4NGUA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_1548), target efi-510103, with bound d-ala-d-ala
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
317
structure length
317
Chain Sequence
MAAAMTVKMSYNGPPSLEDNAVHAFATTFKELVEKESGGGIVIDLYPNSQLGNEQQRMEQVMTGPMINVASFGGMETVFPEMFATNVPFMFESYAAAHEFFDNSSFMDKAGKELRSRTGIELLAVVEEGGFIAFTSKKPVRSPADFKGMKFRAMDASQVAMYEAFGASGTPIPWTEVYLALKTGVADGQMNPPTYIIIGSLYEVQDHLTLANVQYSDQFLLINGELLDSLPDSQRQVIRKAAHEANVKTRQFVESQVDERVKFLASKGMTVYTPTAEELAQFKELGSPSYIKWLSGQIDTAWIDHAMEDARKANEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio alaskensis
molecule tags Transport protein
total genus 102
structure length 317
sequence length 317
ec nomenclature
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4nguA00
4MHFA 4OA4A 4O94A 4P1EA 4PCDA 2PFYA 3FXBA 4PF8A 4PF6A 4MMPA 3GYYA 2ZZVA 2PFZA 4PGNA 4OVQA 4YZZA 2VPOA 4YICA 2XA5A 4XEQA 4X04A 5I5PA 2HZKA 2ZZWA 5IZZA 4X8RA 4MEVA 4NG7A 4PETA 2XWIA 2WX9A 2XWOA 3B50A 4PBHA 4XF5A 4DI4B 4P1LA 4OVPA 2HPGA 4N8GA 5I7IA 2HZLA 2VPNA 2ZZXA 4O7MA 4OVSA 4NN3A 4PFRA 4P47A 4P56A 2XXKA 4NHBA 4PBQA 2XWVA 4MX6A 4PFIA 4MNCA 2V4CA 4PC9A 2CEYA 4PDDA 4XFEA 4PFBA 4PAFA 4NGUA 4MNPA 5CM6A 3U65A 4NQ8A 4NX1A 2WYKA 4NF0A 4MCOA 4LN5A 4PDHA 4N17A 4N4UA 4O8MA 4N8YA 4OVRA 4P8BA 4MIJA 4UABA 4NAPA 5IGAA 4DI3D 4N15A 5IM2A 4PAIA 4P9KA 4N6DA 4N6KA 4PE3A 5LTCA 4N91A 4PGPA 4OVTA 4MNIA 4MAGA 4OANA 2XWKA 4PAKA 2CEXA 4P3LA 2WYPA
chains in the Genus database with same CATH superfamily
3K01A 3SEWA 1QJMA 4MH5A 3EN3A 1B3LA 2AIXA 4LATA 2I0CA 3VXCA 2XXQA 1Y20A 3FJ7A 3O28A 1IUDA 1BKAA 2X26A 3PPRA 1FPKA 4P0GA 4YMAA 5I5PA 2OBGA 4ZZAA 1GV8A 4GL0A 3CFZA 4F39A 1LBWA 1RYXA 5I56A 1KWHA 2UVJA 1MXVA 3IFCA 1PB7A 1M5FA 5HPQA 3QMFA 4BDOA 3KOTA 4GWYA 1IMAA 3C4MA 3VVEA 4P56A 4AS5A 3FATA 1SYHA 1LLSA 1DTGA 1AIVA 4PDDA 3SKPA 4N13A 3TTRA 3MVXA 2XD3A 5ELVA 1FBPA 4OQOA 4NQ8A 4G8HA 4N81A 4NF0A 4NF4B 1VE4A 4H8IA 4XKNA 3MP6A 5EQ7A 3K6XA 3FD3A 4GXSB 2O69A 3K1MA 3OMBA 1UIUA 3LSXA 3HFUA 2QSXA 3PUZE 4KYEA 4GF8A 3TELA 3Q25A 1SW5A 1D9QA 1TFAA 2P2AA 3O29A 4YAHX 4F1UA 2OCUA 4QFOA 2PFYA 1IQ7A 1CE2A 1B46A 4OESA 4C1TA 4YB5A 4NF4A 3T9UA 3U92A 1FTJA 1EH3A 4HW8A 3LBSA 2H25A 5ESYA 2XXVA 3IB0A 5CRYA 4X8RA 3NOHA 2KQZA 2XD2A 4MFIA 1UTBA 1N3WA 4DDDA 2Y7PA 4C1UA 2CMOA 4QSCA 3V8XB 2VOZA 4LQ2A 5LDZA 2QS2A 2QVUA 1DPEA 1URGA 3U93A 5L9SA 1HSEA 4OVSA 1Y3PA 4P47A 5JTYB 1SBPA 2QS1A 2XWVA 3KSXA 1PB8A 1YPNA 3GZGA 5CMCA 1B1XA 1FQDA 3LSWA 3QUJA 5JEIA 5IAIA 1GR2A 2CEYA 3PPNA 2DXRA 2F7AA 4PFWA 3MVYA 4U4XA 3IB1A 2DE2A 2AYSA 5AE4A 1A8FA 4GBWA 4F22A 4N17A 3VFJA 5DW8A 4R2BA 4U23A 3K02A 2R9JA 1NV3A 4OXVA 4RNSA 5JTYA 3H6WA 3C34A 4GIZA 2CZKA 3QAXA 3W9VA 4OZ9A 3WAFA 3L6GA 1LGBC 2A5TA 3G3HA 1QULA 1PDAA 2OZZA 5L8DA 1N7XA 1RDZA 1TT1A 4X48A 3O2AA 3U1OA 5KCJA 5DTBA 1B6HA 2Q9TA 3BBRA 3OEMA 4DCYA 4QFKA 4YZZA 2Z8DA 2F6GA 4PFUA 4FECA 1P1QA 3R6UA 4MJOA 4ISUA 4TLMB 4X9TA 3B50A 2XWOA 4GWXA 2ZNTA 2KLFA 2R71A 2DDKA 1LB8A 3VDFA 1MS7A 3TQLA 1FBEA 2XHDA 2ZZXA 1XVYA 4O7MA 4NE4A 3LSFB 3VE1B 4R74A 3DLNA 5CBSA 4ZEBA 5I2NA 4MBPA 4H46A 3OD7A 1JVYA 4JWOA 5TP9B 4MNCA 5AA2B 3E9XA 3EHUA 2HHMA 4EXKA 2RKMA 4GWWA 4I62A 2F3DA 2V84A 2WYKA 3ILUB 4EQ7A 4ZS9A 5DVIA 1FRPA 4N8YA 4P8BA 1LSTA 2I6EA 2REGA 2GRVA 1INPA 1Q9DA 4MF3A 4QFNA 1EZPA 5J1DA 5IM2A 4PTKA 3TPAA 3MZBA 4QXDA 3TTKA 1UIVA 3C36A 1B2HA 4N6KA 4N91A 4F3PA 2AL5A 1BLFA 1BIYA 1MG1A 5I58B 4WEPA 4X1DA 2CEXA 4ZEDA 3G3GA 4G68B 1SI0A 1VDWA 1B32A 3IB2A 2Z8EA 2G93A 4G61A 4BDMA 1D9YA 4F1VA 1FQCA 5AA4B 2FIXA 3F11A 4LZ7A 3WAEA 2ZNUA 1PB9A 2XA5A 1QVSA 1O7TA 1EYJA 1IEJA 4NF5A 3ZSFA 5HBCA 1AMFA 1EYKA 2WX9A 4NTLA 4DI4B 1QUJA 3SETA 2XX8A 3CFLA 3C31A 1Y1MA 1ZBMA 4GWOA 1CNQA 5I57A 2HXWA 3B6QA 5H8SA 1K9ZA 4FAJA 3MW0A 3CR9A 2ZMBA 4HXVA 1Z7ME 4ESWA 3IR1A 3A3UA 2AL4A 1MM7A 4RPOA 4XFEA 5F7VA 1PC3A 5L9MA 4PFBA 2FIEA 3T22A 4NX1A 2PT1A 4IO4A 4U22A 3FVOA 4F1YA 4PDHA 1J1NA 3SZPA 3S9EA 1PBQA 3MAMA 5ITPA 3PU5A 4ZZEA 3TTNA 3FVGA 5TPAA 3RTWB 3FIRA 3LR1A 2BJJX 4N6DA 4LUBA 4PE3A 2QJEA 5B7DA 1M5CA 3ZS6A 1MQDA 3OO9A 3O66A 2WYPA 3TTMA 3FZVA 3VV5A 4EUOA 3E78A 4THIA 1B05A 3FVNA 1NV5A 3M3KA 4N6PA 3RPLA 4HE0A 