1BTJA

Human serum transferrin, recombinant n-terminal lobe, apo form, crystal form 2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
333
structure length
333
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords PROTEIN (SERUM TRANSFERRIN)
publication title Ligand-induced conformational change in transferrins: crystal structure of the open form of the N-terminal half-molecule of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1btjA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1btjA02
3TTKA 3K6VA 1IXIA 2ZNSA 5I59B 2H25A 4IGTA 3FV2A 1Z7NE 1B05A 2AYSA 4XKRA 4XTCQ 4AB5A 3M3KA 1II5A 2QS1A 4YU0A 2F8DA 1HSEA 2B3FA 1Y1ZA 3MPLA 3O29A 2RC7A 1MQIA 4QFOA 3N6TA 2O1LA 1VFDA 4GL0A 3EN3A 5AA2B 4KCCA 5JEIA 2E1SA 2GFEA 4FAJA 4PE5B 4H8JA 1NH7A 2R71A 4FATA 4OTEA 3THIA 4WEDA 3LUYA 2HZKA 1FCKA 3H3GA 1A99A 3C35A 1XS5A 2ZYOA 4Q5TA 4OFJA 4NMYA 5I58B 4PP0A 4YB5A 3TQWA 4DIGA 3CFXA 3CRBA 2CMOA 3T66A 3PUVE 1NL5A 2DP8A 1XHYA 2DE2A 4N6PA 3N26A 2I4CA 3KZGA 1LCFA 5I84A 1D9YA 3HHGA 1QVSA 4HCYA 3V89B 3RGYA 4C0RA 2HEUA 4R72A 5CMCA 4F19A 3CFZA 1ZTYA 2Q2CA 5DVJA 4RY1A 3MPKA 4C1UA 4MLQA 5CC2A 4LZ5A 4UACA 1FQEA 1SYIA 1MPDA 4YB7A 2H98A 2BJJX 1TFAA 1BIYA 4ND9A 4IY6A 1Y3NA 3MZBA 2REJA 2UXAA 4YICA 3UORA 5FHOA 3HO7A 5H8QB 2RINA 1MXXA 3O66A 5ELVA 3QUJA 4ZECA 4OETA 4ZEFA 1LGBC 3PD9A 5I57A 3DELB 4NEDA 3FVGA 4F18A 4R2FA 1BKAA 5B70A 1NNKA 4ECFA 5TPAB 3LSWA 1YCJA 3HHFA 3Q26A 5F7VA 2PX1A 2H4IA 3PUYE 2P1SA 5K2XA 4ZE9A 1ATGA 2XXVA 2Z8DA 2D21A 2VP1A 4XIGQ 3PPQA 1EZOA 3T9VA 2GHAA 4OEUA 2XD2A 2Y7KA 1R9LA 3VDFA 3LSFB 1B2HA 4F31B 4NF6B 2AIXA 3TQLA 3KSXA 4BDRA 1M5FA 1GTKA 1FQAA 3G3KA 2XXUA 4RPOA 1ZKBA 3VE1B 4Q0CA 2F7BA 2Y7RA 3U94A 1R9QA 1B0LA 1B7UA 1M5DA 4NF8B 3TTRA 3GBBA 2I58A 4G68A 2QS3A 3CG1A 3U92A 5TU0A 1DMBA 3C36A 4X1DA 3H4ZA 4KPTA 1XVYA 4EUOA 4RA1A 1H76A 1N84A 3TMGA 2ONSA 1B7ZA 4DE8A 1GR2A 3UP9A 2OJTA 3PUZE 3SKPA 5H8HA 3O9PA 4BLAA 1SBPA 1HSLA 1BP5A 1H3DA 4TOZA 4OESA 4JDFA 4TLLB 2Q88A 3LC8A 1H44A 2I0BA 1US4A 2GRVA 4THIA 2XXIA 4FORA 3E13X 3UIFA 1JETA 1UTHB 1MY2A 1JEUA 1YTVA 1POY1 5DVFA 3VVEA 4YZZA 3MBPA 4IO6A 4HCWA 3C34A 1ZJLA 2VOZA 4C1TA 2O7IA 2R6GE 4OFLA 3KG2A 1NMUA 1PBQA 1TWYA 3R7XA 1IQ7A 3OO6A 1MXVA 3OSRA 1FQDA 2XXXA 2HFBA 3OEKA 4POWA 1Y4TA 4HTGA 5DVIA 3TCGA 3N94A 3FATA 4FECA 4QFLA 1MH3A 2Z8EA 1SYHA 1FTKA 1SI1A 3HSTA 5DEXB 4H1XA 1ZLQA 4P0IA 4F2QA 1AH5A 1Y20A 4KD5A 3MZ1A 1LLSA 4EF1A 3K0VA 5H8NB 1XOCA 3QK6A 4EXKA 1MXYA 1FW0A 1A40A 1FQCA 5AA4A 3OEMA 2G93A 4F1UA 5LOMA 3GBAA 5HBCA 3VFJA 3C33A 2ABHA 2OLBA 3KJ7A 2VD2A 3A3UA 5F1QA 3HCQA 4MBPA 4TQUQ 4LZ8A 4ZEKA 4KYSA 4LONB 2O6AA 3EHSA 5FHMA 3T9UA 4LZ7A 3RLFE 3PD8A 4OERA 4QSEA 2X7QA 3K01A 2FYIA 5L8DA 3EHUA 2AL5A 1LAFE 1A8EA 3U8QA 1O64A 1AOVA 5FTHA 1P1WA 3IB1A 4QFKA 2NXOA 3G7WA 3ZKKA 3IOWA 2RKMA 5JTYA 4X1BA 2FA7A 3RY3A 3FVOA 1IITA 1Z7ME 2F7CA 1JNFA 3HN0A 1SW2A 3TTMA 4F1YA 4YKPA 1NKXA 2PYYA 4LQ5A 3EHTA 4POXA 5I56B 2ALUA 4LATA 2H5YA 3E4RA 4R9FA 3M3FA 3FJ7A 1M5CA 2UYEA 1R6ZA 4QSCA 2NOOA 4EQ7A 2X7PA 4ZZAA 1D9VA 1DTGA 1L5TA 1PDAA 2A5TA 2ONKE 1MM7A 5J1DA 1P1OA 1AIVA 3Q28A 2VGQA 3GZGA 3LR1A 1BLFA 1I6BA 3FZVA 3MVZA 1LFGA 1MY4A 4ELOA 1QUIA 1NH8A 2I49A 1N76A 5L9MA 3R6UA 4KHZE 3K6WA 1SDXA 3MWBA 2DWIA 4JBZA 3T93B 1IXGA 1LSTA 2DOJA 4R75A 1J1NA 1MDP1 3A3CA 3M8UA 4JWXA 4ELPA 1MH4A 1MY3A 4G8HA 4DDDA 2ESNA 1B5JA 4H5GA 1B6HA 1H43A 2QMWA 1SVXB 1DPEA 1N7WA 4H65A 3KFMA 3T22A 3TCFA 1PB8A 3S2VA 1OMPA 2ZYNA 3MP1A 3K6UA 4R74A 3EQ1A 3CVGA 4MF3A 4H67A 3DP8A 1IIWA 2Y84A 2XXHA 3H6VA 4ZE8A 2OZZA 1B5HA 1ELJA 1VR5A 1LAGE 4R2BA 2I6EA 2D5WA 2GH9A 3BFTA 2VD3A 1Q1KA 4I8CA 3KJTA 3IOTA 1B51A 5I2KA 2W7YA 1B58A 4NF5A 2ONRA 5B7DA 4BDMA 3K02A 5TP9A 2PVUA 3PPNA 3Q25A 1LBCA 2DWHA 3FGSA 4IO2A 4F3PA 1LBBA 5I59A 1MPCA 5ITOA 1T0KA 3SERA 5HM4B 4EXLA 4U21A 3K6XA 5BUUA 3TELA 3OSQA 1WODA 3IK6B 3O6HA 5ICTA 3OOAA 5DTBA 3OO9A 2V3TA 4O3CA 1DPPA 4IB2A 4QFNA 5KCJA 5AA2A 1M5BA 4M4GA 1URSA 4KYEA 4X9TA 3W9VA 5HPQA 2O68A 4H0WA 4L17A 4RK2A 4OMBA 3SDFA 2Y7IA 2IEEA 3AXFA 4U1ZA 3UN6A 1NFTA 3TTLA 1F9BA 4R73A 3L6HA 4GL8A 4U1OA 4MFIA 5KDTB 4ZS9A 4GIZA 3PV0E 3TYHA 3GXAA 3TKDA 4IO3A 4G68B 2XD3A 1Y3QA 3SETA 2ZYKA 4RYAA 4I1DA 2RC9A 5CMBA 3MVYA 3VVDA 1P99A 2RCAA 3B7DA 4DCXA 1VSOA 3N5LA 3U72A 2NWJA 1OVBA 3MUQA 5H8HB 2I0CA 1A7LA 5JK4A 1MY0A 1B3EA 3MAMA 2Q8JA 5H8SA 3FASA 4E0XA 1XVXA 2H9BA 5H8QA 3O28A 1P1QA 3IB2A 4OFOA 1QJMA 4ZDMA 2NUVA 2I4BA 3FD3A 2D3IA 4JXIA 1GVCA 5AE4A 3PUWE 1UQWA 2XX9A 1FTMA 4JWYA 1UTBA 2QJEA 2P0SA 3T9HB 1B3FA 3U93A 4F29A 1QULA 2QMXA 3IOVA 4DXUA 3O2AA 4H6DA 2I3WA 1MG1A 1MM6A 1VFEA 3C32A 4MH5A 1OQHA 1N04A 3MVXA 1RYXA 5H8FA 2XXTA 2HXWA 3K1MA 3Q27A 3FJGA 3OENA 4FEBA 1B52A 4H5FA 1B4HA 3OELA 1LAHE 1NNTA 1FQFA 3PUXE 3VV5A 1VE4A 3TZAA 1SQYA 4P0GA 2I3VA 5CMKA 1AL3A 2KLFA 1OVTA 1FTOA 4NF6A 4OEVA 3G3HA 3MC2A 3QUFA 3KBRA 4MLVA 4YMBA 3FVKA 3CG3A 3G3FA 1B1HA 1JVYA 3V83A 1M5EA 1B3HA 2I48A 1LB8A 4LA9A 4U22A 2DXYA 1IXCA 4NF8A 3FVNA 2O69A 4R6YA 2ZNUA 2QS2A 4GWOA 3IAZA 4ZEDA 1US5A 4F39A 3K00A 3TCHA 2Z23A 3OD7A 3S9LC 3O97A 2CZLA 3DP4A 3TODA 3MP8A 4F22A 1WDNA 1WVJA 3TDJA 4R6HA 3EPEA 4EF2A 3JYRA 1FTLA 5ISUA 3CFLA 1N0TA 1UTHA 1LFHA 1IXHA 3LSLA 2DWAA 1UIUA 3SEXA 4G8MA 2QPQA 3S4UA 1JW4A 4PFUA 3JV9A 1QKAA 3RT6B 3QIMA 3OMBA 4KQPA 2OWSA 3H7MA 2DE3A 4AB6A 5DT6A 4NWCA 2QRYA 5A5XB 4UA8A 1EZPA 1GGGA 4RXLA 5I2NA 2DS9A 3RPWA 2FNCA 3N6UA 3S9MC 3QSLA 4KI0E 1LCTA 1TXFA 5AA1A 3JZJA 1Y3PA 3VXBA 1DSNA 1B5IA 3ZKLA 3SEWA 1D3KA 1JW5A 2NVUB 3PMVA 3ONMA 3RT8A 2XHDA 3TEPA 3RTWB 3K4UA 3KOTA 2XX8A 4OVJA 1P1NA 4TLMB 1B46A 3T9XB 2F7AA 2DXRA 3DLNA 1SD3A 5ITPA 2G29A 3T96B 3VXCA 5CMMA 4GD5A 3ODBA 2DVCA 2F6PA 4HW8A 3PGFA 1B40A 1EH3A 3UK4A 2LAOA 3IJXB 4U4SA 4NF4A 4BDQA 1OQGA 3OO8A 4KFQA 4YKJA 4DZ1A 3RUMA 4BDLA 4OXVA 4EDPA 4YKKA 3OXNA 1OIBA 3IB0A 3I6VA 2Q2AA 1MPBA 4YB6A 3IX1A 3L6GA 4PFWA 4PQJA 3H6TA 1RYOA 2XX7A 2O1MA 4QRZA 3K1PA 5I2KB 3PPRA 4JSOA 3PPOA 1S7YA 2WKYA 4I62A 2QL3A 3SEVA 1D4NA 5K2YA 3FUZA 3QYTA 5TP9B 2F6GA 2HQ0A 1NNPA 3Q29A 3KGCA 1MRPA 4KCDA 1MXWA 3G3GA 4YKIA 4QHQA 3G3JA 4U2RA 3V5AA 1B32A 1ZBMA 3C31A 4G8NA 4LQ2A 1SW1A 5AA3A 3O6GA 2OK2A 4BDOA 3ILUB 4G4PA 1OLAA 1N7XA 3H03A 3TPAA 1B3LA 2AL4A 1SW5A 4LP2B 4G77A 2DSFA 5KCJB 3TAJA 4OENA 4XXUA 2M8CA 1XC1A 4IY5A 2V3QA 1O63A 4AQ4A 5I57B 3BBRA 4JSDA 1UIVA 2RF1A 2Y7WA 4G2ZA 1LAXA 1I6AA 3IO4A 4PFTA 3KN8A 4P11A 4QFPA 4RNSA 2F5XA 4RK9A 4NE4A 1PBPA 4GVOA 2Y7PA 4Z0IA 1JVXA 2F35A 4GRKA 1B0HA 3CSGA 2ANJA 3MW0A 4PFYA 4ZZEA 1USYH 2ZNTA 1OLCA 4X48A 1B4ZA 1MS7A 4OHNA 1CE2A 3IR1A 3CI8A 3B6QA 1RKMA 5L9OA 4Z7EA 4PETA 2P2AA 1EZ9A 1LB9A 2THIA 2R9JA 5CRYA 1MDQA 1I6QA 3C4MA 3KOSA 3B6TA 4WXJA 2VHAA 4K3FA 2V93A 4IO7A 2F78A 3IORA 1URGA 1QW0A 4HS7A 5I58A 1A8FA 2B65A 2O51A 1BTJA 3K2DA 2A5SA 4IO4A 1MQJA 3CIJA 4O3BA 2OBGA 3KEIA 3B6WA 1PEBA 4F3BA 4JWOA 3VLWA 4QSDA 2V25A 3HV1A 3WAEA 2PT1A 1UTBB 4N13A 1TFDA 5IAIA 3RQTA 1ZIUA 1PB7A 3MP6A 3W9WA 1TT1A 3O6IA 3DP6A 1LFIA 5H8FB 2DE4A 1KWHA 4XKQA 3TUSA 1JW1A 3V8XB 2XXQA 3BKIB 3IL1B 1Q35A 3USDA 1QUJA 1GV8A 3TTNA 4WKMA 1IUDA 1Y4CA 4I9DA 2UVJA 4GLIA 5EHMA 2XXWA 4R9GA 4E0WA 4ESXA 4FJPA 1R1NA 3PMXA 5CBSA 4ESWA 3PPPA 5CBRA 4XKNA 4U23A 4FE8A 4FIMA 3WAFA 4Q8RA 5IKBA 3LSXA 2IA4A 1JEVA 1N3XA 5TPAA 3VLVA 3VLUA 4QF9A 5EYFA 5KDTA 4GXSB 2E0SA 1FQBA 2UVHA 2OCUA 2PMSA 3E3KA 5L9SA 2H99A 4ZEBA 4GOTA 5CM6A 1PC3A 2XXYA 3G3IA 3IJOB 3BFUA 5FTIA 4XKPA 1MXUA 3A09A 4GF8A 1I69A 4OYVA 3ILTB 5CI5A 5M2VA 3UGWA 3H6WA 4GQOA 4DXBA 2UVIA 3OO7A 3F11A 1B9JA 3C9HA 2YJPA 3R26A 4YAHX 1S9TA 3P7IA 4RPNA 4F2OA 3IOUA 1ANFA 5AA4B 4U4XA 5KZTA 4KYDA 1Y1MA 4NTLA 4ZEIA 4BDNA 3MJNA 1POTA 4OWDA 4EQBA 3M3LA 3GLBA 1USYE 3VVFA 1AMFA 4ELRA 3H6UA 4IO5A 1PB9A 1MQHA 4GXAA 2XXRA 4DXCA 4R6KA 2HAUA 3DM0A 1ZU0A 3FJMA 3H06B 1B1XA 4KR5A 4F1VA 5EHSA 2Q89A 5I2NB 4GFRA 4OQOA 1N3WA 4F3SA 1IEJA 2YPNA 5DYHA 3SEUA 2ZYMA 2DWJA 4G68C 5JTYB 4JB7A 3W15C 1B3GA 3KN3A 4H8IA 4ISUA 2Z22A 3RN8A 4OZ9A 2O84X 3MZ9A 3D4CA 2QS4A 3QXMA 1A55A 4ONYA 1YAEA 1NNFA 1JQFA 1QUKA 2X26A 4DCYA 1MXZA 4M1VA 3HPIA 1H45A 3ECRA 1DOTA 1HSJA 1CB6A 4NF4B 3SESA 1YPNA 2A5TB 3ZS6A 1SW4A 1MY1A 1IZ1A 1URDA 5FHNA 4FEDA 5ICQA 3FXQA 2XXPA 3E9XA 2ZXTA 3UA8A 3I5OA 4YMAA 1EU8A 1FTJA 3LBSA 5DEXA 1MQDA 3QAXA 4F3GA 1QKBA 1ZMGA 3KSJA 4DLDA 2F97A 2V3UA 3S9EA 2Q9TA 3EF7A 3MVWA 2RC8A 3SEYA 2PBWA 5H8NA 2HAVA 1SI0A 2HZLA 3FIRA 3FV1A 2F34A 4RJZA 4ELQA 3KN7A 3U1OA 4LUBA 4EQ9A 1S50A 3MQ9A 5BWJA 3CR9A 2F36A 4NWDA 1O7TA 3TFLA 3RTFB 1MQGA 2DVZA 4IGRA 4N07A 2DQVA 2UYFA 2GHBA 3D4GA 3CSBA 3RNNA 1XT8A 5A5XA 2QSXA 3FXRA 4WEPA 1P1UA 3K1NA 5AA2D 2V84A 1Y9UA 3I3VA 2DYXA 4Q30B 2O7UA 2PT2A 3PU5A 2OWTA 4O3AA 4NF5B 4LVQA 2RCBA 2UVGA 3ZSFA 3PMWA 3IO6A 1B7HA 3S9NC 1DTZA 2HCAA 2Z8FA 2ZMBA 2YLNA 3FXUA 2REGA 1A54A 2B3BA 5I56A
