 1OMPA 4JBZA 3MJNA 1US5A 2Z23A 2PT1A 1AL3A 1I6BA 2P2AA 3CSBA 3H7MA 1JW5A 5CM6A 4ZEFA 3TTLA 5I2NA 1N3XA 4GD5A 4YU0A 3K02A 3R7XA 4GL0A 4AB6A 2M8CA 2O68A 3I5OA 4OEVA 1QUKA 1D9VA 1UIVA 1FQAA 4RY1A 3L6HA 5H8QB 4XKPA 1USYE 4KCCA 3C36A 1PEBA 1RKMA 1MY4A 1MXVA 2HFBA 1OVTA 3G3GA 3O2AA 3BFUA 4NF6B 2FNCA 4IGTA 4O3BA 4OFLA 3OO8A 1YAEA 4PETA 4EF1A 5ICQA 3JV9A 3IR1A 1MQDA 1P1QA 1O63A 2DSFA 4GQOA 3EN3A 4PP0A 1P99A 4JDFA 4E0XA 5I84A 1S50A 1B7UA 3B6QA 1LAXA 3ZKLA 3OOAA 4NEDA 3UA8A 3IOUA 4OWDA 1FW0A 4ZEBA 4YKKA 2R71A 2XHDA 2F34A 5L9MA 3QAXA 4ONYA 5I57B 1TWYA 1Y9UA 4JWOA 1IXHA 1EZ9A 1SD3A 1M5CA 1MQGA 2NOOA 5DVFA 1SI1A 3T9XB 3ODBA 1EH3A 1ZTYA 1LCTA 4EUOA 4HS7A 3T9UA 4G68C 3I6VA 4DXBA 5L9SA 1FTKA 4OQOA 5I57A 4F2QA 1ELJA 2H9BA 2XXYA 3D4CA 3TQLA 4KQPA 3VE1B 4EQ9A 1SYIA 5DVJA 1B46A 1URSA 1LCFA 4G68A 1Y20A 3PUZE 2QS1A 3Q25A 3OENA 3FJGA 3GZGA 4AQ4A 1AIVA 2ONSA 3G3JA 3PU5A 4ZECA 3CVGA 3THIA 1LFGA 1XC1A 4R6HA 2XX7A 3RUMA 1O64A 5B70A 4DXCA 1TFDA 2I3VA 3IB1A 3K1NA 3CR9A 1UIUA 4JSOA 4NF5B 1GR2A 3KN7A 4DCXA 4PFWA 2XXTA 1N04A 4R72A 3EQ1A 4YICA 2Y7RA 4MBPA 2HZKA 4I62A 1Y1ZA 3MP8A 5CI5A 4F3BA 2P1SA 1FQEA 4QSDA 2XXVA 3WAFA 1B58A 3MZ1A 4GF8A 1XVXA 5DVIA 2F7AA 4YZZA 3V83A 1JEUA 1ZIUA 3G7WA 3MP6A 2QS2A 4YKPA 3MVZA 3T93B 2OWTA 4F2OA 5AA2D 4R9FA 4RA1A 5FHOA 1H3DA 3K0VA 3TKDA 2OLBA 3SEVA 3VVEA 3L6GA 4Q8RA 2Z8FA 3IOVA 3DP8A 3FVOA 4MFIA 2G29A 1LFHA 4KD5A 3OO6A 4DZ1A 1N7XA 3RT8A 2F8DA 2QS4A 3RT6B 4ZEDA 3TODA 1LBCA 3EF7A 1ZKBA 3KGCA 3N26A 3A3UA 3SERA 2HCAA 1AMFA 2OK2A 3PPNA 3Q29A 5TP9B 3IK6B 2VP1A 5CMBA 1B3FA 2LAOA 3TTNA 1N7WA 1B6HA 5L9OA 3MC2A 1OQHA 1BLFA 1GTKA 2Y7WA 1F9BA 2GFEA 2I4BA 3IORA 2THIA 1DPEA 3S4UA 4C1UA 2DXRA 4GXSB 2OJTA 3PPRA 5I56A 2O84X 1MG1A 3R6UA 1XVYA 3O97A 4F29A 3K1MA 2ZYOA 5ELVA 1B40A 3W9VA 4EQ7A 2XXPA 2HQ0A 2X7QA 3PD9A 3VVFA 3PPPA 5JK4A 1POTA 1BKAA 1R6ZA 5I2NB 2E0SA 2OWSA 4GRKA 2QRYA 3UIFA 3CFZA 4H1XA 3HCQA 4P0IA 3T22A 4XKNA 4XTCQ 4ELOA 3SESA 1MDP1 2Z8EA 4H0WA 5H8SA 3V89B 5IAIA 3O6IA 4RPOA 3IX1A 2B3BA 3LR1A 4ECFA 4IY5A 2DE2A 2VHAA 3CG3A 3MP1A 3FV2A 4FE8A 4P0GA 4ZEKA 3T66A 1B51A 1N76A 3T9VA 4QFOA 1B3LA 3FASA 5AA1A 3IB2A 3VDFA 1O7TA 3GLBA 1WODA 3FGSA 3JZJA 2DOJA 3OD7A 2DVZA 3TFLA 3PPQA 3HPIA 4LUBA 3T9HB 5I58B 4C1TA 3H6UA 4NF6A 1IXIA 2UYFA 3S2VA 3G3IA 3N6UA 4AB5A 1SW5A 4N07A 2RKMA 3TTKA 1A54A 2VD2A 1OIBA 2XXQA 3TQWA 4POXA 4JXIA 2D21A 3HV1A 2XD2A 1D3KA 4GVOA 1SW4A 1QVSA 2DE4A 2PBWA 3EPEA 3KOSA 3PUYE 1B1XA 1UTHA 2ALUA 2Q88A 3OXNA 1GV8A 4FORA 3RTWB 4FEDA 2ZMBA 4H8IA 4QHQA 4QFLA 4HW8A 1HSEA 4WXJA 2HAUA 2I6EA 2REGA 2RF1A 1MM6A 1LFIA 4Q5TA 2F78A 1A99A 3RY3A 3GXAA 4OERA 5KCJB 3C4MA 5AA4B 2XX9A 3DM0A 4Z0IA 3VXBA 2O7IA 3ZKKA 3A09A 4NF8B 2NWJA 1P1WA 3QSLA 2F7CA 3K6UA 5A5XB 2A5TA 1QULA 2V3UA 4L17A 3IB0A 4F1YA 1H45A 5I59A 5JEIA 1TFAA 3LSXA 2O7UA 4ZE8A 2W7YA 3QXMA 4DE8A 5I59B 4NWDA 1EZOA 3N6TA 4RJZA 5DT6A 3IO4A 4ZE9A 3O6GA 3UGWA 1FTOA 2F36A 4OHNA 4U2RA 4GOTA 4WKMA 1NFTA 4GLIA 1I69A 1M5DA 4NWCA 4O3AA 4NF5A 2CZLA 2QL3A 2UVJA 3D4GA 4H5GA 1NL5A 4M4GA 4PQJA 2ZYNA 1XS5A 2O6AA 1VE4A 3Q28A 3C9HA 3IO6A 4HCYA 3KJTA 4BLAA 4ESXA 2AL4A 4NF4B 3VLVA 2ESNA 4LATA 2H5YA 4BDMA 1QKBA 2Q8JA 1SYHA 1JEVA 1SDXA 4KPTA 2V3QA 1USYH 1IXCA 1CB6A 2HXWA 2ONKE 2Q2AA 4O3CA 4QSCA 3TZAA 1GGGA 3RN8A 1FQCA 2YLNA 3R26A 4LVQA 3ILUB 4LA9A 3W15C 2XXIA 1UQWA 3FXQA 4IO7A 1II5A 2O1LA 1N3WA 2RC7A 1LAFE 1PB9A 3KZGA 1XT8A 4KHZE 4M1VA 4R74A 4X9TA 5CRYA 2DP8A 5TPAA 5CMKA 1AOVA 3O9PA 1DMBA 1HSLA 5K2YA 4F3PA 5HBCA 3CRBA 4P11A 3T96B 4RXLA 3E9XA 1Y3QA 1JNFA 3HN0A 4PFYA 1YPNA 3H03A 3BBRA 3DP6A 2ANJA 3ILTB 3PD8A 3EHSA 1OQGA 1OLCA 4RK9A 3OMBA 2B65A 3B6TA 4QFPA 4BDNA 3TEPA 2UVGA 5JTYB 4XIGQ 3S9LC 3FUZA 4OFJA 4LONB 4G8MA 1ATGA 1Y3PA 3H4ZA 4U23A 3RLFE 1UTHB 4YMAA 3TYHA 2E1SA 4RK2A 4YB6A 2PYYA 5IKBA 1B2HA 3BKIB 3MPKA 3KOTA 4G8HA 4ELQA 3O29A 1XOCA 4LQ2A 3RGYA 2OCUA 3FXRA 2AYSA 4ND9A 3TDJA 1NNFA 1A40A 4H67A 2IEEA 2V3TA 3EHTA 4OETA 3M3FA 4F1UA 5HPQA 3C33A 1A7LA 5DYHA 1Q35A 2YJPA 3FD3A 5EHMA 4MLVA 2UVIA 4F19A 1MXYA 4I8CA 5AA2A 1OLAA 1B1HA 1VSOA 1LAGE 1QJMA 4XKRA 3TMGA 1P1OA 1A8FA 3K2DA 5TP9A 2V93A 1B7HA 1DTZA 4QFNA 4OEUA 4EF2A 4ZEIA 2R6GE 1DSNA 1URGA 2Z22A 4NE4A 2RINA 1LBBA 2UXAA 3C32A 2F6GA 4DIGA 1WDNA 2H25A 3LSLA 2QMWA 3PV0E 2HAVA 4WEPA 5AA3A 1MY3A 1LSTA 3QUJA 2GHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DDD A;  4UA8 A;  1B05 A;  4C0R A;  2GRV A;  5B7D A;  1SBP A;  4IGR A;  2X26 A;  1N0T A;  3CG1 A;  2Y7K A;  4OZ9 A;  4JWX A;  5FHM A;  2FA7 A;  3U72 A;  1NH7 A;  2O69 A;  3DLN A;  4G2Z A;  4XXU A;  5H8H B;  1EU8 A;  5CC2 A;  5BUU A;  1FQF A;  1NNK A;  3LSF B;  1MPC A;  2F5X A;  5JTY A;  3U92 A;  1IEJ A;  1Z7M E;  2F35 A;  3KN3 A;  3K4U A;  2KLF A;  2VOZ A;  1B5I A;  2DE3 A;  2GH9 A;  2ZXT A;  3JYR A;  3LSW A;  3MVY A;  2QPQ A;  3PPO A;  4ELP A;  2PVU A;  3SEY A;  4EQB A;  1MXX A;  2H99 A;  1QW0 A;  2REJ A;  1FCK A;  3E3K A;  3GBA A;  3MAM A;  4N13 A;  3RNN A;  5I58 A;  2P0S A;  3DEL B;  4RYA A;  2ZNT A;  3M3L A;  5A5X A;  4IO5 A;  1JET A;  2DWA A;  2ZNS A;  3K6X A;  3FVK A;  1LAH E;  3KJ7 A;  4LQ5 A;  4X48 A;  1OVB A;  2I58 A;  4KI0 E;  1DOT A;  4F39 A;  3K1P A;  2DXY A;  3CI8 A;  3P7I A;  4RPN A;  1FTM A;  3QUF A;  2Q9T A;  3QK6 A;  4OMB A;  5H8F B;  3HO7 A;  5J1D A;  2QS3 A;  3G3F A;  3S9N C;  3M3K A;  4OYV A;  4UAC A;  4ZDM A;  3EHU A;  1DTG A;  1JVX A;  1B9J A;  3FV1 A;  1SQY A;  2DWI A;  2ZYM A;  4Q30 B;  1GVC A;  3UN6 A;  4G77 A;  1FQB A;  1LB8 A;  3F11 A;  4YB5 A;  2VD3 A;  3KSX A;  3VLU