5DEXA 3Q27A 3S9MC 4OERA 1FPIA 3O97A 1RDXA 3E79A 3SDFA 3VVDA 5A5XB 1B7ZA 1MRPA 4L17A 4XEQA 4FBPA 5DT6A 3SERA 1GGGA 3QIMA 3PPPA 4LZ5A 4OEUA 4DIGA 1OQHA 3KBZA 1LAGE 1ZLQA 5I2KB 3VVFA 3CSGA 4OFOA 5F24A 4U21A 2XX7A 1IMDA 1XI6A 3GBBA 4PFIA 3BKIB 3K2DA 3RN8A 3SEVA 4PC9A 1A54A 1NNPA 1H76A 4MNPA 4YMBA 4G8NA 4EF1A 1US4A 2F35A 3K6WA 2OX3A 4PQJA 4HCYA 1B51A 1US5A 1FJ9A 5IKBA 3IK6B 4IO5A 2F3BA 3KC0A 2Z22A 5H8NA 4QHQA 2O51A 1T0KA 5AA1A 2YLNA 2DWIA 3L6HA 3TYHA 4KYDA 5AA2D 1H44A 5ISUA 1NV0A 4DXBA 2O1LA 1DPPA 4RXLA 4MHFA 4OA4A 5I3SA 4Q30B 3LUZA 2FYIA 1DOTA 1LBYA 1OLCA 3S2VA 4F2OA 4OFLA 2DOJA 5I56B 2HXRA 4U1OA 4H6DA 2P1SA 3KC1A 4H67A 1FQEA 1QW0A 3HHFA 1P1UA 3MP8A 4IB2A 3QK6A 1MQJA 5HM4B 4YKPA 2XXWA 2UYEA 1SW1A 4Z0IA 1Y9UA 3EF7A 4TQUQ 4OVJA 1FBDA 2L5VA 3OEKA 4N8GA 2FA7A 3DELB 3FXRA 1WODA 1AL3A 1NV6A 3UGWA 4GOTA 4R72A 2V25A 1A7LA 4FEDA 4ZE8A 3EPEA 3B8BA 2VT5A 1Y3QA 1D4NA 2HAVA 2M8CA 4OMBA 3TQWA 1IMCA 1II5A 3G3FA 2F34A 1LAXA 4KXPA 4RPNA 3MPKA 1MY1A 2RC9A 3H4ZA 4N4UA 3D1RA 1B0LA 1MY4A 4F19A 3RGYA 1N3XA 3M8UA 1POY1 4IO3A 4JWXA 4DE8A 4G2ZA 4EF2A 2F7BA 1A8EA 2NVUB 1GTKA 4NF6A 3ONMA 1B0HA 4JBZA 2XXUA 1DMBA 1NKXA 2D5WA 3CG1A 2I4CA 3EHTA 1P99A 2Y5KA 2DE3A 4C0RA 3UA8A 2H4IA 5T3JA 2WBBA 3M3FA 1MQGA 4O3CA 4OVQA 1UTBB 1FPBA 3IOUA 3K6VA 2HZKA 1I6AA 3ROJA 2DYXA 1I69A 2R8TA 3HN0A 4R6HA 3SEXA 4OVPA 3USDA 3H06B 4AQ4A 3V5AA 3FUZA 1N84A 3UORA 1POTA 3A09A 4NF8A 3U94A 3SEUA 4EDPA 3TAJA 4GRKA 2E1SA 3KBRA 2THIA 3DP6A 1I6BA 2HEUA 1VSOA 5FTIA 2FBPA 1OIBA 2B3FA 1S9TA 1FPLA 4YKJA 3B7DA 2F5XA 3TODA 3V89B 2OWTA 3S9LC 3PPQA 2A5TB 4ESXA 3KG2A 1ATGA 4OETA 4I9DA 1EYIA 3CVGA 2QVRA 5KCJB 1EU8A 5EQ8A 1N7WA 2GQ1A 1GVCA 1NUWA 3PMVA 1B52A 1FBHA 2FHYA 2ZZVA 4N07A 5DYHA 4NWCA 5ET5A 1Y4CA 1Y3NA 4PETA 1USYH 1ZJLA 2OWSA 1MXXA 2D21A 4XF5A 2X7QA 4XTCQ 1NNKA 5I2NB 4JVDA 3ISPA 1B40A 3TTLA 2DSFA 4IY6A 2I0BA 2XXPA 4KHZE 1MY2A 1MPCA 1VFEA 1H43A 2B3BA 4PFTA 1DK4A 3TCHA 3FVKA 5I59A 4JSDA 3DP4A 1ZTYA 2V3QA 1URDA 3TDJA 1AH5A 4ZEIA 1FTKA 1IXGA 3I5OA 2YPNA 1FPFA 1A99A 4YU0A 2B4LA 3OOAA 1YCJA 1FJ6A 1LBZA 4O8MA 5FTHA 3EHSA 4GFRA 3OENA 1NH7A 1B3FA 3H7MA 5F1QA 4EQ9A 3MVWA 4O3AA 5FHNA 4WKMA 1FQFA 1NV4A 1AOVA 2DWAA 4PGPA 3QYTA 4OVTA 2XWKA 2VD3A 2XXXA 4NEDA 2CZLA 2MKZA 1L5TA 2VD2A 2PT2A 5CC2A 4DCXA 2B4MA 3RT6B 5L9OA 4BDLA 4NF5B 4JXIA 3PD8A 4KQPA 1MM6A 2WBDA 1LEVA 2BJIA 2W7YA 2ZYMA 4GLIA 3W9WA 4X04A 1FPJA 3SESA 1OMPA 2Q74A 2ZZWA 2F6PA 1B3HA 3U8QA 5I57B 3ILTB 3IO6A 4PBHA 4QBAA 3CIJA 1G0HA 2DP8A 3D4CA 5AA3A 4KR5A 4WEDA 4IGTA 2QPQA 3IX1A 4I8CA 3ODBA 3K1NA 1JP4A 1P1WA 1P1NA 1ZIUA 4I3EA 2F36A 5EYFA 4G4PA 1QGXA 1Z7NE 4LA9A 2UVHA 3HSTA 4NHBA 1R6ZA 4MX6A 3IORA 1IITA 1S50A 2QFLA 2F7CA 4XKQA 1VFDA 1MXUA 1Q35A 3TUSA 3FV2A 3FGSA 2XX9A 3K0VA 5TPAB 4LZ8A 1XC1A 3H6VA 4QF9A 1MQHA 4OYVA 4PP0A 3ECRA 5IGAA 5I84A 2O84X 2DXYA 1LFGA 4GWZA 4ONYA 1D3KA 4R2FA 4OFJA 2QS4A 3GBAA 4GD5A 5H8HB 1LBCA 2Q8JA 4UACA 3RPLB 1IMEA 5DEXB 4FORA 3QUFA 2XXHA 3E3KA 5H8FA 3OELA 2IA4A 2I49A 1ANFA 2ONKE 3PUVE 1ZU0A 1FCKA 3AXFA 4ND9A 3N94A 2PFZA 2DWJA 5ICQA 3I6VA 3IOVA 4TLLB 4OTEA 4DXCA 4NWDA 1SW2A 4O7IA 1FPDA 2I3VA 2X7PA 1UTHA 4HTGA 2A5SA 2Y84A 1NV7A 3SEYA 5H8HA 4ZECA 1B4ZA 3CFXA 1WDNA 1RKMA 3W15C 5IZ3A 4LQ5A 1IIWA 1JW1A 3LSLA 2D3IA 2ZYOA 3RNNA 2QS3A 4I40A 1MY3A 4AB6A 4NN3A 3JYRA 2XXKA 4ELPA 4GBVA 1B5IA 1XVXA 2ONSA 2H98A 4HE2A 4PFYA 4AS4A 2O1MA 1IZ1A 3TFLA 4GX6A 3H03A 4FATA 3CSBA 2UYFA 4AB5A 3UN6A 1FPGA 1A55A 2I4BA 4LN5A 5H8NB 1YTVA 2ZNSA 1YXIA 1IMFA 4P11A 2JJKA 3JV9A 2V3UA 2E0SA 1BK4A 3TMGA 3MC2A 1SD3A 4BDQA 4RK9A 2REJA 4R6YA 1MXWA 3UP9A 1LCTA 3I3VA 4IO2A 3RYDA 3MQ9A 1NH8A 1HSLA 3PUYE 2NOOA 3VLVA 4O94A 3KEIA 1F9BA 1FPEA 3K6UA 4IY5A 1NNTA 3TKDA 2PYYA 4G8MA 1DBZA 1Y1ZA 4KCCA 2I58A 4YICA 4OHNA 1SQYA 3FXUA 4FIMA 3N6UA 2ABHA 1H3DA 4F29A 2DWHA 2H5YA 1LB9A 1XS5A 4LONB 5KDTA 1OLAA 2HZLA 4U1ZA 2UVIA 3FXQA 2VPNA 3OO7A 2RC7A 3MWBA 5A5LA 1PBPA 3RY3A 1QUIA 4DZ1A 1VR5A 1DSNA 1B58A 3N26A 1NUYA 4DLDA 1D9VA 1OVBA 5M2VA 2Y7KA 1FTAA 1NUZA 2NUVA 2Y5LA 2O68A 4H45A 3LV0A 3PV0E 5K2XA 2O6AA 3LC8A 3E13X 3KOSA 4MIJA 1M5EA 3S9NC 2UVGA 3GLBA 3O6IA 1H45A 3IJOB 3O6HA 4U4SA 2V93A 3KN7A 1LFHA 4JVCA 1N76A 