4NGUA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_1548), target efi-510103, with bound d-ala-d-ala
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
317
structure length
317
Chain Sequence
MAAAMTVKMSYNGPPSLEDNAVHAFATTFKELVEKESGGGIVIDLYPNSQLGNEQQRMEQVMTGPMINVASFGGMETVFPEMFATNVPFMFESYAAAHEFFDNSSFMDKAGKELRSRTGIELLAVVEEGGFIAFTSKKPVRSPADFKGMKFRAMDASQVAMYEAFGASGTPIPWTEVYLALKTGVADGQMNPPTYIIIGSLYEVQDHLTLANVQYSDQFLLINGELLDSLPDSQRQVIRKAAHEANVKTRQFVESQVDERVKFLASKGMTVYTPTAEELAQFKELGSPSYIKWLSGQIDTAWIDHAMEDARKANEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio alaskensis
total genus 102
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4nguA00
4P47A 4O7MA 4OANA 4NN3A 2ZZXA 4PFRA 4NF0A 4DI4B 4PC9A 4MMPA 5I5PA 4PDDA 5IZZA 4XF5A 2HPGA 4PE3A 3B50A 4MNCA 4X04A 4P3LA 4OVSA 2XWVA 2ZZVA 4XFEA 2PFYA 4P1LA 2XWKA 4OVTA 4LN5A 4PBQA 4NGUA 4YZZA 4OVPA 4YICA 2WX9A 4O94A 4UABA 4MEVA 4MX6A 2CEYA 4N15A 4MIJA 5IM2A 2XXKA 2PFZA 3GYYA 2HZKA 4PAIA 2WYKA 4PF8A 4DI3D 4X8RA 4NQ8A 4P9KA 4P8BA 4PGPA 5LTCA 4PCDA 2XWOA 4N91A 4OVRA 2V4CA 4PBHA 5CM6A 4O8MA 4MHFA 4P56A 3U65A 4NHBA 4PDHA 2VPNA 4P1EA 4PGNA 4N8YA 4PAFA 4MNIA 4PFBA 4NAPA 2ZZWA 5I7IA 4PAKA 4PF6A 4XEQA 2CEXA 2XA5A 4PFIA 4NG7A 4MAGA 4N17A 4MCOA 4N6KA 4N4UA 4OVQA 4OA4A 2HZLA 4PETA 4MNPA 2XWIA 4NX1A 4N8GA 2VPOA 5IGAA 4N6DA 3FXBA 2WYPA
chains in the Genus database with same CATH superfamily
3C31A 2XXYA 5EYHA 2ANJA 2XD2A 1FPLA 4R73A 4ELOA 4DCXA 2GHAA 4N6PA 2FA7A 1L5TA 2L5VA 5ET6A 3EHTA 3N6TA 4X48A 2Q2CA 2I4BA 1LBBA 3IOUA 3B50A 4O3CA 3HHFA 4GX3A 3RQTA 4QFPA 1FRPA 5AA1A 2ZMBA 4C1TA 4DDDA 1BTJA 5ELVA 3VXBA 2CEYA 3TTMA 3UK4A 2XXKA 2HZKA 3K6XA 5A5XB 1LCFA 1RYXA 3CG1A 1OQHA 1A7LA 4PBHA 4YMAA 1JVYA 1RDZA 3K2DA 3HPIA 1XOCA 1LBCA 3BFUA 2E0SA 3OSRA 4G68A 2XXRA 4NF8A 5EQ8A 4EQ9A 4JXIA 1JETA 4OYVA 1NUWA 5DYHA 1MDP1 3E13X 4O3BA 3PGFA 3S9MC 1MM7A 1KWHA 3RTFB 3PMWA 1FQAA 2GRVA 3N5LA 4NMYA 1QVSA 1CB6A 3IFCA 2WEFA 2ZYOA 1NNFA 4ZS9A 1B7ZA 3H6UA 4IO2A 4H45A 1LEVA 4P47A 1ZJLA 2CZKA 4FECA 4ZZAA 1POY1 4E0XA 1Z7NE 1BIYA 3E9XA 1B5IA 1OVTA 1FBFA 1OIBA 1JEUA 4X04A 5KDTA 3T9UA 4NWCA 1D4NA 4LQ5A 2XXWA 5IZ3B 4DCYA 4LN5A 2D21A 4EF2A 3EKIA 4GWUA 1YTVA 1AL3A 5ITOA 4O94A 1EH3A 1FQEA 4I3YA 3ZKLA 3FVGA 2H25A 3G7WA 1NI9A 4PAIA 2RC7A 3T1BA 5KCJB 3IJXB 2ONKE 4NQ8A 3MZ1A 3KN3A 1Q35A 4IO6A 4JDFA 2F3BA 5I59A 1R9LA 1MG1A 2V4CA 3W15C 4H67A 4BDQA 4QFNA 3GZGA 2Y7RA 1FTAA 4NHBA 1NMUA 2Q2AA 4YB7A 2Y7IA 1URGA 3RPLB 4ZEBA 3OXNA 5KZTA 3T9XB 3PUZE 1NH8A 3KOTA 2XA5A 4PFIA 3KEIA 5CI5A 3CI8A 3LV0A 4MAGA 3RYDA 4MCOA 2FBPA 3TTLA 2QMWA 3QYTA 1XC1A 3OMBA 2PYYA 5FHMA 3FIRA 3SEYA 3TEPA 3DLNA 1N0TA 4Q0CA 4GVOA 1B32A 1F9BA 4F1UA 1IXGA 5IGAA 2PVUA 3KBZA 2NWJA 3TCFA 4GWSA 5CRYA 2OBGA 2AYSA 2ZZXA 4X1DA 4KXPA 3MP6A 4PC9A 1CE2A 2GHBA 2FYIA 3PPNA 3V8XB 3K6UA 3VE1B 1SI1A 2HPGA 4N13A 4G8MA 4IY6A 5AA2B 4LVQA 2ZZVA 3C33A 3DELB 3PPQA 1FPKA 2PFZA 4LATA 4ZEIA 1GV8A 3IO6A 1MY0A 3IO4A 4ZEFA 2QS1A 5CBRA 3PTYA 3NOHA 3E3KA 2OJTA 1INPA 1JW4A 2OWTA 1SYHA 3IFAA 1DCUA 1Y4CA 1JVXA 1FPDA 5ISUA 2V3TA 4IR8A 2V84A 2XXTA 1SDXA 4PFUA 4FATA 1Y3NA 3HV1A 3TELA 5FHNA 1LFHA 3OELA 3R7XA 3CVGA 4JWXA 4NG7A 1DPPA 5CMBA 2XXPA 4N6KA 4LZ7A 1US4A 2DVCA 3O6GA 3PPOA 1UIVA 1MQDA 1NV6A 4PFWA 4F18A 1LLSA 1FPGA 2BJIA 5EHMA 2DWHA 1ZBMA 4RNSA 3TODA 1ZU0A 4GX4A 2Z8EA 5AE4A 3TKDA 3QUJA 3WAFA 3N94A 1B3LA 1FBGA 3TCHA 3FV1A 1RDXA 3T9VA 3T93B 1EYKA 4IO3A 1MQGA 1DTZA 2P0SA 3FV2A 3PPRA 4Q30B 5AA3A 3RY3A 2HXRA 4R74A 3RN8A 4GFRA 4FORA 3BIHA 1EZPA 4OETA 3IOVA 4RYAA 2CMOA 3RGYA 2NUVA 3E79A 2Z23A 1B9JA 3HCQA 2YLNA 2E1SA 1Y1MA 3S9LC 2G29A 1B3EA 3PUXE 3C34A 2I49A 4G8HA 4KI0E 2W7YA 3TDJA 2BJJX 2O7IA 2GQ1A 1ZIUA 3Q26A 3B6TA 4POWA 1IMAA 1NL5A 4NF4A 4OVJA 1IMCA 3IB0A 4NEDA 5EYFA 2DYXA 4ESXA 2DXRA 2PT2A 2OZZA 5ITPA 1SBPA 4RPOA 1ATGA 1FQBA 2F78A 1FTLA 5I2KA 4FBPA 2I0BA 3N6UA 1LGBC 4OHNA 3LSLA 4YB5A 4OVQA 2XX9A 2XD3A 4N8GA 1O64A 3IB2A 3KJTA 3S9EA 4KD5A 3TFLA 1NNTA 3DP4A 4OXVA 2WYPA 1H3DA 4IO5A 4BDNA 1GVCA 1BP5A 1DMBA 1IXCA 1B51A 4MF3A 1QUKA 2QVRA 3MBPA 5EQ9A 1B58A 3KN8A 4R2BA 5CBSA 3AXFA 5IZ1A 5A5XA 3I5OA 3HHGA 1MM6A 5H8QB 2AL4A 1KA1A 