A;  1QUI A;  1YTV A;  5ITO A;  3AXF A;  3H6W A;  4KYE A;  3OSR A;  2H4I A;  2XXU A;  3WAE A;  5ITP A;  3IOW A;  1SVX B;  3CFX A;  3CFL A;  3K00 A;  4FAJ A;  4KFQ A;  5I56 B;  3TUS A;  2Y7I A;  2DVC A;  3KBR A;  4MF3 A;  2I4C A;  3KSJ A;  5F7V A;  3FVG A;  4R6Y A;  2DYX A;  1SW2 A;  3HHF A;  3TPA A;  1T0K A;  3K6W A;  3U94 A;  4BDL A;  3LC8 A;  3H6T A;  3C31 A;  4IO4 A;  4QF9 A;  4E0W A;  1JW1 A;  2F6P A;  1L5T A;  2DWJ A;  5AA2 B;  1MS7 A;  4IO3 A;  1I6A A;  1MQJ A;  1PC3 A;  2I0B A;  4G68 B;  4R2F A;  5CMC A;  5FTH A;  5L8D A;  1S7Y A;  2NVU B;  5H8H A;  3UOR A;  1TXF A;  4XKQ A;  3OO7 A;  3FJ7 A;  3MUQ A;  1J1N A;  3B7D A;  5DTB A;  3VV5 A;  4BDQ A;  4TLM B;  1R9L A;  1B3E A;  3SKP A;  4GFR A;  4KCD A;  3PMV A;  4LZ5 A;  4YKJ A;  3TTM A;  2UYE A;  1B4H A;  4U21 A;  4BDO A;  4F18 A;  4QSE A;  1PBQ A;  2OZZ A;  5K2X A;  4BDR A;  1B52 A;  2PT2 A;  1H43 A;  1QKA A;  3FXU A;  3PMW A;  1XHY A;  3MBP A;  1Y3N A;  4QRZ A;  1PBP A;  4U22 A;  5H8F A;  3QIM A;  2ZNU A;  2OBG A;  4JWY A;  3IOT A;  5F1Q A;  2D3I A;  3C34 A;  1P1N A;  3I3V A;  4HCW A;  1PDA A;  3PMX A;  2ONR A;  4JB7 A;  2H98 A;  3KEI A;  5LOM A;  4F3G A;  3UK4 A;  1ZBM A;  5DEX A;  4U1Z A;  3S9M C;  1M5B A;  1DPP A;  2F97 A;  3MZ9 A;  2ZYK A;  4YAH X;  3IAZ A;  4TQU Q;  4OVJ A;  4G4P A;  3RQT A;  4PFU A;  3SEX A;  1ZLQ A;  5KZT A;  4IO2 A;  3U93 A;  1CE2 A;  4IO6 A;  1QUJ A;  1FQD A;  4G8N A;  4OFO A;  1RYX A;  3OO9 A;  1IZ1 A;  1RYO A;  3OSQ A;  3OEK A;  4KYD A;  1US4 A;  2QMX A;  3FAT A;  2Y7P A;  4TLL B;  4EXK A;  1LLS A;  2VGQ A;  4NTL A;  5ISU A;  2UVH A;  3Q26 A;  4PFT A;  2XXH A;  2BJJ X;  4NF4 A;  5BWJ A;  3OEM A;  4R73 A;  4FIM A;  4U1O A;  4FJP A;  2D5W A;  2I49 A;  2PX1 A;  3BFT A;  1MM7 A;  2YPN A;  3HHG A;  2I3W A;  4MH5 A;  4R6K A;  4RNS A;  1FTL A;  4DCY A;  2XXW A;  4ESW A;  2R9J A;  3MVX A;  3RPW A;  1UTB A;  2DS9 A;  5H8N A;  4I9D A;  5I2K A;  2XXX A;  3DP4 A;  4Q0C A;  1MQH A;  2O51 A;  1PB8 A;  3KG2 A;  4H5F A;  4N6P A;  3V8X B;  3W9W A;  2DWH A;  3KN8 A;  4OES A;  1NH8 A;  2V84 A;  1MPD A;  2B3F A;  3QYT A;  1EZP A;  1MY0 A;  2Z8D A;  1AH5 A;  1NMU A;  4Z7E A;  3HST A;  4NMY A;  3E13 X;  3TEL A;  1YCJ A;  4WED A;  3TCG A;  3SET A;  1LB9 A;  1MPB A;  2QJE A;  3MW0 A;  4PE5 B;  3SEW A;  4ELR A;  5KDT A;  1UTB B;  4JSD A;  5I2K B;  1VR5 A;  1SI0 A;  4ZZE A;  3PGF A;  5KCJ A;  4U4S A;  3ZSF A;  3IJO B;  1Y1M A;  1IXG A;  3O66 A;  1TT1 A;  4DXU A;  1VFE A;  2G93 A;  4H6D A;  3ZS6 A;  2FYI A;  4OXV A;  5H8Q A;  4FEC A;  1B5J A;  1PB7 A;  3FIR A;  3IL1 B;  3PUX E;  4YMB A;  1BIY A;  1MXU A;  1Y4T A;  1B3G A;  3O6H A;  4LZ8 A;  4KYS A;  4YKI A;  2Q2C A;  3FVN A;  3TCH A;  1IIT A;  4F1V A;  2RC9 A;  3MPL A;  4F22 A;  4FEB A;  1D4N A;  1JVY A;  2CMO A;  3OEL A;  2RCB A;  5EHS A;  5AE4 A;  3KFM A;  4H65 A;  3VFJ A;  4FAT A;  4X1D A;  4R75 A;  1JW4 A;  2DQV A;  1FTJ A;  1MDQ A;  2X7P A;  3GBB A;  3PUW E;  3H3G A;  3IJX B;  4GL8 A;  3N94 A;  4LZ7 A;  4IB2 A;  3H6V A;  1S9T A;  1ANF A;  4YB7 A;  4MLQ A;  5TU0 A;  3LUY A;  3U1O A;  5CBS A;  5KDT B;  5DEX B;  2GHB A;  1BTJ A;  5FHN A;  2NUV A;  1I6Q A;  1B4Z A;  2O1M A;  3N5L A;  4THI A;  4X1B A;  5TPA B;  5HM4 B;  3USD A;  3S9E A;  1A8E A;  1IIW A;  3RTF B;  1B7Z A;  4ZZA A;  1IUD A;  4OTE A;  3K6V A;  4ZS9 A;  1B0L A;  1LGB C;  2XX8 A;  2HZL A;  3SDF A;  1M5F A;  4I1D A;  2IA4 A;  3B6W A;  3MZB A;  4R2B A;  3Q27 A;  1ZU0 A;  2A5T B;  2AL5 A;  2XXR A;  3MWB A;  1NNT A;  1B32 A;  3A3C A;  3H06 B;  1POY 1;  1P1U A;  3K01 A;  1MXZ A;  1Q1K A;  1R9Q A;  2V25 A;  4ISU A;  1BP5 A;  3ONM A;  3SEU A;  1D9Y A;  4IY6 A;  3PUV E;  2I0C A;  1NKX A;  1MXW A;  1URD A;  4OEN A;  4U4X A;  1MH4 A;  2RCA A;  3LBS A;  4TOZ A;  4KR5 A;  5FTI A;  3FJM A;  1B5H A;  3V5A A;  1B0H A;  2WKY A;  1B3H A;  4H8J A;  3M8U A;  3O28 A;  2AIX A;  3MQ9 A;  2ABH A;  4F3S A;  4DLD A;  1WVJ A;  1H76 A;  3G3H A;  4POW A;  4R9G A;  5M2V A;  4QFK A;  3U8Q A;  3MVW A;  3VVD A;  1R1N A;  4K3F A;  3VXC A;  1MQI A;  2RC8 A;  2XD3 A;  1Y4C A;  4LP2 B;  3C35 A;  3G3K A;  1MY2 A;  1SW1 A;  2A5S A;  3TAJ A;  3TCF A;  1ZMG A;  1MH3 A;  1Z7N E;  1NNP A;  4GWO A;  5ICT A;  3E4R A;  2PMS A;  2F7B A;  2HEU A;  2NXO A;  1N84 A;  4GIZ A;  3CIJ A;  4GXA A;  1KWH A;  3UP9 A;  4EXL A;  4F31 B;  3ECR A;  3FZV A;  1MRP A;  3TTR A;  3VLW A;  3CSG A;  5H8N B;  1M5E A;  1VFD A;  2QSX A;  4NF8 A;  4EDP A;  5CBR A;  1HSJ A;  1ZJL A;  5EYF A;  5CMM A;  5AA4 A;  1A55 A;  1MY1 A;  2Y84 A;  1IQ7 A;  1H44 A;  1JQF A;  2I48 A;  2Q89 A;  4HTG A;  1OMP A;  4JBZ A;  3MJN A;  1US5 A;  2Z23 A;  2PT1 A;  1AL3 A;  1I6B A;  2P2A A;  3CSB A;  3H7M A;  1JW5 A;  5CM6 A;  4ZEF A;  3TTL A;  5I2N A;  1N3X A;  4GD5 A;  4YU0 A;  3K02 A;  3R7X A;  4GL0 A;  4AB6 A;  2M8C A;  2O68 A;  3I5O A;  4OEV A;  1QUK A;  1D9V A;  1UIV A;  1FQA A;  4RY1 A;  3L6H A;  5H8Q B;  4XKP A;  1USY E;  4KCC A;  3C36 A;  1PEB A;  1RKM A;  1MY4 A;  1MXV A;  2HFB A;  1OVT A;  3G3G A;  3O2A A;  3BFU A;  4NF6 B;  2FNC A;  4IGT A;  4O3B A;  4OFL A;  3OO8 A;  1YAE A;  4PET A;  4EF1 A;  5ICQ A;  3JV9 A;  3IR1 A;  1MQD A;  1P1Q A;  1O63 A;  2DSF A;  4GQO A;  3EN3 A;  4PP0 A;  1P99 A;  4JDF A;  4E0X A;  5I84 A;  1S50 A;  1B7U A;  3B6Q A;  1LAX A;  3ZKL A;  3OOA A;  4NED A;  3UA8 A;  3IOU A;  4OWD A;  1FW0 A;  4ZEB A;  4YKK A;  2R71 A;  2XHD A;  2F34 A;  5L9M A;  3QAX A;  4ONY A;  5I57 B;  1TWY A;  1Y9U A;  