1CB6A 4DI3D 4JSOA 3IOWA 1DTZA 4NF6B 1KA0A 4F3SA 3G3JA 2DVZA 5J16A 1N04A 2V3TA 5DVFA 4OANA 1QKAA 2ESNA 1IXCA 4P3LA 2ZXTA 2HAUA 4IO6A 3M3LA 5FBPA 2PCRA 4JVIA 4MLQA 4PF6A 3PGFA 3DM0A 4BDNA 4IR8A 4PGNA 1B9JA 2PX1A 4I1DA 4POXA 2VPOA 3IO4A 2Y7IA 5ET8A 2WEFA 1M5DA 4KYSA 4H5GA 4GX3A 4ELQA 4NF8B 4GQOA 3FASA 5ET7A 1TWYA 4P1LA 4I3YA 4RYAA 4X1BA 3FV1A 2Q88A 3A29A 4KCDA 3N5LA 2PMSA 4RJZA 1A40A 4M1VA 2Q8MA 1FQAA 1MXYA 3HV1A 4YB7A 1XOCA 1NFTA 4KD5A 4PAFA 2OJTA 1YZ0A 2I3WA 3CI8A 3O6GA 3T9HB 4F31B 1FTOA 4MCOA 4ZEKA 2Q89A 2DQVA 1NI9A 4UABA 4H1XA 2I48A 2ANJA 4QSDA 4Q8RA 5FHMA 4JB7A 3MP1A 4R9FA 2R6GE 1LCFA 3PPOA 4ELRA 4EXLA 1IXIA 2HFBA 1JW4A 3Q29A 1BP5A 4HE1A 1MPBA 1FTMA 1QUKA 4PAKA 3IAZA 2VHAA 1B3GA 3VLWA 1P1OA 3C32A 2GHBA 5ICTA 3G3KA 4PF8A 3RT8A 5EHSA 3HHGA 2RF1A 4GL8A 3T96B 1MH4A 2OK2A 2IEEA 3FJGA 3G3IA 1MPDA 4R75A 3CRBA 2ZYNA 1B7HA 4F2QA 1S7YA 4MEVA 1KA1A 5K2YA 2XWIA 1WVJA 2HPGA 3PMXA 3Q28A 5I59B 3GXAA 4BDRA 3FJMA 4ELOA 2ALUA 3KSJA 1R9QA 1EZ9A 2FVZA 3B6WA 4ZEFA 4F3BA 2B65A 3H3GA 1JQFA 2XXRA 3PUWE 3TEPA 4ECFA 4PBQA 2RCBA 1FSAA 4OENA 3BFUA 4GX4A 3K1PA 4YKIA 2CZHA 4YKKA 3K4UA 4NGUA 5CM6A 4IO7A 3U65A 3P7IA 1IMBA 3RLFE 1XT8A 4E0XA 3IOTA 4WXJA 2F97A 5H8QB 1ZMGA 3UIFA 3QSLA 4XKRA 4KI0E 2NWJA 3A3CA 4N15A 4Q5TA 1LAHE 4H0WA 4PAIA 3HO7A 1SYIA 1ELJA 1JW5A 5EYHA 3T9XB 5BUUA 4U2RA 1SI1A 4GWSA 2H9BA 2QMWA 3TZAA 1YYZA 4ZDMA 1LAFE 3LUYA 4FJPA 3BIHA 2XXYA 2HQ0A 3FXBA 3KJTA 3FBPA 4MMPA 1JETA 3PUXE 3E4RA 4XIGQ 5H8QA 1RDYA 3VLUA 1MDP1 2O7UA 3OO8A 5IZZA 4NG7A 2HCAA 2RC8A 3Q26A 5BWJA 1QKBA 1XHYA 1PEBA 4POWA 2G29A 3RQTA 4JDFA 1FQBA 1KZ8A 4QFPA 3S4UA 2Q2AA 2F78A 4NMYA 3RUMA 3OXNA 3N6TA 2GHAA 4GVOA 4ZE9A 3MVZA 5ITOA 1EZOA 3CHGA 2V4CA 2GFEA 3V83A 3KN8A 3RPWA 3EQ1A 3MJNA 1HSJA 5EYGA 3T0JA 4R9GA 1M5BA 5TP9A 1YAEA 5AA2A 3DP8A 1LBXA 3OSRA 1JEVA 2O7IA 5CMBA 4F18A 3BIGA 1G0IA 4DXUA 5H8FB 3R7XA 1NMUA 3MZ1A 4P9KA 1FBFA 2PBWA 3MZ9A 5LTCA 4MNIA 4MAGA 1B1HA 2GH9A 4E0WA 2Q2CA 2QRYA 1B5HA 4LVQA 4OWDA 1FBGA 1Q1KA 4XKPA 3H6UA 4R6KA 1JNFA 4BLAA 3QXMA 3ZKLA 3KJ7A 1R9LA 5I58A 3MBPA 1UTHB 3D4GA 3T9VA 3HCQA 4K3FA 4G68A 2XXIA 3KGCA 4TOZA 5IZ3B 3T1BA 1MDQA 2Z8FA 5CMMA 2DVCA 1SVXB 4XXUA 2WKYA 5AA4A 4IGRA 4QSEA 4G77A 3KFMA 5I7IA 5ET6A 4YB6A 4RY1A 3RTFB 3T66A 2RINA 3TCGA 3HPIA 3K00A 3BFTA 1I6QA 2PVUA 1LBVA 2ZYKA 2ONRA 3IFAA 4LP2B 1FW0A 1LFIA 4EQBA 5KZTA 1MH3A 1UQWA 3TCFA 2NXOA 4PE5B 5EQ9A 1SDXA 1N0TA 3THIA 4M4GA 3IJXB 2LAOA 1FBCA 5TU0A 3U72A 3PTYA 1K9YA 1BTJA 1URSA 2Y7WA 2QMXA 1RYOA 3C33A 1LBBA 4HCWA 1Y4TA 4R73A 2UXAA 2OWZA 4GWUA 1AWBA 1JEUA 3MPLA 3IL1B 3C9HA 1MQIA 1NV2A 3OO6A 2QL3A 5FHOA 2P3VA 2DS9A 4H65A 1ZKBA 4HS7A 4P0IA 4OEVA 1MY0A 4P1EA 4PCDA 1TFDA 4KPTA 1B4HA 3VXBA 1NUXA 3GYYA 4QRZA 4FE8A 2YJPA 5KDTB 1O63A 1O64A 3PMWA 5IZ1A 1TXFA 1MXZA 3PD9A 2H99A 2VP1A 3JZJA 2QVVA 3R26A 2KR0A 3KZGA 5A5XA 5B70A 1DCUA 2OLBA 3EKIA 1B5JA 1R1NA 1NL5A 3MSTA 2P0SA 3ZKKA 2CZIA 3KN3A 4FEBA 4PFRA 2DE4A 3MUQA 1NNFA 4H8JA 1OVTA 4UA8A 2Z23A 1IXHA 1JVXA 5JK4A 5I2KA 1OQGA 4RA1A 4RK2A 4QFLA 4JWYA 4F3GA 1FTLA 1USYE 2XXTA 4G68C 1B7UA 3H6TA 3CG3A 4OVRA 4H5FA 3OSQA 5LOMA 5CI5A 4NAPA 2RCAA 4MLVA 5DVJA 5EHMA 5CMKA 4Z7EA 3C35A 1B3EA 2FNCA 3MYUA 3UK4A 5CBRA 1SW4A 2VGQA 5EQAA 3G7WA 4KFQA 2Y7RA 1SPIA 3O9PA 2F8DA 3T93B 4O3BA 1NV1A 4Q0CA 2P3NA 3B6TA 4GXAA
chains in the Genus database with same CATH topology
2MKZA 3E78A 1NV5A 3RPLA 2B4MA 4HE0A 4PF8A 1FPIA 2WBDA 1RDXA 1LEVA 3E79A 1FPKA 2BJIA 4XEQA 3W9WA 4FBPA 4X04A 1FPJA 5I5PA 2Q74A 2ZZWA 4MEVA 1KA1A 2XWIA 4PBHA 1LBWA 4QBAA 1G0HA 2HPGA 2QPQA 3KBZA 3IFCA 1JP4A 4I3EA 3QMFA 2FVZA 4GWYA 1IMAA 1QGXA 5F24A 4P56A 4AS5A 4NHBA 1IMDA 1XI6A 4PBQA 4MX6A 1FSAA 4PFIA 4GX4A 2QFLA 4PC9A 2CZHA 4PDDA 4NGUA 4MNPA 1FBPA 5CM6A 3U65A 4NQ8A 2OX3A 4N81A 4HCYA 1IMBA 4NF0A 1FJ9A 5EQ7A 2F3BA 5IGAA 4GWZA 4N15A 3KC0A 4PAIA 3HFUA 3RPLB 1IMEA 5EYHA 4GWSA 1D9QA 1NV0A 4F1UA 1YYZA 4MHFA 4OA4A 5I3SA 2PFYA 3LUZA 3BIHA 1LBYA 3FXBA 3FBPA 4MMPA 2PFZA 1RDYA 2HXRA 3KC1A 4O7IA 5ESYA 1FPDA 5IZZA 4X8RA 3NOHA 4NG7A 2KQZA 1NV7A 1FBDA 2L5VA 4N8GA 5IZ3A 5LDZA 1KZ8A 1NV6A 2QVUA 4I40A 4OVSA 3B8BA 4NN3A 4P47A 2XXKA 4GBVA 4HE2A 2XWVA 3CHGA 4AS4A 2VT5A 