2IA4A 4GBWA 4ZECA 1LFGA 2DVZA 2XWVA 4XFEA 4F1VA 1UQWA 5JTYA 4N07A 3TPAA 4ZDMA 3V89B 4M4GA 4FIMA 1Y3PA 3FZVA 2I3WA 1WODA 1ZTYA 2V93A 1B7HA 3PMVA 4ZZEA 4ELQA 4H65A 4RXLA 1WVJA 4FAJA 3ODBA 3RLFE 2RCBA 1MRPA 3S4UA 3K4UA 1MPDA 2ABHA 1RYOA 2QPQA 4U1OA 1LB9A 1D9YA 3MSTA 5DW8A 3MWBA 4MBPA 3T22A 2Y84A 3FBPA 4N8YA 4AQ4A 3SKPA 1MH4A 1FPEA 3SESA 2Y7KA 4N17A 4TOZA 3FGSA 4FEDA 1PEBA 4WEPA 2V25A 4LUBA 3OO7A 1QKBA 1FPFA 2HEUA 3HN0A 4G77A 3CIJA 2F7CA 3G3GA 2ZXTA 2H9BA 1O7TA 2B65A 2ESNA 4IGTA 3CFLA 4THIA 1EYIA 1N7XA 3C4MA 2CZHA 4YKIA 4DLDA 3TUSA 1FSAA 3FXUA 2XXHA 1FJ9A 1NFTA 3A29A 2YPNA 4U2RA 1B0LA 2QFLA 3Q29A 5KCJA 1UTBA 4PTKA 1Y3QA 3TAJA 4U23A 1HSEA 3MZ9A 2DDKA 1Y20A 2A5TB 1JP4A 5HPQA 4H8IA 4YZZA 1B46A 2DS9A 2I3VA 3MVWA 2RF1A 3PUVE 2GFEA 3BIGA 1II5A 3FD3A 4I9DA 1DBZA 4EF1A 3RPLA 5IAIA 3Q27A 4OMBA 1DK4A 4BDRA 4OEUA 2H5YA 1WDNA 3VVEA 4MLVA 4OEVA 3F11A 5AA4B 3O2AA 5K2XA 1PDAA 4JVCA 2ZZWA 5AA2D 3CRBA 4XEQA 3O6IA 2F7AA 4G4PA 1QKAA 1IXHA 4OERA 3KGCA 2HZLA 2I6EA 2R9JA 4NX1A 3PV0E 3CG3A 3OEMA 1PB7A 3KJ7A 1XVYA 3U1OA 5AA2A 4C0RA 2QS2A 4WEDA 4PE5B 3T96B 1USYE 1EYJA 1IMEA 3LSWA 1G0IA 2Q89A 4H1XA 3QMFA 5L8DA 5TPAA 1TWYA 2PT1A 1I6AA 4OWDA 3IOWA 4YKJA 4K3FA 2AL5A 4WKMA 2B4LA 4MJOA 3O28A 1P1UA 2OLBA 5EQ7A 3IK6B 4PF8A 4DI3D 5I56A 4QFKA 3UP9A 3G3HA 4O3AA 5EHSA 2XWOA 4EUOA 1N76A 1D3KA 1SVXB 2UVGA 2P3VA 4MHFA 3U93A 4Z7EA 3FJ7A 3TQWA 4I40A 4RJZA 1QW0A 1B7UA 4ECFA 5TU0A 5DVJA 3B7DA 1NUYA 4LONB 4PFBA 1A99A 4PAKA 3O97A 1B5JA 5DT6A 4F31B 4N4UA 3LSXA 3JYRA 2F35A 4F19A 4GWXA 3EHSA 4PETA 5J1DA 4R72A 3FUZA 1AOVA 5I57A 4G2ZA 2R6GE 4N6DA 2B3BA 4LZ5A 3T0JA 4O7MA 4OANA 4NN3A 3RT8A 4NF0A 1JW5A 1RDYA 3MVYA 3PUWE 3L6HA 2DWIA 2RC9A 1MY3A 2DP8A 1FBPA 3R6UA 2ZNTA 2H99A 3EN3A 4MNCA 4F22A 4TLLB 2PFYA 2M8CA 3OO9A 4PBQA 5HBCA 5EQAA 2DOJA 1T0KA 3FASA 3HFUA 3P7IA 4MEVA 1M5FA 1B0HA 3DP8A 4OFOA 4N15A 3MPKA 2Y7WA 1M5CA 3L6GA 4IB2A 4KYSA 3TMGA 4YKKA 1RKMA 4RK9A 5LTCA 4F1YA 3ZS6A 3QSLA 3GBAA 4OESA 4QFOA 1FTJA 2PX1A 4ELPA 4EDPA 3TQLA 5H8NA 4NF8B 1CNQA 3KBRA 3BKIB 5I58A 2V3QA 1URDA 4PP0A 1SYIA 1ELJA 4MH5A 2QJEA 3H03A 2R71A 4O7IA 4OA4A 3CHGA 3KZGA 3SETA 3OEKA 2RINA 1AWBA 1FTKA 3G3IA 3IB1A 3T66A 4H0WA 4GIZA 3CFZA 1NNKA 1SD3A 4Q8RA 5H8QA 5H8HB 5EYGA 2QRYA 5DVIA 1J1NA 4R6KA 2XXUA 4FEBA 4U4XA 1AIVA 5H8SA 3K6VA 5KDTB 3ZSFA 5HM4B 5I2NA 5M2VA 1H76A 1TFDA 3U8QA 1NV0A 1HSJA 1ANFA 4LZ8A 2UYEA 1LBWA 4QBAA 1P99A 4UABA 3CR9A 2DQVA 3UA8A 1N84A 4RPNA 4H5FA 2DXYA 3KSXA 1B6HA 3O6HA 1OVBA 4X8RA 4P8BA 1UTHB 5I59B 5T3JA 4XTCQ 4PCDA 4AS5A 3SERA 5ICQA 4N91A 3R26A 1LCTA 2PMSA 4I8CA 4AB5A 3PMXA 3TYHA 3A3CA 2OWSA 4NF6B 3MP8A 1VE4A 3H6TA 4MNIA 1POTA 4NAPA 4QFLA 3VDFA 2F5XA 2XX7A 3MC2A 3A3UA 5H8FB 1B1XA 4P0IA 3V83A 4UA8A 3K1NA 1MS7A 1JW1A 2DWAA 5F7VA 4DIGA 3H6VA 3A09A 4L17A 1SW5A 1M5BA 3U92A 5FTHA 3G3KA 2UXAA 5DEXA 4AS4A 4R9GA 4UACA 2X7QA 3M3LA 5I84A 4NF5A 4DE8A 1H43A 4PFRA 2A5TA 1LAGE 2HHMA 3I3VA 4DI4B 4G68C 4EXLA 2HAVA 3BFTA 1M5EA 1IITA 3RTWB 1A8FA 4OQOA 3M8UA 1D9QA 4OFLA 1DPEA 4H46A 2OCUA 4F3SA 3S9NC 1Y1ZA 2Z22A 2OK2A 1P1WA 1JEVA 3QUFA 4HXVA 4HCYA 4MX6A 4XKNA 4LA9A 4MIJA 1XT8A 1O63A 4DXBA 1FBDA 2WYKA 4F2QA 3K01A 2FIEA 1PC3A 4DXCA 3USDA 4PGPA 1P1OA 2JJKA 3VV5A 4ZEKA 4QRZA 4YKPA 4O8MA 4P56A 1YAEA 3MP1A 3ECRA 2HXWA 4E0WA 4HW8A 3KSJA 3THIA 3UORA 1A54A 3LUZA 4F3PA 1D9VA 1SQYA 3CSGA 4IO4A 1VSOA 1OLAA 1ZMGA 5F24A 3ILTB 5LOMA 2YJPA 2LAOA 3KG2A 5JK4A 3IOTA 3D4CA 3OD7A 4EXKA 1MQJA 4MFIA 4U1ZA 1NH7A 4U4SA 1N04A 3U72A 3RT6B 1K9YA 3E78A 4KR5A 4JWYA 3C35A 5DTBA 1QUIA 2NXOA 3MJNA 1VR5A 3B6WA 4PDDA 5BWJA 1ZLQA 1SW4A 1GGGA 3IR1A 4GD5A 1Y4TA 4G61A 4JB7A 3FXRA 3MVZA 1B40A 4P3LA 4PFTA 2KLFA 1I6QA 4GF8A 4P1LA 4P0GA 1LAFE 2HQ0A 4KQPA 4RA1A 5IZ3A 4HS7A 3C36A 1AMFA 2DWJA 4GL8A 1R1NA 2B3FA 4H5GA 5TP9B 1IIWA 4GRKA 2ZYKA 1K9ZA 4KFQA 1IMBA 4GXAA 3C32A 5ET7A 4NF4B 1R9QA 2FVZA 3FVOA 5L9OA 3VVFA 3IAZA 3ISPA 3CFXA 1TXFA 4PGNA 4GBVA 3K02A 5I2KB 1H44A 2R8TA 1FW0A 4X9TA 1FPJA 2CEXA 2X7PA 3K0VA 2D3IA 2O7UA 2XXXA 2RKMA 4MLQA 1IMDA 2F7BA 2VHAA 2G93A 4NTLA 4XIGQ 1USYH 3MQ9A 5FBPA 2XWIA 4C1UA 2VPOA 4XXUA 3HO7A 4YB6A 3FVNA 1A55A 5I3SA 3KC1A 1MDQA 3IJOB 4BDLA 3G3JA 