4JWO A;  1IXH A;  1EZ9 A;  1SD3 A;  1M5C A;  1MQG A;  2NOO A;  5DVF A;  1SI1 A;  3T9X B;  3ODB A;  1EH3 A;  1ZTY A;  1LCT A;  4EUO A;  4HS7 A;  3T9U A;  4G68 C;  3I6V A;  4DXB A;  5L9S A;  1FTK A;  4OQO A;  5I57 A;  4F2Q A;  1ELJ A;  2H9B A;  2XXY A;  3D4C A;  3TQL A;  4KQP A;  3VE1 B;  4EQ9 A;  1SYI A;  5DVJ A;  1B46 A;  1URS A;  1LCF A;  4G68 A;  1Y20 A;  3PUZ E;  2QS1 A;  3Q25 A;  3OEN A;  3FJG A;  3GZG A;  4AQ4 A;  1AIV A;  2ONS A;  3G3J A;  3PU5 A;  4ZEC A;  3CVG A;  3THI A;  1LFG A;  1XC1 A;  4R6H A;  2XX7 A;  3RUM A;  1O64 A;  5B70 A;  4DXC A;  1TFD A;  2I3V A;  3IB1 A;  3K1N A;  3CR9 A;  1UIU A;  4JSO A;  4NF5 B;  1GR2 A;  3KN7 A;  4DCX A;  4PFW A;  2XXT A;  1N04 A;  4R72 A;  3EQ1 A;  4YIC A;  2Y7R A;  4MBP A;  2HZK A;  4I62 A;  1Y1Z A;  3MP8 A;  5CI5 A;  4F3B A;  2P1S A;  1FQE A;  4QSD A;  2XXV A;  3WAF A;  1B58 A;  3MZ1 A;  4GF8 A;  1XVX A;  5DVI A;  2F7A A;  4YZZ A;  3V83 A;  1JEU A;  1ZIU A;  3G7W A;  3MP6 A;  2QS2 A;  4YKP A;  3MVZ A;  3T93 B;  2OWT A;  4F2O A;  5AA2 D;  4R9F A;  4RA1 A;  5FHO A;  1H3D A;  3K0V A;  3TKD A;  2OLB A;  3SEV A;  3VVE A;  3L6G A;  4Q8R A;  2Z8F A;  3IOV A;  3DP8 A;  3FVO A;  4MFI A;  2G29 A;  1LFH A;  4KD5 A;  3OO6 A;  4DZ1 A;  1N7X A;  3RT8 A;  2F8D A;  2QS4 A;  3RT6 B;  4ZED A;  3TOD A;  1LBC A;  3EF7 A;  1ZKB A;  3KGC A;  3N26 A;  3A3U A;  3SER A;  2HCA A;  1AMF A;  2OK2 A;  3PPN A;  3Q29 A;  5TP9 B;  3IK6 B;  2VP1 A;  5CMB A;  1B3F A;  2LAO A;  3TTN A;  1N7W A;  1B6H A;  5L9O A;  3MC2 A;  1OQH A;  1BLF A;  1GTK A;  2Y7W A;  1F9B A;  2GFE A;  2I4B A;  3IOR A;  2THI A;  1DPE A;  3S4U A;  4C1U A;  2DXR A;  4GXS B;  2OJT A;  3PPR A;  5I56 A;  2O84 X;  1MG1 A;  3R6U A;  1XVY A;  3O97 A;  4F29 A;  3K1M A;  2ZYO A;  5ELV A;  1B40 A;  3W9V A;  4EQ7 A;  2XXP A;  2HQ0 A;  2X7Q A;  3PD9 A;  3VVF A;  3PPP A;  5JK4 A;  1POT A;  1BKA A;  1R6Z A;  5I2N B;  2E0S A;  2OWS A;  4GRK A;  2QRY A;  3UIF A;  3CFZ A;  4H1X A;  3HCQ A;  4P0I A;  3T22 A;  4XKN A;  4XTC Q;  4ELO A;  3SES A;  1MDP 1;  2Z8E A;  4H0W A;  5H8S A;  3V89 B;  5IAI A;  3O6I A;  4RPO A;  3IX1 A;  2B3B A;  3LR1 A;  4ECF A;  4IY5 A;  2DE2 A;  2VHA A;  3CG3 A;  3MP1 A;  3FV2 A;  4FE8 A;  4P0G A;  4ZEK A;  3T66 A;  1B51 A;  1N76 A;  3T9V A;  4QFO A;  1B3L A;  3FAS A;  5AA1 A;  3IB2 A;  3VDF A;  1O7T A;  3GLB A;  1WOD A;  3FGS A;  3JZJ A;  2DOJ A;  3OD7 A;  2DVZ A;  3TFL A;  3PPQ A;  3HPI A;  4LUB A;  3T9H B;  5I58 B;  4C1T A;  3H6U A;  4NF6 A;  1IXI A;  2UYF A;  3S2V A;  3G3I A;  3N6U A;  4AB5 A;  1SW5 A;  4N07 A;  2RKM A;  3TTK A;  1A54 A;  2VD2 A;  1OIB A;  2XXQ A;  3TQW A;  4POX A;  4JXI A;  2D21 A;  3HV1 A;  2XD2 A;  1D3K A;  4GVO A;  1SW4 A;  1QVS A;  2DE4 A;  2PBW A;  3EPE A;  3KOS A;  3PUY E;  1B1X A;  1UTH A;  2ALU A;  2Q88 A;  3OXN A;  1GV8 A;  4FOR A;  3RTW B;  4FED A;  2ZMB A;  4H8I A;  4QHQ A;  4QFL A;  4HW8 A;  1HSE A;  4WXJ A;  2HAU A;  2I6E A;  2REG A;  2RF1 A;  1MM6 A;  1LFI A;  4Q5T A;  2F78 A;  1A99 A;  3RY3 A;  3GXA A;  4OER A;  5KCJ B;  3C4M A;  5AA4 B;  2XX9 A;  3DM0 A;  4Z0I A;  3VXB A;  2O7I A;  3ZKK A;  3A09 A;  4NF8 B;  2NWJ A;  1P1W A;  3QSL A;  2F7C A;  3K6U A;  5A5X B;  2A5T A;  1QUL A;  2V3U A;  4L17 A;  3IB0 A;  4F1Y A;  1H45 A;  5I59 A;  5JEI A;  1TFA A;  3LSX A;  2O7U A;  4ZE8 A;  2W7Y A;  3QXM A;  4DE8 A;  5I59 B;  4NWD A;  1EZO A;  3N6T A;  4RJZ A;  5DT6 A;  3IO4 A;  4ZE9 A;  3O6G A;  3UGW A;  1FTO A;  2F36 A;  4OHN A;  4U2R A;  4GOT A;  4WKM A;  1NFT A;  4GLI A;  1I69 A;  1M5D A;  4NWC A;  4O3A A;  4NF5 A;  2CZL A;  2QL3 A;  2UVJ A;  3D4G A;  4H5G A;  1NL5 A;  4M4G A;  4PQJ A;  2ZYN A;  1XS5 A;  2O6A A;  1VE4 A;  3Q28 A;  3C9H A;  3IO6 A;  4HCY A;  3KJT A;  4BLA A;  4ESX A;  2AL4 A;  4NF4 B;  3VLV A;  2ESN A;  4LAT A;  2H5Y A;  4BDM A;  1QKB A;  2Q8J A;  1SYH A;  1JEV A;  1SDX A;  4KPT A;  2V3Q A;  1USY H;  1IXC A;  1CB6 A;  2HXW A;  2ONK E;  2Q2A A;  4O3C A;  4QSC A;  3TZA A;  1GGG A;  3RN8 A;  1FQC A;  2YLN A;  3R26 A;  4LVQ A;  3ILU B;  4LA9 A;  3W15 C;  2XXI A;  1UQW A;  3FXQ A;  4IO7 A;  1II5 A;  2O1L A;  1N3W A;  2RC7 A;  1LAF E;  1PB9 A;  3KZG A;  1XT8 A;  4KHZ E;  4M1V A;  4R74 A;  4X9T A;  5CRY A;  2DP8 A;  5TPA A;  5CMK A;  1AOV A;  3O9P A;  1DMB A;  1HSL A;  5K2Y A;  4F3P A;  5HBC A;  3CRB A;  4P11 A;  3T96 B;  4RXL A;  3E9X A;  1Y3Q A;  1JNF A;  3HN0 A;  4PFY A;  1YPN A;  3H03 A;  3BBR A;  3DP6 A;  2ANJ A;  3ILT B;  3PD8 A;  3EHS A;  1OQG A;  1OLC A;  4RK9 A;  3OMB A;  2B65 A;  3B6T A;  4QFP A;  4BDN A;  3TEP A;  2UVG A;  5JTY B;  4XIG Q;  3S9L C;  3FUZ A;  4OFJ A;  4LON B;  4G8M A;  1ATG A;  1Y3P A;  3H4Z A;  4U23 A;  3RLF E;  1UTH B;  4YMA A;  3TYH A;  2E1S A;  4RK2 A;  4YB6 A;  2PYY A;  5IKB A;  1B2H A;  3BKI B;  3MPK A;  3KOT A;  4G8H A;  4ELQ A;  3O29 A;  1XOC A;  4LQ2 A;  3RGY A;  2OCU A;  3FXR A;  2AYS A;  4ND9 A;  3TDJ A;  1NNF A;  1A40 A;  4H67 A;  2IEE A;  2V3T A;  3EHT A;  4OET A;  3M3F A;  4F1U A;  5HPQ A;  3C33 A;  1A7L A;  5DYH A;  1Q35 A;  2YJP A;  3FD3 A;  5EHM A;  4MLV A;  2UVI A;  4F19 A;  1MXY A;  4I8C A;  5AA2 A;  1OLA A;  1B1H A;  1VSO A;  1LAG E;  1QJM A;  4XKR A;  3TMG A;  1P1O A;  1A8F A;  3K2D A;  5TP9 A;  2V93 A;  1B7H A;  1DTZ A;  4QFN A;  4OEU A;  4EF2 A;  4ZEI A;  2R6G E;  1DSN A;  1URG A;  2Z22 A;  4NE4 A;  2RIN A;  1LBB A;  2UXA A;  3C32 A;  2F6G A;  4DIG A;  1WDN A;  2H25 A;  3LSL A;  2QMW A;  3PV0 E;  2HAV A;  4WEP A;  5AA3 A;  1MY3 A;  1LST A;  3QUJ A;  2GHA A; 