2V4CA 4GX6A 2CEYA 1IMCA 5EYGA 3T0JA 2DE2A 4KXPA 1FPGA 4LN5A 4GBWA 4N17A 1LBXA 4N4UA 3D1RA 1YXIA 5DW8A 1IMFA 4F18A 2JJKA 4F19A 3BIGA 1G0IA 1NV3A 1BK4A 4P9KA 1FBFA 5LTCA 2CZKA 4MNIA 3W9VA 4MAGA 3RYDA 1FBGA 4O94A 1RDZA 2Y5KA 1FPEA 2DE3A 1DBZA 2Q9TA 5T3JA 2WBBA 4OVQA 1FPBA 4YZZA 4YICA 5IZ3B 3T1BA 2HZKA 4MJOA 4X9TA 3ROJA 3B50A 2XWOA 2R8TA 4GWXA 4OVPA 2DDKA 5I7IA 2HZLA 5ET6A 2VPNA 1FBEA 2ZZXA 4O7MA 5A5LA 4H46A 4MNCA 1LBVA 1NUYA 3IFAA 2FBPA 2HHMA 1FTAA 1NUZA 4GWWA 2Y5LA 2F3DA 2WYKA 1FPLA 2F5XA 5EQ9A 4H45A 3LV0A 1FRPA 4N8YA 4MIJA 4P8BA 1FBCA 1INPA 3PTYA 1Q9DA 1K9YA 4JVCA 4DI3D 5J1DA 5IM2A 4PTKA 4QXDA 1KA0A 2DVZA 5J16A 4HCWA 4N6KA 1EYIA 4N91A 2OWZA 1NV1A 4GWUA 1AWBA 2QVRA 4OANA 1NV2A 2CEXA 4P3LA 2P3VA 5EQ8A 2GQ1A 4P1EA 4PCDA 1NUWA 1VDWA 5FBPA 2PCRA 4JVIA 1FBHA 1NUXA 4PF6A 2FHYA 4G61A 3GYYA 2ZZVA 4IR8A 4PGNA 4F1VA 5ET5A 2VPOA 2FIXA 2XA5A 1EYJA 4PETA 5ET8A 5IZ1A 2WEFA 1EYKA 2WX9A 4GX3A 2QVVA 2KR0A 4XF5A 5ET7A 4DI4B 4P1LA 4I3YA 1DCUA 3EKIA 4JVDA 3ISPA 1CNQA 3MSTA 2CZIA 3A29A 1K9ZA 4PFRA 2DE4A 1DK4A 4M1VA 2Q8MA 2V3QA 4HXVA 5JK4A 4XFEA 4PFBA 4PAFA 2FIEA 1YZ0A 4NX1A 1FPFA 2B4LA 4MCOA 4PDHA 3SZPA 1FJ6A 1LBZA 4O8MA 4OVRA 1NI9A 4UABA 4NAPA 3MYUA 4N6DA 1NV4A 4PE3A 5EQAA 4PGPA 4OVTA 4HE1A 1SPIA 2XWKA 4PAKA 2WYPA 2P3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHF A;  4OA4 A;  4O94 A;  4P1E A;  4PCD A;  2PFY A;  3FXB A;  4PF8 A;  4PF6 A;  4MMP A;  3GYY A;  2ZZV A;  2PFZ A;  4PGN A;  4OVQ A;  4YZZ A;  2VPO A;  4YIC A;  2XA5 A;  4XEQ A;  4X04 A;  5I5P A;  2HZK A;  2ZZW A;  5IZZ A;  4X8R A;  4MEV A;  4NG7 A;  4PET A;  2XWI A;  2WX9 A;  2XWO A;  3B50 A;  4PBH A;  4XF5 A;  4DI4 B;  4P1L A;  4OVP A;  2HPG A;  4N8G A;  5I7I A;  2HZL A;  2VPN A;  2ZZX A;  4O7M A;  4OVS A;  4NN3 A;  4PFR A;  4P47 A;  4P56 A;  2XXK A;  4NHB A;  4PBQ A;  2XWV A;  4MX6 A;  4PFI A;  4MNC A;  2V4C A;  4PC9 A;  2CEY A;  4PDD A;  4XFE A;  4PFB A;  4PAF A;  4NGU A;  4MNP A;  5CM6 A;  3U65 A;  4NQ8 A;  4NX1 A;  2WYK A;  4NF0 A;  4MCO A;  4LN5 A;  4PDH A;  4N17 A;  4N4U A;  4O8M A;  4N8Y A;  4OVR A;  4P8B A;  4MIJ A;  4UAB A;  4NAP A;  5IGA A;  4DI3 D;  4N15 A;  5IM2 A;  4PAI A;  4P9K A;  4N6D A;  4N6K A;  4PE3 A;  5LTC A;  4N91 A;  4PGP A;  4OVT A;  4MNI A;  4MAG A;  4OAN A;  2XWK A;  4PAK A;  2CEX A;  4P3L A;  2WYP A; 
#chains in the Genus database with same CATH topology
 3K01 A;  3SEW A;  1QJM A;  4MH5 A;  3EN3 A;  1B3L A;  2AIX A;  4LAT A;  2I0C A;  3VXC A;  2XXQ A;  1Y20 A;  3FJ7 A;  3O28 A;  1IUD A;  1BKA A;  2X26 A;  3PPR A;  1FPK A;  4P0G A;  4YMA A;  5I5P A;  2OBG A;  4ZZA A;  1GV8 A;  4GL0 A;  3CFZ A;  4F39 A;  1LBW A;  1RYX A;  5I56 A;  1KWH A;  2UVJ A;  1MXV A;  3IFC A;  1PB7 A;  1M5F A;  5HPQ A;  3QMF A;  4BDO A;  3KOT A;  4GWY A;  1IMA A;  3C4M A;  3VVE A;  4P56 A;  4AS5 A;  3FAT A;  1SYH A;  1LLS A;  1DTG A;  1AIV A;  4PDD A;  3SKP A;  4N13 A;  3TTR A;  3MVX A;  2XD3 A;  5ELV A;  1FBP A;  4OQO A;  4NQ8 A;  4G8H A;  4N81 A;  4NF0 A;  4NF4 B;  1VE4 A;  4H8I A;  4XKN A;  3MP6 A;  5EQ7 A;  3K6X A;  3FD3 A;  4GXS B;  2O69 A;  3K1M A;  3OMB A;  1UIU A;  3LSX A;  3HFU A;  2QSX A;  3PUZ E;  4KYE A;  4GF8 A;  3TEL A;  3Q25 A;  1SW5 A;  1D9Q A;  1TFA A;  2P2A A;  3O29 A;  4YAH X;  4F1U A;  2OCU A;  4QFO A;  2PFY A;  1IQ7 A;  1CE2 A;  1B46 A;  4OES A;  4C1T A;  4YB5 A;  4NF4 A;  3T9U A;  3U92 A;  1FTJ A;  1EH3 A;  4HW8 A;  3LBS A;  2H25 A;  5ESY A;  2XXV A;  3IB0 A;  5CRY A;  4X8R A;  3NOH A;  2KQZ A;  2XD2 A;  4MFI A;  1UTB A;  1N3W A;  4DDD A;  2Y7P A;  4C1U A;  2CMO A;  4QSC A;  3V8X B;  2VOZ A;  4LQ2 A;  5LDZ A;  2QS2 A;  2QVU A;  1DPE A;  1URG A;  3U93 A;  5L9S A;  1HSE A;  4OVS A;  1Y3P A;  4P47 A;  5JTY B;  1SBP A;  2QS1 A;  2XWV A;  3KSX A;  1PB8 A;  1YPN A;  3GZG A;  5CMC A;  1B1X A;  1FQD A;  3LSW A;  3QUJ A;  5JEI A;  5IAI A;  1GR2 A;  2CEY A;  3PPN A;  2DXR A;  2F7A A;  4PFW A;  3MVY A;  4U4X A;  3IB1 A;  2DE2 A;  2AYS A;  5AE4 A;  1A8F A;  4GBW A;  4F22 A;  4N17 A;  3VFJ A;  5DW8 A;  4R2B A;  4U23 A;  3K02 A;  2R9J A;  1NV3 A;  4OXV A;  4RNS A;  5JTY A;  3H6W A;  3C34 A;  4GIZ A;  