chains in the Genus database with same CATH superfamily
4O7IA 3TTKA 3K6VA 1IXIA 2ZNSA 5I59B 4P8BA 2H25A 4IGTA 3FV2A 1Z7NE 1YZ0A 1B05A 2AYSA 4XKRA 4XTCQ 4AB5A 3M3KA 4GWZA 1II5A 2QS1A 4YU0A 2F8DA 1HSEA 2B3FA 1Y1ZA 1RDYA 3MPLA 3O29A 2RC7A 1MQIA 4QFOA 4PTKA 3N6TA 2O1LA 2CZKA 1VFDA 1IMEA 4GL0A 3EN3A 5AA2B 4GWSA 4KCCA 5JEIA 2E1SA 2GFEA 4FAJA 4PE5B 5ET6A 4H8JA 1NH7A 5I7IA 2R71A 4FATA 4OTEA 3THIA 3SZPA 4H46A 4WEDA 3LUYA 2HZKA 1FCKA 3H3GA 1A99A 3C35A 2XXKA 2CZIA 1XS5A 2ZYOA 4Q5TA 2WYKA 4OFJA 4NMYA 5I58B 4PP0A 4YB5A 3TQWA 4DIGA 4HE0A 3CFXA 3CRBA 2CMOA 3T66A 3PUVE 2Y5LA 1NL5A 2DP8A 1XHYA 2DE2A 4HE2A 4N6PA 3N26A 2I4CA 3KZGA 1LCFA 5I84A 1D9YA 3HHGA 1QVSA 4HCYA 3V89B 3RGYA 4C0RA 2HEUA 4R72A 5CMCA 4F19A 1QGXA 3CFZA 1ZTYA 2Q2CA 5DVJA 5ET5A 4RY1A 3MPKA 4C1UA 4MLQA 4MNPA 5CC2A 4HXVA 4LZ5A 2FIXA 2ZZWA 4UACA 1FQEA 1SYIA 1MPDA 4YB7A 2H98A 2BJJX 1TFAA 1BIYA 4ND9A 4IY6A 1Y3NA 3MZBA 2REJA 2UXAA 4YICA 3UORA 5FHOA 3HO7A 5H8QB 2RINA 2HXRA 1MXXA 3O66A 5ELVA 5EQ9A 3QUJA 4ZECA 4OETA 4ZEFA 1LGBC 3PD9A 5I57A 3DELB 4AS5A 4NEDA 3GYYA 3FVGA 4F18A 4R2FA 1BKAA 5B70A 1NNKA 4ECFA 2WBDA 5TPAB 1FRPA 1IMFA 3LSWA 1YCJA 3HHFA 3Q26A 5F7VA 2JJKA 2PX1A 2H4IA 3PUYE 2P1SA 5K2XA 4ZE9A 4MIJA 1ATGA 2XXVA 2Z8DA 2D21A 2VP1A 4XIGQ 1NV6A 4GWUA 3PPQA 1EZOA 3T9VA 2GHAA 4OEUA 2XD2A 2Y7KA 1R9LA 3VDFA 3LSFB 3KC0A 1NV2A 1B2HA 4F31B 4N6KA 4NF6B 4N17A 2AIXA 3TQLA 3KSXA 4BDRA 1M5FA 1GTKA 1FQAA 3G3KA 4IR8A 2XXUA 4RPOA 1ZKBA 4MJOA 3VE1B 4Q0CA 2F7BA 2Y7RA 3U94A 1XI6A 1R9QA 1B0LA 3B50A 1B7UA 1M5DA 3ROJA 4NF8B 3TTRA 3GBBA 2I58A 4G68A 2QS3A 3CG1A 3U92A 5TU0A 1DMBA 3C36A 4X1DA 3H4ZA 4KPTA 1XVYA 5IZ3B 4EUOA 4RA1A 3RYDA 1H76A 1N84A 3TMGA 2ONSA 1B7ZA 4DE8A 1GR2A 3UP9A 2OJTA 3PUZE 3SKPA 5H8HA 3O9PA 4N81A 4BLAA 1SBPA 3FBPA 4OANA 1HSLA 1BP5A 1H3DA 4TOZA 4OESA 4JDFA 3BIGA 4TLLB 2Q88A 3LC8A 4P47A 1H44A 4PBHA 2I0BA 1US4A 2GRVA 4THIA 2XXIA 4FORA 3E13X 3UIFA 1JETA 1UTHB 3MSTA 1MY2A 5I3SA 1JEUA 1FPKA 1YTVA 1POY1 5DVFA 3VVEA 1RDXA 4YZZA 3MBPA 1DBZA 4IO6A 4HCWA 2PFZA 3C34A 1ZJLA 4XFEA 4P3LA 2VOZA 4C1TA 2O7IA 2R6GE 4OFLA 3KG2A 1NMUA 1PBQA 1TWYA 3R7XA 1IQ7A 1KA1A 3OO6A 1MXVA 3OSRA 1FQDA 1FPGA 2XXXA 1NUWA 2HFBA 3OEKA 4POWA 1Y4TA 4HTGA 5DVIA 3TCGA 3N94A 3FATA 4FECA 4QFLA 1MH3A 2Z8EA 1SYHA 1FTKA 1SI1A 3HSTA 5DEXB 4H1XA 1ZLQA 2Q74A 4P0IA 4F2QA 1AH5A 2VPNA 1Y20A 4KD5A 3MZ1A 1LLSA 4G61A 4EF1A 3K0VA 5H8NB 1LBZA 5F24A 1XOCA 3QK6A 4EXKA 1MXYA 1FW0A 1A40A 1FQCA 5AA4A 4PDDA 3OEMA 2G93A 4F1UA 1FBDA 5LOMA 3GBAA 5HBCA 3VFJA 3C33A 3KJ7A 2ABHA 2OLBA 2VD2A 3A3UA 5F1QA 3HCQA 4MBPA 4TQUQ 4LZ8A 4ZEKA 4KYSA 4LONB 4PE3A 2O6AA 3EHSA 5FHMA 3T9UA 4LZ7A 3RLFE 3PD8A 4OERA 4QSEA 2X7QA 3K01A 2FYIA 1NV0A 5L8DA 4NAPA 3EHUA 2AL5A 1LAFE 1A8EA 3U8QA 4OVRA 1O64A 1AOVA 5FTHA 1P1WA 3IB1A 4QFKA 2NXOA 3G7WA 3ZKKA 3IOWA 5A5LA 2RKMA 5JTYA 4X1BA 2FA7A 3RY3A 2QVUA 3FVOA 4I3EA 1IITA 4MNCA 1Z7ME 2F7CA 1JNFA 3HN0A 1SW2A 3TTMA 4F1YA 4YKPA 1NKXA 2PYYA 4LQ5A 3EHTA 2BJIA 4POXA 5I56B 2ALUA 4LATA 2H5YA 3E4RA 4R9FA 3M3FA 1IMDA 3FJ7A 1M5CA 2UYEA 1R6ZA 4OA4A 4QSCA 2NOOA 4EQ7A 2X7PA 4ZZAA 1D9VA 2QFLA 1DTGA 1L5TA 1PDAA 2A5TA 2ONKE 1MM7A 5J1DA 1P1OA 1K9YA 1AIVA 3Q28A 2VGQA 3GZGA 4P9KA 3LR1A 1BLFA 1I6BA 3FZVA 3MVZA 2V4CA 1LFGA 2FVZA 1MY4A 4ELOA 1QUIA 1NH8A 2I49A 1Q9DA 1N76A 5L9MA 3R6UA 4KHZE 3K6WA 4OVTA 1SDXA 3MWBA 2DWIA 4GWYA 4JBZA 3T93B 1IXGA 1LSTA 2DOJA 4R75A 1J1NA 1MDP1 3A3CA 3M8UA 4JWXA 4ELPA 1NUZA 1MH4A 1MY3A 2GQ1A 1FPLA 4G8HA 4DDDA 2ESNA 1B5JA 4H5GA 1B6HA 1H43A 2QMWA 1SVXB 1DPEA 1N7WA 4H65A 3KFMA 2B4MA 5FBPA 3T22A 3TCFA 1PB8A 3S2VA 1FPDA 1OMPA 2ZYNA 3MP1A 3ISPA 4MX6A 3K6UA 4R74A 3EQ1A 3CVGA 4MAGA 4MF3A 4H67A 1JP4A 3B8BA 3DP8A 1FTAA 1IIWA 4P56A 2Y84A 2XXHA 3H6VA 3T1BA 2FIEA 4ZE8A 2OZZA 1B5HA 1ELJA 1VR5A 1LAGE 4R2BA 2I6EA 2D5WA 2GH9A 3BFTA 2VD3A 4AS4A 1Q1KA 4I8CA 3KJTA 3IOTA 1B51A 5I2KA 2W7YA 1B58A 1FBCA 4NF5A 4JVDA 2ONRA 5B7DA 4BDMA 3K02A 5ET8A 5TP9A 2PVUA 2ZZXA 3PPNA 3A29A 3Q25A 5EYGA 1LBCA 2DWHA 3FGSA 4IO2A 4LN5A 4F3PA 1LBBA 5I59A 1MPCA 5ITOA 1T0KA 3SERA 5HM4B 4EXLA 4U21A 3K6XA 5BUUA 2F3BA 2DDKA 3TELA 2XWOA 3OSQA 1WODA 3IK6B 3O6HA 5ICTA 3OOAA 5DTBA 4X04A 3OO9A 2V3TA 4O3CA 1DPPA 4IB2A 4QFNA 5KCJA 4NQ8A 2CEYA 3BIHA 1FPBA 5AA2A 1M5BA 4M4GA 1URSA 4KYEA 4X9TA 3W9VA 5HPQA 2O68A 4H0WA 4MEVA 4L17A 4RK2A 4OMBA 3SDFA 2Y7IA 2IEEA 4QBAA 3AXFA 4U1ZA 3UN6A 2B4LA 1NFTA 3TTLA 1F9BA 4R73A 3L6HA 4GL8A 4U1OA 4MFIA 5KDTB 4ZS9A 4GIZA 5LDZA 4HE1A 3PV0E 3TYHA 3GXAA 3TKDA 4IO3A 2Y5KA 4G68B 2XD3A 1Y3QA 3SETA 2ZYKA 4RYAA 4I1DA 2RC9A 5CMBA 3MVYA 3VVDA 1P99A 4GX6A 2RCAA 3B7DA 4DCXA 1VSOA 4PGNA 3N5LA 3U72A 4PAFA 2NWJA 4NGUA 4JVCA 1OVBA 3MUQA 5H8HB 2I0CA 1A7LA 5JK4A 4QXDA 1MY0A 1B3EA 3MAMA 4N4UA 2Q8JA 5H8SA 3FASA 1NV7A 4E0XA 1XVXA 2H9BA 5H8QA 3RPLA 3O28A 1P1QA 1FBPA 3IB2A 3LUZA 4OFOA 1QJMA 4ZDMA 2NUVA 2I4BA 3FD3A 2D3IA 4PBQA 4JXIA 3KC1A 1GVCA 5AE4A 1NV5A 3PUWE 1UQWA 4DI3D 2XX9A 1FTMA 4MMPA 1RDZA 4JWYA 1UTBA 2QJEA 2P0SA 3T9HB 1B3FA 1VDWA 3U93A 4F29A 1QULA 2QMXA 3IOVA 4DXUA 3O2AA 4H6DA 2I3WA 1MG1A 1MM6A 1VFEA 2P3VA 3C32A 4MH5A 1OQHA 1N04A 4PC9A 3MVXA 1RYXA 5H8FA 2VPOA 5EYHA 2XXTA 2HXWA 3K1MA 3Q27A 3FJGA 3OENA 4FEBA 1B52A 4H5FA 1B4HA 1EYJA 3OELA 1LAHE 1NNTA 1FQFA 3PUXE 1LBYA 3VV5A 1VE4A 3TZAA 1SQYA 4P0GA 2I3VA 5CMKA 1AL3A 2KLFA 5LTCA 1OVTA 1FTOA 2WX9A 4NF6A 4XF5A 4OEVA 3LV0A 3G3HA 3MC2A 3QUFA 3KBRA 4MLVA 4NN3A 4YMBA 3FVKA 1DK4A 3CG3A 3G3FA 1B1HA 1JVYA 3V83A 1M5EA 1B3HA 4N6DA 2I48A 1LB8A 4LA9A 4U22A 2DXYA 1IXCA 4NF8A 3FVNA 2O69A 4NF0A 1G0HA 4R6YA 4GX3A 2ZNUA 2QS2A 4GWOA 3IAZA 5IZ3A 4ZEDA 1US5A 4F39A 3K00A 5IZ1A 3TCHA 2Z23A 3OD7A 3S9LC 3O97A 2CZLA 3DP4A 3TODA 3MP8A 4F22A 1WDNA 1WVJA 1LBWA 3TDJA 4R6HA 3EPEA 4EF2A 3JYRA 1LEVA 1FTLA 3PTYA 4X8RA 5ISUA 3CFLA 1N0TA 1UTHA 1LFHA 1IXHA 1NI9A 4FBPA 3LSLA 2DWAA 1UIUA 3SEXA 4G8MA 2QPQA 3S4UA 4PFRA 1JW4A 4PFUA 3JV9A 5EQ7A 1QKAA 3RT6B 3QIMA 1INPA 3OMBA 4KQPA 2OWSA 3H7MA 2DE3A 1FSAA 4AB6A 5DT6A 1KZ8A 4NWCA 2QRYA 5A5XB 4UA8A 1EZPA 1GGGA 4RXLA 5I2NA 4JVIA 2DS9A 3RPWA 2FNCA 3N6UA 3S9MC 3QSLA 4KI0E 1LCTA 1TXFA 5AA1A 3JZJA 1Y3PA 3VXBA 1DSNA 1B5IA 3ZKLA 3SEWA 1D3KA 1JW5A 1LBXA 2NVUB 3PMVA 3ONMA 3RT8A 2XHDA 3MYUA 3TEPA 3RTWB 3K4UA 3KOTA 2XX8A 4OVJA 1P1NA 4TLMB 1SPIA 4P1EA 4PFIA 1B46A 3T9XB 2F7AA 2DXRA 3DLNA 1SD3A 5ITPA 1G0IA 4UABA 2G29A 4PFBA 3T96B 4NG7A 3VXCA 5CMMA 4GD5A 3ODBA 5EQAA 2DVCA 2F6PA 4HW8A 3PGFA 1B40A 1IMAA 1EH3A 2CEXA 3UK4A 2LAOA 3IJXB 4U4SA 4NF4A 4BDQA 4OVSA 1OQGA 3OO8A 4KFQA 4YKJA 1NV4A 4DZ1A 1FBHA 3RUMA 4BDLA 4OXVA 4EDPA 4YKKA 3OXNA 1OIBA 3IB0A 3I6VA 2Q2AA 1FPJA 1MPBA 4YB6A 3IX1A 3L6GA 4PFWA 4PQJA 3H6TA 4N91A 1RYOA 1FPIA 2XX7A 2O1MA 4QRZA 2QVVA 3K1PA 5I2KB 3PPRA 4JSOA 3PPOA 1S7YA 2WKYA 4PGPA 1LBVA 4I62A 2QL3A 3SEVA 1D4NA 5K2YA 3FUZA 3QYTA 5TP9B 2F6GA 2HQ0A 3D1RA 1NNPA 3Q29A 2XA5A 3KGCA 1MRPA 4KCDA 1MXWA 3G3GA 1EYKA 4YKIA 4QHQA 3G3JA 1YXIA 4U2RA 2WBBA 3V5AA 5I5PA 1B32A 2KQZA 1ZBMA 4GWWA 4I3YA 3C31A 4G8NA 4LQ2A 1SW1A 5AA3A 3O6GA 2WEFA 2OK2A 4BDOA 3ILUB 4G4PA 1OLAA 1N7XA 3H03A 3TPAA 1B3LA 2AL4A 1SW5A 4LP2B 4G77A 2DSFA 5KCJB 4OVPA 3TAJA 4OENA 4XXUA 4DI4B 4PAKA 2M8CA 1XC1A 4IY5A 2V3QA 1O63A 4AQ4A 5I57B 5IGAA 3BBRA 5IM2A 4JSDA 1UIVA 2RF1A 2Y7WA 4G2ZA 1LAXA 1I6AA 3IO4A 5DW8A 4PFTA 3KN8A 4P11A 4QFPA 4RNSA 2F5XA 4KXPA 4RK9A 4NE4A 1PBPA 4GVOA 2Y7PA 4Z0IA 2PFYA 1JVXA 2F35A 4GRKA 1IMCA 1B0HA 3CSGA 2ANJA 3MW0A 4PFYA 4ZZEA 1NUXA 1USYH 2ZNTA 1OLCA 2ZZVA 4X48A 1B4ZA 1MS7A 1AWBA 4OHNA 4N8YA 1CE2A 3IR1A 2FBPA 4PAIA 3CI8A 3B6QA 1RKMA 5L9OA 4Z7EA 4NX1A 5ET7A 3T0JA 1FBFA 4PETA 2P2AA 1BK4A 1EZ9A 1LB9A 2THIA 2R9JA 5CRYA 1MDQA 1I6QA 3C4MA 3KOSA 3B6TA 4WXJA 3CHGA 2VHAA 4GX4A 4K3FA 4O7MA 2V93A 2CZHA 4IO7A 3RPLB 1KA0A 2F78A 3IORA 1URGA 1QW0A 4HS7A 5I58A 1A8FA 2B65A 2O51A 1BTJA 3K2DA 2A5SA 4IO4A 4GWXA 1MQJA 3CIJA 4O3BA 4N8GA 2OBGA 3KEIA 2XWKA 3B6WA 1PEBA 4F3BA 4JWOA 3VLWA 4QSDA 2V25A 3HV1A 3WAEA 2PT1A 1UTBB 4N13A 1TFDA 5IAIA 3RQTA 1ZIUA 1PB7A 4OVQA 3MP6A 3W9WA 1TT1A 3O6IA 1IMBA 1FJ9A 3DP6A 3EKIA 1LFIA 5H8FB 2DE4A 1KWHA 4XKQA 3TUSA 1JW1A 3V8XB 1EYIA 2KR0A 2XXQA 1NUYA 3BKIB 