#chains in the Genus database with same CATH topology
 2Y7K A;  4OZ9 A;  2FA7 A;  3U72 A;  1YZ0 A;  1NH7 A;  2O69 A;  5H8H B;  1FQF A;  4KXP A;  2F5X A;  4P47 A;  3KN3 A;  3K4U A;  4JVD A;  3PPO A;  2ZXT A;  3JYR A;  1MXX A;  2VT5 A;  2V4C A;  3M3L A;  4GX4 A;  2DWA A;  3K6X A;  5JTY B;  4F39 A;  2DXY A;  2QS3 A;  3M3K A;  4OYV A;  3EHU A;  1JVX A;  3FV1 A;  4Q30 B;  4X04 A;  1FQB A;  4YB5 A;  3VLU A;  1YTV A;  3H6W A;  4N6D A;  4PDD A;  3WAE A;  5ITP A;  3TUS A;  2DVC A;  5F7V A;  3LC8 A;  3H6T A;  2F6P A;  5AA2 B;  4IO3 A;  5CMC A;  4I3Y A;  3FJ7 A;  1FBF A;  1KA1 A;  3PMV A;  3TTM A;  2UYE A;  4AS5 A;  1NV4 A;  1B52 A;  2PT2 A;  3FXU A;  1XHY A;  4U22 A;  1P1N A;  4HCW A;  1IME A;  3MZ9 A;  3IAZ A;  1CE2 A;  1RYX A;  3OO9 A;  1RYO A;  3A29 A;  3OSQ A;  2QMX A;  4EXK A;  1LLS A;  4NF4 A;  4FIM A;  2I3W A;  3MVX A;  4GWZ A;  4I9D A;  2O51 A;  4H5F A;  1PB8 A;  3KG2 A;  3W9W A;  3KN8 A;  4OES A;  1MPD A;  3HST A;  3E13 X;  2ZZV A;  2QJE A;  4ELR A;  4JSD A;  4U4S A;  2P3V A;  1Y1M A;  1IXG A;  4H6D A;  4OXV A;  3EKI A;  5H8Q A;  4FEC A;  4YMB A;  3PUX E;  3IL1 B;  4GBV A;  1BIY A;  4KYS A;  4F1V A;  3MPL A;  1D4N A;  4G61 A;  4P1L A;  3OEL A;  1RDY A;  5AE4 A;  4X1D A;  3BIH A;  4PAK A;  4NF5 B;  3H6V A;  3MST A;  4MLQ A;  2GHB A;  5FHN A;  2FHY A;  1B4Z A;  4X1B A;  3N5L A;  1FPK A;  3RTF B;  2XX8 A;  3B6W A;  5BWJ A;  3Q27 A;  2XXR A;  1MXZ A;  2V25 A;  4ISU A;  1D9Y A;  4P3L A;  1NKX A;  1MXW A;  5FTI A;  4KR5 A;  3FJM A;  3V5A A;  2WKY A;  1B3H A;  2Y5K A;  4I3E A;  2ABH A;  4DLD A;  3G3H A;  1H76 A;  4POW A;  3E78 A;  4QFK A;  4FBP A;  3VXC A;  1Y4C A;  3TAJ A;  1NNP A;  3UP9 A;  3ECR A;  3FZV A;  5CBR A;  5EYF A;  5CMM A;  1IQ7 A;  1JQF A;  1OMP A;  1US5 A;  2Z23 A;  3TTL A;  1UIV A;  1FQA A;  3IFC A;  3RT8 A;  4PFR A;  3T96 B;  4IGT A;  4MHF A;  1YAE A;  5I7I A;  3IR1 A;  1P1Q A;  3EN3 A;  1LAX A;  2XHD A;  2F34 A;  5L9M A;  4P1E A;  5I57 B;  1TWY A;  4JWO A;  2NOO A;  1M5C A;  2WBB A;  5DVF A;  5EQ7 A;  1EH3 A;  3I6V A;  3TQL A;  4KQP A;  1FBH A;  1SYI A;  1B46 A;  1LCF A;  1Y20 A;  3OEN A;  3FJG A;  3GZG A;  4AQ4 A;  4GWS A;  3PU5 A;  3NOH A;  1NUW A;  3RUM A;  1O64 A;  2I3V A;  4JSO A;  3EQ1 A;  4I62 A;  1Y1Z A;  2HXR A;  4XF5 A;  4O94 A;  1B58 A;  4GF8 A;  1XVX A;  2F7A A;  1JEU A;  2QS2 A;  4KD5 A;  3OO6 A;  4DZ1 A;  1N7X A;  2F8D A;  3KGC A;  2LAO A;  5L9O A;  2R8T A;  4NX1 A;  2I4B A;  3PPR A;  3T1B A;  4F29 A;  1XVY A;  2XA5 A;  2E0S A;  2QRY A;  3T22 A;  4XTC Q;  4ELO A;  1G0H A;  3V89 B;  3IX1 A;  1EYI A;  3KC1 A;  4IY5 A;  3T66 A;  1B51 A;  3FAS A;  5AA1 A;  3VDF A;  3FGS A;  2DOJ A;  2DVZ A;  3PPQ A;  2UYF A;  3N6U A;  4AB5 A;  2RKM A;  2VD2 A;  4HXV A;  4POX A;  4JXI A;  2D21 A;  4GVO A;  2DE4 A;  3PUY E;  1UTH A;  2ALU A;  2Q88 A;  4H8I A;  4QHQ A;  4QFL A;  5F24 A;  4WXJ A;  2HAU A;  2REG A;  1A99 A;  3GXA A;  5KCJ B;  3DM0 A;  1INP A;  3ZKK A;  4NF8 B;  1P1W A;  2F7C A;  3K6U A;  5A5X B;  3IB0 A;  5I59 A;  4DE8 A;  4NWD A;  5DT6 A;  3UGW A;  4OHN A;  2F36 A;  4GLI A;  4NF5 A;  2QL3 A;  4M4G A;  2O6A A;  2Q8M A;  4HCY A;  4ESX A;  4NF4 B;  2ESN A;  4MEV A;  2JJK A;  1QKB A;  1SYH A;  1JEV A;  1SDX A;  4MNI A;  1D9Q A;  1USY H;  2HXW A;  4O3C A;  5ET8 A;  2XXI A;  1UQW A;  3FXQ A;  2O1L A;  2RC7 A;  5CRY A;  1PB9 A;  2WYK A;  1XT8 A;  2DP8 A;  1HSL A;  4RXL A;  5IZ3 B;  4PFY A;  1FPI A;  3H03 A;  3EHS A;  1OLC A;  2B65 A;  4HE0 A;  2UVG A;  1FJ9 A;  1Y3P A;  3H4Z A;  4U23 A;  1UTH B;  2E1S A;  4RK2 A;  4YB6 A;  1B2H A;  4G8H A;  2OCU A;  3TDJ A;  3GYY A;  4H67 A;  3M3F A;  4F1U A;  3C33 A;  1A7L A;  3FD3 A;  5AA2 A;  5EQ8 A;  1A8F A;  4EF2 A;  4ZEI A;  4ZE8 A;  2UXA A;  2F6G A;  2H25 A;  1BK4 A;  4OA4 A;  4DI3 D;  2FIX A;  4WEP A;  1LEV A;  4DDD A;  4UA8 A;  2GRV A;  5B7D A;  4G2Z A;  4XXU A;  5BUU A;  1IEJ A;  1B5I A;  2DE3 A;  3MVY A;  4ELP A;  1QW0 A;  3GBA A;  1FCK A;  2ZNT A;  4IO5 A;  2ZNS A;  4LQ5 A;  4X48 A;  2I58 A;  2CEX A;  1FTM A;  2Q9T A;  3QK6 A;  4OMB A;  5H8F B;  3HO7 A;  3CHG A;  3RYD A;  4UAC A;  1SQY A;  3UN6 A;  2ZYM A;  1LB8 A;  2VD3 A;  3KSX A;  3AXF A;  3K00 A;  4FAJ A;  2Y7I A;  4MF3 A;  2I4C A;  3KSJ A;  3FVG A;  3TPA A;  3U94 A;  4QF9 A;  4IO4 A;  1JW1 A;  3T0J A;  2DWJ A;  1QGX A;  1I6A A;  1MQJ A;  2I0B A;  4G68 B;  3UOR A;  2Q74 A;  5H8H A;  4GX3 A;  3VV5 A;  4BDQ A;  4AS4 A;  4PAF A;  2OZZ A;  5K2X A;  1QKA A;  4QRZ A;  1PBP A;  3QIM A;  2ZNU A;  4JWY A;  3IOT A;  3I3V A;  1PDA A;  2ONR A;  4F3G A;  3UK4 A;  1DPP A;  1NUY A;  4G4P A;  3RQT A;  5KZT A;  3U93 A;  4IO6 A;  1KZ8 A;  2Y7P A;  1YXI A;  3OEM A;  4R73 A;  4FJP A;  2D5W A;  1MM7 A;  3HHG A;  4MH5 A;  1JP4 A;  4ESW A;  3RPW A;  2DS9 A;  2XXX A;  3DP4 A;  4P8B A;  4N6P A;  4PFB A;  1NH8 A;  1NV0 A;  2V84 A;  3QYT A;  1EZP A;  1MY0 A;  4Z7E A;  4WED A;  5KCJ A;  3PTY A;  4GX6 A;  1TT1 A;  4DXU A;  2FYI A;  1B5J A;  1PB7 A;  3TCH A;  2Q2C A;  4FEB A;  2B4M A;  2RCB A;  3VFJ A;  4FAT A;  1MDQ A;  4ZS9 A;  3N94 A;  4PF8 A;  1S9T A;  2BJI A;  5TU0 A;  3U1O A;  5CBS A;  3LUY A;  5DEX B;  2NUV A;  2VPN A;  4THI A;  3USD A;  1A8E A;  1IUD A;  3MZB A;  4R2B A;  4OWD A;  1ZU0 A;  3MWB A;  1NNT A;  3A3C A;  3H06 B;  1P1U A;  3ONM A;  4PCD A;  1MH4 A;  1NV1 A;  1B5H A;  1B0H A;  4H8J A;  3O28 A;  2AIX A;  3MQ9 A;  4F3S A;  1LBZ A;  4IR8 A;  4K3F A;  1FSA A;  1SW1 A;  2A5S A;  