2CZK A;  3QAX A;  3W9V A;  4OZ9 A;  3WAF A;  3L6G A;  1LGB C;  2A5T A;  3G3H A;  1QUL A;  1PDA A;  2OZZ A;  5L8D A;  1N7X A;  1RDZ A;  1TT1 A;  4X48 A;  3O2A A;  3U1O A;  5KCJ A;  5DTB A;  1B6H A;  2Q9T A;  3BBR A;  3OEM A;  4DCY A;  4QFK A;  4YZZ A;  2Z8D A;  2F6G A;  4PFU A;  4FEC A;  1P1Q A;  3R6U A;  4MJO A;  4ISU A;  4TLM B;  4X9T A;  3B50 A;  2XWO A;  4GWX A;  2ZNT A;  2KLF A;  2R71 A;  2DDK A;  1LB8 A;  3VDF A;  1MS7 A;  3TQL A;  1FBE A;  2XHD A;  2ZZX A;  1XVY A;  4O7M A;  4NE4 A;  3LSF B;  3VE1 B;  4R74 A;  3DLN A;  5CBS A;  4ZEB A;  5I2N A;  4MBP A;  4H46 A;  3OD7 A;  1JVY A;  4JWO A;  5TP9 B;  4MNC A;  5AA2 B;  3E9X A;  3EHU A;  2HHM A;  4EXK A;  2RKM A;  4GWW A;  4I62 A;  2F3D A;  2V84 A;  2WYK A;  3ILU B;  4EQ7 A;  4ZS9 A;  5DVI A;  1FRP A;  4N8Y A;  4P8B A;  1LST A;  2I6E A;  2REG A;  2GRV A;  1INP A;  1Q9D A;  4MF3 A;  4QFN A;  1EZP A;  5J1D A;  5IM2 A;  4PTK A;  3TPA A;  3MZB A;  4QXD A;  3TTK A;  1UIV A;  3C36 A;  1B2H A;  4N6K A;  4N91 A;  4F3P A;  2AL5 A;  1BLF A;  1BIY A;  1MG1 A;  5I58 B;  4WEP A;  4X1D A;  2CEX A;  4ZED A;  3G3G A;  4G68 B;  1SI0 A;  1VDW A;  1B32 A;  3IB2 A;  2Z8E A;  2G93 A;  4G61 A;  4BDM A;  1D9Y A;  4F1V A;  1FQC A;  5AA4 B;  2FIX A;  3F11 A;  4LZ7 A;  3WAE A;  2ZNU A;  1PB9 A;  2XA5 A;  1QVS A;  1O7T A;  1EYJ A;  1IEJ A;  4NF5 A;  3ZSF A;  5HBC A;  1AMF A;  1EYK A;  2WX9 A;  4NTL A;  4DI4 B;  1QUJ A;  3SET A;  2XX8 A;  3CFL A;  3C31 A;  1Y1M A;  1ZBM A;  4GWO A;  1CNQ A;  5I57 A;  2HXW A;  3B6Q A;  5H8S A;  1K9Z A;  4FAJ A;  3MW0 A;  3CR9 A;  2ZMB A;  4HXV A;  1Z7M E;  4ESW A;  3IR1 A;  3A3U A;  2AL4 A;  1MM7 A;  4RPO A;  4XFE A;  5F7V A;  1PC3 A;  5L9M A;  4PFB A;  2FIE A;  3T22 A;  4NX1 A;  2PT1 A;  4IO4 A;  4U22 A;  3FVO A;  4F1Y A;  4PDH A;  1J1N A;  3SZP A;  3S9E A;  1PBQ A;  3MAM A;  5ITP A;  3PU5 A;  4ZZE A;  3TTN A;  3FVG A;  5TPA A;  3RTW B;  3FIR A;  3LR1 A;  2BJJ X;  4N6D A;  4LUB A;  4PE3 A;  2QJE A;  5B7D A;  1M5C A;  3ZS6 A;  1MQD A;  3OO9 A;  3O66 A;  2WYP A;  3TTM A;  3FZV A;  3VV5 A;  4EUO A;  3E78 A;  4THI A;  1B05 A;  3FVN A;  1NV5 A;  3M3K A;  4N6P A;  3RPL A;  4HE0 A;  5DEX A;  3Q27 A;  3S9M C;  4OER A;  1FPI A;  3O97 A;  1RDX A;  3E79 A;  3SDF A;  3VVD A;  5A5X B;  1B7Z A;  1MRP A;  4L17 A;  4XEQ A;  4FBP A;  5DT6 A;  3SER A;  1GGG A;  3QIM A;  3PPP A;  4LZ5 A;  4OEU A;  4DIG A;  1OQH A;  3KBZ A;  1LAG E;  1ZLQ A;  5I2K B;  3VVF A;  3CSG A;  4OFO A;  5F24 A;  4U21 A;  2XX7 A;  1IMD A;  1XI6 A;  3GBB A;  4PFI A;  3BKI B;  3K2D A;  3RN8 A;  3SEV A;  4PC9 A;  1A54 A;  1NNP A;  1H76 A;  4MNP A;  4YMB A;  4G8N A;  4EF1 A;  1US4 A;  2F35 A;  3K6W A;  2OX3 A;  4PQJ A;  4HCY A;  1B51 A;  1US5 A;  1FJ9 A;  5IKB A;  3IK6 B;  4IO5 A;  2F3B A;  3KC0 A;  2Z22 A;  5H8N A;  4QHQ A;  2O51 A;  1T0K A;  5AA1 A;  2YLN A;  2DWI A;  3L6H A;  3TYH A;  4KYD A;  5AA2 D;  1H44 A;  5ISU A;  1NV0 A;  4DXB A;  2O1L A;  1DPP A;  4RXL A;  4MHF A;  4OA4 A;  5I3S A;  4Q30 B;  3LUZ A;  2FYI A;  1DOT A;  1LBY A;  1OLC A;  3S2V A;  4F2O A;  4OFL A;  2DOJ A;  5I56 B;  2HXR A;  4U1O A;  4H6D A;  2P1S A;  3KC1 A;  4H67 A;  1FQE A;  1QW0 A;  3HHF A;  1P1U A;  3MP8 A;  4IB2 A;  3QK6 A;  1MQJ A;  5HM4 B;  4YKP A;  2XXW A;  2UYE A;  1SW1 A;  4Z0I A;  1Y9U A;  3EF7 A;  4TQU Q;  4OVJ A;  1FBD A;  2L5V A;  3OEK A;  4N8G A;  2FA7 A;  3DEL B;  3FXR A;  1WOD A;  1AL3 A;  1NV6 A;  3UGW A;  4GOT A;  4R72 A;  2V25 A;  1A7L A;  4FED A;  4ZE8 A;  3EPE A;  3B8B A;  2VT5 A;  1Y3Q A;  1D4N A;  2HAV A;  2M8C A;  4OMB A;  3TQW A;  1IMC A;  1II5 A;  3G3F A;  2F34 A;  1LAX A;  4KXP A;  4RPN A;  3MPK A;  1MY1 A;  2RC9 A;  3H4Z A;  4N4U A;  3D1R A;  1B0L A;  1MY4 A;  4F19 A;  3RGY A;  1N3X A;  3M8U A;  1POY 1;  4IO3 A;  4JWX A;  4DE8 A;  4G2Z A;  4EF2 A;  2F7B A;  1A8E A;  2NVU B;  1GTK A;  4NF6 A;  3ONM A;  1B0H A;  4JBZ A;  2XXU A;  1DMB A;  1NKX A;  2D5W A;  3CG1 A;  2I4C A;  3EHT A;  1P99 A;  2Y5K A;  2DE3 A;  4C0R A;  3UA8 A;  2H4I A;  5T3J A;  2WBB A;  3M3F A;  1MQG A;  4O3C A;  4OVQ A;  1UTB B;  1FPB A;  3IOU A;  3K6V A;  2HZK A;  1I6A