3IL1B 1Q35A 3USDA 4MHFA 1QUJA 1GV8A 3TTNA 4WKMA 1IUDA 1D9QA 1Y4CA 4I9DA 2UVJA 1DCUA 4GLIA 5EHMA 2XXWA 4R9GA 1FPFA 4E0WA 3E79A 4ESXA 4FJPA 1R1NA 3PMXA 2HHMA 4H45A 5J16A 2QVRA 5CBSA 4ESWA 3PPPA 5CBRA 4XKNA 4U23A 4FE8A 4FIMA 3WAFA 4Q8RA 5IKBA 3LSXA 2IA4A 1JEVA 1N3XA 5TPAA 4O8MA 3NOHA 3VLVA 3VLUA 4QF9A 2OX3A 5EYFA 5KDTA 4GXSB 2E0SA 1FQBA 2UVHA 2OCUA 2PMSA 3E3KA 2OWZA 1K9ZA 5L9SA 2H99A 3QMFA 4GOTA 4ZEBA 5CM6A 1PC3A 2XXYA 3G3IA 3IJOB 3BFUA 5FTIA 4XKPA 1MXUA 2XWVA 3A09A 3HFUA 4XEQA 4GF8A 1I69A 4OYVA 3ILTB 5CI5A 5M2VA 3UGWA 3H6WA 4GQOA 4DXBA 2UVIA 3OO7A 3F11A 1B9JA 3C9HA 2YJPA 4I40A 3R26A 4YAHX 1S9TA 3P7IA 4RPNA 2VT5A 4F2OA 3IOUA 1ANFA 2L5VA 5AA4B 4U4XA 5KZTA 4GBVA 4KYDA 1Y1MA 4NTLA 4ZEIA 4BDNA 3MJNA 2Q8MA 1POTA 4OWDA 4EQBA 3M3LA 3GLBA 1YYZA 1USYE 3VVFA 1AMFA 5IZZA 2PCRA 4ELRA 3H6UA 4IO5A 1PB9A 1MQHA 4GXAA 2XXRA 4DXCA 5T3JA 4R6KA 2HAUA 3DM0A 1ZU0A 3FJMA 3H06B 1B1XA 4KR5A 4F1VA 5EHSA 2Q89A 5I2NB 4GFRA 4OQOA 1N3WA 4F3SA 1IEJA 2YPNA 5DYHA 3SEUA 2ZYMA 2DWJA 4G68C 5JTYB 4JB7A 3W15C 1B3GA 3KN3A 4H8IA 4N15A 4ISUA 2Z22A 3RN8A 1FBGA 4OZ9A 2O84X 3MZ9A 3D4CA 2QS4A 3FXBA 3QXMA 1A55A 4ONYA 2MKZA 1YAEA 1NNFA 1JQFA 1QUKA 2X26A 4DCYA 1MXZA 4M1VA 3HPIA 4MNIA 1H45A 3ECRA 1CNQA 1DOTA 1HSJA 1CB6A 4PCDA 4NF4B 3SESA 1YPNA 2A5TB 3ZS6A 5EQ8A 1SW4A 1MY1A 1IZ1A 1URDA 5FHNA 4FEDA 5ICQA 2XWIA 3FXQA 3E78A 2XXPA 3E9XA 2ZXTA 3UA8A 3I5OA 4YMAA 1EU8A 1FTJA 3LBSA 5DEXA 1MQDA 3QAXA 1NV3A 4F3GA 1QKBA 1ZMGA 3KSJA 4GBWA 4DLDA 2F97A 2V3UA 3S9EA 2Q9TA 3EF7A 3MVWA 2RC8A 3SEYA 2PBWA 3IFAA 5H8NA 2HAVA 1SI0A 2HZLA 3FIRA 4MCOA 2FHYA 3FV1A 2F34A 4RJZA 4ELQA 3U65A 3KN7A 3U1OA 4PDHA 4LUBA 4EQ9A 1S50A 4NHBA 2P3NA 5ESYA 1FJ6A 3MQ9A 5BWJA 3CR9A 2F36A 4NWDA 1O7TA 2F3DA 2R8TA 3TFLA 3RTFB 1MQGA 2DVZA 4IGRA 4N07A 2DQVA 2UYFA 1FBEA 2GHBA 3D4GA 3CSBA 3RNNA 1FPEA 4P1LA 1XT8A 5A5XA 2QSXA 3FXRA 4WEPA 1P1UA 3K1NA 4O94A 5AA2D 2V84A 2WYPA 1Y9UA 3I3VA 2DYXA 4Q30B 2O7UA 2PT2A 4PF8A 3PU5A 2OWTA 4O3AA 4NF5B 4LVQA 3KBZA 4PF6A 2RCBA 2UVGA 3ZSFA 3PMWA 3IO6A 1B7HA 3IFCA 3S9NC 1DTZA 2HCAA 2HPGA 2Z8FA 1NV1A 2ZMBA 2YLNA 3FXUA 2REGA 1A54A 2B3BA 5I56A
chains in the Genus database with same CATH topology
3TTKA 3K6VA 1IXIA 2ZNSA 5I59B 2H25A 4IGTA 3FV2A 1Z7NE 1B05A 2AYSA 4XKRA 4XTCQ 4AB5A 3M3KA 1II5A 2QS1A 4YU0A 2F8DA 1HSEA 2B3FA 1Y1ZA 3MPLA 3O29A 2RC7A 1MQIA 4QFOA 3N6TA 2O1LA 1VFDA 4GL0A 3EN3A 5AA2B 4KCCA 5JEIA 2E1SA 2GFEA 4FAJA 4PE5B 4H8JA 1NH7A 2R71A 4FATA 4OTEA 3THIA 4WEDA 3LUYA 2HZKA 1FCKA 3H3GA 1A99A 3C35A 1XS5A 2ZYOA 4Q5TA 4OFJA 4NMYA 5I58B 4PP0A 4YB5A 3TQWA 4DIGA 3CFXA 3CRBA 2CMOA 3T66A 3PUVE 1NL5A 2DP8A 1XHYA 2DE2A 4N6PA 3N26A 2I4CA 3KZGA 1LCFA 5I84A 1D9YA 3HHGA 1QVSA 4HCYA 3V89B 3RGYA 4C0RA 2HEUA 4R72A 5CMCA 4F19A 3CFZA 1ZTYA 2Q2CA 5DVJA 4RY1A 3MPKA 4C1UA 4MLQA 5CC2A 4LZ5A 4UACA 1FQEA 1SYIA 1MPDA 4YB7A 2H98A 2BJJX 1TFAA 1BIYA 4ND9A 4IY6A 1Y3NA 3MZBA 2REJA 2UXAA 4YICA 3UORA 5FHOA 3HO7A 5H8QB 2RINA 1MXXA 3O66A 5ELVA 3QUJA 4ZECA 4OETA 4ZEFA 1LGBC 3PD9A 5I57A 3DELB 4NEDA 3FVGA 4F18A 4R2FA 1BKAA 5B70A 1NNKA 4ECFA 5TPAB 3LSWA 1YCJA 3HHFA 3Q26A 5F7VA 2PX1A 2H4IA 3PUYE 2P1SA 5K2XA 4ZE9A 1ATGA 2XXVA 2Z8DA 2D21A 2VP1A 4XIGQ 3PPQA 1EZOA 3T9VA 2GHAA 4OEUA 2XD2A 2Y7KA 1R9LA 3VDFA 3LSFB 1B2HA 4F31B 4NF6B 2AIXA 3TQLA 3KSXA 4BDRA 1M5FA 1GTKA 1FQAA 3G3KA 2XXUA 4RPOA 1ZKBA 3VE1B 4Q0CA 2F7BA 2Y7RA 3U94A 1R9QA 1B0LA 1B7UA 1M5DA 4NF8B 3TTRA 3GBBA 2I58A 4G68A 2QS3A 3CG1A 3U92A 5TU0A 1DMBA 3C36A 4X1DA 3H4ZA 4KPTA 1XVYA 4EUOA 4RA1A 1H76A 1N84A 3TMGA 2ONSA 1B7ZA 4DE8A 1GR2A 3UP9A 2OJTA 3PUZE 3SKPA 5H8HA 3O9PA 4BLAA 1SBPA 1HSLA 1BP5A 1H3DA 4TOZA 4OESA 4JDFA 4TLLB 2Q88A 3LC8A 1H44A 2I0BA 1US4A 2GRVA 4THIA 2XXIA 4FORA 3E13X 3UIFA 1JETA 1UTHB 1MY2A 1JEUA 1YTVA 1POY1 5DVFA 3VVEA 4YZZA 3MBPA 4IO6A 4HCWA 3C34A 1ZJLA 2VOZA 4C1TA 2O7IA 2R6GE 4OFLA 3KG2A 1NMUA 1PBQA 1TWYA 3R7XA 1IQ7A 3OO6A 1MXVA 3OSRA 1FQDA 2XXXA 2HFBA 3OEKA 4POWA 1Y4TA 4HTGA 5DVIA 3TCGA 3N94A 3FATA 4FECA 4QFLA 1MH3A 2Z8EA 1SYHA 1FTKA 1SI1A 3HSTA 5DEXB 4H1XA 1ZLQA 4P0IA 4F2QA 1AH5A 1Y20A 4KD5A 3MZ1A 1LLSA 4EF1A 3K0VA 5H8NB 1XOCA 3QK6A 4EXKA 1MXYA 1FW0A 1A40A 1FQCA 5AA4A 3OEMA 2G93A 4F1UA 5LOMA 3GBAA 5HBCA 3VFJA 3C33A 2ABHA 2OLBA 3KJ7A 2VD2A 3A3UA 5F1QA 3HCQA 4MBPA 4TQUQ 4LZ8A 4ZEKA 4KYSA 4LONB 2O6AA 3EHSA 5FHMA 3T9UA 4LZ7A 3RLFE 3PD8A 4OERA 4QSEA 2X7QA 3K01A 2FYIA 5L8DA 3EHUA 2AL5A 1LAFE 1A8EA 3U8QA 1O64A 1AOVA 5FTHA 1P1WA 3IB1A 4QFKA 2NXOA 3G7WA 3ZKKA 3IOWA 2RKMA 5JTYA 4X1BA 2FA7A 3RY3A 3FVOA 1IITA 1Z7ME 2F7CA 1JNFA 3HN0A 1SW2A 3TTMA 4F1YA 4YKPA 1NKXA 2PYYA 4LQ5A 3EHTA 4POXA 5I56B 2ALUA 4LATA 2H5YA 3E4RA 4R9FA 3M3FA 3FJ7A 1M5CA 2UYEA 1R6ZA 4QSCA 2NOOA 4EQ7A 2X7PA 4ZZAA 1D9VA 1DTGA 1L5TA 1PDAA 2A5TA 2ONKE 1MM7A 5J1DA 1P1OA 1AIVA 3Q28A 2VGQA 3GZGA 3LR1A 1BLFA 1I6BA 3FZVA 3MVZA 1LFGA 1MY4A 4ELOA 1QUIA 1NH8A 2I49A 1N76A 5L9MA 3R6UA 4KHZE 3K6WA 1SDXA 3MWBA 2DWIA 4JBZA 3T93B 1IXGA 1LSTA 2DOJA 4R75A 1J1NA 1MDP1 3A3CA 3M8UA 4JWXA 4ELPA 1MH4A 1MY3A 4G8HA 4DDDA 2ESNA 1B5JA 4H5GA 1B6HA 1H43A 2QMWA 1SVXB 1DPEA 1N7WA 4H65A 3KFMA 3T22A 3TCFA 1PB8A 3S2VA 1OMPA 2ZYNA 3MP1A 3K6UA 4R74A 3EQ1A 3CVGA 4MF3A 4H67A 3DP8A 1IIWA 2Y84A 2XXHA 3H6VA 4ZE8A 2OZZA 1B5HA 1ELJA 1VR5A 1LAGE 4R2BA 2I6EA 2D5WA 2GH9A 3BFTA 2VD3A 1Q1KA 4I8CA 3KJTA 3IOTA 1B51A 5I2KA 2W7YA 1B58A 4NF5A 2ONRA 5B7DA 4BDMA 3K02A 5TP9A 2PVUA 3PPNA 3Q25A 1LBCA 2DWHA 3FGSA 4IO2A 4F3PA 1LBBA 5I59A 1MPCA 5ITOA 1T0KA 3SERA 5HM4B 4EXLA 4U21A 3K6XA 5BUUA 3TELA 3OSQA 1WODA 3IK6B 3O6HA 5ICTA 3OOAA 5DTBA 3OO9A 2V3TA 4O3CA 1DPPA 4IB2A 4QFNA 5KCJA 5AA2A 1M5BA 4M4GA 1URSA 4KYEA 4X9TA 3W9VA 5HPQA 2O68A 4H0WA 4L17A 4RK2A 4OMBA 3SDFA 2Y7IA 2IEEA 3AXFA 4U1ZA 3UN6A 1NFTA 3TTLA 1F9BA 4R73A 3L6HA 4GL8A 4U1OA 4MFIA 5KDTB 4ZS9A 4GIZA 3PV0E 3TYHA 3GXAA 3TKDA 4IO3A 4G68B 2XD3A 1Y3QA 3SETA 2ZYKA 4RYAA 4I1DA 2RC9A 5CMBA 3MVYA 3VVDA 1P99A 2RCAA 3B7DA 4DCXA 1VSOA 3N5LA 3U72A 2NWJA 1OVBA 3MUQA 5H8HB 2I0CA 1A7LA 5JK4A 1MY0A 1B3EA 3MAMA 2Q8JA 5H8SA 3FASA 4E0XA 1XVXA 2H9BA 5H8QA 3O28A 1P1QA 3IB2A 4OFOA 1QJMA 4ZDMA 2NUVA 2I4BA 3FD3A 2D3IA 4JXIA 1GVCA 5AE4A 3PUWE 1UQWA 2XX9A 1FTMA 4JWYA 1UTBA 2QJEA 2P0SA 3T9HB 1B3FA 3U93A 4F29A 1QULA 2QMXA 3IOVA 4DXUA 3O2AA 4H6DA 2I3WA 1MG1A 1MM6A 1VFEA 3C32A 4MH5A 1OQHA 1N04A 3MVXA 1RYXA 5H8FA 2XXTA 2HXWA 3K1MA 3Q27A 3FJGA 3OENA 4FEBA 1B52A 4H5FA 1B4HA 3OELA 1LAHE 1NNTA 1FQFA 3PUXE 3VV5A 1VE4A 3TZAA 1SQYA 4P0GA 2I3VA 5CMKA 1AL3A 2KLFA 1OVTA 1FTOA 4NF6A 4OEVA 3G3HA 3MC2A 3QUFA 3KBRA 4MLVA 4YMBA 3FVKA 3CG3A 3G3FA 1B1HA 1JVYA 3V83A 1M5EA 1B3HA 2I48A 1LB8A 4LA9A 4U22A 2DXYA 1IXCA 4NF8A 3FVNA 2O69A 4R6YA 2ZNUA 2QS2A 4GWOA 3IAZA 4ZEDA 1US5A 4F39A 3K00A 3TCHA 2Z23A 3OD7A 3S9LC 3O97A 2CZLA 3DP4A 3TODA 3MP8A 4F22A 1WDNA 1WVJA 3TDJA 4R6HA 3EPEA 4EF2A 3JYRA 1FTLA 5ISUA 3CFLA 1N0TA 1UTHA 1LFHA 1IXHA 3LSLA 2DWAA 1UIUA 3SEXA 4G8MA 2QPQA 3S4UA 1JW4A 4PFUA 3JV9A 1QKAA 3RT6B 3QIMA 3OMBA 4KQPA 2OWSA 3H7MA 2DE3A 4AB6A 5DT6A 4NWCA 2QRYA 5A5XB 4UA8A 1EZPA 1GGGA 4RXLA 5I2NA 2DS9A 3RPWA 2FNCA 3N6UA 3S9MC 3QSLA 4KI0E 1LCTA 1TXFA 5AA1A 3JZJA 1Y3PA 3VXBA 1DSNA 1B5IA 3ZKLA 3SEWA 1D3KA 1JW5A 2NVUB 3PMVA 3ONMA 3RT8A 2XHDA 3TEPA 3RTWB 3K4UA 3KOTA 2XX8A 4OVJA 1P1NA 4TLMB 1B46A 3T9XB 2F7AA 2DXRA 3DLNA 1SD3A 5ITPA 2G29A 3T96B 3VXCA 5CMMA 4GD5A 3ODBA 2DVCA 2F6PA 4HW8A 3PGFA 1B40A 1EH3A 3UK4A 2LAOA 3IJXB 4U4SA 4NF4A 4BDQA 1OQGA 3OO8A 4KFQA 4YKJA 4DZ1A 3RUMA 4BDLA 4OXVA 4EDPA 4YKKA 3OXNA 1OIBA 3IB0A 3I6VA 2Q2AA 1MPBA 4YB6A 3IX1A 3L6GA 4PFWA 4PQJA 3H6TA 1RYOA 2XX7A 2O1MA 4QRZA 3K1PA 5I2KB 3PPRA 4JSOA 3PPOA 1S7YA 2WKYA 4I62A 2QL3A 3SEVA 1D4NA 5K2YA 3FUZA 3QYTA 5TP9B 2F6GA 2HQ0A 1NNPA 3Q29A 3KGCA 1MRPA 4KCDA 1MXWA 3G3GA 4YKIA 4QHQA 3G3JA 4U2RA 3V5AA 1B32A 1ZBMA 3C31A 4G8NA 4LQ2A 1SW1A 5AA3A 3O6GA 2OK2A 4BDOA 3ILUB 4G4PA 1OLAA 1N7XA 3H03A 3TPAA 1B3LA 2AL4A 1SW5A 4LP2B 4G77A 2DSFA 5KCJB 3TAJA 4OENA 4XXUA 2M8CA 1XC1A 4IY5A 2V3QA 1O63A 4AQ4A 5I57B 3BBRA 4JSDA 1UIVA 2RF1A 2Y7WA 4G2ZA 1LAXA 1I6AA 3IO4A 4PFTA 3KN8A 4P11A 4QFPA 4RNSA 2F5XA 4RK9A 4NE4A 1PBPA 4GVOA 2Y7PA 4Z0IA 1JVXA 2F35A 4GRKA 1B0HA 3CSGA 2ANJA 3MW0A 4PFYA 4ZZEA 1USYH 2ZNTA 1OLCA 4X48A 1B4ZA 1MS7A 4OHNA 1CE2A 3IR1A 3CI8A 3B6QA 1RKMA 5L9OA 4Z7EA 4PETA 2P2AA 1EZ9A 1LB9A 2THIA 2R9JA 5CRYA 1MDQA 1I6QA 3C4MA 3KOSA 3B6TA 4WXJA 2VHAA 4K3FA 2V93A 4IO7A 2F78A 3IORA 1URGA 1QW0A 4HS7A 5I58A 1A8FA 2B65A 2O51A 1BTJA 3K2DA 2A5SA 