1ZMG A;  4GWO A;  5ICT A;  3E4R A;  4O8M A;  4NQ8 A;  4GXA A;  2NXO A;  4EXL A;  4F31 B;  3TTR A;  1MRP A;  3VLW A;  2QSX A;  1HSJ A;  5AA4 A;  1A55 A;  1MY1 A;  3U65 A;  3MJN A;  1AL3 A;  1I6B A;  2P2A A;  4ZEF A;  5I2N A;  5LDZ A;  1N3X A;  3R7X A;  4YU0 A;  3K02 A;  2O68 A;  1QUK A;  3L6H A;  5H8Q B;  5IZ1 A;  1RKM A;  1MY4 A;  3G3G A;  1OVT A;  3O2A A;  3BFU A;  4OFL A;  5ICQ A;  4N81 A;  1MQD A;  2DSF A;  4PP0 A;  1P99 A;  5I84 A;  1B7U A;  3B6Q A;  3OOA A;  3IOU A;  1FTA A;  1FW0 A;  4ZEB A;  3QAX A;  3T9X B;  1MQG A;  3ODB A;  2CZH A;  4EUO A;  1FTK A;  5I57 A;  1ELJ A;  4EQ9 A;  3VE1 B;  5DVJ A;  4G68 A;  2QS1 A;  3Q25 A;  3G3J A;  4PAI A;  1XC1 A;  5B70 A;  3CR9 A;  4PFW A;  4YIC A;  4F3B A;  1K9Z A;  4OVS A;  1H3D A;  3K0V A;  2Z8F A;  5EYH A;  1LFH A;  4MFI A;  2G29 A;  3RT6 B;  3A3U A;  3SER A;  3IK6 B;  2VP1 A;  1DCU A;  1B6H A;  3MC2 A;  1OQH A;  2GFE A;  3S4U A;  4N8Y A;  4MNP A;  2HHM A;  2OJT A;  5IGA A;  2ZYO A;  4EQ7 A;  1B40 A;  5JK4 A;  2HQ0 A;  2X7Q A;  3VVF A;  3PPP A;  1POT A;  3UIF A;  3CFZ A;  2L5V A;  3SES A;  1KA0 A;  4H0W A;  3O6I A;  2VHA A;  3CG3 A;  4P0G A;  1FPD A;  3FV2 A;  1N76 A;  4QFO A;  2ZZX A;  1O7T A;  1RDZ A;  3H6U A;  3S2V A;  1SW5 A;  3TTK A;  2XXQ A;  1D3K A;  1DK4 A;  1QVS A;  1FBD A;  4FOR A;  2F3D A;  2ZMB A;  2RF1 A;  1LBY A;  2HPG A;  4OER A;  3C4M A;  5AA4 B;  2XX9 A;  1QUL A;  5JEI A;  1TFA A;  3LSX A;  3SZP A;  5I59 B;  2WEF A;  3RPL B;  4ZE9 A;  2QFL A;  3O6G A;  4WKM A;  1NFT A;  2UVJ A;  5K2Y A;  5IZZ A;  1XS5 A;  1FBP A;  1VE4 A;  3C9H A;  3VLV A;  2H5Y A;  4BDM A;  2Q8J A;  3TZA A;  1IXC A;  1CB6 A;  2ONK E;  2Q2A A;  1GGG A;  1FQC A;  3ILU B;  4M1V A;  1FPB A;  2KQZ A;  4F3P A;  5FBP A;  1Y3Q A;  1YPN A;  3PD8 A;  3BBR A;  3DP6 A;  4RK9 A;  4LON B;  3RLF E;  4LN5 A;  3TYH A;  2PYY A;  2WYP A;  3BKI B;  4ELQ A;  3O29 A;  4GWU A;  3FXR A;  1NNF A;  4OET A;  4GWY A;  3E79 A;  5EHM A;  4MLV A;  1MXY A;  4I8C A;  4GWW A;  1VSO A;  1B1H A;  1LAG E;  1QJM A;  3TMG A;  4P9K A;  1URG A;  4DIG A;  3C32 A;  4N17 A;  1IMA A;  2HAV A;  5I5P A;  1SBP A;  4IGR A;  2X26 A;  3CG1 A;  5FHM A;  4JWX A;  1FBE A;  5CC2 A;  1NNK A;  3LSF B;  1MPC A;  5JTY A;  4O7I A;  1Z7M E;  2QPQ A;  2PVU A;  3SEY A;  4NAP A;  2H99 A;  2REJ A;  3E3K A;  3MAM A;  3RNN A;  5I58 A;  3DEL B;  1NV3 A;  1JET A;  3KJ7 A;  3FVK A;  1LAH E;  4KI0 E;  1DOT A;  3K1P A;  3CI8 A;  3QUF A;  1IMD A;  3G3F A;  5I3S A;  1GVC A;  3F11 A;  5ITO A;  4N8G A;  2H4I A;  2XXU A;  3IOW A;  3CFX A;  5I56 B;  3KBR A;  4R6Y A;  2DYX A;  1SW2 A;  3HHF A;  1FBG A;  3K6W A;  4BDL A;  3C31 A;  4PDH A;  4R2F A;  5FTH A;  1TXF A;  4XKQ A;  3OO7 A;  3HFU A;  1J1N A;  3B7D A;  4MX6 A;  1VDW A;  4GFR A;  1B4H A;  1PBQ A;  4BDR A;  3PMW A;  1H43 A;  3MBP A;  1Y3N A;  3B8B A;  1EYK A;  3C34 A;  4JB7 A;  5EYG A;  3KEI A;  1M5B A;  5DW8 A;  4P56 A;  4PFU A;  4OVP A;  1FQD A;  4OFO A;  1IZ1 A;  4KYD A;  4NTL A;  2VGQ A;  5ISU A;  3Q26 A;  2XXH A;  2BJJ X;  4NGU A;  4U1O A;  2I49 A;  2PX1 A;  4RNS A;  1YYZ A;  2XXW A;  1UTB A;  5I2K A;  5ET7 A;  3V8X B;  1NV2 A;  2B3F A;  1K9Y A;  1NMU A;  2Z8D A;  4NMY A;  3TEL A;  3IFA A;  3SET A;  1LB9 A;  4PE5 B;  3SEW A;  1UTB B;  5I2K B;  2FBP A;  1VR5 A;  2QVV A;  3ZSF A;  3IJO B;  3O66 A;  2G93 A;  1AWB A;  1MXU A;  1B3G A;  4YKI A;  4N15 A;  3FVN A;  4NG7 A;  1IIT A;  2RC9 A;  4F22 A;  1JVY A;  2WX9 A;  5EHS A;  2CEY A;  1JW4 A;  2DQV A;  2X7P A;  3GBB A;  4GL8 A;  5ET5 A;  3IJX B;  5A5L A;  4IB2 A;  4YB7 A;  5IZ3 A;  1BTJ A;  1I6Q A;  3RPL A;  2O1M A;  1IIW A;  3K6V A;  1B0L A;  4MCO A;  3SDF A;  4F18 A;  1M5F A;  2IA4 A;  5EQA A;  5HM4 B;  2AL5 A;  2A5T B;  1B32 A;  1Q1K A;  1R9Q A;  3BIG A;  3SEU A;  3PUV E;  4PF6 A;  4PGN A;  2RCA A;  4TOZ A;  3M8U A;  4R9G A;  3U8Q A;  3MVW A;  4LP2 B;  3G3K A;  1MY2 A;  1NV7 A;  3TCF A;  1MH3 A;  1Z7N E;  2PMS A;  2HEU A;  3CIJ A;  3CSG A;  5H8N B;  1M5E A;  2Y84 A;  1H44 A;  2I48 A;  2Q89 A;  3KBZ A;  4JVC A;  3H7M A;  1JW5 A;  2PCR A;  2OX3 A;  4GD5 A;  4GL0 A;  4AB6 A;  2M8C A;  4OEV A;  1D9V A;  2HFB A;  4ZDM A;  4O3B A;  4EF1 A;  2FNC A;  3OO8 A;  3JV9 A;  4GQO A;  4JDF A;  1S50 A;  3ZKL A;  4NED A;  4N4U A;  2R71 A;  1Y9U A;  1IXH A;  1EZ9 A;  4MIJ A;  1LCT A;  4HS7 A;  5L9S A;  4OQO A;  1FRP A;  4F2Q A;  2XXY A;  2H9B A;  3D4C A;  4OVQ A;  2VPO A;  1URS A;  3PUZ E;  2ONS A;  3CVG A;  3THI A;  1LFG A;  4QXD A;  4DXC A;  2XWK A;  3IB1 A;  3K1N A;  4DCX A;  1N04 A;  1LBX A;  4MBP A;  2HZK A;  3LV0 A;  4QSD A;  3WAF A;  4YZZ A;  5DVI A;  3V83 A;  1ZIU A;  3G7W A;  3MP6 A;  3MVZ A;  1DBZ A;  4NHB A;  4F2O A;  4RA1 A;  5FHO A;  1FPE A;  3TKD A;  2OLB A;  3SEV A;  3VVE A;  3LUZ A;  3DP8 A;  2QS4 A;  4ZED A;  3QMF A;  3Q29 A;  1AMF A;  2OK2 A;  5CMB A;  1N7W A;  1XI6 A;  4XFE A;  1BLF A;  2XWO A;  1GTK A;  2Y7W A;  1F9B A;  4OVT A;  2THI A;  4C1U A;  4JVI A;  4GXS B;  2O84 X;  3O97 A;  3W9V A;  4PBH A;  2ZZW A;  1BKA A;  1R6Z A;  1RDX A;  2OWS A;  1FPF A;  3HCQ A;  4XKN A;  5H8S A;  4ECF A;  2FVZ A;  3MP1 A;  5T3J A;  1LBV A;  4ZEK A;  3T9V A;  3IB2 A;  3GLB A;  1EYJ A;  3OD7 A;  4NF0 A;  3HPI A;  4HE2 A;  5I58 B;  1IXI A;  3HV1 A;  2PBW A;  3EPE A;  1GV8 A;  3OXN A;  4FED A;  4HW8 A;  1HSE A;  2I6E A;  1LFI A;  4Q5T A;  4Z0I A;  3A09 A;  2NWJ A;  4PC9 A;  2A5T A;  2V3U A;  4L17 A;  2O7U A;  1EZO A;  3N6T A;  3IO4 A;  1FTO A;  4GOT A;  4H46 A;  