1LBZA 4ISUA 1DTGA 3JV9A 3MAMA 4R9FA 1MXYA 4ONYA 2F34A 3SEWA 2QSXA 3FXQA 3EPEA 4R2FA 3UN6A 3MYUA 1LAHE 3G3FA 3GXAA 5JTYB 5CMCA 2IEEA 4HE1A 3UIFA 1MXZA 1Q9DA 3MVXA 1LAXA 2O68A 2Q8MA 3ONMA 4M1VA 4OVPA 3EF7A 3VXCA 4WXJA 3O29A 4FJPA 3IX1A 2XX8A 3OSQA 5FTIA 1YXIA 3GYYA 1NV7A 4GWOA 5F1QA 4F29A 1KA0A 4HCWA 3DM0A 4JVIA 2XHDA 4OVRA 1B52A 2F8DA 1NV2A 3K00A 1FQDA 4POXA 2P3NA 1MXVA 4JSDA 5CM6A 1M5DA 2O1LA 4F2OA 3U65A 1MQIA 1VFDA 3H7MA 3SDFA 2KQZA 1BK4A 1LBYA 2DE3A 4G8NA 3I6VA 4JBZA 4PF6A 1GR2A 3QXMA 3TTKA 2HFBA 3VLUA 2Z8DA 4GWYA 4QF9A 3PPPA 4N81A 1IQ7A 5H8HA 3T9HB 1SW1A 1S9TA 1A40A 1XVXA 1URSA 3SEXA 3M3KA 4R75A 4ZEDA 1FBEA 2VOZA 3FVKA 3FXBA 4TQUQ 3K1MA 3W9VA 4JSOA 4F3GA 3OO6A 2THIA 3H4ZA 2F3DA 1XI6A 3LBSA 3FATA 1UTBB 4XF5A 2H4IA 4ND9A 5DVFA 1GTKA 2DSFA 1QGXA 1UTHA 2KR0A 2Y7PA 2I58A 4HE2A 2WKYA 4OVTA 1US5A 1FJ6A 1HSLA 1A8EA 3B8BA 1IXIA 3PU5A 2WX9A 1SW2A 1IEJA 4NF6A 2Q8JA 4YU0A 3RUMA 3CSBA 3Q28A 3KC0A 2Y5LA 1MPBA 1ZKBA 3JZJA 5H8FA 2XXIA 1YCJA 2OX3A 4BDOA 2I0CA 4KCCA 3TCGA 1B1HA 2PCRA 2F6GA 1JQFA 2QMXA 5CC2A 1IZ1A 1JNFA 3TTRA 1YPNA 4OTEA 1NUZA 3ZKKA 1XS5A 4XKRA 1TT1A 3H6WA 3S2VA 1IUDA 4Q5TA 3K1PA 2Q88A 4GXSB 4GL0A 1S7YA 3MZBA 2VGQA 1FQCA 1MXWA 4DXUA 2VP1A 3LSFB 1I69A 2QL3A 4RK2A 2UVHA 3M3FA 1SPIA 3VLWA 1N7WA 3D4GA 4G68B 1FTMA 2O1MA 1NKXA 2DE4A 1EU8A 4F39A 1MPCA 4QXDA 1Y9UA 3FJGA 2WBBA 4IGRA 1N3XA 3D1RA 2QVVA 4KPTA 4PQJA 3FJMA 3PD9A 4I1DA 5TPAB 1B4ZA 5IZZA 1NUXA 2P1SA 3OOAA 1SI0A 2ZNSA 3O9PA 3SEVA 1B3GA 1NV1A 4X1BA 3IORA 4HE0A 2H98A 2RC8A 1H45A 1BLFA 2O6AA 1LFIA 1DOTA 5I56B 2QS4A 4YMBA 4P9KA 2HAUA 3KFMA 2F36A 3E4RA 5JEIA 4GOTA 3U94A 4U21A 3RNNA 3C9HA 4GWWA 5L9SA 1FPIA 3IL1B 3WAEA 1B5HA 1FBHA 2VPNA 4BDMA 2REGA 1AH5A 3OO8A 2I4CA 2X26A 1B3HA 2Y5KA 1MXUA 1MY4A 1UIUA 2VD2A 4GX6A 5I57B 4KHZE 1NV4A 1LBXA 3V5AA 4MNPA 5ET8A 3O66A 2UVJA 3LC8A 1QJMA 2P2AA 3HSTA 3ROJA 3BBRA 2MKZA 3LUYA 2FNCA 4IO7A 2UVIA 4MMPA 1NV5A 1P1QA 4HTGA 5I5PA 1FPBA 5TP9A 2OWZA 3N26A 2Z8FA 4NE4A 4PE3A 5ICTA 4R6HA 4Z0IA 4AB6A 5IKBA 4R6YA 5B7DA 2AIXA 2O69A 3MPLA 4EQ7A 4NGUA 4JVDA 1DSNA 3PUYE 4OFJA 2XXVA 2ALUA 5IM2A 4LP2B 4KCDA 1QULA 4QSEA 2VD3A 4EQBA 1R6ZA 5B70A 1I6BA 2DE2A 3K6WA 2UYFA 1PB9A 1Z7ME 3QIMA 2ZYMA 2ONSA 5H8NB 5ESYA 2Q9TA 3LR1A 1LBVA 4H6DA 1PBQA 4XKPA 4I62A 1MQHA 1YZ0A 4PFYA 4QSDA 5ET5A 5I58B 5AA4A 3EQ1A 2XXQA 2QS3A 1OQGA 5I7IA 5LDZA 4F3BA 4KYDA 1B05A 1OMPA 3VVDA 4I3EA 1EZOA 1Q1KA 3H3GA 3KN7A 3VLVA 3ILUB 5CMMA 2CZLA 2B4MA 5BUUA 3DP6A 3TTNA 4JWOA 2V3UA 1N3WA 2D5WA 4TLMB 5CMKA 1XHYA 3B6QA 3KOSA 5A5LA 1MXXA 2CZIA 1IMFA 4OENA 2A5SA 2PBWA 4QHQA 3VFJA 3QAXA 2O51A 3Q25A 2FHYA 1QUJA 5L9MA 3UGWA 1MY2A 4GWZA 2ONRA 2ZNUA 1EZ9A 3TZAA 2FIXA 5I2NB 4IY5A 1B2HA 4P11A 4NWDA 1LSTA 3GLBA 1TFAA 4OVSA 2F97A 4RY1A 2Q74A 3EHUA 2XWKA 1NNPA 2GH9A 1MH3A 2REJA 2NVUB 1MY1A 1B3FA 4YICA 3PD8A 1BKAA 4U22A 3MW0A 3RPWA 2I48A 1VDWA 2ZYNA 1PB8A 5FHOA 1OLCA 1VFEA 1YYZA 1PBPA 1FBCA 4ZE8A 4BLAA 4GLIA 3SEUA 3W9WA 4XKQA 3QK6A 1B4HA 2WBDA 1G0HA 4PDHA 4QSCA 2QVUA 4P1EA 4ZE9A 3GBBA 3H06B 4YAHX 5J16A 1KZ8A 4PAFA 1S50A 1P1NA 3MUQA 4KYEA 2NOOA 2VT5A 1FQFA 1FCKA 4GQOA 3SZPA 3OENA 4ESWA 1NV3A 4DZ1A 4FE8A 5DEXB 1FTOA 4LQ2A 2O84X 2HCAA 4OZ9A 2F6PA 1LB8A 2RCAA 4H8JA 4ELRA 4NF5B 5K2YA
chains in the Genus database with same CATH topology
5EYHA 3W9VA 5EYGA 1FPLA 2F3DA 1XI6A 2L5VA 5ET6A 2QVRA 5EQ9A 4XF5A 5IZ1A 3B50A 1QGXA 4GBWA 1KA1A 2KR0A 1NV0A 2DVZA 2XWVA 4XFEA 4F1VA 4GX3A 4HE2A 4OVTA 1FJ6A 1FRPA 1LBWA 4QBAA 3B8BA 2WX9A 4UABA 2CEYA 2XXKA 2HZKA 4X8RA 4P8BA 5T3JA 3KC0A 4PCDA 4AS5A 2Y5LA 4N91A 4PBHA 1RDZA 2QPQA 2OX3A 3MSTA 5DW8A 2PCRA 3FBPA 1NUZA 5EQ8A 4N8YA 4MNIA 4NAPA 2F5XA 1NUWA 1FPEA 4N17A 1SPIA 1FPFA 3IFCA 2WEFA 4AS4A 2DE4A 4QXDA 4H45A 1LEVA 4P47A 2CZKA 2WBBA 1EYIA 4PFRA 2CZHA 1FSAA 2HHMA 4DI4B 3D1RA 2QVVA 1FJ9A 5IZZA 1NUXA 3A29A 1FBFA 2QFLA 4PTKA 4X04A 1D9QA 4H46A 1NV1A 2DDKA 1JP4A 5IZ3B 4LN5A 4HE0A 4YZZA 3EKIA 4GWUA 4O94A 4HXVA 3BIGA 4HCYA 4MX6A 4I3YA 4MIJA 1DBZA 1NI9A 1FBDA 4PAIA 2WYKA 3T1BA 2FIEA 3RPLA 4NQ8A 4P9KA 1DK4A 4PGPA 2JJKA 2F3BA 2V4CA 4GWWA 4O8MA 4P56A 1FPIA 1FTAA 1FBHA 4NHBA 2VPNA 4JVCA 3RPLB 3LUZA 2ZZWA 4XEQA 2XA5A 2Y5KA 