4IO4A 1MQJA 3CIJA 4O3BA 2OBGA 3KEIA 3B6WA 1PEBA 4F3BA 4JWOA 3VLWA 4QSDA 2V25A 3HV1A 3WAEA 2PT1A 1UTBB 4N13A 1TFDA 5IAIA 3RQTA 1ZIUA 1PB7A 3MP6A 3W9WA 1TT1A 3O6IA 3DP6A 1LFIA 5H8FB 2DE4A 1KWHA 4XKQA 3TUSA 1JW1A 3V8XB 2XXQA 3BKIB 3IL1B 1Q35A 3USDA 1QUJA 1GV8A 3TTNA 4WKMA 1IUDA 1Y4CA 4I9DA 2UVJA 4GLIA 5EHMA 2XXWA 4R9GA 4E0WA 4ESXA 4FJPA 1R1NA 3PMXA 5CBSA 4ESWA 3PPPA 5CBRA 4XKNA 4U23A 4FE8A 4FIMA 3WAFA 4Q8RA 5IKBA 3LSXA 2IA4A 1JEVA 1N3XA 5TPAA 3VLVA 3VLUA 4QF9A 5EYFA 5KDTA 4GXSB 2E0SA 1FQBA 2UVHA 2OCUA 2PMSA 3E3KA 5L9SA 2H99A 4ZEBA 4GOTA 5CM6A 1PC3A 2XXYA 3G3IA 3IJOB 3BFUA 5FTIA 4XKPA 1MXUA 3A09A 4GF8A 1I69A 4OYVA 3ILTB 5CI5A 5M2VA 3UGWA 3H6WA 4GQOA 4DXBA 2UVIA 3OO7A 3F11A 1B9JA 3C9HA 2YJPA 3R26A 4YAHX 1S9TA 3P7IA 4RPNA 4F2OA 3IOUA 1ANFA 5AA4B 4U4XA 5KZTA 4KYDA 1Y1MA 4NTLA 4ZEIA 4BDNA 3MJNA 1POTA 4OWDA 4EQBA 3M3LA 3GLBA 1USYE 3VVFA 1AMFA 4ELRA 3H6UA 4IO5A 1PB9A 1MQHA 4GXAA 2XXRA 4DXCA 4R6KA 2HAUA 3DM0A 1ZU0A 3FJMA 3H06B 1B1XA 4KR5A 4F1VA 5EHSA 2Q89A 5I2NB 4GFRA 4OQOA 1N3WA 4F3SA 1IEJA 2YPNA 5DYHA 3SEUA 2ZYMA 2DWJA 4G68C 5JTYB 4JB7A 3W15C 1B3GA 3KN3A 4H8IA 4ISUA 2Z22A 3RN8A 4OZ9A 2O84X 3MZ9A 3D4CA 2QS4A 3QXMA 1A55A 4ONYA 1YAEA 1NNFA 1JQFA 1QUKA 2X26A 4DCYA 1MXZA 4M1VA 3HPIA 1H45A 3ECRA 1DOTA 1HSJA 1CB6A 4NF4B 3SESA 1YPNA 2A5TB 3ZS6A 1SW4A 1MY1A 1IZ1A 1URDA 5FHNA 4FEDA 5ICQA 3FXQA 2XXPA 3E9XA 2ZXTA 3UA8A 3I5OA 4YMAA 1EU8A 1FTJA 3LBSA 5DEXA 1MQDA 3QAXA 4F3GA 1QKBA 1ZMGA 3KSJA 4DLDA 2F97A 2V3UA 3S9EA 2Q9TA 3EF7A 3MVWA 2RC8A 3SEYA 2PBWA 5H8NA 2HAVA 1SI0A 2HZLA 3FIRA 3FV1A 2F34A 4RJZA 4ELQA 3KN7A 3U1OA 4LUBA 4EQ9A 1S50A 3MQ9A 5BWJA 3CR9A 2F36A 4NWDA 1O7TA 3TFLA 3RTFB 1MQGA 2DVZA 4IGRA 4N07A 2DQVA 2UYFA 2GHBA 3D4GA 3CSBA 3RNNA 1XT8A 5A5XA 2QSXA 3FXRA 4WEPA 1P1UA 3K1NA 5AA2D 2V84A 1Y9UA 3I3VA 2DYXA 4Q30B 2O7UA 2PT2A 3PU5A 2OWTA 4O3AA 4NF5B 4LVQA 2RCBA 2UVGA 3ZSFA 3PMWA 3IO6A 1B7HA 3S9NC 1DTZA 2HCAA 2Z8FA 2ZMBA 2YLNA 3FXUA 2REGA 1A54A 2B3BA 5I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTK A;  3K6V A;  1IXI A;  2ZNS A;  5I59 B;  2H25 A;  4IGT A;  3FV2 A;  1Z7N E;  1B05 A;  2AYS A;  4XKR A;  4XTC Q;  4AB5 A;  3M3K A;  1II5 A;  2QS1 A;  4YU0 A;  2F8D A;  1HSE A;  2B3F A;  1Y1Z A;  3MPL A;  3O29 A;  2RC7 A;  1MQI A;  4QFO A;  3N6T A;  2O1L A;  1VFD A;  4GL0 A;  3EN3 A;  5AA2 B;  4KCC A;  5JEI A;  2E1S A;  2GFE A;  4FAJ A;  4PE5 B;  4H8J A;  1NH7 A;  2R71 A;  4FAT A;  4OTE A;  3THI A;  4WED A;  3LUY A;  2HZK A;  1FCK A;  3H3G A;  1A99 A;  3C35 A;  1XS5 A;  2ZYO A;  4Q5T A;  4OFJ A;  4NMY A;  5I58 B;  4PP0 A;  4YB5 A;  3TQW A;  4DIG A;  3CFX A;  3CRB A;  2CMO A;  3T66 A;  3PUV E;  1NL5 A;  2DP8 A;  1XHY A;  2DE2 A;  4N6P A;  3N26 A;  2I4C A;  3KZG A;  1LCF A;  5I84 A;  1D9Y A;  3HHG A;  1QVS A;  4HCY A;  3V89 B;  3RGY A;  4C0R A;  2HEU A;  4R72 A;  5CMC A;  4F19 A;  3CFZ A;  1ZTY A;  2Q2C A;  5DVJ A;  4RY1 A;  3MPK A;  4C1U A;  4MLQ A;  5CC2 A;  4LZ5 A;  4UAC A;  1FQE A;  1SYI A;  1MPD A;  4YB7 A;  2H98 A;  2BJJ X;  1TFA A;  1BIY A;  4ND9 A;  4IY6 A;  1Y3N A;  3MZB A;  2REJ A;  2UXA A;  4YIC A;  3UOR A;  5FHO A;  3HO7 A;  5H8Q B;  2RIN A;  1MXX A;  3O66 A;  5ELV A;  3QUJ A;  4ZEC A;  4OET A;  4ZEF A;  1LGB C;  3PD9 A;  5I57 A;  3DEL B;  4NED A;  3FVG A;  4F18 A;  4R2F A;  1BKA A;  5B70 A;  1NNK A;  4ECF A;  5TPA B;  3LSW A;  1YCJ A;  3HHF A;  3Q26 A;  5F7V A;  2PX1 A;  2H4I A;  3PUY E;  2P1S A;  5K2X A;  4ZE9 A;  1ATG A;  2XXV A;  2Z8D A;  2D21 A;  2VP1 A;  4XIG Q;  3PPQ A;  1EZO A;  3T9V A;  2GHA A;  4OEU A;  2XD2 A;  2Y7K A;  1R9L A;  3VDF A;  3LSF B;  1B2H A;  4F31 B;  4NF6 B;  2AIX A;  3TQL A;  3KSX A;  4BDR A;  1M5F A;  1GTK A;  1FQA A;  3G3K A;  2XXU A;  4RPO A;  1ZKB A;  3VE1 B;  4Q0C A;  2F7B A;  2Y7R A;  3U94 A;  1R9Q A;  1B0L A;  1B7U A;  1M5D A;  4NF8 B;  3TTR A;  3GBB A;  2I58 A;  4G68 A;  2QS3 A;  3CG1 A;  3U92 A;  5TU0 A;  1DMB A;  3C36 A;  4X1D A;  3H4Z A;  4KPT A;  1XVY A;  4EUO A;  4RA1 A;  1H76 A;  1N84 A;  3TMG A;  2ONS A;  1B7Z A;  4DE8 A;  1GR2 A;  3UP9 A;  2OJT A;  3PUZ E;  3SKP A;  5H8H A;  3O9P A;  4BLA A;  1SBP A;  1HSL A;  1BP5 A;  1H3D A;  4TOZ A;  4OES A;  4JDF A;  4TLL B;  2Q88 A;  3LC8 A;  1H44 A;  2I0B A;  1US4 A;  2GRV A;  4THI A;  2XXI A;  4FOR A;  3E13 X;  3UIF A;  1JET A;  1UTH B;  1MY2 A;  1JEU A;  1YTV A;  1POY 1;  5DVF A;  3VVE A;  4YZZ A;  3MBP A;  4IO6 A;  4HCW A;  3C34 A;  1ZJL A;  2VOZ A;  4C1T A;  2O7I A;  2R6G E;  4OFL A;  3KG2 A;  1NMU A;  1PBQ A;  1TWY A;  3R7X A;  1IQ7 A;  3OO6 A;  1MXV A;  3OSR A;  1FQD A;  2XXX A;  2HFB A;  3OEK A;  4POW A;  1Y4T A;  4HTG A;  5DVI A;  3TCG A;  3N94 A;  3FAT A;  4FEC A;  4QFL A;  1MH3 A;  2Z8E A;  1SYH A;  1FTK A;  1SI1 A;  3HST A;  5DEX B;  4H1X A;  1ZLQ A;  4P0I A;  4F2Q A;  1AH5 A;  1Y20 A;  4KD5 A;  3MZ1 A;  1LLS A;  4EF1 A;  3K0V A;  5H8N B;  1XOC A;  3QK6 A;  4EXK A;  1MXY A;  1FW0 A;  1A40 A;  1FQC A;  5AA4 A;  3OEM A;  2G93 A;  4F1U A;  5LOM A;  3GBA A;  5HBC A;  3VFJ A;  3C33 A;  2ABH A;  2OLB A;  3KJ7 A;  2VD2 A;  3A3U A;  5F1Q A;  3HCQ A;  4MBP A;  4TQU Q;  4LZ8 A;  4ZEK A;  4KYS A;  4LON B;  2O6A A;  3EHS A;  5FHM A;  3T9U A;  4LZ7 A;  3RLF E;  3PD8 A;  4OER A;  4QSE A;  2X7Q A;  3K01 A;  2FYI A;  5L8D A;  3EHU A;  2AL5 A;  1LAF E;  1A8E A;  3U8Q A;  1O64 A;  1AOV A;  5FTH A;  1P1W A;  3IB1 A;  4QFK A;  2NXO A;  3G7W A;  3ZKK A;  3IOW A;  2RKM A;  5JTY A;  4X1B A;  2FA7 A;  3RY3 A;  3FVO A;  1IIT A;  1Z7M E;  2F7C A;  1JNF A;  3HN0 A;  1SW2 A;  3TTM A;  4F1Y A;  4YKP A;  1NKX A;  2PYY A;  4LQ5 A;  3EHT A;  4POX A;  5I56 B;  2ALU A;  4LAT A;  2H5Y A;  3E4R A;  4R9F A;  3M3F A;  3FJ7 A;  1M5C A;  2UYE A;  1R6Z A;  4QSC A;  2NOO A;  4EQ7 A;  2X7P A;  4ZZA A;  1D9V A;  1DTG A;  1L5T A;  1PDA A;  2A5T A;  2ONK E;  1MM7 A;  5J1D A;  1P1O A;  1AIV A;  3Q28 A;  2VGQ A;  3GZG A;  3LR1 A;  1BLF A;  1I6B A;  3FZV A;  3MVZ A;  1LFG A;  1MY4 A;  4ELO A;  1QUI A;  1NH8 A;  2I49 A;  1N76 A;  5L9M A;  3R6U A;  4KHZ E;  3K6W A;  1SDX A;  3MWB A;  2DWI A;  4JBZ A;  3T93 B;  1IXG A;  1LST A;  2DOJ A;  4R75 A;  1J1N A;  1MDP 1;  3A3C A;  3M8U A;  4JWX A;  4ELP A;  1MH4 A;  1MY3 A;  4G8H A;  4DDD A;  2ESN A;  1B5J A;  4H5G A;  1B6H A;  1H43 A;  2QMW A;  1SVX B;  1DPE A;  1N7W A;  4H65 A;  3KFM A;  3T22 A;  3TCF A;  1PB8 A;  3S2V A;  1OMP A;  2ZYN A;  3MP1 A;  3K6U A;  4R74 A;  3EQ1 A;  3CVG A;  4MF3 A;  4H67 A;  3DP8 A;  1IIW A;  2Y84 A;  2XXH A;  3H6V A;  4ZE8 A;  2OZZ A;  1B5H A;  1ELJ A;  1VR5 A;  1LAG E;  4R2B A;  2I6E A;  2D5W A;  2GH9 A;  3BFT A;  2VD3 A;  1Q1K A;  4I8C A;  3KJT A;  3IOT A;  1B51 A;  5I2K A;  2W7Y A;  1B58 A;  4NF5 A;  2ONR A;  5B7D A;  4BDM A;  3K02 A;  5TP9 A;  2PVU A;  3PPN A;  3Q25 A;  1LBC A;  2DWH A;  3FGS A;  4IO2 A;  4F3P A;  1LBB A;  5I59 A;  1MPC A;  5ITO A;  1T0K A;  3SER A;  5HM4 B;  4EXL A;  4U21 A;  3K6X A;  5BUU A;  3TEL A;  3OSQ A;  1WOD A;  3IK6 B;  3O6H A;  5ICT A;  3OOA A;  5DTB A;  3OO9 A;  2V3T A;  4O3C A;  1DPP A;  4IB2 A;  4QFN A;  5KCJ A;  5AA2 A;  1M5B A;  4M4G A;  1URS A;  4KYE A;  4X9T A;  3W9V A;  5HPQ A;  2O68 A;  4H0W A;  4L17 A;  4RK2 A;  4OMB A;  3SDF A;  2Y7I A;  2IEE A;  3AXF A;  4U1Z A;  3UN6 A;  1NFT A;  3TTL A;  1F9B A;  4R73 A;  3L6H A;  4GL8 A;  4U1O A;  4MFI A;  5KDT B;  4ZS9 A;  4GIZ A;  3PV0 E;  3TYH A;  3GXA A;  3TKD A;  4IO3 A;  4G68 B;  2XD3 A;  1Y3Q A;  3SET A;  2ZYK A;  4RYA A;  4I1D A;  2RC9 A;  5CMB A;  3MVY A;  3VVD A;  1P99 A;  2RCA A;  3B7D A;  4DCX A;  1VSO A;  3N5L A;  3U72 A;  2NWJ A;  1OVB A;  3MUQ A;  5H8H B;  2I0C A;  1A7L A;  5JK4 A;  1MY0 A;  1B3E A;  3MAM A;  2Q8J A;  5H8S A;  3FAS A;  4E0X A;  1XVX A;  2H9B A;  5H8Q A;  3O28 A;  1P1Q A;  3IB2 A;  4OFO A;  1QJM A;  4ZDM A;  2NUV A;  2I4B A;  3FD3 A;  2D3I A;  4JXI A;  1GVC A;  5AE4 A;  3PUW E;  1UQW A;  2XX9 A;  1FTM A;  4JWY A;  1UTB A;  2QJE A;  2P0S A;  3T9H B;  1B3F A;  3U93 A;  4F29 A;  1QUL A;  2QMX A;  3IOV A;  4DXU A;  3O2A A;  4H6D A;  2I3W A;  1MG1 A;  1MM6 A;  1VFE A;  3C32 A;  4MH5 A;  1OQH A;  1N04 A;  3MVX A;  1RYX A;  5H8F A;  2XXT A;  2HXW A;  3K1M A;  3Q27 A;  3FJG A;  3OEN A;  4FEB A;  1B52 A;  4H5F A;  1B4H A;  3OEL A;  1LAH E;  1NNT A;  1FQF A;  3PUX E;  3VV5 A;  1VE4 A;  3TZA A;  1SQY A;  4P0G A;  2I3V A;  5CMK A;  1AL3 