4O3A A;  3D4G A;  1NL5 A;  4PQJ A;  2ZYN A;  3IO6 A;  3KJT A;  4BLA A;  1LBW A;  1Q9D A;  1SPI A;  4LAT A;  4MAG A;  4KPT A;  2YLN A;  3R26 A;  4LA9 A;  1II5 A;  4X9T A;  1N3W A;  1LAF E;  4R74 A;  3KZG A;  4PFI A;  1AOV A;  3FXB A;  3CRB A;  4P11 A;  4GWX A;  1JNF A;  2ANJ A;  2XWV A;  3TEP A;  3OMB A;  3B6T A;  4XIG Q;  3FUZ A;  4OFJ A;  1IMC A;  4G8M A;  4YMA A;  5IKB A;  2KR0 A;  4LQ2 A;  1XOC A;  2WBD A;  4ND9 A;  4PBQ A;  1A40 A;  2IEE A;  3EHT A;  2YJP A;  3FBP A;  1OLA A;  1P1O A;  4QFN A;  1DTZ A;  4H45 A;  2R6G E;  2Z22 A;  1LBB A;  1WDN A;  3LSL A;  3PV0 E;  4NN3 A;  4QBA A;  1MY3 A;  2GHA A;  1IMB A;  1B05 A;  3ISP A;  4C0R A;  1NV5 A;  1N0T A;  1IMF A;  3DLN A;  1EU8 A;  3U92 A;  2F35 A;  2KLF A;  2VOZ A;  2GH9 A;  3LSW A;  1NUZ A;  4EQB A;  4N13 A;  2P0S A;  4RYA A;  2QVR A;  1OVB A;  3P7I A;  4RPN A;  3S9N C;  4PGP A;  1DTG A;  1B9J A;  2DWI A;  4XEQ A;  4G77 A;  1QUI A;  4KYE A;  3OSR A;  1SVX B;  3CFL A;  4KFQ A;  2CZK A;  1G0I A;  1T0K A;  4E0W A;  1L5T A;  1MS7 A;  1PC3 A;  2OWZ A;  5L8D A;  1S7Y A;  2NVU B;  1NV6 A;  3MUQ A;  5DTB A;  4PE3 A;  4TLM B;  1R9L A;  1B3E A;  3SKP A;  4KCD A;  4LZ5 A;  4YKJ A;  4BDO A;  4U21 A;  4QSE A;  5H8F A;  2OBG A;  5F1Q A;  2D3I A;  3PMX A;  2H98 A;  5LOM A;  1ZBM A;  5DEX A;  2XWI A;  4U1Z A;  3S9M C;  2F97 A;  2ZYK A;  4PTK A;  4YAH X;  4TQU Q;  4OVJ A;  3SEX A;  1ZLQ A;  4IO2 A;  1CNQ A;  1QUJ A;  4G8N A;  4TLL B;  3OEK A;  1US4 A;  3FAT A;  2UVH A;  4PFT A;  3BFT A;  5J1D A;  2YPN A;  4R6K A;  1FTL A;  4DCY A;  2R9J A;  5H8N A;  4Q0C A;  1MQH A;  2B4L A;  2DWH A;  1AH5 A;  1YCJ A;  3TCG A;  1MPB A;  3MW0 A;  5KDT A;  1SI0 A;  4ZZE A;  3PGF A;  5ET6 A;  1VFE A;  3ZS6 A;  3FIR A;  1Y4T A;  3O6H A;  4LZ8 A;  2CMO A;  3KFM A;  4H65 A;  4R75 A;  3PUW E;  1FTJ A;  3H3G A;  4LZ7 A;  1ANF A;  5KDT B;  4UAB A;  5TPA B;  3S9E A;  1B7Z A;  4ZZA A;  4OTE A;  1LGB C;  2HZL A;  4I1D A;  1POY 1;  3K01 A;  1BP5 A;  4IY6 A;  2I0C A;  4U4X A;  1URD A;  4OEN A;  3LBS A;  2MKZ A;  4HE1 A;  1WVJ A;  3ROJ A;  2Y5L A;  5M2V A;  3VVD A;  1R1N A;  1MQI A;  2RC8 A;  2XD3 A;  2XXK A;  3C35 A;  2F7B A;  4GIZ A;  4O7M A;  1N84 A;  5A5X A;  1KWH A;  4NF8 A;  1VFD A;  4EDP A;  1ZJL A;  4HTG A;  4JBZ A;  2P3N A;  2PT1 A;  4DI4 B;  3CSB A;  5CM6 A;  3I5O A;  2FIE A;  4RY1 A;  4XKP A;  5ESY A;  1USY E;  4KCC A;  2DDK A;  3C36 A;  1PEB A;  1MXV A;  4NF6 B;  4PET A;  1O63 A;  4E0X A;  3UA8 A;  4YKK A;  4ONY A;  1SD3 A;  5IM2 A;  1SI1 A;  4X8R A;  1ZTY A;  3T9U A;  1FPL A;  4G68 C;  4DXB A;  3B50 A;  1FJ6 A;  1AIV A;  4ZEC A;  2PFZ A;  4R6H A;  2XX7 A;  1TFD A;  1UIU A;  1GR2 A;  3KN7 A;  2XXT A;  4R72 A;  2Y7R A;  3MP8 A;  5CI5 A;  2P1S A;  1FQE A;  2XXV A;  3MZ1 A;  3T93 B;  4YKP A;  4MJO A;  2OWT A;  5AA2 D;  4N91 A;  4R9F A;  4MNC A;  4Q8R A;  3L6G A;  3IOV A;  3FVO A;  3TOD A;  1LBC A;  3EF7 A;  1ZKB A;  3N26 A;  4N6K A;  5J16 A;  2HCA A;  3PPN A;  2PFY A;  5TP9 B;  1NI9 A;  1B3F A;  3TTN A;  3IOR A;  1DPE A;  2DXR A;  5I56 A;  1MG1 A;  3R6U A;  3K1M A;  5ELV A;  2XXP A;  3PD9 A;  5I2N B;  5LTC A;  4GRK A;  4H1X A;  4P0I A;  1MDP 1;  2Z8E A;  5IAI A;  2F3B A;  4RPO A;  2B3B A;  3LR1 A;  2DE2 A;  4FE8 A;  1B3L A;  3JZJ A;  1WOD A;  3TFL A;  4LUB A;  3T9H B;  4C1T A;  4NF6 A;  3G3I A;  4N07 A;  5EQ9 A;  1A54 A;  1OIB A;  3TQW A;  2XD2 A;  1SW4 A;  3RTW B;  3KOS A;  1B1X A;  4I40 A;  1MM6 A;  2F78 A;  3RY3 A;  4GBW A;  3VXB A;  2O7I A;  3KC0 A;  3QSL A;  4F1Y A;  1H45 A;  3MYU A;  2W7Y A;  3QXM A;  4RJZ A;  4U2R A;  1I69 A;  1M5D A;  1FPG A;  4NWC A;  2CZL A;  4H5G A;  3Q28 A;  2AL4 A;  4OAN A;  2V3Q A;  4MMP A;  4QSC A;  3RN8 A;  4LVQ A;  1FPJ A;  3W15 C;  4IO7 A;  5CMK A;  4KHZ E;  5TPA A;  3O9P A;  1DMB A;  5HBC A;  3E9X A;  3HN0 A;  3ILT B;  1OQG A;  4QFP A;  4BDN A;  3S9L C;  1ATG A;  1NUX A;  4OVR A;  3MPK A;  3KOT A;  3RGY A;  2AYS A;  2V3T A;  2GQ1 A;  3D1R A;  5HPQ A;  5DYH A;  1Q35 A;  4F19 A;  2UVI A;  1FBC A;  4XKR A;  5TP9 A;  3K2D A;  2QVU A;  2V93 A;  1B7H A;  4OEU A;  1DSN A;  4NE4 A;  2RIN A;  2CZI A;  2QMW A;  5AA3 A;  1LST A;  3QUJ A; 
#chains in the Genus database with same CATH homology
 4DDD A;  4UA8 A;  1B05 A;  4C0R A;  2GRV A;  5B7D A;  1SBP A;  4IGR A;  2X26 A;  1N0T A;  3CG1 A;  2Y7K A;  4OZ9 A;  4JWX A;  5FHM A;  2FA7 A;  3U72 A;  1NH7 A;  2O69 A;  3DLN A;  4G2Z A;  4XXU A;  5H8H B;  1EU8 A;  5CC2 A;  5BUU A;  1FQF A;  1NNK A;  3LSF B;  1MPC A;  2F5X A;  5JTY A;  3U92 A;  1IEJ A;  1Z7M E;  2F35 A;  3KN3 A;  3K4U A;  2KLF A;  2VOZ A;  1B5I A;  2DE3 A;  2GH9 A;  2ZXT A;  3JYR A;  3LSW A;  3MVY A;  2QPQ A;  3PPO A;  4ELP A;  2PVU A;  3SEY A;  4EQB A;  1MXX A;  2H99 A;  1QW0 A;  2REJ A;  1FCK A;  3E3K A;  3GBA A;  3MAM A;  4N13 A;  3RNN A;  5I58 A;  2P0S A;  3DEL B;  4RYA A;  2ZNT A;  3M3L A;  5A5X A;  4IO5 A;  1JET A;  2DWA A;  2ZNS A;  3K6X A;  3FVK A;  1LAH E;  3KJ7 A;  4LQ5 A;  4X48 A;  1OVB A;  2I58 A;  4KI0 E;  1DOT A;  4F39 A;  3K1P A;  2DXY A;  3CI8 A;  3P7I A;  4RPN A;  1FTM A;  3QUF A;  2Q9T A;  3QK6 A;  4OMB A;  5H8F B;  3HO7 A;  5J1D A;  2QS3 A;  3G3F A;  3S9N C;  3M3K A;  4OYV A;  4UAC A;  4ZDM A;  3EHU A;  1DTG A;  1JVX A;  1B9J A;  3FV1 A;  1SQY A;  2DWI A;  2ZYM A;  4Q30 B;  1GVC A;  3UN6 A;  4G77 A;  1FQB A;  1LB8 A;  3F11 A;  4YB5 A;  2VD3 A;  3KSX A;  3VLU A;  1QUI A;  1YTV A;  5ITO A;  3AXF A;  3H6W A;  4KYE A;  3OSR A;  2H4I A;  2XXU