4PFIA 5F24A 3LV0A 4MAGA 4GX6A 3RYDA 4MCOA 5JK4A 2FBPA 1NV4A 1LBXA 2HZLA 4MNPA 4NX1A 5ET8A 4F1UA 5IGAA 3KBZA 1K9YA 4GWSA 3E78A 3ROJA 2MKZA 2ZZXA 4KXPA 1EYJA 4PC9A 4MMPA 1IMEA 1NV5A 5I5PA 1FPBA 4PDDA 1G0IA 3QMFA 2HPGA 4G61A 2OWZA 4PE3A 4P3LA 2ZZVA 4P1LA 4NGUA 4JVDA 5IZ3A 2B4LA 4MJOA 1FPKA 5IM2A 2PFZA 5EQ7A 4PF8A 4DI3D 1K9ZA 2DE2A 1IMBA 2XWOA 3PTYA 5ET7A 2FVZA 3NOHA 1INPA 5ESYA 2Q9TA 2P3VA 1LBVA 4MHFA 3IFAA 1DCUA 3ISPA 4I40A 1YZ0A 1FPDA 4PGNA 5ET5A 4GBVA 4IR8A 1NUYA 4PFBA 2R8TA 5I7IA 5LDZA 4PAKA 4X9TA 1FPJA 2CEXA 4I3EA 4NG7A 1IMDA 2B4MA 4N6KA 4N4UA 4F19A 4GWXA 4PETA 5J1DA 5FBPA 1NV6A 2XWIA 4F18A 5A5LA 1FPGA 2CZIA 2BJIA 2VPOA 1IMFA 4GX4A 4N6DA 5I3SA 3KC1A 1FBGA 3T0JA 2FHYA 1LBZA 4O7MA 4OANA 4NN3A 4GWZA 4NF0A 1RDXA 1RDYA 1EYKA 2FIXA 1FBPA 3MYUA 2HXRA 4MNCA 4OVSA 4HE1A 1Q9DA 3BIHA 2Q74A 2Q8MA 2PFYA 2XWKA 4PBQA 4M1VA 5EQAA 4OVPA 4YICA 3HFUA 3E79A 4MEVA 4N15A 1VDWA 1YXIA 3GYYA 1NV7A 1KA0A 4HCWA 4JVIA 1YYZA 1FBCA 5LTCA 4OVRA 1NV2A 2GQ1A 3W9WA 2P3NA 5CM6A 1IMAA 2WBDA 1IMCA 3U65A 1G0HA 4PDHA 1CNQA 2QVUA 4P1EA 5J16A 4PAFA 1KZ8A 2KQZA 1BK4A 1LBYA 2DE3A 2V3QA 4PF6A 4FBPA 2VT5A 4GWYA 4N81A 4O7IA 4OVQA 3SZPA 4OA4A 1NV3A 3CHGA 1AWBA 4N8GA 1FBEA 3FXBA 2WYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P47 A;  4O7M A;  4OAN A;  4NN3 A;  2ZZX A;  4PFR A;  4NF0 A;  4DI4 B;  4PC9 A;  4MMP A;  5I5P A;  4PDD A;  5IZZ A;  4XF5 A;  2HPG A;  4PE3 A;  3B50 A;  4MNC A;  4X04 A;  4P3L A;  4OVS A;  2XWV A;  2ZZV A;  4XFE A;  2PFY A;  4P1L A;  2XWK A;  4OVT A;  4LN5 A;  4PBQ A;  4NGU A;  4YZZ A;  4OVP A;  4YIC A;  2WX9 A;  4O94 A;  4UAB A;  4MEV A;  4MX6 A;  2CEY A;  4N15 A;  4MIJ A;  5IM2 A;  2XXK A;  2PFZ A;  3GYY A;  2HZK A;  4PAI A;  2WYK A;  4PF8 A;  4DI3 D;  4X8R A;  4NQ8 A;  4P9K A;  4P8B A;  4PGP A;  5LTC A;  4PCD A;  2XWO A;  4N91 A;  4OVR A;  2V4C A;  4PBH A;  5CM6 A;  4O8M A;  4MHF A;  4P56 A;  3U65 A;  4NHB A;  4PDH A;  2VPN A;  4P1E A;  4PGN A;  4N8Y A;  4PAF A;  4MNI A;  4PFB A;  4NAP A;  2ZZW A;  5I7I A;  4PAK A;  4PF6 A;  4XEQ A;  2CEX A;  2XA5 A;  4PFI A;  4NG7 A;  4MAG A;  4N17 A;  4MCO A;  4N6K A;  4N4U A;  4OVQ A;  4OA4 A;  2HZL A;  4PET A;  4MNP A;  2XWI A;  4NX1 A;  4N8G A;  2VPO A;  5IGA A;  4N6D A;  3FXB A;  2WYP A; 
#chains in the Genus database with same CATH topology
 3C31 A;  2XXY A;  5EYH A;  2ANJ A;  2XD2 A;  1FPL A;  4R73 A;  4ELO A;  4DCX A;  2GHA A;  4N6P A;  2FA7 A;  1L5T A;  2L5V A;  5ET6 A;  3EHT A;  3N6T A;  4X48 A;  2Q2C A;  2I4B A;  1LBB A;  3IOU A;  3B50 A;  4O3C A;  3HHF A;  4GX3 A;  3RQT A;  4QFP A;  1FRP A;  5AA1 A;  2ZMB A;  4C1T A;  4DDD A;  1BTJ A;  5ELV A;  3VXB A;  2CEY A;  3TTM A;  3UK4 A;  2XXK A;  2HZK A;  3K6X A;  5A5X B;  1LCF A;  1RYX A;  3CG1 A;  1OQH A;  1A7L A;  4PBH A;  4YMA A;  1JVY A;  1RDZ A;  3K2D A;  3HPI A;  1XOC A;  1LBC A;  3BFU A;  2E0S A;  3OSR A;  4G68 A;  2XXR A;  4NF8 A;  5EQ8 A;  4EQ9 A;  4JXI A;  1JET A;  4OYV A;  1NUW A;  5DYH A;  1MDP 1;  3E13 X;  4O3B A;  3PGF A;  3S9M C;  1MM7 A;  1KWH A;  3RTF B;  3PMW A;  1FQA A;  2GRV A;  3N5L A;  4NMY A;  1QVS A;  1CB6 A;  3IFC A;  2WEF A;  2ZYO A;  1NNF A;  4ZS9 A;  1B7Z A;  3H6U A;  4IO2 A;  4H45 A;  1LEV A;  4P47 A;  1ZJL A;  2CZK A;  4FEC A;  4ZZA A;  1POY 1;  4E0X A;  1Z7N E;  1BIY A;  3E9X A;  1B5I A;  1OVT A;  1FBF A;  1OIB A;  1JEU A;  4X04 A;  5KDT A;  3T9U A;  4NWC A;  1D4N A;  4LQ5 A;  2XXW A;  5IZ3 B;  4DCY A;  4LN5 A;  2D21 A;  4EF2 A;  3EKI A;  4GWU A;  1YTV A;  1AL3 A;  5ITO A;  4O94 A;  1EH3 A;  1FQE A;  4I3Y A;  3ZKL A;  3FVG A;  2H25 A;  3G7W A;  1NI9 A;  4PAI A;  2RC7 A;  3T1B A;  5KCJ B;  3IJX B;  2ONK E;  4NQ8 A;  3MZ1 A;  3KN3 A;  1Q35 A;  4IO6 A;  4JDF A;  2F3B A;  5I59 A;  1R9L A;  1MG1 A;  2V4C A;  3W15 C;  4H67 A;  4BDQ A;  4QFN A;  3GZG A;  2Y7R A;  1FTA A;  4NHB A;  1NMU A;  2Q2A A;  4YB7 A;  2Y7I A;  1URG A;  3RPL B;  4ZEB A;  3OXN A;  5KZT A;  3T9X B;  3PUZ E;  1NH8 A;  3KOT A;  2XA5 A;  4PFI A;  3KEI A;  5CI5 A;  3CI8 A;  3LV0 A;  4MAG A;  3RYD A;  4MCO A;  2FBP A;  3TTL A;  2QMW A;  3QYT A;  1XC1 A;  3OMB A;  2PYY