A;  2KLF A;  1OVT A;  1FTO A;  4NF6 A;  4OEV A;  3G3H A;  3MC2 A;  3QUF A;  3KBR A;  4MLV A;  4YMB A;  3FVK A;  3CG3 A;  3G3F A;  1B1H A;  1JVY A;  3V83 A;  1M5E A;  1B3H A;  2I48 A;  1LB8 A;  4LA9 A;  4U22 A;  2DXY A;  1IXC A;  4NF8 A;  3FVN A;  2O69 A;  4R6Y A;  2ZNU A;  2QS2 A;  4GWO A;  3IAZ A;  4ZED A;  1US5 A;  4F39 A;  3K00 A;  3TCH A;  2Z23 A;  3OD7 A;  3S9L C;  3O97 A;  2CZL A;  3DP4 A;  3TOD A;  3MP8 A;  4F22 A;  1WDN A;  1WVJ A;  3TDJ A;  4R6H A;  3EPE A;  4EF2 A;  3JYR A;  1FTL A;  5ISU A;  3CFL A;  1N0T A;  1UTH A;  1LFH A;  1IXH A;  3LSL A;  2DWA A;  1UIU A;  3SEX A;  4G8M A;  2QPQ A;  3S4U A;  1JW4 A;  4PFU A;  3JV9 A;  1QKA A;  3RT6 B;  3QIM A;  3OMB A;  4KQP A;  2OWS A;  3H7M A;  2DE3 A;  4AB6 A;  5DT6 A;  4NWC A;  2QRY A;  5A5X B;  4UA8 A;  1EZP A;  1GGG A;  4RXL A;  5I2N A;  2DS9 A;  3RPW A;  2FNC A;  3N6U A;  3S9M C;  3QSL A;  4KI0 E;  1LCT A;  1TXF A;  5AA1 A;  3JZJ A;  1Y3P A;  3VXB A;  1DSN A;  1B5I A;  3ZKL A;  3SEW A;  1D3K A;  1JW5 A;  2NVU B;  3PMV A;  3ONM A;  3RT8 A;  2XHD A;  3TEP A;  3RTW B;  3K4U A;  3KOT A;  2XX8 A;  4OVJ A;  1P1N A;  4TLM B;  1B46 A;  3T9X B;  2F7A A;  2DXR A;  3DLN A;  1SD3 A;  5ITP A;  2G29 A;  3T96 B;  3VXC A;  5CMM A;  4GD5 A;  3ODB A;  2DVC A;  2F6P A;  4HW8 A;  3PGF A;  1B40 A;  1EH3 A;  3UK4 A;  2LAO A;  3IJX B;  4U4S A;  4NF4 A;  4BDQ A;  1OQG A;  3OO8 A;  4KFQ A;  4YKJ A;  4DZ1 A;  3RUM A;  4BDL A;  4OXV A;  4EDP A;  4YKK A;  3OXN A;  1OIB A;  3IB0 A;  3I6V A;  2Q2A A;  1MPB A;  4YB6 A;  3IX1 A;  3L6G A;  4PFW A;  4PQJ A;  3H6T A;  1RYO A;  2XX7 A;  2O1M A;  4QRZ A;  3K1P A;  5I2K B;  3PPR A;  4JSO A;  3PPO A;  1S7Y A;  2WKY A;  4I62 A;  2QL3 A;  3SEV A;  1D4N A;  5K2Y A;  3FUZ A;  3QYT A;  5TP9 B;  2F6G A;  2HQ0 A;  1NNP A;  3Q29 A;  3KGC A;  1MRP A;  4KCD A;  1MXW A;  3G3G A;  4YKI A;  4QHQ A;  3G3J A;  4U2R A;  3V5A A;  1B32 A;  1ZBM A;  3C31 A;  4G8N A;  4LQ2 A;  1SW1 A;  5AA3 A;  3O6G A;  2OK2 A;  4BDO A;  3ILU B;  4G4P A;  1OLA A;  1N7X A;  3H03 A;  3TPA A;  1B3L A;  2AL4 A;  1SW5 A;  4LP2 B;  4G77 A;  2DSF A;  5KCJ B;  3TAJ A;  4OEN A;  4XXU A;  2M8C A;  1XC1 A;  4IY5 A;  2V3Q A;  1O63 A;  4AQ4 A;  5I57 B;  3BBR A;  4JSD A;  1UIV A;  2RF1 A;  2Y7W A;  4G2Z A;  1LAX A;  1I6A A;  3IO4 A;  4PFT A;  3KN8 A;  4P11 A;  4QFP A;  4RNS A;  2F5X A;  4RK9 A;  4NE4 A;  1PBP A;  4GVO A;  2Y7P A;  4Z0I A;  1JVX A;  2F35 A;  4GRK A;  1B0H A;  3CSG A;  2ANJ A;  3MW0 A;  4PFY A;  4ZZE A;  1USY H;  2ZNT A;  1OLC A;  4X48 A;  1B4Z A;  1MS7 A;  4OHN A;  1CE2 A;  3IR1 A;  3CI8 A;  3B6Q A;  1RKM A;  5L9O A;  4Z7E A;  4PET A;  2P2A A;  1EZ9 A;  1LB9 A;  2THI A;  2R9J A;  5CRY A;  1MDQ A;  1I6Q A;  3C4M A;  3KOS A;  3B6T A;  4WXJ A;  2VHA A;  4K3F A;  2V93 A;  4IO7 A;  2F78 A;  3IOR A;  1URG A;  1QW0 A;  4HS7 A;  5I58 A;  1A8F A;  2B65 A;  2O51 A;  1BTJ A;  3K2D A;  2A5S A;  4IO4 A;  1MQJ A;  3CIJ A;  4O3B A;  2OBG A;  3KEI A;  3B6W A;  1PEB A;  4F3B A;  4JWO A;  3VLW A;  4QSD A;  2V25 A;  3HV1 A;  3WAE A;  2PT1 A;  1UTB B;  4N13 A;  1TFD A;  5IAI A;  3RQT A;  1ZIU A;  1PB7 A;  3MP6 A;  3W9W A;  1TT1 A;  3O6I A;  3DP6 A;  1LFI A;  5H8F B;  2DE4 A;  1KWH A;  4XKQ A;  3TUS A;  1JW1 A;  3V8X B;  2XXQ A;  3BKI B;  3IL1 B;  1Q35 A;  3USD A;  1QUJ A;  1GV8 A;  3TTN A;  4WKM A;  1IUD A;  1Y4C A;  4I9D A;  2UVJ A;  4GLI A;  5EHM A;  2XXW A;  4R9G A;  4E0W A;  4ESX A;  4FJP A;  1R1N A;  3PMX A;  5CBS A;  4ESW A;  3PPP A;  5CBR A;  4XKN A;  4U23 A;  4FE8 A;  4FIM A;  3WAF A;  4Q8R A;  5IKB A;  3LSX A;  2IA4 A;  1JEV A;  1N3X A;  5TPA A;  3VLV A;  3VLU A;  4QF9 A;  5EYF A;  5KDT A;  4GXS B;  2E0S A;  1FQB A;  2UVH A;  2OCU A;  2PMS A;  3E3K A;  5L9S A;  2H99 A;  4ZEB A;  4GOT A;  5CM6 A;  1PC3 A;  2XXY A;  3G3I A;  3IJO B;  3BFU A;  5FTI A;  4XKP A;  1MXU A;  3A09 A;  4GF8 A;  1I69 A;  4OYV A;  3ILT B;  5CI5 A;  5M2V A;  3UGW A;  3H6W A;  4GQO A;  4DXB A;  2UVI A;  3OO7 A;  3F11 A;  1B9J A;  3C9H A;  2YJP A;  3R26 A;  4YAH X;  1S9T A;  3P7I A;  4RPN A;  4F2O A;  3IOU A;  1ANF A;  5AA4 B;  4U4X A;  5KZT A;  4KYD A;  1Y1M A;  4NTL A;  4ZEI A;  4BDN A;  3MJN A;  1POT A;  4OWD A;  4EQB A;  3M3L A;  3GLB A;  1USY E;  3VVF A;  1AMF A;  4ELR A;  3H6U A;  4IO5 A;  1PB9 A;  1MQH A;  4GXA A;  2XXR A;  4DXC A;  4R6K A;  2HAU A;  3DM0 A;  1ZU0 A;  3FJM A;  3H06 B;  1B1X A;  4KR5 A;  4F1V A;  5EHS A;  2Q89 A;  5I2N B;  4GFR A;  4OQO A;  1N3W A;  4F3S A;  1IEJ A;  2YPN A;  5DYH A;  3SEU A;  2ZYM A;  2DWJ A;  4G68 C;  5JTY B;  4JB7 A;  3W15 C;  1B3G A;  3KN3 A;  4H8I A;  4ISU A;  2Z22 A;  3RN8 A;  4OZ9 A;  2O84 X;  3MZ9 A;  3D4C A;  2QS4 A;  3QXM A;  1A55 A;  4ONY A;  1YAE A;  1NNF A;  1JQF A;  1QUK A;  2X26 A;  4DCY A;  1MXZ A;  4M1V A;  3HPI A;  1H45 A;  3ECR A;  1DOT A;  1HSJ A;  1CB6 A;  4NF4 B;  3SES A;  1YPN A;  2A5T B;  3ZS6 A;  1SW4 A;  1MY1 A;  1IZ1 A;  1URD A;  5FHN A;  4FED A;  5ICQ A;  3FXQ A;  2XXP A;  3E9X A;  2ZXT A;  3UA8 A;  3I5O A;  4YMA A;  1EU8 A;  1FTJ A;  3LBS A;  5DEX A;  1MQD A;  3QAX A;  4F3G A;  1QKB A;  1ZMG A;  3KSJ A;  4DLD A;  2F97 A;  2V3U A;  3S9E A;  2Q9T A;  3EF7 A;  3MVW A;  2RC8 A;  3SEY A;  2PBW A;  5H8N A;  2HAV A;  1SI0 A;  2HZL A;  3FIR A;  3FV1 A;  2F34 A;  4RJZ A;  4ELQ A;  3KN7 A;  3U1O A;  4LUB A;  4EQ9 A;  1S50 A;  3MQ9 A;  5BWJ A;  3CR9 A;  2F36 A;  4NWD A;  1O7T A;  3TFL A;  3RTF B;  1MQG A;  2DVZ A;  4IGR A;  4N07 A;  2DQV A;  2UYF A;  2GHB A;  3D4G A;  3CSB A;  3RNN A;  1XT8 A;  5A5X A;  2QSX A;  3FXR A;  4WEP A;  1P1U A;  3K1N A;  5AA2 D;  2V84 A;  1Y9U A;  3I3V A;  2DYX A;  4Q30 B;  2O7U A;  2PT2 A;  3PU5 A;  2OWT A;  4O3A A;  4NF5 B;  4LVQ A;  2RCB A;  2UVG A;  3ZSF A;  3PMW A;  3IO6 A;  1B7H A;  3S9N C;  1DTZ A;  2HCA A;  2Z8F A;  2ZMB A;  2YLN A;  3FXU A;  2REG A;  1A54 A;  2B3B A;  5I56 A; 
#chains in the Genus database with same CATH topology
 4O7I A;  3TTK A;  3K6V A;  1IXI A;  2ZNS A;  5I59 B;  4P8B A;  2H25 A;  4IGT A;  3FV2 A;  1Z7N E;  1YZ0 A;  1B05 A;  2AYS A;  4XKR A;  4XTC Q;  4AB5 A;  3M3K A;  4GWZ A;  1II5 A;  2QS1 A;  4YU0 A;  2F8D A;  1HSE A;  2B3F A;  1Y1Z A;  1RDY A;  3MPL A;  3O29 A;  2RC7 A;  1MQI A;  4QFO A;  4PTK A;  3N6T A;  2O1L A;  2CZK A;  1VFD A;  1IME A;  4GL0 A;  3EN3 A;  5AA2 B;  4GWS A;  4KCC A;  5JEI A;  2E1S A;  2GFE A;  4FAJ A;  4PE5 B;  5ET6 A;  4H8J A;  1NH7 A;  5I7I A;  2R71 A;  4FAT A;  4OTE A;  3THI A;  3SZP A;  4H46 A;  4WED A;  3LUY A;  2HZK A;  1FCK A;  3H3G A;  1A99 A;  3C35 A;  2XXK A;  2CZI A;  1XS5 A;  2ZYO A;  4Q5T A;  2WYK A;  4OFJ A;  4NMY A;  5I58 B;  4PP0 A;  4YB5 A;  3TQW A;  4DIG A;  4HE0 A;  3CFX A;  3CRB A;  2CMO A;  3T66 A;  3PUV E;  2Y5L A;  1NL5 A;  2DP8 A;  1XHY A;  2DE2 A;  4HE2 A;  4N6P A;  3N26 A;  2I4C A;  3KZG A;  1LCF A;  5I84 A;  1D9Y A;  3HHG A;  1QVS A;  4HCY A;  3V89 B;  3RGY A;  4C0R A;  2HEU A;  4R72 A;  5CMC A;  4F19 A;  1QGX A;  3CFZ A;  1ZTY A;  2Q2C A;  5DVJ A;  5ET5 A;  4RY1 A;  3MPK A;  4C1U A;  4MLQ A;  4MNP A;  5CC2 A;  4HXV A;  4LZ5 A;  2FIX A;  2ZZW A;  4UAC A;  1FQE A;  1SYI A;  1MPD A;  4YB7 A;  2H98 A;  2BJJ X;  1TFA A;  1BIY A;  4ND9 A;  4IY6 A;  1Y3N A;  3MZB A;  2REJ A;  2UXA A;  4YIC A;  3UOR A;  5FHO A;  3HO7 A;  5H8Q B;  2RIN A;  2HXR A;  1MXX A;  3O66 A;  5ELV A;  5EQ9 A;  3QUJ A;  4ZEC A;  4OET A;  4ZEF A;  1LGB C;  3PD9 A;  5I57 A;  3DEL B;  4AS5 A;  4NED A;  3GYY A;  3FVG A;  4F18 A;  4R2F A;  1BKA A;  5B70 A;  1NNK A;  4ECF A;  2WBD A;  5TPA B;  1FRP A;  1IMF A;  3LSW A;  1YCJ A;  3HHF A;  3Q26 A;  5F7V A;  2JJK A;  2PX1 A;  2H4I A;  3PUY E;  2P1S A;  5K2X A;  4ZE9 A;  4MIJ A;  1ATG A;  2XXV A;  2Z8D A;  2D21 A;  2VP1 A;  4XIG Q;  1NV6 A;  4GWU A;  3PPQ A;  1EZO A;  3T9V A;  2GHA A;  4OEU A;  2XD2 A;  2Y7K A;  1R9L A;  3VDF A;  3LSF B;  3KC0 A;  1NV2 A;  1B2H A;  4F31 B;  4N6K A;  4NF6 B;  4N17 A;  2AIX A;  3TQL A;  3KSX A;  4BDR A;  1M5F A;  1GTK A;  1FQA A;  3G3K A;  4IR8 A;  2XXU A;  4RPO A;  1ZKB A;  4MJO A;  3VE1 B;  4Q0C A;  2F7B A;  2Y7R A;  3U94 A;  1XI6 A;  1R9Q A;  1B0L A;  3B50 A;  1B7U A;  1M5D A;  3ROJ A;  4NF8 B;  3TTR A;  3GBB A;  2I58 A;  4G68 A;  2QS3 A;  3CG1 A;  3U92 A;  5TU0 A;  1DMB A;  3C36 A;  4X1D A;  3H4Z A;  4KPT A;  1XVY A;  5IZ3 B;  4EUO A;  