A;  3WAE A;  5ITP A;  3IOW A;  1SVX B;  3CFX A;  3CFL A;  3K00 A;  4FAJ A;  4KFQ A;  5I56 B;  3TUS A;  2Y7I A;  2DVC A;  3KBR A;  4MF3 A;  2I4C A;  3KSJ A;  5F7V A;  3FVG A;  4R6Y A;  2DYX A;  1SW2 A;  3HHF A;  3TPA A;  1T0K A;  3K6W A;  3U94 A;  4BDL A;  3LC8 A;  3H6T A;  3C31 A;  4IO4 A;  4QF9 A;  4E0W A;  1JW1 A;  2F6P A;  1L5T A;  2DWJ A;  5AA2 B;  1MS7 A;  4IO3 A;  1I6A A;  1MQJ A;  1PC3 A;  2I0B A;  4G68 B;  4R2F A;  5CMC A;  5FTH A;  5L8D A;  1S7Y A;  2NVU B;  5H8H A;  3UOR A;  1TXF A;  4XKQ A;  3OO7 A;  3FJ7 A;  3MUQ A;  1J1N A;  3B7D A;  5DTB A;  3VV5 A;  4BDQ A;  4TLM B;  1R9L A;  1B3E A;  3SKP A;  4GFR A;  4KCD A;  3PMV A;  4LZ5 A;  4YKJ A;  3TTM A;  2UYE A;  1B4H A;  4U21 A;  4BDO A;  4F18 A;  4QSE A;  1PBQ A;  2OZZ A;  5K2X A;  4BDR A;  1B52 A;  2PT2 A;  1H43 A;  1QKA A;  3FXU A;  3PMW A;  1XHY A;  3MBP A;  1Y3N A;  4QRZ A;  1PBP A;  4U22 A;  5H8F A;  3QIM A;  2ZNU A;  2OBG A;  4JWY A;  3IOT A;  5F1Q A;  2D3I A;  3C34 A;  1P1N A;  3I3V A;  4HCW A;  1PDA A;  3PMX A;  2ONR A;  4JB7 A;  2H98 A;  3KEI A;  5LOM A;  4F3G A;  3UK4 A;  1ZBM A;  5DEX A;  4U1Z A;  3S9M C;  1M5B A;  1DPP A;  2F97 A;  3MZ9 A;  2ZYK A;  4YAH X;  3IAZ A;  4TQU Q;  4OVJ A;  4G4P A;  3RQT A;  4PFU A;  3SEX A;  1ZLQ A;  5KZT A;  4IO2 A;  3U93 A;  1CE2 A;  4IO6 A;  1QUJ A;  1FQD A;  4G8N A;  4OFO A;  1RYX A;  3OO9 A;  1IZ1 A;  1RYO A;  3OSQ A;  3OEK A;  4KYD A;  1US4 A;  2QMX A;  3FAT A;  2Y7P A;  4TLL B;  4EXK A;  1LLS A;  2VGQ A;  4NTL A;  5ISU A;  2UVH A;  3Q26 A;  4PFT A;  2XXH A;  2BJJ X;  4NF4 A;  5BWJ A;  3OEM A;  4R73 A;  4FIM A;  4U1O A;  4FJP A;  2D5W A;  2I49 A;  2PX1 A;  3BFT A;  1MM7 A;  2YPN A;  3HHG A;  2I3W A;  4MH5 A;  4R6K A;  4RNS A;  1FTL A;  4DCY A;  2XXW A;  4ESW A;  2R9J A;  3MVX A;  3RPW A;  1UTB A;  2DS9 A;  5H8N A;  4I9D A;  5I2K A;  2XXX A;  3DP4 A;  4Q0C A;  1MQH A;  2O51 A;  1PB8 A;  3KG2 A;  4H5F A;  4N6P A;  3V8X B;  3W9W A;  2DWH A;  3KN8 A;  4OES A;  1NH8 A;  2V84 A;  1MPD A;  2B3F A;  3QYT A;  1EZP A;  1MY0 A;  2Z8D A;  1AH5 A;  1NMU A;  4Z7E A;  3HST A;  4NMY A;  3E13 X;  3TEL A;  1YCJ A;  4WED A;  3TCG A;  3SET A;  1LB9 A;  1MPB A;  2QJE A;  3MW0 A;  4PE5 B;  3SEW A;  4ELR A;  5KDT A;  1UTB B;  4JSD A;  5I2K B;  1VR5 A;  1SI0 A;  4ZZE A;  3PGF A;  5KCJ A;  4U4S A;  3ZSF A;  3IJO B;  1Y1M A;  1IXG A;  3O66 A;  1TT1 A;  4DXU A;  1VFE A;  2G93 A;  4H6D A;  3ZS6 A;  2FYI A;  4OXV A;  5H8Q A;  4FEC A;  1B5J A;  1PB7 A;  3FIR A;  3IL1 B;  3PUX E;  4YMB A;  1BIY A;  1MXU A;  1Y4T A;  1B3G A;  3O6H A;  4LZ8 A;  4KYS A;  4YKI A;  2Q2C A;  3FVN A;  3TCH A;  1IIT A;  4F1V A;  2RC9 A;  3MPL A;  4F22 A;  4FEB A;  1D4N A;  1JVY A;  2CMO A;  3OEL A;  2RCB A;  5EHS A;  5AE4 A;  3KFM A;  4H65 A;  3VFJ A;  4FAT A;  4X1D A;  4R75 A;  1JW4 A;  2DQV A;  1FTJ A;  1MDQ A;  2X7P A;  3GBB A;  3PUW E;  3H3G A;  3IJX B;  4GL8 A;  3N94 A;  4LZ7 A;  4IB2 A;  3H6V A;  1S9T A;  1ANF A;  4YB7 A;  4MLQ A;  5TU0 A;  3LUY A;  3U1O A;  5CBS A;  5KDT B;  5DEX B;  2GHB A;  1BTJ A;  5FHN A;  2NUV A;  1I6Q A;  1B4Z A;  2O1M A;  3N5L A;  4THI A;  4X1B A;  5TPA B;  5HM4 B;  3USD A;  3S9E A;  1A8E A;  1IIW A;  3RTF B;  1B7Z A;  4ZZA A;  1IUD A;  4OTE A;  3K6V A;  4ZS9 A;  1B0L A;  1LGB C;  2XX8 A;  2HZL A;  3SDF A;  1M5F A;  4I1D A;  2IA4 A;  3B6W A;  3MZB A;  4R2B A;  3Q27 A;  1ZU0 A;  2A5T B;  2AL5 A;  2XXR A;  3MWB A;  1NNT A;  1B32 A;  3A3C A;  3H06 B;  1POY 1;  1P1U A;  3K01 A;  1MXZ A;  1Q1K A;  1R9Q A;  2V25 A;  4ISU A;  1BP5 A;  3ONM A;  3SEU A;  1D9Y A;  4IY6 A;  3PUV E;  2I0C A;  1NKX A;  1MXW A;  1URD A;  4OEN A;  4U4X A;  1MH4 A;  2RCA A;  3LBS A;  4TOZ A;  4KR5 A;  5FTI A;  3FJM A;  1B5H A;  3V5A A;  1B0H A;  2WKY A;  1B3H A;  4H8J A;  3M8U A;  3O28 A;  2AIX A;  3MQ9 A;  2ABH A;  4F3S A;  4DLD A;  1WVJ A;  1H76 A;  3G3H A;  4POW A;  4R9G A;  5M2V A;  4QFK A;  3U8Q A;  3MVW A;  3VVD A;  1R1N A;  4K3F A;  3VXC A;  1MQI A;  2RC8 A;  2XD3 A;  1Y4C A;  4LP2 B;  3C35 A;  3G3K A;  1MY2 A;  1SW1 A;  2A5S A;  3TAJ A;  3TCF A;  1ZMG A;  1MH3 A;  1Z7N E;  1NNP A;  4GWO A;  5ICT A;  3E4R A;  2PMS A;  2F7B A;  2HEU A;  2NXO A;  1N84 A;  4GIZ A;  3CIJ A;  4GXA A;  1KWH A;  3UP9 A;  4EXL A;  4F31 B;  3ECR A;  3FZV A;  1MRP A;  3TTR A;  3VLW A;  3CSG A;  5H8N B;  1M5E A;  1VFD A;  2QSX A;  4NF8 A;  4EDP A;  5CBR A;  1HSJ A;  1ZJL A;  5EYF A;  5CMM A;  5AA4 A;  1A55 A;  1MY1 A;  2Y84 A;  1IQ7 A;  1H44 A;  1JQF A;  2I48 A;  2Q89 A;  4HTG A;  1OMP A;  4JBZ A;  3MJN A;  1US5 A;  2Z23 A;  2PT1 A;  1AL3 A;  1I6B A;  2P2A A;  3CSB A;  3H7M A;  1JW5 A;  5CM6 A;  4ZEF A;  3TTL A;  5I2N A;  1N3X A;  4GD5 A;  4YU0 A;  3K02 A;  3R7X A;  4GL0 A;  4AB6 A;  2M8C A;  2O68 A;  3I5O A;  4OEV A;  1QUK A;  1D9V A;  1UIV A;  1FQA A;  4RY1 A;  3L6H A;  5H8Q B;  4XKP A;  1USY E;  4KCC A;  3C36 A;  1PEB A;  1RKM A;  1MY4 A;  1MXV A;  2HFB A;  1OVT A;  3G3G A;  3O2A A;  3BFU A;  4NF6 B;  2FNC A;  4IGT A;  4O3B A;  4OFL A;  3OO8 A;  1YAE A;  4PET A;  4EF1 A;  5ICQ A;  3JV9 A;  3IR1 A;  1MQD A;  1P1Q A;  1O63 A;  2DSF A;  4GQO A;  3EN3 A;  4PP0 A;  1P99 A;  4JDF A;  4E0X A;  5I84 A;  1S50 A;  1B7U A;  3B6Q A;  1LAX A;  3ZKL A;  3OOA A;  4NED A;  3UA8 A;  3IOU A;  4OWD A;  1FW0 A;  4ZEB A;  4YKK A;  2R71 A;  2XHD A;  2F34 A;  5L9M A;  3QAX A;  4ONY A;  5I57 B;  1TWY A;  1Y9U A;  4JWO A;  1IXH A;  1EZ9 A;  1SD3 A;  1M5C A;  1MQG A;  2NOO A;  5DVF A;  1SI1 A;  