A;  5FHM A;  3FIR A;  3SEY A;  3TEP A;  3DLN A;  1N0T A;  4Q0C A;  4GVO A;  1B32 A;  1F9B A;  4F1U A;  1IXG A;  5IGA A;  2PVU A;  3KBZ A;  2NWJ A;  3TCF A;  4GWS A;  5CRY A;  2OBG A;  2AYS A;  2ZZX A;  4X1D A;  4KXP A;  3MP6 A;  4PC9 A;  1CE2 A;  2GHB A;  2FYI A;  3PPN A;  3V8X B;  3K6U A;  3VE1 B;  1SI1 A;  2HPG A;  4N13 A;  4G8M A;  4IY6 A;  5AA2 B;  4LVQ A;  2ZZV A;  3C33 A;  3DEL B;  3PPQ A;  1FPK A;  2PFZ A;  4LAT A;  4ZEI A;  1GV8 A;  3IO6 A;  1MY0 A;  3IO4 A;  4ZEF A;  2QS1 A;  5CBR A;  3PTY A;  3NOH A;  3E3K A;  2OJT A;  1INP A;  1JW4 A;  2OWT A;  1SYH A;  3IFA A;  1DCU A;  1Y4C A;  1JVX A;  1FPD A;  5ISU A;  2V3T A;  4IR8 A;  2V84 A;  2XXT A;  1SDX A;  4PFU A;  4FAT A;  1Y3N A;  3HV1 A;  3TEL A;  5FHN A;  1LFH A;  3OEL A;  3R7X A;  3CVG A;  4JWX A;  4NG7 A;  1DPP A;  5CMB A;  2XXP A;  4N6K A;  4LZ7 A;  1US4 A;  2DVC A;  3O6G A;  3PPO A;  1UIV A;  1MQD A;  1NV6 A;  4PFW A;  4F18 A;  1LLS A;  1FPG A;  2BJI A;  5EHM A;  2DWH A;  1ZBM A;  4RNS A;  3TOD A;  1ZU0 A;  4GX4 A;  2Z8E A;  5AE4 A;  3TKD A;  3QUJ A;  3WAF A;  3N94 A;  1B3L A;  1FBG A;  3TCH A;  3FV1 A;  1RDX A;  3T9V A;  3T93 B;  1EYK A;  4IO3 A;  1MQG A;  1DTZ A;  2P0S A;  3FV2 A;  3PPR A;  4Q30 B;  5AA3 A;  3RY3 A;  2HXR A;  4R74 A;  3RN8 A;  4GFR A;  4FOR A;  3BIH A;  1EZP A;  4OET A;  3IOV A;  4RYA A;  2CMO A;  3RGY A;  2NUV A;  3E79 A;  2Z23 A;  1B9J A;  3HCQ A;  2YLN A;  2E1S A;  1Y1M A;  3S9L C;  2G29 A;  1B3E A;  3PUX E;  3C34 A;  2I49 A;  4G8H A;  4KI0 E;  2W7Y A;  3TDJ A;  2BJJ X;  2O7I A;  2GQ1 A;  1ZIU A;  3Q26 A;  3B6T A;  4POW A;  1IMA A;  1NL5 A;  4NF4 A;  4OVJ A;  1IMC A;  3IB0 A;  4NED A;  5EYF A;  2DYX A;  4ESX A;  2DXR A;  2PT2 A;  2OZZ A;  5ITP A;  1SBP A;  4RPO A;  1ATG A;  1FQB A;  2F78 A;  1FTL A;  5I2K A;  4FBP A;  2I0B A;  3N6U A;  1LGB C;  4OHN A;  3LSL A;  4YB5 A;  4OVQ A;  2XX9 A;  2XD3 A;  4N8G A;  1O64 A;  3IB2 A;  3KJT A;  3S9E A;  4KD5 A;  3TFL A;  1NNT A;  3DP4 A;  4OXV A;  2WYP A;  1H3D A;  4IO5 A;  4BDN A;  1GVC A;  1BP5 A;  1DMB A;  1IXC A;  1B51 A;  4MF3 A;  1QUK A;  2QVR A;  3MBP A;  5EQ9 A;  1B58 A;  3KN8 A;  4R2B A;  5CBS A;  3AXF A;  5IZ1 A;  5A5X A;  3I5O A;  3HHG A;  1MM6 A;  5H8Q B;  2AL4 A;  1KA1 A;  2IA4 A;  4GBW A;  4ZEC A;  1LFG A;  2DVZ A;  2XWV A;  4XFE A;  4F1V A;  1UQW A;  5JTY A;  4N07 A;  3TPA A;  4ZDM A;  3V89 B;  4M4G A;  4FIM A;  1Y3P A;  3FZV A;  2I3W A;  1WOD A;  1ZTY A;  2V93 A;  1B7H A;  3PMV A;  4ZZE A;  4ELQ A;  4H65 A;  4RXL A;  1WVJ A;  4FAJ A;  3ODB A;  3RLF E;  2RCB A;  1MRP A;  3S4U A;  3K4U A;  1MPD A;  2ABH A;  1RYO A;  2QPQ A;  4U1O A;  1LB9 A;  1D9Y A;  3MST A;  5DW8 A;  3MWB A;  4MBP A;  3T22 A;  2Y84 A;  3FBP A;  4N8Y A;  4AQ4 A;  3SKP A;  1MH4 A;  1FPE A;  3SES A;  2Y7K A;  4N17 A;  4TOZ A;  3FGS A;  4FED A;  1PEB A;  4WEP A;  2V25 A;  4LUB A;  3OO7 A;  1QKB A;  1FPF A;  2HEU A;  3HN0 A;  4G77 A;  3CIJ A;  2F7C A;  3G3G A;  2ZXT A;  2H9B A;  1O7T A;  2B65 A;  2ESN A;  4IGT A;  3CFL A;  4THI A;  1EYI A;  1N7X A;  3C4M A;  2CZH A;  4YKI A;  4DLD A;  3TUS A;  1FSA A;  3FXU A;  2XXH A;  1FJ9 A;  1NFT A;  3A29 A;  2YPN A;  4U2R A;  1B0L A;  2QFL A;  3Q29 A;  5KCJ A;  1UTB A;  4PTK A;  1Y3Q A;  3TAJ A;  4U23 A;  1HSE A;  3MZ9 A;  2DDK A;  1Y20 A;  2A5T B;  1JP4 A;  5HPQ A;  4H8I A;  4YZZ A;  1B46 A;  2DS9 A;  2I3V A;  3MVW A;  2RF1 A;  3PUV E;  2GFE A;  3BIG A;  1II5 A;  3FD3 A;  4I9D A;  1DBZ A;  4EF1 A;  3RPL A;  5IAI A;  3Q27 A;  4OMB A;  1DK4 A;  4BDR A;  4OEU A;  2H5Y A;  1WDN A;  3VVE A;  4MLV A;  4OEV A;  3F11 A;  5AA4 B;  3O2A A;  5K2X A;  1PDA A;  4JVC A;  2ZZW A;  5AA2 D;  3CRB A;  4XEQ A;  3O6I A;  2F7A A;  4G4P A;  1QKA A;  1IXH A;  4OER A;  3KGC A;  2HZL A;  2I6E A;  2R9J A;  4NX1 A;  3PV0 E;  3CG3 A;  3OEM A;  1PB7 A;  3KJ7 A;  1XVY A;  3U1O A;  5AA2 A;  4C0R A;  2QS2 A;  4WED A;  4PE5 B;  3T96 B;  1USY E;  1EYJ A;  1IME A;  3LSW A;  1G0I A;  2Q89 A;  4H1X A;  3QMF A;  5L8D A;  5TPA A;  1TWY A;  2PT1 A;  1I6A A;  4OWD A;  3IOW A;  4YKJ A;  4K3F A;  2AL5 A;  4WKM A;  2B4L A;  4MJO A;  3O28 A;  