4RA1 A;  3RYD A;  1H76 A;  1N84 A;  3TMG A;  2ONS A;  1B7Z A;  4DE8 A;  1GR2 A;  3UP9 A;  2OJT A;  3PUZ E;  3SKP A;  5H8H A;  3O9P A;  4N81 A;  4BLA A;  1SBP A;  3FBP A;  4OAN A;  1HSL A;  1BP5 A;  1H3D A;  4TOZ A;  4OES A;  4JDF A;  3BIG A;  4TLL B;  2Q88 A;  3LC8 A;  4P47 A;  1H44 A;  4PBH A;  2I0B A;  1US4 A;  2GRV A;  4THI A;  2XXI A;  4FOR A;  3E13 X;  3UIF A;  1JET A;  1UTH B;  3MST A;  1MY2 A;  5I3S A;  1JEU A;  1FPK A;  1YTV A;  1POY 1;  5DVF A;  3VVE A;  1RDX A;  4YZZ A;  3MBP A;  1DBZ A;  4IO6 A;  4HCW A;  2PFZ A;  3C34 A;  1ZJL A;  4XFE A;  4P3L A;  2VOZ A;  4C1T A;  2O7I A;  2R6G E;  4OFL A;  3KG2 A;  1NMU A;  1PBQ A;  1TWY A;  3R7X A;  1IQ7 A;  1KA1 A;  3OO6 A;  1MXV A;  3OSR A;  1FQD A;  1FPG A;  2XXX A;  1NUW A;  2HFB A;  3OEK A;  4POW A;  1Y4T A;  4HTG A;  5DVI A;  3TCG A;  3N94 A;  3FAT A;  4FEC A;  4QFL A;  1MH3 A;  2Z8E A;  1SYH A;  1FTK A;  1SI1 A;  3HST A;  5DEX B;  4H1X A;  1ZLQ A;  2Q74 A;  4P0I A;  4F2Q A;  1AH5 A;  2VPN A;  1Y20 A;  4KD5 A;  3MZ1 A;  1LLS A;  4G61 A;  4EF1 A;  3K0V A;  5H8N B;  1LBZ A;  5F24 A;  1XOC A;  3QK6 A;  4EXK A;  1MXY A;  1FW0 A;  1A40 A;  1FQC A;  5AA4 A;  4PDD A;  3OEM A;  2G93 A;  4F1U A;  1FBD A;  5LOM A;  3GBA A;  5HBC A;  3VFJ A;  3C33 A;  3KJ7 A;  2ABH A;  2OLB A;  2VD2 A;  3A3U A;  5F1Q A;  3HCQ A;  4MBP A;  4TQU Q;  4LZ8 A;  4ZEK A;  4KYS A;  4LON B;  4PE3 A;  2O6A A;  3EHS A;  5FHM A;  3T9U A;  4LZ7 A;  3RLF E;  3PD8 A;  4OER A;  4QSE A;  2X7Q A;  3K01 A;  2FYI A;  1NV0 A;  5L8D A;  4NAP A;  3EHU A;  2AL5 A;  1LAF E;  1A8E A;  3U8Q A;  4OVR A;  1O64 A;  1AOV A;  5FTH A;  1P1W A;  3IB1 A;  4QFK A;  2NXO A;  3G7W A;  3ZKK A;  3IOW A;  5A5L A;  2RKM A;  5JTY A;  4X1B A;  2FA7 A;  3RY3 A;  2QVU A;  3FVO A;  4I3E A;  1IIT A;  4MNC A;  1Z7M E;  2F7C A;  1JNF A;  3HN0 A;  1SW2 A;  3TTM A;  4F1Y A;  4YKP A;  1NKX A;  2PYY A;  4LQ5 A;  3EHT A;  2BJI A;  4POX A;  5I56 B;  2ALU A;  4LAT A;  2H5Y A;  3E4R A;  4R9F A;  3M3F A;  1IMD A;  3FJ7 A;  1M5C A;  2UYE A;  1R6Z A;  4OA4 A;  4QSC A;  2NOO A;  4EQ7 A;  2X7P A;  4ZZA A;  1D9V A;  2QFL A;  1DTG A;  1L5T A;  1PDA A;  2A5T A;  2ONK E;  1MM7 A;  5J1D A;  1P1O A;  1K9Y A;  1AIV A;  3Q28 A;  2VGQ A;  3GZG A;  4P9K A;  3LR1 A;  1BLF A;  1I6B A;  3FZV A;  3MVZ A;  2V4C A;  1LFG A;  2FVZ A;  1MY4 A;  4ELO A;  1QUI A;  1NH8 A;  2I49 A;  1Q9D A;  1N76 A;  5L9M A;  3R6U A;  4KHZ E;  3K6W A;  4OVT A;  1SDX A;  3MWB A;  2DWI A;  4GWY A;  4JBZ A;  3T93 B;  1IXG A;  1LST A;  2DOJ A;  4R75 A;  1J1N A;  1MDP 1;  3A3C A;  3M8U A;  4JWX A;  4ELP A;  1NUZ A;  1MH4 A;  1MY3 A;  2GQ1 A;  1FPL A;  4G8H A;  4DDD A;  2ESN A;  1B5J A;  4H5G A;  1B6H A;  1H43 A;  2QMW A;  1SVX B;  1DPE A;  1N7W A;  4H65 A;  3KFM A;  2B4M A;  5FBP A;  3T22 A;  3TCF A;  1PB8 A;  3S2V A;  1FPD A;  1OMP A;  2ZYN A;  3MP1 A;  3ISP A;  4MX6 A;  3K6U A;  4R74 A;  3EQ1 A;  3CVG A;  4MAG A;  4MF3 A;  4H67 A;  1JP4 A;  3B8B A;  3DP8 A;  1FTA A;  1IIW A;  4P56 A;  2Y84 A;  2XXH A;  3H6V A;  3T1B A;  2FIE A;  4ZE8 A;  2OZZ A;  1B5H A;  1ELJ A;  1VR5 A;  1LAG E;  4R2B A;  2I6E A;  2D5W A;  2GH9 A;  3BFT A;  2VD3 A;  4AS4 A;  1Q1K A;  4I8C A;  3KJT A;  3IOT A;  1B51 A;  5I2K A;  2W7Y A;  1B58 A;  1FBC A;  4NF5 A;  4JVD A;  2ONR A;  5B7D A;  4BDM A;  3K02 A;  5ET8 A;  5TP9 A;  2PVU A;  2ZZX A;  3PPN A;  3A29 A;  3Q25 A;  5EYG A;  1LBC A;  2DWH A;  3FGS A;  4IO2 A;  4LN5 A;  4F3P A;  1LBB A;  5I59 A;  1MPC A;  5ITO A;  1T0K A;  3SER A;  5HM4 B;  4EXL A;  4U21 A;  3K6X A;  5BUU A;  2F3B A;  2DDK A;  3TEL A;  2XWO A;  3OSQ A;  1WOD A;  3IK6 B;  3O6H A;  5ICT A;  3OOA A;  5DTB A;  4X04 A;  3OO9 A;  2V3T A;  4O3C A;  1DPP A;  4IB2 A;  4QFN A;  5KCJ A;  4NQ8 A;  2CEY A;  3BIH A;  1FPB A;  5AA2 A;  1M5B A;  4M4G A;  1URS A;  4KYE A;  4X9T A;  3W9V A;  5HPQ A;  2O68 A;  4H0W A;  4MEV A;  4L17 A;  4RK2 A;  4OMB A;  3SDF A;  2Y7I A;  2IEE A;  4QBA A;  3AXF A;  4U1Z A;  3UN6 A;  2B4L A;  1NFT A;  3TTL A;  1F9B A;  4R73 A;  3L6H A;  4GL8 A;  4U1O A;  4MFI A;  5KDT B;  4ZS9 A;  4GIZ A;  5LDZ A;  4HE1 A;  3PV0 E;  3TYH A;  3GXA A;  3TKD A;  4IO3 A;  2Y5K A;  4G68 B;  2XD3 A;  1Y3Q A;  3SET A;  2ZYK A;  4RYA A;  4I1D A;  2RC9 A;  5CMB A;  3MVY A;  3VVD A;  1P99 A;  4GX6 A;  2RCA A;  3B7D A;  4DCX A;  1VSO A;  4PGN A;  3N5L A;  3U72 A;  4PAF A;  2NWJ A;  4NGU A;  4JVC A;  1OVB A;  3MUQ A;  5H8H B;  2I0C A;  1A7L A;  5JK4 A;  4QXD A;  1MY0 A;  1B3E A;  3MAM A;  4N4U A;  2Q8J A;  5H8S A;  3FAS A;  1NV7 A;  4E0X A;  1XVX A;  2H9B A;  5H8Q A;  3RPL A;  3O28 A;  1P1Q A;  1FBP A;  3IB2 A;  3LUZ A;  4OFO A;  1QJM A;  4ZDM A;  2NUV A;  2I4B A;  3FD3 A;  2D3I A;  4PBQ A;  4JXI A;  3KC1 A;  1GVC A;  5AE4 A;  1NV5 A;  3PUW E;  1UQW A;  4DI3 D;  2XX9 A;  1FTM A;  4MMP A;  1RDZ A;  4JWY A;  1UTB A;  2QJE A;  2P0S A;  3T9H B;  1B3F A;  1VDW A;  3U93 A;  4F29 A;  1QUL A;  2QMX A;  3IOV A;  4DXU A;  3O2A A;  4H6D A;  2I3W A;  1MG1 A;  1MM6 A;  1VFE A;  2P3V A;  3C32 A;  4MH5 A;  1OQH A;  1N04 A;  4PC9 A;  3MVX A;  1RYX A;  5H8F A;  2VPO A;  5EYH A;  2XXT A;  2HXW A;  3K1M A;  3Q27 A;  3FJG A;  3OEN A;  4FEB A;  1B52 A;  4H5F A;  1B4H A;  1EYJ A;  3OEL A;  1LAH E;  1NNT A;  1FQF A;  3PUX E;  1LBY A;  3VV5 A;  1VE4 A;  3TZA A;  1SQY A;  4P0G A;  2I3V A;  5CMK A;  1AL3 A;  2KLF A;  5LTC A;  1OVT A;  1FTO A;  2WX9 A;  4NF6 A;  4XF5 A;  4OEV A;  3LV0 A;  3G3H A;  3MC2 A;  3QUF A;  3KBR A;  4MLV A;  4NN3 A;  4YMB A;  3FVK A;  1DK4 A;  3CG3 A;  3G3F A;  1B1H A;  1JVY A;  3V83 A;  1M5E A;  1B3H A;  4N6D A;  2I48 A;  1LB8 A;  4LA9 A;  4U22 A;  2DXY A;  1IXC A;  4NF8 A;  3FVN A;  2O69 A;  4NF0 A;  1G0H A;  4R6Y A;  4GX3 A;  2ZNU A;  2QS2 A;  4GWO A;  3IAZ A;  5IZ3 A;  4ZED A;  1US5 A;  4F39 A;  3K00 A;  5IZ1 A;  3TCH A;  2Z23 A;  3OD7 A;  3S9L C;  3O97 A;  2CZL A;  3DP4 A;  3TOD A;  3MP8 A;  4F22 A;  1WDN A;  1WVJ A;  1LBW A;  3TDJ A;  4R6H A;  3EPE A;  4EF2 A;  3JYR A;  1LEV A;  1FTL A;  3PTY A;  4X8R A;  5ISU A;  3CFL A;  1N0T A;  1UTH A;  1LFH A;  1IXH A;  1NI9 A;  4FBP A;  3LSL A;  2DWA A;  1UIU A;  3SEX A;  4G8M A;  2QPQ A;  3S4U A;  4PFR A;  1JW4 A;  4PFU A;  3JV9 A;  5EQ7 A;  1QKA A;  3RT6 B;  3QIM A;  1INP A;  3OMB A;  4KQP A;  2OWS A;  3H7M A;  2DE3 A;  1FSA A;  4AB6 A;  5DT6 A;  1KZ8 A;  4NWC A;  2QRY A;  5A5X B;  4UA8 A;  1EZP A;  1GGG A;  4RXL A;  5I2N A;  4JVI A;  2DS9 A;  3RPW A;  2FNC A;  3N6U A;  3S9M C;  3QSL A;  4KI0 E;  1LCT A;  1TXF A;  5AA1 A;  3JZJ A;  1Y3P A;  3VXB A;  1DSN A;  1B5I A;  3ZKL A;  3SEW A;  1D3K A;  1JW5 A;  1LBX A;  2NVU B;  3PMV A;  3ONM A;  3RT8 A;  2XHD A;  3MYU A;  3TEP A;  3RTW B;  3K4U A;  3KOT A;  2XX8 A;  4OVJ A;  1P1N A;  4TLM B;  1SPI A;  4P1E A;  4PFI A;  1B46 A;  3T9X B;  2F7A A;  2DXR A;  3DLN A;  1SD3 A;  5ITP A;  1G0I A;  4UAB A;  2G29 A;  4PFB A;  3T96 B;  4NG7 A;  3VXC A;  5CMM A;  4GD5 A;  3ODB A;  5EQA A;  2DVC A;  2F6P A;  4HW8 A;  3PGF A;  1B40 A;  1IMA A;  1EH3 A;  2CEX A;  3UK4 A;  2LAO A;  3IJX B;  4U4S A;  4NF4 A;  4BDQ A;  4OVS A;  1OQG A;  3OO8 A;  4KFQ A;  4YKJ A;  1NV4 A;  4DZ1 A;  1FBH A;  3RUM A;  4BDL A;  4OXV A;  4EDP A;  4YKK A;  3OXN A;  1OIB A;  3IB0 A;  3I6V A;  2Q2A A;  1FPJ A;  1MPB A;  4YB6 A;  3IX1 A;  3L6G A;  4PFW A;  4PQJ A;  3H6T A;  4N91 A;  1RYO A;  1FPI A;  2XX7 A;  2O1M A;  4QRZ A;  2QVV A;  3K1P A;  5I2K B;  3PPR A;  4JSO A;  3PPO A;  1S7Y A;  2WKY A;  4PGP A;  1LBV A;  4I62 A;  2QL3 A;  3SEV A;  1D4N A;  5K2Y A;  3FUZ A;  3QYT A;  5TP9 B;  2F6G A;  2HQ0 A;  3D1R A;  1NNP A;  3Q29 A;  2XA5 A;  3KGC A;  1MRP A;  4KCD A;  1MXW A;  3G3G A;  1EYK A;  4YKI A;  4QHQ A;  3G3J A;  1YXI A;  4U2R A;  2WBB A;  3V5A A;  5I5P A;  1B32 A;  2KQZ A;  1ZBM A;  4GWW A;  4I3Y A;  3C31 A;  4G8N A;  4LQ2 A;  1SW1 A;  5AA3 A;  3O6G A;  2WEF A;  2OK2 A;  4BDO A;  3ILU B;  4G4P A;  1OLA A;  1N7X A;  3H03 A;  3TPA A;  1B3L A;  2AL4 A;  1SW5 A;  4LP2 B;  4G77 A;  2DSF A;  5KCJ B;  4OVP A;  3TAJ A;  4OEN A;  4XXU A;  4DI4 B;  4PAK A;  2M8C A;  1XC1 A;  4IY5 A;  2V3Q A;  1O63 A;  4AQ4 A;  5I57 B;  5IGA A;  3BBR A;  5IM2 A;  4JSD A;  1UIV A;  2RF1 A;  2Y7W A;  4G2Z A;  1LAX A;  1I6A A;  3IO4 A;  5DW8 A;  4PFT A;  3KN8 A;  4P11 A;  4QFP A;  4RNS A;  2F5X A;  4KXP A;  4RK9 A;  