A;  3ROJ A;  2DYX A;  1I69 A;  2R8T A;  3HN0 A;  4R6H A;  3SEX A;  4OVP A;  3USD A;  3H06 B;  4AQ4 A;  3V5A A;  3FUZ A;  1N84 A;  3UOR A;  1POT A;  3A09 A;  4NF8 A;  3U94 A;  3SEU A;  4EDP A;  3TAJ A;  4GRK A;  2E1S A;  3KBR A;  2THI A;  3DP6 A;  1I6B A;  2HEU A;  1VSO A;  5FTI A;  2FBP A;  1OIB A;  2B3F A;  1S9T A;  1FPL A;  4YKJ A;  3B7D A;  2F5X A;  3TOD A;  3V89 B;  2OWT A;  3S9L C;  3PPQ A;  2A5T B;  4ESX A;  3KG2 A;  1ATG A;  4OET A;  4I9D A;  1EYI A;  3CVG A;  2QVR A;  5KCJ B;  1EU8 A;  5EQ8 A;  1N7W A;  2GQ1 A;  1GVC A;  1NUW A;  3PMV A;  1B52 A;  1FBH A;  2FHY A;  2ZZV A;  4N07 A;  5DYH A;  4NWC A;  5ET5 A;  1Y4C A;  1Y3N A;  4PET A;  1USY H;  1ZJL A;  2OWS A;  1MXX A;  2D21 A;  4XF5 A;  2X7Q A;  4XTC Q;  1NNK A;  5I2N B;  4JVD A;  3ISP A;  1B40 A;  3TTL A;  2DSF A;  4IY6 A;  2I0B A;  2XXP A;  4KHZ E;  1MY2 A;  1MPC A;  1VFE A;  1H43 A;  2B3B A;  4PFT A;  1DK4 A;  3TCH A;  3FVK A;  5I59 A;  4JSD A;  3DP4 A;  1ZTY A;  2V3Q A;  1URD A;  3TDJ A;  1AH5 A;  4ZEI A;  1FTK A;  1IXG A;  3I5O A;  2YPN A;  1FPF A;  1A99 A;  4YU0 A;  2B4L A;  3OOA A;  1YCJ A;  1FJ6 A;  1LBZ A;  4O8M A;  5FTH A;  3EHS A;  4GFR A;  3OEN A;  1NH7 A;  1B3F A;  3H7M A;  5F1Q A;  4EQ9 A;  3MVW A;  4O3A A;  5FHN A;  4WKM A;  1FQF A;  1NV4 A;  1AOV A;  2DWA A;  4PGP A;  3QYT A;  4OVT A;  2XWK A;  2VD3 A;  2XXX A;  4NED A;  2CZL A;  2MKZ A;  1L5T A;  2VD2 A;  2PT2 A;  5CC2 A;  4DCX A;  2B4M A;  3RT6 B;  5L9O A;  4BDL A;  4NF5 B;  4JXI A;  3PD8 A;  4KQP A;  1MM6 A;  2WBD A;  1LEV A;  2BJI A;  2W7Y A;  2ZYM A;  4GLI A;  3W9W A;  4X04 A;  1FPJ A;  3SES A;  1OMP A;  2Q74 A;  2ZZW A;  2F6P A;  1B3H A;  3U8Q A;  5I57 B;  3ILT B;  3IO6 A;  4PBH A;  4QBA A;  3CIJ A;  1G0H A;  2DP8 A;  3D4C A;  5AA3 A;  4KR5 A;  4WED A;  4IGT A;  2QPQ A;  3IX1 A;  4I8C A;  3ODB A;  3K1N A;  1JP4 A;  1P1W A;  1P1N A;  1ZIU A;  4I3E A;  2F36 A;  5EYF A;  4G4P A;  1QGX A;  1Z7N E;  4LA9 A;  2UVH A;  3HST A;  4NHB A;  1R6Z A;  4MX6 A;  3IOR A;  1IIT A;  1S50 A;  2QFL A;  2F7C A;  4XKQ A;  1VFD A;  1MXU A;  1Q35 A;  3TUS A;  3FV2 A;  3FGS A;  2XX9 A;  3K0V A;  5TPA B;  4LZ8 A;  1XC1 A;  3H6V A;  4QF9 A;  1MQH A;  4OYV A;  4PP0 A;  3ECR A;  5IGA A;  5I84 A;  2O84 X;  2DXY A;  1LFG A;  4GWZ A;  4ONY A;  1D3K A;  4R2F A;  4OFJ A;  2QS4 A;  3GBA A;  4GD5 A;  5H8H B;  1LBC A;  2Q8J A;  4UAC A;  3RPL B;  1IME A;  5DEX B;  4FOR A;  3QUF A;  2XXH A;  3E3K A;  5H8F A;  3OEL A;  2IA4 A;  2I49 A;  1ANF A;  2ONK E;  3PUV E;  1ZU0 A;  1FCK A;  3AXF A;  4ND9 A;  3N94 A;  2PFZ A;  2DWJ A;  5ICQ A;  3I6V A;  3IOV A;  4TLL B;  4OTE A;  4DXC A;  4NWD A;  1SW2 A;  4O7I A;  1FPD A;  2I3V A;  2X7P A;  1UTH A;  4HTG A;  2A5S A;  2Y84 A;  1NV7 A;  3SEY A;  5H8H A;  4ZEC A;  1B4Z A;  3CFX A;  1WDN A;  1RKM A;  3W15 C;  5IZ3 A;  4LQ5 A;  1IIW A;  1JW1 A;  3LSL A;  2D3I A;  2ZYO A;  3RNN A;  2QS3 A;  4I40 A;  1MY3 A;  4AB6 A;  4NN3 A;  3JYR A;  2XXK A;  4ELP A;  4GBV A;  1B5I A;  1XVX A;  2ONS A;  2H98 A;  4HE2 A;  4PFY A;  4AS4 A;  2O1M A;  1IZ1 A;  3TFL A;  4GX6 A;  3H03 A;  4FAT A;  3CSB A;  2UYF A;  4AB5 A;  3UN6 A;  1FPG A;  1A55 A;  2I4B A;  4LN5 A;  5H8N B;  1YTV A;  2ZNS A;  1YXI A;  1IMF A;  4P11 A;  2JJK A;  3JV9 A;  2V3U A;  2E0S A;  1BK4 A;  3TMG A;  3MC2 A;  1SD3 A;  4BDQ A;  4RK9 A;  2REJ A;  4R6Y A;  1MXW A;  3UP9 A;  1LCT A;  3I3V A;  4IO2 A;  3RYD A;  3MQ9 A;  1NH8 A;  1HSL A;  3PUY E;  2NOO A;  3VLV A;  4O94 A;  3KEI A;  1F9B A;  1FPE A;  3K6U A;  4IY5 A;  1NNT A;  3TKD A;  2PYY A;  4G8M A;  1DBZ A;  1Y1Z A;  4KCC A;  2I58 A;  4YIC A;  4OHN A;  1SQY A;  3FXU A;  4FIM A;  3N6U A;  2ABH A;  1H3D A;  4F29 A;  2DWH A;  2H5Y A;  1LB9 A;  1XS5 A;  4LON B;  5KDT A;  1OLA A;  2HZL A;  4U1Z A;  2UVI A;  3FXQ A;  2VPN A;  3OO7 A;  2RC7 A;  3MWB A;  5A5L A;  1PBP A;  3RY3 A;  1QUI A;  4DZ1 A;  1VR5 A;  1DSN A;  1B58 A;  3N26 A;  1NUY A;  4DLD A;  1D9V A;  1OVB A;  5M2V A;  2Y7K A;  1FTA A;  1NUZ A;  2NUV A;  2Y5L A;  2O68 A;  4H45 A;  3LV0 A;  3PV0 E;  5K2X A;  2O6A A;  3LC8 A;  3E13 X;  3KOS A;  4MIJ A;  1M5E A;  3S9N