1P1U A;  2OLB A;  5EQ7 A;  3IK6 B;  4PF8 A;  4DI3 D;  5I56 A;  4QFK A;  3UP9 A;  3G3H A;  4O3A A;  5EHS A;  2XWO A;  4EUO A;  1N76 A;  1D3K A;  1SVX B;  2UVG A;  2P3V A;  4MHF A;  3U93 A;  4Z7E A;  3FJ7 A;  3TQW A;  4I40 A;  4RJZ A;  1QW0 A;  1B7U A;  4ECF A;  5TU0 A;  5DVJ A;  3B7D A;  1NUY A;  4LON B;  4PFB A;  1A99 A;  4PAK A;  3O97 A;  1B5J A;  5DT6 A;  4F31 B;  4N4U A;  3LSX A;  3JYR A;  2F35 A;  4F19 A;  4GWX A;  3EHS A;  4PET A;  5J1D A;  4R72 A;  3FUZ A;  1AOV A;  5I57 A;  4G2Z A;  2R6G E;  4N6D A;  2B3B A;  4LZ5 A;  3T0J A;  4O7M A;  4OAN A;  4NN3 A;  3RT8 A;  4NF0 A;  1JW5 A;  1RDY A;  3MVY A;  3PUW E;  3L6H A;  2DWI A;  2RC9 A;  1MY3 A;  2DP8 A;  1FBP A;  3R6U A;  2ZNT A;  2H99 A;  3EN3 A;  4MNC A;  4F22 A;  4TLL B;  2PFY A;  2M8C A;  3OO9 A;  4PBQ A;  5HBC A;  5EQA A;  2DOJ A;  1T0K A;  3FAS A;  3HFU A;  3P7I A;  4MEV A;  1M5F A;  1B0H A;  3DP8 A;  4OFO A;  4N15 A;  3MPK A;  2Y7W A;  1M5C A;  3L6G A;  4IB2 A;  4KYS A;  3TMG A;  4YKK A;  1RKM A;  4RK9 A;  5LTC A;  4F1Y A;  3ZS6 A;  3QSL A;  3GBA A;  4OES A;  4QFO A;  1FTJ A;  2PX1 A;  4ELP A;  4EDP A;  3TQL A;  5H8N A;  4NF8 B;  1CNQ A;  3KBR A;  3BKI B;  5I58 A;  2V3Q A;  1URD A;  4PP0 A;  1SYI A;  1ELJ A;  4MH5 A;  2QJE A;  3H03 A;  2R71 A;  4O7I A;  4OA4 A;  3CHG A;  3KZG A;  3SET A;  3OEK A;  2RIN A;  1AWB A;  1FTK A;  3G3I A;  3IB1 A;  3T66 A;  4H0W A;  4GIZ A;  3CFZ A;  1NNK A;  1SD3 A;  4Q8R A;  5H8Q A;  5H8H B;  5EYG A;  2QRY A;  5DVI A;  1J1N A;  4R6K A;  2XXU A;  4FEB A;  4U4X A;  1AIV A;  5H8S A;  3K6V A;  5KDT B;  3ZSF A;  5HM4 B;  5I2N A;  5M2V A;  1H76 A;  1TFD A;  3U8Q A;  1NV0 A;  1HSJ A;  1ANF A;  4LZ8 A;  2UYE A;  1LBW A;  4QBA A;  1P99 A;  4UAB A;  3CR9 A;  2DQV A;  3UA8 A;  1N84 A;  4RPN A;  4H5F A;  2DXY A;  3KSX A;  1B6H A;  3O6H A;  1OVB A;  4X8R A;  4P8B A;  1UTH B;  5I59 B;  5T3J A;  4XTC Q;  4PCD A;  4AS5 A;  3SER A;  5ICQ A;  4N91 A;  3R26 A;  1LCT A;  2PMS A;  4I8C A;  4AB5 A;  3PMX A;  3TYH A;  3A3C A;  2OWS A;  4NF6 B;  3MP8 A;  1VE4 A;  3H6T A;  4MNI A;  1POT A;  4NAP A;  4QFL A;  3VDF A;  2F5X A;  2XX7 A;  3MC2 A;  3A3U A;  5H8F B;  1B1X A;  4P0I A;  3V83 A;  4UA8 A;  3K1N A;  1MS7 A;  1JW1 A;  2DWA A;  5F7V A;  4DIG A;  3H6V A;  3A09 A;  4L17 A;  1SW5 A;  1M5B A;  3U92 A;  5FTH A;  3G3K A;  2UXA A;  5DEX A;  4AS4 A;  4R9G A;  4UAC A;  2X7Q A;  3M3L A;  5I84 A;  4NF5 A;  4DE8 A;  1H43 A;  4PFR A;  2A5T A;  1LAG E;  2HHM A;  3I3V A;  4DI4 B;  4G68 C;  4EXL A;  2HAV A;  3BFT A;  1M5E A;  1IIT A;  3RTW B;  1A8F A;  4OQO A;  3M8U A;  1D9Q A;  4OFL A;  1DPE A;  4H46 A;  2OCU A;  4F3S A;  3S9N C;  1Y1Z A;  2Z22 A;  2OK2 A;  1P1W A;  1JEV A;  3QUF A;  4HXV A;  4HCY A;  4MX6 A;  4XKN A;  4LA9 A;  4MIJ A;  1XT8 A;  1O63 A;  4DXB A;  1FBD A;  2WYK A;  4F2Q A;  3K01 A;  2FIE A;  1PC3 A;  4DXC A;  3USD A;  4PGP A;  1P1O A;  2JJK A;  3VV5 A;  4ZEK A;  4QRZ A;  4YKP A;  4O8M A;  4P56 A;  1YAE A;  3MP1 A;  3ECR A;  2HXW A;  4E0W A;  4HW8 A;  3KSJ A;  3THI A;  3UOR A;  1A54 A;  3LUZ A;  4F3P A;  1D9V A;  1SQY A;  3CSG A;  4IO4 A;  1VSO A;  1OLA A;  1ZMG A;  5F24 A;  3ILT B;  5LOM A;  2YJP A;  2LAO A;  3KG2 A;  5JK4 A;  3IOT A;  3D4C A;  3OD7 A;  4EXK A;  1MQJ A;  4MFI A;  4U1Z A;  1NH7 A;  4U4S A;  1N04 A;  3U72 A;  3RT6 B;  1K9Y A;  3E78 A;  4KR5 A;  4JWY A;  3C35 A;  5DTB A;  1QUI A;  2NXO A;  3MJN A;  1VR5 A;  3B6W A;  4PDD A;  5BWJ A;  1ZLQ A;  1SW4 A;  1GGG A;  3IR1 A;  4GD5 A;  1Y4T A;  4G61 A;  4JB7 A;  3FXR A;  3MVZ A;  1B40 A;  4P3L A;  4PFT A;  2KLF A;  1I6Q A;  4GF8 A;  4P1L A;  4P0G A;  1LAF E;  2HQ0 A;  4KQP A;  4RA1 A;  5IZ3 A;  4HS7 A;  3C36 A;  1AMF A;  2DWJ A;  4GL8 A;  1R1N A;  2B3F A;  4H5G A;  5TP9 B;  1IIW A;  4GRK A;  2ZYK A;  1K9Z A;  4KFQ A;  1IMB A;  4GXA A;  3C32 A;  5ET7 A;  4NF4 B;  1R9Q A;  2FVZ A;  3FVO A;  5L9O A;  3VVF A;  3IAZ A;  3ISP A;  3CFX A;  1TXF A;  4PGN A;  4GBV A;  3K02 A;  5I2K B;  1H44 A;  2R8T A;  1FW0 A;  4X9T A;  1FPJ A;  2CEX A;  2X7P A;  3K0V A;  2D3I A;  2O7U A;  2XXX A;  2RKM A;  4MLQ A;  1IMD A;  2F7B A;  