4NE4 A;  1PBP A;  4GVO A;  2Y7P A;  4Z0I A;  2PFY A;  1JVX A;  2F35 A;  4GRK A;  1IMC A;  1B0H A;  3CSG A;  2ANJ A;  3MW0 A;  4PFY A;  4ZZE A;  1NUX A;  1USY H;  2ZNT A;  1OLC A;  2ZZV A;  4X48 A;  1B4Z A;  1MS7 A;  1AWB A;  4OHN A;  4N8Y A;  1CE2 A;  3IR1 A;  2FBP A;  4PAI A;  3CI8 A;  3B6Q A;  1RKM A;  5L9O A;  4Z7E A;  4NX1 A;  5ET7 A;  3T0J A;  1FBF A;  4PET A;  2P2A A;  1BK4 A;  1EZ9 A;  1LB9 A;  2THI A;  2R9J A;  5CRY A;  1MDQ A;  1I6Q A;  3C4M A;  3KOS A;  3B6T A;  4WXJ A;  3CHG A;  2VHA A;  4GX4 A;  4K3F A;  4O7M A;  2V93 A;  2CZH A;  4IO7 A;  3RPL B;  1KA0 A;  2F78 A;  3IOR A;  1URG A;  1QW0 A;  4HS7 A;  5I58 A;  1A8F A;  2B65 A;  2O51 A;  1BTJ A;  3K2D A;  2A5S A;  4IO4 A;  4GWX A;  1MQJ A;  3CIJ A;  4O3B A;  4N8G A;  2OBG A;  3KEI A;  2XWK A;  3B6W A;  1PEB A;  4F3B A;  4JWO A;  3VLW A;  4QSD A;  2V25 A;  3HV1 A;  3WAE A;  2PT1 A;  1UTB B;  4N13 A;  1TFD A;  5IAI A;  3RQT A;  1ZIU A;  1PB7 A;  4OVQ A;  3MP6 A;  3W9W A;  1TT1 A;  3O6I A;  1IMB A;  1FJ9 A;  3DP6 A;  3EKI A;  1LFI A;  5H8F B;  2DE4 A;  1KWH A;  4XKQ A;  3TUS A;  1JW1 A;  3V8X B;  1EYI A;  2KR0 A;  2XXQ A;  1NUY A;  3BKI B;  3IL1 B;  1Q35 A;  3USD A;  4MHF A;  1QUJ A;  1GV8 A;  3TTN A;  4WKM A;  1IUD A;  1D9Q A;  1Y4C A;  4I9D A;  2UVJ A;  1DCU A;  4GLI A;  5EHM A;  2XXW A;  4R9G A;  1FPF A;  4E0W A;  3E79 A;  4ESX A;  4FJP A;  1R1N A;  3PMX A;  2HHM A;  4H45 A;  5J16 A;  2QVR A;  5CBS A;  4ESW A;  3PPP A;  5CBR A;  4XKN A;  4U23 A;  4FE8 A;  4FIM A;  3WAF A;  4Q8R A;  5IKB A;  3LSX A;  2IA4 A;  1JEV A;  1N3X A;  5TPA A;  4O8M A;  3NOH A;  3VLV A;  3VLU A;  4QF9 A;  2OX3 A;  5EYF A;  5KDT A;  4GXS B;  2E0S A;  1FQB A;  2UVH A;  2OCU A;  2PMS A;  3E3K A;  2OWZ A;  1K9Z A;  5L9S A;  2H99 A;  3QMF A;  4GOT A;  4ZEB A;  5CM6 A;  1PC3 A;  2XXY A;  3G3I A;  3IJO B;  3BFU A;  5FTI A;  4XKP A;  1MXU A;  2XWV A;  3A09 A;  3HFU A;  4XEQ A;  4GF8 A;  1I69 A;  4OYV A;  3ILT B;  5CI5 A;  5M2V A;  3UGW A;  3H6W A;  4GQO A;  4DXB A;  2UVI A;  3OO7 A;  3F11 A;  1B9J A;  3C9H A;  2YJP A;  4I40 A;  3R26 A;  4YAH X;  1S9T A;  3P7I A;  4RPN A;  2VT5 A;  4F2O A;  3IOU A;  1ANF A;  2L5V A;  5AA4 B;  4U4X A;  5KZT A;  4GBV A;  4KYD A;  1Y1M A;  4NTL A;  4ZEI A;  4BDN A;  3MJN A;  2Q8M A;  1POT A;  4OWD A;  4EQB A;  3M3L A;  3GLB A;  1YYZ A;  1USY E;  3VVF A;  1AMF A;  5IZZ A;  2PCR A;  4ELR A;  3H6U A;  4IO5 A;  1PB9 A;  1MQH A;  4GXA A;  2XXR A;  4DXC A;  5T3J A;  4R6K A;  2HAU A;  3DM0 A;  1ZU0 A;  3FJM A;  3H06 B;  1B1X A;  4KR5 A;  4F1V A;  5EHS A;  2Q89 A;  5I2N B;  4GFR A;  4OQO A;  1N3W A;  4F3S A;  1IEJ A;  2YPN A;  5DYH A;  3SEU A;  2ZYM A;  2DWJ A;  4G68 C;  5JTY B;  4JB7 A;  3W15 C;  1B3G A;  3KN3 A;  4H8I A;  4N15 A;  4ISU A;  2Z22 A;  3RN8 A;  1FBG A;  4OZ9 A;  2O84 X;  3MZ9 A;  3D4C A;  2QS4 A;  3FXB A;  3QXM A;  1A55 A;  4ONY A;  2MKZ A;  1YAE A;  1NNF A;  1JQF A;  1QUK A;  2X26 A;  4DCY A;  1MXZ A;  4M1V A;  3HPI A;  4MNI A;  1H45 A;  3ECR A;  1CNQ A;  1DOT A;  1HSJ A;  1CB6 A;  4PCD A;  4NF4 B;  3SES A;  1YPN A;  2A5T B;  3ZS6 A;  5EQ8 A;  1SW4 A;  1MY1 A;  1IZ1 A;  1URD A;  5FHN A;  4FED A;  5ICQ A;  2XWI A;  3FXQ A;  3E78 A;  2XXP A;  3E9X A;  2ZXT A;  3UA8 A;  3I5O A;  4YMA A;  1EU8 A;  1FTJ A;  3LBS A;  5DEX A;  1MQD A;  3QAX A;  1NV3 A;  4F3G A;  1QKB A;  1ZMG A;  3KSJ A;  4GBW A;  4DLD A;  2F97 A;  2V3U A;  3S9E A;  2Q9T A;  3EF7 A;  3MVW A;  2RC8 A;  3SEY A;  2PBW A;  3IFA A;  5H8N A;  2HAV A;  1SI0 A;  2HZL A;  3FIR A;  4MCO A;  2FHY A;  3FV1 A;  2F34 A;  4RJZ A;  4ELQ A;  3U65 A;  3KN7 A;  3U1O A;  4PDH A;  4LUB A;  4EQ9 A;  1S50 A;  4NHB A;  2P3N A;  5ESY A;  1FJ6 A;  3MQ9 A;  5BWJ A;  3CR9 A;  2F36 A;  4NWD A;  1O7T A;  2F3D A;  2R8T A;  3TFL A;  3RTF B;  1MQG A;  2DVZ A;  4IGR A;  4N07 A;  2DQV A;  2UYF A;  1FBE A;  2GHB A;  3D4G A;  3CSB A;  3RNN A;  1FPE A;  4P1L A;  1XT8 A;  5A5X A;  2QSX A;  3FXR A;  4WEP A;  1P1U A;  3K1N A;  4O94 A;  5AA2 D;  2V84 A;  2WYP A;  1Y9U A;  3I3V A;  2DYX A;  4Q30 B;  2O7U A;  2PT2 A;  4PF8 A;  3PU5 A;  2OWT A;  4O3A A;  4NF5 B;  4LVQ A;  3KBZ A;  4PF6 A;  2RCB A;  2UVG A;  3ZSF A;  3PMW A;  3IO6 A;  1B7H A;  3IFC A;  3S9N C;  1DTZ A;  2HCA A;  2HPG A;  2Z8F A;  1NV1 A;  2ZMB A;  2YLN A;  3FXU A;  2REG A;  1A54 A;  2B3B A;  5I56 A; 
#chains in the Genus database with same CATH homology
 3TTK A;  3K6V A;  1IXI A;  2ZNS A;  5I59 B;  2H25 A;  4IGT A;  3FV2 A;  1Z7N E;  1B05 A;  2AYS A;  4XKR A;  4XTC Q;  4AB5 A;  3M3K A;  1II5 A;  2QS1 A;  4YU0 A;  2F8D A;  1HSE A;  2B3F A;  1Y1Z A;  3MPL A;  3O29 A;  2RC7 A;  1MQI A;  4QFO A;  3N6T A;  2O1L A;  1VFD A;  4GL0 A;  3EN3 A;  5AA2 B;  4KCC A;  5JEI A;  2E1S A;  2GFE A;  4FAJ A;  4PE5 B;  4H8J A;  1NH7 A;  2R71 A;  4FAT A;  4OTE A;  3THI A;  4WED A;  3LUY A;  2HZK A;  1FCK A;  3H3G A;  1A99 A;  3C35 A;  1XS5 A;  2ZYO A;  4Q5T A;  4OFJ A;  4NMY A;  5I58 B;  4PP0 A;  4YB5 A;  3TQW A;  4DIG A;  3CFX A;  3CRB A;  2CMO A;  3T66 A;  3PUV E;  1NL5 A;  2DP8 A;  1XHY A;  2DE2 A;  4N6P A;  3N26 A;  2I4C A;  3KZG A;  1LCF A;  5I84 A;  1D9Y A;  3HHG A;  1QVS A;  4HCY A;  3V89 B;  3RGY A;  4C0R A;  2HEU A;  4R72 A;  5CMC A;  4F19 A;  3CFZ A;  1ZTY A;  2Q2C A;  5DVJ A;  4RY1 A;  3MPK A;  4C1U A;  4MLQ A;  5CC2 A;  4LZ5 A;  4UAC A;  1FQE A;  1SYI A;  1MPD A;  4YB7 A;  2H98 A;  2BJJ X;  1TFA A;  1BIY A;  4ND9 A;  4IY6 A;  1Y3N A;  3MZB A;  2REJ A;  2UXA A;  4YIC A;  3UOR A;  5FHO A;  3HO7 A;  5H8Q B;  2RIN A;  1MXX A;  3O66 A;  5ELV A;  3QUJ A;  4ZEC A;  4OET A;  4ZEF A;  1LGB C;  3PD9 A;  5I57 A;  3DEL B;  4NED A;  3FVG A;  4F18 A;  4R2F A;  1BKA A;  5B70 A;  1NNK A;  4ECF A;  5TPA B;  3LSW A;  1YCJ A;  3HHF A;  3Q26 A;  5F7V A;  2PX1 A;  2H4I A;  3PUY E;  2P1S A;  5K2X A;  4ZE9 A;  1ATG A;  2XXV A;  2Z8D A;  2D21 A;  2VP1 A;  4XIG Q;  3PPQ A;  1EZO A;  3T9V A;  2GHA A;  4OEU A;  2XD2 A;  2Y7K A;  1R9L A;  3VDF A;  3LSF B;  1B2H A;  4F31 B;  4NF6 B;  2AIX A;  3TQL A;  3KSX A;  4BDR A;  1M5F A;  1GTK A;  1FQA A;  3G3K A;  2XXU A;  4RPO A;  1ZKB A;  3VE1 B;  4Q0C A;  2F7B A;  2Y7R A;  3U94 A;  1R9Q A;  1B0L A;  1B7U A;  1M5D A;  4NF8 B;  3TTR A;  3GBB A;  2I58 A;  4G68 A;  2QS3 A;  3CG1 A;  3U92 A;  5TU0 A;  1DMB A;  3C36 A;  4X1D A;  3H4Z A;  4KPT A;  1XVY A;  4EUO A;  4RA1 A;  1H76 A;  1N84 A;  3TMG A;  2ONS A;  1B7Z A;  4DE8 A;  1GR2 A;  3UP9 A;  2OJT A;  3PUZ E;  3SKP A;  5H8H A;  3O9P A;  4BLA A;  1SBP A;  1HSL A;  1BP5 A;  1H3D A;  4TOZ A;  4OES A;  4JDF A;  4TLL B;  2Q88 A;  3LC8 A;  1H44 A;  2I0B A;  1US4 A;  2GRV A;  4THI A;  2XXI A;  4FOR A;  3E13 X;  3UIF A;  1JET A;  1UTH B;  1MY2 A;  1JEU A;  1YTV A;  1POY 1;  5DVF A;  3VVE A;  4YZZ A;  3MBP A;  4IO6 A;  4HCW A;  3C34 A;  1ZJL A;  2VOZ A;  4C1T A;  2O7I A;  2R6G E;  4OFL A;  3KG2 A;  1NMU A;  1PBQ A;  1TWY A;  3R7X A;  1IQ7 A;  3OO6 A;  1MXV A;  3OSR A;  1FQD A;  2XXX A;  2HFB A;  3OEK A;  4POW A;  1Y4T A;  4HTG A;  5DVI A;  3TCG A;  3N94 A;  3FAT A;  4FEC A;  4QFL A;  1MH3 A;  2Z8E A;  1SYH A;  1FTK A;  1SI1 A;  3HST A;  5DEX B;  4H1X A;  1ZLQ A;  4P0I A;  4F2Q A;  1AH5 A;  1Y20 A;  4KD5 A;  3MZ1 A;  1LLS A;  4EF1 A;  3K0V A;  5H8N B;  1XOC A;  3QK6 A;  4EXK A;  1MXY A;  1FW0 A;  1A40 A;  1FQC A;  5AA4 A;  3OEM A;  2G93 A;  4F1U A;  5LOM A;  3GBA A;  5HBC A;  3VFJ A;  3C33 A;  2ABH A;  2OLB A;  3KJ7 A;  2VD2 A;  3A3U A;  5F1Q A;  3HCQ A;  4MBP A;  4TQU Q;  4LZ8 A;  4ZEK A;  4KYS A;  4LON B;  2O6A A;  3EHS A;  5FHM A;  3T9U A;  4LZ7 A;  3RLF E;  3PD8 A;  4OER A;  4QSE A;  2X7Q A;  3K01 A;  2FYI A;  5L8D A;  3EHU A;  2AL5 A;  1LAF E;  1A8E A;  3U8Q A;  1O64 A;  1AOV A;  5FTH A;  1P1W A;  3IB1 A;  4QFK A;  2NXO A;  3G7W A;  3ZKK A;  3IOW A;  2RKM A;  5JTY A;  4X1B A;  2FA7 A;  3RY3 A;  3FVO A;  1IIT A;  1Z7M E;  2F7C A;  1JNF A;  3HN0 A;  1SW2 A;  3TTM A;  4F1Y A;  4YKP A;  1NKX A;  2PYY A;  4LQ5 A;  3EHT A;  4POX A;  5I56 B;  2ALU A;  4LAT A;  2H5Y A;  3E4R A;  4R9F A;  3M3F A;  3FJ7 A;  1M5C A;  2UYE A;  1R6Z A;  4QSC A;  2NOO A;  4EQ7 A;  2X7P A;  4ZZA A;  1D9V A;  1DTG A;  1L5T A;  1PDA A;  2A5T A;  2ONK E;  1MM7 A;  5J1D A;  1P1O A;  1AIV A;  3Q28 A;  2VGQ A;  3GZG A;  3LR1 A;  1BLF A;  1I6B A;  3FZV A;  3MVZ A;  1LFG A;  1MY4 