C;  2UVG A;  3GLB A;  3O6I A;  1H45 A;  3IJO B;  3O6H A;  4U4S A;  2V93 A;  3KN7 A;  1LFH A;  4JVC A;  1N76 A;  1CB6 A;  4DI3 D;  4JSO A;  3IOW A;  1DTZ A;  4NF6 B;  1KA0 A;  4F3S A;  3G3J A;  2DVZ A;  5J16 A;  1N04 A;  2V3T A;  5DVF A;  4OAN A;  1QKA A;  2ESN A;  1IXC A;  4P3L A;  2ZXT A;  2HAU A;  4IO6 A;  3M3L A;  5FBP A;  2PCR A;  4JVI A;  4MLQ A;  4PF6 A;  3PGF A;  3DM0 A;  4BDN A;  4IR8 A;  4PGN A;  1B9J A;  2PX1 A;  4I1D A;  4POX A;  2VPO A;  3IO4 A;  2Y7I A;  5ET8 A;  2WEF A;  1M5D A;  4KYS A;  4H5G A;  4GX3 A;  4ELQ A;  4NF8 B;  4GQO A;  3FAS A;  5ET7 A;  1TWY A;  4P1L A;  4I3Y A;  4RYA A;  4X1B A;  3FV1 A;  2Q88 A;  3A29 A;  4KCD A;  3N5L A;  2PMS A;  4RJZ A;  1A40 A;  4M1V A;  2Q8M A;  1FQA A;  1MXY A;  3HV1 A;  4YB7 A;  1XOC A;  1NFT A;  4KD5 A;  4PAF A;  2OJT A;  1YZ0 A;  2I3W A;  3CI8 A;  3O6G A;  3T9H B;  4F31 B;  1FTO A;  4MCO A;  4ZEK A;  2Q89 A;  2DQV A;  1NI9 A;  4UAB A;  4H1X A;  2I48 A;  2ANJ A;  4QSD A;  4Q8R A;  5FHM A;  4JB7 A;  3MP1 A;  4R9F A;  2R6G E;  1LCF A;  3PPO A;  4ELR A;  4EXL A;  1IXI A;  2HFB A;  1JW4 A;  3Q29 A;  1BP5 A;  4HE1 A;  1MPB A;  1FTM A;  1QUK A;  4PAK A;  3IAZ A;  2VHA A;  1B3G A;  3VLW A;  1P1O A;  3C32 A;  2GHB A;  5ICT A;  3G3K A;  4PF8 A;  3RT8 A;  5EHS A;  3HHG A;  2RF1 A;  4GL8 A;  3T96 B;  1MH4 A;  2OK2 A;  2IEE A;  3FJG A;  3G3I A;  1MPD A;  4R75 A;  3CRB A;  2ZYN A;  1B7H A;  4F2Q A;  1S7Y A;  4MEV A;  1KA1 A;  5K2Y A;  2XWI A;  1WVJ A;  2HPG A;  3PMX A;  3Q28 A;  5I59 B;  3GXA A;  4BDR A;  3FJM A;  4ELO A;  2ALU A;  3KSJ A;  1R9Q A;  1EZ9 A;  2FVZ A;  3B6W A;  4ZEF A;  4F3B A;  2B65 A;  3H3G A;  1JQF A;  2XXR A;  3PUW E;  3TEP A;  4ECF A;  4PBQ A;  2RCB A;  1FSA A;  4OEN A;  3BFU A;  4GX4 A;  3K1P A;  4YKI A;  2CZH A;  4YKK A;  3K4U A;  4NGU A;  5CM6 A;  4IO7 A;  3U65 A;  3P7I A;  1IMB A;  3RLF E;  1XT8 A;  4E0X A;  3IOT A;  4WXJ A;  2F97 A;  5H8Q B;  1ZMG A;  3UIF A;  3QSL A;  4XKR A;  4KI0 E;  2NWJ A;  3A3C A;  4N15 A;  4Q5T A;  1LAH E;  4H0W A;  4PAI A;  3HO7 A;  1SYI A;  1ELJ A;  1JW5 A;  5EYH A;  3T9X B;  5BUU A;  4U2R A;  1SI1 A;  4GWS A;  2H9B A;  2QMW A;  3TZA A;  1YYZ A;  4ZDM A;  1LAF E;  3LUY A;  4FJP A;  3BIH A;  2XXY A;  2HQ0 A;  3FXB A;  3KJT A;  3FBP A;  4MMP A;  1JET A;  3PUX E;  3E4R A;  4XIG Q;  5H8Q A;  1RDY A;  3VLU A;  1MDP 1;  2O7U A;  3OO8 A;  5IZZ A;  4NG7 A;  2HCA A;  2RC8 A;  3Q26 A;  5BWJ A;  1QKB A;  1XHY A;  1PEB A;  4POW A;  2G29 A;  3RQT A;  4JDF A;  1FQB A;  1KZ8 A;  4QFP A;  3S4U A;  2Q2A A;  2F78 A;  4NMY A;  3RUM A;  3OXN A;  3N6T A;  2GHA A;  4GVO A;  4ZE9 A;  3MVZ A;  5ITO A;  1EZO A;  3CHG A;  2V4C A;  2GFE A;  3V83 A;  3KN8 A;  3RPW A;  3EQ1 A;  3MJN A;  1HSJ A;  5EYG A;  3T0J A;  4R9G A;  1M5B A;  5TP9 A;  1YAE A;  5AA2 A;  3DP8 A;  1LBX A;  3OSR A;  1JEV A;  2O7I A;  5CMB A;  4F18 A;  3BIG A;  1G0I A;  4DXU A;  5H8F B;  3R7X A;  1NMU A;  3MZ1 A;  4P9K A;  1FBF A;  2PBW A;  3MZ9 A;  5LTC A;  4MNI A;  4MAG A;  1B1H A;  2GH9 A;  4E0W A;  2Q2C A;  2QRY A;  1B5H A;  4LVQ A;  4OWD A;  1FBG A;  1Q1K A;  4XKP A;  3H6U A;  4R6K A;  1JNF A;  4BLA A;  3QXM A;  3ZKL A;  3KJ7 A;  1R9L A;  5I58 A;  3MBP A;  1UTH B;  3D4G A;  3T9V A;  3HCQ A;  4K3F A;  4G68 A;  2XXI A;  3KGC A;  4TOZ A;  5IZ3 B;  3T1B A;  1MDQ A;  2Z8F A;  5CMM A;  2DVC A;  1SVX B;  4XXU A;  2WKY A;  5AA4 A;  4IGR A;  4QSE A;  4G77 A;  3KFM A;  5I7I A;  5ET6 A;  4YB6 A;  4RY1 A;  3RTF B;  3T66 A;  2RIN A;  3TCG A;  3HPI A;  3K00 A;  3BFT A;  1I6Q A;  2PVU A;  1LBV A;  2ZYK A;  2ONR A;  3IFA A;  4LP2 B;  1FW0 A;  1LFI A;  4EQB A;  5KZT A;  1MH3 A;  1UQW A;  3TCF A;  2NXO A;  4PE5 B;  5EQ9 A;  1SDX A;  1N0T A;  3THI A;  4M4G A;  3IJX B;  2LAO A;  1FBC A;  5TU0 A;  3U72 A;  3PTY A;  1K9Y A;  1BTJ A;  1URS A;  2Y7W A;  2QMX A;  1RYO A;  3C33 A;  1LBB A;  4HCW A;  1Y4T A;  4R73 A;  2UXA A;  2OWZ A;  4GWU A;  1AWB A;  1JEU A;  3MPL A;  3IL1 B;  3C9H A;  1MQI A;  1NV2 A;  3OO6 A;  2QL3 A;  5FHO A;  2P3V A;  2DS9 A;  4H65 A;  1ZKB A;  4HS7 A;  4P0I A;  4OEV A;  1MY0 A;  4P1E A;  4PCD A;  1TFD A;  4KPT A;  