2VHA A;  2G93 A;  4NTL A;  4XIG Q;  1USY H;  3MQ9 A;  5FBP A;  2XWI A;  4C1U A;  2VPO A;  4XXU A;  3HO7 A;  4YB6 A;  3FVN A;  1A55 A;  5I3S A;  3KC1 A;  1MDQ A;  3IJO B;  4BDL A;  3G3J A;  1LBZ A;  4ISU A;  1DTG A;  3JV9 A;  3MAM A;  4R9F A;  1MXY A;  4ONY A;  2F34 A;  3SEW A;  2QSX A;  3FXQ A;  3EPE A;  4R2F A;  3UN6 A;  3MYU A;  1LAH E;  3G3F A;  3GXA A;  5JTY B;  5CMC A;  2IEE A;  4HE1 A;  3UIF A;  1MXZ A;  1Q9D A;  3MVX A;  1LAX A;  2O68 A;  2Q8M A;  3ONM A;  4M1V A;  4OVP A;  3EF7 A;  3VXC A;  4WXJ A;  3O29 A;  4FJP A;  3IX1 A;  2XX8 A;  3OSQ A;  5FTI A;  1YXI A;  3GYY A;  1NV7 A;  4GWO A;  5F1Q A;  4F29 A;  1KA0 A;  4HCW A;  3DM0 A;  4JVI A;  2XHD A;  4OVR A;  1B52 A;  2F8D A;  1NV2 A;  3K00 A;  1FQD A;  4POX A;  2P3N A;  1MXV A;  4JSD A;  5CM6 A;  1M5D A;  2O1L A;  4F2O A;  3U65 A;  1MQI A;  1VFD A;  3H7M A;  3SDF A;  2KQZ A;  1BK4 A;  1LBY A;  2DE3 A;  4G8N A;  3I6V A;  4JBZ A;  4PF6 A;  1GR2 A;  3QXM A;  3TTK A;  2HFB A;  3VLU A;  2Z8D A;  4GWY A;  4QF9 A;  3PPP A;  4N81 A;  1IQ7 A;  5H8H A;  3T9H B;  1SW1 A;  1S9T A;  1A40 A;  1XVX A;  1URS A;  3SEX A;  3M3K A;  4R75 A;  4ZED A;  1FBE A;  2VOZ A;  3FVK A;  3FXB A;  4TQU Q;  3K1M A;  3W9V A;  4JSO A;  4F3G A;  3OO6 A;  2THI A;  3H4Z A;  2F3D A;  1XI6 A;  3LBS A;  3FAT A;  1UTB B;  4XF5 A;  2H4I A;  4ND9 A;  5DVF A;  1GTK A;  2DSF A;  1QGX A;  1UTH A;  2KR0 A;  2Y7P A;  2I58 A;  4HE2 A;  2WKY A;  4OVT A;  1US5 A;  1FJ6 A;  1HSL A;  1A8E A;  3B8B A;  1IXI A;  3PU5 A;  2WX9 A;  1SW2 A;  1IEJ A;  4NF6 A;  2Q8J A;  4YU0 A;  3RUM A;  3CSB A;  3Q28 A;  3KC0 A;  2Y5L A;  1MPB A;  1ZKB A;  3JZJ A;  5H8F A;  2XXI A;  1YCJ A;  2OX3 A;  4BDO A;  2I0C A;  4KCC A;  3TCG A;  1B1H A;  2PCR A;  2F6G A;  1JQF A;  2QMX A;  5CC2 A;  1IZ1 A;  1JNF A;  3TTR A;  1YPN A;  4OTE A;  1NUZ A;  3ZKK A;  1XS5 A;  4XKR A;  1TT1 A;  3H6W A;  3S2V A;  1IUD A;  4Q5T A;  3K1P A;  2Q88 A;  4GXS B;  4GL0 A;  1S7Y A;  3MZB A;  2VGQ A;  1FQC A;  1MXW A;  4DXU A;  2VP1 A;  3LSF B;  1I69 A;  2QL3 A;  4RK2 A;  2UVH A;  3M3F A;  1SPI A;  3VLW A;  1N7W A;  3D4G A;  4G68 B;  1FTM A;  2O1M A;  1NKX A;  2DE4 A;  1EU8 A;  4F39 A;  1MPC A;  4QXD A;  1Y9U A;  3FJG A;  2WBB A;  4IGR A;  1N3X A;  3D1R A;  2QVV A;  4KPT A;  4PQJ A;  3FJM A;  3PD9 A;  4I1D A;  5TPA B;  1B4Z A;  5IZZ A;  1NUX A;  2P1S A;  3OOA A;  1SI0 A;  2ZNS A;  3O9P A;  3SEV A;  1B3G A;  1NV1 A;  4X1B A;  3IOR A;  4HE0 A;  2H98 A;  2RC8 A;  1H45 A;  1BLF A;  2O6A A;  1LFI A;  1DOT A;  5I56 B;  2QS4 A;  4YMB A;  4P9K A;  2HAU A;  3KFM A;  2F36 A;  3E4R A;  5JEI A;  4GOT A;  3U94 A;  4U21 A;  3RNN A;  3C9H A;  4GWW A;  5L9S A;  1FPI A;  3IL1 B;  3WAE A;  1B5H A;  1FBH A;  2VPN A;  4BDM A;  2REG A;  1AH5 A;  3OO8 A;  2I4C A;  2X26 A;  1B3H A;  2Y5K A;  1MXU A;  1MY4 A;  1UIU A;  2VD2 A;  4GX6 A;  5I57 B;  4KHZ E;  1NV4 A;  1LBX A;  3V5A A;  4MNP A;  5ET8 A;  3O66 A;  2UVJ A;  3LC8 A;  1QJM A;  2P2A A;  3HST A;  3ROJ A;  3BBR A;  2MKZ A;  3LUY A;  2FNC A;  4IO7 A;  2UVI A;  4MMP A;  1NV5 A;  1P1Q A;  4HTG A;  5I5P A;  1FPB A;  5TP9 A;  2OWZ A;  3N26 A;  2Z8F A;  4NE4 A;  4PE3 A;  5ICT A;  4R6H A;  4Z0I A;  4AB6 A;  5IKB A;  4R6Y A;  5B7D A;  2AIX A;  2O69 A;  3MPL A;  4EQ7 A;  4NGU A;  4JVD A;  1DSN A;  3PUY E;  4OFJ A;  2XXV A;  2ALU A;  5IM2 A;  4LP2 B;  4KCD A;  1QUL A;  4QSE A;  2VD3 A;  4EQB A;  1R6Z A;  5B70 A;  1I6B A;  2DE2 A;  3K6W A;  2UYF A;  1PB9 A;  1Z7M E;  3QIM A;  2ZYM A;  2ONS A;  5H8N B;  5ESY A;  2Q9T A;  3LR1 A;  1LBV A;  4H6D A;  1PBQ A;  4XKP A;  4I62 A;  1MQH A;  1YZ0 A;  4PFY A;  4QSD A;  5ET5 A;  5I58 B;  5AA4 A;  3EQ1 A;  2XXQ A;  2QS3 A;  1OQG A;  5I7I A;  5LDZ A;  4F3B A;  4KYD A;  1B05 A;  1OMP A;  3VVD A;  4I3E A;  1EZO A;  1Q1K A;  3H3G A;  3KN7 A;  3VLV A;  3ILU B;  5CMM A;  2CZL A;  2B4M A;  5BUU A;  3DP6 A;  3TTN A;  4JWO A;  2V3U A;  1N3W A;  2D5W A;  4TLM B;  5CMK A;  1XHY A;  3B6Q A;  3KOS A;  5A5L A;  1MXX A;  2CZI A;  1IMF A;  4OEN A;  2A5S A;  2PBW A;  4QHQ A;  3VFJ A;  3QAX A;  2O51 A;  3Q25 A;  2FHY A;  1QUJ A;  5L9M A;  3UGW