A;  4ELO A;  1QUI A;  1NH8 A;  2I49 A;  1N76 A;  5L9M A;  3R6U A;  4KHZ E;  3K6W A;  1SDX A;  3MWB A;  2DWI A;  4JBZ A;  3T93 B;  1IXG A;  1LST A;  2DOJ A;  4R75 A;  1J1N A;  1MDP 1;  3A3C A;  3M8U A;  4JWX A;  4ELP A;  1MH4 A;  1MY3 A;  4G8H A;  4DDD A;  2ESN A;  1B5J A;  4H5G A;  1B6H A;  1H43 A;  2QMW A;  1SVX B;  1DPE A;  1N7W A;  4H65 A;  3KFM A;  3T22 A;  3TCF A;  1PB8 A;  3S2V A;  1OMP A;  2ZYN A;  3MP1 A;  3K6U A;  4R74 A;  3EQ1 A;  3CVG A;  4MF3 A;  4H67 A;  3DP8 A;  1IIW A;  2Y84 A;  2XXH A;  3H6V A;  4ZE8 A;  2OZZ A;  1B5H A;  1ELJ A;  1VR5 A;  1LAG E;  4R2B A;  2I6E A;  2D5W A;  2GH9 A;  3BFT A;  2VD3 A;  1Q1K A;  4I8C A;  3KJT A;  3IOT A;  1B51 A;  5I2K A;  2W7Y A;  1B58 A;  4NF5 A;  2ONR A;  5B7D A;  4BDM A;  3K02 A;  5TP9 A;  2PVU A;  3PPN A;  3Q25 A;  1LBC A;  2DWH A;  3FGS A;  4IO2 A;  4F3P A;  1LBB A;  5I59 A;  1MPC A;  5ITO A;  1T0K A;  3SER A;  5HM4 B;  4EXL A;  4U21 A;  3K6X A;  5BUU A;  3TEL A;  3OSQ A;  1WOD A;  3IK6 B;  3O6H A;  5ICT A;  3OOA A;  5DTB A;  3OO9 A;  2V3T A;  4O3C A;  1DPP A;  4IB2 A;  4QFN A;  5KCJ A;  5AA2 A;  1M5B A;  4M4G A;  1URS A;  4KYE A;  4X9T A;  3W9V A;  5HPQ A;  2O68 A;  4H0W A;  4L17 A;  4RK2 A;  4OMB A;  3SDF A;  2Y7I A;  2IEE A;  3AXF A;  4U1Z A;  3UN6 A;  1NFT A;  3TTL A;  1F9B A;  4R73 A;  3L6H A;  4GL8 A;  4U1O A;  4MFI A;  5KDT B;  4ZS9 A;  4GIZ A;  3PV0 E;  3TYH A;  3GXA A;  3TKD A;  4IO3 A;  4G68 B;  2XD3 A;  1Y3Q A;  3SET A;  2ZYK A;  4RYA A;  4I1D A;  2RC9 A;  5CMB A;  3MVY A;  3VVD A;  1P99 A;  2RCA A;  3B7D A;  4DCX A;  1VSO A;  3N5L A;  3U72 A;  2NWJ A;  1OVB A;  3MUQ A;  5H8H B;  2I0C A;  1A7L A;  5JK4 A;  1MY0 A;  1B3E A;  3MAM A;  2Q8J A;  5H8S A;  3FAS A;  4E0X A;  1XVX A;  2H9B A;  5H8Q A;  3O28 A;  1P1Q A;  3IB2 A;  4OFO A;  1QJM A;  4ZDM A;  2NUV A;  2I4B A;  3FD3 A;  2D3I A;  4JXI A;  1GVC A;  5AE4 A;  3PUW E;  1UQW A;  2XX9 A;  1FTM A;  4JWY A;  1UTB A;  2QJE A;  2P0S A;  3T9H B;  1B3F A;  3U93 A;  4F29 A;  1QUL A;  2QMX A;  3IOV A;  4DXU A;  3O2A A;  4H6D A;  2I3W A;  1MG1 A;  1MM6 A;  1VFE A;  3C32 A;  4MH5 A;  1OQH A;  1N04 A;  3MVX A;  1RYX A;  5H8F A;  2XXT A;  2HXW A;  3K1M A;  3Q27 A;  3FJG A;  3OEN A;  4FEB A;  1B52 A;  4H5F A;  1B4H A;  3OEL A;  1LAH E;  1NNT A;  1FQF A;  3PUX E;  3VV5 A;  1VE4 A;  3TZA A;  1SQY A;  4P0G A;  2I3V A;  5CMK A;  1AL3 A;  2KLF A;  1OVT A;  1FTO A;  4NF6 A;  4OEV A;  3G3H A;  3MC2 A;  3QUF A;  3KBR A;  4MLV A;  4YMB A;  3FVK A;  3CG3 A;  3G3F A;  1B1H A;  1JVY A;  3V83 A;  1M5E A;  1B3H A;  2I48 A;  1LB8 A;  4LA9 A;  4U22 A;  2DXY A;  1IXC A;  4NF8 A;  3FVN A;  2O69 A;  4R6Y A;  2ZNU A;  2QS2 A;  4GWO A;  3IAZ A;  4ZED A;  1US5 A;  4F39 A;  3K00 A;  3TCH A;  2Z23 A;  3OD7 A;  3S9L C;  3O97 A;  2CZL A;  3DP4 A;  3TOD A;  3MP8 A;  4F22 A;  1WDN A;  1WVJ A;  3TDJ A;  4R6H A;  3EPE A;  4EF2 A;  3JYR A;  1FTL A;  5ISU A;  3CFL A;  1N0T A;  1UTH A;  1LFH A;  1IXH A;  3LSL A;  2DWA A;  1UIU A;  3SEX A;  4G8M A;  2QPQ A;  3S4U A;  1JW4 A;  4PFU A;  3JV9 A;  1QKA A;  3RT6 B;  3QIM A;  3OMB A;  4KQP A;  2OWS A;  3H7M A;  2DE3 A;  4AB6 A;  5DT6 A;  4NWC A;  2QRY A;  5A5X B;  4UA8 A;  1EZP A;  1GGG A;  4RXL A;  5I2N A;  2DS9 A;  3RPW A;  2FNC A;  3N6U A;  3S9M C;  3QSL A;  4KI0 E;  1LCT A;  1TXF A;  5AA1 A;  3JZJ A;  1Y3P A;  3VXB A;  1DSN A;  1B5I A;  3ZKL A;  3SEW A;  1D3K A;  1JW5 A;  2NVU B;  3PMV A;  3ONM A;  3RT8 A;  2XHD A;  3TEP A;  3RTW B;  3K4U A;  3KOT A;  2XX8 A;  4OVJ A;  1P1N A;  4TLM B;  1B46 A;  3T9X B;  2F7A A;  2DXR A;  3DLN A;  1SD3 A;  5ITP A;  2G29 A;  3T96 B;  3VXC A;  5CMM A;  4GD5 A;  3ODB A;  2DVC A;  2F6P A;  4HW8 A;  3PGF A;  1B40 A;  1EH3 A;  3UK4 A;  2LAO A;  3IJX B;  4U4S A;  4NF4 A;  4BDQ A;  1OQG A;  3OO8 A;  4KFQ A;  4YKJ A;  4DZ1 A;  3RUM A;  4BDL A;  4OXV A;  4EDP A;  4YKK A;  3OXN A;  1OIB A;  3IB0 A;  3I6V A;  2Q2A A;  1MPB A;  4YB6 A;  3IX1 A;  3L6G A;  4PFW A;  4PQJ A;  3H6T A;  1RYO A;  2XX7 A;  2O1M A;  4QRZ A;  3K1P A;  5I2K B;  3PPR A;  4JSO A;  3PPO A;  1S7Y A;  2WKY A;  4I62 A;  2QL3 A;  3SEV A;  1D4N A;  5K2Y A;  3FUZ A;  3QYT A;  5TP9 B;  2F6G A;  2HQ0 A;  1NNP A;  3Q29 A;  3KGC A;  1MRP A;  4KCD A;  1MXW A;  3G3G A;  4YKI A;  4QHQ A;  3G3J A;  4U2R A;  3V5A A;  1B32 A;  1ZBM A;  3C31 A;  4G8N A;  4LQ2 A;  1SW1 A;  5AA3 A;  3O6G A;  2OK2 A;  4BDO A;  3ILU B;  4G4P A;  1OLA A;  1N7X A;  3H03 A;  3TPA A;  1B3L A;  2AL4 A;  1SW5 A;  4LP2 B;  4G77 A;  2DSF A;  5KCJ B;  3TAJ A;  4OEN A;  4XXU A;  2M8C A;  1XC1 A;  4IY5 A;  2V3Q A;  1O63 A;  4AQ4 A;  5I57 B;  3BBR A;  4JSD A;  1UIV A;  2RF1 A;  2Y7W A;  4G2Z A;  1LAX A;  1I6A A;  3IO4 A;  4PFT A;  3KN8 A;  4P11 A;  4QFP A;  4RNS A;  2F5X A;  4RK9 A;  4NE4 A;  1PBP A;  4GVO A;  2Y7P A;  4Z0I A;  1JVX A;  2F35 A;  4GRK A;  1B0H A;  3CSG A;  2ANJ A;  3MW0 A;  4PFY A;  4ZZE A;  1USY H;  2ZNT A;  1OLC A;  4X48 A;  1B4Z A;  1MS7 A;  4OHN A;  1CE2 A;  3IR1 A;  3CI8 A;  3B6Q A;  1RKM A;  5L9O A;  4Z7E A;  4PET A;  2P2A A;  1EZ9 A;  1LB9 A;  2THI A;  2R9J A;  5CRY A;  1MDQ A;  1I6Q A;  3C4M A;  3KOS A;  3B6T A;  4WXJ A;  2VHA A;  4K3F A;  2V93 A;  4IO7 A;  2F78 A;  3IOR A;  1URG A;  1QW0 A;  4HS7 A;  5I58 A;  1A8F A;  2B65 A;  2O51 A;  1BTJ A;  3K2D A;  2A5S A;  4IO4 A;  1MQJ A;  3CIJ A;  4O3B A;  2OBG A;  3KEI A;  3B6W A;  1PEB A;  4F3B A;  4JWO A;  3VLW A;  4QSD A;  2V25 A;  3HV1 A;  3WAE A;  2PT1 A;  1UTB B;  4N13 A;  1TFD A;  5IAI A;  3RQT A;  1ZIU A;  1PB7 A;  3MP6 A;  3W9W A;  1TT1 A;  3O6I A;  3DP6 A;  1LFI A;  5H8F B;  2DE4 A;  1KWH A;  4XKQ A;  3TUS A;  1JW1 A;  3V8X B;  2XXQ A;  3BKI B;  3IL1 B;  1Q35 A;  3USD A;  1QUJ A;  1GV8 A;  3TTN A;  4WKM A;  1IUD A;  1Y4C A;  4I9D A;  2UVJ A;  4GLI A;  5EHM A;  2XXW A;  4R9G A;  4E0W A;  4ESX A;  4FJP A;  1R1N A;  3PMX A;  5CBS A;  4ESW A;  3PPP A;  5CBR A;  4XKN A;  4U23 A;  4FE8 A;  4FIM A;  3WAF A;  4Q8R A;  5IKB A;  3LSX A;  2IA4 A;  1JEV A;  1N3X A;  5TPA A;  3VLV A;  3VLU A;  4QF9 A;  5EYF A;  5KDT A;  4GXS B;  2E0S A;  1FQB A;  2UVH A;  2OCU A;  2PMS A;  3E3K A;  5L9S A;  2H99 A;  4ZEB A;  4GOT A;  5CM6 A;  1PC3 A;  2XXY A;  3G3I A;  3IJO B;  3BFU A;  5FTI A;  4XKP A;  1MXU A;  3A09 A;  4GF8 A;  1I69 A;  4OYV A;  3ILT B;  5CI5 A;  5M2V A;  3UGW A;  3H6W A;  4GQO A;  4DXB A;  2UVI A;  3OO7 A;  3F11 A;  1B9J A;  3C9H A;  2YJP A;  3R26 A;  4YAH X;  1S9T A;  3P7I A;  4RPN A;  4F2O A;  3IOU A;  1ANF A;  5AA4 B;  4U4X A;  5KZT A;  4KYD A;  1Y1M A;  4NTL A;  4ZEI A;  4BDN A;  3MJN A;  1POT A;  4OWD A;  4EQB A;  3M3L A;  3GLB A;  1USY E;  3VVF A;  1AMF A;  4ELR A;  3H6U A;  4IO5 A;  1PB9 A;  1MQH A;  4GXA A;  2XXR A;  4DXC A;  4R6K A;  2HAU A;  3DM0 A;  1ZU0 A;  3FJM A;  3H06 B;  1B1X A;  4KR5 A;  4F1V A;  5EHS A;  2Q89 A;  5I2N B;  4GFR A;  4OQO A;  1N3W A;  4F3S A;  1IEJ A;  2YPN A;  5DYH A;  3SEU A;  2ZYM A;  2DWJ A;  4G68 C;  5JTY B;  4JB7 A;  3W15 C;  1B3G A;  3KN3 A;  4H8I A;  4ISU A;  2Z22 A;  3RN8 A;  4OZ9 A;  2O84 X;  3MZ9 A;  3D4C A;  2QS4 A;  3QXM A;  1A55 A;  4ONY A;  1YAE A;  1NNF A;  1JQF A;  1QUK A;  2X26 A;  4DCY A;  1MXZ A;  4M1V A;  3HPI A;  1H45 A;  3ECR A;  1DOT A;  1HSJ A;  1CB6 A;  4NF4 B;  3SES A;  1YPN A;  2A5T B;  3ZS6 A;  1SW4 A;  1MY1 A;  1IZ1 A;  1URD A;  5FHN A;  4FED A;  5ICQ A;  3FXQ A;  2XXP A;  3E9X A;  2ZXT A;  3UA8 A;  3I5O A;  4YMA A;  1EU8 A;  1FTJ A;  3LBS A;  5DEX A;  1MQD A;  3QAX A;  4F3G A;  1QKB A;  1ZMG A;  3KSJ A;  4DLD A;  2F97 A;  2V3U A;  3S9E A;  2Q9T A;  3EF7 A;  3MVW A;  2RC8 A;  3SEY A;  2PBW A;  5H8N A;  2HAV A;  1SI0 A;  2HZL A;  3FIR A;  3FV1 A;  2F34 A;  4RJZ A;  4ELQ A;  3KN7 A;  3U1O A;  4LUB A;  4EQ9 A;  1S50 A;  3MQ9 A;  5BWJ A;  3CR9 A;  2F36 A;  4NWD A;  1O7T A;  3TFL A;  3RTF B;  1MQG A;  2DVZ A;  4IGR A;  4N07 A;  2DQV A;  2UYF A;  2GHB A;  3D4G A;  3CSB A;  3RNN A;  1XT8 A;  5A5X A;  2QSX A;  3FXR A;  4WEP A;  1P1U A;  3K1N A;  5AA2 D;  2V84 A;  1Y9U A;  3I3V A;  2DYX A;  4Q30 B;  2O7U A;  2PT2 A;  3PU5 A;  2OWT A;  4O3A A;  4NF5 B;  4LVQ A;  2RCB A;  2UVG A;  3ZSF A;  3PMW A;  3IO6 A;  1B7H A;  3S9N C;  1DTZ A;  2HCA A;  2Z8F A;  2ZMB A;  2YLN A;  3FXU A;  2REG A;  1A54 A;  2B3B A;  5I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...