1B4H A;  3VXB A;  1NUX A;  3GYY A;  4QRZ A;  4FE8 A;  2YJP A;  5KDT B;  1O63 A;  1O64 A;  3PMW A;  5IZ1 A;  1TXF A;  1MXZ A;  3PD9 A;  2H99 A;  2VP1 A;  3JZJ A;  2QVV A;  3R26 A;  2KR0 A;  3KZG A;  5A5X A;  5B70 A;  1DCU A;  2OLB A;  3EKI A;  1B5J A;  1R1N A;  1NL5 A;  3MST A;  2P0S A;  3ZKK A;  2CZI A;  3KN3 A;  4FEB A;  4PFR A;  2DE4 A;  3MUQ A;  1NNF A;  4H8J A;  1OVT A;  4UA8 A;  2Z23 A;  1IXH A;  1JVX A;  5JK4 A;  5I2K A;  1OQG A;  4RA1 A;  4RK2 A;  4QFL A;  4JWY A;  4F3G A;  1FTL A;  1USY E;  2XXT A;  4G68 C;  1B7U A;  3H6T A;  3CG3 A;  4OVR A;  4H5F A;  3OSQ A;  5LOM A;  5CI5 A;  4NAP A;  2RCA A;  4MLV A;  5DVJ A;  5EHM A;  5CMK A;  4Z7E A;  3C35 A;  1B3E A;  2FNC A;  3MYU A;  3UK4 A;  5CBR A;  1SW4 A;  2VGQ A;  5EQA A;  3G7W A;  4KFQ A;  2Y7R A;  1SPI A;  3O9P A;  2F8D A;  3T93 B;  4O3B A;  1NV1 A;  4Q0C A;  2P3N A;  3B6T A;  4GXA A; 
#chains in the Genus database with same CATH homology
 2MKZ A;  3E78 A;  1NV5 A;  3RPL A;  2B4M A;  4HE0 A;  4PF8 A;  1FPI A;  2WBD A;  1RDX A;  1LEV A;  3E79 A;  1FPK A;  2BJI A;  4XEQ A;  3W9W A;  4FBP A;  4X04 A;  1FPJ A;  5I5P A;  2Q74 A;  2ZZW A;  4MEV A;  1KA1 A;  2XWI A;  4PBH A;  1LBW A;  4QBA A;  1G0H A;  2HPG A;  2QPQ A;  3KBZ A;  3IFC A;  1JP4 A;  4I3E A;  3QMF A;  2FVZ A;  4GWY A;  1IMA A;  1QGX A;  5F24 A;  4P56 A;  4AS5 A;  4NHB A;  1IMD A;  1XI6 A;  4PBQ A;  4MX6 A;  1FSA A;  4PFI A;  4GX4 A;  2QFL A;  4PC9 A;  2CZH A;  4PDD A;  4NGU A;  4MNP A;  1FBP A;  5CM6 A;  3U65 A;  4NQ8 A;  2OX3 A;  4N81 A;  4HCY A;  1IMB A;  4NF0 A;  1FJ9 A;  5EQ7 A;  2F3B A;  5IGA A;  4GWZ A;  4N15 A;  3KC0 A;  4PAI A;  3HFU A;  3RPL B;  1IME A;  5EYH A;  4GWS A;  1D9Q A;  1NV0 A;  4F1U A;  1YYZ A;  4MHF A;  4OA4 A;  5I3S A;  2PFY A;  3LUZ A;  3BIH A;  1LBY A;  3FXB A;  3FBP A;  4MMP A;  2PFZ A;  1RDY A;  2HXR A;  3KC1 A;  4O7I A;  5ESY A;  1FPD A;  5IZZ A;  4X8R A;  3NOH A;  4NG7 A;  2KQZ A;  1NV7 A;  1FBD A;  2L5V A;  4N8G A;  5IZ3 A;  5LDZ A;  1KZ8 A;  1NV6 A;  2QVU A;  4I40 A;  4OVS A;  3B8B A;  4NN3 A;  4P47 A;  2XXK A;  4GBV A;  4HE2 A;  2XWV A;  3CHG A;  4AS4 A;  2VT5 A;  2V4C A;  4GX6 A;  2CEY A;  1IMC A;  5EYG A;  3T0J A;  2DE2 A;  4KXP A;  1FPG A;  4LN5 A;  4GBW A;  4N17 A;  1LBX A;  4N4U A;  3D1R A;  1YXI A;  5DW8 A;  1IMF A;  4F18 A;  2JJK A;  4F19 A;  3BIG A;  1G0I A;  1NV3 A;  1BK4 A;  4P9K A;  1FBF A;  5LTC A;  2CZK A;  4MNI A;  3W9V A;  4MAG A;  3RYD A;  1FBG A;  4O94 A;  1RDZ A;  2Y5K A;  1FPE A;  2DE3 A;  1DBZ A;  2Q9T A;  5T3J A;  2WBB A;  4OVQ A;  1FPB A;  4YZZ A;  4YIC A;  5IZ3 B;  3T1B A;  2HZK A;  4MJO A;  4X9T A;  3ROJ A;  3B50 A;  2XWO A;  2R8T A;  4GWX A;  4OVP A;  2DDK A;  5I7I A;  2HZL A;  5ET6 A;  2VPN A;  1FBE A;  2ZZX A;  4O7M A;  5A5L A;  4H46 A;  4MNC A;  1LBV A;  1NUY A;  3IFA A;  2FBP A;  2HHM A;  1FTA A;  1NUZ A;  4GWW A;  2Y5L A;  2F3D A;  2WYK A;  1FPL A;  2F5X A;  5EQ9 A;  4H45 A;  3LV0 A;  1FRP A;  4N8Y A;  4MIJ A;  4P8B A;  1FBC A;  1INP A;  3PTY A;  1Q9D A;  1K9Y A;  4JVC A;  4DI3 D;  5J1D A;  5IM2 A;  4PTK A;  4QXD A;  1KA0 A;  2DVZ A;  5J16 A;  4HCW A;  4N6K A;  1EYI A;  4N91 A;  2OWZ A;  1NV1 A;  4GWU A;  1AWB A;  2QVR A;  4OAN A;  1NV2 A;  2CEX A;  4P3L A;  2P3V A;  5EQ8 A;  2GQ1 A;  4P1E A;  4PCD A;  1NUW A;  1VDW A;  5FBP A;  2PCR A;  4JVI A;  1FBH A;  1NUX A;  4PF6 A;  2FHY A;  4G61 A;  3GYY A;  2ZZV A;  4IR8 A;  4PGN A;  4F1V A;  5ET5 A;  2VPO A;  2FIX A;  2XA5 A;  1EYJ A;  4PET A;  5ET8 A;  5IZ1 A;  2WEF A;  1EYK A;  2WX9 A;  4GX3 A;  2QVV A;  2KR0 A;  4XF5 A;  5ET7 A;  4DI4 B;  4P1L A;  4I3Y A;  1DCU A;  3EKI A;  4JVD A;  3ISP A;  1CNQ A;  3MST A;  2CZI A;  3A29 A;  1K9Z A;  4PFR A;  2DE4 A;  1DK4 A;  4M1V A;  2Q8M A;  2V3Q A;  4HXV A;  5JK4 A;  4XFE A;  4PFB A;  4PAF A;  2FIE A;  1YZ0 A;  4NX1 A;  1FPF A;  2B4L A;  4MCO A;  4PDH A;  3SZP A;  1FJ6 A;  1LBZ A;  4O8M A;  4OVR A;  1NI9 A;  4UAB A;  4NAP A;  3MYU A;  4N6D A;  1NV4 A;  4PE3 A;  5EQA A;  4PGP A;  4OVT A;  4HE1 A;  1SPI A;  2XWK A;  4PAK A;  2WYP A;  2P3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...