A;  1MY2 A;  4GWZ A;  2ONR A;  2ZNU A;  1EZ9 A;  3TZA A;  2FIX A;  5I2N B;  4IY5 A;  1B2H A;  4P11 A;  4NWD A;  1LST A;  3GLB A;  1TFA A;  4OVS A;  2F97 A;  4RY1 A;  2Q74 A;  3EHU A;  2XWK A;  1NNP A;  2GH9 A;  1MH3 A;  2REJ A;  2NVU B;  1MY1 A;  1B3F A;  4YIC A;  3PD8 A;  1BKA A;  4U22 A;  3MW0 A;  3RPW A;  2I48 A;  1VDW A;  2ZYN A;  1PB8 A;  5FHO A;  1OLC A;  1VFE A;  1YYZ A;  1PBP A;  1FBC A;  4ZE8 A;  4BLA A;  4GLI A;  3SEU A;  3W9W A;  4XKQ A;  3QK6 A;  1B4H A;  2WBD A;  1G0H A;  4PDH A;  4QSC A;  2QVU A;  4P1E A;  4ZE9 A;  3GBB A;  3H06 B;  4YAH X;  5J16 A;  1KZ8 A;  4PAF A;  1S50 A;  1P1N A;  3MUQ A;  4KYE A;  2NOO A;  2VT5 A;  1FQF A;  1FCK A;  4GQO A;  3SZP A;  3OEN A;  4ESW A;  1NV3 A;  4DZ1 A;  4FE8 A;  5DEX B;  1FTO A;  4LQ2 A;  2O84 X;  2HCA A;  4OZ9 A;  2F6P A;  1LB8 A;  2RCA A;  4H8J A;  4ELR A;  4NF5 B;  5K2Y A; 
#chains in the Genus database with same CATH homology
 5EYH A;  3W9V A;  5EYG A;  1FPL A;  2F3D A;  1XI6 A;  2L5V A;  5ET6 A;  2QVR A;  5EQ9 A;  4XF5 A;  5IZ1 A;  3B50 A;  1QGX A;  4GBW A;  1KA1 A;  2KR0 A;  1NV0 A;  2DVZ A;  2XWV A;  4XFE A;  4F1V A;  4GX3 A;  4HE2 A;  4OVT A;  1FJ6 A;  1FRP A;  1LBW A;  4QBA A;  3B8B A;  2WX9 A;  4UAB A;  2CEY A;  2XXK A;  2HZK A;  4X8R A;  4P8B A;  5T3J A;  3KC0 A;  4PCD A;  4AS5 A;  2Y5L A;  4N91 A;  4PBH A;  1RDZ A;  2QPQ A;  2OX3 A;  3MST A;  5DW8 A;  2PCR A;  3FBP A;  1NUZ A;  5EQ8 A;  4N8Y A;  4MNI A;  4NAP A;  2F5X A;  1NUW A;  1FPE A;  4N17 A;  1SPI A;  1FPF A;  3IFC A;  2WEF A;  4AS4 A;  2DE4 A;  4QXD A;  4H45 A;  1LEV A;  4P47 A;  2CZK A;  2WBB A;  1EYI A;  4PFR A;  2CZH A;  1FSA A;  2HHM A;  4DI4 B;  3D1R A;  2QVV A;  1FJ9 A;  5IZZ A;  1NUX A;  3A29 A;  1FBF A;  2QFL A;  4PTK A;  4X04 A;  1D9Q A;  4H46 A;  1NV1 A;  2DDK A;  1JP4 A;  5IZ3 B;  4LN5 A;  4HE0 A;  4YZZ A;  3EKI A;  4GWU A;  4O94 A;  4HXV A;  3BIG A;  4HCY A;  4MX6 A;  4I3Y A;  4MIJ A;  1DBZ A;  1NI9 A;  1FBD A;  4PAI A;  2WYK A;  3T1B A;  2FIE A;  3RPL A;  4NQ8 A;  4P9K A;  1DK4 A;  4PGP A;  2JJK A;  2F3B A;  2V4C A;  4GWW A;  4O8M A;  4P56 A;  1FPI A;  1FTA A;  1FBH A;  4NHB A;  2VPN A;  4JVC A;  3RPL B;  3LUZ A;  2ZZW A;  4XEQ A;  2XA5 A;  2Y5K A;  4PFI A;  5F24 A;  3LV0 A;  4MAG A;  4GX6 A;  3RYD A;  4MCO A;  5JK4 A;  2FBP A;  1NV4 A;  1LBX A;  2HZL A;  4MNP A;  4NX1 A;  5ET8 A;  4F1U A;  5IGA A;  3KBZ A;  1K9Y A;  4GWS A;  3E78 A;  3ROJ A;  2MKZ A;  2ZZX A;  4KXP A;  1EYJ A;  4PC9 A;  4MMP A;  1IME A;  1NV5 A;  5I5P A;  1FPB A;  4PDD A;  1G0I A;  3QMF A;  2HPG A;  4G61 A;  2OWZ A;  4PE3 A;  4P3L A;  2ZZV A;  4P1L A;  4NGU A;  4JVD A;  5IZ3 A;  2B4L A;  4MJO A;  1FPK A;  5IM2 A;  2PFZ A;  5EQ7 A;  4PF8 A;  4DI3 D;  1K9Z A;  2DE2 A;  1IMB A;  2XWO A;  3PTY A;  5ET7 A;  2FVZ A;  3NOH A;  1INP A;  5ESY A;  2Q9T A;  2P3V A;  1LBV A;  4MHF A;  3IFA A;  1DCU A;  3ISP A;  4I40 A;  1YZ0 A;  1FPD A;  4PGN A;  5ET5 A;  4GBV A;  4IR8 A;  1NUY A;  4PFB A;  2R8T A;  5I7I A;  5LDZ A;  4PAK A;  4X9T A;  1FPJ A;  2CEX A;  4I3E A;  4NG7 A;  1IMD A;  2B4M A;  4N6K A;  4N4U A;  4F19 A;  4GWX A;  4PET A;  5J1D A;  5FBP A;  1NV6 A;  2XWI A;  4F18 A;  5A5L A;  1FPG A;  2CZI A;  2BJI A;  2VPO A;  1IMF A;  4GX4 A;  4N6D A;  5I3S A;  3KC1 A;  1FBG A;  3T0J A;  2FHY A;  1LBZ A;  4O7M A;  4OAN A;  4NN3 A;  4GWZ A;  4NF0 A;  1RDX A;  1RDY A;  1EYK A;  2FIX A;  1FBP A;  3MYU A;  2HXR A;  4MNC A;  4OVS A;  4HE1 A;  1Q9D A;  3BIH A;  2Q74 A;  2Q8M A;  2PFY A;  2XWK A;  4PBQ A;  4M1V A;  5EQA A;  4OVP A;  4YIC A;  3HFU A;  3E79 A;  4MEV A;  4N15 A;  1VDW A;  1YXI A;  3GYY A;  1NV7 A;  1KA0 A;  4HCW A;  4JVI A;  1YYZ A;  1FBC A;  5LTC A;  4OVR A;  1NV2 A;  2GQ1 A;  3W9W A;  2P3N A;  5CM6 A;  1IMA A;  2WBD A;  1IMC A;  3U65 A;  1G0H A;  4PDH A;  1CNQ A;  2QVU A;  4P1E A;  5J16 A;  4PAF A;  1KZ8 A;  2KQZ A;  1BK4 A;  1LBY A;  2DE3 A;  2V3Q A;  4PF6 A;  4FBP A;  2VT5 A;  4GWY A;  4N81 A;  4O7I A;  4OVQ A;  3SZP A;  4OA4 A;  1NV3 A;  3CHG A;  1AWB A;  4N8G A;  1FBE A;  3FXB A;  2WYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...