3T9X B;  3ODB A;  1EH3 A;  1ZTY A;  1LCT A;  4EUO A;  4HS7 A;  3T9U A;  4G68 C;  3I6V A;  4DXB A;  5L9S A;  1FTK A;  4OQO A;  5I57 A;  4F2Q A;  1ELJ A;  2H9B A;  2XXY A;  3D4C A;  3TQL A;  4KQP A;  3VE1 B;  4EQ9 A;  1SYI A;  5DVJ A;  1B46 A;  1URS A;  1LCF A;  4G68 A;  1Y20 A;  3PUZ E;  2QS1 A;  3Q25 A;  3OEN A;  3FJG A;  3GZG A;  4AQ4 A;  1AIV A;  2ONS A;  3G3J A;  3PU5 A;  4ZEC A;  3CVG A;  3THI A;  1LFG A;  1XC1 A;  4R6H A;  2XX7 A;  3RUM A;  1O64 A;  5B70 A;  4DXC A;  1TFD A;  2I3V A;  3IB1 A;  3K1N A;  3CR9 A;  1UIU A;  4JSO A;  4NF5 B;  1GR2 A;  3KN7 A;  4DCX A;  4PFW A;  2XXT A;  1N04 A;  4R72 A;  3EQ1 A;  4YIC A;  2Y7R A;  4MBP A;  2HZK A;  4I62 A;  1Y1Z A;  3MP8 A;  5CI5 A;  4F3B A;  2P1S A;  1FQE A;  4QSD A;  2XXV A;  3WAF A;  1B58 A;  3MZ1 A;  4GF8 A;  1XVX A;  5DVI A;  2F7A A;  4YZZ A;  3V83 A;  1JEU A;  1ZIU A;  3G7W A;  3MP6 A;  2QS2 A;  4YKP A;  3MVZ A;  3T93 B;  2OWT A;  4F2O A;  5AA2 D;  4R9F A;  4RA1 A;  5FHO A;  1H3D A;  3K0V A;  3TKD A;  2OLB A;  3SEV A;  3VVE A;  3L6G A;  4Q8R A;  2Z8F A;  3IOV A;  3DP8 A;  3FVO A;  4MFI A;  2G29 A;  1LFH A;  4KD5 A;  3OO6 A;  4DZ1 A;  1N7X A;  3RT8 A;  2F8D A;  2QS4 A;  3RT6 B;  4ZED A;  3TOD A;  1LBC A;  3EF7 A;  1ZKB A;  3KGC A;  3N26 A;  3A3U A;  3SER A;  2HCA A;  1AMF A;  2OK2 A;  3PPN A;  3Q29 A;  5TP9 B;  3IK6 B;  2VP1 A;  5CMB A;  1B3F A;  2LAO A;  3TTN A;  1N7W A;  1B6H A;  5L9O A;  3MC2 A;  1OQH A;  1BLF A;  1GTK A;  2Y7W A;  1F9B A;  2GFE A;  2I4B A;  3IOR A;  2THI A;  1DPE A;  3S4U A;  4C1U A;  2DXR A;  4GXS B;  2OJT A;  3PPR A;  5I56 A;  2O84 X;  1MG1 A;  3R6U A;  1XVY A;  3O97 A;  4F29 A;  3K1M A;  2ZYO A;  5ELV A;  1B40 A;  3W9V A;  4EQ7 A;  2XXP A;  2HQ0 A;  2X7Q A;  3PD9 A;  3VVF A;  3PPP A;  5JK4 A;  1POT A;  1BKA A;  1R6Z A;  5I2N B;  2E0S A;  2OWS A;  4GRK A;  2QRY A;  3UIF A;  3CFZ A;  4H1X A;  3HCQ A;  4P0I A;  3T22 A;  4XKN A;  4XTC Q;  4ELO A;  3SES A;  1MDP 1;  2Z8E A;  4H0W A;  5H8S A;  3V89 B;  5IAI A;  3O6I A;  4RPO A;  3IX1 A;  2B3B A;  3LR1 A;  4ECF A;  4IY5 A;  2DE2 A;  2VHA A;  3CG3 A;  3MP1 A;  3FV2 A;  4FE8 A;  4P0G A;  4ZEK A;  3T66 A;  1B51 A;  1N76 A;  3T9V A;  4QFO A;  1B3L A;  3FAS A;  5AA1 A;  3IB2 A;  3VDF A;  1O7T A;  3GLB A;  1WOD A;  3FGS A;  3JZJ A;  2DOJ A;  3OD7 A;  2DVZ A;  3TFL A;  3PPQ A;  3HPI A;  4LUB A;  3T9H B;  5I58 B;  4C1T A;  3H6U A;  4NF6 A;  1IXI A;  2UYF A;  3S2V A;  3G3I A;  3N6U A;  4AB5 A;  1SW5 A;  4N07 A;  2RKM A;  3TTK A;  1A54 A;  2VD2 A;  1OIB A;  2XXQ A;  3TQW A;  4POX A;  4JXI A;  2D21 A;  3HV1 A;  2XD2 A;  1D3K A;  4GVO A;  1SW4 A;  1QVS A;  2DE4 A;  2PBW A;  3EPE A;  3KOS A;  3PUY E;  1B1X A;  1UTH A;  2ALU A;  2Q88 A;  3OXN A;  1GV8 A;  4FOR A;  3RTW B;  4FED A;  2ZMB A;  4H8I A;  4QHQ A;  4QFL A;  4HW8 A;  1HSE A;  4WXJ A;  2HAU A;  2I6E A;  2REG A;  2RF1 A;  1MM6 A;  1LFI A;  4Q5T A;  2F78 A;  1A99 A;  3RY3 A;  3GXA A;  4OER A;  5KCJ B;  3C4M A;  5AA4 B;  2XX9 A;  3DM0 A;  4Z0I A;  3VXB A;  2O7I A;  3ZKK A;  3A09 A;  4NF8 B;  2NWJ A;  1P1W A;  3QSL A;  2F7C A;  3K6U A;  5A5X B;  2A5T A;  1QUL A;  2V3U A;  4L17 A;  3IB0 A;  4F1Y A;  1H45 A;  5I59 A;  5JEI A;  1TFA A;  3LSX A;  2O7U A;  4ZE8 A;  2W7Y A;  3QXM A;  4DE8 A;  5I59 B;  4NWD A;  1EZO A;  3N6T A;  4RJZ A;  5DT6 A;  3IO4 A;  4ZE9 A;  3O6G A;  3UGW A;  1FTO A;  2F36 A;  4OHN A;  4U2R A;  4GOT A;  4WKM A;  1NFT A;  4GLI A;  1I69 A;  1M5D A;  4NWC A;  4O3A A;  4NF5 A;  2CZL A;  2QL3 A;  2UVJ A;  3D4G A;  4H5G A;  1NL5 A;  4M4G A;  4PQJ A;  2ZYN A;  1XS5 A;  2O6A A;  1VE4 A;  3Q28 A;  3C9H A;  3IO6 A;  4HCY A;  3KJT A;  4BLA A;  4ESX A;  2AL4 A;  4NF4 B;  3VLV A;  2ESN A;  4LAT A;  2H5Y A;  4BDM A;  1QKB A;  2Q8J A;  1SYH A;  1JEV A;  1SDX A;  4KPT A;  2V3Q A;  1USY H;  1IXC A;  1CB6 A;  2HXW A;  2ONK E;  2Q2A A;  4O3C A;  4QSC A;  3TZA A;  1GGG A;  3RN8 A;  1FQC A;  2YLN A;  3R26 A;  4LVQ A;  3ILU B;  4LA9 A;  3W15 C;  2XXI A;  1UQW A;  3FXQ A;  4IO7 A;  1II5 A;  2O1L A;  1N3W A;  2RC7 A;  1LAF E;  1PB9 A;  3KZG A;  1XT8 A;  4KHZ E;  4M1V A;  4R74 A;  4X9T A;  5CRY A;  2DP8 A;  5TPA A;  5CMK A;  1AOV A;  3O9P A;  1DMB A;  1HSL A;  5K2Y A;  4F3P A;  5HBC A;  3CRB A;  4P11 A;  3T96 B;  4RXL A;  3E9X A;  1Y3Q A;  1JNF A;  3HN0 A;  4PFY A;  1YPN A;  3H03 A;  3BBR A;  3DP6 A;  2ANJ A;  3ILT B;  3PD8 A;  3EHS A;  1OQG A;  1OLC A;  4RK9 A;  3OMB A;  2B65 A;  3B6T A;  4QFP A;  4BDN A;  3TEP A;  2UVG A;  5JTY B;  4XIG Q;  3S9L C;  3FUZ A;  4OFJ A;  4LON B;  4G8M A;  1ATG A;  1Y3P A;  3H4Z A;  4U23 A;  3RLF E;  1UTH B;  4YMA A;  3TYH A;  2E1S A;  4RK2 A;  4YB6 A;  2PYY A;  5IKB A;  1B2H A;  3BKI B;  3MPK A;  3KOT A;  4G8H A;  4ELQ A;  3O29 A;  1XOC A;  4LQ2 A;  3RGY A;  2OCU A;  3FXR A;  2AYS A;  4ND9 A;  3TDJ A;  1NNF A;  1A40 A;  4H67 A;  2IEE A;  2V3T A;  3EHT A;  4OET A;  3M3F A;  4F1U A;  5HPQ A;  3C33 A;  1A7L A;  5DYH A;  1Q35 A;  2YJP A;  3FD3 A;  5EHM A;  4MLV A;  2UVI A;  4F19 A;  1MXY A;  4I8C A;  5AA2 A;  1OLA A;  1B1H A;  1VSO A;  1LAG E;  1QJM A;  4XKR A;  3TMG A;  1P1O A;  1A8F A;  3K2D A;  5TP9 A;  2V93 A;  1B7H A;  1DTZ A;  4QFN A;  4OEU A;  4EF2 A;  4ZEI A;  2R6G E;  1DSN A;  1URG A;  2Z22 A;  4NE4 A;  2RIN A;  1LBB A;  2UXA A;  3C32 A;  2F6G A;  4DIG A;  1WDN A;  2H25 A;  3LSL A;  2QMW A;  3PV0 E;  2HAV A;  4WEP A;  5AA3 A;  1MY3 A;  1LST A;  3QUJ A;  2GHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...